4M77F

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
b'ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77F00
3BDUA 3V7CA 4EMHA 5GAOr 4PJOE 1X01A 5GAN7 4J6WA 3JB9D 5DY9A 4NL3A 4C8QF 2EJ9A 3HSBA 4XTZA 4M77A 5LJ5f 5GANd 5GMKm 1YCYA 2ZGWA 4M7AC 1M5Q1 4HA8A 5GANg 3EFRA 2I2LA 3M4GA 4JRIA 3VU3C 3JCMQ 3L1AA 3JCMJ 3BFMA 3QSUA 2YLCA 4HT8A 4RCCA 5GMKh 4M78G 3SWNC 4M75C 5GAMh 4M7DG 3JCMV 3FB9A 2QTXA 3RESA 1JBMA 4MMLA 2DZ9A 5LJ5e 3JCMg 4PJOF 4V2SA 5GAOp 4PJOB 5LJ3h 4PJOD 3QHSA 3QO3A 2E41A 3BY7A 3JCMc 5GAN8 4XU0A 2EJGA 4OP0A 4EMGA 5GAOq 3V8LA 4M77F 1Y96B 4XTUA 4EMKC 5LJ3e 1U1TA 1I5LA 1BIBA 4M77D 5CAIA 4PJOA 3JB9F 3PGGA 4J6YA 3JCMP 2E10A 1LNXA 4M78C 1Y96A 2RD1A 2Y90A 4C92E 5GAMf 3JB9J 4M7DC 4F7UB 4C8QG 3JCMb 2DZCA 3JCMW 4XQ3A 3JCMh 4X9CA 2FYKA 4N0AC 3RKYA 4XTXA 5LJ3f 3EFSA 4Y91A 4F7UE 3JCMe 4HT9A 4XU2A 4MMKA 4DQ2A 3HFNA 3INZA 1B34B 3L2ZA 4JUVA 4M75B 3SWNB 3FIFA 2HNIA 5I21A 5GMKi 2E1HA 2VXFA 5GAMe 5GMKe 3V8KA 4JRKA 1HXDA 1HK9A 1MGQA 2K57A 2EAYA 2VXEA 4XTYA 2YLBA 4XU3A 1B34A 4M75E 4M75A 4PJOG 3SWNA 5LJ5j 5GAMj 3JB9H 3FJPA 4C8QC 4C92F 2EJFA 4C92B 4C92D 5GAOl 5GANh 1I4K1 2DTOA 1TH7A 4M77G 3JCMf 1M8VA 4NOYA 5LJ3j 4NL2A 5GANe 3JB9G 1WQWA 4C92A 5GAN3 4WF2A 4M78B 4C8QE 4F7UF 1D3BB 2DJZA 1WPYA 2DTHA 3RIRA 1I8FA 4M7AF 4M7AB 4M7AD 5GMKl 2E65A 4XU1A 3GIBA 1H641 4JLIA 4M78E 3AHUA 4X9DA 4PJOC 4F7UA 5LJ5d 5GAMd 2VC8A 4M7DE 3JCMX 4M75F 4M7AA 2YHTA 4M75D 4M77C 4A53A 5LJ5g 5GANf 2E64A 4N0AA 3RERA 5LJ3d 5GAOn 2EWNA 2DTIA 1WQ7A 2FB7A 3V8JA 3V7RA 3HFOA 1LOJA 5GMKj 3RKXA 5LJ3g 4XTWA 2RA2A 1KQ1A 1WNLA 4M77E 4C8QB 4C8QD 4EMKB 4C92G 4J6XA 4A54A 1N9SA 2CGHA 2DXUA 5GAN5 1BIAA 1I81A 4M78F 3JB9I 2DXTA 4C8QA 4M78D 3RKWA 2DEQA 4EMKA 4M7DF 4J5YA 4XTVA 1JRIA 4RCBA 4QVCA 4M7DD 5LJ5h 4M7DB 5GANj 4F7UG 3JCMd 3SB2A 2JN0A 2DVEA 4M7AG 4QVDA 4M78A 1D3BA 3BW1A 1U1SA 5GAN6 2DKGA 1KQ2A 4M7DA 3V7SA 4M7AE 5GAN2 4PNOA 5GAOm 1LJOA 3RUXA 4C92C 5GAMg 5GAN4 2RB6A 1N9RA 4M75G 2RM4A 4M77B 3QUIA
chains in the Genus database with same CATH superfamily
1I0CA 4GY5A 2E6NA 5D6YA 3VYHB 5GMKm 1QVGA 3GBQA 3L2UA 4JRIA 2QK0A 1QQJA 2RMOA 5CR2A 3CC2A 5J39A 3T9NA 4PJOB 1M8VA 2DBMA 2RI2A 4NS5A 2A08A 1Y96B 2EQIA 4M77F 5FRNA 5KYUB 4XAXB 2QASA 2FPFA 1HSQA 2E10A 1JB0E 2A28A 4JJCA 1VQNT 4J9CA 2L5QA 1Q81U 3LGLA 4JZ4A 2C06A 2JTEA 1QVGS 4XTXA 1VQKA 1EFNA 2LDMA 3REBB 4E7ZA 2CP5A 4MZTA 1B3QA 1I07A 1HXDA 1BYMA 1ZSZB 1AWXA 1KQ2A 3QBYA 1B34A 2EYZA 4M75E 2J6FA 2M1HA 3GNFB 4BI8B 5LJ3j 1QVPA 5KH6A 2QYZA 8ATCB 1V76A 1IREB 2IPOB 2FRWA 2GQVA 5GMKl 4KT0E 1Q81R 4ZN1A 3GIBA 3LW5E 2DD5A 4M7DE 4M7AA 2XHCA 1RLPC 1Y07A 3URGA 4BE2A 2EGCA 3OBYA 1VQLQ 2CH4A 1SSFA 1VOMA 1WXBA 1VYTA 1R8OB 2ROTA 3X20B 5GAN5 4R56A 3RKWA 5IXBA 1YJWA 5FU6C 2DX1A 1SKUB 1IRXA 2R58A 5GAN6 2HMAA 3FJ5A 4ZN3A 1VQNA 4RMOA 1FMWA 3EGDB 4ZTJA 1LJOA 1G8XA 1JO8A 1ARKA 2OTLQ 2FRYA 4PJOE 1YHQQ 2PUOB 2RJFA 4J9GA 1PNJA 5LJ5f 2XG8D 1W2BP 3QDRB 1UGPB 3A5ZB 4FYWB 1YIJQ 1BCOA 4HT8A 4PJJA 2XU8A 1NPRA 2E6ZA 2PUKB 3QZ9B 2DJQA 2GF7A 3MP6A 3JB9F 4IURA 2ABLA 2NLUA 2EFIA 3LGFA 4IUPA 1S72Q 1KK7A 3PMIA 3A98A 4JS4A 2AKKA 2O2OA 2V1QA 2QG9B 4LDXA 4JUVA 1TUDA 1MNEA 3CBOA 4PLIA 5A0DA 2SEMA 4XU3A 4M75A 5GAMj 3FJPA 3GOXA 3ULRB 2LNHB 1PG5B 5IT9E 1TXQA 1NBEB 1KQSP 3M53A 3META 2E3IA 4F7UF 3FRNA 3SDZA 1VQ7A 1N5ZA 3KXTA 1SF9A 2KI7A 1VQMQ 1D1BA 2KNBB 4F17A 2DF6A 2HBWA 4M75D 2LT1A 2P84A 2RQWA 2HKNA 2HZYA 3TSWA 1VA7A 2HSEB 3CXCA 3CCRT 2QQBA 3CC4Q 4M78F 1E6HA 3CCST 2F5TX 1JRIA 1VQPA 4M7DD 1VQOA 4FYYB 1D1CA 4M7AG 3DLLA 1X6GA 4OB0B 3ASKA 2DMOA 5FWBA 2A3LA 3OBWA 2DA9A 5AT1B 1KHCA 1X27A 3CCVQ 3OW2P 2I2LA 3CXCS 1KD1C 3CMEQ 4BE0A 1ZSZC 1FMKA 4PJOD 5FW9A 4XU0A 1LPLA 1SHFA 1I5LA 3QDFA 1YITQ 2NWMA 2RO0A 2Y90A 2K2VA 3PFSA 4A4GA 1Y57A 4CC3A 4XQ3A 1TU0B 3MEWA 2MMPA 4HVUA 3INZA 4HCZA 4OB3B 1AOJA 2FHDA 3X28B 1MGQA 1QVGP 3JB9H 4C92B 5GANh 2EQKA 1AHJB 1OOTA 1WA7A 2GFUA 2JS2A 2XIDA 2CP7A 2CT4A 4N4IA 1VQLT 2LRQA 3PIPA 4MDXA 1WHGA 2A0FB 2MK5A 3G4ST 1M9SA 2DILA 2NUTA 4LUDA 4N0AA 3M0QA 2E3HA 2DL4A 4Z88A 1JJ2A 5L8RE 2SRCA 1KQ1A 1VUBA 1BU1A 4EMKB 2YRCA 2GCXA 2KT8A 4QW2A 2E4HA 1G83A 2HL5C 3BW1A 3GP8A 5GAN2 1TSFA 4GLMA 2AIRB 3AT1B 1YIJT 3H0FA 1UECA 3O8VA 1M3CA 4ZGJB 1BBZA 2O01E 4XTZA 2QQAA 3CCQQ 2EYYA 1WJSA 1JJ2S 2Z0WA 5GANg 5I22A 1AWJA 4J8OA 3VUBA 3M0PA 4J7FA 2KR3A 4XK8E 1X43A 1WHKA 2BKDN 2YRVA 2EBPA 1QMCA 1S72T 5GAOp 2K3YA 3CCLQ 3QHSA 2QAZA 3J7AF 1J3TA 1CKBA 3MHXA 3TU4K 2KYMA 3GLXA 5A2QE 3G4SA 3JCMP 3ZL7C 2HL3A 4C92E 5KYWA 3OS0A 2DXCA 3A8OB 1Y7XA 3JCMh 1Q82C 4IKFA 2M9UA 4JZ3A 5GMKi 4ZGDB 4JRKA 1HK9A 1JQQA 2D0NA 3I9QA 3X25B 1WX6A 2VGMA 2JT4A 1PD0A 1NM7A 3E19A 1KD1U 5CKFA 4OGCA 1QP2A 3TREA 1BI3A 2RHUA 2HAXA 3A8LB 2JZ2A 1MV0B 4C0DC 1UDLA 2JOYA 4RTTA 3PNWC 4M75F 3CCMQ 3M55A 3CC4T 5LJ5g 3QWXX 2XDBA 4PL6A 1OI1A 3LLRA 3SD4A 2LTOA 3CC7Q 2EVRA 1H8KA 2CUDA 4XTWA 4E6RA 5KYYB 3MCAB 4A54A 4QKUA 2RH2A 1KHIA 1VQ6T 4PK4A 1O75A 1WJRA 3DB3A 4M7DF 4XTVA 2BZ8A 1KD1R 2CZ6B 2YUNA 1W2BA 2MWOA 4HKEA 1QW1A 1X75C 3CCVT 1N9RA 2EKHA 3RIRA 3CEYA 1VQ8T 1XTDA 4RG8A 3CBPA 3CMET 5L23A 1IHVA 2NUPB 4BACA 2ZGWA 3GPLA 1KSWA 2A37A 4PFOA 1C1AA 3NPFA 1YITT 1OX9A 1ACMB 2AKLA 4PJOF 3CCJQ 3I56Q 4LXCA 2ZCFB 1W2BS 2E41A 3CXCP 1YJ9A 5LJ3e 2F2VA 1QVFP 5KE3A 1D0XA 4ORZA 3JV3A 1T3LA 2O31A 1LNXA 2RF0A 4IIMA 3C0CA 2RD1A 1RAIB 2K5FA 1AWOA 2L89A 3QXEB 4ZGEB 3RDVA 3SWNB 2F1LA 2RJEA 5IAYA 2W0ZA 4N4GA 2RHZA 1VQ6A 1ZUUA 2R57A 2F2WA 2QTVA 4C92D 1TH7A 4M77G 1T0HA 4NL2A 5FRMA 2DTHA 1VQ8A 3C94A 3CD6Q 3M57A 4F7UA 4E7HA 3JCMX 2PTKA 2YHTA 2E64A 2F5KA 1A0NB 3V8JA 4KRTA 1RI9A 1FYNA 1OQKA 2RQRA 3TQ7P 2JUFA 2K3BA 3I35A 4C8QA 4BDZA 3L2VA 3CQTA 3S3OA 3CCEQ 4E47A 4M78A 1AZEA 1WIEA 2O4XA 3OW2A 1YWOA 1XQHA 2O9SA 1I1JA 2RB6A 2KQWA 1NJIC 3EG9B 1D0YA 4MZPA 1YN8A 3CPFA 2J06A 3G71A 1PM3A 2M51A 4BE1A 3NTKA 1RADB 4LDVA 3OYCA 3CCLT 2DETA 1WXTA 2JTFA 1Q7YC 1VQ9A 3GNGA 3VS1A 1YCSB 2DM1A 3FB9A 5CKDA 2QEXQ 1JJ2P 4EIKA 1IHWA 3OW2S 1M3AA 2KYBA 2QA4T 2LZ6B 3RNJA 3QJYA 2EIFA 4LDYA 4JRPA 1HJDA 3CCUQ 1S1NA 2V8JA 3HRUA 4JDSA 1IB8A 1HD3A 2HNIA 3VUZA 3I5RA 3X24B 1PRLC 1OX8A 2RI5A 4CRIA 2OTJQ 1FXXA 3CCMT 3JB9G 4HCCA 1CSKA 4JRQA 3EHQA 2DJZA 2QXFA 1VQ5Q 2JS0A 1AEYA 1FWZA 4XU1A 4F14A 1UFFA 3CC7T 2J6OA 3A8HB 2E5KA 2EQJA 2XDPA 1RI0A 5GANf 3RERA 1G3SA 3EG0A 4JJDA 3EG3A 2RA2A 2KT1A 2CZ0B 2LJ1A 4AG1C 2HQHA 2DXUA 2F69A 2D8HA 4DBRA 1RAEB 1XNIA 3MP8A 4R55A 4F7UG 2QA4A 2ZZDA 1RLQC 3CMAQ 1U06A 1WJQA 2KGTA 3RUXA 2W10A 1PWTA 3UA6A 4OMLA 1U5SA 4L5GA 4J9DA 4NL3A 1C0MA 2BZYA 5GANd 1YI2Q 3VRYA 1YBYA 4M7AC 1Z9QA 4J9IA 2DEUA 1WYXA 4M78G 3SWNC 4FT2A 4BY6C 2YUQA 2XICA 3F70A 3HRSA 3E1SA 4Z89A 1BIBA 4FSXA 1AD5A 3EGXA 4B9XA 2AK5A 1OULA 1X6OA 2K79A 2MAMA 1PCXA 4IIOA 3JCMb 2BIVA 1QCOA 3HL8A 4IUUA 3EFSA 2K2MA 4A4KA 3M9QA 1NJIU 1YWPA 1H92A 4CC2A 5I2MA 2E12A 1WZOA 1OEBA 4P5NA 2VXEA 2LQWA 2YLBA 4OMMA 4C92F 3SEMA 3OYMA 1YJNQ 3CD6T 3JCMf 1Q7YU 2V1RA 1E7OA 3MJXA 3D7SB 1M1KU 4A63B 2XK0A 2L0AA 1P92A 2QGGA 2FL7A 2J7IA 4M4ZA 5DM7R 1M2VA 1M2OA 2CS7A 2KSSA 5LJ5d 4E7IA 1WDXA 1NJIR 2KDSA 2IIMA 1BI0A 1XOVA 5GAOn 2EWNA 2DTIA 3C95A 3M56A 3HFOA 3CCET 1UGSB 4LE9A 3C4SA 5C6SA 4E7JA 1N9SA 2HD0A 8AT1B 2CGHA 4AFSC 1Q7YR 2DXTA 2ZPEB 3UWNA 1M1KR 3JCMd 5GJWB 3E9GA 2WACA 3SB2A 2DVEA 4A4HA 1AWWA 3P8DA 4M7DA 2H3JA 2WSEE 4M77B 4E7LA 4EMHA 3HP9A 4Z8AA 1ZLMA 3U23A 2HCKA 5KYXA 4C8QF 2QEXT 1VQ4Q 1PC0A 2X4YA 2CP2A 3VU3C 1QVFA 2FPDA 2D0QB 1IGQA 1H3ZA 3OYIA 2XDDA 3JCMV 4RTYA 4FIBA 3J80E 4C0DB 2QI2A 3OSSC 4OP0A 3CCUT 5IN1A 2DIGA 2F2XA 5CAIA 1SRLA 4PJOA 5D6XA 1OPKA 1RAFB 2CH4W 1Y96A 5HY6A 5KYUA 3THKA 2D9TA 2LMJA 4C0FA 3OYEA 2PQWA 4HVVA 1TUCA 2C0OA 3HRTA 1SG5A 2IG0A 2KVQG 1QVFS 4XU2A 2QGFB 3L2ZA 3JCMW 2CDTA 3FIFA 4N4HA 3PIOA 4OF1A 1QWFA 1UHFA 2G3RA 2WSFE 1GCPA 3KFVA 1GCQA 5DLOA 2PVGB 2DTOA 1QKWA 3M59A 1R0BG 3J81E 4PFZA 2VWFA 4FSSA 3VS6A 2DLPA 2PVDB 1YP5A 2GTOA 3H0IA 2K6DA 4MZMA 3AHUA 5CQYA 2ESWA 2FVUA 2JM9A 1AZGB 1PD1A 3EH2A 3CCRA 2K7AA 2PU9B 2VYTA 3CCSA 1N6AA 1MNDA 4M77E 5D7UA 7AT1B 1WI7A 3CMAT 1TS9A 1RAGB 1OZ2A 3G6EQ 2ZPFB 3RR6A 1G3WA 4CC4B 2DKGA 2MPXC 3QPHA 5IXFA 2DIQA 5GAN4 4M75G 3JCMc 3QUIA 3BDUA 3WXMB 3EGDA 5CQXA 1BI1A 2LJ3A 1K8AC 1M30A 2JXBA 2DL5A 1UGQB 1MMAA 2XMFA 2OTLT 3UDCA 2XKOC 2O88A 3S3MA 2G6FX 1YHQT 4M7DG 3OYBA 1BI2A 3DB4A 5LJ3h 4RG2A 3M0RA 1F1BB 1D1AA 2R5AA 1GL5A 2DO3A 4PJNA 4C0ZA 1X6BA 3CPWA 4K11A 1PSEA 2ZPBB 4DOVA 1IGUA 2KRNA 2YDLA 4OMPA 2BE9B 4F7UB 1Q95G 2R5MA 2DL7A 4PKCC 2O9VA 1ZA1B 1BB9A 3CC2Q 4MMKA 1YJNT 1K4US 1JXOA 4KBMB 2PZ1A 4AG2C 2DAQA 2M0YA 4PJOG 2DL8A 1VQLA 1K1ZA 4KUDK 2EJFA 5CKEA 3A8MB 1WFWA 2BTTA 3OS1A 4E2FB 2L2PA 1B7TA 2CP3A 4M78B 3CPWS 2KXDA 4OMFB 3S6WA 1VQKQ 5CVIA 5IHKA 2CUBA 2P4RA 4QVZA 1ABOA 4KH1B 4M77C 3EFOB 3ME9A 4KUIA 5CKHA 2OTLA 1ZHIA 1M4ZA 2RJDA 5LJ3g 1YHQA 2K4YA 1WNLA 1VQMT 4RUGA 4F04B 1PSFA 3JB9I 1ZA2B 2EW3A 1Y71A 1YIJA 3OS5A 3OY9A 3ZEHA 5GAOm 3EAEA 1ZSGA 1ABQA 3I5SA 1M1GA 2I0NA 2DBKA 2J05A 5DY9A 3L2WA 5IHIA 2JMAA 2OAWA 2JVVA 1NLOC 4F16A 1S72A 1X69A 3JCMQ 1IO6A 1YJWQ 2YLCA 2RI3A 3UATA 4FYVB 3P8HA 5GAMh 1NLPC 2FEIA 2M0OA 4LD9K 1VQNQ 3HPWA 2DZ9A 3JCMg 3N5BB 2DFUA 2LCCA 3FEOA 1RUWA 2D8JA 1FX7A 2CREA 4BI3A 3OYGA 3DKMA 2BUDA 4C5EA 4RTUA 4DA4A 1DJ7B 1E6GA 2JMCA 4OMQA 1VQMA 1B34B 2RK1A 2VXFA 1K8AU 1GFDA 4X34A 3FDRA 2D6FA 3H9NA 1G3YA 2FPEA 5GAOl 2XD0A 1OU8A 2KXCA 2DK3A 1WXUA 4C92A 3CC4A 1RAAB 3TEEA 2OX7A 1NZ9A 2LT4A 4M7AB 2AHJB 2GGRA 3QG1A 1H641 3VJPA 1WHLA 2MOXA 4MDWA 2MIOA 2AT1B 2RQVA 4BY6B 4LUEA 1GBRA 3ZBDA 4Y28E 3H6ZA 2KY9A 1K8AR 3RKXA 2DRKA 2P4TA 3L2QA 2MF2A 1NPPA 2JJ9A 5EG2A 1VQ7Q 3CCVA 4EMKA 2EYXA 4RCBA 3A8GB 3ZFJA 3MEUA 1EZZB 3CMEA 1MMGA 2CZ1B 2KMTA 3EGXB 1W4SA 5EC7A 2ECZA 3P8BB 3JSCA 3V7CA 2GTJA 3JB9D 1YITA 1SRMA 3PVQA 3M0UA 1UGVA 2RHXA 3EFRA 1VQPQ 3QSUA 3L1AA 1VQOQ 2CZ7B 3OYFA 2QTXA 3LH5A 3CCQT 5CK9A 4UC4A 4L59A 1KJWA 2RNAA 4J6YA 4M78C 5A0LA 3L42A 3JB9J 1UTIA 2RJCA 2M02A 3VS7A 1M1KC 4M7AE 4M75B 1NYFA 5GAMe 3CBMA 4LNPA 3VS3A 2X3XD 1NEBA 2EAYA 2HBPA 1MUZA 3C12A 2FG0A 3OYDA 2OI3A 2CP6A 3OYHA 2LX9A 4ZTFA 4ANJA 3FC3A 5CKBA 4KULA 1AVZC 4HCBA 1SEMA 1WPYA 3TVTA 4E7KA 1OPLA 3OSVA 3MKDA 2LQKA 3CPWP 1UEBA 4A4FA 2EQMA 2EPDA 5KYXB 4JJBA 2CP0A 2KEAA 2L3RA 5GMKj 2CSIA 4C92G 3X26B 4OB2B 2VV5A 3CCQA 4D8KA 5KYYA 2A7YA 4L6V5 2ED1A 4C5HA 5GANj 2KRSA 4LD6A 1M90C 1UGRB 2VUBA 1D3BA 4DOWA 3QYGB 5HKCA 4QQ6A 3CCLA 1FMVA 2RM4A 4CI0C 4FCYA 1YJWT 4Q5WA 5GAOr 1X2KA 1G3TA 2EKOA 4D6WA 3MO8A 1UJ0A 4D8DA 4BI4A 3OYLA 1WHJA 4DEXA 2NUPA 1CKAA 3PTAA 2MYSA 3LWIA 3QIIA 4BUGA 1JU5C 1QLYA 1JBMA 4DBQA 2EGEA 1B07A 1PRMC 1W6XA 2B8AA 1KC8C 4Y92A 2LCLA 3UPUA 4FL6A 4O6JA 4GBQA 2RHIA 5KCOA 2L3PA 4QT7A 2VKNA 2JNGA 4LN2A 4AFQC 4KH0B 4C8QG 3CCJT 1BK2A 2K9GA 3M0SA 3I56T 1IZ6A 2FYKA 4DBFA 5LJ3f 3NTHA 4HT9A 2L3QA 2LP5A 1QWEA 2P0KA 3EH1A 3HFNA 5I21A 1KIKA 3CCMA 1X2QA 2YT6A 3SWNA 5HK3A 5LJ5j 4J9FA 2CYZB 1QCFA 3RBBB 4CC7A 3OQ5A 3G4SQ 2V8KA 3CC7A 1H3HA 4VUBA 3M0TA 4NOYA 5M9OA 1K9MC 3NMZC 1K0SA 1TOVA 3OYKA 1OZ3A 2NUTB 2VB6A 1U8RA 4M7AD 2LNVA 2P0QA 1G5VA 1MMNA 2WSCE 2X4XA 1UUEA 1V1CA 1ZBJA 4J9HA 6AT1B 1NG2A 1VQ7T 5LJ3d 3SFMA 1WQ7A 1IXDA 1SHGA 4ELZC 1I5OB 3QWYA 3VS2A 1K73C 4Z02A 1BIAA 2QDYB 1RACB 2YWWA 1GFCA 2ED0A 4BB7A 2X3WD 3L2RA 4GLKA 4AFUC 5J26A 4QVDA 1KFZA 2C0IA 4FW2A 1VYVA 4J7IA 3OB9A 4RKUE 3V7SA 4PNOA 3CCJA 3OMCA 2LQ8A 3I56A 5A0GA 1VQPT 1M27C 1K0XA 4WCIA 1VQOT 3OYAA 4OGEA 1YFNA 2EJ9A 4FYXB 1AT1B 3EG9A 1M5Q1 4HA8A 3H41A 3M4GA 3JCMJ 4C5GA 4M75C 2EYQA 2YXYA 1T0JA 1RL2A 3OA6A 1QP3A 4B9WA 3RESA 3UA7A 2X9HA 2ENMA 2COZA 1ZQ1A 3BY7A 3E9FA 4OMNA 2EJGA 3VRZA 2AZVA 5KYWB 3TCJA 1GXIE 2E70A 1K76A 4IUTA 1N27A 4C0GA 3LYIA 1OYXA 2DXBA 5GAMf 2FO0A 4M7DC 1M90U 2KRMA 4KGZB 1QCNA 3G7ZA 3TSZA 2FZKB 5FU7B 2AZSA 3IQLA 4DQ2A 3CD6A 1M3BA 3VKIA 1ZX6A 4BD3A 1YJ9Q 3LWHA 3H0HA 3UF4A 1N8RC 1UG1A 1PHTA 2HDAA 4BDYA 2YUOA 2EYWA 3S3NA 2QQSA 3E2UA 1GRIA 4PJMA 1QKXA 1GBQA 1M90R 1T3SA 3CCEA 4II1A 5DLQE 4PJOC 5GAMd 2RK2A 1KC8U 1NEGA 2DNUA 1VQ6Q 2ZAEA 4J9EA 2OTJT 3M4YA 5FROA 2LCSA 2JTMA 4O5VA 3REAB 2PNIA 5CO7A 1OV3A 1O9SA 3RMSA 1VQ5T 3OMGA 3HKSA 1TUGB 4C5IA 1ZSZA 4J6XA 2HEQA 3VS0A 4JJNK 3EHRA 1VQ8Q 2V26A 2H8HA 2ZPGB 4QVCA 4WTOB 2YRDA 2GBQA 3PMTA 2DPPB 1GCQC 1U1SA 2XI9A 1HYOA 5KYNA 4JS5A 4A4EA 2QEXA 1V29B 2ZPHB 2X4WA 1Y0MA 1KC8R 2RQUA 4YTLA 2X4JA 1WGSA 2VASA 1K9MU 4ELYC 1D0ZA 3RMQA 4PLLA 1Q86C 1YCYA 1YNZA 3I55Q 3VS5A 5KCHA 9ATCB 2KK4A 2OJ2A 3JRZA 3CCUA 4KGVB 4RCCA 5GMKh 2V8IA 2D1XA 3MEVA 2DVJA 4MMLA 4JLGA 4EDUA 1YI2T 3M58A 2LVMA 3BDLA 3V8LA 1K73U 2GNCA 3G71Q 3PGGA 2MCNA 3QJ6A 4FM4B 1K9MR 1LCKA 2OTJA 1UHCA 1VQ9Q 4X9CA 4N0AC 3RKYA 4ME7A 1VQ5A 2HKQB 4Y91A 2ROLA 5FLXE 4RTXA 1ZBXA 2DD4A 4PJLA 3NGPA 4DBHA 2RN8A 2LJ0A 4XTYA 2E5QA 1I4K1 2K5LA 1K73R 3M54A 1M8MA 3R6NA 3NFCA 4WF2A 3KBGA 1I8FA 1W1FA 4M7AF 2E65A 4DEYA 5KE2A 2K5IA 5LL6S 3MEAA 5CCAA 3R6OA 2KROA 3PE0A 1Z9ZA 4LDWA 3CMAA 4OMOA 1BKBA 1K9AA 4IUVA 5HCKA 4FW1A 3HTRA 2QDLA 2EQUA 3H8ZA 4C8QB 4HVWA 4OB1B 5AYFA 3OYJA 1YI2A 2FZGB 1VIEA 2O4XB 4J5YA 1PKTA 3EG1A 5LJ5h 2B86A 4OVAA 4R0KA 2A36A 1N8RU 2GQIA 5I11A 2DRMA 1UE9A 5I2SA 3JAME 2H3EB 4TVRA 2COWA 1X01A 5GAN7 4J6WA 1WHHA 1RAHB 4M77A 3A1PA 5C0MA 3KUFA 1C6VX 4KGXB 5FU7C 4AMCA 2QA4Q 2Y4XA 1KG1A 1EIFA 1N8RR 4V2SA 1D09B 1VQ4T 3QO3A 4RTZA 1MMDA 1U1TA 4M77D 4B6MA 3PT9A 3GF5A 1MV3A 4ZNXA 2BZXA 1WHMA 3DLMA 2GFAA 1YJNA 2CSQA 4EPCA 3FLGA 3OYYA 2QQ9A 1JEGA 1YJ9T 2DZCA 3MPUB 2LC4A 4F7UE 2Y4YA 2YUPA 1UB4A 2LX7A 4PFPA 5GMKe 3MP1A 5CIUA 3OYNA 2EGAA 1Q86U 4ESRA 2OAUA 3G1JA 2C0TA 1R0CB 5GANe 1R77A 1WQWA 3SHWA 4C8QE 1D3BB 4J83A 2KAFA 4M78E 4X9DA 2M16A 1VYUA 2VC8A 2ZPIB 3Q1JA 3WVEB 1BCMA 1OU9A 2P0PA 3BE3A 1TWBA 4HCKA 3ER0A 1VIFA 3LH0A 5ECAA 1Q86R 2DE0X 2KBTA 1W70A 2RHYA 1VQ4A 2VVKA 2CKKA 3OS2A 4AT1B 3UT1A 1SSHA 2JN0A 1Q81C 2IVWA 2MI6A 3I55T 2X51A 4C92C 5GAMg 1M1FA 2HSPA 3G6ET 2BE7D 3QYHB 3M5AA 3HSBA 1RABB 1TTHB 3BFMA 4RTWA 3NHNA 1KQSA 4HXJA 2KE9A 3G71T 5LJ5e 5FU6B 2PVOB 3HHTB 4ATOA 1EX4A 2YSQA 2NYSA 3O5ZA 5GAN8 1TG0A 5GAOq 4EMGA 1VQ9T 4XTUA 4EMKC 4AFZC 5D6WA 2COYA 2JW4A 1SPKA 4FT4A 1LVKA 5IH2A 3VS4A 3VYGA 2X35A 3QKJA 3NTIA 1G2BA 3JCMe 5J3BA 2QQRA 4FU6A 3LX7A 2E1HA 4E7SA 3V8KA 1KQSS 2DL3A 3EG2A 2K57A 1MHNA 2CT3A 4C8QC 2RPNA 1NYGA 2L3SA 1JXMA 2K3XA 1NE8A 3PVLA 3CC2T 1PKSA 5HK0A 1Q82U 3I55A 5GAN3 1M2VB 2NUZA 2LQNA 2FZCB 3G6EA 3EGUA 4JLIA 4JPBW 4LDUA 1UJYA 2J6KA 2HQXA 5FWCA 4A53A 4J9BA 3VV0A 1XJWB 3WVDB 2FB7A 3V7RA 2HQEA 1LOJA 1ZUKA 2MWPA 2RQTA 1VQKT 2DERA 3EFOA 5IHNA 4C8QD 1ZUYA 4QQDA 1WLPB 1I81A 2ATCB 2L8DA 3QZ5B 4QQGA 4M78D 2DEQA 1Q82R 4M7DB 5GJVB 4RTVA 2VGNA 2DYIA 3CCRQ 2DYBA 1U3OA 4IUQA 2JM8A 4X1VA 3CCSQ
chains in the Genus database with same CATH topology
3BDUA 3WXMB 1VQ8T 1XTDA 4GY5A 1VQOT 2E6NA 1BI1A 4RG8A 3CBPA 5CQXA 4OGEA 3OYAA 1K8AC 3CMET 5D6YA 2EJ9A 3VYHB 5GMKm 4BACA 1QVGA 2ZGWA 3GPLA 1UGQB 1M5Q1 4HA8A 3L2UA 3M4GA 4JRIA 3JCMJ 2OTLT 4C5GA 5CR2A 3UDCA 2XKOC 4M75C 1YITT 2EYQA 3S3MA 1YHQT 3CC2A 4M7DG 1RL2A 3OA6A 1QP3A 4B9WA 3RESA 5J39A 3OYBA 3T9NA 4PJOF 1BI2A 3DB4A 4PJOB 5LJ3h 2ZCFB 1M8VA 2RI2A 1ZQ1A 2E41A 3BY7A 3E9FA 4RG2A 1W2BS 1YJ9A 2EJGA 2R5AA 2DO3A 4NS5A 4M77F 1Y96B 4C0ZA 5LJ3e 5KE3A 5FRNA 3CPWA 4XAXB 3TCJA 1GXIE 2E70A 2E10A 1JB0E 1LNXA 1PSEA 2ZPBB 1N27A 4IUTA 4C0GA 3LYIA 1OYXA 2RD1A 4DOVA 1VQNT 2DXBA 5GAMf 2L5QA 4M7DC 1M90U 1Q81U 3LGLA 4F7UB 2R5MA 2C06A 2K5FA 3G7ZA 4PKCC 2L89A 3QXEB 1QVGS 4XTXA 1VQKA 2LDMA 5FU7B 4ZGEB 4MMKA 4DQ2A 1YJNT 3SWNB 4MZTA 3CD6A 2RJEA 5IAYA 3VKIA 1HXDA 1BYMA 4BD3A 4N4GA 2RHZA 1VQ6A 4KBMB 3LWHA 1N8RC 1KQ2A 3QBYA 2R57A 2DAQA 1B34A 4M75E 4PJOG 1VQLA 2M1HA 4BDYA 4KUDK 2EJFA 5CKEA 4C92D 3A8MB 3S3NA 1TH7A 4M77G 3GNFB 4BI8B 3OS1A 2QQSA 5LJ3j 4NL2A 1QVPA 4HCCA 5FRMA 4M78B 3CPWS 5KH6A 2DTHA 4OMFB 1IREB 3S6WA 1VQ8A 2GQVA 3C94A 5GMKl 4KT0E 3CCEA 4ZN1A 3GIBA 5CVIA 4II1A 3LW5E 5DLQE 4PJOC 2DD5A 3M57A 4F7UA 5GAMd 4E7HA 2RK2A 3JCMX 4M7DE 1KC8U 4M7AA 2XHCA 2YHTA 4QVZA 1Y07A 3URGA 4M77C 4BE2A 2E64A 2F5KA 3M4YA 3ME9A 5FROA 3OBYA 2OTJT 4KUIA 2JTMA 4O5VA 5CKHA 3V8JA 2OTLA 1ZHIA 1M4ZA 2RJDA 5CO7A 1O9SA 1SSFA 3RMSA 1VQ5T 3OMGA 5LJ3g 3HKSA 2K4YA 1YHQA 4C5IA 1WNLA 1R8OB 1VQMT 3X20B 4J6XA 5GAN5 2JUFA 4JJNK 4R56A 1PSFA 3JB9I 4C8QA 3RKWA 4BDZA 3L2VA 1Y71A 3S3OA 2ZPGB 1YIJA 3OS5A 4QVCA 1YJWA 3PMTA 5FU6C 3OY9A 2DPPB 4E47A 2R58A 4M78A 5GAN6 1U1SA 2O4XA 2XI9A 3OW2A 3ZEHA 4A4EA 4ZN3A 1XQHA 4RMOA 2QEXA 4JS5A 1VQNA 1V29B 2ZPHB 2X4WA 1LJOA 3EAEA 5GAOm 4ZTJA 1M1GA 2RB6A 2KQWA 4YTLA 2X4JA 1NJIC 1WGSA 4PJOE 1K9MU 4ELYC 2PUOB 4MZPA 3CPFA 5DY9A 2RJFA 3L2WA 3G71A 3RMQA 4PLLA 5LJ5f 2XG8D 1Q86C 1YCYA 4BE1A 2JVVA 3NTKA 3QDRB 4LDVA 5KCHA 1UGPB 3OYCA 1S72A 3A5ZB 3CCLT 3JCMQ 2KK4A 3JRZA 2JTFA 2YLCA 1Q7YC 2RI3A 3GNGA 3CCUA 1VQ9A 4RCCA 4HT8A 5GMKh 3P8HA 5GAMh 2XU8A 2V8IA 1NPRA 2M0OA 2E6ZA 2PUKB 3FB9A 3HPWA 5CKDA 3MEVA 4LD9K 4MMLA 2DZ9A 4JLGA 4EDUA 3JCMg 3N5BB 3QZ9B 1YI2T 3M58A 2LCCA 2LVMA 3BDLA 3OW2S 3V8LA 2GF7A 3FEOA 3MP6A 1K73U 2QA4T 4IURA 3JB9F 3PGGA 3QJ6A 2NLUA 4FM4B 3QJYA 2EIFA 1FX7A 2EFIA 3LGFA 4IUPA 4LDYA 4BI3A 3OYGA 3DKMA 2BUDA 4JRPA 4C5EA 2OTJA 4DA4A 3PMIA 4X9CA 1DJ7B 4N0AC 4ME7A 3RKYA 4JS4A 1VQ5A 2V8JA 3HRUA 4Y91A 4LDXA 4JDSA 1VQMA 4JUVA 5FLXE 1B34B 2HNIA 1ZBXA 2DD4A 2RK1A 2VXFA 3CBOA 3VUZA 1K8AU 3X24B 4PLIA 4X34A 4XTYA 3FDRA 5A0DA 2D6FA 4XU3A 4M75A 5GAMj 2E5QA 3FJPA 3GOXA 5GAOl 1G3YA 1I4K1 2RI5A 2K5LA 5IT9E 3M54A 2XD0A 4CRIA 2DK3A 1FXXA 3CCMT 3JB9G 3M53A 3NFCA 3META 4WF2A 4C92A 4JRQA 3CC4A 3KBGA 3TEEA 2DJZA 4F7UF 3FRNA 2QXFA 1I8FA 1NZ9A 3SDZA 2LT4A 1KC8C 1VQ7A 4M7AF 4M7AB 3KXTA 1FWZA 2E65A 2AHJB 4XU1A 3QG1A 1H641 2K5IA 5LL6S 5KE2A 3VJPA 3CC7T 3MEAA 4MDWA 5CCAA 3R6OA 3A8HB 4LDWA 3CMAA 2EQJA 4M75D 2XDPA 1RI0A 1BKBA 2LT1A 4BY6B 5GANf 3RERA 1G3SA 3ZBDA 4Y28E 3H6ZA 4IUVA 2KY9A 3RKXA 2RA2A 2P4TA 3L2QA 2EQUA 2CZ0B 3H8ZA 4C8QB 2MF2A 1NPPA 4OB1B 5AYFA 2QQBA 3CXCA 3CCRT 5EG2A 3OYJA 2DXUA 1YI2A 2F69A 1VIEA 4M78F 3CCVA 3CCST 2F5TX 1XNIA 4EMKA 2O4XB 4J5YA 1JRIA 3A8GB 4RCBA 1VQPA 3MP8A 5LJ5h 4R55A 4M7DD 4F7UG 4OVAA 3ZFJA 2QA4A 3MEUA 1VQOA 1N8RU 4M7AG 2ZZDA 3DLLA 3CMEA 1WJQA 5I2SA 3JAME 4OB0B 4TVRA 2KMTA 2CZ1B 1W4SA 3RUXA 3ASKA 3P8BB 3JSCA 2A3LA 3OBWA 3V7CA 1X01A 5GAN7 4J6WA 4L5GA 3JB9D 1YITA 4NL3A 1KHCA 4M77A 5GANd 1YBYA 4M7AC 5C0MA 2RHXA 3EFRA 2I2LA 3KUFA 3QSUA 3L1AA 5FU7C 3CXCS 2Y4XA 4M78G 3SWNC 4FT2A 1KD1C 2CZ7B 4BY6C 1KG1A 3OYFA 4BE0A 1EIFA 2QTXA 2XICA 4V2SA 3CCQT 4PJOD 1VQ4T 3QO3A 3JCMc 5CK9A 3F70A 4XU0A 3HRSA 3E1SA 1I5LA 1U1TA 1BIBA 4M77D 4FSXA 4L59A 4UC4A 3PT9A 3GF5A 4J6YA 4B9XA 2RO0A 3DLMA 2GFAA 4M78C 1X6OA 5A0LA 1YJNA 2MAMA 2Y90A 2K2VA 3L42A 4EPCA 3JB9J 3FLGA 3PFSA 3OYYA 2QQ9A 4A4GA 1YJ9T 3JCMb 2DZCA 4XQ3A 2RJCA 2BIVA 2MMPA 2LC4A 3MEWA 3HL8A 4IUUA 3EFSA 4A4KA 4F7UE 3M9QA 2Y4YA 1NJIU 1UB4A 1M1KC 3INZA 4M7AE 4M75B 4HCZA 5GMKe 4OB3B 5I2MA 3CBMA 2FHDA 3X28B 3MP1A 5GAMe 2E12A 1MGQA 4P5NA 2VXEA 2EAYA 5CIUA 3OYNA 2YLBA 2HBPA 1Q86U 3C12A 3OYDA 3JB9H 4C92F 4C92B 2OAUA 3OYMA 5GANh 2EQKA 1AHJB 2GFUA 3OYHA 2LX9A 3JCMf 4ZTFA 1Q7YU 3CD6T 3FC3A 5CKBA 2XIDA 4KULA 5GANe 4HCBA 1WQWA 1M1KU 4C8QE 1D3BB 4N4IA 1WPYA 2XK0A 4E7KA 1P92A 1VQLT 3OSVA 2LRQA 2FL7A 3PIPA 4MDXA 5DM7R 4J83A 2KAFA 4M78E 4X9DA 2KSSA 2CS7A 3G4ST 2M16A 5LJ5d 2VC8A 4E7IA 2ZPIB 2LQKA 1M9SA 3Q1JA 1UEBA 4A4FA 2EQMA 2KDSA 1BI0A 3WVEB 4N0AA 1XOVA 5GAOn 2L3RA 2EWNA 2P0PA 2DTIA 3C95A 3M56A 3ER0A 3HFOA 1UGSB 1VIFA 5GMKj 3CCET 3LH0A 1JJ2A 5L8RE 1KQ1A 1VUBA 4EMKB 4C92G 3C4SA 3X26B 5C6SA 4E7JA 1N9SA 2HD0A 4OB2B 2GCXA 2CGHA 2RHYA 2VV5A 3CCQA 1VQ4A 2DXTA 2ZPEB 3UWNA 2CKKA 2A7YA 4QW2A 4L6V5 3OS2A 4C5HA 3UT1A 5GANj 3JCMd 3E9GA 2WACA 4LD6A 2JN0A 2DVEA 3SB2A 4A4HA 1Q81C 1UGRB 1M90C 2VUBA 1D3BA 2IVWA 3BW1A 3P8DA 3GP8A 4M7DA 2MI6A 4DOWA 5GAN2 3I55T 3QYGB 5HKCA 2H3JA 4C92C 4QQ6A 5GAMg 3CCLA 2RM4A 2WSEE 1M1FA 4M77B 4CI0C 4E7LA 1YIJT 4Q5WA 4EMHA 5GAOr 1YJWT 3HP9A 3G6ET 1G3TA 3O8VA 3QYHB 4ZGJB 3M5AA 4C8QF 2EKOA 3HSBA 2O01E 4XTZA 2QQAA 4D6WA 2QEXT 3MO8A 1WJSA 2X4YA 4BI4A 3OYLA 1JJ2S 5GANg 3VU3C 1QVFA 2D0QB 3BFMA 1H3ZA 3OYIA 4J8OA 3VUBA 3PTAA 4J7FA 2XDDA 1KQSA 3LWIA 4XK8E 3G71T 3JCMV 3QIIA 4BUGA 4FIBA 5LJ5e 1JBMA 5FU6B 3J80E 2PVOB 2BKDN 2YRVA 3HHTB 4ATOA 4C0DB 1S72T 5GAOp 2K3YA 2QI2A 3OSSC 3QHSA 5GAN8 3J7AF 4OP0A 4EMGA 5GAOq 1VQ9T 3CCUT 2B8AA 5IN1A 4XTUA 2DIGA 3MHXA 2LCLA 4EMKC 3UPUA 5CAIA 3TU4K 4FL6A 5D6WA 4O6JA 4PJOA 2RHIA 5D6XA 3GLXA 5A2QE 3G4SA 3JCMP 5KCOA 4FT4A 1Y96A 5HY6A 4C92E 2JNGA 3OS0A 3VYGA 4C8QG 2D9TA 2DXCA 2X35A 3QKJA 4C0FA 3OYEA 2PQWA 3I56T 3A8OB 1Y7XA 1IZ6A 3NTIA 3JCMh 2FYKA 5LJ3f 3NTHA 3HRTA 4HT9A 3JCMe 2IG0A 2KVQG 5J3BA 2QQRA 1Q82C 1QVFS 4XU2A 2P0KA 2M9UA 3HFNA 3L2ZA 4FU6A 3JCMW 5GMKi 4IKFA 4ZGDB 3FIFA 5I21A 3LX7A 2E1HA 4N4HA 3V8KA 4JRKA 3CCMA 1KQSS 1HK9A 3PIOA 4OF1A 2G3RA 2K57A 2WSFE 1MHNA 3SWNA 5HK3A 5LJ5j 2CYZB 4C8QC 3X25B 3OQ5A 2V8KA 2K3XA 5DLOA 3CC7A 2PVGB 1NE8A 2DTOA 3CC2T 4VUBA 2VGMA 3M59A 4NOYA 3J81E 5M9OA 3E19A 5HK0A 3I55A 1Q82U 1KD1U 5GAN3 3CCJT 3OYKA 1K9MC 5CKFA 4OGCA 1OZ3A 1QP2A 3TREA 2PVDB 1U8RA 4M7AD 2LNVA 1BI3A 2RHUA 3G6EA 4JLIA 3A8LB 2HAXA 2JZ2A 2P0QA 4MZMA 4C0DC 3AHUA 4LDUA 5CQYA 2FVUA 1G5VA 2JOYA 2WSCE 2HQXA 2X4XA 3PNWC 4M75F 3CCRA 2PU9B 3M55A 2VYTA 4A53A 5LJ5g 3CC4T 3VV0A 2XDBA 4PL6A 1OI1A 1VQ7T 5LJ3d 3WVDB 3LLRA 3SFMA 3CCSA 1WQ7A 2FB7A 3V7RA 1N6AA 2HQEA 1LOJA 3SD4A 2LTOA 2MWPA 4ELZC 1VQKT 4XTWA 4M77E 4C8QD 3MCAB 4A54A 4QQDA 3CMAT 1K73C 4Z02A 1BIAA 2QDYB 2RH2A 1I81A 2L8DA 1KHIA 3QZ5B 4QQGA 1VQ6T 4M78D 1O75A 1WJRA 2DEQA 3DB3A 1OZ2A 4XTVA 4BB7A 3L2RA 2ZPFB 4M7DF 4M7DB 4GLKA 2CZ6B 1W2BA 2MWOA 5J26A 4HKEA 1G3WA 1QW1A 2VGNA 4QVDA 2DKGA 4J7IA 3OB9A 4RKUE 3V7SA 3QPHA 4IUQA 1X75C 4PNOA 2DIQA 3CCJA 3CCVT 5GAN4 3OMCA 2LQ8A 1N9RA 4M75G 3I56A 5A0GA 1VQPT 3RIRA 3CEYA 3QUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDU A;  3V7C A;  4EMH A;  5GAO r;  4PJO E;  1X01 A;  5GAN 7;  4J6W A;  3JB9 D;  5DY9 A;  4NL3 A;  4C8Q F;  2EJ9 A;  3HSB A;  4XTZ A;  4M77 A;  5LJ5 f;  5GAN d;  5GMK m;  1YCY A;  2ZGW A;  4M7A C;  1M5Q 1;  4HA8 A;  5GAN g;  3EFR A;  2I2L A;  3M4G A;  4JRI A;  3VU3 C;  3JCM Q;  3L1A A;  3JCM J;  3BFM A;  3QSU A;  2YLC A;  4HT8 A;  4RCC A;  5GMK h;  4M78 G;  3SWN C;  4M75 C;  5GAM h;  4M7D G;  3JCM V;  3FB9 A;  2QTX A;  3RES A;  1JBM A;  4MML A;  2DZ9 A;  5LJ5 e;  3JCM g;  4PJO F;  4V2S A;  5GAO p;  4PJO B;  5LJ3 h;  4PJO D;  3QHS A;  3QO3 A;  2E41 A;  3BY7 A;  3JCM c;  5GAN 8;  4XU0 A;  2EJG A;  4OP0 A;  4EMG A;  5GAO q;  3V8L A;  4M77 F;  1Y96 B;  4XTU A;  4EMK C;  5LJ3 e;  1U1T A;  1I5L A;  1BIB A;  4M77 D;  5CAI A;  4PJO A;  3JB9 F;  3PGG A;  4J6Y A;  3JCM P;  2E10 A;  1LNX A;  4M78 C;  1Y96 A;  2RD1 A;  2Y90 A;  4C92 E;  5GAM f;  3JB9 J;  4M7D C;  4F7U B;  4C8Q G;  3JCM b;  2DZC A;  3JCM W;  4XQ3 A;  3JCM h;  4X9C A;  2FYK A;  4N0A C;  3RKY A;  4XTX A;  5LJ3 f;  3EFS A;  4Y91 A;  4F7U E;  3JCM e;  4HT9 A;  4XU2 A;  4MMK A;  4DQ2 A;  3HFN A;  3INZ A;  1B34 B;  3L2Z A;  4JUV A;  4M75 B;  3SWN B;  3FIF A;  2HNI A;  5I21 A;  5GMK i;  2E1H A;  2VXF A;  5GAM e;  5GMK e;  3V8K A;  4JRK A;  1HXD A;  1HK9 A;  1MGQ A;  2K57 A;  2EAY A;  2VXE A;  4XTY A;  2YLB A;  4XU3 A;  1B34 A;  4M75 E;  4M75 A;  4PJO G;  3SWN A;  5LJ5 j;  5GAM j;  3JB9 H;  3FJP A;  4C8Q C;  4C92 F;  2EJF A;  4C92 B;  4C92 D;  5GAO l;  5GAN h;  1I4K 1;  2DTO A;  1TH7 A;  4M77 G;  3JCM f;  1M8V A;  4NOY A;  5LJ3 j;  4NL2 A;  5GAN e;  3JB9 G;  1WQW A;  4C92 A;  5GAN 3;  4WF2 A;  4M78 B;  4C8Q E;  4F7U F;  1D3B B;  2DJZ A;  1WPY A;  2DTH A;  3RIR A;  1I8F A;  4M7A F;  4M7A B;  4M7A D;  5GMK l;  2E65 A;  4XU1 A;  3GIB A;  1H64 1;  4JLI A;  4M78 E;  3AHU A;  4X9D A;  4PJO C;  4F7U A;  5LJ5 d;  5GAM d;  2VC8 A;  4M7D E;  3JCM X;  4M75 F;  4M7A A;  2YHT A;  4M75 D;  4M77 C;  4A53 A;  5LJ5 g;  5GAN f;  2E64 A;  4N0A A;  3RER A;  5LJ3 d;  5GAO n;  2EWN A;  2DTI A;  1WQ7 A;  2FB7 A;  3V8J A;  3V7R A;  3HFO A;  1LOJ A;  5GMK j;  3RKX A;  5LJ3 g;  4XTW A;  2RA2 A;  1KQ1 A;  1WNL A;  4M77 E;  4C8Q B;  4C8Q D;  4EMK B;  4C92 G;  4J6X A;  4A54 A;  1N9S A;  2CGH A;  2DXU A;  5GAN 5;  1BIA A;  1I81 A;  4M78 F;  3JB9 I;  2DXT A;  4C8Q A;  4M78 D;  3RKW A;  2DEQ A;  4EMK A;  4M7D F;  4J5Y A;  4XTV A;  1JRI A;  4RCB A;  4QVC A;  4M7D D;  5LJ5 h;  4M7D B;  5GAN j;  4F7U G;  3JCM d;  3SB2 A;  2JN0 A;  2DVE A;  4M7A G;  4QVD A;  4M78 A;  1D3B A;  3BW1 A;  1U1S A;  5GAN 6;  2DKG A;  1KQ2 A;  4M7D A;  3V7S A;  4M7A E;  5GAN 2;  4PNO A;  5GAO m;  1LJO A;  3RUX A;  4C92 C;  5GAM g;  5GAN 4;  2RB6 A;  1N9R A;  4M75 G;  2RM4 A;  4M77 B;  3QUI A; 
#chains in the Genus database with same CATH topology
 1I0C A;  4GY5 A;  2E6N A;  5D6Y A;  3VYH B;  5GMK m;  1QVG A;  3GBQ A;  3L2U A;  4JRI A;  2QK0 A;  1QQJ A;  2RMO A;  5CR2 A;  3CC2 A;  5J39 A;  3T9N A;  4PJO B;  1M8V A;  2DBM A;  2RI2 A;  4NS5 A;  2A08 A;  1Y96 B;  2EQI A;  4M77 F;  5FRN A;  5KYU B;  4XAX B;  2QAS A;  2FPF A;  1HSQ A;  2E10 A;  1JB0 E;  2A28 A;  4JJC A;  1VQN T;  4J9C A;  2L5Q A;  1Q81 U;  3LGL A;  4JZ4 A;  2C06 A;  2JTE A;  1QVG S;  4XTX A;  1VQK A;  1EFN A;  2LDM A;  3REB B;  4E7Z A;  2CP5 A;  4MZT A;  1B3Q A;  1I07 A;  1HXD A;  1BYM A;  1ZSZ B;  1AWX A;  1KQ2 A;  3QBY A;  1B34 A;  2EYZ A;  4M75 E;  2J6F A;  2M1H A;  3GNF B;  4BI8 B;  5LJ3 j;  1QVP A;  5KH6 A;  2QYZ A;  8ATC B;  1V76 A;  1IRE B;  2IPO B;  2FRW A;  2GQV A;  5GMK l;  4KT0 E;  1Q81 R;  4ZN1 A;  3GIB A;  3LW5 E;  2DD5 A;  4M7D E;  4M7A A;  2XHC A;  1RLP C;  1Y07 A;  3URG A;  4BE2 A;  2EGC A;  3OBY A;  1VQL Q;  2CH4 A;  1SSF A;  1VOM A;  1WXB A;  1VYT A;  1R8O B;  2ROT A;  3X20 B;  5GAN 5;  4R56 A;  3RKW A;  5IXB A;  1YJW A;  5FU6 C;  2DX1 A;  1SKU B;  1IRX A;  2R58 A;  5GAN 6;  2HMA A;  3FJ5 A;  4ZN3 A;  1VQN A;  4RMO A;  1FMW A;  3EGD B;  4ZTJ A;  1LJO A;  1G8X A;  1JO8 A;  1ARK A;  2OTL Q;  2FRY A;  4PJO E;  1YHQ Q;  2PUO B;  2RJF A;  4J9G A;  1PNJ A;  5LJ5 f;  2XG8 D;  1W2B P;  3QDR B;  1UGP B;  3A5Z B;  4FYW B;  1YIJ Q;  1BCO A;  4HT8 A;  4PJJ A;  2XU8 A;  1NPR A;  2E6Z A;  2PUK B;  3QZ9 B;  2DJQ A;  2GF7 A;  3MP6 A;  3JB9 F;  4IUR A;  2ABL A;  2NLU A;  2EFI A;  3LGF A;  4IUP A;  1S72 Q;  1KK7 A;  3PMI A;  3A98 A;  4JS4 A;  2AKK A;  2O2O A;  2V1Q A;  2QG9 B;  4LDX A;  4JUV A;  1TUD A;  1MNE A;  3CBO A;  4PLI A;  5A0D A;  2SEM A;  4XU3 A;  4M75 A;  5GAM j;  3FJP A;  3GOX A;  3ULR B;  2LNH B;  1PG5 B;  5IT9 E;  1TXQ A;  1NBE B;  1KQS P;  3M53 A;  3MET A;  2E3I A;  4F7U F;  3FRN A;  3SDZ A;  1VQ7 A;  1N5Z A;  3KXT A;  1SF9 A;  2KI7 A;  1VQM Q;  1D1B A;  2KNB B;  4F17 A;  2DF6 A;  2HBW A;  4M75 D;  2LT1 A;  2P84 A;  2RQW A;  2HKN A;  2HZY A;  3TSW A;  1VA7 A;  2HSE B;  3CXC A;  3CCR T;  2QQB A;  3CC4 Q;  4M78 F;  1E6H A;  3CCS T;  2F5T X;  1JRI A;  1VQP A;  4M7D D;  1VQO A;  4FYY B;  1D1C A;  4M7A G;  3DLL A;  1X6G A;  4OB0 B;  3ASK A;  2DMO A;  5FWB A;  2A3L A;  3OBW A;  2DA9 A;  5AT1 B;  1KHC A;  1X27 A;  3CCV Q;  3OW2 P;  2I2L A;  3CXC S;  1KD1 C;  3CME Q;  4BE0 A;  1ZSZ C;  1FMK A;  4PJO D;  5FW9 A;  4XU0 A;  1LPL A;  1SHF A;  1I5L A;  3QDF A;  1YIT Q;  2NWM A;  2RO0 A;  2Y90 A;  2K2V A;  3PFS A;  4A4G A;  1Y57 A;  4CC3 A;  4XQ3 A;  1TU0 B;  3MEW A;  2MMP A;  4HVU A;  3INZ A;  4HCZ A;  4OB3 B;  1AOJ A;  2FHD A;  3X28 B;  1MGQ A;  1QVG P;  3JB9 H;  4C92 B;  5GAN h;  2EQK A;  1AHJ B;  1OOT A;  1WA7 A;  2GFU A;  2JS2 A;  2XID A;  2CP7 A;  2CT4 A;  4N4I A;  1VQL T;  2LRQ A;  3PIP A;  4MDX A;  1WHG A;  2A0F B;  2MK5 A;  3G4S T;  1M9S A;  2DIL A;  2NUT A;  4LUD A;  4N0A A;  3M0Q A;  2E3H A;  2DL4 A;  4Z88 A;  1JJ2 A;  5L8R E;  2SRC A;  1KQ1 A;  1VUB A;  1BU1 A;  4EMK B;  2YRC A;  2GCX A;  2KT8 A;  4QW2 A;  2E4H A;  1G83 A;  2HL5 C;  3BW1 A;  3GP8 A;  5GAN 2;  1TSF A;  4GLM A;  2AIR B;  3AT1 B;  1YIJ T;  3H0F A;  1UEC A;  3O8V A;  1M3C A;  4ZGJ B;  1BBZ A;  2O01 E;  4XTZ A;  2QQA A;  3CCQ Q;  2EYY A;  1WJS A;  1JJ2 S;  2Z0W A;  5GAN g;  5I22 A;  1AWJ A;  4J8O A;  3VUB A;  3M0P A;  4J7F A;  2KR3 A;  4XK8 E;  1X43 A;  1WHK A;  2BKD N;  2YRV A;  2EBP A;  1QMC A;  1S72 T;  5GAO p;  2K3Y A;  3CCL Q;  3QHS A;  2QAZ A;  3J7A F;  1J3T A;  1CKB A;  3MHX A;  3TU4 K;  2KYM A;  3GLX A;  5A2Q E;  3G4S A;  3JCM P;  3ZL7 C;  2HL3 A;  4C92 E;  5KYW A;  3OS0 A;  2DXC A;  3A8O B;  1Y7X A;  3JCM h;  1Q82 C;  4IKF A;  2M9U A;  4JZ3 A;  5GMK i;  4ZGD B;  4JRK A;  1HK9 A;  1JQQ A;  2D0N A;  3I9Q A;  3X25 B;  1WX6 A;  2VGM A;  2JT4 A;  1PD0 A;  1NM7 A;  3E19 A;  1KD1 U;  5CKF A;  4OGC A;  1QP2 A;  3TRE A;  1BI3 A;  2RHU A;  2HAX A;  3A8L B;  2JZ2 A;  1MV0 B;  4C0D C;  1UDL A;  2JOY A;  4RTT A;  3PNW C;  4M75 F;  3CCM Q;  3M55 A;  3CC4 T;  5LJ5 g;  3QWX X;  2XDB A;  4PL6 A;  1OI1 A;  3LLR A;  3SD4 A;  2LTO A;  3CC7 Q;  2EVR A;  1H8K A;  2CUD A;  4XTW A;  4E6R A;  5KYY B;  3MCA B;  4A54 A;  4QKU A;  2RH2 A;  1KHI A;  1VQ6 T;  4PK4 A;  1O75 A;  1WJR A;  3DB3 A;  4M7D F;  4XTV A;  2BZ8 A;  1KD1 R;  2CZ6 B;  2YUN A;  1W2B A;  2MWO A;  4HKE A;  1QW1 A;  1X75 C;  3CCV T;  1N9R A;  2EKH A;  3RIR A;  3CEY A;  1VQ8 T;  1XTD A;  4RG8 A;  3CBP A;  3CME T;  5L23 A;  1IHV A;  2NUP B;  4BAC A;  2ZGW A;  3GPL A;  1KSW A;  2A37 A;  4PFO A;  1C1A A;  3NPF A;  1YIT T;  1OX9 A;  1ACM B;  2AKL A;  4PJO F;  3CCJ Q;  3I56 Q;  4LXC A;  2ZCF B;  1W2B S;  2E41 A;  3CXC P;  1YJ9 A;  5LJ3 e;  2F2V A;  1QVF P;  5KE3 A;  1D0X A;  4ORZ A;  3JV3 A;  1T3L A;  2O31 A;  1LNX A;  2RF0 A;  4IIM A;  3C0C A;  2RD1 A;  1RAI B;  2K5F A;  1AWO A;  2L89 A;  3QXE B;  4ZGE B;  3RDV A;  3SWN B;  2F1L A;  2RJE A;  5IAY A;  2W0Z A;  4N4G A;  2RHZ A;  1VQ6 A;  1ZUU A;  2R57 A;  2F2W A;  2QTV A;  4C92 D;  1TH7 A;  4M77 G;  1T0H A;  4NL2 A;  5FRM A;  2DTH A;  1VQ8 A;  3C94 A;  3CD6 Q;  3M57 A;  4F7U A;  4E7H A;  3JCM X;  2PTK A;  2YHT A;  2E64 A;  2F5K A;  1A0N B;  3V8J A;  4KRT A;  1RI9 A;  1FYN A;  1OQK A;  2RQR A;  3TQ7 P;  2JUF A;  2K3B A;  3I35 A;  4C8Q A;  4BDZ A;  3L2V A;  3CQT A;  3S3O A;  3CCE Q;  4E47 A;  4M78 A;  1AZE A;  1WIE A;  2O4X A;  3OW2 A;  1YWO A;  1XQH A;  2O9S A;  1I1J A;  2RB6 A;  2KQW A;  1NJI C;  3EG9 B;  1D0Y A;  4MZP A;  1YN8 A;  3CPF A;  2J06 A;  3G71 A;  1PM3 A;  2M51 A;  4BE1 A;  3NTK A;  1RAD B;  4LDV A;  3OYC A;  3CCL T;  2DET A;  1WXT A;  2JTF A;  1Q7Y C;  1VQ9 A;  3GNG A;  3VS1 A;  1YCS B;  2DM1 A;  3FB9 A;  5CKD A;  2QEX Q;  1JJ2 P;  4EIK A;  1IHW A;  3OW2 S;  1M3A A;  2KYB A;  2QA4 T;  2LZ6 B;  3RNJ A;  3QJY A;  2EIF A;  4LDY A;  4JRP A;  1HJD A;  3CCU Q;  1S1N A;  2V8J A;  3HRU A;  4JDS A;  1IB8 A;  1HD3 A;  2HNI A;  3VUZ A;  3I5R A;  3X24 B;  1PRL C;  1OX8 A;  2RI5 A;  4CRI A;  2OTJ Q;  1FXX A;  3CCM T;  3JB9 G;  4HCC A;  1CSK A;  4JRQ A;  3EHQ A;  2DJZ A;  2QXF A;  1VQ5 Q;  2JS0 A;  1AEY A;  1FWZ A;  4XU1 A;  4F14 A;  1UFF A;  3CC7 T;  2J6O A;  3A8H B;  2E5K A;  2EQJ A;  2XDP A;  1RI0 A;  5GAN f;  3RER A;  1G3S A;  3EG0 A;  4JJD A;  3EG3 A;  2RA2 A;  2KT1 A;  2CZ0 B;  2LJ1 A;  4AG1 C;  2HQH A;  2DXU A;  2F69 A;  2D8H A;  4DBR A;  1RAE B;  1XNI A;  3MP8 A;  4R55 A;  4F7U G;  2QA4 A;  2ZZD A;  1RLQ C;  3CMA Q;  1U06 A;  1WJQ A;  2KGT A;  3RUX A;  2W10 A;  1PWT A;  3UA6 A;  4OML A;  1U5S A;  4L5G A;  4J9D A;  4NL3 A;  1C0M A;  2BZY A;  5GAN d;  1YI2 Q;  3VRY A;  1YBY A;  4M7A C;  1Z9Q A;  4J9I A;  2DEU A;  1WYX A;  4M78 G;  3SWN C;  4FT2 A;  4BY6 C;  2YUQ A;  2XIC A;  3F70 A;  3HRS A;  3E1S A;  4Z89 A;  1BIB A;  4FSX A;  1AD5 A;  3EGX A;  4B9X A;  2AK5 A;  1OUL A;  1X6O A;  2K79 A;  2MAM A;  1PCX A;  4IIO A;  3JCM b;  2BIV A;  1QCO A;  3HL8 A;  4IUU A;  3EFS A;  2K2M A;  4A4K A;  3M9Q A;  1NJI U;  1YWP A;  1H92 A;  4CC2 A;  5I2M A;  2E12 A;  1WZO A;  1OEB A;  4P5N A;  2VXE A;  2LQW A;  2YLB A;  4OMM A;  4C92 F;  3SEM A;  3OYM A;  1YJN Q;  3CD6 T;  3JCM f;  1Q7Y U;  2V1R A;  1E7O A;  3MJX A;  3D7S B;  1M1K U;  4A63 B;  2XK0 A;  2L0A A;  1P92 A;  2QGG A;  2FL7 A;  2J7I A;  4M4Z A;  5DM7 R;  1M2V A;  1M2O A;  2CS7 A;  2KSS A;  5LJ5 d;  4E7I A;  1WDX A;  1NJI R;  2KDS A;  2IIM A;  1BI0 A;  1XOV A;  5GAO n;  2EWN A;  2DTI A;  3C95 A;  3M56 A;  3HFO A;  3CCE T;  1UGS B;  4LE9 A;  3C4S A;  5C6S A;  4E7J A;  1N9S A;  2HD0 A;  8AT1 B;  2CGH A;  4AFS C;  1Q7Y R;  2DXT A;  2ZPE B;  3UWN A;  1M1K R;  3JCM d;  5GJW B;  3E9G A;  2WAC A;  3SB2 A;  2DVE A;  4A4H A;  1AWW A;  3P8D A;  4M7D A;  2H3J A;  2WSE E;  4M77 B;  4E7L A;  4EMH A;  3HP9 A;  4Z8A A;  1ZLM A;  3U23 A;  2HCK A;  5KYX A;  4C8Q F;  2QEX T;  1VQ4 Q;  1PC0 A;  2X4Y A;  2CP2 A;  3VU3 C;  1QVF A;  2FPD A;  2D0Q B;  1IGQ A;  1H3Z A;  3OYI A;  2XDD A;  3JCM V;  4RTY A;  4FIB A;  3J80 E;  4C0D B;  2QI2 A;  3OSS C;  4OP0 A;  3CCU T;  5IN1 A;  2DIG A;  2F2X A;  5CAI A;  1SRL A;  4PJO A;  5D6X A;  1OPK A;  1RAF B;  2CH4 W;  1Y96 A;  5HY6 A;  5KYU A;  3THK A;  2D9T A;  2LMJ A;  4C0F A;  3OYE A;  2PQW A;  4HVV A;  1TUC A;  2C0O A;  3HRT A;  1SG5 A;  2IG0 A;  2KVQ G;  1QVF S;  4XU2 A;  2QGF B;  3L2Z A;  3JCM W;  2CDT A;  3FIF A;  4N4H A;  3PIO A;  4OF1 A;  1QWF A;  1UHF A;  2G3R A;  2WSF E;  1GCP A;  3KFV A;  1GCQ A;  5DLO A;  2PVG B;  2DTO A;  1QKW A;  3M59 A;  1R0B G;  3J81 E;  4PFZ A;  2VWF A;  4FSS A;  3VS6 A;  2DLP A;  2PVD B;  1YP5 A;  2GTO A;  3H0I A;  2K6D A;  4MZM A;  3AHU A;  5CQY A;  2ESW A;  2FVU A;  2JM9 A;  1AZG B;  1PD1 A;  3EH2 A;  3CCR A;  2K7A A;  2PU9 B;  2VYT A;  3CCS A;  1N6A A;  1MND A;  4M77 E;  5D7U A;  7AT1 B;  1WI7 A;  3CMA T;  1TS9 A;  1RAG B;  1OZ2 A;  3G6E Q;  2ZPF B;  3RR6 A;  1G3W A;  4CC4 B;  2DKG A;  2MPX C;  3QPH A;  5IXF A;  2DIQ A;  5GAN 4;  4M75 G;  3JCM c;  3QUI A;  3BDU A;  3WXM B;  3EGD A;  5CQX A;  1BI1 A;  2LJ3 A;  1K8A C;  1M30 A;  2JXB A;  2DL5 A;  1UGQ B;  1MMA A;  2XMF A;  2OTL T;  3UDC A;  2XKO C;  2O88 A;  3S3M A;  2G6F X;  1YHQ T;  4M7D G;  3OYB A;  1BI2 A;  3DB4 A;  5LJ3 h;  4RG2 A;  3M0R A;  1F1B B;  1D1A A;  2R5A A;  1GL5 A;  2DO3 A;  4PJN A;  4C0Z A;  1X6B A;  3CPW A;  4K11 A;  1PSE A;  2ZPB B;  4DOV A;  1IGU A;  2KRN A;  2YDL A;  4OMP A;  2BE9 B;  4F7U B;  1Q95 G;  2R5M A;  2DL7 A;  4PKC C;  2O9V A;  1ZA1 B;  1BB9 A;  3CC2 Q;  4MMK A;  1YJN T;  1K4U S;  1JXO A;  4KBM B;  2PZ1 A;  4AG2 C;  2DAQ A;  2M0Y A;  4PJO G;  2DL8 A;  1VQL A;  1K1Z A;  4KUD K;  2EJF A;  5CKE A;  3A8M B;  1WFW A;  2BTT A;  3OS1 A;  4E2F B;  2L2P A;  1B7T A;  2CP3 A;  4M78 B;  3CPW S;  2KXD A;  4OMF B;  3S6W A;  1VQK Q;  5CVI A;  5IHK A;  2CUB A;  2P4R A;  4QVZ A;  1ABO A;  4KH1 B;  4M77 C;  3EFO B;  3ME9 A;  4KUI A;  5CKH A;  2OTL A;  1ZHI A;  1M4Z A;  2RJD A;  5LJ3 g;  1YHQ A;  2K4Y A;  1WNL A;  1VQM T;  4RUG A;  4F04 B;  1PSF A;  3JB9 I;  1ZA2 B;  2EW3 A;  1Y71 A;  1YIJ A;  3OS5 A;  3OY9 A;  3ZEH A;  5GAO m;  3EAE A;  1ZSG A;  1ABQ A;  3I5S A;  1M1G A;  2I0N A;  2DBK A;  2J05 A;  5DY9 A;  3L2W A;  5IHI A;  2JMA A;  2OAW A;  2JVV A;  1NLO C;  4F16 A;  1S72 A;  1X69 A;  3JCM Q;  1IO6 A;  1YJW Q;  2YLC A;  2RI3 A;  3UAT A;  4FYV B;  3P8H A;  5GAM h;  1NLP C;  2FEI A;  2M0O A;  4LD9 K;  1VQN Q;  3HPW A;  2DZ9 A;  3JCM g;  3N5B B;  2DFU A;  2LCC A;  3FEO A;  1RUW A;  2D8J A;  1FX7 A;  2CRE A;  4BI3 A;  3OYG A;  3DKM A;  2BUD A;  4C5E A;  4RTU A;  4DA4 A;  1DJ7 B;  1E6G A;  2JMC A;  4OMQ A;  1VQM A;  1B34 B;  2RK1 A;  2VXF A;  1K8A U;  1GFD A;  4X34 A;  3FDR A;  2D6F A;  3H9N A;  1G3Y A;  2FPE A;  5GAO l;  2XD0 A;  1OU8 A;  2KXC A;  2DK3 A;  1WXU A;  4C92 A;  3CC4 A;  1RAA B;  3TEE A;  2OX7 A;  1NZ9 A;  2LT4 A;  4M7A B;  2AHJ B;  2GGR A;  3QG1 A;  1H64 1;  3VJP A;  1WHL A;  2MOX A;  4MDW A;  2MIO A;  2AT1 B;  2RQV A;  4BY6 B;  4LUE A;  1GBR A;  3ZBD A;  4Y28 E;  3H6Z A;  2KY9 A;  1K8A R;  3RKX A;  2DRK A;  2P4T A;  3L2Q A;  2MF2 A;  1NPP A;  2JJ9 A;  5EG2 A;  1VQ7 Q;  3CCV A;  4EMK A;  2EYX A;  4RCB A;  3A8G B;  3ZFJ A;  3MEU A;  1EZZ B;  3CME A;  1MMG A;  2CZ1 B;  2KMT A;  3EGX B;  1W4S A;  5EC7 A;  2ECZ A;  3P8B B;  3JSC A;  3V7C A;  2GTJ A;  3JB9 D;  1YIT A;  1SRM A;  3PVQ A;  3M0U A;  1UGV A;  2RHX A;  3EFR A;  1VQP Q;  3QSU A;  3L1A A;  1VQO Q;  2CZ7 B;  3OYF A;  2QTX A;  3LH5 A;  3CCQ T;  5CK9 A;  4UC4 A;  4L59 A;  1KJW A;  2RNA A;  4J6Y A;  4M78 C;  5A0L A;  3L42 A;  3JB9 J;  1UTI A;  2RJC A;  2M02 A;  3VS7 A;  1M1K C;  4M7A E;  4M75 B;  1NYF A;  5GAM e;  3CBM A;  4LNP A;  3VS3 A;  2X3X D;  1NEB A;  2EAY A;  2HBP A;  1MUZ A;  3C12 A;  2FG0 A;  3OYD A;  2OI3 A;  2CP6 A;  3OYH A;  2LX9 A;  4ZTF A;  4ANJ A;  3FC3 A;  5CKB A;  4KUL A;  1AVZ C;  4HCB A;  1SEM A;  1WPY A;  3TVT A;  4E7K A;  1OPL A;  3OSV A;  3MKD A;  2LQK A;  3CPW P;  1UEB A;  4A4F A;  2EQM A;  2EPD A;  5KYX B;  4JJB A;  2CP0 A;  2KEA A;  2L3R A;  5GMK j;  2CSI A;  4C92 G;  3X26 B;  4OB2 B;  2VV5 A;  3CCQ A;  4D8K A;  5KYY A;  2A7Y A;  4L6V 5;  2ED1 A;  4C5H A;  5GAN j;  2KRS A;  4LD6 A;  1M90 C;  1UGR B;  2VUB A;  1D3B A;  4DOW A;  3QYG B;  5HKC A;  4QQ6 A;  3CCL A;  1FMV A;  2RM4 A;  4CI0 C;  4FCY A;  1YJW T;  4Q5W A;  5GAO r;  1X2K A;  1G3T A;  2EKO A;  4D6W A;  3MO8 A;  1UJ0 A;  4D8D A;  4BI4 A;  3OYL A;  1WHJ A;  4DEX A;  2NUP A;  1CKA A;  3PTA A;  2MYS A;  3LWI A;  3QII A;  4BUG A;  1JU5 C;  1QLY A;  1JBM A;  4DBQ A;  2EGE A;  1B07 A;  1PRM C;  1W6X A;  2B8A A;  1KC8 C;  4Y92 A;  2LCL A;  3UPU A;  4FL6 A;  4O6J A;  4GBQ A;  2RHI A;  5KCO A;  2L3P A;  4QT7 A;  2VKN A;  2JNG A;  4LN2 A;  4AFQ C;  4KH0 B;  4C8Q G;  3CCJ T;  1BK2 A;  2K9G A;  3M0S A;  3I56 T;  1IZ6 A;  2FYK A;  4DBF A;  5LJ3 f;  3NTH A;  4HT9 A;  2L3Q A;  2LP5 A;  1QWE A;  2P0K A;  3EH1 A;  3HFN A;  5I21 A;  1KIK A;  3CCM A;  1X2Q A;  2YT6 A;  3SWN A;  5HK3 A;  5LJ5 j;  4J9F A;  2CYZ B;  1QCF A;  3RBB B;  4CC7 A;  3OQ5 A;  3G4S Q;  2V8K A;  3CC7 A;  1H3H A;  4VUB A;  3M0T A;  4NOY A;  5M9O A;  1K9M C;  3NMZ C;  1K0S A;  1TOV A;  3OYK A;  1OZ3 A;  2NUT B;  2VB6 A;  1U8R A;  4M7A D;  2LNV A;  2P0Q A;  1G5V A;  1MMN A;  2WSC E;  2X4X A;  1UUE A;  1V1C A;  1ZBJ A;  4J9H A;  6AT1 B;  1NG2 A;  1VQ7 T;  5LJ3 d;  3SFM A;  1WQ7 A;  1IXD A;  1SHG A;  4ELZ C;  1I5O B;  3QWY A;  3VS2 A;  1K73 C;  4Z02 A;  1BIA A;  2QDY B;  1RAC B;  2YWW A;  1GFC A;  2ED0 A;  4BB7 A;  2X3W D;  3L2R A;  4GLK A;  4AFU C;  5J26 A;  4QVD A;  1KFZ A;  2C0I A;  4FW2 A;  1VYV A;  4J7I A;  3OB9 A;  4RKU E;  3V7S A;  4PNO A;  3CCJ A;  3OMC A;  2LQ8 A;  3I56 A;  5A0G A;  1VQP T;  1M27 C;  1K0X A;  4WCI A;  1VQO T;  3OYA A;  4OGE A;  1YFN A;  2EJ9 A;  4FYX B;  1AT1 B;  3EG9 A;  1M5Q 1;  4HA8 A;  3H41 A;  3M4G A;  3JCM J;  4C5G A;  4M75 C;  2EYQ A;  2YXY A;  1T0J A;  1RL2 A;  3OA6 A;  1QP3 A;  4B9W A;  3RES A;  3UA7 A;  2X9H A;  2ENM A;  2COZ A;  1ZQ1 A;  3BY7 A;  3E9F A;  4OMN A;  2EJG A;  3VRZ A;  2AZV A;  5KYW B;  3TCJ A;  1GXI E;  2E70 A;  1K76 A;  4IUT A;  1N27 A;  4C0G A;  3LYI A;  1OYX A;  2DXB A;  5GAM f;  2FO0 A;  4M7D C;  1M90 U;  2KRM A;  4KGZ B;  1QCN A;  3G7Z A;  3TSZ A;  2FZK B;  5FU7 B;  2AZS A;  3IQL A;  4DQ2 A;  3CD6 A;  1M3B A;  3VKI A;  1ZX6 A;  4BD3 A;  1YJ9 Q;  3LWH A;  3H0H A;  3UF4 A;  1N8R C;  1UG1 A;  1PHT A;  2HDA A;  4BDY A;  2YUO A;  2EYW A;  3S3N A;  2QQS A;  3E2U A;  1GRI A;  4PJM A;  1QKX A;  1GBQ A;  1M90 R;  1T3S A;  3CCE A;  4II1 A;  5DLQ E;  4PJO C;  5GAM d;  2RK2 A;  1KC8 U;  1NEG A;  2DNU A;  1VQ6 Q;  2ZAE A;  4J9E A;  2OTJ T;  3M4Y A;  5FRO A;  2LCS A;  2JTM A;  4O5V A;  3REA B;  2PNI A;  5CO7 A;  1OV3 A;  1O9S A;  3RMS A;  1VQ5 T;  3OMG A;  3HKS A;  1TUG B;  4C5I A;  1ZSZ A;  4J6X A;  2HEQ A;  3VS0 A;  4JJN K;  3EHR A;  1VQ8 Q;  2V26 A;  2H8H A;  2ZPG B;  4QVC A;  4WTO B;  2YRD A;  2GBQ A;  3PMT A;  2DPP B;  1GCQ C;  1U1S A;  2XI9 A;  1HYO A;  5KYN A;  4JS5 A;  4A4E A;  2QEX A;  1V29 B;  2ZPH B;  2X4W A;  1Y0M A;  1KC8 R;  2RQU A;  4YTL A;  2X4J A;  1WGS A;  2VAS A;  1K9M U;  4ELY C;  1D0Z A;  3RMQ A;  4PLL A;  1Q86 C;  1YCY A;  1YNZ A;  3I55 Q;  3VS5 A;  5KCH A;  9ATC B;  2KK4 A;  2OJ2 A;  3JRZ A;  3CCU A;  4KGV B;  4RCC A;  5GMK h;  2V8I A;  2D1X A;  3MEV A;  2DVJ A;  4MML A;  4JLG A;  4EDU A;  1YI2 T;  3M58 A;  2LVM A;  3BDL A;  3V8L A;  1K73 U;  2GNC A;  3G71 Q;  3PGG A;  2MCN A;  3QJ6 A;  4FM4 B;  1K9M R;  1LCK A;  2OTJ A;  1UHC A;  1VQ9 Q;  4X9C A;  4N0A C;  3RKY A;  4ME7 A;  1VQ5 A;  2HKQ B;  4Y91 A;  2ROL A;  5FLX E;  4RTX A;  1ZBX A;  2DD4 A;  4PJL A;  3NGP A;  4DBH A;  2RN8 A;  2LJ0 A;  4XTY A;  2E5Q A;  1I4K 1;  2K5L A;  1K73 R;  3M54 A;  1M8M A;  3R6N A;  3NFC A;  4WF2 A;  3KBG A;  1I8F A;  1W1F A;  4M7A F;  2E65 A;  4DEY A;  5KE2 A;  2K5I A;  5LL6 S;  3MEA A;  5CCA A;  3R6O A;  2KRO A;  3PE0 A;  1Z9Z A;  4LDW A;  3CMA A;  4OMO A;  1BKB A;  1K9A A;  4IUV A;  5HCK A;  4FW1 A;  3HTR A;  2QDL A;  2EQU A;  3H8Z A;  4C8Q B;  4HVW A;  4OB1 B;  5AYF A;  3OYJ A;  1YI2 A;  2FZG B;  1VIE A;  2O4X B;  4J5Y A;  1PKT A;  3EG1 A;  5LJ5 h;  2B86 A;  4OVA A;  4R0K A;  2A36 A;  1N8R U;  2GQI A;  5I11 A;  2DRM A;  1UE9 A;  5I2S A;  3JAM E;  2H3E B;  4TVR A;  2COW A;  1X01 A;  5GAN 7;  4J6W A;  1WHH A;  1RAH B;  4M77 A;  3A1P A;  5C0M A;  3KUF A;  1C6V X;  4KGX B;  5FU7 C;  4AMC A;  2QA4 Q;  2Y4X A;  1KG1 A;  1EIF A;  1N8R R;  4V2S A;  1D09 B;  1VQ4 T;  3QO3 A;  4RTZ A;  1MMD A;  1U1T A;  4M77 D;  4B6M A;  3PT9 A;  3GF5 A;  1MV3 A;  4ZNX A;  2BZX A;  1WHM A;  3DLM A;  2GFA A;  1YJN A;  2CSQ A;  4EPC A;  3FLG A;  3OYY A;  2QQ9 A;  1JEG A;  1YJ9 T;  2DZC A;  3MPU B;  2LC4 A;  4F7U E;  2Y4Y A;  2YUP A;  1UB4 A;  2LX7 A;  4PFP A;  5GMK e;  3MP1 A;  5CIU A;  3OYN A;  2EGA A;  1Q86 U;  4ESR A;  2OAU A;  3G1J A;  2C0T A;  1R0C B;  5GAN e;  1R77 A;  1WQW A;  3SHW A;  4C8Q E;  1D3B B;  4J83 A;  2KAF A;  4M78 E;  4X9D A;  2M16 A;  1VYU A;  2VC8 A;  2ZPI B;  3Q1J A;  3WVE B;  1BCM A;  1OU9 A;  2P0P A;  3BE3 A;  1TWB A;  4HCK A;  3ER0 A;  1VIF A;  3LH0 A;  5ECA A;  1Q86 R;  2DE0 X;  2KBT A;  1W70 A;  2RHY A;  1VQ4 A;  2VVK A;  2CKK A;  3OS2 A;  4AT1 B;  3UT1 A;  1SSH A;  2JN0 A;  1Q81 C;  2IVW A;  2MI6 A;  3I55 T;  2X51 A;  4C92 C;  5GAM g;  1M1F A;  2HSP A;  3G6E T;  2BE7 D;  3QYH B;  3M5A A;  3HSB A;  1RAB B;  1TTH B;  3BFM A;  4RTW A;  3NHN A;  1KQS A;  4HXJ A;  2KE9 A;  3G71 T;  5LJ5 e;  5FU6 B;  2PVO B;  3HHT B;  4ATO A;  1EX4 A;  2YSQ A;  2NYS A;  3O5Z A;  5GAN 8;  1TG0 A;  5GAO q;  4EMG A;  1VQ9 T;  4XTU A;  4EMK C;  4AFZ C;  5D6W A;  2COY A;  2JW4 A;  1SPK A;  4FT4 A;  1LVK A;  5IH2 A;  3VS4 A;  3VYG A;  2X35 A;  3QKJ A;  3NTI A;  1G2B A;  3JCM e;  5J3B A;  2QQR A;  4FU6 A;  3LX7 A;  2E1H A;  4E7S A;  3V8K A;  1KQS S;  2DL3 A;  3EG2 A;  2K57 A;  1MHN A;  2CT3 A;  4C8Q C;  2RPN A;  1NYG A;  2L3S A;  1JXM A;  2K3X A;  1NE8 A;  3PVL A;  3CC2 T;  1PKS A;  5HK0 A;  1Q82 U;  3I55 A;  5GAN 3;  1M2V B;  2NUZ A;  2LQN A;  2FZC B;  3G6E A;  3EGU A;  4JLI A;  4JPB W;  4LDU A;  1UJY A;  2J6K A;  2HQX A;  5FWC A;  4A53 A;  4J9B A;  3VV0 A;  1XJW B;  3WVD B;  2FB7 A;  3V7R A;  2HQE A;  1LOJ A;  1ZUK A;  2MWP A;  2RQT A;  1VQK T;  2DER A;  3EFO A;  5IHN A;  4C8Q D;  1ZUY A;  4QQD A;  1WLP B;  1I81 A;  2ATC B;  2L8D A;  3QZ5 B;  4QQG A;  4M78 D;  2DEQ A;  1Q82 R;  4M7D B;  5GJV B;  4RTV A;  2VGN A;  2DYI A;  3CCR Q;  2DYB A;  1U3O A;  4IUQ A;  2JM8 A;  4X1V A;  3CCS Q; 
#chains in the Genus database with same CATH homology
 3BDU A;  3WXM B;  1VQ8 T;  1XTD A;  4GY5 A;  1VQO T;  2E6N A;  1BI1 A;  4RG8 A;  3CBP A;  5CQX A;  4OGE A;  3OYA A;  1K8A C;  3CME T;  5D6Y A;  2EJ9 A;  3VYH B;  5GMK m;  4BAC A;  1QVG A;  2ZGW A;  3GPL A;  1UGQ B;  1M5Q 1;  4HA8 A;  3L2U A;  3M4G A;  4JRI A;  3JCM J;  2OTL T;  4C5G A;  5CR2 A;  3UDC A;  2XKO C;  4M75 C;  1YIT T;  2EYQ A;  3S3M A;  1YHQ T;  3CC2 A;  4M7D G;  1RL2 A;  3OA6 A;  1QP3 A;  4B9W A;  3RES A;  5J39 A;  3OYB A;  3T9N A;  4PJO F;  1BI2 A;  3DB4 A;  4PJO B;  5LJ3 h;  2ZCF B;  1M8V A;  2RI2 A;  1ZQ1 A;  2E41 A;  3BY7 A;  3E9F A;  4RG2 A;  1W2B S;  1YJ9 A;  2EJG A;  2R5A A;  2DO3 A;  4NS5 A;  4M77 F;  1Y96 B;  4C0Z A;  5LJ3 e;  5KE3 A;  5FRN A;  3CPW A;  4XAX B;  3TCJ A;  1GXI E;  2E70 A;  2E10 A;  1JB0 E;  1LNX A;  1PSE A;  2ZPB B;  1N27 A;  4IUT A;  4C0G A;  3LYI A;  1OYX A;  2RD1 A;  4DOV A;  1VQN T;  2DXB A;  5GAM f;  2L5Q A;  4M7D C;  1M90 U;  1Q81 U;  3LGL A;  4F7U B;  2R5M A;  2C06 A;  2K5F A;  3G7Z A;  4PKC C;  2L89 A;  3QXE B;  1QVG S;  4XTX A;  1VQK A;  2LDM A;  5FU7 B;  4ZGE B;  4MMK A;  4DQ2 A;  1YJN T;  3SWN B;  4MZT A;  3CD6 A;  2RJE A;  5IAY A;  3VKI A;  1HXD A;  1BYM A;  4BD3 A;  4N4G A;  2RHZ A;  1VQ6 A;  4KBM B;  3LWH A;  1N8R C;  1KQ2 A;  3QBY A;  2R57 A;  2DAQ A;  1B34 A;  4M75 E;  4PJO G;  1VQL A;  2M1H A;  4BDY A;  4KUD K;  2EJF A;  5CKE A;  4C92 D;  3A8M B;  3S3N A;  1TH7 A;  4M77 G;  3GNF B;  4BI8 B;  3OS1 A;  2QQS A;  5LJ3 j;  4NL2 A;  1QVP A;  4HCC A;  5FRM A;  4M78 B;  3CPW S;  5KH6 A;  2DTH A;  4OMF B;  1IRE B;  3S6W A;  1VQ8 A;  2GQV A;  3C94 A;  5GMK l;  4KT0 E;  3CCE A;  4ZN1 A;  3GIB A;  5CVI A;  4II1 A;  3LW5 E;  5DLQ E;  4PJO C;  2DD5 A;  3M57 A;  4F7U A;  5GAM d;  4E7H A;  2RK2 A;  3JCM X;  4M7D E;  1KC8 U;  4M7A A;  2XHC A;  2YHT A;  4QVZ A;  1Y07 A;  3URG A;  4M77 C;  4BE2 A;  2E64 A;  2F5K A;  3M4Y A;  3ME9 A;  5FRO A;  3OBY A;  2OTJ T;  4KUI A;  2JTM A;  4O5V A;  5CKH A;  3V8J A;  2OTL A;  1ZHI A;  1M4Z A;  2RJD A;  5CO7 A;  1O9S A;  1SSF A;  3RMS A;  1VQ5 T;  3OMG A;  5LJ3 g;  3HKS A;  2K4Y A;  1YHQ A;  4C5I A;  1WNL A;  1R8O B;  1VQM T;  3X20 B;  4J6X A;  5GAN 5;  2JUF A;  4JJN K;  4R56 A;  1PSF A;  3JB9 I;  4C8Q A;  3RKW A;  4BDZ A;  3L2V A;  1Y71 A;  3S3O A;  2ZPG B;  1YIJ A;  3OS5 A;  4QVC A;  1YJW A;  3PMT A;  5FU6 C;  3OY9 A;  2DPP B;  4E47 A;  2R58 A;  4M78 A;  5GAN 6;  1U1S A;  2O4X A;  2XI9 A;  3OW2 A;  3ZEH A;  4A4E A;  4ZN3 A;  1XQH A;  4RMO A;  2QEX A;  4JS5 A;  1VQN A;  1V29 B;  2ZPH B;  2X4W A;  1LJO A;  3EAE A;  5GAO m;  4ZTJ A;  1M1G A;  2RB6 A;  2KQW A;  4YTL A;  2X4J A;  1NJI C;  1WGS A;  4PJO E;  1K9M U;  4ELY C;  2PUO B;  4MZP A;  3CPF A;  5DY9 A;  2RJF A;  3L2W A;  3G71 A;  3RMQ A;  4PLL A;  5LJ5 f;  2XG8 D;  1Q86 C;  1YCY A;  4BE1 A;  2JVV A;  3NTK A;  3QDR B;  4LDV A;  5KCH A;  1UGP B;  3OYC A;  1S72 A;  3A5Z B;  3CCL T;  3JCM Q;  2KK4 A;  3JRZ A;  2JTF A;  2YLC A;  1Q7Y C;  2RI3 A;  3GNG A;  3CCU A;  1VQ9 A;  4RCC A;  4HT8 A;  5GMK h;  3P8H A;  5GAM h;  2XU8 A;  2V8I A;  1NPR A;  2M0O A;  2E6Z A;  2PUK B;  3FB9 A;  3HPW A;  5CKD A;  3MEV A;  4LD9 K;  4MML A;  2DZ9 A;  4JLG A;  4EDU A;  3JCM g;  3N5B B;  3QZ9 B;  1YI2 T;  3M58 A;  2LCC A;  2LVM A;  3BDL A;  3OW2 S;  3V8L A;  2GF7 A;  3FEO A;  3MP6 A;  1K73 U;  2QA4 T;  4IUR A;  3JB9 F;  3PGG A;  3QJ6 A;  2NLU A;  4FM4 B;  3QJY A;  2EIF A;  1FX7 A;  2EFI A;  3LGF A;  4IUP A;  4LDY A;  4BI3 A;  3OYG A;  3DKM A;  2BUD A;  4JRP A;  4C5E A;  2OTJ A;  4DA4 A;  3PMI A;  4X9C A;  1DJ7 B;  4N0A C;  4ME7 A;  3RKY A;  4JS4 A;  1VQ5 A;  2V8J A;  3HRU A;  4Y91 A;  4LDX A;  4JDS A;  1VQM A;  4JUV A;  5FLX E;  1B34 B;  2HNI A;  1ZBX A;  2DD4 A;  2RK1 A;  2VXF A;  3CBO A;  3VUZ A;  1K8A U;  3X24 B;  4PLI A;  4X34 A;  4XTY A;  3FDR A;  5A0D A;  2D6F A;  4XU3 A;  4M75 A;  5GAM j;  2E5Q A;  3FJP A;  3GOX A;  5GAO l;  1G3Y A;  1I4K 1;  2RI5 A;  2K5L A;  5IT9 E;  3M54 A;  2XD0 A;  4CRI A;  2DK3 A;  1FXX A;  3CCM T;  3JB9 G;  3M53 A;  3NFC A;  3MET A;  4WF2 A;  4C92 A;  4JRQ A;  3CC4 A;  3KBG A;  3TEE A;  2DJZ A;  4F7U F;  3FRN A;  2QXF A;  1I8F A;  1NZ9 A;  3SDZ A;  2LT4 A;  1KC8 C;  1VQ7 A;  4M7A F;  4M7A B;  3KXT A;  1FWZ A;  2E65 A;  2AHJ B;  4XU1 A;  3QG1 A;  1H64 1;  2K5I A;  5LL6 S;  5KE2 A;  3VJP A;  3CC7 T;  3MEA A;  4MDW A;  5CCA A;  3R6O A;  3A8H B;  4LDW A;  3CMA A;  2EQJ A;  4M75 D;  2XDP A;  1RI0 A;  1BKB A;  2LT1 A;  4BY6 B;  5GAN f;  3RER A;  1G3S A;  3ZBD A;  4Y28 E;  3H6Z A;  4IUV A;  2KY9 A;  3RKX A;  2RA2 A;  2P4T A;  3L2Q A;  2EQU A;  2CZ0 B;  3H8Z A;  4C8Q B;  2MF2 A;  1NPP A;  4OB1 B;  5AYF A;  2QQB A;  3CXC A;  3CCR T;  5EG2 A;  3OYJ A;  2DXU A;  1YI2 A;  2F69 A;  1VIE A;  4M78 F;  3CCV A;  3CCS T;  2F5T X;  1XNI A;  4EMK A;  2O4X B;  4J5Y A;  1JRI A;  3A8G B;  4RCB A;  1VQP A;  3MP8 A;  5LJ5 h;  4R55 A;  4M7D D;  4F7U G;  4OVA A;  3ZFJ A;  2QA4 A;  3MEU A;  1VQO A;  1N8R U;  4M7A G;  2ZZD A;  3DLL A;  3CME A;  1WJQ A;  5I2S A;  3JAM E;  4OB0 B;  4TVR A;  2KMT A;  2CZ1 B;  1W4S A;  3RUX A;  3ASK A;  3P8B B;  3JSC A;  2A3L A;  3OBW A;  3V7C A;  1X01 A;  5GAN 7;  4J6W A;  4L5G A;  3JB9 D;  1YIT A;  4NL3 A;  1KHC A;  4M77 A;  5GAN d;  1YBY A;  4M7A C;  5C0M A;  2RHX A;  3EFR A;  2I2L A;  3KUF A;  3QSU A;  3L1A A;  5FU7 C;  3CXC S;  2Y4X A;  4M78 G;  3SWN C;  4FT2 A;  1KD1 C;  2CZ7 B;  4BY6 C;  1KG1 A;  3OYF A;  4BE0 A;  1EIF A;  2QTX A;  2XIC A;  4V2S A;  3CCQ T;  4PJO D;  1VQ4 T;  3QO3 A;  3JCM c;  5CK9 A;  3F70 A;  4XU0 A;  3HRS A;  3E1S A;  1I5L A;  1U1T A;  1BIB A;  4M77 D;  4FSX A;  4L59 A;  4UC4 A;  3PT9 A;  3GF5 A;  4J6Y A;  4B9X A;  2RO0 A;  3DLM A;  2GFA A;  4M78 C;  1X6O A;  5A0L A;  1YJN A;  2MAM A;  2Y90 A;  2K2V A;  3L42 A;  4EPC A;  3JB9 J;  3FLG A;  3PFS A;  3OYY A;  2QQ9 A;  4A4G A;  1YJ9 T;  3JCM b;  2DZC A;  4XQ3 A;  2RJC A;  2BIV A;  2MMP A;  2LC4 A;  3MEW A;  3HL8 A;  4IUU A;  3EFS A;  4A4K A;  4F7U E;  3M9Q A;  2Y4Y A;  1NJI U;  1UB4 A;  1M1K C;  3INZ A;  4M7A E;  4M75 B;  4HCZ A;  5GMK e;  4OB3 B;  5I2M A;  3CBM A;  2FHD A;  3X28 B;  3MP1 A;  5GAM e;  2E12 A;  1MGQ A;  4P5N A;  2VXE A;  2EAY A;  5CIU A;  3OYN A;  2YLB A;  2HBP A;  1Q86 U;  3C12 A;  3OYD A;  3JB9 H;  4C92 F;  4C92 B;  2OAU A;  3OYM A;  5GAN h;  2EQK A;  1AHJ B;  2GFU A;  3OYH A;  2LX9 A;  3JCM f;  4ZTF A;  1Q7Y U;  3CD6 T;  3FC3 A;  5CKB A;  2XID A;  4KUL A;  5GAN e;  4HCB A;  1WQW A;  1M1K U;  4C8Q E;  1D3B B;  4N4I A;  1WPY A;  2XK0 A;  4E7K A;  1P92 A;  1VQL T;  3OSV A;  2LRQ A;  2FL7 A;  3PIP A;  4MDX A;  5DM7 R;  4J83 A;  2KAF A;  4M78 E;  4X9D A;  2KSS A;  2CS7 A;  3G4S T;  2M16 A;  5LJ5 d;  2VC8 A;  4E7I A;  2ZPI B;  2LQK A;  1M9S A;  3Q1J A;  1UEB A;  4A4F A;  2EQM A;  2KDS A;  1BI0 A;  3WVE B;  4N0A A;  1XOV A;  5GAO n;  2L3R A;  2EWN A;  2P0P A;  2DTI A;  3C95 A;  3M56 A;  3ER0 A;  3HFO A;  1UGS B;  1VIF A;  5GMK j;  3CCE T;  3LH0 A;  1JJ2 A;  5L8R E;  1KQ1 A;  1VUB A;  4EMK B;  4C92 G;  3C4S A;  3X26 B;  5C6S A;  4E7J A;  1N9S A;  2HD0 A;  4OB2 B;  2GCX A;  2CGH A;  2RHY A;  2VV5 A;  3CCQ A;  1VQ4 A;  2DXT A;  2ZPE B;  3UWN A;  2CKK A;  2A7Y A;  4QW2 A;  4L6V 5;  3OS2 A;  4C5H A;  3UT1 A;  5GAN j;  3JCM d;  3E9G A;  2WAC A;  4LD6 A;  2JN0 A;  2DVE A;  3SB2 A;  4A4H A;  1Q81 C;  1UGR B;  1M90 C;  2VUB A;  1D3B A;  2IVW A;  3BW1 A;  3P8D A;  3GP8 A;  4M7D A;  2MI6 A;  4DOW A;  5GAN 2;  3I55 T;  3QYG B;  5HKC A;  2H3J A;  4C92 C;  4QQ6 A;  5GAM g;  3CCL A;  2RM4 A;  2WSE E;  1M1F A;  4M77 B;  4CI0 C;  4E7L A;  1YIJ T;  4Q5W A;  4EMH A;  5GAO r;  1YJW T;  3HP9 A;  3G6E T;  1G3T A;  3O8V A;  3QYH B;  4ZGJ B;  3M5A A;  4C8Q F;  2EKO A;  3HSB A;  2O01 E;  4XTZ A;  2QQA A;  4D6W A;  2QEX T;  3MO8 A;  1WJS A;  2X4Y A;  4BI4 A;  3OYL A;  1JJ2 S;  5GAN g;  3VU3 C;  1QVF A;  2D0Q B;  3BFM A;  1H3Z A;  3OYI A;  4J8O A;  3VUB A;  3PTA A;  4J7F A;  2XDD A;  1KQS A;  3LWI A;  4XK8 E;  3G71 T;  3JCM V;  3QII A;  4BUG A;  4FIB A;  5LJ5 e;  1JBM A;  5FU6 B;  3J80 E;  2PVO B;  2BKD N;  2YRV A;  3HHT B;  4ATO A;  4C0D B;  1S72 T;  5GAO p;  2K3Y A;  2QI2 A;  3OSS C;  3QHS A;  5GAN 8;  3J7A F;  4OP0 A;  4EMG A;  5GAO q;  1VQ9 T;  3CCU T;  2B8A A;  5IN1 A;  4XTU A;  2DIG A;  3MHX A;  2LCL A;  4EMK C;  3UPU A;  5CAI A;  3TU4 K;  4FL6 A;  5D6W A;  4O6J A;  4PJO A;  2RHI A;  5D6X A;  3GLX A;  5A2Q E;  3G4S A;  3JCM P;  5KCO A;  4FT4 A;  1Y96 A;  5HY6 A;  4C92 E;  2JNG A;  3OS0 A;  3VYG A;  4C8Q G;  2D9T A;  2DXC A;  2X35 A;  3QKJ A;  4C0F A;  3OYE A;  2PQW A;  3I56 T;  3A8O B;  1Y7X A;  1IZ6 A;  3NTI A;  3JCM h;  2FYK A;  5LJ3 f;  3NTH A;  3HRT A;  4HT9 A;  3JCM e;  2IG0 A;  2KVQ G;  5J3B A;  2QQR A;  1Q82 C;  1QVF S;  4XU2 A;  2P0K A;  2M9U A;  3HFN A;  3L2Z A;  4FU6 A;  3JCM W;  5GMK i;  4IKF A;  4ZGD B;  3FIF A;  5I21 A;  3LX7 A;  2E1H A;  4N4H A;  3V8K A;  4JRK A;  3CCM A;  1KQS S;  1HK9 A;  3PIO A;  4OF1 A;  2G3R A;  2K57 A;  2WSF E;  1MHN A;  3SWN A;  5HK3 A;  5LJ5 j;  2CYZ B;  4C8Q C;  3X25 B;  3OQ5 A;  2V8K A;  2K3X A;  5DLO A;  3CC7 A;  2PVG B;  1NE8 A;  2DTO A;  3CC2 T;  4VUB A;  2VGM A;  3M59 A;  4NOY A;  3J81 E;  5M9O A;  3E19 A;  5HK0 A;  3I55 A;  1Q82 U;  1KD1 U;  5GAN 3;  3CCJ T;  3OYK A;  1K9M C;  5CKF A;  4OGC A;  1OZ3 A;  1QP2 A;  3TRE A;  2PVD B;  1U8R A;  4M7A D;  2LNV A;  1BI3 A;  2RHU A;  3G6E A;  4JLI A;  3A8L B;  2HAX A;  2JZ2 A;  2P0Q A;  4MZM A;  4C0D C;  3AHU A;  4LDU A;  5CQY A;  2FVU A;  1G5V A;  2JOY A;  2WSC E;  2HQX A;  2X4X A;  3PNW C;  4M75 F;  3CCR A;  2PU9 B;  3M55 A;  2VYT A;  4A53 A;  5LJ5 g;  3CC4 T;  3VV0 A;  2XDB A;  4PL6 A;  1OI1 A;  1VQ7 T;  5LJ3 d;  3WVD B;  3LLR A;  3SFM A;  3CCS A;  1WQ7 A;  2FB7 A;  3V7R A;  1N6A A;  2HQE A;  1LOJ A;  3SD4 A;  2LTO A;  2MWP A;  4ELZ C;  1VQK T;  4XTW A;  4M77 E;  4C8Q D;  3MCA B;  4A54 A;  4QQD A;  3CMA T;  1K73 C;  4Z02 A;  1BIA A;  2QDY B;  2RH2 A;  1I81 A;  2L8D A;  1KHI A;  3QZ5 B;  4QQG A;  1VQ6 T;  4M78 D;  1O75 A;  1WJR A;  2DEQ A;  3DB3 A;  1OZ2 A;  4XTV A;  4BB7 A;  3L2R A;  2ZPF B;  4M7D F;  4M7D B;  4GLK A;  2CZ6 B;  1W2B A;  2MWO A;  5J26 A;  4HKE A;  1G3W A;  1QW1 A;  2VGN A;  4QVD A;  2DKG A;  4J7I A;  3OB9 A;  4RKU E;  3V7S A;  3QPH A;  4IUQ A;  1X75 C;  4PNO A;  2DIQ A;  3CCJ A;  3CCV T;  5GAN 4;  3OMC A;  2LQ8 A;  1N9R A;  4M75 G;  3I56 A;  5A0G A;  1VQP T;  3RIR A;  3CEY A;  3QUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...