4M77F

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77F00
2E1HA 4XTYA 4M75F 1HK9A 5GMKl 5GAMd 2YLBA 3L2ZA 4J5YA 2HNIA 1B34A 4XTUA 2DXTA 2DZ9A 2FYKA 4M77G 2DTIA 5GAN3 5GAMg 4C92D 4M7AE 4XTVA 1TH7A 2E41A 4C8QA 3JB9I 1KQ1A 3BY7A 3FJPA 4NL2A 4C8QC 3SWNB 5GAOn 1YCYA 2QTXA 1Y96A 2EJFA 2DTOA 5LJ5d 4RCCA 5GANf 4F7UF 5LJ3h 2DKGA 2E10A 5LJ5g 3JCMc 3JCMJ 3JCMX 4M75B 4M7DB 4M7AA 5LJ3f 4C92F 5GAMh 4M7AC 3JCMf 4EMKB 5GMKi 5GMKm 5GAMe 3V7RA 2DTHA 3V8LA 1D3BA 1JBMA 2I2LA 4MMKA 2JN0A 4DQ2A 4PJOB 4C8QG 3FIFA 3RESA 4M75E 5GAN7 4JRIA 4M78C 3JCMV 2ZGWA 3V7SA 5LJ5h 4M7DE 4M78B 4EMHA 4X9CA 4XU2A 5LJ5e 4C8QD 5GMKj 4J6YA 3SWNA 3JB9J 2E64A 1U1TA 2DEQA 4JUVA 3RUXA 3SWNC 5GAOq 4PJOE 4M7AG 2E65A 2YHTA 4J6XA 3RKXA 2EAYA 5GAN4 1HXDA 5GAOl 4M77B 1I5LA 3JCMb 4M78E 4M75A 4M7DA 4RCBA 5GMKe 5GANd 4M7AD 4M75C 3V7CA 4M7DC 1JRIA 4EMKA 3JCMQ 4C8QF 4EMKC 5GANg 3L1AA 4MMLA 4C92C 4EMGA 5GAN2 3RERA 2K57A 2RD1A 3QSUA 2CGHA 3JCMd 4JLIA 4M77E 4PJOA 5GAMf 1WNLA 5GAN6 4A53A 5GANj 3JB9G 4PJOC 3JCMg 4XU1A 2VXEA 4XTWA 3AHUA 2EJGA 4M78A 4NOYA 4M7AF 2VC8A 3SB2A 1MGQA 3JB9D 3JB9H 4F7UB 5CAIA 2RA2A 1KQ2A 4QVDA 3RKYA 4M7DG 5LJ5f 2DXUA 3GIBA 4HT8A 4C92B 3HFNA 4X9DA 3JCMW 4J6WA 4M77A 1LJOA 5GAOp 1BIAA 1I81A 2VXFA 4M77C 4XU3A 3QUIA 4M7DD 1WQ7A 4OP0A 4F7UE 5GMKh 1I8FA 2EWNA 1M5Q1 4HA8A 4PJOG 1U1SA 3JB9F 4A54A 2DZCA 3BFMA 3FB9A 3RKWA 3V8KA 2EJ9A 1WPYA 3PGGA 4C92E 4M78G 2DJZA 4QVCA 4XQ3A 4PJOD 3EFSA 5LJ3d 2FB7A 1WQWA 1LOJA 4XU0A 5LJ3g 4M7DF 4M78D 5I21A 3M4GA 3QHSA 4XTZA 4F7UA 3HSBA 3EFRA 3JCMP 5GAOm 2Y90A 5LJ3j 1B34B 4C92A 5GANh 3HFOA 4N0AA 2RM4A 4M77D 4M75G 1I4K1 4PJOF 4C8QB 4WF2A 4N0AC 1H641 5GANe 5GAMj 4Y91A 4M78F 1Y96B 1N9SA 1BIBA 3INZA 2RB6A 4M75D 4PNOA 3JCMh 5LJ3e 5GAOr 3BW1A 3JCMe 4HT9A 3RIRA 1LNXA 5GAN8 3VU3C 3QO3A 2YLCA 3BDUA 5DY9A 3V8JA 1M8VA 4M7AB 5LJ5j 1N9RA 4JRKA 4C8QE 4V2SA 4F7UG 4M77F 5GAN5 4XTXA 2DVEA 1X01A 4NL3A 1D3BB 4C92G
chains in the Genus database with same CATH superfamily
2HQXA 5C0MA 1KK7A 4J5YA 3VS0A 2HNIA 2ROLA 5GAN3 1X6BA 2FO0A 4HVVA 4PJMA 4NL2A 1Y96A 2EJFA 2YDLA 2QA4A 3JSCA 4ANJA 2XHCA 5FW9A 1T0HA 2LJ1A 3JCMf 1W4SA 4PJLA 2D8HA 3EG9A 1D3BA 1KJWA 2DM1A 3EG1A 3RESA 4HVUA 1YBYA 3T9NA 3OYIA 5LJ5h 1D1CA 2RJCA 4J6YA 3RDVA 1UHCA 1PC0A 2VVKA 2YHTA 4J6XA 2C0IA 3FRNA 1HXDA 4BE2A 3PVLA 4JPBW 1M1KR 3SEMA 2RN8A 2CZ6B 3V7CA 3CXCA 1D0ZA 2LC4A 2VYTA 2F2VA 4LD9K 1OU9A 4XAXB 2LQNA 4LN2A 4BI8B 3JCMd 3KFVA 1M30A 3EFOA 3JRZA 4A53A 2GTOA 3CCUT 1MGQA 1K9MU 4E7KA 2FZKB 4MZPA 1KC8R 2P0QA 4C92B 3HFNA 1WA7A 2JOYA 2F69A 3E1SA 3QBYA 4ZTFA 1F1BB 2EQJA 3CCST 2COZA 2MCNA 1U1SA 1OQKA 3CCJQ 3E2UA 4K11A 2RQWA 2KEAA 3CCJT 3CPWA 1HYOA 1S72Q 1RAAB 4RTXA 2FPFA 1WXTA 2IPOB 1Y0MA 3CBPA 3UDCA 3C0CA 3CC4Q 2JT4A 3M0UA 1NM7A 2KDSA 3CC4T 3CCQA 2DBKA 1IXDA 3RIRA 2CDTA 3VU3C 3S3NA 3M9QA 5LL6S 3PFSA 1TWBA 2MI6A 1M2VA 1NYFA 2F5TX 4M7AE 1IRXA 4OMPA 5GAMg 1GBRA 5CQXA 3MPUB 1AHJB 2LNVA 2IVWA 3MP6A 1AVZC 1UGQB 1YIJQ 2QEXA 2RJEA 4DA4A 3U23A 2L0AA 3C4SA 1NLPC 3V7SA 3GBQA 3R6OA 4ZN3A 2EFIA 4C8QD 5GMKj 1ZX6A 3DLLA 1U1TA 1VQ7Q 1NE8A 4PJOE 4FT2A 5GAOl 2AKLA 2DYBA 9ATCB 4F04B 4M7DA 1M3AA 2HQEA 2DA9A 3L1AA 2M16A 2FZCB 4MZMA 1U3OA 1WGSA 2L2PA 2ABLA 4OB1B 4RTVA 3RR6A 2K9GA 3CD6Q 4ME7A 3UA7A 3CD6T 4P5NA 3QUIA 2P84A 3L2WA 5KYUB 1VA7A 4A54A 3UF4A 1VYUA 2JW4A 3V8KA 3MP1A 4M78G 3CMAT 2E3HA 2PQWA 1BYMA 2DLPA 3EGDB 3OYAA 3E19A 5LJ3g 2L5QA 4LDVA 1BU1A 1SSHA 1JQQA 4GLMA 2YT6A 3CXCP 3OYEA 4J9DA 2JM9A 2FPEA 2HQHA 2PVOB 4JRPA 3VKIA 3VUZA 3I5RA 2R5MA 3NGPA 4M7AB 1DJ7B 1VQPT 4F7UG 2JZ2A 2XDBA 4IIOA 4PFOA 4FSXA 1U06A 2ZCFB 2AT1B 1CKBA 3QPHA 4FYVB 1WJRA 2QA4Q 4JJDA 2HBPA 2X4JA 4ELZC 1J3TA 2O01E 4FW1A 2MK5A 4PJOB 2OTJQ 1X75C 1PNJA 4KH1B 4BD3A 2OTJT 2E70A 4O6JA 4KULA 4KT0E 2O88A 2DPPB 4LDUA 1EZZB 2DEQA 3RUXA 2RQTA 1YJNT 1ZBXA 2WACA 3RKXA 2RHYA 4MDWA 3L2RA 2WSCE 3WVDB 2K6DA 1KD1U 3HL8A 1NPPA 3L42A 3M0RA 5GMKe 1PG5B 1HD3A 4EMKA 2GGRA 4Z8AA 1VQMT 4J9IA 4D8DA 3O5ZA 2R58A 2OJ2A 3UATA 5GANj 3A8LB 2LMJA 3PT9A 4X1VA 2VGMA 3CPWS 2D6FA 2EQMA 1G83A 2FRWA 4LDXA 1VQ5A 1G8XA 2KNBB 4AMCA 3G4SA 5J3BA 3J80E 1PCXA 4BI4A 4FYWB 4B9XA 2F2XA 2J6KA 1QVFS 1OOTA 3EHRA 1ZUKA 1HSQA 1M3BA 1H641 4Z89A 2CH4W 1Y96B 4C0DB 3QJ6A 1VQ9T 1N8RR 3CCQQ 5DY9A 4ATOA 1BB9A 4Z88A 2VB6A 3EG9B 1D3BB 3SFMA 4JS5A 5HK0A 5GAMd 1M90U 4XTUA 4BDYA 4C92D 1TH7A 2R5AA 4IUQA 2AHJB 1Q82R 2HDAA 1BCOA 4L6V5 2EYWA 1JJ2A 1PWTA 2DKGA 4ZN1A 2M0OA 3OS2A 3S3MA 2QEXQ 3UT1A 1A0NB 2X3XD 1Q86U 2JN0A 3EFOB 1XOVA 1AWXA 4M7DE 4KGZB 2RNAA 1K9MC 2CP7A 2L3QA 3CBOA 2EW3A 3TREA 4DBFA 5KCHA 4JUVA 3SWNC 1PRLC 1YJWA 2PVDB 3A98A 2J6FA 4RCBA 4OB3B 4AFSC 4OB2B 2RO0A 3OYFA 2RD1A 3MCAB 4L59A 1IZ6A 1GCQC 1W6XA 5CKFA 1RAFB 3EGUA 1UJYA 4JZ4A 4ZGDB 2YWWA 4OMQA 1LVKA 4KH0B 2EBPA 2G3RA 2B8AA 3RBBB 1UB4A 5GMKh 1G3WA 2YRCA 3JB9F 2IIMA 2P4RA 3RKWA 1WLPB 1QKXA 3RMQA 1QCNA 2JUFA 3H6ZA 4RTTA 5LJ3d 2FB7A 1K0SA 2LX9A 1N27A 4DEYA 1M2VB 1M2OA 1QMCA 1RAGB 1D0XA 1K76A 1R0BG 1IB8A 4N0AA 1IO6A 1GRIA 5ECAA 6AT1B 1KQSS 2D0QB 4M75D 3NTHA 1QWEA 1BBZA 2NYSA 2MF2A 4FU6A 2BZ8A 2AZSA 1PM3A 2DIQA 2ZPGB 2LRQA 4II1A 3GOXA 1AWOA 4C5EA 3X20B 1UGSB 1PSFA 1PHTA 3JB9I 2Y4YA 2MOXA 1UFFA 1VQKA 2QQAA 2QXFA 4ZNXA 3PIPA 4M7DB 3BE3A 2FG0A 3V7RA 2VUBA 4RG2A 2PNIA 1U8RA 2JNGA 1T0JA 1Z9ZA 5LJ5e 4BUGA 3REAB 2QI2A 2YRDA 3TQ7P 4WTOB 4DOWA 2DE0X 1JXOA 4BI3A 3G71A 3EG0A 4ZTJA 2O9VA 4M7AD 1VIFA 4M75C 4OMOA 2J05A 2C0OA 5FLXE 5C6SA 4LD6A 3JB9H 4IUTA 4IKFA 2KRMA 1WYXA 4XK8E 1SHFA 2D1XA 1FXXA 2VWFA 1ZSZA 2VXFA 1Z9QA 4F16A 2LDMA 1M5Q1 1VQ5Q 2HD0A 3E9GA 3G4SQ 2EJ9A 3HRTA 1LPLA 3VS7A 4XQ3A 4PJOD 2QQBA 3EFSA 1E6GA 5HY6A 1QKWA 3P8DA 3MEUA 1TU0B 3IQLA 1QP2A 2Y90A 3AT1B 2ATCB 5GANh 2RMOA 2JS0A 1AD5A 2RK2A 1UECA 1E6HA 1M1KU 4Y91A 3INZA 5FU7B 2DL7A 3SD4A 5CQYA 4NS5A 3TSWA 1JJ2S 3QWXX 2DVEA 5CR2A 3CMEQ 2YUPA 1KFZA 3CCLT 1HJDA 3FLGA 3CMET 3L2ZA 4OB0B 2JTMA 1KC8U 1R0CB 4TVRA 2K2VA 2E41A 2CZ0B 3EH2A 2LP5A 3HRSA 2QTXA 1D09B 1KD1C 1YHQT 2E10A 3EH1A 1P92A 4C5IA 2MPXC 4N4GA 4EMKB 2DXCA 2RJDA 1YI2A 1H8KA 1VOMA 1YCSB 3GF5A 2C0TA 4JZ3A 4C8QG 2ROTA 1FMVA 3PMTA 2B86A 2E12A 2KR3A 3THKA 3OB9A 1VQ4A 2LCCA 4RTUA 2LNHB 4O5VA 2ECZA 1QQJA 2EGEA 1ZUUA 4FM4B 4LDWA 3L2VA 5KYXA 3GPLA 4KBMB 1Q7YC 2F1LA 2PZ1A 5D6XA 2JTEA 4FYYB 1MMDA 1D1AA 3CCRA 5CAIA 3CC2Q 4LDYA 2CP3A 1SPKA 5LJ5f 3CC2T 4OGCA 4GBQA 1U5SA 2XDPA 2K7AA 4M77C 5CKDA 3MJXA 5EG2A 1LCKA 1QVGA 1C0MA 1WHKA 2M02A 2D0NA 1XJWB 2AKKA 2Y4XA 3Q1JA 4AG2C 1WI7A 1RUWA 2DEUA 1X43A 4MZTA 4FL6A 5L23A 1OZ2A 3QHSA 3EFRA 3EGXA 2CKKA 4E7HA 3META 2ZPFB 3CC7A 5GAMj 1OEBA 1YITA 1ZA1B 3NMZC 1RL2A 2MYSA 1G3TA 2XKOC 3M0QA 4M78F 2LJ0A 1FYNA 1ZLMA 5J39A 1LNXA 2ENMA 1VQ8Q 2RQRA 2KVQG 2OTLQ 1VQ8T 3CCMA 1D0YA 3OMGA 1Q86C 2K5FA 2OTLT 3CBMA 4NL3A 3G6EA 3REBB 2DBMA 8AT1B 3DLMA 5GMKl 4N4HA 1S72T 2BZXA 2DTIA 2KQWA 4PK4A 1YJ9A 3QZ9B 3ZEHA 1ZQ1A 1NEGA 4F7UF 1VQKQ 1K73R 2DERA 2DETA 2FL7A 1QVFA 2QGGA 4HKEA 5CIUA 3OYBA 1S1NA 2QTVA 2M1HA 1RI9A 2J06A 1NG2A 5GAOq 1NLOC 1NYGA 1VQLQ 5GAN4 2QQSA 5FWBA 3CCEA 4OMLA 4J9CA 5FROA 1VQLT 1Q81U 3RERA 1O75A 2E5KA 4QQDA 1YIJT 3TU4K 1WNLA 2LT1A 4R56A 2BTTA 2VC8A 3NHNA 3GIBA 1WIEA 1ZUYA 5I11A 1VQOA 3M54A 4BDZA 1JB0E 4M7DD 1WQ7A 4JJCA 2EYXA 1VQ7T 2E6ZA 3H9NA 2K5IA 4Y92A 1WPYA 2DVJA 4E7ZA 2P0KA 2CSIA 2K4YA 5I21A 3I55A 2FHDA 3M0TA 3M4YA 1OPLA 3VJPA 1TS9A 1SG5A 2HCKA 3UWNA 2D9TA 2JTFA 1QLYA 3MEWA 3KUFA 5A0DA 1N9SA 3A8HB 1KIKA 3BDUA 5IH2A 3DB4A 1XNIA 3VS3A 5DLQE 4C92G 3M5AA 1HK9A 2AK5A 2X4XA 4A63B 4C0ZA 4IUVA 7AT1B 1ZBJA 3VS2A 1T3SA 1VQ6A 2AIRB 4BY6C 3M57A 1W1FA 1H3ZA 4C8QC 1MV3A 2V26A 1ABQA 3LH5A 4J9HA 2EYQA 3TSZA 1X6GA 1V29B 2CZ1B 1H3HA 1FMWA 4FIBA 3A8MB 1K8AU 1K9AA 2JJ9A 1YI2Q 4YTLA 2DIGA 2OI3A 1KQSA 3EAEA 4EMHA 1RACB 2QK0A 2XU8A 4JRQA 2L3SA 1VQ4Q 2KGTA 4DEXA 1ZSZB 1N8RU 3CPWP 4J9EA 1R8OB 2QA4T 1W2BS 1YP5A 1M1FA 5GAN6 1OULA 1QVGS 4XU1A 4PL6A 4EDUA 3CCRQ 2SRCA 4QVDA 3CCVA 1UE9A 2G6FX 1M1KC 4C5HA 4XU3A 1TOVA 2COYA 4EIKA 1QWFA 4HA8A 2DZCA 1SRMA 4RKUE 3CQTA 4QVCA 2HKNA 4J9FA 2RI5A 1QCOA 4XU0A 2DRKA 4CI0C 1H92A 3OQ5A 1MNEA 3OS0A 1KC8C 1XTDA 4RUGA 4M75G 2K5LA 3CC7Q 1YITQ 5FU7C 1WX6A 1MV0B 1UG1A 4M77F 2DF6A 2RJFA 1KHIA 2VGNA 4AG1C 3OW2S 4XTYA 3TEEA 3G6EQ 2DZ9A 3VUBA 1UGPB 2BZYA 3FJPA 1EFNA 1YJ9Q 1PKTA 2KMTA 4JS4A 5L8RE 2DYIA 1YFNA 2OAWA 4JLGA 4RCCA 2BE9B 3JCMc 3JCMX 3HKSA 3G7ZA 3VS4A 1MNDA 5KYXB 5GAMh 3LGLA 4C0FA 3CCQT 1QP3A 1VYVA 3HTRA 3X25B 1WXBA 1WHHA 3OS5A 3I56A 1OPKA 4AFQC 3QDRB 3SWNA 3JB9J 2E64A 3OYGA 4M7AG 1RLPC 2Z0WA 1VQNA 1NEBA 3CCEQ 1SSFA 1YWOA 1M8MA 2RI2A 5GANg 3MEAA 4AFUC 2DL8A 5A2QE 1PD0A 2GFUA 2HL3A 5IXFA 1RAHB 2QEXT 1GCQA 2E5QA 4M78A 4NOYA 3ULRB 3SB2A 3EGXB 2GQIA 2LCLA 4J6WA 1RAEB 3EG3A 1KD1R 4CC3A 2BIVA 1EX4A 2CP0A 1V1CA 4PJOG 5A0GA 2EPDA 2ZPIB 4KUIA 2CS7A 2CP6A 3LWHA 1I0CA 2GTJA 5KH6A 4PLIA 3TVTA 4F7UA 3I55Q 3FDRA 8ATCB 3OYYA 3ZFJA 1AEYA 4DBRA 4C92C 5GANe 3QZ5B 5KCOA 1MMGA 1T3LA 2RH2A 2CUDA 2RB6A 2EQKA 2JVVA 2YLCA 3OYMA 1NJIU 1Q7YR 2XG8D 1VIEA 2ZAEA 3OYLA 1AZEA 3OMCA 4A4EA 3WXMB 2RF0A 4M4ZA 2DXTA 2LTOA 4M77G 1WJSA 2A0FB 4PFZA 2I0NA 4JJBA 2X4WA 1RLQC 1UGVA 1SKUB 5IN1A 4CC2A 1TXQA 5AYFA 1Q81C 3ZL7C 5LJ5g 4VUBA 3CCUA 3FC3A 5IHKA 2QG9B 3X24B 4HCKA 3ME9A 4QW2A 4JRIA 1QW1A 1PSEA 4JDSA 2DJQA 3CCSA 4B6MA 1SRLA 2RHIA 3JCMb 2J6OA 3CCJA 4M75A 2ZPEB 4C8QF 1B7TA 2E3IA 1PRMC 2X3WD 4QKUA 2VV5A 1B3QA 4C0GA 1OV3A 1Q86R 4IURA 4A4HA 1Q95G 2KBTA 3CC4A 3M56A 3PNWC 2QGFB 3CCVQ 1NZ9A 2A36A 2HSPA 2V8KA 4OP0A 5KE2A 1OI1A 2DL3A 3S3OA 1AT1B 4KGXB 4DOVA 3BFMA 3OSVA 4BE1A 2XICA 4E7LA 3M0SA 3G1JA 3H8ZA 1OX9A 2MIOA 4XTZA 5KYYA 3MKDA 4J9BA 5CKEA 1JJ2P 5IAYA 3HSBA 2RM4A 2DFUA 1TUCA 5IT9E 4IIMA 1KG1A 3OYDA 1BIBA 2K2MA 3GP8A 4B9WA 3QO3A 3V8JA 1K8AC 1VQ5T 1K1ZA 5GAN5 1WHLA 3G4ST 2K79A 4QVZA 3C95A 2RHXA 3OS1A 2PU9B 1OX8A 4Z02A 1B34A 3QG1A 5FWCA 2KRNA 2DK3A 5DLOA 2YXYA 2NUPA 3L2UA 2GFAA 4LUEA 2EQIA 5GANf 1M9SA 1UDLA 2MWOA 5I22A 3JCMJ 2ED1A 4M7AC 2YUQA 4E7JA 2I2LA 3MO8A 3OBYA 1TUDA 3R6NA 2P4TA 3CD6A 4X9CA 4XU2A 3LLRA 3PVQA 4AT1B 3I56Q 2A3LA 2KYBA 1E7OA 3FJ5A 4OVAA 3ASKA 3CMAA 4M78E 4A4KA 5GANd 3I9QA 3PMIA 1RI0A 2KT1A 2M51A 3VRZA 1BI3A 2E4HA 2K57A 4JLIA 1I5OB 4PJOC 1JO8A 1GL5A 1BK2A 1X2QA 2KI7A 5CCAA 3AHUA 2LQWA 4GLKA 2LZ6B 3OYCA 4E6RA 4OMMA 2V1QA 1VUBA 1WDXA 1BKBA 4M7DG 1BI0A 4M77A 2DL4A 4C5GA 2D8JA 1VQPA 1K73U 2LJ3A 1YJWQ 4F7UE 1YJWT 3H0HA 2CUBA 4LE9A 5FU6B 2MMPA 2NLUA 3M58A 3NTIA 3MEVA 1RAIB 4JJNK 2PUKB 3URGA 2XD0A 1MMNA 1WJQA 4WF2A 4IUPA 2CT3A 3JCMh 2OX7A 1W2BA 3I35A 1O9SA 1GFDA 3E9FA 2JXBA 2OTJA 1X01A 4E2FB 1YJNA 2YLBA 1M90C 3VS6A 2FYKA 2DD5A 1RADB 5GJVB 2H8HA 4XTVA 3BY7A 3SWNB 2E6NA 1VQMA 1YCYA 4CC4B 2DTOA 2K3YA 5LJ5d 3CEYA 3LW5E 1WHGA 4C0DC 4C92F 2KXCA 2CT4A 5GMKi 2YRVA 2FZGB 3N5BB 2ZPBB 2QDLA 3CCUQ 3J81E 4HCBA 4DQ2A 4PFPA 3NTKA 3FIFA 4M75E 2P0PA 4M78B 1YWPA 1D1BA 5I2SA 2W10A 1FMKA 2QAZA 3VS5A 3CCSQ 3LX7A 2JMCA 2JS2A 1I5LA 3QWYA 2W0ZA 1AZGB 2NWMA 5AT1B 3OW2A 1VQKT 5GAN2 3NPFA 3OYNA 3SDZA 5D7UA 1M1GA 1Y7XA 4CC7A 4BE0A 4J7IA 2EJGA 1QVPA 1EIFA 3C12A 4DBQA 4F7UB 3JB9D 2RA2A 2QYZA 1JEGA 1VQ9A 1K0XA 1LJOA 5HKCA 1BIAA 2V8IA 5CVIA 3G71Q 1I8FA 2EWNA 1C6VX 4RG8A 2GQVA 3G71T 1NJIC 4FYXB 1MUZA 4MDXA 4FSSA 2MAMA 3M0PA 3QYGB 2HKQB 1M4ZA 5LJ3j 4RTZA 2CYZB 3HFOA 5D6WA 3I5SA 5EC7A 5CO7A 3QDFA 4LNPA 2CP2A 3X28B 2BE7D 2NUTA 2VASA 2DMOA 1AOJA 2EIFA 3PE0A 3PTAA 4M75F 4KGVB 1M27C 2ESWA 2LT4A 5DM7R 1K9MR 4C8QA 3UA6A 5I2MA 5GAOn 3A8GB 1FX7A 2JMAA 2DNUA 4M75B 3H41A 2GCXA 2JM8A 4R55A 5GMKm 4QQGA 4N4IA 5GAMe 2HZYA 4D8KA 1JBMA 2BUDA 2ZGWA 2RQVA 3QXEB 1AWJA 2XMFA 3QJYA 1W2BP 1VYTA 4AFZC 1QVGP 2DILA 5FRNA 2HSEB 2EKOA 2EAYA 1X27A 2A28A 4QQ6A 1BI2A 3OYHA 5HK3A 1TG0A 3C94A 3CMAQ 4M7DC 3M59A 2XIDA 4FT4A 4EMGA 3VYHB 4M77E 4F17A 2VXEA 1OYXA 2DRMA 4OMNA 1K4US 4M7AF 2PVGB 4RMOA 2XK0A 5KYYB 1YI2T 1XQHA 3JV3A 4PJJA 2EVRA 3JCMW 2EYYA 2AZVA 1I81A 2KRSA 2L3PA 2O4XA 1VQ4T 3KBGA 2CP5A 1VQPQ 1Q81R 2QQ9A 4ESRA 3FB9A 2LQ8A 1GXIE 3OBWA 5KYWA 4KUDK 2WSFE 1PKSA 1Y57A 1OZ3A 5HCKA 5GAOm 1B34B 1IREB 3OW2P 1PD1A 4PJOF 1I4K1 4E7SA 1Q82U 4UC4A 5CK9A 2NUPB 3CCRT 1NBEB 1QVFP 5GJWB 4FCYA 1G5VA 5LJ3e 5GAOr 3BW1A 1WFWA 4WCIA 4IUUA 4E7IA 3OA6A 2EGAA 1UJ0A 4V2SA 1ZA2B 1ACMB 5IHNA 4XTXA 3CXCS 1M3CA 2HL5C 2EYZA 2YUNA 2E1HA 3S6WA 3VV0A 2QASA 4ZGJB 4EPCA 3DB3A 2KROA 1YJNQ 1KQ1A 2O2OA 3LGFA 1VQMQ 1W70A 1B07A 1G2BA 1FWZA 3CC7T 2IG0A 4HCZA 3H0FA 3MHXA 1YITT 2FEIA 2OAUA 2HEQA 1C1AA 1X6OA 1ARKA 2DO3A 1TSFA 3MP8A 1KHCA 1WXUA 1RABB 3CCMQ 2KXDA 4Y28E 3CCMT 1I07A 3G6ET 1G3YA 2XI9A 2NUZA 1R77A 2RK1A 2E65A 1K73C 4HXJA 4M77B 2EKHA 1YJ9T 1JRIA 1BCMA 1Q7YU 4EMKC 2LQKA 1K8AR 5GAMf 5FRMA 4HVWA 2X9HA 1KSWA 2ED0A 3CPFA 1ABOA 3OSSC 2KK4A 1VQ9Q 5KE3A 2RI3A 2SEMA 3QKJA 4E47A 3CCLA 5FU6C 3CCET 3PGGA 1WHMA 3CMEA 2CZ7B 1UEBA 2ZZDA 2FRYA 1LOJA 3VRYA 3FEOA 4M78D 3M4GA 2A08A 4OGEA 1NPRA 1YHQA 4C92A 4A4FA 2DXBA 2KYMA 3ER0A 3SHWA 2VKNA 2GBQA 3BDLA 3RMSA 1N5ZA 2K3XA 4HT9A 1VQOQ 5KYNA 5GAN8 1VQOT 1M8VA 4LUDA 5LJ5j 4C8QE 1KQSP 1IGQA 2GNCA 1SHGA 1X69A 3A8OB 1SEMA 4F14A 2KSSA 5M9OA 2O31A 2O9SA 1MMAA 2L8DA 3DKMA 3LYIA 4LXCA 3I55T 2H3JA 1WHJA 3HHTB 5LJ3h 3D7SB 1V76A 2X51A 5LJ3f 4OF1A 1TTHB 2DTHA 3V8LA 1YNZA 1ZSGA 3ZBDA 3CC2A 3EG2A 3JCMV 4M78C 1Y07A 1CKAA 2EGCA 3OY9A 3VS1A 3OYJA 4QT7A 2F2WA 4OMFB 2RPNA 1WZOA 2QDYB 1VQ6Q 1QCFA 4ORZA 1GCPA 1VQ6T 3L2QA 2CH4A 2V8JA 5CKHA 4MMLA 4PLLA 3JCMg 1GBQA 3TCJA 1I1JA 2FVUA 4ZGEB 1M90R 2WSEE 4HCCA 1KQ2A 3VYGA 1TUGB 3RKYA 4HT8A 4X9DA 4GY5A 3X26B 2A7YA 4J9GA 3UPUA 1IGUA 2RHUA 2LCSA 1VQ8A 3LH0A 2OTLA 1Y71A 2NUTB 4FW2A 4J83A 1S72A 1WQWA 1UUEA 3M53A 4M7DF 2KE9A 3JCMP 2DX1A 1N6AA 4BY6B 4C8QB 4N0AC 1MHNA 1UHFA 5CKBA 5KYUA 2XDDA 3CCVT 3HPWA 3HRUA 3JCMe 4R0KA 2PUOB 4JRKA 2L89A 2C06A 2V1RA 3EGDA 2KT8A 2YSQA 1ZHIA 1UTIA 3A1PA 3QSUA 4J7FA 2DAQA 3WVEB 2HAXA 2FPDA 1VQLA 3KXTA 1CSKA 2L3RA 2LX7A 1UGRB 2LVMA 2K3BA 1IHWA 4Q5WA 1YIJA 3GNFB 1JU5C 4M7AA 3GLXA 2A37A 2HBWA 4CRIA 1BI1A 1NJIR 2DL5A 2M0YA 2ZPHB 4MMKA 3OYKA 5GAN7 2EQUA 2PTKA 1VQ7A 2H3EB 2M9UA 3RNJA 1X2KA 1SF9A 2O4XB 3F70A 1N8RC 1G3SA 2CREA 3JCMQ 2GF7A 3QYHB 2CGHA 5J26A 1IHVA 2HMAA 4PJOA 5KYWB 3JB9G 3EHQA 4A4GA 2RHZA 2MWPA 4XTWA 3M55A 3J7AF 2COWA 4L5GA 4X34A 4D6WA 3P8BB 2DXUA 2DD4A 1Q82C 5GAOp 2BKDN 5D6YA 4BACA 4KRTA 1GFCA 3I56T 1ZSZC 1AWWA 1YN8A 2CSQA 4PKCC 4RTWA 1VQNQ 3LWIA 5A0LA 4C92E 4DBHA 4BB7A 2DJZA 2RQUA 3CCLQ 1VQNT 2YUOA 3PIOA 2X4YA 2F5KA 3P8HA 1OU8A 3QIIA 1JXMA 2J7IA 4J8OA 4M77D 1YHQQ 3GNGA 3HP9A 5IXBA 2QQRA 4RTYA 3JAME 4PNOA 4PJNA 2KY9A 3H0IA 5IHIA 3O8VA 3NFCA 2X35A 2KAFA 3A5ZB 1N9RA 2R57A 4ELYC
chains in the Genus database with same CATH topology
2HQXA 2LRQA 2ZPGB 4II1A 4XTYA 4M75F 3TEEA 5C0MA 4C5EA 3PTAA 3GOXA 3X20B 1UGSB 1PSFA 4J5YA 2HNIA 2DZ9A 5GAN3 3VUBA 2LT4A 5DM7R 1UGPB 4C8QA 3JB9I 3FJPA 4NL2A 5I2MA 2Y4YA 5GAOn 2KMTA 1Y96A 3A8GB 2EJFA 5L8RE 4JS4A 1VQKA 1FX7A 2QQAA 2QXFA 4JLGA 3JSCA 4RCCA 2QA4A 2XHCA 3JCMc 3PIPA 3JCMX 4M75B 4M7DB 3HKSA 3G7ZA 5GAMh 2GCXA 3JCMf 3LGLA 4R55A 1W4SA 4QQGA 4N4IA 5GAMe 5GMKm 3V7RA 4C0FA 3CCQT 1QP3A 1D3BA 1JBMA 2BUDA 3X25B 2VUBA 4RG2A 3RESA 1U8RA 3OYIA 1YBYA 3T9NA 2JNGA 2ZGWA 3QXEB 5LJ5h 3OS5A 3QJYA 5LJ5e 2RJCA 4BUGA 3I56A 2QI2A 4J6YA 3QDRB 3SWNA 4DOWA 3JB9J 2E64A 3OYGA 5FRNA 4BI3A 3G71A 2YHTA 4M7AG 4J6XA 2EKOA 2EAYA 3FRNA 1HXDA 4ZTJA 4BE2A 4QQ6A 1VQNA 1BI2A 1SSFA 3OYHA 5HK3A 4M7AD 1VIFA 2CZ6B 3C94A 4M75C 3V7CA 3CXCA 4M7DC 2RI2A 2LC4A 2VYTA 3M59A 2XIDA 4FT4A 5GANg 4EMGA 4LD9K 3MEAA 4XAXB 3VYHB 3JCMd 4BI8B 4M77E 5A2QE 2GFUA 4A53A 3JRZA 5FLXE 2VXEA 1OYXA 2QEXT 2E5QA 4M78A 4NOYA 5C6SA 4M7AF 4LD6A 3SB2A 1MGQA 2PVGB 4RMOA 4IUTA 2XK0A 3CCUT 1YI2T 1K9MU 4IKFA 3JB9H 4E7KA 4MZPA 4XK8E 1XQHA 2P0QA 4C92B 3HFNA 2LCLA 3JCMW 4J6WA 1FXXA 2JOYA 2F69A 1I81A 2VXFA 2O4XA 3E1SA 3QBYA 4ZTFA 1VQ4T 3KBGA 2LDMA 2BIVA 2EQJA 3CCST 1M5Q1 2QQ9A 4PJOG 1U1SA 5A0GA 2HD0A 3E9GA 3FB9A 2ZPIB 2EJ9A 2LQ8A 1GXIE 3HRTA 2CS7A 3OBWA 4KUIA 4KUDK 4XQ3A 2WSFE 3CCJT 4PJOD 2QQBA 3EFSA 3LWHA 3CPWA 5HY6A 3P8DA 5KH6A 3MEUA 4PLIA 4F7UA 1OZ3A 1QP2A 3CBPA 5GAOm 2Y90A 1B34B 3FDRA 1IREB 3OYYA 5GANh 3UDCA 3ZFJA 4PJOF 4C92C 1I4K1 2RK2A 5GANe 1Q82U 3QZ5B 4UC4A 5CK9A 5KCOA 3CCRT 2RH2A 1M1KU 2KDSA 4Y91A 3CC4T 1G5VA 3INZA 2RB6A 3CCQA 5LJ3e 5GAOr 2EQKA 3BW1A 3RIRA 4IUUA 2JVVA 5FU7B 4E7IA 3VU3C 3SD4A 3S3NA 2YLCA 3M9QA 5CQYA 5LL6S 3OYMA 4NS5A 3OA6A 1NJIU 2XG8D 3PFSA 1VIEA 1JJ2S 3OYLA 4V2SA 4XTXA 2DVEA 2MI6A 3CXCS 5CR2A 3OMCA 3CCLT 2E1HA 3S6WA 3VV0A 4A4EA 3FLGA 2F5TX 3WXMB 4ZGJB 3CMET 3L2ZA 4OB0B 4EPCA 3DB3A 4M7AE 2DXTA 2LTOA 4M77G 2JTMA 1WJSA 5GAMg 1KC8U 4TVRA 2K2VA 2X4WA 5CQXA 2E41A 1KQ1A 2CZ0B 1AHJB 2LNVA 3HRSA 2IVWA 5IN1A 2QTXA 3MP6A 3LGFA 1KD1C 5AYFA 1Q81C 1YHQT 1FWZA 1UGQB 2E10A 5LJ5g 3CC7T 4VUBA 2IG0A 1P92A 4HCZA 4C5IA 3MHXA 4N4GA 1YITT 2QEXA 2OAUA 4EMKB 2DXCA 2RJDA 1X6OA 2DO3A 3CCUA 3FC3A 3MP8A 1KHCA 1YI2A 3X24B 2RJEA 3ME9A 4DA4A 3GF5A 3C4SA 4C8QG 4QW2A 4JRIA 1QW1A 4Y28E 3V7SA 3PMTA 3CCMT 1PSEA 3R6OA 2E12A 4JDSA 4ZN3A 3OB9A 3G6ET 2EFIA 2LCCA 4C8QD 5GMKj 1VQ4A 1G3YA 4O5VA 2XI9A 3DLLA 3CCSA 1U1TA 4PJOE 1NE8A 2RHIA 2E65A 2RK1A 4FM4B 4FT2A 5GAOl 1K73C 4LDWA 4M77B 3JCMb 3L2VA 3CCJA 1YJ9T 4M75A 2ZPEB 4M7DA 3GPLA 2HQEA 1JRIA 1Q7YU 4KBMB 1Q7YC 4C8QF 4EMKC 3L1AA 2LQKA 5D6XA 2M16A 2VV5A 5GAMf 4C0GA 4IURA 4MZMA 4A4HA 1WGSA 5FRMA 3CCRA 4OB1B 5CAIA 3CPFA 3CC4A 4LDYA 3M56A 3OSSC 2KK4A 3PNWC 5LJ5f 3CC2T 4OGCA 4ME7A 1NZ9A 2XDPA 4M77C 3CD6T 5KE3A 2RI3A 3QUIA 4P5NA 5CKDA 2V8KA 4OP0A 5EG2A 5KE2A 1OI1A 3S3OA 3QKJA 4E47A 3L2WA 4DOVA 1QVGA 4A54A 3BFMA 1QVGS 3CCLA 3V8KA 5FU6C 3CCET 3PGGA 2Y4XA 3OSVA 3MP1A 3Q1JA 4M78G 3CMEA 3CMAT 2CZ7B 4BE1A 1UEBA 2PQWA 2XICA 2ZZDA 4E7LA 1BYMA 3OYAA 3E19A 1LOJA 5LJ3g 3FEOA 4FL6A 2L5QA 4M78D 1OZ2A 3M4GA 3H8ZA 4LDVA 4MZTA 3QHSA 4XTZA 3HSBA 5CKEA 4OGEA 3EFRA 5IAYA 2CKKA 4E7HA 1NPRA 1YHQA 3META 3OYEA 4C92A 2ZPFB 3CC7A 2PVOB 4A4FA 2DXBA 2RM4A 3ER0A 5GAMj 1YITA 5IT9E 3BDLA 1RL2A 3RMSA 1G3TA 2XKOC 4M78F 3OYDA 1KG1A 4JRPA 1BIBA 2K3XA 3VKIA 3VUZA 4HT9A 3JB9G 3GP8A 2R5MA 4B9WA 5J39A 1LNXA 5GAN8 3QO3A 1VQOT 2KVQG 1M8VA 3V8JA 4M7AB 5LJ5j 1DJ7B 4C8QE 1VQPT 1K8AC 1VQ5T 1VQ8T 4F7UG 3CCMA 5GAN5 2JZ2A 3OMGA 2XDBA 1Q86C 2K5FA 3G4ST 3CBMA 4NL3A 3G6EA 2OTLT 3A8OB 4QVZA 3C95A 2RHXA 3OS1A 2KSSA 3DLMA 2PU9B 5GMKl 4Z02A 1B34A 5M9OA 4N4HA 1S72T 2DTIA 2KQWA 3QG1A 1YJ9A 2DK3A 3QZ9B 3ZEHA 5DLOA 2L8DA 3DKMA 4FSXA 2ZCFB 3LYIA 3L2UA 1ZQ1A 2GFAA 3I55T 2H3JA 5GANf 3QPHA 4F7UF 1WJRA 3HHTB 5LJ3h 1M9SA 2MWOA 3JCMJ 2HBPA 5LJ3f 2X4JA 4OF1A 4M7AC 2FL7A 4ELZC 2O01E 1QVFA 2DTHA 3V8LA 4E7JA 2I2LA 3MO8A 4PJOB 3OBYA 4HKEA 1X75C 3ZBDA 3CC2A 5CIUA 4M78C 3JCMV 4BD3A 1Y07A 2OTJT 2E70A 2P4TA 4O6JA 3OYBA 3CD6A 4X9CA 4KULA 4XU2A 3LLRA 4KT0E 2M1HA 3OY9A 3OYJA 2DPPB 4LDUA 2A3LA 2DEQA 3RUXA 4OMFB 5GAOq 4OVAA 1ZBXA 2WACA 1YJNT 3RKXA 2QQSA 2RHYA 2QDYB 5GAN4 4MDWA 3L2RA 3CCEA 2WSCE 3ASKA 3WVDB 3CMAA 1KD1U 3HL8A 5FROA 1NPPA 4M78E 3L42A 1Q81U 1VQLT 1VQ6T 5GMKe 4A4KA 5GANd 3L2QA 3PMIA 1VQMT 4EMKA 1RI0A 2V8JA 5CKHA 3RERA 4MMLA 1BI3A 1O75A 2K57A 4QQDA 4JLIA 1YIJT 2R58A 3TU4K 1WNLA 2LT1A 5GANj 3A8LB 4PLLA 3JCMg 4PJOC 4R56A 3TCJA 5CCAA 3PT9A 3AHUA 4GLKA 2VC8A 2FVUA 3OYCA 4ZGEB 4HCCA 2WSEE 1KQ2A 3VYGA 1VUBA 2VGMA 3RKYA 1BKBA 3CPWS 2D6FA 4M7DG 3GIBA 1BI0A 2EQMA 4HT8A 4X9DA 4GY5A 3X26B 2A7YA 4M77A 1VQOA 3M54A 4C5GA 4BDZA 4LDXA 1JB0E 3UPUA 2RHUA 1VQPA 1K73U 1VQ5A 1VQ8A 1WQ7A 3LH0A 4M7DD 1VQ7T 4F7UE 2E6ZA 3G4SA 5J3BA 2OTLA 3J80E 1YJWT 1Y71A 2K5IA 4BI4A 1WPYA 4B9XA 4J83A 5FU6B 1S72A 2MMPA 2P0KA 1WQWA 3M53A 2NLUA 3M58A 4M7DF 2K4YA 5I21A 3NTIA 3MEVA 2FHDA 3M4YA 3VJPA 3I55A 4JJNK 2PUKB 1QVFS 3JCMP 3URGA 1N6AA 3UWNA 2XD0A 2D9TA 4BY6B 2JTFA 1WJQA 4C8QB 4WF2A 4N0AC 1H641 3MEWA 1MHNA 3KUFA 4IUPA 1Y96B 5A0DA 1N9SA 3JCMh 3A8HB 5CKBA 2XDDA 3CCVT 1W2BA 3HPWA 3HRUA 4C0DB 3JCMe 3QJ6A 1VQ9T 1O9SA 5DY9A 3BDUA 3E9FA 2PUOB 4JRKA 2L89A 2C06A 3DB4A 4ATOA 1XNIA 2OTJA 1X01A 1ZHIA 1D3BB 5DLQE 4C92G 3QSUA 4J7FA 2DAQA 3SFMA 3M5AA 3WVEB 1HK9A 4JS5A 5HK0A 5GAMd 1YJNA 2X4XA 2YLBA 1M90U 1M90C 4C0ZA 4XTUA 2HAXA 2FYKA 2DD5A 4BDYA 4IUVA 4C92D 4XTVA 1VQLA 3KXTA 1TH7A 2R5AA 4BY6C 3BY7A 3M57A 1VQ6A 2L3RA 1H3ZA 1UGRB 4C8QC 3SWNB 2E6NA 2LVMA 4IUQA 1VQMA 2AHJB 1YCYA 2DTOA 2K3YA 4L6V5 5LJ5d 3CEYA 1JJ2A 3LW5E 2DKGA 2EYQA 4Q5WA 4C0DC 1YIJA 3GNFB 4ZN1A 4M7AA 1V29B 3GLXA 2M0OA 4C92F 3OS2A 4CRIA 1BI1A 2CZ1B 2YRVA 5GMKi 3S3MA 4FIBA 3N5BB 3A8MB 1K8AU 2ZPBB 3UT1A 2ZPHB 1Q86U 4MMKA 3J81E 4HCBA 2JN0A 4DQ2A 3NTKA 1XOVA 3FIFA 4YTLA 4M75E 5GAN7 3OYKA 4M7DE 2P0PA 2DIGA 1K9MC 4M78B 3CBOA 3EAEA 2EQUA 4EMHA 1KQSA 3TREA 5KCHA 2XU8A 5I2SA 4JRQA 1VQ7A 4JUVA 3SWNC 1YJWA 2M9UA 3LX7A 2PVDB 1I5LA 1N8RU 2O4XB 3F70A 1N8RC 4RCBA 4OB3B 1R8OB 1G3SA 4OB2B 3JCMQ 2RO0A 3OW2A 1VQKT 2GF7A 5GAN2 3OYNA 3SDZA 3OYFA 2RD1A 2QA4T 3QYHB 2CGHA 5J26A 1W2BS 4PJOA 1M1FA 3MCAB 5GAN6 4A4GA 1M1GA 2RHZA 1Y7XA 2MWPA 4L59A 4PL6A 4XTWA 4XU1A 4BE0A 4J7IA 4EDUA 1IZ6A 2EJGA 3M55A 3J7AF 1QVPA 4L5GA 1EIFA 3C12A 3JB9D 4F7UB 4X34A 2RA2A 5CKFA 4D6WA 4QVDA 3CCVA 3P8BB 2DXUA 4ZGDB 2DD4A 1Q82C 1VQ9A 5GAOp 1LJOA 2BKDN 5D6YA 5HKCA 4BACA 1M1KC 1BIAA 4C5HA 2G3RA 4XU3A 3I56T 2B8AA 1UB4A 2V8IA 5CVIA 5GMKh 1I8FA 1G3WA 2EWNA 4HA8A 4PKCC 4RG8A 3JB9F 2DZCA 2GQVA 3RKWA 3LWIA 4RKUE 3G71T 3RMQA 1NJIC 5A0LA 4C92E 2JUFA 4BB7A 2DJZA 1VQNT 4QVCA 3H6ZA 4MDXA 5LJ3d 2FB7A 2X4YA 2MAMA 3PIOA 2RI5A 2F5KA 4XU0A 3P8HA 3QYGB 3QIIA 2LX9A 1N27A 1M4ZA 4CI0C 3OQ5A 3OS0A 1KC8C 5LJ3j 1XTDA 4J8OA 2CYZB 3HFOA 4N0AA 4M77D 4M75G 5D6WA 2K5LA 3GNGA 1KQSS 3HP9A 5CO7A 2D0QB 2QQRA 3JAME 4PNOA 4M75D 2KY9A 5FU7C 3NTHA 3X28B 3O8VA 3NFCA 2X35A 2KAFA 3A5ZB 1N9RA 2R57A 4M77F 2MF2A 4FU6A 2RJFA 2VGNA 1KHIA 4ELYC 2DIQA 2EIFA 3OW2S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1H A;  4XTY A;  4M75 F;  1HK9 A;  5GMK l;  5GAM d;  2YLB A;  3L2Z A;  4J5Y A;  2HNI A;  1B34 A;  4XTU A;  2DXT A;  2DZ9 A;  2FYK A;  4M77 G;  2DTI A;  5GAN 3;  5GAM g;  4C92 D;  4M7A E;  4XTV A;  1TH7 A;  2E41 A;  4C8Q A;  3JB9 I;  1KQ1 A;  3BY7 A;  3FJP A;  4NL2 A;  4C8Q C;  3SWN B;  5GAO n;  1YCY A;  2QTX A;  1Y96 A;  2EJF A;  2DTO A;  5LJ5 d;  4RCC A;  5GAN f;  4F7U F;  5LJ3 h;  2DKG A;  2E10 A;  5LJ5 g;  3JCM c;  3JCM J;  3JCM X;  4M75 B;  4M7D B;  4M7A A;  5LJ3 f;  4C92 F;  5GAM h;  4M7A C;  3JCM f;  4EMK B;  5GMK i;  5GMK m;  5GAM e;  3V7R A;  2DTH A;  3V8L A;  1D3B A;  1JBM A;  2I2L A;  4MMK A;  2JN0 A;  4DQ2 A;  4PJO B;  4C8Q G;  3FIF A;  3RES A;  4M75 E;  5GAN 7;  4JRI A;  4M78 C;  3JCM V;  2ZGW A;  3V7S A;  5LJ5 h;  4M7D E;  4M78 B;  4EMH A;  4X9C A;  4XU2 A;  5LJ5 e;  4C8Q D;  5GMK j;  4J6Y A;  3SWN A;  3JB9 J;  2E64 A;  1U1T A;  2DEQ A;  4JUV A;  3RUX A;  3SWN C;  5GAO q;  4PJO E;  4M7A G;  2E65 A;  2YHT A;  4J6X A;  3RKX A;  2EAY A;  5GAN 4;  1HXD A;  5GAO l;  4M77 B;  1I5L A;  3JCM b;  4M78 E;  4M75 A;  4M7D A;  4RCB A;  5GMK e;  5GAN d;  4M7A D;  4M75 C;  3V7C A;  4M7D C;  1JRI A;  4EMK A;  3JCM Q;  4C8Q F;  4EMK C;  5GAN g;  3L1A A;  4MML A;  4C92 C;  4EMG A;  5GAN 2;  3RER A;  2K57 A;  2RD1 A;  3QSU A;  2CGH A;  3JCM d;  4JLI A;  4M77 E;  4PJO A;  5GAM f;  1WNL A;  5GAN 6;  4A53 A;  5GAN j;  3JB9 G;  4PJO C;  3JCM g;  4XU1 A;  2VXE A;  4XTW A;  3AHU A;  2EJG A;  4M78 A;  4NOY A;  4M7A F;  2VC8 A;  3SB2 A;  1MGQ A;  3JB9 D;  3JB9 H;  4F7U B;  5CAI A;  2RA2 A;  1KQ2 A;  4QVD A;  3RKY A;  4M7D G;  5LJ5 f;  2DXU A;  3GIB A;  4HT8 A;  4C92 B;  3HFN A;  4X9D A;  3JCM W;  4J6W A;  4M77 A;  1LJO A;  5GAO p;  1BIA A;  1I81 A;  2VXF A;  4M77 C;  4XU3 A;  3QUI A;  4M7D D;  1WQ7 A;  4OP0 A;  4F7U E;  5GMK h;  1I8F A;  2EWN A;  1M5Q 1;  4HA8 A;  4PJO G;  1U1S A;  3JB9 F;  4A54 A;  2DZC A;  3BFM A;  3FB9 A;  3RKW A;  3V8K A;  2EJ9 A;  1WPY A;  3PGG A;  4C92 E;  4M78 G;  2DJZ A;  4QVC A;  4XQ3 A;  4PJO D;  3EFS A;  5LJ3 d;  2FB7 A;  1WQW A;  1LOJ A;  4XU0 A;  5LJ3 g;  4M7D F;  4M78 D;  5I21 A;  3M4G A;  3QHS A;  4XTZ A;  4F7U A;  3HSB A;  3EFR A;  3JCM P;  5GAO m;  2Y90 A;  5LJ3 j;  1B34 B;  4C92 A;  5GAN h;  3HFO A;  4N0A A;  2RM4 A;  4M77 D;  4M75 G;  1I4K 1;  4PJO F;  4C8Q B;  4WF2 A;  4N0A C;  1H64 1;  5GAN e;  5GAM j;  4Y91 A;  4M78 F;  1Y96 B;  1N9S A;  1BIB A;  3INZ A;  2RB6 A;  4M75 D;  4PNO A;  3JCM h;  5LJ3 e;  5GAO r;  3BW1 A;  3JCM e;  4HT9 A;  3RIR A;  1LNX A;  5GAN 8;  3VU3 C;  3QO3 A;  2YLC A;  3BDU A;  5DY9 A;  3V8J A;  1M8V A;  4M7A B;  5LJ5 j;  1N9R A;  4JRK A;  4C8Q E;  4V2S A;  4F7U G;  4M77 F;  5GAN 5;  4XTX A;  2DVE A;  1X01 A;  4NL3 A;  1D3B B;  4C92 G; 
#chains in the Genus database with same CATH topology
 2HQX A;  5C0M A;  1KK7 A;  4J5Y A;  3VS0 A;  2HNI A;  2ROL A;  5GAN 3;  1X6B A;  2FO0 A;  4HVV A;  4PJM A;  4NL2 A;  1Y96 A;  2EJF A;  2YDL A;  2QA4 A;  3JSC A;  4ANJ A;  2XHC A;  5FW9 A;  1T0H A;  2LJ1 A;  3JCM f;  1W4S A;  4PJL A;  2D8H A;  3EG9 A;  1D3B A;  1KJW A;  2DM1 A;  3EG1 A;  3RES A;  4HVU A;  1YBY A;  3T9N A;  3OYI A;  5LJ5 h;  1D1C A;  2RJC A;  4J6Y A;  3RDV A;  1UHC A;  1PC0 A;  2VVK A;  2YHT A;  4J6X A;  2C0I A;  3FRN A;  1HXD A;  4BE2 A;  3PVL A;  4JPB W;  1M1K R;  3SEM A;  2RN8 A;  2CZ6 B;  3V7C A;  3CXC A;  1D0Z A;  2LC4 A;  2VYT A;  2F2V A;  4LD9 K;  1OU9 A;  4XAX B;  2LQN A;  4LN2 A;  4BI8 B;  3JCM d;  3KFV A;  1M30 A;  3EFO A;  3JRZ A;  4A53 A;  2GTO A;  3CCU T;  1MGQ A;  1K9M U;  4E7K A;  2FZK B;  4MZP A;  1KC8 R;  2P0Q A;  4C92 B;  3HFN A;  1WA7 A;  2JOY A;  2F69 A;  3E1S A;  3QBY A;  4ZTF A;  1F1B B;  2EQJ A;  3CCS T;  2COZ A;  2MCN A;  1U1S A;  1OQK A;  3CCJ Q;  3E2U A;  4K11 A;  2RQW A;  2KEA A;  3CCJ T;  3CPW A;  1HYO A;  1S72 Q;  1RAA B;  4RTX A;  2FPF A;  1WXT A;  2IPO B;  1Y0M A;  3CBP A;  3UDC A;  3C0C A;  3CC4 Q;  2JT4 A;  3M0U A;  1NM7 A;  2KDS A;  3CC4 T;  3CCQ A;  2DBK A;  1IXD A;  3RIR A;  2CDT A;  3VU3 C;  3S3N A;  3M9Q A;  5LL6 S;  3PFS A;  1TWB A;  2MI6 A;  1M2V A;  1NYF A;  2F5T X;  4M7A E;  1IRX A;  4OMP A;  5GAM g;  1GBR A;  5CQX A;  3MPU B;  1AHJ B;  2LNV A;  2IVW A;  3MP6 A;  1AVZ C;  1UGQ B;  1YIJ Q;  2QEX A;  2RJE A;  4DA4 A;  3U23 A;  2L0A A;  3C4S A;  1NLP C;  3V7S A;  3GBQ A;  3R6O A;  4ZN3 A;  2EFI A;  4C8Q D;  5GMK j;  1ZX6 A;  3DLL A;  1U1T A;  1VQ7 Q;  1NE8 A;  4PJO E;  4FT2 A;  5GAO l;  2AKL A;  2DYB A;  9ATC B;  4F04 B;  4M7D A;  1M3A A;  2HQE A;  2DA9 A;  3L1A A;  2M16 A;  2FZC B;  4MZM A;  1U3O A;  1WGS A;  2L2P A;  2ABL A;  4OB1 B;  4RTV A;  3RR6 A;  2K9G A;  3CD6 Q;  4ME7 A;  3UA7 A;  3CD6 T;  4P5N A;  3QUI A;  2P84 A;  3L2W A;  5KYU B;  1VA7 A;  4A54 A;  3UF4 A;  1VYU A;  2JW4 A;  3V8K A;  3MP1 A;  4M78 G;  3CMA T;  2E3H A;  2PQW A;  1BYM A;  2DLP A;  3EGD B;  3OYA A;  3E19 A;  5LJ3 g;  2L5Q A;  4LDV A;  1BU1 A;  1SSH A;  1JQQ A;  4GLM A;  2YT6 A;  3CXC P;  3OYE A;  4J9D A;  2JM9 A;  2FPE A;  2HQH A;  2PVO B;  4JRP A;  3VKI A;  3VUZ A;  3I5R A;  2R5M A;  3NGP A;  4M7A B;  1DJ7 B;  1VQP T;  4F7U G;  2JZ2 A;  2XDB A;  4IIO A;  4PFO A;  4FSX A;  1U06 A;  2ZCF B;  2AT1 B;  1CKB A;  3QPH A;  4FYV B;  1WJR A;  2QA4 Q;  4JJD A;  2HBP A;  2X4J A;  4ELZ C;  1J3T A;  2O01 E;  4FW1 A;  2MK5 A;  4PJO B;  2OTJ Q;  1X75 C;  1PNJ A;  4KH1 B;  4BD3 A;  2OTJ T;  2E70 A;  4O6J A;  4KUL A;  4KT0 E;  2O88 A;  2DPP B;  4LDU A;  1EZZ B;  2DEQ A;  3RUX A;  2RQT A;  1YJN T;  1ZBX A;  2WAC A;  3RKX A;  2RHY A;  4MDW A;  3L2R A;  2WSC E;  3WVD B;  2K6D A;  1KD1 U;  3HL8 A;  1NPP A;  3L42 A;  3M0R A;  5GMK e;  1PG5 B;  1HD3 A;  4EMK A;  2GGR A;  4Z8A A;  1VQM T;  4J9I A;  4D8D A;  3O5Z A;  2R58 A;  2OJ2 A;  3UAT A;  5GAN j;  3A8L B;  2LMJ A;  3PT9 A;  4X1V A;  2VGM A;  3CPW S;  2D6F A;  2EQM A;  1G83 A;  2FRW A;  4LDX A;  1VQ5 A;  1G8X A;  2KNB B;  4AMC A;  3G4S A;  5J3B A;  3J80 E;  1PCX A;  4BI4 A;  4FYW B;  4B9X A;  2F2X A;  2J6K A;  1QVF S;  1OOT A;  3EHR A;  1ZUK A;  1HSQ A;  1M3B A;  1H64 1;  4Z89 A;  2CH4 W;  1Y96 B;  4C0D B;  3QJ6 A;  1VQ9 T;  1N8R R;  3CCQ Q;  5DY9 A;  4ATO A;  1BB9 A;  4Z88 A;  2VB6 A;  3EG9 B;  1D3B B;  3SFM A;  4JS5 A;  5HK0 A;  5GAM d;  1M90 U;  4XTU A;  4BDY A;  4C92 D;  1TH7 A;  2R5A A;  4IUQ A;  2AHJ B;  1Q82 R;  2HDA A;  1BCO A;  4L6V 5;  2EYW A;  1JJ2 A;  1PWT A;  2DKG A;  4ZN1 A;  2M0O A;  3OS2 A;  3S3M A;  2QEX Q;  3UT1 A;  1A0N B;  2X3X D;  1Q86 U;  2JN0 A;  3EFO B;  1XOV A;  1AWX A;  4M7D E;  4KGZ B;  2RNA A;  1K9M C;  2CP7 A;  2L3Q A;  3CBO A;  2EW3 A;  3TRE A;  4DBF A;  5KCH A;  4JUV A;  3SWN C;  1PRL C;  1YJW A;  2PVD B;  3A98 A;  2J6F A;  4RCB A;  4OB3 B;  4AFS C;  4OB2 B;  2RO0 A;  3OYF A;  2RD1 A;  3MCA B;  4L59 A;  1IZ6 A;  1GCQ C;  1W6X A;  5CKF A;  1RAF B;  3EGU A;  1UJY A;  4JZ4 A;  4ZGD B;  2YWW A;  4OMQ A;  1LVK A;  4KH0 B;  2EBP A;  2G3R A;  2B8A A;  3RBB B;  1UB4 A;  5GMK h;  1G3W A;  2YRC A;  3JB9 F;  2IIM A;  2P4R A;  3RKW A;  1WLP B;  1QKX A;  3RMQ A;  1QCN A;  2JUF A;  3H6Z A;  4RTT A;  5LJ3 d;  2FB7 A;  1K0S A;  2LX9 A;  1N27 A;  4DEY A;  1M2V B;  1M2O A;  1QMC A;  1RAG B;  1D0X A;  1K76 A;  1R0B G;  1IB8 A;  4N0A A;  1IO6 A;  1GRI A;  5ECA A;  6AT1 B;  1KQS S;  2D0Q B;  4M75 D;  3NTH A;  1QWE A;  1BBZ A;  2NYS A;  2MF2 A;  4FU6 A;  2BZ8 A;  2AZS A;  1PM3 A;  2DIQ A;  2ZPG B;  2LRQ A;  4II1 A;  3GOX A;  1AWO A;  4C5E A;  3X20 B;  1UGS B;  1PSF A;  1PHT A;  3JB9 I;  2Y4Y A;  2MOX A;  1UFF A;  1VQK A;  2QQA A;  2QXF A;  4ZNX A;  3PIP A;  4M7D B;  3BE3 A;  2FG0 A;  3V7R A;  2VUB A;  4RG2 A;  2PNI A;  1U8R A;  2JNG A;  1T0J A;  1Z9Z A;  5LJ5 e;  4BUG A;  3REA B;  2QI2 A;  2YRD A;  3TQ7 P;  4WTO B;  4DOW A;  2DE0 X;  1JXO A;  4BI3 A;  3G71 A;  3EG0 A;  4ZTJ A;  2O9V A;  4M7A D;  1VIF A;  4M75 C;  4OMO A;  2J05 A;  2C0O A;  5FLX E;  5C6S A;  4LD6 A;  3JB9 H;  4IUT A;  4IKF A;  2KRM A;  1WYX A;  4XK8 E;  1SHF A;  2D1X A;  1FXX A;  2VWF A;  1ZSZ A;  2VXF A;  1Z9Q A;  4F16 A;  2LDM A;  1M5Q 1;  1VQ5 Q;  2HD0 A;  3E9G A;  3G4S Q;  2EJ9 A;  3HRT A;  1LPL A;  3VS7 A;  4XQ3 A;  4PJO D;  2QQB A;  3EFS A;  1E6G A;  5HY6 A;  1QKW A;  3P8D A;  3MEU A;  1TU0 B;  3IQL A;  1QP2 A;  2Y90 A;  3AT1 B;  2ATC B;  5GAN h;  2RMO A;  2JS0 A;  1AD5 A;  2RK2 A;  1UEC A;  1E6H A;  1M1K U;  4Y91 A;  3INZ A;  5FU7 B;  2DL7 A;  3SD4 A;  5CQY A;  4NS5 A;  3TSW A;  1JJ2 S;  3QWX X;  2DVE A;  5CR2 A;  3CME Q;  2YUP A;  1KFZ A;  3CCL T;  1HJD A;  3FLG A;  3CME T;  3L2Z A;  4OB0 B;  2JTM A;  1KC8 U;  1R0C B;  4TVR A;  2K2V A;  2E41 A;  2CZ0 B;  3EH2 A;  2LP5 A;  3HRS A;  2QTX A;  1D09 B;  1KD1 C;  1YHQ T;  2E10 A;  3EH1 A;  1P92 A;  4C5I A;  2MPX C;  4N4G A;  4EMK B;  2DXC A;  2RJD A;  1YI2 A;  1H8K A;  1VOM A;  1YCS B;  3GF5 A;  2C0T A;  4JZ3 A;  4C8Q G;  2ROT A;  1FMV A;  3PMT A;  2B86 A;  2E12 A;  2KR3 A;  3THK A;  3OB9 A;  1VQ4 A;  2LCC A;  4RTU A;  2LNH B;  4O5V A;  2ECZ A;  1QQJ A;  2EGE A;  1ZUU A;  4FM4 B;  4LDW A;  3L2V A;  5KYX A;  3GPL A;  4KBM B;  1Q7Y C;  2F1L A;  2PZ1 A;  5D6X A;  2JTE A;  4FYY B;  1MMD A;  1D1A A;  3CCR A;  5CAI A;  3CC2 Q;  4LDY A;  2CP3 A;  1SPK A;  5LJ5 f;  3CC2 T;  4OGC A;  4GBQ A;  1U5S A;  2XDP A;  2K7A A;  4M77 C;  5CKD A;  3MJX A;  5EG2 A;  1LCK A;  1QVG A;  1C0M A;  1WHK A;  2M02 A;  2D0N A;  1XJW B;  2AKK A;  2Y4X A;  3Q1J A;  4AG2 C;  1WI7 A;  1RUW A;  2DEU A;  1X43 A;  4MZT A;  4FL6 A;  5L23 A;  1OZ2 A;  3QHS A;  3EFR A;  3EGX A;  2CKK A;  4E7H A;  3MET A;  2ZPF B;  3CC7 A;  5GAM j;  1OEB A;  1YIT A;  1ZA1 B;  3NMZ C;  1RL2 A;  2MYS A;  1G3T A;  2XKO C;  3M0Q A;  4M78 F;  2LJ0 A;  1FYN A;  1ZLM A;  5J39 A;  1LNX A;  2ENM A;  1VQ8 Q;  2RQR A;  2KVQ G;  2OTL Q;  1VQ8 T;  3CCM A;  1D0Y A;  3OMG A;  1Q86 C;  2K5F A;  2OTL T;  3CBM A;  4NL3 A;  3G6E A;  3REB B;  2DBM A;  8AT1 B;  3DLM A;  5GMK l;  4N4H A;  1S72 T;  2BZX A;  2DTI A;  2KQW A;  4PK4 A;  1YJ9 A;  3QZ9 B;  3ZEH A;  1ZQ1 A;  1NEG A;  4F7U F;  1VQK Q;  1K73 R;  2DER A;  2DET A;  2FL7 A;  1QVF A;  2QGG A;  4HKE A;  5CIU A;  3OYB A;  1S1N A;  2QTV A;  2M1H A;  1RI9 A;  2J06 A;  1NG2 A;  5GAO q;  1NLO C;  1NYG A;  1VQL Q;  5GAN 4;  2QQS A;  5FWB A;  3CCE A;  4OML A;  4J9C A;  5FRO A;  1VQL T;  1Q81 U;  3RER A;  1O75 A;  2E5K A;  4QQD A;  1YIJ T;  3TU4 K;  1WNL A;  2LT1 A;  4R56 A;  2BTT A;  2VC8 A;  3NHN A;  3GIB A;  1WIE A;  1ZUY A;  5I11 A;  1VQO A;  3M54 A;  4BDZ A;  1JB0 E;  4M7D D;  1WQ7 A;  4JJC A;  2EYX A;  1VQ7 T;  2E6Z A;  3H9N A;  2K5I A;  4Y92 A;  1WPY A;  2DVJ A;  4E7Z A;  2P0K A;  2CSI A;  2K4Y A;  5I21 A;  3I55 A;  2FHD A;  3M0T A;  3M4Y A;  1OPL A;  3VJP A;  1TS9 A;  1SG5 A;  2HCK A;  3UWN A;  2D9T A;  2JTF A;  1QLY A;  3MEW A;  3KUF A;  5A0D A;  1N9S A;  3A8H B;  1KIK A;  3BDU A;  5IH2 A;  3DB4 A;  1XNI A;  3VS3 A;  5DLQ E;  4C92 G;  3M5A A;  1HK9 A;  2AK5 A;  2X4X A;  4A63 B;  4C0Z A;  4IUV A;  7AT1 B;  1ZBJ A;  3VS2 A;  1T3S A;  1VQ6 A;  2AIR B;  4BY6 C;  3M57 A;  1W1F A;  1H3Z A;  4C8Q C;  1MV3 A;  2V26 A;  1ABQ A;  3LH5 A;  4J9H A;  2EYQ A;  3TSZ A;  1X6G A;  1V29 B;  2CZ1 B;  1H3H A;  1FMW A;  4FIB A;  3A8M B;  1K8A U;  1K9A A;  2JJ9 A;  1YI2 Q;  4YTL A;  2DIG A;  2OI3 A;  1KQS A;  3EAE A;  4EMH A;  1RAC B;  2QK0 A;  2XU8 A;  4JRQ A;  2L3S A;  1VQ4 Q;  2KGT A;  4DEX A;  1ZSZ B;  1N8R U;  3CPW P;  4J9E A;  1R8O B;  2QA4 T;  1W2B S;  1YP5 A;  1M1F A;  5GAN 6;  1OUL A;  1QVG S;  4XU1 A;  4PL6 A;  4EDU A;  3CCR Q;  2SRC A;  4QVD A;  3CCV A;  1UE9 A;  2G6F X;  1M1K C;  4C5H A;  4XU3 A;  1TOV A;  2COY A;  4EIK A;  1QWF A;  4HA8 A;  2DZC A;  1SRM A;  4RKU E;  3CQT A;  4QVC A;  2HKN A;  4J9F A;  2RI5 A;  1QCO A;  4XU0 A;  2DRK A;  4CI0 C;  1H92 A;  3OQ5 A;  1MNE A;  3OS0 A;  1KC8 C;  1XTD A;  4RUG A;  4M75 G;  2K5L A;  3CC7 Q;  1YIT Q;  5FU7 C;  1WX6 A;  1MV0 B;  1UG1 A;  4M77 F;  2DF6 A;  2RJF A;  1KHI A;  2VGN A;  4AG1 C;  3OW2 S;  4XTY A;  3TEE A;  3G6E Q;  2DZ9 A;  3VUB A;  1UGP B;  2BZY A;  3FJP A;  1EFN A;  1YJ9 Q;  1PKT A;  2KMT A;  4JS4 A;  5L8R E;  2DYI A;  1YFN A;  2OAW A;  4JLG A;  4RCC A;  2BE9 B;  3JCM c;  3JCM X;  3HKS A;  3G7Z A;  3VS4 A;  1MND A;  5KYX B;  5GAM h;  3LGL A;  4C0F A;  3CCQ T;  1QP3 A;  1VYV A;  3HTR A;  3X25 B;  1WXB A;  1WHH A;  3OS5 A;  3I56 A;  1OPK A;  4AFQ C;  3QDR B;  3SWN A;  3JB9 J;  2E64 A;  3OYG A;  4M7A G;  1RLP C;  2Z0W A;  1VQN A;  1NEB A;  3CCE Q;  1SSF A;  1YWO A;  1M8M A;  2RI2 A;  5GAN g;  3MEA A;  4AFU C;  2DL8 A;  5A2Q E;  1PD0 A;  2GFU A;  2HL3 A;  5IXF A;  1RAH B;  2QEX T;  1GCQ A;  2E5Q A;  4M78 A;  4NOY A;  3ULR B;  3SB2 A;  3EGX B;  2GQI A;  2LCL A;  4J6W A;  1RAE B;  3EG3 A;  1KD1 R;  4CC3 A;  2BIV A;  1EX4 A;  2CP0 A;  1V1C A;  4PJO G;  5A0G A;  2EPD A;  2ZPI B;  4KUI A;  2CS7 A;  2CP6 A;  3LWH A;  1I0C A;  2GTJ A;  5KH6 A;  4PLI A;  3TVT A;  4F7U A;  3I55 Q;  3FDR A;  8ATC B;  3OYY A;  3ZFJ A;  1AEY A;  4DBR A;  4C92 C;  5GAN e;  3QZ5 B;  5KCO A;  1MMG A;  1T3L A;  2RH2 A;  2CUD A;  2RB6 A;  2EQK A;  2JVV A;  2YLC A;  3OYM A;  1NJI U;  1Q7Y R;  2XG8 D;  1VIE A;  2ZAE A;  3OYL A;  1AZE A;  3OMC A;  4A4E A;  3WXM B;  2RF0 A;  4M4Z A;  2DXT A;  2LTO A;  4M77 G;  1WJS A;  2A0F B;  4PFZ A;  2I0N A;  4JJB A;  2X4W A;  1RLQ C;  1UGV A;  1SKU B;  5IN1 A;  4CC2 A;  1TXQ A;  5AYF A;  1Q81 C;  3ZL7 C;  5LJ5 g;  4VUB A;  3CCU A;  3FC3 A;  5IHK A;  2QG9 B;  3X24 B;  4HCK A;  3ME9 A;  4QW2 A;  4JRI A;  1QW1 A;  1PSE A;  4JDS A;  2DJQ A;  3CCS A;  4B6M A;  1SRL A;  2RHI A;  3JCM b;  2J6O A;  3CCJ A;  4M75 A;  2ZPE B;  4C8Q F;  1B7T A;  2E3I A;  1PRM C;  2X3W D;  4QKU A;  2VV5 A;  1B3Q A;  4C0G A;  1OV3 A;  1Q86 R;  4IUR A;  4A4H A;  1Q95 G;  2KBT A;  3CC4 A;  3M56 A;  3PNW C;  2QGF B;  3CCV Q;  1NZ9 A;  2A36 A;  2HSP A;  2V8K A;  4OP0 A;  5KE2 A;  1OI1 A;  2DL3 A;  3S3O A;  1AT1 B;  4KGX B;  4DOV A;  3BFM A;  3OSV A;  4BE1 A;  2XIC A;  4E7L A;  3M0S A;  3G1J A;  3H8Z A;  1OX9 A;  2MIO A;  4XTZ A;  5KYY A;  3MKD A;  4J9B A;  5CKE A;  1JJ2 P;  5IAY A;  3HSB A;  2RM4 A;  2DFU A;  1TUC A;  5IT9 E;  4IIM A;  1KG1 A;  3OYD A;  1BIB A;  2K2M A;  3GP8 A;  4B9W A;  3QO3 A;  3V8J A;  1K8A C;  1VQ5 T;  1K1Z A;  5GAN 5;  1WHL A;  3G4S T;  2K79 A;  4QVZ A;  3C95 A;  2RHX A;  3OS1 A;  2PU9 B;  1OX8 A;  4Z02 A;  1B34 A;  3QG1 A;  5FWC A;  2KRN A;  2DK3 A;  5DLO A;  2YXY A;  2NUP A;  3L2U A;  2GFA A;  4LUE A;  2EQI A;  5GAN f;  1M9S A;  1UDL A;  2MWO A;  5I22 A;  3JCM J;  2ED1 A;  4M7A C;  2YUQ A;  4E7J A;  2I2L A;  3MO8 A;  3OBY A;  1TUD A;  3R6N A;  2P4T A;  3CD6 A;  4X9C A;  4XU2 A;  3LLR A;  3PVQ A;  4AT1 B;  3I56 Q;  2A3L A;  2KYB A;  1E7O A;  3FJ5 A;  4OVA A;  3ASK A;  3CMA A;  4M78 E;  4A4K A;  5GAN d;  3I9Q A;  3PMI A;  1RI0 A;  2KT1 A;  2M51 A;  3VRZ A;  1BI3 A;  2E4H A;  2K57 A;  4JLI A;  1I5O B;  4PJO C;  1JO8 A;  1GL5 A;  1BK2 A;  1X2Q A;  2KI7 A;  5CCA A;  3AHU A;  2LQW A;  4GLK A;  2LZ6 B;  3OYC A;  4E6R A;  4OMM A;  2V1Q A;  1VUB A;  1WDX A;  1BKB A;  4M7D G;  1BI0 A;  4M77 A;  2DL4 A;  4C5G A;  2D8J A;  1VQP A;  1K73 U;  2LJ3 A;  1YJW Q;  4F7U E;  1YJW T;  3H0H A;  2CUB A;  4LE9 A;  5FU6 B;  2MMP A;  2NLU A;  3M58 A;  3NTI A;  3MEV A;  1RAI B;  4JJN K;  2PUK B;  3URG A;  2XD0 A;  1MMN A;  1WJQ A;  4WF2 A;  4IUP A;  2CT3 A;  3JCM h;  2OX7 A;  1W2B A;  3I35 A;  1O9S A;  1GFD A;  3E9F A;  2JXB A;  2OTJ A;  1X01 A;  4E2F B;  1YJN A;  2YLB A;  1M90 C;  3VS6 A;  2FYK A;  2DD5 A;  1RAD B;  5GJV B;  2H8H A;  4XTV A;  3BY7 A;  3SWN B;  2E6N A;  1VQM A;  1YCY A;  4CC4 B;  2DTO A;  2K3Y A;  5LJ5 d;  3CEY A;  3LW5 E;  1WHG A;  4C0D C;  4C92 F;  2KXC A;  2CT4 A;  5GMK i;  2YRV A;  2FZG B;  3N5B B;  2ZPB B;  2QDL A;  3CCU Q;  3J81 E;  4HCB A;  4DQ2 A;  4PFP A;  3NTK A;  3FIF A;  4M75 E;  2P0P A;  4M78 B;  1YWP A;  1D1B A;  5I2S A;  2W10 A;  1FMK A;  2QAZ A;  3VS5 A;  3CCS Q;  3LX7 A;  2JMC A;  2JS2 A;  1I5L A;  3QWY A;  2W0Z A;  1AZG B;  2NWM A;  5AT1 B;  3OW2 A;  1VQK T;  5GAN 2;  3NPF A;  3OYN A;  3SDZ A;  5D7U A;  1M1G A;  1Y7X A;  4CC7 A;  4BE0 A;  4J7I A;  2EJG A;  1QVP A;  1EIF A;  3C12 A;  4DBQ A;  4F7U B;  3JB9 D;  2RA2 A;  2QYZ A;  1JEG A;  1VQ9 A;  1K0X A;  1LJO A;  5HKC A;  1BIA A;  2V8I A;  5CVI A;  3G71 Q;  1I8F A;  2EWN A;  1C6V X;  4RG8 A;  2GQV A;  3G71 T;  1NJI C;  4FYX B;  1MUZ A;  4MDX A;  4FSS A;  2MAM A;  3M0P A;  3QYG B;  2HKQ B;  1M4Z A;  5LJ3 j;  4RTZ A;  2CYZ B;  3HFO A;  5D6W A;  3I5S A;  5EC7 A;  5CO7 A;  3QDF A;  4LNP A;  2CP2 A;  3X28 B;  2BE7 D;  2NUT A;  2VAS A;  2DMO A;  1AOJ A;  2EIF A;  3PE0 A;  3PTA A;  4M75 F;  4KGV B;  1M27 C;  2ESW A;  2LT4 A;  5DM7 R;  1K9M R;  4C8Q A;  3UA6 A;  5I2M A;  5GAO n;  3A8G B;  1FX7 A;  2JMA A;  2DNU A;  4M75 B;  3H41 A;  2GCX A;  2JM8 A;  4R55 A;  5GMK m;  4QQG A;  4N4I A;  5GAM e;  2HZY A;  4D8K A;  1JBM A;  2BUD A;  2ZGW A;  2RQV A;  3QXE B;  1AWJ A;  2XMF A;  3QJY A;  1W2B P;  1VYT A;  4AFZ C;  1QVG P;  2DIL A;  5FRN A;  2HSE B;  2EKO A;  2EAY A;  1X27 A;  2A28 A;  4QQ6 A;  1BI2 A;  3OYH A;  5HK3 A;  1TG0 A;  3C94 A;  3CMA Q;  4M7D C;  3M59 A;  2XID A;  4FT4 A;  4EMG A;  3VYH B;  4M77 E;  4F17 A;  2VXE A;  1OYX A;  2DRM A;  4OMN A;  1K4U S;  4M7A F;  2PVG B;  4RMO A;  2XK0 A;  5KYY B;  1YI2 T;  1XQH A;  3JV3 A;  4PJJ A;  2EVR A;  3JCM W;  2EYY A;  2AZV A;  1I81 A;  2KRS A;  2L3P A;  2O4X A;  1VQ4 T;  3KBG A;  2CP5 A;  1VQP Q;  1Q81 R;  2QQ9 A;  4ESR A;  3FB9 A;  2LQ8 A;  1GXI E;  3OBW A;  5KYW A;  4KUD K;  2WSF E;  1PKS A;  1Y57 A;  1OZ3 A;  5HCK A;  5GAO m;  1B34 B;  1IRE B;  3OW2 P;  1PD1 A;  4PJO F;  1I4K 1;  4E7S A;  1Q82 U;  4UC4 A;  5CK9 A;  2NUP B;  3CCR T;  1NBE B;  1QVF P;  5GJW B;  4FCY A;  1G5V A;  5LJ3 e;  5GAO r;  3BW1 A;  1WFW A;  4WCI A;  4IUU A;  4E7I A;  3OA6 A;  2EGA A;  1UJ0 A;  4V2S A;  1ZA2 B;  1ACM B;  5IHN A;  4XTX A;  3CXC S;  1M3C A;  2HL5 C;  2EYZ A;  2YUN A;  2E1H A;  3S6W A;  3VV0 A;  2QAS A;  4ZGJ B;  4EPC A;  3DB3 A;  2KRO A;  1YJN Q;  1KQ1 A;  2O2O A;  3LGF A;  1VQM Q;  1W70 A;  1B07 A;  1G2B A;  1FWZ A;  3CC7 T;  2IG0 A;  4HCZ A;  3H0F A;  3MHX A;  1YIT T;  2FEI A;  2OAU A;  2HEQ A;  1C1A A;  1X6O A;  1ARK A;  2DO3 A;  1TSF A;  3MP8 A;  1KHC A;  1WXU A;  1RAB B;  3CCM Q;  2KXD A;  4Y28 E;  3CCM T;  1I07 A;  3G6E T;  1G3Y A;  2XI9 A;  2NUZ A;  1R77 A;  2RK1 A;  2E65 A;  1K73 C;  4HXJ A;  4M77 B;  2EKH A;  1YJ9 T;  1JRI A;  1BCM A;  1Q7Y U;  4EMK C;  2LQK A;  1K8A R;  5GAM f;  5FRM A;  4HVW A;  2X9H A;  1KSW A;  2ED0 A;  3CPF A;  1ABO A;  3OSS C;  2KK4 A;  1VQ9 Q;  5KE3 A;  2RI3 A;  2SEM A;  3QKJ A;  4E47 A;  3CCL A;  5FU6 C;  3CCE T;  3PGG A;  1WHM A;  3CME A;  2CZ7 B;  1UEB A;  2ZZD A;  2FRY A;  1LOJ A;  3VRY A;  3FEO A;  4M78 D;  3M4G A;  2A08 A;  4OGE A;  1NPR A;  1YHQ A;  4C92 A;  4A4F A;  2DXB A;  2KYM A;  3ER0 A;  3SHW A;  2VKN A;  2GBQ A;  3BDL A;  3RMS A;  1N5Z A;  2K3X A;  4HT9 A;  1VQO Q;  5KYN A;  5GAN 8;  1VQO T;  1M8V A;  4LUD A;  5LJ5 j;  4C8Q E;  1KQS P;  1IGQ A;  2GNC A;  1SHG A;  1X69 A;  3A8O B;  1SEM A;  4F14 A;  2KSS A;  5M9O A;  2O31 A;  2O9S A;  1MMA A;  2L8D A;  3DKM A;  3LYI A;  4LXC A;  3I55 T;  2H3J A;  1WHJ A;  3HHT B;  5LJ3 h;  3D7S B;  1V76 A;  2X51 A;  5LJ3 f;  4OF1 A;  1TTH B;  2DTH A;  3V8L A;  1YNZ A;  1ZSG A;  3ZBD A;  3CC2 A;  3EG2 A;  3JCM V;  4M78 C;  1Y07 A;  1CKA A;  2EGC A;  3OY9 A;  3VS1 A;  3OYJ A;  4QT7 A;  2F2W A;  4OMF B;  2RPN A;  1WZO A;  2QDY B;  1VQ6 Q;  1QCF A;  4ORZ A;  1GCP A;  1VQ6 T;  3L2Q A;  2CH4 A;  2V8J A;  5CKH A;  4MML A;  4PLL A;  3JCM g;  1GBQ A;  3TCJ A;  1I1J A;  2FVU A;  4ZGE B;  1M90 R;  2WSE E;  4HCC A;  1KQ2 A;  3VYG A;  1TUG B;  3RKY A;  4HT8 A;  4X9D A;  4GY5 A;  3X26 B;  2A7Y A;  4J9G A;  3UPU A;  1IGU A;  2RHU A;  2LCS A;  1VQ8 A;  3LH0 A;  2OTL A;  1Y71 A;  2NUT B;  4FW2 A;  4J83 A;  1S72 A;  1WQW A;  1UUE A;  3M53 A;  4M7D F;  2KE9 A;  3JCM P;  2DX1 A;  1N6A A;  4BY6 B;  4C8Q B;  4N0A C;  1MHN A;  1UHF A;  5CKB A;  5KYU A;  2XDD A;  3CCV T;  3HPW A;  3HRU A;  3JCM e;  4R0K A;  2PUO B;  4JRK A;  2L89 A;  2C06 A;  2V1R A;  3EGD A;  2KT8 A;  2YSQ A;  1ZHI A;  1UTI A;  3A1P A;  3QSU A;  4J7F A;  2DAQ A;  3WVE B;  2HAX A;  2FPD A;  1VQL A;  3KXT A;  1CSK A;  2L3R A;  2LX7 A;  1UGR B;  2LVM A;  2K3B A;  1IHW A;  4Q5W A;  1YIJ A;  3GNF B;  1JU5 C;  4M7A A;  3GLX A;  2A37 A;  2HBW A;  4CRI A;  1BI1 A;  1NJI R;  2DL5 A;  2M0Y A;  2ZPH B;  4MMK A;  3OYK A;  5GAN 7;  2EQU A;  2PTK A;  1VQ7 A;  2H3E B;  2M9U A;  3RNJ A;  1X2K A;  1SF9 A;  2O4X B;  3F70 A;  1N8R C;  1G3S A;  2CRE A;  3JCM Q;  2GF7 A;  3QYH B;  2CGH A;  5J26 A;  1IHV A;  2HMA A;  4PJO A;  5KYW B;  3JB9 G;  3EHQ A;  4A4G A;  2RHZ A;  2MWP A;  4XTW A;  3M55 A;  3J7A F;  2COW A;  4L5G A;  4X34 A;  4D6W A;  3P8B B;  2DXU A;  2DD4 A;  1Q82 C;  5GAO p;  2BKD N;  5D6Y A;  4BAC A;  4KRT A;  1GFC A;  3I56 T;  1ZSZ C;  1AWW A;  1YN8 A;  2CSQ A;  4PKC C;  4RTW A;  1VQN Q;  3LWI A;  5A0L A;  4C92 E;  4DBH A;  4BB7 A;  2DJZ A;  2RQU A;  3CCL Q;  1VQN T;  2YUO A;  3PIO A;  2X4Y A;  2F5K A;  3P8H A;  1OU8 A;  3QII A;  1JXM A;  2J7I A;  4J8O A;  4M77 D;  1YHQ Q;  3GNG A;  3HP9 A;  5IXB A;  2QQR A;  4RTY A;  3JAM E;  4PNO A;  4PJN A;  2KY9 A;  3H0I A;  5IHI A;  3O8V A;  3NFC A;  2X35 A;  2KAF A;  3A5Z B;  1N9R A;  2R57 A;  4ELY C; 
#chains in the Genus database with same CATH homology
 2HQX A;  2LRQ A;  2ZPG B;  4II1 A;  4XTY A;  4M75 F;  3TEE A;  5C0M A;  4C5E A;  3PTA A;  3GOX A;  3X20 B;  1UGS B;  1PSF A;  4J5Y A;  2HNI A;  2DZ9 A;  5GAN 3;  3VUB A;  2LT4 A;  5DM7 R;  1UGP B;  4C8Q A;  3JB9 I;  3FJP A;  4NL2 A;  5I2M A;  2Y4Y A;  5GAO n;  2KMT A;  1Y96 A;  3A8G B;  2EJF A;  5L8R E;  4JS4 A;  1VQK A;  1FX7 A;  2QQA A;  2QXF A;  4JLG A;  3JSC A;  4RCC A;  2QA4 A;  2XHC A;  3JCM c;  3PIP A;  3JCM X;  4M75 B;  4M7D B;  3HKS A;  3G7Z A;  5GAM h;  2GCX A;  3JCM f;  3LGL A;  4R55 A;  1W4S A;  4QQG A;  4N4I A;  5GAM e;  5GMK m;  3V7R A;  4C0F A;  3CCQ T;  1QP3 A;  1D3B A;  1JBM A;  2BUD A;  3X25 B;  2VUB A;  4RG2 A;  3RES A;  1U8R A;  3OYI A;  1YBY A;  3T9N A;  2JNG A;  2ZGW A;  3QXE B;  5LJ5 h;  3OS5 A;  3QJY A;  5LJ5 e;  2RJC A;  4BUG A;  3I56 A;  2QI2 A;  4J6Y A;  3QDR B;  3SWN A;  4DOW A;  3JB9 J;  2E64 A;  3OYG A;  5FRN A;  4BI3 A;  3G71 A;  2YHT A;  4M7A G;  4J6X A;  2EKO A;  2EAY A;  3FRN A;  1HXD A;  4ZTJ A;  4BE2 A;  4QQ6 A;  1VQN A;  1BI2 A;  1SSF A;  3OYH A;  5HK3 A;  4M7A D;  1VIF A;  2CZ6 B;  3C94 A;  4M75 C;  3V7C A;  3CXC A;  4M7D C;  2RI2 A;  2LC4 A;  2VYT A;  3M59 A;  2XID A;  4FT4 A;  5GAN g;  4EMG A;  4LD9 K;  3MEA A;  4XAX B;  3VYH B;  3JCM d;  4BI8 B;  4M77 E;  5A2Q E;  2GFU A;  4A53 A;  3JRZ A;  5FLX E;  2VXE A;  1OYX A;  2QEX T;  2E5Q A;  4M78 A;  4NOY A;  5C6S A;  4M7A F;  4LD6 A;  3SB2 A;  1MGQ A;  2PVG B;  4RMO A;  4IUT A;  2XK0 A;  3CCU T;  1YI2 T;  1K9M U;  4IKF A;  3JB9 H;  4E7K A;  4MZP A;  4XK8 E;  1XQH A;  2P0Q A;  4C92 B;  3HFN A;  2LCL A;  3JCM W;  4J6W A;  1FXX A;  2JOY A;  2F69 A;  1I81 A;  2VXF A;  2O4X A;  3E1S A;  3QBY A;  4ZTF A;  1VQ4 T;  3KBG A;  2LDM A;  2BIV A;  2EQJ A;  3CCS T;  1M5Q 1;  2QQ9 A;  4PJO G;  1U1S A;  5A0G A;  2HD0 A;  3E9G A;  3FB9 A;  2ZPI B;  2EJ9 A;  2LQ8 A;  1GXI E;  3HRT A;  2CS7 A;  3OBW A;  4KUI A;  4KUD K;  4XQ3 A;  2WSF E;  3CCJ T;  4PJO D;  2QQB A;  3EFS A;  3LWH A;  3CPW A;  5HY6 A;  3P8D A;  5KH6 A;  3MEU A;  4PLI A;  4F7U A;  1OZ3 A;  1QP2 A;  3CBP A;  5GAO m;  2Y90 A;  1B34 B;  3FDR A;  1IRE B;  3OYY A;  5GAN h;  3UDC A;  3ZFJ A;  4PJO F;  4C92 C;  1I4K 1;  2RK2 A;  5GAN e;  1Q82 U;  3QZ5 B;  4UC4 A;  5CK9 A;  5KCO A;  3CCR T;  2RH2 A;  1M1K U;  2KDS A;  4Y91 A;  3CC4 T;  1G5V A;  3INZ A;  2RB6 A;  3CCQ A;  5LJ3 e;  5GAO r;  2EQK A;  3BW1 A;  3RIR A;  4IUU A;  2JVV A;  5FU7 B;  4E7I A;  3VU3 C;  3SD4 A;  3S3N A;  2YLC A;  3M9Q A;  5CQY A;  5LL6 S;  3OYM A;  4NS5 A;  3OA6 A;  1NJI U;  2XG8 D;  3PFS A;  1VIE A;  1JJ2 S;  3OYL A;  4V2S A;  4XTX A;  2DVE A;  2MI6 A;  3CXC S;  5CR2 A;  3OMC A;  3CCL T;  2E1H A;  3S6W A;  3VV0 A;  4A4E A;  3FLG A;  2F5T X;  3WXM B;  4ZGJ B;  3CME T;  3L2Z A;  4OB0 B;  4EPC A;  3DB3 A;  4M7A E;  2DXT A;  2LTO A;  4M77 G;  2JTM A;  1WJS A;  5GAM g;  1KC8 U;  4TVR A;  2K2V A;  2X4W A;  5CQX A;  2E41 A;  1KQ1 A;  2CZ0 B;  1AHJ B;  2LNV A;  3HRS A;  2IVW A;  5IN1 A;  2QTX A;  3MP6 A;  3LGF A;  1KD1 C;  5AYF A;  1Q81 C;  1YHQ T;  1FWZ A;  1UGQ B;  2E10 A;  5LJ5 g;  3CC7 T;  4VUB A;  2IG0 A;  1P92 A;  4HCZ A;  4C5I A;  3MHX A;  4N4G A;  1YIT T;  2QEX A;  2OAU A;  4EMK B;  2DXC A;  2RJD A;  1X6O A;  2DO3 A;  3CCU A;  3FC3 A;  3MP8 A;  1KHC A;  1YI2 A;  3X24 B;  2RJE A;  3ME9 A;  4DA4 A;  3GF5 A;  3C4S A;  4C8Q G;  4QW2 A;  4JRI A;  1QW1 A;  4Y28 E;  3V7S A;  3PMT A;  3CCM T;  1PSE A;  3R6O A;  2E12 A;  4JDS A;  4ZN3 A;  3OB9 A;  3G6E T;  2EFI A;  2LCC A;  4C8Q D;  5GMK j;  1VQ4 A;  1G3Y A;  4O5V A;  2XI9 A;  3DLL A;  3CCS A;  1U1T A;  4PJO E;  1NE8 A;  2RHI A;  2E65 A;  2RK1 A;  4FM4 B;  4FT2 A;  5GAO l;  1K73 C;  4LDW A;  4M77 B;  3JCM b;  3L2V A;  3CCJ A;  1YJ9 T;  4M75 A;  2ZPE B;  4M7D A;  3GPL A;  2HQE A;  1JRI A;  1Q7Y U;  4KBM B;  1Q7Y C;  4C8Q F;  4EMK C;  3L1A A;  2LQK A;  5D6X A;  2M16 A;  2VV5 A;  5GAM f;  4C0G A;  4IUR A;  4MZM A;  4A4H A;  1WGS A;  5FRM A;  3CCR A;  4OB1 B;  5CAI A;  3CPF A;  3CC4 A;  4LDY A;  3M56 A;  3OSS C;  2KK4 A;  3PNW C;  5LJ5 f;  3CC2 T;  4OGC A;  4ME7 A;  1NZ9 A;  2XDP A;  4M77 C;  3CD6 T;  5KE3 A;  2RI3 A;  3QUI A;  4P5N A;  5CKD A;  2V8K A;  4OP0 A;  5EG2 A;  5KE2 A;  1OI1 A;  3S3O A;  3QKJ A;  4E47 A;  3L2W A;  4DOV A;  1QVG A;  4A54 A;  3BFM A;  1QVG S;  3CCL A;  3V8K A;  5FU6 C;  3CCE T;  3PGG A;  2Y4X A;  3OSV A;  3MP1 A;  3Q1J A;  4M78 G;  3CME A;  3CMA T;  2CZ7 B;  4BE1 A;  1UEB A;  2PQW A;  2XIC A;  2ZZD A;  4E7L A;  1BYM A;  3OYA A;  3E19 A;  1LOJ A;  5LJ3 g;  3FEO A;  4FL6 A;  2L5Q A;  4M78 D;  1OZ2 A;  3M4G A;  3H8Z A;  4LDV A;  4MZT A;  3QHS A;  4XTZ A;  3HSB A;  5CKE A;  4OGE A;  3EFR A;  5IAY A;  2CKK A;  4E7H A;  1NPR A;  1YHQ A;  3MET A;  3OYE A;  4C92 A;  2ZPF B;  3CC7 A;  2PVO B;  4A4F A;  2DXB A;  2RM4 A;  3ER0 A;  5GAM j;  1YIT A;  5IT9 E;  3BDL A;  1RL2 A;  3RMS A;  1G3T A;  2XKO C;  4M78 F;  3OYD A;  1KG1 A;  4JRP A;  1BIB A;  2K3X A;  3VKI A;  3VUZ A;  4HT9 A;  3JB9 G;  3GP8 A;  2R5M A;  4B9W A;  5J39 A;  1LNX A;  5GAN 8;  3QO3 A;  1VQO T;  2KVQ G;  1M8V A;  3V8J A;  4M7A B;  5LJ5 j;  1DJ7 B;  4C8Q E;  1VQP T;  1K8A C;  1VQ5 T;  1VQ8 T;  4F7U G;  3CCM A;  5GAN 5;  2JZ2 A;  3OMG A;  2XDB A;  1Q86 C;  2K5F A;  3G4S T;  3CBM A;  4NL3 A;  3G6E A;  2OTL T;  3A8O B;  4QVZ A;  3C95 A;  2RHX A;  3OS1 A;  2KSS A;  3DLM A;  2PU9 B;  5GMK l;  4Z02 A;  1B34 A;  5M9O A;  4N4H A;  1S72 T;  2DTI A;  2KQW A;  3QG1 A;  1YJ9 A;  2DK3 A;  3QZ9 B;  3ZEH A;  5DLO A;  2L8D A;  3DKM A;  4FSX A;  2ZCF B;  3LYI A;  3L2U A;  1ZQ1 A;  2GFA A;  3I55 T;  2H3J A;  5GAN f;  3QPH A;  4F7U F;  1WJR A;  3HHT B;  5LJ3 h;  1M9S A;  2MWO A;  3JCM J;  2HBP A;  5LJ3 f;  2X4J A;  4OF1 A;  4M7A C;  2FL7 A;  4ELZ C;  2O01 E;  1QVF A;  2DTH A;  3V8L A;  4E7J A;  2I2L A;  3MO8 A;  4PJO B;  3OBY A;  4HKE A;  1X75 C;  3ZBD A;  3CC2 A;  5CIU A;  4M78 C;  3JCM V;  4BD3 A;  1Y07 A;  2OTJ T;  2E70 A;  2P4T A;  4O6J A;  3OYB A;  3CD6 A;  4X9C A;  4KUL A;  4XU2 A;  3LLR A;  4KT0 E;  2M1H A;  3OY9 A;  3OYJ A;  2DPP B;  4LDU A;  2A3L A;  2DEQ A;  3RUX A;  4OMF B;  5GAO q;  4OVA A;  1ZBX A;  2WAC A;  1YJN T;  3RKX A;  2QQS A;  2RHY A;  2QDY B;  5GAN 4;  4MDW A;  3L2R A;  3CCE A;  2WSC E;  3ASK A;  3WVD B;  3CMA A;  1KD1 U;  3HL8 A;  5FRO A;  1NPP A;  4M78 E;  3L42 A;  1Q81 U;  1VQL T;  1VQ6 T;  5GMK e;  4A4K A;  5GAN d;  3L2Q A;  3PMI A;  1VQM T;  4EMK A;  1RI0 A;  2V8J A;  5CKH A;  3RER A;  4MML A;  1BI3 A;  1O75 A;  2K57 A;  4QQD A;  4JLI A;  1YIJ T;  2R58 A;  3TU4 K;  1WNL A;  2LT1 A;  5GAN j;  3A8L B;  4PLL A;  3JCM g;  4PJO C;  4R56 A;  3TCJ A;  5CCA A;  3PT9 A;  3AHU A;  4GLK A;  2VC8 A;  2FVU A;  3OYC A;  4ZGE B;  4HCC A;  2WSE E;  1KQ2 A;  3VYG A;  1VUB A;  2VGM A;  3RKY A;  1BKB A;  3CPW S;  2D6F A;  4M7D G;  3GIB A;  1BI0 A;  2EQM A;  4HT8 A;  4X9D A;  4GY5 A;  3X26 B;  2A7Y A;  4M77 A;  1VQO A;  3M54 A;  4C5G A;  4BDZ A;  4LDX A;  1JB0 E;  3UPU A;  2RHU A;  1VQP A;  1K73 U;  1VQ5 A;  1VQ8 A;  1WQ7 A;  3LH0 A;  4M7D D;  1VQ7 T;  4F7U E;  2E6Z A;  3G4S A;  5J3B A;  2OTL A;  3J80 E;  1YJW T;  1Y71 A;  2K5I A;  4BI4 A;  1WPY A;  4B9X A;  4J83 A;  5FU6 B;  1S72 A;  2MMP A;  2P0K A;  1WQW A;  3M53 A;  2NLU A;  3M58 A;  4M7D F;  2K4Y A;  5I21 A;  3NTI A;  3MEV A;  2FHD A;  3M4Y A;  3VJP A;  3I55 A;  4JJN K;  2PUK B;  1QVF S;  3JCM P;  3URG A;  1N6A A;  3UWN A;  2XD0 A;  2D9T A;  4BY6 B;  2JTF A;  1WJQ A;  4C8Q B;  4WF2 A;  4N0A C;  1H64 1;  3MEW A;  1MHN A;  3KUF A;  4IUP A;  1Y96 B;  5A0D A;  1N9S A;  3JCM h;  3A8H B;  5CKB A;  2XDD A;  3CCV T;  1W2B A;  3HPW A;  3HRU A;  4C0D B;  3JCM e;  3QJ6 A;  1VQ9 T;  1O9S A;  5DY9 A;  3BDU A;  3E9F A;  2PUO B;  4JRK A;  2L89 A;  2C06 A;  3DB4 A;  4ATO A;  1XNI A;  2OTJ A;  1X01 A;  1ZHI A;  1D3B B;  5DLQ E;  4C92 G;  3QSU A;  4J7F A;  2DAQ A;  3SFM A;  3M5A A;  3WVE B;  1HK9 A;  4JS5 A;  5HK0 A;  5GAM d;  1YJN A;  2X4X A;  2YLB A;  1M90 U;  1M90 C;  4C0Z A;  4XTU A;  2HAX A;  2FYK A;  2DD5 A;  4BDY A;  4IUV A;  4C92 D;  4XTV A;  1VQL A;  3KXT A;  1TH7 A;  2R5A A;  4BY6 C;  3BY7 A;  3M57 A;  1VQ6 A;  2L3R A;  1H3Z A;  1UGR B;  4C8Q C;  3SWN B;  2E6N A;  2LVM A;  4IUQ A;  1VQM A;  2AHJ B;  1YCY A;  2DTO A;  2K3Y A;  4L6V 5;  5LJ5 d;  3CEY A;  1JJ2 A;  3LW5 E;  2DKG A;  2EYQ A;  4Q5W A;  4C0D C;  1YIJ A;  3GNF B;  4ZN1 A;  4M7A A;  1V29 B;  3GLX A;  2M0O A;  4C92 F;  3OS2 A;  4CRI A;  1BI1 A;  2CZ1 B;  2YRV A;  5GMK i;  3S3M A;  4FIB A;  3N5B B;  3A8M B;  1K8A U;  2ZPB B;  3UT1 A;  2ZPH B;  1Q86 U;  4MMK A;  3J81 E;  4HCB A;  2JN0 A;  4DQ2 A;  3NTK A;  1XOV A;  3FIF A;  4YTL A;  4M75 E;  5GAN 7;  3OYK A;  4M7D E;  2P0P A;  2DIG A;  1K9M C;  4M78 B;  3CBO A;  3EAE A;  2EQU A;  4EMH A;  1KQS A;  3TRE A;  5KCH A;  2XU8 A;  5I2S A;  4JRQ A;  1VQ7 A;  4JUV A;  3SWN C;  1YJW A;  2M9U A;  3LX7 A;  2PVD B;  1I5L A;  1N8R U;  2O4X B;  3F70 A;  1N8R C;  4RCB A;  4OB3 B;  1R8O B;  1G3S A;  4OB2 B;  3JCM Q;  2RO0 A;  3OW2 A;  1VQK T;  2GF7 A;  5GAN 2;  3OYN A;  3SDZ A;  3OYF A;  2RD1 A;  2QA4 T;  3QYH B;  2CGH A;  5J26 A;  1W2B S;  4PJO A;  1M1F A;  3MCA B;  5GAN 6;  4A4G A;  1M1G A;  2RHZ A;  1Y7X A;  2MWP A;  4L59 A;  4PL6 A;  4XTW A;  4XU1 A;  4BE0 A;  4J7I A;  4EDU A;  1IZ6 A;  2EJG A;  3M55 A;  3J7A F;  1QVP A;  4L5G A;  1EIF A;  3C12 A;  3JB9 D;  4F7U B;  4X34 A;  2RA2 A;  5CKF A;  4D6W A;  4QVD A;  3CCV A;  3P8B B;  2DXU A;  4ZGD B;  2DD4 A;  1Q82 C;  1VQ9 A;  5GAO p;  1LJO A;  2BKD N;  5D6Y A;  5HKC A;  4BAC A;  1M1K C;  1BIA A;  4C5H A;  2G3R A;  4XU3 A;  3I56 T;  2B8A A;  1UB4 A;  2V8I A;  5CVI A;  5GMK h;  1I8F A;  1G3W A;  2EWN A;  4HA8 A;  4PKC C;  4RG8 A;  3JB9 F;  2DZC A;  2GQV A;  3RKW A;  3LWI A;  4RKU E;  3G71 T;  3RMQ A;  1NJI C;  5A0L A;  4C92 E;  2JUF A;  4BB7 A;  2DJZ A;  1VQN T;  4QVC A;  3H6Z A;  4MDX A;  5LJ3 d;  2FB7 A;  2X4Y A;  2MAM A;  3PIO A;  2RI5 A;  2F5K A;  4XU0 A;  3P8H A;  3QYG B;  3QII A;  2LX9 A;  1N27 A;  1M4Z A;  4CI0 C;  3OQ5 A;  3OS0 A;  1KC8 C;  5LJ3 j;  1XTD A;  4J8O A;  2CYZ B;  3HFO A;  4N0A A;  4M77 D;  4M75 G;  5D6W A;  2K5L A;  3GNG A;  1KQS S;  3HP9 A;  5CO7 A;  2D0Q B;  2QQR A;  3JAM E;  4PNO A;  4M75 D;  2KY9 A;  5FU7 C;  3NTH A;  3X28 B;  3O8V A;  3NFC A;  2X35 A;  2KAF A;  3A5Z B;  1N9R A;  2R57 A;  4M77 F;  2MF2 A;  4FU6 A;  2RJF A;  2VGN A;  1KHI A;  4ELY C;  2DIQ A;  2EIF A;  3OW2 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...