3EG2A

Crystal structure of the n114q mutant of abl-sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg2A00
2ROLA 2FPDA 2J6KA 4ESRA 1WI7A 1QWFA 1VA7A 3M0QA 1MV0B 3IQLA 2CH4W 3U23A 1PKSA 1AVZC 3EGUA 1JXOA 3VS0A 1SHGA 3TSWA 3VS6A 2DL4A 4JJCA 1W6XA 2AKLA 2L3QA 1UJYA 2DVJA 3H0HA 1PHTA 2RQUA 1M3CA 2K79A 5L23A 1GCQA 2GQIA 4J9EA 1MUZA 2LZ6B 1G83A 2VWFA 4RTVA 4KRTA 1NEBA 2C0IA 2EYYA 3TVTA 2K9GA 3PVQA 2RQVA 4GBQA 2KNBB 2D8HA 2D0NA 1H8KA 2I0NA 2V1RA 2KRNA 1BU1A 1AOJA 1QWEA 1YN8A 2YUNA 1UG1A 1X2KA 1WFWA 1S1NA 1WXUA 3UF4A 4AG2C 1M8MA 5I11A 2A28A 1AWXA 3QWXX 2AZVA 1NLPC 3H0IA 2O88A 4OMQA 1A0NB 2HBWA 1SEMA 2LQNA 2DJQA 1HD3A 2F2VA 3VS4A 3VS7A 2EQIA 4K11A 2FRYA 1Z9ZA 4RTYA 1UHFA 3LH5A 2NUZA 2EBPA 2K3BA 4EIKA 4J9GA 2SRCA 2DM1A 1AWWA 2X3WD 2KT8A 3H0FA 2GNCA 4E6RA 2M0YA 2YSQA 1ZLMA 4HVUA 2GGRA 4HVVA 1W1FA 4D8DA 5IH2A 2FO0A 2CSIA 5EC7A 3SHWA 1GCQC 3EG1A 1WDXA 2ESWA 2RN8A 1KIKA 3VS2A 3I5SA 1Z9QA 1U06A 2BZ8A 4DEXA 2DBMA 5FW9A 1HJDA 1KFZA 4HXJA 4IIOA 3EG2A 2BTTA 3QWYA 1ZUUA 2LQWA 2P4RA 2SEMA 4LN2A 1NG2A 1GL5A 2KT1A 1TUDA 1GBQA 1H3HA 1HSQA 2JMAA 5HCKA 2W10A 3H41A 3GBQA 3I35A 2YUPA 1UJ0A 4AFUC 1OOTA 1WXTA 3M0PA 1PWTA 2FEIA 2A08A 1AZGB 1NEGA 1YP5A 4RTTA 2IIMA 2ED0A 2LNHB 4IIMA 1YCSB 3EHRA 4JJBA 4OMMA 1X6GA 2C0TA 2CT4A 2AK5A 3KFVA 2DMOA 2LJ0A 1H92A 4OMOA 2PNIA 1JEGA 1WLPB 2CT3A 1GRIA 2DBKA 2E5KA 2EGEA 1I1JA 2X3XD 2J6FA 1V1CA 4LE9A 1OPLA 2RF0A 3NMZC 5IHKA 2DL3A 3JV3A 3FJ5A 2EYXA 3SEMA 1CSKA 1MV3A 1T0JA 1WIEA 1WX6A 4ZNXA 1JO8A 1RUWA 1PRLC 2HEQA 4Z8AA 2W0ZA 4OMLA 5IHNA 3THKA 1ZBJA 1T3LA 3ZL7C 1PKTA 1GBRA 1K0SA 1OV3A 1ABQA 2LJ3A 1QKWA 1T3SA 2LX7A 4ORZA 2DL7A 1VYVA 1ZX6A 2EKHA 1X43A 1CKBA 1X27A 4RTUA 1TUCA 2DX1A 2KROA 2OAWA 2JS2A 2KXCA 1RLPC 4GLMA 2JM9A 2EPDA 2DE0X 1UDLA 2DILA 1BB9A 1BBZA 2AKKA 2YUOA 1OEBA 1M27C 2BZXA 4CC2A 3EG3A 2KRSA 2DRMA 1M3BA 1AEYA 1K1ZA 1VYUA 2EW3A 3RNJA 2DRKA 2CUBA 2RNAA 2DYBA 1I07A 2PTKA 2O2OA 1JU5C 2EYWA 1AZEA 1QCFA 3PE0A 1K76A 4Y92A 2J7IA 1ZUKA 3TSZA 2K2MA 1M3AA 1JXMA 4CC3A 3VS3A 2DNUA 2JS0A 2HDAA 1QKXA 1IO6A 1AWOA 3UA6A 4RTWA 2ED1A 2LMJA 4WCIA 1UGVA 5GJWB 2D8JA 4J9HA 4HVWA 4JZ3A 2JT4A 2KXDA 2RQWA 1B07A 2QDLA 5I22A 3EHQA 4LUDA 2OI3A 2MCNA 2RQRA 4Z88A 2O9SA 2O9VA 2HCKA 1UFFA 2J06A 4J9DA 4Z89A 4A63B 1K9AA 1ABOA 2F2XA 2KYBA 2MOXA 4OMPA 4LUEA 1VYTA 1ARKA 1AWJA 1SRMA 2NWMA 2KR3A 1T0HA 4RTZA 2D1XA 4OMNA 1GFCA 1I0CA 5FWBA 2ABLA 2OJ2A 1SRLA 1SHFA 2JXBA 1SSHA 2EYZA 4R0KA 1WA7A 2AZSA 2PZ1A 4FSSA 3UATA 4JPBW 1GFDA 1E6GA 1NLOC 4QT7A 4F16A 2A37A 2EGAA 2VVKA 1XOVA 5IXBA 4J9FA 1UUEA 4F14A 3O5ZA 2FPEA 2BZYA 3I5RA 3EG0A 2JTEA 2O31A 2L3PA 2XMFA 4RTXA 3M0TA 2FPFA 2CDTA 1AD5A 5IXFA 1UHCA 2KBTA 2DLPA 3A98A 2ECZA 2LCSA 3REBB 4CC4B 3I9QA 2M51A 3NGPA 3VS5A 1QLYA 2L2PA 2JMCA 2HSPA 4AFQC 1G2BA 4M4ZA 4F17A 1X6BA 2EVRA 2DL5A 4JZ4A 1OPKA 2KYMA 2DA9A 3M0RA 1TG0A 3CQTA 2RPNA 1K4US 2ENMA 4JJDA 4X1VA 2KEAA 2KRMA 1PNJA 2G6FX 2YDLA 2VKNA 1KSWA 3M0UA 3VRYA 2DL8A 4AFSC 2CREA 1UTIA 2EGCA 2KGTA 2RQTA 2YUQA 4LNPA 5IHIA 1J3TA 1W70A 2JM8A 4CC7A 1YWPA 1Y0MA 2A36A 4RUGA 2C0OA 2LP5A 1UE9A 2DF6A 4AFZC 1RI9A 2V1QA 1YNZA 2L3SA 2K6DA 4J9IA 3NPFA 3REAB 3M0SA 2FRWA 1RLQC 1U3OA 1KJWA 4DEYA 4D8KA 1E6HA 1YWOA 5GJVB 3ULRB 2KE9A 5ECAA 1FYNA 1WXBA 2RMOA 2J6OA 1U5SA 1N5ZA 3NHNA 2H8HA 3VS1A 1WYXA 2K7AA 1X2QA 2J05A 3PVLA 3UA7A 1B3QA 5FWCA 3R6NA 1Y57A 1SPKA 2L0AA 1FMKA 1ZSGA 2JW4A 2MIOA 2ROTA 4HCKA 1CKAA 3VRZA 1LCKA 2CUDA 1EFNA 1NM7A 2F2WA 3RBBB 1E7OA 4AG1C 2CH4A 1K0XA 2YT6A 2B86A 1NYGA 1X69A 2LJ1A 4J9CA 2GTOA 3C0CA 1NYFA 1PRMC 1BK2A 1M30A 1JQQA 2FG0A 2GTJA 1UECA 2GBQA 4J9BA 1GCPA 2CSQA 1ZUYA
chains in the Genus database with same CATH superfamily
2ROLA 4ESRA 2QA4A 1XQHA 1VIFA 3NTKA 1VA7A 2QK0A 2FHDA 1MV0B 2CH4W 3JCMh 4MZPA 1M1GA 1IREB 1G3YA 4EPCA 4A4FA 3CPWP 4QQDA 1Q95G 1UJYA 4IUVA 1YJWA 3CCLA 5GANh 2E3HA 1PHTA 1N27A 4FIBA 4C8QA 4PNOA 4M75E 2LZ6B 2P84A 4RTVA 4A4GA 3JB9G 2NUPB 1KK7A 3TVTA 1YIJA 1N9SA 1MMGA 4GBQA 4J83A 4BI3A 2QEXT 1VQOT 2D8HA 1WHHA 2E70A 4PJMA 3PGGA 2V1RA 2ATCB 2KRNA 1AOJA 1Q81C 4M78G 2RH2A 2EQKA 4E47A 3M57A 4LD6A 1M8MA 3MEWA 2A28A 1SKUB 3I56A 4E7HA 4TVRA 4BE1A 3VJPA 5GAN7 4XQ3A 2RB6A 4UC4A 1KQSP 3L2VA 2DJQA 2QGGA 4K11A 3URGA 4RTYA 3SWNC 2QG9B 2K3BA 4C0GA 3L1AA 3L2QA 3CCUT 4J6WA 3CCSQ 2PUOB 1AHJB 1VQPA 3A1PA 5EG2A 2E1HA 1C1AA 4J6YA 2X3WD 3MO8A 1QVFA 2VASA 1M2VA 4FM4B 5CIUA 3H0FA 2RJEA 3CC4Q 3FRNA 4E6RA 4FCYA 2FZKB 1ZLMA 1W1FA 4D8DA 2FO0A 4PLLA 1TS9A 5FU7B 2CSIA 3WVDB 2RN8A 3VS2A 4PJOC 2KK4A 1Z9QA 1U06A 2BZ8A 1OZ2A 2DBMA 5FW9A 3HRTA 1HJDA 5LJ3e 4D6WA 3M56A 2LNVA 2RHYA 4KGVB 1IHVA 4HXJA 3CCEQ 3JB9H 1KFZA 3RKYA 2QQBA 1K9MU 2GFUA 3QWYA 1VQLT 3DB3A 2ZPFB 3J81E 2E65A 3EFRA 4JRPA 5KYUB 2KT1A 1PM3A 4EMGA 1H3HA 3OB9A 3CXCP 1R0BG 5HCKA 4HCBA 3OY9A 4WTOB 1OOTA 3QHSA 2FEIA 4J7IA 4KBMB 2DPPB 1YJ9A 1YP5A 1IZ6A 4M77C 4Q5WA 3JCMJ 2ED0A 1YCSB 4L59A 5IT9E 2DZCA 1XJWB 2K2VA 1M90C 4KUIA 4JUVA 3OYFA 1ZA1B 1N6AA 2O4XA 3OS2A 1H92A 4C92B 4C5IA 4J8OA 1YBYA 2EGEA 5GAOq 3JB9J 2FVUA 4AMCA 1N9RA 2Y90A 2MPXC 2E64A 3CMAQ 1D0ZA 4M7AF 1R8OB 2DL3A 2EYXA 4FW2A 3SEMA 1CSKA 2XHCA 3ER0A 4GLKA 3A5ZB 2L3RA 2XI9A 4L6V5 3CPWA 1RUWA 1PRLC 2RHZA 2W0ZA 4OMLA 1VQ5A 5CQXA 1PKTA 1RAEB 1QP2A 1ABQA 1N8RU 3GNGA 4F7UF 1ZX6A 2EKHA 4ELYC 4PLIA 4RTUA 2VC8A 4M7DF 2BE7D 4GLMA 1RAFB 4F04B 2WSEE 3RKXA 3OYAA 1TH7A 2DILA 2DETA 2AKKA 1YHQT 2YUOA 1OU9A 2VGNA 5GAMe 1M1KR 2KRSA 1M1FA 4ZN1A 5LJ3g 2QYZA 4LDVA 1AEYA 2GF7A 4M77D 4M75A 1VYUA 3MHXA 2EW3A 4XU3A 2KQWA 4BE0A 1ZSZC 2CKKA 4E7IA 1HYOA 2XKOC 2DRKA 3EG9B 5CO7A 4M77B 1EIFA 2DXBA 2O2OA 1VQ9Q 2EYWA 3EH1A 1K9MR 3CCVT 4BY6C 1K76A 4B9XA 1D3BA 3TSZA 5I2SA 3CCQT 5L8RE 4A4KA 1X01A 2DNUA 4BUGA 5FU6C 4M78F 3G4SQ 2K3XA 4OF1A 4O5VA 2LMJA 4WCIA 1MHNA 3M9QA 4ATOA 2D8JA 1UGRB 4JZ3A 2IG0A 2KXDA 1WNLA 2QDLA 3PNWC 3HTRA 2OI3A 2JNGA 2PVDB 2MCNA 4Z88A 3HRUA 1QQJA 2F69A 1UFFA 1IHWA 2J06A 4A63B 2CZ1B 2RO0A 1ABOA 2KYBA 3UDCA 5KCHA 1SRMA 4DOWA 1BYMA 2V26A 2KR3A 4RTZA 4OMNA 4Y28E 2NUPA 1I0CA 5FWBA 3CXCA 2ABLA 1O9SA 1VQ6Q 2DTOA 1SRLA 2KAFA 1BIBA 1B34A 1Y96A 2CP3A 4FSXA 3C95A 4FSSA 3UATA 4MZTA 3LGFA 1NJIC 4M78C 1D0XA 2QA4T 1D0YA 2A37A 3A8GB 1UUEA 3RMSA 2FB7A 4F14A 3CMAA 1N8RR 5LJ5f 2BZYA 2JTEA 2K3YA 4A4EA 1FMWA 3M0TA 1KC8R 2FPFA 2L5QA 3CCLT 1YJWT 1KHIA 2HL3A 1UHCA 2LCSA 2BUDA 2ECZA 1WHJA 4HKEA 2M51A 5GAMg 4C8QD 3JCMV 1V76A 2L2PA 4OB2B 1VQ4Q 3G6EA 2RHXA 4KUDK 3PFSA 4LDYA 4BY6B 4C8QB 1X6BA 2K5FA 3LGLA 5LJ3j 1YIJT 3OS0A 1PC0A 3M0RA 1K8AU 2YRDA 3E9FA 4OB1B 4JJDA 1M8VA 4JRIA 1RAHB 2DYIA 2VKNA 3M0UA 4XTWA 2WSCE 2X35A 3CCRA 3HFNA 3V7CA 1UTIA 1OX9A 4LNPA 3I56T 4M7AE 2KY9A 1O75A 2JM8A 3LWIA 4RUGA 2EKOA 3X25B 2F1LA 3JB9D 3VYHB 5J26A 1RI9A 4E7SA 2P0PA 3P8DA 4J9IA 1GXIE 3M0SA 2FRWA 1U3OA 4DEYA 3Q1JA 1Y71A 1YCYA 2JUFA 3WXMB 2J6OA 2KMTA 1N5ZA 3FC3A 2ZGWA 1VQPT 4F7UE 1WYXA 3M59A 4E7ZA 1UGQB 1YITA 2J05A 3QIIA 3EFSA 5J3BA 4M7DE 1FMKA 1M2VB 4DOVA 3L2ZA 1LJOA 2OTJA 2B8AA 3M5AA 2A0FB 1LCKA 1VQKA 2CZ0B 3CD6A 2YT6A 3OMGA 1Q82U 3C0CA 4ELZC 1NYFA 5A0GA 4HT9A 2K5IA 1BK2A 4LDWA 1UECA 3CCMQ 3SWNA 3CMEA 2XD0A 5KH6A 1VQ7T 1WI7A 3MEAA 3M0QA 3NTIA 3IQLA 5GAOn 2M9UA 3MP6A 1YJ9T 4A53A 5A2QE 3VS6A 5GAMj 4M75C 2E6ZA 5FRNA 2LDMA 3H0HA 4M78E 1OU8A 3OW2P 1VQMA 1JJ2S 2RQUA 4II1A 2MMPA 1I4K1 3CBMA 3I55A 1K73U 4QQGA 3JCMf 1MUZA 4PJOA 4QKUA 2MWPA 3HHTB 2OTLA 2O4XB 2C0IA 1UB4A 1D1CA 2YLBA 2K9GA 1TWBA 2A7YA 2RQVA 2DJZA 3ZBDA 5GANf 2KNBB 5C0MA 1VQ8Q 1H8KA 1Q86C 1VQ4A 2VGMA 2C06A 1SF9A 1RADB 3UF4A 3G7ZA 4AG2C 5I11A 1VQ5T 5FROA 1AWXA 1LVKA 4M77A 2OX7A 3QDRB 2DVEA 3DB4A 1A0NB 1SEMA 2HKQB 2FRYA 3GOXA 1Z9ZA 1U1TA 3LH5A 2F5KA 3OYJA 4EIKA 2HQEA 4J9GA 4CI0C 3V7SA 3N5BB 2ZCFB 2LRQA 2COYA 4BDYA 2E6NA 4DQ2A 2YSQA 4LDXA 4M7AG 5EC7A 4M75D 3X26B 1GCQC 3OYDA 3EG1A 2V8IA 3TCJA 5DLOA 1Q82R 4M75B 2GFAA 3VKIA 3A8HB 4ME7A 4IIOA 2QTVA 2DZ9A 3EG2A 2BTTA 3EGXA 3G71Q 5CR2A 5AT1B 3UPUA 5GAOp 1D3BB 1MNDA 3H9NA 2P4TA 4F7UG 1HSQA 3PMIA 2W10A 2YUPA 1WXTA 3R6OA 3TQ7P 4M7AA 4M7DG 2LCCA 2A08A 3RDVA 2IIMA 2JTMA 3HP9A 2H3EB 3CCJQ 4JJBA 2LTOA 4OMMA 2DD4A 4RG8A 2X4WA 1X6GA 1K73R 2IVWA 3KFVA 2DMOA 4NS5A 1ZSZA 4OMOA 1BIAA 2E5KA 4X9DA 1U1SA 1I1JA 1TSFA 1V1CA 2EQJA 1H3ZA 2JJ9A 3CC2Q 4C92F 5KCOA 4Z02A 5KYNA 1Q81U 2Y4XA 1B34B 1Y96B 4R55A 3RR6A 2DD5A 3OW2A 3JRZA 5IHNA 3THKA 1ZBJA 5HK3A 2I2LA 1T3LA 4OB0B 7AT1B 3CMAT 1OV3A 2O01E 1QKWA 1VQ8A 2COZA 2HL5C 2HD0A 1Q7YC 1SSFA 1VQNQ 4KH1B 5I2MA 1TUCA 2DX1A 2KROA 2OAWA 2Z0WA 3DKMA 2K5LA 5CKEA 2BKDN 2M0OA 2FZCB 1RLPC 3G6ET 4MDXA 2JM9A 4DBRA 3JCMW 5DY9A 2DE0X 1UDLA 5D6WA 1KG1A 1IGQA 2KI7A 1RI0A 2RA2A 5LJ5d 2JOYA 2BE9B 3ZFJA 4M78A 3TREA 2QXFA 1M5Q1 1K1ZA 2QQAA 3CCRT 5CK9A 2LQ8A 3OYMA 1FX7A 1JU5C 1BCOA 3OMCA 3PE0A 1BI0A 1ZUKA 2QDYB 3VS3A 4PFOA 1FMVA 4PJJA 5KYWA 1JBMA 3MKDA 1IO6A 1AWOA 2E5QA 4QVDA 4ZTJA 4IUQA 1W2BS 2YRCA 2F5TX 2HQXA 1UGVA 2RK2A 3A8OB 1VQ7A 1WPYA 2JT4A 2RQWA 2LVMA 1B07A 3OSVA 1M90U 3LW5E 2DXCA 4PJNA 1YITT 2LX9A 3BDUA 4XTYA 1M1KC 2HCKA 4Z89A 1TTHB 3OS5A 2CZ7B 2GQVA 2OTJT 2MOXA 4LUEA 1VYTA 1ARKA 1AWJA 2KSSA 1VQKT 2VUBA 3PIOA 1GFCA 2MAMA 3CD6T 1RAAB 4R56A 1SHFA 2DEQA 3C12A 2JXBA 2M02A 4R0KA 1WA7A 4JPBW 2VXEA 1GFDA 3KUFA 1NLOC 3L2RA 2RJFA 1OULA 3CMET 3D7SB 4FT2A 4F16A 4FU6A 3SWNB 5HKCA 1KQ1A 4OMFB 2AHJB 2K57A 3I5RA 2QEXQ 3GF5A 2JZ2A 2L3PA 2DERA 4JRKA 2PU9B 3FEOA 1AD5A 1ZHIA 4HCCA 3CXCS 1VQMT 2M1HA 3J7AF 3JAME 3I55T 4JRQA 3MP8A 1WJQA 4PJOD 1H641 4O6JA 1G2BA 4JDSA 2ZPIB 1WQWA 3SD4A 2OTLT 4F17A 4PJOB 1OPKA 1VQNA 2DA9A 1MGQA 3E2UA 1I5LA 2RPNA 5KYYA 1K4US 2XDDA 4PFZA 4C8QF 2KRMA 1PNJA 5CVIA 1VQ4T 4M7AC 3OYEA 3V8JA 2HAXA 1IRXA 1KSWA 2DL8A 4AFSC 2MF2A 2WACA 2RQTA 3META 3LH0A 5IHIA 3MPUB 4XK8E 3JCMd 1KQSA 3QPHA 4C92E 3CCSA 1YI2Q 1W70A 4MZMA 1S72Q 1UE9A 5LJ3h 1KC8C 1YNZA 5GANd 3CC4A 3LYIA 3LX7A 1RLQC 1KJWA 4E7JA 5CQYA 1YWOA 3ULRB 3QZ9B 1FYNA 4DBHA 1WXBA 3VV0A 4M7DC 1U5SA 1M90R 2H8HA 1VQLQ 9ATCB 3CBPA 1X2QA 2RM4A 2XG8D 3UA7A 1B3QA 1I5OB 5FWCA 3CCEA 2OAUA 4HA8A 1Y57A 2JW4A 2MIOA 3S3OA 3AHUA 1CKAA 1SG5A 1YFNA 1IB8A 2X4YA 2YRVA 2LJ1A 1NYGA 2RHUA 1NJIU 1WJSA 3VUBA 2GBQA 3OBWA 2EYQA 1BI2A 1OI1A 4J9BA 3EGXB 5GAN6 2J6KA 2DXTA 3FLGA 3HPWA 5GAN3 3KBGA 1QWFA 3FB9A 1QMCA 1AVZC 1PD1A 2LC4A 2CP6A 4AT1B 4M7AD 1WZOA 1JXOA 3VS0A 2QASA 1SHGA 4FYYB 4JJCA 2AKLA 2DO3A 5CKBA 2L3QA 1WHGA 3GIBA 4M7AB 3OQ5A 2DVJA 1MMAA 2XU8A 5KYXA 4BI4A 2K79A 5L23A 1GCQA 2GQIA 4J9EA 2VYTA 4ANJA 3EAEA 5LJ5e 4KRTA 1IXDA 1M9SA 2HZYA 1ZSZB 3DLMA 3SB2A 3PVQA 3V7RA 1ZBXA 2MK5A 2RHIA 1YJNQ 2I0NA 4M7DD 4ZGJB 1G5VA 1QWEA 2YUNA 5GAMh 5FU6B 2QI2A 3HKSA 3GLXA 4HT8A 2HBPA 3OS1A 3QWXX 1YHQQ 1NLPC 3H0IA 4MMLA 2O88A 5IN1A 4OMQA 1VQ8T 1UEBA 4OVAA 4N0AA 3NTHA 2HBWA 2LQNA 3BFMA 5GMKj 4EDUA 3OSSC 3VS7A 2EQIA 5GAOr 3GNFB 2H3JA 5GAN2 3HFOA 1UHFA 2FL7A 1PSFA 2NUZA 2EBPA 2SRCA 2V8KA 1YI2A 3CCVQ 2DM1A 1AWWA 1S72A 3HRSA 3CCQQ 1VIEA 1VQ9A 1D1AA 2EFIA 1TOVA 2ZAEA 2GNCA 4M78D 1QVGP 2M0YA 4EMKC 2LQKA 4PFPA 2GGRA 4C92G 2NUTA 4VUBA 2IPOB 4M78B 3RKWA 3G4SA 1FXXA 1KIKA 4DEXA 4LXCA 4JS4A 1NJIR 2DK3A 4C8QE 4KGZB 3V8LA 4IUTA 2SEMA 4JLIA 1GL5A 1GBQA 2JMAA 3H41A 5KYWB 1IGUA 3P8HA 3QYGB 3S3MA 3M0PA 3X28B 3QO3A 4BD3A 1C0MA 4C0DC 5LJ5g 2LNHB 1VQ6A 4IIMA 4KT0E 2QA4Q 2C0TA 2EJ9A 2CT4A 1AT1B 2AK5A 3OYLA 2E41A 2LJ0A 3ME9A 1WQ7A 2PNIA 1JEGA 1WLPB 2LT4A 1GRIA 2DBKA 4IKFA 2QQ9A 1KD1C 4N4IA 2J6FA 4LE9A 1Q86U 1OPLA 3CCLQ 1YJWQ 2ZZDA 3FJ5A 3M54A 4CRIA 1MV3A 1OQKA 1T0JA 3AT1B 4ZNXA 1K8AR 3JCMe 3OYYA 3RIRA 1XTDA 1F1BB 2DAQA 1P92A 4PKCC 3UWNA 1K0SA 5C6SA 1BCMA 3PTAA 5GANe 2LJ3A 1T3SA 2LX7A 5CKFA 1G8XA 4QVZA 3NFCA 1YJNA 1VYVA 1X43A 4PK4A 1CKBA 5KE3A 1X27A 1R0CB 2QQSA 3CC7Q 2JTFA 2JS2A 3JCMb 3I56Q 2X4JA 4OGEA 3E19A 5DLQE 1PSEA 1BB9A 3BE3A 1VQNT 2DTIA 1M27C 2BZXA 1V29B 3S6WA 5GMKm 5KYYB 2CP5A 1KQ2A 4C0DB 1VQPQ 2RNAA 1ACMB 1I07A 2PTKA 2PVOB 1JB0E 1QCFA 3CCST 1AZEA 2V8JA 1NE8A 2J7IA 3X20B 2XK0A 1M3AA 1JXMA 4CC3A 2JS0A 3QG1A 2RI3A 5GAN8 2HDAA 3MEUA 3CC4T 3L42A 4FT4A 3LLRA 4FYWB 1QVGA 4XTXA 3OYBA 5M9OA 1ZQ1A 2ZPEB 5LJ5j 2NYSA 3EGDA 1QVFS 5GJWB 4J9HA 4HVWA 2CS7A 2HMAA 4BI8B 2RQRA 4IUUA 3CCET 2COWA 2NLUA 4XTUA 3CCMA 2MYSA 4N0AC 2F2XA 2D0QB 4C8QG 2NWMA 3RERA 1T0HA 2D1XA 3JCMg 3LWHA 4NL2A 5KE2A 4MDWA 4BACA 2XIDA 2AZSA 2CYZB 5HK0A 4F7UA 5GANg 2QQRA 4QT7A 4A54A 5FU7C 3M55A 2PVGB 3F70A 2EGAA 3MEVA 4M7DA 4J9FA 3SDZA 1Q7YU 4J7FA 2FPEA 1BI3A 3EG0A 2XMFA 1G3WA 5IAYA 3X24B 5GAOm 3ASKA 5IXFA 2KBTA 2FZGB 3A98A 4RG2A 1M2OA 3REBB 4A4HA 3RESA 1VQ5Q 3VS5A 1JRIA 1QLYA 2JMCA 2HSPA 5KYXB 4AFQC 2E3IA 5D6YA 3FDRA 3S3NA 2EVRA 3CPFA 2XDBA 2DL5A 4JZ4A 3J80E 3H6ZA 1X75C 2KYMA 2PUKB 4GY5A 4IUPA 3CPWS 3CC7A 3HSBA 1I81A 4X1VA 2KEAA 4PJOF 2A3LA 3V8KA 3QUIA 4C92C 2G6FX 2YDLA 1EX4A 1W2BP 3VRYA 3PMTA 2MWOA 2KGTA 1RABB 2RD1A 1J3TA 1RL2A 1Y7XA 3BDLA 2QAZA 4CC7A 1YWPA 1Y0MA 2A36A 2C0OA 4MMKA 2DF6A 4C5HA 4AFZC 3JB9I 2V1QA 2L3SA 2G3RA 3NPFA 3MP1A 1I8FA 1Y07A 3CBOA 4DA4A 1E6HA 4YTLA 5GJVB 1EZZB 4M77F 4EMHA 5ECAA 2X9HA 4C0ZA 1YI2T 3NHNA 1M1KU 1S72T 3VS1A 5LJ3f 2K7AA 3QYHB 3PVLA 1VQ9T 4L5GA 4DBQA 1KQSS 5D6XA 3G71A 4N4GA 1LOJA 2ROTA 4HCKA 5A0DA 3G4ST 5GMKe 3VRZA 2R58A 2CUDA 1EFNA 2NUTB 3RBBB 4AG1C 2B86A 4J9CA 5GANj 2GTOA 1PRMC 2L8DA 1M30A 1R77A 1HK9A 2EQUA 4QVCA 3FIFA 1Q81R 3EFOA 2CSQA 1NBEB 3CCJA 2FPDA 1K9MC 3RMQA 1Q7YR 3GPLA 1VUBA 4BB7A 1TU0B 3U23A 6AT1B 1PKSA 1QCNA 2X51A 3EGUA 4C92D 1D1BA 4C5GA 3TSWA 2DL4A 1W6XA 2D9TA 4EMKA 3CC2A 1VQ6T 5D7UA 1VQOQ 2DIQA 1M3CA 4XAXB 2MI6A 1G3SA 2EIFA 1G83A 2VWFA 2EAYA 5AYFA 1NEBA 2EYYA 3A8LB 4BE2A 3C4SA 4PL6A 2E12A 3A8MB 2D0NA 1MMDA 3BW1A 4XU1A 4RCBA 1BU1A 1YN8A 4LD9K 1XNIA 1UG1A 1X2KA 3G6EQ 2DKGA 1WFWA 3DLLA 2EJGA 4XTZA 1S1NA 1WXUA 5A0LA 4N4HA 3KXTA 2AZVA 4M75G 3JCMX 1X6OA 4P5NA 1KC8U 3EH2A 2PQWA 1U8RA 4QW2A 3UT1A 3CCUQ 1LPLA 1YJNT 4XU0A 5GAMf 1HD3A 2F2VA 3VS4A 4JLGA 1N8RC 2AT1B 3CCRQ 2WSFE 2ZPBB 4C5EA 1W2BA 2CP2A 2CZ6B 5FRMA 1OX8A 2KT8A 3SFMA 2P0QA 2E10A 3JB9F 2CGHA 4HVUA 4HVVA 5IH2A 5GMKh 2ZPHB 3SHWA 1D09B 3OYIA 4C8QC 4B9WA 1WDXA 2ESWA 4OB3B 4WF2A 3I5SA 3TU4K 1WJRA 1YITQ 3OBYA 3HL8A 1ZUUA 4PJOE 3M4GA 1QW1A 2LQWA 2P4RA 4LN2A 1NG2A 2E4HA 2OTJQ 1TUDA 3PIPA 5GMKi 1VQKQ 1QP3A 4E7LA 3GBQA 3CD6Q 2RJDA 3I35A 4FYVB 1UJ0A 4AFUC 3M53A 3MJXA 1PWTA 5GAN4 1AZGB 1NEGA 3EGDB 4RTTA 5DM7R 4ZGEB 3OYGA 3CMEQ 3BY7A 3E9GA 3EHRA 4E2FB 1BKBA 1PCXA 1B7TA 3VU3C 2VXFA 1OYXA 3CCMT 3QSUA 2BIVA 2XDPA 4M77E 1G3TA 2P0KA 2CT3A 3H8ZA 2X3XD 2DFUA 1QVPA 2RF0A 3OYKA 3NMZC 5IHKA 1VQOA 2QEXA 1W4SA 3JV3A 1VQMQ 2RI5A 2Y4YA 4J6XA 3I55Q 5LL6S 3ZEHA 1WIEA 1WX6A 1JO8A 3RUXA 2HEQA 5CCAA 4IURA 4Z8AA 4KGXB 2OTLQ 2YXYA 4F7UB 4QQ6A 2YLCA 1TXQA 3ZL7C 4B6MA 1GBRA 5HY6A 5CAIA 1UGSB 5GAN5 2CP0A 4M7DB 4C0FA 2RI2A 4ORZA 2DL7A 1OZ3A 5J39A 2AIRB 4FL6A 2D6FA 2R5MA 1MMNA 3C94A 2JN0A 2KXCA 3QJ6A 1BI1A 4V2SA 2EPDA 4J5YA 3CCUA 3OYHA 4JS5A 1BBZA 1OEBA 4NL3A 3WVEB 2EJFA 4NOYA 4CC2A 3EG3A 3CC7T 4HCZA 2DRMA 1M3BA 1K8AC 3OA6A 8AT1B 3FJPA 2JVVA 3RNJA 2CUBA 1M4ZA 2DYBA 4ZGDB 1WHLA 2X4XA 4Y92A 5KYUA 3QKJA 4PJLA 2K2MA 1PD0A 1VQLA 4DBFA 5CKHA 4LDUA 4RKUE 2LCLA 4Y91A 1QKXA 2EQMA 3UA6A 1JJ2P 4RTWA 2ED1A 2DTHA 4M75F 2L89A 3L2UA 4XTVA 4OP0A 2KDSA 2VB6A 5I22A 3INZA 2DEUA 3EHQA 4LUDA 4KH0B 2KVQG 3QXEB 4C92A 2O9SA 1WGSA 2O9VA 4J9DA 3G71T 1K9AA 1KD1U 2HKNA 2YHTA 3JCMc 4OMPA 4PJOG 3QBYA 1RAGB 2R57A 4X34A 1QVGS 5LJ5h 2OJ2A 5GMKl 2K4YA 1WHMA 1SSHA 2EYZA 3M4YA 4ZTFA 1WHKA 2PZ1A 1Q82C 1E6GA 5LJ3d 2RK1A 4JJNK 3QZ5B 3CCJT 2DXUA 2HNIA 2VVKA 3EFOB 5I21A 3P8BB 1XOVA 4RMOA 5IXBA 1DJ7B 3O5ZA 2O31A 1HXDA 4RTXA 2CP7A 1YIJQ 3O8VA 3JCMP 2CDTA 4M77G 3CC2T 1QCOA 2FYKA 4RCCA 2DLPA 4CC4B 3OYNA 3I9QA 4EMKB 3NGPA 1RACB 3JCMQ 3T9NA 1FWZA 4M4ZA 1K73C 3QJYA 1YHQA 1TG0A 3CQTA 2R5AA 1TUGB 2ENMA 5CKDA 3G1JA 4X9CA 3OW2S 3EG9A 4FW1A 1LNXA 2EWNA 3VYGA 2VV5A 2CREA 1QVFP 2EGCA 2QGFB 2DIGA 2YUQA 1NZ9A 1NPPA 2QTXA 3CCVA 2LP5A 3CCQA 3MCAB 2YWWA 1RAIB 2K6DA 3GP8A 4ZN3A 1UGPB 3REAB 2XICA 3TEEA 4XU2A 4D8KA 1NPRA 2KE9A 2RMOA 2ZPGB 5GAOl 1C6VX 5FLXE 2HSEB 2GCXA 3R6NA 3VUZA 1KD1R 1PG5B 1SPKA 1KHCA 2L0AA 1ZSGA 2RJCA 4E7KA 5GAMd 3JSCA 4KULA 3L2WA 3CEYA 2LT1A 1VQ7Q 8ATCB 1NM7A 2F2WA 3QDFA 1E7OA 1VOMA 2M16A 4FYXB 3PT9A 3OYCA 2CH4A 3E1SA 2HQHA 1K0XA 1X69A 1JJ2A 4OGCA 1ZA2B 4BDZA 3M58A 2FG0A 1JQQA 1YJ9Q 1Q86R 2GTJA 1GCPA 1MNEA 1ZUYA
chains in the Genus database with same CATH topology
2ROLA 2FPDA 2J6KA 4ESRA 1WI7A 1QWFA 1VA7A 3M0QA 1MV0B 3IQLA 2CH4W 3U23A 1PKSA 1AVZC 3EGUA 1JXOA 3VS0A 1SHGA 3TSWA 3VS6A 2DL4A 4JJCA 1W6XA 2AKLA 2L3QA 1UJYA 2DVJA 3H0HA 1PHTA 2RQUA 1M3CA 2K79A 5L23A 1GCQA 2GQIA 4J9EA 1MUZA 2LZ6B 1G83A 2VWFA 4RTVA 4KRTA 1NEBA 2C0IA 2EYYA 3TVTA 2K9GA 3PVQA 2RQVA 4GBQA 2KNBB 2D8HA 2D0NA 1H8KA 2I0NA 2V1RA 2KRNA 1BU1A 1AOJA 1QWEA 1YN8A 2YUNA 1UG1A 1X2KA 1WFWA 1S1NA 1WXUA 3UF4A 4AG2C 1M8MA 5I11A 2A28A 1AWXA 3QWXX 2AZVA 1NLPC 3H0IA 2O88A 4OMQA 1A0NB 2HBWA 1SEMA 2LQNA 2DJQA 1HD3A 2F2VA 3VS4A 3VS7A 2EQIA 4K11A 2FRYA 1Z9ZA 4RTYA 1UHFA 3LH5A 2NUZA 2EBPA 2K3BA 4EIKA 4J9GA 2SRCA 2DM1A 1AWWA 2X3WD 2KT8A 3H0FA 2GNCA 4E6RA 2M0YA 2YSQA 1ZLMA 4HVUA 2GGRA 4HVVA 1W1FA 4D8DA 5IH2A 2FO0A 2CSIA 5EC7A 3SHWA 1GCQC 3EG1A 1WDXA 2ESWA 2RN8A 1KIKA 3VS2A 3I5SA 1Z9QA 1U06A 2BZ8A 4DEXA 2DBMA 5FW9A 1HJDA 1KFZA 4HXJA 4IIOA 3EG2A 2BTTA 3QWYA 1ZUUA 2LQWA 2P4RA 2SEMA 4LN2A 1NG2A 1GL5A 2KT1A 1TUDA 1GBQA 1H3HA 1HSQA 2JMAA 5HCKA 2W10A 3H41A 3GBQA 3I35A 2YUPA 1UJ0A 4AFUC 1OOTA 1WXTA 3M0PA 1PWTA 2FEIA 2A08A 1AZGB 1NEGA 1YP5A 4RTTA 2IIMA 2ED0A 2LNHB 4IIMA 1YCSB 3EHRA 4JJBA 4OMMA 1X6GA 2C0TA 2CT4A 2AK5A 3KFVA 2DMOA 2LJ0A 1H92A 4OMOA 2PNIA 1JEGA 1WLPB 2CT3A 1GRIA 2DBKA 2E5KA 2EGEA 1I1JA 2X3XD 2J6FA 1V1CA 4LE9A 1OPLA 2RF0A 3NMZC 5IHKA 2DL3A 3JV3A 3FJ5A 2EYXA 3SEMA 1CSKA 1MV3A 1T0JA 1WIEA 1WX6A 4ZNXA 1JO8A 1RUWA 1PRLC 2HEQA 4Z8AA 2W0ZA 4OMLA 5IHNA 3THKA 1ZBJA 1T3LA 3ZL7C 1PKTA 1GBRA 1K0SA 1OV3A 1ABQA 2LJ3A 1QKWA 1T3SA 2LX7A 4ORZA 2DL7A 1VYVA 1ZX6A 2EKHA 1X43A 1CKBA 1X27A 4RTUA 1TUCA 2DX1A 2KROA 2OAWA 2JS2A 2KXCA 1RLPC 4GLMA 2JM9A 2EPDA 2DE0X 1UDLA 2DILA 1BB9A 1BBZA 2AKKA 2YUOA 1OEBA 1M27C 2BZXA 4CC2A 3EG3A 2KRSA 2DRMA 1M3BA 1AEYA 1K1ZA 1VYUA 2EW3A 3RNJA 2DRKA 2CUBA 2RNAA 2DYBA 1I07A 2PTKA 2O2OA 1JU5C 2EYWA 1AZEA 1QCFA 3PE0A 1K76A 4Y92A 2J7IA 1ZUKA 3TSZA 2K2MA 1M3AA 1JXMA 4CC3A 3VS3A 2DNUA 2JS0A 2HDAA 1QKXA 1IO6A 1AWOA 3UA6A 4RTWA 2ED1A 2LMJA 4WCIA 1UGVA 5GJWB 2D8JA 4J9HA 4HVWA 4JZ3A 2JT4A 2KXDA 2RQWA 1B07A 2QDLA 5I22A 3EHQA 4LUDA 2OI3A 2MCNA 2RQRA 4Z88A 2O9SA 2O9VA 2HCKA 1UFFA 2J06A 4J9DA 4Z89A 4A63B 1K9AA 1ABOA 2F2XA 2KYBA 2MOXA 4OMPA 4LUEA 1VYTA 1ARKA 1AWJA 1SRMA 2NWMA 2KR3A 1T0HA 4RTZA 2D1XA 4OMNA 1GFCA 1I0CA 5FWBA 2ABLA 2OJ2A 1SRLA 1SHFA 2JXBA 1SSHA 2EYZA 4R0KA 1WA7A 2AZSA 2PZ1A 4FSSA 3UATA 4JPBW 1GFDA 1E6GA 1NLOC 4QT7A 4F16A 2A37A 2EGAA 2VVKA 1XOVA 5IXBA 4J9FA 1UUEA 4F14A 3O5ZA 2FPEA 2BZYA 3I5RA 3EG0A 2JTEA 2O31A 2L3PA 2XMFA 4RTXA 3M0TA 2FPFA 2CDTA 1AD5A 5IXFA 1UHCA 2KBTA 2DLPA 3A98A 2ECZA 2LCSA 3REBB 4CC4B 3I9QA 2M51A 3NGPA 3VS5A 1QLYA 2L2PA 2JMCA 2HSPA 4AFQC 1G2BA 4M4ZA 4F17A 1X6BA 2EVRA 2DL5A 4JZ4A 1OPKA 2KYMA 2DA9A 3M0RA 1TG0A 3CQTA 2RPNA 1K4US 2ENMA 4JJDA 4X1VA 2KEAA 2KRMA 1PNJA 2G6FX 2YDLA 2VKNA 1KSWA 3M0UA 3VRYA 2DL8A 4AFSC 2CREA 1UTIA 2EGCA 2KGTA 2RQTA 2YUQA 4LNPA 5IHIA 1J3TA 1W70A 2JM8A 4CC7A 1YWPA 1Y0MA 2A36A 4RUGA 2C0OA 2LP5A 1UE9A 2DF6A 4AFZC 1RI9A 2V1QA 1YNZA 2L3SA 2K6DA 4J9IA 3NPFA 3REAB 3M0SA 2FRWA 1RLQC 1U3OA 1KJWA 4DEYA 4D8KA 1E6HA 1YWOA 5GJVB 3ULRB 2KE9A 5ECAA 1FYNA 1WXBA 2RMOA 2J6OA 1U5SA 1N5ZA 3NHNA 2H8HA 3VS1A 1WYXA 2K7AA 1X2QA 2J05A 3PVLA 3UA7A 1B3QA 5FWCA 3R6NA 1Y57A 1SPKA 2L0AA 1FMKA 1ZSGA 2JW4A 2MIOA 2ROTA 4HCKA 1CKAA 3VRZA 1LCKA 2CUDA 1EFNA 1NM7A 2F2WA 3RBBB 1E7OA 4AG1C 2CH4A 1K0XA 2YT6A 2B86A 1NYGA 1X69A 2LJ1A 4J9CA 2GTOA 3C0CA 1NYFA 1PRMC 1BK2A 1M30A 1JQQA 2FG0A 2GTJA 1UECA 2GBQA 4J9BA 1GCPA 2CSQA 1ZUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROL A;  2FPD A;  2J6K A;  4ESR A;  1WI7 A;  1QWF A;  1VA7 A;  3M0Q A;  1MV0 B;  3IQL A;  2CH4 W;  3U23 A;  1PKS A;  1AVZ C;  3EGU A;  1JXO A;  3VS0 A;  1SHG A;  3TSW A;  3VS6 A;  2DL4 A;  4JJC A;  1W6X A;  2AKL A;  2L3Q A;  1UJY A;  2DVJ A;  3H0H A;  1PHT A;  2RQU A;  1M3C A;  2K79 A;  5L23 A;  1GCQ A;  2GQI A;  4J9E A;  1MUZ A;  2LZ6 B;  1G83 A;  2VWF A;  4RTV A;  4KRT A;  1NEB A;  2C0I A;  2EYY A;  3TVT A;  2K9G A;  3PVQ A;  2RQV A;  4GBQ A;  2KNB B;  2D8H A;  2D0N A;  1H8K A;  2I0N A;  2V1R A;  2KRN A;  1BU1 A;  1AOJ A;  1QWE A;  1YN8 A;  2YUN A;  1UG1 A;  1X2K A;  1WFW A;  1S1N A;  1WXU A;  3UF4 A;  4AG2 C;  1M8M A;  5I11 A;  2A28 A;  1AWX A;  3QWX X;  2AZV A;  1NLP C;  3H0I A;  2O88 A;  4OMQ A;  1A0N B;  2HBW A;  1SEM A;  2LQN A;  2DJQ A;  1HD3 A;  2F2V A;  3VS4 A;  3VS7 A;  2EQI A;  4K11 A;  2FRY A;  1Z9Z A;  4RTY A;  1UHF A;  3LH5 A;  2NUZ A;  2EBP A;  2K3B A;  4EIK A;  4J9G A;  2SRC A;  2DM1 A;  1AWW A;  2X3W D;  2KT8 A;  3H0F A;  2GNC A;  4E6R A;  2M0Y A;  2YSQ A;  1ZLM A;  4HVU A;  2GGR A;  4HVV A;  1W1F A;  4D8D A;  5IH2 A;  2FO0 A;  2CSI A;  5EC7 A;  3SHW A;  1GCQ C;  3EG1 A;  1WDX A;  2ESW A;  2RN8 A;  1KIK A;  3VS2 A;  3I5S A;  1Z9Q A;  1U06 A;  2BZ8 A;  4DEX A;  2DBM A;  5FW9 A;  1HJD A;  1KFZ A;  4HXJ A;  4IIO A;  3EG2 A;  2BTT A;  3QWY A;  1ZUU A;  2LQW A;  2P4R A;  2SEM A;  4LN2 A;  1NG2 A;  1GL5 A;  2KT1 A;  1TUD A;  1GBQ A;  1H3H A;  1HSQ A;  2JMA A;  5HCK A;  2W10 A;  3H41 A;  3GBQ A;  3I35 A;  2YUP A;  1UJ0 A;  4AFU C;  1OOT A;  1WXT A;  3M0P A;  1PWT A;  2FEI A;  2A08 A;  1AZG B;  1NEG A;  1YP5 A;  4RTT A;  2IIM A;  2ED0 A;  2LNH B;  4IIM A;  1YCS B;  3EHR A;  4JJB A;  4OMM A;  1X6G A;  2C0T A;  2CT4 A;  2AK5 A;  3KFV A;  2DMO A;  2LJ0 A;  1H92 A;  4OMO A;  2PNI A;  1JEG A;  1WLP B;  2CT3 A;  1GRI A;  2DBK A;  2E5K A;  2EGE A;  1I1J A;  2X3X D;  2J6F A;  1V1C A;  4LE9 A;  1OPL A;  2RF0 A;  3NMZ C;  5IHK A;  2DL3 A;  3JV3 A;  3FJ5 A;  2EYX A;  3SEM A;  1CSK A;  1MV3 A;  1T0J A;  1WIE A;  1WX6 A;  4ZNX A;  1JO8 A;  1RUW A;  1PRL C;  2HEQ A;  4Z8A A;  2W0Z A;  4OML A;  5IHN A;  3THK A;  1ZBJ A;  1T3L A;  3ZL7 C;  1PKT A;  1GBR A;  1K0S A;  1OV3 A;  1ABQ A;  2LJ3 A;  1QKW A;  1T3S A;  2LX7 A;  4ORZ A;  2DL7 A;  1VYV A;  1ZX6 A;  2EKH A;  1X43 A;  1CKB A;  1X27 A;  4RTU A;  1TUC A;  2DX1 A;  2KRO A;  2OAW A;  2JS2 A;  2KXC A;  1RLP C;  4GLM A;  2JM9 A;  2EPD A;  2DE0 X;  1UDL A;  2DIL A;  1BB9 A;  1BBZ A;  2AKK A;  2YUO A;  1OEB A;  1M27 C;  2BZX A;  4CC2 A;  3EG3 A;  2KRS A;  2DRM A;  1M3B A;  1AEY A;  1K1Z A;  1VYU A;  2EW3 A;  3RNJ A;  2DRK A;  2CUB A;  2RNA A;  2DYB A;  1I07 A;  2PTK A;  2O2O A;  1JU5 C;  2EYW A;  1AZE A;  1QCF A;  3PE0 A;  1K76 A;  4Y92 A;  2J7I A;  1ZUK A;  3TSZ A;  2K2M A;  1M3A A;  1JXM A;  4CC3 A;  3VS3 A;  2DNU A;  2JS0 A;  2HDA A;  1QKX A;  1IO6 A;  1AWO A;  3UA6 A;  4RTW A;  2ED1 A;  2LMJ A;  4WCI A;  1UGV A;  5GJW B;  2D8J A;  4J9H A;  4HVW A;  4JZ3 A;  2JT4 A;  2KXD A;  2RQW A;  1B07 A;  2QDL A;  5I22 A;  3EHQ A;  4LUD A;  2OI3 A;  2MCN A;  2RQR A;  4Z88 A;  2O9S A;  2O9V A;  2HCK A;  1UFF A;  2J06 A;  4J9D A;  4Z89 A;  4A63 B;  1K9A A;  1ABO A;  2F2X A;  2KYB A;  2MOX A;  4OMP A;  4LUE A;  1VYT A;  1ARK A;  1AWJ A;  1SRM A;  2NWM A;  2KR3 A;  1T0H A;  4RTZ A;  2D1X A;  4OMN A;  1GFC A;  1I0C A;  5FWB A;  2ABL A;  2OJ2 A;  1SRL A;  1SHF A;  2JXB A;  1SSH A;  2EYZ A;  4R0K A;  1WA7 A;  2AZS A;  2PZ1 A;  4FSS A;  3UAT A;  4JPB W;  1GFD A;  1E6G A;  1NLO C;  4QT7 A;  4F16 A;  2A37 A;  2EGA A;  2VVK A;  1XOV A;  5IXB A;  4J9F A;  1UUE A;  4F14 A;  3O5Z A;  2FPE A;  2BZY A;  3I5R A;  3EG0 A;  2JTE A;  2O31 A;  2L3P A;  2XMF A;  4RTX A;  3M0T A;  2FPF A;  2CDT A;  1AD5 A;  5IXF A;  1UHC A;  2KBT A;  2DLP A;  3A98 A;  2ECZ A;  2LCS A;  3REB B;  4CC4 B;  3I9Q A;  2M51 A;  3NGP A;  3VS5 A;  1QLY A;  2L2P A;  2JMC A;  2HSP A;  4AFQ C;  1G2B A;  4M4Z A;  4F17 A;  1X6B A;  2EVR A;  2DL5 A;  4JZ4 A;  1OPK A;  2KYM A;  2DA9 A;  3M0R A;  1TG0 A;  3CQT A;  2RPN A;  1K4U S;  2ENM A;  4JJD A;  4X1V A;  2KEA A;  2KRM A;  1PNJ A;  2G6F X;  2YDL A;  2VKN A;  1KSW A;  3M0U A;  3VRY A;  2DL8 A;  4AFS C;  2CRE A;  1UTI A;  2EGC A;  2KGT A;  2RQT A;  2YUQ A;  4LNP A;  5IHI A;  1J3T A;  1W70 A;  2JM8 A;  4CC7 A;  1YWP A;  1Y0M A;  2A36 A;  4RUG A;  2C0O A;  2LP5 A;  1UE9 A;  2DF6 A;  4AFZ C;  1RI9 A;  2V1Q A;  1YNZ A;  2L3S A;  2K6D A;  4J9I A;  3NPF A;  3REA B;  3M0S A;  2FRW A;  1RLQ C;  1U3O A;  1KJW A;  4DEY A;  4D8K A;  1E6H A;  1YWO A;  5GJV B;  3ULR B;  2KE9 A;  5ECA A;  1FYN A;  1WXB A;  2RMO A;  2J6O A;  1U5S A;  1N5Z A;  3NHN A;  2H8H A;  3VS1 A;  1WYX A;  2K7A A;  1X2Q A;  2J05 A;  3PVL A;  3UA7 A;  1B3Q A;  5FWC A;  3R6N A;  1Y57 A;  1SPK A;  2L0A A;  1FMK A;  1ZSG A;  2JW4 A;  2MIO A;  2ROT A;  4HCK A;  1CKA A;  3VRZ A;  1LCK A;  2CUD A;  1EFN A;  1NM7 A;  2F2W A;  3RBB B;  1E7O A;  4AG1 C;  2CH4 A;  1K0X A;  2YT6 A;  2B86 A;  1NYG A;  1X69 A;  2LJ1 A;  4J9C A;  2GTO A;  3C0C A;  1NYF A;  1PRM C;  1BK2 A;  1M30 A;  1JQQ A;  2FG0 A;  2GTJ A;  1UEC A;  2GBQ A;  4J9B A;  1GCP A;  2CSQ A;  1ZUY A; 
#chains in the Genus database with same CATH topology
 2ROL A;  4ESR A;  2QA4 A;  1XQH A;  1VIF A;  3NTK A;  1VA7 A;  2QK0 A;  2FHD A;  1MV0 B;  2CH4 W;  3JCM h;  4MZP A;  1M1G A;  1IRE B;  1G3Y A;  4EPC A;  4A4F A;  3CPW P;  4QQD A;  1Q95 G;  1UJY A;  4IUV A;  1YJW A;  3CCL A;  5GAN h;  2E3H A;  1PHT A;  1N27 A;  4FIB A;  4C8Q A;  4PNO A;  4M75 E;  2LZ6 B;  2P84 A;  4RTV A;  4A4G A;  3JB9 G;  2NUP B;  1KK7 A;  3TVT A;  1YIJ A;  1N9S A;  1MMG A;  4GBQ A;  4J83 A;  4BI3 A;  2QEX T;  1VQO T;  2D8H A;  1WHH A;  2E70 A;  4PJM A;  3PGG A;  2V1R A;  2ATC B;  2KRN A;  1AOJ A;  1Q81 C;  4M78 G;  2RH2 A;  2EQK A;  4E47 A;  3M57 A;  4LD6 A;  1M8M A;  3MEW A;  2A28 A;  1SKU B;  3I56 A;  4E7H A;  4TVR A;  4BE1 A;  3VJP A;  5GAN 7;  4XQ3 A;  2RB6 A;  4UC4 A;  1KQS P;  3L2V A;  2DJQ A;  2QGG A;  4K11 A;  3URG A;  4RTY A;  3SWN C;  2QG9 B;  2K3B A;  4C0G A;  3L1A A;  3L2Q A;  3CCU T;  4J6W A;  3CCS Q;  2PUO B;  1AHJ B;  1VQP A;  3A1P A;  5EG2 A;  2E1H A;  1C1A A;  4J6Y A;  2X3W D;  3MO8 A;  1QVF A;  2VAS A;  1M2V A;  4FM4 B;  5CIU A;  3H0F A;  2RJE A;  3CC4 Q;  3FRN A;  4E6R A;  4FCY A;  2FZK B;  1ZLM A;  1W1F A;  4D8D A;  2FO0 A;  4PLL A;  1TS9 A;  5FU7 B;  2CSI A;  3WVD B;  2RN8 A;  3VS2 A;  4PJO C;  2KK4 A;  1Z9Q A;  1U06 A;  2BZ8 A;  1OZ2 A;  2DBM A;  5FW9 A;  3HRT A;  1HJD A;  5LJ3 e;  4D6W A;  3M56 A;  2LNV A;  2RHY A;  4KGV B;  1IHV A;  4HXJ A;  3CCE Q;  3JB9 H;  1KFZ A;  3RKY A;  2QQB A;  1K9M U;  2GFU A;  3QWY A;  1VQL T;  3DB3 A;  2ZPF B;  3J81 E;  2E65 A;  3EFR A;  4JRP A;  5KYU B;  2KT1 A;  1PM3 A;  4EMG A;  1H3H A;  3OB9 A;  3CXC P;  1R0B G;  5HCK A;  4HCB A;  3OY9 A;  4WTO B;  1OOT A;  3QHS A;  2FEI A;  4J7I A;  4KBM B;  2DPP B;  1YJ9 A;  1YP5 A;  1IZ6 A;  4M77 C;  4Q5W A;  3JCM J;  2ED0 A;  1YCS B;  4L59 A;  5IT9 E;  2DZC A;  1XJW B;  2K2V A;  1M90 C;  4KUI A;  4JUV A;  3OYF A;  1ZA1 B;  1N6A A;  2O4X A;  3OS2 A;  1H92 A;  4C92 B;  4C5I A;  4J8O A;  1YBY A;  2EGE A;  5GAO q;  3JB9 J;  2FVU A;  4AMC A;  1N9R A;  2Y90 A;  2MPX C;  2E64 A;  3CMA Q;  1D0Z A;  4M7A F;  1R8O B;  2DL3 A;  2EYX A;  4FW2 A;  3SEM A;  1CSK A;  2XHC A;  3ER0 A;  4GLK A;  3A5Z B;  2L3R A;  2XI9 A;  4L6V 5;  3CPW A;  1RUW A;  1PRL C;  2RHZ A;  2W0Z A;  4OML A;  1VQ5 A;  5CQX A;  1PKT A;  1RAE B;  1QP2 A;  1ABQ A;  1N8R U;  3GNG A;  4F7U F;  1ZX6 A;  2EKH A;  4ELY C;  4PLI A;  4RTU A;  2VC8 A;  4M7D F;  2BE7 D;  4GLM A;  1RAF B;  4F04 B;  2WSE E;  3RKX A;  3OYA A;  1TH7 A;  2DIL A;  2DET A;  2AKK A;  1YHQ T;  2YUO A;  1OU9 A;  2VGN A;  5GAM e;  1M1K R;  2KRS A;  1M1F A;  4ZN1 A;  5LJ3 g;  2QYZ A;  4LDV A;  1AEY A;  2GF7 A;  4M77 D;  4M75 A;  1VYU A;  3MHX A;  2EW3 A;  4XU3 A;  2KQW A;  4BE0 A;  1ZSZ C;  2CKK A;  4E7I A;  1HYO A;  2XKO C;  2DRK A;  3EG9 B;  5CO7 A;  4M77 B;  1EIF A;  2DXB A;  2O2O A;  1VQ9 Q;  2EYW A;  3EH1 A;  1K9M R;  3CCV T;  4BY6 C;  1K76 A;  4B9X A;  1D3B A;  3TSZ A;  5I2S A;  3CCQ T;  5L8R E;  4A4K A;  1X01 A;  2DNU A;  4BUG A;  5FU6 C;  4M78 F;  3G4S Q;  2K3X A;  4OF1 A;  4O5V A;  2LMJ A;  4WCI A;  1MHN A;  3M9Q A;  4ATO A;  2D8J A;  1UGR B;  4JZ3 A;  2IG0 A;  2KXD A;  1WNL A;  2QDL A;  3PNW C;  3HTR A;  2OI3 A;  2JNG A;  2PVD B;  2MCN A;  4Z88 A;  3HRU A;  1QQJ A;  2F69 A;  1UFF A;  1IHW A;  2J06 A;  4A63 B;  2CZ1 B;  2RO0 A;  1ABO A;  2KYB A;  3UDC A;  5KCH A;  1SRM A;  4DOW A;  1BYM A;  2V26 A;  2KR3 A;  4RTZ A;  4OMN A;  4Y28 E;  2NUP A;  1I0C A;  5FWB A;  3CXC A;  2ABL A;  1O9S A;  1VQ6 Q;  2DTO A;  1SRL A;  2KAF A;  1BIB A;  1B34 A;  1Y96 A;  2CP3 A;  4FSX A;  3C95 A;  4FSS A;  3UAT A;  4MZT A;  3LGF A;  1NJI C;  4M78 C;  1D0X A;  2QA4 T;  1D0Y A;  2A37 A;  3A8G B;  1UUE A;  3RMS A;  2FB7 A;  4F14 A;  3CMA A;  1N8R R;  5LJ5 f;  2BZY A;  2JTE A;  2K3Y A;  4A4E A;  1FMW A;  3M0T A;  1KC8 R;  2FPF A;  2L5Q A;  3CCL T;  1YJW T;  1KHI A;  2HL3 A;  1UHC A;  2LCS A;  2BUD A;  2ECZ A;  1WHJ A;  4HKE A;  2M51 A;  5GAM g;  4C8Q D;  3JCM V;  1V76 A;  2L2P A;  4OB2 B;  1VQ4 Q;  3G6E A;  2RHX A;  4KUD K;  3PFS A;  4LDY A;  4BY6 B;  4C8Q B;  1X6B A;  2K5F A;  3LGL A;  5LJ3 j;  1YIJ T;  3OS0 A;  1PC0 A;  3M0R A;  1K8A U;  2YRD A;  3E9F A;  4OB1 B;  4JJD A;  1M8V A;  4JRI A;  1RAH B;  2DYI A;  2VKN A;  3M0U A;  4XTW A;  2WSC E;  2X35 A;  3CCR A;  3HFN A;  3V7C A;  1UTI A;  1OX9 A;  4LNP A;  3I56 T;  4M7A E;  2KY9 A;  1O75 A;  2JM8 A;  3LWI A;  4RUG A;  2EKO A;  3X25 B;  2F1L A;  3JB9 D;  3VYH B;  5J26 A;  1RI9 A;  4E7S A;  2P0P A;  3P8D A;  4J9I A;  1GXI E;  3M0S A;  2FRW A;  1U3O A;  4DEY A;  3Q1J A;  1Y71 A;  1YCY A;  2JUF A;  3WXM B;  2J6O A;  2KMT A;  1N5Z A;  3FC3 A;  2ZGW A;  1VQP T;  4F7U E;  1WYX A;  3M59 A;  4E7Z A;  1UGQ B;  1YIT A;  2J05 A;  3QII A;  3EFS A;  5J3B A;  4M7D E;  1FMK A;  1M2V B;  4DOV A;  3L2Z A;  1LJO A;  2OTJ A;  2B8A A;  3M5A A;  2A0F B;  1LCK A;  1VQK A;  2CZ0 B;  3CD6 A;  2YT6 A;  3OMG A;  1Q82 U;  3C0C A;  4ELZ C;  1NYF A;  5A0G A;  4HT9 A;  2K5I A;  1BK2 A;  4LDW A;  1UEC A;  3CCM Q;  3SWN A;  3CME A;  2XD0 A;  5KH6 A;  1VQ7 T;  1WI7 A;  3MEA A;  3M0Q A;  3NTI A;  3IQL A;  5GAO n;  2M9U A;  3MP6 A;  1YJ9 T;  4A53 A;  5A2Q E;  3VS6 A;  5GAM j;  4M75 C;  2E6Z A;  5FRN A;  2LDM A;  3H0H A;  4M78 E;  1OU8 A;  3OW2 P;  1VQM A;  1JJ2 S;  2RQU A;  4II1 A;  2MMP A;  1I4K 1;  3CBM A;  3I55 A;  1K73 U;  4QQG A;  3JCM f;  1MUZ A;  4PJO A;  4QKU A;  2MWP A;  3HHT B;  2OTL A;  2O4X B;  2C0I A;  1UB4 A;  1D1C A;  2YLB A;  2K9G A;  1TWB A;  2A7Y A;  2RQV A;  2DJZ A;  3ZBD A;  5GAN f;  2KNB B;  5C0M A;  1VQ8 Q;  1H8K A;  1Q86 C;  1VQ4 A;  2VGM A;  2C06 A;  1SF9 A;  1RAD B;  3UF4 A;  3G7Z A;  4AG2 C;  5I11 A;  1VQ5 T;  5FRO A;  1AWX A;  1LVK A;  4M77 A;  2OX7 A;  3QDR B;  2DVE A;  3DB4 A;  1A0N B;  1SEM A;  2HKQ B;  2FRY A;  3GOX A;  1Z9Z A;  1U1T A;  3LH5 A;  2F5K A;  3OYJ A;  4EIK A;  2HQE A;  4J9G A;  4CI0 C;  3V7S A;  3N5B B;  2ZCF B;  2LRQ A;  2COY A;  4BDY A;  2E6N A;  4DQ2 A;  2YSQ A;  4LDX A;  4M7A G;  5EC7 A;  4M75 D;  3X26 B;  1GCQ C;  3OYD A;  3EG1 A;  2V8I A;  3TCJ A;  5DLO A;  1Q82 R;  4M75 B;  2GFA A;  3VKI A;  3A8H B;  4ME7 A;  4IIO A;  2QTV A;  2DZ9 A;  3EG2 A;  2BTT A;  3EGX A;  3G71 Q;  5CR2 A;  5AT1 B;  3UPU A;  5GAO p;  1D3B B;  1MND A;  3H9N A;  2P4T A;  4F7U G;  1HSQ A;  3PMI A;  2W10 A;  2YUP A;  1WXT A;  3R6O A;  3TQ7 P;  4M7A A;  4M7D G;  2LCC A;  2A08 A;  3RDV A;  2IIM A;  2JTM A;  3HP9 A;  2H3E B;  3CCJ Q;  4JJB A;  2LTO A;  4OMM A;  2DD4 A;  4RG8 A;  2X4W A;  1X6G A;  1K73 R;  2IVW A;  3KFV A;  2DMO A;  4NS5 A;  1ZSZ A;  4OMO A;  1BIA A;  2E5K A;  4X9D A;  1U1S A;  1I1J A;  1TSF A;  1V1C A;  2EQJ A;  1H3Z A;  2JJ9 A;  3CC2 Q;  4C92 F;  5KCO A;  4Z02 A;  5KYN A;  1Q81 U;  2Y4X A;  1B34 B;  1Y96 B;  4R55 A;  3RR6 A;  2DD5 A;  3OW2 A;  3JRZ A;  5IHN A;  3THK A;  1ZBJ A;  5HK3 A;  2I2L A;  1T3L A;  4OB0 B;  7AT1 B;  3CMA T;  1OV3 A;  2O01 E;  1QKW A;  1VQ8 A;  2COZ A;  2HL5 C;  2HD0 A;  1Q7Y C;  1SSF A;  1VQN Q;  4KH1 B;  5I2M A;  1TUC A;  2DX1 A;  2KRO A;  2OAW A;  2Z0W A;  3DKM A;  2K5L A;  5CKE A;  2BKD N;  2M0O A;  2FZC B;  1RLP C;  3G6E T;  4MDX A;  2JM9 A;  4DBR A;  3JCM W;  5DY9 A;  2DE0 X;  1UDL A;  5D6W A;  1KG1 A;  1IGQ A;  2KI7 A;  1RI0 A;  2RA2 A;  5LJ5 d;  2JOY A;  2BE9 B;  3ZFJ A;  4M78 A;  3TRE A;  2QXF A;  1M5Q 1;  1K1Z A;  2QQA A;  3CCR T;  5CK9 A;  2LQ8 A;  3OYM A;  1FX7 A;  1JU5 C;  1BCO A;  3OMC A;  3PE0 A;  1BI0 A;  1ZUK A;  2QDY B;  3VS3 A;  4PFO A;  1FMV A;  4PJJ A;  5KYW A;  1JBM A;  3MKD A;  1IO6 A;  1AWO A;  2E5Q A;  4QVD A;  4ZTJ A;  4IUQ A;  1W2B S;  2YRC A;  2F5T X;  2HQX A;  1UGV A;  2RK2 A;  3A8O B;  1VQ7 A;  1WPY A;  2JT4 A;  2RQW A;  2LVM A;  1B07 A;  3OSV A;  1M90 U;  3LW5 E;  2DXC A;  4PJN A;  1YIT T;  2LX9 A;  3BDU A;  4XTY A;  1M1K C;  2HCK A;  4Z89 A;  1TTH B;  3OS5 A;  2CZ7 B;  2GQV A;  2OTJ T;  2MOX A;  4LUE A;  1VYT A;  1ARK A;  1AWJ A;  2KSS A;  1VQK T;  2VUB A;  3PIO A;  1GFC A;  2MAM A;  3CD6 T;  1RAA B;  4R56 A;  1SHF A;  2DEQ A;  3C12 A;  2JXB A;  2M02 A;  4R0K A;  1WA7 A;  4JPB W;  2VXE A;  1GFD A;  3KUF A;  1NLO C;  3L2R A;  2RJF A;  1OUL A;  3CME T;  3D7S B;  4FT2 A;  4F16 A;  4FU6 A;  3SWN B;  5HKC A;  1KQ1 A;  4OMF B;  2AHJ B;  2K57 A;  3I5R A;  2QEX Q;  3GF5 A;  2JZ2 A;  2L3P A;  2DER A;  4JRK A;  2PU9 B;  3FEO A;  1AD5 A;  1ZHI A;  4HCC A;  3CXC S;  1VQM T;  2M1H A;  3J7A F;  3JAM E;  3I55 T;  4JRQ A;  3MP8 A;  1WJQ A;  4PJO D;  1H64 1;  4O6J A;  1G2B A;  4JDS A;  2ZPI B;  1WQW A;  3SD4 A;  2OTL T;  4F17 A;  4PJO B;  1OPK A;  1VQN A;  2DA9 A;  1MGQ A;  3E2U A;  1I5L A;  2RPN A;  5KYY A;  1K4U S;  2XDD A;  4PFZ A;  4C8Q F;  2KRM A;  1PNJ A;  5CVI A;  1VQ4 T;  4M7A C;  3OYE A;  3V8J A;  2HAX A;  1IRX A;  1KSW A;  2DL8 A;  4AFS C;  2MF2 A;  2WAC A;  2RQT A;  3MET A;  3LH0 A;  5IHI A;  3MPU B;  4XK8 E;  3JCM d;  1KQS A;  3QPH A;  4C92 E;  3CCS A;  1YI2 Q;  1W70 A;  4MZM A;  1S72 Q;  1UE9 A;  5LJ3 h;  1KC8 C;  1YNZ A;  5GAN d;  3CC4 A;  3LYI A;  3LX7 A;  1RLQ C;  1KJW A;  4E7J A;  5CQY A;  1YWO A;  3ULR B;  3QZ9 B;  1FYN A;  4DBH A;  1WXB A;  3VV0 A;  4M7D C;  1U5S A;  1M90 R;  2H8H A;  1VQL Q;  9ATC B;  3CBP A;  1X2Q A;  2RM4 A;  2XG8 D;  3UA7 A;  1B3Q A;  1I5O B;  5FWC A;  3CCE A;  2OAU A;  4HA8 A;  1Y57 A;  2JW4 A;  2MIO A;  3S3O A;  3AHU A;  1CKA A;  1SG5 A;  1YFN A;  1IB8 A;  2X4Y A;  2YRV A;  2LJ1 A;  1NYG A;  2RHU A;  1NJI U;  1WJS A;  3VUB A;  2GBQ A;  3OBW A;  2EYQ A;  1BI2 A;  1OI1 A;  4J9B A;  3EGX B;  5GAN 6;  2J6K A;  2DXT A;  3FLG A;  3HPW A;  5GAN 3;  3KBG A;  1QWF A;  3FB9 A;  1QMC A;  1AVZ C;  1PD1 A;  2LC4 A;  2CP6 A;  4AT1 B;  4M7A D;  1WZO A;  1JXO A;  3VS0 A;  2QAS A;  1SHG A;  4FYY B;  4JJC A;  2AKL A;  2DO3 A;  5CKB A;  2L3Q A;  1WHG A;  3GIB A;  4M7A B;  3OQ5 A;  2DVJ A;  1MMA A;  2XU8 A;  5KYX A;  4BI4 A;  2K79 A;  5L23 A;  1GCQ A;  2GQI A;  4J9E A;  2VYT A;  4ANJ A;  3EAE A;  5LJ5 e;  4KRT A;  1IXD A;  1M9S A;  2HZY A;  1ZSZ B;  3DLM A;  3SB2 A;  3PVQ A;  3V7R A;  1ZBX A;  2MK5 A;  2RHI A;  1YJN Q;  2I0N A;  4M7D D;  4ZGJ B;  1G5V A;  1QWE A;  2YUN A;  5GAM h;  5FU6 B;  2QI2 A;  3HKS A;  3GLX A;  4HT8 A;  2HBP A;  3OS1 A;  3QWX X;  1YHQ Q;  1NLP C;  3H0I A;  4MML A;  2O88 A;  5IN1 A;  4OMQ A;  1VQ8 T;  1UEB A;  4OVA A;  4N0A A;  3NTH A;  2HBW A;  2LQN A;  3BFM A;  5GMK j;  4EDU A;  3OSS C;  3VS7 A;  2EQI A;  5GAO r;  3GNF B;  2H3J A;  5GAN 2;  3HFO A;  1UHF A;  2FL7 A;  1PSF A;  2NUZ A;  2EBP A;  2SRC A;  2V8K A;  1YI2 A;  3CCV Q;  2DM1 A;  1AWW A;  1S72 A;  3HRS A;  3CCQ Q;  1VIE A;  1VQ9 A;  1D1A A;  2EFI A;  1TOV A;  2ZAE A;  2GNC A;  4M78 D;  1QVG P;  2M0Y A;  4EMK C;  2LQK A;  4PFP A;  2GGR A;  4C92 G;  2NUT A;  4VUB A;  2IPO B;  4M78 B;  3RKW A;  3G4S A;  1FXX A;  1KIK A;  4DEX A;  4LXC A;  4JS4 A;  1NJI R;  2DK3 A;  4C8Q E;  4KGZ B;  3V8L A;  4IUT A;  2SEM A;  4JLI A;  1GL5 A;  1GBQ A;  2JMA A;  3H41 A;  5KYW B;  1IGU A;  3P8H A;  3QYG B;  3S3M A;  3M0P A;  3X28 B;  3QO3 A;  4BD3 A;  1C0M A;  4C0D C;  5LJ5 g;  2LNH B;  1VQ6 A;  4IIM A;  4KT0 E;  2QA4 Q;  2C0T A;  2EJ9 A;  2CT4 A;  1AT1 B;  2AK5 A;  3OYL A;  2E41 A;  2LJ0 A;  3ME9 A;  1WQ7 A;  2PNI A;  1JEG A;  1WLP B;  2LT4 A;  1GRI A;  2DBK A;  4IKF A;  2QQ9 A;  1KD1 C;  4N4I A;  2J6F A;  4LE9 A;  1Q86 U;  1OPL A;  3CCL Q;  1YJW Q;  2ZZD A;  3FJ5 A;  3M54 A;  4CRI A;  1MV3 A;  1OQK A;  1T0J A;  3AT1 B;  4ZNX A;  1K8A R;  3JCM e;  3OYY A;  3RIR A;  1XTD A;  1F1B B;  2DAQ A;  1P92 A;  4PKC C;  3UWN A;  1K0S A;  5C6S A;  1BCM A;  3PTA A;  5GAN e;  2LJ3 A;  1T3S A;  2LX7 A;  5CKF A;  1G8X A;  4QVZ A;  3NFC A;  1YJN A;  1VYV A;  1X43 A;  4PK4 A;  1CKB A;  5KE3 A;  1X27 A;  1R0C B;  2QQS A;  3CC7 Q;  2JTF A;  2JS2 A;  3JCM b;  3I56 Q;  2X4J A;  4OGE A;  3E19 A;  5DLQ E;  1PSE A;  1BB9 A;  3BE3 A;  1VQN T;  2DTI A;  1M27 C;  2BZX A;  1V29 B;  3S6W A;  5GMK m;  5KYY B;  2CP5 A;  1KQ2 A;  4C0D B;  1VQP Q;  2RNA A;  1ACM B;  1I07 A;  2PTK A;  2PVO B;  1JB0 E;  1QCF A;  3CCS T;  1AZE A;  2V8J A;  1NE8 A;  2J7I A;  3X20 B;  2XK0 A;  1M3A A;  1JXM A;  4CC3 A;  2JS0 A;  3QG1 A;  2RI3 A;  5GAN 8;  2HDA A;  3MEU A;  3CC4 T;  3L42 A;  4FT4 A;  3LLR A;  4FYW B;  1QVG A;  4XTX A;  3OYB A;  5M9O A;  1ZQ1 A;  2ZPE B;  5LJ5 j;  2NYS A;  3EGD A;  1QVF S;  5GJW B;  4J9H A;  4HVW A;  2CS7 A;  2HMA A;  4BI8 B;  2RQR A;  4IUU A;  3CCE T;  2COW A;  2NLU A;  4XTU A;  3CCM A;  2MYS A;  4N0A C;  2F2X A;  2D0Q B;  4C8Q G;  2NWM A;  3RER A;  1T0H A;  2D1X A;  3JCM g;  3LWH A;  4NL2 A;  5KE2 A;  4MDW A;  4BAC A;  2XID A;  2AZS A;  2CYZ B;  5HK0 A;  4F7U A;  5GAN g;  2QQR A;  4QT7 A;  4A54 A;  5FU7 C;  3M55 A;  2PVG B;  3F70 A;  2EGA A;  3MEV A;  4M7D A;  4J9F A;  3SDZ A;  1Q7Y U;  4J7F A;  2FPE A;  1BI3 A;  3EG0 A;  2XMF A;  1G3W A;  5IAY A;  3X24 B;  5GAO m;  3ASK A;  5IXF A;  2KBT A;  2FZG B;  3A98 A;  4RG2 A;  1M2O A;  3REB B;  4A4H A;  3RES A;  1VQ5 Q;  3VS5 A;  1JRI A;  1QLY A;  2JMC A;  2HSP A;  5KYX B;  4AFQ C;  2E3I A;  5D6Y A;  3FDR A;  3S3N A;  2EVR A;  3CPF A;  2XDB A;  2DL5 A;  4JZ4 A;  3J80 E;  3H6Z A;  1X75 C;  2KYM A;  2PUK B;  4GY5 A;  4IUP A;  3CPW S;  3CC7 A;  3HSB A;  1I81 A;  4X1V A;  2KEA A;  4PJO F;  2A3L A;  3V8K A;  3QUI A;  4C92 C;  2G6F X;  2YDL A;  1EX4 A;  1W2B P;  3VRY A;  3PMT A;  2MWO A;  2KGT A;  1RAB B;  2RD1 A;  1J3T A;  1RL2 A;  1Y7X A;  3BDL A;  2QAZ A;  4CC7 A;  1YWP A;  1Y0M A;  2A36 A;  2C0O A;  4MMK A;  2DF6 A;  4C5H A;  4AFZ C;  3JB9 I;  2V1Q A;  2L3S A;  2G3R A;  3NPF A;  3MP1 A;  1I8F A;  1Y07 A;  3CBO A;  4DA4 A;  1E6H A;  4YTL A;  5GJV B;  1EZZ B;  4M77 F;  4EMH A;  5ECA A;  2X9H A;  4C0Z A;  1YI2 T;  3NHN A;  1M1K U;  1S72 T;  3VS1 A;  5LJ3 f;  2K7A A;  3QYH B;  3PVL A;  1VQ9 T;  4L5G A;  4DBQ A;  1KQS S;  5D6X A;  3G71 A;  4N4G A;  1LOJ A;  2ROT A;  4HCK A;  5A0D A;  3G4S T;  5GMK e;  3VRZ A;  2R58 A;  2CUD A;  1EFN A;  2NUT B;  3RBB B;  4AG1 C;  2B86 A;  4J9C A;  5GAN j;  2GTO A;  1PRM C;  2L8D A;  1M30 A;  1R77 A;  1HK9 A;  2EQU A;  4QVC A;  3FIF A;  1Q81 R;  3EFO A;  2CSQ A;  1NBE B;  3CCJ A;  2FPD A;  1K9M C;  3RMQ A;  1Q7Y R;  3GPL A;  1VUB A;  4BB7 A;  1TU0 B;  3U23 A;  6AT1 B;  1PKS A;  1QCN A;  2X51 A;  3EGU A;  4C92 D;  1D1B A;  4C5G A;  3TSW A;  2DL4 A;  1W6X A;  2D9T A;  4EMK A;  3CC2 A;  1VQ6 T;  5D7U A;  1VQO Q;  2DIQ A;  1M3C A;  4XAX B;  2MI6 A;  1G3S A;  2EIF A;  1G83 A;  2VWF A;  2EAY A;  5AYF A;  1NEB A;  2EYY A;  3A8L B;  4BE2 A;  3C4S A;  4PL6 A;  2E12 A;  3A8M B;  2D0N A;  1MMD A;  3BW1 A;  4XU1 A;  4RCB A;  1BU1 A;  1YN8 A;  4LD9 K;  1XNI A;  1UG1 A;  1X2K A;  3G6E Q;  2DKG A;  1WFW A;  3DLL A;  2EJG A;  4XTZ A;  1S1N A;  1WXU A;  5A0L A;  4N4H A;  3KXT A;  2AZV A;  4M75 G;  3JCM X;  1X6O A;  4P5N A;  1KC8 U;  3EH2 A;  2PQW A;  1U8R A;  4QW2 A;  3UT1 A;  3CCU Q;  1LPL A;  1YJN T;  4XU0 A;  5GAM f;  1HD3 A;  2F2V A;  3VS4 A;  4JLG A;  1N8R C;  2AT1 B;  3CCR Q;  2WSF E;  2ZPB B;  4C5E A;  1W2B A;  2CP2 A;  2CZ6 B;  5FRM A;  1OX8 A;  2KT8 A;  3SFM A;  2P0Q A;  2E10 A;  3JB9 F;  2CGH A;  4HVU A;  4HVV A;  5IH2 A;  5GMK h;  2ZPH B;  3SHW A;  1D09 B;  3OYI A;  4C8Q C;  4B9W A;  1WDX A;  2ESW A;  4OB3 B;  4WF2 A;  3I5S A;  3TU4 K;  1WJR A;  1YIT Q;  3OBY A;  3HL8 A;  1ZUU A;  4PJO E;  3M4G A;  1QW1 A;  2LQW A;  2P4R A;  4LN2 A;  1NG2 A;  2E4H A;  2OTJ Q;  1TUD A;  3PIP A;  5GMK i;  1VQK Q;  1QP3 A;  4E7L A;  3GBQ A;  3CD6 Q;  2RJD A;  3I35 A;  4FYV B;  1UJ0 A;  4AFU C;  3M53 A;  3MJX A;  1PWT A;  5GAN 4;  1AZG B;  1NEG A;  3EGD B;  4RTT A;  5DM7 R;  4ZGE B;  3OYG A;  3CME Q;  3BY7 A;  3E9G A;  3EHR A;  4E2F B;  1BKB A;  1PCX A;  1B7T A;  3VU3 C;  2VXF A;  1OYX A;  3CCM T;  3QSU A;  2BIV A;  2XDP A;  4M77 E;  1G3T A;  2P0K A;  2CT3 A;  3H8Z A;  2X3X D;  2DFU A;  1QVP A;  2RF0 A;  3OYK A;  3NMZ C;  5IHK A;  1VQO A;  2QEX A;  1W4S A;  3JV3 A;  1VQM Q;  2RI5 A;  2Y4Y A;  4J6X A;  3I55 Q;  5LL6 S;  3ZEH A;  1WIE A;  1WX6 A;  1JO8 A;  3RUX A;  2HEQ A;  5CCA A;  4IUR A;  4Z8A A;  4KGX B;  2OTL Q;  2YXY A;  4F7U B;  4QQ6 A;  2YLC A;  1TXQ A;  3ZL7 C;  4B6M A;  1GBR A;  5HY6 A;  5CAI A;  1UGS B;  5GAN 5;  2CP0 A;  4M7D B;  4C0F A;  2RI2 A;  4ORZ A;  2DL7 A;  1OZ3 A;  5J39 A;  2AIR B;  4FL6 A;  2D6F A;  2R5M A;  1MMN A;  3C94 A;  2JN0 A;  2KXC A;  3QJ6 A;  1BI1 A;  4V2S A;  2EPD A;  4J5Y A;  3CCU A;  3OYH A;  4JS5 A;  1BBZ A;  1OEB A;  4NL3 A;  3WVE B;  2EJF A;  4NOY A;  4CC2 A;  3EG3 A;  3CC7 T;  4HCZ A;  2DRM A;  1M3B A;  1K8A C;  3OA6 A;  8AT1 B;  3FJP A;  2JVV A;  3RNJ A;  2CUB A;  1M4Z A;  2DYB A;  4ZGD B;  1WHL A;  2X4X A;  4Y92 A;  5KYU A;  3QKJ A;  4PJL A;  2K2M A;  1PD0 A;  1VQL A;  4DBF A;  5CKH A;  4LDU A;  4RKU E;  2LCL A;  4Y91 A;  1QKX A;  2EQM A;  3UA6 A;  1JJ2 P;  4RTW A;  2ED1 A;  2DTH A;  4M75 F;  2L89 A;  3L2U A;  4XTV A;  4OP0 A;  2KDS A;  2VB6 A;  5I22 A;  3INZ A;  2DEU A;  3EHQ A;  4LUD A;  4KH0 B;  2KVQ G;  3QXE B;  4C92 A;  2O9S A;  1WGS A;  2O9V A;  4J9D A;  3G71 T;  1K9A A;  1KD1 U;  2HKN A;  2YHT A;  3JCM c;  4OMP A;  4PJO G;  3QBY A;  1RAG B;  2R57 A;  4X34 A;  1QVG S;  5LJ5 h;  2OJ2 A;  5GMK l;  2K4Y A;  1WHM A;  1SSH A;  2EYZ A;  3M4Y A;  4ZTF A;  1WHK A;  2PZ1 A;  1Q82 C;  1E6G A;  5LJ3 d;  2RK1 A;  4JJN K;  3QZ5 B;  3CCJ T;  2DXU A;  2HNI A;  2VVK A;  3EFO B;  5I21 A;  3P8B B;  1XOV A;  4RMO A;  5IXB A;  1DJ7 B;  3O5Z A;  2O31 A;  1HXD A;  4RTX A;  2CP7 A;  1YIJ Q;  3O8V A;  3JCM P;  2CDT A;  4M77 G;  3CC2 T;  1QCO A;  2FYK A;  4RCC A;  2DLP A;  4CC4 B;  3OYN A;  3I9Q A;  4EMK B;  3NGP A;  1RAC B;  3JCM Q;  3T9N A;  1FWZ A;  4M4Z A;  1K73 C;  3QJY A;  1YHQ A;  1TG0 A;  3CQT A;  2R5A A;  1TUG B;  2ENM A;  5CKD A;  3G1J A;  4X9C A;  3OW2 S;  3EG9 A;  4FW1 A;  1LNX A;  2EWN A;  3VYG A;  2VV5 A;  2CRE A;  1QVF P;  2EGC A;  2QGF B;  2DIG A;  2YUQ A;  1NZ9 A;  1NPP A;  2QTX A;  3CCV A;  2LP5 A;  3CCQ A;  3MCA B;  2YWW A;  1RAI B;  2K6D A;  3GP8 A;  4ZN3 A;  1UGP B;  3REA B;  2XIC A;  3TEE A;  4XU2 A;  4D8K A;  1NPR A;  2KE9 A;  2RMO A;  2ZPG B;  5GAO l;  1C6V X;  5FLX E;  2HSE B;  2GCX A;  3R6N A;  3VUZ A;  1KD1 R;  1PG5 B;  1SPK A;  1KHC A;  2L0A A;  1ZSG A;  2RJC A;  4E7K A;  5GAM d;  3JSC A;  4KUL A;  3L2W A;  3CEY A;  2LT1 A;  1VQ7 Q;  8ATC B;  1NM7 A;  2F2W A;  3QDF A;  1E7O A;  1VOM A;  2M16 A;  4FYX B;  3PT9 A;  3OYC A;  2CH4 A;  3E1S A;  2HQH A;  1K0X A;  1X69 A;  1JJ2 A;  4OGC A;  1ZA2 B;  4BDZ A;  3M58 A;  2FG0 A;  1JQQ A;  1YJ9 Q;  1Q86 R;  2GTJ A;  1GCP A;  1MNE A;  1ZUY A; 
#chains in the Genus database with same CATH homology
 2ROL A;  2FPD A;  2J6K A;  4ESR A;  1WI7 A;  1QWF A;  1VA7 A;  3M0Q A;  1MV0 B;  3IQL A;  2CH4 W;  3U23 A;  1PKS A;  1AVZ C;  3EGU A;  1JXO A;  3VS0 A;  1SHG A;  3TSW A;  3VS6 A;  2DL4 A;  4JJC A;  1W6X A;  2AKL A;  2L3Q A;  1UJY A;  2DVJ A;  3H0H A;  1PHT A;  2RQU A;  1M3C A;  2K79 A;  5L23 A;  1GCQ A;  2GQI A;  4J9E A;  1MUZ A;  2LZ6 B;  1G83 A;  2VWF A;  4RTV A;  4KRT A;  1NEB A;  2C0I A;  2EYY A;  3TVT A;  2K9G A;  3PVQ A;  2RQV A;  4GBQ A;  2KNB B;  2D8H A;  2D0N A;  1H8K A;  2I0N A;  2V1R A;  2KRN A;  1BU1 A;  1AOJ A;  1QWE A;  1YN8 A;  2YUN A;  1UG1 A;  1X2K A;  1WFW A;  1S1N A;  1WXU A;  3UF4 A;  4AG2 C;  1M8M A;  5I11 A;  2A28 A;  1AWX A;  3QWX X;  2AZV A;  1NLP C;  3H0I A;  2O88 A;  4OMQ A;  1A0N B;  2HBW A;  1SEM A;  2LQN A;  2DJQ A;  1HD3 A;  2F2V A;  3VS4 A;  3VS7 A;  2EQI A;  4K11 A;  2FRY A;  1Z9Z A;  4RTY A;  1UHF A;  3LH5 A;  2NUZ A;  2EBP A;  2K3B A;  4EIK A;  4J9G A;  2SRC A;  2DM1 A;  1AWW A;  2X3W D;  2KT8 A;  3H0F A;  2GNC A;  4E6R A;  2M0Y A;  2YSQ A;  1ZLM A;  4HVU A;  2GGR A;  4HVV A;  1W1F A;  4D8D A;  5IH2 A;  2FO0 A;  2CSI A;  5EC7 A;  3SHW A;  1GCQ C;  3EG1 A;  1WDX A;  2ESW A;  2RN8 A;  1KIK A;  3VS2 A;  3I5S A;  1Z9Q A;  1U06 A;  2BZ8 A;  4DEX A;  2DBM A;  5FW9 A;  1HJD A;  1KFZ A;  4HXJ A;  4IIO A;  3EG2 A;  2BTT A;  3QWY A;  1ZUU A;  2LQW A;  2P4R A;  2SEM A;  4LN2 A;  1NG2 A;  1GL5 A;  2KT1 A;  1TUD A;  1GBQ A;  1H3H A;  1HSQ A;  2JMA A;  5HCK A;  2W10 A;  3H41 A;  3GBQ A;  3I35 A;  2YUP A;  1UJ0 A;  4AFU C;  1OOT A;  1WXT A;  3M0P A;  1PWT A;  2FEI A;  2A08 A;  1AZG B;  1NEG A;  1YP5 A;  4RTT A;  2IIM A;  2ED0 A;  2LNH B;  4IIM A;  1YCS B;  3EHR A;  4JJB A;  4OMM A;  1X6G A;  2C0T A;  2CT4 A;  2AK5 A;  3KFV A;  2DMO A;  2LJ0 A;  1H92 A;  4OMO A;  2PNI A;  1JEG A;  1WLP B;  2CT3 A;  1GRI A;  2DBK A;  2E5K A;  2EGE A;  1I1J A;  2X3X D;  2J6F A;  1V1C A;  4LE9 A;  1OPL A;  2RF0 A;  3NMZ C;  5IHK A;  2DL3 A;  3JV3 A;  3FJ5 A;  2EYX A;  3SEM A;  1CSK A;  1MV3 A;  1T0J A;  1WIE A;  1WX6 A;  4ZNX A;  1JO8 A;  1RUW A;  1PRL C;  2HEQ A;  4Z8A A;  2W0Z A;  4OML A;  5IHN A;  3THK A;  1ZBJ A;  1T3L A;  3ZL7 C;  1PKT A;  1GBR A;  1K0S A;  1OV3 A;  1ABQ A;  2LJ3 A;  1QKW A;  1T3S A;  2LX7 A;  4ORZ A;  2DL7 A;  1VYV A;  1ZX6 A;  2EKH A;  1X43 A;  1CKB A;  1X27 A;  4RTU A;  1TUC A;  2DX1 A;  2KRO A;  2OAW A;  2JS2 A;  2KXC A;  1RLP C;  4GLM A;  2JM9 A;  2EPD A;  2DE0 X;  1UDL A;  2DIL A;  1BB9 A;  1BBZ A;  2AKK A;  2YUO A;  1OEB A;  1M27 C;  2BZX A;  4CC2 A;  3EG3 A;  2KRS A;  2DRM A;  1M3B A;  1AEY A;  1K1Z A;  1VYU A;  2EW3 A;  3RNJ A;  2DRK A;  2CUB A;  2RNA A;  2DYB A;  1I07 A;  2PTK A;  2O2O A;  1JU5 C;  2EYW A;  1AZE A;  1QCF A;  3PE0 A;  1K76 A;  4Y92 A;  2J7I A;  1ZUK A;  3TSZ A;  2K2M A;  1M3A A;  1JXM A;  4CC3 A;  3VS3 A;  2DNU A;  2JS0 A;  2HDA A;  1QKX A;  1IO6 A;  1AWO A;  3UA6 A;  4RTW A;  2ED1 A;  2LMJ A;  4WCI A;  1UGV A;  5GJW B;  2D8J A;  4J9H A;  4HVW A;  4JZ3 A;  2JT4 A;  2KXD A;  2RQW A;  1B07 A;  2QDL A;  5I22 A;  3EHQ A;  4LUD A;  2OI3 A;  2MCN A;  2RQR A;  4Z88 A;  2O9S A;  2O9V A;  2HCK A;  1UFF A;  2J06 A;  4J9D A;  4Z89 A;  4A63 B;  1K9A A;  1ABO A;  2F2X A;  2KYB A;  2MOX A;  4OMP A;  4LUE A;  1VYT A;  1ARK A;  1AWJ A;  1SRM A;  2NWM A;  2KR3 A;  1T0H A;  4RTZ A;  2D1X A;  4OMN A;  1GFC A;  1I0C A;  5FWB A;  2ABL A;  2OJ2 A;  1SRL A;  1SHF A;  2JXB A;  1SSH A;  2EYZ A;  4R0K A;  1WA7 A;  2AZS A;  2PZ1 A;  4FSS A;  3UAT A;  4JPB W;  1GFD A;  1E6G A;  1NLO C;  4QT7 A;  4F16 A;  2A37 A;  2EGA A;  2VVK A;  1XOV A;  5IXB A;  4J9F A;  1UUE A;  4F14 A;  3O5Z A;  2FPE A;  2BZY A;  3I5R A;  3EG0 A;  2JTE A;  2O31 A;  2L3P A;  2XMF A;  4RTX A;  3M0T A;  2FPF A;  2CDT A;  1AD5 A;  5IXF A;  1UHC A;  2KBT A;  2DLP A;  3A98 A;  2ECZ A;  2LCS A;  3REB B;  4CC4 B;  3I9Q A;  2M51 A;  3NGP A;  3VS5 A;  1QLY A;  2L2P A;  2JMC A;  2HSP A;  4AFQ C;  1G2B A;  4M4Z A;  4F17 A;  1X6B A;  2EVR A;  2DL5 A;  4JZ4 A;  1OPK A;  2KYM A;  2DA9 A;  3M0R A;  1TG0 A;  3CQT A;  2RPN A;  1K4U S;  2ENM A;  4JJD A;  4X1V A;  2KEA A;  2KRM A;  1PNJ A;  2G6F X;  2YDL A;  2VKN A;  1KSW A;  3M0U A;  3VRY A;  2DL8 A;  4AFS C;  2CRE A;  1UTI A;  2EGC A;  2KGT A;  2RQT A;  2YUQ A;  4LNP A;  5IHI A;  1J3T A;  1W70 A;  2JM8 A;  4CC7 A;  1YWP A;  1Y0M A;  2A36 A;  4RUG A;  2C0O A;  2LP5 A;  1UE9 A;  2DF6 A;  4AFZ C;  1RI9 A;  2V1Q A;  1YNZ A;  2L3S A;  2K6D A;  4J9I A;  3NPF A;  3REA B;  3M0S A;  2FRW A;  1RLQ C;  1U3O A;  1KJW A;  4DEY A;  4D8K A;  1E6H A;  1YWO A;  5GJV B;  3ULR B;  2KE9 A;  5ECA A;  1FYN A;  1WXB A;  2RMO A;  2J6O A;  1U5S A;  1N5Z A;  3NHN A;  2H8H A;  3VS1 A;  1WYX A;  2K7A A;  1X2Q A;  2J05 A;  3PVL A;  3UA7 A;  1B3Q A;  5FWC A;  3R6N A;  1Y57 A;  1SPK A;  2L0A A;  1FMK A;  1ZSG A;  2JW4 A;  2MIO A;  2ROT A;  4HCK A;  1CKA A;  3VRZ A;  1LCK A;  2CUD A;  1EFN A;  1NM7 A;  2F2W A;  3RBB B;  1E7O A;  4AG1 C;  2CH4 A;  1K0X A;  2YT6 A;  2B86 A;  1NYG A;  1X69 A;  2LJ1 A;  4J9C A;  2GTO A;  3C0C A;  1NYF A;  1PRM C;  1BK2 A;  1M30 A;  1JQQ A;  2FG0 A;  2GTJ A;  1UEC A;  2GBQ A;  4J9B A;  1GCP A;  2CSQ A;  1ZUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...