4M77F

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77F00
4C92B 3QO3A 4C8QB 4C8QG 3RERA 5LJ5e 1Y96B 3M4GA 5I21A 4F7UF 5GMKh 1Y96A 4MMKA 4M7DG 3JB9H 5GAOl 5GAN7 3QHSA 5LJ3f 4C8QD 2DEQA 2DVEA 3HFOA 2E65A 1B34A 4QVDA 4XTZA 5GMKl 2E41A 4M7DA 4PJOD 5GAOp 3SWNB 4Y91A 2ZGWA 4F7UE 1BIBA 3RKXA 5GAN8 4C92D 4XTWA 3BY7A 4X9DA 5GMKj 3JCMJ 2QTXA 4HT8A 3PGGA 5GANh 4XTUA 3FIFA 4M77E 1MGQA 3JCMV 3L2ZA 4HA8A 2FB7A 3BW1A 4C8QE 4C92F 4MMLA 3INZA 5GANd 4X9CA 3V8LA 4C92A 5GMKi 5LJ5d 3L1AA 3JB9F 4M78E 5DY9A 3EFSA 3RKWA 3JCMQ 3SWNC 4F7UB 2DJZA 4XU3A 4PJOF 2VXFA 5LJ5h 2DKGA 2YLCA 3FJPA 1M8VA 3VU3C 4C8QF 4XTXA 2DTOA 4J6YA 2DZCA 3SB2A 4M7DB 4V2SA 2I2LA 2RB6A 4M77B 5GAOm 4PJOC 1U1SA 4PJOG 2DTHA 4NL3A 2EAYA 4C92E 5GMKm 2VC8A 4M78A 2RD1A 4M75C 5LJ5f 5GANj 3AHUA 4M78F 4M75G 4PJOE 4M7DD 4PJOA 1D3BB 2DTIA 4M75D 5GAOn 5GAMf 5GAN6 4M7DC 5GAMe 3V8KA 3JB9G 2EJGA 3V7SA 4JLIA 1JRIA 1U1TA 4J6WA 3V7CA 5CAIA 1HK9A 5GAN4 3JB9J 4M7DF 4M78D 3JCMg 4C8QA 4M7AG 4M7AC 4EMKB 3BDUA 4M75B 5GAOr 2E10A 1TH7A 2RA2A 4NL2A 4C8QC 4M77D 2FYKA 3RUXA 4JRKA 1WPYA 4EMHA 5GAMh 4M77C 1WQWA 3FB9A 2RM4A 5GAMj 4M7AE 2YHTA 4J5YA 2E64A 5GAMd 5GAN2 4OP0A 5GAMg 3QUIA 2DXUA 4N0AA 4PNOA 5GANf 5GANe 5LJ3g 5LJ3e 4M77A 4A54A 4RCCA 4EMGA 3GIBA 1M5Q1 3RIRA 5GAOq 3JB9D 3JCMf 2EJFA 4M75E 1LJOA 1KQ2A 3JCMW 3V8JA 1LOJA 4M78B 4RCBA 4XTVA 2DZ9A 1WQ7A 4M7AF 4J6XA 4DQ2A 4JUVA 4HT9A 2E1HA 4F7UG 1I5LA 4M78G 3HFNA 2EJ9A 1HXDA 3RESA 4M78C 4M7AD 2VXEA 2CGHA 4M75A 5GMKe 3EFRA 4XTYA 1I81A 5GANg 3JCMP 1BIAA 4EMKA 2YLBA 4JRIA 4NOYA 2HNIA 5LJ3j 4F7UA 2Y90A 4EMKC 3HSBA 3JCMh 4M7AB 4A53A 4M7DE 4M7AA 1I4K1 3JCMX 1LNXA 2JN0A 1JBMA 1X01A 3JCMd 4QVCA 3BFMA 1B34B 3SWNA 2DXTA 3JCMc 5GAN3 1WNLA 4XU1A 5GAN5 3QSUA 4M77F 5LJ5g 1H641 3JCMb 4XU0A 4XU2A 5LJ5j 1N9SA 1D3BA 1N9RA 4WF2A 4C92C 3RKYA 3JB9I 2EWNA 1KQ1A 4N0AC 1YCYA 5LJ3h 4C92G 3V7RA 4M77G 4PJOB 2K57A 3JCMe 1I8FA 4M75F 4XQ3A 5LJ3d
chains in the Genus database with same CATH superfamily
4IKFA 3QO3A 2HQHA 3QG1A 1YIJQ 3OSSC 1WIEA 1ZSZB 1LCKA 1QWFA 3QYHB 3OYMA 2EYYA 1NEGA 1QVFS 5HY6A 3HFOA 9ATCB 1PG5B 1KC8C 2BE7D 1KQSP 2MOXA 2AZSA 3RKXA 3BY7A 1QCNA 2XU8A 3SDZA 4Q5WA 3VYHB 5KYXA 3A8MB 4J9GA 1ABOA 1VQNT 1ZSZC 3A8GB 2GFAA 1TU0B 4LDYA 4E7LA 4OB1B 1QVPA 4KGZB 2R5MA 1YI2T 1UGSB 2CYZB 1Q82C 4P5NA 3SB2A 3H6ZA 2GQIA 1VIFA 3M0PA 5IAYA 4E7KA 1WGSA 5FU6B 3AHUA 1XOVA 2G6FX 3V7SA 5HK3A 2H8HA 3DKMA 1FMWA 3CC4T 4EMKB 4OMQA 2K5LA 3H41A 3OYLA 3PTAA 3A8OB 2DPPB 2KMTA 2DXUA 4QT7A 5GANe 1Z9ZA 5CK9A 4BDYA 5C6SA 2HQEA 2DD4A 2OTJT 1VQ5T 4ZN3A 4PJMA 4AMCA 3NTIA 4EDUA 1M90C 3G71Q 1OZ2A 3MPUB 2F1LA 1BIAA 1N27A 2L3PA 5C0MA 3CEYA 1X01A 4KH1B 2KSSA 3I55Q 3Q1JA 1M4ZA 2O88A 4C92C 4A4FA 4XAXB 2EKOA 4DBRA 2FG0A 1M1FA 2FEIA 1UEBA 1D0YA 1K9MC 2K4YA 1B07A 4F7UF 1Y96A 3NGPA 1GRIA 2O4XB 4C5IA 1D1BA 1VQNA 2B8AA 3QDRB 1V29B 1QVGS 1KJWA 1QKWA 4XTWA 4C92D 4NS5A 4MDXA 3OQ5A 3CPWS 2A36A 1OYXA 3VS4A 2NUZA 5LJ5d 2ATCB 2O4XA 2DE0X 2YLCA 3G4SA 4LD6A 3JSCA 2ZAEA 1AVZC 3QPHA 2CP6A 2ENMA 4PJNA 3OYKA 3OYHA 2L3SA 3RBBB 1YHQA 3CC7Q 2LVMA 3MEVA 3CCQA 3JCMg 4HCCA 4AT1B 3PMIA 2QA4Q 2AK5A 4NL2A 3CCEA 5I2SA 3I55A 2NYSA 1IRXA 2X3XD 2FVUA 3C95A 1I07A 2ZPIB 2DRKA 2LCSA 5CKFA 2LQWA 4EMGA 4Y28E 2MYSA 3QBYA 1M5Q1 3E19A 3FRNA 2FL7A 3UT1A 4M7AF 2RHZA 1WHMA 3S6WA 1WYXA 5D7UA 2X4XA 3MCAB 1WXUA 1K8AC 2RI2A 1NYFA 3ME9A 1N6AA 2DYBA 1RI9A 2QGFB 4ANJA 4OMFB 2NUPB 1VQ5A 3JCMd 1MMGA 2DO3A 3JCMc 3MEWA 4N4HA 3SEMA 1G3TA 2DVJA 1N9RA 1H3ZA 1UFFA 2KT1A 2K57A 2KDSA 5I11A 1GL5A 4KBMB 3PE0A 1FXXA 4XQ3A 1IO6A 3RERA 1M1GA 1HSQA 3UA6A 2Z0WA 2BUDA 2KEAA 2LCCA 1TUCA 1W70A 1X75C 2DEQA 2E65A 4RTYA 2DBKA 5GMKl 4PJOD 1VQ7Q 1WFWA 2RO0A 3UDCA 2J6KA 4A63B 2AT1B 2ZGWA 1YJWQ 1VOMA 2DILA 2KE9A 2QDLA 3FC3A 4HT8A 4KRTA 1KQSA 2E6ZA 3CCRA 4M77E 3PFSA 2ZCFB 1VUBA 1ZLMA 3M57A 3V8LA 4ATOA 1UDLA 2XKOC 3VS1A 1M30A 4BDZA 4AG1C 3CC4A 1BCMA 1N5ZA 5GMKm 4M78F 4HVUA 5GAN6 2QK0A 2EJGA 4KUDK 2WACA 1TH7A 1CKAA 1O9SA 3M0TA 2LT4A 3RUXA 4AFQC 2OTLA 1M8MA 2GQVA 2HL5C 2CP3A 1K9MR 5GAMj 3ZBDA 1D1AA 2JTMA 2RQRA 3QUIA 5GANf 2ROLA 2JUFA 1IXDA 8ATCB 2ZPHB 1VQKA 1PRMC 1LJOA 3HHTB 4J9EA 2HKNA 3G4ST 4XTVA 1B3QA 2G3RA 2E1HA 2EJ9A 2QTVA 1HXDA 3THKA 1IGQA 4J9IA 4A4GA 2MMPA 1TUGB 2KI7A 3HPWA 2YUPA 5FW9A 2DLPA 2K3YA 3OYAA 5HCKA 3TU4K 3I9QA 3CBMA 3BE3A 1B34B 1WNLA 2MPXC 1N8RU 2CUBA 1WHKA 4JPBW 2PUOB 2YT6A 1KHCA 3WXMB 1WJQA 2OJ2A 5J3BA 3JCMe 2LCLA 3GF5A 1RAHB 3WVEB 4M7DG 5KE2A 4ESRA 2X35A 4JJCA 1B34A 4XTZA 4Y92A 4C5HA 3VS2A 3JCMJ 3TSZA 3HRUA 3CCRQ 2DIGA 3BW1A 2KGTA 4C8QE 3HRSA 2ZZDA 1QCOA 2PUKB 1YIJT 1VQMQ 3FLGA 1Q86U 4C5EA 1U3OA 4LXCA 1VQOQ 3OS0A 3P8BB 3VU3C 2XDDA 3G7ZA 4CC4B 4LDWA 2FZKB 1Q86C 2J06A 3PIOA 4C92E 5DLOA 2VC8A 5GANj 4M75G 4OMLA 3CCUQ 4XK8E 2YXYA 3JB9G 1BCOA 1YWOA 3CC2Q 1RACB 1W2BA 2RA2A 4C8QC 1YJNQ 5IXBA 1WPYA 2M0OA 2NUPA 2YHTA 4J5YA 1U8RA 4OP0A 1OZ3A 2AHJB 1VQOA 2A28A 4BACA 2L3QA 3I56A 3MEUA 4F7UG 1FMKA 1B7TA 2XI9A 5CQXA 5GANg 2OX7A 4XTYA 1GCPA 4FSXA 2FPEA 2JNGA 4EMKC 1M90U 3J7AF 3PMTA 1KG1A 1SSHA 2ED1A 3NPFA 2K3XA 4C5GA 1MMAA 3JB9I 4N0AC 5LJ3h 5GJWB 1S72A 4Z88A 1WHJA 2PU9B 3CQTA 4RMOA 1GFCA 5KYWB 3CXCS 3GNFB 2L3RA 3RDVA 1KC8R 4KGVB 1PKTA 3QZ9B 4MMKA 2XDPA 1T3LA 2RJEA 2FPFA 5DLQE 1SSFA 1AWXA 1TWBA 1K8AU 4OB2B 4FM4B 1UGQB 2R57A 3OBWA 4X9DA 3T9NA 3REAB 5GMKj 3TQ7P 2D9TA 2CUDA 2OAUA 1BU1A 2FB7A 1M2OA 2ZPGB 1OQKA 3GLXA 3OW2S 4OMMA 1YBYA 1GBRA 4F7UB 2C0TA 2LQNA 2FRWA 2O9VA 1K8AR 4V2SA 2I0NA 4JZ4A 3SFMA 1Q95G 2NUTB 2P0PA 3OY9A 2K9GA 4AFUC 3KBGA 4M75C 5LJ5f 2CT3A 4J83A 4OGEA 2HDAA 2E5QA 1NJIC 2JMCA 3PVQA 1I5OB 3MP1A 4JLIA 4M7AC 5FU6C 1AZGB 4BY6B 2CH4W 3FEOA 2DL8A 1NG2A 1IGUA 3I5SA 2KBTA 3TVTA 2E5KA 2PVDB 4LD9K 1VQ4T 2A7YA 3NMZC 1BI0A 1XTDA 1PM3A 4PNOA 2EYQA 3DLMA 5FLXE 4LDVA 5IHIA 1KQ2A 3CCST 1X27A 1QVGP 4JJBA 4RCBA 1JU5C 4OMPA 1UTIA 3E9FA 4M78C 4RTZA 2CGHA 5GMKe 2KNBB 1I81A 2QA4T 2L0AA 4J9FA 2FPDA 2DETA 1K4US 4RG2A 1FX7A 1ACMB 5KCHA 2DL5A 3UWNA 5M9OA 2DF6A 3LH0A 1N9SA 4WF2A 2WSFE 3H0IA 1M3BA 3DLLA 1VQ6T 2COZA 4A4EA 3J80E 2RQWA 1YJ9T 1RUWA 1K0SA 3JB9H 5KYYA 1NBEB 3HTRA 4KH0B 4RUGA 4F14A 4M7DA 5GAOp 4Y91A 4PL6A 1VQPT 5CVIA 3M59A 1PD1A 1E6GA 3PGGA 4PJLA 4RTVA 4XTUA 4Z89A 3QIIA 2C0OA 1PHTA 1R8OB 4CRIA 4BE1A 5DY9A 3RMSA 4N4IA 1R0BG 1AWOA 1YWPA 1OX9A 4ME7A 2W10A 1OU9A 4IUTA 2RI5A 4M7DB 4YTLA 3CCVQ 2V1RA 4IUPA 4PJOA 5HK0A 2KRSA 1R0CB 1YHQQ 1JRIA 4J6WA 3V7CA 1TS9A 1EZZB 1UJYA 3JRZA 2FYKA 4ELYC 3LWHA 3OS2A 3O8VA 2V8KA 2X4JA 1VQKQ 1FMVA 2QG9B 1M1KU 1IB8A 3QJYA 4M75E 4C0DB 3JCMW 3V8JA 3CCUA 2DERA 2KVQG 2DZ9A 2ESWA 2ZPBB 2LMJA 4X1VA 2ROTA 3ASKA 4JS4A 4ORZA 4II1A 2JT4A 3EHRA 3EFRA 1QCFA 1TOVA 3JCMh 3HSBA 1AZEA 4E7JA 5AT1B 1JJ2P 1EIFA 2A37A 2RI3A 2K79A 1I4K1 2EGCA 4CC7A 1XQHA 1RADB 2LJ3A 2AIRB 3VUBA 1T0JA 3QSUA 3OYEA 3OMGA 3EH2A 4XU2A 1M3AA 2ECZA 1SEMA 4OVAA 5LJ3d 3HL8A 3NFCA 5LJ5e 3M4GA 1P92A 1VQ7A 4E7ZA 3VS6A 1VQLT 2CREA 2LZ6B 4QKUA 1VQ8T 2YUNA 3L2RA 2KT8A 1Y57A 5KYUB 1UJ0A 1M2VA 3CC2A 3L2ZA 1HJDA 3CPWA 2EGAA 4RTXA 4M78E 4LDUA 5L23A 1MNDA 3G1JA 4C8QF 3REBB 3EG1A 1V76A 1GCQC 2GTJA 1VQ5Q 2IIMA 1NM7A 2MK5A 3CD6T 2HBPA 3PT9A 3G71T 5CIUA 1D3BB 2HSPA 4M75D 1G3YA 1MMDA 2HBWA 3MJXA 5CAIA 1KSWA 3QYGB 4C8QA 3PVLA 4L5GA 1ZUUA 3L2QA 1Q81R 1QQJA 5HKCA 2EYZA 4N0AA 2RNAA 4JRQA 3GIBA 1ZBXA 2MWPA 1BI3A 2HAXA 1T0HA 2WSCE 4RG8A 1RLQC 3CCMT 2LJ0A 3R6OA 4HT9A 5FRMA 3RESA 3HFNA 4M7AD 3TEEA 3KUFA 3CCJA 1SHGA 1G3SA 2LQ8A 4JRIA 2LDMA 2EKHA 5FU7B 2VWFA 4A53A 3CCVA 4M7AA 2GGRA 1RAEB 2JTEA 1WJRA 5LJ5g 3C94A 3A5ZB 2BE9B 2LNVA 1KIKA 3RKYA 2VKNA 1YN8A 2KRMA 3V7RA 2PZ1A 1JXOA 2QQ9A 1I8FA 1YJWA 4WCIA 2QQRA 5I21A 4HCBA 4BE0A 1UUEA 4X34A 2VUBA 1WX6A 1SF9A 5GAN7 1PRLC 3DB3A 1WHLA 2CP7A 3UF4A 2X4WA 1AT1B 3VJPA 4J9CA 1RL2A 3HKSA 1RI0A 2K6DA 3MP8A 4JZ3A 2DM1A 5GANd 3INZA 1VQ9A 2VGNA 1HD3A 2QYZA 3VS0A 1PCXA 8AT1B 5IN1A 2VXFA 2DKGA 2EW3A 2HL3A 2CT4A 2DTOA 4J6YA 3EGDB 3M0SA 4BI3A 5GAOm 3H8ZA 4ZGDB 2AKKA 2EAYA 4IIOA 1ABQA 1PNJA 4DOVA 2RD1A 4PJOE 4FYYB 5KH6A 2CZ0B 2DTIA 2QI2A 3M0QA 4M7DC 3GPLA 2LX9A 3CXCA 1WXBA 2RQVA 5CKBA 2QQBA 6AT1B 1AEYA 4FCYA 2X4YA 4AFSC 2YSQA 1BBZA 2J6OA 3ZFJA 5LJ3g 1YCSB 2XG8D 3H0HA 5GAOq 2EJFA 2EVRA 3I5RA 3EG9A 1RAGB 5KYXB 5CKEA 3P8DA 1QWEA 3UPUA 3MEAA 3RMQA 2LQKA 2E12A 5CCAA 2VXEA 2OI3A 1C1AA 1OI1A 3CCLT 2QEXQ 1K73U 4D8KA 2LNHB 1JBMA 1BKBA 1OULA 1WA7A 4BI4A 3CCLQ 1IHWA 2M02A 2EQUA 1VYTA 1UE9A 1WHGA 4M75F 2K5FA 4ZN1A 4EIKA 1UG1A 2VASA 3I35A 1Q7YC 3G6ET 3A8HB 2DK3A 4C8QD 2QEXA 5IHKA 2E3HA 4PKCC 1NLOC 1UECA 2V1QA 4KT0E 1ZHIA 1TSFA 3GP8A 1WI7A 2V8JA 3CMAQ 3M56A 2RHIA 4KULA 2NLUA 3EG0A 4J8OA 2CP5A 7AT1B 1AWJA 3NTKA 1TUDA 2JS2A 4HA8A 4PLIA 1BB9A 5CO7A 4LDXA 2MCNA 2RJFA 3SWNC 1M8VA 3OYIA 3CC7T 1VQMA 2RB6A 4NL3A 1KD1C 3CMET 5CR2A 1KC8U 2SEMA 1BI1A 1WDXA 3V8KA 2EFIA 3QZ5B 3L2WA 3JB9J 1HK9A 2MIOA 2RMOA 1YITT 3TCJA 4M77D 3EG2A 2K7AA 2W0ZA 2FZCB 1RABB 2IG0A 2FO0A 2BKDN 5KCOA 2MF2A 5LJ3e 3E9GA 2YUOA 1G83A 4M77A 2J05A 4RCCA 1H3HA 3U23A 4M78B 2PNIA 2LP5A 2COYA 2RK2A 1WQ7A 1YJNA 3M4YA 1NJIU 2RH2A 4GLMA 1GFDA 1VQ7T 5FWBA 2JVVA 4PJJA 5D6XA 2ZPEB 1UGRB 3BFMA 3A1PA 2NWMA 4E7HA 1TXQA 1PD0A 1NPRA 3ZL7C 1ZQ1A 3MP6A 4F16A 5A0LA 4C8QG 5GMKh 2H3EB 2OTLQ 1VYVA 1W6XA 1SKUB 2VB6A 1QP3A 3N5BB 1UB4A 3CBPA 2LTOA 2QDYB 4J9DA 3O5ZA 2RQUA 5D6WA 4QVZA 2D0NA 2CSQA 4PFPA 2O9SA 1YNZA 2CKKA 4LE9A 1Q7YU 4HCKA 4M4ZA 5IH2A 3P8HA 2V26A 3GOXA 4C0FA 3LX7A 3QXEB 2HSEB 2RHXA 1YJWT 2GCXA 1KD1R 3QWXX 2Y4XA 1M27C 3OS1A 4DBHA 4M75B 1Q86R 1CKBA 1ARKA 1R77A 1NYGA 2YRCA 2F2VA 2EYWA 1VIEA 2XDBA 1VQ8Q 4HXJA 1C0MA 2XHCA 4JUVA 4JDSA 1K9AA 5IT9E 4PLLA 1NEBA 2C06A 4M75A 3E1SA 5CKHA 4NOYA 4PK4A 2RPNA 2O31A 2JM9A 3QWYA 1TG0A 3M55A 2K5IA 2KROA 1MMNA 1LPLA 4QVCA 1YJ9A 1GBQA 2CZ6B 2P0KA 4XU1A 3F70A 1H641 3PIPA 2VVKA 3GNGA 3S3OA 2GF7A 1KK7A 3CCMQ 5CQYA 1BYMA 1W2BS 2MAMA 2DYIA 1U06A 3CBOA 1Y96B 5ECAA 4JS5A 1JJ2A 4J7IA 4TVRA 2QQAA 1ZBJA 1VQ6Q 5LJ3f 1D1CA 2K2MA 3VYGA 2E41A 4GBQA 3CMEA 2QA4A 3JAME 4OB0B 2DXBA 4HVWA 4FYVB 2PVGB 4F7UE 2M1HA 3CC7A 1GCQA 5A0DA 3S3MA 2DJQA 3ER0A 2YWWA 2M51A 4K11A 3FIFA 2DL3A 3CMAA 1VQ8A 1J3TA 2DX1A 2ZPFB 4R56A 2P0QA 2JXBA 3EGUA 3KFVA 2DJZA 4O6JA 3H9NA 4FYWB 2DZCA 3RNJA 5IXFA 4M77B 2LT1A 1SHFA 4M78A 4BY6C 2XIDA 5GAOn 3C0CA 4ZNXA 2E4HA 4M78D 4GY5A 3CCVT 2KXDA 4EMHA 4M77C 3LYIA 1C6VX 1OV3A 4DA4A 3RIRA 1KFZA 1Y0MA 3OB9A 2BTTA 3OYFA 1EFNA 1N8RR 2JTFA 3X25B 1Q82R 4J6XA 3G6EQ 3CMAT 2QEXT 4MZPA 1K9MU 1NPPA 3E2UA 3OW2A 2Y90A 4ZTFA 4Z8AA 1X6OA 3CC4Q 3M54A 1X43A 2Y4YA 1MHNA 4M7DE 3JCMX 1W1FA 2JOYA 1M3CA 2DXTA 4RTTA 5FWCA 5LJ5j 2D8HA 1YCYA 3HP9A 5A2QE 1Q81U 2VGMA 1XJWB 1NZ9A 3LGLA 3URGA 2E6NA 3VUZA 5KYNA 3CCLA 1Q7YR 1QVFA 3LLRA 2EBPA 2L8DA 3X28B 4O5VA 3OYYA 2DBMA 1YITQ 2P84A 2IVWA 3OW2P 3KXTA 3I56T 2K2VA 1EX4A 5GANh 1D0ZA 2L5QA 3L2VA 3H0FA 4FU6A 4BD3A 4E47A 5I22A 3JCMV 3LH5A 4MMLA 4C92A 2E70A 4DOWA 3SHWA 3X26B 2HMAA 1MV3A 4RKUE 2AZVA 2EYXA 1V1CA 2D0QB 1ZSGA 4PJOG 2KXCA 1AOJA 2ABLA 3JV3A 1M9SA 4IUUA 5GAMf 4KGXB 2DMOA 2DFUA 4E7IA 3OBYA 4OMOA 4BB7A 2ED0A 4IURA 4B6MA 1PSFA 3ZEHA 1BI2A 2J7IA 3CCEQ 1JXMA 1A0NB 1M90R 2DEUA 2DAQA 4A54A 3QKJA 2RF0A 3C4SA 4J7FA 3X24B 1KQSS 1LOJA 2O2OA 2K3BA 1VQ9Q 1S1NA 2D8JA 5A0GA 1I5LA 4M78G 2V8IA 3VRYA 4D6WA 2DIQA 3JCMP 2YLBA 4F7UA 1Y7XA 1VQPQ 2DRMA 3NTHA 3EAEA 5IHNA 1LNXA 4VUBA 1G8XA 5GAN3 2NUTA 2VV5A 4ZTJA 4XU0A 3UATA 3J81E 4R55A 1PC0A 3OSVA 1X2QA 2OAWA 3M5AA 3OS5A 3UA7A 1IZ6A 1MV0B 2M0YA 2RK1A 3RR6A 3QHSA 2DVEA 4QW2A 2E3IA 3CD6A 2EQKA 1I0CA 4R0KA 1BIBA 1TTHB 4DEXA 5GAN8 1NLPC 3CPFA 4GLKA 4C0ZA 4JRPA 1MGQA 1MNEA 1VQKT 1SPKA 1DJ7B 3FJ5A 2XD0A 3HRTA 3L1AA 1YJNT 3EFSA 3JCMQ 1UGPB 4PJOF 3FJPA 2L89A 4XTXA 4PJOC 4MZMA 2H3JA 2DTHA 3QDFA 3G4SQ 2JW4A 2XK0A 3G71A 2YDLA 5I2MA 1KHIA 2BZYA 3OYNA 1YITA 4IIMA 4FL6A 4HCZA 5GAOr 1PWTA 4BI8B 1U5SA 5GAMh 1E7OA 2COWA 4MDWA 1WLPB 2PQWA 5GAMg 2KYBA 1VQMT 3MKDA 3LWIA 2FHDA 4E6RA 2R58A 3CCRT 1YP5A 2R5AA 1ZUKA 3OYGA 2KAFA 2WSEE 3CPWP 2M9UA 1VQ4A 1VQ9T 1X69A 2HQXA 2KK4A 4CC3A 3LW5E 2JM8A 1IHVA 4JJDA 2JN0A 3A98A 2LC4A 4DBQA 1JQQA 5GAN5 2X51A 5AYFA 1WJSA 4Z02A 1AWWA 2QGGA 1OX8A 4PFZA 5KYWA 3AT1B 2D6FA 4C92B 1WHHA 1VA7A 3C12A 3BDLA 4QQGA 1T3SA 2F5TX 3ULRB 4B9WA 3MO8A 1YIJA 4L59A 1ZX6A 2RHYA 1M2VB 2QTXA 2HCKA 2F5KA 5EC7A 1NE8A 1QP2A 1OEBA 4C92F 2JZ2A 2EGEA 1X2KA 2LJ1A 4X9CA 5GJVB 4C0DC 2RJCA 4FIBA 3VRZA 2DL4A 4XU3A 4DEYA 1N8RC 5LJ5h 1VQNQ 4ZGEB 2D1XA 2EIFA 3M53A 1G5VA 1U1SA 1JJ2S 2O01E 1M1KR 1ZA1B 2JMAA 3FDRA 1UHFA 2HD0A 4FW1A 1K1ZA 2F2WA 5GAMe 3A8LB 1S72Q 2MI6A 4M7AG 2MWOA 3CMEQ 2E10A 3WVDB 2BIVA 1WXTA 2RM4A 5KYYB 4N4GA 5GAN2 2RJDA 1YI2Q 2GTOA 2FZGB 3VV0A 3EFOA 3JB9D 1AD5A 1X6GA 1SRMA 2DL7A 1Y71A 2SRCA 4AFZC 3I56Q 3L2UA 4A4KA 4ZGJB 2GBQA 5KE3A 1YJ9Q 3CCSQ 3CC2T 4FSSA 4EPCA 4IUQA 4LUDA 2CDTA 4B9XA 3EFOB 3M58A 5FROA 5J39A 2GFUA 2B86A 2HEQA 1D3BA 2EWNA 3PNWC 4PJOB 3L42A 4LUEA 3EG3A 2OTJQ 3META 1K76A 2AKLA 1H92A 1H8KA 3D7SB 3M0RA 1FWZA 2RQTA 4QVDA 3OYBA 2YRDA 3SWNB 2YRVA 2EQIA 3EGXB 1FYNA 2LRQA 3OYCA 4WTOB 3CCJT 2A08A 3MHXA 2OTJA 4C0GA 3CCMA 2A3LA 5GMKi 3VS5A 2X3WD 1JEGA 4A4HA 5CKDA 2DXCA 1ZSZA 4OB3B 3CCUT 5DM7R 2PTKA 2I2LA 3X20B 2P4TA 2EPDA 1OPKA 4OGCA 2QASA 3OYJA 4RTWA 2CZ7B 1XNIA 3OMCA 4L6V5 2CS7A 3G6EA 4KUIA 4OMNA 4E7SA 1SG5A 4M7DD 4RTUA 2EQMA 2QQSA 1W2BP 1F1BB 3EH1A 1G3WA 3OYDA 4FT4A 2X9HA 1U1TA 5J26A 4M7DF 2RHUA 3BDUA 2CZ1B 1GXIE 1UGVA 1ZUYA 4JRKA 3EHQA 1I1JA 1S72T 2KY9A 1WQWA 1WZOA 1RAAB 1YI2A 4M7AE 2E64A 5GAMd 4PFOA 5EG2A 1SRLA 2L2PA 1RAIB 5KYUA 3EG9B 1LVKA 3GBQA 3CCJQ 1CSKA 4QQDA 1RLPC 1AHJB 4DQ2A 4J9HA 2JJ9A 4FW2A 2DNUA 3DB4A 3SD4A 2LX7A 4EMKA 4CC2A 2HNIA 3VS3A 1YFNA 2OTLT 3EGDA 4LNPA 3CCET 1VQLA 1UHCA 1X6BA 1OPLA 1D09B 1D0XA 1M1KC 2M16A 4CI0C 1YHQT 1KQ1A 4DBFA 2HZYA 4M77G 4J9BA 2PVOB 1OU8A 4C8QB 1QW1A 1PSEA 1IREB 1VQ6A 2BZ8A 4OF1A 2YUQA 5GAOl 1Q82U 4QQ6A 2C0IA 1NJIR 1Z9QA 4F04B 1ZA2B 1K0XA 1MUZA 1BK2A 1QVGA 1QLYA 2KQWA 1OOTA 2A0FB 2KRNA 2CSIA 2HKQB 1VQOT 2DD5A 2KYMA 4HKEA 1W4SA 3JB9F 3VKIA 3RKWA 3VS7A 4F17A 1QKXA 1HYOA 3CCSA 4BUGA 3R6NA 1JO8A 1PKSA 3TREA 3QJ6A 4BE2A 3LGFA 2EQJA 2IPOB 1VQ4Q 1O75A 2XMFA 4LN2A 3M9QA 5D6YA 2XICA 4AG2C 5GAN4 2P4RA 4UC4A 3CD6Q 2CP2A 3CXCP 4IUVA 1Q81C 3IQLA 1VQLQ 3FB9A 1JB0E 3NHNA 1K73R 3S3NA 5LL6S 1K73C 2J6FA 4E2FB 3JCMf 1G2BA 1QVFP 1Y07A 4FT2A 5FRNA 2JS0A 5FU7C 1RAFB 1VYUA 4ELZC 1E6HA 4MZTA 5LJ3j 3I55T 3TSWA 1KD1U 4M7AB 3OA6A 2F69A 2VYTA 1VQPA 2CH4A 2RN8A 2QAZA 4HVVA 2GNCA 3CCQT 4D8DA 3SWNA 2CP0A 4JJNK 2F2XA 4M77F 3M0UA 1QMCA 3JCMb 3EGXA 4JLGA 4C92G 4FYXB 2FRYA 3CCQQ 2DA9A 2BZXA 2QXFA 5L8RE 2KR3A
chains in the Genus database with same CATH topology
4IKFA 3QO3A 3CXCS 3GNFB 2L3RA 3QG1A 1Q7YC 3OSSC 3M5AA 3QZ9B 4MMKA 3OS5A 3G6ET 1VQOT 3A8HB 2XDPA 3QYHB 1IZ6A 2RK1A 3OYMA 2RJEA 5DLQE 2DK3A 3QHSA 4C8QD 2DVEA 1SSFA 3HFOA 5HY6A 2QEXA 1QVFS 4QW2A 4PKCC 1KC8C 3CD6A 4KT0E 1ZHIA 2EQKA 4OB2B 2V8JA 4FM4B 1UGQB 3GP8A 2R57A 1K8AU 1BIBA 3RKXA 5GAN8 3BY7A 3M56A 3OBWA 4X9DA 3T9NA 2RHIA 5GMKj 4KULA 2NLUA 2XU8A 3CPFA 4GLKA 4Q5WA 3SDZA 3A8MB 3VYHB 2D9TA 4C0ZA 4JRPA 4J8OA 2OAUA 1MGQA 3NTKA 4HA8A 2FB7A 4PLIA 1VQKT 2ZPGB 5CO7A 1VQNT 1DJ7B 3GLXA 3OW2S 3A8GB 2GFAA 4LDXA 4LDYA 4E7LA 3HRTA 2XD0A 3L1AA 4OB1B 1YJNT 3EFSA 3JCMQ 1UGPB 1QVPA 1YBYA 2RJFA 3SWNC 2R5MA 4F7UB 1YI2T 4PJOF 1UGSB 3FJPA 1M8VA 2CYZB 1Q82C 2L89A 4P5NA 4XTXA 3OYIA 1VQMA 3CC7T 3SB2A 4V2SA 2RB6A 3H6ZA 4PJOC 4MZMA 2H3JA 3SFMA 1VIFA 2DTHA 5IAYA 4NL3A 4E7KA 1KD1C 3OY9A 2P0PA 3CMET 2XK0A 1WGSA 3G71A 3KBGA 4M75C 5LJ5f 5CR2A 5FU6B 1KC8U 3AHUA 4J83A 5I2MA 1BI1A 4OGEA 2E5QA 1KHIA 1NJIC 3V8KA 3OYNA 2EFIA 3QZ5B 3L2WA 1XOVA 3V7SA 5HK3A 3MP1A 4JLIA 3JB9J 1YITA 4M7AC 1HK9A 1YITT 4FL6A 5FU6C 3TCJA 3DKMA 4HCZA 4BY6B 4EMKB 3CC4T 5GAOr 2K5LA 3FEOA 4M77D 4BI8B 5GAMh 3OYLA 3PTAA 2IG0A 3A8OB 2PVDB 4LD9K 2DPPB 2A7YA 1VQ4T 4MDWA 2KMTA 1BI0A 1XTDA 2BKDN 2DXUA 2PQWA 4PNOA 2MF2A 5KCOA 5GAMg 5GANe 1VQMT 5LJ3e 3E9GA 2EYQA 4M77A 4RCCA 3DLMA 5CK9A 5FLXE 3LWIA 4BDYA 4LDVA 5C6SA 2FHDA 2DD4A 2HQEA 1KQ2A 2R58A 2OTJT 3CCST 1VQ5T 4ZN3A 4M78B 3CCRT 2R5AA 4RCBA 2RK2A 1WQ7A 1YJNA 3NTIA 3M4YA 4EDUA 1NJIU 1M90C 3OYGA 2KAFA 2RH2A 2WSEE 1OZ2A 3E9FA 4M78C 2CGHA 5GMKe 2M9UA 1VQ4A 1VQ9T 1I81A 1BIAA 2QA4T 1N27A 2HQXA 1VQ7T 2KK4A 3LW5E 2JVVA 5C0MA 3CEYA 4RG2A 5D6XA 2JN0A 1X01A 2ZPEB 2KSSA 1UGRB 2LC4A 3BFMA 3Q1JA 1M4ZA 1FX7A 5KCHA 5GAN5 3UWNA 5M9OA 4E7HA 3LH0A 1N9SA 4WF2A 2WSFE 5AYFA 4A4FA 4C92C 1WJSA 4Z02A 4XAXB 2EKOA 3DLLA 1NPRA 1M1FA 1ZQ1A 1VQ6T 3MP6A 1UEBA 4A4EA 3J80E 2D6FA 4C92B 1K9MC 2K4YA 5A0LA 4C8QG 3C12A 3BDLA 1YJ9T 4QQGA 4F7UF 5GMKh 1Y96A 2O4XB 4C5IA 3JB9H 2F5TX 4B9WA 1VQNA 2B8AA 3MO8A 1YIJA 3QDRB 4M7DA 5GAOp 1V29B 4Y91A 4PL6A 1VQPT 1QVGS 1QP3A 3N5BB 4L59A 1UB4A 3CBPA 2LTOA 2RHYA 2QDYB 4XTWA 4C92D 5CVIA 3M59A 2QTXA 4NS5A 5D6WA 3PGGA 2F5KA 4QVZA 4MDXA 4XTUA 3OQ5A 3QIIA 1R8OB 4CRIA 3CPWS 1NE8A 2CKKA 1QP2A 1OYXA 4C92F 4BE1A 2JZ2A 4X9CA 4C0DC 1Q7YU 5LJ5d 2RJCA 4FIBA 5DY9A 3RMSA 4N4IA 2O4XA 4XU3A 1N8RC 4ME7A 3P8HA 5LJ5h 2YLCA 4ZGEB 3G4SA 4IUTA 3GOXA 2EIFA 4C0FA 3M53A 2RI5A 3LX7A 4LD6A 4YTLA 4M7DB 1G5VA 3JSCA 1U1SA 3QXEB 1JJ2S 2O01E 2RHXA 1YJWT 2GCXA 3QPHA 3FDRA 4IUPA 3OYKA 4PJOA 3OYHA 2Y4XA 2HD0A 5HK0A 5GAMe 1YHQA 3A8LB 3OS1A 2LVMA 1JRIA 3MEVA 4J6WA 3V7CA 2MI6A 3CCQA 3JCMg 4M7AG 2MWOA 4HCCA 4M75B 3PMIA 2E10A 4NL2A 3WVDB 3JRZA 2BIVA 2FYKA 4ELYC 3CCEA 5I2SA 3I55A 3LWHA 3OS2A 2FVUA 3C95A 2V8KA 3O8VA 2X4JA 2RM4A 2ZPIB 4N4GA 5GAN2 2RJDA 1M1KU 5CKFA 4EMGA 4Y28E 1VIEA 3QJYA 2XDBA 3QBYA 1M5Q1 3E19A 3VV0A 3JB9D 4M75E 4C0DB 3FRNA 3JCMW 3V8JA 3CCUA 2FL7A 2KVQG 3UT1A 2DZ9A 4M7AF 2ZPBB 2RHZA 2XHCA 3S6WA 4JUVA 4JDSA 5IT9E 4PLLA 2C06A 3ASKA 4JS4A 1Y71A 4II1A 3L2UA 2X4XA 4M75A 3E1SA 3EFRA 3MCAB 5CKHA 4A4KA 4ZGJB 1K8AC 2RI2A 5KE3A 3ME9A 4NOYA 1N6AA 3HSBA 3JCMh 3CC2T 4E7JA 4EPCA 1EIFA 2RI3A 3M55A 2K5IA 1I4K1 4OMFB 4IUQA 1VQ5A 3JCMd 1XQHA 1YJ9A 4QVCA 2CZ6B 3VUBA 2DO3A 2P0KA 3JCMc 4B9XA 4XU1A 3MEWA 4N4HA 3QSUA 3F70A 1H641 3M58A 5FROA 1G3TA 5J39A 3PIPA 3OYEA 3OMGA 2GFUA 4XU2A 1D3BA 1N9RA 3GNGA 3S3OA 1H3ZA 2EWNA 2GF7A 3PNWC 4PJOB 3L42A 5CQYA 1BYMA 2K57A 2KDSA 4KBMB 2MAMA 1FXXA 1W2BS 4OVAA 4XQ3A 5LJ3d 3META 3CBOA 3HL8A 1M1GA 3NFCA 5LJ5e 3RERA 1Y96B 1JJ2A 3M4GA 4JS5A 1P92A 4J7IA 2BUDA 2LCCA 4TVRA 1X75C 2QQAA 5LJ3f 1FWZA 2DEQA 2E65A 1VQ7A 4QVDA 3OYBA 1VQLT 3VYGA 2E41A 5GMKl 3CMEA 2QA4A 3JAME 4PJOD 2RO0A 3SWNB 3UDCA 1VQ8T 2DXBA 4OB0B 2ZGWA 2PVGB 2YRVA 2M1HA 4F7UE 3L2RA 3CC7A 2LRQA 3OYCA 3FC3A 5A0DA 4HT8A 3S3MA 3ER0A 1KQSA 3CC2A 2E6ZA 3CCJT 3CCRA 3FIFA 3MHXA 4M77E 2OTJA 3PFSA 3L2ZA 3CMAA 2ZCFB 1VQ8A 1VUBA 2ZPFB 3M57A 4C0GA 3V8LA 4R56A 2A3LA 2P0QA 5GMKi 2XKOC 3CPWA 3CCMA 4ATOA 4M78E 4LDUA 4BDZA 4A4HA 5CKDA 2DJZA 4O6JA 2DXCA 4OB3B 4C8QF 3CC4A 3CCUT 5DM7R 2DZCA 2I2LA 4M77B 2P4TA 4OGCA 3X20B 3OYJA 2CZ7B 1XNIA 2LT1A 3OMCA 4L6V5 2HBPA 3PT9A 5GMKm 2CS7A 3G6EA 4KUIA 3CD6T 4M78A 4BY6C 4M78F 3G71T 4M7DD 1D3BB 2XIDA 4M75D 5CIUA 2EQMA 2QQSA 5GAN6 1G3YA 5GAOn 1G3WA 2EJGA 3OYDA 4FT4A 5J26A 1U1TA 5CAIA 4KUDK 4M7DF 2RHUA 3QYGB 4M78D 4C8QA 4GY5A 3BDUA 3CCVT 2CZ1B 2WACA 1TH7A 1GXIE 1O9SA 2LT4A 4L5GA 3RUXA 2OTLA 4JRKA 2GQVA 4EMHA 3L2QA 1S72T 4M77C 2KY9A 1WQWA 5GAMj 3ZBDA 1YI2A 4M7AE 5HKCA 2JTMA 2E64A 3LYIA 5GAMd 3QUIA 5EG2A 4N0AA 5GANf 2JUFA 4JRQA 4DA4A 1ZBXA 2MWPA 2ZPHB 1BI3A 3RIRA 1VQKA 3GIBA 1LJOA 3HHTB 3OB9A 3OYFA 2HAXA 3G4ST 2WSCE 2JTFA 4XTVA 4RG8A 3X25B 2G3RA 3CCMT 4J6XA 4QQDA 3R6OA 1AHJB 4DQ2A 4HT9A 2E1HA 3CMAT 5FRMA 3RESA 2EJ9A 3HFNA 1HXDA 4MZPA 3TEEA 2QEXT 4M7AD 3KUFA 3DB4A 3SD4A 3CCJA 1K9MU 1G3SA 1NPPA 2LQ8A 4A4GA 4EMKA 2MMPA 4JRIA 2HNIA 3HPWA 2LDMA 3OW2A 2Y90A 3OYAA 4ZTFA 2K3YA 1X6OA 2OTLT 5FU7B 3M54A 3TU4K 4A53A 2Y4YA 1MHNA 3CCVA 4M7AA 4M7DE 3JCMX 2JOYA 3CBMA 3CCET 1VQLA 1B34B 2DXTA 1WNLA 1N8RU 1WJRA 5LJ5g 3C94A 3A5ZB 1M1KC 2LNVA 2M16A 5LJ5j 2PUOB 4CI0C 1YHQT 1KHCA 3RKYA 1KQ1A 3WXMB 1YCYA 3HP9A 3V7RA 4M77G 1WJQA 5J3BA 5A2QE 1Q81U 2VGMA 3JCMe 2PVOB 2QQ9A 2LCLA 1I8FA 1YJWA 1NZ9A 3GF5A 3LGLA 3URGA 2E6NA 4C8QB 2QQRA 3VUZA 1QW1A 1PSEA 3WVEB 5I21A 1IREB 3CCLA 4OF1A 4HCBA 4BE0A 1VQ6A 4M7DG 1QVFA 4X34A 5KE2A 3LLRA 2VUBA 2X35A 5GAOl 5GAN7 1Q82U 4QQ6A 1B34A 2L8DA 4XTZA 3X28B 4C5HA 3DB3A 4O5VA 3OYYA 2X4WA 2IVWA 1QVGA 3KXTA 2KQWA 3VJPA 3I56T 3JCMJ 2K2VA 5GANh 1RL2A 2L5QA 3L2VA 4FU6A 4BD3A 3HKSA 1RI0A 3MP8A 2DD5A 3JCMV 4E47A 3HRUA 1W4SA 4HKEA 2DIGA 3BW1A 4C8QE 5GANd 3HRSA 3INZA 4MMLA 2VGNA 1VQ9A 4C92A 2ZZDA 3JB9F 2PUKB 2E70A 4DOWA 3VKIA 1YIJT 3RKWA 3X26B 5IN1A 3FLGA 1Q86U 4C5EA 2VXFA 4RKUE 2DKGA 3OS0A 3P8BB 3VU3C 2XDDA 3G7ZA 2DTOA 4J6YA 4LDWA 3CCSA 4BUGA 2D0QB 4BI3A 5GAOm 3TREA 3H8ZA 4ZGDB 4PJOG 1Q86C 2EAYA 3PIOA 4C92E 3QJ6A 5DLOA 4DOVA 4BE2A 2VC8A 2RD1A 5GANj 4PJOE 1M9SA 4M75G 3LGFA 5KH6A 2CZ0B 2DTIA 2QI2A 4IUUA 5GAMf 2EQJA 4M7DC 3GPLA 4XK8E 3JB9G 1O75A 2LX9A 3CXCA 3M9QA 5D6YA 2XICA 5GAN4 4UC4A 5CKBA 4E7IA 2QQBA 3OBYA 4BB7A 1W2BA 2RA2A 4C8QC 4IURA 4IUVA 2X4YA 1WPYA 2M0OA 1Q81C 1PSFA 3ZEHA 1BI2A 3FB9A 2YHTA 4J5YA 1JB0E 1U8RA 4OP0A 1OZ3A 2AHJB 2DAQA 5LL6S 3ZFJA 4A54A 5LJ3g 3S3NA 1VQOA 1K73C 2XG8D 4BACA 5GAOq 3QKJA 3JCMf 2EJFA 3C4SA 4J7FA 3X24B 1Y07A 1LOJA 1KQSS 4FT2A 5CKEA 3I56A 3P8DA 3MEUA 5FRNA 3UPUA 3MEAA 5A0GA 3RMQA 4F7UG 1I5LA 5FU7C 2LQKA 2E12A 2V8IA 2XI9A 4M78G 5CQXA 4D6WA 2VXEA 2DIQA 4ELZC 5CCAA 5GANg 4XTYA 3JCMP 4MZTA 2YLBA 1OI1A 4FSXA 5LJ3j 4F7UA 2JNGA 4EMKC 3I55T 3CCLT 1Y7XA 1KD1U 4M7AB 3OA6A 2F69A 1K73U 1M90U 2VYTA 1VQPA 3J7AF 3NTHA 3EAEA 1LNXA 1JBMA 3PMTA 3CCQT 1KG1A 1BKBA 4VUBA 3SWNA 4JJNK 5GAN3 4M77F 2VV5A 4BI4A 4ZTJA 3JCMb 2K3XA 4XU0A 3J81E 4C5GA 4JLGA 3JB9I 4R55A 4C92G 4N0AC 2EQUA 5LJ3h 1S72A 3OSVA 2PU9B 2QXFA 5L8RE 4M75F 2K5FA 4RMOA 4ZN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 B;  3QO3 A;  4C8Q B;  4C8Q G;  3RER A;  5LJ5 e;  1Y96 B;  3M4G A;  5I21 A;  4F7U F;  5GMK h;  1Y96 A;  4MMK A;  4M7D G;  3JB9 H;  5GAO l;  5GAN 7;  3QHS A;  5LJ3 f;  4C8Q D;  2DEQ A;  2DVE A;  3HFO A;  2E65 A;  1B34 A;  4QVD A;  4XTZ A;  5GMK l;  2E41 A;  4M7D A;  4PJO D;  5GAO p;  3SWN B;  4Y91 A;  2ZGW A;  4F7U E;  1BIB A;  3RKX A;  5GAN 8;  4C92 D;  4XTW A;  3BY7 A;  4X9D A;  5GMK j;  3JCM J;  2QTX A;  4HT8 A;  3PGG A;  5GAN h;  4XTU A;  3FIF A;  4M77 E;  1MGQ A;  3JCM V;  3L2Z A;  4HA8 A;  2FB7 A;  3BW1 A;  4C8Q E;  4C92 F;  4MML A;  3INZ A;  5GAN d;  4X9C A;  3V8L A;  4C92 A;  5GMK i;  5LJ5 d;  3L1A A;  3JB9 F;  4M78 E;  5DY9 A;  3EFS A;  3RKW A;  3JCM Q;  3SWN C;  4F7U B;  2DJZ A;  4XU3 A;  4PJO F;  2VXF A;  5LJ5 h;  2DKG A;  2YLC A;  3FJP A;  1M8V A;  3VU3 C;  4C8Q F;  4XTX A;  2DTO A;  4J6Y A;  2DZC A;  3SB2 A;  4M7D B;  4V2S A;  2I2L A;  2RB6 A;  4M77 B;  5GAO m;  4PJO C;  1U1S A;  4PJO G;  2DTH A;  4NL3 A;  2EAY A;  4C92 E;  5GMK m;  2VC8 A;  4M78 A;  2RD1 A;  4M75 C;  5LJ5 f;  5GAN j;  3AHU A;  4M78 F;  4M75 G;  4PJO E;  4M7D D;  4PJO A;  1D3B B;  2DTI A;  4M75 D;  5GAO n;  5GAM f;  5GAN 6;  4M7D C;  5GAM e;  3V8K A;  3JB9 G;  2EJG A;  3V7S A;  4JLI A;  1JRI A;  1U1T A;  4J6W A;  3V7C A;  5CAI A;  1HK9 A;  5GAN 4;  3JB9 J;  4M7D F;  4M78 D;  3JCM g;  4C8Q A;  4M7A G;  4M7A C;  4EMK B;  3BDU A;  4M75 B;  5GAO r;  2E10 A;  1TH7 A;  2RA2 A;  4NL2 A;  4C8Q C;  4M77 D;  2FYK A;  3RUX A;  4JRK A;  1WPY A;  4EMH A;  5GAM h;  4M77 C;  1WQW A;  3FB9 A;  2RM4 A;  5GAM j;  4M7A E;  2YHT A;  4J5Y A;  2E64 A;  5GAM d;  5GAN 2;  4OP0 A;  5GAM g;  3QUI A;  2DXU A;  4N0A A;  4PNO A;  5GAN f;  5GAN e;  5LJ3 g;  5LJ3 e;  4M77 A;  4A54 A;  4RCC A;  4EMG A;  3GIB A;  1M5Q 1;  3RIR A;  5GAO q;  3JB9 D;  3JCM f;  2EJF A;  4M75 E;  1LJO A;  1KQ2 A;  3JCM W;  3V8J A;  1LOJ A;  4M78 B;  4RCB A;  4XTV A;  2DZ9 A;  1WQ7 A;  4M7A F;  4J6X A;  4DQ2 A;  4JUV A;  4HT9 A;  2E1H A;  4F7U G;  1I5L A;  4M78 G;  3HFN A;  2EJ9 A;  1HXD A;  3RES A;  4M78 C;  4M7A D;  2VXE A;  2CGH A;  4M75 A;  5GMK e;  3EFR A;  4XTY A;  1I81 A;  5GAN g;  3JCM P;  1BIA A;  4EMK A;  2YLB A;  4JRI A;  4NOY A;  2HNI A;  5LJ3 j;  4F7U A;  2Y90 A;  4EMK C;  3HSB A;  3JCM h;  4M7A B;  4A53 A;  4M7D E;  4M7A A;  1I4K 1;  3JCM X;  1LNX A;  2JN0 A;  1JBM A;  1X01 A;  3JCM d;  4QVC A;  3BFM A;  1B34 B;  3SWN A;  2DXT A;  3JCM c;  5GAN 3;  1WNL A;  4XU1 A;  5GAN 5;  3QSU A;  4M77 F;  5LJ5 g;  1H64 1;  3JCM b;  4XU0 A;  4XU2 A;  5LJ5 j;  1N9S A;  1D3B A;  1N9R A;  4WF2 A;  4C92 C;  3RKY A;  3JB9 I;  2EWN A;  1KQ1 A;  4N0A C;  1YCY A;  5LJ3 h;  4C92 G;  3V7R A;  4M77 G;  4PJO B;  2K57 A;  3JCM e;  1I8F A;  4M75 F;  4XQ3 A;  5LJ3 d; 
#chains in the Genus database with same CATH topology
 4IKF A;  3QO3 A;  2HQH A;  3QG1 A;  1YIJ Q;  3OSS C;  1WIE A;  1ZSZ B;  1LCK A;  1QWF A;  3QYH B;  3OYM A;  2EYY A;  1NEG A;  1QVF S;  5HY6 A;  3HFO A;  9ATC B;  1PG5 B;  1KC8 C;  2BE7 D;  1KQS P;  2MOX A;  2AZS A;  3RKX A;  3BY7 A;  1QCN A;  2XU8 A;  3SDZ A;  4Q5W A;  3VYH B;  5KYX A;  3A8M B;  4J9G A;  1ABO A;  1VQN T;  1ZSZ C;  3A8G B;  2GFA A;  1TU0 B;  4LDY A;  4E7L A;  4OB1 B;  1QVP A;  4KGZ B;  2R5M A;  1YI2 T;  1UGS B;  2CYZ B;  1Q82 C;  4P5N A;  3SB2 A;  3H6Z A;  2GQI A;  1VIF A;  3M0P A;  5IAY A;  4E7K A;  1WGS A;  5FU6 B;  3AHU A;  1XOV A;  2G6F X;  3V7S A;  5HK3 A;  2H8H A;  3DKM A;  1FMW A;  3CC4 T;  4EMK B;  4OMQ A;  2K5L A;  3H41 A;  3OYL A;  3PTA A;  3A8O B;  2DPP B;  2KMT A;  2DXU A;  4QT7 A;  5GAN e;  1Z9Z A;  5CK9 A;  4BDY A;  5C6S A;  2HQE A;  2DD4 A;  2OTJ T;  1VQ5 T;  4ZN3 A;  4PJM A;  4AMC A;  3NTI A;  4EDU A;  1M90 C;  3G71 Q;  1OZ2 A;  3MPU B;  2F1L A;  1BIA A;  1N27 A;  2L3P A;  5C0M A;  3CEY A;  1X01 A;  4KH1 B;  2KSS A;  3I55 Q;  3Q1J A;  1M4Z A;  2O88 A;  4C92 C;  4A4F A;  4XAX B;  2EKO A;  4DBR A;  2FG0 A;  1M1F A;  2FEI A;  1UEB A;  1D0Y A;  1K9M C;  2K4Y A;  1B07 A;  4F7U F;  1Y96 A;  3NGP A;  1GRI A;  2O4X B;  4C5I A;  1D1B A;  1VQN A;  2B8A A;  3QDR B;  1V29 B;  1QVG S;  1KJW A;  1QKW A;  4XTW A;  4C92 D;  4NS5 A;  4MDX A;  3OQ5 A;  3CPW S;  2A36 A;  1OYX A;  3VS4 A;  2NUZ A;  5LJ5 d;  2ATC B;  2O4X A;  2DE0 X;  2YLC A;  3G4S A;  4LD6 A;  3JSC A;  2ZAE A;  1AVZ C;  3QPH A;  2CP6 A;  2ENM A;  4PJN A;  3OYK A;  3OYH A;  2L3S A;  3RBB B;  1YHQ A;  3CC7 Q;  2LVM A;  3MEV A;  3CCQ A;  3JCM g;  4HCC A;  4AT1 B;  3PMI A;  2QA4 Q;  2AK5 A;  4NL2 A;  3CCE A;  5I2S A;  3I55 A;  2NYS A;  1IRX A;  2X3X D;  2FVU A;  3C95 A;  1I07 A;  2ZPI B;  2DRK A;  2LCS A;  5CKF A;  2LQW A;  4EMG A;  4Y28 E;  2MYS A;  3QBY A;  1M5Q 1;  3E19 A;  3FRN A;  2FL7 A;  3UT1 A;  4M7A F;  2RHZ A;  1WHM A;  3S6W A;  1WYX A;  5D7U A;  2X4X A;  3MCA B;  1WXU A;  1K8A C;  2RI2 A;  1NYF A;  3ME9 A;  1N6A A;  2DYB A;  1RI9 A;  2QGF B;  4ANJ A;  4OMF B;  2NUP B;  1VQ5 A;  3JCM d;  1MMG A;  2DO3 A;  3JCM c;  3MEW A;  4N4H A;  3SEM A;  1G3T A;  2DVJ A;  1N9R A;  1H3Z A;  1UFF A;  2KT1 A;  2K57 A;  2KDS A;  5I11 A;  1GL5 A;  4KBM B;  3PE0 A;  1FXX A;  4XQ3 A;  1IO6 A;  3RER A;  1M1G A;  1HSQ A;  3UA6 A;  2Z0W A;  2BUD A;  2KEA A;  2LCC A;  1TUC A;  1W70 A;  1X75 C;  2DEQ A;  2E65 A;  4RTY A;  2DBK A;  5GMK l;  4PJO D;  1VQ7 Q;  1WFW A;  2RO0 A;  3UDC A;  2J6K A;  4A63 B;  2AT1 B;  2ZGW A;  1YJW Q;  1VOM A;  2DIL A;  2KE9 A;  2QDL A;  3FC3 A;  4HT8 A;  4KRT A;  1KQS A;  2E6Z A;  3CCR A;  4M77 E;  3PFS A;  2ZCF B;  1VUB A;  1ZLM A;  3M57 A;  3V8L A;  4ATO A;  1UDL A;  2XKO C;  3VS1 A;  1M30 A;  4BDZ A;  4AG1 C;  3CC4 A;  1BCM A;  1N5Z A;  5GMK m;  4M78 F;  4HVU A;  5GAN 6;  2QK0 A;  2EJG A;  4KUD K;  2WAC A;  1TH7 A;  1CKA A;  1O9S A;  3M0T A;  2LT4 A;  3RUX A;  4AFQ C;  2OTL A;  1M8M A;  2GQV A;  2HL5 C;  2CP3 A;  1K9M R;  5GAM j;  3ZBD A;  1D1A A;  2JTM A;  2RQR A;  3QUI A;  5GAN f;  2ROL A;  2JUF A;  1IXD A;  8ATC B;  2ZPH B;  1VQK A;  1PRM C;  1LJO A;  3HHT B;  4J9E A;  2HKN A;  3G4S T;  4XTV A;  1B3Q A;  2G3R A;  2E1H A;  2EJ9 A;  2QTV A;  1HXD A;  3THK A;  1IGQ A;  4J9I A;  4A4G A;  2MMP A;  1TUG B;  2KI7 A;  3HPW A;  2YUP A;  5FW9 A;  2DLP A;  2K3Y A;  3OYA A;  5HCK A;  3TU4 K;  3I9Q A;  3CBM A;  3BE3 A;  1B34 B;  1WNL A;  2MPX C;  1N8R U;  2CUB A;  1WHK A;  4JPB W;  2PUO B;  2YT6 A;  1KHC A;  3WXM B;  1WJQ A;  2OJ2 A;  5J3B A;  3JCM e;  2LCL A;  3GF5 A;  1RAH B;  3WVE B;  4M7D G;  5KE2 A;  4ESR A;  2X35 A;  4JJC A;  1B34 A;  4XTZ A;  4Y92 A;  4C5H A;  3VS2 A;  3JCM J;  3TSZ A;  3HRU A;  3CCR Q;  2DIG A;  3BW1 A;  2KGT A;  4C8Q E;  3HRS A;  2ZZD A;  1QCO A;  2PUK B;  1YIJ T;  1VQM Q;  3FLG A;  1Q86 U;  4C5E A;  1U3O A;  4LXC A;  1VQO Q;  3OS0 A;  3P8B B;  3VU3 C;  2XDD A;  3G7Z A;  4CC4 B;  4LDW A;  2FZK B;  1Q86 C;  2J06 A;  3PIO A;  4C92 E;  5DLO A;  2VC8 A;  5GAN j;  4M75 G;  4OML A;  3CCU Q;  4XK8 E;  2YXY A;  3JB9 G;  1BCO A;  1YWO A;  3CC2 Q;  1RAC B;  1W2B A;  2RA2 A;  4C8Q C;  1YJN Q;  5IXB A;  1WPY A;  2M0O A;  2NUP A;  2YHT A;  4J5Y A;  1U8R A;  4OP0 A;  1OZ3 A;  2AHJ B;  1VQO A;  2A28 A;  4BAC A;  2L3Q A;  3I56 A;  3MEU A;  4F7U G;  1FMK A;  1B7T A;  2XI9 A;  5CQX A;  5GAN g;  2OX7 A;  4XTY A;  1GCP A;  4FSX A;  2FPE A;  2JNG A;  4EMK C;  1M90 U;  3J7A F;  3PMT A;  1KG1 A;  1SSH A;  2ED1 A;  3NPF A;  2K3X A;  4C5G A;  1MMA A;  3JB9 I;  4N0A C;  5LJ3 h;  5GJW B;  1S72 A;  4Z88 A;  1WHJ A;  2PU9 B;  3CQT A;  4RMO A;  1GFC A;  5KYW B;  3CXC S;  3GNF B;  2L3R A;  3RDV A;  1KC8 R;  4KGV B;  1PKT A;  3QZ9 B;  4MMK A;  2XDP A;  1T3L A;  2RJE A;  2FPF A;  5DLQ E;  1SSF A;  1AWX A;  1TWB A;  1K8A U;  4OB2 B;  4FM4 B;  1UGQ B;  2R57 A;  3OBW A;  4X9D A;  3T9N A;  3REA B;  5GMK j;  3TQ7 P;  2D9T A;  2CUD A;  2OAU A;  1BU1 A;  2FB7 A;  1M2O A;  2ZPG B;  1OQK A;  3GLX A;  3OW2 S;  4OMM A;  1YBY A;  1GBR A;  4F7U B;  2C0T A;  2LQN A;  2FRW A;  2O9V A;  1K8A R;  4V2S A;  2I0N A;  4JZ4 A;  3SFM A;  1Q95 G;  2NUT B;  2P0P A;  3OY9 A;  2K9G A;  4AFU C;  3KBG A;  4M75 C;  5LJ5 f;  2CT3 A;  4J83 A;  4OGE A;  2HDA A;  2E5Q A;  1NJI C;  2JMC A;  3PVQ A;  1I5O B;  3MP1 A;  4JLI A;  4M7A C;  5FU6 C;  1AZG B;  4BY6 B;  2CH4 W;  3FEO A;  2DL8 A;  1NG2 A;  1IGU A;  3I5S A;  2KBT A;  3TVT A;  2E5K A;  2PVD B;  4LD9 K;  1VQ4 T;  2A7Y A;  3NMZ C;  1BI0 A;  1XTD A;  1PM3 A;  4PNO A;  2EYQ A;  3DLM A;  5FLX E;  4LDV A;  5IHI A;  1KQ2 A;  3CCS T;  1X27 A;  1QVG P;  4JJB A;  4RCB A;  1JU5 C;  4OMP A;  1UTI A;  3E9F A;  4M78 C;  4RTZ A;  2CGH A;  5GMK e;  2KNB B;  1I81 A;  2QA4 T;  2L0A A;  4J9F A;  2FPD A;  2DET A;  1K4U S;  4RG2 A;  1FX7 A;  1ACM B;  5KCH A;  2DL5 A;  3UWN A;  5M9O A;  2DF6 A;  3LH0 A;  1N9S A;  4WF2 A;  2WSF E;  3H0I A;  1M3B A;  3DLL A;  1VQ6 T;  2COZ A;  4A4E A;  3J80 E;  2RQW A;  1YJ9 T;  1RUW A;  1K0S A;  3JB9 H;  5KYY A;  1NBE B;  3HTR A;  4KH0 B;  4RUG A;  4F14 A;  4M7D A;  5GAO p;  4Y91 A;  4PL6 A;  1VQP T;  5CVI A;  3M59 A;  1PD1 A;  1E6G A;  3PGG A;  4PJL A;  4RTV A;  4XTU A;  4Z89 A;  3QII A;  2C0O A;  1PHT A;  1R8O B;  4CRI A;  4BE1 A;  5DY9 A;  3RMS A;  4N4I A;  1R0B G;  1AWO A;  1YWP A;  1OX9 A;  4ME7 A;  2W10 A;  1OU9 A;  4IUT A;  2RI5 A;  4M7D B;  4YTL A;  3CCV Q;  2V1R A;  4IUP A;  4PJO A;  5HK0 A;  2KRS A;  1R0C B;  1YHQ Q;  1JRI A;  4J6W A;  3V7C A;  1TS9 A;  1EZZ B;  1UJY A;  3JRZ A;  2FYK A;  4ELY C;  3LWH A;  3OS2 A;  3O8V A;  2V8K A;  2X4J A;  1VQK Q;  1FMV A;  2QG9 B;  1M1K U;  1IB8 A;  3QJY A;  4M75 E;  4C0D B;  3JCM W;  3V8J A;  3CCU A;  2DER A;  2KVQ G;  2DZ9 A;  2ESW A;  2ZPB B;  2LMJ A;  4X1V A;  2ROT A;  3ASK A;  4JS4 A;  4ORZ A;  4II1 A;  2JT4 A;  3EHR A;  3EFR A;  1QCF A;  1TOV A;  3JCM h;  3HSB A;  1AZE A;  4E7J A;  5AT1 B;  1JJ2 P;  1EIF A;  2A37 A;  2RI3 A;  2K79 A;  1I4K 1;  2EGC A;  4CC7 A;  1XQH A;  1RAD B;  2LJ3 A;  2AIR B;  3VUB A;  1T0J A;  3QSU A;  3OYE A;  3OMG A;  3EH2 A;  4XU2 A;  1M3A A;  2ECZ A;  1SEM A;  4OVA A;  5LJ3 d;  3HL8 A;  3NFC A;  5LJ5 e;  3M4G A;  1P92 A;  1VQ7 A;  4E7Z A;  3VS6 A;  1VQL T;  2CRE A;  2LZ6 B;  4QKU A;  1VQ8 T;  2YUN A;  3L2R A;  2KT8 A;  1Y57 A;  5KYU B;  1UJ0 A;  1M2V A;  3CC2 A;  3L2Z A;  1HJD A;  3CPW A;  2EGA A;  4RTX A;  4M78 E;  4LDU A;  5L23 A;  1MND A;  3G1J A;  4C8Q F;  3REB B;  3EG1 A;  1V76 A;  1GCQ C;  2GTJ A;  1VQ5 Q;  2IIM A;  1NM7 A;  2MK5 A;  3CD6 T;  2HBP A;  3PT9 A;  3G71 T;  5CIU A;  1D3B B;  2HSP A;  4M75 D;  1G3Y A;  1MMD A;  2HBW A;  3MJX A;  5CAI A;  1KSW A;  3QYG B;  4C8Q A;  3PVL A;  4L5G A;  1ZUU A;  3L2Q A;  1Q81 R;  1QQJ A;  5HKC A;  2EYZ A;  4N0A A;  2RNA A;  4JRQ A;  3GIB A;  1ZBX A;  2MWP A;  1BI3 A;  2HAX A;  1T0H A;  2WSC E;  4RG8 A;  1RLQ C;  3CCM T;  2LJ0 A;  3R6O A;  4HT9 A;  5FRM A;  3RES A;  3HFN A;  4M7A D;  3TEE A;  3KUF A;  3CCJ A;  1SHG A;  1G3S A;  2LQ8 A;  4JRI A;  2LDM A;  2EKH A;  5FU7 B;  2VWF A;  4A53 A;  3CCV A;  4M7A A;  2GGR A;  1RAE B;  2JTE A;  1WJR A;  5LJ5 g;  3C94 A;  3A5Z B;  2BE9 B;  2LNV A;  1KIK A;  3RKY A;  2VKN A;  1YN8 A;  2KRM A;  3V7R A;  2PZ1 A;  1JXO A;  2QQ9 A;  1I8F A;  1YJW A;  4WCI A;  2QQR A;  5I21 A;  4HCB A;  4BE0 A;  1UUE A;  4X34 A;  2VUB A;  1WX6 A;  1SF9 A;  5GAN 7;  1PRL C;  3DB3 A;  1WHL A;  2CP7 A;  3UF4 A;  2X4W A;  1AT1 B;  3VJP A;  4J9C A;  1RL2 A;  3HKS A;  1RI0 A;  2K6D A;  3MP8 A;  4JZ3 A;  2DM1 A;  5GAN d;  3INZ A;  1VQ9 A;  2VGN A;  1HD3 A;  2QYZ A;  3VS0 A;  1PCX A;  8AT1 B;  5IN1 A;  2VXF A;  2DKG A;  2EW3 A;  2HL3 A;  2CT4 A;  2DTO A;  4J6Y A;  3EGD B;  3M0S A;  4BI3 A;  5GAO m;  3H8Z A;  4ZGD B;  2AKK A;  2EAY A;  4IIO A;  1ABQ A;  1PNJ A;  4DOV A;  2RD1 A;  4PJO E;  4FYY B;  5KH6 A;  2CZ0 B;  2DTI A;  2QI2 A;  3M0Q A;  4M7D C;  3GPL A;  2LX9 A;  3CXC A;  1WXB A;  2RQV A;  5CKB A;  2QQB A;  6AT1 B;  1AEY A;  4FCY A;  2X4Y A;  4AFS C;  2YSQ A;  1BBZ A;  2J6O A;  3ZFJ A;  5LJ3 g;  1YCS B;  2XG8 D;  3H0H A;  5GAO q;  2EJF A;  2EVR A;  3I5R A;  3EG9 A;  1RAG B;  5KYX B;  5CKE A;  3P8D A;  1QWE A;  3UPU A;  3MEA A;  3RMQ A;  2LQK A;  2E12 A;  5CCA A;  2VXE A;  2OI3 A;  1C1A A;  1OI1 A;  3CCL T;  2QEX Q;  1K73 U;  4D8K A;  2LNH B;  1JBM A;  1BKB A;  1OUL A;  1WA7 A;  4BI4 A;  3CCL Q;  1IHW A;  2M02 A;  2EQU A;  1VYT A;  1UE9 A;  1WHG A;  4M75 F;  2K5F A;  4ZN1 A;  4EIK A;  1UG1 A;  2VAS A;  3I35 A;  1Q7Y C;  3G6E T;  3A8H B;  2DK3 A;  4C8Q D;  2QEX A;  5IHK A;  2E3H A;  4PKC C;  1NLO C;  1UEC A;  2V1Q A;  4KT0 E;  1ZHI A;  1TSF A;  3GP8 A;  1WI7 A;  2V8J A;  3CMA Q;  3M56 A;  2RHI A;  4KUL A;  2NLU A;  3EG0 A;  4J8O A;  2CP5 A;  7AT1 B;  1AWJ A;  3NTK A;  1TUD A;  2JS2 A;  4HA8 A;  4PLI A;  1BB9 A;  5CO7 A;  4LDX A;  2MCN A;  2RJF A;  3SWN C;  1M8V A;  3OYI A;  3CC7 T;  1VQM A;  2RB6 A;  4NL3 A;  1KD1 C;  3CME T;  5CR2 A;  1KC8 U;  2SEM A;  1BI1 A;  1WDX A;  3V8K A;  2EFI A;  3QZ5 B;  3L2W A;  3JB9 J;  1HK9 A;  2MIO A;  2RMO A;  1YIT T;  3TCJ A;  4M77 D;  3EG2 A;  2K7A A;  2W0Z A;  2FZC B;  1RAB B;  2IG0 A;  2FO0 A;  2BKD N;  5KCO A;  2MF2 A;  5LJ3 e;  3E9G A;  2YUO A;  1G83 A;  4M77 A;  2J05 A;  4RCC A;  1H3H A;  3U23 A;  4M78 B;  2PNI A;  2LP5 A;  2COY A;  2RK2 A;  1WQ7 A;  1YJN A;  3M4Y A;  1NJI U;  2RH2 A;  4GLM A;  1GFD A;  1VQ7 T;  5FWB A;  2JVV A;  4PJJ A;  5D6X A;  2ZPE B;  1UGR B;  3BFM A;  3A1P A;  2NWM A;  4E7H A;  1TXQ A;  1PD0 A;  1NPR A;  3ZL7 C;  1ZQ1 A;  3MP6 A;  4F16 A;  5A0L A;  4C8Q G;  5GMK h;  2H3E B;  2OTL Q;  1VYV A;  1W6X A;  1SKU B;  2VB6 A;  1QP3 A;  3N5B B;  1UB4 A;  3CBP A;  2LTO A;  2QDY B;  4J9D A;  3O5Z A;  2RQU A;  5D6W A;  4QVZ A;  2D0N A;  2CSQ A;  4PFP A;  2O9S A;  1YNZ A;  2CKK A;  4LE9 A;  1Q7Y U;  4HCK A;  4M4Z A;  5IH2 A;  3P8H A;  2V26 A;  3GOX A;  4C0F A;  3LX7 A;  3QXE B;  2HSE B;  2RHX A;  1YJW T;  2GCX A;  1KD1 R;  3QWX X;  2Y4X A;  1M27 C;  3OS1 A;  4DBH A;  4M75 B;  1Q86 R;  1CKB A;  1ARK A;  1R77 A;  1NYG A;  2YRC A;  2F2V A;  2EYW A;  1VIE A;  2XDB A;  1VQ8 Q;  4HXJ A;  1C0M A;  2XHC A;  4JUV A;  4JDS A;  1K9A A;  5IT9 E;  4PLL A;  1NEB A;  2C06 A;  4M75 A;  3E1S A;  5CKH A;  4NOY A;  4PK4 A;  2RPN A;  2O31 A;  2JM9 A;  3QWY A;  1TG0 A;  3M55 A;  2K5I A;  2KRO A;  1MMN A;  1LPL A;  4QVC A;  1YJ9 A;  1GBQ A;  2CZ6 B;  2P0K A;  4XU1 A;  3F70 A;  1H64 1;  3PIP A;  2VVK A;  3GNG A;  3S3O A;  2GF7 A;  1KK7 A;  3CCM Q;  5CQY A;  1BYM A;  1W2B S;  2MAM A;  2DYI A;  1U06 A;  3CBO A;  1Y96 B;  5ECA A;  4JS5 A;  1JJ2 A;  4J7I A;  4TVR A;  2QQA A;  1ZBJ A;  1VQ6 Q;  5LJ3 f;  1D1C A;  2K2M A;  3VYG A;  2E41 A;  4GBQ A;  3CME A;  2QA4 A;  3JAM E;  4OB0 B;  2DXB A;  4HVW A;  4FYV B;  2PVG B;  4F7U E;  2M1H A;  3CC7 A;  1GCQ A;  5A0D A;  3S3M A;  2DJQ A;  3ER0 A;  2YWW A;  2M51 A;  4K11 A;  3FIF A;  2DL3 A;  3CMA A;  1VQ8 A;  1J3T A;  2DX1 A;  2ZPF B;  4R56 A;  2P0Q A;  2JXB A;  3EGU A;  3KFV A;  2DJZ A;  4O6J A;  3H9N A;  4FYW B;  2DZC A;  3RNJ A;  5IXF A;  4M77 B;  2LT1 A;  1SHF A;  4M78 A;  4BY6 C;  2XID A;  5GAO n;  3C0C A;  4ZNX A;  2E4H A;  4M78 D;  4GY5 A;  3CCV T;  2KXD A;  4EMH A;  4M77 C;  3LYI A;  1C6V X;  1OV3 A;  4DA4 A;  3RIR A;  1KFZ A;  1Y0M A;  3OB9 A;  2BTT A;  3OYF A;  1EFN A;  1N8R R;  2JTF A;  3X25 B;  1Q82 R;  4J6X A;  3G6E Q;  3CMA T;  2QEX T;  4MZP A;  1K9M U;  1NPP A;  3E2U A;  3OW2 A;  2Y90 A;  4ZTF A;  4Z8A A;  1X6O A;  3CC4 Q;  3M54 A;  1X43 A;  2Y4Y A;  1MHN A;  4M7D E;  3JCM X;  1W1F A;  2JOY A;  1M3C A;  2DXT A;  4RTT A;  5FWC A;  5LJ5 j;  2D8H A;  1YCY A;  3HP9 A;  5A2Q E;  1Q81 U;  2VGM A;  1XJW B;  1NZ9 A;  3LGL A;  3URG A;  2E6N A;  3VUZ A;  5KYN A;  3CCL A;  1Q7Y R;  1QVF A;  3LLR A;  2EBP A;  2L8D A;  3X28 B;  4O5V A;  3OYY A;  2DBM A;  1YIT Q;  2P84 A;  2IVW A;  3OW2 P;  3KXT A;  3I56 T;  2K2V A;  1EX4 A;  5GAN h;  1D0Z A;  2L5Q A;  3L2V A;  3H0F A;  4FU6 A;  4BD3 A;  4E47 A;  5I22 A;  3JCM V;  3LH5 A;  4MML A;  4C92 A;  2E70 A;  4DOW A;  3SHW A;  3X26 B;  2HMA A;  1MV3 A;  4RKU E;  2AZV A;  2EYX A;  1V1C A;  2D0Q B;  1ZSG A;  4PJO G;  2KXC A;  1AOJ A;  2ABL A;  3JV3 A;  1M9S A;  4IUU A;  5GAM f;  4KGX B;  2DMO A;  2DFU A;  4E7I A;  3OBY A;  4OMO A;  4BB7 A;  2ED0 A;  4IUR A;  4B6M A;  1PSF A;  3ZEH A;  1BI2 A;  2J7I A;  3CCE Q;  1JXM A;  1A0N B;  1M90 R;  2DEU A;  2DAQ A;  4A54 A;  3QKJ A;  2RF0 A;  3C4S A;  4J7F A;  3X24 B;  1KQS S;  1LOJ A;  2O2O A;  2K3B A;  1VQ9 Q;  1S1N A;  2D8J A;  5A0G A;  1I5L A;  4M78 G;  2V8I A;  3VRY A;  4D6W A;  2DIQ A;  3JCM P;  2YLB A;  4F7U A;  1Y7X A;  1VQP Q;  2DRM A;  3NTH A;  3EAE A;  5IHN A;  1LNX A;  4VUB A;  1G8X A;  5GAN 3;  2NUT A;  2VV5 A;  4ZTJ A;  4XU0 A;  3UAT A;  3J81 E;  4R55 A;  1PC0 A;  3OSV A;  1X2Q A;  2OAW A;  3M5A A;  3OS5 A;  3UA7 A;  1IZ6 A;  1MV0 B;  2M0Y A;  2RK1 A;  3RR6 A;  3QHS A;  2DVE A;  4QW2 A;  2E3I A;  3CD6 A;  2EQK A;  1I0C A;  4R0K A;  1BIB A;  1TTH B;  4DEX A;  5GAN 8;  1NLP C;  3CPF A;  4GLK A;  4C0Z A;  4JRP A;  1MGQ A;  1MNE A;  1VQK T;  1SPK A;  1DJ7 B;  3FJ5 A;  2XD0 A;  3HRT A;  3L1A A;  1YJN T;  3EFS A;  3JCM Q;  1UGP B;  4PJO F;  3FJP A;  2L89 A;  4XTX A;  4PJO C;  4MZM A;  2H3J A;  2DTH A;  3QDF A;  3G4S Q;  2JW4 A;  2XK0 A;  3G71 A;  2YDL A;  5I2M A;  1KHI A;  2BZY A;  3OYN A;  1YIT A;  4IIM A;  4FL6 A;  4HCZ A;  5GAO r;  1PWT A;  4BI8 B;  1U5S A;  5GAM h;  1E7O A;  2COW A;  4MDW A;  1WLP B;  2PQW A;  5GAM g;  2KYB A;  1VQM T;  3MKD A;  3LWI A;  2FHD A;  4E6R A;  2R58 A;  3CCR T;  1YP5 A;  2R5A A;  1ZUK A;  3OYG A;  2KAF A;  2WSE E;  3CPW P;  2M9U A;  1VQ4 A;  1VQ9 T;  1X69 A;  2HQX A;  2KK4 A;  4CC3 A;  3LW5 E;  2JM8 A;  1IHV A;  4JJD A;  2JN0 A;  3A98 A;  2LC4 A;  4DBQ A;  1JQQ A;  5GAN 5;  2X51 A;  5AYF A;  1WJS A;  4Z02 A;  1AWW A;  2QGG A;  1OX8 A;  4PFZ A;  5KYW A;  3AT1 B;  2D6F A;  4C92 B;  1WHH A;  1VA7 A;  3C12 A;  3BDL A;  4QQG A;  1T3S A;  2F5T X;  3ULR B;  4B9W A;  3MO8 A;  1YIJ A;  4L59 A;  1ZX6 A;  2RHY A;  1M2V B;  2QTX A;  2HCK A;  2F5K A;  5EC7 A;  1NE8 A;  1QP2 A;  1OEB A;  4C92 F;  2JZ2 A;  2EGE A;  1X2K A;  2LJ1 A;  4X9C A;  5GJV B;  4C0D C;  2RJC A;  4FIB A;  3VRZ A;  2DL4 A;  4XU3 A;  4DEY A;  1N8R C;  5LJ5 h;  1VQN Q;  4ZGE B;  2D1X A;  2EIF A;  3M53 A;  1G5V A;  1U1S A;  1JJ2 S;  2O01 E;  1M1K R;  1ZA1 B;  2JMA A;  3FDR A;  1UHF A;  2HD0 A;  4FW1 A;  1K1Z A;  2F2W A;  5GAM e;  3A8L B;  1S72 Q;  2MI6 A;  4M7A G;  2MWO A;  3CME Q;  2E10 A;  3WVD B;  2BIV A;  1WXT A;  2RM4 A;  5KYY B;  4N4G A;  5GAN 2;  2RJD A;  1YI2 Q;  2GTO A;  2FZG B;  3VV0 A;  3EFO A;  3JB9 D;  1AD5 A;  1X6G A;  1SRM A;  2DL7 A;  1Y71 A;  2SRC A;  4AFZ C;  3I56 Q;  3L2U A;  4A4K A;  4ZGJ B;  2GBQ A;  5KE3 A;  1YJ9 Q;  3CCS Q;  3CC2 T;  4FSS A;  4EPC A;  4IUQ A;  4LUD A;  2CDT A;  4B9X A;  3EFO B;  3M58 A;  5FRO A;  5J39 A;  2GFU A;  2B86 A;  2HEQ A;  1D3B A;  2EWN A;  3PNW C;  4PJO B;  3L42 A;  4LUE A;  3EG3 A;  2OTJ Q;  3MET A;  1K76 A;  2AKL A;  1H92 A;  1H8K A;  3D7S B;  3M0R A;  1FWZ A;  2RQT A;  4QVD A;  3OYB A;  2YRD A;  3SWN B;  2YRV A;  2EQI A;  3EGX B;  1FYN A;  2LRQ A;  3OYC A;  4WTO B;  3CCJ T;  2A08 A;  3MHX A;  2OTJ A;  4C0G A;  3CCM A;  2A3L A;  5GMK i;  3VS5 A;  2X3W D;  1JEG A;  4A4H A;  5CKD A;  2DXC A;  1ZSZ A;  4OB3 B;  3CCU T;  5DM7 R;  2PTK A;  2I2L A;  3X20 B;  2P4T A;  2EPD A;  1OPK A;  4OGC A;  2QAS A;  3OYJ A;  4RTW A;  2CZ7 B;  1XNI A;  3OMC A;  4L6V 5;  2CS7 A;  3G6E A;  4KUI A;  4OMN A;  4E7S A;  1SG5 A;  4M7D D;  4RTU A;  2EQM A;  2QQS A;  1W2B P;  1F1B B;  3EH1 A;  1G3W A;  3OYD A;  4FT4 A;  2X9H A;  1U1T A;  5J26 A;  4M7D F;  2RHU A;  3BDU A;  2CZ1 B;  1GXI E;  1UGV A;  1ZUY A;  4JRK A;  3EHQ A;  1I1J A;  1S72 T;  2KY9 A;  1WQW A;  1WZO A;  1RAA B;  1YI2 A;  4M7A E;  2E64 A;  5GAM d;  4PFO A;  5EG2 A;  1SRL A;  2L2P A;  1RAI B;  5KYU A;  3EG9 B;  1LVK A;  3GBQ A;  3CCJ Q;  1CSK A;  4QQD A;  1RLP C;  1AHJ B;  4DQ2 A;  4J9H A;  2JJ9 A;  4FW2 A;  2DNU A;  3DB4 A;  3SD4 A;  2LX7 A;  4EMK A;  4CC2 A;  2HNI A;  3VS3 A;  1YFN A;  2OTL T;  3EGD A;  4LNP A;  3CCE T;  1VQL A;  1UHC A;  1X6B A;  1OPL A;  1D09 B;  1D0X A;  1M1K C;  2M16 A;  4CI0 C;  1YHQ T;  1KQ1 A;  4DBF A;  2HZY A;  4M77 G;  4J9B A;  2PVO B;  1OU8 A;  4C8Q B;  1QW1 A;  1PSE A;  1IRE B;  1VQ6 A;  2BZ8 A;  4OF1 A;  2YUQ A;  5GAO l;  1Q82 U;  4QQ6 A;  2C0I A;  1NJI R;  1Z9Q A;  4F04 B;  1ZA2 B;  1K0X A;  1MUZ A;  1BK2 A;  1QVG A;  1QLY A;  2KQW A;  1OOT A;  2A0F B;  2KRN A;  2CSI A;  2HKQ B;  1VQO T;  2DD5 A;  2KYM A;  4HKE A;  1W4S A;  3JB9 F;  3VKI A;  3RKW A;  3VS7 A;  4F17 A;  1QKX A;  1HYO A;  3CCS A;  4BUG A;  3R6N A;  1JO8 A;  1PKS A;  3TRE A;  3QJ6 A;  4BE2 A;  3LGF A;  2EQJ A;  2IPO B;  1VQ4 Q;  1O75 A;  2XMF A;  4LN2 A;  3M9Q A;  5D6Y A;  2XIC A;  4AG2 C;  5GAN 4;  2P4R A;  4UC4 A;  3CD6 Q;  2CP2 A;  3CXC P;  4IUV A;  1Q81 C;  3IQL A;  1VQL Q;  3FB9 A;  1JB0 E;  3NHN A;  1K73 R;  3S3N A;  5LL6 S;  1K73 C;  2J6F A;  4E2F B;  3JCM f;  1G2B A;  1QVF P;  1Y07 A;  4FT2 A;  5FRN A;  2JS0 A;  5FU7 C;  1RAF B;  1VYU A;  4ELZ C;  1E6H A;  4MZT A;  5LJ3 j;  3I55 T;  3TSW A;  1KD1 U;  4M7A B;  3OA6 A;  2F69 A;  2VYT A;  1VQP A;  2CH4 A;  2RN8 A;  2QAZ A;  4HVV A;  2GNC A;  3CCQ T;  4D8D A;  3SWN A;  2CP0 A;  4JJN K;  2F2X A;  4M77 F;  3M0U A;  1QMC A;  3JCM b;  3EGX A;  4JLG A;  4C92 G;  4FYX B;  2FRY A;  3CCQ Q;  2DA9 A;  2BZX A;  2QXF A;  5L8R E;  2KR3 A; 
#chains in the Genus database with same CATH homology
 4IKF A;  3QO3 A;  3CXC S;  3GNF B;  2L3R A;  3QG1 A;  1Q7Y C;  3OSS C;  3M5A A;  3QZ9 B;  4MMK A;  3OS5 A;  3G6E T;  1VQO T;  3A8H B;  2XDP A;  3QYH B;  1IZ6 A;  2RK1 A;  3OYM A;  2RJE A;  5DLQ E;  2DK3 A;  3QHS A;  4C8Q D;  2DVE A;  1SSF A;  3HFO A;  5HY6 A;  2QEX A;  1QVF S;  4QW2 A;  4PKC C;  1KC8 C;  3CD6 A;  4KT0 E;  1ZHI A;  2EQK A;  4OB2 B;  2V8J A;  4FM4 B;  1UGQ B;  3GP8 A;  2R57 A;  1K8A U;  1BIB A;  3RKX A;  5GAN 8;  3BY7 A;  3M56 A;  3OBW A;  4X9D A;  3T9N A;  2RHI A;  5GMK j;  4KUL A;  2NLU A;  2XU8 A;  3CPF A;  4GLK A;  4Q5W A;  3SDZ A;  3A8M B;  3VYH B;  2D9T A;  4C0Z A;  4JRP A;  4J8O A;  2OAU A;  1MGQ A;  3NTK A;  4HA8 A;  2FB7 A;  4PLI A;  1VQK T;  2ZPG B;  5CO7 A;  1VQN T;  1DJ7 B;  3GLX A;  3OW2 S;  3A8G B;  2GFA A;  4LDX A;  4LDY A;  4E7L A;  3HRT A;  2XD0 A;  3L1A A;  4OB1 B;  1YJN T;  3EFS A;  3JCM Q;  1UGP B;  1QVP A;  1YBY A;  2RJF A;  3SWN C;  2R5M A;  4F7U B;  1YI2 T;  4PJO F;  1UGS B;  3FJP A;  1M8V A;  2CYZ B;  1Q82 C;  2L89 A;  4P5N A;  4XTX A;  3OYI A;  1VQM A;  3CC7 T;  3SB2 A;  4V2S A;  2RB6 A;  3H6Z A;  4PJO C;  4MZM A;  2H3J A;  3SFM A;  1VIF A;  2DTH A;  5IAY A;  4NL3 A;  4E7K A;  1KD1 C;  3OY9 A;  2P0P A;  3CME T;  2XK0 A;  1WGS A;  3G71 A;  3KBG A;  4M75 C;  5LJ5 f;  5CR2 A;  5FU6 B;  1KC8 U;  3AHU A;  4J83 A;  5I2M A;  1BI1 A;  4OGE A;  2E5Q A;  1KHI A;  1NJI C;  3V8K A;  3OYN A;  2EFI A;  3QZ5 B;  3L2W A;  1XOV A;  3V7S A;  5HK3 A;  3MP1 A;  4JLI A;  3JB9 J;  1YIT A;  4M7A C;  1HK9 A;  1YIT T;  4FL6 A;  5FU6 C;  3TCJ A;  3DKM A;  4HCZ A;  4BY6 B;  4EMK B;  3CC4 T;  5GAO r;  2K5L A;  3FEO A;  4M77 D;  4BI8 B;  5GAM h;  3OYL A;  3PTA A;  2IG0 A;  3A8O B;  2PVD B;  4LD9 K;  2DPP B;  2A7Y A;  1VQ4 T;  4MDW A;  2KMT A;  1BI0 A;  1XTD A;  2BKD N;  2DXU A;  2PQW A;  4PNO A;  2MF2 A;  5KCO A;  5GAM g;  5GAN e;  1VQM T;  5LJ3 e;  3E9G A;  2EYQ A;  4M77 A;  4RCC A;  3DLM A;  5CK9 A;  5FLX E;  3LWI A;  4BDY A;  4LDV A;  5C6S A;  2FHD A;  2DD4 A;  2HQE A;  1KQ2 A;  2R58 A;  2OTJ T;  3CCS T;  1VQ5 T;  4ZN3 A;  4M78 B;  3CCR T;  2R5A A;  4RCB A;  2RK2 A;  1WQ7 A;  1YJN A;  3NTI A;  3M4Y A;  4EDU A;  1NJI U;  1M90 C;  3OYG A;  2KAF A;  2RH2 A;  2WSE E;  1OZ2 A;  3E9F A;  4M78 C;  2CGH A;  5GMK e;  2M9U A;  1VQ4 A;  1VQ9 T;  1I81 A;  1BIA A;  2QA4 T;  1N27 A;  2HQX A;  1VQ7 T;  2KK4 A;  3LW5 E;  2JVV A;  5C0M A;  3CEY A;  4RG2 A;  5D6X A;  2JN0 A;  1X01 A;  2ZPE B;  2KSS A;  1UGR B;  2LC4 A;  3BFM A;  3Q1J A;  1M4Z A;  1FX7 A;  5KCH A;  5GAN 5;  3UWN A;  5M9O A;  4E7H A;  3LH0 A;  1N9S A;  4WF2 A;  2WSF E;  5AYF A;  4A4F A;  4C92 C;  1WJS A;  4Z02 A;  4XAX B;  2EKO A;  3DLL A;  1NPR A;  1M1F A;  1ZQ1 A;  1VQ6 T;  3MP6 A;  1UEB A;  4A4E A;  3J80 E;  2D6F A;  4C92 B;  1K9M C;  2K4Y A;  5A0L A;  4C8Q G;  3C12 A;  3BDL A;  1YJ9 T;  4QQG A;  4F7U F;  5GMK h;  1Y96 A;  2O4X B;  4C5I A;  3JB9 H;  2F5T X;  4B9W A;  1VQN A;  2B8A A;  3MO8 A;  1YIJ A;  3QDR B;  4M7D A;  5GAO p;  1V29 B;  4Y91 A;  4PL6 A;  1VQP T;  1QVG S;  1QP3 A;  3N5B B;  4L59 A;  1UB4 A;  3CBP A;  2LTO A;  2RHY A;  2QDY B;  4XTW A;  4C92 D;  5CVI A;  3M59 A;  2QTX A;  4NS5 A;  5D6W A;  3PGG A;  2F5K A;  4QVZ A;  4MDX A;  4XTU A;  3OQ5 A;  3QII A;  1R8O B;  4CRI A;  3CPW S;  1NE8 A;  2CKK A;  1QP2 A;  1OYX A;  4C92 F;  4BE1 A;  2JZ2 A;  4X9C A;  4C0D C;  1Q7Y U;  5LJ5 d;  2RJC A;  4FIB A;  5DY9 A;  3RMS A;  4N4I A;  2O4X A;  4XU3 A;  1N8R C;  4ME7 A;  3P8H A;  5LJ5 h;  2YLC A;  4ZGE B;  3G4S A;  4IUT A;  3GOX A;  2EIF A;  4C0F A;  3M53 A;  2RI5 A;  3LX7 A;  4LD6 A;  4YTL A;  4M7D B;  1G5V A;  3JSC A;  1U1S A;  3QXE B;  1JJ2 S;  2O01 E;  2RHX A;  1YJW T;  2GCX A;  3QPH A;  3FDR A;  4IUP A;  3OYK A;  4PJO A;  3OYH A;  2Y4X A;  2HD0 A;  5HK0 A;  5GAM e;  1YHQ A;  3A8L B;  3OS1 A;  2LVM A;  1JRI A;  3MEV A;  4J6W A;  3V7C A;  2MI6 A;  3CCQ A;  3JCM g;  4M7A G;  2MWO A;  4HCC A;  4M75 B;  3PMI A;  2E10 A;  4NL2 A;  3WVD B;  3JRZ A;  2BIV A;  2FYK A;  4ELY C;  3CCE A;  5I2S A;  3I55 A;  3LWH A;  3OS2 A;  2FVU A;  3C95 A;  2V8K A;  3O8V A;  2X4J A;  2RM4 A;  2ZPI B;  4N4G A;  5GAN 2;  2RJD A;  1M1K U;  5CKF A;  4EMG A;  4Y28 E;  1VIE A;  3QJY A;  2XDB A;  3QBY A;  1M5Q 1;  3E19 A;  3VV0 A;  3JB9 D;  4M75 E;  4C0D B;  3FRN A;  3JCM W;  3V8J A;  3CCU A;  2FL7 A;  2KVQ G;  3UT1 A;  2DZ9 A;  4M7A F;  2ZPB B;  2RHZ A;  2XHC A;  3S6W A;  4JUV A;  4JDS A;  5IT9 E;  4PLL A;  2C06 A;  3ASK A;  4JS4 A;  1Y71 A;  4II1 A;  3L2U A;  2X4X A;  4M75 A;  3E1S A;  3EFR A;  3MCA B;  5CKH A;  4A4K A;  4ZGJ B;  1K8A C;  2RI2 A;  5KE3 A;  3ME9 A;  4NOY A;  1N6A A;  3HSB A;  3JCM h;  3CC2 T;  4E7J A;  4EPC A;  1EIF A;  2RI3 A;  3M55 A;  2K5I A;  1I4K 1;  4OMF B;  4IUQ A;  1VQ5 A;  3JCM d;  1XQH A;  1YJ9 A;  4QVC A;  2CZ6 B;  3VUB A;  2DO3 A;  2P0K A;  3JCM c;  4B9X A;  4XU1 A;  3MEW A;  4N4H A;  3QSU A;  3F70 A;  1H64 1;  3M58 A;  5FRO A;  1G3T A;  5J39 A;  3PIP A;  3OYE A;  3OMG A;  2GFU A;  4XU2 A;  1D3B A;  1N9R A;  3GNG A;  3S3O A;  1H3Z A;  2EWN A;  2GF7 A;  3PNW C;  4PJO B;  3L42 A;  5CQY A;  1BYM A;  2K57 A;  2KDS A;  4KBM B;  2MAM A;  1FXX A;  1W2B S;  4OVA A;  4XQ3 A;  5LJ3 d;  3MET A;  3CBO A;  3HL8 A;  1M1G A;  3NFC A;  5LJ5 e;  3RER A;  1Y96 B;  1JJ2 A;  3M4G A;  4JS5 A;  1P92 A;  4J7I A;  2BUD A;  2LCC A;  4TVR A;  1X75 C;  2QQA A;  5LJ3 f;  1FWZ A;  2DEQ A;  2E65 A;  1VQ7 A;  4QVD A;  3OYB A;  1VQL T;  3VYG A;  2E41 A;  5GMK l;  3CME A;  2QA4 A;  3JAM E;  4PJO D;  2RO0 A;  3SWN B;  3UDC A;  1VQ8 T;  2DXB A;  4OB0 B;  2ZGW A;  2PVG B;  2YRV A;  2M1H A;  4F7U E;  3L2R A;  3CC7 A;  2LRQ A;  3OYC A;  3FC3 A;  5A0D A;  4HT8 A;  3S3M A;  3ER0 A;  1KQS A;  3CC2 A;  2E6Z A;  3CCJ T;  3CCR A;  3FIF A;  3MHX A;  4M77 E;  2OTJ A;  3PFS A;  3L2Z A;  3CMA A;  2ZCF B;  1VQ8 A;  1VUB A;  2ZPF B;  3M57 A;  4C0G A;  3V8L A;  4R56 A;  2A3L A;  2P0Q A;  5GMK i;  2XKO C;  3CPW A;  3CCM A;  4ATO A;  4M78 E;  4LDU A;  4BDZ A;  4A4H A;  5CKD A;  2DJZ A;  4O6J A;  2DXC A;  4OB3 B;  4C8Q F;  3CC4 A;  3CCU T;  5DM7 R;  2DZC A;  2I2L A;  4M77 B;  2P4T A;  4OGC A;  3X20 B;  3OYJ A;  2CZ7 B;  1XNI A;  2LT1 A;  3OMC A;  4L6V 5;  2HBP A;  3PT9 A;  5GMK m;  2CS7 A;  3G6E A;  4KUI A;  3CD6 T;  4M78 A;  4BY6 C;  4M78 F;  3G71 T;  4M7D D;  1D3B B;  2XID A;  4M75 D;  5CIU A;  2EQM A;  2QQS A;  5GAN 6;  1G3Y A;  5GAO n;  1G3W A;  2EJG A;  3OYD A;  4FT4 A;  5J26 A;  1U1T A;  5CAI A;  4KUD K;  4M7D F;  2RHU A;  3QYG B;  4M78 D;  4C8Q A;  4GY5 A;  3BDU A;  3CCV T;  2CZ1 B;  2WAC A;  1TH7 A;  1GXI E;  1O9S A;  2LT4 A;  4L5G A;  3RUX A;  2OTL A;  4JRK A;  2GQV A;  4EMH A;  3L2Q A;  1S72 T;  4M77 C;  2KY9 A;  1WQW A;  5GAM j;  3ZBD A;  1YI2 A;  4M7A E;  5HKC A;  2JTM A;  2E64 A;  3LYI A;  5GAM d;  3QUI A;  5EG2 A;  4N0A A;  5GAN f;  2JUF A;  4JRQ A;  4DA4 A;  1ZBX A;  2MWP A;  2ZPH B;  1BI3 A;  3RIR A;  1VQK A;  3GIB A;  1LJO A;  3HHT B;  3OB9 A;  3OYF A;  2HAX A;  3G4S T;  2WSC E;  2JTF A;  4XTV A;  4RG8 A;  3X25 B;  2G3R A;  3CCM T;  4J6X A;  4QQD A;  3R6O A;  1AHJ B;  4DQ2 A;  4HT9 A;  2E1H A;  3CMA T;  5FRM A;  3RES A;  2EJ9 A;  3HFN A;  1HXD A;  4MZP A;  3TEE A;  2QEX T;  4M7A D;  3KUF A;  3DB4 A;  3SD4 A;  3CCJ A;  1K9M U;  1G3S A;  1NPP A;  2LQ8 A;  4A4G A;  4EMK A;  2MMP A;  4JRI A;  2HNI A;  3HPW A;  2LDM A;  3OW2 A;  2Y90 A;  3OYA A;  4ZTF A;  2K3Y A;  1X6O A;  2OTL T;  5FU7 B;  3M54 A;  3TU4 K;  4A53 A;  2Y4Y A;  1MHN A;  3CCV A;  4M7A A;  4M7D E;  3JCM X;  2JOY A;  3CBM A;  3CCE T;  1VQL A;  1B34 B;  2DXT A;  1WNL A;  1N8R U;  1WJR A;  5LJ5 g;  3C94 A;  3A5Z B;  1M1K C;  2LNV A;  2M16 A;  5LJ5 j;  2PUO B;  4CI0 C;  1YHQ T;  1KHC A;  3RKY A;  1KQ1 A;  3WXM B;  1YCY A;  3HP9 A;  3V7R A;  4M77 G;  1WJQ A;  5J3B A;  5A2Q E;  1Q81 U;  2VGM A;  3JCM e;  2PVO B;  2QQ9 A;  2LCL A;  1I8F A;  1YJW A;  1NZ9 A;  3GF5 A;  3LGL A;  3URG A;  2E6N A;  4C8Q B;  2QQR A;  3VUZ A;  1QW1 A;  1PSE A;  3WVE B;  5I21 A;  1IRE B;  3CCL A;  4OF1 A;  4HCB A;  4BE0 A;  1VQ6 A;  4M7D G;  1QVF A;  4X34 A;  5KE2 A;  3LLR A;  2VUB A;  2X35 A;  5GAO l;  5GAN 7;  1Q82 U;  4QQ6 A;  1B34 A;  2L8D A;  4XTZ A;  3X28 B;  4C5H A;  3DB3 A;  4O5V A;  3OYY A;  2X4W A;  2IVW A;  1QVG A;  3KXT A;  2KQW A;  3VJP A;  3I56 T;  3JCM J;  2K2V A;  5GAN h;  1RL2 A;  2L5Q A;  3L2V A;  4FU6 A;  4BD3 A;  3HKS A;  1RI0 A;  3MP8 A;  2DD5 A;  3JCM V;  4E47 A;  3HRU A;  1W4S A;  4HKE A;  2DIG A;  3BW1 A;  4C8Q E;  5GAN d;  3HRS A;  3INZ A;  4MML A;  2VGN A;  1VQ9 A;  4C92 A;  2ZZD A;  3JB9 F;  2PUK B;  2E70 A;  4DOW A;  3VKI A;  1YIJ T;  3RKW A;  3X26 B;  5IN1 A;  3FLG A;  1Q86 U;  4C5E A;  2VXF A;  4RKU E;  2DKG A;  3OS0 A;  3P8B B;  3VU3 C;  2XDD A;  3G7Z A;  2DTO A;  4J6Y A;  4LDW A;  3CCS A;  4BUG A;  2D0Q B;  4BI3 A;  5GAO m;  3TRE A;  3H8Z A;  4ZGD B;  4PJO G;  1Q86 C;  2EAY A;  3PIO A;  4C92 E;  3QJ6 A;  5DLO A;  4DOV A;  4BE2 A;  2VC8 A;  2RD1 A;  5GAN j;  4PJO E;  1M9S A;  4M75 G;  3LGF A;  5KH6 A;  2CZ0 B;  2DTI A;  2QI2 A;  4IUU A;  5GAM f;  2EQJ A;  4M7D C;  3GPL A;  4XK8 E;  3JB9 G;  1O75 A;  2LX9 A;  3CXC A;  3M9Q A;  5D6Y A;  2XIC A;  5GAN 4;  4UC4 A;  5CKB A;  4E7I A;  2QQB A;  3OBY A;  4BB7 A;  1W2B A;  2RA2 A;  4C8Q C;  4IUR A;  4IUV A;  2X4Y A;  1WPY A;  2M0O A;  1Q81 C;  1PSF A;  3ZEH A;  1BI2 A;  3FB9 A;  2YHT A;  4J5Y A;  1JB0 E;  1U8R A;  4OP0 A;  1OZ3 A;  2AHJ B;  2DAQ A;  5LL6 S;  3ZFJ A;  4A54 A;  5LJ3 g;  3S3N A;  1VQO A;  1K73 C;  2XG8 D;  4BAC A;  5GAO q;  3QKJ A;  3JCM f;  2EJF A;  3C4S A;  4J7F A;  3X24 B;  1Y07 A;  1LOJ A;  1KQS S;  4FT2 A;  5CKE A;  3I56 A;  3P8D A;  3MEU A;  5FRN A;  3UPU A;  3MEA A;  5A0G A;  3RMQ A;  4F7U G;  1I5L A;  5FU7 C;  2LQK A;  2E12 A;  2V8I A;  2XI9 A;  4M78 G;  5CQX A;  4D6W A;  2VXE A;  2DIQ A;  4ELZ C;  5CCA A;  5GAN g;  4XTY A;  3JCM P;  4MZT A;  2YLB A;  1OI1 A;  4FSX A;  5LJ3 j;  4F7U A;  2JNG A;  4EMK C;  3I55 T;  3CCL T;  1Y7X A;  1KD1 U;  4M7A B;  3OA6 A;  2F69 A;  1K73 U;  1M90 U;  2VYT A;  1VQP A;  3J7A F;  3NTH A;  3EAE A;  1LNX A;  1JBM A;  3PMT A;  3CCQ T;  1KG1 A;  1BKB A;  4VUB A;  3SWN A;  4JJN K;  5GAN 3;  4M77 F;  2VV5 A;  4BI4 A;  4ZTJ A;  3JCM b;  2K3X A;  4XU0 A;  3J81 E;  4C5G A;  4JLG A;  3JB9 I;  4R55 A;  4C92 G;  4N0A C;  2EQU A;  5LJ3 h;  1S72 A;  3OSV A;  2PU9 B;  2QXF A;  5L8R E;  4M75 F;  2K5F A;  4RMO A;  4ZN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...