1X2QA

Solution structure of the sh3 domain of the signal transducing adaptor molecule 2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
88
structure length
88
Chain Sequence
GSSGSSGSEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPSNFVTTNLNIETEAAAVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Signal transducing adapter molecule 2
publication title Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2
rcsb
source organism Homo sapiens
total genus 6
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x2qA00
1Z9QA 2AZSA 2HCKA 2DE0X 1CSKA 1FMKA 3EG0A 3M0QA 1RUWA 1E6HA 2L3PA 1UGVA 1M8MA 2JT4A 1MUZA 2P4RA 1OOTA 1M3AA 3VS1A 4A63B 2X3XD 2LJ1A 1ZLMA 2CSIA 2DA9A 2KT8A 2PNIA 4OMOA 2OAWA 2D8HA 1ARKA 2EBPA 1OPLA 2QDLA 3VRYA 3ZL7C 3UA6A 1ABQA 1KJWA 1WDXA 1GFDA 3EHQA 1JXMA 1QKXA 4HVUA 2JS2A 2HSPA 1VA7A 4RTTA 3NGPA 2FPEA 2O9SA 4QT7A 1WXTA 2IIMA 2KNBB 2M51A 3GBQA 2O88A 4CC7A 2JM9A 1U06A 1N5ZA 2NUZA 2RF0A 4LE9A 1QCFA 2YT6A 2AZVA 3M0PA 1I1JA 1LCKA 2LZ6B 2FRYA 4HVVA 1VYUA 2DYBA 2EQIA 4AFUC 3VS4A 3REBB 5FWCA 3H41A 5IHIA 2JTEA 1YCSB 5I22A 1X43A 2D8JA 2GTJA 4OMPA 3UF4A 1G83A 3NPFA 4AFSC 1GRIA 1WLPB 2J6OA 1I07A 4AG1C 4RUGA 2BZYA 2F2VA 1PRMC 2HDAA 2DM1A 4JZ3A 2CH4A 4F17A 2MIOA 4CC3A 3NHNA 3A98A 4J9HA 2O9VA 2GGRA 4FSSA 1AWXA 1S1NA 1HSQA 1UFFA 5IXFA 2RMOA 4RTWA 1ZBJA 2KROA 2K7AA 1E7OA 2M0YA 1NEGA 1UG1A 1YWPA 2ED1A 4GBQA 4IIMA 2C0OA 5FW9A 5EC7A 2EVRA 2YUQA 2CSQA 2EYWA 2LMJA 4D8KA 2DL3A 3I35A 1AD5A 1MV3A 4RTVA 1WX6A 1TUDA 1NLOC 3IQLA 5IHKA 1M3CA 2XMFA 3H0HA 1M3BA 4LUEA 1IO6A 4J9FA 2RQTA 1W70A 1UDLA 1E6GA 2AKLA 4R0KA 3TVTA 2KT1A 2LX7A 1NG2A 2L3SA 1QLYA 1W6XA 2YSQA 2J6FA 2X3WD 2CT3A 1JU5C 1PRLC 1PWTA 4J9CA 1ZX6A 1K4US 1NEBA 2DRMA 2GBQA 2KR3A 2GQIA 1V1CA 1UUEA 1OV3A 4Z8AA 2J7IA 2RNAA 4J9GA 1X2QA 3TSWA 4HCKA 2FPFA 2GNCA 1WI7A 3PVLA 2BZ8A 2EW3A 3SHWA 2KRMA 1HJDA 1EFNA 3M0RA 2LQNA 4J9BA 2JS0A 1AVZC 1AZGB 2YUNA 4ZNXA 2F2XA 3UATA 2K79A 5ECAA 1ZUUA 2SRCA 4J9IA 3VS6A 1YN8A 2JXBA 2FEIA 5FWBA 1NM7A 1K1ZA 1SRMA 2DBKA 4EIKA 2A08A 1Y0MA 2HEQA 4JZ4A 1H92A 2DL8A 2BTTA 1YWOA 2GTOA 2MOXA 4JJDA 1JO8A 1BBZA 2CUDA 1VYVA 2FPDA 1BU1A 2DX1A 2W10A 4M4ZA 2EKHA 3REAB 3RBBB 2O31A 4GLMA 1BK2A 1OPKA 3U23A 1QKWA 2E5KA 3EGUA 2W0ZA 1RLPC 1NYGA 1M30A 2HBWA 3H0FA 3UA7A 1AZEA 1U3OA 2AKKA 4LN2A 4Z89A 1WA7A 2KYBA 4LUDA 2I0NA 2JW4A 2J06A 3VS5A 2EYXA 1CKAA 3M0UA 2BZXA 2H8HA 2KYMA 2RQWA 2RQVA 2YDLA 1GL5A 2LJ3A 3QWYA 2KBTA 1K0SA 1SHFA 2K3BA 2RQRA 3QWXX 1AWJA 3VS0A 3H0IA 1ZSGA 2DL4A 4AG2C 1SPKA 2LCSA 4K11A 2L0AA 1MV0B 1AWWA 2KRSA 1K0XA 2DF6A 4E6RA 2DRKA 3JV3A 1H3HA 2ENMA 2LP5A 2LNHB 2MCNA 1PNJA 2CDTA 2SEMA 3I5RA 1QWFA 4LNPA 2KGTA 4Z88A 4ESRA 4F14A 2RQUA 1UHCA 1PKSA 2EYYA 2L3QA 1Y57A 2V1QA 1X6GA 2A37A 2LJ0A 4ORZA 1YNZA 2A36A 1BB9A 1UJ0A 3PVQA 2C0TA 2DNUA 4J9DA 1A0NB 2PZ1A 2CT4A 1SHGA 2EGCA 1FYNA 1NYFA 5GJWB 1ABOA 2EGEA 4F16A 1GCQA 3VS2A 3SEMA 2EPDA 5IXBA 1PKTA 5HCKA 2DBMA 1X6BA 1SRLA 1GCQC 3I9QA 3VRZA 3KFVA 2ED0A 2ABLA 1KIKA 2C0IA 1JQQA 2K6DA 2G6FX 2DILA 4X1VA 2LQWA 2K2MA 1K76A 1M27C 3EG3A 1X69A 2FO0A 2KXCA 4JJCA 4J9EA 4RTUA 4D8DA 3M0SA 1U5SA 1B3QA 5I11A 1HD3A 1GBRA 2NWMA 2J6KA 3PE0A 5IHNA 1WYXA 2DVJA 1YP5A 3O5ZA 2EYZA 1H8KA 1Z9ZA 2F2WA 2FRWA 2KE9A 1CKBA 1WXBA 3VS7A 3EG2A 2AK5A 4CC2A 3ULRB 1RLQC 2VKNA 4IIOA 3R6NA 2KXDA 3TSZA 1GBQA 2K9GA 2V1RA 1AOJA 1KSWA 1OEBA 4HVWA 3THKA 1T3LA 4DEYA 2EGAA 2OI3A 3EG1A 1X2KA 2CUBA 4DEXA 1UECA 1T3SA 1TG0A 2ROLA 2KEAA 1WIEA 2DJQA 3EHRA 2PTKA 1AEYA 2DMOA 2RPNA 2DL5A 2YUPA 2DL7A 4KRTA 2JMCA 2CH4W 4AFZC 2ROTA 1T0HA 1RI9A 2J05A 4OMNA 2DLPA 1JXOA 2B86A 5IH2A 2VWFA 1JEGA 1KFZA 2VVKA 1K9AA 4HXJA 4RTZA 1PHTA 4OMLA 2JMAA 2JM8A 2D1XA 2ECZA 2KRNA 1UHFA 1WXUA 1B07A 4CC4B 1XOVA 2FG0A 1G2BA 5GJVB 4Y92A 2L2PA 4JPBW 1I0CA 3M0TA 2YUOA 1TUCA 1AWOA 1J3TA 1VYTA 3NMZC 1UJYA 4JJBA 1SEMA 1X27A 1UE9A 2O2OA 5L23A 3VS3A 1GFCA 2A28A 2OJ2A 1WFWA 2CREA 1QWEA 4WCIA 1T0JA 3I5SA 4OMQA 3CQTA 4AFQC 1SSHA 3FJ5A 1ZUYA 2ESWA 3LH5A 1GCPA 4OMMA 2RN8A 2D0NA 3C0CA 4RTYA 4RTXA 1W1FA 1NLPC 1ZUKA 3RNJA 1UTIA
chains in the Genus database with same CATH superfamily
1Z9QA 2EFIA 3S3MA 2VXFA 2DE0X 2E64A 5KH6A 1FMKA 2ZCFB 2DKGA 1TTHB 2L3PA 4M78E 4ZN1A 3SWNA 3L1AA 5A0DA 2DA9A 2XG8D 4O6JA 1G8XA 1ARKA 1OPLA 3CXCS 1M90U 3UA6A 3DB3A 4KT0E 3EHQA 4PJOG 3TU4K 1RACB 2JS2A 1BIAA 3PMTA 1JJ2S 1X75C 2ZZDA 1VA7A 5AT1B 3NGPA 2FPEA 3GBQA 4KGXB 3QYHB 1NPPA 5GANf 2DEUA 2JM9A 2E6ZA 1PM3A 2RF0A 4ME7A 2LQ8A 2RI3A 5D7UA 3CCQQ 2AZVA 1PSEA 1I1JA 3OYNA 1XQHA 3V8LA 2EQIA 3KUFA 3UT1A 3REBB 3JSCA 3CCQT 4MDXA 4M78D 3OA6A 3H6ZA 2D8JA 2GTJA 3QDRB 3NPFA 3CCUQ 3LH0A 4AG1C 2DXBA 2F2VA 3BW1A 4PLLA 1QW1A 4JZ3A 3CCUT 2GGRA 4FSSA 1AWXA 3JCMJ 4JRPA 1QVFS 2V8IA 2K7AA 1I5LA 2M0YA 1NEGA 4XTVA 1ZA1B 1YWPA 2ED1A 4KH0B 4DOVA 3PIOA 1RL2A 2HSEB 4JRIA 2YUQA 1YJNQ 2DL3A 3QIIA 1AD5A 1MV3A 4RTVA 1TUDA 2ZPGB 5GMKe 1NLOC 4E2FB 2HKNA 5IHKA 1YJNT 3DLLA 4LUEA 1YITA 2CZ1B 1VQ4Q 5CCAA 1Y96B 1UDLA 3G71A 2AKLA 4R0KA 2LX7A 3VU3C 1NG2A 1S72Q 1VQ4T 3QO3A 3EFOA 4EMKB 4J9CA 3KXTA 2P84A 3F70A 1UUEA 2RNAA 2YHTA 1S72T 1IB8A 2DXUA 5KE2A 1WQ7A 3MHXA 2E4HA 3QZ9B 2GNCA 4N4HA 3WVEB 2MAMA 1DJ7B 2BZ8A 3HKSA 2RM4A 3X25B 3JCMP 1HJDA 2KY9A 3QJ6A 4F7UA 1AZGB 4Q5WA 4QQGA 3Q1JA 4ZNXA 5GAOq 5KYXA 2F2XA 5CKBA 1ZUUA 1Y7XA 5D6XA 2IG0A 2RI5A 4M75G 5J39A 3M4YA 2MPXC 2R58A 4B9XA 3ASKA 2DTOA 2MI6A 4IUPA 4OGCA 4JZ4A 1YWOA 4BD3A 4JJDA 2VASA 2KQWA 3MP6A 2W10A 4C8QB 2O31A 3KBGA 4GLMA 1OULA 1OPKA 2E10A 4DBHA 2W0ZA 1M30A 1D0XA 3JB9G 2AKKA 4RMOA 2KYBA 4C8QF 3PT9A 1LNXA 4XAXB 1NE8A 1N27A 2QQBA 4BB7A 3M0UA 2RQWA 4ZGEB 2LJ3A 4B6MA 1TSFA 2QTXA 3EH2A 2RQRA 3H0IA 1ZSGA 2VXEA 4KULA 1NJIC 4AG2C 4PL6A 2FZKB 1SPKA 5CQXA 1JB0E 1MV0B 1K0XA 2YLBA 2DRKA 3SB2A 1VQNQ 1FWZA 3OYAA 4Z02A 2QEXQ 1XTDA 2CDTA 4LNPA 3RUXA 1VQNT 2L3QA 1Y57A 5GAOp 2QDYB 4LXCA 1BB9A 2ZPIB 2C0TA 2PZ1A 2VGMA 2LCLA 2RD1A 1TOVA 2EGEA 1N6AA 4OB0B 4M7AC 4VUBA 4FU6A 3CCVA 1QVGP 1PKTA 2RK1A 2VC8A 3CXCA 4C0DB 4FT2A 5D6WA 1GCQC 4BI3A 2GQVA 2ED0A 5KCOA 2ABLA 1KIKA 2C0IA 1JQQA 1ZSZC 4P5NA 2CYZB 2G6FX 3RR6A 1VQ8Q 2WSFE 1D3BA 5I21A 5LJ5f 1M1KU 2WSEE 2XIDA 2FO0A 2R5MA 4JJCA 1VQ8T 1RAFB 2JTFA 1D1BA 1YIJA 1R8OB 3G1JA 3M0SA 4M7DA 5I2SA 2X4WA 2NWMA 2J6KA 2V8KA 5DLQE 2EYZA 2O01E 1H8KA 1Z9ZA 1UGQB 3CCSQ 2KE9A 2AK5A 3ULRB 4E7ZA 2IVWA 3R6NA 3I55Q 3CCLA 3CCST 4XTUA 4CI0C 4CRIA 1YI2A 4RCCA 3TSZA 3RMQA 1AOJA 4Y91A 3PIPA 2YXYA 3A1PA 3THKA 2PVGB 3I55T 1QVFA 2Y90A 2OI3A 3EG1A 1X2KA 2M02A 1K9MR 5EG2A 1VQ9Q 2FHDA 4DEXA 3VUBA 4BE0A 1QMCA 3LYIA 1BI0A 1WIEA 3RKYA 5CKHA 4NOYA 1MMGA 1VQ9T 1PC0A 4AFZC 4FM4B 4LDUA 3GIBA 4J7FA 3QXEB 3FDRA 5IH2A 1VQ7A 2HZYA 4M77G 1JEGA 1Q82U 3QYGB 3EFOB 1PHTA 4L59A 2ECZA 4XTXA 1WXUA 1BCOA 4CC4B 4PJOC 4HCZA 1VQKQ 1QVGS 1Q7YR 1IHWA 4JPBW 3OB9A 4C92B 1I0CA 3M0TA 2RJEA 3A8MB 1VQKT 4M78A 2EKOA 3OS2A 1J3TA 1YHQA 4IUQA 1UJYA 5IT9E 1IXDA 2O2OA 1Y07A 2OJ2A 5KYXB 4WCIA 3CCMA 3FB9A 4OMQA 3I5SA 2QA4Q 2O4XB 5J3BA 4F7UF 1VQ6Q 1GCPA 2EQUA 3FC3A 2QA4T 2OTJA 5HK3A 2E5QA 3OYHA 4A4EA 1UTIA 1KC8R 4MZMA 1VQ6T 1H3ZA 1W2BP 5LJ3d 3DKMA 4N4GA 2LRQA 2RJDA 3CCET 2H3JA 1Q81R 3VS1A 1VIEA 4A63B 2CSIA 2PNIA 2E65A 2OAWA 4R55A 2GCXA 2D8HA 3CMEQ 3VRYA 5IN1A 1FMWA 3VYGA 2VYTA 4N4IA 1YJWQ 1GFDA 4NL3A 3CMET 1QKXA 3JCMd 2CZ0B 4FL6A 2QQAA 3GPLA 1O9SA 2JZ2A 4PJOD 4RTTA 1EX4A 2O9SA 3HFOA 1YJWT 2HMAA 1WXTA 4ATOA 2IIMA 2O88A 3E1SA 2CGHA 2NUZA 3L2VA 5FRMA 3BDUA 4OGEA 4QQ6A 1QCFA 2DTIA 2COWA 3I56A 2K2VA 3R6OA 1LCKA 2LZ6B 1KD1R 4HVVA 1O75A 1VYUA 3O8VA 4PJNA 3MPUB 2P4TA 5CIUA 1K9MC 3H41A 4B9WA 5GAMd 1YCSB 1D1AA 5I22A 1TH7A 2D6FA 2RK2A 4BDYA 3UF4A 5GAN4 2JVVA 4AFSC 2J6OA 1LVKA 2KK4A 1PRMC 4XU0A 2HDAA 2DM1A 5CKEA 2CH4A 4F17A 2MIOA 4J9HA 1HSQA 1SKUB 1ZBJA 2HL3A 4BY6C 5GANd 3LWIA 2AIRB 3CBMA 2C0OA 2A7YA 5FW9A 4C92G 2CSQA 2BE9B 3E19A 1K73U 2P0KA 2K5IA 1Q7YC 4JRKA 1G3YA 2RHUA 2DETA 5GAN6 1M3BA 2FZGB 2CP2A 1SF9A 4WF2A 1W2BS 3D7SB 2NUPA 3C94A 4J9FA 3HRUA 4OVAA 4M75E 1KQSS 3L2WA 1QLYA 2YSQA 1PWTA 2Y4XA 1ZX6A 5DM7R 1D3BB 4L6V5 4DBQA 1K4US 2KR3A 4Z8AA 3RMSA 3OYGA 5HK0A 4X34A 1RAGB 1M1FA 5KYWB 2CP6A 2BIVA 1WPYA 5C6SA 4HCKA 2FPFA 3J81E 3G6EA 1KC8C 1MNDA 5GAMj 1YITQ 2YRCA 3JCMV 3LLRA 3NTHA 5FU7C 3G71Q 2NUTA 3NFCA 4J9BA 2JS0A 2K3XA 1YITT 5CQYA 1Q81C 4XTWA 4M7DF 3QHSA 1P92A 3G71T 2HAXA 3CMAA 3HSBA 4MMKA 1ZHIA 1K1ZA 2F1LA 3V8KA 4EIKA 4M75D 4C0FA 2D0QB 1H92A 4EMGA 2BUDA 3CPWS 5DLOA 4EMKC 1BBZA 2A0FB 5GMKi 3ZFJA 4MMLA 1R77A 4FYYB 5KYUB 2EKHA 3RBBB 1VUBA 2RHXA 2E5KA 4LDWA 1KD1C 1RLPC 3EG9A 5GAN8 2HBWA 5FLXE 1Q86R 1YJ9A 3OYJA 1U3OA 1KQ1A 3P8DA 3JCMh 1HK9A 3JB9D 4QVZA 2JW4A 1C6VX 2RA2A 2EYXA 1JRIA 4BI4A 1WJRA 4M75F 2BZXA 2H8HA 2KYMA 2HL5C 3CD6A 1RAIB 3WXMB 3SFMA 1N8RU 1PSFA 3QWYA 4A4KA 1K0SA 1SHFA 1QQJA 1WHLA 1NJIR 3QWXX 3META 1TUGB 1QVGA 4DOWA 2LNVA 5FRNA 8ATCB 2DO3A 3OYFA 5GAMh 1LOJA 4K11A 4ZTJA 1AWWA 2PUOB 4M78F 1H3HA 4LDYA 2LNHB 2JJ9A 4A54A 3JB9F 5GAN2 2MCNA 4ELYC 2COYA 3AT1B 2EJ9A 3V8JA 1QWFA 4F14A 2RQUA 1PKSA 2EYYA 3M59A 5GANh 1X6GA 2LJ0A 4M7AA 3OW2P 5L8RE 3S3NA 2EAYA 3JB9I 3OYDA 2QQRA 1ABOA 4F16A 1GCQA 3VKIA 2YWWA 3CC2A 2DD4A 4J6XA 1MNEA 2CS7A 1OZ2A 1RI0A 1ZSZA 4A4FA 1H641 1MMAA 2DBMA 5FROA 1X6BA 4XU2A 3PFSA 3VRZA 3KFVA 3HP9A 3TEEA 2K2MA 4FT4A 4AT1B 1K76A 1M27C 4M77C 1PCXA 3EG3A 4HCBA 2E3HA 4JJNK 3LX7A 2AHJB 2QXFA 3S6WA 4E7KA 2KSSA 3QSUA 3CCVQ 3HHTB 4D8DA 5I11A 1HD3A 4A4GA 3PE0A 5IHNA 3UWNA 3O5ZA 3CCVT 1SG5A 2AT1B 1M8VA 2F2WA 8AT1B 4IURA 4FYWB 2CP7A 4E7IA 4M77E 1Q86C 2VKNA 3UDCA 2KI7A 1D09B 4C0DC 5CO7A 1OQKA 2VGNA 3JCMc 2DXCA 3GLXA 1YIJQ 1T3LA 3A8HB 3LGFA 4DEYA 3CC4A 1YCYA 3FEOA 4J6YA 3N5BB 2OTLA 1JBMA 1T3SA 4BACA 1TG0A 4X9DA 2ROLA 1YIJT 1BYMA 2DJQA 3VV0A 2PTKA 1AEYA 2DMOA 2YUPA 4KRTA 3QJYA 1QVPA 4EPCA 1Q82R 2NUPB 3CCLQ 1T0HA 1RI9A 2J05A 3M53A 4OMNA 1YI2Q 4PJOA 1JXOA 3EGXA 3OW2S 2VVKA 4HXJA 3CCLT 4JRQA 2VB6A 4M77D 2DIQA 3BDLA 1G3SA 1YI2T 1KQSA 2KVQG 2JM8A 2D1XA 2KRNA 3HL8A 4PJJA 1UHFA 3M9QA 1B07A 1M4ZA 5AYFA 2L2PA 3X26B 4F04B 2FL7A 3OS5A 4QW2A 1AWOA 3NMZC 4N0AC 3SWNB 2NUTB 5KYNA 1VQ7Q 5L23A 1GFCA 2BKDN 1WFWA 1KHIA 3CC7A 4FW1A 1T0JA 2QGGA 5IAYA 1SSHA 1WGSA 3MCAB 3HTRA 3FJ5A 1VQ7T 2Z0WA 2LT1A 2QAZA 4M77F 4OMMA 3EFSA 3C0CA 1MMNA 4QQDA 1W1FA 1ZUKA 1IRXA 4R56A 3UPUA 1R0CB 1M1KC 1JJ2A 3OSVA 3G4SA 3M0QA 1HYOA 2MWOA 2QI2A 1RUWA 3CPWA 1M8MA 2JT4A 2P4RA 4M7AE 1M3AA 3OQ5A 5GAOr 3CCMQ 2LJ1A 1ZLMA 1YHQT 4C8QG 1QP3A 4RKUE 3EG9B 2JUFA 1PD0A 4C92C 3P8BB 3ZL7C 1XJWB 2DZCA 3JCMX 3CCMT 2OTJQ 3G7ZA 1JXMA 2DFUA 1I4K1 5LJ3e 4HVUA 2YRDA 3EGDA 2HSPA 1IREB 3LW5E 1K8AU 1XNIA 2OTJT 1KK7A 3GP8A 2M51A 1B7TA 3MP1A 4JUVA 4CC7A 3L2RA 1N5ZA 3OS1A 2YT6A 2PU9B 1VQPA 1Q95G 4KGZB 3JCMe 4KBMB 3VS4A 2R57A 2ZAEA 2E6NA 2JTEA 4M7AD 2E70A 2OX7A 1VQ5A 3MJXA 1B34A 2RB6A 2MF2A 1I07A 4RUGA 1ZQ1A 2BZYA 4FSXA 1Q82C 4E7HA 3RKXA 4M75A 2QEXA 1RADB 2O9VA 1S1NA 1LJOA 1ZA2B 3MEVA 3V7SA 5IXFA 5GAMe 4FIBA 2RMOA 3I56Q 1UB4A 2KROA 1K73R 1UG1A 4TVRA 5FU6B 4DBRA 4IIMA 1WHGA 3HRTA 3INZA 3ZBDA 3I56T 4BI8B 2EYWA 4J83A 1X6OA 2LMJA 4D8KA 4C92D 1WZOA 4KUDK 1U1SA 2XK0A 4M7AF 1OX9A 2YRVA 4V2SA 1M3CA 4C5IA 1D1CA 4F7UB 5GANe 1IO6A 4ZTFA 1MMDA 3MEUA 4XK8E 4PJMA 4BE2A 2LX9A 1BCMA 3PNWC 2F5TX 4PJOE 2L3SA 3CCJA 1FMVA 4GY5A 1W6XA 2J6FA 2X3WD 1JU5C 1PRLC 1VOMA 1LPLA 2GBQA 3GNFB 1WJQA 1V1CA 4GLKA 2CP5A 1M5Q1 3EAEA 1V29B 2CZ6B 3CCEQ 4LDVA 1WI7A 2MWPA 2PVDB 3A5ZB 1M90R 3SHWA 2KRMA 1EFNA 1X01A 3M0RA 3OSSC 2LQNA 4PFOA 4KH1B 1AVZC 3QBYA 4IKFA 5LJ3g 2YUNA 1Y96A 3CPFA 2SRCA 2LT4A 2JXBA 2FEIA 5FWBA 4EMKA 4J5YA 4IUUA 1SRMA 2HKQB 2DYIA 4MZTA 2A08A 3G6EQ 1Y0MA 1D0YA 2HEQA 2HQXA 2HQHA 3P8HA 2DL8A 2BTTA 3JCMg 1VQLA 2MOXA 1JO8A 3G6ET 3QZ5B 2IPOB 2FPDA 1VYVA 1BU1A 2DX1A 3OYMA 2NYSA 3OYEA 4JLIA 5A0GA 4C5HA 3U23A 1UGRB 3EFRA 1NYGA 4PLIA 5GAOl 2HD0A 3UA7A 1AZEA 2VUBA 4Z89A 1WA7A 4LD6A 4LUDA 2I0NA 4J7IA 1U1TA 4C0ZA 3CMAT 2MK5A 4WTOB 2E41A 2J06A 5GAMg 5CR2A 4HT9A 3OW2A 4PJOF 4BDZA 3E9FA 6AT1B 2YDLA 2DPPB 3L2ZA 1V76A 2X35A 2X4JA 2KBTA 1UGPB 2NLUA 3BFMA 2K3BA 1BKBA 4J8OA 4E7JA 5J26A 5LJ3j 1K9MU 2DL4A 1K73C 3JB9H 1YJ9Q 1WHKA 4E47A 3RKWA 2DJZA 4Y28E 2LCSA 5GANg 1YFNA 2PUKB 2L0AA 4F7UG 1D0ZA 2KRSA 3TQ7P 3OY9A 2DF6A 1YJ9T 3A8OB 2ENMA 2CP3A 1VQOA 3QPHA 2QYZA 1PNJA 2Y4YA 1IHVA 5D6YA 1G5VA 1PG5B 4MZPA 4XU3A 4OP0A 3CD6T 2M0OA 1BI3A 2V1QA 2A37A 4FW2A 4ORZA 2A36A 3PVQA 4C5GA 4PJLA 2E3IA 1QVFP 1NYFA 3T9NA 3SD4A 1M2VA 3MKDA 4RCBA 2QQ9A 4M7DB 3SEMA 2EPDA 2KDSA 4D6WA 4LD9K 5IXBA 5GAOm 2ZPBB 2BE7D 4IUVA 5HCKA 3EGDB 1M90C 2P0QA 1SRLA 4M77A 3QKJA 5GMKm 2LTOA 2X51A 4A4HA 2X9HA 2CKKA 2K6DA 3OMGA 1IGUA 2DILA 4XQ3A 2M16A 1KC8U 5GANj 4BE1A 2G3RA 3CC2Q 1NZ9A 3QDFA 2KXCA 5CVIA 3MEAA 5GAMf 5LJ3h 4RTUA 1I81A 1U5SA 2E12A 3FIFA 2LQKA 1B3QA 3CC2T 3WVDB 1Q81U 2M1HA 2DVJA 1B34B 1YP5A 3PMIA 2RH2A 4BY6B 2FRWA 4M75B 4CC2A 2EQJA 4II1A 1VQMA 4IIOA 3V7RA 5HY6A 5HKCA 2XD0A 1GBQA 3HPWA 3H8ZA 2V1RA 1N8RC 4HVWA 3CCRA 1UEBA 2EGAA 2I2LA 2DERA 3J7AF 1UECA 1OX8A 3FJPA 1OZ3A 2WSCE 1KD1U 4M78B 2JMCA 3AHUA 4HA8A 2HBPA 3ER0A 2ROTA 4JS5A 1IGQA 4PK4A 2DLPA 2MYSA 5LJ5e 1U8RA 4DQ2A 3MO8A 1FX7A 3M54A 1WHMA 3OYLA 4C8QC 4ZN3A 2K3YA 4QKUA 2LCCA 3CC4Q 4L5GA 2OTLQ 3L2QA 3RERA 2FG0A 2XDBA 1TXQA 4N0AA 5FU7B 1VIFA 1HXDA 3OBWA 3CC4T 5GJVB 3DB4A 4PKCC 1TWBA 3QG1A 2OTLT 3GF5A 2OAUA 1RAHB 2RJFA 3X28B 2YUOA 4IUTA 4M7DG 1VYTA 4C8QE 4JJBA 1SEMA 1UE9A 2B8AA 3ME9A 2XHCA 2A28A 2X4YA 3C12A 2CREA 3OYCA 5KYYA 3CQTA 4AFQC 1BI2A 1ZUYA 1QCOA 2RN8A 2D0NA 4RTXA 1NLPC 2EIFA 3RNJA 1M1KR 2AZSA 4ELZC 2HCKA 5KCHA 1CSKA 3JCMb 3EG0A 2MMPA 4C92A 2EYQA 1E6HA 1UGVA 1Y71A 2EJGA 2COZA 1MUZA 1BI1A 2FB7A 1OOTA 3L42A 3J80E 3CC7Q 2X3XD 5GAN3 3CCQA 2KT8A 4OMOA 1WNLA 2EBPA 2QDLA 2O4XA 2QGFB 1K8AR 1TS9A 4C8QD 1ABQA 3CC7T 1EZZB 1KJWA 1WDXA 2FVUA 3M56A 1AHJB 2PVOB 2DXTA 5CAIA 3SWNC 2QQSA 3CCUA 3G4SQ 3NTKA 4QT7A 4JS4A 1MHNA 2KNBB 2EQMA 2VV5A 3A8LB 1I5OB 3LGLA 2D9TA 4NL2A 3TREA 4OB1B 1U06A 3G4ST 2RHYA 4LE9A 2HQEA 3M4GA 1NPRA 3FRNA 7AT1B 2ZPFB 3M0PA 3OS0A 2F5KA 2FRYA 5LJ5d 2CP0A 2DYBA 3CEYA 4AFUC 4M78G 3OBYA 5FWCA 5IHIA 1X43A 5LJ5g 1YJNA 4PFZA 4OMPA 1G83A 1GRIA 1WLPB 2QASA 4PFPA 1WJSA 1Q86U 3OYIA 4HT8A 1F1BB 4QVCA 4CC3A 1VQ4A 2DEQA 3A98A 3NHNA 2HNIA 2A3LA 1W2BA 4ZGDB 1UFFA 1EIFA 1VQPQ 4RTWA 1E7OA 1S72A 4GBQA 4BUGA 2ATCB 5EC7A 1VQPT 2EVRA 5I2MA 1VQ5Q 2X4XA 4MDWA 3VUZA 1WHJA 1M2VB 1NJIU 3I35A 3CBPA 4ZGJB 1WX6A 2DK3A 3IQLA 1VQ5T 2XMFA 3X24B 3M57A 3H0HA 1G3TA 2LDMA 4M77B 2GF7A 2RQTA 1W70A 1E6GA 3TVTA 2KT1A 3BY7A 2QEXT 1OU9A 3JRZA 2L8DA 4HKEA 3OYKA 2L3RA 4RG2A 4X9CA 2CT3A 1NEBA 2DRMA 2QK0A 2GQIA 3CBOA 1OV3A 2J7IA 4J9GA 4FCYA 1X2QA 3FLGA 3TSWA 5LJ5j 2DIGA 2F69A 2K5FA 3PVLA 1YHQQ 3HFNA 5FU6C 2EW3A 1WHHA 2EQKA 1N9SA 4LDXA 4C0GA 3CCJQ 4HCCA 2L89A 4EMHA 3UATA 2K79A 5ECAA 4J9IA 5C0MA 3VS6A 2K5LA 1YN8A 5GMKj 2XDPA 1NM7A 4QVDA 4FYXB 3V7CA 1K8AC 3CCJT 1IZ6A 2DBKA 1RABB 2EWNA 5KYWA 3MP8A 1W4SA 2GTOA 3M55A 2QG9B 3MEWA 2CUDA 4C92E 3EH1A 4M4ZA 4E7LA 3REAB 1BK2A 1QKWA 2PQWA 4F7UE 2WACA 3EGUA 1QP2A 2H3EB 2XI9A 2GFAA 3H0FA 3GNGA 3OYYA 4LN2A 4DA4A 2JTMA 4XU1A 4ANJA 2KAFA 3X20B 2XKOC 3RDVA 3VS5A 1M9SA 4O5VA 3C4SA 1CKAA 1VQLQ 1VQNA 2RQVA 2RO0A 1GL5A 1G3WA 2XDDA 1VQLT 5LL6S 1AWJA 4M7AB 3VS0A 5LJ5h 5KYUA 4YTLA 2RJCA 3H9NA 3OMCA 2JOYA 5KYYB 3VYHB 4E6RA 3BE3A 3JV3A 1ZSZB 3SDZA 2LP5A 2FZCB 1SSFA 2DTHA 1C1AA 2SEMA 3RIRA 1I8FA 3I5RA 5GMKh 2KGTA 3QUIA 3VJPA 4Z88A 2C06A 4ESRA 2GFUA 1UHCA 2EJFA 3JCMQ 1MGQA 4PNOA 2JNGA 1YNZA 2KMTA 1UJ0A 2DNUA 4J9DA 1A0NB 4KUIA 1VQ8A 2CT4A 1PD1A 1SHGA 2EGCA 1FYNA 4E7SA 1FXXA 5GJWB 1BIBA 5KE3A 5A0LA 4C92F 3VS2A 2QTVA 2JN0A 1VQOQ 2ZGWA 5CKDA 1AT1B 5A2QE 3DLMA 1OI1A 2RHZA 2ZPHB 4XTYA 1ACMB 1VQOT 3I9QA 3OYBA 3E2UA 2R5AA 3CCSA 1R0BG 2RI2A 4JLGA 4X1VA 2DAQA 2LQWA 4C5EA 5CK9A 3I55A 2M9UA 1ZBXA 1KQSP 1X69A 3NTIA 4UC4A 2LC4A 2RHIA 2L5QA 1M1GA 4J9EA 4JDSA 5GAOn 5M9OA 1VQ9A 1GBRA 1KHCA 1WYXA 4DBFA 1OYXA 2V8JA 9ATCB 5GAN5 1KQ2A 4XTZA 3CMAQ 1CKBA 1WXBA 3VS7A 3EG2A 4PJOB 4M7DC 3EGXB 4NS5A 1RLQC 5GMKl 2DD5A 1M2OA 2KXDA 1N8RR 3ZEHA 1KG1A 2XICA 2K9GA 1KSWA 1OEBA 3LWHA 3CXCP 3M5AA 1WQWA 3JAME 4AMCA 3URGA 4M7AG 2CUBA 2K57A 3PGGA 3S3OA 3PTAA 5CKFA 1JJ2P 2KEAA 4OB2B 3GOXA 1VQKA 3EHRA 3M58A 4M7DE 1N9RA 2DL5A 2RPNA 4OF1A 2DL7A 1RAEB 4C8QA 3CPWP 2CH4W 2DZ9A 4OMFB 3A8GB 1VQMQ 4FYVB 1NBEB 2K4YA 4OB3B 2YLCA 5GAN7 2CZ7B 2V26A 4KGVB 4RG8A 2B86A 2VWFA 4J6WA 3JCMW 1KFZA 1K9AA 5DY9A 1VQMT 4RTZA 3CCRQ 1TU0B 4OMLA 2ZPEB 3C95A 3CD6Q 2QA4A 3TCJA 2JMAA 3E9GA 1OU8A 4M75C 1XOVA 1VQ6A 1RAAB 3CCRT 1G2BA 3RESA 5LJ3f 4Y92A 3L2UA 3JB9J 2E1HA 2DVEA 2P0PA 3CCEA 1TUCA 2FYKA 3HRSA 1Q7YU 1X27A 1UGSB 4A53A 3VS3A 4EDUA 4M7DD 1QWEA 2LVMA 1GXIE 2XU8A 1C0MA 1QCNA 1YBYA 4M78C 3JCMf 3CMEA 2ESWA 3LH5A 1YJWA 4RTYA
chains in the Genus database with same CATH topology
1Z9QA 2AZSA 2HCKA 2DE0X 1CSKA 1FMKA 3EG0A 3M0QA 1RUWA 1E6HA 2L3PA 1UGVA 1M8MA 2JT4A 1MUZA 2P4RA 1OOTA 1M3AA 3VS1A 4A63B 2X3XD 2LJ1A 1ZLMA 2CSIA 2DA9A 2KT8A 2PNIA 4OMOA 2OAWA 2D8HA 1ARKA 2EBPA 1OPLA 2QDLA 3VRYA 3ZL7C 3UA6A 1ABQA 1KJWA 1WDXA 1GFDA 3EHQA 1JXMA 1QKXA 4HVUA 2JS2A 2HSPA 1VA7A 4RTTA 3NGPA 2FPEA 2O9SA 4QT7A 1WXTA 2IIMA 2KNBB 2M51A 3GBQA 2O88A 4CC7A 2JM9A 1U06A 1N5ZA 2NUZA 2RF0A 4LE9A 1QCFA 2YT6A 2AZVA 3M0PA 1I1JA 1LCKA 2LZ6B 2FRYA 4HVVA 1VYUA 2DYBA 2EQIA 4AFUC 3VS4A 3REBB 5FWCA 3H41A 5IHIA 2JTEA 1YCSB 5I22A 1X43A 2D8JA 2GTJA 4OMPA 3UF4A 1G83A 3NPFA 4AFSC 1GRIA 1WLPB 2J6OA 1I07A 4AG1C 4RUGA 2BZYA 2F2VA 1PRMC 2HDAA 2DM1A 4JZ3A 2CH4A 4F17A 2MIOA 4CC3A 3NHNA 3A98A 4J9HA 2O9VA 2GGRA 4FSSA 1AWXA 1S1NA 1HSQA 1UFFA 5IXFA 2RMOA 4RTWA 1ZBJA 2KROA 2K7AA 1E7OA 2M0YA 1NEGA 1UG1A 1YWPA 2ED1A 4GBQA 4IIMA 2C0OA 5FW9A 5EC7A 2EVRA 2YUQA 2CSQA 2EYWA 2LMJA 4D8KA 2DL3A 3I35A 1AD5A 1MV3A 4RTVA 1WX6A 1TUDA 1NLOC 3IQLA 5IHKA 1M3CA 2XMFA 3H0HA 1M3BA 4LUEA 1IO6A 4J9FA 2RQTA 1W70A 1UDLA 1E6GA 2AKLA 4R0KA 3TVTA 2KT1A 2LX7A 1NG2A 2L3SA 1QLYA 1W6XA 2YSQA 2J6FA 2X3WD 2CT3A 1JU5C 1PRLC 1PWTA 4J9CA 1ZX6A 1K4US 1NEBA 2DRMA 2GBQA 2KR3A 2GQIA 1V1CA 1UUEA 1OV3A 4Z8AA 2J7IA 2RNAA 4J9GA 1X2QA 3TSWA 4HCKA 2FPFA 2GNCA 1WI7A 3PVLA 2BZ8A 2EW3A 3SHWA 2KRMA 1HJDA 1EFNA 3M0RA 2LQNA 4J9BA 2JS0A 1AVZC 1AZGB 2YUNA 4ZNXA 2F2XA 3UATA 2K79A 5ECAA 1ZUUA 2SRCA 4J9IA 3VS6A 1YN8A 2JXBA 2FEIA 5FWBA 1NM7A 1K1ZA 1SRMA 2DBKA 4EIKA 2A08A 1Y0MA 2HEQA 4JZ4A 1H92A 2DL8A 2BTTA 1YWOA 2GTOA 2MOXA 4JJDA 1JO8A 1BBZA 2CUDA 1VYVA 2FPDA 1BU1A 2DX1A 2W10A 4M4ZA 2EKHA 3REAB 3RBBB 2O31A 4GLMA 1BK2A 1OPKA 3U23A 1QKWA 2E5KA 3EGUA 2W0ZA 1RLPC 1NYGA 1M30A 2HBWA 3H0FA 3UA7A 1AZEA 1U3OA 2AKKA 4LN2A 4Z89A 1WA7A 2KYBA 4LUDA 2I0NA 2JW4A 2J06A 3VS5A 2EYXA 1CKAA 3M0UA 2BZXA 2H8HA 2KYMA 2RQWA 2RQVA 2YDLA 1GL5A 2LJ3A 3QWYA 2KBTA 1K0SA 1SHFA 2K3BA 2RQRA 3QWXX 1AWJA 3VS0A 3H0IA 1ZSGA 2DL4A 4AG2C 1SPKA 2LCSA 4K11A 2L0AA 1MV0B 1AWWA 2KRSA 1K0XA 2DF6A 4E6RA 2DRKA 3JV3A 1H3HA 2ENMA 2LP5A 2LNHB 2MCNA 1PNJA 2CDTA 2SEMA 3I5RA 1QWFA 4LNPA 2KGTA 4Z88A 4ESRA 4F14A 2RQUA 1UHCA 1PKSA 2EYYA 2L3QA 1Y57A 2V1QA 1X6GA 2A37A 2LJ0A 4ORZA 1YNZA 2A36A 1BB9A 1UJ0A 3PVQA 2C0TA 2DNUA 4J9DA 1A0NB 2PZ1A 2CT4A 1SHGA 2EGCA 1FYNA 1NYFA 5GJWB 1ABOA 2EGEA 4F16A 1GCQA 3VS2A 3SEMA 2EPDA 5IXBA 1PKTA 5HCKA 2DBMA 1X6BA 1SRLA 1GCQC 3I9QA 3VRZA 3KFVA 2ED0A 2ABLA 1KIKA 2C0IA 1JQQA 2K6DA 2G6FX 2DILA 4X1VA 2LQWA 2K2MA 1K76A 1M27C 3EG3A 1X69A 2FO0A 2KXCA 4JJCA 4J9EA 4RTUA 4D8DA 3M0SA 1U5SA 1B3QA 5I11A 1HD3A 1GBRA 2NWMA 2J6KA 3PE0A 5IHNA 1WYXA 2DVJA 1YP5A 3O5ZA 2EYZA 1H8KA 1Z9ZA 2F2WA 2FRWA 2KE9A 1CKBA 1WXBA 3VS7A 3EG2A 2AK5A 4CC2A 3ULRB 1RLQC 2VKNA 4IIOA 3R6NA 2KXDA 3TSZA 1GBQA 2K9GA 2V1RA 1AOJA 1KSWA 1OEBA 4HVWA 3THKA 1T3LA 4DEYA 2EGAA 2OI3A 3EG1A 1X2KA 2CUBA 4DEXA 1UECA 1T3SA 1TG0A 2ROLA 2KEAA 1WIEA 2DJQA 3EHRA 2PTKA 1AEYA 2DMOA 2RPNA 2DL5A 2YUPA 2DL7A 4KRTA 2JMCA 2CH4W 4AFZC 2ROTA 1T0HA 1RI9A 2J05A 4OMNA 2DLPA 1JXOA 2B86A 5IH2A 2VWFA 1JEGA 1KFZA 2VVKA 1K9AA 4HXJA 4RTZA 1PHTA 4OMLA 2JMAA 2JM8A 2D1XA 2ECZA 2KRNA 1UHFA 1WXUA 1B07A 4CC4B 1XOVA 2FG0A 1G2BA 5GJVB 4Y92A 2L2PA 4JPBW 1I0CA 3M0TA 2YUOA 1TUCA 1AWOA 1J3TA 1VYTA 3NMZC 1UJYA 4JJBA 1SEMA 1X27A 1UE9A 2O2OA 5L23A 3VS3A 1GFCA 2A28A 2OJ2A 1WFWA 2CREA 1QWEA 4WCIA 1T0JA 3I5SA 4OMQA 3CQTA 4AFQC 1SSHA 3FJ5A 1ZUYA 2ESWA 3LH5A 1GCPA 4OMMA 2RN8A 2D0NA 3C0CA 4RTYA 4RTXA 1W1FA 1NLPC 1ZUKA 3RNJA 1UTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9Q A;  2AZS A;  2HCK A;  2DE0 X;  1CSK A;  1FMK A;  3EG0 A;  3M0Q A;  1RUW A;  1E6H A;  2L3P A;  1UGV A;  1M8M A;  2JT4 A;  1MUZ A;  2P4R A;  1OOT A;  1M3A A;  3VS1 A;  4A63 B;  2X3X D;  2LJ1 A;  1ZLM A;  2CSI A;  2DA9 A;  2KT8 A;  2PNI A;  4OMO A;  2OAW A;  2D8H A;  1ARK A;  2EBP A;  1OPL A;  2QDL A;  3VRY A;  3ZL7 C;  3UA6 A;  1ABQ A;  1KJW A;  1WDX A;  1GFD A;  3EHQ A;  1JXM A;  1QKX A;  4HVU A;  2JS2 A;  2HSP A;  1VA7 A;  4RTT A;  3NGP A;  2FPE A;  2O9S A;  4QT7 A;  1WXT A;  2IIM A;  2KNB B;  2M51 A;  3GBQ A;  2O88 A;  4CC7 A;  2JM9 A;  1U06 A;  1N5Z A;  2NUZ A;  2RF0 A;  4LE9 A;  1QCF A;  2YT6 A;  2AZV A;  3M0P A;  1I1J A;  1LCK A;  2LZ6 B;  2FRY A;  4HVV A;  1VYU A;  2DYB A;  2EQI A;  4AFU C;  3VS4 A;  3REB B;  5FWC A;  3H41 A;  5IHI A;  2JTE A;  1YCS B;  5I22 A;  1X43 A;  2D8J A;  2GTJ A;  4OMP A;  3UF4 A;  1G83 A;  3NPF A;  4AFS C;  1GRI A;  1WLP B;  2J6O A;  1I07 A;  4AG1 C;  4RUG A;  2BZY A;  2F2V A;  1PRM C;  2HDA A;  2DM1 A;  4JZ3 A;  2CH4 A;  4F17 A;  2MIO A;  4CC3 A;  3NHN A;  3A98 A;  4J9H A;  2O9V A;  2GGR A;  4FSS A;  1AWX A;  1S1N A;  1HSQ A;  1UFF A;  5IXF A;  2RMO A;  4RTW A;  1ZBJ A;  2KRO A;  2K7A A;  1E7O A;  2M0Y A;  1NEG A;  1UG1 A;  1YWP A;  2ED1 A;  4GBQ A;  4IIM A;  2C0O A;  5FW9 A;  5EC7 A;  2EVR A;  2YUQ A;  2CSQ A;  2EYW A;  2LMJ A;  4D8K A;  2DL3 A;  3I35 A;  1AD5 A;  1MV3 A;  4RTV A;  1WX6 A;  1TUD A;  1NLO C;  3IQL A;  5IHK A;  1M3C A;  2XMF A;  3H0H A;  1M3B A;  4LUE A;  1IO6 A;  4J9F A;  2RQT A;  1W70 A;  1UDL A;  1E6G A;  2AKL A;  4R0K A;  3TVT A;  2KT1 A;  2LX7 A;  1NG2 A;  2L3S A;  1QLY A;  1W6X A;  2YSQ A;  2J6F A;  2X3W D;  2CT3 A;  1JU5 C;  1PRL C;  1PWT A;  4J9C A;  1ZX6 A;  1K4U S;  1NEB A;  2DRM A;  2GBQ A;  2KR3 A;  2GQI A;  1V1C A;  1UUE A;  1OV3 A;  4Z8A A;  2J7I A;  2RNA A;  4J9G A;  1X2Q A;  3TSW A;  4HCK A;  2FPF A;  2GNC A;  1WI7 A;  3PVL A;  2BZ8 A;  2EW3 A;  3SHW A;  2KRM A;  1HJD A;  1EFN A;  3M0R A;  2LQN A;  4J9B A;  2JS0 A;  1AVZ C;  1AZG B;  2YUN A;  4ZNX A;  2F2X A;  3UAT A;  2K79 A;  5ECA A;  1ZUU A;  2SRC A;  4J9I A;  3VS6 A;  1YN8 A;  2JXB A;  2FEI A;  5FWB A;  1NM7 A;  1K1Z A;  1SRM A;  2DBK A;  4EIK A;  2A08 A;  1Y0M A;  2HEQ A;  4JZ4 A;  1H92 A;  2DL8 A;  2BTT A;  1YWO A;  2GTO A;  2MOX A;  4JJD A;  1JO8 A;  1BBZ A;  2CUD A;  1VYV A;  2FPD A;  1BU1 A;  2DX1 A;  2W10 A;  4M4Z A;  2EKH A;  3REA B;  3RBB B;  2O31 A;  4GLM A;  1BK2 A;  1OPK A;  3U23 A;  1QKW A;  2E5K A;  3EGU A;  2W0Z A;  1RLP C;  1NYG A;  1M30 A;  2HBW A;  3H0F A;  3UA7 A;  1AZE A;  1U3O A;  2AKK A;  4LN2 A;  4Z89 A;  1WA7 A;  2KYB A;  4LUD A;  2I0N A;  2JW4 A;  2J06 A;  3VS5 A;  2EYX A;  1CKA A;  3M0U A;  2BZX A;  2H8H A;  2KYM A;  2RQW A;  2RQV A;  2YDL A;  1GL5 A;  2LJ3 A;  3QWY A;  2KBT A;  1K0S A;  1SHF A;  2K3B A;  2RQR A;  3QWX X;  1AWJ A;  3VS0 A;  3H0I A;  1ZSG A;  2DL4 A;  4AG2 C;  1SPK A;  2LCS A;  4K11 A;  2L0A A;  1MV0 B;  1AWW A;  2KRS A;  1K0X A;  2DF6 A;  4E6R A;  2DRK A;  3JV3 A;  1H3H A;  2ENM A;  2LP5 A;  2LNH B;  2MCN A;  1PNJ A;  2CDT A;  2SEM A;  3I5R A;  1QWF A;  4LNP A;  2KGT A;  4Z88 A;  4ESR A;  4F14 A;  2RQU A;  1UHC A;  1PKS A;  2EYY A;  2L3Q A;  1Y57 A;  2V1Q A;  1X6G A;  2A37 A;  2LJ0 A;  4ORZ A;  1YNZ A;  2A36 A;  1BB9 A;  1UJ0 A;  3PVQ A;  2C0T A;  2DNU A;  4J9D A;  1A0N B;  2PZ1 A;  2CT4 A;  1SHG A;  2EGC A;  1FYN A;  1NYF A;  5GJW B;  1ABO A;  2EGE A;  4F16 A;  1GCQ A;  3VS2 A;  3SEM A;  2EPD A;  5IXB A;  1PKT A;  5HCK A;  2DBM A;  1X6B A;  1SRL A;  1GCQ C;  3I9Q A;  3VRZ A;  3KFV A;  2ED0 A;  2ABL A;  1KIK A;  2C0I A;  1JQQ A;  2K6D A;  2G6F X;  2DIL A;  4X1V A;  2LQW A;  2K2M A;  1K76 A;  1M27 C;  3EG3 A;  1X69 A;  2FO0 A;  2KXC A;  4JJC A;  4J9E A;  4RTU A;  4D8D A;  3M0S A;  1U5S A;  1B3Q A;  5I11 A;  1HD3 A;  1GBR A;  2NWM A;  2J6K A;  3PE0 A;  5IHN A;  1WYX A;  2DVJ A;  1YP5 A;  3O5Z A;  2EYZ A;  1H8K A;  1Z9Z A;  2F2W A;  2FRW A;  2KE9 A;  1CKB A;  1WXB A;  3VS7 A;  3EG2 A;  2AK5 A;  4CC2 A;  3ULR B;  1RLQ C;  2VKN A;  4IIO A;  3R6N A;  2KXD A;  3TSZ A;  1GBQ A;  2K9G A;  2V1R A;  1AOJ A;  1KSW A;  1OEB A;  4HVW A;  3THK A;  1T3L A;  4DEY A;  2EGA A;  2OI3 A;  3EG1 A;  1X2K A;  2CUB A;  4DEX A;  1UEC A;  1T3S A;  1TG0 A;  2ROL A;  2KEA A;  1WIE A;  2DJQ A;  3EHR A;  2PTK A;  1AEY A;  2DMO A;  2RPN A;  2DL5 A;  2YUP A;  2DL7 A;  4KRT A;  2JMC A;  2CH4 W;  4AFZ C;  2ROT A;  1T0H A;  1RI9 A;  2J05 A;  4OMN A;  2DLP A;  1JXO A;  2B86 A;  5IH2 A;  2VWF A;  1JEG A;  1KFZ A;  2VVK A;  1K9A A;  4HXJ A;  4RTZ A;  1PHT A;  4OML A;  2JMA A;  2JM8 A;  2D1X A;  2ECZ A;  2KRN A;  1UHF A;  1WXU A;  1B07 A;  4CC4 B;  1XOV A;  2FG0 A;  1G2B A;  5GJV B;  4Y92 A;  2L2P A;  4JPB W;  1I0C A;  3M0T A;  2YUO A;  1TUC A;  1AWO A;  1J3T A;  1VYT A;  3NMZ C;  1UJY A;  4JJB A;  1SEM A;  1X27 A;  1UE9 A;  2O2O A;  5L23 A;  3VS3 A;  1GFC A;  2A28 A;  2OJ2 A;  1WFW A;  2CRE A;  1QWE A;  4WCI A;  1T0J A;  3I5S A;  4OMQ A;  3CQT A;  4AFQ C;  1SSH A;  3FJ5 A;  1ZUY A;  2ESW A;  3LH5 A;  1GCP A;  4OMM A;  2RN8 A;  2D0N A;  3C0C A;  4RTY A;  4RTX A;  1W1F A;  1NLP C;  1ZUK A;  3RNJ A;  1UTI A; 
#chains in the Genus database with same CATH topology
 1Z9Q A;  2EFI A;  3S3M A;  2VXF A;  2DE0 X;  2E64 A;  5KH6 A;  1FMK A;  2ZCF B;  2DKG A;  1TTH B;  2L3P A;  4M78 E;  4ZN1 A;  3SWN A;  3L1A A;  5A0D A;  2DA9 A;  2XG8 D;  4O6J A;  1G8X A;  1ARK A;  1OPL A;  3CXC S;  1M90 U;  3UA6 A;  3DB3 A;  4KT0 E;  3EHQ A;  4PJO G;  3TU4 K;  1RAC B;  2JS2 A;  1BIA A;  3PMT A;  1JJ2 S;  1X75 C;  2ZZD A;  1VA7 A;  5AT1 B;  3NGP A;  2FPE A;  3GBQ A;  4KGX B;  3QYH B;  1NPP A;  5GAN f;  2DEU A;  2JM9 A;  2E6Z A;  1PM3 A;  2RF0 A;  4ME7 A;  2LQ8 A;  2RI3 A;  5D7U A;  3CCQ Q;  2AZV A;  1PSE A;  1I1J A;  3OYN A;  1XQH A;  3V8L A;  2EQI A;  3KUF A;  3UT1 A;  3REB B;  3JSC A;  3CCQ T;  4MDX A;  4M78 D;  3OA6 A;  3H6Z A;  2D8J A;  2GTJ A;  3QDR B;  3NPF A;  3CCU Q;  3LH0 A;  4AG1 C;  2DXB A;  2F2V A;  3BW1 A;  4PLL A;  1QW1 A;  4JZ3 A;  3CCU T;  2GGR A;  4FSS A;  1AWX A;  3JCM J;  4JRP A;  1QVF S;  2V8I A;  2K7A A;  1I5L A;  2M0Y A;  1NEG A;  4XTV A;  1ZA1 B;  1YWP A;  2ED1 A;  4KH0 B;  4DOV A;  3PIO A;  1RL2 A;  2HSE B;  4JRI A;  2YUQ A;  1YJN Q;  2DL3 A;  3QII A;  1AD5 A;  1MV3 A;  4RTV A;  1TUD A;  2ZPG B;  5GMK e;  1NLO C;  4E2F B;  2HKN A;  5IHK A;  1YJN T;  3DLL A;  4LUE A;  1YIT A;  2CZ1 B;  1VQ4 Q;  5CCA A;  1Y96 B;  1UDL A;  3G71 A;  2AKL A;  4R0K A;  2LX7 A;  3VU3 C;  1NG2 A;  1S72 Q;  1VQ4 T;  3QO3 A;  3EFO A;  4EMK B;  4J9C A;  3KXT A;  2P84 A;  3F70 A;  1UUE A;  2RNA A;  2YHT A;  1S72 T;  1IB8 A;  2DXU A;  5KE2 A;  1WQ7 A;  3MHX A;  2E4H A;  3QZ9 B;  2GNC A;  4N4H A;  3WVE B;  2MAM A;  1DJ7 B;  2BZ8 A;  3HKS A;  2RM4 A;  3X25 B;  3JCM P;  1HJD A;  2KY9 A;  3QJ6 A;  4F7U A;  1AZG B;  4Q5W A;  4QQG A;  3Q1J A;  4ZNX A;  5GAO q;  5KYX A;  2F2X A;  5CKB A;  1ZUU A;  1Y7X A;  5D6X A;  2IG0 A;  2RI5 A;  4M75 G;  5J39 A;  3M4Y A;  2MPX C;  2R58 A;  4B9X A;  3ASK A;  2DTO A;  2MI6 A;  4IUP A;  4OGC A;  4JZ4 A;  1YWO A;  4BD3 A;  4JJD A;  2VAS A;  2KQW A;  3MP6 A;  2W10 A;  4C8Q B;  2O31 A;  3KBG A;  4GLM A;  1OUL A;  1OPK A;  2E10 A;  4DBH A;  2W0Z A;  1M30 A;  1D0X A;  3JB9 G;  2AKK A;  4RMO A;  2KYB A;  4C8Q F;  3PT9 A;  1LNX A;  4XAX B;  1NE8 A;  1N27 A;  2QQB A;  4BB7 A;  3M0U A;  2RQW A;  4ZGE B;  2LJ3 A;  4B6M A;  1TSF A;  2QTX A;  3EH2 A;  2RQR A;  3H0I A;  1ZSG A;  2VXE A;  4KUL A;  1NJI C;  4AG2 C;  4PL6 A;  2FZK B;  1SPK A;  5CQX A;  1JB0 E;  1MV0 B;  1K0X A;  2YLB A;  2DRK A;  3SB2 A;  1VQN Q;  1FWZ A;  3OYA A;  4Z02 A;  2QEX Q;  1XTD A;  2CDT A;  4LNP A;  3RUX A;  1VQN T;  2L3Q A;  1Y57 A;  5GAO p;  2QDY B;  4LXC A;  1BB9 A;  2ZPI B;  2C0T A;  2PZ1 A;  2VGM A;  2LCL A;  2RD1 A;  1TOV A;  2EGE A;  1N6A A;  4OB0 B;  4M7A C;  4VUB A;  4FU6 A;  3CCV A;  1QVG P;  1PKT A;  2RK1 A;  2VC8 A;  3CXC A;  4C0D B;  4FT2 A;  5D6W A;  1GCQ C;  4BI3 A;  2GQV A;  2ED0 A;  5KCO A;  2ABL A;  1KIK A;  2C0I A;  1JQQ A;  1ZSZ C;  4P5N A;  2CYZ B;  2G6F X;  3RR6 A;  1VQ8 Q;  2WSF E;  1D3B A;  5I21 A;  5LJ5 f;  1M1K U;  2WSE E;  2XID A;  2FO0 A;  2R5M A;  4JJC A;  1VQ8 T;  1RAF B;  2JTF A;  1D1B A;  1YIJ A;  1R8O B;  3G1J A;  3M0S A;  4M7D A;  5I2S A;  2X4W A;  2NWM A;  2J6K A;  2V8K A;  5DLQ E;  2EYZ A;  2O01 E;  1H8K A;  1Z9Z A;  1UGQ B;  3CCS Q;  2KE9 A;  2AK5 A;  3ULR B;  4E7Z A;  2IVW A;  3R6N A;  3I55 Q;  3CCL A;  3CCS T;  4XTU A;  4CI0 C;  4CRI A;  1YI2 A;  4RCC A;  3TSZ A;  3RMQ A;  1AOJ A;  4Y91 A;  3PIP A;  2YXY A;  3A1P A;  3THK A;  2PVG B;  3I55 T;  1QVF A;  2Y90 A;  2OI3 A;  3EG1 A;  1X2K A;  2M02 A;  1K9M R;  5EG2 A;  1VQ9 Q;  2FHD A;  4DEX A;  3VUB A;  4BE0 A;  1QMC A;  3LYI A;  1BI0 A;  1WIE A;  3RKY A;  5CKH A;  4NOY A;  1MMG A;  1VQ9 T;  1PC0 A;  4AFZ C;  4FM4 B;  4LDU A;  3GIB A;  4J7F A;  3QXE B;  3FDR A;  5IH2 A;  1VQ7 A;  2HZY A;  4M77 G;  1JEG A;  1Q82 U;  3QYG B;  3EFO B;  1PHT A;  4L59 A;  2ECZ A;  4XTX A;  1WXU A;  1BCO A;  4CC4 B;  4PJO C;  4HCZ A;  1VQK Q;  1QVG S;  1Q7Y R;  1IHW A;  4JPB W;  3OB9 A;  4C92 B;  1I0C A;  3M0T A;  2RJE A;  3A8M B;  1VQK T;  4M78 A;  2EKO A;  3OS2 A;  1J3T A;  1YHQ A;  4IUQ A;  1UJY A;  5IT9 E;  1IXD A;  2O2O A;  1Y07 A;  2OJ2 A;  5KYX B;  4WCI A;  3CCM A;  3FB9 A;  4OMQ A;  3I5S A;  2QA4 Q;  2O4X B;  5J3B A;  4F7U F;  1VQ6 Q;  1GCP A;  2EQU A;  3FC3 A;  2QA4 T;  2OTJ A;  5HK3 A;  2E5Q A;  3OYH A;  4A4E A;  1UTI A;  1KC8 R;  4MZM A;  1VQ6 T;  1H3Z A;  1W2B P;  5LJ3 d;  3DKM A;  4N4G A;  2LRQ A;  2RJD A;  3CCE T;  2H3J A;  1Q81 R;  3VS1 A;  1VIE A;  4A63 B;  2CSI A;  2PNI A;  2E65 A;  2OAW A;  4R55 A;  2GCX A;  2D8H A;  3CME Q;  3VRY A;  5IN1 A;  1FMW A;  3VYG A;  2VYT A;  4N4I A;  1YJW Q;  1GFD A;  4NL3 A;  3CME T;  1QKX A;  3JCM d;  2CZ0 B;  4FL6 A;  2QQA A;  3GPL A;  1O9S A;  2JZ2 A;  4PJO D;  4RTT A;  1EX4 A;  2O9S A;  3HFO A;  1YJW T;  2HMA A;  1WXT A;  4ATO A;  2IIM A;  2O88 A;  3E1S A;  2CGH A;  2NUZ A;  3L2V A;  5FRM A;  3BDU A;  4OGE A;  4QQ6 A;  1QCF A;  2DTI A;  2COW A;  3I56 A;  2K2V A;  3R6O A;  1LCK A;  2LZ6 B;  1KD1 R;  4HVV A;  1O75 A;  1VYU A;  3O8V A;  4PJN A;  3MPU B;  2P4T A;  5CIU A;  1K9M C;  3H41 A;  4B9W A;  5GAM d;  1YCS B;  1D1A A;  5I22 A;  1TH7 A;  2D6F A;  2RK2 A;  4BDY A;  3UF4 A;  5GAN 4;  2JVV A;  4AFS C;  2J6O A;  1LVK A;  2KK4 A;  1PRM C;  4XU0 A;  2HDA A;  2DM1 A;  5CKE A;  2CH4 A;  4F17 A;  2MIO A;  4J9H A;  1HSQ A;  1SKU B;  1ZBJ A;  2HL3 A;  4BY6 C;  5GAN d;  3LWI A;  2AIR B;  3CBM A;  2C0O A;  2A7Y A;  5FW9 A;  4C92 G;  2CSQ A;  2BE9 B;  3E19 A;  1K73 U;  2P0K A;  2K5I A;  1Q7Y C;  4JRK A;  1G3Y A;  2RHU A;  2DET A;  5GAN 6;  1M3B A;  2FZG B;  2CP2 A;  1SF9 A;  4WF2 A;  1W2B S;  3D7S B;  2NUP A;  3C94 A;  4J9F A;  3HRU A;  4OVA A;  4M75 E;  1KQS S;  3L2W A;  1QLY A;  2YSQ A;  1PWT A;  2Y4X A;  1ZX6 A;  5DM7 R;  1D3B B;  4L6V 5;  4DBQ A;  1K4U S;  2KR3 A;  4Z8A A;  3RMS A;  3OYG A;  5HK0 A;  4X34 A;  1RAG B;  1M1F A;  5KYW B;  2CP6 A;  2BIV A;  1WPY A;  5C6S A;  4HCK A;  2FPF A;  3J81 E;  3G6E A;  1KC8 C;  1MND A;  5GAM j;  1YIT Q;  2YRC A;  3JCM V;  3LLR A;  3NTH A;  5FU7 C;  3G71 Q;  2NUT A;  3NFC A;  4J9B A;  2JS0 A;  2K3X A;  1YIT T;  5CQY A;  1Q81 C;  4XTW A;  4M7D F;  3QHS A;  1P92 A;  3G71 T;  2HAX A;  3CMA A;  3HSB A;  4MMK A;  1ZHI A;  1K1Z A;  2F1L A;  3V8K A;  4EIK A;  4M75 D;  4C0F A;  2D0Q B;  1H92 A;  4EMG A;  2BUD A;  3CPW S;  5DLO A;  4EMK C;  1BBZ A;  2A0F B;  5GMK i;  3ZFJ A;  4MML A;  1R77 A;  4FYY B;  5KYU B;  2EKH A;  3RBB B;  1VUB A;  2RHX A;  2E5K A;  4LDW A;  1KD1 C;  1RLP C;  3EG9 A;  5GAN 8;  2HBW A;  5FLX E;  1Q86 R;  1YJ9 A;  3OYJ A;  1U3O A;  1KQ1 A;  3P8D A;  3JCM h;  1HK9 A;  3JB9 D;  4QVZ A;  2JW4 A;  1C6V X;  2RA2 A;  2EYX A;  1JRI A;  4BI4 A;  1WJR A;  4M75 F;  2BZX A;  2H8H A;  2KYM A;  2HL5 C;  3CD6 A;  1RAI B;  3WXM B;  3SFM A;  1N8R U;  1PSF A;  3QWY A;  4A4K A;  1K0S A;  1SHF A;  1QQJ A;  1WHL A;  1NJI R;  3QWX X;  3MET A;  1TUG B;  1QVG A;  4DOW A;  2LNV A;  5FRN A;  8ATC B;  2DO3 A;  3OYF A;  5GAM h;  1LOJ A;  4K11 A;  4ZTJ A;  1AWW A;  2PUO B;  4M78 F;  1H3H A;  4LDY A;  2LNH B;  2JJ9 A;  4A54 A;  3JB9 F;  5GAN 2;  2MCN A;  4ELY C;  2COY A;  3AT1 B;  2EJ9 A;  3V8J A;  1QWF A;  4F14 A;  2RQU A;  1PKS A;  2EYY A;  3M59 A;  5GAN h;  1X6G A;  2LJ0 A;  4M7A A;  3OW2 P;  5L8R E;  3S3N A;  2EAY A;  3JB9 I;  3OYD A;  2QQR A;  1ABO A;  4F16 A;  1GCQ A;  3VKI A;  2YWW A;  3CC2 A;  2DD4 A;  4J6X A;  1MNE A;  2CS7 A;  1OZ2 A;  1RI0 A;  1ZSZ A;  4A4F A;  1H64 1;  1MMA A;  2DBM A;  5FRO A;  1X6B A;  4XU2 A;  3PFS A;  3VRZ A;  3KFV A;  3HP9 A;  3TEE A;  2K2M A;  4FT4 A;  4AT1 B;  1K76 A;  1M27 C;  4M77 C;  1PCX A;  3EG3 A;  4HCB A;  2E3H A;  4JJN K;  3LX7 A;  2AHJ B;  2QXF A;  3S6W A;  4E7K A;  2KSS A;  3QSU A;  3CCV Q;  3HHT B;  4D8D A;  5I11 A;  1HD3 A;  4A4G A;  3PE0 A;  5IHN A;  3UWN A;  3O5Z A;  3CCV T;  1SG5 A;  2AT1 B;  1M8V A;  2F2W A;  8AT1 B;  4IUR A;  4FYW B;  2CP7 A;  4E7I A;  4M77 E;  1Q86 C;  2VKN A;  3UDC A;  2KI7 A;  1D09 B;  4C0D C;  5CO7 A;  1OQK A;  2VGN A;  3JCM c;  2DXC A;  3GLX A;  1YIJ Q;  1T3L A;  3A8H B;  3LGF A;  4DEY A;  3CC4 A;  1YCY A;  3FEO A;  4J6Y A;  3N5B B;  2OTL A;  1JBM A;  1T3S A;  4BAC A;  1TG0 A;  4X9D A;  2ROL A;  1YIJ T;  1BYM A;  2DJQ A;  3VV0 A;  2PTK A;  1AEY A;  2DMO A;  2YUP A;  4KRT A;  3QJY A;  1QVP A;  4EPC A;  1Q82 R;  2NUP B;  3CCL Q;  1T0H A;  1RI9 A;  2J05 A;  3M53 A;  4OMN A;  1YI2 Q;  4PJO A;  1JXO A;  3EGX A;  3OW2 S;  2VVK A;  4HXJ A;  3CCL T;  4JRQ A;  2VB6 A;  4M77 D;  2DIQ A;  3BDL A;  1G3S A;  1YI2 T;  1KQS A;  2KVQ G;  2JM8 A;  2D1X A;  2KRN A;  3HL8 A;  4PJJ A;  1UHF A;  3M9Q A;  1B07 A;  1M4Z A;  5AYF A;  2L2P A;  3X26 B;  4F04 B;  2FL7 A;  3OS5 A;  4QW2 A;  1AWO A;  3NMZ C;  4N0A C;  3SWN B;  2NUT B;  5KYN A;  1VQ7 Q;  5L23 A;  1GFC A;  2BKD N;  1WFW A;  1KHI A;  3CC7 A;  4FW1 A;  1T0J A;  2QGG A;  5IAY A;  1SSH A;  1WGS A;  3MCA B;  3HTR A;  3FJ5 A;  1VQ7 T;  2Z0W A;  2LT1 A;  2QAZ A;  4M77 F;  4OMM A;  3EFS A;  3C0C A;  1MMN A;  4QQD A;  1W1F A;  1ZUK A;  1IRX A;  4R56 A;  3UPU A;  1R0C B;  1M1K C;  1JJ2 A;  3OSV A;  3G4S A;  3M0Q A;  1HYO A;  2MWO A;  2QI2 A;  1RUW A;  3CPW A;  1M8M A;  2JT4 A;  2P4R A;  4M7A E;  1M3A A;  3OQ5 A;  5GAO r;  3CCM Q;  2LJ1 A;  1ZLM A;  1YHQ T;  4C8Q G;  1QP3 A;  4RKU E;  3EG9 B;  2JUF A;  1PD0 A;  4C92 C;  3P8B B;  3ZL7 C;  1XJW B;  2DZC A;  3JCM X;  3CCM T;  2OTJ Q;  3G7Z A;  1JXM A;  2DFU A;  1I4K 1;  5LJ3 e;  4HVU A;  2YRD A;  3EGD A;  2HSP A;  1IRE B;  3LW5 E;  1K8A U;  1XNI A;  2OTJ T;  1KK7 A;  3GP8 A;  2M51 A;  1B7T A;  3MP1 A;  4JUV A;  4CC7 A;  3L2R A;  1N5Z A;  3OS1 A;  2YT6 A;  2PU9 B;  1VQP A;  1Q95 G;  4KGZ B;  3JCM e;  4KBM B;  3VS4 A;  2R57 A;  2ZAE A;  2E6N A;  2JTE A;  4M7A D;  2E70 A;  2OX7 A;  1VQ5 A;  3MJX A;  1B34 A;  2RB6 A;  2MF2 A;  1I07 A;  4RUG A;  1ZQ1 A;  2BZY A;  4FSX A;  1Q82 C;  4E7H A;  3RKX A;  4M75 A;  2QEX A;  1RAD B;  2O9V A;  1S1N A;  1LJO A;  1ZA2 B;  3MEV A;  3V7S A;  5IXF A;  5GAM e;  4FIB A;  2RMO A;  3I56 Q;  1UB4 A;  2KRO A;  1K73 R;  1UG1 A;  4TVR A;  5FU6 B;  4DBR A;  4IIM A;  1WHG A;  3HRT A;  3INZ A;  3ZBD A;  3I56 T;  4BI8 B;  2EYW A;  4J83 A;  1X6O A;  2LMJ A;  4D8K A;  4C92 D;  1WZO A;  4KUD K;  1U1S A;  2XK0 A;  4M7A F;  1OX9 A;  2YRV A;  4V2S A;  1M3C A;  4C5I A;  1D1C A;  4F7U B;  5GAN e;  1IO6 A;  4ZTF A;  1MMD A;  3MEU A;  4XK8 E;  4PJM A;  4BE2 A;  2LX9 A;  1BCM A;  3PNW C;  2F5T X;  4PJO E;  2L3S A;  3CCJ A;  1FMV A;  4GY5 A;  1W6X A;  2J6F A;  2X3W D;  1JU5 C;  1PRL C;  1VOM A;  1LPL A;  2GBQ A;  3GNF B;  1WJQ A;  1V1C A;  4GLK A;  2CP5 A;  1M5Q 1;  3EAE A;  1V29 B;  2CZ6 B;  3CCE Q;  4LDV A;  1WI7 A;  2MWP A;  2PVD B;  3A5Z B;  1M90 R;  3SHW A;  2KRM A;  1EFN A;  1X01 A;  3M0R A;  3OSS C;  2LQN A;  4PFO A;  4KH1 B;  1AVZ C;  3QBY A;  4IKF A;  5LJ3 g;  2YUN A;  1Y96 A;  3CPF A;  2SRC A;  2LT4 A;  2JXB A;  2FEI A;  5FWB A;  4EMK A;  4J5Y A;  4IUU A;  1SRM A;  2HKQ B;  2DYI A;  4MZT A;  2A08 A;  3G6E Q;  1Y0M A;  1D0Y A;  2HEQ A;  2HQX A;  2HQH A;  3P8H A;  2DL8 A;  2BTT A;  3JCM g;  1VQL A;  2MOX A;  1JO8 A;  3G6E T;  3QZ5 B;  2IPO B;  2FPD A;  1VYV A;  1BU1 A;  2DX1 A;  3OYM A;  2NYS A;  3OYE A;  4JLI A;  5A0G A;  4C5H A;  3U23 A;  1UGR B;  3EFR A;  1NYG A;  4PLI A;  5GAO l;  2HD0 A;  3UA7 A;  1AZE A;  2VUB A;  4Z89 A;  1WA7 A;  4LD6 A;  4LUD A;  2I0N A;  4J7I A;  1U1T A;  4C0Z A;  3CMA T;  2MK5 A;  4WTO B;  2E41 A;  2J06 A;  5GAM g;  5CR2 A;  4HT9 A;  3OW2 A;  4PJO F;  4BDZ A;  3E9F A;  6AT1 B;  2YDL A;  2DPP B;  3L2Z A;  1V76 A;  2X35 A;  2X4J A;  2KBT A;  1UGP B;  2NLU A;  3BFM A;  2K3B A;  1BKB A;  4J8O A;  4E7J A;  5J26 A;  5LJ3 j;  1K9M U;  2DL4 A;  1K73 C;  3JB9 H;  1YJ9 Q;  1WHK A;  4E47 A;  3RKW A;  2DJZ A;  4Y28 E;  2LCS A;  5GAN g;  1YFN A;  2PUK B;  2L0A A;  4F7U G;  1D0Z A;  2KRS A;  3TQ7 P;  3OY9 A;  2DF6 A;  1YJ9 T;  3A8O B;  2ENM A;  2CP3 A;  1VQO A;  3QPH A;  2QYZ A;  1PNJ A;  2Y4Y A;  1IHV A;  5D6Y A;  1G5V A;  1PG5 B;  4MZP A;  4XU3 A;  4OP0 A;  3CD6 T;  2M0O A;  1BI3 A;  2V1Q A;  2A37 A;  4FW2 A;  4ORZ A;  2A36 A;  3PVQ A;  4C5G A;  4PJL A;  2E3I A;  1QVF P;  1NYF A;  3T9N A;  3SD4 A;  1M2V A;  3MKD A;  4RCB A;  2QQ9 A;  4M7D B;  3SEM A;  2EPD A;  2KDS A;  4D6W A;  4LD9 K;  5IXB A;  5GAO m;  2ZPB B;  2BE7 D;  4IUV A;  5HCK A;  3EGD B;  1M90 C;  2P0Q A;  1SRL A;  4M77 A;  3QKJ A;  5GMK m;  2LTO A;  2X51 A;  4A4H A;  2X9H A;  2CKK A;  2K6D A;  3OMG A;  1IGU A;  2DIL A;  4XQ3 A;  2M16 A;  1KC8 U;  5GAN j;  4BE1 A;  2G3R A;  3CC2 Q;  1NZ9 A;  3QDF A;  2KXC A;  5CVI A;  3MEA A;  5GAM f;  5LJ3 h;  4RTU A;  1I81 A;  1U5S A;  2E12 A;  3FIF A;  2LQK A;  1B3Q A;  3CC2 T;  3WVD B;  1Q81 U;  2M1H A;  2DVJ A;  1B34 B;  1YP5 A;  3PMI A;  2RH2 A;  4BY6 B;  2FRW A;  4M75 B;  4CC2 A;  2EQJ A;  4II1 A;  1VQM A;  4IIO A;  3V7R A;  5HY6 A;  5HKC A;  2XD0 A;  1GBQ A;  3HPW A;  3H8Z A;  2V1R A;  1N8R C;  4HVW A;  3CCR A;  1UEB A;  2EGA A;  2I2L A;  2DER A;  3J7A F;  1UEC A;  1OX8 A;  3FJP A;  1OZ3 A;  2WSC E;  1KD1 U;  4M78 B;  2JMC A;  3AHU A;  4HA8 A;  2HBP A;  3ER0 A;  2ROT A;  4JS5 A;  1IGQ A;  4PK4 A;  2DLP A;  2MYS A;  5LJ5 e;  1U8R A;  4DQ2 A;  3MO8 A;  1FX7 A;  3M54 A;  1WHM A;  3OYL A;  4C8Q C;  4ZN3 A;  2K3Y A;  4QKU A;  2LCC A;  3CC4 Q;  4L5G A;  2OTL Q;  3L2Q A;  3RER A;  2FG0 A;  2XDB A;  1TXQ A;  4N0A A;  5FU7 B;  1VIF A;  1HXD A;  3OBW A;  3CC4 T;  5GJV B;  3DB4 A;  4PKC C;  1TWB A;  3QG1 A;  2OTL T;  3GF5 A;  2OAU A;  1RAH B;  2RJF A;  3X28 B;  2YUO A;  4IUT A;  4M7D G;  1VYT A;  4C8Q E;  4JJB A;  1SEM A;  1UE9 A;  2B8A A;  3ME9 A;  2XHC A;  2A28 A;  2X4Y A;  3C12 A;  2CRE A;  3OYC A;  5KYY A;  3CQT A;  4AFQ C;  1BI2 A;  1ZUY A;  1QCO A;  2RN8 A;  2D0N A;  4RTX A;  1NLP C;  2EIF A;  3RNJ A;  1M1K R;  2AZS A;  4ELZ C;  2HCK A;  5KCH A;  1CSK A;  3JCM b;  3EG0 A;  2MMP A;  4C92 A;  2EYQ A;  1E6H A;  1UGV A;  1Y71 A;  2EJG A;  2COZ A;  1MUZ A;  1BI1 A;  2FB7 A;  1OOT A;  3L42 A;  3J80 E;  3CC7 Q;  2X3X D;  5GAN 3;  3CCQ A;  2KT8 A;  4OMO A;  1WNL A;  2EBP A;  2QDL A;  2O4X A;  2QGF B;  1K8A R;  1TS9 A;  4C8Q D;  1ABQ A;  3CC7 T;  1EZZ B;  1KJW A;  1WDX A;  2FVU A;  3M56 A;  1AHJ B;  2PVO B;  2DXT A;  5CAI A;  3SWN C;  2QQS A;  3CCU A;  3G4S Q;  3NTK A;  4QT7 A;  4JS4 A;  1MHN A;  2KNB B;  2EQM A;  2VV5 A;  3A8L B;  1I5O B;  3LGL A;  2D9T A;  4NL2 A;  3TRE A;  4OB1 B;  1U06 A;  3G4S T;  2RHY A;  4LE9 A;  2HQE A;  3M4G A;  1NPR A;  3FRN A;  7AT1 B;  2ZPF B;  3M0P A;  3OS0 A;  2F5K A;  2FRY A;  5LJ5 d;  2CP0 A;  2DYB A;  3CEY A;  4AFU C;  4M78 G;  3OBY A;  5FWC A;  5IHI A;  1X43 A;  5LJ5 g;  1YJN A;  4PFZ A;  4OMP A;  1G83 A;  1GRI A;  1WLP B;  2QAS A;  4PFP A;  1WJS A;  1Q86 U;  3OYI A;  4HT8 A;  1F1B B;  4QVC A;  4CC3 A;  1VQ4 A;  2DEQ A;  3A98 A;  3NHN A;  2HNI A;  2A3L A;  1W2B A;  4ZGD B;  1UFF A;  1EIF A;  1VQP Q;  4RTW A;  1E7O A;  1S72 A;  4GBQ A;  4BUG A;  2ATC B;  5EC7 A;  1VQP T;  2EVR A;  5I2M A;  1VQ5 Q;  2X4X A;  4MDW A;  3VUZ A;  1WHJ A;  1M2V B;  1NJI U;  3I35 A;  3CBP A;  4ZGJ B;  1WX6 A;  2DK3 A;  3IQL A;  1VQ5 T;  2XMF A;  3X24 B;  3M57 A;  3H0H A;  1G3T A;  2LDM A;  4M77 B;  2GF7 A;  2RQT A;  1W70 A;  1E6G A;  3TVT A;  2KT1 A;  3BY7 A;  2QEX T;  1OU9 A;  3JRZ A;  2L8D A;  4HKE A;  3OYK A;  2L3R A;  4RG2 A;  4X9C A;  2CT3 A;  1NEB A;  2DRM A;  2QK0 A;  2GQI A;  3CBO A;  1OV3 A;  2J7I A;  4J9G A;  4FCY A;  1X2Q A;  3FLG A;  3TSW A;  5LJ5 j;  2DIG A;  2F69 A;  2K5F A;  3PVL A;  1YHQ Q;  3HFN A;  5FU6 C;  2EW3 A;  1WHH A;  2EQK A;  1N9S A;  4LDX A;  4C0G A;  3CCJ Q;  4HCC A;  2L89 A;  4EMH A;  3UAT A;  2K79 A;  5ECA A;  4J9I A;  5C0M A;  3VS6 A;  2K5L A;  1YN8 A;  5GMK j;  2XDP A;  1NM7 A;  4QVD A;  4FYX B;  3V7C A;  1K8A C;  3CCJ T;  1IZ6 A;  2DBK A;  1RAB B;  2EWN A;  5KYW A;  3MP8 A;  1W4S A;  2GTO A;  3M55 A;  2QG9 B;  3MEW A;  2CUD A;  4C92 E;  3EH1 A;  4M4Z A;  4E7L A;  3REA B;  1BK2 A;  1QKW A;  2PQW A;  4F7U E;  2WAC A;  3EGU A;  1QP2 A;  2H3E B;  2XI9 A;  2GFA A;  3H0F A;  3GNG A;  3OYY A;  4LN2 A;  4DA4 A;  2JTM A;  4XU1 A;  4ANJ A;  2KAF A;  3X20 B;  2XKO C;  3RDV A;  3VS5 A;  1M9S A;  4O5V A;  3C4S A;  1CKA A;  1VQL Q;  1VQN A;  2RQV A;  2RO0 A;  1GL5 A;  1G3W A;  2XDD A;  1VQL T;  5LL6 S;  1AWJ A;  4M7A B;  3VS0 A;  5LJ5 h;  5KYU A;  4YTL A;  2RJC A;  3H9N A;  3OMC A;  2JOY A;  5KYY B;  3VYH B;  4E6R A;  3BE3 A;  3JV3 A;  1ZSZ B;  3SDZ A;  2LP5 A;  2FZC B;  1SSF A;  2DTH A;  1C1A A;  2SEM A;  3RIR A;  1I8F A;  3I5R A;  5GMK h;  2KGT A;  3QUI A;  3VJP A;  4Z88 A;  2C06 A;  4ESR A;  2GFU A;  1UHC A;  2EJF A;  3JCM Q;  1MGQ A;  4PNO A;  2JNG A;  1YNZ A;  2KMT A;  1UJ0 A;  2DNU A;  4J9D A;  1A0N B;  4KUI A;  1VQ8 A;  2CT4 A;  1PD1 A;  1SHG A;  2EGC A;  1FYN A;  4E7S A;  1FXX A;  5GJW B;  1BIB A;  5KE3 A;  5A0L A;  4C92 F;  3VS2 A;  2QTV A;  2JN0 A;  1VQO Q;  2ZGW A;  5CKD A;  1AT1 B;  5A2Q E;  3DLM A;  1OI1 A;  2RHZ A;  2ZPH B;  4XTY A;  1ACM B;  1VQO T;  3I9Q A;  3OYB A;  3E2U A;  2R5A A;  3CCS A;  1R0B G;  2RI2 A;  4JLG A;  4X1V A;  2DAQ A;  2LQW A;  4C5E A;  5CK9 A;  3I55 A;  2M9U A;  1ZBX A;  1KQS P;  1X69 A;  3NTI A;  4UC4 A;  2LC4 A;  2RHI A;  2L5Q A;  1M1G A;  4J9E A;  4JDS A;  5GAO n;  5M9O A;  1VQ9 A;  1GBR A;  1KHC A;  1WYX A;  4DBF A;  1OYX A;  2V8J A;  9ATC B;  5GAN 5;  1KQ2 A;  4XTZ A;  3CMA Q;  1CKB A;  1WXB A;  3VS7 A;  3EG2 A;  4PJO B;  4M7D C;  3EGX B;  4NS5 A;  1RLQ C;  5GMK l;  2DD5 A;  1M2O A;  2KXD A;  1N8R R;  3ZEH A;  1KG1 A;  2XIC A;  2K9G A;  1KSW A;  1OEB A;  3LWH A;  3CXC P;  3M5A A;  1WQW A;  3JAM E;  4AMC A;  3URG A;  4M7A G;  2CUB A;  2K57 A;  3PGG A;  3S3O A;  3PTA A;  5CKF A;  1JJ2 P;  2KEA A;  4OB2 B;  3GOX A;  1VQK A;  3EHR A;  3M58 A;  4M7D E;  1N9R A;  2DL5 A;  2RPN A;  4OF1 A;  2DL7 A;  1RAE B;  4C8Q A;  3CPW P;  2CH4 W;  2DZ9 A;  4OMF B;  3A8G B;  1VQM Q;  4FYV B;  1NBE B;  2K4Y A;  4OB3 B;  2YLC A;  5GAN 7;  2CZ7 B;  2V26 A;  4KGV B;  4RG8 A;  2B86 A;  2VWF A;  4J6W A;  3JCM W;  1KFZ A;  1K9A A;  5DY9 A;  1VQM T;  4RTZ A;  3CCR Q;  1TU0 B;  4OML A;  2ZPE B;  3C95 A;  3CD6 Q;  2QA4 A;  3TCJ A;  2JMA A;  3E9G A;  1OU8 A;  4M75 C;  1XOV A;  1VQ6 A;  1RAA B;  3CCR T;  1G2B A;  3RES A;  5LJ3 f;  4Y92 A;  3L2U A;  3JB9 J;  2E1H A;  2DVE A;  2P0P A;  3CCE A;  1TUC A;  2FYK A;  3HRS A;  1Q7Y U;  1X27 A;  1UGS B;  4A53 A;  3VS3 A;  4EDU A;  4M7D D;  1QWE A;  2LVM A;  1GXI E;  2XU8 A;  1C0M A;  1QCN A;  1YBY A;  4M78 C;  3JCM f;  3CME A;  2ESW A;  3LH5 A;  1YJW A;  4RTY A; 
#chains in the Genus database with same CATH homology
 1Z9Q A;  2AZS A;  2HCK A;  2DE0 X;  1CSK A;  1FMK A;  3EG0 A;  3M0Q A;  1RUW A;  1E6H A;  2L3P A;  1UGV A;  1M8M A;  2JT4 A;  1MUZ A;  2P4R A;  1OOT A;  1M3A A;  3VS1 A;  4A63 B;  2X3X D;  2LJ1 A;  1ZLM A;  2CSI A;  2DA9 A;  2KT8 A;  2PNI A;  4OMO A;  2OAW A;  2D8H A;  1ARK A;  2EBP A;  1OPL A;  2QDL A;  3VRY A;  3ZL7 C;  3UA6 A;  1ABQ A;  1KJW A;  1WDX A;  1GFD A;  3EHQ A;  1JXM A;  1QKX A;  4HVU A;  2JS2 A;  2HSP A;  1VA7 A;  4RTT A;  3NGP A;  2FPE A;  2O9S A;  4QT7 A;  1WXT A;  2IIM A;  2KNB B;  2M51 A;  3GBQ A;  2O88 A;  4CC7 A;  2JM9 A;  1U06 A;  1N5Z A;  2NUZ A;  2RF0 A;  4LE9 A;  1QCF A;  2YT6 A;  2AZV A;  3M0P A;  1I1J A;  1LCK A;  2LZ6 B;  2FRY A;  4HVV A;  1VYU A;  2DYB A;  2EQI A;  4AFU C;  3VS4 A;  3REB B;  5FWC A;  3H41 A;  5IHI A;  2JTE A;  1YCS B;  5I22 A;  1X43 A;  2D8J A;  2GTJ A;  4OMP A;  3UF4 A;  1G83 A;  3NPF A;  4AFS C;  1GRI A;  1WLP B;  2J6O A;  1I07 A;  4AG1 C;  4RUG A;  2BZY A;  2F2V A;  1PRM C;  2HDA A;  2DM1 A;  4JZ3 A;  2CH4 A;  4F17 A;  2MIO A;  4CC3 A;  3NHN A;  3A98 A;  4J9H A;  2O9V A;  2GGR A;  4FSS A;  1AWX A;  1S1N A;  1HSQ A;  1UFF A;  5IXF A;  2RMO A;  4RTW A;  1ZBJ A;  2KRO A;  2K7A A;  1E7O A;  2M0Y A;  1NEG A;  1UG1 A;  1YWP A;  2ED1 A;  4GBQ A;  4IIM A;  2C0O A;  5FW9 A;  5EC7 A;  2EVR A;  2YUQ A;  2CSQ A;  2EYW A;  2LMJ A;  4D8K A;  2DL3 A;  3I35 A;  1AD5 A;  1MV3 A;  4RTV A;  1WX6 A;  1TUD A;  1NLO C;  3IQL A;  5IHK A;  1M3C A;  2XMF A;  3H0H A;  1M3B A;  4LUE A;  1IO6 A;  4J9F A;  2RQT A;  1W70 A;  1UDL A;  1E6G A;  2AKL A;  4R0K A;  3TVT A;  2KT1 A;  2LX7 A;  1NG2 A;  2L3S A;  1QLY A;  1W6X A;  2YSQ A;  2J6F A;  2X3W D;  2CT3 A;  1JU5 C;  1PRL C;  1PWT A;  4J9C A;  1ZX6 A;  1K4U S;  1NEB A;  2DRM A;  2GBQ A;  2KR3 A;  2GQI A;  1V1C A;  1UUE A;  1OV3 A;  4Z8A A;  2J7I A;  2RNA A;  4J9G A;  1X2Q A;  3TSW A;  4HCK A;  2FPF A;  2GNC A;  1WI7 A;  3PVL A;  2BZ8 A;  2EW3 A;  3SHW A;  2KRM A;  1HJD A;  1EFN A;  3M0R A;  2LQN A;  4J9B A;  2JS0 A;  1AVZ C;  1AZG B;  2YUN A;  4ZNX A;  2F2X A;  3UAT A;  2K79 A;  5ECA A;  1ZUU A;  2SRC A;  4J9I A;  3VS6 A;  1YN8 A;  2JXB A;  2FEI A;  5FWB A;  1NM7 A;  1K1Z A;  1SRM A;  2DBK A;  4EIK A;  2A08 A;  1Y0M A;  2HEQ A;  4JZ4 A;  1H92 A;  2DL8 A;  2BTT A;  1YWO A;  2GTO A;  2MOX A;  4JJD A;  1JO8 A;  1BBZ A;  2CUD A;  1VYV A;  2FPD A;  1BU1 A;  2DX1 A;  2W10 A;  4M4Z A;  2EKH A;  3REA B;  3RBB B;  2O31 A;  4GLM A;  1BK2 A;  1OPK A;  3U23 A;  1QKW A;  2E5K A;  3EGU A;  2W0Z A;  1RLP C;  1NYG A;  1M30 A;  2HBW A;  3H0F A;  3UA7 A;  1AZE A;  1U3O A;  2AKK A;  4LN2 A;  4Z89 A;  1WA7 A;  2KYB A;  4LUD A;  2I0N A;  2JW4 A;  2J06 A;  3VS5 A;  2EYX A;  1CKA A;  3M0U A;  2BZX A;  2H8H A;  2KYM A;  2RQW A;  2RQV A;  2YDL A;  1GL5 A;  2LJ3 A;  3QWY A;  2KBT A;  1K0S A;  1SHF A;  2K3B A;  2RQR A;  3QWX X;  1AWJ A;  3VS0 A;  3H0I A;  1ZSG A;  2DL4 A;  4AG2 C;  1SPK A;  2LCS A;  4K11 A;  2L0A A;  1MV0 B;  1AWW A;  2KRS A;  1K0X A;  2DF6 A;  4E6R A;  2DRK A;  3JV3 A;  1H3H A;  2ENM A;  2LP5 A;  2LNH B;  2MCN A;  1PNJ A;  2CDT A;  2SEM A;  3I5R A;  1QWF A;  4LNP A;  2KGT A;  4Z88 A;  4ESR A;  4F14 A;  2RQU A;  1UHC A;  1PKS A;  2EYY A;  2L3Q A;  1Y57 A;  2V1Q A;  1X6G A;  2A37 A;  2LJ0 A;  4ORZ A;  1YNZ A;  2A36 A;  1BB9 A;  1UJ0 A;  3PVQ A;  2C0T A;  2DNU A;  4J9D A;  1A0N B;  2PZ1 A;  2CT4 A;  1SHG A;  2EGC A;  1FYN A;  1NYF A;  5GJW B;  1ABO A;  2EGE A;  4F16 A;  1GCQ A;  3VS2 A;  3SEM A;  2EPD A;  5IXB A;  1PKT A;  5HCK A;  2DBM A;  1X6B A;  1SRL A;  1GCQ C;  3I9Q A;  3VRZ A;  3KFV A;  2ED0 A;  2ABL A;  1KIK A;  2C0I A;  1JQQ A;  2K6D A;  2G6F X;  2DIL A;  4X1V A;  2LQW A;  2K2M A;  1K76 A;  1M27 C;  3EG3 A;  1X69 A;  2FO0 A;  2KXC A;  4JJC A;  4J9E A;  4RTU A;  4D8D A;  3M0S A;  1U5S A;  1B3Q A;  5I11 A;  1HD3 A;  1GBR A;  2NWM A;  2J6K A;  3PE0 A;  5IHN A;  1WYX A;  2DVJ A;  1YP5 A;  3O5Z A;  2EYZ A;  1H8K A;  1Z9Z A;  2F2W A;  2FRW A;  2KE9 A;  1CKB A;  1WXB A;  3VS7 A;  3EG2 A;  2AK5 A;  4CC2 A;  3ULR B;  1RLQ C;  2VKN A;  4IIO A;  3R6N A;  2KXD A;  3TSZ A;  1GBQ A;  2K9G A;  2V1R A;  1AOJ A;  1KSW A;  1OEB A;  4HVW A;  3THK A;  1T3L A;  4DEY A;  2EGA A;  2OI3 A;  3EG1 A;  1X2K A;  2CUB A;  4DEX A;  1UEC A;  1T3S A;  1TG0 A;  2ROL A;  2KEA A;  1WIE A;  2DJQ A;  3EHR A;  2PTK A;  1AEY A;  2DMO A;  2RPN A;  2DL5 A;  2YUP A;  2DL7 A;  4KRT A;  2JMC A;  2CH4 W;  4AFZ C;  2ROT A;  1T0H A;  1RI9 A;  2J05 A;  4OMN A;  2DLP A;  1JXO A;  2B86 A;  5IH2 A;  2VWF A;  1JEG A;  1KFZ A;  2VVK A;  1K9A A;  4HXJ A;  4RTZ A;  1PHT A;  4OML A;  2JMA A;  2JM8 A;  2D1X A;  2ECZ A;  2KRN A;  1UHF A;  1WXU A;  1B07 A;  4CC4 B;  1XOV A;  2FG0 A;  1G2B A;  5GJV B;  4Y92 A;  2L2P A;  4JPB W;  1I0C A;  3M0T A;  2YUO A;  1TUC A;  1AWO A;  1J3T A;  1VYT A;  3NMZ C;  1UJY A;  4JJB A;  1SEM A;  1X27 A;  1UE9 A;  2O2O A;  5L23 A;  3VS3 A;  1GFC A;  2A28 A;  2OJ2 A;  1WFW A;  2CRE A;  1QWE A;  4WCI A;  1T0J A;  3I5S A;  4OMQ A;  3CQT A;  4AFQ C;  1SSH A;  3FJ5 A;  1ZUY A;  2ESW A;  3LH5 A;  1GCP A;  4OMM A;  2RN8 A;  2D0N A;  3C0C A;  4RTY A;  4RTX A;  1W1F A;  1NLP C;  1ZUK A;  3RNJ A;  1UTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...