3EG2A

Crystal structure of the n114q mutant of abl-sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
b'MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg2A00
3I5SA 3EHQA 2DBKA 3C0CA 2IIMA 1T0HA 2KT1A 1NEBA 4F14A 2CUBA 2LX7A 1WXUA 4J9EA 3REAB 1HSQA 2L3PA 4CC3A 1BB9A 3EGUA 2F2XA 1HJDA 4HVUA 4RTWA 1YP5A 2DLPA 1PRMC 3IQLA 3H0FA 2ABLA 1H8KA 2A36A 4RTXA 4K11A 1UG1A 4JZ4A 1FYNA 2DMOA 4ORZA 1VYUA 3TVTA 4AFUC 4DEYA 2HDAA 2M0YA 1M3AA 1TUDA 5FWBA 3VS5A 2PZ1A 4M4ZA 4OMQA 2VWFA 1Y0MA 2DL5A 3NPFA 1AWJA 1ZSGA 2J6KA 1QCFA 2CSQA 2EYZA 2ESWA 2K7AA 2ROLA 1NLPC 2HSPA 1X2KA 2D8JA 3VS4A 2EVRA 3NHNA 3EG1A 2DX1A 2AK5A 1PNJA 2JS2A 2W0ZA 1UHFA 2JM8A 2MCNA 1H92A 4OMMA 2GQIA 1JXOA 1ZUUA 4JZ3A 1G2BA 1IO6A 3I35A 3JV3A 1UDLA 3M0TA 1GL5A 2GBQA 4AG2C 1GCPA 1UJYA 1WA7A 2HEQA 1GCQA 1UGVA 4JJDA 1YNZA 3EG0A 1OPLA 1WXTA 1SRMA 2K3BA 1AZGB 3EHRA 1LCKA 4JJCA 2BZXA 2F2WA 1TUCA 2W10A 1GBQA 2QDLA 1M3BA 1X6BA 5L23A 1Z9ZA 2F2VA 1MUZA 4J9CA 1KJWA 4IIMA 2RNAA 1YN8A 2KYBA 2DL7A 2H8HA 2GTOA 3UA6A 1SSHA 1K1ZA 2CH4W 2X3XD 1AEYA 4HVVA 1W6XA 2CSIA 1GFDA 1QKXA 1QWFA 2KXCA 4GBQA 3VS3A 2JMAA 5FW9A 3VS0A 2BTTA 1GBRA 2DRKA 4OMNA 1K76A 1X27A 1K0XA 1GRIA 2YUQA 2CH4A 2NWMA 4D8DA 2EPDA 1JO8A 1GFCA 1CSKA 2ECZA 1BK2A 1UJ0A 1ZUYA 2EYWA 5HCKA 2FEIA 2SEMA 4HXJA 4CC4B 2SRCA 2X3WD 2J05A 2DF6A 1AWOA 1V1CA 1PKTA 1WYXA 2J6FA 4OMOA 4AG1C 2D0NA 3M0RA 1PKSA 1Y57A 2HBWA 1VA7A 2PTKA 2RMOA 2K2MA 4LUEA 2C0OA 1NYFA 1PWTA 1Z9QA 1EFNA 2RN8A 3R6NA 4RTVA 1OOTA 1QLYA 1M8MA 3GBQA 2DA9A 2JS0A 4LUDA 3SEMA 3SHWA 1B3QA 2ROTA 2YUNA 3VS1A 4F16A 4RUGA 2DILA 2CT3A 2C0IA 3ZL7C 2LJ0A 2KR3A 2P4RA 4RTZA 3M0SA 1RLPC 3A98A 1JXMA 1W70A 3KFVA 5ECAA 4FSSA 1B07A 1K4US 1QKWA 1WXBA 2DM1A 2O88A 1ABOA 2DYBA 2AKLA 2L3QA 4HVWA 2DL4A 2FG0A 5I11A 1A0NB 1X2QA 3QWYA 2VVKA 1YWOA 3NMZC 2EW3A 1NM7A 1VYVA 1ZX6A 2A28A 3UF4A 1M3CA 1WIEA 1AWWA 1J3TA 2A37A 1OEBA 2LCSA 2RQUA 1RLQC 4AFZC 1WDXA 2V1RA 2HCKA 1K9AA 3H41A 1S1NA 1AOJA 2GTJA 1E7OA 2O31A 3VS2A 2RPNA 4J9HA 2ENMA 1SRLA 2GGRA 1ZBJA 1BU1A 2EBPA 2FPDA 2KNBB 2OJ2A 3I9QA 5IHNA 1AZEA 1I0CA 2YSQA 4J9GA 4E6RA 3UA7A 4EIKA 1OPKA 1KIKA 1RUWA 2DRMA 1NYGA 1JEGA 1X43A 4RTTA 2MOXA 4OMLA 2LQWA 2DL8A 2DBMA 3PE0A 1VYTA 2CREA 2KT8A 1X69A 2I0NA 2K79A 2EGEA 2J7IA 3EG2A 1SEMA 1I1JA 2EGAA 1ABQA 3QWXX 5I22A 2LJ3A 2MIOA 2AZVA 3PVQA 2OI3A 4LN2A 2CT4A 4J9IA 5IXFA 2DNUA 1XOVA 2DL3A 2AZSA 5EC7A 1YCSB 1SHFA 2DJQA 3O5ZA 2LJ1A 3UATA 4OMPA 5GJWB 2FO0A 2VKNA 2J6OA 4R0KA 2KE9A 1OV3A 3THKA 2J06A 2OAWA 2KGTA 2LNHB 2LQNA 2LP5A 2K6DA 1GCQC 4RTUA 5IHKA 4Z88A 3H0HA 4Z8AA 4D8KA 4JJBA 2FPEA 2YT6A 3ULRB 1UHCA 5IHIA 1RI9A 4LNPA 1ARKA 2RQTA 4J9FA 1SPKA 1UE9A 4IIOA 1MV3A 1AVZC 2ED0A 5IXBA 1H3HA 2DE0X 3RBBB 4HCKA 4ESRA 2YDLA 1U3OA 2L2PA 3TSWA 1X6GA 2D8HA 1JQQA 4LE9A 2K9GA 2KBTA 4KRTA 2M51A 2O9VA 3VS6A 1PHTA 2CUDA 4QT7A 3VRZA 1YWPA 2GNCA 2RQWA 2EGCA 2RF0A 4CC7A 4Z89A 1PRLC 1T0JA 4A63B 1N5ZA 3LH5A 1JU5C 2JMCA 1QWEA 2L0AA 2CDTA 1E6GA 2O2OA 2KRMA 1G83A 1T3LA 2KRNA 3RNJA 3TSZA 4F17A 1M30A 3FJ5A 1WI7A 2V1QA 3REBB 1NLOC 1AWXA 2O9SA 4X1VA 1KFZA 2G6FX 4ZNXA 1I07A 2JM9A 1TG0A 1KSWA 1UFFA 5IH2A 1WFWA 4CC2A 1E6HA 1WLPB 1CKBA 2EYXA 2KROA 2NUZA 3M0UA 1UUEA 3VRYA 5FWCA 2RQRA 1BBZA 2JXBA 1T3SA 2JT4A 1U5SA 2JTEA 1K0SA 2RQVA 3VS7A 2BZ8A 2XMFA 2D1XA 2LMJA 2DVJA 3CQTA 2B86A 4RTYA 2JW4A 1HD3A 3M0PA 1UTIA 2BZYA 2ED1A 1UECA 1WX6A 2YUPA 3U23A 1NG2A 2PNIA 2FPFA 4J9BA 1AD5A 2EKHA 4Y92A 2EYYA 4WCIA 2FRYA 2KRSA 2LZ6B 2AKKA 1W1FA 2KXDA 3EG3A 1SHGA 1MV0B 3H0IA 2YUOA 3M0QA 1M27C 2KEAA 2C0TA 1U06A 2L3SA 2EQIA 2E5KA 4AFSC 4GLMA 3I5RA 3NGPA 3PVLA 1CKAA 2FRWA 4JPBW 5GJVB 2KYMA 1FMKA 1NEGA 2A08A 1ZLMA 4DEXA 1ZUKA 4AFQC 4J9DA
chains in the Genus database with same CATH superfamily
3I5SA 4KH0B 3A8OB 3CCQQ 2ZPIB 5GAN6 3QZ5B 1G3YA 1Y96B 2CUBA 2ZPGB 2LX7A 1WXUA 2QEXQ 1IHWA 4CC3A 3META 3SD4A 1HJDA 1TXQA 4RTWA 4C92E 2DLPA 2EWNA 3ASKA 3A8HB 3LW5E 3BDLA 3QYHB 4ZGEB 4JLGA 2DEUA 1UG1A 2O4XB 3QJYA 1N6AA 3CEYA 2HSEB 4LXCA 1VYUA 4N4IA 4YTLA 3GNFB 3NTHA 3ZBDA 5C0MA 1JJ2P 2ZAEA 1ZSGA 5GAOl 3S3NA 1JJ2A 1QCFA 2VC8A 2EYZA 2V8JA 3OBWA 2JTFA 4B9WA 1VQ8Q 3L2WA 1NLPC 1X75C 2HSPA 2D8JA 4M7AA 4M78E 2EVRA 3OS5A 2LQ8A 3J80E 1U8RA 2CZ1B 3CCUT 1PNJA 2JS2A 2MCNA 2JM8A 2DKGA 4MDWA 1VQKQ 5FLXE 3WVEB 1FWZA 2DPPB 1GL5A 2GBQA 1KC8R 4BI4A 4AG2C 4M77A 3QSUA 4M7AD 1O9SA 1VQPT 1AZGB 3JCMf 2DZCA 4XTYA 4CI0C 1GBQA 1JRIA 2E6ZA 3CCMA 3I56T 2KSSA 3OSVA 4J9CA 2RNAA 4M77F 2GTOA 2VV5A 4J7IA 3UA6A 2X3XD 1AEYA 4IUVA 1VQNT 1W6XA 2HZYA 2R5MA 1RAIB 3CMET 1GFDA 2R58A 2FL7A 1Q81R 2FZKB 2GFAA 3OS0A 3VS0A 4OGEA 5GANh 1YJ9T 2DRKA 3A5ZB 2JUFA 1KK7A 1K76A 3EGXA 2FZCB 3V7CA 1YFNA 2EYWA 5GAMh 2FEIA 3CCJQ 4CRIA 4BI3A 3CCVT 2XKOC 2J05A 2L3RA 3ZFJA 2K4YA 1Q95G 2D0NA 1OZ2A 4XU3A 4E47A 3CC2T 4M75E 3EG9A 1B34B 4LUEA 1M2VB 2Y4XA 2RN8A 2OTJQ 2EIFA 4N4HA 4GLKA 2VGNA 1M1GA 1QLYA 3M4GA 2E65A 3CCLA 3I55Q 3MEVA 1WNLA 1RAEB 2DIQA 3SHWA 2CP7A 3G4ST 2YUNA 3VS1A 2DFUA 3QKJA 1X01A 5LJ3e 2QASA 4O6JA 1WHLA 4O5VA 1VQMA 1VQ6T 1QCNA 3NTKA 2EFIA 3UPUA 3M0SA 2BE9B 1JXMA 5CAIA 3HFOA 3QJ6A 4JDSA 1NE8A 4HT8A 3L2VA 3RKYA 1QKWA 2DM1A 2O88A 1ABOA 1EX4A 2QQSA 4KUIA 1HYOA 2FG0A 1VQ5A 1QQJA 1X2QA 2M1HA 1M2OA 2MWPA 1M1KC 4HA8A 2QG9B 1VQOA 2A28A 2RHXA 3UF4A 1AT1B 3TCJA 4F7UA 5KCHA 2RK2A 4RCCA 5A2QE 1QVFP 4DBHA 3CCUQ 2DETA 3CC7A 4C0DB 5KE3A 5D6WA 1QVFA 3HTRA 4PJLA 1S1NA 2ZZDA 3RDVA 2FVUA 2RM4A 4F7UF 4LDUA 3I9QA 3EH2A 1AZEA 3PGGA 2QK0A 2YSQA 4MDXA 1VQPQ 4M7AB 1VIFA 4PFOA 3JB9H 3HRTA 4IUUA 4L59A 3OY9A 4JUVA 2OTLA 1FXXA 4XTZA 3C12A 4RTTA 3I56Q 4OMLA 2LQWA 3PE0A 2K79A 4Y28E 1SEMA 3JB9D 3M57A 1D0ZA 1VQNQ 2CT4A 4J9IA 3CMEQ 2DNUA 2DL3A 5EC7A 2DO3A 1YIJA 1YJ9Q 1Q82U 3UATA 4DA4A 2QTXA 2MK5A 5GJWB 2DZ9A 3LWIA 3RR6A 2RJEA 1ZSZB 1R8OB 3THKA 2LNHB 4BI8B 3CCVQ 2K6DA 4M7AG 2GFUA 4Z88A 4D8KA 4RG2A 3OYHA 3JCMb 1K9MC 3CC2Q 5FU7B 1UHCA 1RI9A 2RQTA 3A1PA 5CIUA 1IREB 1W2BS 1DJ7B 5IXBA 2RH2A 3LWHA 1RAAB 2DE0X 1ZSZC 5GANd 4QQ6A 3TSWA 1X6GA 2CP0A 4L6V5 1D1BA 4BD3A 1JQQA 2CZ0B 2K9GA 4XK8E 3DLLA 2O9VA 3G4SQ 1M90U 1WPYA 3EG9B 3SB2A 3VRZA 3OW2P 2K5LA 2GNCA 2F5TX 3V8KA 2HQXA 4XU1A 3JCMV 1VQ6Q 4J6YA 2E64A 2L0AA 2CDTA 2KRNA 1M30A 3FJ5A 3C4SA 2HBPA 2EQUA 2O9SA 4J8OA 3OYAA 1KFZA 4M77E 1I07A 3JAME 1IZ6A 1ZHIA 3GF5A 4FYXB 1M9SA 4C5HA 1OX8A 3MP1A 1BI0A 1RADB 4CC2A 1QVGP 1E6HA 1UEBA 2K57A 3LLRA 3M0UA 4QVDA 3LH0A 5FWCA 2RQRA 5LJ3f 4A4GA 5A0GA 5GANg 1QVGA 1NJIU 3DB4A 2XMFA 2LMJA 2HQHA 3CQTA 2DTOA 3DKMA 2CZ7B 2JW4A 2MPXC 4JLIA 2BIVA 3V7SA 2YUPA 3OSSC 5IN1A 3QO3A 1VQ9A 1IRXA 3HL8A 4M7DC 1M5Q1 4J9BA 3CBPA 2CP6A 4OGCA 4OVAA 2EYYA 2KK4A 1BCOA 4JS5A 1WGSA 2KRSA 3A8GB 2A7YA 4ELZC 5HK3A 4E7ZA 3CC4A 1M27C 2Y4YA 2EAYA 2EQIA 4M7DG 2E5KA 3SWNC 2DEQA 3I5RA 4GLMA 4AFSC 3NGPA 1WQ7A 1CKAA 2E41A 1YHQA 5GJVB 4Z02A 2KYMA 3URGA 2QEXT 2QXFA 2K3YA 4N0AC 4QVZA 1NEGA 5HK0A 3M9QA 4J9DA 4XTXA 2O01E 2DBKA 4DBFA 5LJ5e 2HMAA 5GAOm 1NEBA 1HSQA 2L3PA 1BB9A 5CKHA 2L8DA 1RL2A 2R57A 4FIBA 4HVUA 4XU2A 4PKCC 3H0FA 3PMIA 5D6YA 5D6XA 1WZOA 2A36A 2RI2A 3FJPA 3CCSA 3TEEA 3QYGB 4C8QD 4ANJA 4KH1B 5GAOp 3TVTA 3JB9G 2M0YA 2L89A 1TUDA 1QMCA 3J81E 1Y0MA 1PD1A 3NPFA 5M9OA 2CP5A 2XICA 2ESWA 2H3EB 4A4EA 4WTOB 3MJXA 1VOMA 5IAYA 4F7UE 1UHFA 4EDUA 1F1BB 1MNDA 3CD6A 1ZUUA 4JZ3A 1G2BA 1S72A 4FYWB 3CCLT 3I35A 5I2MA 5KYUB 1BCMA 4PFZA 5CKDA 1D1CA 3H6ZA 1XNIA 1UJYA 2RK1A 3QG1A 4JJDA 2FHDA 3CMAA 3EG0A 1OPLA 1WXTA 1SRMA 4PLIA 2COYA 1QP3A 3L1AA 2QQAA 1LCKA 4JJCA 5CO7A 2F2WA 1SG5A 1TUCA 5GAN5 2QDLA 1M3BA 5L23A 2XK0A 2KAFA 1YN8A 2H8HA 3PMTA 4JRKA 1SSHA 1Q82R 2D6FA 3JRZA 4QVCA 2WSCE 2X4JA 4KT0E 2CSIA 1EIFA 4OB2B 1M2VA 1PSEA 2K5IA 2KXCA 2YHTA 5FROA 3OA6A 1GBRA 4C92C 1X27A 3L2UA 8ATCB 2LDMA 2FZGB 3A8LB 3FC3A 1VQOT 1JO8A 4E7KA 2CGHA 1GFCA 1NBEB 2ECZA 4MMKA 3BY7A 4ZTFA 2E5QA 2QQBA 3O8VA 1WJQA 3FRNA 4HXJA 2SRCA 2X3WD 3CC7T 3MEAA 1AWOA 1U1TA 2V8IA 4BE1A 1Q86U 5GAMj 1PKTA 2J6FA 4AG1C 1R77A 3MO8A 3T9NA 2PTKA 2PUOB 5GANe 1M90R 1Z9QA 1EFNA 3R6NA 1XTDA 2A3LA 4RCBA 2LX9A 3P8BB 2DA9A 3G6EA 3S3OA 1R0CB 4XQ3A 1K73U 2P84A 2CT3A 2C0IA 3ZL7C 4EPCA 2RHYA 3WXMB 4PJOD 5FRNA 3CPFA 1YIJT 1RI0A 2P4RA 4RTZA 2DXTA 3A98A 1W70A 1M8VA 1HK9A 3KFVA 4BUGA 2IG0A 3QPHA 3MKDA 4C8QB 2MF2A 3HPWA 4HVWA 1NJIR 2LCCA 1OU9A 3EAEA 1A0NB 3QWYA 5LJ5f 3QDFA 1YWOA 4R55A 1ZX6A 1ZA2B 1UB4A 1MHNA 2CKKA 2XIDA 3PT9A 4M7AF 1M3CA 2DXBA 5A0LA 1YJWT 2WSFE 1RLQC 2EJGA 4AFZC 3H41A 1PM3A 3V8LA 2KDSA 4C8QC 2GTJA 3MCAB 1I4K1 1XJWB 3CCLQ 4J9HA 2ENMA 1ZBJA 5I2SA 3CCQA 3OBYA 2FPDA 2KNBB 5IHNA 1ZSZA 1I0CA 4NS5A 4EIKA 3KUFA 4FT4A 2E6NA 3CCET 1JEGA 3CXCP 4C8QG 2DBMA 1Q82C 2CREA 3EFOA 2I0NA 1N9SA 3CXCA 1I1JA 5I22A 2CYZB 3V8JA 4A4KA 2OI3A 4FT2A 2XG8D 1XOVA 1YCSB 2AT1B 4EMGA 1SHFA 2WACA 3JB9I 4OMPA 1VQLA 1PCXA 1ACMB 5EG2A 1U1SA 1VQOQ 2KE9A 1IXDA 2J06A 2LQNA 3CC7Q 4RTUA 5CKBA 5KYWB 3H0HA 4Z8AA 2FPEA 3TREA 4LNPA 2RB6A 1C6VX 4IIOA 4FW1A 3EGDA 5AYFA 2DXCA 4M7DA 4HCKA 2YDLA 1U3OA 1IGQA 3CC4T 4ELYC 2K5FA 4C0FA 2KBTA 4KRTA 2COWA 4UC4A 1YITA 2M16A 1PHTA 2CUDA 2VASA 4QT7A 3PNWC 2HQEA 2RQWA 2EGCA 5GAOr 4M7DD 1T0JA 3SWNA 4A63B 4PJOB 1YIJQ 1MMGA 2JMCA 2CP3A 1QWEA 3LGLA 1NPPA 2O2OA 5KH6A 2KRMA 3TSZA 3RNJA 4F17A 4BDYA 1WI7A 5GANf 4A53A 3REBB 4N0AA 2I2LA 4X1VA 3BW1A 2G6FX 1TU0B 1TG0A 5LL6S 5KYNA 4QQGA 1WFWA 2PVDB 1KC8C 1VQ7A 1WLPB 4PJOC 1CKBA 1ZBXA 2EYXA 4BE2A 1N9RA 1UUEA 1BBZA 5DM7R 1B7TA 1YJWQ 2NUPA 2RQVA 3JB9J 3CCST 1SSFA 1G3TA 2B86A 1PSFA 1HD3A 1UTIA 2JN0A 1UECA 1BI2A 2PQWA 4BY6C 3CPWS 3U23A 2RHIA 2PNIA 2QQRA 4WCIA 3JB9F 3KXTA 4PJOG 1RAGB 2VUBA 1Q86R 1M1FA 2AKKA 1Q81C 2JTMA 1OX9A 3EG3A 1KQSS 1SHGA 5GAN2 1MV0B 1TS9A 3M0QA 3CCEQ 4ATOA 2KEAA 2C0TA 4QW2A 1U06A 2L3SA 3CD6T 4BE0A 4V2SA 3PVLA 4NOYA 3OS2A 2FRWA 3UT1A 3MPUB 2BE7D 5IT9E 2QA4A 2LT4A 5LJ3h 1K73R 2A08A 4HKEA 4IUPA 2V8KA 4DEXA 1VQ4T 4E7SA 4AFQC 3EFOB 5CK9A 3EHQA 3C0CA 2MI6A 1I5OB 1T0HA 2YRDA 4BDZA 1KD1U 1OQKA 2JVVA 3CCUA 2QTVA 4JJNK 1C0MA 4AT1B 1TH7A 3OYDA 1YP5A 5DLQE 1PRMC 3IQLA 2ABLA 4IKFA 5KYUA 1H8KA 1Y07A 1VQPA 2EQJA 5GAMd 1FYNA 5CQYA 2X4WA 2DMOA 4ORZA 4C92A 4ZN1A 1UGSB 4M7AE 1D09B 1QP2A 3HRUA 4AFUC 3CC4Q 2HDAA 4J83A 4M4ZA 4OMQA 2DL5A 3I56A 1AWJA 2J6KA 3HRSA 2YWWA 4NL2A 2CSQA 3OYCA 2ROLA 4C0GA 3VS4A 3CMEA 3EG1A 2Z0WA 2AK5A 2E3IA 3EGDB 4C92D 3EFSA 4M7DB 2W0ZA 2EKOA 1KQ2A 1H92A 8AT1B 4OMMA 3KBGA 1IO6A 2GCXA 3JV3A 4M78A 4PL6A 3JCMP 1UDLA 1YJNA 1N8RR 3CCRA 3G6ET 1WA7A 2HEQA 3X25B 3HHTB 4D6WA 4PK4A 1BI1A 3GPLA 1H3ZA 1KQSA 1M1KU 3SWNB 3HKSA 4OP0A 1X6BA 1ZQ1A 5GMKl 2LCLA 3G71A 3JCMc 2RHZA 5GAMg 2F2VA 2ZGWA 1MUZA 4R56A 4M78D 4IIMA 2RHUA 2DL7A 4A4FA 5FU6C 5C6SA 3CCSQ 4JRPA 1QWFA 4OF1A 3VS3A 1D1AA 2BTTA 4IUTA 4Q5WA 3G4SA 1Q86C 1GRIA 1W2BP 2CH4A 4D8DA 2EPDA 1BI3A 2F5KA 4NL3A 1CSKA 5CR2A 2NUPB 5J26A 1W2BA 5HCKA 4DBRA 4P5NA 2SEMA 4CC4B 1VQ6A 2DF6A 3CD6Q 1V1CA 1S72Q 3HFNA 4OMOA 3OYYA 5GMKj 3M0RA 3CCMT 4PNOA 4J5YA 4IUQA 2P0PA 2D0QB 5J3BA 2RMOA 3HSBA 2K2MA 4C8QA 3E9FA 1NYFA 2WSEE 4RTVA 3OYMA 2XHCA 1VQ4Q 3VU3C 2EJFA 2MYSA 3OYLA 3MHXA 3PIPA 2ROTA 3OYGA 3NTIA 4RUGA 4C8QF 2DILA 3FLGA 2LJ0A 3OYKA 1K9MU 1BIAA 3GOXA 4M75D 4BACA 1XQHA 3GNGA 1RLPC 1I5LA 3QHSA 3VUBA 1VQLT 1FMWA 4FSSA 2KQWA 1K4US 2R5AA 4TVRA 2RO0A 2DYBA 2RD1A 2DL4A 5LJ3d 2P0QA 3UDCA 2E1HA 2HNIA 2VVKA 2M9UA 3NMZC 2EW3A 3ME9A 1VYVA 1G3SA 2LRQA 2DVEA 2GF7A 1VUBA 1AWWA 1J3TA 2DK3A 2A37A 1UGQB 2C06A 2RQUA 3BE3A 2DYIA 4GY5A 2GQVA 4FW2A 4C92B 1K8AU 1K9AA 2VXFA 5CQXA 4PJJA 3DLMA 3EFRA 2O31A 2QGFB 1JJ2S 2X9HA 1VQMT 3VS2A 1G8XA 1H641 2GGRA 1KHIA 1LJOA 2KVQG 2EBPA 2LQKA 3G6EQ 2OJ2A 3V7RA 2P4TA 2DTHA 1YITT 3VYGA 4E2FB 1BIBA 4J9GA 4E6RA 3UA7A 2E70A 2QDYB 1OPKA 4FU6A 1KIKA 1EZZB 1RUWA 1N27A 3E2UA 4F04B 3P8DA 5KYWA 1VQ5T 1NYGA 3GP8A 1X43A 4J6WA 3JCMX 2MOXA 2DL8A 3FIFA 1VYTA 1X69A 3LGFA 1UGPB 4M78B 2EGAA 2V26A 5LJ3g 3CBMA 4LN2A 5LJ5h 5IXFA 5GMKh 3F70A 2IVWA 3MEUA 1KD1R 4B9XA 4KGVB 4FYYB 4C92G 2A0FB 2FO0A 2VKNA 2AHJB 2YRCA 3C94A 3JCMh 1VQ7T 2J6OA 2RJDA 4R0KA 4RKUE 1OV3A 1HXDA 4M78C 2LP5A 4PJOA 5IHKA 2OTLT 2YT6A 3M53A 3ZEHA 3CCMQ 3X20B 5IHIA 1ARKA 5KE2A 1OZ3A 5GAMe 2EQKA 4N4GA 1MV3A 3BDUA 3GLXA 2JZ2A 1H3HA 2PVGB 4M78G 4HCCA 4KBMB 2MAMA 4PJOF 2L2PA 2D8HA 1KG1A 2DD5A 2EYQA 5L8RE 4LDXA 4KGXB 2M51A 4PJMA 3OYNA 1Y71A 4HCBA 5GAOn 1SKUB 3VS6A 1X6OA 9ATCB 2ATCB 4MZMA 2XDDA 4CC7A 4Z89A 1WHGA 1PRLC 3OYIA 2JNGA 2QA4T 1JU5C 4M75B 4EMKB 1T3LA 3OQ5A 1M1KR 1VQLQ 1FX7A 1AWXA 1YI2A 2FYKA 4ZNXA 4C5EA 4FM4B 1UFFA 5KYYB 5J39A 4C0ZA 4DBQA 2KROA 1NPRA 2COZA 3TQ7P 1LOJA 2JXBA 1T3SA 4M75C 2M0OA 1K0SA 1JB0E 4EMKC 3OB9A 2QEXA 2BZ8A 2RA2A 2DVJA 4QQDA 4FSXA 3X24B 1MMDA 4AMCA 4RTYA 3M0PA 2YRVA 3WVDB 3QDRB 1N8RU 1MMNA 4ZTJA 1PD0A 4IURA 4JRIA 1VQMQ 4PFPA 2FPFA 1AD5A 1QVPA 4Y92A 2LTOA 4XTVA 4M77D 1YITQ 4M75G 3QBYA 1KHCA 3RKXA 2KXDA 2DIGA 3M4YA 2DD4A 1Q7YU 2MWOA 1QVFS 2XI9A 3N5BB 3G1JA 2YUOA 2XD0A 4E7JA 4OB1B 1VQ5Q 2ZPFB 4A4HA 1OI1A 3H9NA 1MMAA 2DXUA 2HKNA 3VJPA 1VQ8A 4MZTA 1IB8A 1YJNT 3CCRT 3JSCA 4JPBW 1WHHA 1FMKA 2XU8A 1KD1C 3OMCA 1VIEA 2PUKB 4XTUA 3M55A 1VQKA 4C8QE 3S3MA 1ZLMA 3M54A 1VQ9T 3G71T 3C95A 1VQ7Q 4PJNA 1K9MR 5HKCA 2H3JA 2IIMA 2CS7A 4LDVA 5LJ3j 2KT1A 3L2QA 1M90C 4F14A 2K3XA 4J9EA 2PVOB 3REAB 1D3BA 2EJ9A 2VYTA 5HY6A 3EGUA 2F2XA 1LPLA 2OTLQ 3MP6A 4HT9A 4L5GA 1IGUA 2KMTA 2G3RA 2XDBA 1MNEA 3PIOA 4VUBA 1P92A 4RTXA 4K11A 1FMVA 4JZ4A 5LJ5d 1YHQT 1RAFB 2QYZA 4M7DF 5GMKi 4DEYA 3VS5A 1M3AA 5FWBA 2E3HA 2PZ1A 2VWFA 4J7FA 1AHJB 1K8AR 3JCMd 4OB3B 3VKIA 1YCYA 5GMKm 2HKQB 2K7AA 4DOWA 2Y90A 2RJCA 2CP2A 1X2KA 5FRMA 5DLOA 3NHNA 1NJIC 3CCJA 3JCMW 2DX1A 4BY6B 4LDWA 2ZPHB 1V29B 1KQ1A 3P8HA 5GAN8 2QA4Q 2GQIA 1JXOA 2QQ9A 5GAMf 3TU4K 5D7UA 1W4SA 2QAZA 3DB3A 3AHUA 3M0TA 2LNVA 1GCPA 2KY9A 3RUXA 1GCQA 1UGVA 3M58A 4ZN3A 1YNZA 2ZCFB 3HP9A 5DY9A 2K3BA 3EHRA 3OW2S 2BZXA 2OTJA 1TOVA 2QGGA 1LVKA 2W10A 3QIIA 4QKUA 3I55A 5LJ5g 1Z9ZA 2BUDA 1V76A 1LNXA 1KJWA 3LYIA 4OMFB 3NFCA 2KYBA 2ZPEB 1K1ZA 2CH4W 2LT1A 4HVVA 3L42A 1TUGB 4E7HA 3J7AF 1R0BG 4A54A 1QKXA 4GBQA 3JCMg 1PC0A 2M02A 2JMAA 5FW9A 3E19A 2E4HA 3X28B 4OMNA 4C0DC 1K0XA 2NUTA 1S72T 3MEWA 1QVGS 2YUQA 2NWMA 4PLLA 5GAN4 4M77B 1BK2A 1UJ0A 1ZUYA 2X35A 3H8ZA 3CMAT 3LX7A 4M7AC 1BKBA 1SF9A 4C5GA 4JRQA 5KYXA 4WF2A 4E7LA 1WYXA 4PJOE 2VXEA 4KULA 1WJRA 1YJNQ 3CCRQ 1PKSA 3E1SA 1Y57A 2HBWA 1VA7A 3JCMQ 2C0OA 4M77C 1PWTA 3INZA 3PTAA 1OOTA 2HD0A 2F69A 1VQ9Q 1M8MA 2VGMA 3GBQA 3G71Q 3EGXB 2JS0A 4Y91A 4LUDA 1WHMA 3SEMA 5GAN7 2EQMA 3FEOA 1B3QA 4ZGJB 1YJWA 4F16A 4EMHA 4M77G 4FCYA 2K2VA 2KR3A 2BKDN 1WQWA 1ZA1B 3RMSA 5ECAA 1YHQQ 1VQNA 3GIBA 1B07A 5FU7C 1WXBA 4C92F 1D3BB 1UGRB 1O75A 2AKLA 3OS1A 2L3QA 4RMOA 1YJ9A 2F1LA 3OW2A 3CCEA 5I11A 3VUZA 7AT1B 3CPWP 5AT1B 1K8AC 3S6WA 5FU6B 4RG8A 3CPWA 1NM7A 2LC4A 3OYBA 1TSFA 2YXYA 3M59A 1WIEA 2MMPA 1OEBA 2LCSA 3RIRA 2FB7A 1KQSP 3BFMA 3JCMJ 2DTIA 1GXIE 3CCVA 1WDXA 2V1RA 2HCKA 3PFSA 2ZPBB 1AOJA 1E7OA 3CC2A 4M78F 1Q7YR 3Q1JA 2RPNA 4KUDK 1SRLA 1BU1A 1RABB 3SFMA 2DRMA 1KC8U 2PU9B 3L2RA 4DQ2A 2HAXA 1OU8A 4X34A 2KT8A 2AIRB 2EGEA 2J7IA 4E7IA 1WJSA 3EG2A 3OYFA 1ABQA 2NLUA 1WHKA 3QWXX 4F7UB 2LJ3A 2MIOA 4J6XA 2AZVA 1Y96A 2HL3A 2KI7A 2B8AA 3PVQA 4X9CA 3RESA 1YI2T 2OAUA 3EH1A 2AZSA 2L5QA 5CCAA 4FYVB 1I8FA 2JOYA 2DJQA 3O5ZA 2LJ1A 5LJ5j 3OYEA 3L2ZA 3M5AA 2E10A 3OYJA 2O4XA 2X4XA 1D0XA 3CCQT 1Q81U 2RI3A 1TWBA 3ER0A 5CVIA 3CMAQ 4LD9K 2OAWA 2KGTA 1K73C 1WHJA 4B6MA 5A0DA 1GCQC 2XDPA 4JJBA 2DERA 4M7DE 4M75A 2NYSA 4EMKA 1YBYA 3ULRB 2NUTB 2IPOB 4J9FA 1SPKA 1UE9A 2VB6A 4JS4A 2LVMA 5GMKe 1AVZC 1M4ZA 2X4YA 2ED0A 4KGZB 3RBBB 4OB0B 3VYHB 4ESRA 4F7UG 3SDZA 1QCOA 1I81A 5KYXB 5KYYA 1C1AA 4M75F 3JCMe 3FDRA 1Y7XA 4LE9A 2CZ6B 3AT1B 2QI2A 3X26B 3RMQA 5I21A 1VQ8T 2D9TA 1YWPA 3MP8A 1QW1A 2RF0A 2HL5C 5GAN3 1N5ZA 3LH5A 5CKEA 2OX7A 1G3WA 1VQKT 3OMGA 3QUIA 1E6GA 1G83A 4LD6A 2V1QA 1BYMA 1NLOC 1JBMA 4XU0A 3CBOA 2JM9A 3QXEB 1KSWA 5IH2A 4II1A 4FL6A 3D7SB 4C5IA 2E12A 1N8RC 3FB9A 2RJFA 2NUZA 4X9DA 3VRYA 1PG5B 3R6OA 2JT4A 1U5SA 2JTEA 5CKFA 3VS7A 2D1XA 3RERA 3A8MB 4XTWA 2RI5A 1Q7YC 2BZYA 2JJ9A 2ED1A 5GAOq 1WX6A 1TTHB 1VQ4A 1IHVA 1NG2A 4ME7A 2YLCA 2EKHA 4BB7A 6AT1B 2FRYA 2X51A 2LZ6B 1B34A 1W1FA 1D0YA 3CCJT 1RAHB 3H0IA 2DAQA 1RACB 3G7ZA 3E9GA 2P0KA 1G5VA 4MZPA 2YLBA 4ZGDB 3VV0A 1MGQA 4DOVA 2DJZA 3UWNA 3RKWA 5GANj 1OULA 4LDYA 1OYXA 1YI2Q 3QZ9B 4MMLA 3M56A 2OTJT 4XAXB 5KCOA 1NZ9A 1ZUKA 3I55T 3CXCS 4HCZA
chains in the Genus database with same CATH topology
3I5SA 3EHQA 2DBKA 3C0CA 2IIMA 1T0HA 2KT1A 1NEBA 4F14A 2CUBA 2LX7A 1WXUA 4J9EA 3REAB 1HSQA 2L3PA 4CC3A 1BB9A 3EGUA 2F2XA 1HJDA 4HVUA 4RTWA 1YP5A 2DLPA 1PRMC 3IQLA 3H0FA 2ABLA 1H8KA 2A36A 4RTXA 4K11A 1UG1A 4JZ4A 1FYNA 2DMOA 4ORZA 1VYUA 3TVTA 4AFUC 4DEYA 2HDAA 2M0YA 1M3AA 1TUDA 5FWBA 3VS5A 2PZ1A 4M4ZA 4OMQA 2VWFA 1Y0MA 2DL5A 3NPFA 1AWJA 1ZSGA 2J6KA 1QCFA 2CSQA 2EYZA 2ESWA 2K7AA 2ROLA 1NLPC 2HSPA 1X2KA 2D8JA 3VS4A 2EVRA 3NHNA 3EG1A 2DX1A 2AK5A 1PNJA 2JS2A 2W0ZA 1UHFA 2JM8A 2MCNA 1H92A 4OMMA 2GQIA 1JXOA 1ZUUA 4JZ3A 1G2BA 1IO6A 3I35A 3JV3A 1UDLA 3M0TA 1GL5A 2GBQA 4AG2C 1GCPA 1UJYA 1WA7A 2HEQA 1GCQA 1UGVA 4JJDA 1YNZA 3EG0A 1OPLA 1WXTA 1SRMA 2K3BA 1AZGB 3EHRA 1LCKA 4JJCA 2BZXA 2F2WA 1TUCA 2W10A 1GBQA 2QDLA 1M3BA 1X6BA 5L23A 1Z9ZA 2F2VA 1MUZA 4J9CA 1KJWA 4IIMA 2RNAA 1YN8A 2KYBA 2DL7A 2H8HA 2GTOA 3UA6A 1SSHA 1K1ZA 2CH4W 2X3XD 1AEYA 4HVVA 1W6XA 2CSIA 1GFDA 1QKXA 1QWFA 2KXCA 4GBQA 3VS3A 2JMAA 5FW9A 3VS0A 2BTTA 1GBRA 2DRKA 4OMNA 1K76A 1X27A 1K0XA 1GRIA 2YUQA 2CH4A 2NWMA 4D8DA 2EPDA 1JO8A 1GFCA 1CSKA 2ECZA 1BK2A 1UJ0A 1ZUYA 2EYWA 5HCKA 2FEIA 2SEMA 4HXJA 4CC4B 2SRCA 2X3WD 2J05A 2DF6A 1AWOA 1V1CA 1PKTA 1WYXA 2J6FA 4OMOA 4AG1C 2D0NA 3M0RA 1PKSA 1Y57A 2HBWA 1VA7A 2PTKA 2RMOA 2K2MA 4LUEA 2C0OA 1NYFA 1PWTA 1Z9QA 1EFNA 2RN8A 3R6NA 4RTVA 1OOTA 1QLYA 1M8MA 3GBQA 2DA9A 2JS0A 4LUDA 3SEMA 3SHWA 1B3QA 2ROTA 2YUNA 3VS1A 4F16A 4RUGA 2DILA 2CT3A 2C0IA 3ZL7C 2LJ0A 2KR3A 2P4RA 4RTZA 3M0SA 1RLPC 3A98A 1JXMA 1W70A 3KFVA 5ECAA 4FSSA 1B07A 1K4US 1QKWA 1WXBA 2DM1A 2O88A 1ABOA 2DYBA 2AKLA 2L3QA 4HVWA 2DL4A 2FG0A 5I11A 1A0NB 1X2QA 3QWYA 2VVKA 1YWOA 3NMZC 2EW3A 1NM7A 1VYVA 1ZX6A 2A28A 3UF4A 1M3CA 1WIEA 1AWWA 1J3TA 2A37A 1OEBA 2LCSA 2RQUA 1RLQC 4AFZC 1WDXA 2V1RA 2HCKA 1K9AA 3H41A 1S1NA 1AOJA 2GTJA 1E7OA 2O31A 3VS2A 2RPNA 4J9HA 2ENMA 1SRLA 2GGRA 1ZBJA 1BU1A 2EBPA 2FPDA 2KNBB 2OJ2A 3I9QA 5IHNA 1AZEA 1I0CA 2YSQA 4J9GA 4E6RA 3UA7A 4EIKA 1OPKA 1KIKA 1RUWA 2DRMA 1NYGA 1JEGA 1X43A 4RTTA 2MOXA 4OMLA 2LQWA 2DL8A 2DBMA 3PE0A 1VYTA 2CREA 2KT8A 1X69A 2I0NA 2K79A 2EGEA 2J7IA 3EG2A 1SEMA 1I1JA 2EGAA 1ABQA 3QWXX 5I22A 2LJ3A 2MIOA 2AZVA 3PVQA 2OI3A 4LN2A 2CT4A 4J9IA 5IXFA 2DNUA 1XOVA 2DL3A 2AZSA 5EC7A 1YCSB 1SHFA 2DJQA 3O5ZA 2LJ1A 3UATA 4OMPA 5GJWB 2FO0A 2VKNA 2J6OA 4R0KA 2KE9A 1OV3A 3THKA 2J06A 2OAWA 2KGTA 2LNHB 2LQNA 2LP5A 2K6DA 1GCQC 4RTUA 5IHKA 4Z88A 3H0HA 4Z8AA 4D8KA 4JJBA 2FPEA 2YT6A 3ULRB 1UHCA 5IHIA 1RI9A 4LNPA 1ARKA 2RQTA 4J9FA 1SPKA 1UE9A 4IIOA 1MV3A 1AVZC 2ED0A 5IXBA 1H3HA 2DE0X 3RBBB 4HCKA 4ESRA 2YDLA 1U3OA 2L2PA 3TSWA 1X6GA 2D8HA 1JQQA 4LE9A 2K9GA 2KBTA 4KRTA 2M51A 2O9VA 3VS6A 1PHTA 2CUDA 4QT7A 3VRZA 1YWPA 2GNCA 2RQWA 2EGCA 2RF0A 4CC7A 4Z89A 1PRLC 1T0JA 4A63B 1N5ZA 3LH5A 1JU5C 2JMCA 1QWEA 2L0AA 2CDTA 1E6GA 2O2OA 2KRMA 1G83A 1T3LA 2KRNA 3RNJA 3TSZA 4F17A 1M30A 3FJ5A 1WI7A 2V1QA 3REBB 1NLOC 1AWXA 2O9SA 4X1VA 1KFZA 2G6FX 4ZNXA 1I07A 2JM9A 1TG0A 1KSWA 1UFFA 5IH2A 1WFWA 4CC2A 1E6HA 1WLPB 1CKBA 2EYXA 2KROA 2NUZA 3M0UA 1UUEA 3VRYA 5FWCA 2RQRA 1BBZA 2JXBA 1T3SA 2JT4A 1U5SA 2JTEA 1K0SA 2RQVA 3VS7A 2BZ8A 2XMFA 2D1XA 2LMJA 2DVJA 3CQTA 2B86A 4RTYA 2JW4A 1HD3A 3M0PA 1UTIA 2BZYA 2ED1A 1UECA 1WX6A 2YUPA 3U23A 1NG2A 2PNIA 2FPFA 4J9BA 1AD5A 2EKHA 4Y92A 2EYYA 4WCIA 2FRYA 2KRSA 2LZ6B 2AKKA 1W1FA 2KXDA 3EG3A 1SHGA 1MV0B 3H0IA 2YUOA 3M0QA 1M27C 2KEAA 2C0TA 1U06A 2L3SA 2EQIA 2E5KA 4AFSC 4GLMA 3I5RA 3NGPA 3PVLA 1CKAA 2FRWA 4JPBW 5GJVB 2KYMA 1FMKA 1NEGA 2A08A 1ZLMA 4DEXA 1ZUKA 4AFQC 4J9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5S A;  3EHQ A;  2DBK A;  3C0C A;  2IIM A;  1T0H A;  2KT1 A;  1NEB A;  4F14 A;  2CUB A;  2LX7 A;  1WXU A;  4J9E A;  3REA B;  1HSQ A;  2L3P A;  4CC3 A;  1BB9 A;  3EGU A;  2F2X A;  1HJD A;  4HVU A;  4RTW A;  1YP5 A;  2DLP A;  1PRM C;  3IQL A;  3H0F A;  2ABL A;  1H8K A;  2A36 A;  4RTX A;  4K11 A;  1UG1 A;  4JZ4 A;  1FYN A;  2DMO A;  4ORZ A;  1VYU A;  3TVT A;  4AFU C;  4DEY A;  2HDA A;  2M0Y A;  1M3A A;  1TUD A;  5FWB A;  3VS5 A;  2PZ1 A;  4M4Z A;  4OMQ A;  2VWF A;  1Y0M A;  2DL5 A;  3NPF A;  1AWJ A;  1ZSG A;  2J6K A;  1QCF A;  2CSQ A;  2EYZ A;  2ESW A;  2K7A A;  2ROL A;  1NLP C;  2HSP A;  1X2K A;  2D8J A;  3VS4 A;  2EVR A;  3NHN A;  3EG1 A;  2DX1 A;  2AK5 A;  1PNJ A;  2JS2 A;  2W0Z A;  1UHF A;  2JM8 A;  2MCN A;  1H92 A;  4OMM A;  2GQI A;  1JXO A;  1ZUU A;  4JZ3 A;  1G2B A;  1IO6 A;  3I35 A;  3JV3 A;  1UDL A;  3M0T A;  1GL5 A;  2GBQ A;  4AG2 C;  1GCP A;  1UJY A;  1WA7 A;  2HEQ A;  1GCQ A;  1UGV A;  4JJD A;  1YNZ A;  3EG0 A;  1OPL A;  1WXT A;  1SRM A;  2K3B A;  1AZG B;  3EHR A;  1LCK A;  4JJC A;  2BZX A;  2F2W A;  1TUC A;  2W10 A;  1GBQ A;  2QDL A;  1M3B A;  1X6B A;  5L23 A;  1Z9Z A;  2F2V A;  1MUZ A;  4J9C A;  1KJW A;  4IIM A;  2RNA A;  1YN8 A;  2KYB A;  2DL7 A;  2H8H A;  2GTO A;  3UA6 A;  1SSH A;  1K1Z A;  2CH4 W;  2X3X D;  1AEY A;  4HVV A;  1W6X A;  2CSI A;  1GFD A;  1QKX A;  1QWF A;  2KXC A;  4GBQ A;  3VS3 A;  2JMA A;  5FW9 A;  3VS0 A;  2BTT A;  1GBR A;  2DRK A;  4OMN A;  1K76 A;  1X27 A;  1K0X A;  1GRI A;  2YUQ A;  2CH4 A;  2NWM A;  4D8D A;  2EPD A;  1JO8 A;  1GFC A;  1CSK A;  2ECZ A;  1BK2 A;  1UJ0 A;  1ZUY A;  2EYW A;  5HCK A;  2FEI A;  2SEM A;  4HXJ A;  4CC4 B;  2SRC A;  2X3W D;  2J05 A;  2DF6 A;  1AWO A;  1V1C A;  1PKT A;  1WYX A;  2J6F A;  4OMO A;  4AG1 C;  2D0N A;  3M0R A;  1PKS A;  1Y57 A;  2HBW A;  1VA7 A;  2PTK A;  2RMO A;  2K2M A;  4LUE A;  2C0O A;  1NYF A;  1PWT A;  1Z9Q A;  1EFN A;  2RN8 A;  3R6N A;  4RTV A;  1OOT A;  1QLY A;  1M8M A;  3GBQ A;  2DA9 A;  2JS0 A;  4LUD A;  3SEM A;  3SHW A;  1B3Q A;  2ROT A;  2YUN A;  3VS1 A;  4F16 A;  4RUG A;  2DIL A;  2CT3 A;  2C0I A;  3ZL7 C;  2LJ0 A;  2KR3 A;  2P4R A;  4RTZ A;  3M0S A;  1RLP C;  3A98 A;  1JXM A;  1W70 A;  3KFV A;  5ECA A;  4FSS A;  1B07 A;  1K4U S;  1QKW A;  1WXB A;  2DM1 A;  2O88 A;  1ABO A;  2DYB A;  2AKL A;  2L3Q A;  4HVW A;  2DL4 A;  2FG0 A;  5I11 A;  1A0N B;  1X2Q A;  3QWY A;  2VVK A;  1YWO A;  3NMZ C;  2EW3 A;  1NM7 A;  1VYV A;  1ZX6 A;  2A28 A;  3UF4 A;  1M3C A;  1WIE A;  1AWW A;  1J3T A;  2A37 A;  1OEB A;  2LCS A;  2RQU A;  1RLQ C;  4AFZ C;  1WDX A;  2V1R A;  2HCK A;  1K9A A;  3H41 A;  1S1N A;  1AOJ A;  2GTJ A;  1E7O A;  2O31 A;  3VS2 A;  2RPN A;  4J9H A;  2ENM A;  1SRL A;  2GGR A;  1ZBJ A;  1BU1 A;  2EBP A;  2FPD A;  2KNB B;  2OJ2 A;  3I9Q A;  5IHN A;  1AZE A;  1I0C A;  2YSQ A;  4J9G A;  4E6R A;  3UA7 A;  4EIK A;  1OPK A;  1KIK A;  1RUW A;  2DRM A;  1NYG A;  1JEG A;  1X43 A;  4RTT A;  2MOX A;  4OML A;  2LQW A;  2DL8 A;  2DBM A;  3PE0 A;  1VYT A;  2CRE A;  2KT8 A;  1X69 A;  2I0N A;  2K79 A;  2EGE A;  2J7I A;  3EG2 A;  1SEM A;  1I1J A;  2EGA A;  1ABQ A;  3QWX X;  5I22 A;  2LJ3 A;  2MIO A;  2AZV A;  3PVQ A;  2OI3 A;  4LN2 A;  2CT4 A;  4J9I A;  5IXF A;  2DNU A;  1XOV A;  2DL3 A;  2AZS A;  5EC7 A;  1YCS B;  1SHF A;  2DJQ A;  3O5Z A;  2LJ1 A;  3UAT A;  4OMP A;  5GJW B;  2FO0 A;  2VKN A;  2J6O A;  4R0K A;  2KE9 A;  1OV3 A;  3THK A;  2J06 A;  2OAW A;  2KGT A;  2LNH B;  2LQN A;  2LP5 A;  2K6D A;  1GCQ C;  4RTU A;  5IHK A;  4Z88 A;  3H0H A;  4Z8A A;  4D8K A;  4JJB A;  2FPE A;  2YT6 A;  3ULR B;  1UHC A;  5IHI A;  1RI9 A;  4LNP A;  1ARK A;  2RQT A;  4J9F A;  1SPK A;  1UE9 A;  4IIO A;  1MV3 A;  1AVZ C;  2ED0 A;  5IXB A;  1H3H A;  2DE0 X;  3RBB B;  4HCK A;  4ESR A;  2YDL A;  1U3O A;  2L2P A;  3TSW A;  1X6G A;  2D8H A;  1JQQ A;  4LE9 A;  2K9G A;  2KBT A;  4KRT A;  2M51 A;  2O9V A;  3VS6 A;  1PHT A;  2CUD A;  4QT7 A;  3VRZ A;  1YWP A;  2GNC A;  2RQW A;  2EGC A;  2RF0 A;  4CC7 A;  4Z89 A;  1PRL C;  1T0J A;  4A63 B;  1N5Z A;  3LH5 A;  1JU5 C;  2JMC A;  1QWE A;  2L0A A;  2CDT A;  1E6G A;  2O2O A;  2KRM A;  1G83 A;  1T3L A;  2KRN A;  3RNJ A;  3TSZ A;  4F17 A;  1M30 A;  3FJ5 A;  1WI7 A;  2V1Q A;  3REB B;  1NLO C;  1AWX A;  2O9S A;  4X1V A;  1KFZ A;  2G6F X;  4ZNX A;  1I07 A;  2JM9 A;  1TG0 A;  1KSW A;  1UFF A;  5IH2 A;  1WFW A;  4CC2 A;  1E6H A;  1WLP B;  1CKB A;  2EYX A;  2KRO A;  2NUZ A;  3M0U A;  1UUE A;  3VRY A;  5FWC A;  2RQR A;  1BBZ A;  2JXB A;  1T3S A;  2JT4 A;  1U5S A;  2JTE A;  1K0S A;  2RQV A;  3VS7 A;  2BZ8 A;  2XMF A;  2D1X A;  2LMJ A;  2DVJ A;  3CQT A;  2B86 A;  4RTY A;  2JW4 A;  1HD3 A;  3M0P A;  1UTI A;  2BZY A;  2ED1 A;  1UEC A;  1WX6 A;  2YUP A;  3U23 A;  1NG2 A;  2PNI A;  2FPF A;  4J9B A;  1AD5 A;  2EKH A;  4Y92 A;  2EYY A;  4WCI A;  2FRY A;  2KRS A;  2LZ6 B;  2AKK A;  1W1F A;  2KXD A;  3EG3 A;  1SHG A;  1MV0 B;  3H0I A;  2YUO A;  3M0Q A;  1M27 C;  2KEA A;  2C0T A;  1U06 A;  2L3S A;  2EQI A;  2E5K A;  4AFS C;  4GLM A;  3I5R A;  3NGP A;  3PVL A;  1CKA A;  2FRW A;  4JPB W;  5GJV B;  2KYM A;  1FMK A;  1NEG A;  2A08 A;  1ZLM A;  4DEX A;  1ZUK A;  4AFQ C;  4J9D A; 
#chains in the Genus database with same CATH topology
 3I5S A;  4KH0 B;  3A8O B;  3CCQ Q;  2ZPI B;  5GAN 6;  3QZ5 B;  1G3Y A;  1Y96 B;  2CUB A;  2ZPG B;  2LX7 A;  1WXU A;  2QEX Q;  1IHW A;  4CC3 A;  3MET A;  3SD4 A;  1HJD A;  1TXQ A;  4RTW A;  4C92 E;  2DLP A;  2EWN A;  3ASK A;  3A8H B;  3LW5 E;  3BDL A;  3QYH B;  4ZGE B;  4JLG A;  2DEU A;  1UG1 A;  2O4X B;  3QJY A;  1N6A A;  3CEY A;  2HSE B;  4LXC A;  1VYU A;  4N4I A;  4YTL A;  3GNF B;  3NTH A;  3ZBD A;  5C0M A;  1JJ2 P;  2ZAE A;  1ZSG A;  5GAO l;  3S3N A;  1JJ2 A;  1QCF A;  2VC8 A;  2EYZ A;  2V8J A;  3OBW A;  2JTF A;  4B9W A;  1VQ8 Q;  3L2W A;  1NLP C;  1X75 C;  2HSP A;  2D8J A;  4M7A A;  4M78 E;  2EVR A;  3OS5 A;  2LQ8 A;  3J80 E;  1U8R A;  2CZ1 B;  3CCU T;  1PNJ A;  2JS2 A;  2MCN A;  2JM8 A;  2DKG A;  4MDW A;  1VQK Q;  5FLX E;  3WVE B;  1FWZ A;  2DPP B;  1GL5 A;  2GBQ A;  1KC8 R;  4BI4 A;  4AG2 C;  4M77 A;  3QSU A;  4M7A D;  1O9S A;  1VQP T;  1AZG B;  3JCM f;  2DZC A;  4XTY A;  4CI0 C;  1GBQ A;  1JRI A;  2E6Z A;  3CCM A;  3I56 T;  2KSS A;  3OSV A;  4J9C A;  2RNA A;  4M77 F;  2GTO A;  2VV5 A;  4J7I A;  3UA6 A;  2X3X D;  1AEY A;  4IUV A;  1VQN T;  1W6X A;  2HZY A;  2R5M A;  1RAI B;  3CME T;  1GFD A;  2R58 A;  2FL7 A;  1Q81 R;  2FZK B;  2GFA A;  3OS0 A;  3VS0 A;  4OGE A;  5GAN h;  1YJ9 T;  2DRK A;  3A5Z B;  2JUF A;  1KK7 A;  1K76 A;  3EGX A;  2FZC B;  3V7C A;  1YFN A;  2EYW A;  5GAM h;  2FEI A;  3CCJ Q;  4CRI A;  4BI3 A;  3CCV T;  2XKO C;  2J05 A;  2L3R A;  3ZFJ A;  2K4Y A;  1Q95 G;  2D0N A;  1OZ2 A;  4XU3 A;  4E47 A;  3CC2 T;  4M75 E;  3EG9 A;  1B34 B;  4LUE A;  1M2V B;  2Y4X A;  2RN8 A;  2OTJ Q;  2EIF A;  4N4H A;  4GLK A;  2VGN A;  1M1G A;  1QLY A;  3M4G A;  2E65 A;  3CCL A;  3I55 Q;  3MEV A;  1WNL A;  1RAE B;  2DIQ A;  3SHW A;  2CP7 A;  3G4S T;  2YUN A;  3VS1 A;  2DFU A;  3QKJ A;  1X01 A;  5LJ3 e;  2QAS A;  4O6J A;  1WHL A;  4O5V A;  1VQM A;  1VQ6 T;  1QCN A;  3NTK A;  2EFI A;  3UPU A;  3M0S A;  2BE9 B;  1JXM A;  5CAI A;  3HFO A;  3QJ6 A;  4JDS A;  1NE8 A;  4HT8 A;  3L2V A;  3RKY A;  1QKW A;  2DM1 A;  2O88 A;  1ABO A;  1EX4 A;  2QQS A;  4KUI A;  1HYO A;  2FG0 A;  1VQ5 A;  1QQJ A;  1X2Q A;  2M1H A;  1M2O A;  2MWP A;  1M1K C;  4HA8 A;  2QG9 B;  1VQO A;  2A28 A;  2RHX A;  3UF4 A;  1AT1 B;  3TCJ A;  4F7U A;  5KCH A;  2RK2 A;  4RCC A;  5A2Q E;  1QVF P;  4DBH A;  3CCU Q;  2DET A;  3CC7 A;  4C0D B;  5KE3 A;  5D6W A;  1QVF A;  3HTR A;  4PJL A;  1S1N A;  2ZZD A;  3RDV A;  2FVU A;  2RM4 A;  4F7U F;  4LDU A;  3I9Q A;  3EH2 A;  1AZE A;  3PGG A;  2QK0 A;  2YSQ A;  4MDX A;  1VQP Q;  4M7A B;  1VIF A;  4PFO A;  3JB9 H;  3HRT A;  4IUU A;  4L59 A;  3OY9 A;  4JUV A;  2OTL A;  1FXX A;  4XTZ A;  3C12 A;  4RTT A;  3I56 Q;  4OML A;  2LQW A;  3PE0 A;  2K79 A;  4Y28 E;  1SEM A;  3JB9 D;  3M57 A;  1D0Z A;  1VQN Q;  2CT4 A;  4J9I A;  3CME Q;  2DNU A;  2DL3 A;  5EC7 A;  2DO3 A;  1YIJ A;  1YJ9 Q;  1Q82 U;  3UAT A;  4DA4 A;  2QTX A;  2MK5 A;  5GJW B;  2DZ9 A;  3LWI A;  3RR6 A;  2RJE A;  1ZSZ B;  1R8O B;  3THK A;  2LNH B;  4BI8 B;  3CCV Q;  2K6D A;  4M7A G;  2GFU A;  4Z88 A;  4D8K A;  4RG2 A;  3OYH A;  3JCM b;  1K9M C;  3CC2 Q;  5FU7 B;  1UHC A;  1RI9 A;  2RQT A;  3A1P A;  5CIU A;  1IRE B;  1W2B S;  1DJ7 B;  5IXB A;  2RH2 A;  3LWH A;  1RAA B;  2DE0 X;  1ZSZ C;  5GAN d;  4QQ6 A;  3TSW A;  1X6G A;  2CP0 A;  4L6V 5;  1D1B A;  4BD3 A;  1JQQ A;  2CZ0 B;  2K9G A;  4XK8 E;  3DLL A;  2O9V A;  3G4S Q;  1M90 U;  1WPY A;  3EG9 B;  3SB2 A;  3VRZ A;  3OW2 P;  2K5L A;  2GNC A;  2F5T X;  3V8K A;  2HQX A;  4XU1 A;  3JCM V;  1VQ6 Q;  4J6Y A;  2E64 A;  2L0A A;  2CDT A;  2KRN A;  1M30 A;  3FJ5 A;  3C4S A;  2HBP A;  2EQU A;  2O9S A;  4J8O A;  3OYA A;  1KFZ A;  4M77 E;  1I07 A;  3JAM E;  1IZ6 A;  1ZHI A;  3GF5 A;  4FYX B;  1M9S A;  4C5H A;  1OX8 A;  3MP1 A;  1BI0 A;  1RAD B;  4CC2 A;  1QVG P;  1E6H A;  1UEB A;  2K57 A;  3LLR A;  3M0U A;  4QVD A;  3LH0 A;  5FWC A;  2RQR A;  5LJ3 f;  4A4G A;  5A0G A;  5GAN g;  1QVG A;  1NJI U;  3DB4 A;  2XMF A;  2LMJ A;  2HQH A;  3CQT A;  2DTO A;  3DKM A;  2CZ7 B;  2JW4 A;  2MPX C;  4JLI A;  2BIV A;  3V7S A;  2YUP A;  3OSS C;  5IN1 A;  3QO3 A;  1VQ9 A;  1IRX A;  3HL8 A;  4M7D C;  1M5Q 1;  4J9B A;  3CBP A;  2CP6 A;  4OGC A;  4OVA A;  2EYY A;  2KK4 A;  1BCO A;  4JS5 A;  1WGS A;  2KRS A;  3A8G B;  2A7Y A;  4ELZ C;  5HK3 A;  4E7Z A;  3CC4 A;  1M27 C;  2Y4Y A;  2EAY A;  2EQI A;  4M7D G;  2E5K A;  3SWN C;  2DEQ A;  3I5R A;  4GLM A;  4AFS C;  3NGP A;  1WQ7 A;  1CKA A;  2E41 A;  1YHQ A;  5GJV B;  4Z02 A;  2KYM A;  3URG A;  2QEX T;  2QXF A;  2K3Y A;  4N0A C;  4QVZ A;  1NEG A;  5HK0 A;  3M9Q A;  4J9D A;  4XTX A;  2O01 E;  2DBK A;  4DBF A;  5LJ5 e;  2HMA A;  5GAO m;  1NEB A;  1HSQ A;  2L3P A;  1BB9 A;  5CKH A;  2L8D A;  1RL2 A;  2R57 A;  4FIB A;  4HVU A;  4XU2 A;  4PKC C;  3H0F A;  3PMI A;  5D6Y A;  5D6X A;  1WZO A;  2A36 A;  2RI2 A;  3FJP A;  3CCS A;  3TEE A;  3QYG B;  4C8Q D;  4ANJ A;  4KH1 B;  5GAO p;  3TVT A;  3JB9 G;  2M0Y A;  2L89 A;  1TUD A;  1QMC A;  3J81 E;  1Y0M A;  1PD1 A;  3NPF A;  5M9O A;  2CP5 A;  2XIC A;  2ESW A;  2H3E B;  4A4E A;  4WTO B;  3MJX A;  1VOM A;  5IAY A;  4F7U E;  1UHF A;  4EDU A;  1F1B B;  1MND A;  3CD6 A;  1ZUU A;  4JZ3 A;  1G2B A;  1S72 A;  4FYW B;  3CCL T;  3I35 A;  5I2M A;  5KYU B;  1BCM A;  4PFZ A;  5CKD A;  1D1C A;  3H6Z A;  1XNI A;  1UJY A;  2RK1 A;  3QG1 A;  4JJD A;  2FHD A;  3CMA A;  3EG0 A;  1OPL A;  1WXT A;  1SRM A;  4PLI A;  2COY A;  1QP3 A;  3L1A A;  2QQA A;  1LCK A;  4JJC A;  5CO7 A;  2F2W A;  1SG5 A;  1TUC A;  5GAN 5;  2QDL A;  1M3B A;  5L23 A;  2XK0 A;  2KAF A;  1YN8 A;  2H8H A;  3PMT A;  4JRK A;  1SSH A;  1Q82 R;  2D6F A;  3JRZ A;  4QVC A;  2WSC E;  2X4J A;  4KT0 E;  2CSI A;  1EIF A;  4OB2 B;  1M2V A;  1PSE A;  2K5I A;  2KXC A;  2YHT A;  5FRO A;  3OA6 A;  1GBR A;  4C92 C;  1X27 A;  3L2U A;  8ATC B;  2LDM A;  2FZG B;  3A8L B;  3FC3 A;  1VQO T;  1JO8 A;  4E7K A;  2CGH A;  1GFC A;  1NBE B;  2ECZ A;  4MMK A;  3BY7 A;  4ZTF A;  2E5Q A;  2QQB A;  3O8V A;  1WJQ A;  3FRN A;  4HXJ A;  2SRC A;  2X3W D;  3CC7 T;  3MEA A;  1AWO A;  1U1T A;  2V8I A;  4BE1 A;  1Q86 U;  5GAM j;  1PKT A;  2J6F A;  4AG1 C;  1R77 A;  3MO8 A;  3T9N A;  2PTK A;  2PUO B;  5GAN e;  1M90 R;  1Z9Q A;  1EFN A;  3R6N A;  1XTD A;  2A3L A;  4RCB A;  2LX9 A;  3P8B B;  2DA9 A;  3G6E A;  3S3O A;  1R0C B;  4XQ3 A;  1K73 U;  2P84 A;  2CT3 A;  2C0I A;  3ZL7 C;  4EPC A;  2RHY A;  3WXM B;  4PJO D;  5FRN A;  3CPF A;  1YIJ T;  1RI0 A;  2P4R A;  4RTZ A;  2DXT A;  3A98 A;  1W70 A;  1M8V A;  1HK9 A;  3KFV A;  4BUG A;  2IG0 A;  3QPH A;  3MKD A;  4C8Q B;  2MF2 A;  3HPW A;  4HVW A;  1NJI R;  2LCC A;  1OU9 A;  3EAE A;  1A0N B;  3QWY A;  5LJ5 f;  3QDF A;  1YWO A;  4R55 A;  1ZX6 A;  1ZA2 B;  1UB4 A;  1MHN A;  2CKK A;  2XID A;  3PT9 A;  4M7A F;  1M3C A;  2DXB A;  5A0L A;  1YJW T;  2WSF E;  1RLQ C;  2EJG A;  4AFZ C;  3H41 A;  1PM3 A;  3V8L A;  2KDS A;  4C8Q C;  2GTJ A;  3MCA B;  1I4K 1;  1XJW B;  3CCL Q;  4J9H A;  2ENM A;  1ZBJ A;  5I2S A;  3CCQ A;  3OBY A;  2FPD A;  2KNB B;  5IHN A;  1ZSZ A;  1I0C A;  4NS5 A;  4EIK A;  3KUF A;  4FT4 A;  2E6N A;  3CCE T;  1JEG A;  3CXC P;  4C8Q G;  2DBM A;  1Q82 C;  2CRE A;  3EFO A;  2I0N A;  1N9S A;  3CXC A;  1I1J A;  5I22 A;  2CYZ B;  3V8J A;  4A4K A;  2OI3 A;  4FT2 A;  2XG8 D;  1XOV A;  1YCS B;  2AT1 B;  4EMG A;  1SHF A;  2WAC A;  3JB9 I;  4OMP A;  1VQL A;  1PCX A;  1ACM B;  5EG2 A;  1U1S A;  1VQO Q;  2KE9 A;  1IXD A;  2J06 A;  2LQN A;  3CC7 Q;  4RTU A;  5CKB A;  5KYW B;  3H0H A;  4Z8A A;  2FPE A;  3TRE A;  4LNP A;  2RB6 A;  1C6V X;  4IIO A;  4FW1 A;  3EGD A;  5AYF A;  2DXC A;  4M7D A;  4HCK A;  2YDL A;  1U3O A;  1IGQ A;  3CC4 T;  4ELY C;  2K5F A;  4C0F A;  2KBT A;  4KRT A;  2COW A;  4UC4 A;  1YIT A;  2M16 A;  1PHT A;  2CUD A;  2VAS A;  4QT7 A;  3PNW C;  2HQE A;  2RQW A;  2EGC A;  5GAO r;  4M7D D;  1T0J A;  3SWN A;  4A63 B;  4PJO B;  1YIJ Q;  1MMG A;  2JMC A;  2CP3 A;  1QWE A;  3LGL A;  1NPP A;  2O2O A;  5KH6 A;  2KRM A;  3TSZ A;  3RNJ A;  4F17 A;  4BDY A;  1WI7 A;  5GAN f;  4A53 A;  3REB B;  4N0A A;  2I2L A;  4X1V A;  3BW1 A;  2G6F X;  1TU0 B;  1TG0 A;  5LL6 S;  5KYN A;  4QQG A;  1WFW A;  2PVD B;  1KC8 C;  1VQ7 A;  1WLP B;  4PJO C;  1CKB A;  1ZBX A;  2EYX A;  4BE2 A;  1N9R A;  1UUE A;  1BBZ A;  5DM7 R;  1B7T A;  1YJW Q;  2NUP A;  2RQV A;  3JB9 J;  3CCS T;  1SSF A;  1G3T A;  2B86 A;  1PSF A;  1HD3 A;  1UTI A;  2JN0 A;  1UEC A;  1BI2 A;  2PQW A;  4BY6 C;  3CPW S;  3U23 A;  2RHI A;  2PNI A;  2QQR A;  4WCI A;  3JB9 F;  3KXT A;  4PJO G;  1RAG B;  2VUB A;  1Q86 R;  1M1F A;  2AKK A;  1Q81 C;  2JTM A;  1OX9 A;  3EG3 A;  1KQS S;  1SHG A;  5GAN 2;  1MV0 B;  1TS9 A;  3M0Q A;  3CCE Q;  4ATO A;  2KEA A;  2C0T A;  4QW2 A;  1U06 A;  2L3S A;  3CD6 T;  4BE0 A;  4V2S A;  3PVL A;  4NOY A;  3OS2 A;  2FRW A;  3UT1 A;  3MPU B;  2BE7 D;  5IT9 E;  2QA4 A;  2LT4 A;  5LJ3 h;  1K73 R;  2A08 A;  4HKE A;  4IUP A;  2V8K A;  4DEX A;  1VQ4 T;  4E7S A;  4AFQ C;  3EFO B;  5CK9 A;  3EHQ A;  3C0C A;  2MI6 A;  1I5O B;  1T0H A;  2YRD A;  4BDZ A;  1KD1 U;  1OQK A;  2JVV A;  3CCU A;  2QTV A;  4JJN K;  1C0M A;  4AT1 B;  1TH7 A;  3OYD A;  1YP5 A;  5DLQ E;  1PRM C;  3IQL A;  2ABL A;  4IKF A;  5KYU A;  1H8K A;  1Y07 A;  1VQP A;  2EQJ A;  5GAM d;  1FYN A;  5CQY A;  2X4W A;  2DMO A;  4ORZ A;  4C92 A;  4ZN1 A;  1UGS B;  4M7A E;  1D09 B;  1QP2 A;  3HRU A;  4AFU C;  3CC4 Q;  2HDA A;  4J83 A;  4M4Z A;  4OMQ A;  2DL5 A;  3I56 A;  1AWJ A;  2J6K A;  3HRS A;  2YWW A;  4NL2 A;  2CSQ A;  3OYC A;  2ROL A;  4C0G A;  3VS4 A;  3CME A;  3EG1 A;  2Z0W A;  2AK5 A;  2E3I A;  3EGD B;  4C92 D;  3EFS A;  4M7D B;  2W0Z A;  2EKO A;  1KQ2 A;  1H92 A;  8AT1 B;  4OMM A;  3KBG A;  1IO6 A;  2GCX A;  3JV3 A;  4M78 A;  4PL6 A;  3JCM P;  1UDL A;  1YJN A;  1N8R R;  3CCR A;  3G6E T;  1WA7 A;  2HEQ A;  3X25 B;  3HHT B;  4D6W A;  4PK4 A;  1BI1 A;  3GPL A;  1H3Z A;  1KQS A;  1M1K U;  3SWN B;  3HKS A;  4OP0 A;  1X6B A;  1ZQ1 A;  5GMK l;  2LCL A;  3G71 A;  3JCM c;  2RHZ A;  5GAM g;  2F2V A;  2ZGW A;  1MUZ A;  4R56 A;  4M78 D;  4IIM A;  2RHU A;  2DL7 A;  4A4F A;  5FU6 C;  5C6S A;  3CCS Q;  4JRP A;  1QWF A;  4OF1 A;  3VS3 A;  1D1A A;  2BTT A;  4IUT A;  4Q5W A;  3G4S A;  1Q86 C;  1GRI A;  1W2B P;  2CH4 A;  4D8D A;  2EPD A;  1BI3 A;  2F5K A;  4NL3 A;  1CSK A;  5CR2 A;  2NUP B;  5J26 A;  1W2B A;  5HCK A;  4DBR A;  4P5N A;  2SEM A;  4CC4 B;  1VQ6 A;  2DF6 A;  3CD6 Q;  1V1C A;  1S72 Q;  3HFN A;  4OMO A;  3OYY A;  5GMK j;  3M0R A;  3CCM T;  4PNO A;  4J5Y A;  4IUQ A;  2P0P A;  2D0Q B;  5J3B A;  2RMO A;  3HSB A;  2K2M A;  4C8Q A;  3E9F A;  1NYF A;  2WSE E;  4RTV A;  3OYM A;  2XHC A;  1VQ4 Q;  3VU3 C;  2EJF A;  2MYS A;  3OYL A;  3MHX A;  3PIP A;  2ROT A;  3OYG A;  3NTI A;  4RUG A;  4C8Q F;  2DIL A;  3FLG A;  2LJ0 A;  3OYK A;  1K9M U;  1BIA A;  3GOX A;  4M75 D;  4BAC A;  1XQH A;  3GNG A;  1RLP C;  1I5L A;  3QHS A;  3VUB A;  1VQL T;  1FMW A;  4FSS A;  2KQW A;  1K4U S;  2R5A A;  4TVR A;  2RO0 A;  2DYB A;  2RD1 A;  2DL4 A;  5LJ3 d;  2P0Q A;  3UDC A;  2E1H A;  2HNI A;  2VVK A;  2M9U A;  3NMZ C;  2EW3 A;  3ME9 A;  1VYV A;  1G3S A;  2LRQ A;  2DVE A;  2GF7 A;  1VUB A;  1AWW A;  1J3T A;  2DK3 A;  2A37 A;  1UGQ B;  2C06 A;  2RQU A;  3BE3 A;  2DYI A;  4GY5 A;  2GQV A;  4FW2 A;  4C92 B;  1K8A U;  1K9A A;  2VXF A;  5CQX A;  4PJJ A;  3DLM A;  3EFR A;  2O31 A;  2QGF B;  1JJ2 S;  2X9H A;  1VQM T;  3VS2 A;  1G8X A;  1H64 1;  2GGR A;  1KHI A;  1LJO A;  2KVQ G;  2EBP A;  2LQK A;  3G6E Q;  2OJ2 A;  3V7R A;  2P4T A;  2DTH A;  1YIT T;  3VYG A;  4E2F B;  1BIB A;  4J9G A;  4E6R A;  3UA7 A;  2E70 A;  2QDY B;  1OPK A;  4FU6 A;  1KIK A;  1EZZ B;  1RUW A;  1N27 A;  3E2U A;  4F04 B;  3P8D A;  5KYW A;  1VQ5 T;  1NYG A;  3GP8 A;  1X43 A;  4J6W A;  3JCM X;  2MOX A;  2DL8 A;  3FIF A;  1VYT A;  1X69 A;  3LGF A;  1UGP B;  4M78 B;  2EGA A;  2V26 A;  5LJ3 g;  3CBM A;  4LN2 A;  5LJ5 h;  5IXF A;  5GMK h;  3F70 A;  2IVW A;  3MEU A;  1KD1 R;  4B9X A;  4KGV B;  4FYY B;  4C92 G;  2A0F B;  2FO0 A;  2VKN A;  2AHJ B;  2YRC A;  3C94 A;  3JCM h;  1VQ7 T;  2J6O A;  2RJD A;  4R0K A;  4RKU E;  1OV3 A;  1HXD A;  4M78 C;  2LP5 A;  4PJO A;  5IHK A;  2OTL T;  2YT6 A;  3M53 A;  3ZEH A;  3CCM Q;  3X20 B;  5IHI A;  1ARK A;  5KE2 A;  1OZ3 A;  5GAM e;  2EQK A;  4N4G A;  1MV3 A;  3BDU A;  3GLX A;  2JZ2 A;  1H3H A;  2PVG B;  4M78 G;  4HCC A;  4KBM B;  2MAM A;  4PJO F;  2L2P A;  2D8H A;  1KG1 A;  2DD5 A;  2EYQ A;  5L8R E;  4LDX A;  4KGX B;  2M51 A;  4PJM A;  3OYN A;  1Y71 A;  4HCB A;  5GAO n;  1SKU B;  3VS6 A;  1X6O A;  9ATC B;  2ATC B;  4MZM A;  2XDD A;  4CC7 A;  4Z89 A;  1WHG A;  1PRL C;  3OYI A;  2JNG A;  2QA4 T;  1JU5 C;  4M75 B;  4EMK B;  1T3L A;  3OQ5 A;  1M1K R;  1VQL Q;  1FX7 A;  1AWX A;  1YI2 A;  2FYK A;  4ZNX A;  4C5E A;  4FM4 B;  1UFF A;  5KYY B;  5J39 A;  4C0Z A;  4DBQ A;  2KRO A;  1NPR A;  2COZ A;  3TQ7 P;  1LOJ A;  2JXB A;  1T3S A;  4M75 C;  2M0O A;  1K0S A;  1JB0 E;  4EMK C;  3OB9 A;  2QEX A;  2BZ8 A;  2RA2 A;  2DVJ A;  4QQD A;  4FSX A;  3X24 B;  1MMD A;  4AMC A;  4RTY A;  3M0P A;  2YRV A;  3WVD B;  3QDR B;  1N8R U;  1MMN A;  4ZTJ A;  1PD0 A;  4IUR A;  4JRI A;  1VQM Q;  4PFP A;  2FPF A;  1AD5 A;  1QVP A;  4Y92 A;  2LTO A;  4XTV A;  4M77 D;  1YIT Q;  4M75 G;  3QBY A;  1KHC A;  3RKX A;  2KXD A;  2DIG A;  3M4Y A;  2DD4 A;  1Q7Y U;  2MWO A;  1QVF S;  2XI9 A;  3N5B B;  3G1J A;  2YUO A;  2XD0 A;  4E7J A;  4OB1 B;  1VQ5 Q;  2ZPF B;  4A4H A;  1OI1 A;  3H9N A;  1MMA A;  2DXU A;  2HKN A;  3VJP A;  1VQ8 A;  4MZT A;  1IB8 A;  1YJN T;  3CCR T;  3JSC A;  4JPB W;  1WHH A;  1FMK A;  2XU8 A;  1KD1 C;  3OMC A;  1VIE A;  2PUK B;  4XTU A;  3M55 A;  1VQK A;  4C8Q E;  3S3M A;  1ZLM A;  3M54 A;  1VQ9 T;  3G71 T;  3C95 A;  1VQ7 Q;  4PJN A;  1K9M R;  5HKC A;  2H3J A;  2IIM A;  2CS7 A;  4LDV A;  5LJ3 j;  2KT1 A;  3L2Q A;  1M90 C;  4F14 A;  2K3X A;  4J9E A;  2PVO B;  3REA B;  1D3B A;  2EJ9 A;  2VYT A;  5HY6 A;  3EGU A;  2F2X A;  1LPL A;  2OTL Q;  3MP6 A;  4HT9 A;  4L5G A;  1IGU A;  2KMT A;  2G3R A;  2XDB A;  1MNE A;  3PIO A;  4VUB A;  1P92 A;  4RTX A;  4K11 A;  1FMV A;  4JZ4 A;  5LJ5 d;  1YHQ T;  1RAF B;  2QYZ A;  4M7D F;  5GMK i;  4DEY A;  3VS5 A;  1M3A A;  5FWB A;  2E3H A;  2PZ1 A;  2VWF A;  4J7F A;  1AHJ B;  1K8A R;  3JCM d;  4OB3 B;  3VKI A;  1YCY A;  5GMK m;  2HKQ B;  2K7A A;  4DOW A;  2Y90 A;  2RJC A;  2CP2 A;  1X2K A;  5FRM A;  5DLO A;  3NHN A;  1NJI C;  3CCJ A;  3JCM W;  2DX1 A;  4BY6 B;  4LDW A;  2ZPH B;  1V29 B;  1KQ1 A;  3P8H A;  5GAN 8;  2QA4 Q;  2GQI A;  1JXO A;  2QQ9 A;  5GAM f;  3TU4 K;  5D7U A;  1W4S A;  2QAZ A;  3DB3 A;  3AHU A;  3M0T A;  2LNV A;  1GCP A;  2KY9 A;  3RUX A;  1GCQ A;  1UGV A;  3M58 A;  4ZN3 A;  1YNZ A;  2ZCF B;  3HP9 A;  5DY9 A;  2K3B A;  3EHR A;  3OW2 S;  2BZX A;  2OTJ A;  1TOV A;  2QGG A;  1LVK A;  2W10 A;  3QII A;  4QKU A;  3I55 A;  5LJ5 g;  1Z9Z A;  2BUD A;  1V76 A;  1LNX A;  1KJW A;  3LYI A;  4OMF B;  3NFC A;  2KYB A;  2ZPE B;  1K1Z A;  2CH4 W;  2LT1 A;  4HVV A;  3L42 A;  1TUG B;  4E7H A;  3J7A F;  1R0B G;  4A54 A;  1QKX A;  4GBQ A;  3JCM g;  1PC0 A;  2M02 A;  2JMA A;  5FW9 A;  3E19 A;  2E4H A;  3X28 B;  4OMN A;  4C0D C;  1K0X A;  2NUT A;  1S72 T;  3MEW A;  1QVG S;  2YUQ A;  2NWM A;  4PLL A;  5GAN 4;  4M77 B;  1BK2 A;  1UJ0 A;  1ZUY A;  2X35 A;  3H8Z A;  3CMA T;  3LX7 A;  4M7A C;  1BKB A;  1SF9 A;  4C5G A;  4JRQ A;  5KYX A;  4WF2 A;  4E7L A;  1WYX A;  4PJO E;  2VXE A;  4KUL A;  1WJR A;  1YJN Q;  3CCR Q;  1PKS A;  3E1S A;  1Y57 A;  2HBW A;  1VA7 A;  3JCM Q;  2C0O A;  4M77 C;  1PWT A;  3INZ A;  3PTA A;  1OOT A;  2HD0 A;  2F69 A;  1VQ9 Q;  1M8M A;  2VGM A;  3GBQ A;  3G71 Q;  3EGX B;  2JS0 A;  4Y91 A;  4LUD A;  1WHM A;  3SEM A;  5GAN 7;  2EQM A;  3FEO A;  1B3Q A;  4ZGJ B;  1YJW A;  4F16 A;  4EMH A;  4M77 G;  4FCY A;  2K2V A;  2KR3 A;  2BKD N;  1WQW A;  1ZA1 B;  3RMS A;  5ECA A;  1YHQ Q;  1VQN A;  3GIB A;  1B07 A;  5FU7 C;  1WXB A;  4C92 F;  1D3B B;  1UGR B;  1O75 A;  2AKL A;  3OS1 A;  2L3Q A;  4RMO A;  1YJ9 A;  2F1L A;  3OW2 A;  3CCE A;  5I11 A;  3VUZ A;  7AT1 B;  3CPW P;  5AT1 B;  1K8A C;  3S6W A;  5FU6 B;  4RG8 A;  3CPW A;  1NM7 A;  2LC4 A;  3OYB A;  1TSF A;  2YXY A;  3M59 A;  1WIE A;  2MMP A;  1OEB A;  2LCS A;  3RIR A;  2FB7 A;  1KQS P;  3BFM A;  3JCM J;  2DTI A;  1GXI E;  3CCV A;  1WDX A;  2V1R A;  2HCK A;  3PFS A;  2ZPB B;  1AOJ A;  1E7O A;  3CC2 A;  4M78 F;  1Q7Y R;  3Q1J A;  2RPN A;  4KUD K;  1SRL A;  1BU1 A;  1RAB B;  3SFM A;  2DRM A;  1KC8 U;  2PU9 B;  3L2R A;  4DQ2 A;  2HAX A;  1OU8 A;  4X34 A;  2KT8 A;  2AIR B;  2EGE A;  2J7I A;  4E7I A;  1WJS A;  3EG2 A;  3OYF A;  1ABQ A;  2NLU A;  1WHK A;  3QWX X;  4F7U B;  2LJ3 A;  2MIO A;  4J6X A;  2AZV A;  1Y96 A;  2HL3 A;  2KI7 A;  2B8A A;  3PVQ A;  4X9C A;  3RES A;  1YI2 T;  2OAU A;  3EH1 A;  2AZS A;  2L5Q A;  5CCA A;  4FYV B;  1I8F A;  2JOY A;  2DJQ A;  3O5Z A;  2LJ1 A;  5LJ5 j;  3OYE A;  3L2Z A;  3M5A A;  2E10 A;  3OYJ A;  2O4X A;  2X4X A;  1D0X A;  3CCQ T;  1Q81 U;  2RI3 A;  1TWB A;  3ER0 A;  5CVI A;  3CMA Q;  4LD9 K;  2OAW A;  2KGT A;  1K73 C;  1WHJ A;  4B6M A;  5A0D A;  1GCQ C;  2XDP A;  4JJB A;  2DER A;  4M7D E;  4M75 A;  2NYS A;  4EMK A;  1YBY A;  3ULR B;  2NUT B;  2IPO B;  4J9F A;  1SPK A;  1UE9 A;  2VB6 A;  4JS4 A;  2LVM A;  5GMK e;  1AVZ C;  1M4Z A;  2X4Y A;  2ED0 A;  4KGZ B;  3RBB B;  4OB0 B;  3VYH B;  4ESR A;  4F7U G;  3SDZ A;  1QCO A;  1I81 A;  5KYX B;  5KYY A;  1C1A A;  4M75 F;  3JCM e;  3FDR A;  1Y7X A;  4LE9 A;  2CZ6 B;  3AT1 B;  2QI2 A;  3X26 B;  3RMQ A;  5I21 A;  1VQ8 T;  2D9T A;  1YWP A;  3MP8 A;  1QW1 A;  2RF0 A;  2HL5 C;  5GAN 3;  1N5Z A;  3LH5 A;  5CKE A;  2OX7 A;  1G3W A;  1VQK T;  3OMG A;  3QUI A;  1E6G A;  1G83 A;  4LD6 A;  2V1Q A;  1BYM A;  1NLO C;  1JBM A;  4XU0 A;  3CBO A;  2JM9 A;  3QXE B;  1KSW A;  5IH2 A;  4II1 A;  4FL6 A;  3D7S B;  4C5I A;  2E12 A;  1N8R C;  3FB9 A;  2RJF A;  2NUZ A;  4X9D A;  3VRY A;  1PG5 B;  3R6O A;  2JT4 A;  1U5S A;  2JTE A;  5CKF A;  3VS7 A;  2D1X A;  3RER A;  3A8M B;  4XTW A;  2RI5 A;  1Q7Y C;  2BZY A;  2JJ9 A;  2ED1 A;  5GAO q;  1WX6 A;  1TTH B;  1VQ4 A;  1IHV A;  1NG2 A;  4ME7 A;  2YLC A;  2EKH A;  4BB7 A;  6AT1 B;  2FRY A;  2X51 A;  2LZ6 B;  1B34 A;  1W1F A;  1D0Y A;  3CCJ T;  1RAH B;  3H0I A;  2DAQ A;  1RAC B;  3G7Z A;  3E9G A;  2P0K A;  1G5V A;  4MZP A;  2YLB A;  4ZGD B;  3VV0 A;  1MGQ A;  4DOV A;  2DJZ A;  3UWN A;  3RKW A;  5GAN j;  1OUL A;  4LDY A;  1OYX A;  1YI2 Q;  3QZ9 B;  4MML A;  3M56 A;  2OTJ T;  4XAX B;  5KCO A;  1NZ9 A;  1ZUK A;  3I55 T;  3CXC S;  4HCZ A; 
#chains in the Genus database with same CATH homology
 3I5S A;  3EHQ A;  2DBK A;  3C0C A;  2IIM A;  1T0H A;  2KT1 A;  1NEB A;  4F14 A;  2CUB A;  2LX7 A;  1WXU A;  4J9E A;  3REA B;  1HSQ A;  2L3P A;  4CC3 A;  1BB9 A;  3EGU A;  2F2X A;  1HJD A;  4HVU A;  4RTW A;  1YP5 A;  2DLP A;  1PRM C;  3IQL A;  3H0F A;  2ABL A;  1H8K A;  2A36 A;  4RTX A;  4K11 A;  1UG1 A;  4JZ4 A;  1FYN A;  2DMO A;  4ORZ A;  1VYU A;  3TVT A;  4AFU C;  4DEY A;  2HDA A;  2M0Y A;  1M3A A;  1TUD A;  5FWB A;  3VS5 A;  2PZ1 A;  4M4Z A;  4OMQ A;  2VWF A;  1Y0M A;  2DL5 A;  3NPF A;  1AWJ A;  1ZSG A;  2J6K A;  1QCF A;  2CSQ A;  2EYZ A;  2ESW A;  2K7A A;  2ROL A;  1NLP C;  2HSP A;  1X2K A;  2D8J A;  3VS4 A;  2EVR A;  3NHN A;  3EG1 A;  2DX1 A;  2AK5 A;  1PNJ A;  2JS2 A;  2W0Z A;  1UHF A;  2JM8 A;  2MCN A;  1H92 A;  4OMM A;  2GQI A;  1JXO A;  1ZUU A;  4JZ3 A;  1G2B A;  1IO6 A;  3I35 A;  3JV3 A;  1UDL A;  3M0T A;  1GL5 A;  2GBQ A;  4AG2 C;  1GCP A;  1UJY A;  1WA7 A;  2HEQ A;  1GCQ A;  1UGV A;  4JJD A;  1YNZ A;  3EG0 A;  1OPL A;  1WXT A;  1SRM A;  2K3B A;  1AZG B;  3EHR A;  1LCK A;  4JJC A;  2BZX A;  2F2W A;  1TUC A;  2W10 A;  1GBQ A;  2QDL A;  1M3B A;  1X6B A;  5L23 A;  1Z9Z A;  2F2V A;  1MUZ A;  4J9C A;  1KJW A;  4IIM A;  2RNA A;  1YN8 A;  2KYB A;  2DL7 A;  2H8H A;  2GTO A;  3UA6 A;  1SSH A;  1K1Z A;  2CH4 W;  2X3X D;  1AEY A;  4HVV A;  1W6X A;  2CSI A;  1GFD A;  1QKX A;  1QWF A;  2KXC A;  4GBQ A;  3VS3 A;  2JMA A;  5FW9 A;  3VS0 A;  2BTT A;  1GBR A;  2DRK A;  4OMN A;  1K76 A;  1X27 A;  1K0X A;  1GRI A;  2YUQ A;  2CH4 A;  2NWM A;  4D8D A;  2EPD A;  1JO8 A;  1GFC A;  1CSK A;  2ECZ A;  1BK2 A;  1UJ0 A;  1ZUY A;  2EYW A;  5HCK A;  2FEI A;  2SEM A;  4HXJ A;  4CC4 B;  2SRC A;  2X3W D;  2J05 A;  2DF6 A;  1AWO A;  1V1C A;  1PKT A;  1WYX A;  2J6F A;  4OMO A;  4AG1 C;  2D0N A;  3M0R A;  1PKS A;  1Y57 A;  2HBW A;  1VA7 A;  2PTK A;  2RMO A;  2K2M A;  4LUE A;  2C0O A;  1NYF A;  1PWT A;  1Z9Q A;  1EFN A;  2RN8 A;  3R6N A;  4RTV A;  1OOT A;  1QLY A;  1M8M A;  3GBQ A;  2DA9 A;  2JS0 A;  4LUD A;  3SEM A;  3SHW A;  1B3Q A;  2ROT A;  2YUN A;  3VS1 A;  4F16 A;  4RUG A;  2DIL A;  2CT3 A;  2C0I A;  3ZL7 C;  2LJ0 A;  2KR3 A;  2P4R A;  4RTZ A;  3M0S A;  1RLP C;  3A98 A;  1JXM A;  1W70 A;  3KFV A;  5ECA A;  4FSS A;  1B07 A;  1K4U S;  1QKW A;  1WXB A;  2DM1 A;  2O88 A;  1ABO A;  2DYB A;  2AKL A;  2L3Q A;  4HVW A;  2DL4 A;  2FG0 A;  5I11 A;  1A0N B;  1X2Q A;  3QWY A;  2VVK A;  1YWO A;  3NMZ C;  2EW3 A;  1NM7 A;  1VYV A;  1ZX6 A;  2A28 A;  3UF4 A;  1M3C A;  1WIE A;  1AWW A;  1J3T A;  2A37 A;  1OEB A;  2LCS A;  2RQU A;  1RLQ C;  4AFZ C;  1WDX A;  2V1R A;  2HCK A;  1K9A A;  3H41 A;  1S1N A;  1AOJ A;  2GTJ A;  1E7O A;  2O31 A;  3VS2 A;  2RPN A;  4J9H A;  2ENM A;  1SRL A;  2GGR A;  1ZBJ A;  1BU1 A;  2EBP A;  2FPD A;  2KNB B;  2OJ2 A;  3I9Q A;  5IHN A;  1AZE A;  1I0C A;  2YSQ A;  4J9G A;  4E6R A;  3UA7 A;  4EIK A;  1OPK A;  1KIK A;  1RUW A;  2DRM A;  1NYG A;  1JEG A;  1X43 A;  4RTT A;  2MOX A;  4OML A;  2LQW A;  2DL8 A;  2DBM A;  3PE0 A;  1VYT A;  2CRE A;  2KT8 A;  1X69 A;  2I0N A;  2K79 A;  2EGE A;  2J7I A;  3EG2 A;  1SEM A;  1I1J A;  2EGA A;  1ABQ A;  3QWX X;  5I22 A;  2LJ3 A;  2MIO A;  2AZV A;  3PVQ A;  2OI3 A;  4LN2 A;  2CT4 A;  4J9I A;  5IXF A;  2DNU A;  1XOV A;  2DL3 A;  2AZS A;  5EC7 A;  1YCS B;  1SHF A;  2DJQ A;  3O5Z A;  2LJ1 A;  3UAT A;  4OMP A;  5GJW B;  2FO0 A;  2VKN A;  2J6O A;  4R0K A;  2KE9 A;  1OV3 A;  3THK A;  2J06 A;  2OAW A;  2KGT A;  2LNH B;  2LQN A;  2LP5 A;  2K6D A;  1GCQ C;  4RTU A;  5IHK A;  4Z88 A;  3H0H A;  4Z8A A;  4D8K A;  4JJB A;  2FPE A;  2YT6 A;  3ULR B;  1UHC A;  5IHI A;  1RI9 A;  4LNP A;  1ARK A;  2RQT A;  4J9F A;  1SPK A;  1UE9 A;  4IIO A;  1MV3 A;  1AVZ C;  2ED0 A;  5IXB A;  1H3H A;  2DE0 X;  3RBB B;  4HCK A;  4ESR A;  2YDL A;  1U3O A;  2L2P A;  3TSW A;  1X6G A;  2D8H A;  1JQQ A;  4LE9 A;  2K9G A;  2KBT A;  4KRT A;  2M51 A;  2O9V A;  3VS6 A;  1PHT A;  2CUD A;  4QT7 A;  3VRZ A;  1YWP A;  2GNC A;  2RQW A;  2EGC A;  2RF0 A;  4CC7 A;  4Z89 A;  1PRL C;  1T0J A;  4A63 B;  1N5Z A;  3LH5 A;  1JU5 C;  2JMC A;  1QWE A;  2L0A A;  2CDT A;  1E6G A;  2O2O A;  2KRM A;  1G83 A;  1T3L A;  2KRN A;  3RNJ A;  3TSZ A;  4F17 A;  1M30 A;  3FJ5 A;  1WI7 A;  2V1Q A;  3REB B;  1NLO C;  1AWX A;  2O9S A;  4X1V A;  1KFZ A;  2G6F X;  4ZNX A;  1I07 A;  2JM9 A;  1TG0 A;  1KSW A;  1UFF A;  5IH2 A;  1WFW A;  4CC2 A;  1E6H A;  1WLP B;  1CKB A;  2EYX A;  2KRO A;  2NUZ A;  3M0U A;  1UUE A;  3VRY A;  5FWC A;  2RQR A;  1BBZ A;  2JXB A;  1T3S A;  2JT4 A;  1U5S A;  2JTE A;  1K0S A;  2RQV A;  3VS7 A;  2BZ8 A;  2XMF A;  2D1X A;  2LMJ A;  2DVJ A;  3CQT A;  2B86 A;  4RTY A;  2JW4 A;  1HD3 A;  3M0P A;  1UTI A;  2BZY A;  2ED1 A;  1UEC A;  1WX6 A;  2YUP A;  3U23 A;  1NG2 A;  2PNI A;  2FPF A;  4J9B A;  1AD5 A;  2EKH A;  4Y92 A;  2EYY A;  4WCI A;  2FRY A;  2KRS A;  2LZ6 B;  2AKK A;  1W1F A;  2KXD A;  3EG3 A;  1SHG A;  1MV0 B;  3H0I A;  2YUO A;  3M0Q A;  1M27 C;  2KEA A;  2C0T A;  1U06 A;  2L3S A;  2EQI A;  2E5K A;  4AFS C;  4GLM A;  3I5R A;  3NGP A;  3PVL A;  1CKA A;  2FRW A;  4JPB W;  5GJV B;  2KYM A;  1FMK A;  1NEG A;  2A08 A;  1ZLM A;  4DEX A;  1ZUK A;  4AFQ C;  4J9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...