4M77F

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77F00
1TH7A 4XU0A 4JUVA 1WNLA 4J6WA 4X9DA 3SWNA 2DTHA 3QUIA 4J6XA 2Y90A 5GAMd 3QSUA 3RERA 4M78F 4M78D 3JCMd 1HK9A 4C8QA 5GMKh 4M75C 2VXFA 4C92F 5LJ3f 4MMLA 4XTVA 4M75B 4F7UG 4M7AC 3QO3A 2YHTA 3M4GA 4PJOD 4F7UE 4M77C 4M77A 3SB2A 2RM4A 4PNOA 1MGQA 4M7AB 4DQ2A 3BW1A 5LJ5g 4JRKA 5GAN2 4NL2A 4N0AC 4A54A 3RIRA 3HSBA 4M77B 4QVCA 3AHUA 5GMKi 4RCCA 2VC8A 3RKWA 5LJ3e 4PJOG 4PJOE 3JB9F 1I4K1 2DTOA 3INZA 5GAOn 3RKYA 3JB9I 3BDUA 1I8FA 4NOYA 2EJGA 5GAMj 5GANd 4M7DC 2DVEA 4M7DG 5GMKm 3JCMX 2DXTA 3RUXA 3V7CA 4M7DE 2JN0A 4QVDA 4M7DB 5GAMf 4M75A 1Y96A 3JB9H 4C92D 3JCMf 1I5LA 4XU2A 4WF2A 4A53A 1Y96B 4M7AA 4J5YA 5LJ3h 2CGHA 2YLBA 4EMKC 5LJ5h 2EWNA 4XQ3A 3V8KA 4F7UB 4XTXA 5LJ3g 1I81A 5GAN8 1B34B 2HNIA 3BY7A 4M78C 4M78G 4N0AA 3EFRA 4J6YA 4EMKB 4C8QF 2FB7A 3BFMA 3EFSA 4M78E 4M75F 3FJPA 4C8QD 4M78B 5GAMe 4XTZA 4HT8A 4PJOC 2RB6A 3JCMe 3GIBA 4M7AF 2DXUA 4XU3A 4JLIA 4M77F 3JCMW 3JB9D 1KQ1A 1BIAA 4M77D 4PJOB 5LJ3d 4XTUA 5GANj 5LJ5d 1N9SA 2DZ9A 1H641 4M7DA 2E65A 3V7SA 1X01A 3PGGA 1U1TA 2EJ9A 4XU1A 3RESA 5GANf 1LJOA 1LOJA 3V8JA 5GAN4 4HT9A 2RD1A 2DKGA 2E1HA 2VXEA 3JCMV 1D3BB 4JRIA 4F7UA 5I21A 1M8VA 5GAOr 1B34A 1JRIA 1N9RA 3FIFA 5GAN7 2E10A 3JCMh 4EMKA 3JCMg 4OP0A 4M78A 3JCMP 4XTWA 4EMGA 5GAOm 1JBMA 2K57A 3QHSA 4C92C 1BIBA 4M75D 2DJZA 2QTXA 3VU3C 4C92G 5GANe 5GMKj 1WQWA 3JCMb 4C92E 4NL3A 3L1AA 4F7UF 5GAN5 4PJOA 4C92B 4M7AD 2DZCA 4EMHA 2I2LA 3SWNC 2DEQA 5LJ3j 2EJFA 3L2ZA 4HA8A 5LJ5j 5GAOq 3V8LA 4MMKA 1HXDA 3HFOA 5DY9A 4Y91A 4C8QC 3SWNB 4C8QG 4RCBA 4M75G 3HFNA 4C8QE 4M75E 4X9CA 5GAN6 4C8QB 4XTYA 5LJ5f 5GAOp 3JB9J 4PJOF 3RKXA 2EAYA 5GMKl 1D3BA 1YCYA 5GAN3 4M7AG 4M7AE 3JB9G 2E64A 1U1SA 4M77G 2ZGWA 3JCMc 5GANh 1WPYA 5GMKe 4M77E 2YLCA 5GAMh 5GANg 2RA2A 5GAMg 3FB9A 1WQ7A 5CAIA 4M7DF 1LNXA 2E41A 4M7DD 4V2SA 2FYKA 5LJ5e 1M5Q1 3JCMJ 1KQ2A 2DTIA 3V7RA 4C92A 3JCMQ 5GAOl
chains in the Genus database with same CATH superfamily
4EDUA 3A8HB 1PNJA 2JM9A 3QUIA 2X9HA 5GMKh 1G3YA 1Q86C 1VYUA 3UT1A 4J9BA 1ACMB 3QO3A 1MUZA 1YIJT 1VQPT 4PNOA 4KH0B 2EFIA 3VS6A 3RIRA 2BZ8A 3ME9A 3G7ZA 1I4K1 3EG0A 3CCMT 2HQHA 2XK0A 4HCKA 1OZ2A 4PJJA 3PIOA 1WIEA 2OTLQ 2IPOB 2LDMA 3QIIA 2QGGA 4A53A 4PFPA 4EMKC 5LJ5h 3X25B 5A0LA 3UA6A 1PC0A 1TUGB 1W2BS 4C8QD 3VJPA 1ZHIA 1MNEA 4M7AF 4P5NA 1KQ1A 5GANj 2EBPA 3ZEHA 3R6NA 3N5BB 5FRMA 4LUEA 5GANf 1D0XA 2L3QA 2VXEA 1K9MC 5GAOr 2YT6A 4OP0A 4M78A 2QEXT 2JMCA 3PMTA 3GP8A 1FMWA 4BI4A 1GXIE 4PFZA 2DIGA 1M1FA 3UA7A 1HXDA 4R56A 3I55A 1S72Q 3X20B 2LQWA 1WXUA 3GLXA 2DJQA 5GMKe 2JS2A 4M77E 4WCIA 4M7DF 2CUBA 3ZFJA 2FEIA 1YHQQ 2CT3A 2KY9A 2GFUA 2O9VA 2XHCA 3JCMQ 5GAOl 4MDXA 2EQKA 2G3RA 4ME7A 2I0NA 2K79A 3EGXA 2J6KA 3CCSQ 2M51A 2ECZA 3BDLA 3OSVA 3SB2A 5KYYA 4HVWA 3BW1A 1RAAB 3HRUA 2GBQA 2RQRA 2VC8A 4JJDA 2QYZA 4OGCA 5CCAA 1G83A 4DBHA 2E4HA 1Y96A 1SRLA 3TSZA 5KYXA 3GOXA 2O31A 4XU2A 2YLBA 2EWNA 2HSPA 3OBYA 1YJNA 5CQYA 4M78B 5GAMe 1YBYA 4HT8A 1UGPB 1TUCA 2MK5A 4MDWA 4KRTA 2BE9B 2D0QB 5LJ3d 4XTUA 3OYAA 5FWCA 1LPLA 1WZOA 3TVTA 1NJIU 3EGDB 3V7SA 2YSQA 4OMLA 2HDAA 2O4XA 2RD1A 5D6YA 1QVFA 1YIJA 4DOWA 1VQ9A 3H0FA 2CKKA 1K73C 3OMCA 1G2BA 5GAOm 1BIBA 5IHNA 3VU3C 5D7UA 3H0IA 2KSSA 3EHQA 1CSKA 4DBFA 3M0PA 3VV0A 2AKLA 5C6SA 5KCHA 1WHHA 2JTFA 2ZZDA 1BI0A 3EGXB 2ZPEB 3CCEQ 2NWMA 3P8DA 1S72T 2EAYA 5GMKl 5HKCA 4M7AE 4IUUA 1V1CA 3RMSA 2EVRA 5KYYB 1M1KR 1NZ9A 3MP6A 3JCMJ 1KQ2A 2LX9A 1YHQT 1QW1A 3CD6T 3OW2S 1Q81U 2AIRB 3SWNA 2DTHA 1VQ5Q 4LN2A 5GAMd 3TREA 3QG1A 3CCST 2LX7A 4XTVA 3LWHA 1RLPC 4OMOA 4N4HA 4M77C 2LJ3A 1ZLMA 2CYZB 3C95A 2KR3A 2YRVA 4JRQA 1JU5C 2RI2A 1D09B 4ZTFA 3INZA 1VQOQ 3CCLQ 1SHGA 1VYVA 4B6MA 2KYBA 1X75C 4M7DE 3CXCA 3OB9A 1WYXA 4A4KA 2O4XB 2QQRA 4XQ3A 1IHWA 4XTXA 1GRIA 4LDVA 3VUZA 4C8QF 2C0OA 4ELYC 3NGPA 2WSCE 1YITQ 3H0HA 3CCUA 2DZ9A 8ATCB 3H8ZA 2E65A 3CEYA 1K9MU 5GAN4 1OZ3A 1JEGA 4JRIA 3HL8A 4OB2B 2O9SA 4E7LA 2E10A 2BUDA 1GFDA 1WXBA 3U23A 2RHUA 3VS4A 1G3TA 2ABLA 3OYYA 4FT4A 2KGTA 2KT8A 2VWFA 4BDZA 2EKOA 4HCZA 1H92A 2F5KA 1QKWA 2DEQA 2PQWA 5L8RE 5IXFA 3SWNB 1KD1R 2HL3A 2BZXA 1UTIA 2DE0X 3M9QA 1M1KC 3JB9G 2Z0WA 4JLGA 2L89A 3JCMc 2CP0A 4RTTA 2RHIA 1Q82U 5AT1B 4D8DA 2FRWA 2CZ0B 5IN1A 1SF9A 1UGSB 4XU0A 4AG1C 1Y0MA 3QSUA 1VQ5T 4PFOA 2EQMA 3PFSA 2DNUA 2E6NA 3CQTA 4M7AC 1NPPA 2CREA 3VKIA 2D8JA 2RK1A 4BD3A 2AT1B 5LJ5g 2VUBA 4PJLA 5IXBA 2RH2A 4IUQA 3E2UA 3NTIA 3JB9F 2DF6A 2V8KA 5GAOn 3CPWP 3QZ9B 1OOTA 2LT4A 1VQOT 3CCLT 3I56A 3M0RA 5IHIA 3FDRA 3WVDB 1UJ0A 1FMKA 4Y28E 4Z02A 1EIFA 4M78G 1RACB 2F69A 4C0GA 3L42A 4FL6A 1YHQA 1RI9A 3CD6A 2E12A 2V1RA 2R5MA 3SFMA 1YITT 3I55Q 2PVGB 3VUBA 1LJOA 5I11A 2IG0A 1E6HA 3NPFA 5FU7B 1PKTA 1QVPA 2DM1A 3OMGA 5AYFA 1IGQA 3OYJA 3MP1A 4KT0E 4EMGA 1SSFA 3QDFA 1JXOA 4BY6B 4A4GA 5GAN5 4M7AD 1QLYA 2DFUA 3CC7A 3VS0A 5DY9A 1RABB 4F04B 4C8QE 3JV3A 1WXTA 3JB9J 1IGUA 1Q95G 1VYTA 1HJDA 2R5AA 2AHJB 5CVIA 2DXCA 1AZGB 1WQ7A 3OS5A 2E41A 1U06A 2XG8D 3M53A 1UJYA 4AG2C 3QBYA 4JJCA 3PE0A 2X4YA 1TH7A 3MEWA 4B9WA 4OMNA 4WTOB 3OYFA 4ZN3A 4A63B 1HK9A 1NE8A 2RK2A 2RNAA 2DD4A 3OYDA 2K7AA 2YHTA 1ZSZC 3ASKA 4PLLA 3R6OA 3J7AF 1WI7A 2RO0A 2MIOA 3NFCA 3SEMA 4OVAA 2EKHA 3Q1JA 3LGFA 4RMOA 3P8HA 1UDLA 4EPCA 4J9GA 2AZSA 3EFOA 3BE3A 3JB9H 1WFWA 2DL8A 2L3SA 2EPDA 1M90U 2C0IA 1VQ8Q 1TUDA 1KC8R 1VQ9Q 5I2SA 3V8KA 2FB7A 3BFMA 2DPPB 4ZN1A 4RTXA 3OYGA 2F2XA 3KUFA 4E7SA 1VQ7Q 3L2RA 5L23A 2HQEA 4A4FA 5FW9A 4QVZA 4FYYB 1KK7A 3S6WA 4CC3A 4JZ3A 1N8RU 5FU6C 1HD3A 2JXBA 2Y4XA 4Y92A 4XTWA 1T0HA 2YRCA 5D6XA 4E7JA 2FPEA 2VGMA 3MEUA 3A1PA 2D0NA 5LJ5j 5KE3A 4MZTA 1QVGP 1VQOA 3CCLA 2VV5A 4RCBA 4M75G 3HFNA 5LJ5f 5GAOp 1ZBJA 5EG2A 1WA7A 2E64A 1UHFA 1G5VA 4L59A 1IB8A 3GF5A 1B7TA 2JW4A 4D6WA 1E7OA 2QQ9A 3LH0A 4KGXB 2K9GA 4OMPA 2LMJA 4OGEA 3KXTA 1G3WA 1MV3A 2PVDB 3EFOB 3CCVA 4F7UG 2EQIA 2HD0A 1YWPA 3H9NA 2C06A 4LDWA 3A8GB 4N0AC 2QA4A 3WXMB 3O5ZA 3M0TA 4RTYA 2L8DA 5I2MA 2MPXC 4N4IA 4LXCA 2FL7A 1ZUUA 2DL4A 4B9XA 2AKKA 2EYZA 3NMZC 3CCUQ 1N5ZA 2M0YA 3BDUA 3SD4A 3JCMX 2DXTA 1F1BB 1JJ2P 3G6EQ 1KC8C 4FT2A 2KRMA 3CMAT 2HAXA 1XOVA 5LJ3h 1VQ8T 3MEVA 1VQ9T 5GAN8 1PHTA 3FJPA 1WDXA 3RNJA 5J26A 3REAB 2KI7A 1OQKA 1N27A 1Q82R 2MYSA 4JLIA 1FYNA 2PU9B 1VQ7T 4RTUA 1X6BA 1C6VX 2X4WA 2DO3A 1RL2A 2HQXA 2XI9A 3FC3A 3FIFA 3EH1A 3JCMh 2DL5A 2DYIA 2FZKB 3OS2A 1Z9ZA 2BZYA 3VS3A 3CCQA 3QJYA 1NLPC 2RMOA 2COYA 2L3RA 1MHNA 1K8AR 1GBQA 3V8LA 4LD6A 2VKNA 4IKFA 4DBRA 3CPWA 3URGA 2F2WA 5GAMh 5A0GA 1MV0B 3OS0A 3SDZA 2QGFB 2ZPIB 1IREB 1R0BG 2EGAA 1M30A 1IO6A 3T9NA 4QQ6A 4C92A 1WNLA 2RJEA 1FX7A 2F2VA 1BU1A 3I56Q 4KGZB 4OB0B 2GFAA 4HXJA 2DD5A 3PMIA 4FIBA 3I5RA 3LLRA 2RI3A 1CKAA 1Y07A 4DQ2A 2F5TX 4CC7A 4AFZC 4F16A 4BACA 3RDVA 1G3SA 1UUEA 2JUFA 3VS7A 5LJ3e 4PJOG 2J06A 3CD6Q 3L2UA 3ZBDA 5GJVB 2EYWA 1FWZA 3CCUT 2CZ7B 2NUPA 2M16A 1K76A 4FCYA 4QVDA 3MO8A 1I5OB 4RUGA 1C1AA 3G6ET 2FPFA 4FYVB 2CGHA 4C0DB 4HVVA 2R58A 3BY7A 4M78C 2DMOA 2DIQA 4AFUC 2DERA 4X34A 1OX9A 3X24B 3JCMe 2DXUA 2DYBA 3CC7Q 1GL5A 1VQKA 1KHIA 3JB9D 5A0DA 1X6OA 5LL6S 2V1QA 4PJMA 4E6RA 3GNFB 1RAEB 3TEEA 1QVFS 1XNIA 5CR2A 2PUOB 4RG2A 1M3AA 3QJ6A 3MCAB 2KK4A 2MAMA 2K57A 3MJXA 4RTVA 1NEBA 1K8AC 1WQWA 2H8HA 1UE9A 4HKEA 4C92B 5HY6A 3HTRA 2LCSA 3EG9A 1BBZA 2XICA 3OA6A 5GAN3 3CMAA 4FM4B 4R55A 5GANh 2YLCA 1VQ8A 2RA2A 1M90R 3FJ5A 1NYGA 2HKQB 1TU0B 1U3OA 3QYHB 5KYNA 2H3EB 1GCQA 4OMMA 1RAGB 1T3SA 1M3CA 5CKDA 2IIMA 4DA4A 1AWWA 1SSHA 4M78D 3JCMd 1VQ7A 2NUPB 3I56T 4X1VA 1WHKA 3META 1NM7A 2XD0A 1WLPB 4M77A 3RBBB 2JMAA 1O75A 3EG1A 4E7KA 3RKWA 5I22A 1ZA2B 4HCCA 4FYWB 2EGCA 4BUGA 1AZEA 3CXCS 4OMFB 1Q86U 2RJDA 3EG2A 4M75A 1QVGA 1Y96B 2KXCA 5KYXB 2E3IA 3EFRA 2K5FA 2A08A 2HEQA 4LDXA 3CC7T 1NYFA 2RPNA 3TQ7P 3EG9B 4DOVA 3PIPA 2RHYA 4YTLA 2E1HA 4A4HA 2MWOA 4F7UA 4XAXB 3HKSA 5J3BA 3SHWA 2P0KA 1ABQA 1NEGA 1OU9A 3PVLA 1Q7YR 3QHSA 5GANe 1UG1A 1Y57A 3LGLA 2HBPA 4GLMA 2NUTA 3JSCA 3SWNC 1K1ZA 2CSIA 3C94A 3AT1B 2A36A 4HCBA 3CCVQ 3G6EA 1VQ4A 5IHKA 1JO8A 1QWFA 2LQ8A 1JJ2A 2QA4Q 1YJ9T 3EHRA 2YUNA 1NLOC 2EQUA 2FYKA 4Z8AA 3G4SQ 1EX4A 2EYQA 3NTKA 3VRYA 2P4RA 2JM8A 2RJCA 1SRMA 2LCLA 3RERA 1K0XA 5C0MA 2CS7A 2OAUA 3THKA 4M75B 1AOJA 3I5SA 5D6WA 2ED0A 4NL2A 3HSBA 3VYHB 3QPHA 2P84A 2YUPA 2L3PA 4JJNK 2QK0A 2E5QA 2MMPA 2LQKA 3RKYA 5GANd 2DVEA 3QZ5B 2RJFA 3RUXA 4J7IA 3M55A 3QWYA 1PRLC 3NHNA 4BE0A 4F7UB 1BYMA 1LCKA 1I81A 2DEUA 1X2KA 4J6YA 2ZCFB 3OS1A 3M59A 3CCQQ 1YN8A 4JS4A 3DLMA 3CBPA 4C0FA 2NUTB 3C4SA 4K11A 1T0JA 1Z9QA 2CP7A 4QKUA 4M7DA 3C0CA 1PM3A 2BTTA 2LNVA 1LOJA 5FU7C 2R57A 4E7ZA 4HT9A 4LNPA 2GQVA 4A4EA 2LTOA 1IZ6A 2CP3A 2ESWA 1NBEB 1B34A 5KCOA 1Q7YC 3IQLA 2J05A 4BY6C 1QCNA 3LH5A 3MEAA 4C92G 1C0MA 2O2OA 4PJOA 2MI6A 3M0QA 1UECA 2GTJA 4JDSA 3L2ZA 5GAOq 1ZSGA 2QXFA 1ARKA 1QQJA 3KBGA 4X9CA 2MCNA 4D8KA 1YCSB 2ATCB 3CCVT 2VGNA 1P92A 1K73U 3HP9A 3M5AA 1BI3A 1WJQA 2DILA 2QA4T 2QTVA 3FB9A 1W2BP 3I9QA 7AT1B 4V2SA 2EYYA 1AWOA 3OYCA 4J83A 5IH2A 1RADB 1X6GA 2M0OA 3G4ST 1W1FA 3JRZA 1KD1C 2DRMA 1N6AA 2DETA 4M78F 2BIVA 1KQSS 1U8RA 4KUIA 3M0UA 4C92F 5HCKA 3O8VA 1SHFA 2BKDN 2O01E 1ZBXA 3HRTA 2YWWA 3REBB 5CKFA 4CC2A 2D9TA 2DXBA 4RCCA 3UF4A 2GTOA 1VQKQ 4N4GA 4C0ZA 1QP3A 4BE2A 1KJWA 1I8FA 2RHZA 3KFVA 2J7IA 4J9IA 2RI5A 2RN8A 2W10A 4M7DB 3CC2Q 4J5YA 1AEYA 1NJIR 1YJ9A 1B34B 4KBMB 3LWIA 1D1BA 1PD0A 3CCQT 4J8OA 1OX8A 1PD1A 2K3BA 4ZGDB 5J39A 4PJOB 1BIAA 2ZPGB 4J9HA 2YUQA 2LC4A 1N9SA 8AT1B 3OBWA 2E6ZA 1X01A 4FW1A 3A8LB 1HYOA 3GBQA 3PGGA 5FROA 2EW3A 3CBMA 3CMAQ 2NUZA 2LP5A 2DKGA 1SPKA 3OYLA 1WHJA 1M8VA 5GAN7 2B86A 5HK3A 1T3LA 3MHXA 2KQWA 1IRXA 2YUOA 3E19A 4FYXB 1YNZA 5GMKj 4HVUA 2OTJA 2L0AA 5LJ3j 1WJSA 1H3ZA 6AT1B 2K3XA 3CC4Q 3UPUA 2KT1A 3E1SA 2SEMA 5CKEA 5GAN6 1Q81R 3ULRB 1D3BA 1UFFA 1WX6A 2CDTA 4M77G 4AFQC 2OI3A 3M54A 1M2OA 3HPWA 2P0PA 3ZL7C 2A0FB 3P8BB 4J9EA 2K3YA 2LJ1A 2Y90A 2QDYB 4C8QA 1A0NB 1M9SA 1RAIB 4BDYA 1M1KU 1RI0A 4CI0C 2ZAEA 1M8MA 1PCXA 2RM4A 4JRKA 3OYNA 3X28B 3QKJA 4QVCA 3OY9A 2WSEE 2JTEA 1O9SA 1VQKT 1VA7A 2GNCA 4RG8A 1X2QA 5GAMj 4ZNXA 3V7CA 1YJWQ 2JN0A 5GAMf 1NJIC 1EZZB 4GBQA 2LT1A 1OULA 3MPUB 4WF2A 3CC2T 2KBTA 2DVJA 5A2QE 1K9MR 3CPFA 1VIFA 4M78E 4M75F 4IUPA 3I35A 2KYMA 3OW2P 4ZGJB 4FSXA 3G4SA 2JNGA 4L6V5 1D1CA 4Z88A 1SEMA 3RESA 1U1TA 1I07A 1VQ4Q 3JAME 3JCMV 1D3BB 5CIUA 4EMKA 3G1JA 2E70A 1M27C 4JS5A 5DM7R 4F7UF 2OX7A 1JXMA 2VB6A 5GJWB 3CPWS 3VS5A 1Q81C 1MMDA 3CC4T 4C8QB 1VQMQ 1X43A 2FO0A 4M7AG 1U1SA 1VOMA 2E3HA 1PRMC 4E7IA 3QXEB 2X3XD 3FRNA 1TSFA 5CAIA 1LNXA 2V26A 2KVQG 1KD1U 1LVKA 1I0CA 3CCJQ 1OEBA 4J6WA 1GFCA 4X9DA 2KROA 3QYGB 4KULA 2A7YA 3L2VA 1TWBA 2DK3A 2QAZA 2FHDA 3DLLA 1K4US 1AWJA 3UDCA 1J3TA 2CH4W 1MGQA 1WHLA 5DLQE 4BE1A 3AHUA 2XKOC 3A8MB 2QQSA 1R0CB 5GMKi 1QCFA 1M4ZA 4J9FA 3HRSA 3PNWC 2EGEA 3M56A 1U5SA 3JB9I 1TTHB 1XTDA 2MF2A 1WGSA 4VUBA 4O6JA 4M7DG 2V8IA 2CUDA 1YJWT 2A37A 4OMQA 4C0DC 1RLQC 1W70A 2HZYA 4EMKB 1UGRB 2OJ2A 1K73R 1M1GA 4XTZA 4OB1B 3GIBA 1W2BA 2VYTA 2YXYA 2QQAA 3CCRA 3EGDA 2LJ0A 3G71Q 1ZA1B 2WSFE 3V8JA 3A5ZB 2CP2A 1VQ4T 1R77A 4LDUA 5IT9E 3FEOA 3L2WA 1RAFB 5CK9A 4KGVB 3JCMP 3QDRB 3DB4A 4C92C 1Q82C 2HMAA 2L2PA 2DZCA 2I2LA 2JJ9A 2KNBB 3PTAA 4C5IA 2X4JA 1YI2Q 5FWBA 1UGVA 1R8OB 1UGQB 2JOYA 4M75E 4LDYA 3UWNA 4PJOF 1TOVA 1VQMT 2CH4A 3CC2A 1OU8A 2A3LA 2GF7A 2PNIA 1X27A 2D1XA 3CMEQ 3OYBA 4RTWA 1MNDA 1D1AA 5LJ5e 4JRPA 2DTIA 3NTHA 1IXDA 4NS5A 1B3QA 1VQLA 1M2VA 1QWEA 3M57A 2E5KA 2ZPFB 3X26B 3CCJT 4ATOA 4FSSA 4PK4A 1VQ6A 2OTLT 2KAFA 4J7FA 3EG3A 2C0TA 4F7UE 1NG2A 2DLPA 2K2MA 1AHJB 1YJ9Q 1OI1A 2O88A 1KG1A 2CSQA 2LZ6B 2CP5A 2FVUA 4ANJA 2DTOA 2RF0A 2PVOB 1KQSP 4NOYA 1QVGS 3CC4A 4BI8B 3ER0A 4C92D 1I5LA 2YRDA 1YP5A 5CO7A 3VRZA 4E47A 1VQPA 4E2FB 2A28A 2W0ZA 4ZGEB 1B07A 2DL7A 5KE2A 1PKSA 2OTJQ 2K5IA 1N8RR 4JZ4A 4PJNA 3CCMA 5KH6A 5LJ5d 2B8AA 5M9OA 4IUTA 1KC8U 1H641 2QI2A 2NYSA 2FG0A 3G71T 3DKMA 4XU1A 4IURA 2X51A 1JRIA 2FPDA 2MOXA 1QMCA 3GPLA 4QT7A 1JB0E 4IIOA 1GCQC 1XJWB 2RQUA 4R0KA 3E9FA 1VQNQ 2EJFA 1MMGA 1YWOA 1M2VB 4C8QG 5HK0A 1YI2T 1JJ2S 1YJWA 3OYEA 1BI1A 4C5HA 2ROTA 2QEXA 1DJ7B 1E6GA 2KXDA 2MWPA 3CMET 2K4YA 2JS0A 2DL3A 4CC4B 1XQHA 1AD5A 4AFSC 2XU8A 1QP2A 2CP6A 3TCJA 2YDLA 2CZ1B 1UB4A 3D7SB 3LW5E 4J6XA 3OW2A 1AWXA 4M75C 2D6FA 2M02A 4MMLA 3H6ZA 4ZTJA 2EQJA 2IVWA 1M90C 5GAN2 3OYKA 1JQQA 2V8JA 4M77B 3RMQA 1D0YA 4F17A 5EC7A 1TXQA 4GLKA 5FLXE 3VYGA 4PJOE 2P4TA 2PZ1A 1X69A 2EJGA 2ZPHB 5GMKm 1KHCA 4ELZC 2AK5A 1MMNA 2J6FA 4II1A 1VQMA 4M7AA 1BK2A 3M58A 5LJ3g 2VVKA 3E9GA 1N8RC 2FZGB 2JTMA 2JVVA 2DA9A 3JCMW 1QKXA 2OTJT 4M77D 2RQTA 2JZ2A 3CCJA 5CKHA 4JPBW 5KYWA 1QCOA 3F70A 2OTLA 3CCET 1GBRA 2JT4A 5KYUA 3M0SA 2EYXA 1VUBA 1GCPA 5I21A 1N9RA 2COWA 2M1HA 2RQWA 3JCMg 2PUKB 3OYMA 2COZA 4M75D 2DJZA 4NL3A 3L1AA 3EH2A 1MMAA 1BKBA 4EMHA 4QQGA 1VQNT 1S1NA 4Y91A 4C5GA 2KDSA 4LUDA 2P0QA 4L5GA 1BCMA 2RQVA 4XTYA 2X4XA 3RKXA 1YCYA 2G6FX 1ZUYA 2ZGWA 2GQIA 1SKUB 1TG0A 4ORZA 5GAMg 1K8AU 2XDDA 4Z89A 4UC4A 1M5Q1 2DBMA 1AT1B 2K6DA 1BCOA 1CKBA 3EGUA 5CKBA 3UATA 2CT4A 3OSSC 1Y7XA 1PSFA 1YFNA 3G71A 3FLGA 2KEAA 1S72A 1NPRA 2ED1A 1TS9A 2QQBA 3M4GA 1AVZC 2HCKA 2XIDA 4M7AB 1EFNA 1FXXA 3A98A 2GGRA 1BB9A 2RHXA 1H3HA 1M3BA 2NLUA 2LNHB 3OQ5A 4JJBA 3CCRQ 2DRKA 3MP8A 2PTKA 2FRYA 3CBOA 4MZPA 3PVQA 4M7DC 3CCSA 5KYWB 3OYHA 1YI2A 3DB3A 3MKDA 2X35A 3S3OA 1OPKA 3A8OB 1ZSZA 4XK8E 5KYUB 3OYIA 1V29B 4MZMA 2D8HA 2J6OA 3EFSA 1KSWA 3CMEA 3EAEA 4PJOC 4O5VA 4XU3A 3C12A 4DBQA 2GCXA 4BB7A 1K0SA 4J9CA 4M4ZA 2EJ9A 4QW2A 1OYXA 1UHCA 3LYIA 3GNGA 2QG9B 2VASA 9ATCB 2K2VA 1D0ZA 1JBMA 3M4YA 4F14A 3JCMb 2KRSA 1RUWA 1VQLQ 3TSWA 4HA8A 2X3WD 3HFOA 2AZVA 1OPLA 1VQ6Q 1KQSA 4KH1B 1ABOA 4Q5WA 2Y4YA 1WPYA 2H3JA 5GANg 4RTZA 1YJNQ 3J81E 4CRIA 4J9DA 4M7DD 1KIKA 2M9UA 4GY5A 2KE9A 2LRQA 5CQXA 2DX1A 2EIFA 1ZUKA 4JUVA 2CZ6B 1W6XA 3HHTB 1SG5A 3H41A 2SRCA 1QVFP 2VXFA 2XDBA 5LJ3f 2QDLA 3PT9A 2DAQA 1V76A 3CCEA 2WACA 1YIJQ 1VQPQ 2ROLA 4PJOD 4KUDK 1KFZA 1Q86R 2FZCB 1ZSZB 4A54A 1WHGA 2BE7D 2ENMA 4DEXA 1HSQA 1BI2A 4AMCA 3CCMQ 3VS2A 2KMTA 3CCRT 2HKNA 4LD9K 1VQNA 3TU4K 3WVEB 3I55T 4C5EA 2QASA 1VQ5A 3RR6A 2LQNA 1UEBA 2OAWA 3S3MA 4DEYA 5DLOA 3JCMf 2HSEB 2ZPBB 4PL6A 2LCCA 2LVMA 3J80E 2HNIA 1WJRA 1I1JA 5IAYA 2L5QA 4N0AA 4BI3A 1FMVA 4E7HA 4AT1B 4FU6A 3LX7A 1PWTA 4IIMA 2HBWA 3VS1A 2RB6A 2F1LA 1PSEA 4ESRA 4M77F 1VIEA 4OB3B 2HL5C 1K9AA 4EIKA 3L2QA 2XDPA 4TVRA 5ECAA 4LE9A 2QEXQ 1W4SA 1Y71A 3S3NA 5FU6B 2QTXA 1ZQ1A 1ZX6A 4C92E 4PLIA 4FW2A 3CXCP 1VQLT 2DBKA 1YITA 4MMKA 4C8QC 4OF1A 1WHMA 1OV3A 4IUVA 1IHVA 1VQ6T 2K5LA 2KRNA 1H8KA 5FRNA 1Q7YU 2XMFA 1G8XA 1RAHB 1YJNT 4QQDA 3V7RA 1PG5B 4RKUE 3QWXX 4PKCC
chains in the Genus database with same CATH topology
2X4YA 1TH7A 4EDUA 3MEWA 3A8HB 4B9WA 1VQLA 2RJCA 2ZPFB 3M57A 3QUIA 3X26B 3CCJT 4ATOA 2LCLA 3OYFA 3RERA 4ZN3A 1HK9A 1G3YA 5GMKh 1NE8A 5C0MA 2RK2A 2KAFA 2OTLT 1VQ6A 4J7FA 1Q86C 2CS7A 2OAUA 3UT1A 4M75B 2DD4A 3OYDA 3QO3A 2YHTA 3ASKA 4F7UE 4PLLA 1YIJT 1VQPT 1AHJB 4PNOA 1OI1A 3R6OA 5D6WA 2EFIA 4NL2A 3RIRA 3HSBA 1KG1A 3VYHB 3QPHA 3J7AF 3ME9A 2RO0A 4JJNK 3G7ZA 3NFCA 2FVUA 2E5QA 2MMPA 2LQKA 1I4K1 2DTOA 4OVAA 2PVOB 3RKYA 3CCMT 2XK0A 3LGFA 3Q1JA 3P8HA 4NOYA 5GANd 1OZ2A 2DVEA 4RMOA 3PIOA 3QZ5B 2RJFA 4EPCA 3RUXA 1QVGS 3CC4A 2LDMA 4BI8B 3JB9H 3ER0A 4J7IA 3QIIA 3M55A 4C92D 1I5LA 1M90U 4A53A 5CO7A 4E47A 1VQPA 4EMKC 5LJ5h 5I2SA 3V8KA 4F7UB 4BE0A 1BYMA 1I81A 3X25B 5A0LA 4J6YA 2ZCFB 3OS1A 3M59A 2FB7A 3BFMA 2DPPB 4C8QD 4ZN1A 3OYGA 4ZGEB 3VJPA 4JS4A 1W2BS 1VQNA 1ZHIA 3DLMA 5KE2A 3CBPA 4M7AF 2K5IA 3KUFA 4C0FA 4P5NA 1KQ1A 3C4SA 3CCMA 5KH6A 3L2RA 5GANj 5LJ5d 3ZEHA 2HQEA 2B8AA 5M9OA 4IUTA 4A4FA 1KC8U 1H641 2QI2A 4M7DA 3G71T 3N5BB 4QVZA 3DKMA 4XU1A 5GANf 5FRMA 2LNVA 1LOJA 5FU7C 2R57A 4HT9A 4IURA 2GQVA 4A4EA 3S6WA 2LTOA 1IZ6A 2VXEA 1K9MC 5GAOr 1B34A 1JRIA 5KCOA 1Q7YC 1N8RU 5FU6C 4BY6C 2Y4XA 4OP0A 4M78A 3GPLA 4XTWA 2QEXT 1JB0E 3MEAA 4C92G 3PMTA 3GP8A 4BI4A 5D6XA 4PJOA 2MI6A 4E7JA 1GXIE 2VGMA 2DIGA 1M1FA 3E9FA 3MEUA 4JDSA 2EJFA 3L2ZA 5GAOq 5LJ5j 5KE3A 1HXDA 4MZTA 1VQOA 3CCLA 4C8QG 2QXFA 2VV5A 4RCBA 4M75G 5HK0A 4R56A 3I55A 3HFNA 4X9CA 3KBGA 3X20B 5LJ5f 5GAOp 1YI2T 1JJ2S 1YJWA 3CCVT 5EG2A 2VGNA 3OYEA 2E64A 3GLXA 1P92A 1G5VA 5GMKe 1K73U 1BI1A 3HP9A 3M5AA 4M77E 4C5HA 1BI3A 4L59A 1WJQA 3GF5A 2QA4T 3FB9A 4M7DF 2QEXA 1DJ7B 4V2SA 2MWPA 3CMET 3ZFJA 4D6WA 3OYCA 2KY9A 2GFUA 4J83A 2XHCA 3JCMQ 2K4YA 5GAOl 2M0OA 2EQKA 4MDXA 2QQ9A 1XQHA 3G4ST 2G3RA 3LH0A 4ME7A 2XU8A 1QP2A 3JRZA 3TCJA 1KD1C 2CZ1B 1N6AA 1UB4A 3LW5E 4J6XA 4OGEA 3OW2A 4M78F 2BIVA 1KQSS 4M75C 4KUIA 3KXTA 1G3WA 1U8RA 4C92F 2D6FA 4MMLA 2PVDB 3H6ZA 3CCVA 4ZTJA 4F7UG 3O8VA 2EQJA 2HD0A 3BDLA 3OSVA 2BKDN 2O01E 2IVWA 3SB2A 1M90C 1ZBXA 3BW1A 3HRTA 3HRUA 4LDWA 3A8GB 5GAN2 4N0AC 3OYKA 2QA4A 2V8JA 4M77B 5CKFA 3RMQA 3WXMB 2L8DA 2D9TA 5I2MA 2DXBA 4RCCA 2VC8A 4N4IA 4GLKA 5FLXE 2FL7A 3VYGA 4PJOE 2P4TA 4B9XA 4N4GA 4C0ZA 4OGCA 5CCAA 1QP3A 4BE2A 3BDUA 1I8FA 2RHZA 2EJGA 3SD4A 2RI5A 2ZPHB 5GMKm 3JCMX 2DXTA 1KHCA 4ELZC 4M7DB 1KC8C 1Y96A 4FT2A 3GOXA 3CMAT 4XU2A 4II1A 2HAXA 1VQMA 4M7AA 1XOVA 4J5YA 5LJ3h 2YLBA 3M58A 1VQ8T 3MEVA 2EWNA 5LJ3g 1VQ9T 1YJ9A 5GAN8 1B34B 3OBYA 1YJNA 3E9GA 4KBMB 3LWIA 1N8RC 3FJPA 5CQYA 4M78B 5GAMe 1YBYA 3CCQT 4J8OA 2JTMA 5J26A 1UGPB 2JVVA 4HT8A 4MDWA 1N27A 4ZGDB 2D0QB 4JLIA 5J39A 3JCMW 2OTJT 4M77D 1BIAA 2ZPGB 4PJOB 5LJ3d 4XTUA 2LC4A 3OYAA 2JZ2A 1N9SA 2PU9B 5CKHA 3CCJA 1VQ7T 1NJIU 3V7SA 3OBWA 2E6ZA 1X01A 3F70A 3A8LB 3PGGA 5FROA 2OTLA 3CCET 2X4WA 3CBMA 2DO3A 1RL2A 2HQXA 2O4XA 2RD1A 2XI9A 5D6YA 2DKGA 3OYLA 1QVFA 3FC3A 5I21A 1VUBA 1YIJA 1M8VA 3FIFA 1N9RA 4DOWA 5GAN7 2M1HA 3JCMh 1VQ9A 5HK3A 3MHXA 2CKKA 1K73C 2KQWA 3JCMg 2PUKB 3OMCA 3OS2A 3OYMA 5GAOm 3E19A 1BIBA 4M75D 2DJZA 3VU3C 5GMKj 3CCQA 4NL3A 2KSSA 3L1AA 3QJYA 1BKBA 4EMHA 2OTJA 3VV0A 5C6SA 2L3RA 5KCHA 1MHNA 4QQGA 5LJ3j 1WJSA 1H3ZA 3V8LA 4LD6A 2K3XA 4IKFA 1VQNT 3UPUA 4Y91A 2JTFA 2ZZDA 2KDSA 4C5GA 1BI0A 3E1SA 5CKEA 2P0QA 4L5GA 2ZPEB 5GAN6 3CPWA 4XTYA 3URGA 3P8DA 2X4XA 2EAYA 3RKXA 1D3BA 1YCYA 5HKCA 5GMKl 1S72T 4M7AE 4IUUA 4M77G 2ZGWA 3RMSA 5GAMh 5A0GA 3M54A 3OS0A 5GAMg 3SDZA 1K8AU 2ZPIB 1NZ9A 1IREB 3MP6A 2XDDA 4UC4A 3JCMJ 1M5Q1 1KQ2A 3HPWA 3T9NA 2P0PA 4QQ6A 2LX9A 4C92A 1YHQT 3P8BB 1QW1A 3CD6T 2K3YA 3OW2S 1Q81U 5CKBA 1WNLA 2RJEA 1FX7A 3SWNA 2DTHA 2Y90A 3OSSC 1Y7XA 5GAMd 1PSFA 2QDYB 3QG1A 3TREA 4C8QA 1M9SA 3G71A 3FLGA 4OB0B 2GFAA 3CCST 4BDYA 1RI0A 2DD5A 3PMIA 4XTVA 4FIBA 4CI0C 1NPRA 1S72A 2QQBA 3LWHA 3LLRA 2RI3A 3M4GA 4N4HA 4M77C 2RM4A 2XIDA 1Y07A 4M7AB 4DQ2A 1FXXA 2F5TX 4JRKA 3OYNA 4BACA 1G3SA 3QKJA 2CYZB 3X28B 4QVCA 3C95A 3OY9A 2RHXA 2WSEE 2JUFA 5LJ3e 2NLUA 2YRVA 4PJOG 4JRQA 3OQ5A 2RI2A 4ZTFA 1O9SA 3L2UA 3ZBDA 1VQKT 3INZA 3MP8A 1FWZA 3CBOA 4RG8A 4MZPA 5GAMj 3CCUT 4M7DC 2CZ7B 1X75C 2M16A 3V7CA 4M7DE 2JN0A 4QVDA 3MO8A 3CXCA 5GAMf 3CCSA 3OYHA 1YI2A 3G6ET 1NJIC 2LT1A 3DB3A 2X35A 3OB9A 4WF2A 3S3OA 4LD9K 4A4KA 2O4XB 3CC2T 2QQRA 3A8OB 2CGHA 5A2QE 4C0DB 4XK8E 4XQ3A 4XTXA 1V29B 4MZMA 3OYIA 4M78C 2R58A 3BY7A 2DIQA 4LDVA 3CPFA 3VUZA 1VIFA 3EFSA 4M78E 4M75F 4X34A 4C8QF 3CMEA 4IUPA 3X24B 3EAEA 4PJOC 4O5VA 4ELYC 4ZGJB 3JCMe 2DXUA 4FSXA 4XU3A 1VQKA 1KHIA 3G4SA 3JB9D 5A0DA 3C12A 2WSCE 1X6OA 2JNGA 3CCUA 5LL6S 2GCXA 4L6V5 4BB7A 2DZ9A 3H8ZA 2E65A 3CEYA 3GNFB 3RESA 1U1TA 2EJ9A 1K9MU 3TEEA 5GAN4 4QW2A 1XNIA 5CR2A 1OYXA 3LYIA 1OZ3A 1QVFS 3JAME 2PUOB 3GNGA 3JCMV 1D3BB 4JRIA 3HL8A 4OB2B 4RG2A 4E7LA 5CIUA 2E10A 4EMKA 2BUDA 3QJ6A 3MCAB 2KK4A 2E70A 2RHUA 2K2VA 2MAMA 1JBMA 1G3TA 2K57A 3OYYA 3M4YA 4FT4A 1K8AC 3JCMb 4JS5A 1M1KU 1WQWA 5DM7R 4F7UF 4BDZA 4HKEA 4C92B 2EKOA 5HY6A 4HCZA 2F5KA 2DEQA 2PQWA 5L8RE 4HA8A 3CPWS 3HFOA 1Q81C 3SWNB 3CC4T 4C8QB 1KQSA 2XICA 4M7AG 3OA6A 5GAN3 3M9QA 1M1KC 3CMAA 4JLGA 4FM4B 1U1SA 4R55A 3JB9G 2L89A 4Q5WA 2Y4YA 1WPYA 2H3JA 3JCMc 5GANh 2YLCA 1VQ8A 5GANg 4E7IA 2RA2A 3QXEB 3FRNA 2RHIA 3J81E 1Q82U 5CAIA 1LNXA 4CRIA 4M7DD 2M9UA 4GY5A 2KVQG 3QYHB 2LRQA 5CQXA 1KD1U 2CZ0B 5IN1A 2EIFA 1UGSB 4XU0A 4JUVA 5CKDA 2CZ6B 4J6WA 4X9DA 3HHTB 3QYGB 4DA4A 4KULA 2A7YA 3QSUA 3L2VA 4M78D 2DK3A 3JCMd 1VQ5T 1VQ7A 2VXFA 2EQMA 2XDBA 3PFSA 5LJ3f 3PT9A 2E6NA 3I56T 2DAQA 2FHDA 3CCEA 3DLLA 2WACA 4M7AC 1NPPA 3META 3VKIA 4PJOD 2RK1A 4KUDK 3UDCA 2XD0A 4BD3A 4M77A 1MGQA 5DLQE 5LJ5g 4BE1A 4A54A 2VUBA 3AHUA 1O75A 2XKOC 3A8MB 2QQSA 2RH2A 5GMKi 4E7KA 3RKWA 4IUQA 4HCCA 1BI2A 1M4ZA 3NTIA 3JB9F 3HRSA 2V8KA 3PNWC 4BUGA 2KMTA 5GAOn 3M56A 3CCRT 3QZ9B 3JB9I 1XTDA 4VUBA 2MF2A 1WGSA 2LT4A 3CXCS 4O6JA 4OMFB 3CCLT 1VQOT 3TU4K 1Q86U 2V8IA 3WVEB 2RJDA 4C5EA 3I55T 1VQ5A 4M7DG 1UEBA 3I56A 3S3MA 4M75A 1YJWT 5DLOA 3JCMf 4C0DC 3FDRA 3WVDB 1QVGA 4Y28E 1Y96B 2ZPBB 4PL6A 4Z02A 2LCCA 2LVMA 3J80E 1EIFA 2HNIA 1WJRA 4M78G 2L5QA 1UGRB 3EFRA 4N0AA 2K5FA 4BI3A 4EMKB 5IAYA 4E7HA 4FU6A 1M1GA 2F69A 3LX7A 4XTZA 4C0GA 4OB1B 3L42A 2RB6A 1W2BA 4FL6A 2VYTA 1PSEA 3GIBA 1YHQA 2QQAA 4M77F 3CD6A 4LDXA 3CCRA 3CC7T 2E12A 2R5MA 1VIEA 4OB3B 3SFMA 1YITT 2PVGB 2WSFE 3VUBA 3L2QA 1LJOA 3V8JA 2XDPA 3A5ZB 4DOVA 3PIPA 2RHYA 2IG0A 4TVRA 4YTLA 2E1HA 1VQ4T 5FU7B 4A4HA 2MWOA 4F7UA 1QVPA 4XAXB 3HKSA 3OMGA 5J3BA 2P0KA 4LDUA 5AYFA 5IT9E 3FEOA 3OYJA 3L2WA 5CK9A 3JCMP 1W4SA 1Y71A 3MP1A 4KT0E 3QDRB 4EMGA 1SSFA 3DB4A 5FU6B 3S3NA 3QHSA 4C92C 5GANe 4BY6B 2QTXA 1ZQ1A 1Q82C 3LGLA 4A4GA 2HBPA 4C92E 4PLIA 5GAN5 4M7AD 2DZCA 2I2LA 3JSCA 3CC7A 3SWNC 1VQLT 1YITA 4MMKA 5DY9A 4C8QC 4OF1A 3C94A 4C5IA 2X4JA 3PTAA 4IUVA 1R8OB 4C8QE 1UGQB 2JOYA 1VQ6T 4M75E 4HCBA 2K5LA 3JB9J 4LDYA 3UWNA 4PJOF 5FRNA 3G6EA 1VQMT 2R5AA 1VQ4A 1Q7YU 2LQ8A 1JJ2A 3CC2A 2C06A 2AHJB 5CVIA 2A3LA 2GF7A 2DXCA 1YJ9T 3OYBA 1WQ7A 3OS5A 1YJNT 2E41A 2EQUA 2FYKA 5LJ5e 4JRPA 4QQDA 2XG8D 2DTIA 3V7RA 3M53A 3NTHA 2EYQA 4NS5A 3QBYA 4RKUE 3NTKA 4PKCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TH7 A;  4XU0 A;  4JUV A;  1WNL A;  4J6W A;  4X9D A;  3SWN A;  2DTH A;  3QUI A;  4J6X A;  2Y90 A;  5GAM d;  3QSU A;  3RER A;  4M78 F;  4M78 D;  3JCM d;  1HK9 A;  4C8Q A;  5GMK h;  4M75 C;  2VXF A;  4C92 F;  5LJ3 f;  4MML A;  4XTV A;  4M75 B;  4F7U G;  4M7A C;  3QO3 A;  2YHT A;  3M4G A;  4PJO D;  4F7U E;  4M77 C;  4M77 A;  3SB2 A;  2RM4 A;  4PNO A;  1MGQ A;  4M7A B;  4DQ2 A;  3BW1 A;  5LJ5 g;  4JRK A;  5GAN 2;  4NL2 A;  4N0A C;  4A54 A;  3RIR A;  3HSB A;  4M77 B;  4QVC A;  3AHU A;  5GMK i;  4RCC A;  2VC8 A;  3RKW A;  5LJ3 e;  4PJO G;  4PJO E;  3JB9 F;  1I4K 1;  2DTO A;  3INZ A;  5GAO n;  3RKY A;  3JB9 I;  3BDU A;  1I8F A;  4NOY A;  2EJG A;  5GAM j;  5GAN d;  4M7D C;  2DVE A;  4M7D G;  5GMK m;  3JCM X;  2DXT A;  3RUX A;  3V7C A;  4M7D E;  2JN0 A;  4QVD A;  4M7D B;  5GAM f;  4M75 A;  1Y96 A;  3JB9 H;  4C92 D;  3JCM f;  1I5L A;  4XU2 A;  4WF2 A;  4A53 A;  1Y96 B;  4M7A A;  4J5Y A;  5LJ3 h;  2CGH A;  2YLB A;  4EMK C;  5LJ5 h;  2EWN A;  4XQ3 A;  3V8K A;  4F7U B;  4XTX A;  5LJ3 g;  1I81 A;  5GAN 8;  1B34 B;  2HNI A;  3BY7 A;  4M78 C;  4M78 G;  4N0A A;  3EFR A;  4J6Y A;  4EMK B;  4C8Q F;  2FB7 A;  3BFM A;  3EFS A;  4M78 E;  4M75 F;  3FJP A;  4C8Q D;  4M78 B;  5GAM e;  4XTZ A;  4HT8 A;  4PJO C;  2RB6 A;  3JCM e;  3GIB A;  4M7A F;  2DXU A;  4XU3 A;  4JLI A;  4M77 F;  3JCM W;  3JB9 D;  1KQ1 A;  1BIA A;  4M77 D;  4PJO B;  5LJ3 d;  4XTU A;  5GAN j;  5LJ5 d;  1N9S A;  2DZ9 A;  1H64 1;  4M7D A;  2E65 A;  3V7S A;  1X01 A;  3PGG A;  1U1T A;  2EJ9 A;  4XU1 A;  3RES A;  5GAN f;  1LJO A;  1LOJ A;  3V8J A;  5GAN 4;  4HT9 A;  2RD1 A;  2DKG A;  2E1H A;  2VXE A;  3JCM V;  1D3B B;  4JRI A;  4F7U A;  5I21 A;  1M8V A;  5GAO r;  1B34 A;  1JRI A;  1N9R A;  3FIF A;  5GAN 7;  2E10 A;  3JCM h;  4EMK A;  3JCM g;  4OP0 A;  4M78 A;  3JCM P;  4XTW A;  4EMG A;  5GAO m;  1JBM A;  2K57 A;  3QHS A;  4C92 C;  1BIB A;  4M75 D;  2DJZ A;  2QTX A;  3VU3 C;  4C92 G;  5GAN e;  5GMK j;  1WQW A;  3JCM b;  4C92 E;  4NL3 A;  3L1A A;  4F7U F;  5GAN 5;  4PJO A;  4C92 B;  4M7A D;  2DZC A;  4EMH A;  2I2L A;  3SWN C;  2DEQ A;  5LJ3 j;  2EJF A;  3L2Z A;  4HA8 A;  5LJ5 j;  5GAO q;  3V8L A;  4MMK A;  1HXD A;  3HFO A;  5DY9 A;  4Y91 A;  4C8Q C;  3SWN B;  4C8Q G;  4RCB A;  4M75 G;  3HFN A;  4C8Q E;  4M75 E;  4X9C A;  5GAN 6;  4C8Q B;  4XTY A;  5LJ5 f;  5GAO p;  3JB9 J;  4PJO F;  3RKX A;  2EAY A;  5GMK l;  1D3B A;  1YCY A;  5GAN 3;  4M7A G;  4M7A E;  3JB9 G;  2E64 A;  1U1S A;  4M77 G;  2ZGW A;  3JCM c;  5GAN h;  1WPY A;  5GMK e;  4M77 E;  2YLC A;  5GAM h;  5GAN g;  2RA2 A;  5GAM g;  3FB9 A;  1WQ7 A;  5CAI A;  4M7D F;  1LNX A;  2E41 A;  4M7D D;  4V2S A;  2FYK A;  5LJ5 e;  1M5Q 1;  3JCM J;  1KQ2 A;  2DTI A;  3V7R A;  4C92 A;  3JCM Q;  5GAO l; 
#chains in the Genus database with same CATH topology
 4EDU A;  3A8H B;  1PNJ A;  2JM9 A;  3QUI A;  2X9H A;  5GMK h;  1G3Y A;  1Q86 C;  1VYU A;  3UT1 A;  4J9B A;  1ACM B;  3QO3 A;  1MUZ A;  1YIJ T;  1VQP T;  4PNO A;  4KH0 B;  2EFI A;  3VS6 A;  3RIR A;  2BZ8 A;  3ME9 A;  3G7Z A;  1I4K 1;  3EG0 A;  3CCM T;  2HQH A;  2XK0 A;  4HCK A;  1OZ2 A;  4PJJ A;  3PIO A;  1WIE A;  2OTL Q;  2IPO B;  2LDM A;  3QII A;  2QGG A;  4A53 A;  4PFP A;  4EMK C;  5LJ5 h;  3X25 B;  5A0L A;  3UA6 A;  1PC0 A;  1TUG B;  1W2B S;  4C8Q D;  3VJP A;  1ZHI A;  1MNE A;  4M7A F;  4P5N A;  1KQ1 A;  5GAN j;  2EBP A;  3ZEH A;  3R6N A;  3N5B B;  5FRM A;  4LUE A;  5GAN f;  1D0X A;  2L3Q A;  2VXE A;  1K9M C;  5GAO r;  2YT6 A;  4OP0 A;  4M78 A;  2QEX T;  2JMC A;  3PMT A;  3GP8 A;  1FMW A;  4BI4 A;  1GXI E;  4PFZ A;  2DIG A;  1M1F A;  3UA7 A;  1HXD A;  4R56 A;  3I55 A;  1S72 Q;  3X20 B;  2LQW A;  1WXU A;  3GLX A;  2DJQ A;  5GMK e;  2JS2 A;  4M77 E;  4WCI A;  4M7D F;  2CUB A;  3ZFJ A;  2FEI A;  1YHQ Q;  2CT3 A;  2KY9 A;  2GFU A;  2O9V A;  2XHC A;  3JCM Q;  5GAO l;  4MDX A;  2EQK A;  2G3R A;  4ME7 A;  2I0N A;  2K79 A;  3EGX A;  2J6K A;  3CCS Q;  2M51 A;  2ECZ A;  3BDL A;  3OSV A;  3SB2 A;  5KYY A;  4HVW A;  3BW1 A;  1RAA B;  3HRU A;  2GBQ A;  2RQR A;  2VC8 A;  4JJD A;  2QYZ A;  4OGC A;  5CCA A;  1G83 A;  4DBH A;  2E4H A;  1Y96 A;  1SRL A;  3TSZ A;  5KYX A;  3GOX A;  2O31 A;  4XU2 A;  2YLB A;  2EWN A;  2HSP A;  3OBY A;  1YJN A;  5CQY A;  4M78 B;  5GAM e;  1YBY A;  4HT8 A;  1UGP B;  1TUC A;  2MK5 A;  4MDW A;  4KRT A;  2BE9 B;  2D0Q B;  5LJ3 d;  4XTU A;  3OYA A;  5FWC A;  1LPL A;  1WZO A;  3TVT A;  1NJI U;  3EGD B;  3V7S A;  2YSQ A;  4OML A;  2HDA A;  2O4X A;  2RD1 A;  5D6Y A;  1QVF A;  1YIJ A;  4DOW A;  1VQ9 A;  3H0F A;  2CKK A;  1K73 C;  3OMC A;  1G2B A;  5GAO m;  1BIB A;  5IHN A;  3VU3 C;  5D7U A;  3H0I A;  2KSS A;  3EHQ A;  1CSK A;  4DBF A;  3M0P A;  3VV0 A;  2AKL A;  5C6S A;  5KCH A;  1WHH A;  2JTF A;  2ZZD A;  1BI0 A;  3EGX B;  2ZPE B;  3CCE Q;  2NWM A;  3P8D A;  1S72 T;  2EAY A;  5GMK l;  5HKC A;  4M7A E;  4IUU A;  1V1C A;  3RMS A;  2EVR A;  5KYY B;  1M1K R;  1NZ9 A;  3MP6 A;  3JCM J;  1KQ2 A;  2LX9 A;  1YHQ T;  1QW1 A;  3CD6 T;  3OW2 S;  1Q81 U;  2AIR B;  3SWN A;  2DTH A;  1VQ5 Q;  4LN2 A;  5GAM d;  3TRE A;  3QG1 A;  3CCS T;  2LX7 A;  4XTV A;  3LWH A;  1RLP C;  4OMO A;  4N4H A;  4M77 C;  2LJ3 A;  1ZLM A;  2CYZ B;  3C95 A;  2KR3 A;  2YRV A;  4JRQ A;  1JU5 C;  2RI2 A;  1D09 B;  4ZTF A;  3INZ A;  1VQO Q;  3CCL Q;  1SHG A;  1VYV A;  4B6M A;  2KYB A;  1X75 C;  4M7D E;  3CXC A;  3OB9 A;  1WYX A;  4A4K A;  2O4X B;  2QQR A;  4XQ3 A;  1IHW A;  4XTX A;  1GRI A;  4LDV A;  3VUZ A;  4C8Q F;  2C0O A;  4ELY C;  3NGP A;  2WSC E;  1YIT Q;  3H0H A;  3CCU A;  2DZ9 A;  8ATC B;  3H8Z A;  2E65 A;  3CEY A;  1K9M U;  5GAN 4;  1OZ3 A;  1JEG A;  4JRI A;  3HL8 A;  4OB2 B;  2O9S A;  4E7L A;  2E10 A;  2BUD A;  1GFD A;  1WXB A;  3U23 A;  2RHU A;  3VS4 A;  1G3T A;  2ABL A;  3OYY A;  4FT4 A;  2KGT A;  2KT8 A;  2VWF A;  4BDZ A;  2EKO A;  4HCZ A;  1H92 A;  2F5K A;  1QKW A;  2DEQ A;  2PQW A;  5L8R E;  5IXF A;  3SWN B;  1KD1 R;  2HL3 A;  2BZX A;  1UTI A;  2DE0 X;  3M9Q A;  1M1K C;  3JB9 G;  2Z0W A;  4JLG A;  2L89 A;  3JCM c;  2CP0 A;  4RTT A;  2RHI A;  1Q82 U;  5AT1 B;  4D8D A;  2FRW A;  2CZ0 B;  5IN1 A;  1SF9 A;  1UGS B;  4XU0 A;  4AG1 C;  1Y0M A;  3QSU A;  1VQ5 T;  4PFO A;  2EQM A;  3PFS A;  2DNU A;  2E6N A;  3CQT A;  4M7A C;  1NPP A;  2CRE A;  3VKI A;  2D8J A;  2RK1 A;  4BD3 A;  2AT1 B;  5LJ5 g;  2VUB A;  4PJL A;  5IXB A;  2RH2 A;  4IUQ A;  3E2U A;  3NTI A;  3JB9 F;  2DF6 A;  2V8K A;  5GAO n;  3CPW P;  3QZ9 B;  1OOT A;  2LT4 A;  1VQO T;  3CCL T;  3I56 A;  3M0R A;  5IHI A;  3FDR A;  3WVD B;  1UJ0 A;  1FMK A;  4Y28 E;  4Z02 A;  1EIF A;  4M78 G;  1RAC B;  2F69 A;  4C0G A;  3L42 A;  4FL6 A;  1YHQ A;  1RI9 A;  3CD6 A;  2E12 A;  2V1R A;  2R5M A;  3SFM A;  1YIT T;  3I55 Q;  2PVG B;  3VUB A;  1LJO A;  5I11 A;  2IG0 A;  1E6H A;  3NPF A;  5FU7 B;  1PKT A;  1QVP A;  2DM1 A;  3OMG A;  5AYF A;  1IGQ A;  3OYJ A;  3MP1 A;  4KT0 E;  4EMG A;  1SSF A;  3QDF A;  1JXO A;  4BY6 B;  4A4G A;  5GAN 5;  4M7A D;  1QLY A;  2DFU A;  3CC7 A;  3VS0 A;  5DY9 A;  1RAB B;  4F04 B;  4C8Q E;  3JV3 A;  1WXT A;  3JB9 J;  1IGU A;  1Q95 G;  1VYT A;  1HJD A;  2R5A A;  2AHJ B;  5CVI A;  2DXC A;  1AZG B;  1WQ7 A;  3OS5 A;  2E41 A;  1U06 A;  2XG8 D;  3M53 A;  1UJY A;  4AG2 C;  3QBY A;  4JJC A;  3PE0 A;  2X4Y A;  1TH7 A;  3MEW A;  4B9W A;  4OMN A;  4WTO B;  3OYF A;  4ZN3 A;  4A63 B;  1HK9 A;  1NE8 A;  2RK2 A;  2RNA A;  2DD4 A;  3OYD A;  2K7A A;  2YHT A;  1ZSZ C;  3ASK A;  4PLL A;  3R6O A;  3J7A F;  1WI7 A;  2RO0 A;  2MIO A;  3NFC A;  3SEM A;  4OVA A;  2EKH A;  3Q1J A;  3LGF A;  4RMO A;  3P8H A;  1UDL A;  4EPC A;  4J9G A;  2AZS A;  3EFO A;  3BE3 A;  3JB9 H;  1WFW A;  2DL8 A;  2L3S A;  2EPD A;  1M90 U;  2C0I A;  1VQ8 Q;  1TUD A;  1KC8 R;  1VQ9 Q;  5I2S A;  3V8K A;  2FB7 A;  3BFM A;  2DPP B;  4ZN1 A;  4RTX A;  3OYG A;  2F2X A;  3KUF A;  4E7S A;  1VQ7 Q;  3L2R A;  5L23 A;  2HQE A;  4A4F A;  5FW9 A;  4QVZ A;  4FYY B;  1KK7 A;  3S6W A;  4CC3 A;  4JZ3 A;  1N8R U;  5FU6 C;  1HD3 A;  2JXB A;  2Y4X A;  4Y92 A;  4XTW A;  1T0H A;  2YRC A;  5D6X A;  4E7J A;  2FPE A;  2VGM A;  3MEU A;  3A1P A;  2D0N A;  5LJ5 j;  5KE3 A;  4MZT A;  1QVG P;  1VQO A;  3CCL A;  2VV5 A;  4RCB A;  4M75 G;  3HFN A;  5LJ5 f;  5GAO p;  1ZBJ A;  5EG2 A;  1WA7 A;  2E64 A;  1UHF A;  1G5V A;  4L59 A;  1IB8 A;  3GF5 A;  1B7T A;  2JW4 A;  4D6W A;  1E7O A;  2QQ9 A;  3LH0 A;  4KGX B;  2K9G A;  4OMP A;  2LMJ A;  4OGE A;  3KXT A;  1G3W A;  1MV3 A;  2PVD B;  3EFO B;  3CCV A;  4F7U G;  2EQI A;  2HD0 A;  1YWP A;  3H9N A;  2C06 A;  4LDW A;  3A8G B;  4N0A C;  2QA4 A;  3WXM B;  3O5Z A;  3M0T A;  4RTY A;  2L8D A;  5I2M A;  2MPX C;  4N4I A;  4LXC A;  2FL7 A;  1ZUU A;  2DL4 A;  4B9X A;  2AKK A;  2EYZ A;  3NMZ C;  3CCU Q;  1N5Z A;  2M0Y A;  3BDU A;  3SD4 A;  3JCM X;  2DXT A;  1F1B B;  1JJ2 P;  3G6E Q;  1KC8 C;  4FT2 A;  2KRM A;  3CMA T;  2HAX A;  1XOV A;  5LJ3 h;  1VQ8 T;  3MEV A;  1VQ9 T;  5GAN 8;  1PHT A;  3FJP A;  1WDX A;  3RNJ A;  5J26 A;  3REA B;  2KI7 A;  1OQK A;  1N27 A;  1Q82 R;  2MYS A;  4JLI A;  1FYN A;  2PU9 B;  1VQ7 T;  4RTU A;  1X6B A;  1C6V X;  2X4W A;  2DO3 A;  1RL2 A;  2HQX A;  2XI9 A;  3FC3 A;  3FIF A;  3EH1 A;  3JCM h;  2DL5 A;  2DYI A;  2FZK B;  3OS2 A;  1Z9Z A;  2BZY A;  3VS3 A;  3CCQ A;  3QJY A;  1NLP C;  2RMO A;  2COY A;  2L3R A;  1MHN A;  1K8A R;  1GBQ A;  3V8L A;  4LD6 A;  2VKN A;  4IKF A;  4DBR A;  3CPW A;  3URG A;  2F2W A;  5GAM h;  5A0G A;  1MV0 B;  3OS0 A;  3SDZ A;  2QGF B;  2ZPI B;  1IRE B;  1R0B G;  2EGA A;  1M30 A;  1IO6 A;  3T9N A;  4QQ6 A;  4C92 A;  1WNL A;  2RJE A;  1FX7 A;  2F2V A;  1BU1 A;  3I56 Q;  4KGZ B;  4OB0 B;  2GFA A;  4HXJ A;  2DD5 A;  3PMI A;  4FIB A;  3I5R A;  3LLR A;  2RI3 A;  1CKA A;  1Y07 A;  4DQ2 A;  2F5T X;  4CC7 A;  4AFZ C;  4F16 A;  4BAC A;  3RDV A;  1G3S A;  1UUE A;  2JUF A;  3VS7 A;  5LJ3 e;  4PJO G;  2J06 A;  3CD6 Q;  3L2U A;  3ZBD A;  5GJV B;  2EYW A;  1FWZ A;  3CCU T;  2CZ7 B;  2NUP A;  2M16 A;  1K76 A;  4FCY A;  4QVD A;  3MO8 A;  1I5O B;  4RUG A;  1C1A A;  3G6E T;  2FPF A;  4FYV B;  2CGH A;  4C0D B;  4HVV A;  2R58 A;  3BY7 A;  4M78 C;  2DMO A;  2DIQ A;  4AFU C;  2DER A;  4X34 A;  1OX9 A;  3X24 B;  3JCM e;  2DXU A;  2DYB A;  3CC7 Q;  1GL5 A;  1VQK A;  1KHI A;  3JB9 D;  5A0D A;  1X6O A;  5LL6 S;  2V1Q A;  4PJM A;  4E6R A;  3GNF B;  1RAE B;  3TEE A;  1QVF S;  1XNI A;  5CR2 A;  2PUO B;  4RG2 A;  1M3A A;  3QJ6 A;  3MCA B;  2KK4 A;  2MAM A;  2K57 A;  3MJX A;  4RTV A;  1NEB A;  1K8A C;  1WQW A;  2H8H A;  1UE9 A;  4HKE A;  4C92 B;  5HY6 A;  3HTR A;  2LCS A;  3EG9 A;  1BBZ A;  2XIC A;  3OA6 A;  5GAN 3;  3CMA A;  4FM4 B;  4R55 A;  5GAN h;  2YLC A;  1VQ8 A;  2RA2 A;  1M90 R;  3FJ5 A;  1NYG A;  2HKQ B;  1TU0 B;  1U3O A;  3QYH B;  5KYN A;  2H3E B;  1GCQ A;  4OMM A;  1RAG B;  1T3S A;  1M3C A;  5CKD A;  2IIM A;  4DA4 A;  1AWW A;  1SSH A;  4M78 D;  3JCM d;  1VQ7 A;  2NUP B;  3I56 T;  4X1V A;  1WHK A;  3MET A;  1NM7 A;  2XD0 A;  1WLP B;  4M77 A;  3RBB B;  2JMA A;  1O75 A;  3EG1 A;  4E7K A;  3RKW A;  5I22 A;  1ZA2 B;  4HCC A;  4FYW B;  2EGC A;  4BUG A;  1AZE A;  3CXC S;  4OMF B;  1Q86 U;  2RJD A;  3EG2 A;  4M75 A;  1QVG A;  1Y96 B;  2KXC A;  5KYX B;  2E3I A;  3EFR A;  2K5F A;  2A08 A;  2HEQ A;  4LDX A;  3CC7 T;  1NYF A;  2RPN A;  3TQ7 P;  3EG9 B;  4DOV A;  3PIP A;  2RHY A;  4YTL A;  2E1H A;  4A4H A;  2MWO A;  4F7U A;  4XAX B;  3HKS A;  5J3B A;  3SHW A;  2P0K A;  1ABQ A;  1NEG A;  1OU9 A;  3PVL A;  1Q7Y R;  3QHS A;  5GAN e;  1UG1 A;  1Y57 A;  3LGL A;  2HBP A;  4GLM A;  2NUT A;  3JSC A;  3SWN C;  1K1Z A;  2CSI A;  3C94 A;  3AT1 B;  2A36 A;  4HCB A;  3CCV Q;  3G6E A;  1VQ4 A;  5IHK A;  1JO8 A;  1QWF A;  2LQ8 A;  1JJ2 A;  2QA4 Q;  1YJ9 T;  3EHR A;  2YUN A;  1NLO C;  2EQU A;  2FYK A;  4Z8A A;  3G4S Q;  1EX4 A;  2EYQ A;  3NTK A;  3VRY A;  2P4R A;  2JM8 A;  2RJC A;  1SRM A;  2LCL A;  3RER A;  1K0X A;  5C0M A;  2CS7 A;  2OAU A;  3THK A;  4M75 B;  1AOJ A;  3I5S A;  5D6W A;  2ED0 A;  4NL2 A;  3HSB A;  3VYH B;  3QPH A;  2P84 A;  2YUP A;  2L3P A;  4JJN K;  2QK0 A;  2E5Q A;  2MMP A;  2LQK A;  3RKY A;  5GAN d;  2DVE A;  3QZ5 B;  2RJF A;  3RUX A;  4J7I A;  3M55 A;  3QWY A;  1PRL C;  3NHN A;  4BE0 A;  4F7U B;  1BYM A;  1LCK A;  1I81 A;  2DEU A;  1X2K A;  4J6Y A;  2ZCF B;  3OS1 A;  3M59 A;  3CCQ Q;  1YN8 A;  4JS4 A;  3DLM A;  3CBP A;  4C0F A;  2NUT B;  3C4S A;  4K11 A;  1T0J A;  1Z9Q A;  2CP7 A;  4QKU A;  4M7D A;  3C0C A;  1PM3 A;  2BTT A;  2LNV A;  1LOJ A;  5FU7 C;  2R57 A;  4E7Z A;  4HT9 A;  4LNP A;  2GQV A;  4A4E A;  2LTO A;  1IZ6 A;  2CP3 A;  2ESW A;  1NBE B;  1B34 A;  5KCO A;  1Q7Y C;  3IQL A;  2J05 A;  4BY6 C;  1QCN A;  3LH5 A;  3MEA A;  4C92 G;  1C0M A;  2O2O A;  4PJO A;  2MI6 A;  3M0Q A;  1UEC A;  2GTJ A;  4JDS A;  3L2Z A;  5GAO q;  1ZSG A;  2QXF A;  1ARK A;  1QQJ A;  3KBG A;  4X9C A;  2MCN A;  4D8K A;  1YCS B;  2ATC B;  3CCV T;  2VGN A;  1P92 A;  1K73 U;  3HP9 A;  3M5A A;  1BI3 A;  1WJQ A;  2DIL A;  2QA4 T;  2QTV A;  3FB9 A;  1W2B P;  3I9Q A;  7AT1 B;  4V2S A;  2EYY A;  1AWO A;  3OYC A;  4J83 A;  5IH2 A;  1RAD B;  1X6G A;  2M0O A;  3G4S T;  1W1F A;  3JRZ A;  1KD1 C;  2DRM A;  1N6A A;  2DET A;  4M78 F;  2BIV A;  1KQS S;  1U8R A;  4KUI A;  3M0U A;  4C92 F;  5HCK A;  3O8V A;  1SHF A;  2BKD N;  2O01 E;  1ZBX A;  3HRT A;  2YWW A;  3REB B;  5CKF A;  4CC2 A;  2D9T A;  2DXB A;  4RCC A;  3UF4 A;  2GTO A;  1VQK Q;  4N4G A;  4C0Z A;  1QP3 A;  4BE2 A;  1KJW A;  1I8F A;  2RHZ A;  3KFV A;  2J7I A;  4J9I A;  2RI5 A;  2RN8 A;  2W10 A;  4M7D B;  3CC2 Q;  4J5Y A;  1AEY A;  1NJI R;  1YJ9 A;  1B34 B;  4KBM B;  3LWI A;  1D1B A;  1PD0 A;  3CCQ T;  4J8O A;  1OX8 A;  1PD1 A;  2K3B A;  4ZGD B;  5J39 A;  4PJO B;  1BIA A;  2ZPG B;  4J9H A;  2YUQ A;  2LC4 A;  1N9S A;  8AT1 B;  3OBW A;  2E6Z A;  1X01 A;  4FW1 A;  3A8L B;  1HYO A;  3GBQ A;  3PGG A;  5FRO A;  2EW3 A;  3CBM A;  3CMA Q;  2NUZ A;  2LP5 A;  2DKG A;  1SPK A;  3OYL A;  1WHJ A;  1M8V A;  5GAN 7;  2B86 A;  5HK3 A;  1T3L A;  3MHX A;  2KQW A;  1IRX A;  2YUO A;  3E19 A;  4FYX B;  1YNZ A;  5GMK j;  4HVU A;  2OTJ A;  2L0A A;  5LJ3 j;  1WJS A;  1H3Z A;  6AT1 B;  2K3X A;  3CC4 Q;  3UPU A;  2KT1 A;  3E1S A;  2SEM A;  5CKE A;  5GAN 6;  1Q81 R;  3ULR B;  1D3B A;  1UFF A;  1WX6 A;  2CDT A;  4M77 G;  4AFQ C;  2OI3 A;  3M54 A;  1M2O A;  3HPW A;  2P0P A;  3ZL7 C;  2A0F B;  3P8B B;  4J9E A;  2K3Y A;  2LJ1 A;  2Y90 A;  2QDY B;  4C8Q A;  1A0N B;  1M9S A;  1RAI B;  4BDY A;  1M1K U;  1RI0 A;  4CI0 C;  2ZAE A;  1M8M A;  1PCX A;  2RM4 A;  4JRK A;  3OYN A;  3X28 B;  3QKJ A;  4QVC A;  3OY9 A;  2WSE E;  2JTE A;  1O9S A;  1VQK T;  1VA7 A;  2GNC A;  4RG8 A;  1X2Q A;  5GAM j;  4ZNX A;  3V7C A;  1YJW Q;  2JN0 A;  5GAM f;  1NJI C;  1EZZ B;  4GBQ A;  2LT1 A;  1OUL A;  3MPU B;  4WF2 A;  3CC2 T;  2KBT A;  2DVJ A;  5A2Q E;  1K9M R;  3CPF A;  1VIF A;  4M78 E;  4M75 F;  4IUP A;  3I35 A;  2KYM A;  3OW2 P;  4ZGJ B;  4FSX A;  3G4S A;  2JNG A;  4L6V 5;  1D1C A;  4Z88 A;  1SEM A;  3RES A;  1U1T A;  1I07 A;  1VQ4 Q;  3JAM E;  3JCM V;  1D3B B;  5CIU A;  4EMK A;  3G1J A;  2E70 A;  1M27 C;  4JS5 A;  5DM7 R;  4F7U F;  2OX7 A;  1JXM A;  2VB6 A;  5GJW B;  3CPW S;  3VS5 A;  1Q81 C;  1MMD A;  3CC4 T;  4C8Q B;  1VQM Q;  1X43 A;  2FO0 A;  4M7A G;  1U1S A;  1VOM A;  2E3H A;  1PRM C;  4E7I A;  3QXE B;  2X3X D;  3FRN A;  1TSF A;  5CAI A;  1LNX A;  2V26 A;  2KVQ G;  1KD1 U;  1LVK A;  1I0C A;  3CCJ Q;  1OEB A;  4J6W A;  1GFC A;  4X9D A;  2KRO A;  3QYG B;  4KUL A;  2A7Y A;  3L2V A;  1TWB A;  2DK3 A;  2QAZ A;  2FHD A;  3DLL A;  1K4U S;  1AWJ A;  3UDC A;  1J3T A;  2CH4 W;  1MGQ A;  1WHL A;  5DLQ E;  4BE1 A;  3AHU A;  2XKO C;  3A8M B;  2QQS A;  1R0C B;  5GMK i;  1QCF A;  1M4Z A;  4J9F A;  3HRS A;  3PNW C;  2EGE A;  3M56 A;  1U5S A;  3JB9 I;  1TTH B;  1XTD A;  2MF2 A;  1WGS A;  4VUB A;  4O6J A;  4M7D G;  2V8I A;  2CUD A;  1YJW T;  2A37 A;  4OMQ A;  4C0D C;  1RLQ C;  1W70 A;  2HZY A;  4EMK B;  1UGR B;  2OJ2 A;  1K73 R;  1M1G A;  4XTZ A;  4OB1 B;  3GIB A;  1W2B A;  2VYT A;  2YXY A;  2QQA A;  3CCR A;  3EGD A;  2LJ0 A;  3G71 Q;  1ZA1 B;  2WSF E;  3V8J A;  3A5Z B;  2CP2 A;  1VQ4 T;  1R77 A;  4LDU A;  5IT9 E;  3FEO A;  3L2W A;  1RAF B;  5CK9 A;  4KGV B;  3JCM P;  3QDR B;  3DB4 A;  4C92 C;  1Q82 C;  2HMA A;  2L2P A;  2DZC A;  2I2L A;  2JJ9 A;  2KNB B;  3PTA A;  4C5I A;  2X4J A;  1YI2 Q;  5FWB A;  1UGV A;  1R8O B;  1UGQ B;  2JOY A;  4M75 E;  4LDY A;  3UWN A;  4PJO F;  1TOV A;  1VQM T;  2CH4 A;  3CC2 A;  1OU8 A;  2A3L A;  2GF7 A;  2PNI A;  1X27 A;  2D1X A;  3CME Q;  3OYB A;  4RTW A;  1MND A;  1D1A A;  5LJ5 e;  4JRP A;  2DTI A;  3NTH A;  1IXD A;  4NS5 A;  1B3Q A;  1VQL A;  1M2V A;  1QWE A;  3M57 A;  2E5K A;  2ZPF B;  3X26 B;  3CCJ T;  4ATO A;  4FSS A;  4PK4 A;  1VQ6 A;  2OTL T;  2KAF A;  4J7F A;  3EG3 A;  2C0T A;  4F7U E;  1NG2 A;  2DLP A;  2K2M A;  1AHJ B;  1YJ9 Q;  1OI1 A;  2O88 A;  1KG1 A;  2CSQ A;  2LZ6 B;  2CP5 A;  2FVU A;  4ANJ A;  2DTO A;  2RF0 A;  2PVO B;  1KQS P;  4NOY A;  1QVG S;  3CC4 A;  4BI8 B;  3ER0 A;  4C92 D;  1I5L A;  2YRD A;  1YP5 A;  5CO7 A;  3VRZ A;  4E47 A;  1VQP A;  4E2F B;  2A28 A;  2W0Z A;  4ZGE B;  1B07 A;  2DL7 A;  5KE2 A;  1PKS A;  2OTJ Q;  2K5I A;  1N8R R;  4JZ4 A;  4PJN A;  3CCM A;  5KH6 A;  5LJ5 d;  2B8A A;  5M9O A;  4IUT A;  1KC8 U;  1H64 1;  2QI2 A;  2NYS A;  2FG0 A;  3G71 T;  3DKM A;  4XU1 A;  4IUR A;  2X51 A;  1JRI A;  2FPD A;  2MOX A;  1QMC A;  3GPL A;  4QT7 A;  1JB0 E;  4IIO A;  1GCQ C;  1XJW B;  2RQU A;  4R0K A;  3E9F A;  1VQN Q;  2EJF A;  1MMG A;  1YWO A;  1M2V B;  4C8Q G;  5HK0 A;  1YI2 T;  1JJ2 S;  1YJW A;  3OYE A;  1BI1 A;  4C5H A;  2ROT A;  2QEX A;  1DJ7 B;  1E6G A;  2KXD A;  2MWP A;  3CME T;  2K4Y A;  2JS0 A;  2DL3 A;  4CC4 B;  1XQH A;  1AD5 A;  4AFS C;  2XU8 A;  1QP2 A;  2CP6 A;  3TCJ A;  2YDL A;  2CZ1 B;  1UB4 A;  3D7S B;  3LW5 E;  4J6X A;  3OW2 A;  1AWX A;  4M75 C;  2D6F A;  2M02 A;  4MML A;  3H6Z A;  4ZTJ A;  2EQJ A;  2IVW A;  1M90 C;  5GAN 2;  3OYK A;  1JQQ A;  2V8J A;  4M77 B;  3RMQ A;  1D0Y A;  4F17 A;  5EC7 A;  1TXQ A;  4GLK A;  5FLX E;  3VYG A;  4PJO E;  2P4T A;  2PZ1 A;  1X69 A;  2EJG A;  2ZPH B;  5GMK m;  1KHC A;  4ELZ C;  2AK5 A;  1MMN A;  2J6F A;  4II1 A;  1VQM A;  4M7A A;  1BK2 A;  3M58 A;  5LJ3 g;  2VVK A;  3E9G A;  1N8R C;  2FZG B;  2JTM A;  2JVV A;  2DA9 A;  3JCM W;  1QKX A;  2OTJ T;  4M77 D;  2RQT A;  2JZ2 A;  3CCJ A;  5CKH A;  4JPB W;  5KYW A;  1QCO A;  3F70 A;  2OTL A;  3CCE T;  1GBR A;  2JT4 A;  5KYU A;  3M0S A;  2EYX A;  1VUB A;  1GCP A;  5I21 A;  1N9R A;  2COW A;  2M1H A;  2RQW A;  3JCM g;  2PUK B;  3OYM A;  2COZ A;  4M75 D;  2DJZ A;  4NL3 A;  3L1A A;  3EH2 A;  1MMA A;  1BKB A;  4EMH A;  4QQG A;  1VQN T;  1S1N A;  4Y91 A;  4C5G A;  2KDS A;  4LUD A;  2P0Q A;  4L5G A;  1BCM A;  2RQV A;  4XTY A;  2X4X A;  3RKX A;  1YCY A;  2G6F X;  1ZUY A;  2ZGW A;  2GQI A;  1SKU B;  1TG0 A;  4ORZ A;  5GAM g;  1K8A U;  2XDD A;  4Z89 A;  4UC4 A;  1M5Q 1;  2DBM A;  1AT1 B;  2K6D A;  1BCO A;  1CKB A;  3EGU A;  5CKB A;  3UAT A;  2CT4 A;  3OSS C;  1Y7X A;  1PSF A;  1YFN A;  3G71 A;  3FLG A;  2KEA A;  1S72 A;  1NPR A;  2ED1 A;  1TS9 A;  2QQB A;  3M4G A;  1AVZ C;  2HCK A;  2XID A;  4M7A B;  1EFN A;  1FXX A;  3A98 A;  2GGR A;  1BB9 A;  2RHX A;  1H3H A;  1M3B A;  2NLU A;  2LNH B;  3OQ5 A;  4JJB A;  3CCR Q;  2DRK A;  3MP8 A;  2PTK A;  2FRY A;  3CBO A;  4MZP A;  3PVQ A;  4M7D C;  3CCS A;  5KYW B;  3OYH A;  1YI2 A;  3DB3 A;  3MKD A;  2X35 A;  3S3O A;  1OPK A;  3A8O B;  1ZSZ A;  4XK8 E;  5KYU B;  3OYI A;  1V29 B;  4MZM A;  2D8H A;  2J6O A;  3EFS A;  1KSW A;  3CME A;  3EAE A;  4PJO C;  4O5V A;  4XU3 A;  3C12 A;  4DBQ A;  2GCX A;  4BB7 A;  1K0S A;  4J9C A;  4M4Z A;  2EJ9 A;  4QW2 A;  1OYX A;  1UHC A;  3LYI A;  3GNG A;  2QG9 B;  2VAS A;  9ATC B;  2K2V A;  1D0Z A;  1JBM A;  3M4Y A;  4F14 A;  3JCM b;  2KRS A;  1RUW A;  1VQL Q;  3TSW A;  4HA8 A;  2X3W D;  3HFO A;  2AZV A;  1OPL A;  1VQ6 Q;  1KQS A;  4KH1 B;  1ABO A;  4Q5W A;  2Y4Y A;  1WPY A;  2H3J A;  5GAN g;  4RTZ A;  1YJN Q;  3J81 E;  4CRI A;  4J9D A;  4M7D D;  1KIK A;  2M9U A;  4GY5 A;  2KE9 A;  2LRQ A;  5CQX A;  2DX1 A;  2EIF A;  1ZUK A;  4JUV A;  2CZ6 B;  1W6X A;  3HHT B;  1SG5 A;  3H41 A;  2SRC A;  1QVF P;  2VXF A;  2XDB A;  5LJ3 f;  2QDL A;  3PT9 A;  2DAQ A;  1V76 A;  3CCE A;  2WAC A;  1YIJ Q;  1VQP Q;  2ROL A;  4PJO D;  4KUD K;  1KFZ A;  1Q86 R;  2FZC B;  1ZSZ B;  4A54 A;  1WHG A;  2BE7 D;  2ENM A;  4DEX A;  1HSQ A;  1BI2 A;  4AMC A;  3CCM Q;  3VS2 A;  2KMT A;  3CCR T;  2HKN A;  4LD9 K;  1VQN A;  3TU4 K;  3WVE B;  3I55 T;  4C5E A;  2QAS A;  1VQ5 A;  3RR6 A;  2LQN A;  1UEB A;  2OAW A;  3S3M A;  4DEY A;  5DLO A;  3JCM f;  2HSE B;  2ZPB B;  4PL6 A;  2LCC A;  2LVM A;  3J80 E;  2HNI A;  1WJR A;  1I1J A;  5IAY A;  2L5Q A;  4N0A A;  4BI3 A;  1FMV A;  4E7H A;  4AT1 B;  4FU6 A;  3LX7 A;  1PWT A;  4IIM A;  2HBW A;  3VS1 A;  2RB6 A;  2F1L A;  1PSE A;  4ESR A;  4M77 F;  1VIE A;  4OB3 B;  2HL5 C;  1K9A A;  4EIK A;  3L2Q A;  2XDP A;  4TVR A;  5ECA A;  4LE9 A;  2QEX Q;  1W4S A;  1Y71 A;  3S3N A;  5FU6 B;  2QTX A;  1ZQ1 A;  1ZX6 A;  4C92 E;  4PLI A;  4FW2 A;  3CXC P;  1VQL T;  2DBK A;  1YIT A;  4MMK A;  4C8Q C;  4OF1 A;  1WHM A;  1OV3 A;  4IUV A;  1IHV A;  1VQ6 T;  2K5L A;  2KRN A;  1H8K A;  5FRN A;  1Q7Y U;  2XMF A;  1G8X A;  1RAH B;  1YJN T;  4QQD A;  3V7R A;  1PG5 B;  4RKU E;  3QWX X;  4PKC C; 
#chains in the Genus database with same CATH homology
 2X4Y A;  1TH7 A;  4EDU A;  3MEW A;  3A8H B;  4B9W A;  1VQL A;  2RJC A;  2ZPF B;  3M57 A;  3QUI A;  3X26 B;  3CCJ T;  4ATO A;  2LCL A;  3OYF A;  3RER A;  4ZN3 A;  1HK9 A;  1G3Y A;  5GMK h;  1NE8 A;  5C0M A;  2RK2 A;  2KAF A;  2OTL T;  1VQ6 A;  4J7F A;  1Q86 C;  2CS7 A;  2OAU A;  3UT1 A;  4M75 B;  2DD4 A;  3OYD A;  3QO3 A;  2YHT A;  3ASK A;  4F7U E;  4PLL A;  1YIJ T;  1VQP T;  1AHJ B;  4PNO A;  1OI1 A;  3R6O A;  5D6W A;  2EFI A;  4NL2 A;  3RIR A;  3HSB A;  1KG1 A;  3VYH B;  3QPH A;  3J7A F;  3ME9 A;  2RO0 A;  4JJN K;  3G7Z A;  3NFC A;  2FVU A;  2E5Q A;  2MMP A;  2LQK A;  1I4K 1;  2DTO A;  4OVA A;  2PVO B;  3RKY A;  3CCM T;  2XK0 A;  3LGF A;  3Q1J A;  3P8H A;  4NOY A;  5GAN d;  1OZ2 A;  2DVE A;  4RMO A;  3PIO A;  3QZ5 B;  2RJF A;  4EPC A;  3RUX A;  1QVG S;  3CC4 A;  2LDM A;  4BI8 B;  3JB9 H;  3ER0 A;  4J7I A;  3QII A;  3M55 A;  4C92 D;  1I5L A;  1M90 U;  4A53 A;  5CO7 A;  4E47 A;  1VQP A;  4EMK C;  5LJ5 h;  5I2S A;  3V8K A;  4F7U B;  4BE0 A;  1BYM A;  1I81 A;  3X25 B;  5A0L A;  4J6Y A;  2ZCF B;  3OS1 A;  3M59 A;  2FB7 A;  3BFM A;  2DPP B;  4C8Q D;  4ZN1 A;  3OYG A;  4ZGE B;  3VJP A;  4JS4 A;  1W2B S;  1VQN A;  1ZHI A;  3DLM A;  5KE2 A;  3CBP A;  4M7A F;  2K5I A;  3KUF A;  4C0F A;  4P5N A;  1KQ1 A;  3C4S A;  3CCM A;  5KH6 A;  3L2R A;  5GAN j;  5LJ5 d;  3ZEH A;  2HQE A;  2B8A A;  5M9O A;  4IUT A;  4A4F A;  1KC8 U;  1H64 1;  2QI2 A;  4M7D A;  3G71 T;  3N5B B;  4QVZ A;  3DKM A;  4XU1 A;  5GAN f;  5FRM A;  2LNV A;  1LOJ A;  5FU7 C;  2R57 A;  4HT9 A;  4IUR A;  2GQV A;  4A4E A;  3S6W A;  2LTO A;  1IZ6 A;  2VXE A;  1K9M C;  5GAO r;  1B34 A;  1JRI A;  5KCO A;  1Q7Y C;  1N8R U;  5FU6 C;  4BY6 C;  2Y4X A;  4OP0 A;  4M78 A;  3GPL A;  4XTW A;  2QEX T;  1JB0 E;  3MEA A;  4C92 G;  3PMT A;  3GP8 A;  4BI4 A;  5D6X A;  4PJO A;  2MI6 A;  4E7J A;  1GXI E;  2VGM A;  2DIG A;  1M1F A;  3E9F A;  3MEU A;  4JDS A;  2EJF A;  3L2Z A;  5GAO q;  5LJ5 j;  5KE3 A;  1HXD A;  4MZT A;  1VQO A;  3CCL A;  4C8Q G;  2QXF A;  2VV5 A;  4RCB A;  4M75 G;  5HK0 A;  4R56 A;  3I55 A;  3HFN A;  4X9C A;  3KBG A;  3X20 B;  5LJ5 f;  5GAO p;  1YI2 T;  1JJ2 S;  1YJW A;  3CCV T;  5EG2 A;  2VGN A;  3OYE A;  2E64 A;  3GLX A;  1P92 A;  1G5V A;  5GMK e;  1K73 U;  1BI1 A;  3HP9 A;  3M5A A;  4M77 E;  4C5H A;  1BI3 A;  4L59 A;  1WJQ A;  3GF5 A;  2QA4 T;  3FB9 A;  4M7D F;  2QEX A;  1DJ7 B;  4V2S A;  2MWP A;  3CME T;  3ZFJ A;  4D6W A;  3OYC A;  2KY9 A;  2GFU A;  4J83 A;  2XHC A;  3JCM Q;  2K4Y A;  5GAO l;  2M0O A;  2EQK A;  4MDX A;  2QQ9 A;  1XQH A;  3G4S T;  2G3R A;  3LH0 A;  4ME7 A;  2XU8 A;  1QP2 A;  3JRZ A;  3TCJ A;  1KD1 C;  2CZ1 B;  1N6A A;  1UB4 A;  3LW5 E;  4J6X A;  4OGE A;  3OW2 A;  4M78 F;  2BIV A;  1KQS S;  4M75 C;  4KUI A;  3KXT A;  1G3W A;  1U8R A;  4C92 F;  2D6F A;  4MML A;  2PVD B;  3H6Z A;  3CCV A;  4ZTJ A;  4F7U G;  3O8V A;  2EQJ A;  2HD0 A;  3BDL A;  3OSV A;  2BKD N;  2O01 E;  2IVW A;  3SB2 A;  1M90 C;  1ZBX A;  3BW1 A;  3HRT A;  3HRU A;  4LDW A;  3A8G B;  5GAN 2;  4N0A C;  3OYK A;  2QA4 A;  2V8J A;  4M77 B;  5CKF A;  3RMQ A;  3WXM B;  2L8D A;  2D9T A;  5I2M A;  2DXB A;  4RCC A;  2VC8 A;  4N4I A;  4GLK A;  5FLX E;  2FL7 A;  3VYG A;  4PJO E;  2P4T A;  4B9X A;  4N4G A;  4C0Z A;  4OGC A;  5CCA A;  1QP3 A;  4BE2 A;  3BDU A;  1I8F A;  2RHZ A;  2EJG A;  3SD4 A;  2RI5 A;  2ZPH B;  5GMK m;  3JCM X;  2DXT A;  1KHC A;  4ELZ C;  4M7D B;  1KC8 C;  1Y96 A;  4FT2 A;  3GOX A;  3CMA T;  4XU2 A;  4II1 A;  2HAX A;  1VQM A;  4M7A A;  1XOV A;  4J5Y A;  5LJ3 h;  2YLB A;  3M58 A;  1VQ8 T;  3MEV A;  2EWN A;  5LJ3 g;  1VQ9 T;  1YJ9 A;  5GAN 8;  1B34 B;  3OBY A;  1YJN A;  3E9G A;  4KBM B;  3LWI A;  1N8R C;  3FJP A;  5CQY A;  4M78 B;  5GAM e;  1YBY A;  3CCQ T;  4J8O A;  2JTM A;  5J26 A;  1UGP B;  2JVV A;  4HT8 A;  4MDW A;  1N27 A;  4ZGD B;  2D0Q B;  4JLI A;  5J39 A;  3JCM W;  2OTJ T;  4M77 D;  1BIA A;  2ZPG B;  4PJO B;  5LJ3 d;  4XTU A;  2LC4 A;  3OYA A;  2JZ2 A;  1N9S A;  2PU9 B;  5CKH A;  3CCJ A;  1VQ7 T;  1NJI U;  3V7S A;  3OBW A;  2E6Z A;  1X01 A;  3F70 A;  3A8L B;  3PGG A;  5FRO A;  2OTL A;  3CCE T;  2X4W A;  3CBM A;  2DO3 A;  1RL2 A;  2HQX A;  2O4X A;  2RD1 A;  2XI9 A;  5D6Y A;  2DKG A;  3OYL A;  1QVF A;  3FC3 A;  5I21 A;  1VUB A;  1YIJ A;  1M8V A;  3FIF A;  1N9R A;  4DOW A;  5GAN 7;  2M1H A;  3JCM h;  1VQ9 A;  5HK3 A;  3MHX A;  2CKK A;  1K73 C;  2KQW A;  3JCM g;  2PUK B;  3OMC A;  3OS2 A;  3OYM A;  5GAO m;  3E19 A;  1BIB A;  4M75 D;  2DJZ A;  3VU3 C;  5GMK j;  3CCQ A;  4NL3 A;  2KSS A;  3L1A A;  3QJY A;  1BKB A;  4EMH A;  2OTJ A;  3VV0 A;  5C6S A;  2L3R A;  5KCH A;  1MHN A;  4QQG A;  5LJ3 j;  1WJS A;  1H3Z A;  3V8L A;  4LD6 A;  2K3X A;  4IKF A;  1VQN T;  3UPU A;  4Y91 A;  2JTF A;  2ZZD A;  2KDS A;  4C5G A;  1BI0 A;  3E1S A;  5CKE A;  2P0Q A;  4L5G A;  2ZPE B;  5GAN 6;  3CPW A;  4XTY A;  3URG A;  3P8D A;  2X4X A;  2EAY A;  3RKX A;  1D3B A;  1YCY A;  5HKC A;  5GMK l;  1S72 T;  4M7A E;  4IUU A;  4M77 G;  2ZGW A;  3RMS A;  5GAM h;  5A0G A;  3M54 A;  3OS0 A;  5GAM g;  3SDZ A;  1K8A U;  2ZPI B;  1NZ9 A;  1IRE B;  3MP6 A;  2XDD A;  4UC4 A;  3JCM J;  1M5Q 1;  1KQ2 A;  3HPW A;  3T9N A;  2P0P A;  4QQ6 A;  2LX9 A;  4C92 A;  1YHQ T;  3P8B B;  1QW1 A;  3CD6 T;  2K3Y A;  3OW2 S;  1Q81 U;  5CKB A;  1WNL A;  2RJE A;  1FX7 A;  3SWN A;  2DTH A;  2Y90 A;  3OSS C;  1Y7X A;  5GAM d;  1PSF A;  2QDY B;  3QG1 A;  3TRE A;  4C8Q A;  1M9S A;  3G71 A;  3FLG A;  4OB0 B;  2GFA A;  3CCS T;  4BDY A;  1RI0 A;  2DD5 A;  3PMI A;  4XTV A;  4FIB A;  4CI0 C;  1NPR A;  1S72 A;  2QQB A;  3LWH A;  3LLR A;  2RI3 A;  3M4G A;  4N4H A;  4M77 C;  2RM4 A;  2XID A;  1Y07 A;  4M7A B;  4DQ2 A;  1FXX A;  2F5T X;  4JRK A;  3OYN A;  4BAC A;  1G3S A;  3QKJ A;  2CYZ B;  3X28 B;  4QVC A;  3C95 A;  3OY9 A;  2RHX A;  2WSE E;  2JUF A;  5LJ3 e;  2NLU A;  2YRV A;  4PJO G;  4JRQ A;  3OQ5 A;  2RI2 A;  4ZTF A;  1O9S A;  3L2U A;  3ZBD A;  1VQK T;  3INZ A;  3MP8 A;  1FWZ A;  3CBO A;  4RG8 A;  4MZP A;  5GAM j;  3CCU T;  4M7D C;  2CZ7 B;  1X75 C;  2M16 A;  3V7C A;  4M7D E;  2JN0 A;  4QVD A;  3MO8 A;  3CXC A;  5GAM f;  3CCS A;  3OYH A;  1YI2 A;  3G6E T;  1NJI C;  2LT1 A;  3DB3 A;  2X35 A;  3OB9 A;  4WF2 A;  3S3O A;  4LD9 K;  4A4K A;  2O4X B;  3CC2 T;  2QQR A;  3A8O B;  2CGH A;  5A2Q E;  4C0D B;  4XK8 E;  4XQ3 A;  4XTX A;  1V29 B;  4MZM A;  3OYI A;  4M78 C;  2R58 A;  3BY7 A;  2DIQ A;  4LDV A;  3CPF A;  3VUZ A;  1VIF A;  3EFS A;  4M78 E;  4M75 F;  4X34 A;  4C8Q F;  3CME A;  4IUP A;  3X24 B;  3EAE A;  4PJO C;  4O5V A;  4ELY C;  4ZGJ B;  3JCM e;  2DXU A;  4FSX A;  4XU3 A;  1VQK A;  1KHI A;  3G4S A;  3JB9 D;  5A0D A;  3C12 A;  2WSC E;  1X6O A;  2JNG A;  3CCU A;  5LL6 S;  2GCX A;  4L6V 5;  4BB7 A;  2DZ9 A;  3H8Z A;  2E65 A;  3CEY A;  3GNF B;  3RES A;  1U1T A;  2EJ9 A;  1K9M U;  3TEE A;  5GAN 4;  4QW2 A;  1XNI A;  5CR2 A;  1OYX A;  3LYI A;  1OZ3 A;  1QVF S;  3JAM E;  2PUO B;  3GNG A;  3JCM V;  1D3B B;  4JRI A;  3HL8 A;  4OB2 B;  4RG2 A;  4E7L A;  5CIU A;  2E10 A;  4EMK A;  2BUD A;  3QJ6 A;  3MCA B;  2KK4 A;  2E70 A;  2RHU A;  2K2V A;  2MAM A;  1JBM A;  1G3T A;  2K57 A;  3OYY A;  3M4Y A;  4FT4 A;  1K8A C;  3JCM b;  4JS5 A;  1M1K U;  1WQW A;  5DM7 R;  4F7U F;  4BDZ A;  4HKE A;  4C92 B;  2EKO A;  5HY6 A;  4HCZ A;  2F5K A;  2DEQ A;  2PQW A;  5L8R E;  4HA8 A;  3CPW S;  3HFO A;  1Q81 C;  3SWN B;  3CC4 T;  4C8Q B;  1KQS A;  2XIC A;  4M7A G;  3OA6 A;  5GAN 3;  3M9Q A;  1M1K C;  3CMA A;  4JLG A;  4FM4 B;  1U1S A;  4R55 A;  3JB9 G;  2L89 A;  4Q5W A;  2Y4Y A;  1WPY A;  2H3J A;  3JCM c;  5GAN h;  2YLC A;  1VQ8 A;  5GAN g;  4E7I A;  2RA2 A;  3QXE B;  3FRN A;  2RHI A;  3J81 E;  1Q82 U;  5CAI A;  1LNX A;  4CRI A;  4M7D D;  2M9U A;  4GY5 A;  2KVQ G;  3QYH B;  2LRQ A;  5CQX A;  1KD1 U;  2CZ0 B;  5IN1 A;  2EIF A;  1UGS B;  4XU0 A;  4JUV A;  5CKD A;  2CZ6 B;  4J6W A;  4X9D A;  3HHT B;  3QYG B;  4DA4 A;  4KUL A;  2A7Y A;  3QSU A;  3L2V A;  4M78 D;  2DK3 A;  3JCM d;  1VQ5 T;  1VQ7 A;  2VXF A;  2EQM A;  2XDB A;  3PFS A;  5LJ3 f;  3PT9 A;  2E6N A;  3I56 T;  2DAQ A;  2FHD A;  3CCE A;  3DLL A;  2WAC A;  4M7A C;  1NPP A;  3MET A;  3VKI A;  4PJO D;  2RK1 A;  4KUD K;  3UDC A;  2XD0 A;  4BD3 A;  4M77 A;  1MGQ A;  5DLQ E;  5LJ5 g;  4BE1 A;  4A54 A;  2VUB A;  3AHU A;  1O75 A;  2XKO C;  3A8M B;  2QQS A;  2RH2 A;  5GMK i;  4E7K A;  3RKW A;  4IUQ A;  4HCC A;  1BI2 A;  1M4Z A;  3NTI A;  3JB9 F;  3HRS A;  2V8K A;  3PNW C;  4BUG A;  2KMT A;  5GAO n;  3M56 A;  3CCR T;  3QZ9 B;  3JB9 I;  1XTD A;  4VUB A;  2MF2 A;  1WGS A;  2LT4 A;  3CXC S;  4O6J A;  4OMF B;  3CCL T;  1VQO T;  3TU4 K;  1Q86 U;  2V8I A;  3WVE B;  2RJD A;  4C5E A;  3I55 T;  1VQ5 A;  4M7D G;  1UEB A;  3I56 A;  3S3M A;  4M75 A;  1YJW T;  5DLO A;  3JCM f;  4C0D C;  3FDR A;  3WVD B;  1QVG A;  4Y28 E;  1Y96 B;  2ZPB B;  4PL6 A;  4Z02 A;  2LCC A;  2LVM A;  3J80 E;  1EIF A;  2HNI A;  1WJR A;  4M78 G;  2L5Q A;  1UGR B;  3EFR A;  4N0A A;  2K5F A;  4BI3 A;  4EMK B;  5IAY A;  4E7H A;  4FU6 A;  1M1G A;  2F69 A;  3LX7 A;  4XTZ A;  4C0G A;  4OB1 B;  3L42 A;  2RB6 A;  1W2B A;  4FL6 A;  2VYT A;  1PSE A;  3GIB A;  1YHQ A;  2QQA A;  4M77 F;  3CD6 A;  4LDX A;  3CCR A;  3CC7 T;  2E12 A;  2R5M A;  1VIE A;  4OB3 B;  3SFM A;  1YIT T;  2PVG B;  2WSF E;  3VUB A;  3L2Q A;  1LJO A;  3V8J A;  2XDP A;  3A5Z B;  4DOV A;  3PIP A;  2RHY A;  2IG0 A;  4TVR A;  4YTL A;  2E1H A;  1VQ4 T;  5FU7 B;  4A4H A;  2MWO A;  4F7U A;  1QVP A;  4XAX B;  3HKS A;  3OMG A;  5J3B A;  2P0K A;  4LDU A;  5AYF A;  5IT9 E;  3FEO A;  3OYJ A;  3L2W A;  5CK9 A;  3JCM P;  1W4S A;  1Y71 A;  3MP1 A;  4KT0 E;  3QDR B;  4EMG A;  1SSF A;  3DB4 A;  5FU6 B;  3S3N A;  3QHS A;  4C92 C;  5GAN e;  4BY6 B;  2QTX A;  1ZQ1 A;  1Q82 C;  3LGL A;  4A4G A;  2HBP A;  4C92 E;  4PLI A;  5GAN 5;  4M7A D;  2DZC A;  2I2L A;  3JSC A;  3CC7 A;  3SWN C;  1VQL T;  1YIT A;  4MMK A;  5DY9 A;  4C8Q C;  4OF1 A;  3C94 A;  4C5I A;  2X4J A;  3PTA A;  4IUV A;  1R8O B;  4C8Q E;  1UGQ B;  2JOY A;  1VQ6 T;  4M75 E;  4HCB A;  2K5L A;  3JB9 J;  4LDY A;  3UWN A;  4PJO F;  5FRN A;  3G6E A;  1VQM T;  2R5A A;  1VQ4 A;  1Q7Y U;  2LQ8 A;  1JJ2 A;  3CC2 A;  2C06 A;  2AHJ B;  5CVI A;  2A3L A;  2GF7 A;  2DXC A;  1YJ9 T;  3OYB A;  1WQ7 A;  3OS5 A;  1YJN T;  2E41 A;  2EQU A;  2FYK A;  5LJ5 e;  4JRP A;  4QQD A;  2XG8 D;  2DTI A;  3V7R A;  3M53 A;  3NTH A;  2EYQ A;  4NS5 A;  3QBY A;  4RKU E;  3NTK A;  4PKC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...