1X2QA

Solution structure of the sh3 domain of the signal transducing adaptor molecule 2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
88
structure length
88
Chain Sequence
GSSGSSGSEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSNFVTTNLNIETEAAAVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal transducing adapter molecule 2
publication title Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x2qA00
3UF4A 4J9GA 1ARKA 2X3XD 2YDLA 1PRMC 3UA7A 4AG1C 2DJQA 2BZXA 2GTOA 3PVLA 4GLMA 2EPDA 2GGRA 1E6GA 1G2BA 2EKHA 2FEIA 5FWCA 3UA6A 2KXCA 2SEMA 3EHRA 2RQUA 4F16A 2FPEA 3R6NA 1WXTA 1WXBA 2J05A 2O9VA 1JQQA 2CREA 2PNIA 3A98A 2LJ1A 1NEGA 3KFVA 2RN8A 2V1QA 4D8DA 4F14A 3VS2A 2DVJA 2KGTA 1EFNA 1W70A 2FRWA 2BTTA 1K76A 2VWFA 1WDXA 4QT7A 4WCIA 3VS6A 4J9CA 2DM1A 2F2XA 1NM7A 1SSHA 2PZ1A 2QDLA 1T3SA 2PTKA 2LQWA 2DNUA 2NUZA 4JPBW 1CKBA 4DEXA 2JT4A 2C0TA 1SRLA 5GJWB 4JJBA 1GCQC 2RQVA 1UGVA 1UG1A 1NG2A 1UJ0A 4M4ZA 2KRNA 2DL4A 1VYVA 2CDTA 3QWXX 2YUQA 1CSKA 1QCFA 2O31A 3ULRB 2CH4W 1YWOA 2B86A 1VA7A 4JZ4A 3VS4A 2ROLA 4EIKA 2E5KA 2K3BA 1Y57A 2YUNA 1NYFA 2EGCA 4J9FA 3REBB 1K9AA 1MV0B 1HD3A 4RTTA 3NMZC 3REAB 2KE9A 1GFCA 2D0NA 2P4RA 1FMKA 1UECA 2AZSA 3GBQA 1PRLC 2KBTA 1QWEA 1UFFA 2LMJA 1K1ZA 1ZUKA 1U3OA 2EQIA 2D8HA 1VYUA 4AFZC 1TG0A 2OI3A 1JO8A 2EGAA 1NLPC 3JV3A 1KIKA 1WX6A 2LP5A 3NGPA 2C0IA 2DMOA 4IIOA 4LN2A 1AWXA 1BB9A 4IIMA 4ORZA 1KFZA 3VS1A 2FG0A 1K0XA 2VVKA 3VRYA 1ZBJA 1ZUUA 3O5ZA 5HCKA 2O9SA 2JMAA 1NEBA 3FJ5A 1T3LA 2EYWA 4F17A 1OPLA 4J9DA 1GBQA 2JM9A 2F2VA 3U23A 2A36A 1GBRA 3M0QA 3ZL7C 2CT3A 2LJ3A 1AWWA 2OAWA 3NPFA 2JMCA 1BBZA 2DX1A 3TSZA 2BZ8A 1I1JA 2V1RA 2EYXA 1TUCA 2GBQA 4ESRA 1UTIA 3H0FA 2NWMA 2AZVA 1YNZA 2AK5A 1UHCA 2LQNA 1CKAA 1GL5A 1H8KA 3THKA 1BU1A 2MOXA 1WYXA 1ZX6A 2EYZA 4LE9A 1V1CA 1WFWA 4JJDA 2J06A 2ROTA 1JEGA 1YN8A 5IHIA 1JXOA 4RUGA 1E7OA 2FPDA 4CC2A 1A0NB 1KJWA 2RMOA 1AZEA 1X2QA 1N5ZA 2IIMA 2KT1A 5FW9A 2KEAA 2HEQA 1PKSA 2L3PA 2AKLA 1T0JA 3H0HA 4OMNA 1WA7A 2LJ0A 3CQTA 1TUDA 2K6DA 4HCKA 4HVUA 3VS3A 1W6XA 2M0YA 2HDAA 1JU5C 3I9QA 5EC7A 4A63B 2DBKA 3EG0A 2HCKA 3NHNA 2DBMA 3RBBB 1YCSB 1X6GA 4X1VA 2CH4A 2LZ6B 2X3WD 4J9IA 1WI7A 5GJVB 2YUOA 4GBQA 2K2MA 1I0CA 4RTZA 3M0RA 1ABQA 1AWJA 2OJ2A 1H92A 2AKKA 2SRCA 3VRZA 5I11A 4K11A 1MUZA 4J9BA 4HXJA 3VS7A 1Y0MA 2J6FA 2CSQA 3LH5A 2ABLA 1SHFA 4LUEA 2CUDA 4AG2C 2L2PA 1BK2A 2A28A 2DYBA 3IQLA 1NLOC 2A37A 3VS0A 1PKTA 1ZUYA 4OMPA 2RQWA 1UHFA 2JS0A 2W10A 3I35A 3EHQA 1QKWA 2DLPA 4KRTA 1OPKA 5FWBA 2O88A 2L0AA 1X6BA 3EGUA 1UE9A 2DL7A 5IHNA 4RTXA 1X2KA 4CC4B 1OEBA 4FSSA 2J6OA 2A08A 2DA9A 2RPNA 1IO6A 1WXUA 4JJCA 4RTYA 2KYMA 2CUBA 4OMOA 2CSIA 2O2OA 2YSQA 4Z8AA 1M3CA 4AFSC 1QWFA 2L3SA 2I0NA 1QLYA 1WIEA 2D1XA 2DE0X 5IXBA 1GCPA 2G6FX 1LCKA 1AVZC 1U5SA 2DILA 4E6RA 1ABOA 1B3QA 3PE0A 2ED1A 1HJDA 2JTEA 1X69A 4CC3A 1B07A 2C0OA 1RLPC 1OOTA 2RF0A 2JXBA 2GQIA 2K79A 4R0KA 4RTUA 2ECZA 4OMLA 2GNCA 1WLPB 2F2WA 3SEMA 4AFQC 2J7IA 4HVWA 1SHGA 2LCSA 2W0ZA 3H0IA 2KXDA 1JXMA 3RNJA 3TVTA 2KROA 3M0PA 2LX7A 2M51A 1SEMA 1H3HA 1RI9A 2FPFA 1M8MA 3EG3A 1M27C 1YWPA 3H41A 5L23A 1OV3A 1Z9QA 2YUPA 1YP5A 2L3QA 2ENMA 2EYYA 2J6KA 1UDLA 1K0SA 4HVVA 2RQTA 5I22A 1T0HA 1W1FA 1AD5A 2ESWA 1X27A 1RLQC 2KNBB 4JZ3A 1M3BA 2GTJA 2D8JA 5IXFA 2K9GA 1HSQA 1U06A 1GCQA 3TSWA 2DRMA 2YT6A 2JW4A 3M0SA 2EW3A 4CC7A 4OMMA 1Z9ZA 1NYGA 2MIOA 4DEYA 2JS2A 3EG1A 4LNPA 2DL8A 2RNAA 1MV3A 4Y92A 5IHKA 4AFUC 1AOJA 4OMQA 1S1NA 1VYTA 2HBWA 1XOVA 2DF6A 1QKXA 2H8HA 2JM8A 2KRSA 2LNHB 2RQRA 5IH2A 2HSPA 4Z89A 1SPKA 2ED0A 3UATA 1M3AA 4LUDA 4J9HA 1PWTA 2DRKA 2EBPA 1KSWA 2CT4A 2MCNA 4J9EA 1PNJA 1E6HA 2BZYA 3I5RA 2EGEA 3VS5A 4RTWA 3M0UA 1PHTA 2KT8A 1G83A 5ECAA 2FRYA 3I5SA 2KRMA 3PVQA 1UUEA 2K7AA 1I07A 1AZGB 2KR3A 2EVRA 3C0CA 3QWYA 2XMFA 1AWOA 1UJYA 2DL3A 4RTVA 2DL5A 3M0TA 1J3TA 1X43A 3EG2A 1SRMA 1ZSGA 3SHWA 1GFDA 2FO0A 4D8KA 1M30A 4ZNXA 1GRIA 2VKNA 1FYNA 1ZLMA 1RUWA 1K4US 4Z88A 2KYBA 1AEYA
chains in the Genus database with same CATH superfamily
1Y7XA 2HKNA 2DERA 2YDLA 3UA7A 3EH1A 4FSXA 1QVGP 2M0OA 2FEIA 1VQOA 1HK9A 2RQUA 4M7DG 3P8HA 2O9VA 3JB9D 2LJ1A 3V7CA 2H3EB 3X25B 1S72T 1ZA1B 2V1QA 4F14A 3CCVT 2X4YA 3QIIA 1PCXA 4XK8E 1EFNA 3VUBA 4M75D 1QP2A 1WDXA 3JCMV 2KY9A 4J9CA 4X9CA 3M5AA 3OS2A 1SF9A 4J6YA 1NM7A 2QDLA 4QVDA 4M7DE 3UWNA 1RAIB 2NUZA 3CC7A 3CBOA 4JPBW 5I2SA 1CKBA 3CEYA 2JT4A 2C0TA 1SRLA 4DEXA 2P0QA 1N8RU 4M75A 1AHJB 1NE8A 4FIBA 1UJ0A 5KCHA 1OQKA 2EJFA 2Z0WA 3JRZA 1Q86C 3GPLA 4M78G 2CH4W 1YWOA 2RK1A 4JZ4A 3OYBA 1YHQT 1I5LA 4EIKA 2K3BA 2YUNA 1JRIA 1UGRB 1NYFA 4J9FA 5GAN6 1HD3A 1MV0B 2E12A 4LD6A 1K8AC 3HFOA 2D0NA 2P4RA 4MDXA 2DETA 3OYNA 2E3IA 4FW1A 5GANg 3G4SQ 1YITA 4LDXA 1YJWA 2XU8A 1UFFA 3EH2A 1ZUKA 3BFMA 2OI3A 4C5IA 3JV3A 2EKOA 2R57A 1KIKA 4LXCA 2CGHA 4N4HA 3QG1A 1W2BA 4LN2A 2HL5C 2DPPB 4ATOA 4EMHA 4ORZA 1KFZA 2RHIA 3E1SA 2FG0A 4KUIA 3JCMh 1WQ7A 1VIEA 1K9MR 2JUFA 3CCVA 4QQDA 4M75F 2DD5A 2NUTA 3CXCA 3QJ6A 4C8QF 3X26B 3VU3C 4J9DA 8AT1B 1FMWA 2JM9A 3CC2A 2F2VA 1NBEB 1NPPA 1YJNA 4DA4A 3SFMA 1YI2A 1Q81U 1LPLA 3INZA 2OAWA 4N0AC 3BW1A 5KYNA 3TSZA 3MHXA 2BZ8A 2FB7A 4M78C 1B7TA 1RAFB 3FC3A 1VOMA 2VASA 4UC4A 3H0FA 4X34A 5FU7C 1VQLA 5CKEA 2AK5A 1UHCA 2EYQA 2M1HA 3HHTB 1BU1A 4JLGA 1VQ6A 1ZX6A 4BDYA 2EYZA 1ZSZB 5CO7A 2JNGA 3CCLQ 1JEGA 3FLGA 3X28B 3CCRA 4PJLA 5A0GA 1JXOA 3L2RA 1W4SA 3CCST 4EDUA 1X01A 3Q1JA 2V8KA 1N5ZA 2CZ0B 3VYHB 3V8KA 2IIMA 5FW9A 1PC0A 2HNIA 4E7JA 4BY6C 2L3PA 2HEQA 1VQ7A 1VIFA 1T0JA 3H0HA 4M77D 4OMNA 2EIFA 3CQTA 2PVGB 5J26A 2LT4A 4HCKA 4HVUA 1YJ9A 4F7UA 4DBFA 1W6XA 1RABB 2CP5A 2E65A 1YIJQ 2GQVA 4L5GA 5GAOp 3AT1B 2RI3A 4A63B 3F70A 2DBKA 4LDVA 3MKDA 4X1VA 3G6EQ 2CH4A 2LZ6B 2R58A 1WI7A 2YUOA 4GBQA 4M77A 2GCXA 3OYMA 4RTZA 5CQXA 2D9TA 4FT4A 2NUPB 3M0RA 4AMCA 1ABQA 1QVFP 1VQ8T 2LTOA 3SD4A 3VS7A 3J7AF 3LLRA 2J6FA 1M90C 5GAN3 4LDYA 3LH5A 4J7FA 1O75A 1RL2A 4QVZA 3DLMA 4ELZC 2L2PA 1M1GA 3IQLA 3E19A 1ZUYA 2DO3A 2RQWA 4DQ2A 2LQ8A 1VQ4T 4C0DC 3HKSA 3EHQA 2OTJQ 1QKWA 4KRTA 1OPKA 2O88A 3EGUA 3S3NA 5IHNA 4CC4B 5GANd 4FSSA 2J6OA 5EG2A 2MAMA 1VQKT 5GMKl 2CUBA 1KC8U 4KBMB 3CPWS 4C92B 1D09B 2V26A 4BACA 1QWFA 2GFAA 2L3SA 4IUUA 2I0NA 2D1XA 1LCKA 2HQHA 1U5SA 3OB9A 2YHTA 1ABOA 4BDZA 2ED1A 3QUIA 4CC3A 2VXFA 2RF0A 1QW1A 2ECZA 1TTHB 4OMLA 2QTVA 1G3WA 2LCSA 1IB8A 2MK5A 2W0ZA 3V7SA 1VQPQ 3LWIA 2A0FB 3FRNA 4PJJA 3H0IA 5A2QE 3TU4K 1VQNQ 5GAOm 5DY9A 4PFOA 2QEXA 1OV3A 2YUPA 1V76A 1K0SA 5FRMA 1D0ZA 1D0YA 2X4XA 3G71A 4PLLA 1ZHIA 2PQWA 3QKJA 1VQ9Q 2D0QB 2MF2A 5LJ3f 1KD1R 3UDCA 2GTJA 3I55Q 4PFPA 1HSQA 1GCQA 3E9FA 4OMMA 3HTRA 2QGFB 4PJOC 2P84A 2AHJB 5LJ5g 1UGQB 1MV3A 2E70A 5IHKA 4AFUC 1UB4A 1S1NA 3AHUA 2HBWA 1XOVA 2DF6A 2QDYB 4X9DA 2H8HA 2KRSA 2HSPA 1K73U 4XTVA 4M78F 1M3AA 4LUDA 1X75C 4NL2A 5GAN8 1KQSS 3OW2A 4F7UB 3OMCA 4II1A 4KT0E 4J9EA 3KXTA 4FCYA 5D6WA 4EMGA 1UGPB 4GLKA 3CD6Q 1IHWA 4FL6A 3I5SA 4QW2A 4OB0B 2LVMA 1RAEB 4IUVA 3M56A 3GP8A 1C6VX 2QK0A 4FYYB 1OI1A 2EVRA 3C0CA 3CPWP 3M4YA 3N5BB 3C94A 3QWYA 1UJYA 3RUXA 3ASKA 3OYKA 4HCZA 2DL5A 1UGSB 3GOXA 2E6NA 4RCBA 1LVKA 1J3TA 2LC4A 1SRMA 1GFDA 1WHHA 4ZNXA 3MCAB 2PU9B 1ZLMA 1G8XA 1LJOA 1ZSZC 2K5IA 2DAQA 3UF4A 1M1KU 1PRMC 4AG1C 2DJQA 3G4ST 4M75E 2BZXA 2GTOA 4CRIA 4GLMA 3CCQQ 1QVGS 3SWNA 1E6GA 4C92G 1YFNA 2RJCA 1N27A 5FWCA 2KXCA 2SEMA 3EHRA 4L59A 5HY6A 1BCMA 2FPEA 3TEEA 4NL3A 1JQQA 2PNIA 3CCUQ 5GAMj 2VYTA 4RKUE 2KGTA 2EQUA 2RO0A 4N4GA 1W70A 4MMLA 1VQMA 5CKBA 5AT1B 1PSEA 5CKFA 2BUDA 1NJIU 2DM1A 4R55A 5D7UA 2YLBA 2DYIA 2F2XA 2EAYA 2PZ1A 2DEUA 1QCOA 2RI2A 2GFUA 5KCOA 2MMPA 4JRKA 2QA4A 3VYGA 2RQVA 1UGVA 4M4ZA 2KRNA 1TU0B 2DXCA 3C95A 1M1FA 2CDTA 1OX9A 2VGMA 3X20B 2B86A 3VS4A 4C0GA 1Y57A 4EPCA 3OYFA 1PD1A 2EGCA 2O4XB 1RI0A 2IPOB 4RTTA 3PMTA 1VQ5A 4R56A 3CCLT 5LJ3h 5LJ5d 3E2UA 2F69A 3VJPA 3OY9A 1UECA 3JCMW 2RHUA 1G3YA 3G7ZA 3DB4A 1PRLC 2KBTA 4C92C 5CR2A 2MPXC 3MO8A 4MZTA 5CKHA 2RB6A 1KG1A 2EQIA 1N8RR 2D8HA 1TG0A 2EGAA 5HK0A 4JRPA 3FJPA 1B34A 2EWNA 3JCMb 1YIJT 3CXCS 1M5Q1 1F1BB 1WHJA 1ZUUA 1K9MC 3GIBA 3G6ET 1T3LA 3PT9A 2M16A 1MMDA 2EYWA 1OPLA 3MEUA 3HRUA 1GBQA 3CCJA 2EFIA 4N4IA 2DVEA 1BCOA 4MDWA 4PJOF 3OYJA 3U23A 2BIVA 3OSSC 3M0QA 3ZL7C 2CT3A 4XTXA 2LJ3A 3OS5A 3NPFA 2YLCA 2JMCA 4F7UE 1BBZA 5GMKi 2DX1A 3M4GA 2EYXA 3M58A 4J8OA 2E5QA 7AT1B 4OGEA 4M7AC 4JRIA 5KYYB 1I4K1 2NWMA 3QZ9B 1OULA 2OTJT 1Q7YC 3DKMA 1RADB 1M4ZA 4M77E 1JBMA 1CKAA 3QJYA 2MOXA 2OTLA 1WYXA 5LJ5e 1IGQA 4GY5A 2ROTA 1N6AA 4C8QD 3I56A 1E7OA 1A0NB 1KJWA 3JB9I 2RMOA 2DZ9A 4Y28E 1X2QA 1G3TA 1D3BA 3BY7A 1D1AA 3CCLA 2F1LA 2RJDA 3PGGA 4B6MA 3P8BB 1PM3A 1Q81R 3SWNB 1PKSA 2AKLA 4ZGDB 2LJ0A 4BE1A 2K6DA 4C8QA 4QVCA 5KYWA 2KVQG 4FT2A 2ZAEA 2FZKB 2F5TX 1JU5C 1TWBA 5EC7A 4JS4A 2HCKA 3EGDB 4QQ6A 1X6GA 1VQPT 2K2MA 5LL6S 4KH1B 2LT1A 4E7HA 1VQNT 1QVFS 2DTIA 1H92A 1U1SA 5I11A 3CCMQ 4K11A 3H6ZA 1MUZA 3JCMg 3CC4A 4ELYC 4HXJA 4JRQA 3LYIA 2ABLA 2QQAA 3WVDB 2Y4XA 4M7DC 2R5AA 4ZGJB 3L2QA 2DYBA 3OA6A 3VS0A 1W2BP 1JB0E 4IUQA 2W10A 2DLPA 3ME9A 2XG8D 4TVRA 1X6BA 1KHCA 3I55T 1P92A 3EGXA 4PJNA 3CXCP 1OEBA 1U1TA 3A8HB 1S72A 2RPNA 5GAOq 2CS7A 4J6XA 1WXUA 4JJCA 1XNIA 2KYMA 2VGNA 1BKBA 2CSIA 4HA8A 3RESA 4Z8AA 5IN1A 5GAN7 4Y91A 4AFSC 1WJSA 1D1BA 3EG9A 2RJEA 3M59A 3CMAQ 2G6FX 2VUBA 4KUDK 3LGFA 3CMEQ 4XU3A 1RLPC 5A0DA 1IRXA 1I81A 2RH2A 1VQOQ 2GNCA 3OYIA 1WLPB 3SEMA 2A7YA 1Q7YR 1Q82U 4D6WA 2OAUA 4PNOA 4EMKC 2QASA 2RA2A 2KROA 3CD6T 2LX7A 1RACB 4PKCC 1O9SA 3M53A 1RI9A 3MPUB 2FPFA 2QTXA 3EG3A 1YHQA 2CP2A 2E4HA 2QQ9A 2ZPBB 1KC8R 2ENMA 4J6WA 4C92F 2J6KA 5GANj 1UDLA 3MP6A 2HBPA 5I22A 1KHIA 1AD5A 2ESWA 2V8JA 3CC7Q 3T9NA 4Q5WA 3NFCA 1KD1C 9ATCB 4JS5A 3O8VA 4XTUA 3HSBA 1WHGA 2I2LA 1BI2A 1XQHA 2EW3A 3LWHA 1NYGA 2P4TA 3C12A 2MIOA 2PUKB 1IGUA 1ZBXA 1OX8A 5GAN4 3DB3A 3CCQT 2JS2A 4LNPA 3S6WA 3OS0A 4OB1B 2CP6A 2IG0A 3RMQA 1TSFA 2L3RA 1AOJA 3GF5A 4OMQA 1WZOA 1VYTA 5CKDA 3CCUT 5GAMf 2RHYA 4B9WA 2JM8A 2LNHB 4FYXB 2NLUA 3QXEB 1YBYA 4M75B 3UT1A 3A8MB 3MEWA 1OZ3A 3M57A 4BUGA 1YITQ 2CZ7B 5GAOr 2DXTA 2DRKA 1ACMB 3OBWA 5AYFA 2K2VA 5KYWB 1YJWQ 4M7AF 1E6HA 2CP3A 4KH0B 4B9XA 5GAN2 1JJ2A 2HMAA 5GAN5 3M0UA 5CVIA 3JCMd 2WSEE 1R77A 1G83A 2FRYA 1M2VA 3PVQA 3FDRA 1UUEA 2K7AA 3CCEQ 1D0XA 1G5VA 2ZPFB 3CCVQ 1BI0A 4ANJA 2GF7A 2L8DA 2XMFA 2Y90A 4JDSA 3CCSA 2DL3A 3M0TA 1K73R 3CC2Q 1ZSGA 4M78D 1YJNQ 3H8ZA 3L2WA 4A4KA 1GRIA 1MGQA 2JOYA 3NTIA 1YI2Q 2K3XA 1M8VA 4KGXB 3RIRA 2HSEB 2KYBA 1SG5A 4JJNK 4BI4A 1QP3A 3HP9A 3EGXB 4J9GA 2X3XD 3M54A 1MMNA 2BE9B 1EIFA 4N0AA 1EZZB 4QQGA 4VUBA 4M78A 1C1AA 1VQLQ 2NUTB 4XU1A 1WHMA 2X4WA 3ZEHA 4F16A 3SWNC 1Q86U 1WXBA 2J05A 2CREA 1M2OA 3A98A 2YRCA 2ZPHB 1VQ6Q 3CCQA 3KFVA 4KGVB 4XAXB 2RN8A 4D8DA 3QYGB 3CCRQ 3VS2A 2EQJA 3EG9B 2DVJA 4M7DF 1VQ8A 5L8RE 4E47A 1PD0A 2CYZB 1K76A 1K8AU 2XD0A 3VKIA 4MZMA 5A0LA 6AT1B 3ZBDA 1VQ7Q 1IZ6A 1SSHA 4FW2A 3MEAA 3JCMe 2KQWA 2PTKA 2LQWA 3RMSA 1RAHB 1VQ4A 1YJ9Q 3E9GA 4JJBA 3L1AA 1M1KR 1OU8A 3QDRB 5DLOA 3C4SA 4OF1A 2DL4A 1VQKA 2ZPEB 5KE2A 3M55A 3QWXX 2YUQA 1CSKA 1QCFA 2ZPIB 2V8IA 3EFRA 1TXQA 3ULRB 4DOWA 2QQBA 3OW2P 3TREA 2ROLA 4C5HA 2HL3A 4HCBA 4BD3A 3REBB 4DOVA 4L6V5 5FLXE 3REAB 2KE9A 3GNGA 3JB9J 1NJIR 2DJZA 2AZSA 2LX9A 3GBQA 2LQKA 3GLXA 4E7SA 2RD1A 3JB9G 1K1ZA 1YCYA 1U3OA 4M77B 3QHSA 1N8RC 1VYUA 2DIQA 3OMGA 4AFZC 1JO8A 1XTDA 3MP8A 2LP5A 3NGPA 5GMKj 4ZGEB 1VUBA 2C0IA 2DMOA 2WACA 4IIOA 4M75G 4ME7A 1BB9A 2HZYA 4KULA 5GAMh 1K0XA 2VVKA 2O9SA 1NEBA 5FROA 4BB7A 4F17A 2HAXA 3OS1A 4C5GA 1Y71A 3CCMT 2A36A 3OBYA 2DIGA 2DZCA 1M2VB 4QKUA 1AWWA 5LJ5j 4C8QE 3H9NA 2MYSA 4BE0A 4BI3A 4ESRA 2QEXQ 2AZVA 1YNZA 2BKDN 1H641 2CP0A 2LQNA 2QYZA 1GL5A 3THKA 2EJ9A 2DD4A 1WFWA 4JJDA 3SB2A 3META 3G71Q 2FHDA 1YN8A 4PL6A 5IHIA 4RUGA 2FPDA 3OQ5A 2CZ6B 1AZEA 4HKEA 1FWZA 1M90U 4LD9K 4PJOD 4PLIA 2KT1A 5KH6A 3L42A 4XQ3A 2EJGA 2HD0A 2ZCFB 1Q81C 2KEAA 1LOJA 5LJ3g 5FU6B 3CMAT 1QVPA 1PG5B 1TUDA 4M75C 3CMET 3VS3A 2M0YA 5D6YA 1M9SA 4PJOA 4A4FA 3OYHA 4MZPA 2EQMA 3RBBB 1YCSB 1VQOT 2C06A 1RAAB 3EFOA 2X3WD 3V8LA 4J9IA 5GJVB 2KI7A 2QGGA 3WXMB 2OX7A 3URGA 4C5EA 1R0BG 2OJ2A 2AKKA 2SRCA 3VRZA 1WNLA 4E2FB 1XJWB 1TUGB 2CSQA 5GANf 3QYHB 2DKGA 3FB9A 2CUDA 2WSFE 4NOYA 5DM7R 4KGZB 1BK2A 4WTOB 1NLOC 1W2BS 2A37A 3EAEA 3G4SA 1PKTA 3CC7T 4OB2B 2JS0A 1LNXA 1KQSA 3VV0A 2DL7A 4XU2A 4RTXA 3OYEA 2IVWA 4F7UG 2A08A 1IHVA 3HL8A 2RM4A 4RTYA 5GAOl 3BDUA 4IURA 3NTHA 1UEBA 3PMIA 1FX7A 5GAOn 1OU9A 4M77G 1KK7A 2RHXA 2P0PA 3MJXA 3LH0A 1WIEA 2DE0X 1KQ1A 3LGLA 1BI3A 4E7ZA 1AVZC 1MHNA 4E6RA 3PNWC 1B3QA 4A4HA 3HFNA 3JCMX 3LW5E 2JTEA 1B07A 1YITT 2JXBA 4JLIA 4RTUA 4R0KA 1Q95G 2VXEA 3RKYA 2F2WA 3CMEA 4AFQC 2J7IA 3A1PA 1MNDA 5GMKm 3RNJA 3TVTA 2JVVA 3M0PA 3RKXA 1SEMA 2O01E 1H3HA 5CIUA 1HXDA 1M27C 3H41A 1Z9QA 5DLQE 1YP5A 2LNVA 1KC8C 1QVGA 3CCET 1VQMQ 1D1CA 5HK3A 2QQSA 3JSCA 2LDMA 2RQTA 3J80E 2X4JA 1BIAA 1T0HA 2DTOA 4JUVA 4RG2A 1RLQC 3S3MA 3CC2T 2NUPA 4WF2A 2QA4Q 1YJNT 4MMKA 1YI2T 5IXFA 3ER0A 4AT1B 5GAMe 2JN0A 2PVDB 2JTMA 3DLLA 3M0SA 4CC7A 3OYYA 1Q82R 5FRNA 4DEYA 5CK9A 1YIJA 2LCCA 4FYWB 2HQXA 1VQLT 5LJ3d 4M77C 3JCMP 4A4EA 3G6EA 4C92D 3OSVA 2VC8A 1OZ2A 4J83A 3MEVA 1VQ6T 1VQ5Q 1QKXA 1QCNA 2XKOC 5IH2A 3CCRT 2QI2A 2WSCE 3UATA 1JJ2S 2KDSA 1PWTA 2EBPA 2CT4A 2XI9A 3QBYA 1PNJA 3V8JA 1VQ9T 2NYSA 3I5RA 4C92A 3LX7A 5CQYA 4PJOB 3CPFA 1VQ7T 3VS5A 2KSSA 3EFOB 4PJMA 4M78E 2PVOB 4OB3B 1YJ9T 5ECAA 1Y96A 2OTJA 2K4YA 4XTYA 2K5LA 1I07A 3G1JA 2H3JA 3JB9F 4CI0C 1AWOA 2M02A 2VV5A 5CAIA 3PTAA 3PIPA 3CCEA 4RTVA 3CCJQ 5GANh 4XTWA 1K73C 3SHWA 2VKNA 4M7AD 4RCCA 2E64A 2XICA 2XDBA 2HQEA 4FM4B 4Z88A 1K4US 1B34B 3FIFA 1AEYA 5IT9E 1ARKA 3KUFA 3L2ZA 3PVLA 2EPDA 5LJ3e 2GGRA 2RHZA 1G2BA 2EKHA 3ZFJA 2ZZDA 4M7AA 3UA6A 3R6NA 1WXTA 1VQPA 3S3OA 2COZA 2OTLQ 4HCCA 5FU6C 1NEGA 2DK3A 2RK2A 1VQNA 1WJRA 3I56Q 4IUPA 2FZCB 2FRWA 2BTTA 1V29B 4OGCA 2VWFA 2QG9B 4QT7A 4WCIA 3VS6A 1MMGA 1T3SA 2EQKA 2DNUA 2E6ZA 3FEOA 1VQ9A 5GJWB 4DBQA 1BIBA 4XTZA 4OMFB 1SSFA 1M1KC 3TQ7P 1GCQC 4E7KA 3I55A 1UG1A 1NG2A 5CCAA 1VYVA 5LJ5f 4BI8B 2FZGB 1Q86R 2O31A 1D3BB 3BDLA 3RDVA 3OYDA 2CZ1B 4M7DD 1VA7A 3SDZA 2QEXT 3OW2S 1K9MU 2E5KA 1OYXA 3CC4Q 3HRTA 2E1HA 3QZ5B 1WHKA 3QO3A 3JCMQ 1K9AA 4C8QB 1K8AR 1JJ2P 3WVEB 3NMZC 1GFCA 1PSFA 1NJIC 3HRSA 3G71T 1FMKA 4ZTFA 4OVAA 2E3HA 4ZTJA 2RI5A 4XU0A 3J81E 4M7DA 1QVFA 1QWEA 1ZA2B 2LMJA 2G3RA 3L2UA 1GXIE 1NLPC 1N9RA 1S72Q 1WX6A 3CD6A 4IUTA 1NZ9A 3RKWA 3BE3A 5M9OA 4NS5A 2R5MA 5I2MA 1AWXA 4IIMA 4LDWA 1Q7YU 5J3BA 3VS1A 2XDDA 3VRYA 1ZBJA 3O5ZA 5HCKA 1TS9A 2JMAA 2X35A 5HKCA 3FJ5A 1SKUB 4PJOG 5KYXA 1I5OB 4F04B 2HKQB 4F7UF 1WHLA 3A8OB 2KK4A 4P5NA 4DBRA 1GBRA 2X9HA 4E7IA 2ATCB 1Y96B 1BYMA 4C0FA 1C0MA 4M77F 5KE3A 3PFSA 3CBMA 2AIRB 5J39A 4A53A 2V1RA 1I1JA 4ZN3A 1IXDA 1TUCA 2GBQA 4PJOE 1UTIA 4PFZA 3HPWA 4EMKA 1YHQQ 1WJQA 2XHCA 3V7RA 1H8KA 3CCUA 4J7IA 4LE9A 1V1CA 4RG8A 1WPYA 2J06A 4BE2A 1FXXA 1DJ7B 4LDUA 2BE7D 1AT1B 4CC2A 1TOVA 4A4GA 3L2VA 4J5YA 4PK4A 3QDFA 1WA7A 2E10A 4M7AB 2O4XA 3OYCA 2MWPA 3QSUA 4O6JA 2HDAA 5GANe 3I9QA 8ATCB 3EG0A 5KYUA 3NHNA 2DBMA 2XK0A 5GMKh 1I0CA 1AWJA 2M9UA 1IREB 2CKKA 2JTFA 5GAMg 1I8FA 4J9BA 3A8GB 1VQMT 1Y0MA 1M90R 2DXUA 5C0MA 2DXBA 1SHFA 4LUEA 4AG2C 1R8OB 3MP1A 2LCLA 2A28A 3GNFB 2AT1B 4FYVB 1RAGB 2L5QA 4OMPA 1UHFA 3I35A 5LJ5h 2QA4T 5FWBA 2JZ2A 2L0AA 2CP7A 2P0KA 2KAFA 1UE9A 2FVUA 4C8QG 1X2KA 5IAYA 2YXYA 2FYKA 2DA9A 2COYA 1HYOA 1IO6A 3KBGA 2A3LA 2FL7A 2X51A 3CCSQ 4OMOA 1ZQ1A 4RMOA 2O2OA 2YSQA 4A54A 1M3CA 1MNEA 1NPRA 4M7DB 5KYYA 3JCMJ 1QQJA 4FU6A 3CPWA 1FMVA 3VUZA 3CBPA 1QLYA 3TCJA 1VQ5T 5IXBA 1GCPA 2KMTA 2DILA 3PIOA 1KD1U 3OYLA 3PE0A 1X6OA 1HJDA 1X69A 4V2SA 2QAZA 3EFSA 2C0OA 4E7LA 5D6XA 1OOTA 2GQIA 1WGSA 2K79A 3D7SB 2QQRA 4HVWA 1SHGA 1G3SA 2ZGWA 2KXDA 1JXMA 2MWOA 1BI1A 2M51A 2YRVA 3OYAA 5KYXB 1M8MA 5I21A 1YWPA 1VQ8Q 5L23A 4ZN1A 2L3QA 2K5FA 2EYYA 4DBHA 3M9QA 4Z02A 1MMAA 3RERA 4HVVA 4C0ZA 1W1FA 3EGDA 1Y07A 4M78B 1X27A 3R6OA 3CCJT 2ZPGB 1VQ4Q 2YRDA 2KNBB 4JZ3A 1R0CB 5FU7B 4C92E 1WQWA 1M3BA 2JJ9A 2LRQA 2K57A 2D8JA 2XIDA 4HT8A 3JB9H 4C8QC 2K9GA 4EMKB 1U06A 4IKFA 3TSWA 2DRMA 2YT6A 2JW4A 1VQKQ 1Z9ZA 2K3YA 4O5VA 3X24B 3OYGA 1Q82C 1EX4A 3EG1A 2DL8A 2RNAA 2YWWA 3A8LB 1N9SA 2VB6A 4Y92A 4YTLA 1TH7A 3P8DA 4BY6B 2B8AA 2OTLT 3JCMf 4M7AG 2MI6A 2COWA 2RQRA 4Z89A 1SPKA 2RJFA 3I56T 3JCMc 2ED0A 3CCMA 4J9HA 1U8RA 1KSWA 1KQSP 2E41A 2MCNA 3JAME 1KQ2A 2BZYA 2EGEA 5KYUB 4RTWA 3A5ZB 1PHTA 5GAMd 2F5KA 2KT8A 2DFUA 2XDPA 3UPUA 2L89A 1QMCA 2KRMA 4M7AE 1AZGB 2KR3A 2Y4YA 2QXFA 4HT9A 1H3ZA 4OP0A 2D6FA 5LJ3j 1X43A 4C0DB 3EG2A 2FO0A 4D8KA 1M30A 1ZSZA 3QPHA 3CC4T 1FYNA 2DTHA 3NTKA 3RR6A 5C6SA 1RUWA 2PUOB 1YJWT 5GMKe 3CMAA 2DEQA
chains in the Genus database with same CATH topology
3UF4A 4J9GA 1ARKA 2X3XD 2YDLA 1PRMC 3UA7A 4AG1C 2DJQA 2BZXA 2GTOA 3PVLA 4GLMA 2EPDA 2GGRA 1E6GA 1G2BA 2EKHA 2FEIA 5FWCA 3UA6A 2KXCA 2SEMA 3EHRA 2RQUA 4F16A 2FPEA 3R6NA 1WXTA 1WXBA 2J05A 2O9VA 1JQQA 2CREA 2PNIA 3A98A 2LJ1A 1NEGA 3KFVA 2RN8A 2V1QA 4D8DA 4F14A 3VS2A 2DVJA 2KGTA 1EFNA 1W70A 2FRWA 2BTTA 1K76A 2VWFA 1WDXA 4QT7A 4WCIA 3VS6A 4J9CA 2DM1A 2F2XA 1NM7A 1SSHA 2PZ1A 2QDLA 1T3SA 2PTKA 2LQWA 2DNUA 2NUZA 4JPBW 1CKBA 4DEXA 2JT4A 2C0TA 1SRLA 5GJWB 4JJBA 1GCQC 2RQVA 1UGVA 1UG1A 1NG2A 1UJ0A 4M4ZA 2KRNA 2DL4A 1VYVA 2CDTA 3QWXX 2YUQA 1CSKA 1QCFA 2O31A 3ULRB 2CH4W 1YWOA 2B86A 1VA7A 4JZ4A 3VS4A 2ROLA 4EIKA 2E5KA 2K3BA 1Y57A 2YUNA 1NYFA 2EGCA 4J9FA 3REBB 1K9AA 1MV0B 1HD3A 4RTTA 3NMZC 3REAB 2KE9A 1GFCA 2D0NA 2P4RA 1FMKA 1UECA 2AZSA 3GBQA 1PRLC 2KBTA 1QWEA 1UFFA 2LMJA 1K1ZA 1ZUKA 1U3OA 2EQIA 2D8HA 1VYUA 4AFZC 1TG0A 2OI3A 1JO8A 2EGAA 1NLPC 3JV3A 1KIKA 1WX6A 2LP5A 3NGPA 2C0IA 2DMOA 4IIOA 4LN2A 1AWXA 1BB9A 4IIMA 4ORZA 1KFZA 3VS1A 2FG0A 1K0XA 2VVKA 3VRYA 1ZBJA 1ZUUA 3O5ZA 5HCKA 2O9SA 2JMAA 1NEBA 3FJ5A 1T3LA 2EYWA 4F17A 1OPLA 4J9DA 1GBQA 2JM9A 2F2VA 3U23A 2A36A 1GBRA 3M0QA 3ZL7C 2CT3A 2LJ3A 1AWWA 2OAWA 3NPFA 2JMCA 1BBZA 2DX1A 3TSZA 2BZ8A 1I1JA 2V1RA 2EYXA 1TUCA 2GBQA 4ESRA 1UTIA 3H0FA 2NWMA 2AZVA 1YNZA 2AK5A 1UHCA 2LQNA 1CKAA 1GL5A 1H8KA 3THKA 1BU1A 2MOXA 1WYXA 1ZX6A 2EYZA 4LE9A 1V1CA 1WFWA 4JJDA 2J06A 2ROTA 1JEGA 1YN8A 5IHIA 1JXOA 4RUGA 1E7OA 2FPDA 4CC2A 1A0NB 1KJWA 2RMOA 1AZEA 1X2QA 1N5ZA 2IIMA 2KT1A 5FW9A 2KEAA 2HEQA 1PKSA 2L3PA 2AKLA 1T0JA 3H0HA 4OMNA 1WA7A 2LJ0A 3CQTA 1TUDA 2K6DA 4HCKA 4HVUA 3VS3A 1W6XA 2M0YA 2HDAA 1JU5C 3I9QA 5EC7A 4A63B 2DBKA 3EG0A 2HCKA 3NHNA 2DBMA 3RBBB 1YCSB 1X6GA 4X1VA 2CH4A 2LZ6B 2X3WD 4J9IA 1WI7A 5GJVB 2YUOA 4GBQA 2K2MA 1I0CA 4RTZA 3M0RA 1ABQA 1AWJA 2OJ2A 1H92A 2AKKA 2SRCA 3VRZA 5I11A 4K11A 1MUZA 4J9BA 4HXJA 3VS7A 1Y0MA 2J6FA 2CSQA 3LH5A 2ABLA 1SHFA 4LUEA 2CUDA 4AG2C 2L2PA 1BK2A 2A28A 2DYBA 3IQLA 1NLOC 2A37A 3VS0A 1PKTA 1ZUYA 4OMPA 2RQWA 1UHFA 2JS0A 2W10A 3I35A 3EHQA 1QKWA 2DLPA 4KRTA 1OPKA 5FWBA 2O88A 2L0AA 1X6BA 3EGUA 1UE9A 2DL7A 5IHNA 4RTXA 1X2KA 4CC4B 1OEBA 4FSSA 2J6OA 2A08A 2DA9A 2RPNA 1IO6A 1WXUA 4JJCA 4RTYA 2KYMA 2CUBA 4OMOA 2CSIA 2O2OA 2YSQA 4Z8AA 1M3CA 4AFSC 1QWFA 2L3SA 2I0NA 1QLYA 1WIEA 2D1XA 2DE0X 5IXBA 1GCPA 2G6FX 1LCKA 1AVZC 1U5SA 2DILA 4E6RA 1ABOA 1B3QA 3PE0A 2ED1A 1HJDA 2JTEA 1X69A 4CC3A 1B07A 2C0OA 1RLPC 1OOTA 2RF0A 2JXBA 2GQIA 2K79A 4R0KA 4RTUA 2ECZA 4OMLA 2GNCA 1WLPB 2F2WA 3SEMA 4AFQC 2J7IA 4HVWA 1SHGA 2LCSA 2W0ZA 3H0IA 2KXDA 1JXMA 3RNJA 3TVTA 2KROA 3M0PA 2LX7A 2M51A 1SEMA 1H3HA 1RI9A 2FPFA 1M8MA 3EG3A 1M27C 1YWPA 3H41A 5L23A 1OV3A 1Z9QA 2YUPA 1YP5A 2L3QA 2ENMA 2EYYA 2J6KA 1UDLA 1K0SA 4HVVA 2RQTA 5I22A 1T0HA 1W1FA 1AD5A 2ESWA 1X27A 1RLQC 2KNBB 4JZ3A 1M3BA 2GTJA 2D8JA 5IXFA 2K9GA 1HSQA 1U06A 1GCQA 3TSWA 2DRMA 2YT6A 2JW4A 3M0SA 2EW3A 4CC7A 4OMMA 1Z9ZA 1NYGA 2MIOA 4DEYA 2JS2A 3EG1A 4LNPA 2DL8A 2RNAA 1MV3A 4Y92A 5IHKA 4AFUC 1AOJA 4OMQA 1S1NA 1VYTA 2HBWA 1XOVA 2DF6A 1QKXA 2H8HA 2JM8A 2KRSA 2LNHB 2RQRA 5IH2A 2HSPA 4Z89A 1SPKA 2ED0A 3UATA 1M3AA 4LUDA 4J9HA 1PWTA 2DRKA 2EBPA 1KSWA 2CT4A 2MCNA 4J9EA 1PNJA 1E6HA 2BZYA 3I5RA 2EGEA 3VS5A 4RTWA 3M0UA 1PHTA 2KT8A 1G83A 5ECAA 2FRYA 3I5SA 2KRMA 3PVQA 1UUEA 2K7AA 1I07A 1AZGB 2KR3A 2EVRA 3C0CA 3QWYA 2XMFA 1AWOA 1UJYA 2DL3A 4RTVA 2DL5A 3M0TA 1J3TA 1X43A 3EG2A 1SRMA 1ZSGA 3SHWA 1GFDA 2FO0A 4D8KA 1M30A 4ZNXA 1GRIA 2VKNA 1FYNA 1ZLMA 1RUWA 1K4US 4Z88A 2KYBA 1AEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UF4 A;  4J9G A;  1ARK A;  2X3X D;  2YDL A;  1PRM C;  3UA7 A;  4AG1 C;  2DJQ A;  2BZX A;  2GTO A;  3PVL A;  4GLM A;  2EPD A;  2GGR A;  1E6G A;  1G2B A;  2EKH A;  2FEI A;  5FWC A;  3UA6 A;  2KXC A;  2SEM A;  3EHR A;  2RQU A;  4F16 A;  2FPE A;  3R6N A;  1WXT A;  1WXB A;  2J05 A;  2O9V A;  1JQQ A;  2CRE A;  2PNI A;  3A98 A;  2LJ1 A;  1NEG A;  3KFV A;  2RN8 A;  2V1Q A;  4D8D A;  4F14 A;  3VS2 A;  2DVJ A;  2KGT A;  1EFN A;  1W70 A;  2FRW A;  2BTT A;  1K76 A;  2VWF A;  1WDX A;  4QT7 A;  4WCI A;  3VS6 A;  4J9C A;  2DM1 A;  2F2X A;  1NM7 A;  1SSH A;  2PZ1 A;  2QDL A;  1T3S A;  2PTK A;  2LQW A;  2DNU A;  2NUZ A;  4JPB W;  1CKB A;  4DEX A;  2JT4 A;  2C0T A;  1SRL A;  5GJW B;  4JJB A;  1GCQ C;  2RQV A;  1UGV A;  1UG1 A;  1NG2 A;  1UJ0 A;  4M4Z A;  2KRN A;  2DL4 A;  1VYV A;  2CDT A;  3QWX X;  2YUQ A;  1CSK A;  1QCF A;  2O31 A;  3ULR B;  2CH4 W;  1YWO A;  2B86 A;  1VA7 A;  4JZ4 A;  3VS4 A;  2ROL A;  4EIK A;  2E5K A;  2K3B A;  1Y57 A;  2YUN A;  1NYF A;  2EGC A;  4J9F A;  3REB B;  1K9A A;  1MV0 B;  1HD3 A;  4RTT A;  3NMZ C;  3REA B;  2KE9 A;  1GFC A;  2D0N A;  2P4R A;  1FMK A;  1UEC A;  2AZS A;  3GBQ A;  1PRL C;  2KBT A;  1QWE A;  1UFF A;  2LMJ A;  1K1Z A;  1ZUK A;  1U3O A;  2EQI A;  2D8H A;  1VYU A;  4AFZ C;  1TG0 A;  2OI3 A;  1JO8 A;  2EGA A;  1NLP C;  3JV3 A;  1KIK A;  1WX6 A;  2LP5 A;  3NGP A;  2C0I A;  2DMO A;  4IIO A;  4LN2 A;  1AWX A;  1BB9 A;  4IIM A;  4ORZ A;  1KFZ A;  3VS1 A;  2FG0 A;  1K0X A;  2VVK A;  3VRY A;  1ZBJ A;  1ZUU A;  3O5Z A;  5HCK A;  2O9S A;  2JMA A;  1NEB A;  3FJ5 A;  1T3L A;  2EYW A;  4F17 A;  1OPL A;  4J9D A;  1GBQ A;  2JM9 A;  2F2V A;  3U23 A;  2A36 A;  1GBR A;  3M0Q A;  3ZL7 C;  2CT3 A;  2LJ3 A;  1AWW A;  2OAW A;  3NPF A;  2JMC A;  1BBZ A;  2DX1 A;  3TSZ A;  2BZ8 A;  1I1J A;  2V1R A;  2EYX A;  1TUC A;  2GBQ A;  4ESR A;  1UTI A;  3H0F A;  2NWM A;  2AZV A;  1YNZ A;  2AK5 A;  1UHC A;  2LQN A;  1CKA A;  1GL5 A;  1H8K A;  3THK A;  1BU1 A;  2MOX A;  1WYX A;  1ZX6 A;  2EYZ A;  4LE9 A;  1V1C A;  1WFW A;  4JJD A;  2J06 A;  2ROT A;  1JEG A;  1YN8 A;  5IHI A;  1JXO A;  4RUG A;  1E7O A;  2FPD A;  4CC2 A;  1A0N B;  1KJW A;  2RMO A;  1AZE A;  1X2Q A;  1N5Z A;  2IIM A;  2KT1 A;  5FW9 A;  2KEA A;  2HEQ A;  1PKS A;  2L3P A;  2AKL A;  1T0J A;  3H0H A;  4OMN A;  1WA7 A;  2LJ0 A;  3CQT A;  1TUD A;  2K6D A;  4HCK A;  4HVU A;  3VS3 A;  1W6X A;  2M0Y A;  2HDA A;  1JU5 C;  3I9Q A;  5EC7 A;  4A63 B;  2DBK A;  3EG0 A;  2HCK A;  3NHN A;  2DBM A;  3RBB B;  1YCS B;  1X6G A;  4X1V A;  2CH4 A;  2LZ6 B;  2X3W D;  4J9I A;  1WI7 A;  5GJV B;  2YUO A;  4GBQ A;  2K2M A;  1I0C A;  4RTZ A;  3M0R A;  1ABQ A;  1AWJ A;  2OJ2 A;  1H92 A;  2AKK A;  2SRC A;  3VRZ A;  5I11 A;  4K11 A;  1MUZ A;  4J9B A;  4HXJ A;  3VS7 A;  1Y0M A;  2J6F A;  2CSQ A;  3LH5 A;  2ABL A;  1SHF A;  4LUE A;  2CUD A;  4AG2 C;  2L2P A;  1BK2 A;  2A28 A;  2DYB A;  3IQL A;  1NLO C;  2A37 A;  3VS0 A;  1PKT A;  1ZUY A;  4OMP A;  2RQW A;  1UHF A;  2JS0 A;  2W10 A;  3I35 A;  3EHQ A;  1QKW A;  2DLP A;  4KRT A;  1OPK A;  5FWB A;  2O88 A;  2L0A A;  1X6B A;  3EGU A;  1UE9 A;  2DL7 A;  5IHN A;  4RTX A;  1X2K A;  4CC4 B;  1OEB A;  4FSS A;  2J6O A;  2A08 A;  2DA9 A;  2RPN A;  1IO6 A;  1WXU A;  4JJC A;  4RTY A;  2KYM A;  2CUB A;  4OMO A;  2CSI A;  2O2O A;  2YSQ A;  4Z8A A;  1M3C A;  4AFS C;  1QWF A;  2L3S A;  2I0N A;  1QLY A;  1WIE A;  2D1X A;  2DE0 X;  5IXB A;  1GCP A;  2G6F X;  1LCK A;  1AVZ C;  1U5S A;  2DIL A;  4E6R A;  1ABO A;  1B3Q A;  3PE0 A;  2ED1 A;  1HJD A;  2JTE A;  1X69 A;  4CC3 A;  1B07 A;  2C0O A;  1RLP C;  1OOT A;  2RF0 A;  2JXB A;  2GQI A;  2K79 A;  4R0K A;  4RTU A;  2ECZ A;  4OML A;  2GNC A;  1WLP B;  2F2W A;  3SEM A;  4AFQ C;  2J7I A;  4HVW A;  1SHG A;  2LCS A;  2W0Z A;  3H0I A;  2KXD A;  1JXM A;  3RNJ A;  3TVT A;  2KRO A;  3M0P A;  2LX7 A;  2M51 A;  1SEM A;  1H3H A;  1RI9 A;  2FPF A;  1M8M A;  3EG3 A;  1M27 C;  1YWP A;  3H41 A;  5L23 A;  1OV3 A;  1Z9Q A;  2YUP A;  1YP5 A;  2L3Q A;  2ENM A;  2EYY A;  2J6K A;  1UDL A;  1K0S A;  4HVV A;  2RQT A;  5I22 A;  1T0H A;  1W1F A;  1AD5 A;  2ESW A;  1X27 A;  1RLQ C;  2KNB B;  4JZ3 A;  1M3B A;  2GTJ A;  2D8J A;  5IXF A;  2K9G A;  1HSQ A;  1U06 A;  1GCQ A;  3TSW A;  2DRM A;  2YT6 A;  2JW4 A;  3M0S A;  2EW3 A;  4CC7 A;  4OMM A;  1Z9Z A;  1NYG A;  2MIO A;  4DEY A;  2JS2 A;  3EG1 A;  4LNP A;  2DL8 A;  2RNA A;  1MV3 A;  4Y92 A;  5IHK A;  4AFU C;  1AOJ A;  4OMQ A;  1S1N A;  1VYT A;  2HBW A;  1XOV A;  2DF6 A;  1QKX A;  2H8H A;  2JM8 A;  2KRS A;  2LNH B;  2RQR A;  5IH2 A;  2HSP A;  4Z89 A;  1SPK A;  2ED0 A;  3UAT A;  1M3A A;  4LUD A;  4J9H A;  1PWT A;  2DRK A;  2EBP A;  1KSW A;  2CT4 A;  2MCN A;  4J9E A;  1PNJ A;  1E6H A;  2BZY A;  3I5R A;  2EGE A;  3VS5 A;  4RTW A;  3M0U A;  1PHT A;  2KT8 A;  1G83 A;  5ECA A;  2FRY A;  3I5S A;  2KRM A;  3PVQ A;  1UUE A;  2K7A A;  1I07 A;  1AZG B;  2KR3 A;  2EVR A;  3C0C A;  3QWY A;  2XMF A;  1AWO A;  1UJY A;  2DL3 A;  4RTV A;  2DL5 A;  3M0T A;  1J3T A;  1X43 A;  3EG2 A;  1SRM A;  1ZSG A;  3SHW A;  1GFD A;  2FO0 A;  4D8K A;  1M30 A;  4ZNX A;  1GRI A;  2VKN A;  1FYN A;  1ZLM A;  1RUW A;  1K4U S;  4Z88 A;  2KYB A;  1AEY A; 
#chains in the Genus database with same CATH topology
 1Y7X A;  2HKN A;  2DER A;  2YDL A;  3UA7 A;  3EH1 A;  4FSX A;  1QVG P;  2M0O A;  2FEI A;  1VQO A;  1HK9 A;  2RQU A;  4M7D G;  3P8H A;  2O9V A;  3JB9 D;  2LJ1 A;  3V7C A;  2H3E B;  3X25 B;  1S72 T;  1ZA1 B;  2V1Q A;  4F14 A;  3CCV T;  2X4Y A;  3QII A;  1PCX A;  4XK8 E;  1EFN A;  3VUB A;  4M75 D;  1QP2 A;  1WDX A;  3JCM V;  2KY9 A;  4J9C A;  4X9C A;  3M5A A;  3OS2 A;  1SF9 A;  4J6Y A;  1NM7 A;  2QDL A;  4QVD A;  4M7D E;  3UWN A;  1RAI B;  2NUZ A;  3CC7 A;  3CBO A;  4JPB W;  5I2S A;  1CKB A;  3CEY A;  2JT4 A;  2C0T A;  1SRL A;  4DEX A;  2P0Q A;  1N8R U;  4M75 A;  1AHJ B;  1NE8 A;  4FIB A;  1UJ0 A;  5KCH A;  1OQK A;  2EJF A;  2Z0W A;  3JRZ A;  1Q86 C;  3GPL A;  4M78 G;  2CH4 W;  1YWO A;  2RK1 A;  4JZ4 A;  3OYB A;  1YHQ T;  1I5L A;  4EIK A;  2K3B A;  2YUN A;  1JRI A;  1UGR B;  1NYF A;  4J9F A;  5GAN 6;  1HD3 A;  1MV0 B;  2E12 A;  4LD6 A;  1K8A C;  3HFO A;  2D0N A;  2P4R A;  4MDX A;  2DET A;  3OYN A;  2E3I A;  4FW1 A;  5GAN g;  3G4S Q;  1YIT A;  4LDX A;  1YJW A;  2XU8 A;  1UFF A;  3EH2 A;  1ZUK A;  3BFM A;  2OI3 A;  4C5I A;  3JV3 A;  2EKO A;  2R57 A;  1KIK A;  4LXC A;  2CGH A;  4N4H A;  3QG1 A;  1W2B A;  4LN2 A;  2HL5 C;  2DPP B;  4ATO A;  4EMH A;  4ORZ A;  1KFZ A;  2RHI A;  3E1S A;  2FG0 A;  4KUI A;  3JCM h;  1WQ7 A;  1VIE A;  1K9M R;  2JUF A;  3CCV A;  4QQD A;  4M75 F;  2DD5 A;  2NUT A;  3CXC A;  3QJ6 A;  4C8Q F;  3X26 B;  3VU3 C;  4J9D A;  8AT1 B;  1FMW A;  2JM9 A;  3CC2 A;  2F2V A;  1NBE B;  1NPP A;  1YJN A;  4DA4 A;  3SFM A;  1YI2 A;  1Q81 U;  1LPL A;  3INZ A;  2OAW A;  4N0A C;  3BW1 A;  5KYN A;  3TSZ A;  3MHX A;  2BZ8 A;  2FB7 A;  4M78 C;  1B7T A;  1RAF B;  3FC3 A;  1VOM A;  2VAS A;  4UC4 A;  3H0F A;  4X34 A;  5FU7 C;  1VQL A;  5CKE A;  2AK5 A;  1UHC A;  2EYQ A;  2M1H A;  3HHT B;  1BU1 A;  4JLG A;  1VQ6 A;  1ZX6 A;  4BDY A;  2EYZ A;  1ZSZ B;  5CO7 A;  2JNG A;  3CCL Q;  1JEG A;  3FLG A;  3X28 B;  3CCR A;  4PJL A;  5A0G A;  1JXO A;  3L2R A;  1W4S A;  3CCS T;  4EDU A;  1X01 A;  3Q1J A;  2V8K A;  1N5Z A;  2CZ0 B;  3VYH B;  3V8K A;  2IIM A;  5FW9 A;  1PC0 A;  2HNI A;  4E7J A;  4BY6 C;  2L3P A;  2HEQ A;  1VQ7 A;  1VIF A;  1T0J A;  3H0H A;  4M77 D;  4OMN A;  2EIF A;  3CQT A;  2PVG B;  5J26 A;  2LT4 A;  4HCK A;  4HVU A;  1YJ9 A;  4F7U A;  4DBF A;  1W6X A;  1RAB B;  2CP5 A;  2E65 A;  1YIJ Q;  2GQV A;  4L5G A;  5GAO p;  3AT1 B;  2RI3 A;  4A63 B;  3F70 A;  2DBK A;  4LDV A;  3MKD A;  4X1V A;  3G6E Q;  2CH4 A;  2LZ6 B;  2R58 A;  1WI7 A;  2YUO A;  4GBQ A;  4M77 A;  2GCX A;  3OYM A;  4RTZ A;  5CQX A;  2D9T A;  4FT4 A;  2NUP B;  3M0R A;  4AMC A;  1ABQ A;  1QVF P;  1VQ8 T;  2LTO A;  3SD4 A;  3VS7 A;  3J7A F;  3LLR A;  2J6F A;  1M90 C;  5GAN 3;  4LDY A;  3LH5 A;  4J7F A;  1O75 A;  1RL2 A;  4QVZ A;  3DLM A;  4ELZ C;  2L2P A;  1M1G A;  3IQL A;  3E19 A;  1ZUY A;  2DO3 A;  2RQW A;  4DQ2 A;  2LQ8 A;  1VQ4 T;  4C0D C;  3HKS A;  3EHQ A;  2OTJ Q;  1QKW A;  4KRT A;  1OPK A;  2O88 A;  3EGU A;  3S3N A;  5IHN A;  4CC4 B;  5GAN d;  4FSS A;  2J6O A;  5EG2 A;  2MAM A;  1VQK T;  5GMK l;  2CUB A;  1KC8 U;  4KBM B;  3CPW S;  4C92 B;  1D09 B;  2V26 A;  4BAC A;  1QWF A;  2GFA A;  2L3S A;  4IUU A;  2I0N A;  2D1X A;  1LCK A;  2HQH A;  1U5S A;  3OB9 A;  2YHT A;  1ABO A;  4BDZ A;  2ED1 A;  3QUI A;  4CC3 A;  2VXF A;  2RF0 A;  1QW1 A;  2ECZ A;  1TTH B;  4OML A;  2QTV A;  1G3W A;  2LCS A;  1IB8 A;  2MK5 A;  2W0Z A;  3V7S A;  1VQP Q;  3LWI A;  2A0F B;  3FRN A;  4PJJ A;  3H0I A;  5A2Q E;  3TU4 K;  1VQN Q;  5GAO m;  5DY9 A;  4PFO A;  2QEX A;  1OV3 A;  2YUP A;  1V76 A;  1K0S A;  5FRM A;  1D0Z A;  1D0Y A;  2X4X A;  3G71 A;  4PLL A;  1ZHI A;  2PQW A;  3QKJ A;  1VQ9 Q;  2D0Q B;  2MF2 A;  5LJ3 f;  1KD1 R;  3UDC A;  2GTJ A;  3I55 Q;  4PFP A;  1HSQ A;  1GCQ A;  3E9F A;  4OMM A;  3HTR A;  2QGF B;  4PJO C;  2P84 A;  2AHJ B;  5LJ5 g;  1UGQ B;  1MV3 A;  2E70 A;  5IHK A;  4AFU C;  1UB4 A;  1S1N A;  3AHU A;  2HBW A;  1XOV A;  2DF6 A;  2QDY B;  4X9D A;  2H8H A;  2KRS A;  2HSP A;  1K73 U;  4XTV A;  4M78 F;  1M3A A;  4LUD A;  1X75 C;  4NL2 A;  5GAN 8;  1KQS S;  3OW2 A;  4F7U B;  3OMC A;  4II1 A;  4KT0 E;  4J9E A;  3KXT A;  4FCY A;  5D6W A;  4EMG A;  1UGP B;  4GLK A;  3CD6 Q;  1IHW A;  4FL6 A;  3I5S A;  4QW2 A;  4OB0 B;  2LVM A;  1RAE B;  4IUV A;  3M56 A;  3GP8 A;  1C6V X;  2QK0 A;  4FYY B;  1OI1 A;  2EVR A;  3C0C A;  3CPW P;  3M4Y A;  3N5B B;  3C94 A;  3QWY A;  1UJY A;  3RUX A;  3ASK A;  3OYK A;  4HCZ A;  2DL5 A;  1UGS B;  3GOX A;  2E6N A;  4RCB A;  1LVK A;  1J3T A;  2LC4 A;  1SRM A;  1GFD A;  1WHH A;  4ZNX A;  3MCA B;  2PU9 B;  1ZLM A;  1G8X A;  1LJO A;  1ZSZ C;  2K5I A;  2DAQ A;  3UF4 A;  1M1K U;  1PRM C;  4AG1 C;  2DJQ A;  3G4S T;  4M75 E;  2BZX A;  2GTO A;  4CRI A;  4GLM A;  3CCQ Q;  1QVG S;  3SWN A;  1E6G A;  4C92 G;  1YFN A;  2RJC A;  1N27 A;  5FWC A;  2KXC A;  2SEM A;  3EHR A;  4L59 A;  5HY6 A;  1BCM A;  2FPE A;  3TEE A;  4NL3 A;  1JQQ A;  2PNI A;  3CCU Q;  5GAM j;  2VYT A;  4RKU E;  2KGT A;  2EQU A;  2RO0 A;  4N4G A;  1W70 A;  4MML A;  1VQM A;  5CKB A;  5AT1 B;  1PSE A;  5CKF A;  2BUD A;  1NJI U;  2DM1 A;  4R55 A;  5D7U A;  2YLB A;  2DYI A;  2F2X A;  2EAY A;  2PZ1 A;  2DEU A;  1QCO A;  2RI2 A;  2GFU A;  5KCO A;  2MMP A;  4JRK A;  2QA4 A;  3VYG A;  2RQV A;  1UGV A;  4M4Z A;  2KRN A;  1TU0 B;  2DXC A;  3C95 A;  1M1F A;  2CDT A;  1OX9 A;  2VGM A;  3X20 B;  2B86 A;  3VS4 A;  4C0G A;  1Y57 A;  4EPC A;  3OYF A;  1PD1 A;  2EGC A;  2O4X B;  1RI0 A;  2IPO B;  4RTT A;  3PMT A;  1VQ5 A;  4R56 A;  3CCL T;  5LJ3 h;  5LJ5 d;  3E2U A;  2F69 A;  3VJP A;  3OY9 A;  1UEC A;  3JCM W;  2RHU A;  1G3Y A;  3G7Z A;  3DB4 A;  1PRL C;  2KBT A;  4C92 C;  5CR2 A;  2MPX C;  3MO8 A;  4MZT A;  5CKH A;  2RB6 A;  1KG1 A;  2EQI A;  1N8R R;  2D8H A;  1TG0 A;  2EGA A;  5HK0 A;  4JRP A;  3FJP A;  1B34 A;  2EWN A;  3JCM b;  1YIJ T;  3CXC S;  1M5Q 1;  1F1B B;  1WHJ A;  1ZUU A;  1K9M C;  3GIB A;  3G6E T;  1T3L A;  3PT9 A;  2M16 A;  1MMD A;  2EYW A;  1OPL A;  3MEU A;  3HRU A;  1GBQ A;  3CCJ A;  2EFI A;  4N4I A;  2DVE A;  1BCO A;  4MDW A;  4PJO F;  3OYJ A;  3U23 A;  2BIV A;  3OSS C;  3M0Q A;  3ZL7 C;  2CT3 A;  4XTX A;  2LJ3 A;  3OS5 A;  3NPF A;  2YLC A;  2JMC A;  4F7U E;  1BBZ A;  5GMK i;  2DX1 A;  3M4G A;  2EYX A;  3M58 A;  4J8O A;  2E5Q A;  7AT1 B;  4OGE A;  4M7A C;  4JRI A;  5KYY B;  1I4K 1;  2NWM A;  3QZ9 B;  1OUL A;  2OTJ T;  1Q7Y C;  3DKM A;  1RAD B;  1M4Z A;  4M77 E;  1JBM A;  1CKA A;  3QJY A;  2MOX A;  2OTL A;  1WYX A;  5LJ5 e;  1IGQ A;  4GY5 A;  2ROT A;  1N6A A;  4C8Q D;  3I56 A;  1E7O A;  1A0N B;  1KJW A;  3JB9 I;  2RMO A;  2DZ9 A;  4Y28 E;  1X2Q A;  1G3T A;  1D3B A;  3BY7 A;  1D1A A;  3CCL A;  2F1L A;  2RJD A;  3PGG A;  4B6M A;  3P8B B;  1PM3 A;  1Q81 R;  3SWN B;  1PKS A;  2AKL A;  4ZGD B;  2LJ0 A;  4BE1 A;  2K6D A;  4C8Q A;  4QVC A;  5KYW A;  2KVQ G;  4FT2 A;  2ZAE A;  2FZK B;  2F5T X;  1JU5 C;  1TWB A;  5EC7 A;  4JS4 A;  2HCK A;  3EGD B;  4QQ6 A;  1X6G A;  1VQP T;  2K2M A;  5LL6 S;  4KH1 B;  2LT1 A;  4E7H A;  1VQN T;  1QVF S;  2DTI A;  1H92 A;  1U1S A;  5I11 A;  3CCM Q;  4K11 A;  3H6Z A;  1MUZ A;  3JCM g;  3CC4 A;  4ELY C;  4HXJ A;  4JRQ A;  3LYI A;  2ABL A;  2QQA A;  3WVD B;  2Y4X A;  4M7D C;  2R5A A;  4ZGJ B;  3L2Q A;  2DYB A;  3OA6 A;  3VS0 A;  1W2B P;  1JB0 E;  4IUQ A;  2W10 A;  2DLP A;  3ME9 A;  2XG8 D;  4TVR A;  1X6B A;  1KHC A;  3I55 T;  1P92 A;  3EGX A;  4PJN A;  3CXC P;  1OEB A;  1U1T A;  3A8H B;  1S72 A;  2RPN A;  5GAO q;  2CS7 A;  4J6X A;  1WXU A;  4JJC A;  1XNI A;  2KYM A;  2VGN A;  1BKB A;  2CSI A;  4HA8 A;  3RES A;  4Z8A A;  5IN1 A;  5GAN 7;  4Y91 A;  4AFS C;  1WJS A;  1D1B A;  3EG9 A;  2RJE A;  3M59 A;  3CMA Q;  2G6F X;  2VUB A;  4KUD K;  3LGF A;  3CME Q;  4XU3 A;  1RLP C;  5A0D A;  1IRX A;  1I81 A;  2RH2 A;  1VQO Q;  2GNC A;  3OYI A;  1WLP B;  3SEM A;  2A7Y A;  1Q7Y R;  1Q82 U;  4D6W A;  2OAU A;  4PNO A;  4EMK C;  2QAS A;  2RA2 A;  2KRO A;  3CD6 T;  2LX7 A;  1RAC B;  4PKC C;  1O9S A;  3M53 A;  1RI9 A;  3MPU B;  2FPF A;  2QTX A;  3EG3 A;  1YHQ A;  2CP2 A;  2E4H A;  2QQ9 A;  2ZPB B;  1KC8 R;  2ENM A;  4J6W A;  4C92 F;  2J6K A;  5GAN j;  1UDL A;  3MP6 A;  2HBP A;  5I22 A;  1KHI A;  1AD5 A;  2ESW A;  2V8J A;  3CC7 Q;  3T9N A;  4Q5W A;  3NFC A;  1KD1 C;  9ATC B;  4JS5 A;  3O8V A;  4XTU A;  3HSB A;  1WHG A;  2I2L A;  1BI2 A;  1XQH A;  2EW3 A;  3LWH A;  1NYG A;  2P4T A;  3C12 A;  2MIO A;  2PUK B;  1IGU A;  1ZBX A;  1OX8 A;  5GAN 4;  3DB3 A;  3CCQ T;  2JS2 A;  4LNP A;  3S6W A;  3OS0 A;  4OB1 B;  2CP6 A;  2IG0 A;  3RMQ A;  1TSF A;  2L3R A;  1AOJ A;  3GF5 A;  4OMQ A;  1WZO A;  1VYT A;  5CKD A;  3CCU T;  5GAM f;  2RHY A;  4B9W A;  2JM8 A;  2LNH B;  4FYX B;  2NLU A;  3QXE B;  1YBY A;  4M75 B;  3UT1 A;  3A8M B;  3MEW A;  1OZ3 A;  3M57 A;  4BUG A;  1YIT Q;  2CZ7 B;  5GAO r;  2DXT A;  2DRK A;  1ACM B;  3OBW A;  5AYF A;  2K2V A;  5KYW B;  1YJW Q;  4M7A F;  1E6H A;  2CP3 A;  4KH0 B;  4B9X A;  5GAN 2;  1JJ2 A;  2HMA A;  5GAN 5;  3M0U A;  5CVI A;  3JCM d;  2WSE E;  1R77 A;  1G83 A;  2FRY A;  1M2V A;  3PVQ A;  3FDR A;  1UUE A;  2K7A A;  3CCE Q;  1D0X A;  1G5V A;  2ZPF B;  3CCV Q;  1BI0 A;  4ANJ A;  2GF7 A;  2L8D A;  2XMF A;  2Y90 A;  4JDS A;  3CCS A;  2DL3 A;  3M0T A;  1K73 R;  3CC2 Q;  1ZSG A;  4M78 D;  1YJN Q;  3H8Z A;  3L2W A;  4A4K A;  1GRI A;  1MGQ A;  2JOY A;  3NTI A;  1YI2 Q;  2K3X A;  1M8V A;  4KGX B;  3RIR A;  2HSE B;  2KYB A;  1SG5 A;  4JJN K;  4BI4 A;  1QP3 A;  3HP9 A;  3EGX B;  4J9G A;  2X3X D;  3M54 A;  1MMN A;  2BE9 B;  1EIF A;  4N0A A;  1EZZ B;  4QQG A;  4VUB A;  4M78 A;  1C1A A;  1VQL Q;  2NUT B;  4XU1 A;  1WHM A;  2X4W A;  3ZEH A;  4F16 A;  3SWN C;  1Q86 U;  1WXB A;  2J05 A;  2CRE A;  1M2O A;  3A98 A;  2YRC A;  2ZPH B;  1VQ6 Q;  3CCQ A;  3KFV A;  4KGV B;  4XAX B;  2RN8 A;  4D8D A;  3QYG B;  3CCR Q;  3VS2 A;  2EQJ A;  3EG9 B;  2DVJ A;  4M7D F;  1VQ8 A;  5L8R E;  4E47 A;  1PD0 A;  2CYZ B;  1K76 A;  1K8A U;  2XD0 A;  3VKI A;  4MZM A;  5A0L A;  6AT1 B;  3ZBD A;  1VQ7 Q;  1IZ6 A;  1SSH A;  4FW2 A;  3MEA A;  3JCM e;  2KQW A;  2PTK A;  2LQW A;  3RMS A;  1RAH B;  1VQ4 A;  1YJ9 Q;  3E9G A;  4JJB A;  3L1A A;  1M1K R;  1OU8 A;  3QDR B;  5DLO A;  3C4S A;  4OF1 A;  2DL4 A;  1VQK A;  2ZPE B;  5KE2 A;  3M55 A;  3QWX X;  2YUQ A;  1CSK A;  1QCF A;  2ZPI B;  2V8I A;  3EFR A;  1TXQ A;  3ULR B;  4DOW A;  2QQB A;  3OW2 P;  3TRE A;  2ROL A;  4C5H A;  2HL3 A;  4HCB A;  4BD3 A;  3REB B;  4DOV A;  4L6V 5;  5FLX E;  3REA B;  2KE9 A;  3GNG A;  3JB9 J;  1NJI R;  2DJZ A;  2AZS A;  2LX9 A;  3GBQ A;  2LQK A;  3GLX A;  4E7S A;  2RD1 A;  3JB9 G;  1K1Z A;  1YCY A;  1U3O A;  4M77 B;  3QHS A;  1N8R C;  1VYU A;  2DIQ A;  3OMG A;  4AFZ C;  1JO8 A;  1XTD A;  3MP8 A;  2LP5 A;  3NGP A;  5GMK j;  4ZGE B;  1VUB A;  2C0I A;  2DMO A;  2WAC A;  4IIO A;  4M75 G;  4ME7 A;  1BB9 A;  2HZY A;  4KUL A;  5GAM h;  1K0X A;  2VVK A;  2O9S A;  1NEB A;  5FRO A;  4BB7 A;  4F17 A;  2HAX A;  3OS1 A;  4C5G A;  1Y71 A;  3CCM T;  2A36 A;  3OBY A;  2DIG A;  2DZC A;  1M2V B;  4QKU A;  1AWW A;  5LJ5 j;  4C8Q E;  3H9N A;  2MYS A;  4BE0 A;  4BI3 A;  4ESR A;  2QEX Q;  2AZV A;  1YNZ A;  2BKD N;  1H64 1;  2CP0 A;  2LQN A;  2QYZ A;  1GL5 A;  3THK A;  2EJ9 A;  2DD4 A;  1WFW A;  4JJD A;  3SB2 A;  3MET A;  3G71 Q;  2FHD A;  1YN8 A;  4PL6 A;  5IHI A;  4RUG A;  2FPD A;  3OQ5 A;  2CZ6 B;  1AZE A;  4HKE A;  1FWZ A;  1M90 U;  4LD9 K;  4PJO D;  4PLI A;  2KT1 A;  5KH6 A;  3L42 A;  4XQ3 A;  2EJG A;  2HD0 A;  2ZCF B;  1Q81 C;  2KEA A;  1LOJ A;  5LJ3 g;  5FU6 B;  3CMA T;  1QVP A;  1PG5 B;  1TUD A;  4M75 C;  3CME T;  3VS3 A;  2M0Y A;  5D6Y A;  1M9S A;  4PJO A;  4A4F A;  3OYH A;  4MZP A;  2EQM A;  3RBB B;  1YCS B;  1VQO T;  2C06 A;  1RAA B;  3EFO A;  2X3W D;  3V8L A;  4J9I A;  5GJV B;  2KI7 A;  2QGG A;  3WXM B;  2OX7 A;  3URG A;  4C5E A;  1R0B G;  2OJ2 A;  2AKK A;  2SRC A;  3VRZ A;  1WNL A;  4E2F B;  1XJW B;  1TUG B;  2CSQ A;  5GAN f;  3QYH B;  2DKG A;  3FB9 A;  2CUD A;  2WSF E;  4NOY A;  5DM7 R;  4KGZ B;  1BK2 A;  4WTO B;  1NLO C;  1W2B S;  2A37 A;  3EAE A;  3G4S A;  1PKT A;  3CC7 T;  4OB2 B;  2JS0 A;  1LNX A;  1KQS A;  3VV0 A;  2DL7 A;  4XU2 A;  4RTX A;  3OYE A;  2IVW A;  4F7U G;  2A08 A;  1IHV A;  3HL8 A;  2RM4 A;  4RTY A;  5GAO l;  3BDU A;  4IUR A;  3NTH A;  1UEB A;  3PMI A;  1FX7 A;  5GAO n;  1OU9 A;  4M77 G;  1KK7 A;  2RHX A;  2P0P A;  3MJX A;  3LH0 A;  1WIE A;  2DE0 X;  1KQ1 A;  3LGL A;  1BI3 A;  4E7Z A;  1AVZ C;  1MHN A;  4E6R A;  3PNW C;  1B3Q A;  4A4H A;  3HFN A;  3JCM X;  3LW5 E;  2JTE A;  1B07 A;  1YIT T;  2JXB A;  4JLI A;  4RTU A;  4R0K A;  1Q95 G;  2VXE A;  3RKY A;  2F2W A;  3CME A;  4AFQ C;  2J7I A;  3A1P A;  1MND A;  5GMK m;  3RNJ A;  3TVT A;  2JVV A;  3M0P A;  3RKX A;  1SEM A;  2O01 E;  1H3H A;  5CIU A;  1HXD A;  1M27 C;  3H41 A;  1Z9Q A;  5DLQ E;  1YP5 A;  2LNV A;  1KC8 C;  1QVG A;  3CCE T;  1VQM Q;  1D1C A;  5HK3 A;  2QQS A;  3JSC A;  2LDM A;  2RQT A;  3J80 E;  2X4J A;  1BIA A;  1T0H A;  2DTO A;  4JUV A;  4RG2 A;  1RLQ C;  3S3M A;  3CC2 T;  2NUP A;  4WF2 A;  2QA4 Q;  1YJN T;  4MMK A;  1YI2 T;  5IXF A;  3ER0 A;  4AT1 B;  5GAM e;  2JN0 A;  2PVD B;  2JTM A;  3DLL A;  3M0S A;  4CC7 A;  3OYY A;  1Q82 R;  5FRN A;  4DEY A;  5CK9 A;  1YIJ A;  2LCC A;  4FYW B;  2HQX A;  1VQL T;  5LJ3 d;  4M77 C;  3JCM P;  4A4E A;  3G6E A;  4C92 D;  3OSV A;  2VC8 A;  1OZ2 A;  4J83 A;  3MEV A;  1VQ6 T;  1VQ5 Q;  1QKX A;  1QCN A;  2XKO C;  5IH2 A;  3CCR T;  2QI2 A;  2WSC E;  3UAT A;  1JJ2 S;  2KDS A;  1PWT A;  2EBP A;  2CT4 A;  2XI9 A;  3QBY A;  1PNJ A;  3V8J A;  1VQ9 T;  2NYS A;  3I5R A;  4C92 A;  3LX7 A;  5CQY A;  4PJO B;  3CPF A;  1VQ7 T;  3VS5 A;  2KSS A;  3EFO B;  4PJM A;  4M78 E;  2PVO B;  4OB3 B;  1YJ9 T;  5ECA A;  1Y96 A;  2OTJ A;  2K4Y A;  4XTY A;  2K5L A;  1I07 A;  3G1J A;  2H3J A;  3JB9 F;  4CI0 C;  1AWO A;  2M02 A;  2VV5 A;  5CAI A;  3PTA A;  3PIP A;  3CCE A;  4RTV A;  3CCJ Q;  5GAN h;  4XTW A;  1K73 C;  3SHW A;  2VKN A;  4M7A D;  4RCC A;  2E64 A;  2XIC A;  2XDB A;  2HQE A;  4FM4 B;  4Z88 A;  1K4U S;  1B34 B;  3FIF A;  1AEY A;  5IT9 E;  1ARK A;  3KUF A;  3L2Z A;  3PVL A;  2EPD A;  5LJ3 e;  2GGR A;  2RHZ A;  1G2B A;  2EKH A;  3ZFJ A;  2ZZD A;  4M7A A;  3UA6 A;  3R6N A;  1WXT A;  1VQP A;  3S3O A;  2COZ A;  2OTL Q;  4HCC A;  5FU6 C;  1NEG A;  2DK3 A;  2RK2 A;  1VQN A;  1WJR A;  3I56 Q;  4IUP A;  2FZC B;  2FRW A;  2BTT A;  1V29 B;  4OGC A;  2VWF A;  2QG9 B;  4QT7 A;  4WCI A;  3VS6 A;  1MMG A;  1T3S A;  2EQK A;  2DNU A;  2E6Z A;  3FEO A;  1VQ9 A;  5GJW B;  4DBQ A;  1BIB A;  4XTZ A;  4OMF B;  1SSF A;  1M1K C;  3TQ7 P;  1GCQ C;  4E7K A;  3I55 A;  1UG1 A;  1NG2 A;  5CCA A;  1VYV A;  5LJ5 f;  4BI8 B;  2FZG B;  1Q86 R;  2O31 A;  1D3B B;  3BDL A;  3RDV A;  3OYD A;  2CZ1 B;  4M7D D;  1VA7 A;  3SDZ A;  2QEX T;  3OW2 S;  1K9M U;  2E5K A;  1OYX A;  3CC4 Q;  3HRT A;  2E1H A;  3QZ5 B;  1WHK A;  3QO3 A;  3JCM Q;  1K9A A;  4C8Q B;  1K8A R;  1JJ2 P;  3WVE B;  3NMZ C;  1GFC A;  1PSF A;  1NJI C;  3HRS A;  3G71 T;  1FMK A;  4ZTF A;  4OVA A;  2E3H A;  4ZTJ A;  2RI5 A;  4XU0 A;  3J81 E;  4M7D A;  1QVF A;  1QWE A;  1ZA2 B;  2LMJ A;  2G3R A;  3L2U A;  1GXI E;  1NLP C;  1N9R A;  1S72 Q;  1WX6 A;  3CD6 A;  4IUT A;  1NZ9 A;  3RKW A;  3BE3 A;  5M9O A;  4NS5 A;  2R5M A;  5I2M A;  1AWX A;  4IIM A;  4LDW A;  1Q7Y U;  5J3B A;  3VS1 A;  2XDD A;  3VRY A;  1ZBJ A;  3O5Z A;  5HCK A;  1TS9 A;  2JMA A;  2X35 A;  5HKC A;  3FJ5 A;  1SKU B;  4PJO G;  5KYX A;  1I5O B;  4F04 B;  2HKQ B;  4F7U F;  1WHL A;  3A8O B;  2KK4 A;  4P5N A;  4DBR A;  1GBR A;  2X9H A;  4E7I A;  2ATC B;  1Y96 B;  1BYM A;  4C0F A;  1C0M A;  4M77 F;  5KE3 A;  3PFS A;  3CBM A;  2AIR B;  5J39 A;  4A53 A;  2V1R A;  1I1J A;  4ZN3 A;  1IXD A;  1TUC A;  2GBQ A;  4PJO E;  1UTI A;  4PFZ A;  3HPW A;  4EMK A;  1YHQ Q;  1WJQ A;  2XHC A;  3V7R A;  1H8K A;  3CCU A;  4J7I A;  4LE9 A;  1V1C A;  4RG8 A;  1WPY A;  2J06 A;  4BE2 A;  1FXX A;  1DJ7 B;  4LDU A;  2BE7 D;  1AT1 B;  4CC2 A;  1TOV A;  4A4G A;  3L2V A;  4J5Y A;  4PK4 A;  3QDF A;  1WA7 A;  2E10 A;  4M7A B;  2O4X A;  3OYC A;  2MWP A;  3QSU A;  4O6J A;  2HDA A;  5GAN e;  3I9Q A;  8ATC B;  3EG0 A;  5KYU A;  3NHN A;  2DBM A;  2XK0 A;  5GMK h;  1I0C A;  1AWJ A;  2M9U A;  1IRE B;  2CKK A;  2JTF A;  5GAM g;  1I8F A;  4J9B A;  3A8G B;  1VQM T;  1Y0M A;  1M90 R;  2DXU A;  5C0M A;  2DXB A;  1SHF A;  4LUE A;  4AG2 C;  1R8O B;  3MP1 A;  2LCL A;  2A28 A;  3GNF B;  2AT1 B;  4FYV B;  1RAG B;  2L5Q A;  4OMP A;  1UHF A;  3I35 A;  5LJ5 h;  2QA4 T;  5FWB A;  2JZ2 A;  2L0A A;  2CP7 A;  2P0K A;  2KAF A;  1UE9 A;  2FVU A;  4C8Q G;  1X2K A;  5IAY A;  2YXY A;  2FYK A;  2DA9 A;  2COY A;  1HYO A;  1IO6 A;  3KBG A;  2A3L A;  2FL7 A;  2X51 A;  3CCS Q;  4OMO A;  1ZQ1 A;  4RMO A;  2O2O A;  2YSQ A;  4A54 A;  1M3C A;  1MNE A;  1NPR A;  4M7D B;  5KYY A;  3JCM J;  1QQJ A;  4FU6 A;  3CPW A;  1FMV A;  3VUZ A;  3CBP A;  1QLY A;  3TCJ A;  1VQ5 T;  5IXB A;  1GCP A;  2KMT A;  2DIL A;  3PIO A;  1KD1 U;  3OYL A;  3PE0 A;  1X6O A;  1HJD A;  1X69 A;  4V2S A;  2QAZ A;  3EFS A;  2C0O A;  4E7L A;  5D6X A;  1OOT A;  2GQI A;  1WGS A;  2K79 A;  3D7S B;  2QQR A;  4HVW A;  1SHG A;  1G3S A;  2ZGW A;  2KXD A;  1JXM A;  2MWO A;  1BI1 A;  2M51 A;  2YRV A;  3OYA A;  5KYX B;  1M8M A;  5I21 A;  1YWP A;  1VQ8 Q;  5L23 A;  4ZN1 A;  2L3Q A;  2K5F A;  2EYY A;  4DBH A;  3M9Q A;  4Z02 A;  1MMA A;  3RER A;  4HVV A;  4C0Z A;  1W1F A;  3EGD A;  1Y07 A;  4M78 B;  1X27 A;  3R6O A;  3CCJ T;  2ZPG B;  1VQ4 Q;  2YRD A;  2KNB B;  4JZ3 A;  1R0C B;  5FU7 B;  4C92 E;  1WQW A;  1M3B A;  2JJ9 A;  2LRQ A;  2K57 A;  2D8J A;  2XID A;  4HT8 A;  3JB9 H;  4C8Q C;  2K9G A;  4EMK B;  1U06 A;  4IKF A;  3TSW A;  2DRM A;  2YT6 A;  2JW4 A;  1VQK Q;  1Z9Z A;  2K3Y A;  4O5V A;  3X24 B;  3OYG A;  1Q82 C;  1EX4 A;  3EG1 A;  2DL8 A;  2RNA A;  2YWW A;  3A8L B;  1N9S A;  2VB6 A;  4Y92 A;  4YTL A;  1TH7 A;  3P8D A;  4BY6 B;  2B8A A;  2OTL T;  3JCM f;  4M7A G;  2MI6 A;  2COW A;  2RQR A;  4Z89 A;  1SPK A;  2RJF A;  3I56 T;  3JCM c;  2ED0 A;  3CCM A;  4J9H A;  1U8R A;  1KSW A;  1KQS P;  2E41 A;  2MCN A;  3JAM E;  1KQ2 A;  2BZY A;  2EGE A;  5KYU B;  4RTW A;  3A5Z B;  1PHT A;  5GAM d;  2F5K A;  2KT8 A;  2DFU A;  2XDP A;  3UPU A;  2L89 A;  1QMC A;  2KRM A;  4M7A E;  1AZG B;  2KR3 A;  2Y4Y A;  2QXF A;  4HT9 A;  1H3Z A;  4OP0 A;  2D6F A;  5LJ3 j;  1X43 A;  4C0D B;  3EG2 A;  2FO0 A;  4D8K A;  1M30 A;  1ZSZ A;  3QPH A;  3CC4 T;  1FYN A;  2DTH A;  3NTK A;  3RR6 A;  5C6S A;  1RUW A;  2PUO B;  1YJW T;  5GMK e;  3CMA A;  2DEQ A; 
#chains in the Genus database with same CATH homology
 3UF4 A;  4J9G A;  1ARK A;  2X3X D;  2YDL A;  1PRM C;  3UA7 A;  4AG1 C;  2DJQ A;  2BZX A;  2GTO A;  3PVL A;  4GLM A;  2EPD A;  2GGR A;  1E6G A;  1G2B A;  2EKH A;  2FEI A;  5FWC A;  3UA6 A;  2KXC A;  2SEM A;  3EHR A;  2RQU A;  4F16 A;  2FPE A;  3R6N A;  1WXT A;  1WXB A;  2J05 A;  2O9V A;  1JQQ A;  2CRE A;  2PNI A;  3A98 A;  2LJ1 A;  1NEG A;  3KFV A;  2RN8 A;  2V1Q A;  4D8D A;  4F14 A;  3VS2 A;  2DVJ A;  2KGT A;  1EFN A;  1W70 A;  2FRW A;  2BTT A;  1K76 A;  2VWF A;  1WDX A;  4QT7 A;  4WCI A;  3VS6 A;  4J9C A;  2DM1 A;  2F2X A;  1NM7 A;  1SSH A;  2PZ1 A;  2QDL A;  1T3S A;  2PTK A;  2LQW A;  2DNU A;  2NUZ A;  4JPB W;  1CKB A;  4DEX A;  2JT4 A;  2C0T A;  1SRL A;  5GJW B;  4JJB A;  1GCQ C;  2RQV A;  1UGV A;  1UG1 A;  1NG2 A;  1UJ0 A;  4M4Z A;  2KRN A;  2DL4 A;  1VYV A;  2CDT A;  3QWX X;  2YUQ A;  1CSK A;  1QCF A;  2O31 A;  3ULR B;  2CH4 W;  1YWO A;  2B86 A;  1VA7 A;  4JZ4 A;  3VS4 A;  2ROL A;  4EIK A;  2E5K A;  2K3B A;  1Y57 A;  2YUN A;  1NYF A;  2EGC A;  4J9F A;  3REB B;  1K9A A;  1MV0 B;  1HD3 A;  4RTT A;  3NMZ C;  3REA B;  2KE9 A;  1GFC A;  2D0N A;  2P4R A;  1FMK A;  1UEC A;  2AZS A;  3GBQ A;  1PRL C;  2KBT A;  1QWE A;  1UFF A;  2LMJ A;  1K1Z A;  1ZUK A;  1U3O A;  2EQI A;  2D8H A;  1VYU A;  4AFZ C;  1TG0 A;  2OI3 A;  1JO8 A;  2EGA A;  1NLP C;  3JV3 A;  1KIK A;  1WX6 A;  2LP5 A;  3NGP A;  2C0I A;  2DMO A;  4IIO A;  4LN2 A;  1AWX A;  1BB9 A;  4IIM A;  4ORZ A;  1KFZ A;  3VS1 A;  2FG0 A;  1K0X A;  2VVK A;  3VRY A;  1ZBJ A;  1ZUU A;  3O5Z A;  5HCK A;  2O9S A;  2JMA A;  1NEB A;  3FJ5 A;  1T3L A;  2EYW A;  4F17 A;  1OPL A;  4J9D A;  1GBQ A;  2JM9 A;  2F2V A;  3U23 A;  2A36 A;  1GBR A;  3M0Q A;  3ZL7 C;  2CT3 A;  2LJ3 A;  1AWW A;  2OAW A;  3NPF A;  2JMC A;  1BBZ A;  2DX1 A;  3TSZ A;  2BZ8 A;  1I1J A;  2V1R A;  2EYX A;  1TUC A;  2GBQ A;  4ESR A;  1UTI A;  3H0F A;  2NWM A;  2AZV A;  1YNZ A;  2AK5 A;  1UHC A;  2LQN A;  1CKA A;  1GL5 A;  1H8K A;  3THK A;  1BU1 A;  2MOX A;  1WYX A;  1ZX6 A;  2EYZ A;  4LE9 A;  1V1C A;  1WFW A;  4JJD A;  2J06 A;  2ROT A;  1JEG A;  1YN8 A;  5IHI A;  1JXO A;  4RUG A;  1E7O A;  2FPD A;  4CC2 A;  1A0N B;  1KJW A;  2RMO A;  1AZE A;  1X2Q A;  1N5Z A;  2IIM A;  2KT1 A;  5FW9 A;  2KEA A;  2HEQ A;  1PKS A;  2L3P A;  2AKL A;  1T0J A;  3H0H A;  4OMN A;  1WA7 A;  2LJ0 A;  3CQT A;  1TUD A;  2K6D A;  4HCK A;  4HVU A;  3VS3 A;  1W6X A;  2M0Y A;  2HDA A;  1JU5 C;  3I9Q A;  5EC7 A;  4A63 B;  2DBK A;  3EG0 A;  2HCK A;  3NHN A;  2DBM A;  3RBB B;  1YCS B;  1X6G A;  4X1V A;  2CH4 A;  2LZ6 B;  2X3W D;  4J9I A;  1WI7 A;  5GJV B;  2YUO A;  4GBQ A;  2K2M A;  1I0C A;  4RTZ A;  3M0R A;  1ABQ A;  1AWJ A;  2OJ2 A;  1H92 A;  2AKK A;  2SRC A;  3VRZ A;  5I11 A;  4K11 A;  1MUZ A;  4J9B A;  4HXJ A;  3VS7 A;  1Y0M A;  2J6F A;  2CSQ A;  3LH5 A;  2ABL A;  1SHF A;  4LUE A;  2CUD A;  4AG2 C;  2L2P A;  1BK2 A;  2A28 A;  2DYB A;  3IQL A;  1NLO C;  2A37 A;  3VS0 A;  1PKT A;  1ZUY A;  4OMP A;  2RQW A;  1UHF A;  2JS0 A;  2W10 A;  3I35 A;  3EHQ A;  1QKW A;  2DLP A;  4KRT A;  1OPK A;  5FWB A;  2O88 A;  2L0A A;  1X6B A;  3EGU A;  1UE9 A;  2DL7 A;  5IHN A;  4RTX A;  1X2K A;  4CC4 B;  1OEB A;  4FSS A;  2J6O A;  2A08 A;  2DA9 A;  2RPN A;  1IO6 A;  1WXU A;  4JJC A;  4RTY A;  2KYM A;  2CUB A;  4OMO A;  2CSI A;  2O2O A;  2YSQ A;  4Z8A A;  1M3C A;  4AFS C;  1QWF A;  2L3S A;  2I0N A;  1QLY A;  1WIE A;  2D1X A;  2DE0 X;  5IXB A;  1GCP A;  2G6F X;  1LCK A;  1AVZ C;  1U5S A;  2DIL A;  4E6R A;  1ABO A;  1B3Q A;  3PE0 A;  2ED1 A;  1HJD A;  2JTE A;  1X69 A;  4CC3 A;  1B07 A;  2C0O A;  1RLP C;  1OOT A;  2RF0 A;  2JXB A;  2GQI A;  2K79 A;  4R0K A;  4RTU A;  2ECZ A;  4OML A;  2GNC A;  1WLP B;  2F2W A;  3SEM A;  4AFQ C;  2J7I A;  4HVW A;  1SHG A;  2LCS A;  2W0Z A;  3H0I A;  2KXD A;  1JXM A;  3RNJ A;  3TVT A;  2KRO A;  3M0P A;  2LX7 A;  2M51 A;  1SEM A;  1H3H A;  1RI9 A;  2FPF A;  1M8M A;  3EG3 A;  1M27 C;  1YWP A;  3H41 A;  5L23 A;  1OV3 A;  1Z9Q A;  2YUP A;  1YP5 A;  2L3Q A;  2ENM A;  2EYY A;  2J6K A;  1UDL A;  1K0S A;  4HVV A;  2RQT A;  5I22 A;  1T0H A;  1W1F A;  1AD5 A;  2ESW A;  1X27 A;  1RLQ C;  2KNB B;  4JZ3 A;  1M3B A;  2GTJ A;  2D8J A;  5IXF A;  2K9G A;  1HSQ A;  1U06 A;  1GCQ A;  3TSW A;  2DRM A;  2YT6 A;  2JW4 A;  3M0S A;  2EW3 A;  4CC7 A;  4OMM A;  1Z9Z A;  1NYG A;  2MIO A;  4DEY A;  2JS2 A;  3EG1 A;  4LNP A;  2DL8 A;  2RNA A;  1MV3 A;  4Y92 A;  5IHK A;  4AFU C;  1AOJ A;  4OMQ A;  1S1N A;  1VYT A;  2HBW A;  1XOV A;  2DF6 A;  1QKX A;  2H8H A;  2JM8 A;  2KRS A;  2LNH B;  2RQR A;  5IH2 A;  2HSP A;  4Z89 A;  1SPK A;  2ED0 A;  3UAT A;  1M3A A;  4LUD A;  4J9H A;  1PWT A;  2DRK A;  2EBP A;  1KSW A;  2CT4 A;  2MCN A;  4J9E A;  1PNJ A;  1E6H A;  2BZY A;  3I5R A;  2EGE A;  3VS5 A;  4RTW A;  3M0U A;  1PHT A;  2KT8 A;  1G83 A;  5ECA A;  2FRY A;  3I5S A;  2KRM A;  3PVQ A;  1UUE A;  2K7A A;  1I07 A;  1AZG B;  2KR3 A;  2EVR A;  3C0C A;  3QWY A;  2XMF A;  1AWO A;  1UJY A;  2DL3 A;  4RTV A;  2DL5 A;  3M0T A;  1J3T A;  1X43 A;  3EG2 A;  1SRM A;  1ZSG A;  3SHW A;  1GFD A;  2FO0 A;  4D8K A;  1M30 A;  4ZNX A;  1GRI A;  2VKN A;  1FYN A;  1ZLM A;  1RUW A;  1K4U S;  4Z88 A;  2KYB A;  1AEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...