2JW4A

Nmr solution structure of the n-terminal sh3 domain of human nckalpha
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
b'GSTMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARAAANSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
publication title Interaction between the N-terminal SH3 domain of Nckalpha and CD3epsilon-derived peptides: Non-canonical and canonical recognition motifs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jw4A00
2C0OA 1T3SA 4HVVA 1ZUKA 4CC2A 1AZEA 5HCKA 4Z89A 4OMNA 4JJDA 1HD3A 3I9QA 2GNCA 4HVWA 1PRLC 2A08A 2EVRA 3NGPA 1E6HA 1K0SA 1K9AA 1RLQC 2X3WD 4AFSC 1GCQA 1RI9A 5L23A 4HVUA 3QWYA 1N5ZA 2RNAA 2JM9A 2EKHA 1JQQA 2GQIA 3I35A 2K7AA 1B3QA 1G2BA 4R0KA 3UF4A 3FJ5A 2K3BA 2DF6A 2C0IA 3VRZA 1AD5A 2O31A 1Y57A 2RQWA 1UG1A 3TSWA 2CREA 1K4US 3VS0A 4AFZC 4RTVA 2RQVA 2YSQA 4OMQA 2MCNA 3EHRA 3PVLA 2ABLA 2DL3A 1GFCA 3SHWA 1W70A 4F16A 2LQWA 3H0IA 1AWXA 4A63B 2KYMA 2F2XA 4LUEA 1H3HA 5IHIA 1NM7A 2DILA 4IIOA 1W6XA 2BZYA 2DL7A 2DYBA 2KEAA 1GFDA 2DL4A 3VS5A 4GLMA 2O9SA 4OMPA 1UECA 2LZ6B 3EG2A 2RQUA 1GBQA 1WLPB 3I5RA 2LCSA 2J7IA 3U23A 1MV3A 1X69A 2J06A 2EBPA 5IH2A 1ZSGA 2FPFA 1JO8A 1OV3A 2CH4A 2D8HA 2D8JA 2PZ1A 2FPEA 3LH5A 2A37A 2W0ZA 1SPKA 3RNJA 1KJWA 1GL5A 1SHGA 2I0NA 3GBQA 2LX7A 2P4RA 5IXFA 1M3BA 1PKSA 2JW4A 2K9GA 1XOVA 1CKBA 1JXOA 1PHTA 2EGCA 1ZX6A 4F14A 2DL8A 1ABOA 2L0AA 2OAWA 2ENMA 1QWFA 2BTTA 4LE9A 3IQLA 5I22A 3C0CA 1T0HA 4WCIA 2ED0A 1X2KA 4RTUA 3M0PA 2DRKA 1OEBA 1Z9QA 1TUDA 4X1VA 2XMFA 2F2WA 1VYVA 2KRNA 2DRMA 1SEMA 4CC4B 1WXBA 4ESRA 2DNUA 4J9BA 2VVKA 2MOXA 4AG2C 1A0NB 2L3SA 2FG0A 2HBWA 1B07A 5EC7A 1MV0B 4DEYA 2JXBA 4F17A 1UHFA 1UDLA 2YUOA 4Z8AA 4GBQA 1GBRA 3O5ZA 1M3AA 1WI7A 4RTYA 2C0TA 4RTTA 2D1XA 4LNPA 1EFNA 2LJ0A 1GCPA 1V1CA 2YUQA 5FWCA 1E6GA 2CDTA 4Y92A 1CKAA 2EYXA 1HSQA 1SHFA 1ZLMA 1ARKA 1VA7A 4HXJA 1TUCA 1AOJA 2NUZA 4RUGA 3H41A 2RQTA 1YWPA 3EG1A 2KR3A 3TSZA 1X6BA 1X27A 1JU5C 2YT6A 3M0UA 2RPNA 4EIKA 2EQIA 2GTJA 3NMZC 4OMLA 1I0CA 2ROLA 4IIMA 1YWOA 1KSWA 2A36A 3QWXX 4JJCA 2KBTA 2AZSA 2SEMA 1QKXA 3UA7A 2GBQA 1UJ0A 4LN2A 2JS0A 1ZUYA 2KT8A 2LJ1A 4J9HA 1PKTA 3EG0A 2DE0X 2RMOA 1QCFA 2YUPA 3VRYA 2BZXA 2JS2A 3ULRB 1MUZA 1X2QA 4J9FA 1I1JA 2DL5A 2EPDA 3THKA 2DBMA 1NG2A 1AWWA 1SRLA 1YNZA 1X43A 1YP5A 3I5SA 1SRMA 3EG3A 2FPDA 1GRIA 2AKLA 1G83A 5IHKA 1JXMA 2W10A 4J9GA 2FRYA 3REAB 1I07A 2CUDA 3A98A 2KXCA 1WIEA 1BU1A 2CUBA 2DA9A 1FMKA 2AK5A 2DJQA 2O9VA 4JZ4A 3NPFA 1QLYA 2JM8A 2KE9A 2KGTA 5IHNA 1S1NA 2OI3A 3PVQA 4AFUC 1UTIA 4E6RA 2J6KA 1YCSB 2GTOA 4RTWA 3JV3A 4J9IA 3M0SA 1VYUA 4K11A 1U06A 2OJ2A 2RQRA 2J05A 1OPKA 3EHQA 3M0TA 4RTZA 4J9DA 1KFZA 3H0FA 2LMJA 2HSPA 2DMOA 4OMMA 1T3LA 4KRTA 1KIKA 1LCKA 1M3CA 1UJYA 3CQTA 2MIOA 4DEXA 2KNBB 1K1ZA 2YUNA 2J6FA 1BK2A 4ZNXA 2L2PA 2NWMA 2HCKA 4RTXA 3VS3A 3VS4A 1VYTA 2FO0A 1H92A 4J9CA 2X3XD 2YDLA 2JT4A 2EGAA 2V1QA 4JZ3A 2EYYA 1K0XA 1WFWA 5I11A 4Z88A 1BB9A 2DX1A 5IXBA 2EGEA 4JJBA 2JMAA 2KYBA 2AKKA 2VWFA 4CC7A 2AZVA 3ZL7C 2L3PA 2O2OA 5GJVB 1OPLA 2KROA 1WDXA 2QDLA 1AWOA 1HJDA 3KFVA 1QKWA 4OMOA 4D8DA 3REBB 1X6GA 2KT1A 2VKNA 1PNJA 3VS2A 2KRSA 4JPBW 2EYZA 2PNIA 2IIMA 5ECAA 4CC3A 1K76A 1WA7A 1ZUUA 2PTKA 3PE0A 1TG0A 4HCKA 2A28A 1AZGB 4D8KA 1UHCA 3VS7A 1Y0MA 1T0JA 2SRCA 2O88A 2EYWA 1AWJA 3RBBB 2ECZA 1J3TA 5FW9A 2CSQA 2K79A 2ED1A 1NYFA 2J6OA 2D0NA 4AG1C 2KRMA 1PRMC 1NEGA 1E7OA 3EGUA 3TVTA 2DVJA 1UGVA 3UA6A 3UATA 4AFQC 1YN8A 5FWBA 4FSSA 2L3QA 1NEBA 1UE9A 2ESWA 1QWEA 3VS1A 1RUWA 2ROTA 1AVZC 1WXUA 1JEGA 2M51A 1SSHA 4QT7A 1NYGA 4M4ZA 2CT3A 4LUDA 1UFFA 2FRWA 2G6FX 1UUEA 3SEMA 1GCQC 2DBKA 1U5SA 2KXDA 1BBZA 2K6DA 2LQNA 2M0YA 1AEYA 2H8HA 4J9EA 1WYXA 3M0QA 2HDAA 2JMCA 2EW3A 1FYNA 1H8KA 2LP5A 2JTEA 1WX6A 1OOTA 2GGRA 2F2VA 2V1RA 2DM1A 1ABQA 1RLPC 2HEQA 3NHNA 2E5KA 4ORZA 1M8MA 2CT4A 1CSKA 2RN8A 2CH4W 2B86A 1U3OA 1PWTA 1Z9ZA 2RF0A 1NLOC 5GJWB 2CSIA 3H0HA 1M30A 1W1FA 2LJ3A 2K2MA 2LNHB 3M0RA 2DLPA 1ZBJA 2BZ8A 2FEIA 1WXTA 1NLPC 3VS6A 1IO6A 3R6NA 1M27C
chains in the Genus database with same CATH superfamily
3I55Q 3CPWA 3QYHB 4Z02A 4PL6A 4AMCA 3CPWS 1IHVA 3SWNB 1C1AA 4AT1B 4FL6A 1OZ2A 1K9MR 3OSVA 4OMNA 2GNCA 5GAMg 3LLRA 4HVWA 1YI2A 2A08A 1OU8A 1KC8R 1M2OA 3BY7A 1PSFA 1IXDA 1K9AA 1RL2A 4AFSC 4C5GA 5L23A 3CCQT 2EKHA 1JQQA 3L2RA 4P5NA 1W2BS 1X6OA 4MZMA 2X4YA 3JSCA 3VRZA 2RHYA 3EFSA 4Q5WA 2P0KA 3LWHA 5GAN4 2ZAEA 1WJRA 2DJZA 2D9TA 1D09B 9ATCB 4BE1A 3NFCA 4M78A 1V29B 4OMQA 3EHRA 2DL3A 1W70A 2RI3A 2V8IA 1VQNA 4XU2A 4A63B 4LUEA 2KSSA 5IHIA 2COZA 1NM7A 3P8HA 2R58A 1W6XA 5D6WA 3QZ5B 3X24B 1VQLT 2CKKA 4PNOA 1EX4A 4IUUA 1MGQA 3OYIA 1R0CB 3CCST 1ZBXA 3JCMV 2LZ6B 1OQKA 4KH0B 2EAYA 1GBQA 3JCMP 4C5IA 2J7IA 1MV3A 2DFUA 1B34A 2QDYB 3SDZA 4Y28E 5IH2A 5GANf 1ZSGA 2JTFA 2FPFA 3I55T 1TS9A 1WHMA 2A37A 5IAYA 1GL5A 4D6WA 3QO3A 1K73C 2YRCA 3GBQA 4LDVA 5AYFA 4M77E 1N9RA 1MNEA 4C92A 4MDWA 2VV5A 5CKDA 2COWA 5GAOl 1PHTA 2E5QA 4BY6B 3A8OB 3CPFA 1Q86U 2OAWA 2PVGB 1SKUB 2L8DA 3C0CA 2QA4A 2ED0A 3CCMQ 1MMNA 4RTUA 3J81E 1VQ9A 4RMOA 5CQYA 1OEBA 2O4XB 4M75C 2F2WA 2WACA 1QMCA 2PVOB 2RK2A 2DNUA 4J9BA 4ELZC 2BUDA 2MOXA 1BI1A 2L3SA 5D6XA 3TCJA 4Y91A 2E4HA 3QXEB 1MV0B 5KYXA 1Q81U 5FLXE 1YCYA 2DAQA 5KE3A 1DJ7B 3O5ZA 3D7SB 4XAXB 2D1XA 4LNPA 3G4SA 1WHKA 3CCVT 1E6GA 3RUXA 3RERA 4M7DE 5KH6A 1CKAA 3OBYA 1HSQA 1M90C 5DM7R 4E7IA 1JB0E 1TUCA 2NUZA 2OTJT 4RUGA 2GFUA 5GMKj 2RQTA 3EG1A 2DTIA 2GTJA 3NMZC 4OMLA 5CQXA 4BY6C 2I2LA 3JCMb 3JB9I 1VQ5T 2QQAA 1KSWA 1TTHB 2A36A 1K9MC 5GAN5 1MNDA 3WXMB 2DZCA 4UC4A 3G7ZA 2CYZB 4TVRA 2B8AA 4J9HA 3EG0A 1NZ9A 2DE0X 2MPXC 3CC7A 2QG9B 5L8RE 2JS2A 4LDYA 5DY9A 3ULRB 5D7UA 2DL5A 4C92D 2DBMA 5LJ5f 1Q86R 3EG3A 3CCEQ 4N4GA 4J9GA 2DTHA 1QP2A 2LNVA 1ACMB 2CUDA 3A98A 2BKDN 2DA9A 3LW5E 3X26B 5GANj 3RMSA 4C92B 3OYEA 2O9VA 4JZ4A 3NPFA 2E41A 3JCMf 1TH7A 3X28B 4A53A 3OYDA 4BDYA 2RHXA 4BB7A 1YITT 4E6RA 3L2WA 5LJ3h 3GNGA 2VUBA 3JV3A 1M1FA 1Q81R 4K11A 1Y96B 5CO7A 2HSPA 2WSEE 4JRQA 5HY6A 1N8RU 3OQ5A 1D0YA 1XTDA 3CQTA 4DEXA 3NTKA 1K1ZA 2YUNA 2J6FA 1LJOA 1NPPA 1WZOA 3ASKA 3VS3A 4F7UE 2HCKA 2YRDA 1H641 3OYLA 2JT4A 3FC3A 5GAN3 3FDRA 5KYXB 2EYYA 1WFWA 1AHJB 2DX1A 4PJJA 4JJBA 5J26A 2RO0A 2AZVA 2VGMA 2O2OA 4PFZA 1TU0B 2DIGA 2KROA 1WDXA 2QDLA 3N5BB 4M78G 1AWOA 3LGLA 1VQPT 1MMAA 3A8LB 3M56A 2KRSA 2K4YA 1D0XA 2DTOA 5ECAA 1MMDA 2E10A 1OX9A 5IN1A 4ZN1A 3V8LA 2EFIA 1AZGB 2QAZA 2X4JA 4FW1A 1RAAB 2SRCA 4ATOA 1AWJA 5FW9A 5FRNA 2CP2A 2D0NA 2D0QB 1NEGA 3HL8A 3UA6A 4AFQC 3KUFA 1YN8A 2V26A 4FSSA 2LQKA 3HRUA 1NEBA 3HKSA 1KHIA 3CCJQ 3VKIA 3VS1A 2LC4A 5LJ3d 3G71A 2K5FA 2PQWA 4DA4A 2EKOA 2CT3A 4LUDA 3E19A 2E65A 1OI1A 5CK9A 3SEMA 2OTLA 3VV0A 3WVDB 2K2VA 3GF5A 5DLOA 3RKXA 2DBKA 4C92G 2M0YA 4J5YA 3OYMA 1IZ6A 3QDRB 1N8RR 3E1SA 4J9EA 1BIAA 3A5ZB 1S72A 4FYYB 2JZ2A 3CC4A 2QGGA 1VIEA 2DIQA 4M78F 4PJOC 4A4EA 2F2VA 1D3BB 1TOVA 1K8AU 2P0PA 3JCMc 1M5Q1 3L42A 1CSKA 5AT1B 3I56A 2B86A 2JTMA 3MHXA 3QZ9B 5HK3A 4E7JA 5GJWB 2QQSA 1W1FA 4M7AA 3M0RA 2GF7A 2BZ8A 2XICA 1NLPC 3RMQA 3VS6A 4OGCA 3CC2Q 3CXCP 4C8QC 2C0OA 3CCLT 1XJWB 4GLKA 1Q86C 1ZUKA 1AZEA 2KI7A 1P92A 1HD3A 2DEQA 1W4SA 4L59A 3LH0A 1M90U 1QVGP 3CBMA 3CCQA 2JN0A 2X3WD 2LT4A 1GCQA 3NTHA 4HVUA 4B6MA 5HKCA 1X75C 2EWNA 3CCJT 2JM9A 3I35A 4R0KA 4QQGA 4OB1B 3UF4A 4R56A 4C92F 2KQWA 2DXCA 1YJNQ 2QTVA 3FB9A 2YLBA 2MI6A 5CKBA 3VUBA 1Y57A 3OYYA 4HKEA 2CZ1B 3TSWA 4M7DG 5GAOq 3VS0A 4NL3A 2RQVA 3M5AA 3E9GA 2MCNA 2CP3A 1GFCA 4JS5A 3SHWA 2LQWA 4HCZA 3H0IA 1RAHB 1Y07A 2CZ7B 4MDXA 1H3HA 1FWZA 4M75E 1VQLA 2AIRB 5KYWB 1JRIA 2DILA 4IIOA 3CCSA 1M1GA 3L2ZA 2A0FB 5GMKh 2KEAA 2M16A 1R77A 1ZSZB 4PKCC 4OMPA 4QVDA 1UECA 1K8AR 3L2VA 2RQUA 5GAMe 1WLPB 2LCSA 3VYGA 3I55A 1OULA 1G3WA 2VXFA 3BW1A 2EBPA 3F70A 2C06A 1IGQA 2D8HA 1WHLA 2D8JA 2PZ1A 2Y90A 2FPEA 2W0ZA 2XI9A 2E3IA 5GAOr 1RADB 3GOXA 2I0NA 1WJSA 2DZ9A 2P4RA 5A0DA 3PMIA 5IXFA 1M3BA 3TQ7P 1D1AA 2X51A 2K9GA 1XOVA 3G6EA 1JXOA 1M90R 3H8ZA 2L5QA 4JS4A 3OYHA 4XTWA 1ABOA 2L0AA 3JAME 4BACA 1KD1U 5GANh 1QWFA 2FZGB 1RAEB 2ATCB 4LE9A 2VYTA 3IQLA 1YJNT 4QVZA 1MHNA 2VXEA 3M4GA 1Q95G 1Z9QA 2M0OA 1NJIU 1TUDA 3JCMW 4X1VA 1LPLA 2XMFA 3LYIA 3PIOA 4XU0A 1FMWA 4E7LA 4PLIA 1SEMA 4CC4B 1WXBA 4ESRA 2VVKA 1N8RC 2WSFE 2FG0A 1ZSZC 1JJ2P 1U1SA 3HTRA 5KYNA 1YBYA 2JXBA 8AT1B 5LJ5g 3OMGA 2P0QA 2QQBA 2H3JA 2BE7D 2MAMA 4EPCA 4DBHA 3CCVA 3MO8A 2ZPIB 1SG5A 3X20B 4N0AC 2X4WA 1V1CA 5M9OA 2RJEA 3CXCA 3CD6Q 2HSEB 1IREB 4Y92A 3TREA 2EYQA 2HL5C 2OTJA 3OW2P 1BCMA 1WGSA 1N6AA 1VQMQ 4HXJA 1KQSA 1LOJA 3DB4A 3JCMg 2EQMA 1KQSS 3OYKA 2KR3A 1QVGA 3TSZA 1X27A 1JU5C 3M0UA 4EIKA 2RPNA 1VQ5A 4E7HA 2ROLA 4IIMA 1Y71A 3NTIA 4JJCA 1QKXA 1FXXA 3UA7A 1UJ0A 1VOMA 4O6JA 2RD1A 2KT8A 4QW2A 1YI2Q 3SWNC 4DQ2A 2RMOA 3ZBDA 2YUPA 5GANd 2HKQB 2RHIA 1X2QA 2ZPEB 3SB2A 2K57A 3THKA 1NG2A 1AWWA 1SRLA 1YP5A 3I5SA 2EJFA 3SD4A 1G83A 1KD1R 2DVEA 2FRYA 3PMTA 4A4FA 3GPLA 1IGUA 3LWIA 4B9XA 2VC8A 4L6V5 2CUBA 1UGPB 1TSFA 1C0MA 3OS5A 1FMKA 2M1HA 3MP8A 3CCRA 1NJIR 4M7AG 1YITA 2JM8A 2KE9A 1LNXA 4IUQA 2QEXA 3INZA 2DETA 2OI3A 1XQHA 5A2QE 4AFUC 3UPUA 1VQNQ 5LJ5h 2HKNA 1YCSB 5CKEA 4RTWA 3ME9A 5HK0A 3M0SA 2OJ2A 2J05A 1OPKA 2CZ6B 1KFZA 4M77A 4RTZA 3OB9A 2Y4XA 1SSFA 2LMJA 3H0FA 4BE0A 1MMGA 1K8AC 4OB3B 1T3LA 1YJWA 3UT1A 4ZGJB 1VQMT 3JCMh 4ZNXA 1OYXA 2L2PA 2NWMA 1PD1A 4RTXA 3VS4A 1VYTA 2MF2A 4M78D 2XHCA 1X01A 2CP0A 1K0XA 3L2QA 1LVKA 1JBMA 5IXBA 2EGEA 4FW2A 5LJ3g 2EQJA 2KYBA 2X35A 2HQHA 3QBYA 4CC7A 4BD3A 1VQPA 3MCAB 1OPLA 3CMAQ 5GAOp 4PJOE 3KFVA 2QGFB 3FEOA 4M78B 3REBB 2PVDB 1X6GA 4LDWA 4C0FA 3VS2A 4JPBW 2EYZA 3QIIA 2QASA 2IIMA 2GFAA 3BFMA 5KYYA 3H6ZA 4LDUA 4M7AF 2ZZDA 4D8KA 2QA4Q 2O88A 1JJ2A 1VQ9Q 4M7DA 1J3TA 4C8QE 2LDMA 4FYXB 4PFOA 4BDZA 4J6WA 1XNIA 1PRMC 2EQKA 2YRVA 5C6SA 1E7OA 3EGUA 7AT1B 1D1CA 3EAEA 1UGVA 3UATA 1G3SA 5CCAA 4KUDK 2HMAA 5GAN6 4EMKA 5LJ5d 2ESWA 4NOYA 1QWEA 2RA2A 1VQNT 1AVZC 2NYSA 4BI8B 1WXUA 1B34B 3CBPA 3OW2A 3MEAA 4QT7A 1NYGA 3CCMT 4RKUE 3HSBA 2FRWA 4XTUA 5GAMf 3FJPA 3LX7A 1RABB 3FRNA 3G4SQ 4N4IA 2KXDA 1BBZA 3JCMd 2KVQG 2YXYA 1FMVA 2JMCA 1FYNA 2AT1B 3FLGA 4LDXA 1H8KA 5DLQE 3M53A 2JTEA 1ZHIA 1WX6A 2AHJB 4KUIA 4M78C 2RJFA 3NHNA 3OY9A 4E7KA 3A8GB 3OS1A 2RN8A 2ZPGB 4FIBA 4A4HA 4M77B 3CMAT 1U3OA 4XTYA 3DLMA 2RF0A 1NLOC 2LJ3A 4XU1A 3CCLA 1ZBJA 1NE8A 4E7ZA 2RM4A 2FEIA 1IO6A 3CC7Q 3R6NA 2LTOA 3P8DA 1T3SA 5GMKm 2DYIA 4KGZB 1KD1C 5CIUA 1F1BB 3R6OA 4FU6A 2F69A 1M9SA 5HCKA 4Z89A 1WQ7A 4JJDA 4WTOB 4J7IA 2NUTA 3PIPA 1WJQA 4OP0A 3RDVA 2EQUA 2EVRA 3PNWC 2A7YA 1PSEA 3NGPA 3GLXA 3A1PA 3JCMJ 1K0SA 1NJIC 3PFSA 4F7UA 4JRKA 1YIJA 1RLQC 4A4GA 4M7DD 1RI9A 1RI0A 4BI3A 3CCUA 1N5ZA 3V8JA 2O01E 2GQIA 3DLLA 4NL2A 2K7AA 1B3QA 1KQ1A 1UGRB 1EIFA 2CZ0B 4FYWB 2CP6A 2DF6A 2K3BA 2C0IA 1KHCA 4C92C 1AD5A 5KYYB 4C0DB 3CCET 2RQWA 3QSUA 1M4ZA 4AFZC 4M7DB 2IG0A 3FIFA 5FU6B 2YSQA 2HNIA 2HZYA 3PVLA 1QVFP 2ABLA 1HYOA 4QKUA 4ZGDB 4LXCA 3EGDA 4FYVB 4PK4A 4EMKB 2NUPA 2F2XA 1N9SA 1OZ3A 2DL7A 2DYBA 1IB8A 1GFDA 2DL4A 3VS5A 4GLMA 3QKJA 2O9SA 1I8FA 1YHQA 1O9SA 1UGQB 2DERA 1N27A 3I5RA 3U23A 2RJCA 2J06A 1VQ6A 1QP3A 2E12A 3CC7T 3L2UA 3C4SA 5GAMj 1JO8A 1OV3A 1PM3A 2CH4A 3CBOA 4B9WA 4X34A 2RK1A 1TWBA 5GAN2 4M77G 2R5MA 2ZPBB 3CPWP 4HCCA 3EG9A 3SFMA 2M9UA 1M1KU 5CKHA 1WHHA 3CMEA 4C0DC 2Y4YA 4KGXB 4IKFA 3EH2A 3RESA 1O75A 2EGCA 1ZX6A 4F14A 1VQOQ 2VASA 2ZGWA 5FU7B 2E70A 4M7DC 3OS2A 4ZTFA 2BTTA 5FU6C 3OYBA 3MJXA 5I22A 3EFOA 4WCIA 2H3EB 3G71Q 1X2KA 2YWWA 1RAFB 2DRKA 2HD0A 1W2BP 1ZA1B 4QQDA 3GP8A 3OYGA 4F04B 4ELYC 2QK0A 2JOYA 1B07A 3C12A 5EC7A 2FL7A 5FROA 3VU3C 1S72Q 4LD9K 4F17A 1UHFA 1UDLA 3CC4Q 3HRTA 3TU4K 5GANg 2E1HA 2ZPHB 2FHDA 2COYA 4RTYA 4IURA 1EFNA 1BIBA 1GCPA 5FWCA 4RCCA 3JCMX 1VQ4Q 3A8MB 3AT1B 2EYXA 2MYSA 1SHFA 3S6WA 1G8XA 2XKOC 2JUFA 4M77F 1YWPA 3EGDB 3ER0A 2NUPB 2FYKA 2EQIA 3MP1A 1UEBA 2EJGA 1YWOA 3OS0A 1G5VA 5FU7C 1RACB 1VQKQ 3V7RA 2YHTA 2AZSA 1SF9A 2SEMA 3MEWA 1EZZB 3C94A 4XQ3A 1UB4A 1YFNA 1ZUYA 2LJ1A 3QYGB 1PKTA 5FRMA 2LCLA 1QCFA 2E64A 1Y7XA 3VRYA 1M1KR 4M75A 4J9FA 3TEEA 2EPDA 1VQOT 2DXUA 2E6ZA 4HT9A 3CC2T 1GRIA 5LJ5e 3G71T 2RJDA 4M7AD 2ZPFB 2W10A 3HP9A 5EG2A 2A3LA 2KXCA 1WIEA 4KGVB 2P4TA 3EG9B 2DJQA 2KMTA 1C6VX 2KK4A 5IHNA 4ZN3A 4NS5A 3X25B 4M7AB 3JCMe 4M7DF 1S72T 2OAUA 4KULA 4ANJA 5KE2A 1I5LA 2GTOA 3VJPA 2Z0WA 4J9IA 1VYUA 4J7FA 2GQVA 2L3RA 1U06A 4II1A 3M0TA 4XTVA 2XDDA 1G3TA 1QQJA 1VQ4T 1VQMA 3QHSA 4HA8A 4E2FB 4KRTA 1BYMA 1KIKA 1M3CA 2FZCB 4F7UG 1QVPA 1VQ8Q 3KXTA 3KBGA 2FO0A 2K3YA 1H92A 4J9CA 4MZTA 4C0GA 4JZ3A 2HAXA 2HQXA 5I11A 1YJ9Q 3ZFJA 4Z88A 1BB9A 3GNFB 1QCOA 2O4XA 2HQEA 8ATCB 1UGSB 2VWFA 1H3ZA 1VQKT 5GJVB 3EGXA 4BUGA 1HJDA 3JB9H 4M78E 3CXCS 1M8VA 2P84A 4OMOA 1VQ7Q 2EIFA 2VKNA 4MZPA 3G6EQ 1RAGB 1W2BA 1KG1A 2QXFA 2PNIA 2L89A 4VUBA 4CC3A 1K76A 2PTKA 1QVGS 4HCKA 1KQ2A 2A28A 4M75D 3QG1A 1UHCA 2BIVA 4M7AC 2EYWA 3RBBB 4IUPA 3META 2G3RA 2ED1A 3OYJA 1D0ZA 5GMKl 2L3QA 2FZKB 1UE9A 1ZA2B 4PJNA 4M75B 2QQRA 3MEUA 3CCMA 1JEGA 2GCXA 1U1TA 2LRQA 4M4ZA 4F7UF 1UFFA 2D6FA 3CCVQ 5LJ3e 1UUEA 4HT8A 1Q82C 1GCQC 2E3HA 5A0LA 3JB9G 4CRIA 4XTZA 4ZGEB 3O8VA 5CKFA 4C92E 2OTJQ 3M0QA 2K5LA 2HDAA 1VQ8T 4A54A 2RHUA 3MEVA 1QW1A 2GGRA 4DBFA 1YJ9T 1VQ5Q 1ABQA 2HEQA 2E5KA 3CMAA 2KDSA 1BI3A 1M8MA 2CT4A 3OYFA 2LT1A 2MK5A 5GAMh 3V8KA 2CH4W 3S3NA 4OVAA 3CD6T 1PWTA 1Z9ZA 4FT4A 2CP7A 2CSIA 3H0HA 1VQ7T 1M30A 2LNHB 5C0MA 3OSSC 3G6ET 1WXTA 1M1KC 3EFRA 3HRSA 1M27C 4RG8A 4R55A 4V2SA 1Y96A 4HVVA 4CC2A 5I2SA 2MMPA 3I9QA 4IUVA 1PRLC 3EGXB 5J39A 3OYNA 1E6HA 3DKMA 2FB7A 4L5GA 3CCRQ 2IPOB 1YI2T 3QWYA 1GXIE 4PJMA 1YITQ 2NLUA 2RNAA 1U8RA 2QEXQ 3JB9F 3CCEA 1OX8A 1G2BA 3FJ5A 2RHZA 2XD0A 4J83A 2MWOA 2O31A 2VB6A 3M54A 1UG1A 2XDPA 2CREA 3V7SA 4PJOA 3BDUA 1K4US 5I2MA 2BE9B 4JRIA 4RTVA 1JJ2S 5J3BA 4A4KA 5KYUA 3QJ6A 4E47A 1Q7YU 4J8OA 4F16A 4ME7A 1YJWQ 2DKGA 1BI2A 1AWXA 1HK9A 4M75G 4N4HA 2KYMA 2DXTA 2EJ9A 3M59A 3Q1JA 4RCBA 4EMHA 3S3OA 5GAMd 2BZYA 3OW2S 3MKDA 1NBEB 3M4YA 4C8QA 1TXQA 5IT9E 3P8BB 3EG2A 1WHGA 1VQPQ 1KC8C 3OA6A 1NPRA 2X4XA 2WSCE 1X69A 4M77D 2F1LA 4XU3A 1WHJA 3LH5A 3RNJA 1PG5B 1SPKA 1KJWA 1SHGA 4LD6A 4JRPA 4EMGA 2LX7A 3VUZA 4KH1B 2OX7A 1PKSA 2JW4A 4DBQA 2LQ8A 6AT1B 4O5VA 1CKBA 3CCRT 4BI4A 3GIBA 2DPPB 3PT9A 2PU9B 2DL8A 4X9CA 2QEXT 1D3BA 2ENMA 3DB3A 3J7AF 3M58A 1T0HA 3ZEHA 3M0PA 3UDCA 4M75F 2QA4T 4MMLA 2QI2A 3HHTB 4PJLA 1VQ9T 1VYVA 1PC0A 2KRNA 2PUKB 2DRMA 1FX7A 2F5TX 4AG2C 2JVVA 1A0NB 1WNLA 3BDLA 3CCJA 4PJOD 3URGA 2X9HA 1YJWT 2HBWA 3RKWA 1ZQ1A 4DEYA 1Q7YR 2YUOA 4Z8AA 2K3XA 1R8OB 4GBQA 1GBRA 3M55A 1M3AA 1WI7A 2C0TA 4RTTA 3JCMQ 1QCNA 2LJ0A 2YUQA 3G1JA 2CDTA 4PJOB 5GMKe 3G4ST 4YTLA 1I4K1 1ZLMA 4C8QD 1VA7A 5KYUB 1ARKA 1AOJA 1PCXA 3H41A 4E7SA 4JLGA 5GMKi 3CCLQ 4OF1A 4M77C 1R0BG 1X6BA 2YT6A 2R5AA 2DXBA 1I0CA 4KT0E 1G3YA 5I21A 5GAOm 2XDBA 2QQ9A 1Q82U 3V7CA 3QWXX 5LL6S 5GAN7 4C8QB 4MMKA 2KBTA 3S3MA 2GBQA 4LN2A 2JS0A 2XK0A 1VQOA 4PFPA 3QDFA 3LGFA 2HBPA 2CGHA 2ZCFB 4DOWA 3CC2A 2BZXA 1MUZA 2XU8A 3MPUB 1I1JA 5KYWA 1YIJQ 1WPYA 1YNZA 2RI2A 2VGNA 1X43A 3CCUQ 2LX9A 1SRMA 2FPDA 1K73U 2AKLA 5LJ3f 5IHKA 2DK3A 1JXMA 5GAOn 1ZSZA 5GANe 2LCCA 1PD0A 4BE2A 3REAB 1I07A 1M2VA 2HL3A 3QJYA 4GY5A 4FCYA 3J80E 1BU1A 5LJ5j 2RI5A 5CAIA 3PTAA 2AK5A 3PGGA 2V8JA 4N0AA 1QLYA 1I5OB 2KGTA 4M7AE 1S1NA 4JJNK 5CVIA 3PVQA 1YJNA 3QPHA 1UTIA 2J6KA 4X9DA 3M9QA 4CI0C 1VQ4A 3UWNA 2RQRA 1AT1B 1BI0A 3EHQA 4J9DA 2DMOA 4EMKC 4OMMA 4JLIA 2K5IA 2NUTB 1LCKA 1YHQQ 1UJYA 2MIOA 2OTLQ 2KNBB 1BK2A 4XK8E 3BE3A 1TUGB 4PLLA 1B7TA 3L1AA 3E2UA 4F7UB 4ZTJA 2X3XD 1VQ6Q 2YDLA 2EGAA 2V1QA 4JDSA 3QUIA 3JB9J 3AHUA 1WQWA 3SWNA 1VQKA 1KQSP 3RIRA 2PUOB 2RB6A 2JMAA 1V76A 2KY9A 5KCHA 2AKKA 2XIDA 4RG2A 3ZL7C 4OB0B 2L3PA 3A8HB 4PJOG 1Q82R 3HFNA 1QKWA 4D8DA 3I56Q 2KT1A 1PNJA 3H9NA 3CMEQ 1YIJT 2DEUA 3OBWA 2JNGA 3CCUT 3MP6A 5KCOA 1K9MU 1WA7A 1ZUUA 3T9NA 1Q81C 3PE0A 1TG0A 1I81A 3EH1A 3VS7A 1Y0MA 1K73R 1T0JA 5A0GA 4J6XA 2ECZA 4FT2A 4C8QG 1OU9A 1KC8U 2CSQA 2K79A 1NYFA 1RAIB 2J6OA 3M57A 3JRZA 3RKYA 4AG1C 1HXDA 4OMFB 2KRMA 3TVTA 4OB2B 2DVJA 4KBMB 3VYHB 4IUTA 5FWBA 3CCQQ 2MWPA 2R57A 4QVCA 2F5KA 1RUWA 2ROTA 3OYAA 3JB9D 2LVMA 2RH2A 4XTXA 1Q7YC 3WVEB 2M51A 2YLCA 1SSHA 3CEYA 4C0ZA 1QVFA 1QVFS 3OMCA 2CS7A 1VIFA 2G6FX 1M2VB 5GAN8 1KK7A 2M02A 3OYCA 1U5SA 1VUBA 3HFOA 1VQ8A 2K6DA 2LQNA 1YHQT 2OTLT 2QTXA 1AEYA 1BKBA 2H8HA 2DD5A 5LJ3j 1WYXA 2KAFA 2EW3A 1YJ9A 4PJOF 2LP5A 4FSXA 4DBRA 2IVWA 1VQ6T 2E6NA 3RR6A 1OOTA 1BCOA 3CC4T 4J6YA 4EDUA 4HCBA 2V1RA 2DM1A 1RLPC 1D1BA 4ORZA 2DO3A 2QYZA 4OGEA 1VQLQ 3CD6A 2FVUA 3EFOB 4JUVA 5CR2A 3HPWA 1VQ7A 3CCSQ 2V8KA 1IRXA 4WF2A 4DOVA 4C5HA 3I56T 2XG8D 3C95A 5D6YA 2K2MA 2DLPA 2CP5A 3CMET 3E9FA 4QQ6A 4C8QF 4FM4B 4C5EA 2DD4A 2JJ9A 1IHWA
chains in the Genus database with same CATH topology
2C0OA 1T3SA 4HVVA 1ZUKA 4CC2A 1AZEA 5HCKA 4Z89A 4OMNA 4JJDA 1HD3A 3I9QA 2GNCA 4HVWA 1PRLC 2A08A 2EVRA 3NGPA 1E6HA 1K0SA 1K9AA 1RLQC 2X3WD 4AFSC 1GCQA 1RI9A 5L23A 4HVUA 3QWYA 1N5ZA 2RNAA 2JM9A 2EKHA 1JQQA 2GQIA 3I35A 2K7AA 1B3QA 1G2BA 4R0KA 3UF4A 3FJ5A 2K3BA 2DF6A 2C0IA 3VRZA 1AD5A 2O31A 1Y57A 2RQWA 1UG1A 3TSWA 2CREA 1K4US 3VS0A 4AFZC 4RTVA 2RQVA 2YSQA 4OMQA 2MCNA 3EHRA 3PVLA 2ABLA 2DL3A 1GFCA 3SHWA 1W70A 4F16A 2LQWA 3H0IA 1AWXA 4A63B 2KYMA 2F2XA 4LUEA 1H3HA 5IHIA 1NM7A 2DILA 4IIOA 1W6XA 2BZYA 2DL7A 2DYBA 2KEAA 1GFDA 2DL4A 3VS5A 4GLMA 2O9SA 4OMPA 1UECA 2LZ6B 3EG2A 2RQUA 1GBQA 1WLPB 3I5RA 2LCSA 2J7IA 3U23A 1MV3A 1X69A 2J06A 2EBPA 5IH2A 1ZSGA 2FPFA 1JO8A 1OV3A 2CH4A 2D8HA 2D8JA 2PZ1A 2FPEA 3LH5A 2A37A 2W0ZA 1SPKA 3RNJA 1KJWA 1GL5A 1SHGA 2I0NA 3GBQA 2LX7A 2P4RA 5IXFA 1M3BA 1PKSA 2JW4A 2K9GA 1XOVA 1CKBA 1JXOA 1PHTA 2EGCA 1ZX6A 4F14A 2DL8A 1ABOA 2L0AA 2OAWA 2ENMA 1QWFA 2BTTA 4LE9A 3IQLA 5I22A 3C0CA 1T0HA 4WCIA 2ED0A 1X2KA 4RTUA 3M0PA 2DRKA 1OEBA 1Z9QA 1TUDA 4X1VA 2XMFA 2F2WA 1VYVA 2KRNA 2DRMA 1SEMA 4CC4B 1WXBA 4ESRA 2DNUA 4J9BA 2VVKA 2MOXA 4AG2C 1A0NB 2L3SA 2FG0A 2HBWA 1B07A 5EC7A 1MV0B 4DEYA 2JXBA 4F17A 1UHFA 1UDLA 2YUOA 4Z8AA 4GBQA 1GBRA 3O5ZA 1M3AA 1WI7A 4RTYA 2C0TA 4RTTA 2D1XA 4LNPA 1EFNA 2LJ0A 1GCPA 1V1CA 2YUQA 5FWCA 1E6GA 2CDTA 4Y92A 1CKAA 2EYXA 1HSQA 1SHFA 1ZLMA 1ARKA 1VA7A 4HXJA 1TUCA 1AOJA 2NUZA 4RUGA 3H41A 2RQTA 1YWPA 3EG1A 2KR3A 3TSZA 1X6BA 1X27A 1JU5C 2YT6A 3M0UA 2RPNA 4EIKA 2EQIA 2GTJA 3NMZC 4OMLA 1I0CA 2ROLA 4IIMA 1YWOA 1KSWA 2A36A 3QWXX 4JJCA 2KBTA 2AZSA 2SEMA 1QKXA 3UA7A 2GBQA 1UJ0A 4LN2A 2JS0A 1ZUYA 2KT8A 2LJ1A 4J9HA 1PKTA 3EG0A 2DE0X 2RMOA 1QCFA 2YUPA 3VRYA 2BZXA 2JS2A 3ULRB 1MUZA 1X2QA 4J9FA 1I1JA 2DL5A 2EPDA 3THKA 2DBMA 1NG2A 1AWWA 1SRLA 1YNZA 1X43A 1YP5A 3I5SA 1SRMA 3EG3A 2FPDA 1GRIA 2AKLA 1G83A 5IHKA 1JXMA 2W10A 4J9GA 2FRYA 3REAB 1I07A 2CUDA 3A98A 2KXCA 1WIEA 1BU1A 2CUBA 2DA9A 1FMKA 2AK5A 2DJQA 2O9VA 4JZ4A 3NPFA 1QLYA 2JM8A 2KE9A 2KGTA 5IHNA 1S1NA 2OI3A 3PVQA 4AFUC 1UTIA 4E6RA 2J6KA 1YCSB 2GTOA 4RTWA 3JV3A 4J9IA 3M0SA 1VYUA 4K11A 1U06A 2OJ2A 2RQRA 2J05A 1OPKA 3EHQA 3M0TA 4RTZA 4J9DA 1KFZA 3H0FA 2LMJA 2HSPA 2DMOA 4OMMA 1T3LA 4KRTA 1KIKA 1LCKA 1M3CA 1UJYA 3CQTA 2MIOA 4DEXA 2KNBB 1K1ZA 2YUNA 2J6FA 1BK2A 4ZNXA 2L2PA 2NWMA 2HCKA 4RTXA 3VS3A 3VS4A 1VYTA 2FO0A 1H92A 4J9CA 2X3XD 2YDLA 2JT4A 2EGAA 2V1QA 4JZ3A 2EYYA 1K0XA 1WFWA 5I11A 4Z88A 1BB9A 2DX1A 5IXBA 2EGEA 4JJBA 2JMAA 2KYBA 2AKKA 2VWFA 4CC7A 2AZVA 3ZL7C 2L3PA 2O2OA 5GJVB 1OPLA 2KROA 1WDXA 2QDLA 1AWOA 1HJDA 3KFVA 1QKWA 4OMOA 4D8DA 3REBB 1X6GA 2KT1A 2VKNA 1PNJA 3VS2A 2KRSA 4JPBW 2EYZA 2PNIA 2IIMA 5ECAA 4CC3A 1K76A 1WA7A 1ZUUA 2PTKA 3PE0A 1TG0A 4HCKA 2A28A 1AZGB 4D8KA 1UHCA 3VS7A 1Y0MA 1T0JA 2SRCA 2O88A 2EYWA 1AWJA 3RBBB 2ECZA 1J3TA 5FW9A 2CSQA 2K79A 2ED1A 1NYFA 2J6OA 2D0NA 4AG1C 2KRMA 1PRMC 1NEGA 1E7OA 3EGUA 3TVTA 2DVJA 1UGVA 3UA6A 3UATA 4AFQC 1YN8A 5FWBA 4FSSA 2L3QA 1NEBA 1UE9A 2ESWA 1QWEA 3VS1A 1RUWA 2ROTA 1AVZC 1WXUA 1JEGA 2M51A 1SSHA 4QT7A 1NYGA 4M4ZA 2CT3A 4LUDA 1UFFA 2FRWA 2G6FX 1UUEA 3SEMA 1GCQC 2DBKA 1U5SA 2KXDA 1BBZA 2K6DA 2LQNA 2M0YA 1AEYA 2H8HA 4J9EA 1WYXA 3M0QA 2HDAA 2JMCA 2EW3A 1FYNA 1H8KA 2LP5A 2JTEA 1WX6A 1OOTA 2GGRA 2F2VA 2V1RA 2DM1A 1ABQA 1RLPC 2HEQA 3NHNA 2E5KA 4ORZA 1M8MA 2CT4A 1CSKA 2RN8A 2CH4W 2B86A 1U3OA 1PWTA 1Z9ZA 2RF0A 1NLOC 5GJWB 2CSIA 3H0HA 1M30A 1W1FA 2LJ3A 2K2MA 2LNHB 3M0RA 2DLPA 1ZBJA 2BZ8A 2FEIA 1WXTA 1NLPC 3VS6A 1IO6A 3R6NA 1M27C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0O A;  1T3S A;  4HVV A;  1ZUK A;  4CC2 A;  1AZE A;  5HCK A;  4Z89 A;  4OMN A;  4JJD A;  1HD3 A;  3I9Q A;  2GNC A;  4HVW A;  1PRL C;  2A08 A;  2EVR A;  3NGP A;  1E6H A;  1K0S A;  1K9A A;  1RLQ C;  2X3W D;  4AFS C;  1GCQ A;  1RI9 A;  5L23 A;  4HVU A;  3QWY A;  1N5Z A;  2RNA A;  2JM9 A;  2EKH A;  1JQQ A;  2GQI A;  3I35 A;  2K7A A;  1B3Q A;  1G2B A;  4R0K A;  3UF4 A;  3FJ5 A;  2K3B A;  2DF6 A;  2C0I A;  3VRZ A;  1AD5 A;  2O31 A;  1Y57 A;  2RQW A;  1UG1 A;  3TSW A;  2CRE A;  1K4U S;  3VS0 A;  4AFZ C;  4RTV A;  2RQV A;  2YSQ A;  4OMQ A;  2MCN A;  3EHR A;  3PVL A;  2ABL A;  2DL3 A;  1GFC A;  3SHW A;  1W70 A;  4F16 A;  2LQW A;  3H0I A;  1AWX A;  4A63 B;  2KYM A;  2F2X A;  4LUE A;  1H3H A;  5IHI A;  1NM7 A;  2DIL A;  4IIO A;  1W6X A;  2BZY A;  2DL7 A;  2DYB A;  2KEA A;  1GFD A;  2DL4 A;  3VS5 A;  4GLM A;  2O9S A;  4OMP A;  1UEC A;  2LZ6 B;  3EG2 A;  2RQU A;  1GBQ A;  1WLP B;  3I5R A;  2LCS A;  2J7I A;  3U23 A;  1MV3 A;  1X69 A;  2J06 A;  2EBP A;  5IH2 A;  1ZSG A;  2FPF A;  1JO8 A;  1OV3 A;  2CH4 A;  2D8H A;  2D8J A;  2PZ1 A;  2FPE A;  3LH5 A;  2A37 A;  2W0Z A;  1SPK A;  3RNJ A;  1KJW A;  1GL5 A;  1SHG A;  2I0N A;  3GBQ A;  2LX7 A;  2P4R A;  5IXF A;  1M3B A;  1PKS A;  2JW4 A;  2K9G A;  1XOV A;  1CKB A;  1JXO A;  1PHT A;  2EGC A;  1ZX6 A;  4F14 A;  2DL8 A;  1ABO A;  2L0A A;  2OAW A;  2ENM A;  1QWF A;  2BTT A;  4LE9 A;  3IQL A;  5I22 A;  3C0C A;  1T0H A;  4WCI A;  2ED0 A;  1X2K A;  4RTU A;  3M0P A;  2DRK A;  1OEB A;  1Z9Q A;  1TUD A;  4X1V A;  2XMF A;  2F2W A;  1VYV A;  2KRN A;  2DRM A;  1SEM A;  4CC4 B;  1WXB A;  4ESR A;  2DNU A;  4J9B A;  2VVK A;  2MOX A;  4AG2 C;  1A0N B;  2L3S A;  2FG0 A;  2HBW A;  1B07 A;  5EC7 A;  1MV0 B;  4DEY A;  2JXB A;  4F17 A;  1UHF A;  1UDL A;  2YUO A;  4Z8A A;  4GBQ A;  1GBR A;  3O5Z A;  1M3A A;  1WI7 A;  4RTY A;  2C0T A;  4RTT A;  2D1X A;  4LNP A;  1EFN A;  2LJ0 A;  1GCP A;  1V1C A;  2YUQ A;  5FWC A;  1E6G A;  2CDT A;  4Y92 A;  1CKA A;  2EYX A;  1HSQ A;  1SHF A;  1ZLM A;  1ARK A;  1VA7 A;  4HXJ A;  1TUC A;  1AOJ A;  2NUZ A;  4RUG A;  3H41 A;  2RQT A;  1YWP A;  3EG1 A;  2KR3 A;  3TSZ A;  1X6B A;  1X27 A;  1JU5 C;  2YT6 A;  3M0U A;  2RPN A;  4EIK A;  2EQI A;  2GTJ A;  3NMZ C;  4OML A;  1I0C A;  2ROL A;  4IIM A;  1YWO A;  1KSW A;  2A36 A;  3QWX X;  4JJC A;  2KBT A;  2AZS A;  2SEM A;  1QKX A;  3UA7 A;  2GBQ A;  1UJ0 A;  4LN2 A;  2JS0 A;  1ZUY A;  2KT8 A;  2LJ1 A;  4J9H A;  1PKT A;  3EG0 A;  2DE0 X;  2RMO A;  1QCF A;  2YUP A;  3VRY A;  2BZX A;  2JS2 A;  3ULR B;  1MUZ A;  1X2Q A;  4J9F A;  1I1J A;  2DL5 A;  2EPD A;  3THK A;  2DBM A;  1NG2 A;  1AWW A;  1SRL A;  1YNZ A;  1X43 A;  1YP5 A;  3I5S A;  1SRM A;  3EG3 A;  2FPD A;  1GRI A;  2AKL A;  1G83 A;  5IHK A;  1JXM A;  2W10 A;  4J9G A;  2FRY A;  3REA B;  1I07 A;  2CUD A;  3A98 A;  2KXC A;  1WIE A;  1BU1 A;  2CUB A;  2DA9 A;  1FMK A;  2AK5 A;  2DJQ A;  2O9V A;  4JZ4 A;  3NPF A;  1QLY A;  2JM8 A;  2KE9 A;  2KGT A;  5IHN A;  1S1N A;  2OI3 A;  3PVQ A;  4AFU C;  1UTI A;  4E6R A;  2J6K A;  1YCS B;  2GTO A;  4RTW A;  3JV3 A;  4J9I A;  3M0S A;  1VYU A;  4K11 A;  1U06 A;  2OJ2 A;  2RQR A;  2J05 A;  1OPK A;  3EHQ A;  3M0T A;  4RTZ A;  4J9D A;  1KFZ A;  3H0F A;  2LMJ A;  2HSP A;  2DMO A;  4OMM A;  1T3L A;  4KRT A;  1KIK A;  1LCK A;  1M3C A;  1UJY A;  3CQT A;  2MIO A;  4DEX A;  2KNB B;  1K1Z A;  2YUN A;  2J6F A;  1BK2 A;  4ZNX A;  2L2P A;  2NWM A;  2HCK A;  4RTX A;  3VS3 A;  3VS4 A;  1VYT A;  2FO0 A;  1H92 A;  4J9C A;  2X3X D;  2YDL A;  2JT4 A;  2EGA A;  2V1Q A;  4JZ3 A;  2EYY A;  1K0X A;  1WFW A;  5I11 A;  4Z88 A;  1BB9 A;  2DX1 A;  5IXB A;  2EGE A;  4JJB A;  2JMA A;  2KYB A;  2AKK A;  2VWF A;  4CC7 A;  2AZV A;  3ZL7 C;  2L3P A;  2O2O A;  5GJV B;  1OPL A;  2KRO A;  1WDX A;  2QDL A;  1AWO A;  1HJD A;  3KFV A;  1QKW A;  4OMO A;  4D8D A;  3REB B;  1X6G A;  2KT1 A;  2VKN A;  1PNJ A;  3VS2 A;  2KRS A;  4JPB W;  2EYZ A;  2PNI A;  2IIM A;  5ECA A;  4CC3 A;  1K76 A;  1WA7 A;  1ZUU A;  2PTK A;  3PE0 A;  1TG0 A;  4HCK A;  2A28 A;  1AZG B;  4D8K A;  1UHC A;  3VS7 A;  1Y0M A;  1T0J A;  2SRC A;  2O88 A;  2EYW A;  1AWJ A;  3RBB B;  2ECZ A;  1J3T A;  5FW9 A;  2CSQ A;  2K79 A;  2ED1 A;  1NYF A;  2J6O A;  2D0N A;  4AG1 C;  2KRM A;  1PRM C;  1NEG A;  1E7O A;  3EGU A;  3TVT A;  2DVJ A;  1UGV A;  3UA6 A;  3UAT A;  4AFQ C;  1YN8 A;  5FWB A;  4FSS A;  2L3Q A;  1NEB A;  1UE9 A;  2ESW A;  1QWE A;  3VS1 A;  1RUW A;  2ROT A;  1AVZ C;  1WXU A;  1JEG A;  2M51 A;  1SSH A;  4QT7 A;  1NYG A;  4M4Z A;  2CT3 A;  4LUD A;  1UFF A;  2FRW A;  2G6F X;  1UUE A;  3SEM A;  1GCQ C;  2DBK A;  1U5S A;  2KXD A;  1BBZ A;  2K6D A;  2LQN A;  2M0Y A;  1AEY A;  2H8H A;  4J9E A;  1WYX A;  3M0Q A;  2HDA A;  2JMC A;  2EW3 A;  1FYN A;  1H8K A;  2LP5 A;  2JTE A;  1WX6 A;  1OOT A;  2GGR A;  2F2V A;  2V1R A;  2DM1 A;  1ABQ A;  1RLP C;  2HEQ A;  3NHN A;  2E5K A;  4ORZ A;  1M8M A;  2CT4 A;  1CSK A;  2RN8 A;  2CH4 W;  2B86 A;  1U3O A;  1PWT A;  1Z9Z A;  2RF0 A;  1NLO C;  5GJW B;  2CSI A;  3H0H A;  1M30 A;  1W1F A;  2LJ3 A;  2K2M A;  2LNH B;  3M0R A;  2DLP A;  1ZBJ A;  2BZ8 A;  2FEI A;  1WXT A;  1NLP C;  3VS6 A;  1IO6 A;  3R6N A;  1M27 C; 
#chains in the Genus database with same CATH topology
 3I55 Q;  3CPW A;  3QYH B;  4Z02 A;  4PL6 A;  4AMC A;  3CPW S;  1IHV A;  3SWN B;  1C1A A;  4AT1 B;  4FL6 A;  1OZ2 A;  1K9M R;  3OSV A;  4OMN A;  2GNC A;  5GAM g;  3LLR A;  4HVW A;  1YI2 A;  2A08 A;  1OU8 A;  1KC8 R;  1M2O A;  3BY7 A;  1PSF A;  1IXD A;  1K9A A;  1RL2 A;  4AFS C;  4C5G A;  5L23 A;  3CCQ T;  2EKH A;  1JQQ A;  3L2R A;  4P5N A;  1W2B S;  1X6O A;  4MZM A;  2X4Y A;  3JSC A;  3VRZ A;  2RHY A;  3EFS A;  4Q5W A;  2P0K A;  3LWH A;  5GAN 4;  2ZAE A;  1WJR A;  2DJZ A;  2D9T A;  1D09 B;  9ATC B;  4BE1 A;  3NFC A;  4M78 A;  1V29 B;  4OMQ A;  3EHR A;  2DL3 A;  1W70 A;  2RI3 A;  2V8I A;  1VQN A;  4XU2 A;  4A63 B;  4LUE A;  2KSS A;  5IHI A;  2COZ A;  1NM7 A;  3P8H A;  2R58 A;  1W6X A;  5D6W A;  3QZ5 B;  3X24 B;  1VQL T;  2CKK A;  4PNO A;  1EX4 A;  4IUU A;  1MGQ A;  3OYI A;  1R0C B;  3CCS T;  1ZBX A;  3JCM V;  2LZ6 B;  1OQK A;  4KH0 B;  2EAY A;  1GBQ A;  3JCM P;  4C5I A;  2J7I A;  1MV3 A;  2DFU A;  1B34 A;  2QDY B;  3SDZ A;  4Y28 E;  5IH2 A;  5GAN f;  1ZSG A;  2JTF A;  2FPF A;  3I55 T;  1TS9 A;  1WHM A;  2A37 A;  5IAY A;  1GL5 A;  4D6W A;  3QO3 A;  1K73 C;  2YRC A;  3GBQ A;  4LDV A;  5AYF A;  4M77 E;  1N9R A;  1MNE A;  4C92 A;  4MDW A;  2VV5 A;  5CKD A;  2COW A;  5GAO l;  1PHT A;  2E5Q A;  4BY6 B;  3A8O B;  3CPF A;  1Q86 U;  2OAW A;  2PVG B;  1SKU B;  2L8D A;  3C0C A;  2QA4 A;  2ED0 A;  3CCM Q;  1MMN A;  4RTU A;  3J81 E;  1VQ9 A;  4RMO A;  5CQY A;  1OEB A;  2O4X B;  4M75 C;  2F2W A;  2WAC A;  1QMC A;  2PVO B;  2RK2 A;  2DNU A;  4J9B A;  4ELZ C;  2BUD A;  2MOX A;  1BI1 A;  2L3S A;  5D6X A;  3TCJ A;  4Y91 A;  2E4H A;  3QXE B;  1MV0 B;  5KYX A;  1Q81 U;  5FLX E;  1YCY A;  2DAQ A;  5KE3 A;  1DJ7 B;  3O5Z A;  3D7S B;  4XAX B;  2D1X A;  4LNP A;  3G4S A;  1WHK A;  3CCV T;  1E6G A;  3RUX A;  3RER A;  4M7D E;  5KH6 A;  1CKA A;  3OBY A;  1HSQ A;  1M90 C;  5DM7 R;  4E7I A;  1JB0 E;  1TUC A;  2NUZ A;  2OTJ T;  4RUG A;  2GFU A;  5GMK j;  2RQT A;  3EG1 A;  2DTI A;  2GTJ A;  3NMZ C;  4OML A;  5CQX A;  4BY6 C;  2I2L A;  3JCM b;  3JB9 I;  1VQ5 T;  2QQA A;  1KSW A;  1TTH B;  2A36 A;  1K9M C;  5GAN 5;  1MND A;  3WXM B;  2DZC A;  4UC4 A;  3G7Z A;  2CYZ B;  4TVR A;  2B8A A;  4J9H A;  3EG0 A;  1NZ9 A;  2DE0 X;  2MPX C;  3CC7 A;  2QG9 B;  5L8R E;  2JS2 A;  4LDY A;  5DY9 A;  3ULR B;  5D7U A;  2DL5 A;  4C92 D;  2DBM A;  5LJ5 f;  1Q86 R;  3EG3 A;  3CCE Q;  4N4G A;  4J9G A;  2DTH A;  1QP2 A;  2LNV A;  1ACM B;  2CUD A;  3A98 A;  2BKD N;  2DA9 A;  3LW5 E;  3X26 B;  5GAN j;  3RMS A;  4C92 B;  3OYE A;  2O9V A;  4JZ4 A;  3NPF A;  2E41 A;  3JCM f;  1TH7 A;  3X28 B;  4A53 A;  3OYD A;  4BDY A;  2RHX A;  4BB7 A;  1YIT T;  4E6R A;  3L2W A;  5LJ3 h;  3GNG A;  2VUB A;  3JV3 A;  1M1F A;  1Q81 R;  4K11 A;  1Y96 B;  5CO7 A;  2HSP A;  2WSE E;  4JRQ A;  5HY6 A;  1N8R U;  3OQ5 A;  1D0Y A;  1XTD A;  3CQT A;  4DEX A;  3NTK A;  1K1Z A;  2YUN A;  2J6F A;  1LJO A;  1NPP A;  1WZO A;  3ASK A;  3VS3 A;  4F7U E;  2HCK A;  2YRD A;  1H64 1;  3OYL A;  2JT4 A;  3FC3 A;  5GAN 3;  3FDR A;  5KYX B;  2EYY A;  1WFW A;  1AHJ B;  2DX1 A;  4PJJ A;  4JJB A;  5J26 A;  2RO0 A;  2AZV A;  2VGM A;  2O2O A;  4PFZ A;  1TU0 B;  2DIG A;  2KRO A;  1WDX A;  2QDL A;  3N5B B;  4M78 G;  1AWO A;  3LGL A;  1VQP T;  1MMA A;  3A8L B;  3M56 A;  2KRS A;  2K4Y A;  1D0X A;  2DTO A;  5ECA A;  1MMD A;  2E10 A;  1OX9 A;  5IN1 A;  4ZN1 A;  3V8L A;  2EFI A;  1AZG B;  2QAZ A;  2X4J A;  4FW1 A;  1RAA B;  2SRC A;  4ATO A;  1AWJ A;  5FW9 A;  5FRN A;  2CP2 A;  2D0N A;  2D0Q B;  1NEG A;  3HL8 A;  3UA6 A;  4AFQ C;  3KUF A;  1YN8 A;  2V26 A;  4FSS A;  2LQK A;  3HRU A;  1NEB A;  3HKS A;  1KHI A;  3CCJ Q;  3VKI A;  3VS1 A;  2LC4 A;  5LJ3 d;  3G71 A;  2K5F A;  2PQW A;  4DA4 A;  2EKO A;  2CT3 A;  4LUD A;  3E19 A;  2E65 A;  1OI1 A;  5CK9 A;  3SEM A;  2OTL A;  3VV0 A;  3WVD B;  2K2V A;  3GF5 A;  5DLO A;  3RKX A;  2DBK A;  4C92 G;  2M0Y A;  4J5Y A;  3OYM A;  1IZ6 A;  3QDR B;  1N8R R;  3E1S A;  4J9E A;  1BIA A;  3A5Z B;  1S72 A;  4FYY B;  2JZ2 A;  3CC4 A;  2QGG A;  1VIE A;  2DIQ A;  4M78 F;  4PJO C;  4A4E A;  2F2V A;  1D3B B;  1TOV A;  1K8A U;  2P0P A;  3JCM c;  1M5Q 1;  3L42 A;  1CSK A;  5AT1 B;  3I56 A;  2B86 A;  2JTM A;  3MHX A;  3QZ9 B;  5HK3 A;  4E7J A;  5GJW B;  2QQS A;  1W1F A;  4M7A A;  3M0R A;  2GF7 A;  2BZ8 A;  2XIC A;  1NLP C;  3RMQ A;  3VS6 A;  4OGC A;  3CC2 Q;  3CXC P;  4C8Q C;  2C0O A;  3CCL T;  1XJW B;  4GLK A;  1Q86 C;  1ZUK A;  1AZE A;  2KI7 A;  1P92 A;  1HD3 A;  2DEQ A;  1W4S A;  4L59 A;  3LH0 A;  1M90 U;  1QVG P;  3CBM A;  3CCQ A;  2JN0 A;  2X3W D;  2LT4 A;  1GCQ A;  3NTH A;  4HVU A;  4B6M A;  5HKC A;  1X75 C;  2EWN A;  3CCJ T;  2JM9 A;  3I35 A;  4R0K A;  4QQG A;  4OB1 B;  3UF4 A;  4R56 A;  4C92 F;  2KQW A;  2DXC A;  1YJN Q;  2QTV A;  3FB9 A;  2YLB A;  2MI6 A;  5CKB A;  3VUB A;  1Y57 A;  3OYY A;  4HKE A;  2CZ1 B;  3TSW A;  4M7D G;  5GAO q;  3VS0 A;  4NL3 A;  2RQV A;  3M5A A;  3E9G A;  2MCN A;  2CP3 A;  1GFC A;  4JS5 A;  3SHW A;  2LQW A;  4HCZ A;  3H0I A;  1RAH B;  1Y07 A;  2CZ7 B;  4MDX A;  1H3H A;  1FWZ A;  4M75 E;  1VQL A;  2AIR B;  5KYW B;  1JRI A;  2DIL A;  4IIO A;  3CCS A;  1M1G A;  3L2Z A;  2A0F B;  5GMK h;  2KEA A;  2M16 A;  1R77 A;  1ZSZ B;  4PKC C;  4OMP A;  4QVD A;  1UEC A;  1K8A R;  3L2V A;  2RQU A;  5GAM e;  1WLP B;  2LCS A;  3VYG A;  3I55 A;  1OUL A;  1G3W A;  2VXF A;  3BW1 A;  2EBP A;  3F70 A;  2C06 A;  1IGQ A;  2D8H A;  1WHL A;  2D8J A;  2PZ1 A;  2Y90 A;  2FPE A;  2W0Z A;  2XI9 A;  2E3I A;  5GAO r;  1RAD B;  3GOX A;  2I0N A;  1WJS A;  2DZ9 A;  2P4R A;  5A0D A;  3PMI A;  5IXF A;  1M3B A;  3TQ7 P;  1D1A A;  2X51 A;  2K9G A;  1XOV A;  3G6E A;  1JXO A;  1M90 R;  3H8Z A;  2L5Q A;  4JS4 A;  3OYH A;  4XTW A;  1ABO A;  2L0A A;  3JAM E;  4BAC A;  1KD1 U;  5GAN h;  1QWF A;  2FZG B;  1RAE B;  2ATC B;  4LE9 A;  2VYT A;  3IQL A;  1YJN T;  4QVZ A;  1MHN A;  2VXE A;  3M4G A;  1Q95 G;  1Z9Q A;  2M0O A;  1NJI U;  1TUD A;  3JCM W;  4X1V A;  1LPL A;  2XMF A;  3LYI A;  3PIO A;  4XU0 A;  1FMW A;  4E7L A;  4PLI A;  1SEM A;  4CC4 B;  1WXB A;  4ESR A;  2VVK A;  1N8R C;  2WSF E;  2FG0 A;  1ZSZ C;  1JJ2 P;  1U1S A;  3HTR A;  5KYN A;  1YBY A;  2JXB A;  8AT1 B;  5LJ5 g;  3OMG A;  2P0Q A;  2QQB A;  2H3J A;  2BE7 D;  2MAM A;  4EPC A;  4DBH A;  3CCV A;  3MO8 A;  2ZPI B;  1SG5 A;  3X20 B;  4N0A C;  2X4W A;  1V1C A;  5M9O A;  2RJE A;  3CXC A;  3CD6 Q;  2HSE B;  1IRE B;  4Y92 A;  3TRE A;  2EYQ A;  2HL5 C;  2OTJ A;  3OW2 P;  1BCM A;  1WGS A;  1N6A A;  1VQM Q;  4HXJ A;  1KQS A;  1LOJ A;  3DB4 A;  3JCM g;  2EQM A;  1KQS S;  3OYK A;  2KR3 A;  1QVG A;  3TSZ A;  1X27 A;  1JU5 C;  3M0U A;  4EIK A;  2RPN A;  1VQ5 A;  4E7H A;  2ROL A;  4IIM A;  1Y71 A;  3NTI A;  4JJC A;  1QKX A;  1FXX A;  3UA7 A;  1UJ0 A;  1VOM A;  4O6J A;  2RD1 A;  2KT8 A;  4QW2 A;  1YI2 Q;  3SWN C;  4DQ2 A;  2RMO A;  3ZBD A;  2YUP A;  5GAN d;  2HKQ B;  2RHI A;  1X2Q A;  2ZPE B;  3SB2 A;  2K57 A;  3THK A;  1NG2 A;  1AWW A;  1SRL A;  1YP5 A;  3I5S A;  2EJF A;  3SD4 A;  1G83 A;  1KD1 R;  2DVE A;  2FRY A;  3PMT A;  4A4F A;  3GPL A;  1IGU A;  3LWI A;  4B9X A;  2VC8 A;  4L6V 5;  2CUB A;  1UGP B;  1TSF A;  1C0M A;  3OS5 A;  1FMK A;  2M1H A;  3MP8 A;  3CCR A;  1NJI R;  4M7A G;  1YIT A;  2JM8 A;  2KE9 A;  1LNX A;  4IUQ A;  2QEX A;  3INZ A;  2DET A;  2OI3 A;  1XQH A;  5A2Q E;  4AFU C;  3UPU A;  1VQN Q;  5LJ5 h;  2HKN A;  1YCS B;  5CKE A;  4RTW A;  3ME9 A;  5HK0 A;  3M0S A;  2OJ2 A;  2J05 A;  1OPK A;  2CZ6 B;  1KFZ A;  4M77 A;  4RTZ A;  3OB9 A;  2Y4X A;  1SSF A;  2LMJ A;  3H0F A;  4BE0 A;  1MMG A;  1K8A C;  4OB3 B;  1T3L A;  1YJW A;  3UT1 A;  4ZGJ B;  1VQM T;  3JCM h;  4ZNX A;  1OYX A;  2L2P A;  2NWM A;  1PD1 A;  4RTX A;  3VS4 A;  1VYT A;  2MF2 A;  4M78 D;  2XHC A;  1X01 A;  2CP0 A;  1K0X A;  3L2Q A;  1LVK A;  1JBM A;  5IXB A;  2EGE A;  4FW2 A;  5LJ3 g;  2EQJ A;  2KYB A;  2X35 A;  2HQH A;  3QBY A;  4CC7 A;  4BD3 A;  1VQP A;  3MCA B;  1OPL A;  3CMA Q;  5GAO p;  4PJO E;  3KFV A;  2QGF B;  3FEO A;  4M78 B;  3REB B;  2PVD B;  1X6G A;  4LDW A;  4C0F A;  3VS2 A;  4JPB W;  2EYZ A;  3QII A;  2QAS A;  2IIM A;  2GFA A;  3BFM A;  5KYY A;  3H6Z A;  4LDU A;  4M7A F;  2ZZD A;  4D8K A;  2QA4 Q;  2O88 A;  1JJ2 A;  1VQ9 Q;  4M7D A;  1J3T A;  4C8Q E;  2LDM A;  4FYX B;  4PFO A;  4BDZ A;  4J6W A;  1XNI A;  1PRM C;  2EQK A;  2YRV A;  5C6S A;  1E7O A;  3EGU A;  7AT1 B;  1D1C A;  3EAE A;  1UGV A;  3UAT A;  1G3S A;  5CCA A;  4KUD K;  2HMA A;  5GAN 6;  4EMK A;  5LJ5 d;  2ESW A;  4NOY A;  1QWE A;  2RA2 A;  1VQN T;  1AVZ C;  2NYS A;  4BI8 B;  1WXU A;  1B34 B;  3CBP A;  3OW2 A;  3MEA A;  4QT7 A;  1NYG A;  3CCM T;  4RKU E;  3HSB A;  2FRW A;  4XTU A;  5GAM f;  3FJP A;  3LX7 A;  1RAB B;  3FRN A;  3G4S Q;  4N4I A;  2KXD A;  1BBZ A;  3JCM d;  2KVQ G;  2YXY A;  1FMV A;  2JMC A;  1FYN A;  2AT1 B;  3FLG A;  4LDX A;  1H8K A;  5DLQ E;  3M53 A;  2JTE A;  1ZHI A;  1WX6 A;  2AHJ B;  4KUI A;  4M78 C;  2RJF A;  3NHN A;  3OY9 A;  4E7K A;  3A8G B;  3OS1 A;  2RN8 A;  2ZPG B;  4FIB A;  4A4H A;  4M77 B;  3CMA T;  1U3O A;  4XTY A;  3DLM A;  2RF0 A;  1NLO C;  2LJ3 A;  4XU1 A;  3CCL A;  1ZBJ A;  1NE8 A;  4E7Z A;  2RM4 A;  2FEI A;  1IO6 A;  3CC7 Q;  3R6N A;  2LTO A;  3P8D A;  1T3S A;  5GMK m;  2DYI A;  4KGZ B;  1KD1 C;  5CIU A;  1F1B B;  3R6O A;  4FU6 A;  2F69 A;  1M9S A;  5HCK A;  4Z89 A;  1WQ7 A;  4JJD A;  4WTO B;  4J7I A;  2NUT A;  3PIP A;  1WJQ A;  4OP0 A;  3RDV A;  2EQU A;  2EVR A;  3PNW C;  2A7Y A;  1PSE A;  3NGP A;  3GLX A;  3A1P A;  3JCM J;  1K0S A;  1NJI C;  3PFS A;  4F7U A;  4JRK A;  1YIJ A;  1RLQ C;  4A4G A;  4M7D D;  1RI9 A;  1RI0 A;  4BI3 A;  3CCU A;  1N5Z A;  3V8J A;  2O01 E;  2GQI A;  3DLL A;  4NL2 A;  2K7A A;  1B3Q A;  1KQ1 A;  1UGR B;  1EIF A;  2CZ0 B;  4FYW B;  2CP6 A;  2DF6 A;  2K3B A;  2C0I A;  1KHC A;  4C92 C;  1AD5 A;  5KYY B;  4C0D B;  3CCE T;  2RQW A;  3QSU A;  1M4Z A;  4AFZ C;  4M7D B;  2IG0 A;  3FIF A;  5FU6 B;  2YSQ A;  2HNI A;  2HZY A;  3PVL A;  1QVF P;  2ABL A;  1HYO A;  4QKU A;  4ZGD B;  4LXC A;  3EGD A;  4FYV B;  4PK4 A;  4EMK B;  2NUP A;  2F2X A;  1N9S A;  1OZ3 A;  2DL7 A;  2DYB A;  1IB8 A;  1GFD A;  2DL4 A;  3VS5 A;  4GLM A;  3QKJ A;  2O9S A;  1I8F A;  1YHQ A;  1O9S A;  1UGQ B;  2DER A;  1N27 A;  3I5R A;  3U23 A;  2RJC A;  2J06 A;  1VQ6 A;  1QP3 A;  2E12 A;  3CC7 T;  3L2U A;  3C4S A;  5GAM j;  1JO8 A;  1OV3 A;  1PM3 A;  2CH4 A;  3CBO A;  4B9W A;  4X34 A;  2RK1 A;  1TWB A;  5GAN 2;  4M77 G;  2R5M A;  2ZPB B;  3CPW P;  4HCC A;  3EG9 A;  3SFM A;  2M9U A;  1M1K U;  5CKH A;  1WHH A;  3CME A;  4C0D C;  2Y4Y A;  4KGX B;  4IKF A;  3EH2 A;  3RES A;  1O75 A;  2EGC A;  1ZX6 A;  4F14 A;  1VQO Q;  2VAS A;  2ZGW A;  5FU7 B;  2E70 A;  4M7D C;  3OS2 A;  4ZTF A;  2BTT A;  5FU6 C;  3OYB A;  3MJX A;  5I22 A;  3EFO A;  4WCI A;  2H3E B;  3G71 Q;  1X2K A;  2YWW A;  1RAF B;  2DRK A;  2HD0 A;  1W2B P;  1ZA1 B;  4QQD A;  3GP8 A;  3OYG A;  4F04 B;  4ELY C;  2QK0 A;  2JOY A;  1B07 A;  3C12 A;  5EC7 A;  2FL7 A;  5FRO A;  3VU3 C;  1S72 Q;  4LD9 K;  4F17 A;  1UHF A;  1UDL A;  3CC4 Q;  3HRT A;  3TU4 K;  5GAN g;  2E1H A;  2ZPH B;  2FHD A;  2COY A;  4RTY A;  4IUR A;  1EFN A;  1BIB A;  1GCP A;  5FWC A;  4RCC A;  3JCM X;  1VQ4 Q;  3A8M B;  3AT1 B;  2EYX A;  2MYS A;  1SHF A;  3S6W A;  1G8X A;  2XKO C;  2JUF A;  4M77 F;  1YWP A;  3EGD B;  3ER0 A;  2NUP B;  2FYK A;  2EQI A;  3MP1 A;  1UEB A;  2EJG A;  1YWO A;  3OS0 A;  1G5V A;  5FU7 C;  1RAC B;  1VQK Q;  3V7R A;  2YHT A;  2AZS A;  1SF9 A;  2SEM A;  3MEW A;  1EZZ B;  3C94 A;  4XQ3 A;  1UB4 A;  1YFN A;  1ZUY A;  2LJ1 A;  3QYG B;  1PKT A;  5FRM A;  2LCL A;  1QCF A;  2E64 A;  1Y7X A;  3VRY A;  1M1K R;  4M75 A;  4J9F A;  3TEE A;  2EPD A;  1VQO T;  2DXU A;  2E6Z A;  4HT9 A;  3CC2 T;  1GRI A;  5LJ5 e;  3G71 T;  2RJD A;  4M7A D;  2ZPF B;  2W10 A;  3HP9 A;  5EG2 A;  2A3L A;  2KXC A;  1WIE A;  4KGV B;  2P4T A;  3EG9 B;  2DJQ A;  2KMT A;  1C6V X;  2KK4 A;  5IHN A;  4ZN3 A;  4NS5 A;  3X25 B;  4M7A B;  3JCM e;  4M7D F;  1S72 T;  2OAU A;  4KUL A;  4ANJ A;  5KE2 A;  1I5L A;  2GTO A;  3VJP A;  2Z0W A;  4J9I A;  1VYU A;  4J7F A;  2GQV A;  2L3R A;  1U06 A;  4II1 A;  3M0T A;  4XTV A;  2XDD A;  1G3T A;  1QQJ A;  1VQ4 T;  1VQM A;  3QHS A;  4HA8 A;  4E2F B;  4KRT A;  1BYM A;  1KIK A;  1M3C A;  2FZC B;  4F7U G;  1QVP A;  1VQ8 Q;  3KXT A;  3KBG A;  2FO0 A;  2K3Y A;  1H92 A;  4J9C A;  4MZT A;  4C0G A;  4JZ3 A;  2HAX A;  2HQX A;  5I11 A;  1YJ9 Q;  3ZFJ A;  4Z88 A;  1BB9 A;  3GNF B;  1QCO A;  2O4X A;  2HQE A;  8ATC B;  1UGS B;  2VWF A;  1H3Z A;  1VQK T;  5GJV B;  3EGX A;  4BUG A;  1HJD A;  3JB9 H;  4M78 E;  3CXC S;  1M8V A;  2P84 A;  4OMO A;  1VQ7 Q;  2EIF A;  2VKN A;  4MZP A;  3G6E Q;  1RAG B;  1W2B A;  1KG1 A;  2QXF A;  2PNI A;  2L89 A;  4VUB A;  4CC3 A;  1K76 A;  2PTK A;  1QVG S;  4HCK A;  1KQ2 A;  2A28 A;  4M75 D;  3QG1 A;  1UHC A;  2BIV A;  4M7A C;  2EYW A;  3RBB B;  4IUP A;  3MET A;  2G3R A;  2ED1 A;  3OYJ A;  1D0Z A;  5GMK l;  2L3Q A;  2FZK B;  1UE9 A;  1ZA2 B;  4PJN A;  4M75 B;  2QQR A;  3MEU A;  3CCM A;  1JEG A;  2GCX A;  1U1T A;  2LRQ A;  4M4Z A;  4F7U F;  1UFF A;  2D6F A;  3CCV Q;  5LJ3 e;  1UUE A;  4HT8 A;  1Q82 C;  1GCQ C;  2E3H A;  5A0L A;  3JB9 G;  4CRI A;  4XTZ A;  4ZGE B;  3O8V A;  5CKF A;  4C92 E;  2OTJ Q;  3M0Q A;  2K5L A;  2HDA A;  1VQ8 T;  4A54 A;  2RHU A;  3MEV A;  1QW1 A;  2GGR A;  4DBF A;  1YJ9 T;  1VQ5 Q;  1ABQ A;  2HEQ A;  2E5K A;  3CMA A;  2KDS A;  1BI3 A;  1M8M A;  2CT4 A;  3OYF A;  2LT1 A;  2MK5 A;  5GAM h;  3V8K A;  2CH4 W;  3S3N A;  4OVA A;  3CD6 T;  1PWT A;  1Z9Z A;  4FT4 A;  2CP7 A;  2CSI A;  3H0H A;  1VQ7 T;  1M30 A;  2LNH B;  5C0M A;  3OSS C;  3G6E T;  1WXT A;  1M1K C;  3EFR A;  3HRS A;  1M27 C;  4RG8 A;  4R55 A;  4V2S A;  1Y96 A;  4HVV A;  4CC2 A;  5I2S A;  2MMP A;  3I9Q A;  4IUV A;  1PRL C;  3EGX B;  5J39 A;  3OYN A;  1E6H A;  3DKM A;  2FB7 A;  4L5G A;  3CCR Q;  2IPO B;  1YI2 T;  3QWY A;  1GXI E;  4PJM A;  1YIT Q;  2NLU A;  2RNA A;  1U8R A;  2QEX Q;  3JB9 F;  3CCE A;  1OX8 A;  1G2B A;  3FJ5 A;  2RHZ A;  2XD0 A;  4J83 A;  2MWO A;  2O31 A;  2VB6 A;  3M54 A;  1UG1 A;  2XDP A;  2CRE A;  3V7S A;  4PJO A;  3BDU A;  1K4U S;  5I2M A;  2BE9 B;  4JRI A;  4RTV A;  1JJ2 S;  5J3B A;  4A4K A;  5KYU A;  3QJ6 A;  4E47 A;  1Q7Y U;  4J8O A;  4F16 A;  4ME7 A;  1YJW Q;  2DKG A;  1BI2 A;  1AWX A;  1HK9 A;  4M75 G;  4N4H A;  2KYM A;  2DXT A;  2EJ9 A;  3M59 A;  3Q1J A;  4RCB A;  4EMH A;  3S3O A;  5GAM d;  2BZY A;  3OW2 S;  3MKD A;  1NBE B;  3M4Y A;  4C8Q A;  1TXQ A;  5IT9 E;  3P8B B;  3EG2 A;  1WHG A;  1VQP Q;  1KC8 C;  3OA6 A;  1NPR A;  2X4X A;  2WSC E;  1X69 A;  4M77 D;  2F1L A;  4XU3 A;  1WHJ A;  3LH5 A;  3RNJ A;  1PG5 B;  1SPK A;  1KJW A;  1SHG A;  4LD6 A;  4JRP A;  4EMG A;  2LX7 A;  3VUZ A;  4KH1 B;  2OX7 A;  1PKS A;  2JW4 A;  4DBQ A;  2LQ8 A;  6AT1 B;  4O5V A;  1CKB A;  3CCR T;  4BI4 A;  3GIB A;  2DPP B;  3PT9 A;  2PU9 B;  2DL8 A;  4X9C A;  2QEX T;  1D3B A;  2ENM A;  3DB3 A;  3J7A F;  3M58 A;  1T0H A;  3ZEH A;  3M0P A;  3UDC A;  4M75 F;  2QA4 T;  4MML A;  2QI2 A;  3HHT B;  4PJL A;  1VQ9 T;  1VYV A;  1PC0 A;  2KRN A;  2PUK B;  2DRM A;  1FX7 A;  2F5T X;  4AG2 C;  2JVV A;  1A0N B;  1WNL A;  3BDL A;  3CCJ A;  4PJO D;  3URG A;  2X9H A;  1YJW T;  2HBW A;  3RKW A;  1ZQ1 A;  4DEY A;  1Q7Y R;  2YUO A;  4Z8A A;  2K3X A;  1R8O B;  4GBQ A;  1GBR A;  3M55 A;  1M3A A;  1WI7 A;  2C0T A;  4RTT A;  3JCM Q;  1QCN A;  2LJ0 A;  2YUQ A;  3G1J A;  2CDT A;  4PJO B;  5GMK e;  3G4S T;  4YTL A;  1I4K 1;  1ZLM A;  4C8Q D;  1VA7 A;  5KYU B;  1ARK A;  1AOJ A;  1PCX A;  3H41 A;  4E7S A;  4JLG A;  5GMK i;  3CCL Q;  4OF1 A;  4M77 C;  1R0B G;  1X6B A;  2YT6 A;  2R5A A;  2DXB A;  1I0C A;  4KT0 E;  1G3Y A;  5I21 A;  5GAO m;  2XDB A;  2QQ9 A;  1Q82 U;  3V7C A;  3QWX X;  5LL6 S;  5GAN 7;  4C8Q B;  4MMK A;  2KBT A;  3S3M A;  2GBQ A;  4LN2 A;  2JS0 A;  2XK0 A;  1VQO A;  4PFP A;  3QDF A;  3LGF A;  2HBP A;  2CGH A;  2ZCF B;  4DOW A;  3CC2 A;  2BZX A;  1MUZ A;  2XU8 A;  3MPU B;  1I1J A;  5KYW A;  1YIJ Q;  1WPY A;  1YNZ A;  2RI2 A;  2VGN A;  1X43 A;  3CCU Q;  2LX9 A;  1SRM A;  2FPD A;  1K73 U;  2AKL A;  5LJ3 f;  5IHK A;  2DK3 A;  1JXM A;  5GAO n;  1ZSZ A;  5GAN e;  2LCC A;  1PD0 A;  4BE2 A;  3REA B;  1I07 A;  1M2V A;  2HL3 A;  3QJY A;  4GY5 A;  4FCY A;  3J80 E;  1BU1 A;  5LJ5 j;  2RI5 A;  5CAI A;  3PTA A;  2AK5 A;  3PGG A;  2V8J A;  4N0A A;  1QLY A;  1I5O B;  2KGT A;  4M7A E;  1S1N A;  4JJN K;  5CVI A;  3PVQ A;  1YJN A;  3QPH A;  1UTI A;  2J6K A;  4X9D A;  3M9Q A;  4CI0 C;  1VQ4 A;  3UWN A;  2RQR A;  1AT1 B;  1BI0 A;  3EHQ A;  4J9D A;  2DMO A;  4EMK C;  4OMM A;  4JLI A;  2K5I A;  2NUT B;  1LCK A;  1YHQ Q;  1UJY A;  2MIO A;  2OTL Q;  2KNB B;  1BK2 A;  4XK8 E;  3BE3 A;  1TUG B;  4PLL A;  1B7T A;  3L1A A;  3E2U A;  4F7U B;  4ZTJ A;  2X3X D;  1VQ6 Q;  2YDL A;  2EGA A;  2V1Q A;  4JDS A;  3QUI A;  3JB9 J;  3AHU A;  1WQW A;  3SWN A;  1VQK A;  1KQS P;  3RIR A;  2PUO B;  2RB6 A;  2JMA A;  1V76 A;  2KY9 A;  5KCH A;  2AKK A;  2XID A;  4RG2 A;  3ZL7 C;  4OB0 B;  2L3P A;  3A8H B;  4PJO G;  1Q82 R;  3HFN A;  1QKW A;  4D8D A;  3I56 Q;  2KT1 A;  1PNJ A;  3H9N A;  3CME Q;  1YIJ T;  2DEU A;  3OBW A;  2JNG A;  3CCU T;  3MP6 A;  5KCO A;  1K9M U;  1WA7 A;  1ZUU A;  3T9N A;  1Q81 C;  3PE0 A;  1TG0 A;  1I81 A;  3EH1 A;  3VS7 A;  1Y0M A;  1K73 R;  1T0J A;  5A0G A;  4J6X A;  2ECZ A;  4FT2 A;  4C8Q G;  1OU9 A;  1KC8 U;  2CSQ A;  2K79 A;  1NYF A;  1RAI B;  2J6O A;  3M57 A;  3JRZ A;  3RKY A;  4AG1 C;  1HXD A;  4OMF B;  2KRM A;  3TVT A;  4OB2 B;  2DVJ A;  4KBM B;  3VYH B;  4IUT A;  5FWB A;  3CCQ Q;  2MWP A;  2R57 A;  4QVC A;  2F5K A;  1RUW A;  2ROT A;  3OYA A;  3JB9 D;  2LVM A;  2RH2 A;  4XTX A;  1Q7Y C;  3WVE B;  2M51 A;  2YLC A;  1SSH A;  3CEY A;  4C0Z A;  1QVF A;  1QVF S;  3OMC A;  2CS7 A;  1VIF A;  2G6F X;  1M2V B;  5GAN 8;  1KK7 A;  2M02 A;  3OYC A;  1U5S A;  1VUB A;  3HFO A;  1VQ8 A;  2K6D A;  2LQN A;  1YHQ T;  2OTL T;  2QTX A;  1AEY A;  1BKB A;  2H8H A;  2DD5 A;  5LJ3 j;  1WYX A;  2KAF A;  2EW3 A;  1YJ9 A;  4PJO F;  2LP5 A;  4FSX A;  4DBR A;  2IVW A;  1VQ6 T;  2E6N A;  3RR6 A;  1OOT A;  1BCO A;  3CC4 T;  4J6Y A;  4EDU A;  4HCB A;  2V1R A;  2DM1 A;  1RLP C;  1D1B A;  4ORZ A;  2DO3 A;  2QYZ A;  4OGE A;  1VQL Q;  3CD6 A;  2FVU A;  3EFO B;  4JUV A;  5CR2 A;  3HPW A;  1VQ7 A;  3CCS Q;  2V8K A;  1IRX A;  4WF2 A;  4DOV A;  4C5H A;  3I56 T;  2XG8 D;  3C95 A;  5D6Y A;  2K2M A;  2DLP A;  2CP5 A;  3CME T;  3E9F A;  4QQ6 A;  4C8Q F;  4FM4 B;  4C5E A;  2DD4 A;  2JJ9 A;  1IHW A; 
#chains in the Genus database with same CATH homology
 2C0O A;  1T3S A;  4HVV A;  1ZUK A;  4CC2 A;  1AZE A;  5HCK A;  4Z89 A;  4OMN A;  4JJD A;  1HD3 A;  3I9Q A;  2GNC A;  4HVW A;  1PRL C;  2A08 A;  2EVR A;  3NGP A;  1E6H A;  1K0S A;  1K9A A;  1RLQ C;  2X3W D;  4AFS C;  1GCQ A;  1RI9 A;  5L23 A;  4HVU A;  3QWY A;  1N5Z A;  2RNA A;  2JM9 A;  2EKH A;  1JQQ A;  2GQI A;  3I35 A;  2K7A A;  1B3Q A;  1G2B A;  4R0K A;  3UF4 A;  3FJ5 A;  2K3B A;  2DF6 A;  2C0I A;  3VRZ A;  1AD5 A;  2O31 A;  1Y57 A;  2RQW A;  1UG1 A;  3TSW A;  2CRE A;  1K4U S;  3VS0 A;  4AFZ C;  4RTV A;  2RQV A;  2YSQ A;  4OMQ A;  2MCN A;  3EHR A;  3PVL A;  2ABL A;  2DL3 A;  1GFC A;  3SHW A;  1W70 A;  4F16 A;  2LQW A;  3H0I A;  1AWX A;  4A63 B;  2KYM A;  2F2X A;  4LUE A;  1H3H A;  5IHI A;  1NM7 A;  2DIL A;  4IIO A;  1W6X A;  2BZY A;  2DL7 A;  2DYB A;  2KEA A;  1GFD A;  2DL4 A;  3VS5 A;  4GLM A;  2O9S A;  4OMP A;  1UEC A;  2LZ6 B;  3EG2 A;  2RQU A;  1GBQ A;  1WLP B;  3I5R A;  2LCS A;  2J7I A;  3U23 A;  1MV3 A;  1X69 A;  2J06 A;  2EBP A;  5IH2 A;  1ZSG A;  2FPF A;  1JO8 A;  1OV3 A;  2CH4 A;  2D8H A;  2D8J A;  2PZ1 A;  2FPE A;  3LH5 A;  2A37 A;  2W0Z A;  1SPK A;  3RNJ A;  1KJW A;  1GL5 A;  1SHG A;  2I0N A;  3GBQ A;  2LX7 A;  2P4R A;  5IXF A;  1M3B A;  1PKS A;  2JW4 A;  2K9G A;  1XOV A;  1CKB A;  1JXO A;  1PHT A;  2EGC A;  1ZX6 A;  4F14 A;  2DL8 A;  1ABO A;  2L0A A;  2OAW A;  2ENM A;  1QWF A;  2BTT A;  4LE9 A;  3IQL A;  5I22 A;  3C0C A;  1T0H A;  4WCI A;  2ED0 A;  1X2K A;  4RTU A;  3M0P A;  2DRK A;  1OEB A;  1Z9Q A;  1TUD A;  4X1V A;  2XMF A;  2F2W A;  1VYV A;  2KRN A;  2DRM A;  1SEM A;  4CC4 B;  1WXB A;  4ESR A;  2DNU A;  4J9B A;  2VVK A;  2MOX A;  4AG2 C;  1A0N B;  2L3S A;  2FG0 A;  2HBW A;  1B07 A;  5EC7 A;  1MV0 B;  4DEY A;  2JXB A;  4F17 A;  1UHF A;  1UDL A;  2YUO A;  4Z8A A;  4GBQ A;  1GBR A;  3O5Z A;  1M3A A;  1WI7 A;  4RTY A;  2C0T A;  4RTT A;  2D1X A;  4LNP A;  1EFN A;  2LJ0 A;  1GCP A;  1V1C A;  2YUQ A;  5FWC A;  1E6G A;  2CDT A;  4Y92 A;  1CKA A;  2EYX A;  1HSQ A;  1SHF A;  1ZLM A;  1ARK A;  1VA7 A;  4HXJ A;  1TUC A;  1AOJ A;  2NUZ A;  4RUG A;  3H41 A;  2RQT A;  1YWP A;  3EG1 A;  2KR3 A;  3TSZ A;  1X6B A;  1X27 A;  1JU5 C;  2YT6 A;  3M0U A;  2RPN A;  4EIK A;  2EQI A;  2GTJ A;  3NMZ C;  4OML A;  1I0C A;  2ROL A;  4IIM A;  1YWO A;  1KSW A;  2A36 A;  3QWX X;  4JJC A;  2KBT A;  2AZS A;  2SEM A;  1QKX A;  3UA7 A;  2GBQ A;  1UJ0 A;  4LN2 A;  2JS0 A;  1ZUY A;  2KT8 A;  2LJ1 A;  4J9H A;  1PKT A;  3EG0 A;  2DE0 X;  2RMO A;  1QCF A;  2YUP A;  3VRY A;  2BZX A;  2JS2 A;  3ULR B;  1MUZ A;  1X2Q A;  4J9F A;  1I1J A;  2DL5 A;  2EPD A;  3THK A;  2DBM A;  1NG2 A;  1AWW A;  1SRL A;  1YNZ A;  1X43 A;  1YP5 A;  3I5S A;  1SRM A;  3EG3 A;  2FPD A;  1GRI A;  2AKL A;  1G83 A;  5IHK A;  1JXM A;  2W10 A;  4J9G A;  2FRY A;  3REA B;  1I07 A;  2CUD A;  3A98 A;  2KXC A;  1WIE A;  1BU1 A;  2CUB A;  2DA9 A;  1FMK A;  2AK5 A;  2DJQ A;  2O9V A;  4JZ4 A;  3NPF A;  1QLY A;  2JM8 A;  2KE9 A;  2KGT A;  5IHN A;  1S1N A;  2OI3 A;  3PVQ A;  4AFU C;  1UTI A;  4E6R A;  2J6K A;  1YCS B;  2GTO A;  4RTW A;  3JV3 A;  4J9I A;  3M0S A;  1VYU A;  4K11 A;  1U06 A;  2OJ2 A;  2RQR A;  2J05 A;  1OPK A;  3EHQ A;  3M0T A;  4RTZ A;  4J9D A;  1KFZ A;  3H0F A;  2LMJ A;  2HSP A;  2DMO A;  4OMM A;  1T3L A;  4KRT A;  1KIK A;  1LCK A;  1M3C A;  1UJY A;  3CQT A;  2MIO A;  4DEX A;  2KNB B;  1K1Z A;  2YUN A;  2J6F A;  1BK2 A;  4ZNX A;  2L2P A;  2NWM A;  2HCK A;  4RTX A;  3VS3 A;  3VS4 A;  1VYT A;  2FO0 A;  1H92 A;  4J9C A;  2X3X D;  2YDL A;  2JT4 A;  2EGA A;  2V1Q A;  4JZ3 A;  2EYY A;  1K0X A;  1WFW A;  5I11 A;  4Z88 A;  1BB9 A;  2DX1 A;  5IXB A;  2EGE A;  4JJB A;  2JMA A;  2KYB A;  2AKK A;  2VWF A;  4CC7 A;  2AZV A;  3ZL7 C;  2L3P A;  2O2O A;  5GJV B;  1OPL A;  2KRO A;  1WDX A;  2QDL A;  1AWO A;  1HJD A;  3KFV A;  1QKW A;  4OMO A;  4D8D A;  3REB B;  1X6G A;  2KT1 A;  2VKN A;  1PNJ A;  3VS2 A;  2KRS A;  4JPB W;  2EYZ A;  2PNI A;  2IIM A;  5ECA A;  4CC3 A;  1K76 A;  1WA7 A;  1ZUU A;  2PTK A;  3PE0 A;  1TG0 A;  4HCK A;  2A28 A;  1AZG B;  4D8K A;  1UHC A;  3VS7 A;  1Y0M A;  1T0J A;  2SRC A;  2O88 A;  2EYW A;  1AWJ A;  3RBB B;  2ECZ A;  1J3T A;  5FW9 A;  2CSQ A;  2K79 A;  2ED1 A;  1NYF A;  2J6O A;  2D0N A;  4AG1 C;  2KRM A;  1PRM C;  1NEG A;  1E7O A;  3EGU A;  3TVT A;  2DVJ A;  1UGV A;  3UA6 A;  3UAT A;  4AFQ C;  1YN8 A;  5FWB A;  4FSS A;  2L3Q A;  1NEB A;  1UE9 A;  2ESW A;  1QWE A;  3VS1 A;  1RUW A;  2ROT A;  1AVZ C;  1WXU A;  1JEG A;  2M51 A;  1SSH A;  4QT7 A;  1NYG A;  4M4Z A;  2CT3 A;  4LUD A;  1UFF A;  2FRW A;  2G6F X;  1UUE A;  3SEM A;  1GCQ C;  2DBK A;  1U5S A;  2KXD A;  1BBZ A;  2K6D A;  2LQN A;  2M0Y A;  1AEY A;  2H8H A;  4J9E A;  1WYX A;  3M0Q A;  2HDA A;  2JMC A;  2EW3 A;  1FYN A;  1H8K A;  2LP5 A;  2JTE A;  1WX6 A;  1OOT A;  2GGR A;  2F2V A;  2V1R A;  2DM1 A;  1ABQ A;  1RLP C;  2HEQ A;  3NHN A;  2E5K A;  4ORZ A;  1M8M A;  2CT4 A;  1CSK A;  2RN8 A;  2CH4 W;  2B86 A;  1U3O A;  1PWT A;  1Z9Z A;  2RF0 A;  1NLO C;  5GJW B;  2CSI A;  3H0H A;  1M30 A;  1W1F A;  2LJ3 A;  2K2M A;  2LNH B;  3M0R A;  2DLP A;  1ZBJ A;  2BZ8 A;  2FEI A;  1WXT A;  1NLP C;  3VS6 A;  1IO6 A;  3R6N A;  1M27 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...