3EG2A

Crystal structure of the n114q mutant of abl-sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg2A00
1WXTA 1GCPA 3TSWA 1J3TA 4IIOA 5ECAA 1T3SA 2EYWA 2GTOA 1BU1A 2RF0A 1PRLC 2A28A 2LX7A 1UG1A 3FJ5A 1SRMA 1QLYA 4RTVA 2KYBA 2ED0A 2PZ1A 4CC2A 2DVJA 1E6GA 3GBQA 2I0NA 2LZ6B 2J6OA 4Z8AA 2OAWA 1ZX6A 1NG2A 2CREA 3PVLA 2CUBA 3EHRA 1JXMA 1I1JA 2DMOA 5I11A 5IHKA 1IO6A 1VYUA 1QKWA 2X3XD 3IQLA 1ZUKA 2B86A 3A98A 3I35A 2EVRA 3U23A 2KEAA 1WLPB 3EG2A 2QDLA 1G2BA 4OMNA 1CKAA 2LCSA 2RN8A 2EQIA 1XOVA 3M0UA 1K0XA 1K1ZA 1YNZA 4HVVA 4RTUA 1MV3A 4Z89A 1AZEA 2HBWA 2DILA 2PNIA 1K0SA 1U5SA 4J9GA 2HCKA 2O88A 2DF6A 4D8KA 1ABQA 4K11A 2D1XA 2P4RA 1W6XA 4OMLA 2DYBA 1FMKA 4OMQA 2J6FA 2KT1A 2YDLA 2CT3A 2FEIA 2EGAA 2K3BA 1QWFA 2KXCA 3TVTA 1BK2A 2DL7A 2YUQA 1VA7A 2AZVA 2AK5A 2J6KA 2K7AA 1UDLA 3R6NA 2EYZA 1NYFA 1OEBA 3EGUA 1M3BA 3EG3A 4CC4B 3VS3A 3NHNA 1YWOA 1W70A 4AG1C 1GL5A 1T3LA 5I22A 3KFVA 1GBRA 1YN8A 2CSQA 2BZXA 3M0TA 1X6GA 2LJ1A 4E6RA 2V1QA 2F2VA 3I5RA 1WFWA 2ABLA 2EYYA 2YUPA 1VYVA 1UECA 2NWMA 2ECZA 2ED1A 3NGPA 4J9BA 4Z88A 2SEMA 1KFZA 4EIKA 3NMZC 3QWYA 2J7IA 5FWBA 1E7OA 3VS4A 2ROTA 4J9DA 2W10A 2AKKA 2DBKA 4HXJA 3VS7A 1AEYA 4JPBW 3ZL7C 1CSKA 4JZ3A 2YUNA 2LQNA 2YUOA 1OOTA 2O9SA 4JJBA 2DL4A 2JS0A 2DX1A 2L3SA 1I0CA 1JQQA 1B3QA 3VRYA 4LNPA 2KR3A 4J9HA 4R0KA 2OJ2A 1JXOA 1GBQA 4AFSC 4HVUA 1U3OA 3M0QA 4LUEA 1K9AA 2G6FX 1RUWA 2PTKA 5FWCA 3QWXX 2M51A 1GFDA 1HD3A 2DNUA 5HCKA 1UE9A 2RQWA 2KXDA 1ABOA 1AZGB 5IXFA 4J9CA 2FG0A 3TSZA 2GBQA 1X27A 2RMOA 2JXBA 2RQVA 1H3HA 1OPKA 1JEGA 2CT4A 1YP5A 1K4US 1ZLMA 2JW4A 2JT4A 2LNHB 2H8HA 4GLMA 2IIMA 4QT7A 2EYXA 2L3QA 3NPFA 5IHIA 2KBTA 4JJDA 1X69A 1ZSGA 5IXBA 3VS6A 4RTZA 1CKBA 1Y0MA 1SRLA 1S1NA 2DL8A 2DM1A 5IH2A 1X43A 3VS2A 4RTTA 2VKNA 1T0HA 1KIKA 1B07A 2A36A 3ULRB 4M4ZA 2JMAA 2LJ0A 2ENMA 1SHGA 4LN2A 2O2OA 2V1RA 1JU5C 3PE0A 1UUEA 2X3WD 2CH4W 4HVWA 3CQTA 2CSIA 1M3CA 1RLQC 2J05A 1NEBA 1Z9ZA 3REBB 2KROA 3H0HA 2VVKA 1M30A 4Y92A 1HJDA 4ZNXA 1PRMC 2RPNA 4J9EA 2HDAA 4FSSA 1SPKA 1WIEA 2RNAA 2AZSA 1WX6A 3REAB 4IIMA 1KJWA 2RQUA 5EC7A 3M0SA 2DRMA 1E6HA 2L0AA 3THKA 1RI9A 1H92A 2NUZA 2JS2A 2MIOA 2KRSA 3M0RA 2EPDA 4J9FA 4AFUC 2LQWA 1VYTA 1V1CA 4RUGA 4RTWA 1A0NB 2ESWA 2C0OA 2KNBB 2XMFA 1Z9QA 3PVQA 1PWTA 2ROLA 3RNJA 1GCQA 3I9QA 4DEXA 2C0TA 3O5ZA 1TUCA 2RQRA 4CC7A 1BB9A 1PNJA 1MV0B 1AWXA 3LH5A 4JJCA 3VRZA 1K76A 1Y57A 1H8KA 1PHTA 1ZUYA 1BBZA 3UF4A 2KT8A 1PKSA 1X2QA 1N5ZA 1WYXA 1AOJA 1WA7A 2D8HA 1WXUA 1QWEA 2JM9A 1TG0A 1OPLA 2SRCA 3EG1A 3SHWA 2J06A 2A37A 4AFQC 1WXBA 1NYGA 4OMMA 2K6DA 1AWWA 4GBQA 2F2WA 4F16A 1RLPC 2FO0A 2JTEA 1UHCA 1M8MA 1EFNA 2O31A 2K79A 2CH4A 2KYMA 2GNCA 4LE9A 2FPEA 1TUDA 2HSPA 1M3AA 4ORZA 1YCSB 1SHFA 3UA6A 1ARKA 2JM8A 4CC3A 3JV3A 2MCNA 2JMCA 4JZ4A 1LCKA 1NLOC 3H0IA 2D0NA 5GJVB 1SSHA 4D8DA 2DL5A 5IHNA 2GQIA 2MOXA 4LUDA 2HEQA 2DL3A 4F14A 1AVZC 2BZYA 3VS0A 2FPFA 2KRNA 1HSQA 1NEGA 1GFCA 5FW9A 2DBMA 2DRKA 1X2KA 2L3PA 2DLPA 1UJYA 1GCQC 1AWOA 1PKTA 3M0PA 2L2PA 2RQTA 2BZ8A 1YWPA 3VS5A 1AWJA 4KRTA 4AG2C 1UFFA 1X6BA 1G83A 2EGEA 3SEMA 1UGVA 1I07A 2W0ZA 1W1FA 4RTYA 2BTTA 5GJWB 4AFZC 2DJQA 4F17A 2YT6A 2KRMA 2A08A 2KE9A 4ESRA 4RTXA 2AKLA 2YSQA 4DEYA 2VWFA 3C0CA 1MUZA 4OMPA 2M0YA 2CDTA 2F2XA 2GTJA 3H0FA 1JO8A 1QCFA 1U06A 4X1VA 3UA7A 2EW3A 3H41A 2KGTA 4WCIA 2EBPA 1WI7A 2LP5A 3UATA 1UTIA 5L23A 2LMJA 1NLPC 1SEMA 2EKHA 1ZBJA 1NM7A 2GGRA 2EGCA 2D8JA 4OMOA 2FPDA 1T0JA 3EHQA 2DA9A 4HCKA 3RBBB 2FRYA 1KSWA 2O9VA 1OV3A 1AD5A 2K2MA 2FRWA 1GRIA 3EG0A 3I5SA 2LJ3A 1WDXA 1FYNA 1M27C 1ZUUA 2OI3A 1UHFA 2C0IA 2E5KA 2DE0X 1QKXA 4A63B 1UJ0A 4J9IA 3VS1A 2K9GA 2CUDA
chains in the Genus database with same CATH superfamily
4NOYA 3BE3A 3JCMJ 2H3EB 3CC4Q 1OX8A 1YJNA 2LNVA 4M7AB 2DD5A 1BU1A 2RF0A 2VYTA 2P0KA 3CCMA 1UB4A 4L5GA 1YI2T 2O4XB 1E6GA 4M7DG 3GBQA 2LZ6B 2J6OA 2HL5C 4EPCA 1U8RA 4M78C 3PVLA 2E4HA 5I11A 4JRKA 3CCUQ 1IO6A 3BW1A 1VYUA 1QKWA 4BE1A 4DBHA 4EMGA 5D6YA 3A98A 5GMKi 2KEAA 4M7DB 1G2BA 2P84A 2OTJA 5GMKe 2ATCB 3LH0A 1X01A 2VUBA 3I56A 1K8AC 1YNZA 3C12A 2RK1A 2R57A 4OB2B 2PNIA 1Q95G 1K0SA 3CC2Q 4J9GA 2O88A 5KYUA 4RCBA 2E12A 2DF6A 4KBMB 3OYBA 3GNFB 3L2RA 3DLLA 1VQ6Q 3HPWA 4OMQA 2J6FA 4C8QD 2DD4A 2YDLA 3OYMA 3HHTB 4PKCC 2K3BA 1WJRA 2PQWA 2L5QA 3TVTA 2YUQA 3RERA 4WF2A 2DXCA 4OGCA 3M59A 3RMQA 5CKEA 4IUQA 4M7DF 3PT9A 2HZYA 2J6KA 1PSFA 3CCST 4J6WA 2EYZA 3C95A 4F7UA 3G6ET 5KYWB 1KD1U 2BUDA 3EGUA 2VXFA 3VS3A 1PCXA 2DIQA 3NHNA 2PVOB 1YWOA 5I22A 1Y07A 1Q82R 2JUFA 1GBRA 2CSQA 1X6GA 1WFWA 1SF9A 2XDBA 3V7CA 2YUPA 1UECA 2ECZA 3LWHA 1BI2A 4FYYB 4CRIA 2XI9A 5HK0A 4BY6B 4Z88A 4OP0A 1KFZA 4EIKA 3NMZC 2J7IA 1I4K1 2F5KA 1E7OA 2ROTA 1EIFA 3R6OA 2AKKA 3ZEHA 1KC8C 2ZPIB 1AT1B 4R55A 3ZFJA 2YUOA 3V8JA 3CCQA 1N8RR 3JCMc 2K5LA 2VGNA 4A54A 2DL4A 2JS0A 2CGHA 4JS4A 1D09B 4BUGA 3JCMd 2CP6A 3H9NA 3OSVA 3EFRA 1WQ7A 1IGQA 1H3ZA 5GANg 2QTXA 4M77G 2LDMA 2CYZB 2G6FX 4KGZB 3JCMf 5FWCA 4ZTJA 3JRZA 2OTJQ 1D1BA 3CC4T 2DFUA 1UE9A 4J6YA 1AZGB 3OYKA 1EX4A 3I56Q 2FG0A 3LWIA 3FIFA 4MZPA 3CCJA 5J39A 2RMOA 2JXBA 4M77B 4B9XA 2CT4A 2L89A 2JT4A 1Q81U 5CQXA 3M4GA 2RI5A 3G1JA 4BB7A 5IXBA 2DXUA 5IT9E 1W4SA 3CBMA 1Y0MA 1C0MA 1F1BB 2E6NA 1SRLA 1S1NA 2DL8A 4A53A 4IUTA 2DM1A 2KI7A 4E2FB 1U1SA 3PMIA 1SSFA 4FM4B 1VQ5Q 2EJ9A 2JTFA 2ZPGB 4KGVB 1WJSA 1KIKA 2EQJA 4C0FA 2LJ0A 3JCMW 1QVGA 2V1RA 1YJWQ 1JU5C 1MNDA 3META 4EMKB 5D6WA 2CH4W 2V8JA 4HVWA 3CXCS 1M1KU 4M77F 5I21A 1C1AA 4C5GA 1Z9ZA 2BIVA 4C8QE 2K57A 1JJ2S 1KQ2A 1K9MU 1MMDA 1HJDA 1EZZB 1PRMC 3EH1A 4JJNK 4XAXB 1VQNQ 1Q86U 4M7AA 1Y96B 3MO8A 4L6V5 3REAB 3JCMe 3LYIA 1VQLQ 2L0AA 3VKIA 2DEQA 1H92A 2FVUA 2BE9B 3SFMA 3CCQQ 3LW5E 2LQWA 3NTHA 4RUGA 4RTWA 3PVQA 1TWBA 2DERA 1IRXA 2ROLA 4M78G 3RNJA 2E10A 3VUBA 3H8ZA 1KD1C 4DEXA 2K5FA 3O5ZA 2RQRA 1PNJA 1MV0B 3M56A 3LH5A 4EDUA 1K76A 1RAGB 4HKEA 2F69A 4RCCA 1QCOA 3HRSA 1ZUYA 3A8LB 3GLXA 1N5ZA 3HKSA 4M78B 5GANj 1QWEA 2JM9A 3LGFA 1OPLA 3CCJQ 1WXBA 3OYIA 4LDWA 1AWWA 4N0AA 2F2WA 2FO0A 1HXDA 1HK9A 2JTEA 1UHCA 2P0QA 3Q1JA 2C06A 2CH4A 4M7DD 2LC4A 1LJOA 2GNCA 3OW2A 2MAMA 4FT2A 3S6WA 3HL8A 2MWPA 4J83A 1YIJA 1SHFA 3CCRA 3CBPA 1I5LA 5D7UA 4C5EA 2XICA 2HKQB 2M02A 5KE3A 4JZ4A 4RKUE 4M7AC 2OTJT 1LCKA 2D0NA 4OMFB 5GJVB 1VQ7Q 3G7ZA 2CS7A 5KYWA 5DLOA 1YJ9A 5GAMf 1UGSB 3I56T 1Q7YC 3FEOA 1AVZC 2QYZA 2BZYA 1Y71A 2FPFA 4PLLA 3CCVQ 1RAEB 1NEGA 3OYJA 4CI0C 3NFCA 1M9SA 1V29B 1N27A 4J8OA 1AWOA 5GAN3 2PU9B 1KG1A 2BZ8A 4KULA 2COWA 1I8FA 3MEUA 3AT1B 4GY5A 3RESA 2RH2A 1KQ1A 1VQ5T 2QASA 4F17A 2YT6A 1VQ8A 5LJ3d 2A08A 3V8LA 1TUGB 4BDYA 4XTXA 2KE9A 4ESRA 3JCMb 2AKLA 2YSQA 3X28B 2KDSA 3KUFA 1H641 3QZ9B 4Y28E 2QDYB 4N0AC 1RAAB 5LJ3f 2MWOA 5FLXE 1WNLA 1JO8A 1U06A 1M1KC 1WHKA 3H41A 8ATCB 4WCIA 4F04B 3UATA 1KHCA 3MJXA 5GAOm 3GOXA 5KYUB 3QIIA 1ZBJA 1NM7A 3OYAA 2FPDA 3VYHB 3EHQA 2DA9A 5KYNA 1Q86C 2E3HA 4JLIA 3VUZA 4F7UG 1PG5B 2FRYA 2ZPFB 3CCQT 2K2MA 3L1AA 5GAMe 3V7SA 4KH1B 2DTOA 2K3YA 1WHJA 3I5SA 1S72Q 1BIAA 2OI3A 4XU0A 2DJZA 2C0IA 1BKBA 4M7AE 2DE0X 3TCJA 1ZSZB 4E7HA 3A8HB 3EAEA 4DOVA 3OW2S 3M9QA 4F7UB 3CCRQ 3V7RA 1WXTA 3RKYA 1X75C 4FIBA 1T3SA 2GCXA 1XJWB 2GTOA 1VQ9A 1NJIR 1D3BA 1PRLC 2A28A 2LX7A 2RHYA 3M55A 2COYA 4RTVA 1V76A 2XK0A 2DEUA 4HT9A 3CCJT 1K8AU 1SG5A 2MYSA 3OYEA 4Z8AA 5GAOp 2E41A 4M7DE 3CC7A 3JAME 2XD0A 3EHRA 1JXMA 4PJOA 3OS2A 5C0MA 4R56A 2WACA 3CXCP 2B86A 4QQDA 5LJ3e 2OAUA 1WGSA 1WLPB 2FHDA 3EG2A 5M9OA 2QDLA 4OMNA 1JJ2P 3L2QA 4F7UF 4NL3A 2LCSA 2RN8A 2LQ8A 2EQIA 4E7KA 3G4SQ 1Y7XA 2RHZA 4HVVA 1VQ8Q 3PNWC 4Z89A 1AZEA 2WSEE 2KQWA 2CZ0B 3RKXA 3KXTA 2DILA 3X24B 1U5SA 2IG0A 3CCVT 3NTIA 1ABQA 2DZ9A 4K11A 2P4RA 2R5AA 3JB9G 4PJMA 2DYBA 3RUXA 2KT1A 1IREB 3OB9A 3QG1A 5DY9A 4KUIA 1QWFA 5CKDA 2KXCA 4BI8B 3GIBA 2NLUA 1OI1A 4JS5A 3VJPA 5CAIA 2RJFA 1MNEA 1O75A 1UDLA 2K7AA 4PNOA 1R0BG 1VIFA 1PC0A 3C94A 3EG3A 3JCMV 2CP5A 2QXFA 1KC8U 4FT4A 3QDRB 3DB4A 1W70A 1GL5A 1T3LA 1TOVA 3M0TA 2X4YA 3L2UA 2V1QA 3OYCA 2P0PA 2F2VA 3I5RA 1XTDA 1YFNA 2ABLA 4PJOC 5FRMA 1B34A 2PVDB 3EGXA 3NGPA 2HKNA 2KVQG 4J9BA 1WHLA 2X51A 4LDVA 5FWBA 1VQ9Q 2VV5A 5GAN7 9ATCB 2JNGA 3VS7A 4C92B 3ZL7C 1CSKA 4JZ3A 2YUNA 4Q5WA 3OYHA 1YITA 1N9RA 3JB9F 1WHGA 1NPPA 2DX1A 1YHQA 2JZ2A 1R77A 1JQQA 1FMVA 3JB9I 1S72T 4QKUA 2YRVA 4R0KA 4QVDA 1U3OA 3M0QA 3MP1A 1D0ZA 1QVGP 1YCYA 2XDDA 4A4EA 3I55A 3OBWA 1D1CA 2M51A 3CCRT 1Q81R 4M77E 1GFDA 2ZPBB 1HD3A 3SB2A 2RQWA 5IXFA 5LJ5h 4J9CA 4RMOA 2JOYA 1X27A 1BCOA 1TH7A 5KE2A 1KQSS 4ZN1A 5IAYA 2MPXC 2XIDA 1K4US 2DTIA 1ZLMA 2LNHB 5J26A 4GLMA 4J7IA 2EYXA 3NPFA 3TREA 4JJDA 3CD6A 2DYIA 3MHXA 2BE7D 3VS6A 4M7AF 3QYGB 4RTZA 1TS9A 1CKBA 1W2BS 1TU0B 3AHUA 1VQOA 4MMLA 1QP2A 3S3NA 3RMSA 1T0HA 4QQGA 1K9MR 4NS5A 3ULRB 2EYQA 3MEAA 4IUVA 3G4ST 4LN2A 2R58A 3OYFA 2I2LA 4AMCA 2Y90A 2YLBA 1VQMA 1VQ8T 4MZMA 2X3WD 4N4IA 1M8VA 5D6XA 4YTLA 1LVKA 5KCHA 2LTOA 3J80E 3BDUA 1ZSZA 5A0LA 3REBB 3FJPA 3FDRA 2KROA 3CXCA 2EKOA 1M30A 4ZGEB 5GAOn 2QQRA 2EAYA 3JCMP 2RPNA 5CKBA 4PJNA 1WIEA 1IZ6A 2RNAA 4EMHA 2KMTA 1JJ2A 1TXQA 2XDPA 1KJWA 1VUBA 3MP6A 4KT0E 3QO3A 3OW2P 2FZCB 2AT1B 5GMKm 2OTLA 2NUZA 2MIOA 3M0RA 2RM4A 1VYTA 1V1CA 1OU9A 2RD1A 2XMFA 2XHCA 1JRIA 2HD0A 1YJNQ 1M90U 3FC3A 2RHXA 3I9QA 3CCMQ 4M78E 1AWXA 4LXCA 3X25B 2MI6A 4X9DA 2QEXA 2H3JA 2L3RA 2YRCA 3UF4A 1FX7A 2FZGB 1XNIA 1X2QA 4LD9K 1VQ9T 4DBQA 4C5HA 1TG0A 2X4WA 3EG1A 2J06A 1RL2A 3KBGA 4AFQC 1D0XA 1NYGA 3HTRA 2K6DA 1Q7YU 4GBQA 1XQHA 2K79A 2KYMA 5FU6B 2K4YA 4ZTFA 1ZSZC 1M3AA 1PSEA 4ORZA 3UA6A 1ARKA 4BI4A 2JM8A 4PFOA 1RI0A 3WXMB 1VQPA 2JMCA 3H0IA 2DL5A 2Y4YA 5FROA 2MOXA 1MGQA 1OU8A 2DL3A 2HEQA 3ER0A 1ZA2B 1OZ2A 3L2WA 1HSQA 1ZQ1A 1GFCA 5FW9A 1X2KA 4D6WA 4IUUA 4JRPA 4PJOG 1M1FA 1D3BB 4FW1A 4E7SA 3CCEA 4FYXB 3JB9D 3VV0A 5GMKh 3J81E 3CMEA 2RO0A 4PJJA 2EGEA 2LVMA 2COZA 1UGVA 2W0ZA 4C92A 4MMKA 5GANd 4RTYA 3WVEB 2D6FA 5GJWB 4PJOB 1QVFA 1WHHA 2K5IA 4DEYA 1JB0E 4ZN3A 2LT4A 5GANf 1UGPB 3MEWA 4KH0B 3JSCA 2CDTA 1G3WA 2GTJA 4TVRA 3HP9A 2EW3A 2QEXQ 3BFMA 1RABB 4FW2A 1WI7A 2XU8A 2KY9A 2YRDA 3OS5A 2D8JA 4Y91A 4HCKA 4M7AD 4DOWA 4ME7A 3X20B 2O9VA 5LJ5g 1OV3A 4A4GA 5J3BA 2FRWA 1BI0A 4RG2A 4F7UE 3EG0A 1YHQT 1YJNT 2LJ3A 1FYNA 3QHSA 1KQSP 5DM7R 2E5KA 1ACMB 3EFSA 3CCMT 1K8AR 1M90C 1UJ0A 3VS1A 1WJQA 2KSSA 2CUDA 4FSXA 1D1AA 3TSWA 3TQ7P 3SDZA 2EYWA 3CPFA 5KYYA 3PFSA 1W2BP 2KYBA 2ED0A 4C92C 2PZ1A 2DVJA 5GAMd 2I0NA 2RK2A 1B34B 3EGXB 3M57A 2OAWA 1K73C 1NG2A 2CKKA 5GANe 1YI2A 4M75A 4M78F 3IQLA 1ZUKA 3CD6T 2PUOB 1MHNA 1NPRA 2MMPA 3I35A 3G71A 2EVRA 4LDYA 1QW1A 1VQOT 2E64A 1JBMA 4XU3A 3CMEQ 3NTKA 2WSFE 1CKAA 1OX9A 1XOVA 3EH2A 3M0UA 2A3LA 4RTUA 1FXXA 2PUKB 2HCKA 4B9WA 2DVEA 1QVFS 4D8KA 2D1XA 1W6XA 2EQKA 2QGFB 4OMLA 1M2OA 1KC8R 2FEIA 5GAOr 2EGAA 1UGRB 4MDWA 4ATOA 3RDVA 2ZAEA 2FB7A 3PMTA 4X34A 2DK3A 3OYLA 2D9TA 5CKHA 2DXBA 1G5VA 4IURA 4BD3A 3ME9A 2OTLT 2X4JA 5CO7A 4CC4B 2RJEA 3OMGA 1G3YA 3SD4A 2O01E 2BZXA 4XTUA 4E6RA 2EWNA 2EYYA 2QK0A 4OB3B 4PJLA 5LJ5j 1VYVA 2NWMA 7AT1B 4M75C 2ED1A 4C92E 5GAN2 3JCMQ 3JCMh 3H6ZA 2QEXT 5FRNA 2SEMA 5CIUA 2NUPA 1PD1A 2ZPHB 3VS4A 4J9DA 2CZ7B 2V26A 4BE0A 4N4GA 4ANJA 5CK9A 1AEYA 1KK7A 1G8XA 3CPWS 2LQNA 2O9SA 1YIJQ 1DJ7B 5A0GA 4JRIA 1PD0A 4M77D 2LT1A 1I0CA 3M58A 1B3QA 3VRYA 2KR3A 1M1GA 4VUBA 4J9HA 1QCNA 2OJ2A 1JXOA 1YJ9Q 1GBQA 3SWNB 3UT1A 3A8GB 2RA2A 3DKMA 3OBYA 2PTKA 3G71Q 4XTYA 2G3RA 3QWXX 2RI2A 1Q82C 3A1PA 2DNUA 4E7IA 2VXEA 3MEVA 4E47A 3MCAB 4RG8A 3RR6A 3TSZA 2HQXA 3CEYA 3OMCA 2RQVA 1H3HA 1G3SA 1YP5A 4LD6A 3OYNA 1D0YA 3CC4A 2IIMA 4QT7A 5IN1A 5FU6C 1KQSA 1UEBA 3OY9A 1ZHIA 2KBTA 1IHVA 1ZSGA 1N8RC 2QAZA 3CCET 2GFAA 3DLMA 3E19A 2QA4A 1X43A 3DB3A 1FWZA 3CMET 3VS2A 4RTTA 1W2BA 1KD1R 3CCUA 1OZ3A 1B07A 2A36A 4ZGJB 1MMAA 1N6AA 1SHGA 2O2OA 3OYYA 3MPUB 5FU7C 1QQJA 2RHIA 2CP7A 1M3CA 1PM3A 2J05A 3M54A 3N5BB 2VVKA 2HDAA 4JLGA 3CC2A 2GQVA 1R8OB 1OYXA 2AZSA 4DBRA 4PL6A 2DRMA 1E6HA 4C92G 1VQ6A 2GFUA 1RI9A 4M78D 4OGEA 2K3XA 2KRSA 2EPDA 4J9FA 4AFUC 3FRNA 1A0NB 3O8VA 2C0OA 1AHJB 1TTHB 2E65A 1IXDA 8AT1B 2PVGB 3JCMX 2C0TA 1TUCA 2RI3A 4CC7A 5DLQE 4BE2A 3EG9A 3VRZA 1KHIA 1Y57A 3PGGA 1Q7YR 1OQKA 1H8KA 3OS1A 2AHJB 2KT8A 4Z02A 4HCCA 3QYHB 1M2VA 3CC7Q 3CMAA 3LLRA 1WQWA 2E6ZA 5GAMh 2SRCA 3RKWA 1RACB 4II1A 3SHWA 2A37A 2XG8D 1YIJT 4C5IA 3GPLA 4OMMA 5I2SA 4F16A 2DXTA 2DKGA 4XTZA 5GMKj 1EFNA 2O31A 3QKJA 1LPLA 2DIGA 2HNIA 1TUDA 3A5ZB 5C6SA 1YJ9T 1YCSB 4C0DC 1QVFP 2BKDN 2E70A 3E2UA 4HA8A 5AT1B 4C92F 3G71T 4CC3A 3OS0A 2QG9B 2QA4Q 2NUTA 4NL2A 4JDSA 2Y4XA 1NJIU 5IHNA 1VQ4A 4OB1B 4X9CA 1I5OB 4F14A 1M1KR 3VS0A 4E7ZA 4HT8A 3E1SA 3EFOA 4C8QA 2DBMA 2L3PA 3OA6A 2DLPA 5KYYB 5LJ3h 2R5MA 4M75G 4L59A 1P92A 1Q86R 1YWPA 3VS5A 4PJOE 1AWJA 4AG2C 1NBEB 2XKOC 1UFFA 1G83A 1YBYA 2ZZDA 4JUVA 4B6MA 1W1FA 2WSCE 3JCMg 2M0OA 2BTTA 4AFZC 2DJQA 4M75B 2HMAA 3V8KA 4OVAA 2CP2A 4RTXA 3INZA 2VWFA 3MKDA 4MZTA 1MUZA 4PK4A 3CPWP 3SWNA 1VQ5A 4OMPA 2M0YA 2K2VA 3M4YA 3CCLA 5HY6A 3S3OA 1QCFA 1YJWA 3UA7A 3PIPA 1YITQ 2KGTA 4BI3A 1YHQQ 2EBPA 4LDUA 4LDXA 2LP5A 1UTIA 3QZ5B 2HQEA 2LMJA 1NLPC 3CMAQ 2EGCA 2X4XA 1M4ZA 2LQKA 2DZCA 4ELYC 2VB6A 3RBBB 1KSWA 3I55Q 3RIRA 1VQNA 3TU4K 2E5QA 2B8AA 3QJYA 1SKUB 4M75F 3BY7A 2A0FB 1WDXA 4C8QC 1M27C 4AT1B 1VQLA 1ZUUA 1K73U 1UHFA 2LCLA 3MP8A 1BYMA 4A63B 1LNXA 4C0ZA 2K9GA 4QQ6A 4FL6A 1GCPA 5CR2A 2QQAA 1J3TA 5GAN6 4IIOA 5ECAA 4QW2A 3CC7T 2ZPEB 4IUPA 1UG1A 3FJ5A 1SRMA 1QLYA 3GF5A 3CD6Q 2FYKA 4XK8E 4CC2A 4FYVB 5GAOl 4FCYA 1VQ4Q 1VQOQ 3D7SB 1ZX6A 2CREA 3E9GA 2CUBA 1NZ9A 2MF2A 2V8KA 1I1JA 2DMOA 2NUPB 4HCZA 5IHKA 3SWNC 4JRQA 2X3XD 1VQKA 1VIEA 3LX7A 1VQMQ 3U23A 3QXEB 5FU7B 4C0GA 2EQUA 3FLGA 2QA4T 3QJ6A 3HRTA 2QTVA 1IB8A 3CCUT 2QGGA 2HAXA 1K0XA 1K1ZA 4V2SA 3EGDA 4E7JA 1MV3A 2HBWA 2YWWA 2EJFA 1BIBA 4J7FA 1NJIC 4XU2A 1QMCA 1UGQB 1VQ7A 1BCMA 2OTLQ 1FMKA 3CCLQ 5KYXA 2CT3A 1QP3A 2F1LA 3CCVA 1BK2A 2DL7A 3CC2T 3L42A 1VA7A 4FYWB 2AZVA 2RJDA 2AK5A 3ASKA 3R6NA 1VQ6T 4HCBA 1NYFA 5L8RE 2F5TX 1OEBA 4GLKA 3UPUA 1M3BA 4C92D 1X6OA 4AG1C 5GAMg 1M5Q1 3KFVA 3VYGA 1YN8A 3A8OB 3URGA 2LJ1A 3QSUA 3M5AA 2O4XA 1IGUA 3OYDA 5AYFA 1RAFB 2YXYA 3QDFA 4PJOF 1YITT 3C4SA 3CBOA 3QWYA 5CKFA 4ELZC 2W10A 1Q82U 3CMAT 2DBKA 4HXJA 2Z0WA 4JPBW 1BI3A 4C0DB 4XU1A 1OOTA 4M7DA 1MMGA 4JJBA 4UC4A 3OYGA 3I55T 5GAN4 3LGLA 1VQPQ 2L3SA 2EJGA 3CPWA 2AIRB 2QQBA 2M16A 4LNPA 5CQYA 1G3TA 4P5NA 4AFSC 2FZKB 1BI1A 4HVUA 2DETA 4LUEA 1VQKQ 1O9SA 4XTVA 1K9AA 2MK5A 4PFPA 1RUWA 1WPYA 2DTHA 5LJ3g 1N8RU 2HL3A 5HCKA 3P8BB 1U1TA 1S72A 2KXDA 1ABOA 2L8DA 4O5VA 5CCAA 1MMNA 2GBQA 3X26B 4FU6A 3EG9B 3CCEQ 2FL7A 1OPKA 1VQ4T 5HKCA 1JEGA 2JW4A 5HK3A 2H8HA 2IPOB 2P4TA 2L3QA 3M53A 5IHIA 2JVVA 1M2VB 1X69A 2HSEB 1OULA 3HFNA 5LJ5d 2DO3A 2E1HA 2ZCFB 1VQMT 4A4FA 2GF7A 4M75D 5IH2A 1QVGS 4KGXB 1WHMA 5LJ5f 2VKNA 5GAN5 4DA4A 4M4ZA 2JMAA 2ENMA 4WTOB 3PE0A 1Q81C 1UUEA 2EIFA 2M9UA 4M7DC 1LOJA 2HBPA 3JB9H 2VASA 1RAHB 3HSBA 2CP0A 3GNGA 2CZ1B 4C8QG 3CQTA 2CSIA 1RLQC 4MDXA 2NUTB 3UWNA 1NEBA 2JTMA 5A0DA 3G4SA 3GP8A 3H0HA 2M1HA 2JN0A 3QBYA 4Y92A 3CCLT 4PFZA 4J5YA 4ZNXA 3TEEA 4J9EA 1YJWT 4FSSA 5GAMj 3J7AF 1SPKA 1WX6A 4IIMA 1WZOA 3EFOB 2RQUA 5EC7A 4C8QB 3L2VA 4DBFA 3M0SA 4ZGDB 3CCSA 3THKA 5LL6S 3G6EA 1C6VX 2QQSA 2JS2A 4OF1A 5I2MA 3QPHA 2ESWA 2KNBB 2NYSA 1Z9QA 1PWTA 2X9HA 1VQNT 1GCQA 3E9FA 1K9MC 2DPPB 1BB9A 1VQLT 1NE8A 4JJCA 4M77A 1ZBXA 2X35A 2CP3A 1PHTA 4XQ3A 1BBZA 5KCOA 1PKSA 3P8DA 4XTWA 1WYXA 2E3IA 5EG2A 4DQ2A 1AOJA 1WA7A 2D8HA 1YI2Q 1WXUA 1VOMA 4C8QF 1IHWA 5LJ5e 2KK4A 5LJ3j 5CVIA 3T9NA 2QQ9A 5GAN8 3HFOA 1R0CB 2HQHA 5GMKl 1RLPC 1I81A 4BY6C 1RADB 1M8MA 1VQPT 4LE9A 2D0QB 2FPEA 2HSPA 2A7YA 1VQKT 4EMKA 4A4HA 4QVCA 3JV3A 1RAIB 2MCNA 1N9SA 1B7TA 1NLOC 2CZ6B 5KH6A 4OB0B 1SSHA 4D8DA 2EQMA 3JB9J 2OX7A 2GQIA 2RB6A 4LUDA 2VGMA 1Y96A 4PJOD 2KRNA 3L2ZA 2LRQA 4IKFA 3UDCA 3PIOA 5GANh 2DRKA 1UJYA 1GCQC 1ZA1B 4PLIA 1VQ7T 1PKTA 3M0PA 4BACA 5GAOq 1TSFA 2L2PA 2RQTA 3PTAA 4M77C 3FB9A 6AT1B 4KRTA 4M75E 1X6BA 3SEMA 1I07A 2YHTA 3CCSQ 1GXIE 4O6JA 3OQ5A 2VC8A 3G6EQ 2KRMA 4KUDK 3QUIA 1M90R 1FMWA 2IVWA 3A8MB 4BDZA 4M78A 2JJ9A 3BDLA 3C0CA 2KAFA 4QVZA 3VU3C 2RJCA 2ZGWA 3ZBDA 3F70A 2F2XA 3H0FA 2DAQA 4X1VA 3EGDB 2V8IA 4EMKC 2YLCA 1K73R 5L23A 2LCCA 1SEMA 4J6XA 2EKHA 3HRUA 2GGRA 3P8HA 5A2QE 2LX9A 4OMOA 1T0JA 4E7LA 5KYXB 2QI2A 1AD5A 4N4HA 1GRIA 3S3MA 4M7AG 1HYOA 2EFIA 4A4KA 3OSSC 1QKXA 3WVDB 1QVPA 4J9IA 2RHUA
chains in the Genus database with same CATH topology
1WXTA 1GCPA 3TSWA 1J3TA 4IIOA 5ECAA 1T3SA 2EYWA 2GTOA 1BU1A 2RF0A 1PRLC 2A28A 2LX7A 1UG1A 3FJ5A 1SRMA 1QLYA 4RTVA 2KYBA 2ED0A 2PZ1A 4CC2A 2DVJA 1E6GA 3GBQA 2I0NA 2LZ6B 2J6OA 4Z8AA 2OAWA 1ZX6A 1NG2A 2CREA 3PVLA 2CUBA 3EHRA 1JXMA 1I1JA 2DMOA 5I11A 5IHKA 1IO6A 1VYUA 1QKWA 2X3XD 3IQLA 1ZUKA 2B86A 3A98A 3I35A 2EVRA 3U23A 2KEAA 1WLPB 3EG2A 2QDLA 1G2BA 4OMNA 1CKAA 2LCSA 2RN8A 2EQIA 1XOVA 3M0UA 1K0XA 1K1ZA 1YNZA 4HVVA 4RTUA 1MV3A 4Z89A 1AZEA 2HBWA 2DILA 2PNIA 1K0SA 1U5SA 4J9GA 2HCKA 2O88A 2DF6A 4D8KA 1ABQA 4K11A 2D1XA 2P4RA 1W6XA 4OMLA 2DYBA 1FMKA 4OMQA 2J6FA 2KT1A 2YDLA 2CT3A 2FEIA 2EGAA 2K3BA 1QWFA 2KXCA 3TVTA 1BK2A 2DL7A 2YUQA 1VA7A 2AZVA 2AK5A 2J6KA 2K7AA 1UDLA 3R6NA 2EYZA 1NYFA 1OEBA 3EGUA 1M3BA 3EG3A 4CC4B 3VS3A 3NHNA 1YWOA 1W70A 4AG1C 1GL5A 1T3LA 5I22A 3KFVA 1GBRA 1YN8A 2CSQA 2BZXA 3M0TA 1X6GA 2LJ1A 4E6RA 2V1QA 2F2VA 3I5RA 1WFWA 2ABLA 2EYYA 2YUPA 1VYVA 1UECA 2NWMA 2ECZA 2ED1A 3NGPA 4J9BA 4Z88A 2SEMA 1KFZA 4EIKA 3NMZC 3QWYA 2J7IA 5FWBA 1E7OA 3VS4A 2ROTA 4J9DA 2W10A 2AKKA 2DBKA 4HXJA 3VS7A 1AEYA 4JPBW 3ZL7C 1CSKA 4JZ3A 2YUNA 2LQNA 2YUOA 1OOTA 2O9SA 4JJBA 2DL4A 2JS0A 2DX1A 2L3SA 1I0CA 1JQQA 1B3QA 3VRYA 4LNPA 2KR3A 4J9HA 4R0KA 2OJ2A 1JXOA 1GBQA 4AFSC 4HVUA 1U3OA 3M0QA 4LUEA 1K9AA 2G6FX 1RUWA 2PTKA 5FWCA 3QWXX 2M51A 1GFDA 1HD3A 2DNUA 5HCKA 1UE9A 2RQWA 2KXDA 1ABOA 1AZGB 5IXFA 4J9CA 2FG0A 3TSZA 2GBQA 1X27A 2RMOA 2JXBA 2RQVA 1H3HA 1OPKA 1JEGA 2CT4A 1YP5A 1K4US 1ZLMA 2JW4A 2JT4A 2LNHB 2H8HA 4GLMA 2IIMA 4QT7A 2EYXA 2L3QA 3NPFA 5IHIA 2KBTA 4JJDA 1X69A 1ZSGA 5IXBA 3VS6A 4RTZA 1CKBA 1Y0MA 1SRLA 1S1NA 2DL8A 2DM1A 5IH2A 1X43A 3VS2A 4RTTA 2VKNA 1T0HA 1KIKA 1B07A 2A36A 3ULRB 4M4ZA 2JMAA 2LJ0A 2ENMA 1SHGA 4LN2A 2O2OA 2V1RA 1JU5C 3PE0A 1UUEA 2X3WD 2CH4W 4HVWA 3CQTA 2CSIA 1M3CA 1RLQC 2J05A 1NEBA 1Z9ZA 3REBB 2KROA 3H0HA 2VVKA 1M30A 4Y92A 1HJDA 4ZNXA 1PRMC 2RPNA 4J9EA 2HDAA 4FSSA 1SPKA 1WIEA 2RNAA 2AZSA 1WX6A 3REAB 4IIMA 1KJWA 2RQUA 5EC7A 3M0SA 2DRMA 1E6HA 2L0AA 3THKA 1RI9A 1H92A 2NUZA 2JS2A 2MIOA 2KRSA 3M0RA 2EPDA 4J9FA 4AFUC 2LQWA 1VYTA 1V1CA 4RUGA 4RTWA 1A0NB 2ESWA 2C0OA 2KNBB 2XMFA 1Z9QA 3PVQA 1PWTA 2ROLA 3RNJA 1GCQA 3I9QA 4DEXA 2C0TA 3O5ZA 1TUCA 2RQRA 4CC7A 1BB9A 1PNJA 1MV0B 1AWXA 3LH5A 4JJCA 3VRZA 1K76A 1Y57A 1H8KA 1PHTA 1ZUYA 1BBZA 3UF4A 2KT8A 1PKSA 1X2QA 1N5ZA 1WYXA 1AOJA 1WA7A 2D8HA 1WXUA 1QWEA 2JM9A 1TG0A 1OPLA 2SRCA 3EG1A 3SHWA 2J06A 2A37A 4AFQC 1WXBA 1NYGA 4OMMA 2K6DA 1AWWA 4GBQA 2F2WA 4F16A 1RLPC 2FO0A 2JTEA 1UHCA 1M8MA 1EFNA 2O31A 2K79A 2CH4A 2KYMA 2GNCA 4LE9A 2FPEA 1TUDA 2HSPA 1M3AA 4ORZA 1YCSB 1SHFA 3UA6A 1ARKA 2JM8A 4CC3A 3JV3A 2MCNA 2JMCA 4JZ4A 1LCKA 1NLOC 3H0IA 2D0NA 5GJVB 1SSHA 4D8DA 2DL5A 5IHNA 2GQIA 2MOXA 4LUDA 2HEQA 2DL3A 4F14A 1AVZC 2BZYA 3VS0A 2FPFA 2KRNA 1HSQA 1NEGA 1GFCA 5FW9A 2DBMA 2DRKA 1X2KA 2L3PA 2DLPA 1UJYA 1GCQC 1AWOA 1PKTA 3M0PA 2L2PA 2RQTA 2BZ8A 1YWPA 3VS5A 1AWJA 4KRTA 4AG2C 1UFFA 1X6BA 1G83A 2EGEA 3SEMA 1UGVA 1I07A 2W0ZA 1W1FA 4RTYA 2BTTA 5GJWB 4AFZC 2DJQA 4F17A 2YT6A 2KRMA 2A08A 2KE9A 4ESRA 4RTXA 2AKLA 2YSQA 4DEYA 2VWFA 3C0CA 1MUZA 4OMPA 2M0YA 2CDTA 2F2XA 2GTJA 3H0FA 1JO8A 1QCFA 1U06A 4X1VA 3UA7A 2EW3A 3H41A 2KGTA 4WCIA 2EBPA 1WI7A 2LP5A 3UATA 1UTIA 5L23A 2LMJA 1NLPC 1SEMA 2EKHA 1ZBJA 1NM7A 2GGRA 2EGCA 2D8JA 4OMOA 2FPDA 1T0JA 3EHQA 2DA9A 4HCKA 3RBBB 2FRYA 1KSWA 2O9VA 1OV3A 1AD5A 2K2MA 2FRWA 1GRIA 3EG0A 3I5SA 2LJ3A 1WDXA 1FYNA 1M27C 1ZUUA 2OI3A 1UHFA 2C0IA 2E5KA 2DE0X 1QKXA 4A63B 1UJ0A 4J9IA 3VS1A 2K9GA 2CUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXT A;  1GCP A;  3TSW A;  1J3T A;  4IIO A;  5ECA A;  1T3S A;  2EYW A;  2GTO A;  1BU1 A;  2RF0 A;  1PRL C;  2A28 A;  2LX7 A;  1UG1 A;  3FJ5 A;  1SRM A;  1QLY A;  4RTV A;  2KYB A;  2ED0 A;  2PZ1 A;  4CC2 A;  2DVJ A;  1E6G A;  3GBQ A;  2I0N A;  2LZ6 B;  2J6O A;  4Z8A A;  2OAW A;  1ZX6 A;  1NG2 A;  2CRE A;  3PVL A;  2CUB A;  3EHR A;  1JXM A;  1I1J A;  2DMO A;  5I11 A;  5IHK A;  1IO6 A;  1VYU A;  1QKW A;  2X3X D;  3IQL A;  1ZUK A;  2B86 A;  3A98 A;  3I35 A;  2EVR A;  3U23 A;  2KEA A;  1WLP B;  3EG2 A;  2QDL A;  1G2B A;  4OMN A;  1CKA A;  2LCS A;  2RN8 A;  2EQI A;  1XOV A;  3M0U A;  1K0X A;  1K1Z A;  1YNZ A;  4HVV A;  4RTU A;  1MV3 A;  4Z89 A;  1AZE A;  2HBW A;  2DIL A;  2PNI A;  1K0S A;  1U5S A;  4J9G A;  2HCK A;  2O88 A;  2DF6 A;  4D8K A;  1ABQ A;  4K11 A;  2D1X A;  2P4R A;  1W6X A;  4OML A;  2DYB A;  1FMK A;  4OMQ A;  2J6F A;  2KT1 A;  2YDL A;  2CT3 A;  2FEI A;  2EGA A;  2K3B A;  1QWF A;  2KXC A;  3TVT A;  1BK2 A;  2DL7 A;  2YUQ A;  1VA7 A;  2AZV A;  2AK5 A;  2J6K A;  2K7A A;  1UDL A;  3R6N A;  2EYZ A;  1NYF A;  1OEB A;  3EGU A;  1M3B A;  3EG3 A;  4CC4 B;  3VS3 A;  3NHN A;  1YWO A;  1W70 A;  4AG1 C;  1GL5 A;  1T3L A;  5I22 A;  3KFV A;  1GBR A;  1YN8 A;  2CSQ A;  2BZX A;  3M0T A;  1X6G A;  2LJ1 A;  4E6R A;  2V1Q A;  2F2V A;  3I5R A;  1WFW A;  2ABL A;  2EYY A;  2YUP A;  1VYV A;  1UEC A;  2NWM A;  2ECZ A;  2ED1 A;  3NGP A;  4J9B A;  4Z88 A;  2SEM A;  1KFZ A;  4EIK A;  3NMZ C;  3QWY A;  2J7I A;  5FWB A;  1E7O A;  3VS4 A;  2ROT A;  4J9D A;  2W10 A;  2AKK A;  2DBK A;  4HXJ A;  3VS7 A;  1AEY A;  4JPB W;  3ZL7 C;  1CSK A;  4JZ3 A;  2YUN A;  2LQN A;  2YUO A;  1OOT A;  2O9S A;  4JJB A;  2DL4 A;  2JS0 A;  2DX1 A;  2L3S A;  1I0C A;  1JQQ A;  1B3Q A;  3VRY A;  4LNP A;  2KR3 A;  4J9H A;  4R0K A;  2OJ2 A;  1JXO A;  1GBQ A;  4AFS C;  4HVU A;  1U3O A;  3M0Q A;  4LUE A;  1K9A A;  2G6F X;  1RUW A;  2PTK A;  5FWC A;  3QWX X;  2M51 A;  1GFD A;  1HD3 A;  2DNU A;  5HCK A;  1UE9 A;  2RQW A;  2KXD A;  1ABO A;  1AZG B;  5IXF A;  4J9C A;  2FG0 A;  3TSZ A;  2GBQ A;  1X27 A;  2RMO A;  2JXB A;  2RQV A;  1H3H A;  1OPK A;  1JEG A;  2CT4 A;  1YP5 A;  1K4U S;  1ZLM A;  2JW4 A;  2JT4 A;  2LNH B;  2H8H A;  4GLM A;  2IIM A;  4QT7 A;  2EYX A;  2L3Q A;  3NPF A;  5IHI A;  2KBT A;  4JJD A;  1X69 A;  1ZSG A;  5IXB A;  3VS6 A;  4RTZ A;  1CKB A;  1Y0M A;  1SRL A;  1S1N A;  2DL8 A;  2DM1 A;  5IH2 A;  1X43 A;  3VS2 A;  4RTT A;  2VKN A;  1T0H A;  1KIK A;  1B07 A;  2A36 A;  3ULR B;  4M4Z A;  2JMA A;  2LJ0 A;  2ENM A;  1SHG A;  4LN2 A;  2O2O A;  2V1R A;  1JU5 C;  3PE0 A;  1UUE A;  2X3W D;  2CH4 W;  4HVW A;  3CQT A;  2CSI A;  1M3C A;  1RLQ C;  2J05 A;  1NEB A;  1Z9Z A;  3REB B;  2KRO A;  3H0H A;  2VVK A;  1M30 A;  4Y92 A;  1HJD A;  4ZNX A;  1PRM C;  2RPN A;  4J9E A;  2HDA A;  4FSS A;  1SPK A;  1WIE A;  2RNA A;  2AZS A;  1WX6 A;  3REA B;  4IIM A;  1KJW A;  2RQU A;  5EC7 A;  3M0S A;  2DRM A;  1E6H A;  2L0A A;  3THK A;  1RI9 A;  1H92 A;  2NUZ A;  2JS2 A;  2MIO A;  2KRS A;  3M0R A;  2EPD A;  4J9F A;  4AFU C;  2LQW A;  1VYT A;  1V1C A;  4RUG A;  4RTW A;  1A0N B;  2ESW A;  2C0O A;  2KNB B;  2XMF A;  1Z9Q A;  3PVQ A;  1PWT A;  2ROL A;  3RNJ A;  1GCQ A;  3I9Q A;  4DEX A;  2C0T A;  3O5Z A;  1TUC A;  2RQR A;  4CC7 A;  1BB9 A;  1PNJ A;  1MV0 B;  1AWX A;  3LH5 A;  4JJC A;  3VRZ A;  1K76 A;  1Y57 A;  1H8K A;  1PHT A;  1ZUY A;  1BBZ A;  3UF4 A;  2KT8 A;  1PKS A;  1X2Q A;  1N5Z A;  1WYX A;  1AOJ A;  1WA7 A;  2D8H A;  1WXU A;  1QWE A;  2JM9 A;  1TG0 A;  1OPL A;  2SRC A;  3EG1 A;  3SHW A;  2J06 A;  2A37 A;  4AFQ C;  1WXB A;  1NYG A;  4OMM A;  2K6D A;  1AWW A;  4GBQ A;  2F2W A;  4F16 A;  1RLP C;  2FO0 A;  2JTE A;  1UHC A;  1M8M A;  1EFN A;  2O31 A;  2K79 A;  2CH4 A;  2KYM A;  2GNC A;  4LE9 A;  2FPE A;  1TUD A;  2HSP A;  1M3A A;  4ORZ A;  1YCS B;  1SHF A;  3UA6 A;  1ARK A;  2JM8 A;  4CC3 A;  3JV3 A;  2MCN A;  2JMC A;  4JZ4 A;  1LCK A;  1NLO C;  3H0I A;  2D0N A;  5GJV B;  1SSH A;  4D8D A;  2DL5 A;  5IHN A;  2GQI A;  2MOX A;  4LUD A;  2HEQ A;  2DL3 A;  4F14 A;  1AVZ C;  2BZY A;  3VS0 A;  2FPF A;  2KRN A;  1HSQ A;  1NEG A;  1GFC A;  5FW9 A;  2DBM A;  2DRK A;  1X2K A;  2L3P A;  2DLP A;  1UJY A;  1GCQ C;  1AWO A;  1PKT A;  3M0P A;  2L2P A;  2RQT A;  2BZ8 A;  1YWP A;  3VS5 A;  1AWJ A;  4KRT A;  4AG2 C;  1UFF A;  1X6B A;  1G83 A;  2EGE A;  3SEM A;  1UGV A;  1I07 A;  2W0Z A;  1W1F A;  4RTY A;  2BTT A;  5GJW B;  4AFZ C;  2DJQ A;  4F17 A;  2YT6 A;  2KRM A;  2A08 A;  2KE9 A;  4ESR A;  4RTX A;  2AKL A;  2YSQ A;  4DEY A;  2VWF A;  3C0C A;  1MUZ A;  4OMP A;  2M0Y A;  2CDT A;  2F2X A;  2GTJ A;  3H0F A;  1JO8 A;  1QCF A;  1U06 A;  4X1V A;  3UA7 A;  2EW3 A;  3H41 A;  2KGT A;  4WCI A;  2EBP A;  1WI7 A;  2LP5 A;  3UAT A;  1UTI A;  5L23 A;  2LMJ A;  1NLP C;  1SEM A;  2EKH A;  1ZBJ A;  1NM7 A;  2GGR A;  2EGC A;  2D8J A;  4OMO A;  2FPD A;  1T0J A;  3EHQ A;  2DA9 A;  4HCK A;  3RBB B;  2FRY A;  1KSW A;  2O9V A;  1OV3 A;  1AD5 A;  2K2M A;  2FRW A;  1GRI A;  3EG0 A;  3I5S A;  2LJ3 A;  1WDX A;  1FYN A;  1M27 C;  1ZUU A;  2OI3 A;  1UHF A;  2C0I A;  2E5K A;  2DE0 X;  1QKX A;  4A63 B;  1UJ0 A;  4J9I A;  3VS1 A;  2K9G A;  2CUD A; 
#chains in the Genus database with same CATH topology
 4NOY A;  3BE3 A;  3JCM J;  2H3E B;  3CC4 Q;  1OX8 A;  1YJN A;  2LNV A;  4M7A B;  2DD5 A;  1BU1 A;  2RF0 A;  2VYT A;  2P0K A;  3CCM A;  1UB4 A;  4L5G A;  1YI2 T;  2O4X B;  1E6G A;  4M7D G;  3GBQ A;  2LZ6 B;  2J6O A;  2HL5 C;  4EPC A;  1U8R A;  4M78 C;  3PVL A;  2E4H A;  5I11 A;  4JRK A;  3CCU Q;  1IO6 A;  3BW1 A;  1VYU A;  1QKW A;  4BE1 A;  4DBH A;  4EMG A;  5D6Y A;  3A98 A;  5GMK i;  2KEA A;  4M7D B;  1G2B A;  2P84 A;  2OTJ A;  5GMK e;  2ATC B;  3LH0 A;  1X01 A;  2VUB A;  3I56 A;  1K8A C;  1YNZ A;  3C12 A;  2RK1 A;  2R57 A;  4OB2 B;  2PNI A;  1Q95 G;  1K0S A;  3CC2 Q;  4J9G A;  2O88 A;  5KYU A;  4RCB A;  2E12 A;  2DF6 A;  4KBM B;  3OYB A;  3GNF B;  3L2R A;  3DLL A;  1VQ6 Q;  3HPW A;  4OMQ A;  2J6F A;  4C8Q D;  2DD4 A;  2YDL A;  3OYM A;  3HHT B;  4PKC C;  2K3B A;  1WJR A;  2PQW A;  2L5Q A;  3TVT A;  2YUQ A;  3RER A;  4WF2 A;  2DXC A;  4OGC A;  3M59 A;  3RMQ A;  5CKE A;  4IUQ A;  4M7D F;  3PT9 A;  2HZY A;  2J6K A;  1PSF A;  3CCS T;  4J6W A;  2EYZ A;  3C95 A;  4F7U A;  3G6E T;  5KYW B;  1KD1 U;  2BUD A;  3EGU A;  2VXF A;  3VS3 A;  1PCX A;  2DIQ A;  3NHN A;  2PVO B;  1YWO A;  5I22 A;  1Y07 A;  1Q82 R;  2JUF A;  1GBR A;  2CSQ A;  1X6G A;  1WFW A;  1SF9 A;  2XDB A;  3V7C A;  2YUP A;  1UEC A;  2ECZ A;  3LWH A;  1BI2 A;  4FYY B;  4CRI A;  2XI9 A;  5HK0 A;  4BY6 B;  4Z88 A;  4OP0 A;  1KFZ A;  4EIK A;  3NMZ C;  2J7I A;  1I4K 1;  2F5K A;  1E7O A;  2ROT A;  1EIF A;  3R6O A;  2AKK A;  3ZEH A;  1KC8 C;  2ZPI B;  1AT1 B;  4R55 A;  3ZFJ A;  2YUO A;  3V8J A;  3CCQ A;  1N8R R;  3JCM c;  2K5L A;  2VGN A;  4A54 A;  2DL4 A;  2JS0 A;  2CGH A;  4JS4 A;  1D09 B;  4BUG A;  3JCM d;  2CP6 A;  3H9N A;  3OSV A;  3EFR A;  1WQ7 A;  1IGQ A;  1H3Z A;  5GAN g;  2QTX A;  4M77 G;  2LDM A;  2CYZ B;  2G6F X;  4KGZ B;  3JCM f;  5FWC A;  4ZTJ A;  3JRZ A;  2OTJ Q;  1D1B A;  3CC4 T;  2DFU A;  1UE9 A;  4J6Y A;  1AZG B;  3OYK A;  1EX4 A;  3I56 Q;  2FG0 A;  3LWI A;  3FIF A;  4MZP A;  3CCJ A;  5J39 A;  2RMO A;  2JXB A;  4M77 B;  4B9X A;  2CT4 A;  2L89 A;  2JT4 A;  1Q81 U;  5CQX A;  3M4G A;  2RI5 A;  3G1J A;  4BB7 A;  5IXB A;  2DXU A;  5IT9 E;  1W4S A;  3CBM A;  1Y0M A;  1C0M A;  1F1B B;  2E6N A;  1SRL A;  1S1N A;  2DL8 A;  4A53 A;  4IUT A;  2DM1 A;  2KI7 A;  4E2F B;  1U1S A;  3PMI A;  1SSF A;  4FM4 B;  1VQ5 Q;  2EJ9 A;  2JTF A;  2ZPG B;  4KGV B;  1WJS A;  1KIK A;  2EQJ A;  4C0F A;  2LJ0 A;  3JCM W;  1QVG A;  2V1R A;  1YJW Q;  1JU5 C;  1MND A;  3MET A;  4EMK B;  5D6W A;  2CH4 W;  2V8J A;  4HVW A;  3CXC S;  1M1K U;  4M77 F;  5I21 A;  1C1A A;  4C5G A;  1Z9Z A;  2BIV A;  4C8Q E;  2K57 A;  1JJ2 S;  1KQ2 A;  1K9M U;  1MMD A;  1HJD A;  1EZZ B;  1PRM C;  3EH1 A;  4JJN K;  4XAX B;  1VQN Q;  1Q86 U;  4M7A A;  1Y96 B;  3MO8 A;  4L6V 5;  3REA B;  3JCM e;  3LYI A;  1VQL Q;  2L0A A;  3VKI A;  2DEQ A;  1H92 A;  2FVU A;  2BE9 B;  3SFM A;  3CCQ Q;  3LW5 E;  2LQW A;  3NTH A;  4RUG A;  4RTW A;  3PVQ A;  1TWB A;  2DER A;  1IRX A;  2ROL A;  4M78 G;  3RNJ A;  2E10 A;  3VUB A;  3H8Z A;  1KD1 C;  4DEX A;  2K5F A;  3O5Z A;  2RQR A;  1PNJ A;  1MV0 B;  3M56 A;  3LH5 A;  4EDU A;  1K76 A;  1RAG B;  4HKE A;  2F69 A;  4RCC A;  1QCO A;  3HRS A;  1ZUY A;  3A8L B;  3GLX A;  1N5Z A;  3HKS A;  4M78 B;  5GAN j;  1QWE A;  2JM9 A;  3LGF A;  1OPL A;  3CCJ Q;  1WXB A;  3OYI A;  4LDW A;  1AWW A;  4N0A A;  2F2W A;  2FO0 A;  1HXD A;  1HK9 A;  2JTE A;  1UHC A;  2P0Q A;  3Q1J A;  2C06 A;  2CH4 A;  4M7D D;  2LC4 A;  1LJO A;  2GNC A;  3OW2 A;  2MAM A;  4FT2 A;  3S6W A;  3HL8 A;  2MWP A;  4J83 A;  1YIJ A;  1SHF A;  3CCR A;  3CBP A;  1I5L A;  5D7U A;  4C5E A;  2XIC A;  2HKQ B;  2M02 A;  5KE3 A;  4JZ4 A;  4RKU E;  4M7A C;  2OTJ T;  1LCK A;  2D0N A;  4OMF B;  5GJV B;  1VQ7 Q;  3G7Z A;  2CS7 A;  5KYW A;  5DLO A;  1YJ9 A;  5GAM f;  1UGS B;  3I56 T;  1Q7Y C;  3FEO A;  1AVZ C;  2QYZ A;  2BZY A;  1Y71 A;  2FPF A;  4PLL A;  3CCV Q;  1RAE B;  1NEG A;  3OYJ A;  4CI0 C;  3NFC A;  1M9S A;  1V29 B;  1N27 A;  4J8O A;  1AWO A;  5GAN 3;  2PU9 B;  1KG1 A;  2BZ8 A;  4KUL A;  2COW A;  1I8F A;  3MEU A;  3AT1 B;  4GY5 A;  3RES A;  2RH2 A;  1KQ1 A;  1VQ5 T;  2QAS A;  4F17 A;  2YT6 A;  1VQ8 A;  5LJ3 d;  2A08 A;  3V8L A;  1TUG B;  4BDY A;  4XTX A;  2KE9 A;  4ESR A;  3JCM b;  2AKL A;  2YSQ A;  3X28 B;  2KDS A;  3KUF A;  1H64 1;  3QZ9 B;  4Y28 E;  2QDY B;  4N0A C;  1RAA B;  5LJ3 f;  2MWO A;  5FLX E;  1WNL A;  1JO8 A;  1U06 A;  1M1K C;  1WHK A;  3H41 A;  8ATC B;  4WCI A;  4F04 B;  3UAT A;  1KHC A;  3MJX A;  5GAO m;  3GOX A;  5KYU B;  3QII A;  1ZBJ A;  1NM7 A;  3OYA A;  2FPD A;  3VYH B;  3EHQ A;  2DA9 A;  5KYN A;  1Q86 C;  2E3H A;  4JLI A;  3VUZ A;  4F7U G;  1PG5 B;  2FRY A;  2ZPF B;  3CCQ T;  2K2M A;  3L1A A;  5GAM e;  3V7S A;  4KH1 B;  2DTO A;  2K3Y A;  1WHJ A;  3I5S A;  1S72 Q;  1BIA A;  2OI3 A;  4XU0 A;  2DJZ A;  2C0I A;  1BKB A;  4M7A E;  2DE0 X;  3TCJ A;  1ZSZ B;  4E7H A;  3A8H B;  3EAE A;  4DOV A;  3OW2 S;  3M9Q A;  4F7U B;  3CCR Q;  3V7R A;  1WXT A;  3RKY A;  1X75 C;  4FIB A;  1T3S A;  2GCX A;  1XJW B;  2GTO A;  1VQ9 A;  1NJI R;  1D3B A;  1PRL C;  2A28 A;  2LX7 A;  2RHY A;  3M55 A;  2COY A;  4RTV A;  1V76 A;  2XK0 A;  2DEU A;  4HT9 A;  3CCJ T;  1K8A U;  1SG5 A;  2MYS A;  3OYE A;  4Z8A A;  5GAO p;  2E41 A;  4M7D E;  3CC7 A;  3JAM E;  2XD0 A;  3EHR A;  1JXM A;  4PJO A;  3OS2 A;  5C0M A;  4R56 A;  2WAC A;  3CXC P;  2B86 A;  4QQD A;  5LJ3 e;  2OAU A;  1WGS A;  1WLP B;  2FHD A;  3EG2 A;  5M9O A;  2QDL A;  4OMN A;  1JJ2 P;  3L2Q A;  4F7U F;  4NL3 A;  2LCS A;  2RN8 A;  2LQ8 A;  2EQI A;  4E7K A;  3G4S Q;  1Y7X A;  2RHZ A;  4HVV A;  1VQ8 Q;  3PNW C;  4Z89 A;  1AZE A;  2WSE E;  2KQW A;  2CZ0 B;  3RKX A;  3KXT A;  2DIL A;  3X24 B;  1U5S A;  2IG0 A;  3CCV T;  3NTI A;  1ABQ A;  2DZ9 A;  4K11 A;  2P4R A;  2R5A A;  3JB9 G;  4PJM A;  2DYB A;  3RUX A;  2KT1 A;  1IRE B;  3OB9 A;  3QG1 A;  5DY9 A;  4KUI A;  1QWF A;  5CKD A;  2KXC A;  4BI8 B;  3GIB A;  2NLU A;  1OI1 A;  4JS5 A;  3VJP A;  5CAI A;  2RJF A;  1MNE A;  1O75 A;  1UDL A;  2K7A A;  4PNO A;  1R0B G;  1VIF A;  1PC0 A;  3C94 A;  3EG3 A;  3JCM V;  2CP5 A;  2QXF A;  1KC8 U;  4FT4 A;  3QDR B;  3DB4 A;  1W70 A;  1GL5 A;  1T3L A;  1TOV A;  3M0T A;  2X4Y A;  3L2U A;  2V1Q A;  3OYC A;  2P0P A;  2F2V A;  3I5R A;  1XTD A;  1YFN A;  2ABL A;  4PJO C;  5FRM A;  1B34 A;  2PVD B;  3EGX A;  3NGP A;  2HKN A;  2KVQ G;  4J9B A;  1WHL A;  2X51 A;  4LDV A;  5FWB A;  1VQ9 Q;  2VV5 A;  5GAN 7;  9ATC B;  2JNG A;  3VS7 A;  4C92 B;  3ZL7 C;  1CSK A;  4JZ3 A;  2YUN A;  4Q5W A;  3OYH A;  1YIT A;  1N9R A;  3JB9 F;  1WHG A;  1NPP A;  2DX1 A;  1YHQ A;  2JZ2 A;  1R77 A;  1JQQ A;  1FMV A;  3JB9 I;  1S72 T;  4QKU A;  2YRV A;  4R0K A;  4QVD A;  1U3O A;  3M0Q A;  3MP1 A;  1D0Z A;  1QVG P;  1YCY A;  2XDD A;  4A4E A;  3I55 A;  3OBW A;  1D1C A;  2M51 A;  3CCR T;  1Q81 R;  4M77 E;  1GFD A;  2ZPB B;  1HD3 A;  3SB2 A;  2RQW A;  5IXF A;  5LJ5 h;  4J9C A;  4RMO A;  2JOY A;  1X27 A;  1BCO A;  1TH7 A;  5KE2 A;  1KQS S;  4ZN1 A;  5IAY A;  2MPX C;  2XID A;  1K4U S;  2DTI A;  1ZLM A;  2LNH B;  5J26 A;  4GLM A;  4J7I A;  2EYX A;  3NPF A;  3TRE A;  4JJD A;  3CD6 A;  2DYI A;  3MHX A;  2BE7 D;  3VS6 A;  4M7A F;  3QYG B;  4RTZ A;  1TS9 A;  1CKB A;  1W2B S;  1TU0 B;  3AHU A;  1VQO A;  4MML A;  1QP2 A;  3S3N A;  3RMS A;  1T0H A;  4QQG A;  1K9M R;  4NS5 A;  3ULR B;  2EYQ A;  3MEA A;  4IUV A;  3G4S T;  4LN2 A;  2R58 A;  3OYF A;  2I2L A;  4AMC A;  2Y90 A;  2YLB A;  1VQM A;  1VQ8 T;  4MZM A;  2X3W D;  4N4I A;  1M8V A;  5D6X A;  4YTL A;  1LVK A;  5KCH A;  2LTO A;  3J80 E;  3BDU A;  1ZSZ A;  5A0L A;  3REB B;  3FJP A;  3FDR A;  2KRO A;  3CXC A;  2EKO A;  1M30 A;  4ZGE B;  5GAO n;  2QQR A;  2EAY A;  3JCM P;  2RPN A;  5CKB A;  4PJN A;  1WIE A;  1IZ6 A;  2RNA A;  4EMH A;  2KMT A;  1JJ2 A;  1TXQ A;  2XDP A;  1KJW A;  1VUB A;  3MP6 A;  4KT0 E;  3QO3 A;  3OW2 P;  2FZC B;  2AT1 B;  5GMK m;  2OTL A;  2NUZ A;  2MIO A;  3M0R A;  2RM4 A;  1VYT A;  1V1C A;  1OU9 A;  2RD1 A;  2XMF A;  2XHC A;  1JRI A;  2HD0 A;  1YJN Q;  1M90 U;  3FC3 A;  2RHX A;  3I9Q A;  3CCM Q;  4M78 E;  1AWX A;  4LXC A;  3X25 B;  2MI6 A;  4X9D A;  2QEX A;  2H3J A;  2L3R A;  2YRC A;  3UF4 A;  1FX7 A;  2FZG B;  1XNI A;  1X2Q A;  4LD9 K;  1VQ9 T;  4DBQ A;  4C5H A;  1TG0 A;  2X4W A;  3EG1 A;  2J06 A;  1RL2 A;  3KBG A;  4AFQ C;  1D0X A;  1NYG A;  3HTR A;  2K6D A;  1Q7Y U;  4GBQ A;  1XQH A;  2K79 A;  2KYM A;  5FU6 B;  2K4Y A;  4ZTF A;  1ZSZ C;  1M3A A;  1PSE A;  4ORZ A;  3UA6 A;  1ARK A;  4BI4 A;  2JM8 A;  4PFO A;  1RI0 A;  3WXM B;  1VQP A;  2JMC A;  3H0I A;  2DL5 A;  2Y4Y A;  5FRO A;  2MOX A;  1MGQ A;  1OU8 A;  2DL3 A;  2HEQ A;  3ER0 A;  1ZA2 B;  1OZ2 A;  3L2W A;  1HSQ A;  1ZQ1 A;  1GFC A;  5FW9 A;  1X2K A;  4D6W A;  4IUU A;  4JRP A;  4PJO G;  1M1F A;  1D3B B;  4FW1 A;  4E7S A;  3CCE A;  4FYX B;  3JB9 D;  3VV0 A;  5GMK h;  3J81 E;  3CME A;  2RO0 A;  4PJJ A;  2EGE A;  2LVM A;  2COZ A;  1UGV A;  2W0Z A;  4C92 A;  4MMK A;  5GAN d;  4RTY A;  3WVE B;  2D6F A;  5GJW B;  4PJO B;  1QVF A;  1WHH A;  2K5I A;  4DEY A;  1JB0 E;  4ZN3 A;  2LT4 A;  5GAN f;  1UGP B;  3MEW A;  4KH0 B;  3JSC A;  2CDT A;  1G3W A;  2GTJ A;  4TVR A;  3HP9 A;  2EW3 A;  2QEX Q;  3BFM A;  1RAB B;  4FW2 A;  1WI7 A;  2XU8 A;  2KY9 A;  2YRD A;  3OS5 A;  2D8J A;  4Y91 A;  4HCK A;  4M7A D;  4DOW A;  4ME7 A;  3X20 B;  2O9V A;  5LJ5 g;  1OV3 A;  4A4G A;  5J3B A;  2FRW A;  1BI0 A;  4RG2 A;  4F7U E;  3EG0 A;  1YHQ T;  1YJN T;  2LJ3 A;  1FYN A;  3QHS A;  1KQS P;  5DM7 R;  2E5K A;  1ACM B;  3EFS A;  3CCM T;  1K8A R;  1M90 C;  1UJ0 A;  3VS1 A;  1WJQ A;  2KSS A;  2CUD A;  4FSX A;  1D1A A;  3TSW A;  3TQ7 P;  3SDZ A;  2EYW A;  3CPF A;  5KYY A;  3PFS A;  1W2B P;  2KYB A;  2ED0 A;  4C92 C;  2PZ1 A;  2DVJ A;  5GAM d;  2I0N A;  2RK2 A;  1B34 B;  3EGX B;  3M57 A;  2OAW A;  1K73 C;  1NG2 A;  2CKK A;  5GAN e;  1YI2 A;  4M75 A;  4M78 F;  3IQL A;  1ZUK A;  3CD6 T;  2PUO B;  1MHN A;  1NPR A;  2MMP A;  3I35 A;  3G71 A;  2EVR A;  4LDY A;  1QW1 A;  1VQO T;  2E64 A;  1JBM A;  4XU3 A;  3CME Q;  3NTK A;  2WSF E;  1CKA A;  1OX9 A;  1XOV A;  3EH2 A;  3M0U A;  2A3L A;  4RTU A;  1FXX A;  2PUK B;  2HCK A;  4B9W A;  2DVE A;  1QVF S;  4D8K A;  2D1X A;  1W6X A;  2EQK A;  2QGF B;  4OML A;  1M2O A;  1KC8 R;  2FEI A;  5GAO r;  2EGA A;  1UGR B;  4MDW A;  4ATO A;  3RDV A;  2ZAE A;  2FB7 A;  3PMT A;  4X34 A;  2DK3 A;  3OYL A;  2D9T A;  5CKH A;  2DXB A;  1G5V A;  4IUR A;  4BD3 A;  3ME9 A;  2OTL T;  2X4J A;  5CO7 A;  4CC4 B;  2RJE A;  3OMG A;  1G3Y A;  3SD4 A;  2O01 E;  2BZX A;  4XTU A;  4E6R A;  2EWN A;  2EYY A;  2QK0 A;  4OB3 B;  4PJL A;  5LJ5 j;  1VYV A;  2NWM A;  7AT1 B;  4M75 C;  2ED1 A;  4C92 E;  5GAN 2;  3JCM Q;  3JCM h;  3H6Z A;  2QEX T;  5FRN A;  2SEM A;  5CIU A;  2NUP A;  1PD1 A;  2ZPH B;  3VS4 A;  4J9D A;  2CZ7 B;  2V26 A;  4BE0 A;  4N4G A;  4ANJ A;  5CK9 A;  1AEY A;  1KK7 A;  1G8X A;  3CPW S;  2LQN A;  2O9S A;  1YIJ Q;  1DJ7 B;  5A0G A;  4JRI A;  1PD0 A;  4M77 D;  2LT1 A;  1I0C A;  3M58 A;  1B3Q A;  3VRY A;  2KR3 A;  1M1G A;  4VUB A;  4J9H A;  1QCN A;  2OJ2 A;  1JXO A;  1YJ9 Q;  1GBQ A;  3SWN B;  3UT1 A;  3A8G B;  2RA2 A;  3DKM A;  3OBY A;  2PTK A;  3G71 Q;  4XTY A;  2G3R A;  3QWX X;  2RI2 A;  1Q82 C;  3A1P A;  2DNU A;  4E7I A;  2VXE A;  3MEV A;  4E47 A;  3MCA B;  4RG8 A;  3RR6 A;  3TSZ A;  2HQX A;  3CEY A;  3OMC A;  2RQV A;  1H3H A;  1G3S A;  1YP5 A;  4LD6 A;  3OYN A;  1D0Y A;  3CC4 A;  2IIM A;  4QT7 A;  5IN1 A;  5FU6 C;  1KQS A;  1UEB A;  3OY9 A;  1ZHI A;  2KBT A;  1IHV A;  1ZSG A;  1N8R C;  2QAZ A;  3CCE T;  2GFA A;  3DLM A;  3E19 A;  2QA4 A;  1X43 A;  3DB3 A;  1FWZ A;  3CME T;  3VS2 A;  4RTT A;  1W2B A;  1KD1 R;  3CCU A;  1OZ3 A;  1B07 A;  2A36 A;  4ZGJ B;  1MMA A;  1N6A A;  1SHG A;  2O2O A;  3OYY A;  3MPU B;  5FU7 C;  1QQJ A;  2RHI A;  2CP7 A;  1M3C A;  1PM3 A;  2J05 A;  3M54 A;  3N5B B;  2VVK A;  2HDA A;  4JLG A;  3CC2 A;  2GQV A;  1R8O B;  1OYX A;  2AZS A;  4DBR A;  4PL6 A;  2DRM A;  1E6H A;  4C92 G;  1VQ6 A;  2GFU A;  1RI9 A;  4M78 D;  4OGE A;  2K3X A;  2KRS A;  2EPD A;  4J9F A;  4AFU C;  3FRN A;  1A0N B;  3O8V A;  2C0O A;  1AHJ B;  1TTH B;  2E65 A;  1IXD A;  8AT1 B;  2PVG B;  3JCM X;  2C0T A;  1TUC A;  2RI3 A;  4CC7 A;  5DLQ E;  4BE2 A;  3EG9 A;  3VRZ A;  1KHI A;  1Y57 A;  3PGG A;  1Q7Y R;  1OQK A;  1H8K A;  3OS1 A;  2AHJ B;  2KT8 A;  4Z02 A;  4HCC A;  3QYH B;  1M2V A;  3CC7 Q;  3CMA A;  3LLR A;  1WQW A;  2E6Z A;  5GAM h;  2SRC A;  3RKW A;  1RAC B;  4II1 A;  3SHW A;  2A37 A;  2XG8 D;  1YIJ T;  4C5I A;  3GPL A;  4OMM A;  5I2S A;  4F16 A;  2DXT A;  2DKG A;  4XTZ A;  5GMK j;  1EFN A;  2O31 A;  3QKJ A;  1LPL A;  2DIG A;  2HNI A;  1TUD A;  3A5Z B;  5C6S A;  1YJ9 T;  1YCS B;  4C0D C;  1QVF P;  2BKD N;  2E70 A;  3E2U A;  4HA8 A;  5AT1 B;  4C92 F;  3G71 T;  4CC3 A;  3OS0 A;  2QG9 B;  2QA4 Q;  2NUT A;  4NL2 A;  4JDS A;  2Y4X A;  1NJI U;  5IHN A;  1VQ4 A;  4OB1 B;  4X9C A;  1I5O B;  4F14 A;  1M1K R;  3VS0 A;  4E7Z A;  4HT8 A;  3E1S A;  3EFO A;  4C8Q A;  2DBM A;  2L3P A;  3OA6 A;  2DLP A;  5KYY B;  5LJ3 h;  2R5M A;  4M75 G;  4L59 A;  1P92 A;  1Q86 R;  1YWP A;  3VS5 A;  4PJO E;  1AWJ A;  4AG2 C;  1NBE B;  2XKO C;  1UFF A;  1G83 A;  1YBY A;  2ZZD A;  4JUV A;  4B6M A;  1W1F A;  2WSC E;  3JCM g;  2M0O A;  2BTT A;  4AFZ C;  2DJQ A;  4M75 B;  2HMA A;  3V8K A;  4OVA A;  2CP2 A;  4RTX A;  3INZ A;  2VWF A;  3MKD A;  4MZT A;  1MUZ A;  4PK4 A;  3CPW P;  3SWN A;  1VQ5 A;  4OMP A;  2M0Y A;  2K2V A;  3M4Y A;  3CCL A;  5HY6 A;  3S3O A;  1QCF A;  1YJW A;  3UA7 A;  3PIP A;  1YIT Q;  2KGT A;  4BI3 A;  1YHQ Q;  2EBP A;  4LDU A;  4LDX A;  2LP5 A;  1UTI A;  3QZ5 B;  2HQE A;  2LMJ A;  1NLP C;  3CMA Q;  2EGC A;  2X4X A;  1M4Z A;  2LQK A;  2DZC A;  4ELY C;  2VB6 A;  3RBB B;  1KSW A;  3I55 Q;  3RIR A;  1VQN A;  3TU4 K;  2E5Q A;  2B8A A;  3QJY A;  1SKU B;  4M75 F;  3BY7 A;  2A0F B;  1WDX A;  4C8Q C;  1M27 C;  4AT1 B;  1VQL A;  1ZUU A;  1K73 U;  1UHF A;  2LCL A;  3MP8 A;  1BYM A;  4A63 B;  1LNX A;  4C0Z A;  2K9G A;  4QQ6 A;  4FL6 A;  1GCP A;  5CR2 A;  2QQA A;  1J3T A;  5GAN 6;  4IIO A;  5ECA A;  4QW2 A;  3CC7 T;  2ZPE B;  4IUP A;  1UG1 A;  3FJ5 A;  1SRM A;  1QLY A;  3GF5 A;  3CD6 Q;  2FYK A;  4XK8 E;  4CC2 A;  4FYV B;  5GAO l;  4FCY A;  1VQ4 Q;  1VQO Q;  3D7S B;  1ZX6 A;  2CRE A;  3E9G A;  2CUB A;  1NZ9 A;  2MF2 A;  2V8K A;  1I1J A;  2DMO A;  2NUP B;  4HCZ A;  5IHK A;  3SWN C;  4JRQ A;  2X3X D;  1VQK A;  1VIE A;  3LX7 A;  1VQM Q;  3U23 A;  3QXE B;  5FU7 B;  4C0G A;  2EQU A;  3FLG A;  2QA4 T;  3QJ6 A;  3HRT A;  2QTV A;  1IB8 A;  3CCU T;  2QGG A;  2HAX A;  1K0X A;  1K1Z A;  4V2S A;  3EGD A;  4E7J A;  1MV3 A;  2HBW A;  2YWW A;  2EJF A;  1BIB A;  4J7F A;  1NJI C;  4XU2 A;  1QMC A;  1UGQ B;  1VQ7 A;  1BCM A;  2OTL Q;  1FMK A;  3CCL Q;  5KYX A;  2CT3 A;  1QP3 A;  2F1L A;  3CCV A;  1BK2 A;  2DL7 A;  3CC2 T;  3L42 A;  1VA7 A;  4FYW B;  2AZV A;  2RJD A;  2AK5 A;  3ASK A;  3R6N A;  1VQ6 T;  4HCB A;  1NYF A;  5L8R E;  2F5T X;  1OEB A;  4GLK A;  3UPU A;  1M3B A;  4C92 D;  1X6O A;  4AG1 C;  5GAM g;  1M5Q 1;  3KFV A;  3VYG A;  1YN8 A;  3A8O B;  3URG A;  2LJ1 A;  3QSU A;  3M5A A;  2O4X A;  1IGU A;  3OYD A;  5AYF A;  1RAF B;  2YXY A;  3QDF A;  4PJO F;  1YIT T;  3C4S A;  3CBO A;  3QWY A;  5CKF A;  4ELZ C;  2W10 A;  1Q82 U;  3CMA T;  2DBK A;  4HXJ A;  2Z0W A;  4JPB W;  1BI3 A;  4C0D B;  4XU1 A;  1OOT A;  4M7D A;  1MMG A;  4JJB A;  4UC4 A;  3OYG A;  3I55 T;  5GAN 4;  3LGL A;  1VQP Q;  2L3S A;  2EJG A;  3CPW A;  2AIR B;  2QQB A;  2M16 A;  4LNP A;  5CQY A;  1G3T A;  4P5N A;  4AFS C;  2FZK B;  1BI1 A;  4HVU A;  2DET A;  4LUE A;  1VQK Q;  1O9S A;  4XTV A;  1K9A A;  2MK5 A;  4PFP A;  1RUW A;  1WPY A;  2DTH A;  5LJ3 g;  1N8R U;  2HL3 A;  5HCK A;  3P8B B;  1U1T A;  1S72 A;  2KXD A;  1ABO A;  2L8D A;  4O5V A;  5CCA A;  1MMN A;  2GBQ A;  3X26 B;  4FU6 A;  3EG9 B;  3CCE Q;  2FL7 A;  1OPK A;  1VQ4 T;  5HKC A;  1JEG A;  2JW4 A;  5HK3 A;  2H8H A;  2IPO B;  2P4T A;  2L3Q A;  3M53 A;  5IHI A;  2JVV A;  1M2V B;  1X69 A;  2HSE B;  1OUL A;  3HFN A;  5LJ5 d;  2DO3 A;  2E1H A;  2ZCF B;  1VQM T;  4A4F A;  2GF7 A;  4M75 D;  5IH2 A;  1QVG S;  4KGX B;  1WHM A;  5LJ5 f;  2VKN A;  5GAN 5;  4DA4 A;  4M4Z A;  2JMA A;  2ENM A;  4WTO B;  3PE0 A;  1Q81 C;  1UUE A;  2EIF A;  2M9U A;  4M7D C;  1LOJ A;  2HBP A;  3JB9 H;  2VAS A;  1RAH B;  3HSB A;  2CP0 A;  3GNG A;  2CZ1 B;  4C8Q G;  3CQT A;  2CSI A;  1RLQ C;  4MDX A;  2NUT B;  3UWN A;  1NEB A;  2JTM A;  5A0D A;  3G4S A;  3GP8 A;  3H0H A;  2M1H A;  2JN0 A;  3QBY A;  4Y92 A;  3CCL T;  4PFZ A;  4J5Y A;  4ZNX A;  3TEE A;  4J9E A;  1YJW T;  4FSS A;  5GAM j;  3J7A F;  1SPK A;  1WX6 A;  4IIM A;  1WZO A;  3EFO B;  2RQU A;  5EC7 A;  4C8Q B;  3L2V A;  4DBF A;  3M0S A;  4ZGD B;  3CCS A;  3THK A;  5LL6 S;  3G6E A;  1C6V X;  2QQS A;  2JS2 A;  4OF1 A;  5I2M A;  3QPH A;  2ESW A;  2KNB B;  2NYS A;  1Z9Q A;  1PWT A;  2X9H A;  1VQN T;  1GCQ A;  3E9F A;  1K9M C;  2DPP B;  1BB9 A;  1VQL T;  1NE8 A;  4JJC A;  4M77 A;  1ZBX A;  2X35 A;  2CP3 A;  1PHT A;  4XQ3 A;  1BBZ A;  5KCO A;  1PKS A;  3P8D A;  4XTW A;  1WYX A;  2E3I A;  5EG2 A;  4DQ2 A;  1AOJ A;  1WA7 A;  2D8H A;  1YI2 Q;  1WXU A;  1VOM A;  4C8Q F;  1IHW A;  5LJ5 e;  2KK4 A;  5LJ3 j;  5CVI A;  3T9N A;  2QQ9 A;  5GAN 8;  3HFO A;  1R0C B;  2HQH A;  5GMK l;  1RLP C;  1I81 A;  4BY6 C;  1RAD B;  1M8M A;  1VQP T;  4LE9 A;  2D0Q B;  2FPE A;  2HSP A;  2A7Y A;  1VQK T;  4EMK A;  4A4H A;  4QVC A;  3JV3 A;  1RAI B;  2MCN A;  1N9S A;  1B7T A;  1NLO C;  2CZ6 B;  5KH6 A;  4OB0 B;  1SSH A;  4D8D A;  2EQM A;  3JB9 J;  2OX7 A;  2GQI A;  2RB6 A;  4LUD A;  2VGM A;  1Y96 A;  4PJO D;  2KRN A;  3L2Z A;  2LRQ A;  4IKF A;  3UDC A;  3PIO A;  5GAN h;  2DRK A;  1UJY A;  1GCQ C;  1ZA1 B;  4PLI A;  1VQ7 T;  1PKT A;  3M0P A;  4BAC A;  5GAO q;  1TSF A;  2L2P A;  2RQT A;  3PTA A;  4M77 C;  3FB9 A;  6AT1 B;  4KRT A;  4M75 E;  1X6B A;  3SEM A;  1I07 A;  2YHT A;  3CCS Q;  1GXI E;  4O6J A;  3OQ5 A;  2VC8 A;  3G6E Q;  2KRM A;  4KUD K;  3QUI A;  1M90 R;  1FMW A;  2IVW A;  3A8M B;  4BDZ A;  4M78 A;  2JJ9 A;  3BDL A;  3C0C A;  2KAF A;  4QVZ A;  3VU3 C;  2RJC A;  2ZGW A;  3ZBD A;  3F70 A;  2F2X A;  3H0F A;  2DAQ A;  4X1V A;  3EGD B;  2V8I A;  4EMK C;  2YLC A;  1K73 R;  5L23 A;  2LCC A;  1SEM A;  4J6X A;  2EKH A;  3HRU A;  2GGR A;  3P8H A;  5A2Q E;  2LX9 A;  4OMO A;  1T0J A;  4E7L A;  5KYX B;  2QI2 A;  1AD5 A;  4N4H A;  1GRI A;  3S3M A;  4M7A G;  1HYO A;  2EFI A;  4A4K A;  3OSS C;  1QKX A;  3WVD B;  1QVP A;  4J9I A;  2RHU A; 
#chains in the Genus database with same CATH homology
 1WXT A;  1GCP A;  3TSW A;  1J3T A;  4IIO A;  5ECA A;  1T3S A;  2EYW A;  2GTO A;  1BU1 A;  2RF0 A;  1PRL C;  2A28 A;  2LX7 A;  1UG1 A;  3FJ5 A;  1SRM A;  1QLY A;  4RTV A;  2KYB A;  2ED0 A;  2PZ1 A;  4CC2 A;  2DVJ A;  1E6G A;  3GBQ A;  2I0N A;  2LZ6 B;  2J6O A;  4Z8A A;  2OAW A;  1ZX6 A;  1NG2 A;  2CRE A;  3PVL A;  2CUB A;  3EHR A;  1JXM A;  1I1J A;  2DMO A;  5I11 A;  5IHK A;  1IO6 A;  1VYU A;  1QKW A;  2X3X D;  3IQL A;  1ZUK A;  2B86 A;  3A98 A;  3I35 A;  2EVR A;  3U23 A;  2KEA A;  1WLP B;  3EG2 A;  2QDL A;  1G2B A;  4OMN A;  1CKA A;  2LCS A;  2RN8 A;  2EQI A;  1XOV A;  3M0U A;  1K0X A;  1K1Z A;  1YNZ A;  4HVV A;  4RTU A;  1MV3 A;  4Z89 A;  1AZE A;  2HBW A;  2DIL A;  2PNI A;  1K0S A;  1U5S A;  4J9G A;  2HCK A;  2O88 A;  2DF6 A;  4D8K A;  1ABQ A;  4K11 A;  2D1X A;  2P4R A;  1W6X A;  4OML A;  2DYB A;  1FMK A;  4OMQ A;  2J6F A;  2KT1 A;  2YDL A;  2CT3 A;  2FEI A;  2EGA A;  2K3B A;  1QWF A;  2KXC A;  3TVT A;  1BK2 A;  2DL7 A;  2YUQ A;  1VA7 A;  2AZV A;  2AK5 A;  2J6K A;  2K7A A;  1UDL A;  3R6N A;  2EYZ A;  1NYF A;  1OEB A;  3EGU A;  1M3B A;  3EG3 A;  4CC4 B;  3VS3 A;  3NHN A;  1YWO A;  1W70 A;  4AG1 C;  1GL5 A;  1T3L A;  5I22 A;  3KFV A;  1GBR A;  1YN8 A;  2CSQ A;  2BZX A;  3M0T A;  1X6G A;  2LJ1 A;  4E6R A;  2V1Q A;  2F2V A;  3I5R A;  1WFW A;  2ABL A;  2EYY A;  2YUP A;  1VYV A;  1UEC A;  2NWM A;  2ECZ A;  2ED1 A;  3NGP A;  4J9B A;  4Z88 A;  2SEM A;  1KFZ A;  4EIK A;  3NMZ C;  3QWY A;  2J7I A;  5FWB A;  1E7O A;  3VS4 A;  2ROT A;  4J9D A;  2W10 A;  2AKK A;  2DBK A;  4HXJ A;  3VS7 A;  1AEY A;  4JPB W;  3ZL7 C;  1CSK A;  4JZ3 A;  2YUN A;  2LQN A;  2YUO A;  1OOT A;  2O9S A;  4JJB A;  2DL4 A;  2JS0 A;  2DX1 A;  2L3S A;  1I0C A;  1JQQ A;  1B3Q A;  3VRY A;  4LNP A;  2KR3 A;  4J9H A;  4R0K A;  2OJ2 A;  1JXO A;  1GBQ A;  4AFS C;  4HVU A;  1U3O A;  3M0Q A;  4LUE A;  1K9A A;  2G6F X;  1RUW A;  2PTK A;  5FWC A;  3QWX X;  2M51 A;  1GFD A;  1HD3 A;  2DNU A;  5HCK A;  1UE9 A;  2RQW A;  2KXD A;  1ABO A;  1AZG B;  5IXF A;  4J9C A;  2FG0 A;  3TSZ A;  2GBQ A;  1X27 A;  2RMO A;  2JXB A;  2RQV A;  1H3H A;  1OPK A;  1JEG A;  2CT4 A;  1YP5 A;  1K4U S;  1ZLM A;  2JW4 A;  2JT4 A;  2LNH B;  2H8H A;  4GLM A;  2IIM A;  4QT7 A;  2EYX A;  2L3Q A;  3NPF A;  5IHI A;  2KBT A;  4JJD A;  1X69 A;  1ZSG A;  5IXB A;  3VS6 A;  4RTZ A;  1CKB A;  1Y0M A;  1SRL A;  1S1N A;  2DL8 A;  2DM1 A;  5IH2 A;  1X43 A;  3VS2 A;  4RTT A;  2VKN A;  1T0H A;  1KIK A;  1B07 A;  2A36 A;  3ULR B;  4M4Z A;  2JMA A;  2LJ0 A;  2ENM A;  1SHG A;  4LN2 A;  2O2O A;  2V1R A;  1JU5 C;  3PE0 A;  1UUE A;  2X3W D;  2CH4 W;  4HVW A;  3CQT A;  2CSI A;  1M3C A;  1RLQ C;  2J05 A;  1NEB A;  1Z9Z A;  3REB B;  2KRO A;  3H0H A;  2VVK A;  1M30 A;  4Y92 A;  1HJD A;  4ZNX A;  1PRM C;  2RPN A;  4J9E A;  2HDA A;  4FSS A;  1SPK A;  1WIE A;  2RNA A;  2AZS A;  1WX6 A;  3REA B;  4IIM A;  1KJW A;  2RQU A;  5EC7 A;  3M0S A;  2DRM A;  1E6H A;  2L0A A;  3THK A;  1RI9 A;  1H92 A;  2NUZ A;  2JS2 A;  2MIO A;  2KRS A;  3M0R A;  2EPD A;  4J9F A;  4AFU C;  2LQW A;  1VYT A;  1V1C A;  4RUG A;  4RTW A;  1A0N B;  2ESW A;  2C0O A;  2KNB B;  2XMF A;  1Z9Q A;  3PVQ A;  1PWT A;  2ROL A;  3RNJ A;  1GCQ A;  3I9Q A;  4DEX A;  2C0T A;  3O5Z A;  1TUC A;  2RQR A;  4CC7 A;  1BB9 A;  1PNJ A;  1MV0 B;  1AWX A;  3LH5 A;  4JJC A;  3VRZ A;  1K76 A;  1Y57 A;  1H8K A;  1PHT A;  1ZUY A;  1BBZ A;  3UF4 A;  2KT8 A;  1PKS A;  1X2Q A;  1N5Z A;  1WYX A;  1AOJ A;  1WA7 A;  2D8H A;  1WXU A;  1QWE A;  2JM9 A;  1TG0 A;  1OPL A;  2SRC A;  3EG1 A;  3SHW A;  2J06 A;  2A37 A;  4AFQ C;  1WXB A;  1NYG A;  4OMM A;  2K6D A;  1AWW A;  4GBQ A;  2F2W A;  4F16 A;  1RLP C;  2FO0 A;  2JTE A;  1UHC A;  1M8M A;  1EFN A;  2O31 A;  2K79 A;  2CH4 A;  2KYM A;  2GNC A;  4LE9 A;  2FPE A;  1TUD A;  2HSP A;  1M3A A;  4ORZ A;  1YCS B;  1SHF A;  3UA6 A;  1ARK A;  2JM8 A;  4CC3 A;  3JV3 A;  2MCN A;  2JMC A;  4JZ4 A;  1LCK A;  1NLO C;  3H0I A;  2D0N A;  5GJV B;  1SSH A;  4D8D A;  2DL5 A;  5IHN A;  2GQI A;  2MOX A;  4LUD A;  2HEQ A;  2DL3 A;  4F14 A;  1AVZ C;  2BZY A;  3VS0 A;  2FPF A;  2KRN A;  1HSQ A;  1NEG A;  1GFC A;  5FW9 A;  2DBM A;  2DRK A;  1X2K A;  2L3P A;  2DLP A;  1UJY A;  1GCQ C;  1AWO A;  1PKT A;  3M0P A;  2L2P A;  2RQT A;  2BZ8 A;  1YWP A;  3VS5 A;  1AWJ A;  4KRT A;  4AG2 C;  1UFF A;  1X6B A;  1G83 A;  2EGE A;  3SEM A;  1UGV A;  1I07 A;  2W0Z A;  1W1F A;  4RTY A;  2BTT A;  5GJW B;  4AFZ C;  2DJQ A;  4F17 A;  2YT6 A;  2KRM A;  2A08 A;  2KE9 A;  4ESR A;  4RTX A;  2AKL A;  2YSQ A;  4DEY A;  2VWF A;  3C0C A;  1MUZ A;  4OMP A;  2M0Y A;  2CDT A;  2F2X A;  2GTJ A;  3H0F A;  1JO8 A;  1QCF A;  1U06 A;  4X1V A;  3UA7 A;  2EW3 A;  3H41 A;  2KGT A;  4WCI A;  2EBP A;  1WI7 A;  2LP5 A;  3UAT A;  1UTI A;  5L23 A;  2LMJ A;  1NLP C;  1SEM A;  2EKH A;  1ZBJ A;  1NM7 A;  2GGR A;  2EGC A;  2D8J A;  4OMO A;  2FPD A;  1T0J A;  3EHQ A;  2DA9 A;  4HCK A;  3RBB B;  2FRY A;  1KSW A;  2O9V A;  1OV3 A;  1AD5 A;  2K2M A;  2FRW A;  1GRI A;  3EG0 A;  3I5S A;  2LJ3 A;  1WDX A;  1FYN A;  1M27 C;  1ZUU A;  2OI3 A;  1UHF A;  2C0I A;  2E5K A;  2DE0 X;  1QKX A;  4A63 B;  1UJ0 A;  4J9I A;  3VS1 A;  2K9G A;  2CUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...