3EG2A

Crystal structure of the n114q mutant of abl-sh3 domain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSQYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
total genus 14
structure length 63
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3eg2A00
2KXDA 2ABLA 1WXTA 2KT8A 1I07A 2JMAA 3FJ5A 1AVZC 1B3QA 2AK5A 1M8MA 5IH2A 1QWEA 1SRLA 2H8HA 3KFVA 2V1QA 2DBKA 2A28A 4HVWA 4JJBA 1Y57A 5GJWB 2EGAA 2CSIA 1WIEA 2DL8A 3UATA 2HBWA 1U3OA 2DILA 1BBZA 2CSQA 1XOVA 1YWPA 2DF6A 4DEXA 4E6RA 5I22A 2PNIA 2D8HA 5ECAA 2EYZA 1CSKA 1W70A 1NG2A 2DNUA 1NEBA 2J7IA 2KEAA 3VS6A 3C0CA 2DL7A 1VYUA 2CUBA 1AWJA 2CT4A 3H0IA 2LJ1A 4F17A 4F14A 1BU1A 2O31A 2DL5A 2JS2A 3I35A 2P4RA 4JZ3A 2KRSA 4AG1C 1KIKA 1AWXA 2AZSA 1K9AA 1AZGB 2EYYA 1G2BA 1JO8A 1U5SA 4RTZA 3THKA 2M51A 1X43A 3EG1A 1WFWA 1YN8A 2KRNA 3UA6A 4WCIA 2YUOA 1SHFA 3IQLA 3VS5A 3M0SA 2CH4A 2DYBA 2OI3A 2L3QA 2ROLA 1WX6A 1RUWA 4LN2A 2X3XD 2YUPA 1K0SA 3H0FA 4J9DA 1ZX6A 1K4US 1NLPC 1PWTA 3ULRB 2L2PA 4IIOA 4RTUA 1WLPB 2LCSA 2PTKA 2FG0A 2I0NA 2SRCA 3PVQA 4Z8AA 1JXOA 4OMNA 4J9HA 1SEMA 1QWFA 1PHTA 1PRLC 1VA7A 2D1XA 2HCKA 4CC7A 3ZL7C 2J6FA 2DLPA 5FW9A 2DX1A 2EGEA 4Z88A 1Y0MA 2K7AA 2JTEA 3TSWA 1MV3A 3CQTA 2EYWA 3VS4A 4CC4B 4HVVA 1ZLMA 3REAB 1S1NA 2CREA 1RLQC 2KYMA 2O88A 2JT4A 1UJ0A 1N5ZA 2KR3A 2BZ8A 2OJ2A 2BZYA 3VRYA 4D8DA 3REBB 1H8KA 1UHFA 1GBRA 4RTYA 2ROTA 4Z89A 4OMQA 1M3CA 2MCNA 1QKXA 4AG2C 1GFDA 2DL4A 1TG0A 2EW3A 2K9GA 2BTTA 2LX7A 1CKBA 4AFZC 5IHKA 2KT1A 3M0TA 1E6HA 4OMOA 3VS3A 1SSHA 4GLMA 3RNJA 2JW4A 2GTJA 1PRMC 2DM1A 2ED1A 4J9EA 4ZNXA 2FRWA 4FSSA 2KBTA 5FWBA 3PE0A 2FPDA 2D8JA 1JQQA 2FRYA 1RI9A 2DRMA 2G6FX 4ORZA 4RTWA 3VS2A 1UDLA 1UG1A 4D8KA 1X6BA 2W10A 1SHGA 2A36A 2CUDA 3SHWA 4KRTA 2AKLA 3I5SA 2M0YA 1PNJA 5IXFA 2DVJA 2YT6A 1YNZA 2A08A 2RMOA 1RLPC 2DA9A 3O5ZA 3U23A 2KROA 1X2KA 1LCKA 2FPFA 2K6DA 4J9BA 1UGVA 4JJDA 1UFFA 1X27A 3H41A 2C0IA 2VKNA 2SEMA 2NWMA 3VS7A 4J9GA 2QDLA 1AWWA 1X6GA 1QKWA 1JU5C 2YDLA 2O2OA 1WXBA 2F2XA 2RQTA 2EBPA 1I1JA 4R0KA 4JJCA 1M3AA 4F16A 4LUDA 2F2VA 2YUNA 2KRMA 1KFZA 3QWXX 1TUCA 1OEBA 1M30A 1WYXA 2OAWA 3TSZA 1G83A 2LQNA 2RF0A 3LH5A 1V1CA 4GBQA 4J9IA 2YSQA 1NYGA 1B07A 1BB9A 2PZ1A 1GL5A 4A63B 2HSPA 3EG2A 1HD3A 3A98A 1Z9ZA 4ESRA 1GFCA 2RQUA 4IIMA 1M27C 1OPLA 2EKHA 4X1VA 2VVKA 1WA7A 3I9QA 2O9SA 2E5KA 2LZ6B 1UUEA 3GBQA 2L3PA 1WI7A 1FMKA 2RPNA 3M0QA 1YWOA 2DJQA 2HEQA 2FO0A 4AFUC 2ED0A 4RTTA 2J6OA 4AFQC 4JPBW 2CH4W 5FWCA 4LUEA 2NUZA 3VS1A 2IIMA 2KYBA 1JXMA 3EG3A 1Z9QA 1SPKA 1EFNA 1PKSA 5IHIA 1W6XA 1GCQC 3EHRA 3NHNA 2JMCA 1ZUYA 5L23A 4QT7A 2GQIA 1FYNA 3RBBB 2J05A 3NPFA 2JM9A 2LQWA 2RN8A 1KJWA 4OMPA 1H92A 1MV0B 3EHQA 1HSQA 2ESWA 2FPEA 2JXBA 4JZ4A 1UHCA 2B86A 1ABQA 1UE9A 2K79A 1AZEA 1CKAA 1U06A 1M3BA 4CC3A 3NMZC 4HVUA 4HXJA 3QWYA 1T0JA 2EQIA 4AFSC 1E7OA 1AEYA 1H3HA 1WDXA 4LNPA 2RQWA 2KE9A 3R6NA 1KSWA 1T3SA 2XMFA 1T3LA 5GJVB 2GBQA 1W1FA 2LP5A 2FEIA 1K1ZA 2RNAA 2AZVA 2KXCA 5HCKA 3M0PA 2EYXA 1IO6A 2GTOA 2J06A 2C0TA 1GRIA 1UJYA 3H0HA 3SEMA 2BZXA 3UF4A 1ABOA 2ECZA 1I0CA 2CT3A 1PKTA 4RTXA 1NEGA 2A37A 2LNHB 2VWFA 4OMMA 1K0XA 3JV3A 4DEYA 1AWOA 1ZSGA 1OOTA 2ENMA 3UA7A 2DMOA 2HDAA 1AD5A 2DBMA 1E6GA 1HJDA 3VRZA 1UTIA 2C0OA 1J3TA 5IHNA 1OV3A 1X69A 1GBQA 4HCKA 1ZUUA 2LJ0A 1T0HA 1QCFA 4RTVA 1YCSB 2L0AA 1UECA 1AOJA 5IXBA 2KNBB 4K11A 3M0UA 1X2QA 2KGTA 1JEGA 3M0RA 4EIKA 1GCPA 2X3WD 4M4ZA 2RQVA 3I5RA 3TVTA 2MOXA 2AKKA 1NM7A 2EPDA 2JM8A 1ZUKA 2DL3A 3EGUA 4RUGA 2J6KA 2V1RA 5I11A 4OMLA 2EVRA 1ARKA 2DRKA 1SRMA 1VYTA 2GGRA 1YP5A 2MIOA 1VYVA 2D0NA 4Y92A 5EC7A 3NGPA 2LJ3A 4CC2A 3EG0A 1QLYA 2O9VA 1BK2A 1MUZA 1OPKA 1NLOC 2GNCA 1K76A 1GCQA 2W0ZA 4LE9A 1WXUA 2F2WA 2JS0A 1TUDA 2K3BA 1ZBJA 2K2MA 2L3SA 4J9FA 2YUQA 1NYFA 2EGCA 2RQRA 1A0NB 2DE0X 4J9CA 3PVLA 2CDTA 3VS0A 2LMJA
chains in the Genus database with same CATH superfamily
2KXDA 2HL5C 3BFMA 5IT9E 5DLQE 2JMAA 1M1KR 2GQVA 4MZMA 4FYXB 1WHKA 2DTHA 2H8HA 3P8BB 5HY6A 4MZTA 2OAUA 2A28A 4PJOE 2CSIA 1WIEA 2DL8A 3V8KA 3UATA 2DILA 4J8OA 3SWNC 2QYZA 1WHMA 2HQHA 4E6RA 2ZPHB 3A8GB 1S72A 4NL2A 2PNIA 5ECAA 2EYZA 2QI2A 1W70A 3PGGA 1NG2A 2DNUA 2CGHA 1NEBA 4XU1A 2AHJB 2X4XA 2E41A 4XTWA 1AWJA 2CT4A 1HXDA 2DL5A 2P4RA 1JB0E 2AZSA 3E19A 4M78B 5KYWA 1ZHIA 1U5SA 4RTZA 4LDXA 2M51A 2K5LA 2RB6A 4EMKB 3SWNA 3LLRA 1YN8A 2DVEA 1XTDA 1SHFA 2CH4A 5KYUA 5CCAA 1VQ8T 1TU0B 1PC0A 3L2WA 2L3QA 3OB9A 2CS7A 3RUXA 3BW1A 2VUBA 2PVOB 3ZFJA 2YUPA 2YLCA 2A7YA 3CCMQ 2WSCE 5KYNA 3V8JA 1WLPB 2LCSA 2EQKA 2MWPA 1UGRB 4PJJA 1JXOA 4J6XA 1I4K1 1PHTA 3M4YA 1IREB 2D1XA 4CC7A 1W2BS 2DLPA 2DX1A 2XI9A 2DJZA 1KQSP 5CVIA 4CC4B 2DKGA 3CEYA 2OTJT 1ZLMA 1YIJT 1QP3A 4M78A 5LL6S 3CCQQ 3OMCA 2CREA 1VIFA 3KBGA 5KE2A 2ZPGB 2BZ8A 2OJ2A 1Q82C 1VQ5A 4D8DA 1UHFA 2C06A 4RTYA 4QQGA 4Z89A 4OMQA 3ZEHA 2LT1A 2DL4A 4XK8E 4RMOA 3I55A 4M7AF 4FYWB 4DA4A 3L42A 1CKBA 4AFZC 1VQLT 2VV5A 2RA2A 4M7AA 4AMCA 2WSEE 1EX4A 4OMOA 1SSHA 4C0GA 1OX9A 2MYSA 1QQJA 1D0XA 1VQ6Q 3OYIA 2GTJA 1PRMC 3HFOA 4E7SA 5A0GA 1YJ9Q 3JAME 3O8VA 4M7DB 4FSSA 2DEQA 4PJOG 2KBTA 5FWBA 3PE0A 2D8JA 4J6YA 2G6FX 2Y4XA 3EFOB 2NLUA 4EMKC 1ZQ1A 1UDLA 1OZ3A 8ATCB 1VQ4Q 4D8KA 2A36A 3CCJT 1KQ1A 3I5SA 4F7UA 5AT1B 2RMOA 3JCMP 3U23A 1QMCA 2KDSA 3CMEA 4M7DF 1TTHB 2RD1A 4J7IA 1VQLQ 5LJ5j 3LWHA 3LYIA 4J9BA 2FB7A 2DD5A 1X27A 5C0MA 1VQ8Q 2VKNA 4R56A 2MAMA 2NWMA 1QVPA 1OU8A 3CC2Q 3OW2S 4JLIA 2RO0A 2CP3A 3PMIA 1QKWA 5GAN8 4BE2A 3M4GA 2RQTA 4R0KA 4F16A 2F2VA 1Y07A 4C92D 1KFZA 3QWXX 2DETA 1M30A 3JCMX 1WYXA 1G83A 3MKDA 4GBQA 4J9IA 1XQHA 3CCUQ 2YSQA 5LJ5f 5LJ5d 3CC7Q 5KYXB 4KGVB 1YJWQ 4KBMB 3QZ9B 3CCLQ 4IIMA 4QVDA 2Y90A 2QQAA 2EJFA 2EKHA 1WA7A 3OYJA 4JUVA 3I9QA 1N8RR 3CCET 2V26A 1WQWA 1UUEA 4X9DA 2RPNA 4IURA 1VQLA 1M1KC 2DJQA 3OA6A 4AFUC 5C6SA 2ED0A 2DFUA 1SG5A 3RMSA 1LPLA 4Q5WA 2E3IA 2IIMA 2IG0A 1X6OA 2XHCA 1SPKA 3GOXA 2YLBA 5IHIA 3RMQA 4C92A 4DBRA 3P8DA 1D1BA 1GCQC 5GMKl 3NHNA 2E3HA 2J05A 5GAN6 2EJGA 3NPFA 2LQWA 4M7DA 2DXUA 1PSEA 1H92A 5GAOl 4ZTFA 2ESWA 2FPEA 1Q82U 3KUFA 1VQ9T 2K79A 1CKAA 2JUFA 4GLKA 2ZZDA 3FEOA 2RM4A 4HXJA 2EQIA 3F70A 4XU2A 2QTXA 3JCMb 1AEYA 2A0FB 4M77G 4D6WA 4F04B 4LNPA 5I2SA 2R5AA 2QASA 1Y96A 4NOYA 3MO8A 4N0AC 5GAMf 3TU4K 5GJVB 1W1FA 3VU3C 1OU9A 2RNAA 2EYXA 3I56A 2GTOA 2J06A 2C0TA 1GRIA 1R0CB 4PKCC 3G7ZA 1K8AR 1B34B 5D6YA 2LRQA 3ZBDA 2COYA 2DIGA 4C0ZA 2LNHB 2RJEA 4OMMA 2OTLA 2QGFB 4M75C 1AWOA 1OOTA 3UA7A 4M78G 4B9WA 3CCRA 2BE9B 3RESA 1VQPA 4M7AD 4E7KA 3OYDA 1YJNQ 2P0PA 3S3NA 2O4XA 3EG9A 1KD1U 3G4SA 5GAN7 4J5YA 1YCSB 1OX8A 2XG8D 9ATCB 2DZCA 2L0AA 1NPRA 4K11A 3JCMg 3PIPA 5I2MA 4EIKA 2FYKA 4TVRA 3CPWS 4OVAA 1UEBA 5LJ3g 1IXDA 3I5RA 3EGDB 3EH2A 3CCST 1NM7A 4A53A 2JM8A 1JJ2A 4C92F 4O6JA 4A54A 1K8AC 5FRMA 2V1RA 3L2UA 3CCQA 5I11A 2EVRA 1RACB 2GGRA 1YP5A 3V7CA 2DXTA 5EC7A 3NGPA 4C0DB 4Z02A 4BB7A 3JB9D 2LJ3A 4KUDK 2O9VA 2LC4A 4ZN3A 5KH6A 1BK2A 4C8QF 3OYLA 1M8VA 4LE9A 2VC8A 3MEWA 1Q82R 3MCAB 1N9RA 4E2FB 1BI0A 2KVQG 3CCMA 4M7AE 2L3SA 4J9FA 2EWNA 5CKBA 1ZA1B 3OYEA 1NYFA 2OTJA 3HSBA 2RQRA 1A0NB 1Q81R 3VS0A 1WXTA 1TUGB 3VYGA 4N4IA 1W2BA 1AVZC 1B3QA 1VQ5T 1QWEA 3VKIA 5LJ3h 1VQ9Q 1BI1A 1Y57A 3BDUA 2LDMA 2Z0WA 1IZ6A 1QW1A 5GAOm 5KYYA 3CC7T 2HBWA 1VQ6T 3CPFA 3I55T 2MWOA 4M7AC 1XOVA 4DEXA 5I22A 4EMKA 1WJSA 1RAGB 1CSKA 5A2QE 4PJMA 4F7UE 4L6V5 2KEAA 4ME7A 3C4SA 1VYUA 4CRIA 1UGQB 1VQ4T 1VQOQ 3QG1A 2FL7A 3MP1A 1M2OA 5GAOq 1D3BA 2KRSA 4AG1C 3M57A 1LVKA 2E64A 1AZGB 1K9AA 1G3SA 2EYYA 4GY5A 5AYFA 2HMAA 3CMAA 2CP7A 1BCMA 4C92B 3FJPA 4EPCA 4OGEA 3LH0A 1Q81C 3JCMJ 1NJIR 3MPUB 1YHQA 1BIBA 4WCIA 3RKYA 3VUBA 4V2SA 3HRUA 4DBHA 2JZ2A 1VQNA 3LGLA 2LCCA 3EFOA 2OI3A 1P92A 1WX6A 1ZX6A 1K4US 2L2PA 1NJIC 2MPXC 2PTKA 1LJOA 2SRCA 3PTAA 4X9CA 1I5LA 3RERA 5GAMh 3OW2A 2XIDA 1SEMA 1QWFA 4C8QG 4RKUE 1PRLC 3A8OB 2HCKA 2PU9B 4FCYA 1K9MC 1VUBA 2J6FA 2EGEA 3MEAA 1Y0MA 2JTEA 2K7AA 3TSWA 3CCMT 1RI0A 5GAMd 3BE3A 4BACA 4HVVA 2FZCB 3E9FA 3J80E 4JS4A 2LQ8A 1PD1A 1RLQC 2X51A 2KYMA 3LW5E 8AT1B 1WPYA 3H9NA 1TWBA 1UJ0A 2HQEA 3JCMh 5CK9A 2MI6A 4RG8A 4XTZA 1QKXA 2CP6A 3L2ZA 2EW3A 3CCEA 3J7AF 4M7AG 2K9GA 4JRKA 4J6WA 5GAN5 1K9MR 3QUIA 1E6HA 3CXCA 3VS3A 4XTXA 4F7UB 3GP8A 4GLMA 3CMEQ 4C92C 1X01A 4M77C 4OB2B 3CD6T 4M77F 5DLOA 2DM1A 2ED1A 5GAOp 2Y4YA 3JB9J 1HK9A 4KH0B 4L59A 2VGNA 4J9EA 2RI3A 5FLXE 3CC4T 2GFUA 1K73U 2PUKB 3RKWA 2FPDA 4PLLA 1JQQA 3CCSQ 1IGUA 4RTWA 6AT1B 4C5GA 1ZSZA 1BI2A 2W10A 3QIIA 2QQRA 4BI8B 1D09B 1WZOA 1D3BB 3OYNA 4JS5A 3X25B 2YT6A 4M77B 4A4FA 2KROA 1LCKA 5GMKm 3EFSA 2KSSA 1W2BP 4RG2A 3QBYA 4NL3A 2O4XB 3QO3A 3M9QA 4LDUA 5KYXA 5J3BA 4C5EA 4J9GA 3JCMQ 1VQMA 3OYYA 3X24B 3PIOA 3I56T 4ZTJA 2LCLA 1AWWA 1X6GA 1JU5C 1WXBA 1I1JA 2KRMA 2CP0A 1TUCA 1OEBA 2OTLT 2MK5A 5GAN3 2EQMA 2V8KA 1ZA2B 1G3YA 2RF0A 4PNOA 2IVWA 1HYOA 3G6EQ 2QEXA 4Y91A 1YI2T 5KE3A 4A63B 5LJ3e 2DZ9A 3EG2A 3A98A 2CZ1B 2CKKA 1Z9ZA 4ESRA 1M27C 3G71A 1OI1A 2RK2A 3G4ST 1RAFB 2VVKA 1WJRA 3MP8A 4XQ3A 1MMAA 5IAYA 3UPUA 3GBQA 4EMHA 1EIFA 4M77D 1NPPA 1WI7A 5GANd 3X26B 2QDYB 5J26A 2XDPA 2CZ7B 2E6ZA 1G8XA 4AFQC 4JPBW 1YJWT 4PK4A 4LUEA 3SD4A 3VJPA 3EG9B 4EMGA 3VS1A 1TOVA 3SDZA 3EG3A 3TQ7P 3OW2P 3WVEB 3LWIA 3CCQT 3TREA 3VV0A 1W6XA 2X4YA 3CCEQ 3EHRA 2PUOB 1PSFA 2L3RA 3BDLA 2JMCA 2VASA 1ZUYA 4QT7A 2GQIA 3JCMf 2M1HA 1KD1R 2JM9A 2RN8A 4BDZA 1Q7YR 2RHXA 3DKMA 3EHQA 2JXBA 4IUVA 2B86A 4A4GA 3QXEB 3TCJA 4KGXB 4Y28E 5GMKj 4LD9K 1AZEA 3NMZC 4M7AB 2ATCB 1N8RC 4XAXB 1KSWA 1VQNQ 1T3LA 2LP5A 4E47A 1RADB 1K1ZA 2E5QA 1VQMT 3AHUA 3CC7A 2K2VA 2I2LA 1W4SA 4BY6C 2BZXA 3UF4A 2ECZA 4PJOB 3JB9F 1PM3A 1VQ7A 2LT4A 3FLGA 1GXIE 3JB9I 1TS9A 1FMWA 1Q7YC 5CKDA 4F7UG 1ZSGA 4QQDA 1M90R 3RKXA 4KT0E 2YRCA 1UTIA 1YI2A 2OTLQ 4LDYA 3T9NA 2XDBA 2CP5A 4J83A 1LOJA 4E7JA 4HCKA 1M5Q1 1ZUUA 4HCBA 2RI5A 4M75E 5CR2A 1QCFA 4PFOA 4CI0C 1Q95G 5A0LA 1UECA 1YJNA 2KNBB 1M2VB 1KC8U 3CC2T 2L89A 3M0UA 2KGTA 3QYHB 4RCCA 4M4ZA 3JB9G 2RQVA 3TVTA 5FU7B 1U8RA 3E1SA 3ME9A 2DAQA 5CKFA 1O75A 4M7DD 2CZ0B 3CMAQ 3INZA 5CQXA 3URGA 2DL3A 3M58A 4IUTA 4OP0A 1M90C 5HK0A 3C95A 2GFAA 1QLYA 1NLOC 4C8QE 2W0ZA 3OBWA 4FT2A 2X4JA 4E7HA 4ATOA 1JRIA 2JS0A 3SWNB 3CPWA 3VYHB 1TUDA 2K2MA 5KYWB 4N4HA 2QQ9A 1VQ9A 5L8RE 3RIRA 1KC8R 1O9SA 1FXXA 2JVVA 1I07A 3FB9A 2RHIA 2YRDA 2AK5A 5D6WA 1M8MA 4XTUA 5IH2A 4PJOC 1SRLA 3DLLA 2B8AA 2QA4T 2DBKA 2JN0A 1BKBA 1VQMQ 4HVWA 2VYTA 3OBYA 2EGAA 3CPWP 1U3OA 1BBZA 2CSQA 2E4HA 4FL6A 1YWPA 5J39A 3L1AA 5GAMj 3GLXA 2D9TA 3NTHA 2RI2A 2J7IA 3C0CA 4XTYA 2CUBA 4IUQA 3H0IA 4C8QD 2LJ1A 3CD6A 2OX7A 4F17A 4F14A 1BU1A 2O31A 3GNGA 1K73R 4C8QC 3EGXA 2NUTA 3CCRT 2JS2A 5LJ5h 3I35A 3MEVA 3CC4A 5IN1A 3FRNA 3JCMV 1AWXA 4FT4A 4WF2A 3M56A 1UGSB 5D6XA 3OSSC 1G2BA 1JO8A 4ZGDB 3THKA 2QXFA 2FZGB 3M59A 3EG1A 1VQKQ 3H8ZA 4M78D 3UA6A 4M7DC 3CCJA 4A4HA 3CC2A 1PG5B 4JRIA 3VS5A 1IRXA 1M90U 3RR6A 1VQOT 2LX9A 2DYBA 2V8IA 1BYMA 1OQKA 4OB0B 2ROLA 1RUWA 4LN2A 1KQSS 3CCSA 2X3XD 1K0SA 4JJNK 3J81E 4JDSA 4J9DA 4QKUA 3CXCS 1NLPC 1PWTA 4IIOA 3EFRA 2M16A 2O01E 3HFNA 1C0MA 3S3OA 1Q81U 2I0NA 1NBEB 3PVQA 4Z8AA 2AT1B 4FIBA 4E7IA 2EYQA 2HQXA 1MGQA 4J9HA 4QVCA 4DBQA 1VA7A 3L2VA 3JSCA 3ZL7C 1QCNA 3L2QA 1I8FA 3TEEA 1MV3A 4JRQA 3CQTA 4HCZA 5GANh 2EYWA 1SSFA 3VS4A 5FRNA 3QDRB 1S1NA 1Y96B 1X75C 4BI4A 1BIAA 4ZN1A 5KCOA 2DK3A 4PJLA 3ER0A 2JT4A 1R0BG 1OULA 4IUPA 2H3JA 4X34A 4ELYC 2EAYA 1BCOA 2E6NA 1YITA 5CIUA 2E10A 3FDRA 1G5VA 3C12A 3META 1XJWB 1Q86U 4XU3A 1KK7A 2E12A 2EIFA 2BTTA 2LX7A 3OQ5A 2KT1A 4PFZA 2E1HA 3M0TA 4C5IA 1G3TA 2M9UA 2QGGA 4VUBA 3QHSA 1IGQA 4C5HA 2K3YA 2ZCFB 3RNJA 3G71Q 2JW4A 4HCCA 1FMVA 2QTVA 2PVGB 4ZNXA 1U1SA 3M5AA 3OYGA 3VUZA 2FRYA 2P4TA 3OYHA 1VQKT 3CMAT 4II1A 4LXCA 3VS2A 2DTOA 2KQWA 4HT8A 3SHWA 1JJ2S 2P84A 2E70A 2AKLA 4C0DC 1N27A 2X35A 2CZ6B 4ELZC 1PNJA 1VQNT 1XNIA 5IXFA 3QJYA 2A08A 2LVMA 1RLPC 1JBMA 3O5ZA 1C1AA 1MNDA 4DBFA 3UDCA 2K6DA 1UGVA 3A8LB 1UFFA 4L5GA 2QG9B 3H41A 1B34A 2C0IA 5KYUB 5FU7C 3OYBA 3CBOA 1YHQQ 1M4ZA 1N6AA 3H6ZA 2ZPFB 4XU0A 1KQ2A 3AT1B 2K5FA 2EBPA 3JCMe 4JJCA 4LUDA 2YUNA 3GF5A 1Q7YU 2NUPA 2QQSA 3FC3A 2HL3A 3TSZA 5GAOn 2QQBA 2BIVA 3LH5A 1V1CA 1H641 1V76A 1TSFA 3I56Q 4FYVB 2HSPA 1VQPT 1QCOA 4M75F 1GFCA 2RQUA 3A5ZB 1IHVA 3HPWA 2COWA 3E9GA 4M75G 1YJ9A 1BI3A 2O9SA 2E5KA 1SF9A 1WNLA 2L3PA 2EFIA 4KULA 1KQSA 3M0QA 1YWOA 2HSEB 2HEQA 4RTTA 2J6OA 4IKFA 3OYKA 4O5VA 5FWCA 3NTKA 3GNFB 3OSVA 5LJ3f 1JXMA 3PT9A 1IHWA 5FROA 1EFNA 1PKSA 1RAEB 3HKSA 4PLIA 1AT1B 3HRTA 3JCMW 5GMKi 3CXCP 1WQ7A 5L23A 3DB3A 3RBBB 3E2UA 3KXTA 4M77E 4OMPA 2K4YA 1Q86R 1MV0B 1HSQA 4JZ4A 2R57A 1RAHB 2MMPA 1ABQA 1UE9A 2XICA 4PJOF 1U06A 1M1KU 2WSFE 4HVUA 3QWYA 1T0JA 5FU6B 1B7TA 1E7OA 4M75B 5HKCA 1H3HA 4OB1B 4E7LA 1WJQA 2RH2A 4R55A 4BE1A 1T3SA 2PQWA 2XMFA 2QA4A 4PL6A 2GBQA 1AHJB 3CD6Q 1VQ7Q 4BY6B 2RHYA 2KXCA 1YITQ 3CC4Q 3M0PA 7AT1B 2DTIA 1IO6A 4M7DG 1UJYA 3H0HA 1MMGA 3SEMA 1S72T 1I0CA 3GIBA 4UC4A 3P8HA 4RTXA 4FW2A 1IB8A 2A37A 2VWFA 3M54A 2COZA 2ENMA 3WVDB 2DMOA 5CQYA 1AD5A 1TH7A 4M77A 1VQ4A 2HAXA 3VRZA 1HJDA 2DYIA 1ACMB 2C0OA 4OGCA 4QQ6A 1R8OB 5IHNA 1X69A 2P0QA 2X4WA 2NUPB 3G71T 4C92E 2LQKA 5GAOr 3A1PA 3SB2A 3CCVT 1MMNA 5KYYB 1AOJA 5IXBA 4ZGJB 2NUTB 3EGXB 1JEGA 1GCPA 2MOXA 2AKKA 2EPDA 2VB6A 1M1FA 4B6MA 3OS0A 5LJ3j 2J6KA 1G3WA 4C0FA 3OYMA 3S3MA 1ZSZB 3QPHA 2MIOA 2ZPBB 1VYVA 2D0NA 1KG1A 2M02A 1YFNA 4MMKA 2F2WA 1KHCA 4LDVA 5KCHA 2XDDA 3CCLA 1H3ZA 2YUQA 5DM7R 3MHXA 4BE0A 2DE0X 4J9CA 3PVLA 2CDTA 4FM4B 5FU6C 2ABLA 2KT8A 4LD6A 2HKNA 1K9MU 2DD4A 3FJ5A 3Q1JA 3G4SQ 3KFVA 3UWNA 2V1QA 2EQJA 3PMTA 3MEUA 1YITT 4JJBA 2KAFA 2QA4Q 2ZPIB 5GJWB 5CKHA 1RABB 5HK3A 2PVDB 2DF6A 2XD0A 3QSUA 2JNGA 2XK0A 3G1JA 2D8HA 1VQ7T 2XU8A 3QZ5B 2JJ9A 2HD0A 3VS6A 4C8QB 4NS5A 2DL7A 3N5BB 5LJ3d 1M2VA 1JJ2P 1M1GA 4JZ3A 2EQUA 4LDWA 1KIKA 1VIEA 1QVFP 4M7DE 4OF1A 4QW2A 1X43A 2FHDA 5GMKe 2DEUA 1WFWA 1WGSA 2WACA 1NZ9A 1UGPB 4A4KA 4F7UF 2KRNA 2YUOA 5CKEA 3HRSA 4WTOB 1N9SA 3IQLA 2YWWA 3M0SA 1K8AU 2BUDA 3QJ6A 1QP2A 4E7ZA 5GMKh 3CMET 3BY7A 2DIQA 3H0FA 2EKOA 2HKQB 2D0QB 3ULRB 4RTUA 2OTJQ 1ZSZC 2FG0A 1QVGA 2HBPA 1UB4A 3HHTB 1KC8C 4B9XA 4OMNA 4ANJA 3I55Q 1D1AA 2M0OA 5D7UA 3R6OA 5FW9A 2K57A 2KI7A 4Z88A 4M78E 2NYSA 1V29B 4PJOD 3QYGB 3REAB 2KMTA 1S72Q 1OZ2A 2O88A 2QEXT 1N5ZA 2KR3A 2BZYA 2G3RA 3VRYA 3REBB 1H8KA 2E65A 1GBRA 1VOMA 3OYFA 2ROTA 2GF7A 1R77A 2VXEA 1M3CA 3EAEA 3X28B 2MCNA 3JCMc 4AG2C 1GFDA 1TG0A 1YJ9T 4BD3A 1WHHA 1I81A 2F1LA 2R58A 2KK4A 2RK1A 5IHKA 2JOYA 1QVFA 1YBYA 1N8RU 5LJ5g 3QDFA 1SKUB 1YI2Q 3PFSA 4BUGA 3G6ET 4P5NA 4OMFB 2FRWA 3JCMd 1KD1C 2XKOC 4DOVA 5GAN2 1RI9A 2DRMA 3SFMA 4ORZA 5GANj 2HZYA 5EG2A 3V8LA 1UG1A 2YRVA 1X6BA 5CAIA 3D7SB 1SHGA 1WHGA 2CUDA 2DXCA 4KRTA 3GPLA 2M0YA 2VGMA 4HT9A 3V7RA 5A0DA 1VQOA 2DVJA 2JTMA 2BKDN 1YNZA 4FSXA 3UT1A 1VQ8A 2AIRB 2DA9A 3NFCA 3X20B 1X2KA 5GAMe 1I5OB 1Y71A 2FPFA 3HTRA 4JJDA 3CBPA 1MHNA 2F5KA 4PJOA 2SEMA 2HNIA 3RDVA 2LTOA 3VS7A 1KHIA 3WXMB 3QKJA 2QDLA 3CBMA 3JB9H 5GANf 4A4EA 4JLGA 2ZPEB 5GANg 3L2RA 2YDLA 2O2OA 2F2XA 4ZGEB 2DPPB 1M3AA 1U1TA 4KUIA 2OAWA 2LQNA 3DB4A 4HA8A 2LNVA 3ASKA 3S6WA 1NYGA 4EDUA 1B07A 1BB9A 2H3EB 2R5MA 2PZ1A 4C8QA 2K5IA 1GL5A 3CCJQ 2F69A 1HD3A 4JRPA 2DERA 1M9SA 5GAN4 4C92G 1OPLA 4X1VA 1QVGS 4HKEA 2QEXQ 5CO7A 3CCVA 2LZ6B 1YJNT 4MDWA 4M78C 2DXBA 1K73C 4XTVA 1FMKA 2BE7D 2FVUA 2A3LA 3LX7A 1MNEA 2FO0A 1VQPQ 2KY9A 4DOWA 2CH4W 4FYYB 2NUZA 1DJ7B 2KYBA 1PD0A 3CCUA 2F5TX 3G6EA 5LJ5e 1Z9QA 4QVZA 2X9HA 1QVGP 1NE8A 4MMLA 3EGDA 1VQKA 1Q86C 1FWZA 3HL8A 1Y7XA 1FYNA 4MDXA 1KJWA 2IPOB 3CCLT 2YHTA 1UHCA 1ZBXA 4J7FA 4M75D 1M3BA 4CC3A 2RJFA 2ZAEA 3MP6A 3OMGA 4AFSC 4N4GA 1D0YA 1WDXA 4OB3B 2P0KA 2QK0A 1RL2A 5GAMg 4BDYA 2RQWA 2DO3A 2KE9A 3HP9A 3R6NA 3OS2A 4FW1A 1LNXA 3JRZA 4KH1B 2FEIA 2AZVA 1C6VX 5HCKA 1RAAB 1F1BB 1VQ6A 1FX7A 2CYZB 2JTFA 1ABOA 2CT3A 1OYXA 2EJ9A 1PKTA 4BI3A 5GANe 1NEGA 2V8JA 5M9OA 1WHLA 1K0XA 3JV3A 4DEYA 4MZPA 2HDAA 2DBMA 1E6GA 2D6FA 3A8HB 5DY9A 1J3TA 1OV3A 3OY9A 3NTIA 2L5QA 2ZGWA 1GBQA 2LJ0A 1T0HA 4DQ2A 4RTVA 4KGZB 2QAZA 1YHQT 1MMDA 3OS1A 3OYAA 1YCYA 1QVFS 3LGFA 3M55A 2RJCA 1X2QA 1RAIB 5I21A 3V7SA 3M0RA 4FU6A 2X3WD 1WHJA 4YTLA 1NJIU 4IUUA 1YJWA 4M78F 4RCBA 4N0AA 4PFPA 3MJXA 1EZZB 1PCXA 3CCUT 1ZUKA 3PNWC 3EGUA 3OYCA 3CCRQ 2VXFA 4RUGA 4PJNA 3M53A 4OMLA 2FZKB 3CCVQ 1ARKA 2DRKA 1SRMA 1VYTA 4Y92A 4AT1B 2RHUA 4CC2A 3EG0A 1VQ5Q 2CP2A 3C94A 1MUZA 1OPKA 1YIJQ 2RHZA 2GNCA 1K76A 1GCQA 2GCXA 2YXYA 2L8DA 1D0ZA 4M75A 1WXUA 3DLMA 2RJDA 2K3BA 3A8MB 1ZBJA 1D1CA 2EGCA 1YIJA 3OS5A 2K3XA 1TXQA 2MF2A 3EH1A 3FIFA 2LMJA
chains in the Genus database with same CATH topology
2KXDA 2ABLA 1WXTA 2KT8A 1I07A 2JMAA 3FJ5A 1AVZC 1B3QA 2AK5A 1M8MA 5IH2A 1QWEA 1SRLA 2H8HA 3KFVA 2V1QA 2DBKA 2A28A 4HVWA 4JJBA 1Y57A 5GJWB 2EGAA 2CSIA 1WIEA 2DL8A 3UATA 2HBWA 1U3OA 2DILA 1BBZA 2CSQA 1XOVA 1YWPA 2DF6A 4DEXA 4E6RA 5I22A 2PNIA 2D8HA 5ECAA 2EYZA 1CSKA 1W70A 1NG2A 2DNUA 1NEBA 2J7IA 2KEAA 3VS6A 3C0CA 2DL7A 1VYUA 2CUBA 1AWJA 2CT4A 3H0IA 2LJ1A 4F17A 4F14A 1BU1A 2O31A 2DL5A 2JS2A 3I35A 2P4RA 4JZ3A 2KRSA 4AG1C 1KIKA 1AWXA 2AZSA 1K9AA 1AZGB 2EYYA 1G2BA 1JO8A 1U5SA 4RTZA 3THKA 2M51A 1X43A 3EG1A 1WFWA 1YN8A 2KRNA 3UA6A 4WCIA 2YUOA 1SHFA 3IQLA 3VS5A 3M0SA 2CH4A 2DYBA 2OI3A 2L3QA 2ROLA 1WX6A 1RUWA 4LN2A 2X3XD 2YUPA 1K0SA 3H0FA 4J9DA 1ZX6A 1K4US 1NLPC 1PWTA 3ULRB 2L2PA 4IIOA 4RTUA 1WLPB 2LCSA 2PTKA 2FG0A 2I0NA 2SRCA 3PVQA 4Z8AA 1JXOA 4OMNA 4J9HA 1SEMA 1QWFA 1PHTA 1PRLC 1VA7A 2D1XA 2HCKA 4CC7A 3ZL7C 2J6FA 2DLPA 5FW9A 2DX1A 2EGEA 4Z88A 1Y0MA 2K7AA 2JTEA 3TSWA 1MV3A 3CQTA 2EYWA 3VS4A 4CC4B 4HVVA 1ZLMA 3REAB 1S1NA 2CREA 1RLQC 2KYMA 2O88A 2JT4A 1UJ0A 1N5ZA 2KR3A 2BZ8A 2OJ2A 2BZYA 3VRYA 4D8DA 3REBB 1H8KA 1UHFA 1GBRA 4RTYA 2ROTA 4Z89A 4OMQA 1M3CA 2MCNA 1QKXA 4AG2C 1GFDA 2DL4A 1TG0A 2EW3A 2K9GA 2BTTA 2LX7A 1CKBA 4AFZC 5IHKA 2KT1A 3M0TA 1E6HA 4OMOA 3VS3A 1SSHA 4GLMA 3RNJA 2JW4A 2GTJA 1PRMC 2DM1A 2ED1A 4J9EA 4ZNXA 2FRWA 4FSSA 2KBTA 5FWBA 3PE0A 2FPDA 2D8JA 1JQQA 2FRYA 1RI9A 2DRMA 2G6FX 4ORZA 4RTWA 3VS2A 1UDLA 1UG1A 4D8KA 1X6BA 2W10A 1SHGA 2A36A 2CUDA 3SHWA 4KRTA 2AKLA 3I5SA 2M0YA 1PNJA 5IXFA 2DVJA 2YT6A 1YNZA 2A08A 2RMOA 1RLPC 2DA9A 3O5ZA 3U23A 2KROA 1X2KA 1LCKA 2FPFA 2K6DA 4J9BA 1UGVA 4JJDA 1UFFA 1X27A 3H41A 2C0IA 2VKNA 2SEMA 2NWMA 3VS7A 4J9GA 2QDLA 1AWWA 1X6GA 1QKWA 1JU5C 2YDLA 2O2OA 1WXBA 2F2XA 2RQTA 2EBPA 1I1JA 4R0KA 4JJCA 1M3AA 4F16A 4LUDA 2F2VA 2YUNA 2KRMA 1KFZA 3QWXX 1TUCA 1OEBA 1M30A 1WYXA 2OAWA 3TSZA 1G83A 2LQNA 2RF0A 3LH5A 1V1CA 4GBQA 4J9IA 2YSQA 1NYGA 1B07A 1BB9A 2PZ1A 1GL5A 4A63B 2HSPA 3EG2A 1HD3A 3A98A 1Z9ZA 4ESRA 1GFCA 2RQUA 4IIMA 1M27C 1OPLA 2EKHA 4X1VA 2VVKA 1WA7A 3I9QA 2O9SA 2E5KA 2LZ6B 1UUEA 3GBQA 2L3PA 1WI7A 1FMKA 2RPNA 3M0QA 1YWOA 2DJQA 2HEQA 2FO0A 4AFUC 2ED0A 4RTTA 2J6OA 4AFQC 4JPBW 2CH4W 5FWCA 4LUEA 2NUZA 3VS1A 2IIMA 2KYBA 1JXMA 3EG3A 1Z9QA 1SPKA 1EFNA 1PKSA 5IHIA 1W6XA 1GCQC 3EHRA 3NHNA 2JMCA 1ZUYA 5L23A 4QT7A 2GQIA 1FYNA 3RBBB 2J05A 3NPFA 2JM9A 2LQWA 2RN8A 1KJWA 4OMPA 1H92A 1MV0B 3EHQA 1HSQA 2ESWA 2FPEA 2JXBA 4JZ4A 1UHCA 2B86A 1ABQA 1UE9A 2K79A 1AZEA 1CKAA 1U06A 1M3BA 4CC3A 3NMZC 4HVUA 4HXJA 3QWYA 1T0JA 2EQIA 4AFSC 1E7OA 1AEYA 1H3HA 1WDXA 4LNPA 2RQWA 2KE9A 3R6NA 1KSWA 1T3SA 2XMFA 1T3LA 5GJVB 2GBQA 1W1FA 2LP5A 2FEIA 1K1ZA 2RNAA 2AZVA 2KXCA 5HCKA 3M0PA 2EYXA 1IO6A 2GTOA 2J06A 2C0TA 1GRIA 1UJYA 3H0HA 3SEMA 2BZXA 3UF4A 1ABOA 2ECZA 1I0CA 2CT3A 1PKTA 4RTXA 1NEGA 2A37A 2LNHB 2VWFA 4OMMA 1K0XA 3JV3A 4DEYA 1AWOA 1ZSGA 1OOTA 2ENMA 3UA7A 2DMOA 2HDAA 1AD5A 2DBMA 1E6GA 1HJDA 3VRZA 1UTIA 2C0OA 1J3TA 5IHNA 1OV3A 1X69A 1GBQA 4HCKA 1ZUUA 2LJ0A 1T0HA 1QCFA 4RTVA 1YCSB 2L0AA 1UECA 1AOJA 5IXBA 2KNBB 4K11A 3M0UA 1X2QA 2KGTA 1JEGA 3M0RA 4EIKA 1GCPA 2X3WD 4M4ZA 2RQVA 3I5RA 3TVTA 2MOXA 2AKKA 1NM7A 2EPDA 2JM8A 1ZUKA 2DL3A 3EGUA 4RUGA 2J6KA 2V1RA 5I11A 4OMLA 2EVRA 1ARKA 2DRKA 1SRMA 1VYTA 2GGRA 1YP5A 2MIOA 1VYVA 2D0NA 4Y92A 5EC7A 3NGPA 2LJ3A 4CC2A 3EG0A 1QLYA 2O9VA 1BK2A 1MUZA 1OPKA 1NLOC 2GNCA 1K76A 1GCQA 2W0ZA 4LE9A 1WXUA 2F2WA 2JS0A 1TUDA 2K3BA 1ZBJA 2K2MA 2L3SA 4J9FA 2YUQA 1NYFA 2EGCA 2RQRA 1A0NB 2DE0X 4J9CA 3PVLA 2CDTA 3VS0A 2LMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXD A;  2ABL A;  1WXT A;  2KT8 A;  1I07 A;  2JMA A;  3FJ5 A;  1AVZ C;  1B3Q A;  2AK5 A;  1M8M A;  5IH2 A;  1QWE A;  1SRL A;  2H8H A;  3KFV A;  2V1Q A;  2DBK A;  2A28 A;  4HVW A;  4JJB A;  1Y57 A;  5GJW B;  2EGA A;  2CSI A;  1WIE A;  2DL8 A;  3UAT A;  2HBW A;  1U3O A;  2DIL A;  1BBZ A;  2CSQ A;  1XOV A;  1YWP A;  2DF6 A;  4DEX A;  4E6R A;  5I22 A;  2PNI A;  2D8H A;  5ECA A;  2EYZ A;  1CSK A;  1W70 A;  1NG2 A;  2DNU A;  1NEB A;  2J7I A;  2KEA A;  3VS6 A;  3C0C A;  2DL7 A;  1VYU A;  2CUB A;  1AWJ A;  2CT4 A;  3H0I A;  2LJ1 A;  4F17 A;  4F14 A;  1BU1 A;  2O31 A;  2DL5 A;  2JS2 A;  3I35 A;  2P4R A;  4JZ3 A;  2KRS A;  4AG1 C;  1KIK A;  1AWX A;  2AZS A;  1K9A A;  1AZG B;  2EYY A;  1G2B A;  1JO8 A;  1U5S A;  4RTZ A;  3THK A;  2M51 A;  1X43 A;  3EG1 A;  1WFW A;  1YN8 A;  2KRN A;  3UA6 A;  4WCI A;  2YUO A;  1SHF A;  3IQL A;  3VS5 A;  3M0S A;  2CH4 A;  2DYB A;  2OI3 A;  2L3Q A;  2ROL A;  1WX6 A;  1RUW A;  4LN2 A;  2X3X D;  2YUP A;  1K0S A;  3H0F A;  4J9D A;  1ZX6 A;  1K4U S;  1NLP C;  1PWT A;  3ULR B;  2L2P A;  4IIO A;  4RTU A;  1WLP B;  2LCS A;  2PTK A;  2FG0 A;  2I0N A;  2SRC A;  3PVQ A;  4Z8A A;  1JXO A;  4OMN A;  4J9H A;  1SEM A;  1QWF A;  1PHT A;  1PRL C;  1VA7 A;  2D1X A;  2HCK A;  4CC7 A;  3ZL7 C;  2J6F A;  2DLP A;  5FW9 A;  2DX1 A;  2EGE A;  4Z88 A;  1Y0M A;  2K7A A;  2JTE A;  3TSW A;  1MV3 A;  3CQT A;  2EYW A;  3VS4 A;  4CC4 B;  4HVV A;  1ZLM A;  3REA B;  1S1N A;  2CRE A;  1RLQ C;  2KYM A;  2O88 A;  2JT4 A;  1UJ0 A;  1N5Z A;  2KR3 A;  2BZ8 A;  2OJ2 A;  2BZY A;  3VRY A;  4D8D A;  3REB B;  1H8K A;  1UHF A;  1GBR A;  4RTY A;  2ROT A;  4Z89 A;  4OMQ A;  1M3C A;  2MCN A;  1QKX A;  4AG2 C;  1GFD A;  2DL4 A;  1TG0 A;  2EW3 A;  2K9G A;  2BTT A;  2LX7 A;  1CKB A;  4AFZ C;  5IHK A;  2KT1 A;  3M0T A;  1E6H A;  4OMO A;  3VS3 A;  1SSH A;  4GLM A;  3RNJ A;  2JW4 A;  2GTJ A;  1PRM C;  2DM1 A;  2ED1 A;  4J9E A;  4ZNX A;  2FRW A;  4FSS A;  2KBT A;  5FWB A;  3PE0 A;  2FPD A;  2D8J A;  1JQQ A;  2FRY A;  1RI9 A;  2DRM A;  2G6F X;  4ORZ A;  4RTW A;  3VS2 A;  1UDL A;  1UG1 A;  4D8K A;  1X6B A;  2W10 A;  1SHG A;  2A36 A;  2CUD A;  3SHW A;  4KRT A;  2AKL A;  3I5S A;  2M0Y A;  1PNJ A;  5IXF A;  2DVJ A;  2YT6 A;  1YNZ A;  2A08 A;  2RMO A;  1RLP C;  2DA9 A;  3O5Z A;  3U23 A;  2KRO A;  1X2K A;  1LCK A;  2FPF A;  2K6D A;  4J9B A;  1UGV A;  4JJD A;  1UFF A;  1X27 A;  3H41 A;  2C0I A;  2VKN A;  2SEM A;  2NWM A;  3VS7 A;  4J9G A;  2QDL A;  1AWW A;  1X6G A;  1QKW A;  1JU5 C;  2YDL A;  2O2O A;  1WXB A;  2F2X A;  2RQT A;  2EBP A;  1I1J A;  4R0K A;  4JJC A;  1M3A A;  4F16 A;  4LUD A;  2F2V A;  2YUN A;  2KRM A;  1KFZ A;  3QWX X;  1TUC A;  1OEB A;  1M30 A;  1WYX A;  2OAW A;  3TSZ A;  1G83 A;  2LQN A;  2RF0 A;  3LH5 A;  1V1C A;  4GBQ A;  4J9I A;  2YSQ A;  1NYG A;  1B07 A;  1BB9 A;  2PZ1 A;  1GL5 A;  4A63 B;  2HSP A;  3EG2 A;  1HD3 A;  3A98 A;  1Z9Z A;  4ESR A;  1GFC A;  2RQU A;  4IIM A;  1M27 C;  1OPL A;  2EKH A;  4X1V A;  2VVK A;  1WA7 A;  3I9Q A;  2O9S A;  2E5K A;  2LZ6 B;  1UUE A;  3GBQ A;  2L3P A;  1WI7 A;  1FMK A;  2RPN A;  3M0Q A;  1YWO A;  2DJQ A;  2HEQ A;  2FO0 A;  4AFU C;  2ED0 A;  4RTT A;  2J6O A;  4AFQ C;  4JPB W;  2CH4 W;  5FWC A;  4LUE A;  2NUZ A;  3VS1 A;  2IIM A;  2KYB A;  1JXM A;  3EG3 A;  1Z9Q A;  1SPK A;  1EFN A;  1PKS A;  5IHI A;  1W6X A;  1GCQ C;  3EHR A;  3NHN A;  2JMC A;  1ZUY A;  5L23 A;  4QT7 A;  2GQI A;  1FYN A;  3RBB B;  2J05 A;  3NPF A;  2JM9 A;  2LQW A;  2RN8 A;  1KJW A;  4OMP A;  1H92 A;  1MV0 B;  3EHQ A;  1HSQ A;  2ESW A;  2FPE A;  2JXB A;  4JZ4 A;  1UHC A;  2B86 A;  1ABQ A;  1UE9 A;  2K79 A;  1AZE A;  1CKA A;  1U06 A;  1M3B A;  4CC3 A;  3NMZ C;  4HVU A;  4HXJ A;  3QWY A;  1T0J A;  2EQI A;  4AFS C;  1E7O A;  1AEY A;  1H3H A;  1WDX A;  4LNP A;  2RQW A;  2KE9 A;  3R6N A;  1KSW A;  1T3S A;  2XMF A;  1T3L A;  5GJV B;  2GBQ A;  1W1F A;  2LP5 A;  2FEI A;  1K1Z A;  2RNA A;  2AZV A;  2KXC A;  5HCK A;  3M0P A;  2EYX A;  1IO6 A;  2GTO A;  2J06 A;  2C0T A;  1GRI A;  1UJY A;  3H0H A;  3SEM A;  2BZX A;  3UF4 A;  1ABO A;  2ECZ A;  1I0C A;  2CT3 A;  1PKT A;  4RTX A;  1NEG A;  2A37 A;  2LNH B;  2VWF A;  4OMM A;  1K0X A;  3JV3 A;  4DEY A;  1AWO A;  1ZSG A;  1OOT A;  2ENM A;  3UA7 A;  2DMO A;  2HDA A;  1AD5 A;  2DBM A;  1E6G A;  1HJD A;  3VRZ A;  1UTI A;  2C0O A;  1J3T A;  5IHN A;  1OV3 A;  1X69 A;  1GBQ A;  4HCK A;  1ZUU A;  2LJ0 A;  1T0H A;  1QCF A;  4RTV A;  1YCS B;  2L0A A;  1UEC A;  1AOJ A;  5IXB A;  2KNB B;  4K11 A;  3M0U A;  1X2Q A;  2KGT A;  1JEG A;  3M0R A;  4EIK A;  1GCP A;  2X3W D;  4M4Z A;  2RQV A;  3I5R A;  3TVT A;  2MOX A;  2AKK A;  1NM7 A;  2EPD A;  2JM8 A;  1ZUK A;  2DL3 A;  3EGU A;  4RUG A;  2J6K A;  2V1R A;  5I11 A;  4OML A;  2EVR A;  1ARK A;  2DRK A;  1SRM A;  1VYT A;  2GGR A;  1YP5 A;  2MIO A;  1VYV A;  2D0N A;  4Y92 A;  5EC7 A;  3NGP A;  2LJ3 A;  4CC2 A;  3EG0 A;  1QLY A;  2O9V A;  1BK2 A;  1MUZ A;  1OPK A;  1NLO C;  2GNC A;  1K76 A;  1GCQ A;  2W0Z A;  4LE9 A;  1WXU A;  2F2W A;  2JS0 A;  1TUD A;  2K3B A;  1ZBJ A;  2K2M A;  2L3S A;  4J9F A;  2YUQ A;  1NYF A;  2EGC A;  2RQR A;  1A0N B;  2DE0 X;  4J9C A;  3PVL A;  2CDT A;  3VS0 A;  2LMJ A; 
#chains in the Genus database with same CATH topology
 2KXD A;  2HL5 C;  3BFM A;  5IT9 E;  5DLQ E;  2JMA A;  1M1K R;  2GQV A;  4MZM A;  4FYX B;  1WHK A;  2DTH A;  2H8H A;  3P8B B;  5HY6 A;  4MZT A;  2OAU A;  2A28 A;  4PJO E;  2CSI A;  1WIE A;  2DL8 A;  3V8K A;  3UAT A;  2DIL A;  4J8O A;  3SWN C;  2QYZ A;  1WHM A;  2HQH A;  4E6R A;  2ZPH B;  3A8G B;  1S72 A;  4NL2 A;  2PNI A;  5ECA A;  2EYZ A;  2QI2 A;  1W70 A;  3PGG A;  1NG2 A;  2DNU A;  2CGH A;  1NEB A;  4XU1 A;  2AHJ B;  2X4X A;  2E41 A;  4XTW A;  1AWJ A;  2CT4 A;  1HXD A;  2DL5 A;  2P4R A;  1JB0 E;  2AZS A;  3E19 A;  4M78 B;  5KYW A;  1ZHI A;  1U5S A;  4RTZ A;  4LDX A;  2M51 A;  2K5L A;  2RB6 A;  4EMK B;  3SWN A;  3LLR A;  1YN8 A;  2DVE A;  1XTD A;  1SHF A;  2CH4 A;  5KYU A;  5CCA A;  1VQ8 T;  1TU0 B;  1PC0 A;  3L2W A;  2L3Q A;  3OB9 A;  2CS7 A;  3RUX A;  3BW1 A;  2VUB A;  2PVO B;  3ZFJ A;  2YUP A;  2YLC A;  2A7Y A;  3CCM Q;  2WSC E;  5KYN A;  3V8J A;  1WLP B;  2LCS A;  2EQK A;  2MWP A;  1UGR B;  4PJJ A;  1JXO A;  4J6X A;  1I4K 1;  1PHT A;  3M4Y A;  1IRE B;  2D1X A;  4CC7 A;  1W2B S;  2DLP A;  2DX1 A;  2XI9 A;  2DJZ A;  1KQS P;  5CVI A;  4CC4 B;  2DKG A;  3CEY A;  2OTJ T;  1ZLM A;  1YIJ T;  1QP3 A;  4M78 A;  5LL6 S;  3CCQ Q;  3OMC A;  2CRE A;  1VIF A;  3KBG A;  5KE2 A;  2ZPG B;  2BZ8 A;  2OJ2 A;  1Q82 C;  1VQ5 A;  4D8D A;  1UHF A;  2C06 A;  4RTY A;  4QQG A;  4Z89 A;  4OMQ A;  3ZEH A;  2LT1 A;  2DL4 A;  4XK8 E;  4RMO A;  3I55 A;  4M7A F;  4FYW B;  4DA4 A;  3L42 A;  1CKB A;  4AFZ C;  1VQL T;  2VV5 A;  2RA2 A;  4M7A A;  4AMC A;  2WSE E;  1EX4 A;  4OMO A;  1SSH A;  4C0G A;  1OX9 A;  2MYS A;  1QQJ A;  1D0X A;  1VQ6 Q;  3OYI A;  2GTJ A;  1PRM C;  3HFO A;  4E7S A;  5A0G A;  1YJ9 Q;  3JAM E;  3O8V A;  4M7D B;  4FSS A;  2DEQ A;  4PJO G;  2KBT A;  5FWB A;  3PE0 A;  2D8J A;  4J6Y A;  2G6F X;  2Y4X A;  3EFO B;  2NLU A;  4EMK C;  1ZQ1 A;  1UDL A;  1OZ3 A;  8ATC B;  1VQ4 Q;  4D8K A;  2A36 A;  3CCJ T;  1KQ1 A;  3I5S A;  4F7U A;  5AT1 B;  2RMO A;  3JCM P;  3U23 A;  1QMC A;  2KDS A;  3CME A;  4M7D F;  1TTH B;  2RD1 A;  4J7I A;  1VQL Q;  5LJ5 j;  3LWH A;  3LYI A;  4J9B A;  2FB7 A;  2DD5 A;  1X27 A;  5C0M A;  1VQ8 Q;  2VKN A;  4R56 A;  2MAM A;  2NWM A;  1QVP A;  1OU8 A;  3CC2 Q;  3OW2 S;  4JLI A;  2RO0 A;  2CP3 A;  3PMI A;  1QKW A;  5GAN 8;  4BE2 A;  3M4G A;  2RQT A;  4R0K A;  4F16 A;  2F2V A;  1Y07 A;  4C92 D;  1KFZ A;  3QWX X;  2DET A;  1M30 A;  3JCM X;  1WYX A;  1G83 A;  3MKD A;  4GBQ A;  4J9I A;  1XQH A;  3CCU Q;  2YSQ A;  5LJ5 f;  5LJ5 d;  3CC7 Q;  5KYX B;  4KGV B;  1YJW Q;  4KBM B;  3QZ9 B;  3CCL Q;  4IIM A;  4QVD A;  2Y90 A;  2QQA A;  2EJF A;  2EKH A;  1WA7 A;  3OYJ A;  4JUV A;  3I9Q A;  1N8R R;  3CCE T;  2V26 A;  1WQW A;  1UUE A;  4X9D A;  2RPN A;  4IUR A;  1VQL A;  1M1K C;  2DJQ A;  3OA6 A;  4AFU C;  5C6S A;  2ED0 A;  2DFU A;  1SG5 A;  3RMS A;  1LPL A;  4Q5W A;  2E3I A;  2IIM A;  2IG0 A;  1X6O A;  2XHC A;  1SPK A;  3GOX A;  2YLB A;  5IHI A;  3RMQ A;  4C92 A;  4DBR A;  3P8D A;  1D1B A;  1GCQ C;  5GMK l;  3NHN A;  2E3H A;  2J05 A;  5GAN 6;  2EJG A;  3NPF A;  2LQW A;  4M7D A;  2DXU A;  1PSE A;  1H92 A;  5GAO l;  4ZTF A;  2ESW A;  2FPE A;  1Q82 U;  3KUF A;  1VQ9 T;  2K79 A;  1CKA A;  2JUF A;  4GLK A;  2ZZD A;  3FEO A;  2RM4 A;  4HXJ A;  2EQI A;  3F70 A;  4XU2 A;  2QTX A;  3JCM b;  1AEY A;  2A0F B;  4M77 G;  4D6W A;  4F04 B;  4LNP A;  5I2S A;  2R5A A;  2QAS A;  1Y96 A;  4NOY A;  3MO8 A;  4N0A C;  5GAM f;  3TU4 K;  5GJV B;  1W1F A;  3VU3 C;  1OU9 A;  2RNA A;  2EYX A;  3I56 A;  2GTO A;  2J06 A;  2C0T A;  1GRI A;  1R0C B;  4PKC C;  3G7Z A;  1K8A R;  1B34 B;  5D6Y A;  2LRQ A;  3ZBD A;  2COY A;  2DIG A;  4C0Z A;  2LNH B;  2RJE A;  4OMM A;  2OTL A;  2QGF B;  4M75 C;  1AWO A;  1OOT A;  3UA7 A;  4M78 G;  4B9W A;  3CCR A;  2BE9 B;  3RES A;  1VQP A;  4M7A D;  4E7K A;  3OYD A;  1YJN Q;  2P0P A;  3S3N A;  2O4X A;  3EG9 A;  1KD1 U;  3G4S A;  5GAN 7;  4J5Y A;  1YCS B;  1OX8 A;  2XG8 D;  9ATC B;  2DZC A;  2L0A A;  1NPR A;  4K11 A;  3JCM g;  3PIP A;  5I2M A;  4EIK A;  2FYK A;  4TVR A;  3CPW S;  4OVA A;  1UEB A;  5LJ3 g;  1IXD A;  3I5R A;  3EGD B;  3EH2 A;  3CCS T;  1NM7 A;  4A53 A;  2JM8 A;  1JJ2 A;  4C92 F;  4O6J A;  4A54 A;  1K8A C;  5FRM A;  2V1R A;  3L2U A;  3CCQ A;  5I11 A;  2EVR A;  1RAC B;  2GGR A;  1YP5 A;  3V7C A;  2DXT A;  5EC7 A;  3NGP A;  4C0D B;  4Z02 A;  4BB7 A;  3JB9 D;  2LJ3 A;  4KUD K;  2O9V A;  2LC4 A;  4ZN3 A;  5KH6 A;  1BK2 A;  4C8Q F;  3OYL A;  1M8V A;  4LE9 A;  2VC8 A;  3MEW A;  1Q82 R;  3MCA B;  1N9R A;  4E2F B;  1BI0 A;  2KVQ G;  3CCM A;  4M7A E;  2L3S A;  4J9F A;  2EWN A;  5CKB A;  1ZA1 B;  3OYE A;  1NYF A;  2OTJ A;  3HSB A;  2RQR A;  1A0N B;  1Q81 R;  3VS0 A;  1WXT A;  1TUG B;  3VYG A;  4N4I A;  1W2B A;  1AVZ C;  1B3Q A;  1VQ5 T;  1QWE A;  3VKI A;  5LJ3 h;  1VQ9 Q;  1BI1 A;  1Y57 A;  3BDU A;  2LDM A;  2Z0W A;  1IZ6 A;  1QW1 A;  5GAO m;  5KYY A;  3CC7 T;  2HBW A;  1VQ6 T;  3CPF A;  3I55 T;  2MWO A;  4M7A C;  1XOV A;  4DEX A;  5I22 A;  4EMK A;  1WJS A;  1RAG B;  1CSK A;  5A2Q E;  4PJM A;  4F7U E;  4L6V 5;  2KEA A;  4ME7 A;  3C4S A;  1VYU A;  4CRI A;  1UGQ B;  1VQ4 T;  1VQO Q;  3QG1 A;  2FL7 A;  3MP1 A;  1M2O A;  5GAO q;  1D3B A;  2KRS A;  4AG1 C;  3M57 A;  1LVK A;  2E64 A;  1AZG B;  1K9A A;  1G3S A;  2EYY A;  4GY5 A;  5AYF A;  2HMA A;  3CMA A;  2CP7 A;  1BCM A;  4C92 B;  3FJP A;  4EPC A;  4OGE A;  3LH0 A;  1Q81 C;  3JCM J;  1NJI R;  3MPU B;  1YHQ A;  1BIB A;  4WCI A;  3RKY A;  3VUB A;  4V2S A;  3HRU A;  4DBH A;  2JZ2 A;  1VQN A;  3LGL A;  2LCC A;  3EFO A;  2OI3 A;  1P92 A;  1WX6 A;  1ZX6 A;  1K4U S;  2L2P A;  1NJI C;  2MPX C;  2PTK A;  1LJO A;  2SRC A;  3PTA A;  4X9C A;  1I5L A;  3RER A;  5GAM h;  3OW2 A;  2XID A;  1SEM A;  1QWF A;  4C8Q G;  4RKU E;  1PRL C;  3A8O B;  2HCK A;  2PU9 B;  4FCY A;  1K9M C;  1VUB A;  2J6F A;  2EGE A;  3MEA A;  1Y0M A;  2JTE A;  2K7A A;  3TSW A;  3CCM T;  1RI0 A;  5GAM d;  3BE3 A;  4BAC A;  4HVV A;  2FZC B;  3E9F A;  3J80 E;  4JS4 A;  2LQ8 A;  1PD1 A;  1RLQ C;  2X51 A;  2KYM A;  3LW5 E;  8AT1 B;  1WPY A;  3H9N A;  1TWB A;  1UJ0 A;  2HQE A;  3JCM h;  5CK9 A;  2MI6 A;  4RG8 A;  4XTZ A;  1QKX A;  2CP6 A;  3L2Z A;  2EW3 A;  3CCE A;  3J7A F;  4M7A G;  2K9G A;  4JRK A;  4J6W A;  5GAN 5;  1K9M R;  3QUI A;  1E6H A;  3CXC A;  3VS3 A;  4XTX A;  4F7U B;  3GP8 A;  4GLM A;  3CME Q;  4C92 C;  1X01 A;  4M77 C;  4OB2 B;  3CD6 T;  4M77 F;  5DLO A;  2DM1 A;  2ED1 A;  5GAO p;  2Y4Y A;  3JB9 J;  1HK9 A;  4KH0 B;  4L59 A;  2VGN A;  4J9E A;  2RI3 A;  5FLX E;  3CC4 T;  2GFU A;  1K73 U;  2PUK B;  3RKW A;  2FPD A;  4PLL A;  1JQQ A;  3CCS Q;  1IGU A;  4RTW A;  6AT1 B;  4C5G A;  1ZSZ A;  1BI2 A;  2W10 A;  3QII A;  2QQR A;  4BI8 B;  1D09 B;  1WZO A;  1D3B B;  3OYN A;  4JS5 A;  3X25 B;  2YT6 A;  4M77 B;  4A4F A;  2KRO A;  1LCK A;  5GMK m;  3EFS A;  2KSS A;  1W2B P;  4RG2 A;  3QBY A;  4NL3 A;  2O4X B;  3QO3 A;  3M9Q A;  4LDU A;  5KYX A;  5J3B A;  4C5E A;  4J9G A;  3JCM Q;  1VQM A;  3OYY A;  3X24 B;  3PIO A;  3I56 T;  4ZTJ A;  2LCL A;  1AWW A;  1X6G A;  1JU5 C;  1WXB A;  1I1J A;  2KRM A;  2CP0 A;  1TUC A;  1OEB A;  2OTL T;  2MK5 A;  5GAN 3;  2EQM A;  2V8K A;  1ZA2 B;  1G3Y A;  2RF0 A;  4PNO A;  2IVW A;  1HYO A;  3G6E Q;  2QEX A;  4Y91 A;  1YI2 T;  5KE3 A;  4A63 B;  5LJ3 e;  2DZ9 A;  3EG2 A;  3A98 A;  2CZ1 B;  2CKK A;  1Z9Z A;  4ESR A;  1M27 C;  3G71 A;  1OI1 A;  2RK2 A;  3G4S T;  1RAF B;  2VVK A;  1WJR A;  3MP8 A;  4XQ3 A;  1MMA A;  5IAY A;  3UPU A;  3GBQ A;  4EMH A;  1EIF A;  4M77 D;  1NPP A;  1WI7 A;  5GAN d;  3X26 B;  2QDY B;  5J26 A;  2XDP A;  2CZ7 B;  2E6Z A;  1G8X A;  4AFQ C;  4JPB W;  1YJW T;  4PK4 A;  4LUE A;  3SD4 A;  3VJP A;  3EG9 B;  4EMG A;  3VS1 A;  1TOV A;  3SDZ A;  3EG3 A;  3TQ7 P;  3OW2 P;  3WVE B;  3LWI A;  3CCQ T;  3TRE A;  3VV0 A;  1W6X A;  2X4Y A;  3CCE Q;  3EHR A;  2PUO B;  1PSF A;  2L3R A;  3BDL A;  2JMC A;  2VAS A;  1ZUY A;  4QT7 A;  2GQI A;  3JCM f;  2M1H A;  1KD1 R;  2JM9 A;  2RN8 A;  4BDZ A;  1Q7Y R;  2RHX A;  3DKM A;  3EHQ A;  2JXB A;  4IUV A;  2B86 A;  4A4G A;  3QXE B;  3TCJ A;  4KGX B;  4Y28 E;  5GMK j;  4LD9 K;  1AZE A;  3NMZ C;  4M7A B;  2ATC B;  1N8R C;  4XAX B;  1KSW A;  1VQN Q;  1T3L A;  2LP5 A;  4E47 A;  1RAD B;  1K1Z A;  2E5Q A;  1VQM T;  3AHU A;  3CC7 A;  2K2V A;  2I2L A;  1W4S A;  4BY6 C;  2BZX A;  3UF4 A;  2ECZ A;  4PJO B;  3JB9 F;  1PM3 A;  1VQ7 A;  2LT4 A;  3FLG A;  1GXI E;  3JB9 I;  1TS9 A;  1FMW A;  1Q7Y C;  5CKD A;  4F7U G;  1ZSG A;  4QQD A;  1M90 R;  3RKX A;  4KT0 E;  2YRC A;  1UTI A;  1YI2 A;  2OTL Q;  4LDY A;  3T9N A;  2XDB A;  2CP5 A;  4J83 A;  1LOJ A;  4E7J A;  4HCK A;  1M5Q 1;  1ZUU A;  4HCB A;  2RI5 A;  4M75 E;  5CR2 A;  1QCF A;  4PFO A;  4CI0 C;  1Q95 G;  5A0L A;  1UEC A;  1YJN A;  2KNB B;  1M2V B;  1KC8 U;  3CC2 T;  2L89 A;  3M0U A;  2KGT A;  3QYH B;  4RCC A;  4M4Z A;  3JB9 G;  2RQV A;  3TVT A;  5FU7 B;  1U8R A;  3E1S A;  3ME9 A;  2DAQ A;  5CKF A;  1O75 A;  4M7D D;  2CZ0 B;  3CMA Q;  3INZ A;  5CQX A;  3URG A;  2DL3 A;  3M58 A;  4IUT A;  4OP0 A;  1M90 C;  5HK0 A;  3C95 A;  2GFA A;  1QLY A;  1NLO C;  4C8Q E;  2W0Z A;  3OBW A;  4FT2 A;  2X4J A;  4E7H A;  4ATO A;  1JRI A;  2JS0 A;  3SWN B;  3CPW A;  3VYH B;  1TUD A;  2K2M A;  5KYW B;  4N4H A;  2QQ9 A;  1VQ9 A;  5L8R E;  3RIR A;  1KC8 R;  1O9S A;  1FXX A;  2JVV A;  1I07 A;  3FB9 A;  2RHI A;  2YRD A;  2AK5 A;  5D6W A;  1M8M A;  4XTU A;  5IH2 A;  4PJO C;  1SRL A;  3DLL A;  2B8A A;  2QA4 T;  2DBK A;  2JN0 A;  1BKB A;  1VQM Q;  4HVW A;  2VYT A;  3OBY A;  2EGA A;  3CPW P;  1U3O A;  1BBZ A;  2CSQ A;  2E4H A;  4FL6 A;  1YWP A;  5J39 A;  3L1A A;  5GAM j;  3GLX A;  2D9T A;  3NTH A;  2RI2 A;  2J7I A;  3C0C A;  4XTY A;  2CUB A;  4IUQ A;  3H0I A;  4C8Q D;  2LJ1 A;  3CD6 A;  2OX7 A;  4F17 A;  4F14 A;  1BU1 A;  2O31 A;  3GNG A;  1K73 R;  4C8Q C;  3EGX A;  2NUT A;  3CCR T;  2JS2 A;  5LJ5 h;  3I35 A;  3MEV A;  3CC4 A;  5IN1 A;  3FRN A;  3JCM V;  1AWX A;  4FT4 A;  4WF2 A;  3M56 A;  1UGS B;  5D6X A;  3OSS C;  1G2B A;  1JO8 A;  4ZGD B;  3THK A;  2QXF A;  2FZG B;  3M59 A;  3EG1 A;  1VQK Q;  3H8Z A;  4M78 D;  3UA6 A;  4M7D C;  3CCJ A;  4A4H A;  3CC2 A;  1PG5 B;  4JRI A;  3VS5 A;  1IRX A;  1M90 U;  3RR6 A;  1VQO T;  2LX9 A;  2DYB A;  2V8I A;  1BYM A;  1OQK A;  4OB0 B;  2ROL A;  1RUW A;  4LN2 A;  1KQS S;  3CCS A;  2X3X D;  1K0S A;  4JJN K;  3J81 E;  4JDS A;  4J9D A;  4QKU A;  3CXC S;  1NLP C;  1PWT A;  4IIO A;  3EFR A;  2M16 A;  2O01 E;  3HFN A;  1C0M A;  3S3O A;  1Q81 U;  2I0N A;  1NBE B;  3PVQ A;  4Z8A A;  2AT1 B;  4FIB A;  4E7I A;  2EYQ A;  2HQX A;  1MGQ A;  4J9H A;  4QVC A;  4DBQ A;  1VA7 A;  3L2V A;  3JSC A;  3ZL7 C;  1QCN A;  3L2Q A;  1I8F A;  3TEE A;  1MV3 A;  4JRQ A;  3CQT A;  4HCZ A;  5GAN h;  2EYW A;  1SSF A;  3VS4 A;  5FRN A;  3QDR B;  1S1N A;  1Y96 B;  1X75 C;  4BI4 A;  1BIA A;  4ZN1 A;  5KCO A;  2DK3 A;  4PJL A;  3ER0 A;  2JT4 A;  1R0B G;  1OUL A;  4IUP A;  2H3J A;  4X34 A;  4ELY C;  2EAY A;  1BCO A;  2E6N A;  1YIT A;  5CIU A;  2E10 A;  3FDR A;  1G5V A;  3C12 A;  3MET A;  1XJW B;  1Q86 U;  4XU3 A;  1KK7 A;  2E12 A;  2EIF A;  2BTT A;  2LX7 A;  3OQ5 A;  2KT1 A;  4PFZ A;  2E1H A;  3M0T A;  4C5I A;  1G3T A;  2M9U A;  2QGG A;  4VUB A;  3QHS A;  1IGQ A;  4C5H A;  2K3Y A;  2ZCF B;  3RNJ A;  3G71 Q;  2JW4 A;  4HCC A;  1FMV A;  2QTV A;  2PVG B;  4ZNX A;  1U1S A;  3M5A A;  3OYG A;  3VUZ A;  2FRY A;  2P4T A;  3OYH A;  1VQK T;  3CMA T;  4II1 A;  4LXC A;  3VS2 A;  2DTO A;  2KQW A;  4HT8 A;  3SHW A;  1JJ2 S;  2P84 A;  2E70 A;  2AKL A;  4C0D C;  1N27 A;  2X35 A;  2CZ6 B;  4ELZ C;  1PNJ A;  1VQN T;  1XNI A;  5IXF A;  3QJY A;  2A08 A;  2LVM A;  1RLP C;  1JBM A;  3O5Z A;  1C1A A;  1MND A;  4DBF A;  3UDC A;  2K6D A;  1UGV A;  3A8L B;  1UFF A;  4L5G A;  2QG9 B;  3H41 A;  1B34 A;  2C0I A;  5KYU B;  5FU7 C;  3OYB A;  3CBO A;  1YHQ Q;  1M4Z A;  1N6A A;  3H6Z A;  2ZPF B;  4XU0 A;  1KQ2 A;  3AT1 B;  2K5F A;  2EBP A;  3JCM e;  4JJC A;  4LUD A;  2YUN A;  3GF5 A;  1Q7Y U;  2NUP A;  2QQS A;  3FC3 A;  2HL3 A;  3TSZ A;  5GAO n;  2QQB A;  2BIV A;  3LH5 A;  1V1C A;  1H64 1;  1V76 A;  1TSF A;  3I56 Q;  4FYV B;  2HSP A;  1VQP T;  1QCO A;  4M75 F;  1GFC A;  2RQU A;  3A5Z B;  1IHV A;  3HPW A;  2COW A;  3E9G A;  4M75 G;  1YJ9 A;  1BI3 A;  2O9S A;  2E5K A;  1SF9 A;  1WNL A;  2L3P A;  2EFI A;  4KUL A;  1KQS A;  3M0Q A;  1YWO A;  2HSE B;  2HEQ A;  4RTT A;  2J6O A;  4IKF A;  3OYK A;  4O5V A;  5FWC A;  3NTK A;  3GNF B;  3OSV A;  5LJ3 f;  1JXM A;  3PT9 A;  1IHW A;  5FRO A;  1EFN A;  1PKS A;  1RAE B;  3HKS A;  4PLI A;  1AT1 B;  3HRT A;  3JCM W;  5GMK i;  3CXC P;  1WQ7 A;  5L23 A;  3DB3 A;  3RBB B;  3E2U A;  3KXT A;  4M77 E;  4OMP A;  2K4Y A;  1Q86 R;  1MV0 B;  1HSQ A;  4JZ4 A;  2R57 A;  1RAH B;  2MMP A;  1ABQ A;  1UE9 A;  2XIC A;  4PJO F;  1U06 A;  1M1K U;  2WSF E;  4HVU A;  3QWY A;  1T0J A;  5FU6 B;  1B7T A;  1E7O A;  4M75 B;  5HKC A;  1H3H A;  4OB1 B;  4E7L A;  1WJQ A;  2RH2 A;  4R55 A;  4BE1 A;  1T3S A;  2PQW A;  2XMF A;  2QA4 A;  4PL6 A;  2GBQ A;  1AHJ B;  3CD6 Q;  1VQ7 Q;  4BY6 B;  2RHY A;  2KXC A;  1YIT Q;  3CC4 Q;  3M0P A;  7AT1 B;  2DTI A;  1IO6 A;  4M7D G;  1UJY A;  3H0H A;  1MMG A;  3SEM A;  1S72 T;  1I0C A;  3GIB A;  4UC4 A;  3P8H A;  4RTX A;  4FW2 A;  1IB8 A;  2A37 A;  2VWF A;  3M54 A;  2COZ A;  2ENM A;  3WVD B;  2DMO A;  5CQY A;  1AD5 A;  1TH7 A;  4M77 A;  1VQ4 A;  2HAX A;  3VRZ A;  1HJD A;  2DYI A;  1ACM B;  2C0O A;  4OGC A;  4QQ6 A;  1R8O B;  5IHN A;  1X69 A;  2P0Q A;  2X4W A;  2NUP B;  3G71 T;  4C92 E;  2LQK A;  5GAO r;  3A1P A;  3SB2 A;  3CCV T;  1MMN A;  5KYY B;  1AOJ A;  5IXB A;  4ZGJ B;  2NUT B;  3EGX B;  1JEG A;  1GCP A;  2MOX A;  2AKK A;  2EPD A;  2VB6 A;  1M1F A;  4B6M A;  3OS0 A;  5LJ3 j;  2J6K A;  1G3W A;  4C0F A;  3OYM A;  3S3M A;  1ZSZ B;  3QPH A;  2MIO A;  2ZPB B;  1VYV A;  2D0N A;  1KG1 A;  2M02 A;  1YFN A;  4MMK A;  2F2W A;  1KHC A;  4LDV A;  5KCH A;  2XDD A;  3CCL A;  1H3Z A;  2YUQ A;  5DM7 R;  3MHX A;  4BE0 A;  2DE0 X;  4J9C A;  3PVL A;  2CDT A;  4FM4 B;  5FU6 C;  2ABL A;  2KT8 A;  4LD6 A;  2HKN A;  1K9M U;  2DD4 A;  3FJ5 A;  3Q1J A;  3G4S Q;  3KFV A;  3UWN A;  2V1Q A;  2EQJ A;  3PMT A;  3MEU A;  1YIT T;  4JJB A;  2KAF A;  2QA4 Q;  2ZPI B;  5GJW B;  5CKH A;  1RAB B;  5HK3 A;  2PVD B;  2DF6 A;  2XD0 A;  3QSU A;  2JNG A;  2XK0 A;  3G1J A;  2D8H A;  1VQ7 T;  2XU8 A;  3QZ5 B;  2JJ9 A;  2HD0 A;  3VS6 A;  4C8Q B;  4NS5 A;  2DL7 A;  3N5B B;  5LJ3 d;  1M2V A;  1JJ2 P;  1M1G A;  4JZ3 A;  2EQU A;  4LDW A;  1KIK A;  1VIE A;  1QVF P;  4M7D E;  4OF1 A;  4QW2 A;  1X43 A;  2FHD A;  5GMK e;  2DEU A;  1WFW A;  1WGS A;  2WAC A;  1NZ9 A;  1UGP B;  4A4K A;  4F7U F;  2KRN A;  2YUO A;  5CKE A;  3HRS A;  4WTO B;  1N9S A;  3IQL A;  2YWW A;  3M0S A;  1K8A U;  2BUD A;  3QJ6 A;  1QP2 A;  4E7Z A;  5GMK h;  3CME T;  3BY7 A;  2DIQ A;  3H0F A;  2EKO A;  2HKQ B;  2D0Q B;  3ULR B;  4RTU A;  2OTJ Q;  1ZSZ C;  2FG0 A;  1QVG A;  2HBP A;  1UB4 A;  3HHT B;  1KC8 C;  4B9X A;  4OMN A;  4ANJ A;  3I55 Q;  1D1A A;  2M0O A;  5D7U A;  3R6O A;  5FW9 A;  2K57 A;  2KI7 A;  4Z88 A;  4M78 E;  2NYS A;  1V29 B;  4PJO D;  3QYG B;  3REA B;  2KMT A;  1S72 Q;  1OZ2 A;  2O88 A;  2QEX T;  1N5Z A;  2KR3 A;  2BZY A;  2G3R A;  3VRY A;  3REB B;  1H8K A;  2E65 A;  1GBR A;  1VOM A;  3OYF A;  2ROT A;  2GF7 A;  1R77 A;  2VXE A;  1M3C A;  3EAE A;  3X28 B;  2MCN A;  3JCM c;  4AG2 C;  1GFD A;  1TG0 A;  1YJ9 T;  4BD3 A;  1WHH A;  1I81 A;  2F1L A;  2R58 A;  2KK4 A;  2RK1 A;  5IHK A;  2JOY A;  1QVF A;  1YBY A;  1N8R U;  5LJ5 g;  3QDF A;  1SKU B;  1YI2 Q;  3PFS A;  4BUG A;  3G6E T;  4P5N A;  4OMF B;  2FRW A;  3JCM d;  1KD1 C;  2XKO C;  4DOV A;  5GAN 2;  1RI9 A;  2DRM A;  3SFM A;  4ORZ A;  5GAN j;  2HZY A;  5EG2 A;  3V8L A;  1UG1 A;  2YRV A;  1X6B A;  5CAI A;  3D7S B;  1SHG A;  1WHG A;  2CUD A;  2DXC A;  4KRT A;  3GPL A;  2M0Y A;  2VGM A;  4HT9 A;  3V7R A;  5A0D A;  1VQO A;  2DVJ A;  2JTM A;  2BKD N;  1YNZ A;  4FSX A;  3UT1 A;  1VQ8 A;  2AIR B;  2DA9 A;  3NFC A;  3X20 B;  1X2K A;  5GAM e;  1I5O B;  1Y71 A;  2FPF A;  3HTR A;  4JJD A;  3CBP A;  1MHN A;  2F5K A;  4PJO A;  2SEM A;  2HNI A;  3RDV A;  2LTO A;  3VS7 A;  1KHI A;  3WXM B;  3QKJ A;  2QDL A;  3CBM A;  3JB9 H;  5GAN f;  4A4E A;  4JLG A;  2ZPE B;  5GAN g;  3L2R A;  2YDL A;  2O2O A;  2F2X A;  4ZGE B;  2DPP B;  1M3A A;  1U1T A;  4KUI A;  2OAW A;  2LQN A;  3DB4 A;  4HA8 A;  2LNV A;  3ASK A;  3S6W A;  1NYG A;  4EDU A;  1B07 A;  1BB9 A;  2H3E B;  2R5M A;  2PZ1 A;  4C8Q A;  2K5I A;  1GL5 A;  3CCJ Q;  2F69 A;  1HD3 A;  4JRP A;  2DER A;  1M9S A;  5GAN 4;  4C92 G;  1OPL A;  4X1V A;  1QVG S;  4HKE A;  2QEX Q;  5CO7 A;  3CCV A;  2LZ6 B;  1YJN T;  4MDW A;  4M78 C;  2DXB A;  1K73 C;  4XTV A;  1FMK A;  2BE7 D;  2FVU A;  2A3L A;  3LX7 A;  1MNE A;  2FO0 A;  1VQP Q;  2KY9 A;  4DOW A;  2CH4 W;  4FYY B;  2NUZ A;  1DJ7 B;  2KYB A;  1PD0 A;  3CCU A;  2F5T X;  3G6E A;  5LJ5 e;  1Z9Q A;  4QVZ A;  2X9H A;  1QVG P;  1NE8 A;  4MML A;  3EGD A;  1VQK A;  1Q86 C;  1FWZ A;  3HL8 A;  1Y7X A;  1FYN A;  4MDX A;  1KJW A;  2IPO B;  3CCL T;  2YHT A;  1UHC A;  1ZBX A;  4J7F A;  4M75 D;  1M3B A;  4CC3 A;  2RJF A;  2ZAE A;  3MP6 A;  3OMG A;  4AFS C;  4N4G A;  1D0Y A;  1WDX A;  4OB3 B;  2P0K A;  2QK0 A;  1RL2 A;  5GAM g;  4BDY A;  2RQW A;  2DO3 A;  2KE9 A;  3HP9 A;  3R6N A;  3OS2 A;  4FW1 A;  1LNX A;  3JRZ A;  4KH1 B;  2FEI A;  2AZV A;  1C6V X;  5HCK A;  1RAA B;  1F1B B;  1VQ6 A;  1FX7 A;  2CYZ B;  2JTF A;  1ABO A;  2CT3 A;  1OYX A;  2EJ9 A;  1PKT A;  4BI3 A;  5GAN e;  1NEG A;  2V8J A;  5M9O A;  1WHL A;  1K0X A;  3JV3 A;  4DEY A;  4MZP A;  2HDA A;  2DBM A;  1E6G A;  2D6F A;  3A8H B;  5DY9 A;  1J3T A;  1OV3 A;  3OY9 A;  3NTI A;  2L5Q A;  2ZGW A;  1GBQ A;  2LJ0 A;  1T0H A;  4DQ2 A;  4RTV A;  4KGZ B;  2QAZ A;  1YHQ T;  1MMD A;  3OS1 A;  3OYA A;  1YCY A;  1QVF S;  3LGF A;  3M55 A;  2RJC A;  1X2Q A;  1RAI B;  5I21 A;  3V7S A;  3M0R A;  4FU6 A;  2X3W D;  1WHJ A;  4YTL A;  1NJI U;  4IUU A;  1YJW A;  4M78 F;  4RCB A;  4N0A A;  4PFP A;  3MJX A;  1EZZ B;  1PCX A;  3CCU T;  1ZUK A;  3PNW C;  3EGU A;  3OYC A;  3CCR Q;  2VXF A;  4RUG A;  4PJN A;  3M53 A;  4OML A;  2FZK B;  3CCV Q;  1ARK A;  2DRK A;  1SRM A;  1VYT A;  4Y92 A;  4AT1 B;  2RHU A;  4CC2 A;  3EG0 A;  1VQ5 Q;  2CP2 A;  3C94 A;  1MUZ A;  1OPK A;  1YIJ Q;  2RHZ A;  2GNC A;  1K76 A;  1GCQ A;  2GCX A;  2YXY A;  2L8D A;  1D0Z A;  4M75 A;  1WXU A;  3DLM A;  2RJD A;  2K3B A;  3A8M B;  1ZBJ A;  1D1C A;  2EGC A;  1YIJ A;  3OS5 A;  2K3X A;  1TXQ A;  2MF2 A;  3EH1 A;  3FIF A;  2LMJ A; 
#chains in the Genus database with same CATH homology
 2KXD A;  2ABL A;  1WXT A;  2KT8 A;  1I07 A;  2JMA A;  3FJ5 A;  1AVZ C;  1B3Q A;  2AK5 A;  1M8M A;  5IH2 A;  1QWE A;  1SRL A;  2H8H A;  3KFV A;  2V1Q A;  2DBK A;  2A28 A;  4HVW A;  4JJB A;  1Y57 A;  5GJW B;  2EGA A;  2CSI A;  1WIE A;  2DL8 A;  3UAT A;  2HBW A;  1U3O A;  2DIL A;  1BBZ A;  2CSQ A;  1XOV A;  1YWP A;  2DF6 A;  4DEX A;  4E6R A;  5I22 A;  2PNI A;  2D8H A;  5ECA A;  2EYZ A;  1CSK A;  1W70 A;  1NG2 A;  2DNU A;  1NEB A;  2J7I A;  2KEA A;  3VS6 A;  3C0C A;  2DL7 A;  1VYU A;  2CUB A;  1AWJ A;  2CT4 A;  3H0I A;  2LJ1 A;  4F17 A;  4F14 A;  1BU1 A;  2O31 A;  2DL5 A;  2JS2 A;  3I35 A;  2P4R A;  4JZ3 A;  2KRS A;  4AG1 C;  1KIK A;  1AWX A;  2AZS A;  1K9A A;  1AZG B;  2EYY A;  1G2B A;  1JO8 A;  1U5S A;  4RTZ A;  3THK A;  2M51 A;  1X43 A;  3EG1 A;  1WFW A;  1YN8 A;  2KRN A;  3UA6 A;  4WCI A;  2YUO A;  1SHF A;  3IQL A;  3VS5 A;  3M0S A;  2CH4 A;  2DYB A;  2OI3 A;  2L3Q A;  2ROL A;  1WX6 A;  1RUW A;  4LN2 A;  2X3X D;  2YUP A;  1K0S A;  3H0F A;  4J9D A;  1ZX6 A;  1K4U S;  1NLP C;  1PWT A;  3ULR B;  2L2P A;  4IIO A;  4RTU A;  1WLP B;  2LCS A;  2PTK A;  2FG0 A;  2I0N A;  2SRC A;  3PVQ A;  4Z8A A;  1JXO A;  4OMN A;  4J9H A;  1SEM A;  1QWF A;  1PHT A;  1PRL C;  1VA7 A;  2D1X A;  2HCK A;  4CC7 A;  3ZL7 C;  2J6F A;  2DLP A;  5FW9 A;  2DX1 A;  2EGE A;  4Z88 A;  1Y0M A;  2K7A A;  2JTE A;  3TSW A;  1MV3 A;  3CQT A;  2EYW A;  3VS4 A;  4CC4 B;  4HVV A;  1ZLM A;  3REA B;  1S1N A;  2CRE A;  1RLQ C;  2KYM A;  2O88 A;  2JT4 A;  1UJ0 A;  1N5Z A;  2KR3 A;  2BZ8 A;  2OJ2 A;  2BZY A;  3VRY A;  4D8D A;  3REB B;  1H8K A;  1UHF A;  1GBR A;  4RTY A;  2ROT A;  4Z89 A;  4OMQ A;  1M3C A;  2MCN A;  1QKX A;  4AG2 C;  1GFD A;  2DL4 A;  1TG0 A;  2EW3 A;  2K9G A;  2BTT A;  2LX7 A;  1CKB A;  4AFZ C;  5IHK A;  2KT1 A;  3M0T A;  1E6H A;  4OMO A;  3VS3 A;  1SSH A;  4GLM A;  3RNJ A;  2JW4 A;  2GTJ A;  1PRM C;  2DM1 A;  2ED1 A;  4J9E A;  4ZNX A;  2FRW A;  4FSS A;  2KBT A;  5FWB A;  3PE0 A;  2FPD A;  2D8J A;  1JQQ A;  2FRY A;  1RI9 A;  2DRM A;  2G6F X;  4ORZ A;  4RTW A;  3VS2 A;  1UDL A;  1UG1 A;  4D8K A;  1X6B A;  2W10 A;  1SHG A;  2A36 A;  2CUD A;  3SHW A;  4KRT A;  2AKL A;  3I5S A;  2M0Y A;  1PNJ A;  5IXF A;  2DVJ A;  2YT6 A;  1YNZ A;  2A08 A;  2RMO A;  1RLP C;  2DA9 A;  3O5Z A;  3U23 A;  2KRO A;  1X2K A;  1LCK A;  2FPF A;  2K6D A;  4J9B A;  1UGV A;  4JJD A;  1UFF A;  1X27 A;  3H41 A;  2C0I A;  2VKN A;  2SEM A;  2NWM A;  3VS7 A;  4J9G A;  2QDL A;  1AWW A;  1X6G A;  1QKW A;  1JU5 C;  2YDL A;  2O2O A;  1WXB A;  2F2X A;  2RQT A;  2EBP A;  1I1J A;  4R0K A;  4JJC A;  1M3A A;  4F16 A;  4LUD A;  2F2V A;  2YUN A;  2KRM A;  1KFZ A;  3QWX X;  1TUC A;  1OEB A;  1M30 A;  1WYX A;  2OAW A;  3TSZ A;  1G83 A;  2LQN A;  2RF0 A;  3LH5 A;  1V1C A;  4GBQ A;  4J9I A;  2YSQ A;  1NYG A;  1B07 A;  1BB9 A;  2PZ1 A;  1GL5 A;  4A63 B;  2HSP A;  3EG2 A;  1HD3 A;  3A98 A;  1Z9Z A;  4ESR A;  1GFC A;  2RQU A;  4IIM A;  1M27 C;  1OPL A;  2EKH A;  4X1V A;  2VVK A;  1WA7 A;  3I9Q A;  2O9S A;  2E5K A;  2LZ6 B;  1UUE A;  3GBQ A;  2L3P A;  1WI7 A;  1FMK A;  2RPN A;  3M0Q A;  1YWO A;  2DJQ A;  2HEQ A;  2FO0 A;  4AFU C;  2ED0 A;  4RTT A;  2J6O A;  4AFQ C;  4JPB W;  2CH4 W;  5FWC A;  4LUE A;  2NUZ A;  3VS1 A;  2IIM A;  2KYB A;  1JXM A;  3EG3 A;  1Z9Q A;  1SPK A;  1EFN A;  1PKS A;  5IHI A;  1W6X A;  1GCQ C;  3EHR A;  3NHN A;  2JMC A;  1ZUY A;  5L23 A;  4QT7 A;  2GQI A;  1FYN A;  3RBB B;  2J05 A;  3NPF A;  2JM9 A;  2LQW A;  2RN8 A;  1KJW A;  4OMP A;  1H92 A;  1MV0 B;  3EHQ A;  1HSQ A;  2ESW A;  2FPE A;  2JXB A;  4JZ4 A;  1UHC A;  2B86 A;  1ABQ A;  1UE9 A;  2K79 A;  1AZE A;  1CKA A;  1U06 A;  1M3B A;  4CC3 A;  3NMZ C;  4HVU A;  4HXJ A;  3QWY A;  1T0J A;  2EQI A;  4AFS C;  1E7O A;  1AEY A;  1H3H A;  1WDX A;  4LNP A;  2RQW A;  2KE9 A;  3R6N A;  1KSW A;  1T3S A;  2XMF A;  1T3L A;  5GJV B;  2GBQ A;  1W1F A;  2LP5 A;  2FEI A;  1K1Z A;  2RNA A;  2AZV A;  2KXC A;  5HCK A;  3M0P A;  2EYX A;  1IO6 A;  2GTO A;  2J06 A;  2C0T A;  1GRI A;  1UJY A;  3H0H A;  3SEM A;  2BZX A;  3UF4 A;  1ABO A;  2ECZ A;  1I0C A;  2CT3 A;  1PKT A;  4RTX A;  1NEG A;  2A37 A;  2LNH B;  2VWF A;  4OMM A;  1K0X A;  3JV3 A;  4DEY A;  1AWO A;  1ZSG A;  1OOT A;  2ENM A;  3UA7 A;  2DMO A;  2HDA A;  1AD5 A;  2DBM A;  1E6G A;  1HJD A;  3VRZ A;  1UTI A;  2C0O A;  1J3T A;  5IHN A;  1OV3 A;  1X69 A;  1GBQ A;  4HCK A;  1ZUU A;  2LJ0 A;  1T0H A;  1QCF A;  4RTV A;  1YCS B;  2L0A A;  1UEC A;  1AOJ A;  5IXB A;  2KNB B;  4K11 A;  3M0U A;  1X2Q A;  2KGT A;  1JEG A;  3M0R A;  4EIK A;  1GCP A;  2X3W D;  4M4Z A;  2RQV A;  3I5R A;  3TVT A;  2MOX A;  2AKK A;  1NM7 A;  2EPD A;  2JM8 A;  1ZUK A;  2DL3 A;  3EGU A;  4RUG A;  2J6K A;  2V1R A;  5I11 A;  4OML A;  2EVR A;  1ARK A;  2DRK A;  1SRM A;  1VYT A;  2GGR A;  1YP5 A;  2MIO A;  1VYV A;  2D0N A;  4Y92 A;  5EC7 A;  3NGP A;  2LJ3 A;  4CC2 A;  3EG0 A;  1QLY A;  2O9V A;  1BK2 A;  1MUZ A;  1OPK A;  1NLO C;  2GNC A;  1K76 A;  1GCQ A;  2W0Z A;  4LE9 A;  1WXU A;  2F2W A;  2JS0 A;  1TUD A;  2K3B A;  1ZBJ A;  2K2M A;  2L3S A;  4J9F A;  2YUQ A;  1NYF A;  2EGC A;  2RQR A;  1A0N B;  2DE0 X;  4J9C A;  3PVL A;  2CDT A;  3VS0 A;  2LMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...