4M77F

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77F00
3FIFA 3JCMQ 3PGGA 3JCMV 4OP0A 4EMHA 4N0AC 5LJ5d 4NOYA 5GMKl 2DZ9A 2EWNA 3QUIA 3JCMg 1BIAA 4C8QF 1WNLA 3HFOA 3JB9F 1JBMA 1N9RA 2DVEA 3L1AA 4XTUA 3V7SA 4M7AF 5GAN5 5DY9A 3JCMf 4C92A 5GAN3 1N9SA 4RCCA 5GANg 1D3BA 4M7DA 3JCMb 1I81A 4J6WA 5GAOp 4NL3A 4A54A 1I8FA 4EMKB 4C8QD 3RUXA 4EMKC 5LJ3h 1B34A 1KQ1A 1U1SA 4J5YA 3JB9D 4PJOB 3SB2A 4M7AD 3JCMX 4QVDA 5GAMd 5GAMg 4XTZA 1LOJA 2E1HA 4M78E 5LJ5j 3QSUA 4M7DF 4XTWA 1JRIA 3FB9A 3SWNC 3SWNB 1Y96A 3L2ZA 2DZCA 2JN0A 1TH7A 3V7CA 3V8LA 4A53A 1M5Q1 2DKGA 3QHSA 5LJ3e 5GAOm 4XTYA 2RD1A 4M75B 4M75C 1M8VA 4Y91A 4HT8A 3AHUA 2FB7A 4F7UB 4M7DD 3HSBA 4JUVA 4M77B 4M77C 3BFMA 3JCMd 4PJOC 3JB9H 2E41A 3JB9I 5LJ5h 1HK9A 5GAMj 2E64A 2EJGA 5GMKj 1BIBA 4WF2A 5GMKe 5GAOn 2VXFA 3RKXA 2EAYA 3BW1A 5GANj 4M78G 3M4GA 4M78A 5GAOl 3RESA 1LJOA 5CAIA 1HXDA 2E65A 3GIBA 4XU2A 4PJOG 4PNOA 2QTXA 3EFSA 3VU3C 5LJ3g 3JCMP 5GAMh 4C8QB 1X01A 4M75G 3RIRA 4C8QC 2RB6A 4M78F 3V7RA 5LJ3f 4M7AB 4F7UG 4M7AC 2VC8A 5GANh 1WQ7A 2EJFA 1H641 4PJOE 4JRIA 4N0AA 1KQ2A 5LJ5e 4PJOF 4X9DA 4M75E 4NL2A 4XTXA 4XU1A 4M78D 4F7UE 3JCMJ 4M77E 2DTOA 4C92C 4C92B 4F7UF 4XU0A 3JCMh 1D3BB 4M7DC 3EFRA 4M7DB 4J6YA 4HA8A 1U1TA 4EMGA 4EMKA 5GAN4 3BDUA 1B34B 2YHTA 3JB9J 1I5LA 2Y90A 2RM4A 5GAMe 4V2SA 5GAN2 3V8KA 4C8QG 2EJ9A 4XTVA 3JCMW 3JB9G 5GMKi 4XQ3A 3SWNA 1Y96B 5LJ3d 1I4K1 4XU3A 5GANd 2RA2A 5GAOr 4PJOA 5GAN7 4RCBA 1MGQA 4M75A 4X9CA 4C8QE 3INZA 2YLBA 2DTHA 5LJ5g 4F7UA 4M77G 4HT9A 4DQ2A 5GAOq 3JCMc 4M7AE 4M77A 2VXEA 1WQWA 4QVCA 5GAN8 4C92G 2DEQA 5LJ5f 3JCMe 3HFNA 4M7DG 2CGHA 2DJZA 4M75F 3V8JA 5GMKm 4MMLA 2DXUA 2FYKA 3RKYA 3BY7A 3RERA 5GMKh 2DXTA 3RKWA 5LJ3j 4M77F 4MMKA 4C92E 4PJOD 2YLCA 4M78C 4M78B 2E10A 2HNIA 3QO3A 4M7DE 1YCYA 4C92F 4M75D 1LNXA 1WPYA 2I2LA 3FJPA 5GAMf 5GAN6 5I21A 4JRKA 4M77D 2ZGWA 4C8QA 2DTIA 4M7AG 5GANe 5GANf 4M7AA 4JLIA 4C92D 4J6XA 2K57A
chains in the Genus database with same CATH superfamily
3WVEB 3FIFA 1G3TA 1UJYA 3OS1A 3PVQA 2LQNA 2GTOA 3CCMA 2D1XA 3OBYA 4O6JA 3GNFB 3LWHA 3CC4Q 5I2SA 4QQGA 1GCPA 4RUGA 1U1SA 3JB9D 4KGXB 5ECAA 1LOJA 2CT4A 1MMNA 2ABLA 1MNEA 1BCOA 4C0DC 1SHGA 4Y91A 4PK4A 4HT8A 3SFMA 4CRIA 1KIKA 5HCKA 1AWJA 2LCCA 3A8LB 3E9GA 3TEEA 1HK9A 5GAMj 3CMEA 4O5VA 1N6AA 2L3QA 4ZNXA 2O9SA 5CKHA 3X20B 1UG1A 2AZSA 4AG1C 2L89A 2P0KA 1BI2A 1M2OA 2DM1A 2OTJA 1VQMT 1OZ3A 3OYNA 2LX7A 2QGGA 1EX4A 2ZPFB 3JCMJ 1J3TA 1KJWA 3CBMA 4XU0A 1VYTA 3UATA 2KEAA 1TSFA 1T3SA 1B34B 1YHQA 1I5LA 4BI3A 4C8QG 5FW9A 2KMTA 1C1AA 3THKA 2KYBA 3S3NA 4L5GA 4ANJA 3WVDB 1WI7A 2VVKA 3RMSA 1VQLT 4M7DG 2HQHA 2KQWA 2EFIA 2PQWA 1D09B 4E7IA 2DXTA 3ULRB 3KUFA 3CCJQ 2GCXA 1X69A 2PVGB 1WYXA 2QAZA 3DKMA 2QA4T 4AFSC 1UECA 1PHTA 1EZZB 2KT1A 1TUGB 1ZBJA 4C92D 2X35A 1BI1A 5GMKl 4E7KA 1NZ9A 1BIAA 5FU7C 1WNLA 1NYGA 1QCNA 4HVVA 3QYGB 2EQMA 4MZPA 4E7JA 2ZPGB 3TSWA 4RTYA 4EMKB 3H8ZA 4MDWA 1VQ5Q 4M7AD 1RAFB 5GAMd 3CMAA 1VQ7Q 3SWNB 1RAGB 1WIEA 2QQBA 3EGXA 1S1NA 2JS2A 4WCIA 2FVUA 3HRSA 2AKLA 2DF6A 3LWIA 3CCMT 2AZVA 1AWXA 3VS2A 1VQOQ 5GAOn 3SHWA 1BYMA 4BDYA 2RN8A 1CKBA 1YIJQ 3GF5A 1HJDA 1JEGA 3LGFA 1KHIA 2J06A 2CP7A 1ZA2B 1C0MA 1E6GA 4Z8AA 1N8RC 3CBOA 3CMET 1BI3A 1SHFA 3UA6A 2K7AA 2EKHA 3H0IA 1R77A 2K79A 1LVKA 5L23A 1YP5A 4J6YA 1UTIA 2ZZDA 2RQTA 2L5QA 2VWFA 1OU8A 2LC4A 1KFZA 4FIBA 5KYWB 1Q82R 5DLQE 2OTJT 1Y96B 4J9HA 4RTTA 4ZTFA 3LYIA 2X9HA 3HL8A 3ZEHA 1I5OB 5KYYB 4HT9A 2VXEA 2GNCA 3RKYA 3CXCS 3X26B 1YHQT 1U5SA 1YCYA 3FC3A 1N8RR 1QVFP 5EG2A 1NLPC 3MP6A 5GANe 1YJNA 1ZBXA 2XI9A 2NYSA 1OV3A 3VUBA 2HL3A 2QQAA 1TUCA 1N9RA 1G8XA 4R0KA 1KHCA 2GF7A 2F1LA 1M90C 4ZGDB 2ZPEB 2NUZA 1G3YA 1B34A 1M1KU 1D0ZA 2X4XA 1UGPB 3UWNA 2E1HA 5LJ5j 3C0CA 5GANg 1PCXA 5CO7A 4F7UB 3DLLA 4AG2C 2FPDA 3CEYA 2JNGA 1F1BB 1M3AA 1LPLA 3BFMA 4WF2A 2WSFE 1Q86C 4FSXA 3OYYA 1RAIB 2G3RA 3CMAT 2LX9A 3RMQA 2CZ1B 4XU2A 2LMJA 2HDAA 4M75G 4M78F 4VUBA 4OMQA 2RHXA 5FU6B 3VRYA 1M90R 2P84A 3EAEA 1T3LA 5DM7R 5A0LA 4L6V5 2F2XA 4JDSA 2AT1B 4JJNK 4EMKA 2CS7A 2ZAEA 1M3BA 1QVGA 2YHTA 1T0HA 1E6HA 3I56A 5J3BA 3JCMW 1OULA 1VQMQ 2HBWA 3SWNA 4AFQC 1HD3A 1VQ6A 1UB4A 2KE9A 2RHZA 2KSSA 2FG0A 1M3CA 2DRMA 3H0FA 2PNIA 2PTKA 3PT9A 2YDLA 2DEUA 2A0FB 5GMKm 1OPLA 1XNIA 2L2PA 2V26A 4M78B 1EFNA 5D7UA 4R56A 4R55A 2CH4A 2EYYA 2J05A 1WHGA 3L2RA 2HEQA 2LQKA 4BACA 3E2UA 1JJ2S 1VQLQ 1VQ5A 5LJ5d 1VOMA 1VUBA 4KULA 3M0RA 4UC4A 2PUKB 1D0XA 4EMKC 2D0NA 2XDPA 5CKFA 4BI4A 3F70A 3A8GB 4KRTA 1YJNT 5KYWA 1JRIA 3FB9A 3SWNC 4LXCA 1Y96A 1KQSS 2HQEA 2JN0A 5LJ3e 3PIPA 4PJOB 1ARKA 1Y71A 3S6WA 4OMLA 5KYYA 1M27C 5GMKe 2DK3A 2PZ1A 2LVMA 2E65A 1I0CA 5LJ3g 2KI7A 3OY9A 3CCMQ 3I55Q 4FCYA 2DVJA 4JJDA 4E6RA 3G7ZA 3M55A 2J6KA 1YJWA 1W70A 2QQRA 1SPKA 3VS0A 1GRIA 2E3HA 4FU6A 3OYJA 1D1CA 3CMEQ 3PFSA 4LDXA 2XG8D 2F69A 4F7UA 1OX8A 2M1HA 1FMWA 3M5AA 2FRWA 2D8HA 3JCMe 2H3JA 2Y4YA 3RNJA 1IB8A 2K3XA 3I5RA 2DIQA 3BY7A 3LX7A 1K4US 3RKWA 1O75A 3EH1A 3CC7A 3CD6A 3OYBA 3I56T 2E70A 1VQ6T 1UE9A 2P4TA 2DL4A 4FYVB 2YT6A 4AMCA 4OP0A 3UA7A 1VQPA 1RLPC 3QUIA 1OQKA 3JCMg 3JB9F 1YHQQ 4PL6A 1AVZC 2Y4XA 2EIFA 3G4SA 3OQ5A 2KBTA 4A54A 1ZSZB 2XDBA 4QVDA 2DBMA 3M54A 1QWFA 1R0CB 3V7CA 4JZ3A 2BE7D 2MAMA 2DXBA 2LTOA 2KVQG 3OS5A 1JXOA 2GGRA 1IGQA 3EHQA 1SRMA 1H8KA 2E64A 1ACMB 2K6DA 4JJBA 1UGVA 4X1VA 2KK4A 3UF4A 3NTKA 5CR2A 1VQ8A 4M78A 3EG2A 4DBRA 3EG0A 2QTXA 3JCMP 2RB6A 2PU9B 5FU6C 3FRNA 4F7UE 4ZN3A 2V1RA 3CMAQ 4E47A 1WZOA 4CC2A 5IXFA 1WHKA 1TG0A 3BDUA 2DETA 2KAFA 2D8JA 2MOXA 1QLYA 3O5ZA 4XQ3A 2K4YA 4PJOA 2RA2A 2YXYA 1H3ZA 1O9SA 1OX9A 4DOWA 4X9CA 4LDWA 4QVCA 1YJWT 2QXFA 5IAYA 1GFCA 2DXUA 2FYKA 4OMPA 1WFWA 2QASA 2YLCA 4M78C 5KCHA 4DA4A 1QKWA 2HKNA 3J80E 4C92F 3SDZA 3S3OA 1LNXA 1ZSGA 1UDLA 3D7SB 5HY6A 1BB9A 1UEBA 1YI2A 3EGDB 5LJ3h 5HK0A 1AT1B 1TS9A 1GBQA 2DPPB 4M7AF 3OYEA 4HCCA 3CC7T 3CD6T 2JTFA 1WXTA 4NL3A 5CK9A 2JTEA 2KDSA 5FRMA 4EIKA 4F14A 3MEUA 4M78E 4XTWA 1NEGA 4J8OA 4PJOC 3VS4A 1U06A 1VQPT 1VQNA 2YRVA 4KGZB 2CT3A 4IUVA 1PKTA 3S3MA 3G4ST 3I55A 4CC4B 5GANj 1Q7YC 1IGUA 1YJNQ 1QW1A 3OYKA 1PKSA 1IO6A 5FLXE 5AT1B 3RIRA 4M7AB 4MZTA 1Q81R 4PJOE 3CCEA 1UJ0A 3PE0A 1IHVA 4XTXA 2VYTA 4XU1A 1X6BA 3VS1A 4MZMA 3JCMh 1VQ8T 2BUDA 2DD5A 2DJQA 4HA8A 1ZSZA 5CKEA 3QKJA 2RQRA 3OYMA 2LNVA 3ZBDA 4FSSA 4RCBA 4JZ4A 3M0TA 3C95A 1Q7YR 2JVVA 4OGEA 3QXEB 4DQ2A 2MF2A 3KXTA 1DJ7B 1WHMA 4IIOA 2E12A 4RKUE 3OSVA 4IUQA 1VYVA 4YTLA 2E5KA 2YUOA 1KD1R 2AK5A 3ASKA 1YJ9A 2ZGWA 1G83A 3VJPA 4OMOA 4AT1B 1H3HA 5DLOA 4BUGA 1K9MR 2DZ9A 3A5ZB 1BU1A 3V7SA 3I56Q 1I81A 1KC8C 1N8RU 1VQ6Q 2AIRB 1ZSZC 1RABB 2LJ3A 1WA7A 1YI2T 3JCMX 2RMOA 2EYZA 1FXXA 2MWPA 4F17A 5GANd 4E7LA 2EYXA 1OI1A 2FHDA 3HHTB 3HPWA 4C5EA 4ME7A 2MPXC 4II1A 4FW2A 2MYSA 3PMTA 3JB9H 2YUPA 2MCNA 2EJGA 3QJYA 3RKXA 5LL6S 2ED1A 3BW1A 3C4SA 4BE1A 5CKDA 2CZ0B 1LJOA 2FZCB 5IT9E 1BI0A 1K9AA 3MKDA 2LT1A 2R5MA 3A8HB 1VQNT 2RQUA 5LJ3f 4N4IA 3EGDA 4RTVA 2EJFA 1QQJA 4JJCA 2RF0A 1KC8R 1QMCA 4NL2A 2QDYB 3I55T 4A4KA 1Q82C 5KYUB 4KBMB 1TU0B 4OMNA 2G6FX 3OMCA 2HD0A 1X2KA 2OAUA 4HVUA 4F04B 1TTHB 1UGRB 1T0JA 2RM4A 3LH0A 2DXCA 2JXBA 2RI5A 5GAOr 1M90U 3CCET 1VQKA 3M0PA 3C12A 3M57A 3E1SA 4M77G 1NE8A 1N5ZA 1ZUUA 1AD5A 1VYUA 1VQ4A 4J7FA 4D6WA 4K11A 5KE3A 1KQSP 1GCQA 2A36A 1XJWB 2RJFA 2H8HA 1Q86U 2QDLA 3UDCA 4M7AA 4E7SA 1I4K1 3OBWA 1YJWQ 1XOVA 3CPFA 3JCMf 4C5IA 2LCSA 1XTDA 4RG8A 1NG2A 2R57A 4C8QD 2KNBB 2M9UA 4J5YA 5GJVB 1NPPA 4C5GA 1CKAA 1YJ9T 1M2VB 3ZFJA 3L2ZA 2DZCA 4N4HA 3OW2P 1NEBA 2HQXA 2RD1A 2SRCA 2QQSA 4M7DD 1JQQA 2X4JA 4GLKA 3CC7Q 3CD6Q 4LDUA 4FT4A 2L3PA 5J26A 2YUNA 2OTLQ 1SRLA 4J9FA 1GBRA 1YNZA 2DAQA 1GCQC 2F5KA 2JMAA 5GAOl 1VQPQ 1WX6A 2DIGA 5FWCA 4B9XA 1X01A 2QG9B 3V7RA 3EH2A 4F7UG 4M7AC 5EC7A 3G4SQ 2CSIA 1WLPB 4BI8B 1QVGS 2VKNA 4JS4A 3AT1B 2A28A 4GBQA 4RG2A 2XDDA 3VUZA 2VASA 2L3RA 4FYYB 1SKUB 2M02A 4E7ZA 2FL7A 5GAMe 3EHRA 3V8KA 4DEYA 2P0QA 3M58A 1V29B 1PRLC 2LRQA 5J39A 4DEXA 2FPFA 2DTHA 3EFOB 4M7AE 4GLMA 4FL6A 1VQ8Q 1OEBA 2ZPBB 5GAN8 1W2BS 2CSQA 4J83A 1RAEB 2BTTA 2DJZA 5CQXA 1FX7A 2DE0X 2VV5A 1W4SA 1X43A 1NJIC 3KFVA 2V8IA 3QO3A 2XU8A 2RK2A 1VQKT 4KUDK 4M77D 3OS0A 4OB2B 1OOTA 2RO0A 1U8RA 3PGGA 1PD0A 4C5HA 4C0ZA 3MO8A 1LCKA 2A7YA 1VQ4T 1K0XA 3HFOA 2DVEA 5KYUA 2ENMA 1Z9QA 1AOJA 4QVZA 4J6WA 3JSCA 2CP3A 4HVWA 1ZUYA 3NTHA 2OI3A 2DX1A 1TH7A 4XK8E 1RI9A 2GTJA 1G2BA 1YCSB 2FB7A 5KE2A 2HSEB 1NJIR 3HSBA 1D1AA 7AT1B 2F5TX 4PKCC 3GLXA 1YI2Q 3QZ9B 1A0NB 1QKXA 3CPWP 1RI0A 2JZ2A 1FWZA 3QPHA 2WSCE 1WJSA 3FDRA 4PJOG 2VUBA 3G71A 3HTRA 4ESRA 1ZUKA 2X3XD 2A37A 1KQ2A 4J9GA 2EVRA 2K5IA 3QZ5B 4JLGA 4LDVA 2COZA 2ESWA 4BB7A 4ZGEB 2DO3A 2CP0A 2LZ6B 5GAN4 3J7AF 4J9CA 2K2MA 1VQNQ 2Y90A 1M2VA 2PUOB 2RHYA 5GMKi 2O2OA 3Q1JA 2KT8A 1ZLMA 1JB0E 3I5SA 8ATCB 1E7OA 3JCMc 1M9SA 5IXBA 1QP2A 2DL8A 4BD3A 4ZN1A 5C0MA 2CP6A 4MMKA 2KYMA 2F2VA 2V8JA 3CCEQ 4M75D 1M30A 2EKOA 1K8AC 4J9EA 3X25B 2C0IA 9ATCB 2C06A 2E3IA 3NGPA 2BZ8A 3DB4A 1WGSA 1RACB 2JW4A 3GPLA 4EDUA 1RADB 2NWMA 5FWBA 2QEXA 4NOYA 1WHJA 1FYNA 2SEMA 4PFPA 3L1AA 2FEIA 3JRZA 3M56A 3BE3A 4RCCA 5GAOp 1V76A 2M0OA 1KQ1A 2E5QA 1G3WA 4ELZC 1UHCA 2OTLA 2EYWA 2JT4A 2RHUA 5GAOm 4XTYA 1AZEA 4QQ6A 2GFUA 3AHUA 2CYZB 3EFOA 1X27A 4JUVA 2ROLA 2M51A 4FYWB 2ECZA 3UPUA 3CCRA 2CREA 1K8AR 1Q95G 2VXFA 1YJ9Q 2JS0A 4D8DA 1QVFA 2LQ8A 2DERA 3OW2A 3X28B 1HXDA 2CUBA 4PNOA 3VU3C 3H9NA 1IHWA 5GAMh 3SEMA 4A63B 2C0TA 2J6OA 1ABQA 2CDTA 5LJ5e 4DBQA 2MMPA 3E9FA 2CZ7B 1NLOC 2P4RA 2AKKA 2EYQA 2MWOA 1KK7A 1IXDA 4PLLA 3MEAA 3OYCA 3TCJA 2A08A 1YN8A 4PLIA 1MMGA 3EG9B 2O01E 4ELYC 2QTVA 4XTVA 3G71T 3JB9G 2X4YA 2RJCA 4F16A 2CH4W 2QGFB 5KCOA 5LJ5g 2RPNA 2L8DA 1M4ZA 4IUUA 1OPKA 1ZX6A 4X34A 3GP8A 2DEQA 3J81E 3G6EA 4RTWA 4E7HA 2BZXA 4HKEA 3UT1A 3VRZA 1QP3A 3WXMB 2HNIA 2E6ZA 3EGUA 1VA7A 3G1JA 3FJPA 4LN2A 2HCKA 1WHHA 1FMKA 1Q7YU 2KROA 2DRKA 5FROA 3CC2Q 2D0QB 2XD0A 3JCMQ 4C0GA 2O9VA 3OB9A 2DD4A 2CP5A 1PSFA 2DYBA 5DY9A 5M9OA 1EIFA 2DLPA 3VYGA 5KYNA 2RJDA 1VQKQ 3O8VA 2E4HA 3SB2A 3MJXA 1UFFA 3QSUA 1OYXA 2XKOC 3CQTA 1M5Q1 3OMGA 1VQ4Q 2QEXT 2MK5A 3A8OB 1BKBA 2IIMA 1QWEA 3HP9A 2E41A 1PWTA 1AHJB 2L0AA 2EAYA 1Q81C 2WACA 4LNPA 1PD1A 2OTLT 1X6OA 4A4GA 3EFSA 4CI0C 2ROTA 1WQ7A 2ED0A 3CCQA 4X9DA 3CPWA 3CCRT 4C92B 3EFRA 4IIMA 4KUIA 4EMGA 1B7TA 1FMVA 3JB9J 4PFZA 2J7IA 1W1FA 4RTUA 2EJ9A 2LQWA 1KSWA 2XICA 1R0BG 1IRXA 1KC8U 1VQ9A 5CCAA 2YRDA 4EPCA 5I22A 1KD1C 3ZL7C 3CXCP 2K3BA 3V8JA 1MV0B 1K73C 4GY5A 1TUDA 3FJ5A 2A3LA 3C94A 1B07A 3PNWC 1K9MC 2B86A 2PVDB 5C6SA 5GAMf 5GAN6 2DFUA 1ZA1B 3LW5E 5FRNA 3M53A 3JCMV 3M0QA 2MIOA 2KRMA 1PSEA 3G6ET 4C8QF 4XTUA 2HBPA 1N9SA 2LT4A 4PJLA 3CCVA 5HKCA 4FM4B 2I0NA 1I8FA 2AHJB 2K9GA 4RMOA 3CCSA 3EG9A 1Q82U 2JJ9A 1Y57A 3QYHB 4M7DF 3VYHB 1YITA 1G5VA 2OX7A 1W6XA 1QVGP 2EPDA 2X3WD 4LD9K 4HCKA 1K73R 2KRNA 4OF1A 3R6NA 3CCUA 4FYXB 4PJNA 1WJRA 4LUEA 3RR6A 3OYHA 2M16A 1HSQA 5LJ5h 1BIBA 2F2WA 3RESA 3HRTA 1SSHA 3M9QA 4PJMA 3M4YA 4QT7A 4DBHA 4C8QB 1M1FA 2K3YA 1W2BP 2EQUA 1M1GA 4J9DA 1JO8A 4JRIA 3OYDA 1X2QA 2LP5A 1V1CA 5D6XA 1D3BB 2HZYA 4M7DB 4WTOB 4PJJA 2DILA 2K5FA 5GAN2 3R6OA 2FZKB 3NHNA 3CCQT 2HKQB 1TWBA 2YLBA 1ZQ1A 1WQWA 4TVRA 1SF9A 5A0DA 4AFZC 2FRYA 5CKBA 2NUPB 5GJWB 5IHNA 2L3SA 3RERA 2RI2A 3CC2A 2O4XB 4M4ZA 5LJ3j 4M77F 3PVLA 4C0FA 3QJ6A 3G71Q 4OMMA 2E10A 3VKIA 1BK2A 1GL5A 3BDLA 3ME9A 1VQ9T 1JJ2P 4AFUC 5CIUA 3LLRA 2LNHB 4FT2A 2XK0A 4LD6A 2IPOB 5GMKj 2K57A 2XMFA 3OSSC 1K76A 2FO0A 1YWOA 4C92A 1H92A 3JV3A 4IUPA 2KGTA 1MMDA 2RNAA 2O88A 2WSEE 5IHKA 5L8RE 1S72A 3CBPA 1JU5C 4CC7A 4A53A 1Z9ZA 3QHSA 3EG1A 5CVIA 1M8VA 3RDVA 1XQHA 1ZHIA 4M77B 2O31A 1PG5B 3NPFA 4HCBA 3CCVT 3JB9I 2W10A 4BY6B 6AT1B 4DOVA 2EGCA 3CCST 2R5AA 2DMOA 4B9WA 1YITT 3CCLA 2QEXQ 1YBYA 3MEWA 3CCUT 1CSKA 1NJIU 3MEVA 2BIVA 4BDZA 4KT0E 1YWPA 1GFDA 2MI6A 1QCOA 2CZ6B 4RTZA 2K2VA 5D6WA 4C92C 4F7UF 3NFCA 2YRCA 4LE9A 2FPEA 3OA6A 2YSQA 3L2VA 2EBPA 4FW1A 2EQIA 4LDYA 1I07A 3CC4A 4D8KA 5LJ3d 4XU3A 2HAXA 1X75C 5GAN7 2XHCA 2RH2A 3CCRQ 1OZ2A 3REBB 2EGEA 2ZCFB 2X51A 4J7IA 2ZPHB 3OYIA 3DLMA 5LJ5f 1IREB 2CGHA 4M75F 4ORZA 1NM7A 2EQJA 4HCZA 4C92E 3TU4K 4C8QA 1QCFA 3CXCA 4Q5WA 5HK3A 3JAME 4J6XA 1MHNA 2IVWA 4EMHA 8AT1B 2EWNA 1SSFA 2LJ1A 3CC2T 2K5LA 1SG5A 4JPBW 2JUFA 1D3BA 4M7DA 3JCMb 3H41A 3RUXA 2QQ9A 1X6GA 3P8HA 5GAMg 2KXDA 1PNJA 3MP1A 4LUDA 3QDRB 4ZGJB 2VGNA 3OYAA 2DKGA 3G6EQ 1UUEA 4M75B 3VS5A 3QIIA 4OMFB 2RJEA 1Y0MA 2JM9A 3JCMd 2DYIA 3QG1A 3M0UA 2NUPA 4BE2A 2O4XA 2PVOB 1UGSB 4M78G 2VB6A 5CQYA 4OB3B 1S72T 5CAIA 4OGCA 2CP2A 1I1JA 2BZYA 3DB3A 1AZGB 5KYXB 3A1PA 2ATCB 4C8QC 5A0GA 3GNGA 2VGMA 3CCJA 1Q86R 3H0HA 2EW3A 2NUTB 1C6VX 3TQ7P 4N0AA 4PJOF 3PIOA 1M1KC 1K8AU 4BE0A 1D0YA 2BKDN 2COYA 1OU9A 2DA9A 2EGAA 4M7DC 3REAB 1U1TA 3CCLT 1RAHB 2KRSA 3TREA 1W2BA 3NTIA 1MUZA 2Z0WA 1TOVA 2QYZA 2LDMA 3QWYA 2JMCA 4C8QE 5IN1A 4M77A 1VQ7A 1D1BA 4IURA 2V8KA 4MMLA 2LCLA 3A8MB 2QA4Q 4P5NA 4M7DE 3SD4A 3KBGA 3CC4T 2GQVA 2GBQA 3CCQQ 1WPYA 2DL5A 1VQOA 3VV0A 2GQIA 1MV3A 1M1KR 5I21A 2H3EB 1NBEB 2DTIA 2DNUA 3META 4JLIA 3HKSA 1MMAA 1YIJA 4N0AC 2W0ZA 2DL3A 3OS2A 1PRMC 1Y07A 1JBMA 3OYFA 5GAN5 5GAN3 1JJ2A 2RQWA 1VQ9Q 1UHFA 4DBFA 3MCAB 3IQLA 4NS5A 4IUTA 5IH2A 3P8DA 2YWWA 4XTZA 4MDXA 3U23A 3V8LA 1RUWA 1U3OA 3E19A 3QBYA 4RTXA 3L2QA 4C0DB 2ZPIB 1QVFS 1UGQB 2DBKA 2OAWA 3I35A 3OW2S 1BBZA 4M77C 1AWWA 1IZ6A 1R8OB 1KQSA 2JM8A 4OB1B 4BY6C 3QWXX 1SEMA 1AEYA 2RK1A 1K1ZA 3PTAA 2COWA 4CC3A 4Y92A 2D6FA 3VS7A 5GANh 4B6MA 3CCVQ 1H641 2XIDA 4J9BA 1RLQC 4E2FB 3TSZA 2R58A 2JOYA 4QKUA 4M78D 3CCSQ 3GBQA 2JTMA 3T9NA 4M77E 2LJ0A 1P92A 1Y7XA 1YITQ 2QK0A 2V1QA 3L2UA 5KH6A 2OTJQ 1BCMA 4JS5A 3CCUQ 5AYFA 3MHXA 3ER0A 3OYGA 4Y28E 3CCJT 2RHIA 2P0PA 1NYFA 3L42A 3MP8A 1MGQA 4M75A 3GOXA 3A98A 3FEOA 5D6YA 3M59A 3OYLA 4JRQA 3RBBB 4A4FA 1WDXA 4KH1B 1PC0A 4PJOD 1WJQA 3QDFA 1GXIE 4JRPA 3N5BB 2I2LA 5KYXA 4JRKA 1VQ5T 4A4HA 1Q81U 5I11A 1VQ7T 2NUTA 3L2WA 1AWOA 3NMZC 4ZTJA 4KH0B 5FU7B 3X24B 2DL7A 2KY9A 3LH5A 4N4GA 4KGVB 4OVAA 1VQOT 1B3QA 1QVPA 1YFNA 4PFOA 1MNDA 1YIJT 4M75C 1VQMA 2KXCA 4XAXB 5A2QE 2FZGB 2EQKA 2YUQA 1N27A 2E6NA 3VS3A 3H6ZA 4Z88A 4IKFA 2CKKA 4HXJA 3M4GA 1KD1U 2M0YA 4QQDA 3GIBA 2D9TA 3FLGA 4A4EA 3CPWS 1K73U 2J6FA 1WXBA 2C0OA 1K9MU 3MPUB 2VC8A 3PMIA 4Z89A 1TXQA 4Z02A 1RAAB 4M75E 2QI2A 5IHIA 1JXMA 2KR3A 4OB0B 1M8MA 2DTOA 1S72Q 4L59A 1VQLA 2RI3A 5I2MA 4V2SA 1G3SA 2IG0A 2X4WA 2HSPA 2OJ2A 3M0SA 3LGLA 1K0SA 2QA4A 4ATOA 3EGXB 3INZA 4QW2A 1KG1A 2HL5C 2NLUA 5GAOq 3URGA 2CUDA 4C92G 1WHLA 3CCLQ 3HFNA 1NPRA 1PM3A 1VIEA 5GMKh 4J9IA 2GFAA 1ABOA 1RL2A 3EG3A 1WXUA 3HRUA 3VS6A 1VIFA 2HMAA 1HYOA 2B8AA 2RQVA 3P8BB 2BE9B 4M7AG 5GANf 3I9QA 3TVTA
chains in the Genus database with same CATH topology
3WVEB 3FIFA 1U8RA 1G3TA 3PGGA 3OS1A 4OP0A 4C5HA 3OSSC 4C0ZA 1VQPA 3MO8A 3QUIA 3JCMg 2A7YA 1VQ4T 3HFOA 3JB9F 4PL6A 2DVEA 3CCMA 3OBYA 4O6JA 4C92A 3GNFB 3LWHA 5I2SA 4QQGA 4QVZA 2Y4XA 4IUPA 4J6WA 2EIFA 3G4SA 3JSCA 3OQ5A 3CD6T 4A54A 2WSEE 3JB9D 1U1SA 5L8RE 2XDBA 4QVDA 3NTHA 1LOJA 1S72A 3CBPA 3M54A 3V7CA 4A53A 1TH7A 3QHSA 4XK8E 2MAMA 2DXBA 2LTOA 4C0DC 5CVIA 1M8VA 4Y91A 4HT8A 2FB7A 2KVQG 5KE2A 3SFMA 4CRIA 1XQHA 1ZHIA 3OS5A 3HSBA 4M77B 2F5TX 4HCBA 2LCCA 3A8LB 3CCVT 4PKCC 3E9GA 3TEEA 3JB9I 1HK9A 5GAMj 3CMEA 2E64A 4O5VA 1N6AA 4BY6B 3GLXA 2KK4A 4DOVA 3QZ9B 3NTKA 5CR2A 5CKHA 3X20B 3CCST 2R5AA 1VQ8A 4M78A 4B9WA 1RI0A 2JZ2A 1FWZA 3QPHA 1YITT 3CCLA 2WSCE 1WJSA 3FDRA 4PJOG 2QTXA 3JCMP 1YBYA 3MEWA 2L89A 3CCUT 2P0KA 2VUBA 2RB6A 1NJIU 3G71A 1BI2A 2PU9B 3MEVA 5FU6C 2BIVA 2OTJA 4BDZA 1VQMT 4KT0E 1OZ3A 1KQ2A 3OYNA 2K5IA 3QZ5B 2MI6A 3FRNA 4JLGA 2ZPFB 4F7UE 3JCMJ 4ZN3A 2CZ6B 2K2VA 3CBMA 4LDVA 5D6WA 4C92C 4BB7A 4F7UF 3NFCA 4XU0A 4ZGEB 2DO3A 4E47A 3OA6A 3L2VA 5GAN4 3BDUA 1B34B 3J7AF 2KAFA 1YHQA 1I5LA 2Y90A 4BI3A 2PUOB 2RHYA 4LDYA 4C8QG 3CC4A 2KMTA 4XQ3A 5GMKi 2K4YA 5LJ3d 4PJOA 4XU3A 2RA2A 3Q1JA 2HAXA 1X75C 5GAN7 1H3ZA 1O9SA 2RH2A 2XHCA 4DOWA 1OZ2A 1JB0E 4X9CA 3S3NA 4L5GA 4LDWA 2ZCFB 3JCMc 1M9SA 3WVDB 4J7IA 2ZPHB 3OYIA 1QP2A 3DLMA 4QVCA 3RMSA 4BD3A 1IREB 4ZN1A 5LJ5f 1VQLT 1YJWT 4M7DG 2CGHA 4M75F 2KQWA 2QXFA 5C0MA 5IAYA 2EFIA 2PQWA 2DXUA 2FYKA 4E7IA 2DXTA 2EQJA 4HCZA 4MMKA 2V8JA 4C92E 3KUFA 2YLCA 4M78C 3TU4K 5KCHA 4DA4A 3J80E 4C92F 3SDZA 3S3OA 4M75D 1LNXA 2GCXA 2PVGB 2EKOA 5HY6A 1K8AC 3DKMA 1UEBA 3X25B 2QA4T 1YI2A 4C8QA 2C06A 3CXCA 4Q5WA 5HK3A 3DB4A 1WGSA 3GPLA 4C92D 4J6XA 5LJ3h 5HK0A 4EDUA 1MHNA 2IVWA 2X35A 4EMHA 1BI1A 2QEXA 4NOYA 5GMKl 2EWNA 1SSFA 4E7KA 1NZ9A 1BIAA 5FU7C 1WNLA 3L1AA 3CC2T 2DPPB 2K5LA 4M7AF 3JRZA 3OYEA 4HCCA 3M56A 3CC7T 3QYGB 4RCCA 2JUFA 1D3BA 2EQMA 2JTFA 4MZPA 3JCMb 5GAOp 4E7JA 3RERA 4NL3A 4M7DA 2M0OA 2ZPGB 5CK9A 4EMKB 2KDSA 3RUXA 5FRMA 3H8ZA 1KQ1A 4MDWA 2E5QA 4M7AD 2QQ9A 3P8HA 5GAMd 1G3WA 4ELZC 5GAMg 3MEUA 4M78E 3CMAA 4XTWA 3MP1A 3SWNB 3QDRB 2OTLA 4J8OA 4ZGJB 2VGNA 2RHUA 5GAOm 4PJOC 3OYAA 2DKGA 2QQBA 4XTYA 4QQ6A 4M75B 1VQPT 2GFUA 1VQNA 2FVUA 3HRSA 3AHUA 2CYZB 2YRVA 3QIIA 4IUVA 3LWIA 4OMFB 2RJEA 3CCMT 4JUVA 3JCMd 3S3MA 3QG1A 3G4ST 3I55A 3UPUA 3CCRA 5GAOn 4BE2A 2VXFA 2O4XA 2PVOB 1UGSB 5GANj 1Q7YC 1QVFA 4M78G 2LQ8A 1BYMA 1QW1A 5CQYA 4BDYA 3OW2A 3X28B 4OB3B 1S72T 5CAIA 1HXDA 4OGCA 3OYKA 5FLXE 3GF5A 4PNOA 3DB3A 3LGFA 3VU3C 1KHIA 5GAMh 4C8QC 3RIRA 5A0GA 3GNGA 2VGMA 4M7AB 3CCJA 4MZTA 4PJOE 3CCEA 4N0AA 1N8RC 5LJ5e 4PJOF 3CBOA 3CMET 3PIOA 1BI3A 1M1KC 4XTXA 2VYTA 2MMPA 3E9FA 2CZ7B 4XU1A 4BE0A 1K8AU 2EYQA 2MWOA 4PLLA 3MEAA 2BKDN 4MZMA 3JCMh 3OYCA 1VQ8T 2BUDA 2DD5A 4M7DC 3TCJA 4J6YA 4HA8A 1U1TA 3CCLT 2ZZDA 5CKEA 2L5QA 2LC4A 4PLIA 3QKJA 3TREA 1W2BA 3OYMA 3NTIA 2O01E 2LNVA 4ELYC 4XTVA 3G71T 3JB9G 4FIBA 2X4YA 5DLQE 2OTJT 1Y96B 2RJCA 2LDMA 3ZBDA 4ZTFA 3LYIA 4RCBA 3HL8A 4C8QE 3ZEHA 3C95A 5KCOA 5IN1A 5LJ5g 2JVVA 1M4ZA 2L8DA 4OGEA 3QXEB 4DQ2A 4IUUA 4HT9A 4M77A 1VQ7A 2VXEA 2MF2A 3KXTA 4X34A 3GP8A 2DEQA 3J81E 4IURA 1DJ7B 3G6EA 4E7HA 2V8KA 4MMLA 3RKYA 3CXCS 2LCLA 3A8MB 4HKEA 2E12A 3X26B 1YHQT 4RKUE 3UT1A 3OSVA 1QP3A 4IUQA 4P5NA 3WXMB 2HNIA 3SD4A 4M7DE 1YCYA 3KBGA 2E6ZA 4YTLA 2GQVA 3FC3A 3CC4T 1WPYA 1VQOA 3VV0A 3ASKA 3FJPA 5EG2A 5I21A 1YJ9A 2ZGWA 3MP6A 2DTIA 1Q7YU 5GANe 1YJNA 3META 4JLIA 5FROA 1ZBXA 3HKSA 2D0QB 3VJPA 2XI9A 2XD0A 3JCMQ 4C0GA 5DLOA 4N0AC 3VUBA 4BUGA 1YIJA 2DZ9A 3OB9A 3OS2A 2QQAA 3A5ZB 2DD4A 1Y07A 1JBMA 1N9RA 3V7SA 3OYFA 5GAN5 1PSFA 5DY9A 5M9OA 1EIFA 5GAN3 1KHCA 1JJ2A 2GF7A 3VYGA 1I81A 1M90C 4ZGDB 1KC8C 2ZPEB 1N8RU 2RJDA 3O8VA 1G3YA 3MCAB 1B34A 4IUTA 4NS5A 1M1KU 3P8DA 3SB2A 2X4XA 1UGPB 1YI2T 3JCMX 3UWNA 4XTZA 2E1HA 5LJ5j 3QSUA 4MDXA 1FXXA 2MWPA 1OYXA 2XKOC 3V8LA 5GANg 5GANd 4E7LA 3E19A 1M5Q1 1OI1A 2FHDA 3QBYA 3L2QA 3OMGA 3HHTB 2QEXT 4C0DB 5CO7A 2ZPIB 3HPWA 4C5EA 1QVFS 1UGQB 4F7UB 3DLLA 4II1A 4ME7A 3OW2S 2JNGA 3CEYA 3A8OB 1BKBA 4M77C 1IZ6A 3BFMA 1R8OB 3PMTA 3JB9H 3HP9A 2E41A 1KQSA 1AHJB 2EJGA 3QJYA 4OB1B 4BY6C 4WF2A 2RK1A 2WSFE 5LL6S 2EAYA 3RKXA 3PTAA 3BW1A 4FSXA 3OYYA 2K57A 2WACA 1Q81C 1Q86C 3C4SA 4BE1A 2G3RA 5CKDA 2LX9A 3CMAT 2CZ0B 1LJOA 3RMQA 5GANf 2OTLT 2CZ1B 4XU2A 5IT9E 2D6FA 1X6OA 4A4GA 3EFSA 1BI0A 2LT1A 2R5MA 3A8HB 1VQNT 4M75G 4M78F 4CI0C 4VUBA 2RHXA 5FU6B 4N4IA 5LJ3f 5GANh 1WQ7A 2EJFA 1H641 2XIDA 3EAEA 3CCQA 5DM7R 2R58A 4X9DA 4NL2A 2JOYA 2QDYB 3I55T 4A4KA 3CPWA 3CCRT 5A0LA 4L6V5 4M78D 1Q82C 4JDSA 4KBMB 2JTMA 3T9NA 4M77E 4C92B 4JJNK 1P92A 1Y7XA 3EFRA 3OMCA 2HD0A 3L2UA 2OAUA 4KUIA 4EMGA 4EMKA 5KH6A 2CS7A 4JS5A 1QVGA 2YHTA 1UGRB 3JB9J 3LH0A 2RM4A 3MHXA 5AYFA 2DXCA 3ER0A 3I56A 2EJ9A 5J3BA 3OYGA 4Y28E 3JCMW 2RI5A 3SWNA 2XICA 2RHIA 3CCJT 2P0PA 5GAOr 1KC8U 1M90U 3L42A 1VQ9A 1VQ6A 1UB4A 3CCET 1VQKA 5CCAA 3MP8A 2RHZA 4EPCA 1MGQA 3C12A 4M75A 3M57A 3GOXA 2KSSA 3E1SA 4M77G 3FEOA 1KD1C 1NE8A 3M59A 5D6YA 3OYLA 4JRQA 3PT9A 4A4FA 3V8JA 1VQ4A 4J7FA 5GMKm 1K73C 4GY5A 4D6WA 2A3LA 5KE3A 3C94A 1XNIA 4PJOD 4M78B 3PNWC 1K9MC 1WJQA 2PVDB 4R55A 1GXIE 4R56A 4JRPA 3N5BB 2I2LA 3L2RA 5C6SA 2RJFA 2LQKA 5GAMf 5GAN6 4JRKA 1Q86U 4BACA 1VQ5T 4A4HA 1Q81U 3UDCA 1JJ2S 4M7AA 3LW5E 1VQ7T 1I4K1 5FRNA 3OBWA 3M53A 3JCMV 3L2WA 1VQ5A 1XOVA 5LJ5d 3CPFA 1PSEA 3G6ET 4ZTJA 4C8QF 5FU7B 3X24B 1VUBA 4KULA 2KY9A 4XTUA 3JCMf 2HBPA 4C5IA 1N9SA 2LT4A 4UC4A 3CCVA 1XTDA 4RG8A 5HKCA 4FM4B 4N4GA 2R57A 2PUKB 1I8FA 4EMKC 2XDPA 5CKFA 4BI4A 4C8QD 4OVAA 1VQOT 3F70A 2AHJB 2M9UA 4J5YA 1QVPA 3A8GB 4RMOA 1NPPA 4C5GA 3CCSA 1YJ9T 1Q82U 3ZFJA 3QYHB 1YJNT 3VYHB 4M7DF 1YITA 1G5VA 1JRIA 3FB9A 3SWNC 1KQSS 1Y96A 3L2ZA 2DZCA 2HQEA 2JN0A 4N4HA 5LJ3e 3PIPA 4PJOB 4LD9K 1YIJT 2HQXA 2RD1A 1Y71A 4M75C 4OF1A 3S6WA 2QQSA 3CCUA 4M7DD 2X4JA 1WJRA 4GLKA 4LDUA 1VQMA 3OYHA 4FT4A 4XAXB 2M16A 5LJ5h 5A2QE 5J26A 2EQKA 1BIBA 5GMKe 1N27A 2E6NA 3H6ZA 4IKFA 2CKKA 2DAQA 3M4GA 1KD1U 2F5KA 4QQDA 2DK3A 3HRTA 3RESA 5GAOl 2LVMA 2E65A 3GIBA 2D9TA 3M9QA 3FLGA 3M4YA 4A4EA 3CPWS 5LJ3g 1K73U 2DIGA 4B9XA 3OY9A 4C8QB 1X01A 3V7RA 1M1FA 4F7UG 2K3YA 3PMIA 2VC8A 2EQUA 1M1GA 1K9MU 4M7AC 4JRIA 4Z02A 3OYDA 4BI8B 1QVGS 4M75E 2QI2A 4JS4A 3G7ZA 3M55A 4OB0B 2DTOA 4RG2A 4L59A 5D6XA 2XDDA 1D3BB 1VQLA 1YJWA 4M7DB 3VUZA 2QQRA 2RI3A 2L3RA 5I2MA 2K5FA 2FL7A 5GAMe 4V2SA 5GAN2 1G3SA 3V8KA 4FU6A 2IG0A 2P0QA 2X4WA 1V29B 3M58A 3R6OA 3OYJA 2LRQA 5J39A 3PFSA 3LGLA 3CCQT 4LDXA 2QA4A 4ATOA 3INZA 2YLBA 2XG8D 2DTHA 2F69A 4QW2A 4F7UA 1KG1A 2M1HA 2NLUA 5GAOq 4FL6A 4M7AE 1ZQ1A 3M5AA 2ZPBB 1WQWA 3URGA 5GAN8 4TVRA 4C92G 3JCMe 4J83A 1W2BS 2H3JA 5A0DA 2Y4YA 3HFNA 5CKBA 2DJZA 2K3XA 5CQXA 1NPRA 1FX7A 2DIQA 2VV5A 2RI2A 3BY7A 2O4XB 3LX7A 1VIEA 1W4SA 5GMKh 3RKWA 5LJ3j 3CC2A 1O75A 4M77F 1NJIC 4C0FA 3QJ6A 3CC7A 3OYBA 2V8IA 3CD6A 2GFAA 2E10A 3QO3A 3VKIA 1RL2A 2XU8A 3HRUA 3I56T 2E70A 3BDLA 3ME9A 2RK2A 1VQ9T 1VQ6T 2P4TA 1VIFA 1VQKT 4KUDK 2B8AA 5CIUA 4M77D 3OS0A 4OB2B 3P8BB 4M7AG 3LLRA 4FT2A 2XK0A 4LD6A 5GMKj 3JAME 2RO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIF A;  3JCM Q;  3PGG A;  3JCM V;  4OP0 A;  4EMH A;  4N0A C;  5LJ5 d;  4NOY A;  5GMK l;  2DZ9 A;  2EWN A;  3QUI A;  3JCM g;  1BIA A;  4C8Q F;  1WNL A;  3HFO A;  3JB9 F;  1JBM A;  1N9R A;  2DVE A;  3L1A A;  4XTU A;  3V7S A;  4M7A F;  5GAN 5;  5DY9 A;  3JCM f;  4C92 A;  5GAN 3;  1N9S A;  4RCC A;  5GAN g;  1D3B A;  4M7D A;  3JCM b;  1I81 A;  4J6W A;  5GAO p;  4NL3 A;  4A54 A;  1I8F A;  4EMK B;  4C8Q D;  3RUX A;  4EMK C;  5LJ3 h;  1B34 A;  1KQ1 A;  1U1S A;  4J5Y A;  3JB9 D;  4PJO B;  3SB2 A;  4M7A D;  3JCM X;  4QVD A;  5GAM d;  5GAM g;  4XTZ A;  1LOJ A;  2E1H A;  4M78 E;  5LJ5 j;  3QSU A;  4M7D F;  4XTW A;  1JRI A;  3FB9 A;  3SWN C;  3SWN B;  1Y96 A;  3L2Z A;  2DZC A;  2JN0 A;  1TH7 A;  3V7C A;  3V8L A;  4A53 A;  1M5Q 1;  2DKG A;  3QHS A;  5LJ3 e;  5GAO m;  4XTY A;  2RD1 A;  4M75 B;  4M75 C;  1M8V A;  4Y91 A;  4HT8 A;  3AHU A;  2FB7 A;  4F7U B;  4M7D D;  3HSB A;  4JUV A;  4M77 B;  4M77 C;  3BFM A;  3JCM d;  4PJO C;  3JB9 H;  2E41 A;  3JB9 I;  5LJ5 h;  1HK9 A;  5GAM j;  2E64 A;  2EJG A;  5GMK j;  1BIB A;  4WF2 A;  5GMK e;  5GAO n;  2VXF A;  3RKX A;  2EAY A;  3BW1 A;  5GAN j;  4M78 G;  3M4G A;  4M78 A;  5GAO l;  3RES A;  1LJO A;  5CAI A;  1HXD A;  2E65 A;  3GIB A;  4XU2 A;  4PJO G;  4PNO A;  2QTX A;  3EFS A;  3VU3 C;  5LJ3 g;  3JCM P;  5GAM h;  4C8Q B;  1X01 A;  4M75 G;  3RIR A;  4C8Q C;  2RB6 A;  4M78 F;  3V7R A;  5LJ3 f;  4M7A B;  4F7U G;  4M7A C;  2VC8 A;  5GAN h;  1WQ7 A;  2EJF A;  1H64 1;  4PJO E;  4JRI A;  4N0A A;  1KQ2 A;  5LJ5 e;  4PJO F;  4X9D A;  4M75 E;  4NL2 A;  4XTX A;  4XU1 A;  4M78 D;  4F7U E;  3JCM J;  4M77 E;  2DTO A;  4C92 C;  4C92 B;  4F7U F;  4XU0 A;  3JCM h;  1D3B B;  4M7D C;  3EFR A;  4M7D B;  4J6Y A;  4HA8 A;  1U1T A;  4EMG A;  4EMK A;  5GAN 4;  3BDU A;  1B34 B;  2YHT A;  3JB9 J;  1I5L A;  2Y90 A;  2RM4 A;  5GAM e;  4V2S A;  5GAN 2;  3V8K A;  4C8Q G;  2EJ9 A;  4XTV A;  3JCM W;  3JB9 G;  5GMK i;  4XQ3 A;  3SWN A;  1Y96 B;  5LJ3 d;  1I4K 1;  4XU3 A;  5GAN d;  2RA2 A;  5GAO r;  4PJO A;  5GAN 7;  4RCB A;  1MGQ A;  4M75 A;  4X9C A;  4C8Q E;  3INZ A;  2YLB A;  2DTH A;  5LJ5 g;  4F7U A;  4M77 G;  4HT9 A;  4DQ2 A;  5GAO q;  3JCM c;  4M7A E;  4M77 A;  2VXE A;  1WQW A;  4QVC A;  5GAN 8;  4C92 G;  2DEQ A;  5LJ5 f;  3JCM e;  3HFN A;  4M7D G;  2CGH A;  2DJZ A;  4M75 F;  3V8J A;  5GMK m;  4MML A;  2DXU A;  2FYK A;  3RKY A;  3BY7 A;  3RER A;  5GMK h;  2DXT A;  3RKW A;  5LJ3 j;  4M77 F;  4MMK A;  4C92 E;  4PJO D;  2YLC A;  4M78 C;  4M78 B;  2E10 A;  2HNI A;  3QO3 A;  4M7D E;  1YCY A;  4C92 F;  4M75 D;  1LNX A;  1WPY A;  2I2L A;  3FJP A;  5GAM f;  5GAN 6;  5I21 A;  4JRK A;  4M77 D;  2ZGW A;  4C8Q A;  2DTI A;  4M7A G;  5GAN e;  5GAN f;  4M7A A;  4JLI A;  4C92 D;  4J6X A;  2K57 A; 
#chains in the Genus database with same CATH topology
 3WVE B;  3FIF A;  1G3T A;  1UJY A;  3OS1 A;  3PVQ A;  2LQN A;  2GTO A;  3CCM A;  2D1X A;  3OBY A;  4O6J A;  3GNF B;  3LWH A;  3CC4 Q;  5I2S A;  4QQG A;  1GCP A;  4RUG A;  1U1S A;  3JB9 D;  4KGX B;  5ECA A;  1LOJ A;  2CT4 A;  1MMN A;  2ABL A;  1MNE A;  1BCO A;  4C0D C;  1SHG A;  4Y91 A;  4PK4 A;  4HT8 A;  3SFM A;  4CRI A;  1KIK A;  5HCK A;  1AWJ A;  2LCC A;  3A8L B;  3E9G A;  3TEE A;  1HK9 A;  5GAM j;  3CME A;  4O5V A;  1N6A A;  2L3Q A;  4ZNX A;  2O9S A;  5CKH A;  3X20 B;  1UG1 A;  2AZS A;  4AG1 C;  2L89 A;  2P0K A;  1BI2 A;  1M2O A;  2DM1 A;  2OTJ A;  1VQM T;  1OZ3 A;  3OYN A;  2LX7 A;  2QGG A;  1EX4 A;  2ZPF B;  3JCM J;  1J3T A;  1KJW A;  3CBM A;  4XU0 A;  1VYT A;  3UAT A;  2KEA A;  1TSF A;  1T3S A;  1B34 B;  1YHQ A;  1I5L A;  4BI3 A;  4C8Q G;  5FW9 A;  2KMT A;  1C1A A;  3THK A;  2KYB A;  3S3N A;  4L5G A;  4ANJ A;  3WVD B;  1WI7 A;  2VVK A;  3RMS A;  1VQL T;  4M7D G;  2HQH A;  2KQW A;  2EFI A;  2PQW A;  1D09 B;  4E7I A;  2DXT A;  3ULR B;  3KUF A;  3CCJ Q;  2GCX A;  1X69 A;  2PVG B;  1WYX A;  2QAZ A;  3DKM A;  2QA4 T;  4AFS C;  1UEC A;  1PHT A;  1EZZ B;  2KT1 A;  1TUG B;  1ZBJ A;  4C92 D;  2X35 A;  1BI1 A;  5GMK l;  4E7K A;  1NZ9 A;  1BIA A;  5FU7 C;  1WNL A;  1NYG A;  1QCN A;  4HVV A;  3QYG B;  2EQM A;  4MZP A;  4E7J A;  2ZPG B;  3TSW A;  4RTY A;  4EMK B;  3H8Z A;  4MDW A;  1VQ5 Q;  4M7A D;  1RAF B;  5GAM d;  3CMA A;  1VQ7 Q;  3SWN B;  1RAG B;  1WIE A;  2QQB A;  3EGX A;  1S1N A;  2JS2 A;  4WCI A;  2FVU A;  3HRS A;  2AKL A;  2DF6 A;  3LWI A;  3CCM T;  2AZV A;  1AWX A;  3VS2 A;  1VQO Q;  5GAO n;  3SHW A;  1BYM A;  4BDY A;  2RN8 A;  1CKB A;  1YIJ Q;  3GF5 A;  1HJD A;  1JEG A;  3LGF A;  1KHI A;  2J06 A;  2CP7 A;  1ZA2 B;  1C0M A;  1E6G A;  4Z8A A;  1N8R C;  3CBO A;  3CME T;  1BI3 A;  1SHF A;  3UA6 A;  2K7A A;  2EKH A;  3H0I A;  1R77 A;  2K79 A;  1LVK A;  5L23 A;  1YP5 A;  4J6Y A;  1UTI A;  2ZZD A;  2RQT A;  2L5Q A;  2VWF A;  1OU8 A;  2LC4 A;  1KFZ A;  4FIB A;  5KYW B;  1Q82 R;  5DLQ E;  2OTJ T;  1Y96 B;  4J9H A;  4RTT A;  4ZTF A;  3LYI A;  2X9H A;  3HL8 A;  3ZEH A;  1I5O B;  5KYY B;  4HT9 A;  2VXE A;  2GNC A;  3RKY A;  3CXC S;  3X26 B;  1YHQ T;  1U5S A;  1YCY A;  3FC3 A;  1N8R R;  1QVF P;  5EG2 A;  1NLP C;  3MP6 A;  5GAN e;  1YJN A;  1ZBX A;  2XI9 A;  2NYS A;  1OV3 A;  3VUB A;  2HL3 A;  2QQA A;  1TUC A;  1N9R A;  1G8X A;  4R0K A;  1KHC A;  2GF7 A;  2F1L A;  1M90 C;  4ZGD B;  2ZPE B;  2NUZ A;  1G3Y A;  1B34 A;  1M1K U;  1D0Z A;  2X4X A;  1UGP B;  3UWN A;  2E1H A;  5LJ5 j;  3C0C A;  5GAN g;  1PCX A;  5CO7 A;  4F7U B;  3DLL A;  4AG2 C;  2FPD A;  3CEY A;  2JNG A;  1F1B B;  1M3A A;  1LPL A;  3BFM A;  4WF2 A;  2WSF E;  1Q86 C;  4FSX A;  3OYY A;  1RAI B;  2G3R A;  3CMA T;  2LX9 A;  3RMQ A;  2CZ1 B;  4XU2 A;  2LMJ A;  2HDA A;  4M75 G;  4M78 F;  4VUB A;  4OMQ A;  2RHX A;  5FU6 B;  3VRY A;  1M90 R;  2P84 A;  3EAE A;  1T3L A;  5DM7 R;  5A0L A;  4L6V 5;  2F2X A;  4JDS A;  2AT1 B;  4JJN K;  4EMK A;  2CS7 A;  2ZAE A;  1M3B A;  1QVG A;  2YHT A;  1T0H A;  1E6H A;  3I56 A;  5J3B A;  3JCM W;  1OUL A;  1VQM Q;  2HBW A;  3SWN A;  4AFQ C;  1HD3 A;  1VQ6 A;  1UB4 A;  2KE9 A;  2RHZ A;  2KSS A;  2FG0 A;  1M3C A;  2DRM A;  3H0F A;  2PNI A;  2PTK A;  3PT9 A;  2YDL A;  2DEU A;  2A0F B;  5GMK m;  1OPL A;  1XNI A;  2L2P A;  2V26 A;  4M78 B;  1EFN A;  5D7U A;  4R56 A;  4R55 A;  2CH4 A;  2EYY A;  2J05 A;  1WHG A;  3L2R A;  2HEQ A;  2LQK A;  4BAC A;  3E2U A;  1JJ2 S;  1VQL Q;  1VQ5 A;  5LJ5 d;  1VOM A;  1VUB A;  4KUL A;  3M0R A;  4UC4 A;  2PUK B;  1D0X A;  4EMK C;  2D0N A;  2XDP A;  5CKF A;  4BI4 A;  3F70 A;  3A8G B;  4KRT A;  1YJN T;  5KYW A;  1JRI A;  3FB9 A;  3SWN C;  4LXC A;  1Y96 A;  1KQS S;  2HQE A;  2JN0 A;  5LJ3 e;  3PIP A;  4PJO B;  1ARK A;  1Y71 A;  3S6W A;  4OML A;  5KYY A;  1M27 C;  5GMK e;  2DK3 A;  2PZ1 A;  2LVM A;  2E65 A;  1I0C A;  5LJ3 g;  2KI7 A;  3OY9 A;  3CCM Q;  3I55 Q;  4FCY A;  2DVJ A;  4JJD A;  4E6R A;  3G7Z A;  3M55 A;  2J6K A;  1YJW A;  1W70 A;  2QQR A;  1SPK A;  3VS0 A;  1GRI A;  2E3H A;  4FU6 A;  3OYJ A;  1D1C A;  3CME Q;  3PFS A;  4LDX A;  2XG8 D;  2F69 A;  4F7U A;  1OX8 A;  2M1H A;  1FMW A;  3M5A A;  2FRW A;  2D8H A;  3JCM e;  2H3J A;  2Y4Y A;  3RNJ A;  1IB8 A;  2K3X A;  3I5R A;  2DIQ A;  3BY7 A;  3LX7 A;  1K4U S;  3RKW A;  1O75 A;  3EH1 A;  3CC7 A;  3CD6 A;  3OYB A;  3I56 T;  2E70 A;  1VQ6 T;  1UE9 A;  2P4T A;  2DL4 A;  4FYV B;  2YT6 A;  4AMC A;  4OP0 A;  3UA7 A;  1VQP A;  1RLP C;  3QUI A;  1OQK A;  3JCM g;  3JB9 F;  1YHQ Q;  4PL6 A;  1AVZ C;  2Y4X A;  2EIF A;  3G4S A;  3OQ5 A;  2KBT A;  4A54 A;  1ZSZ B;  2XDB A;  4QVD A;  2DBM A;  3M54 A;  1QWF A;  1R0C B;  3V7C A;  4JZ3 A;  2BE7 D;  2MAM A;  2DXB A;  2LTO A;  2KVQ G;  3OS5 A;  1JXO A;  2GGR A;  1IGQ A;  3EHQ A;  1SRM A;  1H8K A;  2E64 A;  1ACM B;  2K6D A;  4JJB A;  1UGV A;  4X1V A;  2KK4 A;  3UF4 A;  3NTK A;  5CR2 A;  1VQ8 A;  4M78 A;  3EG2 A;  4DBR A;  3EG0 A;  2QTX A;  3JCM P;  2RB6 A;  2PU9 B;  5FU6 C;  3FRN A;  4F7U E;  4ZN3 A;  2V1R A;  3CMA Q;  4E47 A;  1WZO A;  4CC2 A;  5IXF A;  1WHK A;  1TG0 A;  3BDU A;  2DET A;  2KAF A;  2D8J A;  2MOX A;  1QLY A;  3O5Z A;  4XQ3 A;  2K4Y A;  4PJO A;  2RA2 A;  2YXY A;  1H3Z A;  1O9S A;  1OX9 A;  4DOW A;  4X9C A;  4LDW A;  4QVC A;  1YJW T;  2QXF A;  5IAY A;  1GFC A;  2DXU A;  2FYK A;  4OMP A;  1WFW A;  2QAS A;  2YLC A;  4M78 C;  5KCH A;  4DA4 A;  1QKW A;  2HKN A;  3J80 E;  4C92 F;  3SDZ A;  3S3O A;  1LNX A;  1ZSG A;  1UDL A;  3D7S B;  5HY6 A;  1BB9 A;  1UEB A;  1YI2 A;  3EGD B;  5LJ3 h;  5HK0 A;  1AT1 B;  1TS9 A;  1GBQ A;  2DPP B;  4M7A F;  3OYE A;  4HCC A;  3CC7 T;  3CD6 T;  2JTF A;  1WXT A;  4NL3 A;  5CK9 A;  2JTE A;  2KDS A;  5FRM A;  4EIK A;  4F14 A;  3MEU A;  4M78 E;  4XTW A;  1NEG A;  4J8O A;  4PJO C;  3VS4 A;  1U06 A;  1VQP T;  1VQN A;  2YRV A;  4KGZ B;  2CT3 A;  4IUV A;  1PKT A;  3S3M A;  3G4S T;  3I55 A;  4CC4 B;  5GAN j;  1Q7Y C;  1IGU A;  1YJN Q;  1QW1 A;  3OYK A;  1PKS A;  1IO6 A;  5FLX E;  5AT1 B;  3RIR A;  4M7A B;  4MZT A;  1Q81 R;  4PJO E;  3CCE A;  1UJ0 A;  3PE0 A;  1IHV A;  4XTX A;  2VYT A;  4XU1 A;  1X6B A;  3VS1 A;  4MZM A;  3JCM h;  1VQ8 T;  2BUD A;  2DD5 A;  2DJQ A;  4HA8 A;  1ZSZ A;  5CKE A;  3QKJ A;  2RQR A;  3OYM A;  2LNV A;  3ZBD A;  4FSS A;  4RCB A;  4JZ4 A;  3M0T A;  3C95 A;  1Q7Y R;  2JVV A;  4OGE A;  3QXE B;  4DQ2 A;  2MF2 A;  3KXT A;  1DJ7 B;  1WHM A;  4IIO A;  2E12 A;  4RKU E;  3OSV A;  4IUQ A;  1VYV A;  4YTL A;  2E5K A;  2YUO A;  1KD1 R;  2AK5 A;  3ASK A;  1YJ9 A;  2ZGW A;  1G83 A;  3VJP A;  4OMO A;  4AT1 B;  1H3H A;  5DLO A;  4BUG A;  1K9M R;  2DZ9 A;  3A5Z B;  1BU1 A;  3V7S A;  3I56 Q;  1I81 A;  1KC8 C;  1N8R U;  1VQ6 Q;  2AIR B;  1ZSZ C;  1RAB B;  2LJ3 A;  1WA7 A;  1YI2 T;  3JCM X;  2RMO A;  2EYZ A;  1FXX A;  2MWP A;  4F17 A;  5GAN d;  4E7L A;  2EYX A;  1OI1 A;  2FHD A;  3HHT B;  3HPW A;  4C5E A;  4ME7 A;  2MPX C;  4II1 A;  4FW2 A;  2MYS A;  3PMT A;  3JB9 H;  2YUP A;  2MCN A;  2EJG A;  3QJY A;  3RKX A;  5LL6 S;  2ED1 A;  3BW1 A;  3C4S A;  4BE1 A;  5CKD A;  2CZ0 B;  1LJO A;  2FZC B;  5IT9 E;  1BI0 A;  1K9A A;  3MKD A;  2LT1 A;  2R5M A;  3A8H B;  1VQN T;  2RQU A;  5LJ3 f;  4N4I A;  3EGD A;  4RTV A;  2EJF A;  1QQJ A;  4JJC A;  2RF0 A;  1KC8 R;  1QMC A;  4NL2 A;  2QDY B;  3I55 T;  4A4K A;  1Q82 C;  5KYU B;  4KBM B;  1TU0 B;  4OMN A;  2G6F X;  3OMC A;  2HD0 A;  1X2K A;  2OAU A;  4HVU A;  4F04 B;  1TTH B;  1UGR B;  1T0J A;  2RM4 A;  3LH0 A;  2DXC A;  2JXB A;  2RI5 A;  5GAO r;  1M90 U;  3CCE T;  1VQK A;  3M0P A;  3C12 A;  3M57 A;  3E1S A;  4M77 G;  1NE8 A;  1N5Z A;  1ZUU A;  1AD5 A;  1VYU A;  1VQ4 A;  4J7F A;  4D6W A;  4K11 A;  5KE3 A;  1KQS P;  1GCQ A;  2A36 A;  1XJW B;  2RJF A;  2H8H A;  1Q86 U;  2QDL A;  3UDC A;  4M7A A;  4E7S A;  1I4K 1;  3OBW A;  1YJW Q;  1XOV A;  3CPF A;  3JCM f;  4C5I A;  2LCS A;  1XTD A;  4RG8 A;  1NG2 A;  2R57 A;  4C8Q D;  2KNB B;  2M9U A;  4J5Y A;  5GJV B;  1NPP A;  4C5G A;  1CKA A;  1YJ9 T;  1M2V B;  3ZFJ A;  3L2Z A;  2DZC A;  4N4H A;  3OW2 P;  1NEB A;  2HQX A;  2RD1 A;  2SRC A;  2QQS A;  4M7D D;  1JQQ A;  2X4J A;  4GLK A;  3CC7 Q;  3CD6 Q;  4LDU A;  4FT4 A;  2L3P A;  5J26 A;  2YUN A;  2OTL Q;  1SRL A;  4J9F A;  1GBR A;  1YNZ A;  2DAQ A;  1GCQ C;  2F5K A;  2JMA A;  5GAO l;  1VQP Q;  1WX6 A;  2DIG A;  5FWC A;  4B9X A;  1X01 A;  2QG9 B;  3V7R A;  3EH2 A;  4F7U G;  4M7A C;  5EC7 A;  3G4S Q;  2CSI A;  1WLP B;  4BI8 B;  1QVG S;  2VKN A;  4JS4 A;  3AT1 B;  2A28 A;  4GBQ A;  4RG2 A;  2XDD A;  3VUZ A;  2VAS A;  2L3R A;  4FYY B;  1SKU B;  2M02 A;  4E7Z A;  2FL7 A;  5GAM e;  3EHR A;  3V8K A;  4DEY A;  2P0Q A;  3M58 A;  1V29 B;  1PRL C;  2LRQ A;  5J39 A;  4DEX A;  2FPF A;  2DTH A;  3EFO B;  4M7A E;  4GLM A;  4FL6 A;  1VQ8 Q;  1OEB A;  2ZPB B;  5GAN 8;  1W2B S;  2CSQ A;  4J83 A;  1RAE B;  2BTT A;  2DJZ A;  5CQX A;  1FX7 A;  2DE0 X;  2VV5 A;  1W4S A;  1X43 A;  1NJI C;  3KFV A;  2V8I A;  3QO3 A;  2XU8 A;  2RK2 A;  1VQK T;  4KUD K;  4M77 D;  3OS0 A;  4OB2 B;  1OOT A;  2RO0 A;  1U8R A;  3PGG A;  1PD0 A;  4C5H A;  4C0Z A;  3MO8 A;  1LCK A;  2A7Y A;  1VQ4 T;  1K0X A;  3HFO A;  2DVE A;  5KYU A;  2ENM A;  1Z9Q A;  1AOJ A;  4QVZ A;  4J6W A;  3JSC A;  2CP3 A;  4HVW A;  1ZUY A;  3NTH A;  2OI3 A;  2DX1 A;  1TH7 A;  4XK8 E;  1RI9 A;  2GTJ A;  1G2B A;  1YCS B;  2FB7 A;  5KE2 A;  2HSE B;  1NJI R;  3HSB A;  1D1A A;  7AT1 B;  2F5T X;  4PKC C;  3GLX A;  1YI2 Q;  3QZ9 B;  1A0N B;  1QKX A;  3CPW P;  1RI0 A;  2JZ2 A;  1FWZ A;  3QPH A;  2WSC E;  1WJS A;  3FDR A;  4PJO G;  2VUB A;  3G71 A;  3HTR A;  4ESR A;  1ZUK A;  2X3X D;  2A37 A;  1KQ2 A;  4J9G A;  2EVR A;  2K5I A;  3QZ5 B;  4JLG A;  4LDV A;  2COZ A;  2ESW A;  4BB7 A;  4ZGE B;  2DO3 A;  2CP0 A;  2LZ6 B;  5GAN 4;  3J7A F;  4J9C A;  2K2M A;  1VQN Q;  2Y90 A;  1M2V A;  2PUO B;  2RHY A;  5GMK i;  2O2O A;  3Q1J A;  2KT8 A;  1ZLM A;  1JB0 E;  3I5S A;  8ATC B;  1E7O A;  3JCM c;  1M9S A;  5IXB A;  1QP2 A;  2DL8 A;  4BD3 A;  4ZN1 A;  5C0M A;  2CP6 A;  4MMK A;  2KYM A;  2F2V A;  2V8J A;  3CCE Q;  4M75 D;  1M30 A;  2EKO A;  1K8A C;  4J9E A;  3X25 B;  2C0I A;  9ATC B;  2C06 A;  2E3I A;  3NGP A;  2BZ8 A;  3DB4 A;  1WGS A;  1RAC B;  2JW4 A;  3GPL A;  4EDU A;  1RAD B;  2NWM A;  5FWB A;  2QEX A;  4NOY A;  1WHJ A;  1FYN A;  2SEM A;  4PFP A;  3L1A A;  2FEI A;  3JRZ A;  3M56 A;  3BE3 A;  4RCC A;  5GAO p;  1V76 A;  2M0O A;  1KQ1 A;  2E5Q A;  1G3W A;  4ELZ C;  1UHC A;  2OTL A;  2EYW A;  2JT4 A;  2RHU A;  5GAO m;  4XTY A;  1AZE A;  4QQ6 A;  2GFU A;  3AHU A;  2CYZ B;  3EFO A;  1X27 A;  4JUV A;  2ROL A;  2M51 A;  4FYW B;  2ECZ A;  3UPU A;  3CCR A;  2CRE A;  1K8A R;  1Q95 G;  2VXF A;  1YJ9 Q;  2JS0 A;  4D8D A;  1QVF A;  2LQ8 A;  2DER A;  3OW2 A;  3X28 B;  1HXD A;  2CUB A;  4PNO A;  3VU3 C;  3H9N A;  1IHW A;  5GAM h;  3SEM A;  4A63 B;  2C0T A;  2J6O A;  1ABQ A;  2CDT A;  5LJ5 e;  4DBQ A;  2MMP A;  3E9F A;  2CZ7 B;  1NLO C;  2P4R A;  2AKK A;  2EYQ A;  2MWO A;  1KK7 A;  1IXD A;  4PLL A;  3MEA A;  3OYC A;  3TCJ A;  2A08 A;  1YN8 A;  4PLI A;  1MMG A;  3EG9 B;  2O01 E;  4ELY C;  2QTV A;  4XTV A;  3G71 T;  3JB9 G;  2X4Y A;  2RJC A;  4F16 A;  2CH4 W;  2QGF B;  5KCO A;  5LJ5 g;  2RPN A;  2L8D A;  1M4Z A;  4IUU A;  1OPK A;  1ZX6 A;  4X34 A;  3GP8 A;  2DEQ A;  3J81 E;  3G6E A;  4RTW A;  4E7H A;  2BZX A;  4HKE A;  3UT1 A;  3VRZ A;  1QP3 A;  3WXM B;  2HNI A;  2E6Z A;  3EGU A;  1VA7 A;  3G1J A;  3FJP A;  4LN2 A;  2HCK A;  1WHH A;  1FMK A;  1Q7Y U;  2KRO A;  2DRK A;  5FRO A;  3CC2 Q;  2D0Q B;  2XD0 A;  3JCM Q;  4C0G A;  2O9V A;  3OB9 A;  2DD4 A;  2CP5 A;  1PSF A;  2DYB A;  5DY9 A;  5M9O A;  1EIF A;  2DLP A;  3VYG A;  5KYN A;  2RJD A;  1VQK Q;  3O8V A;  2E4H A;  3SB2 A;  3MJX A;  1UFF A;  3QSU A;  1OYX A;  2XKO C;  3CQT A;  1M5Q 1;  3OMG A;  1VQ4 Q;  2QEX T;  2MK5 A;  3A8O B;  1BKB A;  2IIM A;  1QWE A;  3HP9 A;  2E41 A;  1PWT A;  1AHJ B;  2L0A A;  2EAY A;  1Q81 C;  2WAC A;  4LNP A;  1PD1 A;  2OTL T;  1X6O A;  4A4G A;  3EFS A;  4CI0 C;  2ROT A;  1WQ7 A;  2ED0 A;  3CCQ A;  4X9D A;  3CPW A;  3CCR T;  4C92 B;  3EFR A;  4IIM A;  4KUI A;  4EMG A;  1B7T A;  1FMV A;  3JB9 J;  4PFZ A;  2J7I A;  1W1F A;  4RTU A;  2EJ9 A;  2LQW A;  1KSW A;  2XIC A;  1R0B G;  1IRX A;  1KC8 U;  1VQ9 A;  5CCA A;  2YRD A;  4EPC A;  5I22 A;  1KD1 C;  3ZL7 C;  3CXC P;  2K3B A;  3V8J A;  1MV0 B;  1K73 C;  4GY5 A;  1TUD A;  3FJ5 A;  2A3L A;  3C94 A;  1B07 A;  3PNW C;  1K9M C;  2B86 A;  2PVD B;  5C6S A;  5GAM f;  5GAN 6;  2DFU A;  1ZA1 B;  3LW5 E;  5FRN A;  3M53 A;  3JCM V;  3M0Q A;  2MIO A;  2KRM A;  1PSE A;  3G6E T;  4C8Q F;  4XTU A;  2HBP A;  1N9S A;  2LT4 A;  4PJL A;  3CCV A;  5HKC A;  4FM4 B;  2I0N A;  1I8F A;  2AHJ B;  2K9G A;  4RMO A;  3CCS A;  3EG9 A;  1Q82 U;  2JJ9 A;  1Y57 A;  3QYH B;  4M7D F;  3VYH B;  1YIT A;  1G5V A;  2OX7 A;  1W6X A;  1QVG P;  2EPD A;  2X3W D;  4LD9 K;  4HCK A;  1K73 R;  2KRN A;  4OF1 A;  3R6N A;  3CCU A;  4FYX B;  4PJN A;  1WJR A;  4LUE A;  3RR6 A;  3OYH A;  2M16 A;  1HSQ A;  5LJ5 h;  1BIB A;  2F2W A;  3RES A;  3HRT A;  1SSH A;  3M9Q A;  4PJM A;  3M4Y A;  4QT7 A;  4DBH A;  4C8Q B;  1M1F A;  2K3Y A;  1W2B P;  2EQU A;  1M1G A;  4J9D A;  1JO8 A;  4JRI A;  3OYD A;  1X2Q A;  2LP5 A;  1V1C A;  5D6X A;  1D3B B;  2HZY A;  4M7D B;  4WTO B;  4PJJ A;  2DIL A;  2K5F A;  5GAN 2;  3R6O A;  2FZK B;  3NHN A;  3CCQ T;  2HKQ B;  1TWB A;  2YLB A;  1ZQ1 A;  1WQW A;  4TVR A;  1SF9 A;  5A0D A;  4AFZ C;  2FRY A;  5CKB A;  2NUP B;  5GJW B;  5IHN A;  2L3S A;  3RER A;  2RI2 A;  3CC2 A;  2O4X B;  4M4Z A;  5LJ3 j;  4M77 F;  3PVL A;  4C0F A;  3QJ6 A;  3G71 Q;  4OMM A;  2E10 A;  3VKI A;  1BK2 A;  1GL5 A;  3BDL A;  3ME9 A;  1VQ9 T;  1JJ2 P;  4AFU C;  5CIU A;  3LLR A;  2LNH B;  4FT2 A;  2XK0 A;  4LD6 A;  2IPO B;  5GMK j;  2K57 A;  2XMF A;  3OSS C;  1K76 A;  2FO0 A;  1YWO A;  4C92 A;  1H92 A;  3JV3 A;  4IUP A;  2KGT A;  1MMD A;  2RNA A;  2O88 A;  2WSE E;  5IHK A;  5L8R E;  1S72 A;  3CBP A;  1JU5 C;  4CC7 A;  4A53 A;  1Z9Z A;  3QHS A;  3EG1 A;  5CVI A;  1M8V A;  3RDV A;  1XQH A;  1ZHI A;  4M77 B;  2O31 A;  1PG5 B;  3NPF A;  4HCB A;  3CCV T;  3JB9 I;  2W10 A;  4BY6 B;  6AT1 B;  4DOV A;  2EGC A;  3CCS T;  2R5A A;  2DMO A;  4B9W A;  1YIT T;  3CCL A;  2QEX Q;  1YBY A;  3MEW A;  3CCU T;  1CSK A;  1NJI U;  3MEV A;  2BIV A;  4BDZ A;  4KT0 E;  1YWP A;  1GFD A;  2MI6 A;  1QCO A;  2CZ6 B;  4RTZ A;  2K2V A;  5D6W A;  4C92 C;  4F7U F;  3NFC A;  2YRC A;  4LE9 A;  2FPE A;  3OA6 A;  2YSQ A;  3L2V A;  2EBP A;  4FW1 A;  2EQI A;  4LDY A;  1I07 A;  3CC4 A;  4D8K A;  5LJ3 d;  4XU3 A;  2HAX A;  1X75 C;  5GAN 7;  2XHC A;  2RH2 A;  3CCR Q;  1OZ2 A;  3REB B;  2EGE A;  2ZCF B;  2X51 A;  4J7I A;  2ZPH B;  3OYI A;  3DLM A;  5LJ5 f;  1IRE B;  2CGH A;  4M75 F;  4ORZ A;  1NM7 A;  2EQJ A;  4HCZ A;  4C92 E;  3TU4 K;  4C8Q A;  1QCF A;  3CXC A;  4Q5W A;  5HK3 A;  3JAM E;  4J6X A;  1MHN A;  2IVW A;  4EMH A;  8AT1 B;  2EWN A;  1SSF A;  2LJ1 A;  3CC2 T;  2K5L A;  1SG5 A;  4JPB W;  2JUF A;  1D3B A;  4M7D A;  3JCM b;  3H41 A;  3RUX A;  2QQ9 A;  1X6G A;  3P8H A;  5GAM g;  2KXD A;  1PNJ A;  3MP1 A;  4LUD A;  3QDR B;  4ZGJ B;  2VGN A;  3OYA A;  2DKG A;  3G6E Q;  1UUE A;  4M75 B;  3VS5 A;  3QII A;  4OMF B;  2RJE A;  1Y0M A;  2JM9 A;  3JCM d;  2DYI A;  3QG1 A;  3M0U A;  2NUP A;  4BE2 A;  2O4X A;  2PVO B;  1UGS B;  4M78 G;  2VB6 A;  5CQY A;  4OB3 B;  1S72 T;  5CAI A;  4OGC A;  2CP2 A;  1I1J A;  2BZY A;  3DB3 A;  1AZG B;  5KYX B;  3A1P A;  2ATC B;  4C8Q C;  5A0G A;  3GNG A;  2VGM A;  3CCJ A;  1Q86 R;  3H0H A;  2EW3 A;  2NUT B;  1C6V X;  3TQ7 P;  4N0A A;  4PJO F;  3PIO A;  1M1K C;  1K8A U;  4BE0 A;  1D0Y A;  2BKD N;  2COY A;  1OU9 A;  2DA9 A;  2EGA A;  4M7D C;  3REA B;  1U1T A;  3CCL T;  1RAH B;  2KRS A;  3TRE A;  1W2B A;  3NTI A;  1MUZ A;  2Z0W A;  1TOV A;  2QYZ A;  2LDM A;  3QWY A;  2JMC A;  4C8Q E;  5IN1 A;  4M77 A;  1VQ7 A;  1D1B A;  4IUR A;  2V8K A;  4MML A;  2LCL A;  3A8M B;  2QA4 Q;  4P5N A;  4M7D E;  3SD4 A;  3KBG A;  3CC4 T;  2GQV A;  2GBQ A;  3CCQ Q;  1WPY A;  2DL5 A;  1VQO A;  3VV0 A;  2GQI A;  1MV3 A;  1M1K R;  5I21 A;  2H3E B;  1NBE B;  2DTI A;  2DNU A;  3MET A;  4JLI A;  3HKS A;  1MMA A;  1YIJ A;  4N0A C;  2W0Z A;  2DL3 A;  3OS2 A;  1PRM C;  1Y07 A;  1JBM A;  3OYF A;  5GAN 5;  5GAN 3;  1JJ2 A;  2RQW A;  1VQ9 Q;  1UHF A;  4DBF A;  3MCA B;  3IQL A;  4NS5 A;  4IUT A;  5IH2 A;  3P8D A;  2YWW A;  4XTZ A;  4MDX A;  3U23 A;  3V8L A;  1RUW A;  1U3O A;  3E19 A;  3QBY A;  4RTX A;  3L2Q A;  4C0D B;  2ZPI B;  1QVF S;  1UGQ B;  2DBK A;  2OAW A;  3I35 A;  3OW2 S;  1BBZ A;  4M77 C;  1AWW A;  1IZ6 A;  1R8O B;  1KQS A;  2JM8 A;  4OB1 B;  4BY6 C;  3QWX X;  1SEM A;  1AEY A;  2RK1 A;  1K1Z A;  3PTA A;  2COW A;  4CC3 A;  4Y92 A;  2D6F A;  3VS7 A;  5GAN h;  4B6M A;  3CCV Q;  1H64 1;  2XID A;  4J9B A;  1RLQ C;  4E2F B;  3TSZ A;  2R58 A;  2JOY A;  4QKU A;  4M78 D;  3CCS Q;  3GBQ A;  2JTM A;  3T9N A;  4M77 E;  2LJ0 A;  1P92 A;  1Y7X A;  1YIT Q;  2QK0 A;  2V1Q A;  3L2U A;  5KH6 A;  2OTJ Q;  1BCM A;  4JS5 A;  3CCU Q;  5AYF A;  3MHX A;  3ER0 A;  3OYG A;  4Y28 E;  3CCJ T;  2RHI A;  2P0P A;  1NYF A;  3L42 A;  3MP8 A;  1MGQ A;  4M75 A;  3GOX A;  3A98 A;  3FEO A;  5D6Y A;  3M59 A;  3OYL A;  4JRQ A;  3RBB B;  4A4F A;  1WDX A;  4KH1 B;  1PC0 A;  4PJO D;  1WJQ A;  3QDF A;  1GXI E;  4JRP A;  3N5B B;  2I2L A;  5KYX A;  4JRK A;  1VQ5 T;  4A4H A;  1Q81 U;  5I11 A;  1VQ7 T;  2NUT A;  3L2W A;  1AWO A;  3NMZ C;  4ZTJ A;  4KH0 B;  5FU7 B;  3X24 B;  2DL7 A;  2KY9 A;  3LH5 A;  4N4G A;  4KGV B;  4OVA A;  1VQO T;  1B3Q A;  1QVP A;  1YFN A;  4PFO A;  1MND A;  1YIJ T;  4M75 C;  1VQM A;  2KXC A;  4XAX B;  5A2Q E;  2FZG B;  2EQK A;  2YUQ A;  1N27 A;  2E6N A;  3VS3 A;  3H6Z A;  4Z88 A;  4IKF A;  2CKK A;  4HXJ A;  3M4G A;  1KD1 U;  2M0Y A;  4QQD A;  3GIB A;  2D9T A;  3FLG A;  4A4E A;  3CPW S;  1K73 U;  2J6F A;  1WXB A;  2C0O A;  1K9M U;  3MPU B;  2VC8 A;  3PMI A;  4Z89 A;  1TXQ A;  4Z02 A;  1RAA B;  4M75 E;  2QI2 A;  5IHI A;  1JXM A;  2KR3 A;  4OB0 B;  1M8M A;  2DTO A;  1S72 Q;  4L59 A;  1VQL A;  2RI3 A;  5I2M A;  4V2S A;  1G3S A;  2IG0 A;  2X4W A;  2HSP A;  2OJ2 A;  3M0S A;  3LGL A;  1K0S A;  2QA4 A;  4ATO A;  3EGX B;  3INZ A;  4QW2 A;  1KG1 A;  2HL5 C;  2NLU A;  5GAO q;  3URG A;  2CUD A;  4C92 G;  1WHL A;  3CCL Q;  3HFN A;  1NPR A;  1PM3 A;  1VIE A;  5GMK h;  4J9I A;  2GFA A;  1ABO A;  1RL2 A;  3EG3 A;  1WXU A;  3HRU A;  3VS6 A;  1VIF A;  2HMA A;  1HYO A;  2B8A A;  2RQV A;  3P8B B;  2BE9 B;  4M7A G;  5GAN f;  3I9Q A;  3TVT A; 
#chains in the Genus database with same CATH homology
 3WVE B;  3FIF A;  1U8R A;  1G3T A;  3PGG A;  3OS1 A;  4OP0 A;  4C5H A;  3OSS C;  4C0Z A;  1VQP A;  3MO8 A;  3QUI A;  3JCM g;  2A7Y A;  1VQ4 T;  3HFO A;  3JB9 F;  4PL6 A;  2DVE A;  3CCM A;  3OBY A;  4O6J A;  4C92 A;  3GNF B;  3LWH A;  5I2S A;  4QQG A;  4QVZ A;  2Y4X A;  4IUP A;  4J6W A;  2EIF A;  3G4S A;  3JSC A;  3OQ5 A;  3CD6 T;  4A54 A;  2WSE E;  3JB9 D;  1U1S A;  5L8R E;  2XDB A;  4QVD A;  3NTH A;  1LOJ A;  1S72 A;  3CBP A;  3M54 A;  3V7C A;  4A53 A;  1TH7 A;  3QHS A;  4XK8 E;  2MAM A;  2DXB A;  2LTO A;  4C0D C;  5CVI A;  1M8V A;  4Y91 A;  4HT8 A;  2FB7 A;  2KVQ G;  5KE2 A;  3SFM A;  4CRI A;  1XQH A;  1ZHI A;  3OS5 A;  3HSB A;  4M77 B;  2F5T X;  4HCB A;  2LCC A;  3A8L B;  3CCV T;  4PKC C;  3E9G A;  3TEE A;  3JB9 I;  1HK9 A;  5GAM j;  3CME A;  2E64 A;  4O5V A;  1N6A A;  4BY6 B;  3GLX A;  2KK4 A;  4DOV A;  3QZ9 B;  3NTK A;  5CR2 A;  5CKH A;  3X20 B;  3CCS T;  2R5A A;  1VQ8 A;  4M78 A;  4B9W A;  1RI0 A;  2JZ2 A;  1FWZ A;  3QPH A;  1YIT T;  3CCL A;  2WSC E;  1WJS A;  3FDR A;  4PJO G;  2QTX A;  3JCM P;  1YBY A;  3MEW A;  2L89 A;  3CCU T;  2P0K A;  2VUB A;  2RB6 A;  1NJI U;  3G71 A;  1BI2 A;  2PU9 B;  3MEV A;  5FU6 C;  2BIV A;  2OTJ A;  4BDZ A;  1VQM T;  4KT0 E;  1OZ3 A;  1KQ2 A;  3OYN A;  2K5I A;  3QZ5 B;  2MI6 A;  3FRN A;  4JLG A;  2ZPF B;  4F7U E;  3JCM J;  4ZN3 A;  2CZ6 B;  2K2V A;  3CBM A;  4LDV A;  5D6W A;  4C92 C;  4BB7 A;  4F7U F;  3NFC A;  4XU0 A;  4ZGE B;  2DO3 A;  4E47 A;  3OA6 A;  3L2V A;  5GAN 4;  3BDU A;  1B34 B;  3J7A F;  2KAF A;  1YHQ A;  1I5L A;  2Y90 A;  4BI3 A;  2PUO B;  2RHY A;  4LDY A;  4C8Q G;  3CC4 A;  2KMT A;  4XQ3 A;  5GMK i;  2K4Y A;  5LJ3 d;  4PJO A;  4XU3 A;  2RA2 A;  3Q1J A;  2HAX A;  1X75 C;  5GAN 7;  1H3Z A;  1O9S A;  2RH2 A;  2XHC A;  4DOW A;  1OZ2 A;  1JB0 E;  4X9C A;  3S3N A;  4L5G A;  4LDW A;  2ZCF B;  3JCM c;  1M9S A;  3WVD B;  4J7I A;  2ZPH B;  3OYI A;  1QP2 A;  3DLM A;  4QVC A;  3RMS A;  4BD3 A;  1IRE B;  4ZN1 A;  5LJ5 f;  1VQL T;  1YJW T;  4M7D G;  2CGH A;  4M75 F;  2KQW A;  2QXF A;  5C0M A;  5IAY A;  2EFI A;  2PQW A;  2DXU A;  2FYK A;  4E7I A;  2DXT A;  2EQJ A;  4HCZ A;  4MMK A;  2V8J A;  4C92 E;  3KUF A;  2YLC A;  4M78 C;  3TU4 K;  5KCH A;  4DA4 A;  3J80 E;  4C92 F;  3SDZ A;  3S3O A;  4M75 D;  1LNX A;  2GCX A;  2PVG B;  2EKO A;  5HY6 A;  1K8A C;  3DKM A;  1UEB A;  3X25 B;  2QA4 T;  1YI2 A;  4C8Q A;  2C06 A;  3CXC A;  4Q5W A;  5HK3 A;  3DB4 A;  1WGS A;  3GPL A;  4C92 D;  4J6X A;  5LJ3 h;  5HK0 A;  4EDU A;  1MHN A;  2IVW A;  2X35 A;  4EMH A;  1BI1 A;  2QEX A;  4NOY A;  5GMK l;  2EWN A;  1SSF A;  4E7K A;  1NZ9 A;  1BIA A;  5FU7 C;  1WNL A;  3L1A A;  3CC2 T;  2DPP B;  2K5L A;  4M7A F;  3JRZ A;  3OYE A;  4HCC A;  3M56 A;  3CC7 T;  3QYG B;  4RCC A;  2JUF A;  1D3B A;  2EQM A;  2JTF A;  4MZP A;  3JCM b;  5GAO p;  4E7J A;  3RER A;  4NL3 A;  4M7D A;  2M0O A;  2ZPG B;  5CK9 A;  4EMK B;  2KDS A;  3RUX A;  5FRM A;  3H8Z A;  1KQ1 A;  4MDW A;  2E5Q A;  4M7A D;  2QQ9 A;  3P8H A;  5GAM d;  1G3W A;  4ELZ C;  5GAM g;  3MEU A;  4M78 E;  3CMA A;  4XTW A;  3MP1 A;  3SWN B;  3QDR B;  2OTL A;  4J8O A;  4ZGJ B;  2VGN A;  2RHU A;  5GAO m;  4PJO C;  3OYA A;  2DKG A;  2QQB A;  4XTY A;  4QQ6 A;  4M75 B;  1VQP T;  2GFU A;  1VQN A;  2FVU A;  3HRS A;  3AHU A;  2CYZ B;  2YRV A;  3QII A;  4IUV A;  3LWI A;  4OMF B;  2RJE A;  3CCM T;  4JUV A;  3JCM d;  3S3M A;  3QG1 A;  3G4S T;  3I55 A;  3UPU A;  3CCR A;  5GAO n;  4BE2 A;  2VXF A;  2O4X A;  2PVO B;  1UGS B;  5GAN j;  1Q7Y C;  1QVF A;  4M78 G;  2LQ8 A;  1BYM A;  1QW1 A;  5CQY A;  4BDY A;  3OW2 A;  3X28 B;  4OB3 B;  1S72 T;  5CAI A;  1HXD A;  4OGC A;  3OYK A;  5FLX E;  3GF5 A;  4PNO A;  3DB3 A;  3LGF A;  3VU3 C;  1KHI A;  5GAM h;  4C8Q C;  3RIR A;  5A0G A;  3GNG A;  2VGM A;  4M7A B;  3CCJ A;  4MZT A;  4PJO E;  3CCE A;  4N0A A;  1N8R C;  5LJ5 e;  4PJO F;  3CBO A;  3CME T;  3PIO A;  1BI3 A;  1M1K C;  4XTX A;  2VYT A;  2MMP A;  3E9F A;  2CZ7 B;  4XU1 A;  4BE0 A;  1K8A U;  2EYQ A;  2MWO A;  4PLL A;  3MEA A;  2BKD N;  4MZM A;  3JCM h;  3OYC A;  1VQ8 T;  2BUD A;  2DD5 A;  4M7D C;  3TCJ A;  4J6Y A;  4HA8 A;  1U1T A;  3CCL T;  2ZZD A;  5CKE A;  2L5Q A;  2LC4 A;  4PLI A;  3QKJ A;  3TRE A;  1W2B A;  3OYM A;  3NTI A;  2O01 E;  2LNV A;  4ELY C;  4XTV A;  3G71 T;  3JB9 G;  4FIB A;  2X4Y A;  5DLQ E;  2OTJ T;  1Y96 B;  2RJC A;  2LDM A;  3ZBD A;  4ZTF A;  3LYI A;  4RCB A;  3HL8 A;  4C8Q E;  3ZEH A;  3C95 A;  5KCO A;  5IN1 A;  5LJ5 g;  2JVV A;  1M4Z A;  2L8D A;  4OGE A;  3QXE B;  4DQ2 A;  4IUU A;  4HT9 A;  4M77 A;  1VQ7 A;  2VXE A;  2MF2 A;  3KXT A;  4X34 A;  3GP8 A;  2DEQ A;  3J81 E;  4IUR A;  1DJ7 B;  3G6E A;  4E7H A;  2V8K A;  4MML A;  3RKY A;  3CXC S;  2LCL A;  3A8M B;  4HKE A;  2E12 A;  3X26 B;  1YHQ T;  4RKU E;  3UT1 A;  3OSV A;  1QP3 A;  4IUQ A;  4P5N A;  3WXM B;  2HNI A;  3SD4 A;  4M7D E;  1YCY A;  3KBG A;  2E6Z A;  4YTL A;  2GQV A;  3FC3 A;  3CC4 T;  1WPY A;  1VQO A;  3VV0 A;  3ASK A;  3FJP A;  5EG2 A;  5I21 A;  1YJ9 A;  2ZGW A;  3MP6 A;  2DTI A;  1Q7Y U;  5GAN e;  1YJN A;  3MET A;  4JLI A;  5FRO A;  1ZBX A;  3HKS A;  2D0Q B;  3VJP A;  2XI9 A;  2XD0 A;  3JCM Q;  4C0G A;  5DLO A;  4N0A C;  3VUB A;  4BUG A;  1YIJ A;  2DZ9 A;  3OB9 A;  3OS2 A;  2QQA A;  3A5Z B;  2DD4 A;  1Y07 A;  1JBM A;  1N9R A;  3V7S A;  3OYF A;  5GAN 5;  1PSF A;  5DY9 A;  5M9O A;  1EIF A;  5GAN 3;  1KHC A;  1JJ2 A;  2GF7 A;  3VYG A;  1I81 A;  1M90 C;  4ZGD B;  1KC8 C;  2ZPE B;  1N8R U;  2RJD A;  3O8V A;  1G3Y A;  3MCA B;  1B34 A;  4IUT A;  4NS5 A;  1M1K U;  3P8D A;  3SB2 A;  2X4X A;  1UGP B;  1YI2 T;  3JCM X;  3UWN A;  4XTZ A;  2E1H A;  5LJ5 j;  3QSU A;  4MDX A;  1FXX A;  2MWP A;  1OYX A;  2XKO C;  3V8L A;  5GAN g;  5GAN d;  4E7L A;  3E19 A;  1M5Q 1;  1OI1 A;  2FHD A;  3QBY A;  3L2Q A;  3OMG A;  3HHT B;  2QEX T;  4C0D B;  5CO7 A;  2ZPI B;  3HPW A;  4C5E A;  1QVF S;  1UGQ B;  4F7U B;  3DLL A;  4II1 A;  4ME7 A;  3OW2 S;  2JNG A;  3CEY A;  3A8O B;  1BKB A;  4M77 C;  1IZ6 A;  3BFM A;  1R8O B;  3PMT A;  3JB9 H;  3HP9 A;  2E41 A;  1KQS A;  1AHJ B;  2EJG A;  3QJY A;  4OB1 B;  4BY6 C;  4WF2 A;  2RK1 A;  2WSF E;  5LL6 S;  2EAY A;  3RKX A;  3PTA A;  3BW1 A;  4FSX A;  3OYY A;  2K57 A;  2WAC A;  1Q81 C;  1Q86 C;  3C4S A;  4BE1 A;  2G3R A;  5CKD A;  2LX9 A;  3CMA T;  2CZ0 B;  1LJO A;  3RMQ A;  5GAN f;  2OTL T;  2CZ1 B;  4XU2 A;  5IT9 E;  2D6F A;  1X6O A;  4A4G A;  3EFS A;  1BI0 A;  2LT1 A;  2R5M A;  3A8H B;  1VQN T;  4M75 G;  4M78 F;  4CI0 C;  4VUB A;  2RHX A;  5FU6 B;  4N4I A;  5LJ3 f;  5GAN h;  1WQ7 A;  2EJF A;  1H64 1;  2XID A;  3EAE A;  3CCQ A;  5DM7 R;  2R58 A;  4X9D A;  4NL2 A;  2JOY A;  2QDY B;  3I55 T;  4A4K A;  3CPW A;  3CCR T;  5A0L A;  4L6V 5;  4M78 D;  1Q82 C;  4JDS A;  4KBM B;  2JTM A;  3T9N A;  4M77 E;  4C92 B;  4JJN K;  1P92 A;  1Y7X A;  3EFR A;  3OMC A;  2HD0 A;  3L2U A;  2OAU A;  4KUI A;  4EMG A;  4EMK A;  5KH6 A;  2CS7 A;  4JS5 A;  1QVG A;  2YHT A;  1UGR B;  3JB9 J;  3LH0 A;  2RM4 A;  3MHX A;  5AYF A;  2DXC A;  3ER0 A;  3I56 A;  2EJ9 A;  5J3B A;  3OYG A;  4Y28 E;  3JCM W;  2RI5 A;  3SWN A;  2XIC A;  2RHI A;  3CCJ T;  2P0P A;  5GAO r;  1KC8 U;  1M90 U;  3L42 A;  1VQ9 A;  1VQ6 A;  1UB4 A;  3CCE T;  1VQK A;  5CCA A;  3MP8 A;  2RHZ A;  4EPC A;  1MGQ A;  3C12 A;  4M75 A;  3M57 A;  3GOX A;  2KSS A;  3E1S A;  4M77 G;  3FEO A;  1KD1 C;  1NE8 A;  3M59 A;  5D6Y A;  3OYL A;  4JRQ A;  3PT9 A;  4A4F A;  3V8J A;  1VQ4 A;  4J7F A;  5GMK m;  1K73 C;  4GY5 A;  4D6W A;  2A3L A;  5KE3 A;  3C94 A;  1XNI A;  4PJO D;  4M78 B;  3PNW C;  1K9M C;  1WJQ A;  2PVD B;  4R55 A;  1GXI E;  4R56 A;  4JRP A;  3N5B B;  2I2L A;  3L2R A;  5C6S A;  2RJF A;  2LQK A;  5GAM f;  5GAN 6;  4JRK A;  1Q86 U;  4BAC A;  1VQ5 T;  4A4H A;  1Q81 U;  3UDC A;  1JJ2 S;  4M7A A;  3LW5 E;  1VQ7 T;  1I4K 1;  5FRN A;  3OBW A;  3M53 A;  3JCM V;  3L2W A;  1VQ5 A;  1XOV A;  5LJ5 d;  3CPF A;  1PSE A;  3G6E T;  4ZTJ A;  4C8Q F;  5FU7 B;  3X24 B;  1VUB A;  4KUL A;  2KY9 A;  4XTU A;  3JCM f;  2HBP A;  4C5I A;  1N9S A;  2LT4 A;  4UC4 A;  3CCV A;  1XTD A;  4RG8 A;  5HKC A;  4FM4 B;  4N4G A;  2R57 A;  2PUK B;  1I8F A;  4EMK C;  2XDP A;  5CKF A;  4BI4 A;  4C8Q D;  4OVA A;  1VQO T;  3F70 A;  2AHJ B;  2M9U A;  4J5Y A;  1QVP A;  3A8G B;  4RMO A;  1NPP A;  4C5G A;  3CCS A;  1YJ9 T;  1Q82 U;  3ZFJ A;  3QYH B;  1YJN T;  3VYH B;  4M7D F;  1YIT A;  1G5V A;  1JRI A;  3FB9 A;  3SWN C;  1KQS S;  1Y96 A;  3L2Z A;  2DZC A;  2HQE A;  2JN0 A;  4N4H A;  5LJ3 e;  3PIP A;  4PJO B;  4LD9 K;  1YIJ T;  2HQX A;  2RD1 A;  1Y71 A;  4M75 C;  4OF1 A;  3S6W A;  2QQS A;  3CCU A;  4M7D D;  2X4J A;  1WJR A;  4GLK A;  4LDU A;  1VQM A;  3OYH A;  4FT4 A;  4XAX B;  2M16 A;  5LJ5 h;  5A2Q E;  5J26 A;  2EQK A;  1BIB A;  5GMK e;  1N27 A;  2E6N A;  3H6Z A;  4IKF A;  2CKK A;  2DAQ A;  3M4G A;  1KD1 U;  2F5K A;  4QQD A;  2DK3 A;  3HRT A;  3RES A;  5GAO l;  2LVM A;  2E65 A;  3GIB A;  2D9T A;  3M9Q A;  3FLG A;  3M4Y A;  4A4E A;  3CPW S;  5LJ3 g;  1K73 U;  2DIG A;  4B9X A;  3OY9 A;  4C8Q B;  1X01 A;  3V7R A;  1M1F A;  4F7U G;  2K3Y A;  3PMI A;  2VC8 A;  2EQU A;  1M1G A;  1K9M U;  4M7A C;  4JRI A;  4Z02 A;  3OYD A;  4BI8 B;  1QVG S;  4M75 E;  2QI2 A;  4JS4 A;  3G7Z A;  3M55 A;  4OB0 B;  2DTO A;  4RG2 A;  4L59 A;  5D6X A;  2XDD A;  1D3B B;  1VQL A;  1YJW A;  4M7D B;  3VUZ A;  2QQR A;  2RI3 A;  2L3R A;  5I2M A;  2K5F A;  2FL7 A;  5GAM e;  4V2S A;  5GAN 2;  1G3S A;  3V8K A;  4FU6 A;  2IG0 A;  2P0Q A;  2X4W A;  1V29 B;  3M58 A;  3R6O A;  3OYJ A;  2LRQ A;  5J39 A;  3PFS A;  3LGL A;  3CCQ T;  4LDX A;  2QA4 A;  4ATO A;  3INZ A;  2YLB A;  2XG8 D;  2DTH A;  2F69 A;  4QW2 A;  4F7U A;  1KG1 A;  2M1H A;  2NLU A;  5GAO q;  4FL6 A;  4M7A E;  1ZQ1 A;  3M5A A;  2ZPB B;  1WQW A;  3URG A;  5GAN 8;  4TVR A;  4C92 G;  3JCM e;  4J83 A;  1W2B S;  2H3J A;  5A0D A;  2Y4Y A;  3HFN A;  5CKB A;  2DJZ A;  2K3X A;  5CQX A;  1NPR A;  1FX7 A;  2DIQ A;  2VV5 A;  2RI2 A;  3BY7 A;  2O4X B;  3LX7 A;  1VIE A;  1W4S A;  5GMK h;  3RKW A;  5LJ3 j;  3CC2 A;  1O75 A;  4M77 F;  1NJI C;  4C0F A;  3QJ6 A;  3CC7 A;  3OYB A;  2V8I A;  3CD6 A;  2GFA A;  2E10 A;  3QO3 A;  3VKI A;  1RL2 A;  2XU8 A;  3HRU A;  3I56 T;  2E70 A;  3BDL A;  3ME9 A;  2RK2 A;  1VQ9 T;  1VQ6 T;  2P4T A;  1VIF A;  1VQK T;  4KUD K;  2B8A A;  5CIU A;  4M77 D;  3OS0 A;  4OB2 B;  3P8B B;  4M7A G;  3LLR A;  4FT2 A;  2XK0 A;  4LD6 A;  5GMK j;  3JAM E;  2RO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...