3EG2A

Crystal structure of the n114q mutant of abl-sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
b'MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg2A00
2EGCA 2V1RA 1JO8A 3EG1A 1WDXA 2DRMA 4JZ4A 1GBRA 5FWBA 3I5RA 2HDAA 3PVQA 2P4RA 2OJ2A 2VVKA 4FSSA 1MUZA 1AWJA 1QKWA 4RTWA 4HXJA 2C0TA 2YSQA 2NUZA 2LNHB 2LX7A 2CH4W 3EGUA 1WIEA 2JXBA 1QKXA 2FEIA 4IIOA 2JTEA 2PTKA 2IIMA 4EIKA 1B3QA 3NHNA 4J9EA 1GBQA 1VYTA 1BB9A 4HCKA 1ZUUA 2O2OA 2FG0A 3REBB 2ENMA 1VYUA 2OAWA 1FMKA 4CC3A 2DL4A 2K6DA 3VS3A 4A63B 2JW4A 1OPKA 2M0YA 3NMZC 1YN8A 2EGEA 4CC2A 2X3XD 3NPFA 2F2VA 5HCKA 1Y0MA 4J9CA 2DMOA 1I07A 2CH4A 2CREA 2DX1A 2A28A 2A08A 5IXFA 5I11A 1X6GA 1AWXA 2AZSA 3RNJA 1Z9ZA 1UTIA 2BZXA 2KXDA 3UA6A 1UHFA 2KBTA 1WXBA 1X69A 3EG3A 3I5SA 1NYGA 2ESWA 5FW9A 2CUDA 4F16A 2LJ1A 1KJWA 1PKSA 2RN8A 2DLPA 3A98A 3M0TA 2E5KA 1K1ZA 1NEBA 2A36A 1UUEA 1X2QA 1BU1A 1KFZA 1QCFA 1QWEA 1SRLA 4J9GA 2PNIA 2JT4A 3VS4A 2LMJA 5FWCA 4AG1C 1ZBJA 1MV0B 3VS1A 1XOVA 1UDLA 2LZ6B 1PHTA 1TUCA 3EG0A 2DA9A 2GNCA 2KE9A 2LJ0A 2YUOA 3PE0A 2EQIA 4GBQA 5IXBA 2HBWA 2RQVA 4JPBW 2EW3A 3EG2A 1PRLC 2O9VA 2DVJA 1SSHA 2JM9A 4DEXA 4RTZA 1QLYA 2O88A 1NG2A 4J9BA 2KROA 1NLPC 4LUEA 2DL8A 2HEQA 2DM1A 1TG0A 1WYXA 2CUBA 2O9SA 4AFQC 1M3CA 4F14A 3JV3A 4RUGA 1AZEA 3ULRB 2DBKA 5ECAA 1G2BA 1ABOA 1AD5A 1X27A 1X2KA 2FRYA 4HVVA 1K4US 1M30A 1ZUKA 1UGVA 4ORZA 1QWFA 2D1XA 4R0KA 2L3PA 4DEYA 2D8JA 1WXUA 4WCIA 3VS6A 3TVTA 3M0PA 2DE0X 2FO0A 1WFWA 2KRSA 2FPDA 2JMCA 5EC7A 1SHFA 1AWOA 2GTJA 1GCQA 3VS7A 4LN2A 5L23A 3UA7A 1YWOA 1CKBA 3FJ5A 2ROTA 2DL7A 2O31A 4RTVA 2BZ8A 1FYNA 5I22A 2F2XA 4JZ3A 1AEYA 2RMOA 1SPKA 2DJQA 1T3SA 1PNJA 2L2PA 4OMMA 2JMAA 2CSIA 3SEMA 4AG2C 1U3OA 1PWTA 4CC4B 2J05A 2DRKA 1GFDA 2D0NA 2D8HA 2OI3A 4J9HA 3VS2A 1V1CA 4KRTA 2XMFA 2J6KA 2L3QA 4Z8AA 2GQIA 2V1QA 2YUQA 2K9GA 2K79A 2L0AA 2EYYA 2MOXA 1UFFA 4AFSC 1OPLA 4F17A 2EYWA 4J9IA 2CT3A 1JXMA 2KT8A 2LCSA 1I1JA 2KRNA 3TSZA 1NEGA 2KGTA 2KXCA 2RF0A 3H41A 2SRCA 2RNAA 1VA7A 2AK5A 2AZVA 2KYMA 1T3LA 1KIKA 4J9DA 1Y57A 1UECA 1LCKA 2C0OA 2J06A 2KR3A 3M0QA 3VRYA 1S1NA 2QDLA 4RTXA 3UF4A 4ZNXA 1RLPC 4JJCA 3KFVA 2W0ZA 3CQTA 2KT1A 3RBBB 2EKHA 2ED1A 2RQTA 1AZGB 2DF6A 1KSWA 4Y92A 2FPEA 2YUPA 1H8KA 4Z89A 4D8KA 3PVLA 1JQQA 1UJ0A 2X3WD 2DNUA 2I0NA 3UATA 2DL5A 2EPDA 2GGRA 2DL3A 2HSPA 2LQWA 1ARKA 4AFUC 1SEMA 2B86A 4OMPA 2NWMA 5IH2A 1GRIA 1M27C 1NM7A 3ZL7C 2DYBA 1T0HA 2J7IA 3VS0A 3THKA 1EFNA 1M8MA 3H0FA 1M3AA 1WX6A 2LP5A 2YT6A 4RTTA 1ABQA 1YNZA 3EHRA 2C0IA 3R6NA 3VS5A 4D8DA 1K76A 3REAB 2KYBA 1OV3A 1WLPB 1UHCA 2EGAA 2FRWA 1J3TA 1H92A 2K3BA 2GBQA 1AOJA 3QWXX 2AKKA 5GJVB 1WA7A 1CSKA 3SHWA 4HVWA 4K11A 1IO6A 2G6FX 1AVZC 1H3HA 2SEMA 4LE9A 1UJYA 2BTTA 1JEGA 2YDLA 1N5ZA 3H0IA 1G83A 3I35A 1U5SA 2H8HA 2KNBB 3I9QA 2LJ3A 4JJBA 3EHQA 4RTYA 2JS2A 2J6FA 2J6OA 1MV3A 1Z9QA 3LH5A 1SHGA 1JU5C 2W10A 1YP5A 2ECZA 1I0CA 4OMNA 2ROLA 2BZYA 3C0CA 1WI7A 1E7OA 3M0SA 2JS0A 1A0NB 1E6GA 4QT7A 1RI9A 1GCQC 1W1FA 2RQWA 1UG1A 3NGPA 1K0SA 4LUDA 2A37A 1NYFA 2MIOA 4ESRA 4OMLA 1BBZA 1YWPA 4GLMA 3VRZA 4AFZC 1OEBA 1W6XA 2HCKA 1U06A 2DILA 2M51A 1GL5A 4E6RA 1ZX6A 2L3SA 4OMOA 2GTOA 3M0UA 1HD3A 1TUDA 1E6HA 3QWYA 1UE9A 1ZSGA 2KEAA 2ABLA 2VKNA 2PZ1A 2F2WA 4Z88A 1BK2A 4LNPA 3M0RA 2CSQA 2FPFA 5GJWB 2K7AA 2RQRA 3H0HA 1VYVA 3U23A 4CC7A 1K0XA 1OOTA 1HJDA 1GCPA 4X1VA 1W70A 4OMQA 2K2MA 1JXOA 1T0JA 4IIMA 1GFCA 1CKAA 1X43A 2RQUA 4M4ZA 1AWWA 3IQLA 1WXTA 2AKLA 5IHNA 2ED0A 2EYXA 1ZUYA 3TSWA 1SRMA 1B07A 1M3BA 2CT4A 2JM8A 2KRMA 5IHKA 1K9AA 2LQNA 1HSQA 4J9FA 1NLOC 2DBMA 3GBQA 2EBPA 2RPNA 2EVRA 4JJDA 1PKTA 4RTUA 2YUNA 2MCNA 1ZLMA 4HVUA 1RUWA 1X6BA 3O5ZA 2CDTA 1RLQC 5IHIA 2VWFA 1YCSB 2EYZA 1PRMC
chains in the Genus database with same CATH superfamily
5CAIA 3V8KA 2EGCA 1QQJA 1W2BS 2DXBA 3EG1A 1WDXA 1GBRA 2CGHA 5FWBA 5GMKe 3CC2T 3RMSA 2VGMA 5LJ5g 4EMKB 4RTWA 1D1CA 5GAMe 2JUFA 4XU3A 2LNHB 2CH4W 1XJWB 5EG2A 2JTEA 4N0AA 4M7DE 2RJFA 3QZ9B 4F7UG 1VIEA 4HCKA 1ZSZA 1ZUUA 1RAFB 2CKKA 2FG0A 2XG8D 5IN1A 4L59A 2ENMA 4KUDK 3JCMX 1ZQ1A 3X24B 2DL4A 3CCMQ 3N5BB 2K6DA 1OPKA 2L5QA 4N4IA 3JCMJ 5HK0A 4CC2A 1RAGB 3CPWA 3QDFA 4HKEA 4BUGA 4AMCA 1W2BA 1WJRA 2EQMA 5I11A 3OSVA 2OTJQ 1X6GA 1Q86U 5GAMd 1Q82R 2KXDA 3UA6A 3OA6A 4BY6B 5AT1B 2HD0A 1LNXA 5KYWB 3EG3A 3C94A 1KHIA 4FCYA 4M77D 4F16A 2LJ1A 3SB2A 1U8RA 1KJWA 1I81A 4BACA 2A36A 4JRQA 3VYHB 2XICA 3QG1A 4FL6A 1BU1A 1KFZA 2HZYA 4J9GA 1PD1A 2LC4A 5FWCA 4HT9A 1K9MR 1MV0B 4MMKA 2MWPA 2E3IA 1NZ9A 2LZ6B 2EAYA 1TUCA 2DKGA 3CXCP 1NE8A 2LQ8A 2KE9A 4J5YA 4JDSA 5GAMf 1OX9A 2EQIA 4GBQA 2CS7A 2HBWA 3EG2A 4B6MA 4PK4A 1AHJB 1SSHA 2L8DA 1NG2A 2KROA 1KQ1A 2XHCA 5J26A 4AFQC 1M3CA 4L5GA 4M78B 4UC4A 3CCSQ 3I56T 2LNVA 2K4YA 1D0XA 2E65A 5KH6A 1BIBA 4QVCA 1X27A 1X2KA 3FJPA 4HVVA 1M30A 3G6EA 1ZUKA 4FT4A 4R0KA 2BUDA 1Q82C 3PMIA 6AT1B 5DLOA 4IUTA 2DD4A 1YJWQ 2CP3A 3TVTA 2LX9A 4J6WA 5CKDA 1VQNT 2ZPBB 3HRTA 1G3SA 1WFWA 1EX4A 5EC7A 2K5IA 1AWOA 4J8OA 2M02A 3CD6A 1YWOA 2AHJB 1RL2A 3QXEB 3MPUB 1G3WA 2ROTA 3UT1A 1K9MC 2K2VA 2DL7A 4FYVB 1QVGA 2BZ8A 5I22A 2CP5A 2F2XA 4II1A 1SPKA 2DJQA 3CMAT 1TWBA 2FHDA 4BI3A 1F1BB 1KD1U 2X4XA 1VQ5T 1U3OA 3L2ZA 3SD4A 1VQMQ 1GFDA 2OI3A 4PJOA 3FIFA 3CCVA 4J7IA 4N0AC 2CZ7B 1VQPT 2L3QA 4Z8AA 2YUQA 1PG5B 4ZGJB 2K9GA 2K79A 2L0AA 1ZSZC 2QTVA 1OPLA 2M9UA 4F17A 2CT3A 1OX8A 4M75A 1JXMA 4FU6A 2MPXC 3TSZA 2QA4Q 1MMNA 5CVIA 8ATCB 3H41A 1M90U 2MAMA 2RI3A 1WNLA 2KYMA 1T3LA 2RHZA 2ZPIB 4J9DA 1UECA 5KYUA 5CKHA 1MMGA 2C0OA 1VQ7Q 1C0MA 1VQKA 1YHQA 3E9GA 1KHCA 5C6SA 4PJNA 1YIJT 2W0ZA 3RBBB 4M7AB 3VU3C 1LJOA 2ED1A 4M77E 4DOWA 2DF6A 2QDYB 2DEUA 4OB1B 2R5AA 4GLKA 1R77A 4Z89A 3OMGA 1JQQA 1OZ3A 2X3WD 2I0NA 4CRIA 2GGRA 2DL3A 5GAN8 2YWWA 4AFUC 3CMEQ 3EG9B 3CC7T 1IHVA 3QYGB 4OMPA 1Q7YR 1GRIA 2M0OA 1M27C 1VQ6T 4NOYA 3JCMh 1M8MA 1PSEA 2HL3A 3CPFA 5GAOm 1BKBA 1YNZA 4KGZB 5A0LA 4RCBA 2HAXA 3PGGA 1Y71A 4D8DA 3JB9D 3REAB 4N4GA 4X34A 1OV3A 1WLPB 3G71Q 2EGAA 4M78E 1KC8R 3CXCA 1J3TA 2GBQA 1WA7A 5FU6B 3X25B 4K11A 2G6FX 3UWNA 3CCQQ 2K3XA 2XDDA 1IZ6A 3H0IA 2KNBB 2LJ3A 2EJFA 4Y28E 1MV3A 1SHGA 2W10A 4OP0A 2F1LA 2RA2A 3OYLA 1OYXA 1TH7A 1WI7A 1Y96B 3CCMT 2JS0A 1U1SA 4PLLA 1RI9A 3BE3A 2H3JA 3CCUA 4M78F 3EAEA 1NYFA 3G4SA 3BDUA 2OTJT 5KE3A 1Q7YC 4JS5A 4ESRA 1RABB 1BBZA 1YWPA 3G7ZA 4AFZC 1OEBA 1W6XA 2DXCA 3CBPA 3LH0A 5LJ5e 2MK5A 1YJNA 1ZX6A 3OBWA 4E7HA 2RK2A 2QEXQ 1FMWA 3CC2A 3M0UA 1VQ8A 1MHNA 2P4TA 1ZSGA 1S72A 1WHHA 3DB3A 2QYZA 4PJOC 2QK0A 2F2WA 1VQLT 1OI1A 4LDXA 4RG2A 2CSQA 2DVEA 3U23A 3H0HA 1KC8C 1Q82U 3ME9A 1KG1A 2XDBA 3M54A 1W4SA 5KYNA 3SWNB 3DB4A 1FXXA 2LCCA 3GNGA 4M75C 1CKAA 4FYXB 3CCJQ 4M4ZA 1QVFP 1AWWA 3RMQA 5IHNA 3RIRA 5KE2A 1SRMA 4PJMA 3OYGA 3QIIA 5GANe 1D3BB 1ACMB 2KRMA 4HCBA 1U1TA 5FRMA 2B8AA 1XTDA 1NLOC 4HT8A 2EBPA 1K9MU 2RPNA 4IURA 3X26B 4DA4A 4JJDA 4RTUA 3EFOB 5GAN7 3OY9A 2P0QA 1ZLMA 3MCAB 4F7UE 3CCST 1RLQC 4P5NA 5IHIA 2DIGA 1R0CB 4BI4A 4C92A 3CPWP 3M58A 3DKMA 4M75G 4ZTJA 2V1RA 3GOXA 4L6V5 1YJ9A 4RCCA 2RJEA 2LT4A 2XIDA 3I5RA 1YJWT 2D9TA 4C8QA 5LJ5f 1KD1R 3RDVA 1YI2A 4FSSA 1MUZA 1M2VB 3JCMQ 3RESA 3KXTA 3GF5A 2NUZA 3SFMA 1WIEA 4M7AF 2PTKA 3CCRA 3TU4K 4EIKA 1PD0A 2HMAA 4C0GA 3A8LB 2O4XA 3X20B 2JN0A 3M4GA 2JOYA 3J81E 1FMKA 1UGSB 4BE0A 3F70A 1SSFA 2AT1B 3VS3A 2M0YA 2ZZDA 1IGUA 4N4HA 3FEOA 1VQMT 1D1AA 2F2VA 3VYGA 3I56A 3MP8A 5HCKA 1H641 3A8HB 2LVMA 2CREA 2K57A 5GANf 3JB9I 3OBYA 2A28A 5CKBA 1PC0A 1RADB 4LDWA 2BZXA 2F5TX 2K3YA 4C8QF 1UHFA 2FYKA 3M5AA 2QA4T 5FW9A 2X35A 2RB6A 1PKSA 2JTFA 2E5QA 2DLPA 3M0TA 1K1ZA 3OW2A 4BB7A 1VQ7T 4KGXB 2YHTA 3OS0A 2VB6A 1M2OA 5CIUA 3ZFJA 2JT4A 2FVUA 2YLCA 4AG1C 8AT1B 4JLGA 1PHTA 4LDYA 3EG0A 2DA9A 5LJ3h 4ELZC 2DTHA 2DXUA 2LJ0A 4E7KA 2M1HA 2RQVA 4JJNK 2DO3A 4X9DA 2QQBA 1BI1A 5A0DA 3L2VA 4OVAA 2DVJA 4DEXA 1MGQA 4RTZA 2RHXA 4DBFA 3QZ5B 1IHWA 1QVGP 1VIFA 4JUVA 5GAOn 2DERA 2HEQA 3CMET 2DM1A 1HK9A 3M57A 2EKOA 2CUBA 2O9SA 3CPWS 1VQ4A 1VQPA 2V8JA 3ULRB 2DBKA 5ECAA 3S6WA 4JS4A 1AD5A 3I55A 1VQOA 2DYIA 1V29B 1TXQA 4C0FA 1UGVA 3T9NA 2BE7D 5DLQE 3OYAA 1JRIA 1G5VA 2RO0A 4IUQA 3JB9H 3OYNA 2D8JA 3VS6A 5GAN3 1Q7YU 1TTHB 4M7DA 2FO0A 1VUBA 3V7CA 1QVFA 1YIJA 3CCQT 2R5MA 2JMCA 3A5ZB 4C92C 5D7UA 3EGDB 3UA7A 1VQ9A 4KT0E 4BDZA 2RHIA 1FX7A 4KUIA 5KYYA 3PIOA 1KC8U 2NUPA 2OTLA 1R8OB 5GAN2 4BI8B 1MMAA 2E41A 2NUTB 4PKCC 2QAZA 4XTVA 5FU7C 4C8QC 4NL2A 4IUPA 5DY9A 3CC7A 2L89A 2M16A 5IAYA 2J05A 5GANg 3KBGA 4J9HA 4PJOD 1FWZA 1RACB 3FC3A 4C92G 2V1QA 2MOXA 1UFFA 4AFSC 5L8RE 1KQSP 1D0YA 2XI9A 4M77B 1YBYA 4M7DF 1WHJA 2R58A 2EWNA 1NEGA 2KXCA 2DZCA 2SRCA 2QEXT 1VA7A 2AZVA 4A4FA 3G6EQ 1BCOA 4C8QG 4BDYA 1JJ2A 1JB0E 3CCLQ 2J06A 2QDLA 4RTXA 2FZKB 4ZNXA 1YITA 3OS5A 4D6WA 3LX7A 4J6XA 3WXMB 3CC4A 2RQTA 1D0ZA 2IG0A 4QQ6A 1KSWA 1QCNA 3M4YA 3WVDB 5GAN5 2FPEA 4DBHA 3INZA 3CD6Q 1H8KA 2K5LA 4XTYA 4D8KA 1QVGS 3MEVA 1UJ0A 2DNUA 4XU1A 3MEUA 5HK3A 2EPDA 4C0DC 1N9RA 3META 2HSPA 1ARKA 1WHGA 1ZA2B 1ZA1B 3NTKA 2B86A 4A54A 2JTMA 2FZCB 4LXCA 3PFSA 4ATOA 2OTJA 3ZL7C 2ZGWA 3PNWC 2DYBA 1T0HA 1X01A 2J7IA 3VS0A 3X28B 3CCVQ 5GMKm 3QYHB 3HHTB 2QTXA 5LJ5j 4RTTA 1WZOA 3FRNA 4ELYC 1I8FA 3NFCA 3M53A 2KYBA 3ER0A 1UHCA 2V8IA 5GAOr 2FRWA 4X9CA 3JAME 1VQLA 1H92A 1Y7XA 1AOJA 3QWXX 2AKKA 1I5OB 4KH0B 5GJVB 3VJPA 3SHWA 1GXIE 4A53A 3P8HA 2Y4YA 2DTOA 4LE9A 4EMKA 1JEGA 3G1JA 1U5SA 4C0ZA 4FW2A 4RTYA 4FSXA 4FYYB 2ZPGB 3MHXA 2RK1A 1I0CA 1R0BG 1PSFA 3E1SA 3JCMc 1ZBXA 4M7DC 5GANj 2ROLA 4XU0A 2BZYA 4XQ3A 2E10A 3JCMW 1BYMA 3EFSA 5FROA 1E6GA 4OMFB 1V76A 5KYXB 4QT7A 2WSFE 1W1FA 4RMOA 2RQWA 1QMCA 2IVWA 1UG1A 1B7TA 3NGPA 1K0SA 4LUDA 2A37A 2COWA 3HRSA 3L2QA 1N8RR 5LL6S 4DBQA 1UB4A 1NJIC 4OGCA 2M51A 1GL5A 4OB2B 2CP7A 5GMKh 4OMOA 4PJOE 3OMCA 1E6HA 3D7SB 3HPWA 4JLIA 1Q81R 4M7DG 5KYWA 3CXCS 3ZBDA 2QASA 2VKNA 4Z88A 3TREA 5GAMh 4LNPA 1P92A 2VC8A 4ZTFA 3S3MA 2K7AA 3BY7A 3P8DA 1HJDA 4F7UB 4OMQA 3C4SA 2RD1A 1M9SA 1GFCA 1D1BA 1B34B 2BKDN 2EQJA 3CCEQ 3IQLA 4J83A 2E12A 1WXTA 2AKLA 1RAIB 2ED0A 2EYXA 1B07A 3J7AF 1M3BA 2CT4A 5I2MA 1SG5A 5IHKA 1HSQA 2I2LA 1KQSA 1YCYA 2KI7A 4MZTA 4GY5A 4HVUA 2JZ2A 3QSUA 5HKCA 2VWFA 1VOMA 2P0KA 5GMKi 2HQHA 4M78A 3L2WA 4C92D 1MNEA 3CCUQ 3J80E 4M77F 3G4SQ 3M55A 2VXEA 1QW1A 4JZ4A 1BI3A 3AHUA 1N8RC 2E6NA 3GLXA 3C12A 4E47A 1VQ7A 1YJNQ 3PVQA 3JCMg 2OJ2A 2P0PA 4A4EA 3CC2Q 1VQ8Q 1QKWA 3MP1A 3FLGA 1S72Q 4OB0B 1Q81C 4HXJA 3OW2P 3MP6A 2JXBA 3UDCA 4IIOA 1B3QA 3NHNA 2BIVA 4C5HA 3QKJA 1BB9A 2O2OA 3MKDA 3REBB 1HYOA 2C06A 1FMVA 4QVDA 2CP6A 4CC3A 4MDXA 1DJ7B 4LDVA 3NMZC 1YN8A 2EGEA 4EMKC 2E3HA 2CZ0B 1Y0MA 2DMOA 1IRXA 1I07A 2CH4A 2H3EB 2DX1A 3EGXB 2XD0A 2A08A 5IXFA 1BI0A 2VUBA 2AZSA 3OYYA 3RNJA 1Z9ZA 2CYZB 4QVZA 2E70A 1M5Q1 2AIRB 3FDRA 4LDUA 3I5SA 4Z02A 2ESWA 4MZPA 1WQWA 3C95A 2RN8A 3G6ET 2LT1A 1YJ9Q 2MYSA 1NEBA 2PUKB 3CCLT 2DJZA 3QJ6A 1X2QA 1LPLA 1QCFA 4XTXA 1QWEA 2PNIA 1K73R 3JCMb 3V7RA 2E4HA 5GMKl 3VS1A 3RKYA 2X4YA 4A4KA 1UDLA 1YI2Q 1M1GA 2GNCA 4M7AA 2DIQA 3PE0A 5LJ5d 3CD6T 4BY6C 4JPBW 3CCRQ 4IUUA 4QKUA 1PRLC 2O88A 4XAXB 1NLPC 1LOJA 4LUEA 1WYXA 4F14A 1IB8A 1AZEA 3EG9A 1G2BA 2LDMA 3I56Q 4OF1A 3CCVT 3TEEA 2YRDA 2E64A 4PLIA 3PTAA 5D6XA 1QWFA 3BFMA 2L3PA 1IREB 1WXUA 4E2FB 5GANd 3M0PA 3QJYA 3EH2A 1NJIU 3OW2S 4C92E 1G8XA 2X4WA 3BDLA 2YRVA 2KQWA 1SHFA 1N27A 3FB9A 4KGVB 4HA8A 2WSCE 1K8AR 1JJ2P 4M78C 2GTJA 3OYCA 1GCQA 3PIPA 4LN2A 2HNIA 2ZAEA 1ZSZB 4F7UF 1MMDA 2V26A 1K73C 1CKBA 5KYYB 2LCLA 3FJ5A 2DETA 2KDSA 4PJJA 3O8VA 4F04B 2O31A 4DBRA 5D6YA 4JZ3A 2RMOA 1T3SA 2KVQG 2L2PA 1OU8A 4PFOA 3OYBA 3E9FA 4E7IA 2OAUA 3SEMA 4AG2C 5KCOA 1M8VA 2GFUA 4B9XA 1PWTA 4CC4B 2DRKA 4KULA 2D0NA 1V1CA 1Y96A 4FM4B 1UEBA 2XMFA 3LWHA 2WSEE 2J6KA 1SKUB 1OQKA 2FL7A 1UGRB 3H6ZA 4M78G 2DTIA 3GP8A 2EYYA 1WJSA 1VQ4Q 3MEAA 1VQPQ 4JRKA 2EYWA 4J9IA 3JB9F 1UGQB 1VQNA 2KT8A 3QDRB 3OYIA 2KRNA 3I55Q 2KGTA 1VQOQ 2RNAA 2L3RA 2HQEA 3QUIA 1KIKA 1Y57A 2F69A 4QW2A 4A4GA 4QQDA 4HCCA 1Y07A 2KR3A 3VRYA 3JRZA 2A0FB 1QVFS 3UF4A 5GAOl 4JJCA 1N8RU 3CQTA 2KT1A 5HY6A 3CMAA 1YIJQ 1AZGB 4ME7A 1K8AC 4Y92A 5M9OA 3VV0A 2YUPA 3SWNA 3VUZA 4Y91A 1Q81U 1VQ5A 1VQ9Q 3CEYA 3CCET 2A7YA 2DEQA 1TS9A 4YTLA 3UATA 4A4HA 2OTLQ 3QHSA 4OB3B 2D0QB 5LJ3g 4FIBA 1SEMA 1TSFA 1D3BA 2NWMA 3RR6A 5IH2A 3HSBA 4IUVA 2LQKA 3CC7Q 2CZ6B 4J7FA 4DOVA 3OYEA 2PUOB 3EFOA 2X51A 4M7AC 4JRIA 1EFNA 5LJ5h 2LP5A 2YT6A 3CCUT 1MNDA 1ABQA 2ZCFB 1M1KR 2C0IA 2QQAA 3G4ST 3R6NA 3G71T 2MWOA 3VS5A 1QVPA 5DM7R 4E7JA 4IKFA 4XTZA 3HL8A 4PNOA 3QO3A 1YJNT 1JJ2S 2HBPA 1CSKA 1IO6A 1VQ8T 2RM4A 2NLUA 2SEMA 2DPPB 1S72T 2JNGA 1UJYA 2BTTA 2RJCA 3I35A 1G83A 2DD5A 1M2VA 2GQVA 4E7LA 2K5FA 5CQXA 1YITQ 4M7AG 2JS2A 2J6OA 3CC4Q 5A0GA 1XQHA 5GAN4 1JU5C 4WTOB 1YP5A 2ECZA 5GANh 3OB9A 4PJOB 5CR2A 2MF2A 5AYFA 3E19A 1VQ6A 1A0NB 1G3TA 5FU6C 1GCQC 5CQYA 2HL5C 2MIOA 4M75B 3RKXA 3A1PA 4M75D 3VRZA 3JCMe 2VGNA 1NPRA 2DILA 5KYUB 4AT1B 2DFUA 2E1HA 5I21A 3NTIA 3RKWA 2D6FA 1HD3A 1UE9A 3JB9G 1M1KC 3OYDA 3HTRA 2PU9B 1YJ9T 1BK2A 5CO7A 1O9SA 2NYSA 5GJWB 2RQRA 1VQLQ 1VYVA 2ATCB 4CC7A 1GCPA 3EH1A 5A2QE 2VYTA 1YI2T 1JXOA 3KUFA 3CCJT 4BD3A 1X43A 2KMTA 3CCMA 2LTOA 4CI0C 2KSSA 3OYJA 3CCRT 4ANJA 1ZUYA 5LJ3j 3JCMd 3TSWA 2JJ9A 2JM8A 2GCXA 4JRPA 1K9AA 2LQNA 1K73U 4J9FA 2DBMA 4V2SA 2EVRA 5J39A 2ZPFB 1NJIR 2YUNA 3UPUA 1PCXA 4DQ2A 1X6BA 5I2SA 3O5ZA 1IGQA 2CDTA 4C5IA 1YCSB 3SWNC 2EIFA 1PRMC 4M78D 3EFRA 5IT9E 1NPPA 1JO8A 4ZGDB 2QQSA 2GF7A 2DRMA 1BCMA 3A8MB 2FB7A 3CCLA 2HDAA 2EJGA 2QI2A 4XU2A 3JCMf 1N9SA 2P4RA 2VVKA 1AWJA 1VQKQ 1YHQQ 2C0TA 2YSQA 2LX7A 3EGUA 1QKXA 2FEIA 5C0MA 2IIMA 1YFNA 4J9EA 2RHYA 3EGDA 1GBQA 1VYTA 4PFPA 3L2RA 1VYUA 2WACA 2OAWA 3M59A 4E7SA 1RAHB 4R56A 1H3ZA 4FYWB 4A63B 2JW4A 2QGGA 2QGFB 2NUTA 1OZ2A 3DLLA 3CCSA 1K8AU 1KQSS 5FLXE 7AT1B 2X3XD 3NPFA 2PVDB 2PVGB 1LVKA 2MMPA 4J9CA 2YLBA 1NBEB 4RG8A 2O01E 2CZ1B 1AWXA 3MEWA 1UTIA 1VQ4T 4EPCA 1BIAA 2G3RA 1YJWA 4KH1B 2KBTA 3JSCA 1WXBA 1X69A 2HSEB 1NYGA 3I55T 3LGLA 1VQOT 4M77A 2CUDA 1HXDA 3A98A 2E5KA 1TUGB 4NL3A 1UUEA 9ATCB 4M75E 1M4ZA 2HKQB 1SRLA 2DXTA 1EIFA 3VS4A 2LMJA 3L42A 4LD6A 4J6YA 3JCMV 1ZBJA 2E6ZA 3OYFA 2KAFA 4BE1A 3S3NA 1XOVA 1WJQA 3LGFA 1XNIA 2RHUA 2YUOA 4M7AD 5GAMg 4PJLA 2RH2A 3QBYA 5IXBA 1VQ9T 2EW3A 1WHMA 1VQMA 2O9VA 3A8GB 2JM9A 1QLYA 4FW1A 4J9BA 4PJOF 2OTLT 3GIBA 3TQ7P 2DL8A 2YRCA 4QQGA 4XK8E 1TG0A 2OX7A 4C92B 3JV3A 3RUXA 4RUGA 2RJDA 3L2UA 2KY9A 1AT1B 3P8BB 2A3LA 1ABOA 3LYIA 4MZMA 2QA4A 4M75F 5CK9A 2FRYA 2RI5A 1K4US 1WQ7A 4ORZA 2COZA 2D1XA 3CBOA 4FT2A 4C8QB 5FU7B 4DEYA 4C8QD 2F5KA 2ZPEB 4XTWA 3ZEHA 3LWIA 3HP9A 4WCIA 4HCZA 4EMGA 3PMTA 1OULA 1Q95G 2EQUA 2DE0X 4MDWA 1D09B 2KRSA 2FPDA 4KBMB 1M1KU 3VS7A 3ASKA 5L23A 4TVRA 4C5EA 5FRNA 5GAN6 4MMLA 3JCMP 2IPOB 4PL6A 2O4XB 1QP2A 3M56A 1YITT 3OYMA 4O6JA 3CCEA 2P84A 5LJ3e 4RTVA 3CC4T 1Q86R 1FYNA 1AEYA 1PNJA 3CMEA 3HFNA 1TU0B 1QCOA 4OMMA 2JMAA 2CSIA 4C5GA 1WGSA 2Y4XA 4ZGEB 3MJXA 2D8HA 3OYKA 3VS2A 4KRTA 3V8JA 1I5LA 2MI6A 1OU9A 2CP0A 4B9WA 5KYXA 2GQIA 1WHKA 3G71A 2XK0A 2QQ9A 2ZPHB 2EQKA 2LCSA 4VUBA 2PQWA 1I1JA 2EJ9A 3OQ5A 2RF0A 3NTHA 2AK5A 3WVEB 5CKFA 3CCQA 4C0DB 5LJ3d 1LCKA 3R6OA 1UGPB 5GMKj 3OS2A 1KQ2A 3M0QA 1C6VX 3GNFB 1S1NA 2XKOC 3RERA 1RLPC 2KK4A 3KFVA 3OYHA 2EKHA 5GAMj 4EMHA 1KK7A 2VASA 4BE2A 4LD9K 4PFZA 4R55A 1X75C 1RAAB 4F7UA 4OGEA 1WHLA 4M77C 3BW1A 3CBMA 2VV5A 3LLRA 3PVLA 3MO8A 1B34A 2DL5A 1Q86C 2LQWA 5LJ3f 3VUBA 2JVVA 5GAOq 3OS1A 5GAOp 4M7AE 3HKSA 4PJOG 3A8OB 1NM7A 2EFIA 3THKA 1G3YA 2QQRA 2V8KA 3H0FA 1M3AA 2QEXA 1WX6A 1ZHIA 2GFAA 1IXDA 3EHRA 1RAEB 4M77G 3HRUA 4M7DB 2R57A 1K76A 4M7DD 2QXFA 1W2BP 2Z0WA 2K3BA 1VQNQ 4HVWA 3LW5E 5CCAA 1AVZC 1QP3A 2XU8A 1YHQT 1VQKT 1H3HA 3PT9A 2YDLA 1N5ZA 3CCJA 4E7ZA 1TOVA 4EDUA 2NUPB 2LRQA 2H8HA 4C8QE 2X4JA 3I9QA 3DLMA 4JJBA 3EHQA 4XTUA 3VKIA 2J6FA 1BI2A 1Z9QA 3LH5A 1SF9A 2EYQA 3CMAQ 3Q1JA 4WF2A 1X6OA 4O5VA 4RKUE 2X9HA 1JBMA 4OMNA 3C0CA 1C1AA 1VQ5Q 1E7OA 2FZGB 3URGA 3M0SA 1M90R 2Y90A 1N6AA 1PM3A 2QG9B 3QPHA 4ZN1A 4C92F 2PVOB 1I4K1 2CP2A 3OSSC 5D6WA 3H8ZA 4OMLA 4GLMA 3V7SA 2VXFA 1EZZB 3EGXA 2DZ9A 2HCKA 1U06A 1M1FA 4E6RA 2L3SA 2GTOA 1TUDA 3QWYA 3HFOA 2KEAA 3M9QA 2ABLA 2COYA 1WPYA 2PZ1A 4Q5WA 3H9NA 5CKEA 4ZN3A 2BE9B 3M0RA 1O75A 2FPFA 2RI2A 2DAQA 1K0XA 1OOTA 5KCHA 3L1AA 4X1VA 1W70A 2K2MA 1T0JA 2DK3A 1KD1C 2XDPA 2HKNA 4IIMA 5J3BA 2RQUA 3E2UA 3GPLA 3JB9J 2YXYA 3SDZA 3GBQA 1RI0A 4NS5A 3V8LA 2HQXA 1PKTA 2MCNA 3S3OA 1RUWA 1M90C 1VQ6Q 3AT1B 3TCJA 2EYZA
chains in the Genus database with same CATH topology
2EGCA 2V1RA 1JO8A 3EG1A 1WDXA 2DRMA 4JZ4A 1GBRA 5FWBA 3I5RA 2HDAA 3PVQA 2P4RA 2OJ2A 2VVKA 4FSSA 1MUZA 1AWJA 1QKWA 4RTWA 4HXJA 2C0TA 2YSQA 2NUZA 2LNHB 2LX7A 2CH4W 3EGUA 1WIEA 2JXBA 1QKXA 2FEIA 4IIOA 2JTEA 2PTKA 2IIMA 4EIKA 1B3QA 3NHNA 4J9EA 1GBQA 1VYTA 1BB9A 4HCKA 1ZUUA 2O2OA 2FG0A 3REBB 2ENMA 1VYUA 2OAWA 1FMKA 4CC3A 2DL4A 2K6DA 3VS3A 4A63B 2JW4A 1OPKA 2M0YA 3NMZC 1YN8A 2EGEA 4CC2A 2X3XD 3NPFA 2F2VA 5HCKA 1Y0MA 4J9CA 2DMOA 1I07A 2CH4A 2CREA 2DX1A 2A28A 2A08A 5IXFA 5I11A 1X6GA 1AWXA 2AZSA 3RNJA 1Z9ZA 1UTIA 2BZXA 2KXDA 3UA6A 1UHFA 2KBTA 1WXBA 1X69A 3EG3A 3I5SA 1NYGA 2ESWA 5FW9A 2CUDA 4F16A 2LJ1A 1KJWA 1PKSA 2RN8A 2DLPA 3A98A 3M0TA 2E5KA 1K1ZA 1NEBA 2A36A 1UUEA 1X2QA 1BU1A 1KFZA 1QCFA 1QWEA 1SRLA 4J9GA 2PNIA 2JT4A 3VS4A 2LMJA 5FWCA 4AG1C 1ZBJA 1MV0B 3VS1A 1XOVA 1UDLA 2LZ6B 1PHTA 1TUCA 3EG0A 2DA9A 2GNCA 2KE9A 2LJ0A 2YUOA 3PE0A 2EQIA 4GBQA 5IXBA 2HBWA 2RQVA 4JPBW 2EW3A 3EG2A 1PRLC 2O9VA 2DVJA 1SSHA 2JM9A 4DEXA 4RTZA 1QLYA 2O88A 1NG2A 4J9BA 2KROA 1NLPC 4LUEA 2DL8A 2HEQA 2DM1A 1TG0A 1WYXA 2CUBA 2O9SA 4AFQC 1M3CA 4F14A 3JV3A 4RUGA 1AZEA 3ULRB 2DBKA 5ECAA 1G2BA 1ABOA 1AD5A 1X27A 1X2KA 2FRYA 4HVVA 1K4US 1M30A 1ZUKA 1UGVA 4ORZA 1QWFA 2D1XA 4R0KA 2L3PA 4DEYA 2D8JA 1WXUA 4WCIA 3VS6A 3TVTA 3M0PA 2DE0X 2FO0A 1WFWA 2KRSA 2FPDA 2JMCA 5EC7A 1SHFA 1AWOA 2GTJA 1GCQA 3VS7A 4LN2A 5L23A 3UA7A 1YWOA 1CKBA 3FJ5A 2ROTA 2DL7A 2O31A 4RTVA 2BZ8A 1FYNA 5I22A 2F2XA 4JZ3A 1AEYA 2RMOA 1SPKA 2DJQA 1T3SA 1PNJA 2L2PA 4OMMA 2JMAA 2CSIA 3SEMA 4AG2C 1U3OA 1PWTA 4CC4B 2J05A 2DRKA 1GFDA 2D0NA 2D8HA 2OI3A 4J9HA 3VS2A 1V1CA 4KRTA 2XMFA 2J6KA 2L3QA 4Z8AA 2GQIA 2V1QA 2YUQA 2K9GA 2K79A 2L0AA 2EYYA 2MOXA 1UFFA 4AFSC 1OPLA 4F17A 2EYWA 4J9IA 2CT3A 1JXMA 2KT8A 2LCSA 1I1JA 2KRNA 3TSZA 1NEGA 2KGTA 2KXCA 2RF0A 3H41A 2SRCA 2RNAA 1VA7A 2AK5A 2AZVA 2KYMA 1T3LA 1KIKA 4J9DA 1Y57A 1UECA 1LCKA 2C0OA 2J06A 2KR3A 3M0QA 3VRYA 1S1NA 2QDLA 4RTXA 3UF4A 4ZNXA 1RLPC 4JJCA 3KFVA 2W0ZA 3CQTA 2KT1A 3RBBB 2EKHA 2ED1A 2RQTA 1AZGB 2DF6A 1KSWA 4Y92A 2FPEA 2YUPA 1H8KA 4Z89A 4D8KA 3PVLA 1JQQA 1UJ0A 2X3WD 2DNUA 2I0NA 3UATA 2DL5A 2EPDA 2GGRA 2DL3A 2HSPA 2LQWA 1ARKA 4AFUC 1SEMA 2B86A 4OMPA 2NWMA 5IH2A 1GRIA 1M27C 1NM7A 3ZL7C 2DYBA 1T0HA 2J7IA 3VS0A 3THKA 1EFNA 1M8MA 3H0FA 1M3AA 1WX6A 2LP5A 2YT6A 4RTTA 1ABQA 1YNZA 3EHRA 2C0IA 3R6NA 3VS5A 4D8DA 1K76A 3REAB 2KYBA 1OV3A 1WLPB 1UHCA 2EGAA 2FRWA 1J3TA 1H92A 2K3BA 2GBQA 1AOJA 3QWXX 2AKKA 5GJVB 1WA7A 1CSKA 3SHWA 4HVWA 4K11A 1IO6A 2G6FX 1AVZC 1H3HA 2SEMA 4LE9A 1UJYA 2BTTA 1JEGA 2YDLA 1N5ZA 3H0IA 1G83A 3I35A 1U5SA 2H8HA 2KNBB 3I9QA 2LJ3A 4JJBA 3EHQA 4RTYA 2JS2A 2J6FA 2J6OA 1MV3A 1Z9QA 3LH5A 1SHGA 1JU5C 2W10A 1YP5A 2ECZA 1I0CA 4OMNA 2ROLA 2BZYA 3C0CA 1WI7A 1E7OA 3M0SA 2JS0A 1A0NB 1E6GA 4QT7A 1RI9A 1GCQC 1W1FA 2RQWA 1UG1A 3NGPA 1K0SA 4LUDA 2A37A 1NYFA 2MIOA 4ESRA 4OMLA 1BBZA 1YWPA 4GLMA 3VRZA 4AFZC 1OEBA 1W6XA 2HCKA 1U06A 2DILA 2M51A 1GL5A 4E6RA 1ZX6A 2L3SA 4OMOA 2GTOA 3M0UA 1HD3A 1TUDA 1E6HA 3QWYA 1UE9A 1ZSGA 2KEAA 2ABLA 2VKNA 2PZ1A 2F2WA 4Z88A 1BK2A 4LNPA 3M0RA 2CSQA 2FPFA 5GJWB 2K7AA 2RQRA 3H0HA 1VYVA 3U23A 4CC7A 1K0XA 1OOTA 1HJDA 1GCPA 4X1VA 1W70A 4OMQA 2K2MA 1JXOA 1T0JA 4IIMA 1GFCA 1CKAA 1X43A 2RQUA 4M4ZA 1AWWA 3IQLA 1WXTA 2AKLA 5IHNA 2ED0A 2EYXA 1ZUYA 3TSWA 1SRMA 1B07A 1M3BA 2CT4A 2JM8A 2KRMA 5IHKA 1K9AA 2LQNA 1HSQA 4J9FA 1NLOC 2DBMA 3GBQA 2EBPA 2RPNA 2EVRA 4JJDA 1PKTA 4RTUA 2YUNA 2MCNA 1ZLMA 4HVUA 1RUWA 1X6BA 3O5ZA 2CDTA 1RLQC 5IHIA 2VWFA 1YCSB 2EYZA 1PRMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGC A;  2V1R A;  1JO8 A;  3EG1 A;  1WDX A;  2DRM A;  4JZ4 A;  1GBR A;  5FWB A;  3I5R A;  2HDA A;  3PVQ A;  2P4R A;  2OJ2 A;  2VVK A;  4FSS A;  1MUZ A;  1AWJ A;  1QKW A;  4RTW A;  4HXJ A;  2C0T A;  2YSQ A;  2NUZ A;  2LNH B;  2LX7 A;  2CH4 W;  3EGU A;  1WIE A;  2JXB A;  1QKX A;  2FEI A;  4IIO A;  2JTE A;  2PTK A;  2IIM A;  4EIK A;  1B3Q A;  3NHN A;  4J9E A;  1GBQ A;  1VYT A;  1BB9 A;  4HCK A;  1ZUU A;  2O2O A;  2FG0 A;  3REB B;  2ENM A;  1VYU A;  2OAW A;  1FMK A;  4CC3 A;  2DL4 A;  2K6D A;  3VS3 A;  4A63 B;  2JW4 A;  1OPK A;  2M0Y A;  3NMZ C;  1YN8 A;  2EGE A;  4CC2 A;  2X3X D;  3NPF A;  2F2V A;  5HCK A;  1Y0M A;  4J9C A;  2DMO A;  1I07 A;  2CH4 A;  2CRE A;  2DX1 A;  2A28 A;  2A08 A;  5IXF A;  5I11 A;  1X6G A;  1AWX A;  2AZS A;  3RNJ A;  1Z9Z A;  1UTI A;  2BZX A;  2KXD A;  3UA6 A;  1UHF A;  2KBT A;  1WXB A;  1X69 A;  3EG3 A;  3I5S A;  1NYG A;  2ESW A;  5FW9 A;  2CUD A;  4F16 A;  2LJ1 A;  1KJW A;  1PKS A;  2RN8 A;  2DLP A;  3A98 A;  3M0T A;  2E5K A;  1K1Z A;  1NEB A;  2A36 A;  1UUE A;  1X2Q A;  1BU1 A;  1KFZ A;  1QCF A;  1QWE A;  1SRL A;  4J9G A;  2PNI A;  2JT4 A;  3VS4 A;  2LMJ A;  5FWC A;  4AG1 C;  1ZBJ A;  1MV0 B;  3VS1 A;  1XOV A;  1UDL A;  2LZ6 B;  1PHT A;  1TUC A;  3EG0 A;  2DA9 A;  2GNC A;  2KE9 A;  2LJ0 A;  2YUO A;  3PE0 A;  2EQI A;  4GBQ A;  5IXB A;  2HBW A;  2RQV A;  4JPB W;  2EW3 A;  3EG2 A;  1PRL C;  2O9V A;  2DVJ A;  1SSH A;  2JM9 A;  4DEX A;  4RTZ A;  1QLY A;  2O88 A;  1NG2 A;  4J9B A;  2KRO A;  1NLP C;  4LUE A;  2DL8 A;  2HEQ A;  2DM1 A;  1TG0 A;  1WYX A;  2CUB A;  2O9S A;  4AFQ C;  1M3C A;  4F14 A;  3JV3 A;  4RUG A;  1AZE A;  3ULR B;  2DBK A;  5ECA A;  1G2B A;  1ABO A;  1AD5 A;  1X27 A;  1X2K A;  2FRY A;  4HVV A;  1K4U S;  1M30 A;  1ZUK A;  1UGV A;  4ORZ A;  1QWF A;  2D1X A;  4R0K A;  2L3P A;  4DEY A;  2D8J A;  1WXU A;  4WCI A;  3VS6 A;  3TVT A;  3M0P A;  2DE0 X;  2FO0 A;  1WFW A;  2KRS A;  2FPD A;  2JMC A;  5EC7 A;  1SHF A;  1AWO A;  2GTJ A;  1GCQ A;  3VS7 A;  4LN2 A;  5L23 A;  3UA7 A;  1YWO A;  1CKB A;  3FJ5 A;  2ROT A;  2DL7 A;  2O31 A;  4RTV A;  2BZ8 A;  1FYN A;  5I22 A;  2F2X A;  4JZ3 A;  1AEY A;  2RMO A;  1SPK A;  2DJQ A;  1T3S A;  1PNJ A;  2L2P A;  4OMM A;  2JMA A;  2CSI A;  3SEM A;  4AG2 C;  1U3O A;  1PWT A;  4CC4 B;  2J05 A;  2DRK A;  1GFD A;  2D0N A;  2D8H A;  2OI3 A;  4J9H A;  3VS2 A;  1V1C A;  4KRT A;  2XMF A;  2J6K A;  2L3Q A;  4Z8A A;  2GQI A;  2V1Q A;  2YUQ A;  2K9G A;  2K79 A;  2L0A A;  2EYY A;  2MOX A;  1UFF A;  4AFS C;  1OPL A;  4F17 A;  2EYW A;  4J9I A;  2CT3 A;  1JXM A;  2KT8 A;  2LCS A;  1I1J A;  2KRN A;  3TSZ A;  1NEG A;  2KGT A;  2KXC A;  2RF0 A;  3H41 A;  2SRC A;  2RNA A;  1VA7 A;  2AK5 A;  2AZV A;  2KYM A;  1T3L A;  1KIK A;  4J9D A;  1Y57 A;  1UEC A;  1LCK A;  2C0O A;  2J06 A;  2KR3 A;  3M0Q A;  3VRY A;  1S1N A;  2QDL A;  4RTX A;  3UF4 A;  4ZNX A;  1RLP C;  4JJC A;  3KFV A;  2W0Z A;  3CQT A;  2KT1 A;  3RBB B;  2EKH A;  2ED1 A;  2RQT A;  1AZG B;  2DF6 A;  1KSW A;  4Y92 A;  2FPE A;  2YUP A;  1H8K A;  4Z89 A;  4D8K A;  3PVL A;  1JQQ A;  1UJ0 A;  2X3W D;  2DNU A;  2I0N A;  3UAT A;  2DL5 A;  2EPD A;  2GGR A;  2DL3 A;  2HSP A;  2LQW A;  1ARK A;  4AFU C;  1SEM A;  2B86 A;  4OMP A;  2NWM A;  5IH2 A;  1GRI A;  1M27 C;  1NM7 A;  3ZL7 C;  2DYB A;  1T0H A;  2J7I A;  3VS0 A;  3THK A;  1EFN A;  1M8M A;  3H0F A;  1M3A A;  1WX6 A;  2LP5 A;  2YT6 A;  4RTT A;  1ABQ A;  1YNZ A;  3EHR A;  2C0I A;  3R6N A;  3VS5 A;  4D8D A;  1K76 A;  3REA B;  2KYB A;  1OV3 A;  1WLP B;  1UHC A;  2EGA A;  2FRW A;  1J3T A;  1H92 A;  2K3B A;  2GBQ A;  1AOJ A;  3QWX X;  2AKK A;  5GJV B;  1WA7 A;  1CSK A;  3SHW A;  4HVW A;  4K11 A;  1IO6 A;  2G6F X;  1AVZ C;  1H3H A;  2SEM A;  4LE9 A;  1UJY A;  2BTT A;  1JEG A;  2YDL A;  1N5Z A;  3H0I A;  1G83 A;  3I35 A;  1U5S A;  2H8H A;  2KNB B;  3I9Q A;  2LJ3 A;  4JJB A;  3EHQ A;  4RTY A;  2JS2 A;  2J6F A;  2J6O A;  1MV3 A;  1Z9Q A;  3LH5 A;  1SHG A;  1JU5 C;  2W10 A;  1YP5 A;  2ECZ A;  1I0C A;  4OMN A;  2ROL A;  2BZY A;  3C0C A;  1WI7 A;  1E7O A;  3M0S A;  2JS0 A;  1A0N B;  1E6G A;  4QT7 A;  1RI9 A;  1GCQ C;  1W1F A;  2RQW A;  1UG1 A;  3NGP A;  1K0S A;  4LUD A;  2A37 A;  1NYF A;  2MIO A;  4ESR A;  4OML A;  1BBZ A;  1YWP A;  4GLM A;  3VRZ A;  4AFZ C;  1OEB A;  1W6X A;  2HCK A;  1U06 A;  2DIL A;  2M51 A;  1GL5 A;  4E6R A;  1ZX6 A;  2L3S A;  4OMO A;  2GTO A;  3M0U A;  1HD3 A;  1TUD A;  1E6H A;  3QWY A;  1UE9 A;  1ZSG A;  2KEA A;  2ABL A;  2VKN A;  2PZ1 A;  2F2W A;  4Z88 A;  1BK2 A;  4LNP A;  3M0R A;  2CSQ A;  2FPF A;  5GJW B;  2K7A A;  2RQR A;  3H0H A;  1VYV A;  3U23 A;  4CC7 A;  1K0X A;  1OOT A;  1HJD A;  1GCP A;  4X1V A;  1W70 A;  4OMQ A;  2K2M A;  1JXO A;  1T0J A;  4IIM A;  1GFC A;  1CKA A;  1X43 A;  2RQU A;  4M4Z A;  1AWW A;  3IQL A;  1WXT A;  2AKL A;  5IHN A;  2ED0 A;  2EYX A;  1ZUY A;  3TSW A;  1SRM A;  1B07 A;  1M3B A;  2CT4 A;  2JM8 A;  2KRM A;  5IHK A;  1K9A A;  2LQN A;  1HSQ A;  4J9F A;  1NLO C;  2DBM A;  3GBQ A;  2EBP A;  2RPN A;  2EVR A;  4JJD A;  1PKT A;  4RTU A;  2YUN A;  2MCN A;  1ZLM A;  4HVU A;  1RUW A;  1X6B A;  3O5Z A;  2CDT A;  1RLQ C;  5IHI A;  2VWF A;  1YCS B;  2EYZ A;  1PRM C; 
#chains in the Genus database with same CATH topology
 5CAI A;  3V8K A;  2EGC A;  1QQJ A;  1W2B S;  2DXB A;  3EG1 A;  1WDX A;  1GBR A;  2CGH A;  5FWB A;  5GMK e;  3CC2 T;  3RMS A;  2VGM A;  5LJ5 g;  4EMK B;  4RTW A;  1D1C A;  5GAM e;  2JUF A;  4XU3 A;  2LNH B;  2CH4 W;  1XJW B;  5EG2 A;  2JTE A;  4N0A A;  4M7D E;  2RJF A;  3QZ9 B;  4F7U G;  1VIE A;  4HCK A;  1ZSZ A;  1ZUU A;  1RAF B;  2CKK A;  2FG0 A;  2XG8 D;  5IN1 A;  4L59 A;  2ENM A;  4KUD K;  3JCM X;  1ZQ1 A;  3X24 B;  2DL4 A;  3CCM Q;  3N5B B;  2K6D A;  1OPK A;  2L5Q A;  4N4I A;  3JCM J;  5HK0 A;  4CC2 A;  1RAG B;  3CPW A;  3QDF A;  4HKE A;  4BUG A;  4AMC A;  1W2B A;  1WJR A;  2EQM A;  5I11 A;  3OSV A;  2OTJ Q;  1X6G A;  1Q86 U;  5GAM d;  1Q82 R;  2KXD A;  3UA6 A;  3OA6 A;  4BY6 B;  5AT1 B;  2HD0 A;  1LNX A;  5KYW B;  3EG3 A;  3C94 A;  1KHI A;  4FCY A;  4M77 D;  4F16 A;  2LJ1 A;  3SB2 A;  1U8R A;  1KJW A;  1I81 A;  4BAC A;  2A36 A;  4JRQ A;  3VYH B;  2XIC A;  3QG1 A;  4FL6 A;  1BU1 A;  1KFZ A;  2HZY A;  4J9G A;  1PD1 A;  2LC4 A;  5FWC A;  4HT9 A;  1K9M R;  1MV0 B;  4MMK A;  2MWP A;  2E3I A;  1NZ9 A;  2LZ6 B;  2EAY A;  1TUC A;  2DKG A;  3CXC P;  1NE8 A;  2LQ8 A;  2KE9 A;  4J5Y A;  4JDS A;  5GAM f;  1OX9 A;  2EQI A;  4GBQ A;  2CS7 A;  2HBW A;  3EG2 A;  4B6M A;  4PK4 A;  1AHJ B;  1SSH A;  2L8D A;  1NG2 A;  2KRO A;  1KQ1 A;  2XHC A;  5J26 A;  4AFQ C;  1M3C A;  4L5G A;  4M78 B;  4UC4 A;  3CCS Q;  3I56 T;  2LNV A;  2K4Y A;  1D0X A;  2E65 A;  5KH6 A;  1BIB A;  4QVC A;  1X27 A;  1X2K A;  3FJP A;  4HVV A;  1M30 A;  3G6E A;  1ZUK A;  4FT4 A;  4R0K A;  2BUD A;  1Q82 C;  3PMI A;  6AT1 B;  5DLO A;  4IUT A;  2DD4 A;  1YJW Q;  2CP3 A;  3TVT A;  2LX9 A;  4J6W A;  5CKD A;  1VQN T;  2ZPB B;  3HRT A;  1G3S A;  1WFW A;  1EX4 A;  5EC7 A;  2K5I A;  1AWO A;  4J8O A;  2M02 A;  3CD6 A;  1YWO A;  2AHJ B;  1RL2 A;  3QXE B;  3MPU B;  1G3W A;  2ROT A;  3UT1 A;  1K9M C;  2K2V A;  2DL7 A;  4FYV B;  1QVG A;  2BZ8 A;  5I22 A;  2CP5 A;  2F2X A;  4II1 A;  1SPK A;  2DJQ A;  3CMA T;  1TWB A;  2FHD A;  4BI3 A;  1F1B B;  1KD1 U;  2X4X A;  1VQ5 T;  1U3O A;  3L2Z A;  3SD4 A;  1VQM Q;  1GFD A;  2OI3 A;  4PJO A;  3FIF A;  3CCV A;  4J7I A;  4N0A C;  2CZ7 B;  1VQP T;  2L3Q A;  4Z8A A;  2YUQ A;  1PG5 B;  4ZGJ B;  2K9G A;  2K79 A;  2L0A A;  1ZSZ C;  2QTV A;  1OPL A;  2M9U A;  4F17 A;  2CT3 A;  1OX8 A;  4M75 A;  1JXM A;  4FU6 A;  2MPX C;  3TSZ A;  2QA4 Q;  1MMN A;  5CVI A;  8ATC B;  3H41 A;  1M90 U;  2MAM A;  2RI3 A;  1WNL A;  2KYM A;  1T3L A;  2RHZ A;  2ZPI B;  4J9D A;  1UEC A;  5KYU A;  5CKH A;  1MMG A;  2C0O A;  1VQ7 Q;  1C0M A;  1VQK A;  1YHQ A;  3E9G A;  1KHC A;  5C6S A;  4PJN A;  1YIJ T;  2W0Z A;  3RBB B;  4M7A B;  3VU3 C;  1LJO A;  2ED1 A;  4M77 E;  4DOW A;  2DF6 A;  2QDY B;  2DEU A;  4OB1 B;  2R5A A;  4GLK A;  1R77 A;  4Z89 A;  3OMG A;  1JQQ A;  1OZ3 A;  2X3W D;  2I0N A;  4CRI A;  2GGR A;  2DL3 A;  5GAN 8;  2YWW A;  4AFU C;  3CME Q;  3EG9 B;  3CC7 T;  1IHV A;  3QYG B;  4OMP A;  1Q7Y R;  1GRI A;  2M0O A;  1M27 C;  1VQ6 T;  4NOY A;  3JCM h;  1M8M A;  1PSE A;  2HL3 A;  3CPF A;  5GAO m;  1BKB A;  1YNZ A;  4KGZ B;  5A0L A;  4RCB A;  2HAX A;  3PGG A;  1Y71 A;  4D8D A;  3JB9 D;  3REA B;  4N4G A;  4X34 A;  1OV3 A;  1WLP B;  3G71 Q;  2EGA A;  4M78 E;  1KC8 R;  3CXC A;  1J3T A;  2GBQ A;  1WA7 A;  5FU6 B;  3X25 B;  4K11 A;  2G6F X;  3UWN A;  3CCQ Q;  2K3X A;  2XDD A;  1IZ6 A;  3H0I A;  2KNB B;  2LJ3 A;  2EJF A;  4Y28 E;  1MV3 A;  1SHG A;  2W10 A;  4OP0 A;  2F1L A;  2RA2 A;  3OYL A;  1OYX A;  1TH7 A;  1WI7 A;  1Y96 B;  3CCM T;  2JS0 A;  1U1S A;  4PLL A;  1RI9 A;  3BE3 A;  2H3J A;  3CCU A;  4M78 F;  3EAE A;  1NYF A;  3G4S A;  3BDU A;  2OTJ T;  5KE3 A;  1Q7Y C;  4JS5 A;  4ESR A;  1RAB B;  1BBZ A;  1YWP A;  3G7Z A;  4AFZ C;  1OEB A;  1W6X A;  2DXC A;  3CBP A;  3LH0 A;  5LJ5 e;  2MK5 A;  1YJN A;  1ZX6 A;  3OBW A;  4E7H A;  2RK2 A;  2QEX Q;  1FMW A;  3CC2 A;  3M0U A;  1VQ8 A;  1MHN A;  2P4T A;  1ZSG A;  1S72 A;  1WHH A;  3DB3 A;  2QYZ A;  4PJO C;  2QK0 A;  2F2W A;  1VQL T;  1OI1 A;  4LDX A;  4RG2 A;  2CSQ A;  2DVE A;  3U23 A;  3H0H A;  1KC8 C;  1Q82 U;  3ME9 A;  1KG1 A;  2XDB A;  3M54 A;  1W4S A;  5KYN A;  3SWN B;  3DB4 A;  1FXX A;  2LCC A;  3GNG A;  4M75 C;  1CKA A;  4FYX B;  3CCJ Q;  4M4Z A;  1QVF P;  1AWW A;  3RMQ A;  5IHN A;  3RIR A;  5KE2 A;  1SRM A;  4PJM A;  3OYG A;  3QII A;  5GAN e;  1D3B B;  1ACM B;  2KRM A;  4HCB A;  1U1T A;  5FRM A;  2B8A A;  1XTD A;  1NLO C;  4HT8 A;  2EBP A;  1K9M U;  2RPN A;  4IUR A;  3X26 B;  4DA4 A;  4JJD A;  4RTU A;  3EFO B;  5GAN 7;  3OY9 A;  2P0Q A;  1ZLM A;  3MCA B;  4F7U E;  3CCS T;  1RLQ C;  4P5N A;  5IHI A;  2DIG A;  1R0C B;  4BI4 A;  4C92 A;  3CPW P;  3M58 A;  3DKM A;  4M75 G;  4ZTJ A;  2V1R A;  3GOX A;  4L6V 5;  1YJ9 A;  4RCC A;  2RJE A;  2LT4 A;  2XID A;  3I5R A;  1YJW T;  2D9T A;  4C8Q A;  5LJ5 f;  1KD1 R;  3RDV A;  1YI2 A;  4FSS A;  1MUZ A;  1M2V B;  3JCM Q;  3RES A;  3KXT A;  3GF5 A;  2NUZ A;  3SFM A;  1WIE A;  4M7A F;  2PTK A;  3CCR A;  3TU4 K;  4EIK A;  1PD0 A;  2HMA A;  4C0G A;  3A8L B;  2O4X A;  3X20 B;  2JN0 A;  3M4G A;  2JOY A;  3J81 E;  1FMK A;  1UGS B;  4BE0 A;  3F70 A;  1SSF A;  2AT1 B;  3VS3 A;  2M0Y A;  2ZZD A;  1IGU A;  4N4H A;  3FEO A;  1VQM T;  1D1A A;  2F2V A;  3VYG A;  3I56 A;  3MP8 A;  5HCK A;  1H64 1;  3A8H B;  2LVM A;  2CRE A;  2K57 A;  5GAN f;  3JB9 I;  3OBY A;  2A28 A;  5CKB A;  1PC0 A;  1RAD B;  4LDW A;  2BZX A;  2F5T X;  2K3Y A;  4C8Q F;  1UHF A;  2FYK A;  3M5A A;  2QA4 T;  5FW9 A;  2X35 A;  2RB6 A;  1PKS A;  2JTF A;  2E5Q A;  2DLP A;  3M0T A;  1K1Z A;  3OW2 A;  4BB7 A;  1VQ7 T;  4KGX B;  2YHT A;  3OS0 A;  2VB6 A;  1M2O A;  5CIU A;  3ZFJ A;  2JT4 A;  2FVU A;  2YLC A;  4AG1 C;  8AT1 B;  4JLG A;  1PHT A;  4LDY A;  3EG0 A;  2DA9 A;  5LJ3 h;  4ELZ C;  2DTH A;  2DXU A;  2LJ0 A;  4E7K A;  2M1H A;  2RQV A;  4JJN K;  2DO3 A;  4X9D A;  2QQB A;  1BI1 A;  5A0D A;  3L2V A;  4OVA A;  2DVJ A;  4DEX A;  1MGQ A;  4RTZ A;  2RHX A;  4DBF A;  3QZ5 B;  1IHW A;  1QVG P;  1VIF A;  4JUV A;  5GAO n;  2DER A;  2HEQ A;  3CME T;  2DM1 A;  1HK9 A;  3M57 A;  2EKO A;  2CUB A;  2O9S A;  3CPW S;  1VQ4 A;  1VQP A;  2V8J A;  3ULR B;  2DBK A;  5ECA A;  3S6W A;  4JS4 A;  1AD5 A;  3I55 A;  1VQO A;  2DYI A;  1V29 B;  1TXQ A;  4C0F A;  1UGV A;  3T9N A;  2BE7 D;  5DLQ E;  3OYA A;  1JRI A;  1G5V A;  2RO0 A;  4IUQ A;  3JB9 H;  3OYN A;  2D8J A;  3VS6 A;  5GAN 3;  1Q7Y U;  1TTH B;  4M7D A;  2FO0 A;  1VUB A;  3V7C A;  1QVF A;  1YIJ A;  3CCQ T;  2R5M A;  2JMC A;  3A5Z B;  4C92 C;  5D7U A;  3EGD B;  3UA7 A;  1VQ9 A;  4KT0 E;  4BDZ A;  2RHI A;  1FX7 A;  4KUI A;  5KYY A;  3PIO A;  1KC8 U;  2NUP A;  2OTL A;  1R8O B;  5GAN 2;  4BI8 B;  1MMA A;  2E41 A;  2NUT B;  4PKC C;  2QAZ A;  4XTV A;  5FU7 C;  4C8Q C;  4NL2 A;  4IUP A;  5DY9 A;  3CC7 A;  2L89 A;  2M16 A;  5IAY A;  2J05 A;  5GAN g;  3KBG A;  4J9H A;  4PJO D;  1FWZ A;  1RAC B;  3FC3 A;  4C92 G;  2V1Q A;  2MOX A;  1UFF A;  4AFS C;  5L8R E;  1KQS P;  1D0Y A;  2XI9 A;  4M77 B;  1YBY A;  4M7D F;  1WHJ A;  2R58 A;  2EWN A;  1NEG A;  2KXC A;  2DZC A;  2SRC A;  2QEX T;  1VA7 A;  2AZV A;  4A4F A;  3G6E Q;  1BCO A;  4C8Q G;  4BDY A;  1JJ2 A;  1JB0 E;  3CCL Q;  2J06 A;  2QDL A;  4RTX A;  2FZK B;  4ZNX A;  1YIT A;  3OS5 A;  4D6W A;  3LX7 A;  4J6X A;  3WXM B;  3CC4 A;  2RQT A;  1D0Z A;  2IG0 A;  4QQ6 A;  1KSW A;  1QCN A;  3M4Y A;  3WVD B;  5GAN 5;  2FPE A;  4DBH A;  3INZ A;  3CD6 Q;  1H8K A;  2K5L A;  4XTY A;  4D8K A;  1QVG S;  3MEV A;  1UJ0 A;  2DNU A;  4XU1 A;  3MEU A;  5HK3 A;  2EPD A;  4C0D C;  1N9R A;  3MET A;  2HSP A;  1ARK A;  1WHG A;  1ZA2 B;  1ZA1 B;  3NTK A;  2B86 A;  4A54 A;  2JTM A;  2FZC B;  4LXC A;  3PFS A;  4ATO A;  2OTJ A;  3ZL7 C;  2ZGW A;  3PNW C;  2DYB A;  1T0H A;  1X01 A;  2J7I A;  3VS0 A;  3X28 B;  3CCV Q;  5GMK m;  3QYH B;  3HHT B;  2QTX A;  5LJ5 j;  4RTT A;  1WZO A;  3FRN A;  4ELY C;  1I8F A;  3NFC A;  3M53 A;  2KYB A;  3ER0 A;  1UHC A;  2V8I A;  5GAO r;  2FRW A;  4X9C A;  3JAM E;  1VQL A;  1H92 A;  1Y7X A;  1AOJ A;  3QWX X;  2AKK A;  1I5O B;  4KH0 B;  5GJV B;  3VJP A;  3SHW A;  1GXI E;  4A53 A;  3P8H A;  2Y4Y A;  2DTO A;  4LE9 A;  4EMK A;  1JEG A;  3G1J A;  1U5S A;  4C0Z A;  4FW2 A;  4RTY A;  4FSX A;  4FYY B;  2ZPG B;  3MHX A;  2RK1 A;  1I0C A;  1R0B G;  1PSF A;  3E1S A;  3JCM c;  1ZBX A;  4M7D C;  5GAN j;  2ROL A;  4XU0 A;  2BZY A;  4XQ3 A;  2E10 A;  3JCM W;  1BYM A;  3EFS A;  5FRO A;  1E6G A;  4OMF B;  1V76 A;  5KYX B;  4QT7 A;  2WSF E;  1W1F A;  4RMO A;  2RQW A;  1QMC A;  2IVW A;  1UG1 A;  1B7T A;  3NGP A;  1K0S A;  4LUD A;  2A37 A;  2COW A;  3HRS A;  3L2Q A;  1N8R R;  5LL6 S;  4DBQ A;  1UB4 A;  1NJI C;  4OGC A;  2M51 A;  1GL5 A;  4OB2 B;  2CP7 A;  5GMK h;  4OMO A;  4PJO E;  3OMC A;  1E6H A;  3D7S B;  3HPW A;  4JLI A;  1Q81 R;  4M7D G;  5KYW A;  3CXC S;  3ZBD A;  2QAS A;  2VKN A;  4Z88 A;  3TRE A;  5GAM h;  4LNP A;  1P92 A;  2VC8 A;  4ZTF A;  3S3M A;  2K7A A;  3BY7 A;  3P8D A;  1HJD A;  4F7U B;  4OMQ A;  3C4S A;  2RD1 A;  1M9S A;  1GFC A;  1D1B A;  1B34 B;  2BKD N;  2EQJ A;  3CCE Q;  3IQL A;  4J83 A;  2E12 A;  1WXT A;  2AKL A;  1RAI B;  2ED0 A;  2EYX A;  1B07 A;  3J7A F;  1M3B A;  2CT4 A;  5I2M A;  1SG5 A;  5IHK A;  1HSQ A;  2I2L A;  1KQS A;  1YCY A;  2KI7 A;  4MZT A;  4GY5 A;  4HVU A;  2JZ2 A;  3QSU A;  5HKC A;  2VWF A;  1VOM A;  2P0K A;  5GMK i;  2HQH A;  4M78 A;  3L2W A;  4C92 D;  1MNE A;  3CCU Q;  3J80 E;  4M77 F;  3G4S Q;  3M55 A;  2VXE A;  1QW1 A;  4JZ4 A;  1BI3 A;  3AHU A;  1N8R C;  2E6N A;  3GLX A;  3C12 A;  4E47 A;  1VQ7 A;  1YJN Q;  3PVQ A;  3JCM g;  2OJ2 A;  2P0P A;  4A4E A;  3CC2 Q;  1VQ8 Q;  1QKW A;  3MP1 A;  3FLG A;  1S72 Q;  4OB0 B;  1Q81 C;  4HXJ A;  3OW2 P;  3MP6 A;  2JXB A;  3UDC A;  4IIO A;  1B3Q A;  3NHN A;  2BIV A;  4C5H A;  3QKJ A;  1BB9 A;  2O2O A;  3MKD A;  3REB B;  1HYO A;  2C06 A;  1FMV A;  4QVD A;  2CP6 A;  4CC3 A;  4MDX A;  1DJ7 B;  4LDV A;  3NMZ C;  1YN8 A;  2EGE A;  4EMK C;  2E3H A;  2CZ0 B;  1Y0M A;  2DMO A;  1IRX A;  1I07 A;  2CH4 A;  2H3E B;  2DX1 A;  3EGX B;  2XD0 A;  2A08 A;  5IXF A;  1BI0 A;  2VUB A;  2AZS A;  3OYY A;  3RNJ A;  1Z9Z A;  2CYZ B;  4QVZ A;  2E70 A;  1M5Q 1;  2AIR B;  3FDR A;  4LDU A;  3I5S A;  4Z02 A;  2ESW A;  4MZP A;  1WQW A;  3C95 A;  2RN8 A;  3G6E T;  2LT1 A;  1YJ9 Q;  2MYS A;  1NEB A;  2PUK B;  3CCL T;  2DJZ A;  3QJ6 A;  1X2Q A;  1LPL A;  1QCF A;  4XTX A;  1QWE A;  2PNI A;  1K73 R;  3JCM b;  3V7R A;  2E4H A;  5GMK l;  3VS1 A;  3RKY A;  2X4Y A;  4A4K A;  1UDL A;  1YI2 Q;  1M1G A;  2GNC A;  4M7A A;  2DIQ A;  3PE0 A;  5LJ5 d;  3CD6 T;  4BY6 C;  4JPB W;  3CCR Q;  4IUU A;  4QKU A;  1PRL C;  2O88 A;  4XAX B;  1NLP C;  1LOJ A;  4LUE A;  1WYX A;  4F14 A;  1IB8 A;  1AZE A;  3EG9 A;  1G2B A;  2LDM A;  3I56 Q;  4OF1 A;  3CCV T;  3TEE A;  2YRD A;  2E64 A;  4PLI A;  3PTA A;  5D6X A;  1QWF A;  3BFM A;  2L3P A;  1IRE B;  1WXU A;  4E2F B;  5GAN d;  3M0P A;  3QJY A;  3EH2 A;  1NJI U;  3OW2 S;  4C92 E;  1G8X A;  2X4W A;  3BDL A;  2YRV A;  2KQW A;  1SHF A;  1N27 A;  3FB9 A;  4KGV B;  4HA8 A;  2WSC E;  1K8A R;  1JJ2 P;  4M78 C;  2GTJ A;  3OYC A;  1GCQ A;  3PIP A;  4LN2 A;  2HNI A;  2ZAE A;  1ZSZ B;  4F7U F;  1MMD A;  2V26 A;  1K73 C;  1CKB A;  5KYY B;  2LCL A;  3FJ5 A;  2DET A;  2KDS A;  4PJJ A;  3O8V A;  4F04 B;  2O31 A;  4DBR A;  5D6Y A;  4JZ3 A;  2RMO A;  1T3S A;  2KVQ G;  2L2P A;  1OU8 A;  4PFO A;  3OYB A;  3E9F A;  4E7I A;  2OAU A;  3SEM A;  4AG2 C;  5KCO A;  1M8V A;  2GFU A;  4B9X A;  1PWT A;  4CC4 B;  2DRK A;  4KUL A;  2D0N A;  1V1C A;  1Y96 A;  4FM4 B;  1UEB A;  2XMF A;  3LWH A;  2WSE E;  2J6K A;  1SKU B;  1OQK A;  2FL7 A;  1UGR B;  3H6Z A;  4M78 G;  2DTI A;  3GP8 A;  2EYY A;  1WJS A;  1VQ4 Q;  3MEA A;  1VQP Q;  4JRK A;  2EYW A;  4J9I A;  3JB9 F;  1UGQ B;  1VQN A;  2KT8 A;  3QDR B;  3OYI A;  2KRN A;  3I55 Q;  2KGT A;  1VQO Q;  2RNA A;  2L3R A;  2HQE A;  3QUI A;  1KIK A;  1Y57 A;  2F69 A;  4QW2 A;  4A4G A;  4QQD A;  4HCC A;  1Y07 A;  2KR3 A;  3VRY A;  3JRZ A;  2A0F B;  1QVF S;  3UF4 A;  5GAO l;  4JJC A;  1N8R U;  3CQT A;  2KT1 A;  5HY6 A;  3CMA A;  1YIJ Q;  1AZG B;  4ME7 A;  1K8A C;  4Y92 A;  5M9O A;  3VV0 A;  2YUP A;  3SWN A;  3VUZ A;  4Y91 A;  1Q81 U;  1VQ5 A;  1VQ9 Q;  3CEY A;  3CCE T;  2A7Y A;  2DEQ A;  1TS9 A;  4YTL A;  3UAT A;  4A4H A;  2OTL Q;  3QHS A;  4OB3 B;  2D0Q B;  5LJ3 g;  4FIB A;  1SEM A;  1TSF A;  1D3B A;  2NWM A;  3RR6 A;  5IH2 A;  3HSB A;  4IUV A;  2LQK A;  3CC7 Q;  2CZ6 B;  4J7F A;  4DOV A;  3OYE A;  2PUO B;  3EFO A;  2X51 A;  4M7A C;  4JRI A;  1EFN A;  5LJ5 h;  2LP5 A;  2YT6 A;  3CCU T;  1MND A;  1ABQ A;  2ZCF B;  1M1K R;  2C0I A;  2QQA A;  3G4S T;  3R6N A;  3G71 T;  2MWO A;  3VS5 A;  1QVP A;  5DM7 R;  4E7J A;  4IKF A;  4XTZ A;  3HL8 A;  4PNO A;  3QO3 A;  1YJN T;  1JJ2 S;  2HBP A;  1CSK A;  1IO6 A;  1VQ8 T;  2RM4 A;  2NLU A;  2SEM A;  2DPP B;  1S72 T;  2JNG A;  1UJY A;  2BTT A;  2RJC A;  3I35 A;  1G83 A;  2DD5 A;  1M2V A;  2GQV A;  4E7L A;  2K5F A;  5CQX A;  1YIT Q;  4M7A G;  2JS2 A;  2J6O A;  3CC4 Q;  5A0G A;  1XQH A;  5GAN 4;  1JU5 C;  4WTO B;  1YP5 A;  2ECZ A;  5GAN h;  3OB9 A;  4PJO B;  5CR2 A;  2MF2 A;  5AYF A;  3E19 A;  1VQ6 A;  1A0N B;  1G3T A;  5FU6 C;  1GCQ C;  5CQY A;  2HL5 C;  2MIO A;  4M75 B;  3RKX A;  3A1P A;  4M75 D;  3VRZ A;  3JCM e;  2VGN A;  1NPR A;  2DIL A;  5KYU B;  4AT1 B;  2DFU A;  2E1H A;  5I21 A;  3NTI A;  3RKW A;  2D6F A;  1HD3 A;  1UE9 A;  3JB9 G;  1M1K C;  3OYD A;  3HTR A;  2PU9 B;  1YJ9 T;  1BK2 A;  5CO7 A;  1O9S A;  2NYS A;  5GJW B;  2RQR A;  1VQL Q;  1VYV A;  2ATC B;  4CC7 A;  1GCP A;  3EH1 A;  5A2Q E;  2VYT A;  1YI2 T;  1JXO A;  3KUF A;  3CCJ T;  4BD3 A;  1X43 A;  2KMT A;  3CCM A;  2LTO A;  4CI0 C;  2KSS A;  3OYJ A;  3CCR T;  4ANJ A;  1ZUY A;  5LJ3 j;  3JCM d;  3TSW A;  2JJ9 A;  2JM8 A;  2GCX A;  4JRP A;  1K9A A;  2LQN A;  1K73 U;  4J9F A;  2DBM A;  4V2S A;  2EVR A;  5J39 A;  2ZPF B;  1NJI R;  2YUN A;  3UPU A;  1PCX A;  4DQ2 A;  1X6B A;  5I2S A;  3O5Z A;  1IGQ A;  2CDT A;  4C5I A;  1YCS B;  3SWN C;  2EIF A;  1PRM C;  4M78 D;  3EFR A;  5IT9 E;  1NPP A;  1JO8 A;  4ZGD B;  2QQS A;  2GF7 A;  2DRM A;  1BCM A;  3A8M B;  2FB7 A;  3CCL A;  2HDA A;  2EJG A;  2QI2 A;  4XU2 A;  3JCM f;  1N9S A;  2P4R A;  2VVK A;  1AWJ A;  1VQK Q;  1YHQ Q;  2C0T A;  2YSQ A;  2LX7 A;  3EGU A;  1QKX A;  2FEI A;  5C0M A;  2IIM A;  1YFN A;  4J9E A;  2RHY A;  3EGD A;  1GBQ A;  1VYT A;  4PFP A;  3L2R A;  1VYU A;  2WAC A;  2OAW A;  3M59 A;  4E7S A;  1RAH B;  4R56 A;  1H3Z A;  4FYW B;  4A63 B;  2JW4 A;  2QGG A;  2QGF B;  2NUT A;  1OZ2 A;  3DLL A;  3CCS A;  1K8A U;  1KQS S;  5FLX E;  7AT1 B;  2X3X D;  3NPF A;  2PVD B;  2PVG B;  1LVK A;  2MMP A;  4J9C A;  2YLB A;  1NBE B;  4RG8 A;  2O01 E;  2CZ1 B;  1AWX A;  3MEW A;  1UTI A;  1VQ4 T;  4EPC A;  1BIA A;  2G3R A;  1YJW A;  4KH1 B;  2KBT A;  3JSC A;  1WXB A;  1X69 A;  2HSE B;  1NYG A;  3I55 T;  3LGL A;  1VQO T;  4M77 A;  2CUD A;  1HXD A;  3A98 A;  2E5K A;  1TUG B;  4NL3 A;  1UUE A;  9ATC B;  4M75 E;  1M4Z A;  2HKQ B;  1SRL A;  2DXT A;  1EIF A;  3VS4 A;  2LMJ A;  3L42 A;  4LD6 A;  4J6Y A;  3JCM V;  1ZBJ A;  2E6Z A;  3OYF A;  2KAF A;  4BE1 A;  3S3N A;  1XOV A;  1WJQ A;  3LGF A;  1XNI A;  2RHU A;  2YUO A;  4M7A D;  5GAM g;  4PJL A;  2RH2 A;  3QBY A;  5IXB A;  1VQ9 T;  2EW3 A;  1WHM A;  1VQM A;  2O9V A;  3A8G B;  2JM9 A;  1QLY A;  4FW1 A;  4J9B A;  4PJO F;  2OTL T;  3GIB A;  3TQ7 P;  2DL8 A;  2YRC A;  4QQG A;  4XK8 E;  1TG0 A;  2OX7 A;  4C92 B;  3JV3 A;  3RUX A;  4RUG A;  2RJD A;  3L2U A;  2KY9 A;  1AT1 B;  3P8B B;  2A3L A;  1ABO A;  3LYI A;  4MZM A;  2QA4 A;  4M75 F;  5CK9 A;  2FRY A;  2RI5 A;  1K4U S;  1WQ7 A;  4ORZ A;  2COZ A;  2D1X A;  3CBO A;  4FT2 A;  4C8Q B;  5FU7 B;  4DEY A;  4C8Q D;  2F5K A;  2ZPE B;  4XTW A;  3ZEH A;  3LWI A;  3HP9 A;  4WCI A;  4HCZ A;  4EMG A;  3PMT A;  1OUL A;  1Q95 G;  2EQU A;  2DE0 X;  4MDW A;  1D09 B;  2KRS A;  2FPD A;  4KBM B;  1M1K U;  3VS7 A;  3ASK A;  5L23 A;  4TVR A;  4C5E A;  5FRN A;  5GAN 6;  4MML A;  3JCM P;  2IPO B;  4PL6 A;  2O4X B;  1QP2 A;  3M56 A;  1YIT T;  3OYM A;  4O6J A;  3CCE A;  2P84 A;  5LJ3 e;  4RTV A;  3CC4 T;  1Q86 R;  1FYN A;  1AEY A;  1PNJ A;  3CME A;  3HFN A;  1TU0 B;  1QCO A;  4OMM A;  2JMA A;  2CSI A;  4C5G A;  1WGS A;  2Y4X A;  4ZGE B;  3MJX A;  2D8H A;  3OYK A;  3VS2 A;  4KRT A;  3V8J A;  1I5L A;  2MI6 A;  1OU9 A;  2CP0 A;  4B9W A;  5KYX A;  2GQI A;  1WHK A;  3G71 A;  2XK0 A;  2QQ9 A;  2ZPH B;  2EQK A;  2LCS A;  4VUB A;  2PQW A;  1I1J A;  2EJ9 A;  3OQ5 A;  2RF0 A;  3NTH A;  2AK5 A;  3WVE B;  5CKF A;  3CCQ A;  4C0D B;  5LJ3 d;  1LCK A;  3R6O A;  1UGP B;  5GMK j;  3OS2 A;  1KQ2 A;  3M0Q A;  1C6V X;  3GNF B;  1S1N A;  2XKO C;  3RER A;  1RLP C;  2KK4 A;  3KFV A;  3OYH A;  2EKH A;  5GAM j;  4EMH A;  1KK7 A;  2VAS A;  4BE2 A;  4LD9 K;  4PFZ A;  4R55 A;  1X75 C;  1RAA B;  4F7U A;  4OGE A;  1WHL A;  4M77 C;  3BW1 A;  3CBM A;  2VV5 A;  3LLR A;  3PVL A;  3MO8 A;  1B34 A;  2DL5 A;  1Q86 C;  2LQW A;  5LJ3 f;  3VUB A;  2JVV A;  5GAO q;  3OS1 A;  5GAO p;  4M7A E;  3HKS A;  4PJO G;  3A8O B;  1NM7 A;  2EFI A;  3THK A;  1G3Y A;  2QQR A;  2V8K A;  3H0F A;  1M3A A;  2QEX A;  1WX6 A;  1ZHI A;  2GFA A;  1IXD A;  3EHR A;  1RAE B;  4M77 G;  3HRU A;  4M7D B;  2R57 A;  1K76 A;  4M7D D;  2QXF A;  1W2B P;  2Z0W A;  2K3B A;  1VQN Q;  4HVW A;  3LW5 E;  5CCA A;  1AVZ C;  1QP3 A;  2XU8 A;  1YHQ T;  1VQK T;  1H3H A;  3PT9 A;  2YDL A;  1N5Z A;  3CCJ A;  4E7Z A;  1TOV A;  4EDU A;  2NUP B;  2LRQ A;  2H8H A;  4C8Q E;  2X4J A;  3I9Q A;  3DLM A;  4JJB A;  3EHQ A;  4XTU A;  3VKI A;  2J6F A;  1BI2 A;  1Z9Q A;  3LH5 A;  1SF9 A;  2EYQ A;  3CMA Q;  3Q1J A;  4WF2 A;  1X6O A;  4O5V A;  4RKU E;  2X9H A;  1JBM A;  4OMN A;  3C0C A;  1C1A A;  1VQ5 Q;  1E7O A;  2FZG B;  3URG A;  3M0S A;  1M90 R;  2Y90 A;  1N6A A;  1PM3 A;  2QG9 B;  3QPH A;  4ZN1 A;  4C92 F;  2PVO B;  1I4K 1;  2CP2 A;  3OSS C;  5D6W A;  3H8Z A;  4OML A;  4GLM A;  3V7S A;  2VXF A;  1EZZ B;  3EGX A;  2DZ9 A;  2HCK A;  1U06 A;  1M1F A;  4E6R A;  2L3S A;  2GTO A;  1TUD A;  3QWY A;  3HFO A;  2KEA A;  3M9Q A;  2ABL A;  2COY A;  1WPY A;  2PZ1 A;  4Q5W A;  3H9N A;  5CKE A;  4ZN3 A;  2BE9 B;  3M0R A;  1O75 A;  2FPF A;  2RI2 A;  2DAQ A;  1K0X A;  1OOT A;  5KCH A;  3L1A A;  4X1V A;  1W70 A;  2K2M A;  1T0J A;  2DK3 A;  1KD1 C;  2XDP A;  2HKN A;  4IIM A;  5J3B A;  2RQU A;  3E2U A;  3GPL A;  3JB9 J;  2YXY A;  3SDZ A;  3GBQ A;  1RI0 A;  4NS5 A;  3V8L A;  2HQX A;  1PKT A;  2MCN A;  3S3O A;  1RUW A;  1M90 C;  1VQ6 Q;  3AT1 B;  3TCJ A;  2EYZ A; 
#chains in the Genus database with same CATH homology
 2EGC A;  2V1R A;  1JO8 A;  3EG1 A;  1WDX A;  2DRM A;  4JZ4 A;  1GBR A;  5FWB A;  3I5R A;  2HDA A;  3PVQ A;  2P4R A;  2OJ2 A;  2VVK A;  4FSS A;  1MUZ A;  1AWJ A;  1QKW A;  4RTW A;  4HXJ A;  2C0T A;  2YSQ A;  2NUZ A;  2LNH B;  2LX7 A;  2CH4 W;  3EGU A;  1WIE A;  2JXB A;  1QKX A;  2FEI A;  4IIO A;  2JTE A;  2PTK A;  2IIM A;  4EIK A;  1B3Q A;  3NHN A;  4J9E A;  1GBQ A;  1VYT A;  1BB9 A;  4HCK A;  1ZUU A;  2O2O A;  2FG0 A;  3REB B;  2ENM A;  1VYU A;  2OAW A;  1FMK A;  4CC3 A;  2DL4 A;  2K6D A;  3VS3 A;  4A63 B;  2JW4 A;  1OPK A;  2M0Y A;  3NMZ C;  1YN8 A;  2EGE A;  4CC2 A;  2X3X D;  3NPF A;  2F2V A;  5HCK A;  1Y0M A;  4J9C A;  2DMO A;  1I07 A;  2CH4 A;  2CRE A;  2DX1 A;  2A28 A;  2A08 A;  5IXF A;  5I11 A;  1X6G A;  1AWX A;  2AZS A;  3RNJ A;  1Z9Z A;  1UTI A;  2BZX A;  2KXD A;  3UA6 A;  1UHF A;  2KBT A;  1WXB A;  1X69 A;  3EG3 A;  3I5S A;  1NYG A;  2ESW A;  5FW9 A;  2CUD A;  4F16 A;  2LJ1 A;  1KJW A;  1PKS A;  2RN8 A;  2DLP A;  3A98 A;  3M0T A;  2E5K A;  1K1Z A;  1NEB A;  2A36 A;  1UUE A;  1X2Q A;  1BU1 A;  1KFZ A;  1QCF A;  1QWE A;  1SRL A;  4J9G A;  2PNI A;  2JT4 A;  3VS4 A;  2LMJ A;  5FWC A;  4AG1 C;  1ZBJ A;  1MV0 B;  3VS1 A;  1XOV A;  1UDL A;  2LZ6 B;  1PHT A;  1TUC A;  3EG0 A;  2DA9 A;  2GNC A;  2KE9 A;  2LJ0 A;  2YUO A;  3PE0 A;  2EQI A;  4GBQ A;  5IXB A;  2HBW A;  2RQV A;  4JPB W;  2EW3 A;  3EG2 A;  1PRL C;  2O9V A;  2DVJ A;  1SSH A;  2JM9 A;  4DEX A;  4RTZ A;  1QLY A;  2O88 A;  1NG2 A;  4J9B A;  2KRO A;  1NLP C;  4LUE A;  2DL8 A;  2HEQ A;  2DM1 A;  1TG0 A;  1WYX A;  2CUB A;  2O9S A;  4AFQ C;  1M3C A;  4F14 A;  3JV3 A;  4RUG A;  1AZE A;  3ULR B;  2DBK A;  5ECA A;  1G2B A;  1ABO A;  1AD5 A;  1X27 A;  1X2K A;  2FRY A;  4HVV A;  1K4U S;  1M30 A;  1ZUK A;  1UGV A;  4ORZ A;  1QWF A;  2D1X A;  4R0K A;  2L3P A;  4DEY A;  2D8J A;  1WXU A;  4WCI A;  3VS6 A;  3TVT A;  3M0P A;  2DE0 X;  2FO0 A;  1WFW A;  2KRS A;  2FPD A;  2JMC A;  5EC7 A;  1SHF A;  1AWO A;  2GTJ A;  1GCQ A;  3VS7 A;  4LN2 A;  5L23 A;  3UA7 A;  1YWO A;  1CKB A;  3FJ5 A;  2ROT A;  2DL7 A;  2O31 A;  4RTV A;  2BZ8 A;  1FYN A;  5I22 A;  2F2X A;  4JZ3 A;  1AEY A;  2RMO A;  1SPK A;  2DJQ A;  1T3S A;  1PNJ A;  2L2P A;  4OMM A;  2JMA A;  2CSI A;  3SEM A;  4AG2 C;  1U3O A;  1PWT A;  4CC4 B;  2J05 A;  2DRK A;  1GFD A;  2D0N A;  2D8H A;  2OI3 A;  4J9H A;  3VS2 A;  1V1C A;  4KRT A;  2XMF A;  2J6K A;  2L3Q A;  4Z8A A;  2GQI A;  2V1Q A;  2YUQ A;  2K9G A;  2K79 A;  2L0A A;  2EYY A;  2MOX A;  1UFF A;  4AFS C;  1OPL A;  4F17 A;  2EYW A;  4J9I A;  2CT3 A;  1JXM A;  2KT8 A;  2LCS A;  1I1J A;  2KRN A;  3TSZ A;  1NEG A;  2KGT A;  2KXC A;  2RF0 A;  3H41 A;  2SRC A;  2RNA A;  1VA7 A;  2AK5 A;  2AZV A;  2KYM A;  1T3L A;  1KIK A;  4J9D A;  1Y57 A;  1UEC A;  1LCK A;  2C0O A;  2J06 A;  2KR3 A;  3M0Q A;  3VRY A;  1S1N A;  2QDL A;  4RTX A;  3UF4 A;  4ZNX A;  1RLP C;  4JJC A;  3KFV A;  2W0Z A;  3CQT A;  2KT1 A;  3RBB B;  2EKH A;  2ED1 A;  2RQT A;  1AZG B;  2DF6 A;  1KSW A;  4Y92 A;  2FPE A;  2YUP A;  1H8K A;  4Z89 A;  4D8K A;  3PVL A;  1JQQ A;  1UJ0 A;  2X3W D;  2DNU A;  2I0N A;  3UAT A;  2DL5 A;  2EPD A;  2GGR A;  2DL3 A;  2HSP A;  2LQW A;  1ARK A;  4AFU C;  1SEM A;  2B86 A;  4OMP A;  2NWM A;  5IH2 A;  1GRI A;  1M27 C;  1NM7 A;  3ZL7 C;  2DYB A;  1T0H A;  2J7I A;  3VS0 A;  3THK A;  1EFN A;  1M8M A;  3H0F A;  1M3A A;  1WX6 A;  2LP5 A;  2YT6 A;  4RTT A;  1ABQ A;  1YNZ A;  3EHR A;  2C0I A;  3R6N A;  3VS5 A;  4D8D A;  1K76 A;  3REA B;  2KYB A;  1OV3 A;  1WLP B;  1UHC A;  2EGA A;  2FRW A;  1J3T A;  1H92 A;  2K3B A;  2GBQ A;  1AOJ A;  3QWX X;  2AKK A;  5GJV B;  1WA7 A;  1CSK A;  3SHW A;  4HVW A;  4K11 A;  1IO6 A;  2G6F X;  1AVZ C;  1H3H A;  2SEM A;  4LE9 A;  1UJY A;  2BTT A;  1JEG A;  2YDL A;  1N5Z A;  3H0I A;  1G83 A;  3I35 A;  1U5S A;  2H8H A;  2KNB B;  3I9Q A;  2LJ3 A;  4JJB A;  3EHQ A;  4RTY A;  2JS2 A;  2J6F A;  2J6O A;  1MV3 A;  1Z9Q A;  3LH5 A;  1SHG A;  1JU5 C;  2W10 A;  1YP5 A;  2ECZ A;  1I0C A;  4OMN A;  2ROL A;  2BZY A;  3C0C A;  1WI7 A;  1E7O A;  3M0S A;  2JS0 A;  1A0N B;  1E6G A;  4QT7 A;  1RI9 A;  1GCQ C;  1W1F A;  2RQW A;  1UG1 A;  3NGP A;  1K0S A;  4LUD A;  2A37 A;  1NYF A;  2MIO A;  4ESR A;  4OML A;  1BBZ A;  1YWP A;  4GLM A;  3VRZ A;  4AFZ C;  1OEB A;  1W6X A;  2HCK A;  1U06 A;  2DIL A;  2M51 A;  1GL5 A;  4E6R A;  1ZX6 A;  2L3S A;  4OMO A;  2GTO A;  3M0U A;  1HD3 A;  1TUD A;  1E6H A;  3QWY A;  1UE9 A;  1ZSG A;  2KEA A;  2ABL A;  2VKN A;  2PZ1 A;  2F2W A;  4Z88 A;  1BK2 A;  4LNP A;  3M0R A;  2CSQ A;  2FPF A;  5GJW B;  2K7A A;  2RQR A;  3H0H A;  1VYV A;  3U23 A;  4CC7 A;  1K0X A;  1OOT A;  1HJD A;  1GCP A;  4X1V A;  1W70 A;  4OMQ A;  2K2M A;  1JXO A;  1T0J A;  4IIM A;  1GFC A;  1CKA A;  1X43 A;  2RQU A;  4M4Z A;  1AWW A;  3IQL A;  1WXT A;  2AKL A;  5IHN A;  2ED0 A;  2EYX A;  1ZUY A;  3TSW A;  1SRM A;  1B07 A;  1M3B A;  2CT4 A;  2JM8 A;  2KRM A;  5IHK A;  1K9A A;  2LQN A;  1HSQ A;  4J9F A;  1NLO C;  2DBM A;  3GBQ A;  2EBP A;  2RPN A;  2EVR A;  4JJD A;  1PKT A;  4RTU A;  2YUN A;  2MCN A;  1ZLM A;  4HVU A;  1RUW A;  1X6B A;  3O5Z A;  2CDT A;  1RLQ C;  5IHI A;  2VWF A;  1YCS B;  2EYZ A;  1PRM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...