3EG2A

Crystal structure of the n114q mutant of abl-sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 14
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg2A00
3M0UA 2DX1A 2KR3A 1JO8A 1BU1A 2KRMA 2NWMA 1OV3A 1X6BA 3PVLA 1PKSA 1M8MA 2A08A 2EQIA 3EG3A 2ED1A 5FWCA 2O9SA 2O2OA 2KYBA 4E6RA 1QCFA 2MCNA 3FJ5A 2LX7A 4M4ZA 2M0YA 2MOXA 3VS2A 1HD3A 4R0KA 1W1FA 3H0HA 2JXBA 1GL5A 2J06A 3NPFA 2SRCA 2L0AA 4DEXA 4GBQA 1I0CA 2RQVA 1T3SA 2GTJA 1PNJA 1B07A 4OMQA 2J6OA 2YUPA 1ABOA 2GQIA 1M3AA 1BK2A 4F14A 2C0IA 2BZYA 4ZNXA 1ARKA 2L2PA 4GLMA 3EGUA 3LH5A 2CSQA 1PRLC 2J6KA 2HBWA 3VS6A 1ZBJA 2DF6A 1GFDA 2RQWA 4ORZA 5I11A 4F16A 1KSWA 2ABLA 1E6GA 3NMZC 2DL7A 1NM7A 2DYBA 2KNBB 1B3QA 4IIOA 2XMFA 2HCKA 4JZ4A 4J9HA 1KJWA 2KRNA 2EYWA 3PE0A 2LP5A 1RUWA 1Y0MA 5GJVB 1X27A 2ECZA 3NGPA 4K11A 3H0FA 2LNHB 3TVTA 4AFUC 1WXBA 1AOJA 1UUEA 1TUCA 2L3QA 4J9GA 1AWOA 2A28A 2KEAA 3I9QA 1PHTA 3VS0A 1ABQA 1AZEA 2KT8A 2KGTA 4CC2A 3M0SA 1ZSGA 4LNPA 4J9IA 1X2QA 1QLYA 2CUDA 1K9AA 2H8HA 2YUNA 1RLQC 1PKTA 1K0SA 4ESRA 4Z88A 2JW4A 1JXOA 1GCQA 4OMOA 2EGAA 2KT1A 1I07A 2HSPA 1SHFA 2FO0A 3A98A 3UATA 2LQWA 1H92A 4DEYA 2K7AA 2CT3A 1U5SA 2RQTA 2W10A 1SEMA 3SHWA 4J9FA 2K2MA 1PRMC 2FEIA 2DA9A 1T0JA 2O9VA 2VVKA 2C0TA 4QT7A 1HSQA 3I35A 2CSIA 1FMKA 2RPNA 1BBZA 4HCKA 2YUQA 1GCQC 2GTOA 3C0CA 4JJBA 3VRYA 1Z9QA 1UE9A 3M0PA 4LUDA 1NYGA 2JMCA 4LUEA 1ZX6A 2DL8A 3REBB 3UF4A 1UJ0A 1QKXA 1AWJA 3REAB 1GCPA 2LJ0A 1GRIA 1W70A 1FYNA 2DL4A 1H8KA 4RTTA 1VYUA 1MV0B 1UTIA 4RTVA 2OI3A 2AZVA 2LQNA 2EYXA 1V1CA 1KFZA 5I22A 2VWFA 2HEQA 2X3XD 1H3HA 2RF0A 3QWYA 2KXDA 3THKA 2RQUA 4J9CA 1Z9ZA 2JTEA 2DE0X 2EW3A 2FPEA 1K1ZA 4HXJA 1UDLA 2I0NA 1LCKA 1M27C 1SHGA 2RN8A 1X6GA 1UFFA 1AD5A 4Y92A 2FPDA 1YNZA 1IO6A 2RMOA 2AKKA 2J6FA 1WA7A 2LJ3A 2CH4W 2ROTA 2K9GA 2SEMA 2A36A 2JM9A 1YWOA 1WFWA 1AZGB 2YT6A 1WYXA 2EKHA 2GBQA 3RBBB 1MV3A 2RQRA 1NLOC 2YDLA 1WDXA 1WXUA 3EG0A 4KRTA 3ZL7C 1VYVA 1N5ZA 2CT4A 2DRKA 2EPDA 1WI7A 5IHKA 1NG2A 1AWXA 4FSSA 2EYYA 2PNIA 4RUGA 1I1JA 1WLPB 2EVRA 1NYFA 4RTUA 2DBMA 1UHFA 1PWTA 2DJQA 1GBRA 1E6HA 2KRSA 4CC3A 2BZXA 3R6NA 4JZ3A 2JT4A 4RTXA 1K4US 1K76A 3EHRA 4RTWA 2FRYA 4JJCA 1UGVA 1ZUYA 3TSZA 3IQLA 5FWBA 2DLPA 2LCSA 2CUBA 3M0RA 2ESWA 2E5KA 3GBQA 1UJYA 2D1XA 2GGRA 2CREA 4D8DA 2AKLA 4X1VA 1BB9A 2FG0A 3VS1A 2KYMA 2LJ1A 2OJ2A 1QWFA 3CQTA 2V1QA 3VS3A 2PTKA 2EBPA 1G2BA 3VS4A 2LMJA 1YCSB 2YUOA 4HVWA 1CKBA 4IIMA 1X2KA 1GBQA 1ZLMA 4OMPA 4CC7A 2B86A 2D8HA 3EHQA 2A37A 1SRLA 5GJWB 1NEGA 3O5ZA 4RTZA 2MIOA 4AG2C 1RI9A 2QDLA 3M0QA 2F2WA 2JS0A 4AG1C 1E7OA 2D8JA 4JJDA 1JQQA 3H0IA 3M0TA 4CC4B 2BZ8A 2J05A 5ECAA 2KXCA 4AFZC 1CSKA 1VA7A 1UHCA 1T3LA 2BTTA 1Y57A 3NHNA 4J9BA 1UECA 2DBKA 4F17A 2KBTA 3U23A 1OPLA 5IHIA 2OAWA 2G6FX 4LE9A 1M30A 2K79A 1JXMA 2ED0A 4RTYA 2AZSA 2DL5A 2P4RA 5IH2A 4AFSC 5HCKA 2DILA 3UA7A 1AVZC 2DVJA 4LN2A 2DNUA 2DL3A 2NUZA 1NLPC 4HVUA 4J9DA 5L23A 4WCIA 3I5SA 2KE9A 4AFQC 2C0OA 5FW9A 1A0NB 1K0XA 1AWWA 1SSHA 2DRMA 1OEBA 1SRMA 1M3CA 3VRZA 1M3BA 2F2XA 1HJDA 2HDAA 4A63B 1VYTA 4EIKA 2ROLA 1SPKA 2GNCA 3UA6A 2EYZA 1G83A 3I5RA 2DMOA 2O31A 1WX6A 1UG1A 1T0HA 3PVQA 3VS5A 2CH4A 1ZUKA 2ENMA 2K6DA 2X3WD 3VS7A 1XOVA 2L3SA 4OMMA 3JV3A 3EG2A 1KIKA 2W0ZA 3QWXX 1TUDA 1U06A 3KFVA 4JPBW 1TG0A 1X69A 2FRWA 4Z8AA 5IXBA 4OMLA 1OPKA 5EC7A 2K3BA 3TSWA 2O88A 1OOTA 2CDTA 4HVVA 1YWPA 1CKAA 4OMNA 2V1RA 1EFNA 1WXTA 1JU5C 2PZ1A 2JM8A 2RNAA 5IXFA 2F2VA 4Z89A 1U3OA 3H41A 3SEMA 2JS2A 2VKNA 5IHNA 2JMAA 3ULRB 2LZ6B 1YN8A 1GFCA 2M51A 2J7IA 2L3PA 1S1NA 2AK5A 1AEYA 2KROA 4D8KA 1QKWA 1WIEA 2DM1A 1W6XA 2IIMA 1QWEA 2EGCA 1ZUUA 3EG1A 1RLPC 2YSQA 1X43A 1YP5A 1JEGA 1MUZA 4J9EA 2FPFA 1NEBA 3RNJA 1J3TA 2EGEA 2D0NA
chains in the Genus database with same CATH superfamily
3M0UA 3EGXB 2EJFA 3I56Q 3CMAT 2RD1A 1N9RA 2XG8D 3OS2A 3VYGA 1X6BA 5KYXA 2OAUA 3JB9D 5LJ5d 1K9MR 4AT1B 1NE8A 2VASA 4IURA 3MP8A 4BI8B 1BCOA 1HD3A 3INZA 2FZKB 3QG1A 1ZA1B 4PFOA 4M77G 2SRCA 2ZZDA 1Q86C 2L89A 2GTJA 3V7SA 3HFNA 2KQWA 4FYWB 2R57A 2J6OA 2YUPA 2GQIA 1EX4A 4J6XA 1AT1B 2BZYA 1VQNQ 2ZCFB 2L2PA 2PVOB 4IUQA 3EGUA 2K3YA 3LH5A 2GFUA 1PRLC 2J6KA 3HKSA 1M5Q1 2HBWA 3LYIA 2ZPHB 2DF6A 4BDYA 5LJ3e 1X75C 5DM7R 1RABB 1Y7XA 4M78B 5I11A 1K9MU 3RMSA 2H3JA 3ER0A 2ABLA 1BCMA 2YRDA 3NMZC 3MJXA 2RJDA 2XMFA 2HCKA 4J9HA 1OX8A 5DY9A 2QASA 2BKDN 3CMEA 2LP5A 2PQWA 4M7DB 1RUWA 3M59A 2LCLA 2Y4YA 4HKEA 5LJ5h 1I8FA 1QMCA 2ECZA 4QQDA 1TU0B 4K11A 2LNHB 3TVTA 3EGDA 5GANf 5D6YA 2RK1A 1UUEA 2L3QA 3EAEA 3EGXA 1AWOA 1IHVA 2A28A 2KEAA 2X9HA 3OYJA 3QKJA 1ABQA 1O75A 4NL2A 4CC2A 1ZSGA 5GMKi 4J9IA 1WHMA 1K9AA 2KMTA 5A0GA 2LT1A 2YUNA 4C8QG 1RLQC 1PKTA 2DXTA 5GAN3 5LJ5g 2C06A 3OYKA 2CP7A 5D7UA 1KQ2A 1I07A 3GNGA 4WTOB 1VQ4A 1KHCA 1H92A 4EMKB 3C12A 3BY7A 1XQHA 2RQTA 3OS0A 1PRMC 2DA9A 1T0JA 1SG5A 2COWA 1M2OA 4QT7A 3QDRB 3I35A 2V26A 2CSIA 2LC4A 4BI3A 1WJRA 3FRNA 3OW2S 3QPHA 2CP6A 2DD4A 2K3XA 3C0CA 4JJBA 5GAN8 1YI2A 3S6WA 1Y96A 3VRYA 4KULA 3M0PA 2QGFB 4BY6B 3CCQT 1YJ9T 4LUDA 3WXMB 2JMCA 3UF4A 3Q1JA 2XD0A 3CCEQ 3REAB 1S72A 1VOMA 2EIFA 3JCMX 4C0DB 1OX9A 1BI2A 4BE0A 4E2FB 1VYUA 2RA2A 3CD6A 2QG9B 2OI3A 2EYXA 4XTYA 1OZ3A 1V1CA 1KFZA 4KGXB 3UWNA 4ANJA 2HEQA 5A0LA 5C0MA 3QWYA 3THKA 2RQUA 5CIUA 4PJOF 2DE0X 2EW3A 2FPEA 2HL5C 3QHSA 1BIBA 1MNDA 1M27C 1SHGA 1UFFA 1AD5A 2YLCA 2FPDA 4C8QA 2KVQG 1YNZA 4HCZA 1IO6A 2ATCB 3PFSA 1YJWT 4ZTFA 2QTVA 3OYNA 3I55A 2EQMA 4A4FA 2K9GA 2RK2A 4LDVA 5FRMA 1M90U 1N27A 1K73C 2DKGA 2YDLA 1WXUA 3ZL7C 2YRCA 2EPDA 5GAOr 3CBPA 4RUGA 2JJ9A 2M9UA 5EG2A 3CC7Q 2EVRA 1NYFA 1KQSP 2DBMA 4C5EA 1PWTA 1E6HA 1RAEB 1FXXA 1JBMA 2BZXA 2QQRA 2LQ8A 2RHZA 1WJQA 4RTXA 3G6EA 1K76A 2LRQA 2E10A 2QK0A 4PJOB 5GMKl 2QEXA 2R58A 3MHXA 3IQLA 2DLPA 2E5KA 1UJYA 1WHGA 2CREA 1QVGP 4DOVA 2V1QA 4XTXA 2PTKA 2LMJA 4N0AA 1X2KA 4M77D 1GBQA 3NFCA 4DBRA 1VQMQ 2B86A 4AMCA 2JUFA 2A37A 5GJWB 3E9GA 3EH2A 4RTZA 3CCQQ 3CCMQ 2E6ZA 5GAN2 3ZFJA 3SDZA 4LD9K 3WVDB 2D8JA 4QQGA 1OQKA 3V7CA 3CCRA 3M0TA 1KG1A 4M7DC 1IRXA 5ECAA 2KXCA 1H3ZA 3GNFB 4DBFA 2MWOA 1Y57A 2FHDA 2MYSA 5KYXB 3SFMA 5GAOq 3CEYA 3NTKA 5GAN7 2QA4A 2G6FX 4M75D 4M75F 4PJOA 2AZSA 2P4RA 2DILA 3E19A 4BI4A 4HVUA 4J9DA 3I5SA 2KE9A 1A0NB 2C0OA 5CKEA 1XTDA 1SSHA 2DRMA 4RCBA 1NPPA 5D6XA 3JCMd 3OSSC 1TSFA 4F7UB 1YHQA 4OB0B 1HJDA 1YITA 3JSCA 2GF7A 3MKDA 3KXTA 4BY6C 3TCJA 2CZ6B 4M75C 1G83A 4DOWA 2DMOA 3DB4A 4M78G 3PVQA 4M7AF 1ZUKA 3G7ZA 4M7DG 2X3WD 1VQLQ 5J26A 4C0FA 1I5LA 3OBWA 2RJFA 3EG2A 1RI0A 1KIKA 2EYQA 4M78E 5KYYB 2E65A 3FJPA 3QWXX 1TUDA 3MP6A 1FX7A 2K3BA 3TSWA 4KH0B 4FIBA 3A8OB 5AYFA 4OMNA 3BDLA 1EFNA 4J7FA 4PNOA 2QTXA 1JU5C 2E1HA 1YJNT 1QVFA 2XI9A 3G4ST 3QBYA 4ZN3A 2VV5A 2DIGA 2VKNA 2JMAA 1V29B 1YN8A 4JS5A 2AK5A 2KROA 2ZPIB 3CC2T 2DM1A 3DKMA 3CCSQ 1U1SA 1ZUUA 2E64A 1LJOA 3SWNB 5LJ5e 4DQ2A 4LDYA 2OX7A 3EFOA 2QQBA 1RAFB 1M1GA 2CP2A 4LDUA 4A4KA 2DX1A 5LJ3h 4N4HA 3JCMg 4HCBA 1D1AA 2KRMA 5C6SA 1VQ9T 1PKSA 2Y4XA 3OS1A 1M8MA 1VQ4Q 2QDYB 3JCMb 2ED1A 5FWCA 3MO8A 2O2OA 3VUZA 7AT1B 3M56A 2LX7A 3CCUT 2IVWA 2MOXA 3VS2A 1W1FA 3OMCA 1SF9A 1X01A 3BW1A 2E12A 3NPFA 2JTFA 2L0AA 2RQVA 4R55A 1I5OB 1VQ5Q 1B07A 1VQ5T 3OMGA 1V76A 2MI6A 4C0GA 1DJ7B 1ABOA 1M3AA 1BK2A 3I55Q 4F14A 1B34A 4M77C 2VGMA 4C0ZA 4EDUA 2CSQA 3VS6A 2K5IA 1ZBJA 3OYBA 5KYWA 3OW2P 1W2BS 2RHUA 3CC4T 5GANg 1C0MA 2RQWA 2YHTA 4P5NA 4F16A 1M2VA 1Q86U 2RI2A 2V8KA 1EIFA 1E6GA 1PG5B 2EKOA 3FLGA 3CMEQ 3CCJA 2KRNA 1TWBA 3VV0A 1Y0MA 3CCUA 2D6FA 3CMAA 2PU9B 3NGPA 2LX9A 4TVRA 3G71Q 1JJ2A 1Q7YU 1AOJA 2R5MA 1VQLA 5L8RE 1G3WA 2CP3A 5FU7C 2KT8A 4JJNK 3QSUA 5HK3A 5KYUB 3H6ZA 1VQ6T 1KK7A 1YJ9A 3PTAA 3M0SA 5IT9E 4LNPA 1IGUA 1X2QA 4UC4A 2EAYA 1D09B 3M55A 4NOYA 1VQ5A 1KC8U 3UT1A 2JW4A 2DXCA 4PKCC 2EGAA 2HSPA 3JB9H 2FO0A 3OYLA 3JCMJ 2R5AA 1ZSZB 1M1KC 1YJNA 3N5BB 1IB8A 1SEMA 2HKNA 2K2MA 1Y71A 5GAMd 4FL6A 3CCVQ 4N4GA 4RG2A 3JCMP 3C4SA 1HSQA 1W2BP 2DO3A 3RIRA 1D0XA 1VIFA 2VGNA 2E41A 2RJCA 3M58A 2YUQA 4ZN1A 1GCQC 3CCET 4FT4A 4QW2A 3JB9F 1LVKA 5I2SA 1TUGB 2P0KA 4X34A 3ZEHA 4PFPA 3CCUQ 3QZ9B 1ZX6A 2DL8A 3HTRA 1R0BG 1AWJA 4QVCA 3CD6Q 1G5VA 4XTVA 2GFAA 2LJ0A 4IUPA 2DJZA 1WQ7A 3F70A 3OYEA 2DAQA 1IZ6A 4RTTA 5FRNA 1MV0B 3TREA 1UTIA 4RTVA 1IXDA 1SKUB 4FYVB 5GANe 1WZOA 4C92G 3GOXA 2HD0A 3FEOA 3CMET 4HT9A 1VUBA 2ZGWA 2CZ1B 4O5VA 2VWFA 4M75G 4RMOA 2DTOA 1H3HA 2RF0A 3CPWA 2KXDA 5M9OA 4VUBA 1Z9ZA 1PSFA 3CXCS 5HKCA 3URGA 3LGFA 4Y28E 2X4JA 3EFSA 4JLIA 3I55T 5CQXA 4R56A 3FDRA 2JN0A 2LJ3A 2Z0WA 2SEMA 1YWOA 2K57A 3E2UA 1WYXA 2EKHA 4E47A 1NLOC 2DEUA 3EG0A 2DRKA 1N5ZA 2CT4A 5GANd 3OYGA 1WI7A 2K5FA 5IHKA 2PNIA 4XU0A 4M7AE 4RTUA 4ZGEB 2DPPB 1GBRA 2LVMA 1BIAA 4QKUA 1UEBA 1YHQT 1B34B 2P4TA 3L42A 5CR2A 2K5LA 3SB2A 2XDPA 3QDFA 1IHWA 4E7IA 2RHIA 2GCXA 1R8OB 3G71T 2CYZB 3BE3A 1QCOA 1YJ9Q 4JJCA 1D0YA 1ZHIA 3J7AF 3M4GA 1WPYA 3TSZA 3MP1A 2QGGA 5FWBA 2CUBA 3M0RA 2XU8A 3G1JA 2A3LA 4LDWA 3VJPA 4D8DA 1BB9A 2RM4A 4EMKA 2ZPFB 2LJ1A 3GF5A 1BKBA 2OJ2A 1QWFA 3CQTA 1C1AA 5I2MA 2EBPA 3JCMf 4EMHA 2YUOA 4JDSA 5FLXE 4CC7A 2RHXA 5HK0A 2F1LA 1NEGA 1VQKT 1TTHB 2BIVA 3S3OA 3H9NA 2GQVA 5KE2A 4RKUE 1JQQA 2XDBA 4L59A 3H0IA 4M7AD 3CC7T 2J05A 4KUDK 3CCVT 4AFZC 1NJIU 1UHCA 5DLQE 3T9NA 1Y96B 2BTTA 4J8OA 2FYKA 4J9BA 3VUBA 3OYDA 1QP3A 1OPLA 5HY6A 5IHIA 3JB9I 3HRUA 2OAWA 2NUTA 3JAME 1M30A 4RTYA 5IH2A 3MEVA 4AFSC 3UA7A 1BI3A 2IG0A 1SSFA 4LN2A 2DL3A 1NPRA 5L23A 5GAOm 3JRZA 3G6EQ 5GAOl 1K0XA 2HSEB 3KBGA 1OEBA 4KGZB 1NJIC 1M3CA 3VRZA 2FB7A 4WF2A 2F2XA 4M78C 1VYTA 3CC7A 2NUPA 2JZ2A 1IGQA 4EIKA 4JS4A 3QO3A 2MK5A 3UA6A 1WHHA 4BE2A 2MWPA 1UG1A 4II1A 2QQ9A 4E7LA 3VS5A 1M2VB 2BUDA 4XTWA 4J7IA 1I4K1 2X4WA 3OYMA 2JOYA 2WSCE 3JV3A 3CCQA 3MEAA 1ZSZC 3CPWS 2O4XB 2MPXC 1N8RU 3CXCA 1TG0A 1X69A 5IXBA 2F69A 1OZ2A 1OOTA 3SD4A 4HVVA 4PJMA 1KQSS 5GMKe 1WXTA 1ACMB 2K2VA 2F2VA 5KYUA 3SEMA 1QVPA 1UGSB 2M51A 2J7IA 1S1NA 3M5AA 1S72Q 4C5HA 2RH2A 3CCVA 3FB9A 1FMVA 1YIJT 2OTLQ 1QWEA 2KY9A 3ASKA 4A54A 1YIJQ 4C92F 3EG1A 2YSQA 1YP5A 4ATOA 1YJWQ 3RKWA 2DIQA 1VQ9Q 2HQEA 3PNWC 2FPFA 1NEBA 2D0NA 5CKFA 1KC8R 2E6NA 1UB4A 1KQ1A 2KR3A 4KGVB 3OYHA 3A8LB 5I21A 5GANj 1BU1A 4O6JA 1OV3A 1MMNA 2A08A 2EQIA 3EG3A 2WACA 1QQJA 4MZTA 4ZGDB 1TOVA 3H8ZA 2OTJT 4MDXA 2PVDB 1QCFA 3V8LA 3MCAB 2MCNA 3FJ5A 4M4ZA 2IPOB 1F1BB 2M0YA 2KI7A 4C92C 3L1AA 2OTLA 1GL5A 2J06A 5KH6A 1I0CA 2L3RA 5KCOA 3J80E 1EZZB 4PJOD 3OYCA 2FVUA 1VQ6Q 4B9WA 5GAMe 4OMQA 4M78A 1WJSA 2QA4Q 1OU9A 4XU2A 2QXFA 2C0IA 4ZNXA 2ZPGB 1K8AC 1ARKA 1FMWA 4GLMA 1KHIA 3A5ZB 4C92E 4FYYB 3QYHB 4ORZA 1KD1C 2RO0A 4JLGA 2K4YA 1FWZA 1KSWA 4F7UA 1NM7A 1BI1A 4JZ4A 4F04B 1KJWA 4QVDA 2EYWA 3X20B 3PE0A 1MNEA 3JCMV 4M77F 1KC8C 3A8GB 1X27A 4C8QB 2RB6A 4XTUA 2NUTB 5FU6C 4M7AB 3G4SA 5J39A 5GAN5 1MMGA 1WXBA 3OQ5A 1TUCA 2RHYA 3I9QA 1VQNT 4XU1A 1PHTA 5KYNA 5GAMj 3JCMe 5KE3A 3CPFA 1VQ8T 1M1KR 4X9DA 3OY9A 4KBMB 3TEEA 2HQXA 4ESRA 4M7AG 1N9SA 1P92A 2KSSA 1GCQA 4OMOA 1G8XA 2KK4A 2M16A 1SHFA 2MMPA 1QVGS 1Q7YC 3A98A 3CC4Q 1MMAA 1XJWB 3LWHA 3QXEB 2K7AA 3CCLQ 3E1SA 3PMIA 1U5SA 1WHJA 2W10A 4C8QF 5GAMh 3CCST 4J9FA 4E7HA 1QVFS 2FEIA 3L2QA 3CCRT 4OVAA 2DVEA 3CCRQ 2C0TA 3RDVA 3GLXA 1UGRB 4IUTA 1NJIR 2RPNA 1B7TA 4PFZA 4PK4A 1BBZA 4KT0E 4HCKA 1VQOQ 3OYFA 3RR6A 2GTOA 6AT1B 2OTLT 4M7AA 1Z9QA 1TS9A 2BE9B 4M77A 1G3SA 1NYGA 4LUEA 3MEWA 2OTJA 1UJ0A 2HNIA 4IUUA 2DFUA 1FYNA 2DL4A 1H8KA 8ATCB 1PD1A 2QA4T 5CQYA 4GLKA 1YI2T 3BDUA 2EJGA 5GAMf 2QEXQ 2LQNA 1JJ2S 3P8DA 5I22A 3JCMh 1ZSZA 4ZGJB 3VU3C 4JRPA 3EG9A 4RCCA 3L2ZA 2JTEA 4HA8A 4MMLA 1YJNQ 3QYGB 1RL2A 4F7UG 1LCKA 1YI2Q 3PMTA 1IREB 1X6GA 5AT1B 3RKYA 3LX7A 4Y92A 3RKXA 3EH1A 5A0DA 4FT2A 3LLRA 4M7DD 1Q82U 2RMOA 2AKKA 2CP5A 1M90R 2B8AA 1VQKA 2ROTA 2A36A 2CKKA 2EQKA 2JM9A 4FW2A 3MPUB 3VKIA 5GAOn 3DB3A 2YLBA 4Z02A 2YT6A 2RI3A 4M77B 2WSEE 3V8JA 2PUOB 3X25B 4NL3A 1WDXA 4KRTA 1VYVA 1PCXA 4DBHA 1NG2A 4FSSA 1VQ8Q 1OYXA 1VQ7T 3GPLA 1WLPB 3LWIA 1VQ7Q 1UHFA 2DJQA 3RMQA 4M7DF 4Q5WA 4CC3A 3TU4K 4JZ3A 1RAGB 4M78D 4KUIA 1UGQB 4F7UE 2G3RA 2I2LA 3EHRA 3QJYA 2E70A 3DLLA 2LDMA 2LCSA 1D0ZA 2ESWA 5CKDA 3NTIA 2DTHA 3OYIA 2NUPB 2AKLA 2KYMA 4V2SA 2CZ0B 3META 4BDZA 5KYYA 4OB3B 5CK9A 1YCSB 2VC8A 4HVWA 1CKBA 3SWNC 3MEUA 3CPWP 1ZLMA 1R0CB 3V8KA 3EHQA 4DBQA 8AT1B 1M90C 1SRLA 1K73R 1Q81U 1X6OA 2HQHA 3CBMA 1ZQ1A 1D3BA 1OI1A 1RI9A 3HPWA 1RAIB 2DXUA 2F2WA 2JS0A 1NZ9A 1KD1R 4AG1C 1E7OA 1I81A 2QQSA 2Y90A 1BYMA 3HSBA 2JVVA 2BZ8A 1CSKA 1VA7A 2E3HA 3JCMQ 9ATCB 4A53A 1JB0E 1GXIE 3NHNA 2DBKA 2PVGB 3U23A 5GMKh 4J83A 3L2RA 4L6V5 1JXMA 5CO7A 1Q86R 4C92D 4QVZA 1AVZC 2F5TX 1TXQA 2DVJA 2DNUA 2NUZA 1U1TA 4E7SA 1AWWA 1YHQQ 4E7KA 1SRMA 1M9SA 1G3TA 2DK3A 2LT4A 5GANh 2A7YA 1HK9A 4A63B 2X4XA 2EQJA 1W2BA 2YRVA 2GNCA 2EYZA 2MAMA 2P0QA 1VQKQ 3AT1B 2O31A 2PUKB 1Q7YR 1WX6A 2L5QA 2YWWA 3G71A 1VQ4T 4PJOC 3CBOA 3HRSA 2VB6A 3JCMW 3I56T 3CMAQ 2E3IA 1BI0A 2H3EB 4EMKC 3LW5E 2EJ9A 3A8MB 2W0ZA 3CCJQ 3PIPA 4M75E 3KFVA 3CCJT 2OTJQ 2FRWA 4OMLA 1OPKA 2HZYA 3R6OA 2DERA 3UPUA 2O88A 2X4YA 3EG9B 2CDTA 3EFRA 1YWPA 2V1RA 1C6VX 1UGPB 1VQMA 4BD3A 3RERA 2JM8A 5CKHA 3M57A 5IXFA 5KCHA 2XK0A 2ZPBB 1KQSA 4D6WA 3SWNA 2ZAEA 5IHNA 3EFOB 1TH7A 2L3PA 1AEYA 5GMKm 1MMDA 4LD6A 1QKWA 1WIEA 2FL7A 1YFNA 1W6XA 3A1PA 1QW1A 2EGCA 1RLPC 2MF2A 1MUZA 5FU6B 1VQOT 3CXCP 3VYHB 3RNJA 3FC3A 2EGEA 1J3TA 4HT8A 2CGHA 2V8JA 3FIFA 3OW2A 2JTMA 3CCLA 1JO8A 2NWMA 3PVLA 4C0DC 1D1CA 3CC4A 4QQ6A 2VXFA 2QQAA 4B6MA 5A2QE 4PLIA 3GP8A 1JJ2P 2P0PA 5LJ3g 3A8HB 5LL6S 2O9SA 3NTHA 4MZMA 2KYBA 4E6RA 1MGQA 1WNLA 3S3NA 1KD1U 3HL8A 4PJNA 4R0KA 2RJEA 3H0HA 2JXBA 4C8QE 4FU6A 4DEXA 4GBQA 1T3SA 2VUBA 2DTIA 3QIIA 1PNJA 4FSXA 4MZPA 4C5GA 3V7RA 4M75B 1K8AU 1S72T 4CRIA 4L5GA 4C92B 2CZ7B 4OGEA 1GFDA 5LJ5j 4PJLA 1QVFP 3LH0A 4BE1A 3WVEB 4PJOE 2DL7A 3CC2Q 2FZGB 2DYBA 5CAIA 2KNBB 1B3QA 2LQKA 4IIOA 3M53A 5IN1A 4F7UF 1VQ6A 4E7ZA 5GJVB 1D1BA 3RUXA 1Q82C 3H0FA 2X51A 3CCEA 4AFUC 5GAN6 2EWNA 3M54A 3C94A 3X24B 4J9GA 4IKFA 1M1FA 2O4XA 3VS0A 1AZEA 4M7AC 2EQUA 2KGTA 3OYAA 2O01E 1YITQ 3L2VA 3P8HA 1YITT 3HHTB 3HP9A 1QLYA 5FU7B 2CUDA 2H8HA 3CD6T 1K0SA 4N4IA 4JRQA 1U8RA 5LJ3d 4Z88A 4PJJA 1YJWA 1JXOA 2KT1A 1MHNA 3QJ6A 2E4HA 1N8RR 2X35A 4JRKA 3UATA 2AHJB 4KH1B 2LQWA 4DEYA 4M75A 5GAMg 1K9MC 1G3YA 2CT3A 4FCYA 3G6ET 3SHWA 1RAHB 4C92A 5GMKj 4YTLA 3OS5A 2VVKA 2O9VA 1VQLT 1FMKA 4XAXB 4B9XA 1YCYA 2KAFA 1LNXA 2COZA 1YIJA 4RG8A 2VXEA 1LOJA 1UE9A 2EFIA 1HXDA 3REBB 3P8BB 3D7SB 1QKXA 3KUFA 3X26B 1GCPA 1XNIA 1GRIA 1W70A 5LJ5f 4N0AC 2M0OA 3OSVA 3G4SQ 4EPCA 3EGDB 5IAYA 1NBEB 1Q81R 2P84A 5KYWB 4JRIA 2AZVA 1QP2A 1VQMT 4GY5A 3QUIA 5D6WA 2X3XD 4OP0A 4X9CA 4LXCA 4A4GA 3CCMT 1QVGA 4J9CA 2XDDA 3E9FA 1VQNA 4MDWA 4A4EA 1K1ZA 1YBYA 4HXJA 1UDLA 2I0NA 4J6YA 1RADB 2NLUA 2RN8A 2L8DA 4C5IA 4M77E 2D9TA 1QCNA 1ZBXA 4ZTJA 2DZCA 4PLLA 2J6FA 1WA7A 2CH4W 5GAOp 1WFWA 1AZGB 4LDXA 1R77A 3PIOA 3LGLA 2CP0A 2M1HA 3J81E 2GBQA 1HYOA 3RBBB 1MV3A 2RQRA 1WHKA 2DEQA 1VQ7A 5LJ3j 1AHJB 1AWXA 1K73U 2EYYA 4MMKA 1I1JA 2XIDA 4XTZA 4C8QC 3CCSA 3DLMA 4HCCA 5CKBA 1PSEA 3BFMA 2KRSA 2CS7A 3R6NA 2JT4A 4BB7A 3S3MA 1K4US 4OB2B 4M78F 2HKQB 4RTWA 1Q81C 2E5QA 1W4SA 2FRYA 3TQ7P 3QZ5B 4ELZC 1UGVA 1ZUYA 2LNVA 3GBQA 4IUVA 2D1XA 2GGRA 4X1VA 1Q95G 2QYZA 2FG0A 3C95A 3VS1A 3L2WA 3VS3A 1LPLA 1G2BA 1VQPT 3VS4A 1RACB 4IIMA 5CCAA 3M4YA 4OMPA 4XU3A 4ELYC 1M4ZA 1N8RC 2D8HA 3O5ZA 2MIOA 4AG2C 3OYYA 2KDSA 2WSFE 3RESA 2QDLA 3HFOA 3M0QA 3JB9G 4JJDA 2AIRB 3PT9A 2XKOC 2JNGA 4CC4B 3O8VA 1VQPQ 2XHCA 1T3LA 3OBYA 2LCCA 4FW1A 1OU8A 3JCMc 1JRIA 5J3BA 1UECA 4BUGA 3UDCA 2KBTA 3X28B 4F17A 1VQOA 3JB9J 5FROA 3CCLT 1Q82R 4LE9A 2K79A 2ZPEB 2ED0A 2RI5A 5GAN4 2DL5A 4XQ3A 5HCKA 3I56A 1Y07A 1NLPC 2DD5A 4C8QD 2QAZA 4M7DA 2YXYA 4WCIA 4PL6A 4AFQC 5FW9A 3HRTA 3ZBDA 4A4HA 4XK8E 4ME7A 1M3BA 1VQ9A 4M7DE 4EMGA 2HDAA 1M8VA 1WGSA 1PM3A 2M02A 1D3BB 2ROLA 1VQ8A 1SPKA 1WHLA 1H641 3I5RA 1PC0A 3GIBA 1PD0A 1T0HA 4E7JA 5DLOA 2NYSA 2CH4A 4CI0C 3CCMA 2ENMA 4J6WA 2K6DA 4NS5A 2QEXT 3VS7A 2VYTA 3CC2A 1XOVA 2V8IA 3OA6A 2L3SA 4OMMA 2QI2A 2HAXA 4OF1A 2LTOA 3M9QA 4FYXB 3PGGA 1VQPA 1K8AR 2D0QB 2FZCB 2DZ9A 4PJOG 4FM4B 1O9SA 4OB1B 1U06A 2XICA 4DA4A 4JPBW 4Z8AA 2AT1B 4OMFB 5EC7A 2DETA 2COYA 3AHUA 1N6AA 1CKAA 2HBPA 2DYIA 2PZ1A 3L2UA 2RNAA 1OULA 1ZA2B 4Z89A 1WQWA 1U3OA 3H41A 2JS2A 3ULRB 2LZ6B 1GFCA 2HMAA 4D8KA 4JUVA 5LJ3f 2IIMA 4OGCA 2HL3A 4Y91A 4J5YA 1VIEA 3OB9A 3ME9A 1X43A 2F5KA 2A0FB 4BACA 1JEGA 2BE7D 2DXBA 4J9EA 5CVIA 1M1KU 1RAAB
chains in the Genus database with same CATH topology
3M0UA 2DX1A 2KR3A 1JO8A 1BU1A 2KRMA 2NWMA 1OV3A 1X6BA 3PVLA 1PKSA 1M8MA 2A08A 2EQIA 3EG3A 2ED1A 5FWCA 2O9SA 2O2OA 2KYBA 4E6RA 1QCFA 2MCNA 3FJ5A 2LX7A 4M4ZA 2M0YA 2MOXA 3VS2A 1HD3A 4R0KA 1W1FA 3H0HA 2JXBA 1GL5A 2J06A 3NPFA 2SRCA 2L0AA 4DEXA 4GBQA 1I0CA 2RQVA 1T3SA 2GTJA 1PNJA 1B07A 4OMQA 2J6OA 2YUPA 1ABOA 2GQIA 1M3AA 1BK2A 4F14A 2C0IA 2BZYA 4ZNXA 1ARKA 2L2PA 4GLMA 3EGUA 3LH5A 2CSQA 1PRLC 2J6KA 2HBWA 3VS6A 1ZBJA 2DF6A 1GFDA 2RQWA 4ORZA 5I11A 4F16A 1KSWA 2ABLA 1E6GA 3NMZC 2DL7A 1NM7A 2DYBA 2KNBB 1B3QA 4IIOA 2XMFA 2HCKA 4JZ4A 4J9HA 1KJWA 2KRNA 2EYWA 3PE0A 2LP5A 1RUWA 1Y0MA 5GJVB 1X27A 2ECZA 3NGPA 4K11A 3H0FA 2LNHB 3TVTA 4AFUC 1WXBA 1AOJA 1UUEA 1TUCA 2L3QA 4J9GA 1AWOA 2A28A 2KEAA 3I9QA 1PHTA 3VS0A 1ABQA 1AZEA 2KT8A 2KGTA 4CC2A 3M0SA 1ZSGA 4LNPA 4J9IA 1X2QA 1QLYA 2CUDA 1K9AA 2H8HA 2YUNA 1RLQC 1PKTA 1K0SA 4ESRA 4Z88A 2JW4A 1JXOA 1GCQA 4OMOA 2EGAA 2KT1A 1I07A 2HSPA 1SHFA 2FO0A 3A98A 3UATA 2LQWA 1H92A 4DEYA 2K7AA 2CT3A 1U5SA 2RQTA 2W10A 1SEMA 3SHWA 4J9FA 2K2MA 1PRMC 2FEIA 2DA9A 1T0JA 2O9VA 2VVKA 2C0TA 4QT7A 1HSQA 3I35A 2CSIA 1FMKA 2RPNA 1BBZA 4HCKA 2YUQA 1GCQC 2GTOA 3C0CA 4JJBA 3VRYA 1Z9QA 1UE9A 3M0PA 4LUDA 1NYGA 2JMCA 4LUEA 1ZX6A 2DL8A 3REBB 3UF4A 1UJ0A 1QKXA 1AWJA 3REAB 1GCPA 2LJ0A 1GRIA 1W70A 1FYNA 2DL4A 1H8KA 4RTTA 1VYUA 1MV0B 1UTIA 4RTVA 2OI3A 2AZVA 2LQNA 2EYXA 1V1CA 1KFZA 5I22A 2VWFA 2HEQA 2X3XD 1H3HA 2RF0A 3QWYA 2KXDA 3THKA 2RQUA 4J9CA 1Z9ZA 2JTEA 2DE0X 2EW3A 2FPEA 1K1ZA 4HXJA 1UDLA 2I0NA 1LCKA 1M27C 1SHGA 2RN8A 1X6GA 1UFFA 1AD5A 4Y92A 2FPDA 1YNZA 1IO6A 2RMOA 2AKKA 2J6FA 1WA7A 2LJ3A 2CH4W 2ROTA 2K9GA 2SEMA 2A36A 2JM9A 1YWOA 1WFWA 1AZGB 2YT6A 1WYXA 2EKHA 2GBQA 3RBBB 1MV3A 2RQRA 1NLOC 2YDLA 1WDXA 1WXUA 3EG0A 4KRTA 3ZL7C 1VYVA 1N5ZA 2CT4A 2DRKA 2EPDA 1WI7A 5IHKA 1NG2A 1AWXA 4FSSA 2EYYA 2PNIA 4RUGA 1I1JA 1WLPB 2EVRA 1NYFA 4RTUA 2DBMA 1UHFA 1PWTA 2DJQA 1GBRA 1E6HA 2KRSA 4CC3A 2BZXA 3R6NA 4JZ3A 2JT4A 4RTXA 1K4US 1K76A 3EHRA 4RTWA 2FRYA 4JJCA 1UGVA 1ZUYA 3TSZA 3IQLA 5FWBA 2DLPA 2LCSA 2CUBA 3M0RA 2ESWA 2E5KA 3GBQA 1UJYA 2D1XA 2GGRA 2CREA 4D8DA 2AKLA 4X1VA 1BB9A 2FG0A 3VS1A 2KYMA 2LJ1A 2OJ2A 1QWFA 3CQTA 2V1QA 3VS3A 2PTKA 2EBPA 1G2BA 3VS4A 2LMJA 1YCSB 2YUOA 4HVWA 1CKBA 4IIMA 1X2KA 1GBQA 1ZLMA 4OMPA 4CC7A 2B86A 2D8HA 3EHQA 2A37A 1SRLA 5GJWB 1NEGA 3O5ZA 4RTZA 2MIOA 4AG2C 1RI9A 2QDLA 3M0QA 2F2WA 2JS0A 4AG1C 1E7OA 2D8JA 4JJDA 1JQQA 3H0IA 3M0TA 4CC4B 2BZ8A 2J05A 5ECAA 2KXCA 4AFZC 1CSKA 1VA7A 1UHCA 1T3LA 2BTTA 1Y57A 3NHNA 4J9BA 1UECA 2DBKA 4F17A 2KBTA 3U23A 1OPLA 5IHIA 2OAWA 2G6FX 4LE9A 1M30A 2K79A 1JXMA 2ED0A 4RTYA 2AZSA 2DL5A 2P4RA 5IH2A 4AFSC 5HCKA 2DILA 3UA7A 1AVZC 2DVJA 4LN2A 2DNUA 2DL3A 2NUZA 1NLPC 4HVUA 4J9DA 5L23A 4WCIA 3I5SA 2KE9A 4AFQC 2C0OA 5FW9A 1A0NB 1K0XA 1AWWA 1SSHA 2DRMA 1OEBA 1SRMA 1M3CA 3VRZA 1M3BA 2F2XA 1HJDA 2HDAA 4A63B 1VYTA 4EIKA 2ROLA 1SPKA 2GNCA 3UA6A 2EYZA 1G83A 3I5RA 2DMOA 2O31A 1WX6A 1UG1A 1T0HA 3PVQA 3VS5A 2CH4A 1ZUKA 2ENMA 2K6DA 2X3WD 3VS7A 1XOVA 2L3SA 4OMMA 3JV3A 3EG2A 1KIKA 2W0ZA 3QWXX 1TUDA 1U06A 3KFVA 4JPBW 1TG0A 1X69A 2FRWA 4Z8AA 5IXBA 4OMLA 1OPKA 5EC7A 2K3BA 3TSWA 2O88A 1OOTA 2CDTA 4HVVA 1YWPA 1CKAA 4OMNA 2V1RA 1EFNA 1WXTA 1JU5C 2PZ1A 2JM8A 2RNAA 5IXFA 2F2VA 4Z89A 1U3OA 3H41A 3SEMA 2JS2A 2VKNA 5IHNA 2JMAA 3ULRB 2LZ6B 1YN8A 1GFCA 2M51A 2J7IA 2L3PA 1S1NA 2AK5A 1AEYA 2KROA 4D8KA 1QKWA 1WIEA 2DM1A 1W6XA 2IIMA 1QWEA 2EGCA 1ZUUA 3EG1A 1RLPC 2YSQA 1X43A 1YP5A 1JEGA 1MUZA 4J9EA 2FPFA 1NEBA 3RNJA 1J3TA 2EGEA 2D0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0U A;  2DX1 A;  2KR3 A;  1JO8 A;  1BU1 A;  2KRM A;  2NWM A;  1OV3 A;  1X6B A;  3PVL A;  1PKS A;  1M8M A;  2A08 A;  2EQI A;  3EG3 A;  2ED1 A;  5FWC A;  2O9S A;  2O2O A;  2KYB A;  4E6R A;  1QCF A;  2MCN A;  3FJ5 A;  2LX7 A;  4M4Z A;  2M0Y A;  2MOX A;  3VS2 A;  1HD3 A;  4R0K A;  1W1F A;  3H0H A;  2JXB A;  1GL5 A;  2J06 A;  3NPF A;  2SRC A;  2L0A A;  4DEX A;  4GBQ A;  1I0C A;  2RQV A;  1T3S A;  2GTJ A;  1PNJ A;  1B07 A;  4OMQ A;  2J6O A;  2YUP A;  1ABO A;  2GQI A;  1M3A A;  1BK2 A;  4F14 A;  2C0I A;  2BZY A;  4ZNX A;  1ARK A;  2L2P A;  4GLM A;  3EGU A;  3LH5 A;  2CSQ A;  1PRL C;  2J6K A;  2HBW A;  3VS6 A;  1ZBJ A;  2DF6 A;  1GFD A;  2RQW A;  4ORZ A;  5I11 A;  4F16 A;  1KSW A;  2ABL A;  1E6G A;  3NMZ C;  2DL7 A;  1NM7 A;  2DYB A;  2KNB B;  1B3Q A;  4IIO A;  2XMF A;  2HCK A;  4JZ4 A;  4J9H A;  1KJW A;  2KRN A;  2EYW A;  3PE0 A;  2LP5 A;  1RUW A;  1Y0M A;  5GJV B;  1X27 A;  2ECZ A;  3NGP A;  4K11 A;  3H0F A;  2LNH B;  3TVT A;  4AFU C;  1WXB A;  1AOJ A;  1UUE A;  1TUC A;  2L3Q A;  4J9G A;  1AWO A;  2A28 A;  2KEA A;  3I9Q A;  1PHT A;  3VS0 A;  1ABQ A;  1AZE A;  2KT8 A;  2KGT A;  4CC2 A;  3M0S A;  1ZSG A;  4LNP A;  4J9I A;  1X2Q A;  1QLY A;  2CUD A;  1K9A A;  2H8H A;  2YUN A;  1RLQ C;  1PKT A;  1K0S A;  4ESR A;  4Z88 A;  2JW4 A;  1JXO A;  1GCQ A;  4OMO A;  2EGA A;  2KT1 A;  1I07 A;  2HSP A;  1SHF A;  2FO0 A;  3A98 A;  3UAT A;  2LQW A;  1H92 A;  4DEY A;  2K7A A;  2CT3 A;  1U5S A;  2RQT A;  2W10 A;  1SEM A;  3SHW A;  4J9F A;  2K2M A;  1PRM C;  2FEI A;  2DA9 A;  1T0J A;  2O9V A;  2VVK A;  2C0T A;  4QT7 A;  1HSQ A;  3I35 A;  2CSI A;  1FMK A;  2RPN A;  1BBZ A;  4HCK A;  2YUQ A;  1GCQ C;  2GTO A;  3C0C A;  4JJB A;  3VRY A;  1Z9Q A;  1UE9 A;  3M0P A;  4LUD A;  1NYG A;  2JMC A;  4LUE A;  1ZX6 A;  2DL8 A;  3REB B;  3UF4 A;  1UJ0 A;  1QKX A;  1AWJ A;  3REA B;  1GCP A;  2LJ0 A;  1GRI A;  1W70 A;  1FYN A;  2DL4 A;  1H8K A;  4RTT A;  1VYU A;  1MV0 B;  1UTI A;  4RTV A;  2OI3 A;  2AZV A;  2LQN A;  2EYX A;  1V1C A;  1KFZ A;  5I22 A;  2VWF A;  2HEQ A;  2X3X D;  1H3H A;  2RF0 A;  3QWY A;  2KXD A;  3THK A;  2RQU A;  4J9C A;  1Z9Z A;  2JTE A;  2DE0 X;  2EW3 A;  2FPE A;  1K1Z A;  4HXJ A;  1UDL A;  2I0N A;  1LCK A;  1M27 C;  1SHG A;  2RN8 A;  1X6G A;  1UFF A;  1AD5 A;  4Y92 A;  2FPD A;  1YNZ A;  1IO6 A;  2RMO A;  2AKK A;  2J6F A;  1WA7 A;  2LJ3 A;  2CH4 W;  2ROT A;  2K9G A;  2SEM A;  2A36 A;  2JM9 A;  1YWO A;  1WFW A;  1AZG B;  2YT6 A;  1WYX A;  2EKH A;  2GBQ A;  3RBB B;  1MV3 A;  2RQR A;  1NLO C;  2YDL A;  1WDX A;  1WXU A;  3EG0 A;  4KRT A;  3ZL7 C;  1VYV A;  1N5Z A;  2CT4 A;  2DRK A;  2EPD A;  1WI7 A;  5IHK A;  1NG2 A;  1AWX A;  4FSS A;  2EYY A;  2PNI A;  4RUG A;  1I1J A;  1WLP B;  2EVR A;  1NYF A;  4RTU A;  2DBM A;  1UHF A;  1PWT A;  2DJQ A;  1GBR A;  1E6H A;  2KRS A;  4CC3 A;  2BZX A;  3R6N A;  4JZ3 A;  2JT4 A;  4RTX A;  1K4U S;  1K76 A;  3EHR A;  4RTW A;  2FRY A;  4JJC A;  1UGV A;  1ZUY A;  3TSZ A;  3IQL A;  5FWB A;  2DLP A;  2LCS A;  2CUB A;  3M0R A;  2ESW A;  2E5K A;  3GBQ A;  1UJY A;  2D1X A;  2GGR A;  2CRE A;  4D8D A;  2AKL A;  4X1V A;  1BB9 A;  2FG0 A;  3VS1 A;  2KYM A;  2LJ1 A;  2OJ2 A;  1QWF A;  3CQT A;  2V1Q A;  3VS3 A;  2PTK A;  2EBP A;  1G2B A;  3VS4 A;  2LMJ A;  1YCS B;  2YUO A;  4HVW A;  1CKB A;  4IIM A;  1X2K A;  1GBQ A;  1ZLM A;  4OMP A;  4CC7 A;  2B86 A;  2D8H A;  3EHQ A;  2A37 A;  1SRL A;  5GJW B;  1NEG A;  3O5Z A;  4RTZ A;  2MIO A;  4AG2 C;  1RI9 A;  2QDL A;  3M0Q A;  2F2W A;  2JS0 A;  4AG1 C;  1E7O A;  2D8J A;  4JJD A;  1JQQ A;  3H0I A;  3M0T A;  4CC4 B;  2BZ8 A;  2J05 A;  5ECA A;  2KXC A;  4AFZ C;  1CSK A;  1VA7 A;  1UHC A;  1T3L A;  2BTT A;  1Y57 A;  3NHN A;  4J9B A;  1UEC A;  2DBK A;  4F17 A;  2KBT A;  3U23 A;  1OPL A;  5IHI A;  2OAW A;  2G6F X;  4LE9 A;  1M30 A;  2K79 A;  1JXM A;  2ED0 A;  4RTY A;  2AZS A;  2DL5 A;  2P4R A;  5IH2 A;  4AFS C;  5HCK A;  2DIL A;  3UA7 A;  1AVZ C;  2DVJ A;  4LN2 A;  2DNU A;  2DL3 A;  2NUZ A;  1NLP C;  4HVU A;  4J9D A;  5L23 A;  4WCI A;  3I5S A;  2KE9 A;  4AFQ C;  2C0O A;  5FW9 A;  1A0N B;  1K0X A;  1AWW A;  1SSH A;  2DRM A;  1OEB A;  1SRM A;  1M3C A;  3VRZ A;  1M3B A;  2F2X A;  1HJD A;  2HDA A;  4A63 B;  1VYT A;  4EIK A;  2ROL A;  1SPK A;  2GNC A;  3UA6 A;  2EYZ A;  1G83 A;  3I5R A;  2DMO A;  2O31 A;  1WX6 A;  1UG1 A;  1T0H A;  3PVQ A;  3VS5 A;  2CH4 A;  1ZUK A;  2ENM A;  2K6D A;  2X3W D;  3VS7 A;  1XOV A;  2L3S A;  4OMM A;  3JV3 A;  3EG2 A;  1KIK A;  2W0Z A;  3QWX X;  1TUD A;  1U06 A;  3KFV A;  4JPB W;  1TG0 A;  1X69 A;  2FRW A;  4Z8A A;  5IXB A;  4OML A;  1OPK A;  5EC7 A;  2K3B A;  3TSW A;  2O88 A;  1OOT A;  2CDT A;  4HVV A;  1YWP A;  1CKA A;  4OMN A;  2V1R A;  1EFN A;  1WXT A;  1JU5 C;  2PZ1 A;  2JM8 A;  2RNA A;  5IXF A;  2F2V A;  4Z89 A;  1U3O A;  3H41 A;  3SEM A;  2JS2 A;  2VKN A;  5IHN A;  2JMA A;  3ULR B;  2LZ6 B;  1YN8 A;  1GFC A;  2M51 A;  2J7I A;  2L3P A;  1S1N A;  2AK5 A;  1AEY A;  2KRO A;  4D8K A;  1QKW A;  1WIE A;  2DM1 A;  1W6X A;  2IIM A;  1QWE A;  2EGC A;  1ZUU A;  3EG1 A;  1RLP C;  2YSQ A;  1X43 A;  1YP5 A;  1JEG A;  1MUZ A;  4J9E A;  2FPF A;  1NEB A;  3RNJ A;  1J3T A;  2EGE A;  2D0N A; 
#chains in the Genus database with same CATH topology
 3M0U A;  3EGX B;  2EJF A;  3I56 Q;  3CMA T;  2RD1 A;  1N9R A;  2XG8 D;  3OS2 A;  3VYG A;  1X6B A;  5KYX A;  2OAU A;  3JB9 D;  5LJ5 d;  1K9M R;  4AT1 B;  1NE8 A;  2VAS A;  4IUR A;  3MP8 A;  4BI8 B;  1BCO A;  1HD3 A;  3INZ A;  2FZK B;  3QG1 A;  1ZA1 B;  4PFO A;  4M77 G;  2SRC A;  2ZZD A;  1Q86 C;  2L89 A;  2GTJ A;  3V7S A;  3HFN A;  2KQW A;  4FYW B;  2R57 A;  2J6O A;  2YUP A;  2GQI A;  1EX4 A;  4J6X A;  1AT1 B;  2BZY A;  1VQN Q;  2ZCF B;  2L2P A;  2PVO B;  4IUQ A;  3EGU A;  2K3Y A;  3LH5 A;  2GFU A;  1PRL C;  2J6K A;  3HKS A;  1M5Q 1;  2HBW A;  3LYI A;  2ZPH B;  2DF6 A;  4BDY A;  5LJ3 e;  1X75 C;  5DM7 R;  1RAB B;  1Y7X A;  4M78 B;  5I11 A;  1K9M U;  3RMS A;  2H3J A;  3ER0 A;  2ABL A;  1BCM A;  2YRD A;  3NMZ C;  3MJX A;  2RJD A;  2XMF A;  2HCK A;  4J9H A;  1OX8 A;  5DY9 A;  2QAS A;  2BKD N;  3CME A;  2LP5 A;  2PQW A;  4M7D B;  1RUW A;  3M59 A;  2LCL A;  2Y4Y A;  4HKE A;  5LJ5 h;  1I8F A;  1QMC A;  2ECZ A;  4QQD A;  1TU0 B;  4K11 A;  2LNH B;  3TVT A;  3EGD A;  5GAN f;  5D6Y A;  2RK1 A;  1UUE A;  2L3Q A;  3EAE A;  3EGX A;  1AWO A;  1IHV A;  2A28 A;  2KEA A;  2X9H A;  3OYJ A;  3QKJ A;  1ABQ A;  1O75 A;  4NL2 A;  4CC2 A;  1ZSG A;  5GMK i;  4J9I A;  1WHM A;  1K9A A;  2KMT A;  5A0G A;  2LT1 A;  2YUN A;  4C8Q G;  1RLQ C;  1PKT A;  2DXT A;  5GAN 3;  5LJ5 g;  2C06 A;  3OYK A;  2CP7 A;  5D7U A;  1KQ2 A;  1I07 A;  3GNG A;  4WTO B;  1VQ4 A;  1KHC A;  1H92 A;  4EMK B;  3C12 A;  3BY7 A;  1XQH A;  2RQT A;  3OS0 A;  1PRM C;  2DA9 A;  1T0J A;  1SG5 A;  2COW A;  1M2O A;  4QT7 A;  3QDR B;  3I35 A;  2V26 A;  2CSI A;  2LC4 A;  4BI3 A;  1WJR A;  3FRN A;  3OW2 S;  3QPH A;  2CP6 A;  2DD4 A;  2K3X A;  3C0C A;  4JJB A;  5GAN 8;  1YI2 A;  3S6W A;  1Y96 A;  3VRY A;  4KUL A;  3M0P A;  2QGF B;  4BY6 B;  3CCQ T;  1YJ9 T;  4LUD A;  3WXM B;  2JMC A;  3UF4 A;  3Q1J A;  2XD0 A;  3CCE Q;  3REA B;  1S72 A;  1VOM A;  2EIF A;  3JCM X;  4C0D B;  1OX9 A;  1BI2 A;  4BE0 A;  4E2F B;  1VYU A;  2RA2 A;  3CD6 A;  2QG9 B;  2OI3 A;  2EYX A;  4XTY A;  1OZ3 A;  1V1C A;  1KFZ A;  4KGX B;  3UWN A;  4ANJ A;  2HEQ A;  5A0L A;  5C0M A;  3QWY A;  3THK A;  2RQU A;  5CIU A;  4PJO F;  2DE0 X;  2EW3 A;  2FPE A;  2HL5 C;  3QHS A;  1BIB A;  1MND A;  1M27 C;  1SHG A;  1UFF A;  1AD5 A;  2YLC A;  2FPD A;  4C8Q A;  2KVQ G;  1YNZ A;  4HCZ A;  1IO6 A;  2ATC B;  3PFS A;  1YJW T;  4ZTF A;  2QTV A;  3OYN A;  3I55 A;  2EQM A;  4A4F A;  2K9G A;  2RK2 A;  4LDV A;  5FRM A;  1M90 U;  1N27 A;  1K73 C;  2DKG A;  2YDL A;  1WXU A;  3ZL7 C;  2YRC A;  2EPD A;  5GAO r;  3CBP A;  4RUG A;  2JJ9 A;  2M9U A;  5EG2 A;  3CC7 Q;  2EVR A;  1NYF A;  1KQS P;  2DBM A;  4C5E A;  1PWT A;  1E6H A;  1RAE B;  1FXX A;  1JBM A;  2BZX A;  2QQR A;  2LQ8 A;  2RHZ A;  1WJQ A;  4RTX A;  3G6E A;  1K76 A;  2LRQ A;  2E10 A;  2QK0 A;  4PJO B;  5GMK l;  2QEX A;  2R58 A;  3MHX A;  3IQL A;  2DLP A;  2E5K A;  1UJY A;  1WHG A;  2CRE A;  1QVG P;  4DOV A;  2V1Q A;  4XTX A;  2PTK A;  2LMJ A;  4N0A A;  1X2K A;  4M77 D;  1GBQ A;  3NFC A;  4DBR A;  1VQM Q;  2B86 A;  4AMC A;  2JUF A;  2A37 A;  5GJW B;  3E9G A;  3EH2 A;  4RTZ A;  3CCQ Q;  3CCM Q;  2E6Z A;  5GAN 2;  3ZFJ A;  3SDZ A;  4LD9 K;  3WVD B;  2D8J A;  4QQG A;  1OQK A;  3V7C A;  3CCR A;  3M0T A;  1KG1 A;  4M7D C;  1IRX A;  5ECA A;  2KXC A;  1H3Z A;  3GNF B;  4DBF A;  2MWO A;  1Y57 A;  2FHD A;  2MYS A;  5KYX B;  3SFM A;  5GAO q;  3CEY A;  3NTK A;  5GAN 7;  2QA4 A;  2G6F X;  4M75 D;  4M75 F;  4PJO A;  2AZS A;  2P4R A;  2DIL A;  3E19 A;  4BI4 A;  4HVU A;  4J9D A;  3I5S A;  2KE9 A;  1A0N B;  2C0O A;  5CKE A;  1XTD A;  1SSH A;  2DRM A;  4RCB A;  1NPP A;  5D6X A;  3JCM d;  3OSS C;  1TSF A;  4F7U B;  1YHQ A;  4OB0 B;  1HJD A;  1YIT A;  3JSC A;  2GF7 A;  3MKD A;  3KXT A;  4BY6 C;  3TCJ A;  2CZ6 B;  4M75 C;  1G83 A;  4DOW A;  2DMO A;  3DB4 A;  4M78 G;  3PVQ A;  4M7A F;  1ZUK A;  3G7Z A;  4M7D G;  2X3W D;  1VQL Q;  5J26 A;  4C0F A;  1I5L A;  3OBW A;  2RJF A;  3EG2 A;  1RI0 A;  1KIK A;  2EYQ A;  4M78 E;  5KYY B;  2E65 A;  3FJP A;  3QWX X;  1TUD A;  3MP6 A;  1FX7 A;  2K3B A;  3TSW A;  4KH0 B;  4FIB A;  3A8O B;  5AYF A;  4OMN A;  3BDL A;  1EFN A;  4J7F A;  4PNO A;  2QTX A;  1JU5 C;  2E1H A;  1YJN T;  1QVF A;  2XI9 A;  3G4S T;  3QBY A;  4ZN3 A;  2VV5 A;  2DIG A;  2VKN A;  2JMA A;  1V29 B;  1YN8 A;  4JS5 A;  2AK5 A;  2KRO A;  2ZPI B;  3CC2 T;  2DM1 A;  3DKM A;  3CCS Q;  1U1S A;  1ZUU A;  2E64 A;  1LJO A;  3SWN B;  5LJ5 e;  4DQ2 A;  4LDY A;  2OX7 A;  3EFO A;  2QQB A;  1RAF B;  1M1G A;  2CP2 A;  4LDU A;  4A4K A;  2DX1 A;  5LJ3 h;  4N4H A;  3JCM g;  4HCB A;  1D1A A;  2KRM A;  5C6S A;  1VQ9 T;  1PKS A;  2Y4X A;  3OS1 A;  1M8M A;  1VQ4 Q;  2QDY B;  3JCM b;  2ED1 A;  5FWC A;  3MO8 A;  2O2O A;  3VUZ A;  7AT1 B;  3M56 A;  2LX7 A;  3CCU T;  2IVW A;  2MOX A;  3VS2 A;  1W1F A;  3OMC A;  1SF9 A;  1X01 A;  3BW1 A;  2E12 A;  3NPF A;  2JTF A;  2L0A A;  2RQV A;  4R55 A;  1I5O B;  1VQ5 Q;  1B07 A;  1VQ5 T;  3OMG A;  1V76 A;  2MI6 A;  4C0G A;  1DJ7 B;  1ABO A;  1M3A A;  1BK2 A;  3I55 Q;  4F14 A;  1B34 A;  4M77 C;  2VGM A;  4C0Z A;  4EDU A;  2CSQ A;  3VS6 A;  2K5I A;  1ZBJ A;  3OYB A;  5KYW A;  3OW2 P;  1W2B S;  2RHU A;  3CC4 T;  5GAN g;  1C0M A;  2RQW A;  2YHT A;  4P5N A;  4F16 A;  1M2V A;  1Q86 U;  2RI2 A;  2V8K A;  1EIF A;  1E6G A;  1PG5 B;  2EKO A;  3FLG A;  3CME Q;  3CCJ A;  2KRN A;  1TWB A;  3VV0 A;  1Y0M A;  3CCU A;  2D6F A;  3CMA A;  2PU9 B;  3NGP A;  2LX9 A;  4TVR A;  3G71 Q;  1JJ2 A;  1Q7Y U;  1AOJ A;  2R5M A;  1VQL A;  5L8R E;  1G3W A;  2CP3 A;  5FU7 C;  2KT8 A;  4JJN K;  3QSU A;  5HK3 A;  5KYU B;  3H6Z A;  1VQ6 T;  1KK7 A;  1YJ9 A;  3PTA A;  3M0S A;  5IT9 E;  4LNP A;  1IGU A;  1X2Q A;  4UC4 A;  2EAY A;  1D09 B;  3M55 A;  4NOY A;  1VQ5 A;  1KC8 U;  3UT1 A;  2JW4 A;  2DXC A;  4PKC C;  2EGA A;  2HSP A;  3JB9 H;  2FO0 A;  3OYL A;  3JCM J;  2R5A A;  1ZSZ B;  1M1K C;  1YJN A;  3N5B B;  1IB8 A;  1SEM A;  2HKN A;  2K2M A;  1Y71 A;  5GAM d;  4FL6 A;  3CCV Q;  4N4G A;  4RG2 A;  3JCM P;  3C4S A;  1HSQ A;  1W2B P;  2DO3 A;  3RIR A;  1D0X A;  1VIF A;  2VGN A;  2E41 A;  2RJC A;  3M58 A;  2YUQ A;  4ZN1 A;  1GCQ C;  3CCE T;  4FT4 A;  4QW2 A;  3JB9 F;  1LVK A;  5I2S A;  1TUG B;  2P0K A;  4X34 A;  3ZEH A;  4PFP A;  3CCU Q;  3QZ9 B;  1ZX6 A;  2DL8 A;  3HTR A;  1R0B G;  1AWJ A;  4QVC A;  3CD6 Q;  1G5V A;  4XTV A;  2GFA A;  2LJ0 A;  4IUP A;  2DJZ A;  1WQ7 A;  3F70 A;  3OYE A;  2DAQ A;  1IZ6 A;  4RTT A;  5FRN A;  1MV0 B;  3TRE A;  1UTI A;  4RTV A;  1IXD A;  1SKU B;  4FYV B;  5GAN e;  1WZO A;  4C92 G;  3GOX A;  2HD0 A;  3FEO A;  3CME T;  4HT9 A;  1VUB A;  2ZGW A;  2CZ1 B;  4O5V A;  2VWF A;  4M75 G;  4RMO A;  2DTO A;  1H3H A;  2RF0 A;  3CPW A;  2KXD A;  5M9O A;  4VUB A;  1Z9Z A;  1PSF A;  3CXC S;  5HKC A;  3URG A;  3LGF A;  4Y28 E;  2X4J A;  3EFS A;  4JLI A;  3I55 T;  5CQX A;  4R56 A;  3FDR A;  2JN0 A;  2LJ3 A;  2Z0W A;  2SEM A;  1YWO A;  2K57 A;  3E2U A;  1WYX A;  2EKH A;  4E47 A;  1NLO C;  2DEU A;  3EG0 A;  2DRK A;  1N5Z A;  2CT4 A;  5GAN d;  3OYG A;  1WI7 A;  2K5F A;  5IHK A;  2PNI A;  4XU0 A;  4M7A E;  4RTU A;  4ZGE B;  2DPP B;  1GBR A;  2LVM A;  1BIA A;  4QKU A;  1UEB A;  1YHQ T;  1B34 B;  2P4T A;  3L42 A;  5CR2 A;  2K5L A;  3SB2 A;  2XDP A;  3QDF A;  1IHW A;  4E7I A;  2RHI A;  2GCX A;  1R8O B;  3G71 T;  2CYZ B;  3BE3 A;  1QCO A;  1YJ9 Q;  4JJC A;  1D0Y A;  1ZHI A;  3J7A F;  3M4G A;  1WPY A;  3TSZ A;  3MP1 A;  2QGG A;  5FWB A;  2CUB A;  3M0R A;  2XU8 A;  3G1J A;  2A3L A;  4LDW A;  3VJP A;  4D8D A;  1BB9 A;  2RM4 A;  4EMK A;  2ZPF B;  2LJ1 A;  3GF5 A;  1BKB A;  2OJ2 A;  1QWF A;  3CQT A;  1C1A A;  5I2M A;  2EBP A;  3JCM f;  4EMH A;  2YUO A;  4JDS A;  5FLX E;  4CC7 A;  2RHX A;  5HK0 A;  2F1L A;  1NEG A;  1VQK T;  1TTH B;  2BIV A;  3S3O A;  3H9N A;  2GQV A;  5KE2 A;  4RKU E;  1JQQ A;  2XDB A;  4L59 A;  3H0I A;  4M7A D;  3CC7 T;  2J05 A;  4KUD K;  3CCV T;  4AFZ C;  1NJI U;  1UHC A;  5DLQ E;  3T9N A;  1Y96 B;  2BTT A;  4J8O A;  2FYK A;  4J9B A;  3VUB A;  3OYD A;  1QP3 A;  1OPL A;  5HY6 A;  5IHI A;  3JB9 I;  3HRU A;  2OAW A;  2NUT A;  3JAM E;  1M30 A;  4RTY A;  5IH2 A;  3MEV A;  4AFS C;  3UA7 A;  1BI3 A;  2IG0 A;  1SSF A;  4LN2 A;  2DL3 A;  1NPR A;  5L23 A;  5GAO m;  3JRZ A;  3G6E Q;  5GAO l;  1K0X A;  2HSE B;  3KBG A;  1OEB A;  4KGZ B;  1NJI C;  1M3C A;  3VRZ A;  2FB7 A;  4WF2 A;  2F2X A;  4M78 C;  1VYT A;  3CC7 A;  2NUP A;  2JZ2 A;  1IGQ A;  4EIK A;  4JS4 A;  3QO3 A;  2MK5 A;  3UA6 A;  1WHH A;  4BE2 A;  2MWP A;  1UG1 A;  4II1 A;  2QQ9 A;  4E7L A;  3VS5 A;  1M2V B;  2BUD A;  4XTW A;  4J7I A;  1I4K 1;  2X4W A;  3OYM A;  2JOY A;  2WSC E;  3JV3 A;  3CCQ A;  3MEA A;  1ZSZ C;  3CPW S;  2O4X B;  2MPX C;  1N8R U;  3CXC A;  1TG0 A;  1X69 A;  5IXB A;  2F69 A;  1OZ2 A;  1OOT A;  3SD4 A;  4HVV A;  4PJM A;  1KQS S;  5GMK e;  1WXT A;  1ACM B;  2K2V A;  2F2V A;  5KYU A;  3SEM A;  1QVP A;  1UGS B;  2M51 A;  2J7I A;  1S1N A;  3M5A A;  1S72 Q;  4C5H A;  2RH2 A;  3CCV A;  3FB9 A;  1FMV A;  1YIJ T;  2OTL Q;  1QWE A;  2KY9 A;  3ASK A;  4A54 A;  1YIJ Q;  4C92 F;  3EG1 A;  2YSQ A;  1YP5 A;  4ATO A;  1YJW Q;  3RKW A;  2DIQ A;  1VQ9 Q;  2HQE A;  3PNW C;  2FPF A;  1NEB A;  2D0N A;  5CKF A;  1KC8 R;  2E6N A;  1UB4 A;  1KQ1 A;  2KR3 A;  4KGV B;  3OYH A;  3A8L B;  5I21 A;  5GAN j;  1BU1 A;  4O6J A;  1OV3 A;  1MMN A;  2A08 A;  2EQI A;  3EG3 A;  2WAC A;  1QQJ A;  4MZT A;  4ZGD B;  1TOV A;  3H8Z A;  2OTJ T;  4MDX A;  2PVD B;  1QCF A;  3V8L A;  3MCA B;  2MCN A;  3FJ5 A;  4M4Z A;  2IPO B;  1F1B B;  2M0Y A;  2KI7 A;  4C92 C;  3L1A A;  2OTL A;  1GL5 A;  2J06 A;  5KH6 A;  1I0C A;  2L3R A;  5KCO A;  3J80 E;  1EZZ B;  4PJO D;  3OYC A;  2FVU A;  1VQ6 Q;  4B9W A;  5GAM e;  4OMQ A;  4M78 A;  1WJS A;  2QA4 Q;  1OU9 A;  4XU2 A;  2QXF A;  2C0I A;  4ZNX A;  2ZPG B;  1K8A C;  1ARK A;  1FMW A;  4GLM A;  1KHI A;  3A5Z B;  4C92 E;  4FYY B;  3QYH B;  4ORZ A;  1KD1 C;  2RO0 A;  4JLG A;  2K4Y A;  1FWZ A;  1KSW A;  4F7U A;  1NM7 A;  1BI1 A;  4JZ4 A;  4F04 B;  1KJW A;  4QVD A;  2EYW A;  3X20 B;  3PE0 A;  1MNE A;  3JCM V;  4M77 F;  1KC8 C;  3A8G B;  1X27 A;  4C8Q B;  2RB6 A;  4XTU A;  2NUT B;  5FU6 C;  4M7A B;  3G4S A;  5J39 A;  5GAN 5;  1MMG A;  1WXB A;  3OQ5 A;  1TUC A;  2RHY A;  3I9Q A;  1VQN T;  4XU1 A;  1PHT A;  5KYN A;  5GAM j;  3JCM e;  5KE3 A;  3CPF A;  1VQ8 T;  1M1K R;  4X9D A;  3OY9 A;  4KBM B;  3TEE A;  2HQX A;  4ESR A;  4M7A G;  1N9S A;  1P92 A;  2KSS A;  1GCQ A;  4OMO A;  1G8X A;  2KK4 A;  2M16 A;  1SHF A;  2MMP A;  1QVG S;  1Q7Y C;  3A98 A;  3CC4 Q;  1MMA A;  1XJW B;  3LWH A;  3QXE B;  2K7A A;  3CCL Q;  3E1S A;  3PMI A;  1U5S A;  1WHJ A;  2W10 A;  4C8Q F;  5GAM h;  3CCS T;  4J9F A;  4E7H A;  1QVF S;  2FEI A;  3L2Q A;  3CCR T;  4OVA A;  2DVE A;  3CCR Q;  2C0T A;  3RDV A;  3GLX A;  1UGR B;  4IUT A;  1NJI R;  2RPN A;  1B7T A;  4PFZ A;  4PK4 A;  1BBZ A;  4KT0 E;  4HCK A;  1VQO Q;  3OYF A;  3RR6 A;  2GTO A;  6AT1 B;  2OTL T;  4M7A A;  1Z9Q A;  1TS9 A;  2BE9 B;  4M77 A;  1G3S A;  1NYG A;  4LUE A;  3MEW A;  2OTJ A;  1UJ0 A;  2HNI A;  4IUU A;  2DFU A;  1FYN A;  2DL4 A;  1H8K A;  8ATC B;  1PD1 A;  2QA4 T;  5CQY A;  4GLK A;  1YI2 T;  3BDU A;  2EJG A;  5GAM f;  2QEX Q;  2LQN A;  1JJ2 S;  3P8D A;  5I22 A;  3JCM h;  1ZSZ A;  4ZGJ B;  3VU3 C;  4JRP A;  3EG9 A;  4RCC A;  3L2Z A;  2JTE A;  4HA8 A;  4MML A;  1YJN Q;  3QYG B;  1RL2 A;  4F7U G;  1LCK A;  1YI2 Q;  3PMT A;  1IRE B;  1X6G A;  5AT1 B;  3RKY A;  3LX7 A;  4Y92 A;  3RKX A;  3EH1 A;  5A0D A;  4FT2 A;  3LLR A;  4M7D D;  1Q82 U;  2RMO A;  2AKK A;  2CP5 A;  1M90 R;  2B8A A;  1VQK A;  2ROT A;  2A36 A;  2CKK A;  2EQK A;  2JM9 A;  4FW2 A;  3MPU B;  3VKI A;  5GAO n;  3DB3 A;  2YLB A;  4Z02 A;  2YT6 A;  2RI3 A;  4M77 B;  2WSE E;  3V8J A;  2PUO B;  3X25 B;  4NL3 A;  1WDX A;  4KRT A;  1VYV A;  1PCX A;  4DBH A;  1NG2 A;  4FSS A;  1VQ8 Q;  1OYX A;  1VQ7 T;  3GPL A;  1WLP B;  3LWI A;  1VQ7 Q;  1UHF A;  2DJQ A;  3RMQ A;  4M7D F;  4Q5W A;  4CC3 A;  3TU4 K;  4JZ3 A;  1RAG B;  4M78 D;  4KUI A;  1UGQ B;  4F7U E;  2G3R A;  2I2L A;  3EHR A;  3QJY A;  2E70 A;  3DLL A;  2LDM A;  2LCS A;  1D0Z A;  2ESW A;  5CKD A;  3NTI A;  2DTH A;  3OYI A;  2NUP B;  2AKL A;  2KYM A;  4V2S A;  2CZ0 B;  3MET A;  4BDZ A;  5KYY A;  4OB3 B;  5CK9 A;  1YCS B;  2VC8 A;  4HVW A;  1CKB A;  3SWN C;  3MEU A;  3CPW P;  1ZLM A;  1R0C B;  3V8K A;  3EHQ A;  4DBQ A;  8AT1 B;  1M90 C;  1SRL A;  1K73 R;  1Q81 U;  1X6O A;  2HQH A;  3CBM A;  1ZQ1 A;  1D3B A;  1OI1 A;  1RI9 A;  3HPW A;  1RAI B;  2DXU A;  2F2W A;  2JS0 A;  1NZ9 A;  1KD1 R;  4AG1 C;  1E7O A;  1I81 A;  2QQS A;  2Y90 A;  1BYM A;  3HSB A;  2JVV A;  2BZ8 A;  1CSK A;  1VA7 A;  2E3H A;  3JCM Q;  9ATC B;  4A53 A;  1JB0 E;  1GXI E;  3NHN A;  2DBK A;  2PVG B;  3U23 A;  5GMK h;  4J83 A;  3L2R A;  4L6V 5;  1JXM A;  5CO7 A;  1Q86 R;  4C92 D;  4QVZ A;  1AVZ C;  2F5T X;  1TXQ A;  2DVJ A;  2DNU A;  2NUZ A;  1U1T A;  4E7S A;  1AWW A;  1YHQ Q;  4E7K A;  1SRM A;  1M9S A;  1G3T A;  2DK3 A;  2LT4 A;  5GAN h;  2A7Y A;  1HK9 A;  4A63 B;  2X4X A;  2EQJ A;  1W2B A;  2YRV A;  2GNC A;  2EYZ A;  2MAM A;  2P0Q A;  1VQK Q;  3AT1 B;  2O31 A;  2PUK B;  1Q7Y R;  1WX6 A;  2L5Q A;  2YWW A;  3G71 A;  1VQ4 T;  4PJO C;  3CBO A;  3HRS A;  2VB6 A;  3JCM W;  3I56 T;  3CMA Q;  2E3I A;  1BI0 A;  2H3E B;  4EMK C;  3LW5 E;  2EJ9 A;  3A8M B;  2W0Z A;  3CCJ Q;  3PIP A;  4M75 E;  3KFV A;  3CCJ T;  2OTJ Q;  2FRW A;  4OML A;  1OPK A;  2HZY A;  3R6O A;  2DER A;  3UPU A;  2O88 A;  2X4Y A;  3EG9 B;  2CDT A;  3EFR A;  1YWP A;  2V1R A;  1C6V X;  1UGP B;  1VQM A;  4BD3 A;  3RER A;  2JM8 A;  5CKH A;  3M57 A;  5IXF A;  5KCH A;  2XK0 A;  2ZPB B;  1KQS A;  4D6W A;  3SWN A;  2ZAE A;  5IHN A;  3EFO B;  1TH7 A;  2L3P A;  1AEY A;  5GMK m;  1MMD A;  4LD6 A;  1QKW A;  1WIE A;  2FL7 A;  1YFN A;  1W6X A;  3A1P A;  1QW1 A;  2EGC A;  1RLP C;  2MF2 A;  1MUZ A;  5FU6 B;  1VQO T;  3CXC P;  3VYH B;  3RNJ A;  3FC3 A;  2EGE A;  1J3T A;  4HT8 A;  2CGH A;  2V8J A;  3FIF A;  3OW2 A;  2JTM A;  3CCL A;  1JO8 A;  2NWM A;  3PVL A;  4C0D C;  1D1C A;  3CC4 A;  4QQ6 A;  2VXF A;  2QQA A;  4B6M A;  5A2Q E;  4PLI A;  3GP8 A;  1JJ2 P;  2P0P A;  5LJ3 g;  3A8H B;  5LL6 S;  2O9S A;  3NTH A;  4MZM A;  2KYB A;  4E6R A;  1MGQ A;  1WNL A;  3S3N A;  1KD1 U;  3HL8 A;  4PJN A;  4R0K A;  2RJE A;  3H0H A;  2JXB A;  4C8Q E;  4FU6 A;  4DEX A;  4GBQ A;  1T3S A;  2VUB A;  2DTI A;  3QII A;  1PNJ A;  4FSX A;  4MZP A;  4C5G A;  3V7R A;  4M75 B;  1K8A U;  1S72 T;  4CRI A;  4L5G A;  4C92 B;  2CZ7 B;  4OGE A;  1GFD A;  5LJ5 j;  4PJL A;  1QVF P;  3LH0 A;  4BE1 A;  3WVE B;  4PJO E;  2DL7 A;  3CC2 Q;  2FZG B;  2DYB A;  5CAI A;  2KNB B;  1B3Q A;  2LQK A;  4IIO A;  3M53 A;  5IN1 A;  4F7U F;  1VQ6 A;  4E7Z A;  5GJV B;  1D1B A;  3RUX A;  1Q82 C;  3H0F A;  2X51 A;  3CCE A;  4AFU C;  5GAN 6;  2EWN A;  3M54 A;  3C94 A;  3X24 B;  4J9G A;  4IKF A;  1M1F A;  2O4X A;  3VS0 A;  1AZE A;  4M7A C;  2EQU A;  2KGT A;  3OYA A;  2O01 E;  1YIT Q;  3L2V A;  3P8H A;  1YIT T;  3HHT B;  3HP9 A;  1QLY A;  5FU7 B;  2CUD A;  2H8H A;  3CD6 T;  1K0S A;  4N4I A;  4JRQ A;  1U8R A;  5LJ3 d;  4Z88 A;  4PJJ A;  1YJW A;  1JXO A;  2KT1 A;  1MHN A;  3QJ6 A;  2E4H A;  1N8R R;  2X35 A;  4JRK A;  3UAT A;  2AHJ B;  4KH1 B;  2LQW A;  4DEY A;  4M75 A;  5GAM g;  1K9M C;  1G3Y A;  2CT3 A;  4FCY A;  3G6E T;  3SHW A;  1RAH B;  4C92 A;  5GMK j;  4YTL A;  3OS5 A;  2VVK A;  2O9V A;  1VQL T;  1FMK A;  4XAX B;  4B9X A;  1YCY A;  2KAF A;  1LNX A;  2COZ A;  1YIJ A;  4RG8 A;  2VXE A;  1LOJ A;  1UE9 A;  2EFI A;  1HXD A;  3REB B;  3P8B B;  3D7S B;  1QKX A;  3KUF A;  3X26 B;  1GCP A;  1XNI A;  1GRI A;  1W70 A;  5LJ5 f;  4N0A C;  2M0O A;  3OSV A;  3G4S Q;  4EPC A;  3EGD B;  5IAY A;  1NBE B;  1Q81 R;  2P84 A;  5KYW B;  4JRI A;  2AZV A;  1QP2 A;  1VQM T;  4GY5 A;  3QUI A;  5D6W A;  2X3X D;  4OP0 A;  4X9C A;  4LXC A;  4A4G A;  3CCM T;  1QVG A;  4J9C A;  2XDD A;  3E9F A;  1VQN A;  4MDW A;  4A4E A;  1K1Z A;  1YBY A;  4HXJ A;  1UDL A;  2I0N A;  4J6Y A;  1RAD B;  2NLU A;  2RN8 A;  2L8D A;  4C5I A;  4M77 E;  2D9T A;  1QCN A;  1ZBX A;  4ZTJ A;  2DZC A;  4PLL A;  2J6F A;  1WA7 A;  2CH4 W;  5GAO p;  1WFW A;  1AZG B;  4LDX A;  1R77 A;  3PIO A;  3LGL A;  2CP0 A;  2M1H A;  3J81 E;  2GBQ A;  1HYO A;  3RBB B;  1MV3 A;  2RQR A;  1WHK A;  2DEQ A;  1VQ7 A;  5LJ3 j;  1AHJ B;  1AWX A;  1K73 U;  2EYY A;  4MMK A;  1I1J A;  2XID A;  4XTZ A;  4C8Q C;  3CCS A;  3DLM A;  4HCC A;  5CKB A;  1PSE A;  3BFM A;  2KRS A;  2CS7 A;  3R6N A;  2JT4 A;  4BB7 A;  3S3M A;  1K4U S;  4OB2 B;  4M78 F;  2HKQ B;  4RTW A;  1Q81 C;  2E5Q A;  1W4S A;  2FRY A;  3TQ7 P;  3QZ5 B;  4ELZ C;  1UGV A;  1ZUY A;  2LNV A;  3GBQ A;  4IUV A;  2D1X A;  2GGR A;  4X1V A;  1Q95 G;  2QYZ A;  2FG0 A;  3C95 A;  3VS1 A;  3L2W A;  3VS3 A;  1LPL A;  1G2B A;  1VQP T;  3VS4 A;  1RAC B;  4IIM A;  5CCA A;  3M4Y A;  4OMP A;  4XU3 A;  4ELY C;  1M4Z A;  1N8R C;  2D8H A;  3O5Z A;  2MIO A;  4AG2 C;  3OYY A;  2KDS A;  2WSF E;  3RES A;  2QDL A;  3HFO A;  3M0Q A;  3JB9 G;  4JJD A;  2AIR B;  3PT9 A;  2XKO C;  2JNG A;  4CC4 B;  3O8V A;  1VQP Q;  2XHC A;  1T3L A;  3OBY A;  2LCC A;  4FW1 A;  1OU8 A;  3JCM c;  1JRI A;  5J3B A;  1UEC A;  4BUG A;  3UDC A;  2KBT A;  3X28 B;  4F17 A;  1VQO A;  3JB9 J;  5FRO A;  3CCL T;  1Q82 R;  4LE9 A;  2K79 A;  2ZPE B;  2ED0 A;  2RI5 A;  5GAN 4;  2DL5 A;  4XQ3 A;  5HCK A;  3I56 A;  1Y07 A;  1NLP C;  2DD5 A;  4C8Q D;  2QAZ A;  4M7D A;  2YXY A;  4WCI A;  4PL6 A;  4AFQ C;  5FW9 A;  3HRT A;  3ZBD A;  4A4H A;  4XK8 E;  4ME7 A;  1M3B A;  1VQ9 A;  4M7D E;  4EMG A;  2HDA A;  1M8V A;  1WGS A;  1PM3 A;  2M02 A;  1D3B B;  2ROL A;  1VQ8 A;  1SPK A;  1WHL A;  1H64 1;  3I5R A;  1PC0 A;  3GIB A;  1PD0 A;  1T0H A;  4E7J A;  5DLO A;  2NYS A;  2CH4 A;  4CI0 C;  3CCM A;  2ENM A;  4J6W A;  2K6D A;  4NS5 A;  2QEX T;  3VS7 A;  2VYT A;  3CC2 A;  1XOV A;  2V8I A;  3OA6 A;  2L3S A;  4OMM A;  2QI2 A;  2HAX A;  4OF1 A;  2LTO A;  3M9Q A;  4FYX B;  3PGG A;  1VQP A;  1K8A R;  2D0Q B;  2FZC B;  2DZ9 A;  4PJO G;  4FM4 B;  1O9S A;  4OB1 B;  1U06 A;  2XIC A;  4DA4 A;  4JPB W;  4Z8A A;  2AT1 B;  4OMF B;  5EC7 A;  2DET A;  2COY A;  3AHU A;  1N6A A;  1CKA A;  2HBP A;  2DYI A;  2PZ1 A;  3L2U A;  2RNA A;  1OUL A;  1ZA2 B;  4Z89 A;  1WQW A;  1U3O A;  3H41 A;  2JS2 A;  3ULR B;  2LZ6 B;  1GFC A;  2HMA A;  4D8K A;  4JUV A;  5LJ3 f;  2IIM A;  4OGC A;  2HL3 A;  4Y91 A;  4J5Y A;  1VIE A;  3OB9 A;  3ME9 A;  1X43 A;  2F5K A;  2A0F B;  4BAC A;  1JEG A;  2BE7 D;  2DXB A;  4J9E A;  5CVI A;  1M1K U;  1RAA B; 
#chains in the Genus database with same CATH homology
 3M0U A;  2DX1 A;  2KR3 A;  1JO8 A;  1BU1 A;  2KRM A;  2NWM A;  1OV3 A;  1X6B A;  3PVL A;  1PKS A;  1M8M A;  2A08 A;  2EQI A;  3EG3 A;  2ED1 A;  5FWC A;  2O9S A;  2O2O A;  2KYB A;  4E6R A;  1QCF A;  2MCN A;  3FJ5 A;  2LX7 A;  4M4Z A;  2M0Y A;  2MOX A;  3VS2 A;  1HD3 A;  4R0K A;  1W1F A;  3H0H A;  2JXB A;  1GL5 A;  2J06 A;  3NPF A;  2SRC A;  2L0A A;  4DEX A;  4GBQ A;  1I0C A;  2RQV A;  1T3S A;  2GTJ A;  1PNJ A;  1B07 A;  4OMQ A;  2J6O A;  2YUP A;  1ABO A;  2GQI A;  1M3A A;  1BK2 A;  4F14 A;  2C0I A;  2BZY A;  4ZNX A;  1ARK A;  2L2P A;  4GLM A;  3EGU A;  3LH5 A;  2CSQ A;  1PRL C;  2J6K A;  2HBW A;  3VS6 A;  1ZBJ A;  2DF6 A;  1GFD A;  2RQW A;  4ORZ A;  5I11 A;  4F16 A;  1KSW A;  2ABL A;  1E6G A;  3NMZ C;  2DL7 A;  1NM7 A;  2DYB A;  2KNB B;  1B3Q A;  4IIO A;  2XMF A;  2HCK A;  4JZ4 A;  4J9H A;  1KJW A;  2KRN A;  2EYW A;  3PE0 A;  2LP5 A;  1RUW A;  1Y0M A;  5GJV B;  1X27 A;  2ECZ A;  3NGP A;  4K11 A;  3H0F A;  2LNH B;  3TVT A;  4AFU C;  1WXB A;  1AOJ A;  1UUE A;  1TUC A;  2L3Q A;  4J9G A;  1AWO A;  2A28 A;  2KEA A;  3I9Q A;  1PHT A;  3VS0 A;  1ABQ A;  1AZE A;  2KT8 A;  2KGT A;  4CC2 A;  3M0S A;  1ZSG A;  4LNP A;  4J9I A;  1X2Q A;  1QLY A;  2CUD A;  1K9A A;  2H8H A;  2YUN A;  1RLQ C;  1PKT A;  1K0S A;  4ESR A;  4Z88 A;  2JW4 A;  1JXO A;  1GCQ A;  4OMO A;  2EGA A;  2KT1 A;  1I07 A;  2HSP A;  1SHF A;  2FO0 A;  3A98 A;  3UAT A;  2LQW A;  1H92 A;  4DEY A;  2K7A A;  2CT3 A;  1U5S A;  2RQT A;  2W10 A;  1SEM A;  3SHW A;  4J9F A;  2K2M A;  1PRM C;  2FEI A;  2DA9 A;  1T0J A;  2O9V A;  2VVK A;  2C0T A;  4QT7 A;  1HSQ A;  3I35 A;  2CSI A;  1FMK A;  2RPN A;  1BBZ A;  4HCK A;  2YUQ A;  1GCQ C;  2GTO A;  3C0C A;  4JJB A;  3VRY A;  1Z9Q A;  1UE9 A;  3M0P A;  4LUD A;  1NYG A;  2JMC A;  4LUE A;  1ZX6 A;  2DL8 A;  3REB B;  3UF4 A;  1UJ0 A;  1QKX A;  1AWJ A;  3REA B;  1GCP A;  2LJ0 A;  1GRI A;  1W70 A;  1FYN A;  2DL4 A;  1H8K A;  4RTT A;  1VYU A;  1MV0 B;  1UTI A;  4RTV A;  2OI3 A;  2AZV A;  2LQN A;  2EYX A;  1V1C A;  1KFZ A;  5I22 A;  2VWF A;  2HEQ A;  2X3X D;  1H3H A;  2RF0 A;  3QWY A;  2KXD A;  3THK A;  2RQU A;  4J9C A;  1Z9Z A;  2JTE A;  2DE0 X;  2EW3 A;  2FPE A;  1K1Z A;  4HXJ A;  1UDL A;  2I0N A;  1LCK A;  1M27 C;  1SHG A;  2RN8 A;  1X6G A;  1UFF A;  1AD5 A;  4Y92 A;  2FPD A;  1YNZ A;  1IO6 A;  2RMO A;  2AKK A;  2J6F A;  1WA7 A;  2LJ3 A;  2CH4 W;  2ROT A;  2K9G A;  2SEM A;  2A36 A;  2JM9 A;  1YWO A;  1WFW A;  1AZG B;  2YT6 A;  1WYX A;  2EKH A;  2GBQ A;  3RBB B;  1MV3 A;  2RQR A;  1NLO C;  2YDL A;  1WDX A;  1WXU A;  3EG0 A;  4KRT A;  3ZL7 C;  1VYV A;  1N5Z A;  2CT4 A;  2DRK A;  2EPD A;  1WI7 A;  5IHK A;  1NG2 A;  1AWX A;  4FSS A;  2EYY A;  2PNI A;  4RUG A;  1I1J A;  1WLP B;  2EVR A;  1NYF A;  4RTU A;  2DBM A;  1UHF A;  1PWT A;  2DJQ A;  1GBR A;  1E6H A;  2KRS A;  4CC3 A;  2BZX A;  3R6N A;  4JZ3 A;  2JT4 A;  4RTX A;  1K4U S;  1K76 A;  3EHR A;  4RTW A;  2FRY A;  4JJC A;  1UGV A;  1ZUY A;  3TSZ A;  3IQL A;  5FWB A;  2DLP A;  2LCS A;  2CUB A;  3M0R A;  2ESW A;  2E5K A;  3GBQ A;  1UJY A;  2D1X A;  2GGR A;  2CRE A;  4D8D A;  2AKL A;  4X1V A;  1BB9 A;  2FG0 A;  3VS1 A;  2KYM A;  2LJ1 A;  2OJ2 A;  1QWF A;  3CQT A;  2V1Q A;  3VS3 A;  2PTK A;  2EBP A;  1G2B A;  3VS4 A;  2LMJ A;  1YCS B;  2YUO A;  4HVW A;  1CKB A;  4IIM A;  1X2K A;  1GBQ A;  1ZLM A;  4OMP A;  4CC7 A;  2B86 A;  2D8H A;  3EHQ A;  2A37 A;  1SRL A;  5GJW B;  1NEG A;  3O5Z A;  4RTZ A;  2MIO A;  4AG2 C;  1RI9 A;  2QDL A;  3M0Q A;  2F2W A;  2JS0 A;  4AG1 C;  1E7O A;  2D8J A;  4JJD A;  1JQQ A;  3H0I A;  3M0T A;  4CC4 B;  2BZ8 A;  2J05 A;  5ECA A;  2KXC A;  4AFZ C;  1CSK A;  1VA7 A;  1UHC A;  1T3L A;  2BTT A;  1Y57 A;  3NHN A;  4J9B A;  1UEC A;  2DBK A;  4F17 A;  2KBT A;  3U23 A;  1OPL A;  5IHI A;  2OAW A;  2G6F X;  4LE9 A;  1M30 A;  2K79 A;  1JXM A;  2ED0 A;  4RTY A;  2AZS A;  2DL5 A;  2P4R A;  5IH2 A;  4AFS C;  5HCK A;  2DIL A;  3UA7 A;  1AVZ C;  2DVJ A;  4LN2 A;  2DNU A;  2DL3 A;  2NUZ A;  1NLP C;  4HVU A;  4J9D A;  5L23 A;  4WCI A;  3I5S A;  2KE9 A;  4AFQ C;  2C0O A;  5FW9 A;  1A0N B;  1K0X A;  1AWW A;  1SSH A;  2DRM A;  1OEB A;  1SRM A;  1M3C A;  3VRZ A;  1M3B A;  2F2X A;  1HJD A;  2HDA A;  4A63 B;  1VYT A;  4EIK A;  2ROL A;  1SPK A;  2GNC A;  3UA6 A;  2EYZ A;  1G83 A;  3I5R A;  2DMO A;  2O31 A;  1WX6 A;  1UG1 A;  1T0H A;  3PVQ A;  3VS5 A;  2CH4 A;  1ZUK A;  2ENM A;  2K6D A;  2X3W D;  3VS7 A;  1XOV A;  2L3S A;  4OMM A;  3JV3 A;  3EG2 A;  1KIK A;  2W0Z A;  3QWX X;  1TUD A;  1U06 A;  3KFV A;  4JPB W;  1TG0 A;  1X69 A;  2FRW A;  4Z8A A;  5IXB A;  4OML A;  1OPK A;  5EC7 A;  2K3B A;  3TSW A;  2O88 A;  1OOT A;  2CDT A;  4HVV A;  1YWP A;  1CKA A;  4OMN A;  2V1R A;  1EFN A;  1WXT A;  1JU5 C;  2PZ1 A;  2JM8 A;  2RNA A;  5IXF A;  2F2V A;  4Z89 A;  1U3O A;  3H41 A;  3SEM A;  2JS2 A;  2VKN A;  5IHN A;  2JMA A;  3ULR B;  2LZ6 B;  1YN8 A;  1GFC A;  2M51 A;  2J7I A;  2L3P A;  1S1N A;  2AK5 A;  1AEY A;  2KRO A;  4D8K A;  1QKW A;  1WIE A;  2DM1 A;  1W6X A;  2IIM A;  1QWE A;  2EGC A;  1ZUU A;  3EG1 A;  1RLP C;  2YSQ A;  1X43 A;  1YP5 A;  1JEG A;  1MUZ A;  4J9E A;  2FPF A;  1NEB A;  3RNJ A;  1J3T A;  2EGE A;  2D0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...