2JW4A

Nmr solution structure of the n-terminal sh3 domain of human nckalpha
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
72
structure length
72
Chain Sequence
GSTMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARAAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK1
publication title Interaction between the N-terminal SH3 domain of Nckalpha and CD3epsilon-derived peptides: Non-canonical and canonical recognition motifs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 5
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2007-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jw4A00
1VYTA 1AOJA 1WXTA 2K7AA 2YUOA 1S1NA 4A63B 2NUZA 1ABQA 1J3TA 1GRIA 2LJ1A 2DBMA 2LMJA 2RQUA 2OJ2A 2DL8A 2K2MA 3UF4A 1V1CA 2RQWA 4RTXA 4Z88A 2ENMA 1U3OA 2YUPA 1T0JA 2AKKA 1JEGA 5IH2A 1M30A 2EPDA 4Z89A 1K9AA 2BZ8A 2K3BA 2D8HA 3C0CA 1JXOA 1T3SA 2RPNA 4HXJA 1QKWA 1WDXA 4ESRA 4OMOA 5ECAA 1RLQC 2JM9A 1IO6A 2CH4A 4IIMA 1M3AA 2DNUA 1KFZA 1AWWA 2C0TA 1K0XA 1WX6A 1FMKA 1RUWA 1H3HA 1ZUUA 2L2PA 1KIKA 3JV3A 2VKNA 4RTTA 1JQQA 2K9GA 3UATA 3LH5A 5EC7A 4AG1C 1M27C 1M3CA 2LX7A 1RI9A 1VA7A 3PVLA 2CH4W 4RTVA 1NG2A 1ZUKA 1UJYA 3EG1A 4WCIA 2J6KA 4OMNA 2DM1A 2O88A 2LQWA 4J9DA 5L23A 1NLOC 1U06A 1YWOA 2OAWA 2DL7A 1PNJA 1QCFA 2GNCA 3NGPA 2LCSA 2DJQA 2EBPA 1K0SA 2XMFA 2CDTA 2V1RA 2F2WA 2C0IA 1AWOA 4OMPA 2A28A 4J9CA 2KE9A 1HSQA 2BZYA 2KROA 2L3SA 2VVKA 1VYVA 1NM7A 3M0PA 4JZ4A 4CC4B 4KRTA 2HDAA 3M0QA 2W10A 1QWEA 2EYWA 1ABOA 1BBZA 2J7IA 1X6GA 3QWXX 2KBTA 2W0ZA 2HBWA 1BK2A 1EFNA 1M8MA 3M0SA 5IHNA 2HEQA 2CT4A 1PRMC 3NHNA 1GBRA 2EGAA 5HCKA 1NEBA 4JJDA 1BU1A 2L3PA 1PRLC 2LJ0A 3THKA 1CSKA 1NYFA 1CKAA 1G2BA 1Y57A 2J6OA 3KFVA 2CSIA 2ECZA 1AVZC 3VS5A 2LP5A 1YP5A 4RTZA 2I0NA 2AZVA 4OMQA 2DL4A 1JO8A 1OPKA 4CC3A 3VS7A 2RNAA 2KNBB 1QKXA 1Z9ZA 3FJ5A 2KRSA 2K79A 1WXUA 1WI7A 4ZNXA 1UJ0A 2V1QA 2DE0X 1AZGB 2A08A 5IXFA 1E6HA 2ED0A 2FG0A 2DA9A 2K6DA 2KYMA 1GBQA 2KXDA 1GFCA 3IQLA 2LJ3A 4LUDA 2DMOA 1ARKA 1ZX6A 4HCKA 4DEXA 2EGCA 5I22A 3NMZC 2G6FX 4RTYA 2KEAA 4CC7A 2F2VA 1QWFA 1JU5C 1PWTA 4ORZA 1ZSGA 4EIKA 3UA7A 4RTWA 4AFSC 3I5SA 1M3BA 2A36A 1I1JA 2LNHB 2EW3A 4DEYA 2EGEA 3RNJA 3VS0A 1TUCA 2ED1A 3EG2A 2GTOA 2J06A 2P4RA 4LNPA 4E6RA 1WXBA 2RQTA 1E6GA 2JT4A 3PVQA 4F17A 2JM8A 1UECA 3PE0A 4JJBA 2CUBA 1B3QA 1OEBA 4AG2C 1NYGA 2AK5A 2PNIA 2BTTA 3ZL7C 2JS0A 2MOXA 1AZEA 4LN2A 1SHFA 1VYUA 4HVVA 4D8KA 4JZ3A 4AFUC 1GCPA 3VS1A 2O2OA 2L3QA 1OOTA 2EKHA 2FEIA 3RBBB 4RUGA 3VS4A 1TG0A 5IHIA 2PZ1A 2DL3A 2HCKA 2KRMA 1CKBA 3REAB 1K4US 1I07A 2SRCA 1WA7A 4J9GA 1YNZA 1W6XA 1YWPA 3VS3A 4OMLA 2KR3A 2MIOA 2DLPA 1WIEA 4F14A 2AKLA 1WLPB 2FO0A 1AWJA 2DRMA 2FPEA 1X2KA 2FRWA 1T0HA 5FWCA 4F16A 2J6FA 1SPKA 3A98A 3I9QA 2D0NA 1YN8A 1UE9A 4AFZC 1GL5A 1PKSA 2EYZA 1U5SA 2M0YA 2ROTA 2VWFA 3VS6A 2FPFA 1B07A 3O5ZA 2DVJA 2F2XA 1A0NB 2A37A 2DILA 1GCQC 2JXBA 2GGRA 1NLPC 2OI3A 1SHGA 3EHQA 2M51A 3VRZA 1I0CA 2KGTA 1T3LA 2CSQA 1G83A 2O9SA 4J9HA 3EGUA 1LCKA 1GCQA 1ZLMA 3M0TA 1SEMA 1ZUYA 3H0HA 4J9BA 1H8KA 5GJWB 2O31A 1AD5A 1N5ZA 2PTKA 4JJCA 3VS2A 2YDLA 1FYNA 5FW9A 1HD3A 2LQNA 3H0FA 2RMOA 3ULRB 2LZ6B 1UDLA 1X69A 1MV0B 1AEYA 3SEMA 3NPFA 1X27A 2JW4A 2ROLA 4OMMA 1AWXA 1PKTA 1UG1A 3SHWA 2C0OA 3M0UA 2FRYA 2X3WD 4RTUA 2DX1A 1RLPC 4IIOA 5GJVB 1WYXA 2BZXA 2MCNA 3VRYA 2D8JA 2J05A 3I5RA 1K76A 2NWMA 1UHFA 1WFWA 1HJDA 1SRLA 2GTJA 1UTIA 1X2QA 2EVRA 2GQIA 5I11A 4J9EA 3UA6A 4K11A 1UGVA 2E5KA 4D8DA 2YSQA 3H0IA 4LE9A 3TVTA 2D1XA 4GLMA 1H92A 1K1ZA 4FSSA 2DRKA 4AFQC 2JMCA 2H8HA 3TSWA 4LUEA 1TUDA 2RQRA 1MUZA 5IXBA 2ABLA 4X1VA 2DYBA 2X3XD 1MV3A 1UFFA 1JXMA 1XOVA 4HVUA 4J9IA 1X6BA 4Z8AA 3GBQA 2KRNA 2YUQA 4GBQA 2SEMA 2ESWA 3EHRA 2DBKA 2GBQA 3REBB 4J9FA 4HVWA 1Z9QA 2IIMA 4JPBW 1W1FA 2AZSA 2JMAA 1KJWA 4M4ZA 4R0KA 2CREA 3QWYA 1E7OA 3H41A 4Y92A 3CQTA 1UUEA 1NEGA 1ZBJA 2RF0A 2YUNA 2RQVA 1KSWA 1OV3A 3EG3A 3R6NA 3EG0A 1UHCA 2DL5A 2YT6A 3U23A 1PHTA 1SSHA 2KT1A 2EYXA 3TSZA 2CT3A 2JTEA 1W70A 1OPLA 1BB9A 2EQIA 2RN8A 2KT8A 2KXCA 3M0RA 2O9VA 1GFDA 2KYBA 2CUDA 2FPDA 1QLYA 2HSPA 2L0AA 1X43A 5FWBA 1SRMA 3I35A 2EYYA 2B86A 2QDLA 2JS2A 4QT7A 1Y0MA 4CC2A 2DF6A 1YCSB 5IHKA
chains in the Genus database with same CATH superfamily
2K7AA 1AOJA 5KYWB 2YUOA 4A63B 1J3TA 1BYMA 2DBMA 2RQUA 3CCRT 2DL8A 2K2MA 3ER0A 4C92F 2RQWA 3G71A 4J5YA 3EFRA 4Z88A 2ENMA 3JB9F 2YRCA 3RERA 1T0JA 2CZ0B 2X4XA 4XU2A 1OX8A 5FRNA 1D0XA 1M30A 2F5TX 4Z89A 3C95A 1VQ5T 2BZ8A 3NTKA 3QHSA 1T3SA 2QGGA 4HKEA 2RPNA 1M9SA 5HY6A 4OMOA 2QAZA 1RLQC 5GAN6 2F1LA 4IIMA 2NUPA 3HRUA 1MMAA 2QA4T 1KK7A 1AWWA 4J7FA 3VUZA 3OYCA 1PD0A 3CCSA 3GNFB 2VKNA 3BW1A 3LH5A 3CCUA 3GPLA 5CKFA 1M90C 1YJWT 2XG8D 3FB9A 2PVDB 2WACA 1OQKA 1RI9A 1VA7A 2DD4A 2CH4W 1NPRA 3OYGA 1NG2A 1TOVA 2A7YA 2ZCFB 2QEXQ 1H641 4J9DA 2HZYA 4EMKA 1U06A 2DL7A 3NGPA 2LCSA 2GNCA 1RI0A 1U8RA 3CCEA 2CDTA 1VOMA 1OULA 1AWOA 4C8QB 5KYYB 4J9CA 3G4SQ 5CKBA 4ZGEB 4HA8A 2KROA 1YITT 1IRXA 2KI7A 2L3SA 3PTAA 4JZ4A 4KRTA 3EAEA 3CCLA 1BCOA 3KXTA 1QWEA 1ABOA 3HKSA 5GAMf 1BBZA 5LJ3d 4II1A 2OX7A 3M5AA 2KBTA 5J39A 1D1CA 1K73U 2HBWA 2EIFA 1KHIA 2D6FA 1EFNA 2MPXC 1M8MA 3M0SA 3CBMA 4JJNK 1X01A 2L3RA 2RJFA 3BDUA 5HCKA 4E7KA 3KUFA 2DZCA 3THKA 1PRLC 1NE8A 1NYFA 4XK8E 1Y57A 1NJIR 3KFVA 3VS5A 1YP5A 2I0NA 1QCNA 4M7AA 1M2VA 3OS2A 1QKXA 1VQNA 2K79A 2RA2A 2HL5C 5KYXB 1UJ0A 2A08A 3G71T 4C0GA 4F7UB 4PKCC 2RHXA 4M75A 2CP5A 4NS5A 2LJ3A 2RH2A 1Q82R 2DMOA 2HQEA 3OYMA 2EGCA 2LQKA 2LCLA 1ZHIA 1JU5C 3QZ9B 3EH2A 4EIKA 2R57A 3OMCA 1DJ7B 3UA7A 4M7AF 1EX4A 2VGMA 3NTHA 1VQPA 2EJ9A 4KGZB 3I5SA 4J6YA 2FYKA 2CZ6B 2RHZA 3E1SA 2JN0A 4ZTJA 2DTOA 4KBMB 2P4RA 1N9SA 2K57A 2RQTA 4M78E 5KYUA 2YWWA 3L2UA 4J6XA 2QK0A 2PNIA 1RADB 4DBFA 2KQWA 3URGA 4FW1A 2JS0A 4N0AC 2MOXA 4B9XA 2KVQG 5FRMA 3UWNA 4LN2A 3MPUB 1SHFA 3EH1A 2FHDA 2VASA 2Z0WA 3EGXB 3ZBDA 4AFUC 1AHJB 4M77B 2L3QA 5KE3A 2H3EB 3FC3A 3CCET 3V7CA 2ATCB 3L1AA 2LC4A 1PD1A 3RBBB 2PZ1A 4IUPA 2RK2A 1OZ2A 3BE3A 2LTOA 1I07A 2VC8A 4KUIA 4GLKA 4PJOG 3CCLT 4J9GA 1W6XA 5D6XA 2OAUA 4LDXA 2JTFA 1WIEA 4F14A 2AKLA 1QVGA 1AWJA 2O01E 5KCHA 4M78D 1N6AA 3J80E 2FRWA 2OTLQ 2RJDA 5FWCA 1SPKA 3I9QA 1Y96A 2RJEA 5GANf 1UE9A 3SWNA 1YI2A 3JCMb 3MP6A 1XNIA 4RKUE 1YJ9A 4C0DC 1U5SA 1Q95G 3QUIA 2ZZDA 2BKDN 5GAN7 2EWNA 4B6MA 2QDYB 3DLMA 1KD1R 3CXCS 1BI2A 2M51A 2EQMA 3VRZA 3HRSA 2KGTA 2HAXA 1T3LA 1VQNT 4Z02A 4J9HA 3X28B 8ATCB 2EJGA 1GCQA 3M0TA 1ZUYA 4J9BA 5GJWB 1QQJA 2O31A 2RHYA 2YDLA 3ZEHA 1O9SA 1FYNA 5FW9A 2QA4Q 2LZ6B 1AEYA 4Y28E 3GLXA 2YRDA 4PJNA 3EG9B 3A1PA 1PKTA 4FCYA 1XTDA 5FU7B 1NJIC 4DBQA 1TSFA 2MWPA 1YJWQ 2EAYA 3HP9A 5GJVB 2HQXA 2MWOA 2HMAA 1UB4A 2D8JA 2J05A 3I5RA 3BFMA 3TU4K 1WFWA 2Y90A 1I4K1 2GTJA 3H9NA 5I11A 4J9EA 1JB0E 3CMAA 4K11A 2D1XA 3C94A 1VQOA 4EPCA 1VQ7T 1Q82C 4A4KA 4JRIA 4OF1A 1TUDA 4M7DB 3CCVA 2RI5A 5IXBA 4ME7A 4M75E 4X1VA 1PSEA 3A8MB 1YITQ 1MV3A 1QVGP 1IZ6A 1I5LA 1JXMA 4BI8B 2DIQA 4C0FA 1S72Q 2B8AA 3GBQA 3MEUA 4M78G 4GBQA 1OI1A 5LJ3f 2RHIA 4J9FA 1Z9QA 2IIMA 3G7ZA 1JJ2S 2AZSA 2WSCE 1I5OB 3H6ZA 3JB9J 2ZPHB 2CREA 4HCCA 1IHVA 1P92A 2ZPBB 1OV3A 1SSHA 5FU6B 3JSCA 4M78C 1TWBA 2JTEA 3AHUA 2IG0A 1N27A 2RN8A 4JRKA 4JS4A 3M0RA 5GAN3 5GAOq 1MMGA 3MHXA 4E7SA 1GFDA 1KQSA 5CR2A 2DERA 1X75C 4M75D 2BIVA 3I35A 2VGNA 1YIJT 3A5ZB 4QT7A 1Y0MA 2RJCA 4WTOB 2DF6A 3VS6A 5IHKA 1OX9A 5D7UA 4C5HA 1S1NA 2NUZA 4C8QA 5KYYA 2DYIA 2LMJA 2OJ2A 3X24B 3JAME 3CC2A 2IVWA 3QKJA 3X26B 1U3OA 3DKMA 1WQWA 4N4HA 5IH2A 2DEUA 4JDSA 1I8FA 3P8HA 1K9AA 4BE1A 2K3BA 2D8HA 5LJ5j 1B34A 1JXOA 5DM7R 1VQ4A 4MDWA 4HXJA 1QKWA 3CD6A 3QIIA 3RKWA 3BDLA 4KUDK 4QQGA 1KD1C 1Y7XA 1R0CB 1WHKA 4QVZA 1RUWA 1Q7YU 1VIFA 2VV5A 1H3HA 4DBRA 2L2PA 4WF2A 5LJ5e 2K9GA 3UATA 1Y96B 5EC7A 1M27C 2RI3A 4E7JA 1M3CA 1VQOT 3CMEA 4PJOF 2CP3A 9ATCB 5GAN8 4DBHA 1G3TA 4EMKC 3PVLA 4RTVA 3RIRA 1RAEB 3CCVT 5KYXA 1BIAA 4WCIA 2DM1A 1VQLA 2LQWA 1N8RR 1M2OA 4DOVA 4FYWB 1K8AR 2EBPA 2C0IA 3PIPA 2A28A 2E6ZA 5GAMh 1VQKA 5C6SA 5IN1A 2GFAA 3TREA 4D6WA 1ZSZC 2VVKA 3GP8A 4CC4B 2EQUA 3M59A 3CCMA 3M55A 3M0QA 2JTMA 2LNVA 3HRTA 4BY6C 2VXFA 2X9HA 3LLRA 3HFOA 1EIFA 5J3BA 1VQ8A 1PRMC 3X20B 4J8OA 4FL6A 1CSKA 3E19A 5LJ5g 3HSBA 1VQMT 5GMKi 1AVZC 3EGXA 1VQ6T 4LDVA 1Q86R 4M77A 4XTZA 2AZVA 1M1GA 4OMQA 2JVVA 1JO8A 4A4EA 4M75C 3VS7A 1IGQA 5IT9E 3QJ6A 4ZGDB 1O75A 1WXUA 1WI7A 3MO8A 2DE0X 1AZGB 2KMTA 5IXFA 2FG0A 2DA9A 2K6DA 1W2BS 1C6VX 1IB8A 4LUDA 1GXIE 1ARKA 4HCKA 2CYZB 2G6FX 1U1TA 2L8DA 2KEAA 1IHWA 1QWFA 4A4GA 1VQ4T 2M9UA 4HCBA 2LDMA 4M77F 4UC4A 4RTWA 3FLGA 3FIFA 3QZ5B 2X4WA 2M16A 2LNHB 4FIBA 3SB2A 3QPHA 1F1BB 3RNJA 1VQ7Q 1KQSS 4MZTA 2IPOB 4L5GA 5GMKm 3OYLA 3I55A 1WXBA 4KGVB 2JT4A 2COWA 4F17A 2E64A 1IGUA 1XJWB 1B3QA 1OEBA 3N5BB 1NYGA 2BTTA 2K5IA 3M54A 4C8QE 1AZEA 3EGDA 4HVVA 3VS1A 3G6EA 5CCAA 3M56A 1YHQQ 1OOTA 2EKHA 2Y4XA 3CC7A 1VQKT 1LVKA 2OTJA 3V7RA 1TUGB 3OBWA 2CP0A 2EFIA 2XU8A 1R0BG 3EG9A 4PJOB 1OYXA 2KY9A 3CCMT 1YNZA 5GAMj 5GANh 1B34B 1YWPA 4QVDA 3OYHA 1NJIU 4JUVA 4OMLA 4E7IA 2DLPA 4XTVA 1WLPB 1Q7YC 1R77A 4BE0A 2DRMA 4EMGA 2QQBA 3CEYA 4PJMA 1VQ8T 3DB3A 1X2KA 1WGSA 5CQXA 2GF7A 1N8RC 5GAMe 1YIJQ 3JCMQ 2JZ2A 1GL5A 2CP2A 1PKSA 3CCJA 1K8AC 4O6JA 4C8QD 3M53A 2FPFA 3L2ZA 2CP7A 4F7UE 2DVJA 2F2XA 4M7DA 1Q82U 2A37A 1TS9A 1GCQC 2OI3A 2FVUA 2PVOB 1SHGA 1I0CA 4NOYA 4JS5A 1G83A 3OMGA 1I81A 1Q81R 3FJPA 3OYDA 4PFZA 3H0HA 1N5ZA 2PTKA 1M8VA 4JRQA 4LD9K 3HFNA 2V8KA 2LQNA 4X34A 4C92E 3OYKA 3L2RA 2MF2A 4IUVA 4M7DF 1PG5B 1N9RA 3SEMA 1UG1A 2C0OA 3LX7A 5CIUA 3M0UA 2X3WD 4XU3A 1WHHA 3CCST 1M4ZA 1WHJA 3LWIA 1VQOQ 1Q86C 2BZXA 2MCNA 3CCUT 1RAIB 1WHLA 3D7SB 4JLIA 2NWMA 1UHFA 3I55T 1WQ7A 4C5IA 1UTIA 3MKDA 2EVRA 3CCVQ 4Q5WA 2E5KA 5A0DA 3H0IA 4LE9A 5GAMg 1H92A 3V7SA 4FSSA 2RO0A 2DRKA 5LJ5d 2G3RA 1SKUB 3TSWA 4R55A 1MUZA 3V8KA 2E3HA 1WJRA 3CC7T 4PFPA 4M78B 3QDFA 4XTXA 4HVUA 4J9IA 2HNIA 4C92D 3J81E 1RL2A 3EHRA 2GBQA 3REBB 1G3YA 3RR6A 1D3BB 3JB9D 2COYA 4XU0A 5GAN4 2QQAA 5GAOm 3TEEA 2QEXA 5LL6S 4R0KA 2P0QA 2D0QB 1FMVA 2K4YA 4EMHA 2ZPEB 3H41A 3VU3C 1QCOA 1NEGA 1ZBJA 1KD1U 3JCMf 2YUNA 2RQVA 3G4SA 3LH0A 3EG3A 5CVIA 4XQ3A 3R6NA 3EG0A 1UHCA 5GANj 1VQMQ 1PHTA 1VQ6Q 3PFSA 2EYXA 3PMIA 4F04B 3L42A 2CZ7B 3OS0A 3CCJT 2CT3A 2MK5A 4CI0C 1BI1A 4ZTFA 4BI3A 3QJYA 3CCRQ 3M57A 3ZFJA 1U1SA 3LWHA 3Q1JA 2KYBA 1ZQ1A 2CUDA 1QLYA 2EQKA 1WHGA 3MEAA 4C8QC 1D09B 3CPWP 2L0AA 4L6V5 1X43A 5GANe 3ME9A 3EGDB 2B86A 2QDLA 2NYSA 4XTUA 2O4XB 1YCSB 1VQ5Q 1KC8R 1ABQA 1GRIA 2LJ1A 5LJ5h 1M1FA 3UF4A 3J7AF 1V1CA 2YRVA 3QYGB 2YUPA 2AKKA 2DFUA 1JEGA 3SDZA 2E4HA 3OB9A 2EPDA 4E2FB 1VQPT 4ATOA 1QP3A 3RUXA 1WDXA 3JCMX 5ECAA 2JM9A 2XD0A 2YXYA 2CH4A 2P0KA 7AT1B 1M3AA 2DNUA 1KFZA 2C0TA 1WX6A 5CO7A 3SD4A 3JRZA 4OB3B 4M7AE 1ZUUA 3JB9H 1KIKA 3TCJA 3JV3A 4RTTA 1Q81C 2RB6A 1LPLA 2R5MA 1TU0B 2LX7A 2DEQA 4C92G 2DETA 5GAOr 4A4FA 1PM3A 3PIOA 5A0GA 2E41A 1ZUKA 2DO3A 1UJYA 4OMNA 5I2MA 2KSSA 5CKHA 2QI2A 5GANg 3H8ZA 1FX7A 1NLOC 1YWOA 3GF5A 1K0SA 5LJ3j 4HCZA 4PLIA 2EYQA 2V1RA 3VJPA 2KE9A 1HSQA 3OYFA 3RDVA 4ZN3A 4HT9A 3CCQA 2MAMA 3OYYA 1VYVA 4C92C 3M0PA 4NL2A 5IAYA 2X51A 1LJOA 1VQ8Q 2COZA 2QQRA 2HDAA 5LJ3e 2W10A 4PFOA 1HYOA 2GQVA 4B9WA 2J7IA 4M7AD 3QWXX 1UGQB 3G4ST 4TVRA 2LVMA 2W0ZA 2EQJA 1YI2T 1ZBXA 2HSEB 2X4JA 3L2VA 1YJ9T 3C12A 2E1HA 5A2QE 1ZA1B 5IHNA 2WSEE 3NHNA 1GBRA 1UGPB 4M77C 1FMWA 1NEBA 2DTHA 3A8HB 4JJDA 1BU1A 2QGFB 2L3PA 2LJ0A 4E7HA 3G71Q 1XQHA 3UDCA 1D1BA 1CKAA 1G2BA 1PC0A 5D6WA 2FL7A 5GAMd 1Y07A 2LP5A 2DL4A 2DXCA 4CC3A 3E2UA 3NTIA 2RNAA 2HKNA 2KNBB 2OTLA 1Z9ZA 2FB7A 2KRSA 4ZNXA 3LYIA 2ED0A 2KYMA 3M4GA 1GBQA 1RAFB 2KXDA 4IUUA 4PJOA 2AHJB 1OU8A 1M90R 3IQLA 3V8JA 6AT1B 1MNEA 1QVGS 3GNGA 1KQ1A 3CCSQ 3NMZC 2CKKA 4QVCA 3CCUQ 4RG8A 2L89A 1PWTA 5DLOA 1M1KR 4AFSC 2AT1B 2XK0A 2VB6A 4PJLA 5LJ3g 5KYNA 2K5FA 1I1JA 2DK3A 2EW3A 2HD0A 3CMAT 3VS0A 4BUGA 1TUCA 1N8RU 1M5Q1 5KH6A 3VYHB 4LNPA 1VQ9A 1KC8C 2PUKB 1K8AU 3CCEQ 3PVQA 4PNOA 5FROA 1UECA 4JJBA 4KT0E 4AG2C 2LT4A 2AK5A 3MEWA 3CC7Q 2XI9A 2QTVA 3META 3DB4A 4D8KA 4JZ3A 3CCLQ 1RABB 2O2OA 2PQWA 3X25B 1KG1A 3P8BB 2FEIA 4FYVB 1UGRB 4RUGA 3VS4A 4ZN1A 5FU7C 2HBPA 3JCMV 2LQ8A 1WHMA 3OBYA 2QG9B 3CCQT 4DA4A 1FWZA 5HK3A 1K4US 1WA7A 3OYBA 3F70A 3M58A 4M75G 4GY5A 1YITA 3VS3A 2YLBA 2KR3A 4FM4B 8AT1B 2MIOA 1Q86U 5GMKl 1S72A 5AT1B 2FO0A 3QBYA 2BUDA 1LOJA 4ZGJB 1G5VA 2DVEA 3I56A 1K9MR 2D9TA 2FPEA 4PL6A 3BY7A 4M7AC 4F16A 1VQNQ 2J6FA 2L5QA 1OU9A 2P84A 2D0NA 3FRNA 2DAQA 2DXBA 3E9FA 2EYZA 3SFMA 4C0ZA 2XDBA 2M0YA 2ROTA 3GIBA 2VWFA 1A0NB 1NLPC 2XDPA 2XHCA 4X9CA 2OTLT 3PGGA 4DQ2A 4M78A 3CC2T 3EGUA 4FSXA 3JCMc 1LCKA 3OQ5A 4N4GA 5CK9A 1VQPQ 3OYNA 2NLUA 1TXQA 3QG1A 1SEMA 5GANd 1H8KA 2AIRB 1D3BA 4JJCA 3VS2A 1WZOA 4PLLA 4BE2A 3DLLA 4MZPA 3CD6T 1IXDA 2QQ9A 3JCMW 3H0FA 5FU6C 4KH1B 3ULRB 2X4YA 1UDLA 1X69A 1MV0B 3WXMB 2HKQB 2ROLA 4OMMA 3SHWA 3OYAA 5GAOp 3G1JA 2FRYA 4RTUA 4FU6A 1RLPC 3RMSA 4QQ6A 2VXEA 3AT1B 4IIOA 4M78F 3EFOB 1WYXA 4E47A 3VRYA 4BB7A 1PCXA 1K76A 3CMET 1VQ9T 1HJDA 1SRLA 2K5LA 2GQIA 4IKFA 2KDSA 3RKYA 3UA6A 2VUBA 1UGVA 3OYIA 4D8DA 2YSQA 1Y71A 5C0MA 4V2SA 2K3XA 1W4SA 2O4XA 3GOXA 1VQLT 4X9DA 4AFQC 2E6NA 2QTXA 3OW2A 4PJOE 1UGSB 3VKIA 3M4YA 2DYBA 4IURA 4BD3A 4KULA 4C0DB 1UFFA 4QQDA 1M1KC 3OS1A 1XOVA 1X6BA 4Z8AA 1BKBA 2DPPB 4E7LA 2I2LA 3CXCA 2ESWA 3JCMh 2CGHA 3L2QA 4JPBW 2DD5A 1KHCA 2JMAA 2M1HA 4FT2A 1YI2Q 4M4ZA 4ELZC 1YJ9Q 4PJJA 2JUFA 4OB0B 3QWYA 2ZAEA 2ZGWA 3SWNC 1V29B 1E7OA 4Y92A 3NFCA 1S72T 3CQTA 4YTLA 4NL3A 1UUEA 3CC4A 2RI2A 1YJNA 5CQYA 2RF0A 3I56T 1KSWA 1ZSZA 1WJQA 3MP1A 2DL5A 3A8OB 1QMCA 3V8LA 3OSSC 1Q81U 3L2WA 2R58A 1YCYA 2EQIA 5GAOn 2KT8A 2KXCA 4OB1B 2ZPFB 1C1AA 4PJOD 4OP0A 3JCMJ 3KBGA 5DLQE 2EYYA 2JS2A 3QYHB 4CC2A 1K73R 3CBPA 2R5AA 1VYTA 1WXTA 2CS7A 2RK1A 2MMPA 1RAHB 2DXTA 3HPWA 2LX9A 2E3IA 4MZMA 1HK9A 4RTXA 3P8DA 5GAOl 4RMOA 2V8IA 1MMDA 2KAFA 2XIDA 3CPWA 2GFUA 4RCCA 1K9MC 5CAIA 4ANJA 5GAN2 4FW2A 2KK4A 3C0CA 3CMAQ 2NUTB 3CBOA 4ESRA 3OW2P 1IO6A 2DZ9A 2V26A 4BDZA 1K0XA 2A3LA 4M77E 1JJ2A 1FMKA 4L59A 5CKEA 2PUOB 1MHNA 1JQQA 4C92B 2LCCA 4AG1C 3CXCP 1TTHB 5LJ3h 2XICA 4M75F 2QYZA 4OMFB 3G6ET 1RAGB 4P5NA 2M02A 3M9QA 2DJZA 3EG1A 2QASA 2J6KA 3S3MA 2O88A 1VQ7A 2PU9B 2OTJT 3CCQQ 5L23A 2OAWA 3FEOA 1PNJA 1QCFA 3RMQA 2DJQA 2PVGB 2XMFA 2BE7D 2F2WA 4OMPA 4VUBA 4OB2B 3VUBA 2E5QA 4C8QG 2BZYA 1QVPA 5KE2A 3UPUA 1BCMA 1NM7A 2XDDA 3S3NA 4BACA 3ASKA 2GCXA 1YHQA 2EYWA 5FLXE 3CC4T 3WVEB 1YJNT 4M77D 3VYGA 1X6GA 2WSFE 1YFNA 2RD1A 4XTYA 4LD6A 3RKXA 4QKUA 1ACMB 3PMTA 1BK2A 2A0FB 5DY9A 4HT8A 2NUPB 2HEQA 2CT4A 2QQSA 1KC8U 2EGAA 3JCMe 1BI3A 1MMNA 5L8RE 3OW2S 3CC2Q 2J6OA 2MI6A 4KGXB 2CSIA 2ECZA 2C06A 4XU1A 4LDWA 2HQHA 2DTIA 4RG2A 4RTZA 3OYJA 2MYSA 3WVDB 1HXDA 2HL3A 1OPKA 3E9GA 4PJOC 3OA6A 1VQ4Q 4OVAA 2FZCB 1PSFA 3FDRA 3FJ5A 3CD6Q 1YIJA 2V1QA 4LDYA 1E6HA 5D6YA 2ZPGB 4A54A 3C4SA 1JJ2P 4EMKB 1QVFA 1GFCA 1R8OB 4F7UG 1QP2A 1KQ2A 2P4TA 1ZX6A 4JRPA 1LNXA 4DEXA 5I22A 4RTYA 2YHTA 4CC7A 1MGQA 2F2VA 2DKGA 2QXFA 4ORZA 2BE9B 1ZSGA 3CMEQ 4C5GA 1VQ9Q 3QSUA 2LRQA 1M3BA 2A36A 5CKDA 5HKCA 4M7DE 2VYTA 4DEYA 1SG5A 1X6OA 2EGEA 1ZSZB 3MCAB 2H3JA 1VQLQ 1K73C 2RHUA 4O5VA 2ED1A 2FZGB 2E70A 4KH0B 3EG2A 2GTOA 2J06A 4E6RA 3OSVA 1E6GA 2LT1A 3JB9G 2JM8A 3PE0A 5J26A 1VQKQ 2CUBA 3JB9I 4BY6B 3JCMg 5GMKh 3ZL7C 2CZ1B 1VYUA 3QO3A 3A8LB 2E65A 3CCMQ 5I2SA 1GCPA 5KYWA 3QDRB 3MJXA 3O8VA 4M7AB 4N0AA 3CPWS 1VUBA 3HHTB 3EFSA 4M77G 1M2VB 3MP8A 1RACB 1TG0A 2F5KA 5IHIA 2QEXT 2DL3A 2HCKA 1EZZB 2KRMA 4C5EA 1CKBA 1NPPA 2E10A 3REAB 4M75B 2SRCA 3I56Q 4PK4A 2DXUA 3S6WA 3TQ7P 1YHQT 4MDXA 1G3WA 1TH7A 3EFOA 1OZ3A 4M7DD 4QW2A 3RESA 3HTRA 1W2BA 1BI0A 5I21A 5A0LA 1YBYA 4A4HA 1MNDA 2JOYA 3JCMP 1WPYA 4N4IA 1T0HA 3A98A 1QVFP 1YN8A 4AFZC 4FYXB 1D1AA 2K2VA 1AT1B 3VV0A 1M90U 1B07A 3O5ZA 5KYUB 1UEBA 5M9OA 3HL8A 2DILA 5GAN5 2JXBA 2GGRA 2EKOA 1C0MA 4Y91A 4XAXB 3EHQA 4XTWA 1VQMA 2CSQA 4LXCA 2O9SA 4CRIA 3QXEB 1VQ6A 2CP6A 4R56A 1SF9A 1ZLMA 1M1KU 4MMKA 1VIEA 2YLCA 3CCRA 1AD5A 5EG2A 2P0PA 1HD3A 1WJSA 1H3ZA 3I55Q 3OYEA 2RMOA 1ZA2B 4AMCA 1VQ5A 2XKOC 1V76A 3NPFA 1X27A 2JW4A 1AWXA 2DX1A 2ZPIB 1RAAB 5LJ5f 4ELYC 4J7IA 3T9NA 5KCOA 4MMLA 1D0ZA 2QA4A 2M0OA 3G6EQ 4BI4A 3LGFA 1X2QA 1NZ9A 4C8QF 1G8XA 2JNGA 2FZKB 2E12A 2OTJQ 5HK0A 1YJWA 3TVTA 4GLMA 5AYFA 1D0YA 1K1ZA 3SWNB 4LDUA 2JJ9A 4J83A 2JMCA 2H8HA 4IUTA 3OS5A 4LUEA 1QVFS 2RQRA 4M7AG 2ABLA 3PT9A 3UT1A 3CPFA 1Q7YR 4M7DG 5GMKj 4BDYA 1W2BP 2X3XD 1QW1A 4F7UA 4DOWA 3MEVA 2RM4A 2KRNA 2K3YA 2YUQA 2SEMA 2DBKA 3CC4Q 3R6OA 1K9MU 4HVWA 4J6WA 1YJNQ 2NUTA 3INZA 1W1FA 1IREB 1KJWA 5GMKe 3CCJQ 4FT4A 2EJFA 2F69A 2V8JA 4OGCA 4FYYB 2Y4YA 1B7TA 4RCBA 1JRIA 1BIBA 3PNWC 1KQSP 3LW5E 4M7DC 1WNLA 2X35A 4A53A 4IUQA 4C92A 3S3OA 2YT6A 3U23A 4F7UF 2KT1A 3TSZA 4EDUA 3LGLA 1W70A 1OPLA 3A8GB 4OGEA 1BB9A 4JLGA 1JBMA 1G3SA 1SSFA 2O9VA 2FPDA 4E7ZA 2HSPA 5FWBA 1SRMA 2DIGA 4AT1B 1NBEB 3JCMd 3OY9A 1FXXA
chains in the Genus database with same CATH topology
1VYTA 1AOJA 1WXTA 2K7AA 2YUOA 1S1NA 4A63B 2NUZA 1ABQA 1J3TA 1GRIA 2LJ1A 2DBMA 2LMJA 2RQUA 2OJ2A 2DL8A 2K2MA 3UF4A 1V1CA 2RQWA 4RTXA 4Z88A 2ENMA 1U3OA 2YUPA 1T0JA 2AKKA 1JEGA 5IH2A 1M30A 2EPDA 4Z89A 1K9AA 2BZ8A 2K3BA 2D8HA 3C0CA 1JXOA 1T3SA 2RPNA 4HXJA 1QKWA 1WDXA 4ESRA 4OMOA 5ECAA 1RLQC 2JM9A 1IO6A 2CH4A 4IIMA 1M3AA 2DNUA 1KFZA 1AWWA 2C0TA 1K0XA 1WX6A 1FMKA 1RUWA 1H3HA 1ZUUA 2L2PA 1KIKA 3JV3A 2VKNA 4RTTA 1JQQA 2K9GA 3UATA 3LH5A 5EC7A 4AG1C 1M27C 1M3CA 2LX7A 1RI9A 1VA7A 3PVLA 2CH4W 4RTVA 1NG2A 1ZUKA 1UJYA 3EG1A 4WCIA 2J6KA 4OMNA 2DM1A 2O88A 2LQWA 4J9DA 5L23A 1NLOC 1U06A 1YWOA 2OAWA 2DL7A 1PNJA 1QCFA 2GNCA 3NGPA 2LCSA 2DJQA 2EBPA 1K0SA 2XMFA 2CDTA 2V1RA 2F2WA 2C0IA 1AWOA 4OMPA 2A28A 4J9CA 2KE9A 1HSQA 2BZYA 2KROA 2L3SA 2VVKA 1VYVA 1NM7A 3M0PA 4JZ4A 4CC4B 4KRTA 2HDAA 3M0QA 2W10A 1QWEA 2EYWA 1ABOA 1BBZA 2J7IA 1X6GA 3QWXX 2KBTA 2W0ZA 2HBWA 1BK2A 1EFNA 1M8MA 3M0SA 5IHNA 2HEQA 2CT4A 1PRMC 3NHNA 1GBRA 2EGAA 5HCKA 1NEBA 4JJDA 1BU1A 2L3PA 1PRLC 2LJ0A 3THKA 1CSKA 1NYFA 1CKAA 1G2BA 1Y57A 2J6OA 3KFVA 2CSIA 2ECZA 1AVZC 3VS5A 2LP5A 1YP5A 4RTZA 2I0NA 2AZVA 4OMQA 2DL4A 1JO8A 1OPKA 4CC3A 3VS7A 2RNAA 2KNBB 1QKXA 1Z9ZA 3FJ5A 2KRSA 2K79A 1WXUA 1WI7A 4ZNXA 1UJ0A 2V1QA 2DE0X 1AZGB 2A08A 5IXFA 1E6HA 2ED0A 2FG0A 2DA9A 2K6DA 2KYMA 1GBQA 2KXDA 1GFCA 3IQLA 2LJ3A 4LUDA 2DMOA 1ARKA 1ZX6A 4HCKA 4DEXA 2EGCA 5I22A 3NMZC 2G6FX 4RTYA 2KEAA 4CC7A 2F2VA 1QWFA 1JU5C 1PWTA 4ORZA 1ZSGA 4EIKA 3UA7A 4RTWA 4AFSC 3I5SA 1M3BA 2A36A 1I1JA 2LNHB 2EW3A 4DEYA 2EGEA 3RNJA 3VS0A 1TUCA 2ED1A 3EG2A 2GTOA 2J06A 2P4RA 4LNPA 4E6RA 1WXBA 2RQTA 1E6GA 2JT4A 3PVQA 4F17A 2JM8A 1UECA 3PE0A 4JJBA 2CUBA 1B3QA 1OEBA 4AG2C 1NYGA 2AK5A 2PNIA 2BTTA 3ZL7C 2JS0A 2MOXA 1AZEA 4LN2A 1SHFA 1VYUA 4HVVA 4D8KA 4JZ3A 4AFUC 1GCPA 3VS1A 2O2OA 2L3QA 1OOTA 2EKHA 2FEIA 3RBBB 4RUGA 3VS4A 1TG0A 5IHIA 2PZ1A 2DL3A 2HCKA 2KRMA 1CKBA 3REAB 1K4US 1I07A 2SRCA 1WA7A 4J9GA 1YNZA 1W6XA 1YWPA 3VS3A 4OMLA 2KR3A 2MIOA 2DLPA 1WIEA 4F14A 2AKLA 1WLPB 2FO0A 1AWJA 2DRMA 2FPEA 1X2KA 2FRWA 1T0HA 5FWCA 4F16A 2J6FA 1SPKA 3A98A 3I9QA 2D0NA 1YN8A 1UE9A 4AFZC 1GL5A 1PKSA 2EYZA 1U5SA 2M0YA 2ROTA 2VWFA 3VS6A 2FPFA 1B07A 3O5ZA 2DVJA 2F2XA 1A0NB 2A37A 2DILA 1GCQC 2JXBA 2GGRA 1NLPC 2OI3A 1SHGA 3EHQA 2M51A 3VRZA 1I0CA 2KGTA 1T3LA 2CSQA 1G83A 2O9SA 4J9HA 3EGUA 1LCKA 1GCQA 1ZLMA 3M0TA 1SEMA 1ZUYA 3H0HA 4J9BA 1H8KA 5GJWB 2O31A 1AD5A 1N5ZA 2PTKA 4JJCA 3VS2A 2YDLA 1FYNA 5FW9A 1HD3A 2LQNA 3H0FA 2RMOA 3ULRB 2LZ6B 1UDLA 1X69A 1MV0B 1AEYA 3SEMA 3NPFA 1X27A 2JW4A 2ROLA 4OMMA 1AWXA 1PKTA 1UG1A 3SHWA 2C0OA 3M0UA 2FRYA 2X3WD 4RTUA 2DX1A 1RLPC 4IIOA 5GJVB 1WYXA 2BZXA 2MCNA 3VRYA 2D8JA 2J05A 3I5RA 1K76A 2NWMA 1UHFA 1WFWA 1HJDA 1SRLA 2GTJA 1UTIA 1X2QA 2EVRA 2GQIA 5I11A 4J9EA 3UA6A 4K11A 1UGVA 2E5KA 4D8DA 2YSQA 3H0IA 4LE9A 3TVTA 2D1XA 4GLMA 1H92A 1K1ZA 4FSSA 2DRKA 4AFQC 2JMCA 2H8HA 3TSWA 4LUEA 1TUDA 2RQRA 1MUZA 5IXBA 2ABLA 4X1VA 2DYBA 2X3XD 1MV3A 1UFFA 1JXMA 1XOVA 4HVUA 4J9IA 1X6BA 4Z8AA 3GBQA 2KRNA 2YUQA 4GBQA 2SEMA 2ESWA 3EHRA 2DBKA 2GBQA 3REBB 4J9FA 4HVWA 1Z9QA 2IIMA 4JPBW 1W1FA 2AZSA 2JMAA 1KJWA 4M4ZA 4R0KA 2CREA 3QWYA 1E7OA 3H41A 4Y92A 3CQTA 1UUEA 1NEGA 1ZBJA 2RF0A 2YUNA 2RQVA 1KSWA 1OV3A 3EG3A 3R6NA 3EG0A 1UHCA 2DL5A 2YT6A 3U23A 1PHTA 1SSHA 2KT1A 2EYXA 3TSZA 2CT3A 2JTEA 1W70A 1OPLA 1BB9A 2EQIA 2RN8A 2KT8A 2KXCA 3M0RA 2O9VA 1GFDA 2KYBA 2CUDA 2FPDA 1QLYA 2HSPA 2L0AA 1X43A 5FWBA 1SRMA 3I35A 2EYYA 2B86A 2QDLA 2JS2A 4QT7A 1Y0MA 4CC2A 2DF6A 1YCSB 5IHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYT A;  1AOJ A;  1WXT A;  2K7A A;  2YUO A;  1S1N A;  4A63 B;  2NUZ A;  1ABQ A;  1J3T A;  1GRI A;  2LJ1 A;  2DBM A;  2LMJ A;  2RQU A;  2OJ2 A;  2DL8 A;  2K2M A;  3UF4 A;  1V1C A;  2RQW A;  4RTX A;  4Z88 A;  2ENM A;  1U3O A;  2YUP A;  1T0J A;  2AKK A;  1JEG A;  5IH2 A;  1M30 A;  2EPD A;  4Z89 A;  1K9A A;  2BZ8 A;  2K3B A;  2D8H A;  3C0C A;  1JXO A;  1T3S A;  2RPN A;  4HXJ A;  1QKW A;  1WDX A;  4ESR A;  4OMO A;  5ECA A;  1RLQ C;  2JM9 A;  1IO6 A;  2CH4 A;  4IIM A;  1M3A A;  2DNU A;  1KFZ A;  1AWW A;  2C0T A;  1K0X A;  1WX6 A;  1FMK A;  1RUW A;  1H3H A;  1ZUU A;  2L2P A;  1KIK A;  3JV3 A;  2VKN A;  4RTT A;  1JQQ A;  2K9G A;  3UAT A;  3LH5 A;  5EC7 A;  4AG1 C;  1M27 C;  1M3C A;  2LX7 A;  1RI9 A;  1VA7 A;  3PVL A;  2CH4 W;  4RTV A;  1NG2 A;  1ZUK A;  1UJY A;  3EG1 A;  4WCI A;  2J6K A;  4OMN A;  2DM1 A;  2O88 A;  2LQW A;  4J9D A;  5L23 A;  1NLO C;  1U06 A;  1YWO A;  2OAW A;  2DL7 A;  1PNJ A;  1QCF A;  2GNC A;  3NGP A;  2LCS A;  2DJQ A;  2EBP A;  1K0S A;  2XMF A;  2CDT A;  2V1R A;  2F2W A;  2C0I A;  1AWO A;  4OMP A;  2A28 A;  4J9C A;  2KE9 A;  1HSQ A;  2BZY A;  2KRO A;  2L3S A;  2VVK A;  1VYV A;  1NM7 A;  3M0P A;  4JZ4 A;  4CC4 B;  4KRT A;  2HDA A;  3M0Q A;  2W10 A;  1QWE A;  2EYW A;  1ABO A;  1BBZ A;  2J7I A;  1X6G A;  3QWX X;  2KBT A;  2W0Z A;  2HBW A;  1BK2 A;  1EFN A;  1M8M A;  3M0S A;  5IHN A;  2HEQ A;  2CT4 A;  1PRM C;  3NHN A;  1GBR A;  2EGA A;  5HCK A;  1NEB A;  4JJD A;  1BU1 A;  2L3P A;  1PRL C;  2LJ0 A;  3THK A;  1CSK A;  1NYF A;  1CKA A;  1G2B A;  1Y57 A;  2J6O A;  3KFV A;  2CSI A;  2ECZ A;  1AVZ C;  3VS5 A;  2LP5 A;  1YP5 A;  4RTZ A;  2I0N A;  2AZV A;  4OMQ A;  2DL4 A;  1JO8 A;  1OPK A;  4CC3 A;  3VS7 A;  2RNA A;  2KNB B;  1QKX A;  1Z9Z A;  3FJ5 A;  2KRS A;  2K79 A;  1WXU A;  1WI7 A;  4ZNX A;  1UJ0 A;  2V1Q A;  2DE0 X;  1AZG B;  2A08 A;  5IXF A;  1E6H A;  2ED0 A;  2FG0 A;  2DA9 A;  2K6D A;  2KYM A;  1GBQ A;  2KXD A;  1GFC A;  3IQL A;  2LJ3 A;  4LUD A;  2DMO A;  1ARK A;  1ZX6 A;  4HCK A;  4DEX A;  2EGC A;  5I22 A;  3NMZ C;  2G6F X;  4RTY A;  2KEA A;  4CC7 A;  2F2V A;  1QWF A;  1JU5 C;  1PWT A;  4ORZ A;  1ZSG A;  4EIK A;  3UA7 A;  4RTW A;  4AFS C;  3I5S A;  1M3B A;  2A36 A;  1I1J A;  2LNH B;  2EW3 A;  4DEY A;  2EGE A;  3RNJ A;  3VS0 A;  1TUC A;  2ED1 A;  3EG2 A;  2GTO A;  2J06 A;  2P4R A;  4LNP A;  4E6R A;  1WXB A;  2RQT A;  1E6G A;  2JT4 A;  3PVQ A;  4F17 A;  2JM8 A;  1UEC A;  3PE0 A;  4JJB A;  2CUB A;  1B3Q A;  1OEB A;  4AG2 C;  1NYG A;  2AK5 A;  2PNI A;  2BTT A;  3ZL7 C;  2JS0 A;  2MOX A;  1AZE A;  4LN2 A;  1SHF A;  1VYU A;  4HVV A;  4D8K A;  4JZ3 A;  4AFU C;  1GCP A;  3VS1 A;  2O2O A;  2L3Q A;  1OOT A;  2EKH A;  2FEI A;  3RBB B;  4RUG A;  3VS4 A;  1TG0 A;  5IHI A;  2PZ1 A;  2DL3 A;  2HCK A;  2KRM A;  1CKB A;  3REA B;  1K4U S;  1I07 A;  2SRC A;  1WA7 A;  4J9G A;  1YNZ A;  1W6X A;  1YWP A;  3VS3 A;  4OML A;  2KR3 A;  2MIO A;  2DLP A;  1WIE A;  4F14 A;  2AKL A;  1WLP B;  2FO0 A;  1AWJ A;  2DRM A;  2FPE A;  1X2K A;  2FRW A;  1T0H A;  5FWC A;  4F16 A;  2J6F A;  1SPK A;  3A98 A;  3I9Q A;  2D0N A;  1YN8 A;  1UE9 A;  4AFZ C;  1GL5 A;  1PKS A;  2EYZ A;  1U5S A;  2M0Y A;  2ROT A;  2VWF A;  3VS6 A;  2FPF A;  1B07 A;  3O5Z A;  2DVJ A;  2F2X A;  1A0N B;  2A37 A;  2DIL A;  1GCQ C;  2JXB A;  2GGR A;  1NLP C;  2OI3 A;  1SHG A;  3EHQ A;  2M51 A;  3VRZ A;  1I0C A;  2KGT A;  1T3L A;  2CSQ A;  1G83 A;  2O9S A;  4J9H A;  3EGU A;  1LCK A;  1GCQ A;  1ZLM A;  3M0T A;  1SEM A;  1ZUY A;  3H0H A;  4J9B A;  1H8K A;  5GJW B;  2O31 A;  1AD5 A;  1N5Z A;  2PTK A;  4JJC A;  3VS2 A;  2YDL A;  1FYN A;  5FW9 A;  1HD3 A;  2LQN A;  3H0F A;  2RMO A;  3ULR B;  2LZ6 B;  1UDL A;  1X69 A;  1MV0 B;  1AEY A;  3SEM A;  3NPF A;  1X27 A;  2JW4 A;  2ROL A;  4OMM A;  1AWX A;  1PKT A;  1UG1 A;  3SHW A;  2C0O A;  3M0U A;  2FRY A;  2X3W D;  4RTU A;  2DX1 A;  1RLP C;  4IIO A;  5GJV B;  1WYX A;  2BZX A;  2MCN A;  3VRY A;  2D8J A;  2J05 A;  3I5R A;  1K76 A;  2NWM A;  1UHF A;  1WFW A;  1HJD A;  1SRL A;  2GTJ A;  1UTI A;  1X2Q A;  2EVR A;  2GQI A;  5I11 A;  4J9E A;  3UA6 A;  4K11 A;  1UGV A;  2E5K A;  4D8D A;  2YSQ A;  3H0I A;  4LE9 A;  3TVT A;  2D1X A;  4GLM A;  1H92 A;  1K1Z A;  4FSS A;  2DRK A;  4AFQ C;  2JMC A;  2H8H A;  3TSW A;  4LUE A;  1TUD A;  2RQR A;  1MUZ A;  5IXB A;  2ABL A;  4X1V A;  2DYB A;  2X3X D;  1MV3 A;  1UFF A;  1JXM A;  1XOV A;  4HVU A;  4J9I A;  1X6B A;  4Z8A A;  3GBQ A;  2KRN A;  2YUQ A;  4GBQ A;  2SEM A;  2ESW A;  3EHR A;  2DBK A;  2GBQ A;  3REB B;  4J9F A;  4HVW A;  1Z9Q A;  2IIM A;  4JPB W;  1W1F A;  2AZS A;  2JMA A;  1KJW A;  4M4Z A;  4R0K A;  2CRE A;  3QWY A;  1E7O A;  3H41 A;  4Y92 A;  3CQT A;  1UUE A;  1NEG A;  1ZBJ A;  2RF0 A;  2YUN A;  2RQV A;  1KSW A;  1OV3 A;  3EG3 A;  3R6N A;  3EG0 A;  1UHC A;  2DL5 A;  2YT6 A;  3U23 A;  1PHT A;  1SSH A;  2KT1 A;  2EYX A;  3TSZ A;  2CT3 A;  2JTE A;  1W70 A;  1OPL A;  1BB9 A;  2EQI A;  2RN8 A;  2KT8 A;  2KXC A;  3M0R A;  2O9V A;  1GFD A;  2KYB A;  2CUD A;  2FPD A;  1QLY A;  2HSP A;  2L0A A;  1X43 A;  5FWB A;  1SRM A;  3I35 A;  2EYY A;  2B86 A;  2QDL A;  2JS2 A;  4QT7 A;  1Y0M A;  4CC2 A;  2DF6 A;  1YCS B;  5IHK A; 
#chains in the Genus database with same CATH topology
 2K7A A;  1AOJ A;  5KYW B;  2YUO A;  4A63 B;  1J3T A;  1BYM A;  2DBM A;  2RQU A;  3CCR T;  2DL8 A;  2K2M A;  3ER0 A;  4C92 F;  2RQW A;  3G71 A;  4J5Y A;  3EFR A;  4Z88 A;  2ENM A;  3JB9 F;  2YRC A;  3RER A;  1T0J A;  2CZ0 B;  2X4X A;  4XU2 A;  1OX8 A;  5FRN A;  1D0X A;  1M30 A;  2F5T X;  4Z89 A;  3C95 A;  1VQ5 T;  2BZ8 A;  3NTK A;  3QHS A;  1T3S A;  2QGG A;  4HKE A;  2RPN A;  1M9S A;  5HY6 A;  4OMO A;  2QAZ A;  1RLQ C;  5GAN 6;  2F1L A;  4IIM A;  2NUP A;  3HRU A;  1MMA A;  2QA4 T;  1KK7 A;  1AWW A;  4J7F A;  3VUZ A;  3OYC A;  1PD0 A;  3CCS A;  3GNF B;  2VKN A;  3BW1 A;  3LH5 A;  3CCU A;  3GPL A;  5CKF A;  1M90 C;  1YJW T;  2XG8 D;  3FB9 A;  2PVD B;  2WAC A;  1OQK A;  1RI9 A;  1VA7 A;  2DD4 A;  2CH4 W;  1NPR A;  3OYG A;  1NG2 A;  1TOV A;  2A7Y A;  2ZCF B;  2QEX Q;  1H64 1;  4J9D A;  2HZY A;  4EMK A;  1U06 A;  2DL7 A;  3NGP A;  2LCS A;  2GNC A;  1RI0 A;  1U8R A;  3CCE A;  2CDT A;  1VOM A;  1OUL A;  1AWO A;  4C8Q B;  5KYY B;  4J9C A;  3G4S Q;  5CKB A;  4ZGE B;  4HA8 A;  2KRO A;  1YIT T;  1IRX A;  2KI7 A;  2L3S A;  3PTA A;  4JZ4 A;  4KRT A;  3EAE A;  3CCL A;  1BCO A;  3KXT A;  1QWE A;  1ABO A;  3HKS A;  5GAM f;  1BBZ A;  5LJ3 d;  4II1 A;  2OX7 A;  3M5A A;  2KBT A;  5J39 A;  1D1C A;  1K73 U;  2HBW A;  2EIF A;  1KHI A;  2D6F A;  1EFN A;  2MPX C;  1M8M A;  3M0S A;  3CBM A;  4JJN K;  1X01 A;  2L3R A;  2RJF A;  3BDU A;  5HCK A;  4E7K A;  3KUF A;  2DZC A;  3THK A;  1PRL C;  1NE8 A;  1NYF A;  4XK8 E;  1Y57 A;  1NJI R;  3KFV A;  3VS5 A;  1YP5 A;  2I0N A;  1QCN A;  4M7A A;  1M2V A;  3OS2 A;  1QKX A;  1VQN A;  2K79 A;  2RA2 A;  2HL5 C;  5KYX B;  1UJ0 A;  2A08 A;  3G71 T;  4C0G A;  4F7U B;  4PKC C;  2RHX A;  4M75 A;  2CP5 A;  4NS5 A;  2LJ3 A;  2RH2 A;  1Q82 R;  2DMO A;  2HQE A;  3OYM A;  2EGC A;  2LQK A;  2LCL A;  1ZHI A;  1JU5 C;  3QZ9 B;  3EH2 A;  4EIK A;  2R57 A;  3OMC A;  1DJ7 B;  3UA7 A;  4M7A F;  1EX4 A;  2VGM A;  3NTH A;  1VQP A;  2EJ9 A;  4KGZ B;  3I5S A;  4J6Y A;  2FYK A;  2CZ6 B;  2RHZ A;  3E1S A;  2JN0 A;  4ZTJ A;  2DTO A;  4KBM B;  2P4R A;  1N9S A;  2K57 A;  2RQT A;  4M78 E;  5KYU A;  2YWW A;  3L2U A;  4J6X A;  2QK0 A;  2PNI A;  1RAD B;  4DBF A;  2KQW A;  3URG A;  4FW1 A;  2JS0 A;  4N0A C;  2MOX A;  4B9X A;  2KVQ G;  5FRM A;  3UWN A;  4LN2 A;  3MPU B;  1SHF A;  3EH1 A;  2FHD A;  2VAS A;  2Z0W A;  3EGX B;  3ZBD A;  4AFU C;  1AHJ B;  4M77 B;  2L3Q A;  5KE3 A;  2H3E B;  3FC3 A;  3CCE T;  3V7C A;  2ATC B;  3L1A A;  2LC4 A;  1PD1 A;  3RBB B;  2PZ1 A;  4IUP A;  2RK2 A;  1OZ2 A;  3BE3 A;  2LTO A;  1I07 A;  2VC8 A;  4KUI A;  4GLK A;  4PJO G;  3CCL T;  4J9G A;  1W6X A;  5D6X A;  2OAU A;  4LDX A;  2JTF A;  1WIE A;  4F14 A;  2AKL A;  1QVG A;  1AWJ A;  2O01 E;  5KCH A;  4M78 D;  1N6A A;  3J80 E;  2FRW A;  2OTL Q;  2RJD A;  5FWC A;  1SPK A;  3I9Q A;  1Y96 A;  2RJE A;  5GAN f;  1UE9 A;  3SWN A;  1YI2 A;  3JCM b;  3MP6 A;  1XNI A;  4RKU E;  1YJ9 A;  4C0D C;  1U5S A;  1Q95 G;  3QUI A;  2ZZD A;  2BKD N;  5GAN 7;  2EWN A;  4B6M A;  2QDY B;  3DLM A;  1KD1 R;  3CXC S;  1BI2 A;  2M51 A;  2EQM A;  3VRZ A;  3HRS A;  2KGT A;  2HAX A;  1T3L A;  1VQN T;  4Z02 A;  4J9H A;  3X28 B;  8ATC B;  2EJG A;  1GCQ A;  3M0T A;  1ZUY A;  4J9B A;  5GJW B;  1QQJ A;  2O31 A;  2RHY A;  2YDL A;  3ZEH A;  1O9S A;  1FYN A;  5FW9 A;  2QA4 Q;  2LZ6 B;  1AEY A;  4Y28 E;  3GLX A;  2YRD A;  4PJN A;  3EG9 B;  3A1P A;  1PKT A;  4FCY A;  1XTD A;  5FU7 B;  1NJI C;  4DBQ A;  1TSF A;  2MWP A;  1YJW Q;  2EAY A;  3HP9 A;  5GJV B;  2HQX A;  2MWO A;  2HMA A;  1UB4 A;  2D8J A;  2J05 A;  3I5R A;  3BFM A;  3TU4 K;  1WFW A;  2Y90 A;  1I4K 1;  2GTJ A;  3H9N A;  5I11 A;  4J9E A;  1JB0 E;  3CMA A;  4K11 A;  2D1X A;  3C94 A;  1VQO A;  4EPC A;  1VQ7 T;  1Q82 C;  4A4K A;  4JRI A;  4OF1 A;  1TUD A;  4M7D B;  3CCV A;  2RI5 A;  5IXB A;  4ME7 A;  4M75 E;  4X1V A;  1PSE A;  3A8M B;  1YIT Q;  1MV3 A;  1QVG P;  1IZ6 A;  1I5L A;  1JXM A;  4BI8 B;  2DIQ A;  4C0F A;  1S72 Q;  2B8A A;  3GBQ A;  3MEU A;  4M78 G;  4GBQ A;  1OI1 A;  5LJ3 f;  2RHI A;  4J9F A;  1Z9Q A;  2IIM A;  3G7Z A;  1JJ2 S;  2AZS A;  2WSC E;  1I5O B;  3H6Z A;  3JB9 J;  2ZPH B;  2CRE A;  4HCC A;  1IHV A;  1P92 A;  2ZPB B;  1OV3 A;  1SSH A;  5FU6 B;  3JSC A;  4M78 C;  1TWB A;  2JTE A;  3AHU A;  2IG0 A;  1N27 A;  2RN8 A;  4JRK A;  4JS4 A;  3M0R A;  5GAN 3;  5GAO q;  1MMG A;  3MHX A;  4E7S A;  1GFD A;  1KQS A;  5CR2 A;  2DER A;  1X75 C;  4M75 D;  2BIV A;  3I35 A;  2VGN A;  1YIJ T;  3A5Z B;  4QT7 A;  1Y0M A;  2RJC A;  4WTO B;  2DF6 A;  3VS6 A;  5IHK A;  1OX9 A;  5D7U A;  4C5H A;  1S1N A;  2NUZ A;  4C8Q A;  5KYY A;  2DYI A;  2LMJ A;  2OJ2 A;  3X24 B;  3JAM E;  3CC2 A;  2IVW A;  3QKJ A;  3X26 B;  1U3O A;  3DKM A;  1WQW A;  4N4H A;  5IH2 A;  2DEU A;  4JDS A;  1I8F A;  3P8H A;  1K9A A;  4BE1 A;  2K3B A;  2D8H A;  5LJ5 j;  1B34 A;  1JXO A;  5DM7 R;  1VQ4 A;  4MDW A;  4HXJ A;  1QKW A;  3CD6 A;  3QII A;  3RKW A;  3BDL A;  4KUD K;  4QQG A;  1KD1 C;  1Y7X A;  1R0C B;  1WHK A;  4QVZ A;  1RUW A;  1Q7Y U;  1VIF A;  2VV5 A;  1H3H A;  4DBR A;  2L2P A;  4WF2 A;  5LJ5 e;  2K9G A;  3UAT A;  1Y96 B;  5EC7 A;  1M27 C;  2RI3 A;  4E7J A;  1M3C A;  1VQO T;  3CME A;  4PJO F;  2CP3 A;  9ATC B;  5GAN 8;  4DBH A;  1G3T A;  4EMK C;  3PVL A;  4RTV A;  3RIR A;  1RAE B;  3CCV T;  5KYX A;  1BIA A;  4WCI A;  2DM1 A;  1VQL A;  2LQW A;  1N8R R;  1M2O A;  4DOV A;  4FYW B;  1K8A R;  2EBP A;  2C0I A;  3PIP A;  2A28 A;  2E6Z A;  5GAM h;  1VQK A;  5C6S A;  5IN1 A;  2GFA A;  3TRE A;  4D6W A;  1ZSZ C;  2VVK A;  3GP8 A;  4CC4 B;  2EQU A;  3M59 A;  3CCM A;  3M55 A;  3M0Q A;  2JTM A;  2LNV A;  3HRT A;  4BY6 C;  2VXF A;  2X9H A;  3LLR A;  3HFO A;  1EIF A;  5J3B A;  1VQ8 A;  1PRM C;  3X20 B;  4J8O A;  4FL6 A;  1CSK A;  3E19 A;  5LJ5 g;  3HSB A;  1VQM T;  5GMK i;  1AVZ C;  3EGX A;  1VQ6 T;  4LDV A;  1Q86 R;  4M77 A;  4XTZ A;  2AZV A;  1M1G A;  4OMQ A;  2JVV A;  1JO8 A;  4A4E A;  4M75 C;  3VS7 A;  1IGQ A;  5IT9 E;  3QJ6 A;  4ZGD B;  1O75 A;  1WXU A;  1WI7 A;  3MO8 A;  2DE0 X;  1AZG B;  2KMT A;  5IXF A;  2FG0 A;  2DA9 A;  2K6D A;  1W2B S;  1C6V X;  1IB8 A;  4LUD A;  1GXI E;  1ARK A;  4HCK A;  2CYZ B;  2G6F X;  1U1T A;  2L8D A;  2KEA A;  1IHW A;  1QWF A;  4A4G A;  1VQ4 T;  2M9U A;  4HCB A;  2LDM A;  4M77 F;  4UC4 A;  4RTW A;  3FLG A;  3FIF A;  3QZ5 B;  2X4W A;  2M16 A;  2LNH B;  4FIB A;  3SB2 A;  3QPH A;  1F1B B;  3RNJ A;  1VQ7 Q;  1KQS S;  4MZT A;  2IPO B;  4L5G A;  5GMK m;  3OYL A;  3I55 A;  1WXB A;  4KGV B;  2JT4 A;  2COW A;  4F17 A;  2E64 A;  1IGU A;  1XJW B;  1B3Q A;  1OEB A;  3N5B B;  1NYG A;  2BTT A;  2K5I A;  3M54 A;  4C8Q E;  1AZE A;  3EGD A;  4HVV A;  3VS1 A;  3G6E A;  5CCA A;  3M56 A;  1YHQ Q;  1OOT A;  2EKH A;  2Y4X A;  3CC7 A;  1VQK T;  1LVK A;  2OTJ A;  3V7R A;  1TUG B;  3OBW A;  2CP0 A;  2EFI A;  2XU8 A;  1R0B G;  3EG9 A;  4PJO B;  1OYX A;  2KY9 A;  3CCM T;  1YNZ A;  5GAM j;  5GAN h;  1B34 B;  1YWP A;  4QVD A;  3OYH A;  1NJI U;  4JUV A;  4OML A;  4E7I A;  2DLP A;  4XTV A;  1WLP B;  1Q7Y C;  1R77 A;  4BE0 A;  2DRM A;  4EMG A;  2QQB A;  3CEY A;  4PJM A;  1VQ8 T;  3DB3 A;  1X2K A;  1WGS A;  5CQX A;  2GF7 A;  1N8R C;  5GAM e;  1YIJ Q;  3JCM Q;  2JZ2 A;  1GL5 A;  2CP2 A;  1PKS A;  3CCJ A;  1K8A C;  4O6J A;  4C8Q D;  3M53 A;  2FPF A;  3L2Z A;  2CP7 A;  4F7U E;  2DVJ A;  2F2X A;  4M7D A;  1Q82 U;  2A37 A;  1TS9 A;  1GCQ C;  2OI3 A;  2FVU A;  2PVO B;  1SHG A;  1I0C A;  4NOY A;  4JS5 A;  1G83 A;  3OMG A;  1I81 A;  1Q81 R;  3FJP A;  3OYD A;  4PFZ A;  3H0H A;  1N5Z A;  2PTK A;  1M8V A;  4JRQ A;  4LD9 K;  3HFN A;  2V8K A;  2LQN A;  4X34 A;  4C92 E;  3OYK A;  3L2R A;  2MF2 A;  4IUV A;  4M7D F;  1PG5 B;  1N9R A;  3SEM A;  1UG1 A;  2C0O A;  3LX7 A;  5CIU A;  3M0U A;  2X3W D;  4XU3 A;  1WHH A;  3CCS T;  1M4Z A;  1WHJ A;  3LWI A;  1VQO Q;  1Q86 C;  2BZX A;  2MCN A;  3CCU T;  1RAI B;  1WHL A;  3D7S B;  4JLI A;  2NWM A;  1UHF A;  3I55 T;  1WQ7 A;  4C5I A;  1UTI A;  3MKD A;  2EVR A;  3CCV Q;  4Q5W A;  2E5K A;  5A0D A;  3H0I A;  4LE9 A;  5GAM g;  1H92 A;  3V7S A;  4FSS A;  2RO0 A;  2DRK A;  5LJ5 d;  2G3R A;  1SKU B;  3TSW A;  4R55 A;  1MUZ A;  3V8K A;  2E3H A;  1WJR A;  3CC7 T;  4PFP A;  4M78 B;  3QDF A;  4XTX A;  4HVU A;  4J9I A;  2HNI A;  4C92 D;  3J81 E;  1RL2 A;  3EHR A;  2GBQ A;  3REB B;  1G3Y A;  3RR6 A;  1D3B B;  3JB9 D;  2COY A;  4XU0 A;  5GAN 4;  2QQA A;  5GAO m;  3TEE A;  2QEX A;  5LL6 S;  4R0K A;  2P0Q A;  2D0Q B;  1FMV A;  2K4Y A;  4EMH A;  2ZPE B;  3H41 A;  3VU3 C;  1QCO A;  1NEG A;  1ZBJ A;  1KD1 U;  3JCM f;  2YUN A;  2RQV A;  3G4S A;  3LH0 A;  3EG3 A;  5CVI A;  4XQ3 A;  3R6N A;  3EG0 A;  1UHC A;  5GAN j;  1VQM Q;  1PHT A;  1VQ6 Q;  3PFS A;  2EYX A;  3PMI A;  4F04 B;  3L42 A;  2CZ7 B;  3OS0 A;  3CCJ T;  2CT3 A;  2MK5 A;  4CI0 C;  1BI1 A;  4ZTF A;  4BI3 A;  3QJY A;  3CCR Q;  3M57 A;  3ZFJ A;  1U1S A;  3LWH A;  3Q1J A;  2KYB A;  1ZQ1 A;  2CUD A;  1QLY A;  2EQK A;  1WHG A;  3MEA A;  4C8Q C;  1D09 B;  3CPW P;  2L0A A;  4L6V 5;  1X43 A;  5GAN e;  3ME9 A;  3EGD B;  2B86 A;  2QDL A;  2NYS A;  4XTU A;  2O4X B;  1YCS B;  1VQ5 Q;  1KC8 R;  1ABQ A;  1GRI A;  2LJ1 A;  5LJ5 h;  1M1F A;  3UF4 A;  3J7A F;  1V1C A;  2YRV A;  3QYG B;  2YUP A;  2AKK A;  2DFU A;  1JEG A;  3SDZ A;  2E4H A;  3OB9 A;  2EPD A;  4E2F B;  1VQP T;  4ATO A;  1QP3 A;  3RUX A;  1WDX A;  3JCM X;  5ECA A;  2JM9 A;  2XD0 A;  2YXY A;  2CH4 A;  2P0K A;  7AT1 B;  1M3A A;  2DNU A;  1KFZ A;  2C0T A;  1WX6 A;  5CO7 A;  3SD4 A;  3JRZ A;  4OB3 B;  4M7A E;  1ZUU A;  3JB9 H;  1KIK A;  3TCJ A;  3JV3 A;  4RTT A;  1Q81 C;  2RB6 A;  1LPL A;  2R5M A;  1TU0 B;  2LX7 A;  2DEQ A;  4C92 G;  2DET A;  5GAO r;  4A4F A;  1PM3 A;  3PIO A;  5A0G A;  2E41 A;  1ZUK A;  2DO3 A;  1UJY A;  4OMN A;  5I2M A;  2KSS A;  5CKH A;  2QI2 A;  5GAN g;  3H8Z A;  1FX7 A;  1NLO C;  1YWO A;  3GF5 A;  1K0S A;  5LJ3 j;  4HCZ A;  4PLI A;  2EYQ A;  2V1R A;  3VJP A;  2KE9 A;  1HSQ A;  3OYF A;  3RDV A;  4ZN3 A;  4HT9 A;  3CCQ A;  2MAM A;  3OYY A;  1VYV A;  4C92 C;  3M0P A;  4NL2 A;  5IAY A;  2X51 A;  1LJO A;  1VQ8 Q;  2COZ A;  2QQR A;  2HDA A;  5LJ3 e;  2W10 A;  4PFO A;  1HYO A;  2GQV A;  4B9W A;  2J7I A;  4M7A D;  3QWX X;  1UGQ B;  3G4S T;  4TVR A;  2LVM A;  2W0Z A;  2EQJ A;  1YI2 T;  1ZBX A;  2HSE B;  2X4J A;  3L2V A;  1YJ9 T;  3C12 A;  2E1H A;  5A2Q E;  1ZA1 B;  5IHN A;  2WSE E;  3NHN A;  1GBR A;  1UGP B;  4M77 C;  1FMW A;  1NEB A;  2DTH A;  3A8H B;  4JJD A;  1BU1 A;  2QGF B;  2L3P A;  2LJ0 A;  4E7H A;  3G71 Q;  1XQH A;  3UDC A;  1D1B A;  1CKA A;  1G2B A;  1PC0 A;  5D6W A;  2FL7 A;  5GAM d;  1Y07 A;  2LP5 A;  2DL4 A;  2DXC A;  4CC3 A;  3E2U A;  3NTI A;  2RNA A;  2HKN A;  2KNB B;  2OTL A;  1Z9Z A;  2FB7 A;  2KRS A;  4ZNX A;  3LYI A;  2ED0 A;  2KYM A;  3M4G A;  1GBQ A;  1RAF B;  2KXD A;  4IUU A;  4PJO A;  2AHJ B;  1OU8 A;  1M90 R;  3IQL A;  3V8J A;  6AT1 B;  1MNE A;  1QVG S;  3GNG A;  1KQ1 A;  3CCS Q;  3NMZ C;  2CKK A;  4QVC A;  3CCU Q;  4RG8 A;  2L89 A;  1PWT A;  5DLO A;  1M1K R;  4AFS C;  2AT1 B;  2XK0 A;  2VB6 A;  4PJL A;  5LJ3 g;  5KYN A;  2K5F A;  1I1J A;  2DK3 A;  2EW3 A;  2HD0 A;  3CMA T;  3VS0 A;  4BUG A;  1TUC A;  1N8R U;  1M5Q 1;  5KH6 A;  3VYH B;  4LNP A;  1VQ9 A;  1KC8 C;  2PUK B;  1K8A U;  3CCE Q;  3PVQ A;  4PNO A;  5FRO A;  1UEC A;  4JJB A;  4KT0 E;  4AG2 C;  2LT4 A;  2AK5 A;  3MEW A;  3CC7 Q;  2XI9 A;  2QTV A;  3MET A;  3DB4 A;  4D8K A;  4JZ3 A;  3CCL Q;  1RAB B;  2O2O A;  2PQW A;  3X25 B;  1KG1 A;  3P8B B;  2FEI A;  4FYV B;  1UGR B;  4RUG A;  3VS4 A;  4ZN1 A;  5FU7 C;  2HBP A;  3JCM V;  2LQ8 A;  1WHM A;  3OBY A;  2QG9 B;  3CCQ T;  4DA4 A;  1FWZ A;  5HK3 A;  1K4U S;  1WA7 A;  3OYB A;  3F70 A;  3M58 A;  4M75 G;  4GY5 A;  1YIT A;  3VS3 A;  2YLB A;  2KR3 A;  4FM4 B;  8AT1 B;  2MIO A;  1Q86 U;  5GMK l;  1S72 A;  5AT1 B;  2FO0 A;  3QBY A;  2BUD A;  1LOJ A;  4ZGJ B;  1G5V A;  2DVE A;  3I56 A;  1K9M R;  2D9T A;  2FPE A;  4PL6 A;  3BY7 A;  4M7A C;  4F16 A;  1VQN Q;  2J6F A;  2L5Q A;  1OU9 A;  2P84 A;  2D0N A;  3FRN A;  2DAQ A;  2DXB A;  3E9F A;  2EYZ A;  3SFM A;  4C0Z A;  2XDB A;  2M0Y A;  2ROT A;  3GIB A;  2VWF A;  1A0N B;  1NLP C;  2XDP A;  2XHC A;  4X9C A;  2OTL T;  3PGG A;  4DQ2 A;  4M78 A;  3CC2 T;  3EGU A;  4FSX A;  3JCM c;  1LCK A;  3OQ5 A;  4N4G A;  5CK9 A;  1VQP Q;  3OYN A;  2NLU A;  1TXQ A;  3QG1 A;  1SEM A;  5GAN d;  1H8K A;  2AIR B;  1D3B A;  4JJC A;  3VS2 A;  1WZO A;  4PLL A;  4BE2 A;  3DLL A;  4MZP A;  3CD6 T;  1IXD A;  2QQ9 A;  3JCM W;  3H0F A;  5FU6 C;  4KH1 B;  3ULR B;  2X4Y A;  1UDL A;  1X69 A;  1MV0 B;  3WXM B;  2HKQ B;  2ROL A;  4OMM A;  3SHW A;  3OYA A;  5GAO p;  3G1J A;  2FRY A;  4RTU A;  4FU6 A;  1RLP C;  3RMS A;  4QQ6 A;  2VXE A;  3AT1 B;  4IIO A;  4M78 F;  3EFO B;  1WYX A;  4E47 A;  3VRY A;  4BB7 A;  1PCX A;  1K76 A;  3CME T;  1VQ9 T;  1HJD A;  1SRL A;  2K5L A;  2GQI A;  4IKF A;  2KDS A;  3RKY A;  3UA6 A;  2VUB A;  1UGV A;  3OYI A;  4D8D A;  2YSQ A;  1Y71 A;  5C0M A;  4V2S A;  2K3X A;  1W4S A;  2O4X A;  3GOX A;  1VQL T;  4X9D A;  4AFQ C;  2E6N A;  2QTX A;  3OW2 A;  4PJO E;  1UGS B;  3VKI A;  3M4Y A;  2DYB A;  4IUR A;  4BD3 A;  4KUL A;  4C0D B;  1UFF A;  4QQD A;  1M1K C;  3OS1 A;  1XOV A;  1X6B A;  4Z8A A;  1BKB A;  2DPP B;  4E7L A;  2I2L A;  3CXC A;  2ESW A;  3JCM h;  2CGH A;  3L2Q A;  4JPB W;  2DD5 A;  1KHC A;  2JMA A;  2M1H A;  4FT2 A;  1YI2 Q;  4M4Z A;  4ELZ C;  1YJ9 Q;  4PJJ A;  2JUF A;  4OB0 B;  3QWY A;  2ZAE A;  2ZGW A;  3SWN C;  1V29 B;  1E7O A;  4Y92 A;  3NFC A;  1S72 T;  3CQT A;  4YTL A;  4NL3 A;  1UUE A;  3CC4 A;  2RI2 A;  1YJN A;  5CQY A;  2RF0 A;  3I56 T;  1KSW A;  1ZSZ A;  1WJQ A;  3MP1 A;  2DL5 A;  3A8O B;  1QMC A;  3V8L A;  3OSS C;  1Q81 U;  3L2W A;  2R58 A;  1YCY A;  2EQI A;  5GAO n;  2KT8 A;  2KXC A;  4OB1 B;  2ZPF B;  1C1A A;  4PJO D;  4OP0 A;  3JCM J;  3KBG A;  5DLQ E;  2EYY A;  2JS2 A;  3QYH B;  4CC2 A;  1K73 R;  3CBP A;  2R5A A;  1VYT A;  1WXT A;  2CS7 A;  2RK1 A;  2MMP A;  1RAH B;  2DXT A;  3HPW A;  2LX9 A;  2E3I A;  4MZM A;  1HK9 A;  4RTX A;  3P8D A;  5GAO l;  4RMO A;  2V8I A;  1MMD A;  2KAF A;  2XID A;  3CPW A;  2GFU A;  4RCC A;  1K9M C;  5CAI A;  4ANJ A;  5GAN 2;  4FW2 A;  2KK4 A;  3C0C A;  3CMA Q;  2NUT B;  3CBO A;  4ESR A;  3OW2 P;  1IO6 A;  2DZ9 A;  2V26 A;  4BDZ A;  1K0X A;  2A3L A;  4M77 E;  1JJ2 A;  1FMK A;  4L59 A;  5CKE A;  2PUO B;  1MHN A;  1JQQ A;  4C92 B;  2LCC A;  4AG1 C;  3CXC P;  1TTH B;  5LJ3 h;  2XIC A;  4M75 F;  2QYZ A;  4OMF B;  3G6E T;  1RAG B;  4P5N A;  2M02 A;  3M9Q A;  2DJZ A;  3EG1 A;  2QAS A;  2J6K A;  3S3M A;  2O88 A;  1VQ7 A;  2PU9 B;  2OTJ T;  3CCQ Q;  5L23 A;  2OAW A;  3FEO A;  1PNJ A;  1QCF A;  3RMQ A;  2DJQ A;  2PVG B;  2XMF A;  2BE7 D;  2F2W A;  4OMP A;  4VUB A;  4OB2 B;  3VUB A;  2E5Q A;  4C8Q G;  2BZY A;  1QVP A;  5KE2 A;  3UPU A;  1BCM A;  1NM7 A;  2XDD A;  3S3N A;  4BAC A;  3ASK A;  2GCX A;  1YHQ A;  2EYW A;  5FLX E;  3CC4 T;  3WVE B;  1YJN T;  4M77 D;  3VYG A;  1X6G A;  2WSF E;  1YFN A;  2RD1 A;  4XTY A;  4LD6 A;  3RKX A;  4QKU A;  1ACM B;  3PMT A;  1BK2 A;  2A0F B;  5DY9 A;  4HT8 A;  2NUP B;  2HEQ A;  2CT4 A;  2QQS A;  1KC8 U;  2EGA A;  3JCM e;  1BI3 A;  1MMN A;  5L8R E;  3OW2 S;  3CC2 Q;  2J6O A;  2MI6 A;  4KGX B;  2CSI A;  2ECZ A;  2C06 A;  4XU1 A;  4LDW A;  2HQH A;  2DTI A;  4RG2 A;  4RTZ A;  3OYJ A;  2MYS A;  3WVD B;  1HXD A;  2HL3 A;  1OPK A;  3E9G A;  4PJO C;  3OA6 A;  1VQ4 Q;  4OVA A;  2FZC B;  1PSF A;  3FDR A;  3FJ5 A;  3CD6 Q;  1YIJ A;  2V1Q A;  4LDY A;  1E6H A;  5D6Y A;  2ZPG B;  4A54 A;  3C4S A;  1JJ2 P;  4EMK B;  1QVF A;  1GFC A;  1R8O B;  4F7U G;  1QP2 A;  1KQ2 A;  2P4T A;  1ZX6 A;  4JRP A;  1LNX A;  4DEX A;  5I22 A;  4RTY A;  2YHT A;  4CC7 A;  1MGQ A;  2F2V A;  2DKG A;  2QXF A;  4ORZ A;  2BE9 B;  1ZSG A;  3CME Q;  4C5G A;  1VQ9 Q;  3QSU A;  2LRQ A;  1M3B A;  2A36 A;  5CKD A;  5HKC A;  4M7D E;  2VYT A;  4DEY A;  1SG5 A;  1X6O A;  2EGE A;  1ZSZ B;  3MCA B;  2H3J A;  1VQL Q;  1K73 C;  2RHU A;  4O5V A;  2ED1 A;  2FZG B;  2E70 A;  4KH0 B;  3EG2 A;  2GTO A;  2J06 A;  4E6R A;  3OSV A;  1E6G A;  2LT1 A;  3JB9 G;  2JM8 A;  3PE0 A;  5J26 A;  1VQK Q;  2CUB A;  3JB9 I;  4BY6 B;  3JCM g;  5GMK h;  3ZL7 C;  2CZ1 B;  1VYU A;  3QO3 A;  3A8L B;  2E65 A;  3CCM Q;  5I2S A;  1GCP A;  5KYW A;  3QDR B;  3MJX A;  3O8V A;  4M7A B;  4N0A A;  3CPW S;  1VUB A;  3HHT B;  3EFS A;  4M77 G;  1M2V B;  3MP8 A;  1RAC B;  1TG0 A;  2F5K A;  5IHI A;  2QEX T;  2DL3 A;  2HCK A;  1EZZ B;  2KRM A;  4C5E A;  1CKB A;  1NPP A;  2E10 A;  3REA B;  4M75 B;  2SRC A;  3I56 Q;  4PK4 A;  2DXU A;  3S6W A;  3TQ7 P;  1YHQ T;  4MDX A;  1G3W A;  1TH7 A;  3EFO A;  1OZ3 A;  4M7D D;  4QW2 A;  3RES A;  3HTR A;  1W2B A;  1BI0 A;  5I21 A;  5A0L A;  1YBY A;  4A4H A;  1MND A;  2JOY A;  3JCM P;  1WPY A;  4N4I A;  1T0H A;  3A98 A;  1QVF P;  1YN8 A;  4AFZ C;  4FYX B;  1D1A A;  2K2V A;  1AT1 B;  3VV0 A;  1M90 U;  1B07 A;  3O5Z A;  5KYU B;  1UEB A;  5M9O A;  3HL8 A;  2DIL A;  5GAN 5;  2JXB A;  2GGR A;  2EKO A;  1C0M A;  4Y91 A;  4XAX B;  3EHQ A;  4XTW A;  1VQM A;  2CSQ A;  4LXC A;  2O9S A;  4CRI A;  3QXE B;  1VQ6 A;  2CP6 A;  4R56 A;  1SF9 A;  1ZLM A;  1M1K U;  4MMK A;  1VIE A;  2YLC A;  3CCR A;  1AD5 A;  5EG2 A;  2P0P A;  1HD3 A;  1WJS A;  1H3Z A;  3I55 Q;  3OYE A;  2RMO A;  1ZA2 B;  4AMC A;  1VQ5 A;  2XKO C;  1V76 A;  3NPF A;  1X27 A;  2JW4 A;  1AWX A;  2DX1 A;  2ZPI B;  1RAA B;  5LJ5 f;  4ELY C;  4J7I A;  3T9N A;  5KCO A;  4MML A;  1D0Z A;  2QA4 A;  2M0O A;  3G6E Q;  4BI4 A;  3LGF A;  1X2Q A;  1NZ9 A;  4C8Q F;  1G8X A;  2JNG A;  2FZK B;  2E12 A;  2OTJ Q;  5HK0 A;  1YJW A;  3TVT A;  4GLM A;  5AYF A;  1D0Y A;  1K1Z A;  3SWN B;  4LDU A;  2JJ9 A;  4J83 A;  2JMC A;  2H8H A;  4IUT A;  3OS5 A;  4LUE A;  1QVF S;  2RQR A;  4M7A G;  2ABL A;  3PT9 A;  3UT1 A;  3CPF A;  1Q7Y R;  4M7D G;  5GMK j;  4BDY A;  1W2B P;  2X3X D;  1QW1 A;  4F7U A;  4DOW A;  3MEV A;  2RM4 A;  2KRN A;  2K3Y A;  2YUQ A;  2SEM A;  2DBK A;  3CC4 Q;  3R6O A;  1K9M U;  4HVW A;  4J6W A;  1YJN Q;  2NUT A;  3INZ A;  1W1F A;  1IRE B;  1KJW A;  5GMK e;  3CCJ Q;  4FT4 A;  2EJF A;  2F69 A;  2V8J A;  4OGC A;  4FYY B;  2Y4Y A;  1B7T A;  4RCB A;  1JRI A;  1BIB A;  3PNW C;  1KQS P;  3LW5 E;  4M7D C;  1WNL A;  2X35 A;  4A53 A;  4IUQ A;  4C92 A;  3S3O A;  2YT6 A;  3U23 A;  4F7U F;  2KT1 A;  3TSZ A;  4EDU A;  3LGL A;  1W70 A;  1OPL A;  3A8G B;  4OGE A;  1BB9 A;  4JLG A;  1JBM A;  1G3S A;  1SSF A;  2O9V A;  2FPD A;  4E7Z A;  2HSP A;  5FWB A;  1SRM A;  2DIG A;  4AT1 B;  1NBE B;  3JCM d;  3OY9 A;  1FXX A; 
#chains in the Genus database with same CATH homology
 1VYT A;  1AOJ A;  1WXT A;  2K7A A;  2YUO A;  1S1N A;  4A63 B;  2NUZ A;  1ABQ A;  1J3T A;  1GRI A;  2LJ1 A;  2DBM A;  2LMJ A;  2RQU A;  2OJ2 A;  2DL8 A;  2K2M A;  3UF4 A;  1V1C A;  2RQW A;  4RTX A;  4Z88 A;  2ENM A;  1U3O A;  2YUP A;  1T0J A;  2AKK A;  1JEG A;  5IH2 A;  1M30 A;  2EPD A;  4Z89 A;  1K9A A;  2BZ8 A;  2K3B A;  2D8H A;  3C0C A;  1JXO A;  1T3S A;  2RPN A;  4HXJ A;  1QKW A;  1WDX A;  4ESR A;  4OMO A;  5ECA A;  1RLQ C;  2JM9 A;  1IO6 A;  2CH4 A;  4IIM A;  1M3A A;  2DNU A;  1KFZ A;  1AWW A;  2C0T A;  1K0X A;  1WX6 A;  1FMK A;  1RUW A;  1H3H A;  1ZUU A;  2L2P A;  1KIK A;  3JV3 A;  2VKN A;  4RTT A;  1JQQ A;  2K9G A;  3UAT A;  3LH5 A;  5EC7 A;  4AG1 C;  1M27 C;  1M3C A;  2LX7 A;  1RI9 A;  1VA7 A;  3PVL A;  2CH4 W;  4RTV A;  1NG2 A;  1ZUK A;  1UJY A;  3EG1 A;  4WCI A;  2J6K A;  4OMN A;  2DM1 A;  2O88 A;  2LQW A;  4J9D A;  5L23 A;  1NLO C;  1U06 A;  1YWO A;  2OAW A;  2DL7 A;  1PNJ A;  1QCF A;  2GNC A;  3NGP A;  2LCS A;  2DJQ A;  2EBP A;  1K0S A;  2XMF A;  2CDT A;  2V1R A;  2F2W A;  2C0I A;  1AWO A;  4OMP A;  2A28 A;  4J9C A;  2KE9 A;  1HSQ A;  2BZY A;  2KRO A;  2L3S A;  2VVK A;  1VYV A;  1NM7 A;  3M0P A;  4JZ4 A;  4CC4 B;  4KRT A;  2HDA A;  3M0Q A;  2W10 A;  1QWE A;  2EYW A;  1ABO A;  1BBZ A;  2J7I A;  1X6G A;  3QWX X;  2KBT A;  2W0Z A;  2HBW A;  1BK2 A;  1EFN A;  1M8M A;  3M0S A;  5IHN A;  2HEQ A;  2CT4 A;  1PRM C;  3NHN A;  1GBR A;  2EGA A;  5HCK A;  1NEB A;  4JJD A;  1BU1 A;  2L3P A;  1PRL C;  2LJ0 A;  3THK A;  1CSK A;  1NYF A;  1CKA A;  1G2B A;  1Y57 A;  2J6O A;  3KFV A;  2CSI A;  2ECZ A;  1AVZ C;  3VS5 A;  2LP5 A;  1YP5 A;  4RTZ A;  2I0N A;  2AZV A;  4OMQ A;  2DL4 A;  1JO8 A;  1OPK A;  4CC3 A;  3VS7 A;  2RNA A;  2KNB B;  1QKX A;  1Z9Z A;  3FJ5 A;  2KRS A;  2K79 A;  1WXU A;  1WI7 A;  4ZNX A;  1UJ0 A;  2V1Q A;  2DE0 X;  1AZG B;  2A08 A;  5IXF A;  1E6H A;  2ED0 A;  2FG0 A;  2DA9 A;  2K6D A;  2KYM A;  1GBQ A;  2KXD A;  1GFC A;  3IQL A;  2LJ3 A;  4LUD A;  2DMO A;  1ARK A;  1ZX6 A;  4HCK A;  4DEX A;  2EGC A;  5I22 A;  3NMZ C;  2G6F X;  4RTY A;  2KEA A;  4CC7 A;  2F2V A;  1QWF A;  1JU5 C;  1PWT A;  4ORZ A;  1ZSG A;  4EIK A;  3UA7 A;  4RTW A;  4AFS C;  3I5S A;  1M3B A;  2A36 A;  1I1J A;  2LNH B;  2EW3 A;  4DEY A;  2EGE A;  3RNJ A;  3VS0 A;  1TUC A;  2ED1 A;  3EG2 A;  2GTO A;  2J06 A;  2P4R A;  4LNP A;  4E6R A;  1WXB A;  2RQT A;  1E6G A;  2JT4 A;  3PVQ A;  4F17 A;  2JM8 A;  1UEC A;  3PE0 A;  4JJB A;  2CUB A;  1B3Q A;  1OEB A;  4AG2 C;  1NYG A;  2AK5 A;  2PNI A;  2BTT A;  3ZL7 C;  2JS0 A;  2MOX A;  1AZE A;  4LN2 A;  1SHF A;  1VYU A;  4HVV A;  4D8K A;  4JZ3 A;  4AFU C;  1GCP A;  3VS1 A;  2O2O A;  2L3Q A;  1OOT A;  2EKH A;  2FEI A;  3RBB B;  4RUG A;  3VS4 A;  1TG0 A;  5IHI A;  2PZ1 A;  2DL3 A;  2HCK A;  2KRM A;  1CKB A;  3REA B;  1K4U S;  1I07 A;  2SRC A;  1WA7 A;  4J9G A;  1YNZ A;  1W6X A;  1YWP A;  3VS3 A;  4OML A;  2KR3 A;  2MIO A;  2DLP A;  1WIE A;  4F14 A;  2AKL A;  1WLP B;  2FO0 A;  1AWJ A;  2DRM A;  2FPE A;  1X2K A;  2FRW A;  1T0H A;  5FWC A;  4F16 A;  2J6F A;  1SPK A;  3A98 A;  3I9Q A;  2D0N A;  1YN8 A;  1UE9 A;  4AFZ C;  1GL5 A;  1PKS A;  2EYZ A;  1U5S A;  2M0Y A;  2ROT A;  2VWF A;  3VS6 A;  2FPF A;  1B07 A;  3O5Z A;  2DVJ A;  2F2X A;  1A0N B;  2A37 A;  2DIL A;  1GCQ C;  2JXB A;  2GGR A;  1NLP C;  2OI3 A;  1SHG A;  3EHQ A;  2M51 A;  3VRZ A;  1I0C A;  2KGT A;  1T3L A;  2CSQ A;  1G83 A;  2O9S A;  4J9H A;  3EGU A;  1LCK A;  1GCQ A;  1ZLM A;  3M0T A;  1SEM A;  1ZUY A;  3H0H A;  4J9B A;  1H8K A;  5GJW B;  2O31 A;  1AD5 A;  1N5Z A;  2PTK A;  4JJC A;  3VS2 A;  2YDL A;  1FYN A;  5FW9 A;  1HD3 A;  2LQN A;  3H0F A;  2RMO A;  3ULR B;  2LZ6 B;  1UDL A;  1X69 A;  1MV0 B;  1AEY A;  3SEM A;  3NPF A;  1X27 A;  2JW4 A;  2ROL A;  4OMM A;  1AWX A;  1PKT A;  1UG1 A;  3SHW A;  2C0O A;  3M0U A;  2FRY A;  2X3W D;  4RTU A;  2DX1 A;  1RLP C;  4IIO A;  5GJV B;  1WYX A;  2BZX A;  2MCN A;  3VRY A;  2D8J A;  2J05 A;  3I5R A;  1K76 A;  2NWM A;  1UHF A;  1WFW A;  1HJD A;  1SRL A;  2GTJ A;  1UTI A;  1X2Q A;  2EVR A;  2GQI A;  5I11 A;  4J9E A;  3UA6 A;  4K11 A;  1UGV A;  2E5K A;  4D8D A;  2YSQ A;  3H0I A;  4LE9 A;  3TVT A;  2D1X A;  4GLM A;  1H92 A;  1K1Z A;  4FSS A;  2DRK A;  4AFQ C;  2JMC A;  2H8H A;  3TSW A;  4LUE A;  1TUD A;  2RQR A;  1MUZ A;  5IXB A;  2ABL A;  4X1V A;  2DYB A;  2X3X D;  1MV3 A;  1UFF A;  1JXM A;  1XOV A;  4HVU A;  4J9I A;  1X6B A;  4Z8A A;  3GBQ A;  2KRN A;  2YUQ A;  4GBQ A;  2SEM A;  2ESW A;  3EHR A;  2DBK A;  2GBQ A;  3REB B;  4J9F A;  4HVW A;  1Z9Q A;  2IIM A;  4JPB W;  1W1F A;  2AZS A;  2JMA A;  1KJW A;  4M4Z A;  4R0K A;  2CRE A;  3QWY A;  1E7O A;  3H41 A;  4Y92 A;  3CQT A;  1UUE A;  1NEG A;  1ZBJ A;  2RF0 A;  2YUN A;  2RQV A;  1KSW A;  1OV3 A;  3EG3 A;  3R6N A;  3EG0 A;  1UHC A;  2DL5 A;  2YT6 A;  3U23 A;  1PHT A;  1SSH A;  2KT1 A;  2EYX A;  3TSZ A;  2CT3 A;  2JTE A;  1W70 A;  1OPL A;  1BB9 A;  2EQI A;  2RN8 A;  2KT8 A;  2KXC A;  3M0R A;  2O9V A;  1GFD A;  2KYB A;  2CUD A;  2FPD A;  1QLY A;  2HSP A;  2L0A A;  1X43 A;  5FWB A;  1SRM A;  3I35 A;  2EYY A;  2B86 A;  2QDL A;  2JS2 A;  4QT7 A;  1Y0M A;  4CC2 A;  2DF6 A;  1YCS B;  5IHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...