2JW4A

Nmr solution structure of the n-terminal sh3 domain of human nckalpha
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
GSTMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARAAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK1
publication title Interaction between the N-terminal SH3 domain of Nckalpha and CD3epsilon-derived peptides: Non-canonical and canonical recognition motifs
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jw4A00
3I35A 1QCFA 2L0AA 2CUBA 2YUQA 1UJ0A 2CREA 2LQNA 4Y92A 4CC3A 2DRKA 4J9BA 2ECZA 2FPDA 2BZYA 1H92A 3VRZA 4OMOA 4F14A 2HBWA 2RQTA 3UF4A 1BBZA 1IO6A 1I1JA 5GJVB 2DMOA 2W0ZA 1JO8A 1MV0B 5L23A 4RTUA 5GJWB 1K4US 3M0SA 2F2WA 1JEGA 1E6HA 1GCPA 2K6DA 1JU5C 3H0HA 1BB9A 1SSHA 2KE9A 2JMAA 3FJ5A 3VS7A 2FEIA 2J06A 1OPLA 2HDAA 1WI7A 1NG2A 2VWFA 1YN8A 1AWJA 5FWBA 3M0RA 4J9GA 1QKXA 3O5ZA 2M0YA 1ZLMA 4AFZC 1U3OA 3EG3A 4F17A 2KBTA 1NYFA 2O9SA 2KRNA 1RLPC 3QWYA 4J9FA 4CC7A 1PNJA 3KFVA 2GGRA 2DM1A 1ZUUA 2F2XA 1JQQA 2EBPA 1WYXA 1X6BA 1VYVA 1B07A 2GQIA 1M3BA 3A98A 3IQLA 3RBBB 2DVJA 2LCSA 2K3BA 4JZ3A 1J3TA 1SHGA 2DL3A 1UGVA 2MOXA 1M3AA 3EG0A 1M3CA 2EYXA 1GFCA 2X3WD 2NWMA 1UUEA 1WXTA 2DYBA 1U06A 2HCKA 3NHNA 2BZXA 1Y0MA 2JTEA 3TSWA 2JT4A 1CSKA 2EVRA 4J9EA 1Z9QA 5I22A 2JMCA 2DILA 1UTIA 1X6GA 2JW4A 2ROTA 1I07A 2EKHA 1T0JA 4AG1C 1VYTA 1M30A 3VS0A 2C0TA 2EQIA 1AEYA 3U23A 3PVLA 4OMLA 1U5SA 2A36A 2GBQA 2LP5A 2DBKA 2MCNA 2DBMA 2DJQA 2YUOA 4Z88A 2K9GA 2V1RA 3H41A 2KT8A 4LE9A 3I5RA 2RMOA 4JPBW 1K1ZA 2CSIA 2CT4A 3VS6A 4HVVA 1YP5A 1K0XA 4EIKA 1T3LA 2EYYA 4R0KA 2KYMA 2PTKA 5IXFA 2GNCA 3JV3A 4KRTA 4RUGA 2CUDA 3ULRB 2O31A 1UJYA 2OJ2A 1SEMA 1GCQC 3VRYA 3SHWA 4FSSA 1NEGA 1FMKA 2LMJA 4JJBA 2M51A 2A28A 2G6FX 3M0QA 4CC4B 1HD3A 2XMFA 1LCKA 2KRSA 3ZL7C 3UATA 1B3QA 1G83A 1YWOA 2GTJA 2FRWA 2DA9A 1X69A 2EGCA 2KGTA 2RPNA 2IIMA 1QWFA 1TG0A 1H3HA 5IHIA 4GBQA 4OMPA 4RTZA 2LJ3A 4ORZA 2EGEA 1NLPC 1GL5A 2BTTA 3I5SA 3TVTA 4RTYA 1ARKA 4D8KA 2W10A 1HJDA 2RQWA 1E6GA 2YUNA 1YCSB 1UHFA 5IHKA 2P4RA 4RTVA 2H8HA 2D8JA 2PZ1A 4J9DA 1OPKA 3UA7A 2DL7A 1QLYA 4AG2C 2FPFA 4RTWA 4A63B 1I0CA 2DNUA 4DEYA 4J9CA 2LJ1A 2RN8A 4CC2A 2VKNA 2X3XD 1SHFA 2DL4A 2JXBA 2CH4A 3NGPA 3H0FA 1WFWA 4RTXA 1W70A 2AZSA 3UA6A 1AWWA 3I9QA 3EHQA 3VS5A 1AWOA 1V1CA 4HXJA 1N5ZA 3SEMA 1T0HA 1VA7A 2OAWA 1FYNA 2PNIA 2KROA 2RQUA 1PRLC 3VS3A 2L3PA 2J7IA 2AZVA 1X2QA 2O9VA 5EC7A 3LH5A 1KSWA 2RQVA 1GCQA 4WCIA 1G2BA 2YSQA 4OMMA 2QDLA 2E5KA 4HVWA 3CQTA 3GBQA 5FWCA 3H0IA 5IXBA 1UE9A 2DL5A 2O88A 1AZEA 2KRMA 1K9AA 1W1FA 3NPFA 1SRMA 2KR3A 4AFUC 1ABOA 4HCKA 1XOVA 1ZBJA 1UECA 1QWEA 2AK5A 4ZNXA 4AFSC 2RNAA 2D1XA 2FPEA 2J6FA 2EPDA 5FW9A 1WDXA 2F2VA 1AOJA 2L3QA 2KEAA 2K2MA 2AKLA 4RTTA 2CH4W 2ROLA 1M8MA 3VS1A 2EYZA 4JJDA 2NUZA 2ED0A 2KNBB 2LJ0A 1K76A 1PKTA 2KXDA 4X1VA 4GLMA 2JS0A 1OV3A 2SEMA 1OOTA 1ZUYA 1NM7A 1X27A 1S1NA 1W6XA 1SPKA 1ZX6A 3NMZC 2LX7A 1ZUKA 4OMNA 1TUCA 4QT7A 1UHCA 2DF6A 3C0CA 2YDLA 2K7AA 3REBB 5I11A 4OMQA 1NEBA 2D0NA 2RF0A 3REAB 2CSQA 5IH2A 2ED1A 1ZSGA 3VS2A 2DX1A 4IIMA 2A08A 2L2PA 2CT3A 1WX6A 4Z8AA 2LZ6B 1H8KA 1UDLA 2FO0A 1GBRA 4LUEA 1GRIA 1JXOA 3TSZA 4E6RA 3PVQA 1YNZA 4LNPA 3R6NA 2LNHB 3VS4A 1AZGB 1PRMC 1TUDA 1JXMA 2KT1A 4LN2A 4ESRA 1BU1A 1Z9ZA 1E7OA 1VYUA 1PWTA 2C0IA 2GTOA 1YWPA 4D8DA 4HVUA 2SRCA 1KFZA 1KJWA 3M0TA 1Y57A 1WXBA 1AVZC 2J6OA 4M4ZA 2CDTA 3M0PA 2C0OA 1WIEA 1PHTA 1X43A 2OI3A 1M27C 2O2OA 2FRYA 5HCKA 1WA7A 3THKA 1A0NB 1MV3A 4F16A 1RI9A 2FG0A 2KYBA 1GFDA 2ENMA 2A37A 2K79A 3M0UA 2ESWA 1WXUA 2JS2A 2MIOA 1NLOC 1ABQA 1UG1A 1RLQC 4J9HA 1GBQA 1AD5A 4Z89A 2AKKA 2YUPA 3EG1A 1EFNA 5ECAA 1CKAA 2BZ8A 2EGAA 3EHRA 1HSQA 4IIOA 1OEBA 2I0NA 1RUWA 2JM9A 3PE0A 3RNJA 2V1QA 2ABLA 4JJCA 4AFQC 1MUZA 2DL8A 2B86A 2DE0X 2J6KA 2JM8A 1KIKA 2DRMA 2D8HA 1NYGA 2YT6A 1CKBA 2L3SA 1AWXA 2DLPA 3EG2A 1WLPB 2LQWA 1BK2A 2HSPA 1UFFA 4K11A 1K0SA 2KXCA 2VVKA 4JZ4A 5IHNA 4DEXA 1PKSA 3EGUA 1T3SA 4LUDA 2RQRA 2J05A 2EYWA 2EW3A 3QWXX 1X2KA 2HEQA 1QKWA 4J9IA 1SRLA
chains in the Genus database with same CATH superfamily
3I35A 2CREA 1LVKA 1V29B 3ME9A 2E6NA 4J9BA 1BCMA 1M2VA 3PNWC 2MI6A 2HBWA 1YBYA 1JO8A 1MV0B 2PQWA 2QXFA 4RTUA 1YITQ 4BY6C 4M7AC 3CMET 4GY5A 1F1BB 2K6DA 1JU5C 4PNOA 4F7UG 4PJOB 2QQ9A 2JMAA 3CC2A 3M58A 4FYYB 4XK8E 3HFOA 2NUTA 1TUGB 4DA4A 2I2LA 3M0RA 4J9GA 2E5QA 3OW2A 2DZCA 4F17A 4PJMA 4WF2A 2A3LA 2KRNA 3M53A 1PNJA 2QQRA 5I2MA 1D0YA 3I56A 4B9WA 2GFAA 3FEOA 1ZUUA 2F2XA 4A54A 1WYXA 2QI2A 4XU2A 1Q86R 1M3BA 3A98A 2XICA 1C0MA 2DVJA 4PJOD 3BFMA 1IZ6A 1LPLA 1IGUA 3I55Q 2DL3A 1M3CA 1GFCA 1XTDA 1QVFP 4Y28E 4DQ2A 1M5Q1 3CCSA 4BD3A 2FVUA 5I22A 1OZ3A 2JMCA 3CPWA 2DILA 1UTIA 2MMPA 2AHJB 1KC8R 3AHUA 5AYFA 4OF1A 3FLGA 2EKHA 3CD6T 3MP6A 1I81A 2C0TA 5CKEA 3V7RA 4PFZA 2JZ2A 2EJ9A 4C5GA 2GBQA 2A36A 2OTLQ 3PIPA 4PLLA 2QG9B 2DJQA 2HKQB 2ZPIB 4Z88A 2K9GA 2KT8A 1WNLA 3CCVT 5KCOA 1NJIR 4JPBW 1OU9A 5GAN4 3M9QA 1K0XA 2DEUA 3CMAQ 4P5NA 1N8RU 2O31A 1U1SA 4FYVB 3CCMT 4L5GA 3L2ZA 1M2VB 2LMJA 2G6FX 4EMGA 1VQMQ 2KRSA 1NJIC 4BE2A 3EGDA 4O6JA 2DA9A 2RK1A 2E70A 2M0OA 1BI0A 1VQ6Q 1H3HA 5HKCA 4GBQA 2EKOA 4V2SA 2QEXT 2EGEA 1VQLA 2AT1B 4D8KA 2W10A 1HJDA 1UHFA 1RL2A 3UPUA 2H8HA 2MAMA 3JCMg 1W2BS 4AG2C 4A63B 1ACMB 3CBOA 3MPUB 2ZZDA 3GIBA 2X4XA 3PT9A 3RIRA 2X3XD 4X34A 3NGPA 3X20B 1VQ4A 1VIEA 3I9QA 4J7FA 3CC2Q 3NFCA 2MYSA 2ZPBB 1N5ZA 4BE0A 2QYZA 1KQ2A 3LGLA 1KQSP 1VA7A 2QA4Q 1TU0B 2RQUA 1D0ZA 2WSEE 1VQPA 3SFMA 4X9DA 2VUBA 3I56Q 3JCMf 4PFPA 2AZVA 3EH1A 5HK0A 2O9VA 1MMAA 5C0MA 5DM7R 1GCQA 4WCIA 4OMMA 3OMGA 4HVWA 4A53A 1XNIA 3GBQA 3MEUA 3H0IA 2O4XB 2RH2A 3QBYA 3C94A 4ZN3A 3S3MA 4QQ6A 4IURA 2RJDA 1YHQT 2KRMA 2FYKA 1VQ5A 2CP5A 1K9AA 4LDVA 4AFUC 4LD9K 1ABOA 5HY6A 5GAOr 2BIVA 3CCSQ 1UECA 4M7DC 1H641 3MEVA 1YCYA 4IUTA 2RNAA 2D1XA 2X9HA 4N4GA 5A0GA 2RK2A 5FW9A 1WDXA 4RMOA 2D0QB 1I5LA 1NPRA 4OGCA 2K2MA 2E4HA 3MP1A 3VS1A 1JBMA 4JJDA 2LJ0A 3JCMJ 3C4SA 2QAZA 4X1VA 1OOTA 1X27A 5DLOA 5KYWB 2XI9A 2VGNA 1W6XA 5KCHA 1JJ2A 4WTOB 5J39A 4M78C 1XQHA 2WSFE 1WJQA 1TUCA 3EFOA 4E47A 3OYNA 2K7AA 4ATOA 1BIBA 4OMQA 3EFSA 1M2OA 2CSQA 4M77B 2LDMA 2MWOA 3OYMA 3TQ7P 2XU8A 3VS2A 3JCMX 2DX1A 1K9MR 2MF2A 3S3NA 2DD4A 1VQKA 3G4SA 5CAIA 1WHJA 1ZSZB 1UDLA 1VQ7A 4M75C 3SWNA 3QPHA 2LNHB 3MHXA 2YLCA 3VS4A 5GANd 1Q81R 3P8HA 4A4EA 4PJNA 2CZ0B 2KT1A 1YI2T 2CZ7B 3ER0A 1W4SA 4ELYC 3NTIA 4PJOF 4NS5A 2LNVA 1SKUB 4PL6A 5GMKm 5GAN7 1KQ1A 4M77D 1Y71A 3QYHB 2J6OA 1M90U 2CDTA 4KT0E 3G6EA 1QVGS 3LW5E 2JVVA 5KYUA 3WXMB 1X43A 1M27C 4IUVA 2O2OA 4M7AE 1WQWA 2FHDA 2FRYA 4HT9A 3JCMW 2DIGA 1Q81C 1VQ8A 4DBHA 4E7ZA 1KK7A 4M77G 2JS2A 4J8OA 2ZGWA 4B9XA 4J9HA 4Z89A 2AKKA 2X35A 1FMVA 5DLQE 5ECAA 2KSSA 1CKAA 2BZ8A 1HSQA 4XTXA 3TREA 2V1QA 4AFQC 2FL7A 2V8JA 2HQXA 4Y91A 2JM8A 1KIKA 2R57A 1AWXA 3J81E 5CK9A 1OYXA 5FRNA 2DLPA 4BUGA 1IHWA 1AT1B 2YWWA 2KXCA 4JZ4A 3ASKA 3OBYA 5IHNA 2FZGB 3EGUA 3OS0A 5A0DA 2E3HA 3CCRA 3QSUA 4E7LA 3QWXX 5AT1B 3DLMA 3QG1A 1VQ5Q 4FU6A 2CZ1B 4J9IA 2DAQA 3V8JA 3J80E 2L0AA 2CUBA 4Y92A 3PIOA 3EFOB 2F69A 3BW1A 4BI8B 4MMKA 1H92A 2DXUA 3M5AA 1ZA2B 4XTWA 3UF4A 5GMKl 5GJVB 2X51A 5KE3A 5L23A 1MNDA 3G7ZA 3H9NA 4C5IA 3A8HB 3CCUA 3HPWA 3JCMQ 2HL3A 4PJOA 2E1HA 3VV0A 4JRIA 3JSCA 2EJGA 5GANg 4JRQA 3VS7A 2FEIA 1OPLA 2HDAA 2QASA 3SWNB 3CXCA 4EPCA 3I55A 1YN8A 2GQVA 3Q1JA 5KYYA 3O5ZA 2M0YA 4M7AG 4C5EA 3EG3A 2KBTA 3QO3A 3QWYA 1YJNQ 3JAME 1Q82R 2HQHA 2VASA 2PVOB 1VQKQ 3G4SQ 2GGRA 2DM1A 3OYEA 1WHMA 2FZCB 4OB2B 5KYUB 1X6BA 2XK0A 1Q7YU 1VQ7Q 2DTOA 4E7SA 4E7HA 3IQLA 1KD1R 3MKDA 2OTLA 5LJ5d 3BDLA 5GANf 2LCSA 1J3TA 4QQGA 2ZCFB 1M3AA 3H8ZA 3EG0A 2M1HA 5GANh 2EYXA 1JJ2S 5GANe 1VQLT 1EIFA 1WXTA 3NHNA 4BI3A 2BZXA 1NZ9A 1M1KU 2QQBA 4J9EA 1WGSA 3O8VA 4PFOA 1WJSA 4DOVA 3CMAA 3RESA 3G6EQ 1X6GA 2JTMA 4E7IA 3A8LB 1T0JA 1VYTA 1HK9A 3OYCA 1KD1C 2DK3A 2EQIA 4F7UB 1AEYA 3U23A 4JJNK 1QW1A 1VQ8Q 1U5SA 4ZTJA 2LP5A 3OYAA 1EX4A 3M4YA 4C8QB 2DEQA 1VUBA 3AT1B 3S3OA 4ZGDB 4R55A 4J7IA 4ZGEB 1VQ4T 3OYYA 4E2FB 2CSIA 2CT4A 3UDCA 3VS6A 1OX8A 2CYZB 3HTRA 3MP8A 3CC4A 4KGXB 3RKWA 1T3LA 2P84A 1RAHB 2PTKA 4R0KA 1VQ6A 4KUDK 2NYSA 4OP0A 5HK3A 2X4YA 4KRTA 3G71T 2CUDA 4J83A 3ULRB 3QDFA 2OJ2A 1SEMA 1VQPT 1GCQC 3VRYA 3SHWA 4XU1A 3P8DA 5C6SA 1VIFA 4QW2A 2A28A 3OYFA 1HD3A 1LCKA 2CGHA 3JB9I 1B3QA 1G83A 2FRWA 5CKHA 3E2UA 4C8QD 2KGTA 2DTHA 2RPNA 5GANj 4FT4A 5GAN8 2VC8A 3CCRQ 4KBMB 2GF7A 1QWFA 1K9MC 1TG0A 4JS4A 4OMPA 3QXEB 4M7DE 3L42A 2HZYA 5GAOn 1NLPC 2RI5A 4N4IA 1OI1A 3LWIA 2LT1A 5FU7B 4J5YA 4C8QG 3F70A 1YCSB 3CCJA 5KYYB 1PC0A 2QA4A 2IPOB 2PZ1A 4TVRA 1G3SA 3UT1A 1Y07A 2DL7A 1QLYA 1U8RA 1I0CA 1C6VX 3JB9H 2Z0WA 8AT1B 4J9CA 4M77F 2LJ1A 2RN8A 4CC2A 5A0LA 2KQWA 2CH4A 3CCUQ 3L1AA 4M78E 1VQ9Q 2RHXA 5LJ5g 2QQAA 3EAEA 3OYLA 3QIIA 5IT9E 1VOMA 1MMNA 4PKCC 3VS5A 3NTKA 3FRNA 3SEMA 2VGMA 1T0HA 1BCOA 3OSVA 2OAWA 1FYNA 4ZN1A 1G5VA 4C0ZA 2QK0A 1N8RR 2Y4XA 3VS3A 4L6V5 2BUDA 2J7IA 1R0BG 2ZPGB 1QQJA 2RQVA 1Q86C 1PSFA 1G2BA 4M75E 2E5KA 4O5VA 8ATCB 1VQ7T 2WACA 3CQTA 5FWCA 2FB7A 2O4XA 5L8RE 5LJ5f 2O88A 4ME7A 3M56A 2DIQA 5LJ5h 1AZEA 5LJ5e 2F1LA 4LXCA 5D6YA 2KR3A 2QTXA 1KC8C 1X75C 1ZBJA 4AFSC 3CXCS 2V8IA 4EMHA 3LX7A 1RAIB 2FPEA 1AOJA 2LRQA 3G6ET 2K5LA 4C92C 1G3YA 4JDSA 2CH4W 3TU4K 3GPLA 1QCNA 3GOXA 5GAN6 4MMLA 4NOYA 3RDVA 1WHLA 2JS0A 2SEMA 1RABB 1ZUYA 2ATCB 2HQEA 5KYWA 3V8LA 4M7DG 2RHYA 1SPKA 3VKIA 3KUFA 2COYA 4GLKA 2LCLA 3NMZC 4PJLA 4OMNA 3FIFA 1OX9A 4QT7A 2DD5A 3CC4Q 1UHCA 2YXYA 1B34A 3RUXA 1TWBA 2XHCA 3EGXB 3REAB 2VYTA 4M77A 2ED1A 2QTVA 2XG8D 2HAXA 2A08A 1BI3A 2CT3A 4A4GA 1ZSZA 4Z8AA 1X01A 2X4JA 2RHIA 2FO0A 1GBRA 3GNFB 4LUEA 3E1SA 1IXDA 1JXOA 3E9FA 4MDWA 4E6RA 5LJ5j 1YITT 2K5IA 4F04B 1AZGB 1TXQA 4ESRA 4LN2A 3BDUA 1Z9ZA 5D6WA 4KULA 3CCQQ 1H3ZA 4FM4B 3X24B 3SDZA 4C5HA 2GTOA 3PMTA 4RKUE 4EDUA 2DETA 3S6WA 2MK5A 3CCJQ 1FMWA 2EIFA 2NUPB 2JJ9A 1N27A 2OI3A 1WIEA 1PHTA 2ZPHB 9ATCB 1WZOA 5HCKA 4A4KA 1WJRA 4PJOC 1WA7A 1MV3A 1RI9A 1YJWQ 2PUOB 2A37A 1K8AU 2ESWA 1WXUA 2QGGA 1QCOA 3CCUT 2MIOA 1NLOC 2K3YA 5KYXB 4J6YA 1UG1A 2OX7A 3D7SB 2RHUA 1AD5A 4BDYA 3CC7A 1W2BP 1BI1A 4HA8A 3EG1A 1EFNA 3A8MB 4CI0C 2RJCA 3I55T 3RKXA 2I0NA 1RUWA 1IGQA 2JM9A 3PE0A 4JJCA 2DL8A 2DE0X 2DVEA 4LDUA 1WQ7A 3EFRA 2J6KA 2M9UA 3L2UA 3SD4A 2D8HA 1NYGA 2DXTA 2YT6A 2L3SA 1K73R 3UWNA 3VYGA 3OW2S 1BK2A 4K11A 2EQUA 3MEWA 3V7SA 2OTLT 4F7UF 1NE8A 2RQRA 2J05A 2EYWA 1IB8A 1X2KA 1QKWA 1GXIE 1VQNQ 1D0XA 4C8QF 2HKNA 5CKBA 2H3EB 2YUQA 1UEBA 2XDBA 1B7TA 2DRKA 5FU6B 1VQOA 1B34B 3CMAT 3QYGB 2BZYA 3VRZA 4OMOA 1N9RA 4F14A 2JOYA 1BBZA 1R77A 5M9OA 4RG8A 1K73U 1YJNA 2DMOA 1M90R 2LQ8A 5GAN5 3CPWS 3M0SA 2F2WA 2WSCE 1VQMT 1E6HA 2DYIA 2IG0A 5KE2A 1VQ6T 3VUZA 2HSEB 2VWFA 1D09B 1M90C 1U3OA 2O9SA 4J9FA 4CC7A 4BI4A 4HCCA 1ZQ1A 5LJ3h 3BY7A 5LJ3e 1N6AA 1IREB 3HRSA 1JQQA 5FROA 2ZAEA 1B07A 2GQIA 3QJYA 2RB6A 3LH0A 3CCVA 4C0DB 1TH7A 4JRKA 4FCYA 2K3BA 2EYQA 2CP7A 2P4TA 4OB0B 4QQDA 2VB6A 1LOJA 2X3WD 2NWMA 1MMDA 1UUEA 3CC2T 1U06A 2JTEA 3TSWA 2JT4A 1CSKA 2R5MA 3NTHA 3CCMA 3KXTA 1Z9QA 5LL6S 1MGQA 2QA4T 2JW4A 1I07A 4AG1C 3VS0A 1RI0A 4F7UA 1QVFA 3I56T 3H6ZA 4CRIA 4M7DF 3DKMA 2MCNA 4C8QA 4XTYA 4N4HA 4QVDA 2V1RA 2AIRB 3M59A 3H41A 3N5BB 1QVGP 4LE9A 4DBQA 2COWA 2XKOC 4IUUA 2QEXA 3CC7Q 5GAOq 4BY6B 4M7AB 2V26A 4HVVA 1YP5A 4EIKA 5I2SA 3RMQA 2EYYA 5IXFA 2QQSA 1AHJB 3JV3A 2DFUA 4RUGA 5LJ3j 3CCST 3A1PA 1I5OB 1NEGA 3CMEQ 3M0QA 4E7JA 4CC4B 5CKDA 3ZL7C 5GAOm 1MMGA 4DBFA 3KBGA 5CVIA 4EMKA 1X69A 4II1A 2DPPB 1ZBXA 1Q7YR 4Z02A 2HD0A 2LQKA 2RI3A 4M7AD 5IHIA 3EG9B 1VQ9A 4RTZA 2LJ3A 2KY9A 4FYXB 1FWZA 4FT2A 1PCXA 1ARKA 1I8FA 4C92E 1VQOQ 2RQWA 2YUNA 1M1KR 3FB9A 2RM4A 2P4RA 4RTVA 4MDXA 4J9DA 1OPKA 1U1TA 4OGEA 4ZGJB 3UA7A 2CS7A 1Q7YC 2D9TA 2DNUA 4DEYA 3HRUA 5EG2A 3JB9G 5GAMj 1SHFA 2DL4A 3HHTB 2MWPA 3H0FA 3EH2A 4RTXA 1W70A 2DERA 3ZFJA 1EZZB 3MO8A 2AZSA 3M54A 3UA6A 1YHQA 1M8VA 1AWWA 2COZA 1UB4A 3WVEB 3EHQA 4JUVA 4M77C 4XTUA 1V1CA 2CP6A 2M02A 5J26A 3BE3A 4PJJA 4L59A 2E12A 1D3BB 1UGPB 4QVCA 3OSSC 2PNIA 1WPYA 1Q82C 2H3JA 3OA6A 4BB7A 3CD6Q 4M7DA 4OB1B 4ZTFA 2EQMA 1ZSZC 2L3PA 4HCZA 1WHGA 3J7AF 3LH5A 1BIAA 3CCEA 1KQSA 2QDLA 2PVGB 1KG1A 3CCVQ 2YHTA 5GAOl 5IXBA 1UE9A 3FC3A 2DL5A 1RAGB 3TEEA 4ANJA 3PGGA 2RD1A 2GCXA 1W1FA 3E19A 2OTJA 4KUIA 2LCCA 1XOVA 2EAYA 2OAUA 1QWEA 3QHSA 2CP3A 3LLRA 1RAAB 3CCMQ 2GFUA 1YJ9A 5GAN3 3QZ9B 2EPDA 1SG5A 2KEAA 4PJOE 2G3RA 1QP3A 2AKLA 2EQKA 1JJ2P 1M8MA 2C06A 2NUZA 2ED0A 2KNBB 1PKTA 2KXDA 1N9SA 4GLMA 1OV3A 4BE1A 1OZ2A 1S1NA 4D6WA 1ZX6A 1QVPA 4J6XA 3GNGA 3MJXA 2QEXQ 3OY9A 1ZUKA 2HNIA 4C92G 2DTIA 4EMKB 1FXXA 3LGFA 3L2VA 2JNGA 2DF6A 3C0CA 1RAEB 4RCBA 2YDLA 1VQ5T 3HSBA 3A8GB 1NEBA 2RF0A 3EGXA 3HP9A 3CCQA 5IH2A 2P0KA 4HCBA 2ZPFB 1Y96B 2F5KA 3OS2A 3VYHB 2FZKB 3X28B 4UC4A 3MCAB 2L2PA 2LC4A 7AT1B 4NL2A 2LZ6B 2MPXC 1H8KA 2CZ6B 5CO7A 1QVFS 1QMCA 2R5AA 3PVQA 1YJWA 1YNZA 3R6NA 3OBWA 5KH6A 1K9MU 1IRXA 2VV5A 4DBRA 1TUDA 1PRMC 3CEYA 4LDYA 4DOWA 4RCCA 2ZPEB 3PTAA 1BU1A 3P8BB 1E7OA 3V7CA 2QDYB 2LT4A 2E10A 1YWPA 4LD6A 4HVUA 1VQOT 2DO3A 2SRCA 1KFZA 1KJWA 3M0TA 3JCMd 4MZTA 3M57A 1PD0A 1IHVA 1AVZC 2NUPA 5FRMA 2O01E 3L2WA 1OQKA 2C0OA 1YJNT 4M7DB 2E41A 4OMFB 3VJPA 3THKA 1A0NB 2KYBA 1VQKT 3G4ST 2K79A 1KHIA 3A8OB 3M0UA 2E6ZA 2RJFA 3SWNC 5KYXA 1ABQA 1RLQC 1YHQQ 1GBQA 1M1GA 4J6WA 1P92A 2Y90A 2EGAA 4IIOA 4PJOG 4OB3B 1N8RC 1VQNA 4M78B 1MUZA 1PG5B 2B86A 5IN1A 1NBEB 5GMKh 2XIDA 5GMKe 2DRMA 2PUKB 2JN0A 1CKBA 3GLXA 4M7DD 2F5TX 3OS5A 3T9NA 1Q86U 3CCEQ 1NPPA 1WLPB 1G3TA 5GAN2 1K0SA 2VVKA 1YIJA 3VUBA 4FIBA 1VQ8T 4DEXA 3URGA 2KVQG 1PKSA 3PMIA 4FW2A 1T3SA 4FSXA 4JRPA 4FL6A 4LUDA 3CBPA 2EW3A 2EFIA 2EQJA 3RERA 1JRIA 3OS1A 1PSEA 2OTJQ 2DXBA 4M75B 1QVGA 2YRDA 1QCFA 1KC8U 1UJ0A 2LQNA 4FYWB 3JCMc 4CC3A 4JS5A 1YJ9Q 4M7AF 4M78D 2ECZA 3RR6A 2FPDA 3C95A 2L89A 3JRZA 3ZEHA 2VXFA 2RQTA 3E9GA 5CIUA 1IO6A 2YLBA 3QDRB 5LJ3d 4IUQA 1I1JA 3JB9F 4C8QC 2W0ZA 6AT1B 3DLLA 3CXCP 3FDRA 4BDZA 5GJWB 3CPFA 4M78G 1K4US 4N0AA 1JEGA 3CCLA 1KQSS 1NJIU 2CP0A 4KGZB 1GCPA 3HL8A 1TTHB 5GAOp 3H0HA 1YI2Q 2DXCA 1K8AR 1BB9A 1SSHA 2KE9A 3X26B 3FJ5A 2J06A 3L2RA 3CCRT 1WI7A 4VUBA 2NUTB 4M75D 1NG2A 1AWJA 5FWBA 3SB2A 1QKXA 2A7YA 5GMKj 1ZLMA 2DJZA 4AFZC 4B6MA 1NYFA 1RLPC 3KFVA 3R6OA 1V76A 5IAYA 4X9CA 4JLIA 4C0GA 3X25B 4M75G 1R0CB 4EMKC 3OYBA 1K8AC 3HKSA 2EBPA 1ZA1B 1MNEA 1VYVA 3RBBB 1SF9A 5FLXE 5GAMd 5FU7C 1S72A 1I4K1 4JZ3A 1SHGA 4A4HA 1VQ9T 5CQXA 1UGVA 2MOXA 1QP2A 3QUIA 2DYBA 2HCKA 3G71A 3OMCA 1Y0MA 2EVRA 3LYIA 1UGQB 2E3IA 3HFNA 4MZPA 2YRCA 3JCMh 2A0FB 2ROTA 3OYKA 3JCMe 3RKYA 1TSFA 5CQYA 3OYDA 1M30A 2XDPA 1Y7XA 5CCAA 2L8DA 4KGVB 3PVLA 4OMLA 2HL5C 3OYIA 3CMEA 2DBKA 1DJ7B 2DBMA 2YUOA 4C92F 1BKBA 2EJFA 4M77E 3I5RA 2P0QA 2RMOA 3DB4A 4M7AA 3INZA 1MHNA 3JB9J 1K1ZA 2HBPA 4R56A 2KYMA 2GNCA 4KH0B 4ELZC 4XAXB 2RHZA 3RMSA 1KHCA 4QKUA 1UJYA 1K73C 2Y4YA 4FSSA 2K2VA 4PK4A 1FMKA 1M4ZA 4JJBA 5LJ3g 4XTZA 2M51A 3CCET 2XMFA 3QKJA 3UATA 3MEAA 2XD0A 1YWOA 2GTJA 1YIJQ 3EGDB 1LJOA 2DZ9A 2M16A 2EGCA 2KK4A 2IIMA 2DKGA 2L3RA 3EG9A 3OW2P 2IVWA 1BI2A 3OQ5A 2OTJT 4ORZA 4RG2A 2BTTA 1GL5A 3I5SA 4C0FA 3CC4T 3TVTA 4RTYA 1YJ9T 5I21A 1D1AA 1E6GA 5J3BA 1ZHIA 2XDDA 4AT1B 5IHKA 4LDXA 2D8JA 2QGFB 5LJ3f 3CD6A 2FPFA 4RTWA 5GMKi 1WHHA 2VKNA 1M1FA 2JXBA 3CCLQ 1UGSB 3QJ6A 3VU3C 1WFWA 4XU3A 2VXEA 5GAMg 2YRVA 1VQLQ 2EWNA 4OVAA 2KMTA 1SRLA 1HXDA 2RI2A 3M55A 1AWOA 3CPWP 4HXJA 3LWHA 1D3BA 5CKFA 2KROA 3GP8A 2K5FA 3CCQT 1TOVA 1PRLC 2LX9A 1O75A 2HMAA 3QZ5B 3CCJT 1X2QA 4C92A 3CBMA 5EC7A 1KSWA 2YSQA 3DB3A 5D7UA 1BYMA 4JLGA 1C1AA 3META 1VQ4Q 1Q81U 1YJWT 5D6XA 5GAMf 1FX7A 1S72Q 1D1BA 2K3XA 4FW1A 5GAMh 5GAMe 3NPFA 3G71Q 1SRMA 4IUPA 4A4FA 2CP2A 4HCKA 4HT8A 1VQPQ 2AK5A 4ZNXA 1HYOA 2BE7D 5KYNA 3C12A 2J6FA 2F2VA 2L3QA 5DY9A 4RTTA 2ROLA 1YFNA 3V8KA 4M78F 1Q95G 2EYZA 2D6FA 4HKEA 2BKDN 2E65A 1K76A 1YITA 4XU0A 1NM7A 2K4YA 1O9SA 2JTFA 3JCMb 4Q5WA 1WHKA 2LX7A 3TCJA 1RAFB 1PD1A 3G1JA 1UGRB 1JB0E 3M4GA 2R58A 2LTOA 3REBB 1OULA 5I11A 2KI7A 1VQNT 2D0NA 2RO0A 2B8AA 1Y96A 1ZSGA 3JCMV 4M75F 3JB9D 4IIMA 2LVMA 4NL3A 3HRTA 1PM3A 2KDSA 1WX6A 5A2QE 1YIJT 4KH1B 1GRIA 3TSZA 1SSFA 4LNPA 1LNXA 4PLIA 5FU6C 1JXMA 1R8OB 1VYUA 1PWTA 4F7UE 1M1KC 2C0IA 4XQ3A 4D8DA 2L5QA 1X6OA 1Y57A 1WXBA 2PVDB 4M4ZA 4C8QE 3L2QA 4N0AC 3M0PA 1G8XA 4MZMA 4F16A 2FG0A 1G3WA 5CR2A 1GFDA 4C92B 2ENMA 3CCLT 2KAFA 3OYJA 4AMCA 1D1CA 2PU9B 3GF5A 3ZBDA 4BACA 2YUPA 4E7KA 2RA2A 3OYGA 2NLUA 2X4WA 3EHRA 3PFSA 1XJWB 1OEBA 4XTVA 3FJPA 3WVDB 4M78A 4YTLA 3A5ZB 3RNJA 1Q82U 2ABLA 2V8KA 1RACB 1W2BA 4LDWA 2K57A 4QVZA 4C0DC 3OYHA 2E64A 3EG2A 2JUFA 3JCMP 1VQMA 2LQWA 1OU8A 2HSPA 1UFFA 1RADB 1KD1U 1M9SA 2P0PA 4C92D 1TS9A 2BE9B 1S72T 3OB9A 2HEQA 2RJEA 4IKFA 1YI2A 2CKKA 3CC7T 4M75A
chains in the Genus database with same CATH topology
3I35A 1QCFA 2L0AA 2CUBA 2YUQA 1UJ0A 2CREA 2LQNA 4Y92A 4CC3A 2DRKA 4J9BA 2ECZA 2FPDA 2BZYA 1H92A 3VRZA 4OMOA 4F14A 2HBWA 2RQTA 3UF4A 1BBZA 1IO6A 1I1JA 5GJVB 2DMOA 2W0ZA 1JO8A 1MV0B 5L23A 4RTUA 5GJWB 1K4US 3M0SA 2F2WA 1JEGA 1E6HA 1GCPA 2K6DA 1JU5C 3H0HA 1BB9A 1SSHA 2KE9A 2JMAA 3FJ5A 3VS7A 2FEIA 2J06A 1OPLA 2HDAA 1WI7A 1NG2A 2VWFA 1YN8A 1AWJA 5FWBA 3M0RA 4J9GA 1QKXA 3O5ZA 2M0YA 1ZLMA 4AFZC 1U3OA 3EG3A 4F17A 2KBTA 1NYFA 2O9SA 2KRNA 1RLPC 3QWYA 4J9FA 4CC7A 1PNJA 3KFVA 2GGRA 2DM1A 1ZUUA 2F2XA 1JQQA 2EBPA 1WYXA 1X6BA 1VYVA 1B07A 2GQIA 1M3BA 3A98A 3IQLA 3RBBB 2DVJA 2LCSA 2K3BA 4JZ3A 1J3TA 1SHGA 2DL3A 1UGVA 2MOXA 1M3AA 3EG0A 1M3CA 2EYXA 1GFCA 2X3WD 2NWMA 1UUEA 1WXTA 2DYBA 1U06A 2HCKA 3NHNA 2BZXA 1Y0MA 2JTEA 3TSWA 2JT4A 1CSKA 2EVRA 4J9EA 1Z9QA 5I22A 2JMCA 2DILA 1UTIA 1X6GA 2JW4A 2ROTA 1I07A 2EKHA 1T0JA 4AG1C 1VYTA 1M30A 3VS0A 2C0TA 2EQIA 1AEYA 3U23A 3PVLA 4OMLA 1U5SA 2A36A 2GBQA 2LP5A 2DBKA 2MCNA 2DBMA 2DJQA 2YUOA 4Z88A 2K9GA 2V1RA 3H41A 2KT8A 4LE9A 3I5RA 2RMOA 4JPBW 1K1ZA 2CSIA 2CT4A 3VS6A 4HVVA 1YP5A 1K0XA 4EIKA 1T3LA 2EYYA 4R0KA 2KYMA 2PTKA 5IXFA 2GNCA 3JV3A 4KRTA 4RUGA 2CUDA 3ULRB 2O31A 1UJYA 2OJ2A 1SEMA 1GCQC 3VRYA 3SHWA 4FSSA 1NEGA 1FMKA 2LMJA 4JJBA 2M51A 2A28A 2G6FX 3M0QA 4CC4B 1HD3A 2XMFA 1LCKA 2KRSA 3ZL7C 3UATA 1B3QA 1G83A 1YWOA 2GTJA 2FRWA 2DA9A 1X69A 2EGCA 2KGTA 2RPNA 2IIMA 1QWFA 1TG0A 1H3HA 5IHIA 4GBQA 4OMPA 4RTZA 2LJ3A 4ORZA 2EGEA 1NLPC 1GL5A 2BTTA 3I5SA 3TVTA 4RTYA 1ARKA 4D8KA 2W10A 1HJDA 2RQWA 1E6GA 2YUNA 1YCSB 1UHFA 5IHKA 2P4RA 4RTVA 2H8HA 2D8JA 2PZ1A 4J9DA 1OPKA 3UA7A 2DL7A 1QLYA 4AG2C 2FPFA 4RTWA 4A63B 1I0CA 2DNUA 4DEYA 4J9CA 2LJ1A 2RN8A 4CC2A 2VKNA 2X3XD 1SHFA 2DL4A 2JXBA 2CH4A 3NGPA 3H0FA 1WFWA 4RTXA 1W70A 2AZSA 3UA6A 1AWWA 3I9QA 3EHQA 3VS5A 1AWOA 1V1CA 4HXJA 1N5ZA 3SEMA 1T0HA 1VA7A 2OAWA 1FYNA 2PNIA 2KROA 2RQUA 1PRLC 3VS3A 2L3PA 2J7IA 2AZVA 1X2QA 2O9VA 5EC7A 3LH5A 1KSWA 2RQVA 1GCQA 4WCIA 1G2BA 2YSQA 4OMMA 2QDLA 2E5KA 4HVWA 3CQTA 3GBQA 5FWCA 3H0IA 5IXBA 1UE9A 2DL5A 2O88A 1AZEA 2KRMA 1K9AA 1W1FA 3NPFA 1SRMA 2KR3A 4AFUC 1ABOA 4HCKA 1XOVA 1ZBJA 1UECA 1QWEA 2AK5A 4ZNXA 4AFSC 2RNAA 2D1XA 2FPEA 2J6FA 2EPDA 5FW9A 1WDXA 2F2VA 1AOJA 2L3QA 2KEAA 2K2MA 2AKLA 4RTTA 2CH4W 2ROLA 1M8MA 3VS1A 2EYZA 4JJDA 2NUZA 2ED0A 2KNBB 2LJ0A 1K76A 1PKTA 2KXDA 4X1VA 4GLMA 2JS0A 1OV3A 2SEMA 1OOTA 1ZUYA 1NM7A 1X27A 1S1NA 1W6XA 1SPKA 1ZX6A 3NMZC 2LX7A 1ZUKA 4OMNA 1TUCA 4QT7A 1UHCA 2DF6A 3C0CA 2YDLA 2K7AA 3REBB 5I11A 4OMQA 1NEBA 2D0NA 2RF0A 3REAB 2CSQA 5IH2A 2ED1A 1ZSGA 3VS2A 2DX1A 4IIMA 2A08A 2L2PA 2CT3A 1WX6A 4Z8AA 2LZ6B 1H8KA 1UDLA 2FO0A 1GBRA 4LUEA 1GRIA 1JXOA 3TSZA 4E6RA 3PVQA 1YNZA 4LNPA 3R6NA 2LNHB 3VS4A 1AZGB 1PRMC 1TUDA 1JXMA 2KT1A 4LN2A 4ESRA 1BU1A 1Z9ZA 1E7OA 1VYUA 1PWTA 2C0IA 2GTOA 1YWPA 4D8DA 4HVUA 2SRCA 1KFZA 1KJWA 3M0TA 1Y57A 1WXBA 1AVZC 2J6OA 4M4ZA 2CDTA 3M0PA 2C0OA 1WIEA 1PHTA 1X43A 2OI3A 1M27C 2O2OA 2FRYA 5HCKA 1WA7A 3THKA 1A0NB 1MV3A 4F16A 1RI9A 2FG0A 2KYBA 1GFDA 2ENMA 2A37A 2K79A 3M0UA 2ESWA 1WXUA 2JS2A 2MIOA 1NLOC 1ABQA 1UG1A 1RLQC 4J9HA 1GBQA 1AD5A 4Z89A 2AKKA 2YUPA 3EG1A 1EFNA 5ECAA 1CKAA 2BZ8A 2EGAA 3EHRA 1HSQA 4IIOA 1OEBA 2I0NA 1RUWA 2JM9A 3PE0A 3RNJA 2V1QA 2ABLA 4JJCA 4AFQC 1MUZA 2DL8A 2B86A 2DE0X 2J6KA 2JM8A 1KIKA 2DRMA 2D8HA 1NYGA 2YT6A 1CKBA 2L3SA 1AWXA 2DLPA 3EG2A 1WLPB 2LQWA 1BK2A 2HSPA 1UFFA 4K11A 1K0SA 2KXCA 2VVKA 4JZ4A 5IHNA 4DEXA 1PKSA 3EGUA 1T3SA 4LUDA 2RQRA 2J05A 2EYWA 2EW3A 3QWXX 1X2KA 2HEQA 1QKWA 4J9IA 1SRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I35 A;  1QCF A;  2L0A A;  2CUB A;  2YUQ A;  1UJ0 A;  2CRE A;  2LQN A;  4Y92 A;  4CC3 A;  2DRK A;  4J9B A;  2ECZ A;  2FPD A;  2BZY A;  1H92 A;  3VRZ A;  4OMO A;  4F14 A;  2HBW A;  2RQT A;  3UF4 A;  1BBZ A;  1IO6 A;  1I1J A;  5GJV B;  2DMO A;  2W0Z A;  1JO8 A;  1MV0 B;  5L23 A;  4RTU A;  5GJW B;  1K4U S;  3M0S A;  2F2W A;  1JEG A;  1E6H A;  1GCP A;  2K6D A;  1JU5 C;  3H0H A;  1BB9 A;  1SSH A;  2KE9 A;  2JMA A;  3FJ5 A;  3VS7 A;  2FEI A;  2J06 A;  1OPL A;  2HDA A;  1WI7 A;  1NG2 A;  2VWF A;  1YN8 A;  1AWJ A;  5FWB A;  3M0R A;  4J9G A;  1QKX A;  3O5Z A;  2M0Y A;  1ZLM A;  4AFZ C;  1U3O A;  3EG3 A;  4F17 A;  2KBT A;  1NYF A;  2O9S A;  2KRN A;  1RLP C;  3QWY A;  4J9F A;  4CC7 A;  1PNJ A;  3KFV A;  2GGR A;  2DM1 A;  1ZUU A;  2F2X A;  1JQQ A;  2EBP A;  1WYX A;  1X6B A;  1VYV A;  1B07 A;  2GQI A;  1M3B A;  3A98 A;  3IQL A;  3RBB B;  2DVJ A;  2LCS A;  2K3B A;  4JZ3 A;  1J3T A;  1SHG A;  2DL3 A;  1UGV A;  2MOX A;  1M3A A;  3EG0 A;  1M3C A;  2EYX A;  1GFC A;  2X3W D;  2NWM A;  1UUE A;  1WXT A;  2DYB A;  1U06 A;  2HCK A;  3NHN A;  2BZX A;  1Y0M A;  2JTE A;  3TSW A;  2JT4 A;  1CSK A;  2EVR A;  4J9E A;  1Z9Q A;  5I22 A;  2JMC A;  2DIL A;  1UTI A;  1X6G A;  2JW4 A;  2ROT A;  1I07 A;  2EKH A;  1T0J A;  4AG1 C;  1VYT A;  1M30 A;  3VS0 A;  2C0T A;  2EQI A;  1AEY A;  3U23 A;  3PVL A;  4OML A;  1U5S A;  2A36 A;  2GBQ A;  2LP5 A;  2DBK A;  2MCN A;  2DBM A;  2DJQ A;  2YUO A;  4Z88 A;  2K9G A;  2V1R A;  3H41 A;  2KT8 A;  4LE9 A;  3I5R A;  2RMO A;  4JPB W;  1K1Z A;  2CSI A;  2CT4 A;  3VS6 A;  4HVV A;  1YP5 A;  1K0X A;  4EIK A;  1T3L A;  2EYY A;  4R0K A;  2KYM A;  2PTK A;  5IXF A;  2GNC A;  3JV3 A;  4KRT A;  4RUG A;  2CUD A;  3ULR B;  2O31 A;  1UJY A;  2OJ2 A;  1SEM A;  1GCQ C;  3VRY A;  3SHW A;  4FSS A;  1NEG A;  1FMK A;  2LMJ A;  4JJB A;  2M51 A;  2A28 A;  2G6F X;  3M0Q A;  4CC4 B;  1HD3 A;  2XMF A;  1LCK A;  2KRS A;  3ZL7 C;  3UAT A;  1B3Q A;  1G83 A;  1YWO A;  2GTJ A;  2FRW A;  2DA9 A;  1X69 A;  2EGC A;  2KGT A;  2RPN A;  2IIM A;  1QWF A;  1TG0 A;  1H3H A;  5IHI A;  4GBQ A;  4OMP A;  4RTZ A;  2LJ3 A;  4ORZ A;  2EGE A;  1NLP C;  1GL5 A;  2BTT A;  3I5S A;  3TVT A;  4RTY A;  1ARK A;  4D8K A;  2W10 A;  1HJD A;  2RQW A;  1E6G A;  2YUN A;  1YCS B;  1UHF A;  5IHK A;  2P4R A;  4RTV A;  2H8H A;  2D8J A;  2PZ1 A;  4J9D A;  1OPK A;  3UA7 A;  2DL7 A;  1QLY A;  4AG2 C;  2FPF A;  4RTW A;  4A63 B;  1I0C A;  2DNU A;  4DEY A;  4J9C A;  2LJ1 A;  2RN8 A;  4CC2 A;  2VKN A;  2X3X D;  1SHF A;  2DL4 A;  2JXB A;  2CH4 A;  3NGP A;  3H0F A;  1WFW A;  4RTX A;  1W70 A;  2AZS A;  3UA6 A;  1AWW A;  3I9Q A;  3EHQ A;  3VS5 A;  1AWO A;  1V1C A;  4HXJ A;  1N5Z A;  3SEM A;  1T0H A;  1VA7 A;  2OAW A;  1FYN A;  2PNI A;  2KRO A;  2RQU A;  1PRL C;  3VS3 A;  2L3P A;  2J7I A;  2AZV A;  1X2Q A;  2O9V A;  5EC7 A;  3LH5 A;  1KSW A;  2RQV A;  1GCQ A;  4WCI A;  1G2B A;  2YSQ A;  4OMM A;  2QDL A;  2E5K A;  4HVW A;  3CQT A;  3GBQ A;  5FWC A;  3H0I A;  5IXB A;  1UE9 A;  2DL5 A;  2O88 A;  1AZE A;  2KRM A;  1K9A A;  1W1F A;  3NPF A;  1SRM A;  2KR3 A;  4AFU C;  1ABO A;  4HCK A;  1XOV A;  1ZBJ A;  1UEC A;  1QWE A;  2AK5 A;  4ZNX A;  4AFS C;  2RNA A;  2D1X A;  2FPE A;  2J6F A;  2EPD A;  5FW9 A;  1WDX A;  2F2V A;  1AOJ A;  2L3Q A;  2KEA A;  2K2M A;  2AKL A;  4RTT A;  2CH4 W;  2ROL A;  1M8M A;  3VS1 A;  2EYZ A;  4JJD A;  2NUZ A;  2ED0 A;  2KNB B;  2LJ0 A;  1K76 A;  1PKT A;  2KXD A;  4X1V A;  4GLM A;  2JS0 A;  1OV3 A;  2SEM A;  1OOT A;  1ZUY A;  1NM7 A;  1X27 A;  1S1N A;  1W6X A;  1SPK A;  1ZX6 A;  3NMZ C;  2LX7 A;  1ZUK A;  4OMN A;  1TUC A;  4QT7 A;  1UHC A;  2DF6 A;  3C0C A;  2YDL A;  2K7A A;  3REB B;  5I11 A;  4OMQ A;  1NEB A;  2D0N A;  2RF0 A;  3REA B;  2CSQ A;  5IH2 A;  2ED1 A;  1ZSG A;  3VS2 A;  2DX1 A;  4IIM A;  2A08 A;  2L2P A;  2CT3 A;  1WX6 A;  4Z8A A;  2LZ6 B;  1H8K A;  1UDL A;  2FO0 A;  1GBR A;  4LUE A;  1GRI A;  1JXO A;  3TSZ A;  4E6R A;  3PVQ A;  1YNZ A;  4LNP A;  3R6N A;  2LNH B;  3VS4 A;  1AZG B;  1PRM C;  1TUD A;  1JXM A;  2KT1 A;  4LN2 A;  4ESR A;  1BU1 A;  1Z9Z A;  1E7O A;  1VYU A;  1PWT A;  2C0I A;  2GTO A;  1YWP A;  4D8D A;  4HVU A;  2SRC A;  1KFZ A;  1KJW A;  3M0T A;  1Y57 A;  1WXB A;  1AVZ C;  2J6O A;  4M4Z A;  2CDT A;  3M0P A;  2C0O A;  1WIE A;  1PHT A;  1X43 A;  2OI3 A;  1M27 C;  2O2O A;  2FRY A;  5HCK A;  1WA7 A;  3THK A;  1A0N B;  1MV3 A;  4F16 A;  1RI9 A;  2FG0 A;  2KYB A;  1GFD A;  2ENM A;  2A37 A;  2K79 A;  3M0U A;  2ESW A;  1WXU A;  2JS2 A;  2MIO A;  1NLO C;  1ABQ A;  1UG1 A;  1RLQ C;  4J9H A;  1GBQ A;  1AD5 A;  4Z89 A;  2AKK A;  2YUP A;  3EG1 A;  1EFN A;  5ECA A;  1CKA A;  2BZ8 A;  2EGA A;  3EHR A;  1HSQ A;  4IIO A;  1OEB A;  2I0N A;  1RUW A;  2JM9 A;  3PE0 A;  3RNJ A;  2V1Q A;  2ABL A;  4JJC A;  4AFQ C;  1MUZ A;  2DL8 A;  2B86 A;  2DE0 X;  2J6K A;  2JM8 A;  1KIK A;  2DRM A;  2D8H A;  1NYG A;  2YT6 A;  1CKB A;  2L3S A;  1AWX A;  2DLP A;  3EG2 A;  1WLP B;  2LQW A;  1BK2 A;  2HSP A;  1UFF A;  4K11 A;  1K0S A;  2KXC A;  2VVK A;  4JZ4 A;  5IHN A;  4DEX A;  1PKS A;  3EGU A;  1T3S A;  4LUD A;  2RQR A;  2J05 A;  2EYW A;  2EW3 A;  3QWX X;  1X2K A;  2HEQ A;  1QKW A;  4J9I A;  1SRL A; 
#chains in the Genus database with same CATH topology
 3I35 A;  2CRE A;  1LVK A;  1V29 B;  3ME9 A;  2E6N A;  4J9B A;  1BCM A;  1M2V A;  3PNW C;  2MI6 A;  2HBW A;  1YBY A;  1JO8 A;  1MV0 B;  2PQW A;  2QXF A;  4RTU A;  1YIT Q;  4BY6 C;  4M7A C;  3CME T;  4GY5 A;  1F1B B;  2K6D A;  1JU5 C;  4PNO A;  4F7U G;  4PJO B;  2QQ9 A;  2JMA A;  3CC2 A;  3M58 A;  4FYY B;  4XK8 E;  3HFO A;  2NUT A;  1TUG B;  4DA4 A;  2I2L A;  3M0R A;  4J9G A;  2E5Q A;  3OW2 A;  2DZC A;  4F17 A;  4PJM A;  4WF2 A;  2A3L A;  2KRN A;  3M53 A;  1PNJ A;  2QQR A;  5I2M A;  1D0Y A;  3I56 A;  4B9W A;  2GFA A;  3FEO A;  1ZUU A;  2F2X A;  4A54 A;  1WYX A;  2QI2 A;  4XU2 A;  1Q86 R;  1M3B A;  3A98 A;  2XIC A;  1C0M A;  2DVJ A;  4PJO D;  3BFM A;  1IZ6 A;  1LPL A;  1IGU A;  3I55 Q;  2DL3 A;  1M3C A;  1GFC A;  1XTD A;  1QVF P;  4Y28 E;  4DQ2 A;  1M5Q 1;  3CCS A;  4BD3 A;  2FVU A;  5I22 A;  1OZ3 A;  2JMC A;  3CPW A;  2DIL A;  1UTI A;  2MMP A;  2AHJ B;  1KC8 R;  3AHU A;  5AYF A;  4OF1 A;  3FLG A;  2EKH A;  3CD6 T;  3MP6 A;  1I81 A;  2C0T A;  5CKE A;  3V7R A;  4PFZ A;  2JZ2 A;  2EJ9 A;  4C5G A;  2GBQ A;  2A36 A;  2OTL Q;  3PIP A;  4PLL A;  2QG9 B;  2DJQ A;  2HKQ B;  2ZPI B;  4Z88 A;  2K9G A;  2KT8 A;  1WNL A;  3CCV T;  5KCO A;  1NJI R;  4JPB W;  1OU9 A;  5GAN 4;  3M9Q A;  1K0X A;  2DEU A;  3CMA Q;  4P5N A;  1N8R U;  2O31 A;  1U1S A;  4FYV B;  3CCM T;  4L5G A;  3L2Z A;  1M2V B;  2LMJ A;  2G6F X;  4EMG A;  1VQM Q;  2KRS A;  1NJI C;  4BE2 A;  3EGD A;  4O6J A;  2DA9 A;  2RK1 A;  2E70 A;  2M0O A;  1BI0 A;  1VQ6 Q;  1H3H A;  5HKC A;  4GBQ A;  2EKO A;  4V2S A;  2QEX T;  2EGE A;  1VQL A;  2AT1 B;  4D8K A;  2W10 A;  1HJD A;  1UHF A;  1RL2 A;  3UPU A;  2H8H A;  2MAM A;  3JCM g;  1W2B S;  4AG2 C;  4A63 B;  1ACM B;  3CBO A;  3MPU B;  2ZZD A;  3GIB A;  2X4X A;  3PT9 A;  3RIR A;  2X3X D;  4X34 A;  3NGP A;  3X20 B;  1VQ4 A;  1VIE A;  3I9Q A;  4J7F A;  3CC2 Q;  3NFC A;  2MYS A;  2ZPB B;  1N5Z A;  4BE0 A;  2QYZ A;  1KQ2 A;  3LGL A;  1KQS P;  1VA7 A;  2QA4 Q;  1TU0 B;  2RQU A;  1D0Z A;  2WSE E;  1VQP A;  3SFM A;  4X9D A;  2VUB A;  3I56 Q;  3JCM f;  4PFP A;  2AZV A;  3EH1 A;  5HK0 A;  2O9V A;  1MMA A;  5C0M A;  5DM7 R;  1GCQ A;  4WCI A;  4OMM A;  3OMG A;  4HVW A;  4A53 A;  1XNI A;  3GBQ A;  3MEU A;  3H0I A;  2O4X B;  2RH2 A;  3QBY A;  3C94 A;  4ZN3 A;  3S3M A;  4QQ6 A;  4IUR A;  2RJD A;  1YHQ T;  2KRM A;  2FYK A;  1VQ5 A;  2CP5 A;  1K9A A;  4LDV A;  4AFU C;  4LD9 K;  1ABO A;  5HY6 A;  5GAO r;  2BIV A;  3CCS Q;  1UEC A;  4M7D C;  1H64 1;  3MEV A;  1YCY A;  4IUT A;  2RNA A;  2D1X A;  2X9H A;  4N4G A;  5A0G A;  2RK2 A;  5FW9 A;  1WDX A;  4RMO A;  2D0Q B;  1I5L A;  1NPR A;  4OGC A;  2K2M A;  2E4H A;  3MP1 A;  3VS1 A;  1JBM A;  4JJD A;  2LJ0 A;  3JCM J;  3C4S A;  2QAZ A;  4X1V A;  1OOT A;  1X27 A;  5DLO A;  5KYW B;  2XI9 A;  2VGN A;  1W6X A;  5KCH A;  1JJ2 A;  4WTO B;  5J39 A;  4M78 C;  1XQH A;  2WSF E;  1WJQ A;  1TUC A;  3EFO A;  4E47 A;  3OYN A;  2K7A A;  4ATO A;  1BIB A;  4OMQ A;  3EFS A;  1M2O A;  2CSQ A;  4M77 B;  2LDM A;  2MWO A;  3OYM A;  3TQ7 P;  2XU8 A;  3VS2 A;  3JCM X;  2DX1 A;  1K9M R;  2MF2 A;  3S3N A;  2DD4 A;  1VQK A;  3G4S A;  5CAI A;  1WHJ A;  1ZSZ B;  1UDL A;  1VQ7 A;  4M75 C;  3SWN A;  3QPH A;  2LNH B;  3MHX A;  2YLC A;  3VS4 A;  5GAN d;  1Q81 R;  3P8H A;  4A4E A;  4PJN A;  2CZ0 B;  2KT1 A;  1YI2 T;  2CZ7 B;  3ER0 A;  1W4S A;  4ELY C;  3NTI A;  4PJO F;  4NS5 A;  2LNV A;  1SKU B;  4PL6 A;  5GMK m;  5GAN 7;  1KQ1 A;  4M77 D;  1Y71 A;  3QYH B;  2J6O A;  1M90 U;  2CDT A;  4KT0 E;  3G6E A;  1QVG S;  3LW5 E;  2JVV A;  5KYU A;  3WXM B;  1X43 A;  1M27 C;  4IUV A;  2O2O A;  4M7A E;  1WQW A;  2FHD A;  2FRY A;  4HT9 A;  3JCM W;  2DIG A;  1Q81 C;  1VQ8 A;  4DBH A;  4E7Z A;  1KK7 A;  4M77 G;  2JS2 A;  4J8O A;  2ZGW A;  4B9X A;  4J9H A;  4Z89 A;  2AKK A;  2X35 A;  1FMV A;  5DLQ E;  5ECA A;  2KSS A;  1CKA A;  2BZ8 A;  1HSQ A;  4XTX A;  3TRE A;  2V1Q A;  4AFQ C;  2FL7 A;  2V8J A;  2HQX A;  4Y91 A;  2JM8 A;  1KIK A;  2R57 A;  1AWX A;  3J81 E;  5CK9 A;  1OYX A;  5FRN A;  2DLP A;  4BUG A;  1IHW A;  1AT1 B;  2YWW A;  2KXC A;  4JZ4 A;  3ASK A;  3OBY A;  5IHN A;  2FZG B;  3EGU A;  3OS0 A;  5A0D A;  2E3H A;  3CCR A;  3QSU A;  4E7L A;  3QWX X;  5AT1 B;  3DLM A;  3QG1 A;  1VQ5 Q;  4FU6 A;  2CZ1 B;  4J9I A;  2DAQ A;  3V8J A;  3J80 E;  2L0A A;  2CUB A;  4Y92 A;  3PIO A;  3EFO B;  2F69 A;  3BW1 A;  4BI8 B;  4MMK A;  1H92 A;  2DXU A;  3M5A A;  1ZA2 B;  4XTW A;  3UF4 A;  5GMK l;  5GJV B;  2X51 A;  5KE3 A;  5L23 A;  1MND A;  3G7Z A;  3H9N A;  4C5I A;  3A8H B;  3CCU A;  3HPW A;  3JCM Q;  2HL3 A;  4PJO A;  2E1H A;  3VV0 A;  4JRI A;  3JSC A;  2EJG A;  5GAN g;  4JRQ A;  3VS7 A;  2FEI A;  1OPL A;  2HDA A;  2QAS A;  3SWN B;  3CXC A;  4EPC A;  3I55 A;  1YN8 A;  2GQV A;  3Q1J A;  5KYY A;  3O5Z A;  2M0Y A;  4M7A G;  4C5E A;  3EG3 A;  2KBT A;  3QO3 A;  3QWY A;  1YJN Q;  3JAM E;  1Q82 R;  2HQH A;  2VAS A;  2PVO B;  1VQK Q;  3G4S Q;  2GGR A;  2DM1 A;  3OYE A;  1WHM A;  2FZC B;  4OB2 B;  5KYU B;  1X6B A;  2XK0 A;  1Q7Y U;  1VQ7 Q;  2DTO A;  4E7S A;  4E7H A;  3IQL A;  1KD1 R;  3MKD A;  2OTL A;  5LJ5 d;  3BDL A;  5GAN f;  2LCS A;  1J3T A;  4QQG A;  2ZCF B;  1M3A A;  3H8Z A;  3EG0 A;  2M1H A;  5GAN h;  2EYX A;  1JJ2 S;  5GAN e;  1VQL T;  1EIF A;  1WXT A;  3NHN A;  4BI3 A;  2BZX A;  1NZ9 A;  1M1K U;  2QQB A;  4J9E A;  1WGS A;  3O8V A;  4PFO A;  1WJS A;  4DOV A;  3CMA A;  3RES A;  3G6E Q;  1X6G A;  2JTM A;  4E7I A;  3A8L B;  1T0J A;  1VYT A;  1HK9 A;  3OYC A;  1KD1 C;  2DK3 A;  2EQI A;  4F7U B;  1AEY A;  3U23 A;  4JJN K;  1QW1 A;  1VQ8 Q;  1U5S A;  4ZTJ A;  2LP5 A;  3OYA A;  1EX4 A;  3M4Y A;  4C8Q B;  2DEQ A;  1VUB A;  3AT1 B;  3S3O A;  4ZGD B;  4R55 A;  4J7I A;  4ZGE B;  1VQ4 T;  3OYY A;  4E2F B;  2CSI A;  2CT4 A;  3UDC A;  3VS6 A;  1OX8 A;  2CYZ B;  3HTR A;  3MP8 A;  3CC4 A;  4KGX B;  3RKW A;  1T3L A;  2P84 A;  1RAH B;  2PTK A;  4R0K A;  1VQ6 A;  4KUD K;  2NYS A;  4OP0 A;  5HK3 A;  2X4Y A;  4KRT A;  3G71 T;  2CUD A;  4J83 A;  3ULR B;  3QDF A;  2OJ2 A;  1SEM A;  1VQP T;  1GCQ C;  3VRY A;  3SHW A;  4XU1 A;  3P8D A;  5C6S A;  1VIF A;  4QW2 A;  2A28 A;  3OYF A;  1HD3 A;  1LCK A;  2CGH A;  3JB9 I;  1B3Q A;  1G83 A;  2FRW A;  5CKH A;  3E2U A;  4C8Q D;  2KGT A;  2DTH A;  2RPN A;  5GAN j;  4FT4 A;  5GAN 8;  2VC8 A;  3CCR Q;  4KBM B;  2GF7 A;  1QWF A;  1K9M C;  1TG0 A;  4JS4 A;  4OMP A;  3QXE B;  4M7D E;  3L42 A;  2HZY A;  5GAO n;  1NLP C;  2RI5 A;  4N4I A;  1OI1 A;  3LWI A;  2LT1 A;  5FU7 B;  4J5Y A;  4C8Q G;  3F70 A;  1YCS B;  3CCJ A;  5KYY B;  1PC0 A;  2QA4 A;  2IPO B;  2PZ1 A;  4TVR A;  1G3S A;  3UT1 A;  1Y07 A;  2DL7 A;  1QLY A;  1U8R A;  1I0C A;  1C6V X;  3JB9 H;  2Z0W A;  8AT1 B;  4J9C A;  4M77 F;  2LJ1 A;  2RN8 A;  4CC2 A;  5A0L A;  2KQW A;  2CH4 A;  3CCU Q;  3L1A A;  4M78 E;  1VQ9 Q;  2RHX A;  5LJ5 g;  2QQA A;  3EAE A;  3OYL A;  3QII A;  5IT9 E;  1VOM A;  1MMN A;  4PKC C;  3VS5 A;  3NTK A;  3FRN A;  3SEM A;  2VGM A;  1T0H A;  1BCO A;  3OSV A;  2OAW A;  1FYN A;  4ZN1 A;  1G5V A;  4C0Z A;  2QK0 A;  1N8R R;  2Y4X A;  3VS3 A;  4L6V 5;  2BUD A;  2J7I A;  1R0B G;  2ZPG B;  1QQJ A;  2RQV A;  1Q86 C;  1PSF A;  1G2B A;  4M75 E;  2E5K A;  4O5V A;  8ATC B;  1VQ7 T;  2WAC A;  3CQT A;  5FWC A;  2FB7 A;  2O4X A;  5L8R E;  5LJ5 f;  2O88 A;  4ME7 A;  3M56 A;  2DIQ A;  5LJ5 h;  1AZE A;  5LJ5 e;  2F1L A;  4LXC A;  5D6Y A;  2KR3 A;  2QTX A;  1KC8 C;  1X75 C;  1ZBJ A;  4AFS C;  3CXC S;  2V8I A;  4EMH A;  3LX7 A;  1RAI B;  2FPE A;  1AOJ A;  2LRQ A;  3G6E T;  2K5L A;  4C92 C;  1G3Y A;  4JDS A;  2CH4 W;  3TU4 K;  3GPL A;  1QCN A;  3GOX A;  5GAN 6;  4MML A;  4NOY A;  3RDV A;  1WHL A;  2JS0 A;  2SEM A;  1RAB B;  1ZUY A;  2ATC B;  2HQE A;  5KYW A;  3V8L A;  4M7D G;  2RHY A;  1SPK A;  3VKI A;  3KUF A;  2COY A;  4GLK A;  2LCL A;  3NMZ C;  4PJL A;  4OMN A;  3FIF A;  1OX9 A;  4QT7 A;  2DD5 A;  3CC4 Q;  1UHC A;  2YXY A;  1B34 A;  3RUX A;  1TWB A;  2XHC A;  3EGX B;  3REA B;  2VYT A;  4M77 A;  2ED1 A;  2QTV A;  2XG8 D;  2HAX A;  2A08 A;  1BI3 A;  2CT3 A;  4A4G A;  1ZSZ A;  4Z8A A;  1X01 A;  2X4J A;  2RHI A;  2FO0 A;  1GBR A;  3GNF B;  4LUE A;  3E1S A;  1IXD A;  1JXO A;  3E9F A;  4MDW A;  4E6R A;  5LJ5 j;  1YIT T;  2K5I A;  4F04 B;  1AZG B;  1TXQ A;  4ESR A;  4LN2 A;  3BDU A;  1Z9Z A;  5D6W A;  4KUL A;  3CCQ Q;  1H3Z A;  4FM4 B;  3X24 B;  3SDZ A;  4C5H A;  2GTO A;  3PMT A;  4RKU E;  4EDU A;  2DET A;  3S6W A;  2MK5 A;  3CCJ Q;  1FMW A;  2EIF A;  2NUP B;  2JJ9 A;  1N27 A;  2OI3 A;  1WIE A;  1PHT A;  2ZPH B;  9ATC B;  1WZO A;  5HCK A;  4A4K A;  1WJR A;  4PJO C;  1WA7 A;  1MV3 A;  1RI9 A;  1YJW Q;  2PUO B;  2A37 A;  1K8A U;  2ESW A;  1WXU A;  2QGG A;  1QCO A;  3CCU T;  2MIO A;  1NLO C;  2K3Y A;  5KYX B;  4J6Y A;  1UG1 A;  2OX7 A;  3D7S B;  2RHU A;  1AD5 A;  4BDY A;  3CC7 A;  1W2B P;  1BI1 A;  4HA8 A;  3EG1 A;  1EFN A;  3A8M B;  4CI0 C;  2RJC A;  3I55 T;  3RKX A;  2I0N A;  1RUW A;  1IGQ A;  2JM9 A;  3PE0 A;  4JJC A;  2DL8 A;  2DE0 X;  2DVE A;  4LDU A;  1WQ7 A;  3EFR A;  2J6K A;  2M9U A;  3L2U A;  3SD4 A;  2D8H A;  1NYG A;  2DXT A;  2YT6 A;  2L3S A;  1K73 R;  3UWN A;  3VYG A;  3OW2 S;  1BK2 A;  4K11 A;  2EQU A;  3MEW A;  3V7S A;  2OTL T;  4F7U F;  1NE8 A;  2RQR A;  2J05 A;  2EYW A;  1IB8 A;  1X2K A;  1QKW A;  1GXI E;  1VQN Q;  1D0X A;  4C8Q F;  2HKN A;  5CKB A;  2H3E B;  2YUQ A;  1UEB A;  2XDB A;  1B7T A;  2DRK A;  5FU6 B;  1VQO A;  1B34 B;  3CMA T;  3QYG B;  2BZY A;  3VRZ A;  4OMO A;  1N9R A;  4F14 A;  2JOY A;  1BBZ A;  1R77 A;  5M9O A;  4RG8 A;  1K73 U;  1YJN A;  2DMO A;  1M90 R;  2LQ8 A;  5GAN 5;  3CPW S;  3M0S A;  2F2W A;  2WSC E;  1VQM T;  1E6H A;  2DYI A;  2IG0 A;  5KE2 A;  1VQ6 T;  3VUZ A;  2HSE B;  2VWF A;  1D09 B;  1M90 C;  1U3O A;  2O9S A;  4J9F A;  4CC7 A;  4BI4 A;  4HCC A;  1ZQ1 A;  5LJ3 h;  3BY7 A;  5LJ3 e;  1N6A A;  1IRE B;  3HRS A;  1JQQ A;  5FRO A;  2ZAE A;  1B07 A;  2GQI A;  3QJY A;  2RB6 A;  3LH0 A;  3CCV A;  4C0D B;  1TH7 A;  4JRK A;  4FCY A;  2K3B A;  2EYQ A;  2CP7 A;  2P4T A;  4OB0 B;  4QQD A;  2VB6 A;  1LOJ A;  2X3W D;  2NWM A;  1MMD A;  1UUE A;  3CC2 T;  1U06 A;  2JTE A;  3TSW A;  2JT4 A;  1CSK A;  2R5M A;  3NTH A;  3CCM A;  3KXT A;  1Z9Q A;  5LL6 S;  1MGQ A;  2QA4 T;  2JW4 A;  1I07 A;  4AG1 C;  3VS0 A;  1RI0 A;  4F7U A;  1QVF A;  3I56 T;  3H6Z A;  4CRI A;  4M7D F;  3DKM A;  2MCN A;  4C8Q A;  4XTY A;  4N4H A;  4QVD A;  2V1R A;  2AIR B;  3M59 A;  3H41 A;  3N5B B;  1QVG P;  4LE9 A;  4DBQ A;  2COW A;  2XKO C;  4IUU A;  2QEX A;  3CC7 Q;  5GAO q;  4BY6 B;  4M7A B;  2V26 A;  4HVV A;  1YP5 A;  4EIK A;  5I2S A;  3RMQ A;  2EYY A;  5IXF A;  2QQS A;  1AHJ B;  3JV3 A;  2DFU A;  4RUG A;  5LJ3 j;  3CCS T;  3A1P A;  1I5O B;  1NEG A;  3CME Q;  3M0Q A;  4E7J A;  4CC4 B;  5CKD A;  3ZL7 C;  5GAO m;  1MMG A;  4DBF A;  3KBG A;  5CVI A;  4EMK A;  1X69 A;  4II1 A;  2DPP B;  1ZBX A;  1Q7Y R;  4Z02 A;  2HD0 A;  2LQK A;  2RI3 A;  4M7A D;  5IHI A;  3EG9 B;  1VQ9 A;  4RTZ A;  2LJ3 A;  2KY9 A;  4FYX B;  1FWZ A;  4FT2 A;  1PCX A;  1ARK A;  1I8F A;  4C92 E;  1VQO Q;  2RQW A;  2YUN A;  1M1K R;  3FB9 A;  2RM4 A;  2P4R A;  4RTV A;  4MDX A;  4J9D A;  1OPK A;  1U1T A;  4OGE A;  4ZGJ B;  3UA7 A;  2CS7 A;  1Q7Y C;  2D9T A;  2DNU A;  4DEY A;  3HRU A;  5EG2 A;  3JB9 G;  5GAM j;  1SHF A;  2DL4 A;  3HHT B;  2MWP A;  3H0F A;  3EH2 A;  4RTX A;  1W70 A;  2DER A;  3ZFJ A;  1EZZ B;  3MO8 A;  2AZS A;  3M54 A;  3UA6 A;  1YHQ A;  1M8V A;  1AWW A;  2COZ A;  1UB4 A;  3WVE B;  3EHQ A;  4JUV A;  4M77 C;  4XTU A;  1V1C A;  2CP6 A;  2M02 A;  5J26 A;  3BE3 A;  4PJJ A;  4L59 A;  2E12 A;  1D3B B;  1UGP B;  4QVC A;  3OSS C;  2PNI A;  1WPY A;  1Q82 C;  2H3J A;  3OA6 A;  4BB7 A;  3CD6 Q;  4M7D A;  4OB1 B;  4ZTF A;  2EQM A;  1ZSZ C;  2L3P A;  4HCZ A;  1WHG A;  3J7A F;  3LH5 A;  1BIA A;  3CCE A;  1KQS A;  2QDL A;  2PVG B;  1KG1 A;  3CCV Q;  2YHT A;  5GAO l;  5IXB A;  1UE9 A;  3FC3 A;  2DL5 A;  1RAG B;  3TEE A;  4ANJ A;  3PGG A;  2RD1 A;  2GCX A;  1W1F A;  3E19 A;  2OTJ A;  4KUI A;  2LCC A;  1XOV A;  2EAY A;  2OAU A;  1QWE A;  3QHS A;  2CP3 A;  3LLR A;  1RAA B;  3CCM Q;  2GFU A;  1YJ9 A;  5GAN 3;  3QZ9 B;  2EPD A;  1SG5 A;  2KEA A;  4PJO E;  2G3R A;  1QP3 A;  2AKL A;  2EQK A;  1JJ2 P;  1M8M A;  2C06 A;  2NUZ A;  2ED0 A;  2KNB B;  1PKT A;  2KXD A;  1N9S A;  4GLM A;  1OV3 A;  4BE1 A;  1OZ2 A;  1S1N A;  4D6W A;  1ZX6 A;  1QVP A;  4J6X A;  3GNG A;  3MJX A;  2QEX Q;  3OY9 A;  1ZUK A;  2HNI A;  4C92 G;  2DTI A;  4EMK B;  1FXX A;  3LGF A;  3L2V A;  2JNG A;  2DF6 A;  3C0C A;  1RAE B;  4RCB A;  2YDL A;  1VQ5 T;  3HSB A;  3A8G B;  1NEB A;  2RF0 A;  3EGX A;  3HP9 A;  3CCQ A;  5IH2 A;  2P0K A;  4HCB A;  2ZPF B;  1Y96 B;  2F5K A;  3OS2 A;  3VYH B;  2FZK B;  3X28 B;  4UC4 A;  3MCA B;  2L2P A;  2LC4 A;  7AT1 B;  4NL2 A;  2LZ6 B;  2MPX C;  1H8K A;  2CZ6 B;  5CO7 A;  1QVF S;  1QMC A;  2R5A A;  3PVQ A;  1YJW A;  1YNZ A;  3R6N A;  3OBW A;  5KH6 A;  1K9M U;  1IRX A;  2VV5 A;  4DBR A;  1TUD A;  1PRM C;  3CEY A;  4LDY A;  4DOW A;  4RCC A;  2ZPE B;  3PTA A;  1BU1 A;  3P8B B;  1E7O A;  3V7C A;  2QDY B;  2LT4 A;  2E10 A;  1YWP A;  4LD6 A;  4HVU A;  1VQO T;  2DO3 A;  2SRC A;  1KFZ A;  1KJW A;  3M0T A;  3JCM d;  4MZT A;  3M57 A;  1PD0 A;  1IHV A;  1AVZ C;  2NUP A;  5FRM A;  2O01 E;  3L2W A;  1OQK A;  2C0O A;  1YJN T;  4M7D B;  2E41 A;  4OMF B;  3VJP A;  3THK A;  1A0N B;  2KYB A;  1VQK T;  3G4S T;  2K79 A;  1KHI A;  3A8O B;  3M0U A;  2E6Z A;  2RJF A;  3SWN C;  5KYX A;  1ABQ A;  1RLQ C;  1YHQ Q;  1GBQ A;  1M1G A;  4J6W A;  1P92 A;  2Y90 A;  2EGA A;  4IIO A;  4PJO G;  4OB3 B;  1N8R C;  1VQN A;  4M78 B;  1MUZ A;  1PG5 B;  2B86 A;  5IN1 A;  1NBE B;  5GMK h;  2XID A;  5GMK e;  2DRM A;  2PUK B;  2JN0 A;  1CKB A;  3GLX A;  4M7D D;  2F5T X;  3OS5 A;  3T9N A;  1Q86 U;  3CCE Q;  1NPP A;  1WLP B;  1G3T A;  5GAN 2;  1K0S A;  2VVK A;  1YIJ A;  3VUB A;  4FIB A;  1VQ8 T;  4DEX A;  3URG A;  2KVQ G;  1PKS A;  3PMI A;  4FW2 A;  1T3S A;  4FSX A;  4JRP A;  4FL6 A;  4LUD A;  3CBP A;  2EW3 A;  2EFI A;  2EQJ A;  3RER A;  1JRI A;  3OS1 A;  1PSE A;  2OTJ Q;  2DXB A;  4M75 B;  1QVG A;  2YRD A;  1QCF A;  1KC8 U;  1UJ0 A;  2LQN A;  4FYW B;  3JCM c;  4CC3 A;  4JS5 A;  1YJ9 Q;  4M7A F;  4M78 D;  2ECZ A;  3RR6 A;  2FPD A;  3C95 A;  2L89 A;  3JRZ A;  3ZEH A;  2VXF A;  2RQT A;  3E9G A;  5CIU A;  1IO6 A;  2YLB A;  3QDR B;  5LJ3 d;  4IUQ A;  1I1J A;  3JB9 F;  4C8Q C;  2W0Z A;  6AT1 B;  3DLL A;  3CXC P;  3FDR A;  4BDZ A;  5GJW B;  3CPF A;  4M78 G;  1K4U S;  4N0A A;  1JEG A;  3CCL A;  1KQS S;  1NJI U;  2CP0 A;  4KGZ B;  1GCP A;  3HL8 A;  1TTH B;  5GAO p;  3H0H A;  1YI2 Q;  2DXC A;  1K8A R;  1BB9 A;  1SSH A;  2KE9 A;  3X26 B;  3FJ5 A;  2J06 A;  3L2R A;  3CCR T;  1WI7 A;  4VUB A;  2NUT B;  4M75 D;  1NG2 A;  1AWJ A;  5FWB A;  3SB2 A;  1QKX A;  2A7Y A;  5GMK j;  1ZLM A;  2DJZ A;  4AFZ C;  4B6M A;  1NYF A;  1RLP C;  3KFV A;  3R6O A;  1V76 A;  5IAY A;  4X9C A;  4JLI A;  4C0G A;  3X25 B;  4M75 G;  1R0C B;  4EMK C;  3OYB A;  1K8A C;  3HKS A;  2EBP A;  1ZA1 B;  1MNE A;  1VYV A;  3RBB B;  1SF9 A;  5FLX E;  5GAM d;  5FU7 C;  1S72 A;  1I4K 1;  4JZ3 A;  1SHG A;  4A4H A;  1VQ9 T;  5CQX A;  1UGV A;  2MOX A;  1QP2 A;  3QUI A;  2DYB A;  2HCK A;  3G71 A;  3OMC A;  1Y0M A;  2EVR A;  3LYI A;  1UGQ B;  2E3I A;  3HFN A;  4MZP A;  2YRC A;  3JCM h;  2A0F B;  2ROT A;  3OYK A;  3JCM e;  3RKY A;  1TSF A;  5CQY A;  3OYD A;  1M30 A;  2XDP A;  1Y7X A;  5CCA A;  2L8D A;  4KGV B;  3PVL A;  4OML A;  2HL5 C;  3OYI A;  3CME A;  2DBK A;  1DJ7 B;  2DBM A;  2YUO A;  4C92 F;  1BKB A;  2EJF A;  4M77 E;  3I5R A;  2P0Q A;  2RMO A;  3DB4 A;  4M7A A;  3INZ A;  1MHN A;  3JB9 J;  1K1Z A;  2HBP A;  4R56 A;  2KYM A;  2GNC A;  4KH0 B;  4ELZ C;  4XAX B;  2RHZ A;  3RMS A;  1KHC A;  4QKU A;  1UJY A;  1K73 C;  2Y4Y A;  4FSS A;  2K2V A;  4PK4 A;  1FMK A;  1M4Z A;  4JJB A;  5LJ3 g;  4XTZ A;  2M51 A;  3CCE T;  2XMF A;  3QKJ A;  3UAT A;  3MEA A;  2XD0 A;  1YWO A;  2GTJ A;  1YIJ Q;  3EGD B;  1LJO A;  2DZ9 A;  2M16 A;  2EGC A;  2KK4 A;  2IIM A;  2DKG A;  2L3R A;  3EG9 A;  3OW2 P;  2IVW A;  1BI2 A;  3OQ5 A;  2OTJ T;  4ORZ A;  4RG2 A;  2BTT A;  1GL5 A;  3I5S A;  4C0F A;  3CC4 T;  3TVT A;  4RTY A;  1YJ9 T;  5I21 A;  1D1A A;  1E6G A;  5J3B A;  1ZHI A;  2XDD A;  4AT1 B;  5IHK A;  4LDX A;  2D8J A;  2QGF B;  5LJ3 f;  3CD6 A;  2FPF A;  4RTW A;  5GMK i;  1WHH A;  2VKN A;  1M1F A;  2JXB A;  3CCL Q;  1UGS B;  3QJ6 A;  3VU3 C;  1WFW A;  4XU3 A;  2VXE A;  5GAM g;  2YRV A;  1VQL Q;  2EWN A;  4OVA A;  2KMT A;  1SRL A;  1HXD A;  2RI2 A;  3M55 A;  1AWO A;  3CPW P;  4HXJ A;  3LWH A;  1D3B A;  5CKF A;  2KRO A;  3GP8 A;  2K5F A;  3CCQ T;  1TOV A;  1PRL C;  2LX9 A;  1O75 A;  2HMA A;  3QZ5 B;  3CCJ T;  1X2Q A;  4C92 A;  3CBM A;  5EC7 A;  1KSW A;  2YSQ A;  3DB3 A;  5D7U A;  1BYM A;  4JLG A;  1C1A A;  3MET A;  1VQ4 Q;  1Q81 U;  1YJW T;  5D6X A;  5GAM f;  1FX7 A;  1S72 Q;  1D1B A;  2K3X A;  4FW1 A;  5GAM h;  5GAM e;  3NPF A;  3G71 Q;  1SRM A;  4IUP A;  4A4F A;  2CP2 A;  4HCK A;  4HT8 A;  1VQP Q;  2AK5 A;  4ZNX A;  1HYO A;  2BE7 D;  5KYN A;  3C12 A;  2J6F A;  2F2V A;  2L3Q A;  5DY9 A;  4RTT A;  2ROL A;  1YFN A;  3V8K A;  4M78 F;  1Q95 G;  2EYZ A;  2D6F A;  4HKE A;  2BKD N;  2E65 A;  1K76 A;  1YIT A;  4XU0 A;  1NM7 A;  2K4Y A;  1O9S A;  2JTF A;  3JCM b;  4Q5W A;  1WHK A;  2LX7 A;  3TCJ A;  1RAF B;  1PD1 A;  3G1J A;  1UGR B;  1JB0 E;  3M4G A;  2R58 A;  2LTO A;  3REB B;  1OUL A;  5I11 A;  2KI7 A;  1VQN T;  2D0N A;  2RO0 A;  2B8A A;  1Y96 A;  1ZSG A;  3JCM V;  4M75 F;  3JB9 D;  4IIM A;  2LVM A;  4NL3 A;  3HRT A;  1PM3 A;  2KDS A;  1WX6 A;  5A2Q E;  1YIJ T;  4KH1 B;  1GRI A;  3TSZ A;  1SSF A;  4LNP A;  1LNX A;  4PLI A;  5FU6 C;  1JXM A;  1R8O B;  1VYU A;  1PWT A;  4F7U E;  1M1K C;  2C0I A;  4XQ3 A;  4D8D A;  2L5Q A;  1X6O A;  1Y57 A;  1WXB A;  2PVD B;  4M4Z A;  4C8Q E;  3L2Q A;  4N0A C;  3M0P A;  1G8X A;  4MZM A;  4F16 A;  2FG0 A;  1G3W A;  5CR2 A;  1GFD A;  4C92 B;  2ENM A;  3CCL T;  2KAF A;  3OYJ A;  4AMC A;  1D1C A;  2PU9 B;  3GF5 A;  3ZBD A;  4BAC A;  2YUP A;  4E7K A;  2RA2 A;  3OYG A;  2NLU A;  2X4W A;  3EHR A;  3PFS A;  1XJW B;  1OEB A;  4XTV A;  3FJP A;  3WVD B;  4M78 A;  4YTL A;  3A5Z B;  3RNJ A;  1Q82 U;  2ABL A;  2V8K A;  1RAC B;  1W2B A;  4LDW A;  2K57 A;  4QVZ A;  4C0D C;  3OYH A;  2E64 A;  3EG2 A;  2JUF A;  3JCM P;  1VQM A;  2LQW A;  1OU8 A;  2HSP A;  1UFF A;  1RAD B;  1KD1 U;  1M9S A;  2P0P A;  4C92 D;  1TS9 A;  2BE9 B;  1S72 T;  3OB9 A;  2HEQ A;  2RJE A;  4IKF A;  1YI2 A;  2CKK A;  3CC7 T;  4M75 A; 
#chains in the Genus database with same CATH homology
 3I35 A;  1QCF A;  2L0A A;  2CUB A;  2YUQ A;  1UJ0 A;  2CRE A;  2LQN A;  4Y92 A;  4CC3 A;  2DRK A;  4J9B A;  2ECZ A;  2FPD A;  2BZY A;  1H92 A;  3VRZ A;  4OMO A;  4F14 A;  2HBW A;  2RQT A;  3UF4 A;  1BBZ A;  1IO6 A;  1I1J A;  5GJV B;  2DMO A;  2W0Z A;  1JO8 A;  1MV0 B;  5L23 A;  4RTU A;  5GJW B;  1K4U S;  3M0S A;  2F2W A;  1JEG A;  1E6H A;  1GCP A;  2K6D A;  1JU5 C;  3H0H A;  1BB9 A;  1SSH A;  2KE9 A;  2JMA A;  3FJ5 A;  3VS7 A;  2FEI A;  2J06 A;  1OPL A;  2HDA A;  1WI7 A;  1NG2 A;  2VWF A;  1YN8 A;  1AWJ A;  5FWB A;  3M0R A;  4J9G A;  1QKX A;  3O5Z A;  2M0Y A;  1ZLM A;  4AFZ C;  1U3O A;  3EG3 A;  4F17 A;  2KBT A;  1NYF A;  2O9S A;  2KRN A;  1RLP C;  3QWY A;  4J9F A;  4CC7 A;  1PNJ A;  3KFV A;  2GGR A;  2DM1 A;  1ZUU A;  2F2X A;  1JQQ A;  2EBP A;  1WYX A;  1X6B A;  1VYV A;  1B07 A;  2GQI A;  1M3B A;  3A98 A;  3IQL A;  3RBB B;  2DVJ A;  2LCS A;  2K3B A;  4JZ3 A;  1J3T A;  1SHG A;  2DL3 A;  1UGV A;  2MOX A;  1M3A A;  3EG0 A;  1M3C A;  2EYX A;  1GFC A;  2X3W D;  2NWM A;  1UUE A;  1WXT A;  2DYB A;  1U06 A;  2HCK A;  3NHN A;  2BZX A;  1Y0M A;  2JTE A;  3TSW A;  2JT4 A;  1CSK A;  2EVR A;  4J9E A;  1Z9Q A;  5I22 A;  2JMC A;  2DIL A;  1UTI A;  1X6G A;  2JW4 A;  2ROT A;  1I07 A;  2EKH A;  1T0J A;  4AG1 C;  1VYT A;  1M30 A;  3VS0 A;  2C0T A;  2EQI A;  1AEY A;  3U23 A;  3PVL A;  4OML A;  1U5S A;  2A36 A;  2GBQ A;  2LP5 A;  2DBK A;  2MCN A;  2DBM A;  2DJQ A;  2YUO A;  4Z88 A;  2K9G A;  2V1R A;  3H41 A;  2KT8 A;  4LE9 A;  3I5R A;  2RMO A;  4JPB W;  1K1Z A;  2CSI A;  2CT4 A;  3VS6 A;  4HVV A;  1YP5 A;  1K0X A;  4EIK A;  1T3L A;  2EYY A;  4R0K A;  2KYM A;  2PTK A;  5IXF A;  2GNC A;  3JV3 A;  4KRT A;  4RUG A;  2CUD A;  3ULR B;  2O31 A;  1UJY A;  2OJ2 A;  1SEM A;  1GCQ C;  3VRY A;  3SHW A;  4FSS A;  1NEG A;  1FMK A;  2LMJ A;  4JJB A;  2M51 A;  2A28 A;  2G6F X;  3M0Q A;  4CC4 B;  1HD3 A;  2XMF A;  1LCK A;  2KRS A;  3ZL7 C;  3UAT A;  1B3Q A;  1G83 A;  1YWO A;  2GTJ A;  2FRW A;  2DA9 A;  1X69 A;  2EGC A;  2KGT A;  2RPN A;  2IIM A;  1QWF A;  1TG0 A;  1H3H A;  5IHI A;  4GBQ A;  4OMP A;  4RTZ A;  2LJ3 A;  4ORZ A;  2EGE A;  1NLP C;  1GL5 A;  2BTT A;  3I5S A;  3TVT A;  4RTY A;  1ARK A;  4D8K A;  2W10 A;  1HJD A;  2RQW A;  1E6G A;  2YUN A;  1YCS B;  1UHF A;  5IHK A;  2P4R A;  4RTV A;  2H8H A;  2D8J A;  2PZ1 A;  4J9D A;  1OPK A;  3UA7 A;  2DL7 A;  1QLY A;  4AG2 C;  2FPF A;  4RTW A;  4A63 B;  1I0C A;  2DNU A;  4DEY A;  4J9C A;  2LJ1 A;  2RN8 A;  4CC2 A;  2VKN A;  2X3X D;  1SHF A;  2DL4 A;  2JXB A;  2CH4 A;  3NGP A;  3H0F A;  1WFW A;  4RTX A;  1W70 A;  2AZS A;  3UA6 A;  1AWW A;  3I9Q A;  3EHQ A;  3VS5 A;  1AWO A;  1V1C A;  4HXJ A;  1N5Z A;  3SEM A;  1T0H A;  1VA7 A;  2OAW A;  1FYN A;  2PNI A;  2KRO A;  2RQU A;  1PRL C;  3VS3 A;  2L3P A;  2J7I A;  2AZV A;  1X2Q A;  2O9V A;  5EC7 A;  3LH5 A;  1KSW A;  2RQV A;  1GCQ A;  4WCI A;  1G2B A;  2YSQ A;  4OMM A;  2QDL A;  2E5K A;  4HVW A;  3CQT A;  3GBQ A;  5FWC A;  3H0I A;  5IXB A;  1UE9 A;  2DL5 A;  2O88 A;  1AZE A;  2KRM A;  1K9A A;  1W1F A;  3NPF A;  1SRM A;  2KR3 A;  4AFU C;  1ABO A;  4HCK A;  1XOV A;  1ZBJ A;  1UEC A;  1QWE A;  2AK5 A;  4ZNX A;  4AFS C;  2RNA A;  2D1X A;  2FPE A;  2J6F A;  2EPD A;  5FW9 A;  1WDX A;  2F2V A;  1AOJ A;  2L3Q A;  2KEA A;  2K2M A;  2AKL A;  4RTT A;  2CH4 W;  2ROL A;  1M8M A;  3VS1 A;  2EYZ A;  4JJD A;  2NUZ A;  2ED0 A;  2KNB B;  2LJ0 A;  1K76 A;  1PKT A;  2KXD A;  4X1V A;  4GLM A;  2JS0 A;  1OV3 A;  2SEM A;  1OOT A;  1ZUY A;  1NM7 A;  1X27 A;  1S1N A;  1W6X A;  1SPK A;  1ZX6 A;  3NMZ C;  2LX7 A;  1ZUK A;  4OMN A;  1TUC A;  4QT7 A;  1UHC A;  2DF6 A;  3C0C A;  2YDL A;  2K7A A;  3REB B;  5I11 A;  4OMQ A;  1NEB A;  2D0N A;  2RF0 A;  3REA B;  2CSQ A;  5IH2 A;  2ED1 A;  1ZSG A;  3VS2 A;  2DX1 A;  4IIM A;  2A08 A;  2L2P A;  2CT3 A;  1WX6 A;  4Z8A A;  2LZ6 B;  1H8K A;  1UDL A;  2FO0 A;  1GBR A;  4LUE A;  1GRI A;  1JXO A;  3TSZ A;  4E6R A;  3PVQ A;  1YNZ A;  4LNP A;  3R6N A;  2LNH B;  3VS4 A;  1AZG B;  1PRM C;  1TUD A;  1JXM A;  2KT1 A;  4LN2 A;  4ESR A;  1BU1 A;  1Z9Z A;  1E7O A;  1VYU A;  1PWT A;  2C0I A;  2GTO A;  1YWP A;  4D8D A;  4HVU A;  2SRC A;  1KFZ A;  1KJW A;  3M0T A;  1Y57 A;  1WXB A;  1AVZ C;  2J6O A;  4M4Z A;  2CDT A;  3M0P A;  2C0O A;  1WIE A;  1PHT A;  1X43 A;  2OI3 A;  1M27 C;  2O2O A;  2FRY A;  5HCK A;  1WA7 A;  3THK A;  1A0N B;  1MV3 A;  4F16 A;  1RI9 A;  2FG0 A;  2KYB A;  1GFD A;  2ENM A;  2A37 A;  2K79 A;  3M0U A;  2ESW A;  1WXU A;  2JS2 A;  2MIO A;  1NLO C;  1ABQ A;  1UG1 A;  1RLQ C;  4J9H A;  1GBQ A;  1AD5 A;  4Z89 A;  2AKK A;  2YUP A;  3EG1 A;  1EFN A;  5ECA A;  1CKA A;  2BZ8 A;  2EGA A;  3EHR A;  1HSQ A;  4IIO A;  1OEB A;  2I0N A;  1RUW A;  2JM9 A;  3PE0 A;  3RNJ A;  2V1Q A;  2ABL A;  4JJC A;  4AFQ C;  1MUZ A;  2DL8 A;  2B86 A;  2DE0 X;  2J6K A;  2JM8 A;  1KIK A;  2DRM A;  2D8H A;  1NYG A;  2YT6 A;  1CKB A;  2L3S A;  1AWX A;  2DLP A;  3EG2 A;  1WLP B;  2LQW A;  1BK2 A;  2HSP A;  1UFF A;  4K11 A;  1K0S A;  2KXC A;  2VVK A;  4JZ4 A;  5IHN A;  4DEX A;  1PKS A;  3EGU A;  1T3S A;  4LUD A;  2RQR A;  2J05 A;  2EYW A;  2EW3 A;  3QWX X;  1X2K A;  2HEQ A;  1QKW A;  4J9I A;  1SRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...