4A4GA

Solution structure of smn tudor domain in complex with asymmetrically dimethylated arginine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURVIVAL MOTOR NEURON PROTEIN
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4gA00
1N27A 3OS2A 2EQUA 2LCCA 2O4XA 3UT1A 1OI1A 3S3OA 3BDLA 3OQ5A 3S6WA 4C5GA 3OYEA 1WJQA 3OMGA 4X34A 4BE2A 1H3ZA 4E7HA 3OYKA 2GF7A 2VYTA 2EQJA 3L2VA 2X4XA 4IUVA 4LD6A 5D6WA 2RJDA 2DAQA 4CRIA 3OYBA 3OYFA 3OYNA 4E7JA 3LX7A 2FHDA 2LDMA 5C0MA 3QJ6A 3UWNA 4E7LA 2QQSA 4BD3A 3PMTA 4IKFA 2EFIA 2XDPA 2M0OA 3NTHA 2BIVA 2RHXA 2PQWA 1SSFA 3H6ZA 3MEAA 2QQRA 3H8ZA 5KE2A 4HCZA 4ZTJA 3E9FA 3DB4A 1WJSA 4RG2A 4C5IA 2RI5A 5IN1A 3OYJA 5FRMA 3OYHA 3L2RA 4B9WA 4QVZA 4IUUA 4BE0A 2LTOA 4IURA 4IUTA 2WACA 2MWPA 3L2UA 5KCOA 3LGLA 1G5VA 3OMCA 3OYCA 3CEYA 2RJCA 3LGFA 2L89A 2XK0A 2B8AA 4GY5A 3C4SA 4N4HA 5D6XA 4BACA 5C6SA 3OB9A 1OZ2A 4ZTFA 2DIQA 3L2QA 2M1HA 2X4WA 2RHUA 1OYXA 2RI3A 2EQKA 2LRQA 2L3RA 2R57A 4QQ6A 3OYAA 2RJEA 3PNWC 2L8DA 3QBYA 3PFSA 4PL6A 3E9GA 3ME9A 5J26A 3M9QA 4E7IA 3FDRA 5KH6A 5D6YA 2F5KA 3F70A 5FROA 3PMIA 4PLIA 3OS1A 4FU6A 4A4HA 2M16A 1OZ3A 2K3XA 3FEOA 2IG0A 4UC4A 5IAYA 3OYMA 3OYGA 4A4FA 3FC3A 2LVMA 3GOXA 4N4GA 5FRNA 2YRVA 4NS5A 2X35A 2CKKA 2GFUA 3O8VA 3L42A 3ASKA 3S3MA 2BUDA 2RI2A 3QKJA 3OYIA 3DB3A 3LH0A 2X4YA 5CIUA 2R58A 5KE3A 5M9OA 3MO8A 2RJFA 2P0KA 2RHZA 3MP6A 1RI0A 4B9XA 2HQEA 2JTFA 2MWOA 5J39A 3OS0A 4A4GA 3S3NA 3OA6A 3MEWA 2O4XB 2HQXA 4QQDA 2EKOA 5KCHA 3ZEHA 4BDZA 2K3YA 2JZ2A 4OVAA 2GFAA 2E5QA 2RHYA 4IUQA 3LLRA 4EDUA 3DLMA 3EAEA 4QQGA 2BKDN 4A4EA 4Q5WA 3QIIA 3OYDA 4E7KA 4N4IA 1KHCA 2E6NA 2NLUA 3META 1WJRA 1MHNA 3MP8A 3NTIA 4IUPA 3LYIA 2R5MA 2R5AA 2RHIA 3MEUA 4BDYA 4PLLA 3Q1JA 4Z02A 2G3RA 3MEVA 1WGSA 4QW2A 3FLGA 2EQMA 4L59A 3SD4A 4FL6A 3OY9A 2D9TA 3KUFA 3OYLA 4BE1A 2DIGA 3NTKA 1XNIA 3P8DA 4C5HA 3MP1A 4II1A 3L2WA 3P8HA 4C5EA 2RO0A
chains in the Genus database with same CATH superfamily
2CZ1B 2CH4W 2DVEA 2JTMA 4M7AF 4C5GA 1RADB 2ROTA 2EQJA 2DTOA 2YRCA 4R55A 5LJ5e 1YJWQ 3CCVT 1I07A 1FXXA 2ROLA 4C0GA 1IRXA 3NTHA 2K2MA 1ZUYA 5KE2A 5I2MA 3M4YA 1ZBXA 4OMNA 1IZ6A 4KULA 2A3LA 2AK5A 3GNFB 1IREB 2MK5A 3M53A 2WACA 2WSEE 4LDWA 2AT1B 4M78A 1ACMB 1LPLA 3CCLA 3I56A 4ZNXA 3A8OB 2P4TA 3PFSA 1MV3A 3QWYA 2OAWA 1T0JA 2O2OA 5KH6A 2F5KA 2XIDA 2QXFA 5CKHA 1TXQA 3RIRA 1IHVA 1LNXA 2COWA 3O8VA 2KXDA 1I4K1 3JCMV 1LOJA 1PNJA 3ER0A 1VQ6A 4N0AC 1G2BA 4ELZC 4M78F 4RG8A 4XQ3A 2LNVA 5A2QE 2DF6A 1VQPQ 5FWCA 3OW2S 3LW5E 2RA2A 4J7IA 3META 2HBPA 2R5AA 1PD1A 5IXBA 3CC2Q 4Z02A 2MAMA 2LQKA 1AVZC 3JCMf 3QDRB 4J6WA 4C0DC 4ZGDB 4C92C 5GANg 5GJVB 2PVDB 1YJ9Q 2YUNA 1M4ZA 2EAYA 3SWNC 4JJNK 1H641 2OTLQ 4O6JA 2ZAEA 2FHDA 1BI2A 4OMFB 2QTVA 5GAOn 1Z9QA 3UF4A 2O88A 3SEMA 2ENMA 2L3PA 3V7CA 2X3XD 4ZTJA 1ARKA 2DJZA 2XHCA 4PJOC 4XU0A 2HZYA 1YIJA 4EIKA 1HD3A 1PSEA 4OMMA 4F04B 1K9MU 1VQ7A 1G3YA 2JN0A 2RPNA 5D6XA 1QVGP 1CSKA 4HVUA 4DBFA 2CP2A 1K8AC 3QZ9B 2LMJA 2C0OA 2DXUA 4PLIA 2DL4A 1OZ3A 1KFZA 1WFWA 1TTHB 2P0PA 2KEAA 1PWTA 5LJ3j 2KY9A 4HCKA 3X26B 1B7TA 1OULA 1WQWA 2GBQA 1U1TA 4DOVA 5CIUA 1VUBA 1MUZA 2LT4A 2A0FB 1BI3A 1OX9A 1GCQC 2YDLA 5J3BA 2HQEA 3I56T 2C06A 1T3LA 4LXCA 4JZ4A 4XU2A 2JZ2A 3CCJQ 1RAIB 3CCUA 3DLMA 4A4EA 3QIIA 2CT3A 3M55A 4EPCA 4ATOA 2KR3A 1Q86U 3C95A 3G4SA 4C8QG 2KROA 2M0YA 3VS2A 4C5HA 4J7FA 1K9AA 3P8HA 4LDVA 3OS2A 5IHNA 1V29B 1VQ6T 5HCKA 5KYUB 3CCRQ 4F7UA 3OS5A 4ZN1A 1RAFB 1RAHB 2DFUA 2RJDA 3CCMA 1WPYA 4M75E 3EG9B 5C0MA 1AWJA 1K9MR 3QJ6A 4BI3A 3FRNA 2PQWA 4OMPA 4M77B 2QQRA 1LVKA 3EH1A 4Z89A 4XAXB 1QLYA 1UEBA 3DB4A 5GAN4 1WYXA 3ZBDA 3OYHA 2HSPA 4PJJA 3VYHB 1YCYA 3C12A 4EMKB 3OBYA 8ATCB 4J9FA 2OTJA 1TWBA 5C6SA 2COZA 2VUBA 4F7UF 4PJLA 2RI3A 1OOTA 4J9CA 5LJ3e 3L2ZA 5KYYA 3SDZA 4OF1A 3A98A 4XTZA 1Q81U 1WXBA 5CKFA 4F17A 4C8QB 5GAOq 4BY6B 2YRVA 1YIJT 5LJ3g 4RTUA 1ZUUA 2XG8D 1JJ2P 2PUKB 1VQ7T 1TS9A 1M3BA 2G6FX 2E6ZA 2HMAA 2NUPB 3M54A 3BW1A 3VS5A 2DXBA 3UA7A 3HL8A 3CD6A 4BDZA 2EBPA 2RD1A 2E5QA 2RHYA 3MKDA 2CYZB 4M77D 4MZTA 3JB9G 1CKBA 2DTHA 1VA7A 3NPFA 3EGDA 1H92A 1KQSP 2EQMA 2D9TA 4J8OA 4M7DA 3P8DA 4JJCA 1B34A 1LCKA 1AWXA 5FWBA 3CCSQ 1PHTA 3OQ5A 4C92G 1OU9A 3OYEA 3OMGA 3CCUT 1SHGA 2XMFA 1K0XA 1K73C 5A0DA 1KQ1A 4E7LA 4CC4B 1MGQA 4IKFA 1YJNQ 2DRMA 3G4ST 4ORZA 1Q7YU 3RKYA 3FJPA 5FU6B 3I55A 1GCPA 1HXDA 3VJPA 3HKSA 3N5BB 4XTWA 8AT1B 2P4RA 1AT1B 1N9RA 1JRIA 2DRKA 2QK0A 2X3WD 4M7DF 4PJOG 2FO0A 4Y28E 1QVPA 4XU3A 1Q81R 4JLIA 1R77A 1GL5A 2CP7A 1WHKA 3L2QA 3CCMT 2LRQA 2L3RA 2K5FA 3TQ7P 3RUXA 2CSQA 1K73U 1TOVA 2X4JA 3M9QA 1QVFA 1BI1A 1AWOA 1X01A 2K7AA 1VQ5Q 2QG9B 3FEOA 2IG0A 2XD0A 2DYIA 3DLLA 4LN2A 4A4FA 2ZCFB 2E65A 2K9GA 3TSZA 3ASKA 5GMKi 4XTUA 3CBOA 2X4YA 2OTJT 5M9OA 2KE9A 2V8KA 4JDSA 4C92B 3VRZA 3FIFA 2MWOA 4DA4A 1X69A 2DL3A 1PKTA 4WF2A 1YP5A 4M7AD 4DEXA 5KCHA 2SEMA 1KJWA 2PU9B 4QQGA 1RI9A 5CKEA 1M3CA 5KYWA 3VUBA 2EWNA 2LX7A 2G3RA 2ESWA 2FL7A 4QW2A 2J6KA 4BE1A 2B86A 3CCEA 1KK7A 2LCLA 2ZPGB 1WNLA 1Q82U 2VV5A 1VQLQ 1YBYA 1WX6A 3CD6T 1YFNA 1D0XA 1JJ2S 4E7HA 2K2VA 2GF7A 2YT6A 3HSBA 1QWEA 2KQWA 2X4XA 3OYFA 2K5LA 2V8JA 3GF5A 2CGHA 2MMPA 4XU1A 1UHFA 4QKUA 3VV0A 2QA4Q 2RQUA 3E9FA 1X6OA 1WJSA 1YHQQ 1AD5A 2VASA 1K73R 3CBMA 1JXMA 2HKNA 2LTOA 4JRKA 3CMAA 1M1GA 2KGTA 4KH0B 1KQSS 1K4US 1M8MA 2L89A 5GANd 4FYWB 2OAUA 3KXTA 2RMOA 4HVVA 2L8DA 4M78D 2K6DA 3I55T 4RCBA 3QYGB 1YI2Q 2FZKB 2M16A 3RR6A 1VQMA 2EJ9A 4L5GA 1JQQA 1YITQ 1X2QA 2DYBA 3G6EQ 4A54A 2EVRA 2DJQA 3OW2P 4HCCA 1RLQC 2J6FA 4J9BA 2DA9A 4A53A 3VKIA 3CC4A 4E6RA 2J05A 3S3NA 2ZZDA 5KYXB 2HL5C 2BTTA 1PRLC 2KSSA 4M77C 2L2PA 2K3YA 4PFOA 3BY7A 4D8KA 4IUQA 4EMGA 2E6NA 1XTDA 4FSSA 2FPFA 5GAMf 4EMKC 3MEUA 3TCJA 1FWZA 3Q1JA 2JM8A 1M90U 4GLMA 1VQ8Q 2OX7A 3OYLA 4XK8E 3CXCP 4J6YA 3C94A 3QHSA 2V1RA 3P8BB 2E64A 1IO6A 2E3IA 1WJQA 3RKXA 2DM1A 4LD6A 1WZOA 3LX7A 4BY6C 5HKCA 2QGGA 4IIOA 2FB7A 4PKCC 1VQOQ 3H6ZA 4A63B 5CR2A 5GANj 3CCET 2LZ6B 1BYMA 3CMEQ 1ZHIA 1AWWA 1FMWA 4PJMA 1Q95G 1WIEA 4FT4A 3QWXX 2A37A 4AFQC 2KRSA 2CP6A 3REBB 3WVDB 2M1HA 5GANh 1QP3A 5GAN8 3OYAA 1PM3A 1ZBJA 1Y96A 4RKUE 5CO7A 4HT8A 1ZA1B 3ME9A 5J26A 3EFOA 5IXFA 1FMVA 1NLPC 3CPFA 3GOXA 3L42A 1M2VB 3CPWA 1VQKA 5HK0A 2FPDA 3CMAT 2HEQA 1MMGA 4AFUC 4M7AC 2D1XA 4QVDA 1SPKA 1XQHA 5HY6A 1M90R 2EW3A 1NBEB 5FU6C 2DEQA 1KHIA 1NYGA 1ZX6A 3V8JA 2D8HA 1VQMT 3CBPA 4OMLA 1RAGB 3RMQA 1UECA 4MDWA 1SF9A 4BDYA 1PSFA 1NJIU 4RTXA 1I8FA 5KYYB 2EKHA 2JUFA 4C8QE 2EYYA 3RESA 3PTAA 2KK4A 3CCVQ 3CC4T 2JVVA 3LWHA 5LJ3d 1VQ4A 4OB1B 2KYMA 4M75A 3CPWP 4X34A 2E70A 2FZCB 4KBMB 4KGXB 1BK2A 5GANe 5I21A 4E7SA 3OYNA 4DQ2A 4FSXA 2CUBA 3X24B 1VQ9A 3MEAA 5FU7B 2M9UA 1K9MC 3VS3A 1MMNA 4HA8A 2RK1A 3LWIA 2VB6A 2MOXA 3CEYA 5GAOp 1PRMC 3H41A 4OGEA 3CXCS 4RTTA 4M78C 1OZ2A 4M75F 4M7DB 4P5NA 3CCQA 1QWFA 2ED1A 3WXMB 2AZVA 1B34B 1W2BA 4OGCA 3E9GA 3IQLA 1K1ZA 1D1CA 5LJ5f 3F70A 2XICA 1YN8A 2JTEA 4GLKA 2IPOB 3G71A 1BI0A 5GAN6 1AHJB 3CC7A 1H8KA 2F1LA 2MPXC 3HTRA 1QW1A 3RBBB 2VXFA 2R58A 1U06A 2RJFA 2YLCA 1TUGB 2XI9A 3JSCA 1NJIR 3X25B 4A4GA 2DZCA 2O4XB 3M0QA 4J5YA 3I35A 2DL5A 1QMCA 1UGVA 1YWPA 1Q86C 5KYNA 4M77G 1NZ9A 3VS4A 1MHNA 2DE0X 2JJ9A 4L6V5 3AHUA 3PVQA 1VQKT 1M2OA 3MEVA 3PIPA 2D0NA 4L59A 1VIEA 3KUFA 2JS0A 3OSSC 3CCLT 1GBRA 4J9IA 5DM7R 2EQUA 2QGFB 4RMOA 3EGXA 4M7DD 5LJ3h 2A28A 2GNCA 4LUDA 4C92E 4MMLA 3X28B 1XOVA 4OP0A 5CAIA 4HXJA 1Y71A 4E2FB 3HFNA 3UA6A 1X6BA 2ZPHB 3UWNA 2IIMA 1AEYA 4NOYA 2FVUA 2E5KA 4BI4A 5IN1A 2J6OA 3V7SA 3QDFA 1NEBA 2AIRB 1VQ4T 4DOWA 2DEUA 2MWPA 4PK4A 4PJOE 3LGLA 1RLPC 2RJCA 1OX8A 4OMOA 3LGFA 2XK0A 2DERA 3HRSA 3JCMW 1WDXA 3SFMA 3HRTA 4IIMA 1Q81C 4KH1B 3HP9A 1TUCA 3CPWS 1VQ9T 5D6YA 1ABOA 1MNDA 2DILA 3U23A 3CCLQ 1S72A 3I56Q 2X35A 4RTZA 1O9SA 1UGQB 2BUDA 2EQIA 3DB3A 3GNGA 2HL3A 3KBGA 2Y90A 3E1SA 3MP6A 2X9HA 5AYFA 3MJXA 2CZ7B 1NM7A 3CCQT 2HQXA 4M7AG 3JB9J 3JCMP 1WXTA 4ME7A 1X75C 2V1QA 2K3BA 1Y57A 3OYDA 4E7KA 4CC2A 3ZL7C 3G71T 4IUPA 1VQ6Q 3LYIA 3A5ZB 3T9NA 1R0CB 3CC7T 1X27A 2BZYA 3REAB 3SD4A 1TU0B 2YRDA 1Q86R 5CK9A 1QCOA 1A0NB 1C1AA 4RTYA 2F5TX 1SEMA 1Y07A 4D6WA 1M1FA 1M5Q1 2BZ8A 1I81A 3TU4K 1UGRB 3AT1B 5GMKj 1Q7YC 2QEXA 4V2SA 2AKLA 1VYVA 2F69A 5FW9A 1M1KC 1UUEA 2QQSA 1M27C 4BD3A 2EFIA 2M0OA 3EG2A 5GMKl 2HAXA 3L1AA 5A0LA 4C0ZA 3H0IA 2DD5A 1MMDA 4MMKA 4LDXA 2OJ2A 5GAMj 1W2BS 2DPPB 1FMKA 2QYZA 4K11A 4O5VA 4M7AB 3RERA 5GMKm 1EZZB 4NL3A 1YIJQ 3M0SA 3PNWC 2CT4A 4M78G 4F16A 1T0HA 1VQ7Q 2HD0A 1M1KU 3THKA 2YXYA 5FROA 2E41A 2EYZA 1ZSZA 3V8KA 1ZLMA 1JB0E 2FG0A 1QQJA 1G3WA 1SHFA 3EH2A 3LH0A 2KT1A 5KE3A 1FYNA 3EG3A 1VQNA 3WVEB 1NG2A 2CP3A 2RHZA 5CQXA 2VXEA 4FIBA 1RI0A 1YWOA 5J39A 2A36A 4QT7A 1UHCA 2MF2A 1C6VX 3MEWA 3TEEA 5FU7C 3TVTA 1X6GA 2YWWA 3SB2A 3JAME 3JCMd 2QAZA 3HRUA 3OBWA 3GPLA 1S72T 3MP8A 2XKOC 1BIAA 4R56A 1UB4A 2PVOB 1K76A 1Y96B 1Q82C 2LQ8A 3CCUQ 4QVCA 3OY9A 4OB3B 5GMKe 4M7DC 3OYYA 1WA7A 1YJWA 4II1A 2RO0A 2QQAA 2OI3A 3G4SQ 1IGQA 3D7SB 2A08A 1AOJA 4M78B 1ZUKA 3ULRB 2XDPA 5GAMe 3JCMQ 2MIOA 1SSFA 1QVFP 2JNGA 2RQWA 2JOYA 2KI7A 1I5LA 1Q7YR 3CCMQ 3L2RA 3M56A 2YUPA 5DY9A 4ZGEB 1KD1U 2JMCA 1M1KR 5KYUA 2ATCB 3M0RA 1WQ7A 4IUTA 5GAMg 3G7ZA 1MV0B 1NLOC 3JCMX 2QEXT 4J9HA 1PCXA 2KVQG 5I2SA 2D6FA 2LQWA 3EG9A 1Y7XA 2FRWA 1R8OB 1QCFA 5I22A 2YUQA 2OTJQ 4WTOB 4M75B 3FDRA 3OS1A 4N4GA 2K79A 2ED0A 2KRMA 1M30A 2GCXA 3OSVA 1SSHA 1HJDA 2DL8A 1DJ7B 1VQPA 1YCSB 3PVLA 3E19A 4A4KA 2EJFA 2O01E 3J81E 4B9XA 2JTFA 1M8VA 2K57A 4LDYA 3CC2A 2RNAA 3ZFJA 1AZGB 4KRTA 3M5AA 3A8HB 4YTLA 1M90C 2CREA 4AT1B 1B3QA 4C8QA 2NUTA 3NHNA 3A8LB 1D3BA 3CD6Q 1YJ9A 2D0QB 2ABLA 2JMAA 3PGGA 3HPWA 4BUGA 4JS4A 1S1NA 1VQNT 3NTKA 2OTLA 1OQKA 1I5OB 4C5EA 1Y0MA 1SRMA 3S3OA 1ZA2B 2DXCA 2JXBA 4X9CA 3X20B 2DBKA 1Q82R 2EGCA 2KXCA 4IUVA 1KD1R 4CRIA 4M75D 4F7UG 1T3SA 3MCAB 2DVJA 2XDBA 3PMTA 3VS0A 1N8RU 2GTOA 2BE9B 4C8QF 4DBRA 2W10A 2DX1A 2RK2A 1G3SA 4Y92A 1YJWT 2KMTA 1BCMA 3KFVA 2O9VA 3I55Q 3OMCA 3OYCA 1TUDA 2YHTA 3C4SA 4N4HA 2XDDA 2EQKA 2JT4A 2QQBA 3R6OA 4HCBA 1TG0A 4E7IA 5IHIA 4A4HA 4LNPA 3JCMe 4UC4A 3OYMA 2O9SA 2RF0A 3VS7A 2GFUA 3V7RA 3EFRA 2YSQA 4E47A 3CCJA 4RTVA 2CH4A 1QVFS 4DBQA 3MO8A 4AFZC 1SG5A 3PT9A 3JCMg 2LJ0A 3RKWA 4N0AA 3UPUA 3OS0A 3VRYA 2EKOA 3ZEHA 4F7UB 1NJIC 1WXUA 4FYXB 2BZXA 2FRYA 4MZMA 3EAEA 3JB9H 1IHWA 2A7YA 2HQHA 4M77E 1WJRA 1G8XA 2RH2A 4PLLA 3CCRA 1KQ2A 3PIOA 4FL6A 1VQPT 3NMZC 4ELYC 4C92A 5LJ5g 1PKSA 1N8RR 1EX4A 1NEGA 1U3OA 1X2KA 1UJYA 2LCCA 4M7DG 4MDXA 4BB7A 1WHJA 2KT8A 3CC2T 3SWNA 3M4GA 2L5QA 2VYTA 1WI7A 3L2VA 3CCEQ 2GTJA 2E12A 3JB9F 5DLQE 2VC8A 1WHGA 5L8RE 5D7UA 2HKQB 1YJ9T 3HFOA 1VIFA 4J9EA 3H8ZA 1I0CA 1EIFA 4PJOA 2LNHB 2OTLT 4JJBA 3SHWA 3VS6A 3NFCA 1PC0A 4HVWA 5CVIA 4IUUA 4BE0A 4C92F 3L2UA 5KCOA 1RAAB 2B8AA 2CDTA 1NPPA 2AHJB 2SRCA 1D0ZA 2DMOA 2X4WA 2RHUA 1OYXA 5GAN7 5GAOl 4PL6A 2LX9A 2Y4XA 4CI0C 3CMAQ 2YUOA 1MNEA 5FLXE 2NYSA 4JRQA 2C0TA 4PFZA 4FCYA 2DTIA 1N5ZA 5IAYA 2HCKA 3G1JA 4LUEA 3EG0A 2EJGA 3GBQA 2GQVA 2E3HA 4X9DA 4PJOF 2EYWA 2WSCE 4GBQA 3EGDB 4DBHA 4F14A 2GGRA 5GAOm 1GCQA 1VQMQ 5A0GA 2AZSA 3BDUA 1QVGA 2L3SA 1X43A 4Y91A 2PUOB 4FW2A 2H3EB 3BE3A 4M7AE 1Z9ZA 4VUBA 4ZN3A 3NGPA 3CC4Q 2F2VA 3I9QA 3NTIA 3QZ5B 1U5SA 2R5MA 1UGPB 3CCSA 3V8LA 2ZPIB 2HSEB 3FLGA 3CCJT 2DZ9A 3M0PA 1D09B 4R0KA 2FYKA 3LH5A 2ECZA 2JW4A 3L2WA 1ZSZB 1N27A 5CCAA 5KYXA 4HKEA 1UGSB 3S6WA 4JLGA 1YJNA 4M75C 1H3ZA 1G83A 3OYKA 1ABQA 2PVGB 2RM4A 2CZ6B 2K4YA 4E7JA 1W2BP 1WHMA 1OEBA 7AT1B 3GP8A 3CCRT 2H8HA 2CP5A 3VYGA 1K0SA 3EHRA 5I11A 2HDAA 3M58A 1NYFA 3JCMb 2DL7A 1IGUA 4J9DA 3JCMc 1UJ0A 2BE7D 5GAN3 1KG1A 1VQ5A 2JS2A 3M0TA 2DKGA 1F1BB 5DLOA 4Z8AA 2Z0WA 3R6NA 3QBYA 4HT9A 2ZGWA 4JZ3A 1BU1A 2YLBA 4M78E 2EYQA 3EFSA 2L3QA 3EG1A 1JO8A 3M59A 4FM4B 5GANf 3FC3A 1NPRA 2E4HA 3EHQA 4JS5A 1K8AU 5CKDA 2P84A 5KYWB 3H9NA 1KIKA 1RAEB 1JBMA 3QXEB 3QKJA 1QKXA 1C0MA 1PG5B 5IHKA 2P0KA 3QG1A 2KRNA 5IT9E 4PNOA 1OV3A 1MMAA 1U1SA 5GAMd 4ESRA 2DD4A 1VQKQ 2FZGB 2VKNA 2DXTA 4OVAA 4KGVB 4NL2A 2QTXA 2ZPBB 3A8GB 4PFPA 2LCSA 2HNIA 4XTXA 4FT2A 1M2VA 4DEYA 5LL6S 1BKBA 2EPDA 1VQLA 3UATA 1WGSA 3TREA 1JJ2A 5HK3A 3GLXA 2PZ1A 1JXOA 2LQNA 3HHTB 4ZTFA 5CKBA 4XTYA 1I1JA 3BFMA 2RQRA 2J06A 5IH2A 2QA4A 1GFDA 5D6WA 4XTVA 1YHQA 2Y4YA 2LDMA 1KSWA 3EGUA 1VQ4Q 3J7AF 3CCST 1E6GA 1U8RA 4M4ZA 1JEGA 2RHXA 1KQSA 1J3TA 3VU3C 1EFNA 2MYSA 4HCZA 5FRMA 4RTWA 1P92A 2NUTB 1O75A 2CSIA 2I2LA 1YJNT 4KUIA 1G5VA 1D3BB 1VQ9Q 2X51A 1K8AR 1YI2A 2CZ0B 1QKWA 1R0BG 2C0IA 4BACA 3QO3A 2CP0A 2KAFA 1YITA 5AT1B 2PNIA 1UG1A 2RJEA 4ANJA 3GIBA 2VWFA 4OMQA 2QDYB 3G6EA 5GMKh 3PMIA 4EMHA 2VGMA 3OYGA 3CCQQ 2DLPA 1QVGS 1UE9A 2RI2A 4Z88A 2MCNA 4J9GA 5GAOr 1M9SA 1VQ5T 1VYTA 3G71Q 1VYUA 3CC7Q 3OA6A 1QCNA 5GAMh 4JRIA 4KGZB 1VOMA 1VQ8A 2GFAA 4EDUA 3LLRA 3QYHB 2CS7A 2O31A 4Q5WA 4J83A 4AFSC 2EGEA 1FX7A 1IB8A 2RHIA 1SKUB 5GAN2 2RQVA 2FEIA 4C8QD 1AZEA 4FYYB 4RCCA 1IXDA 1GFCA 1BCOA 2QASA 3QUIA 3VS1A 1XNIA 1UFFA 1H3HA 3MP1A 2KDSA 1G3TA 2MI6A 2O4XA 3UT1A 3BDLA 2F2WA 4MZPA 1VQOA 4TVRA 4LD9K 2HBWA 2V26A 3RNJA 4M75G 2DAQA 1E7OA 1YNZA 3FB9A 5LJ3f 3I5RA 3CMEA 4F7UE 2ZPEB 2JM9A 4AMCA 1VQLT 2DNUA 4KUDK 2BIVA 1KD1C 3PE0A 2DETA 3EFOB 4X1VA 5EC7A 1LJOA 3JB9I 1HK9A 3MPUB 4B9WA 1BB9A 1B07A 1HYOA 4IURA 1RL2A 2CUDA 3I5SA 4JUVA 1CKAA 2VGNA 4GY5A 5LJ5d 2QA4T 3TSWA 4ZGJB 2L0AA 1WLPB 4C0DB 1YHQT 2ZPFB 4RUGA 1RUWA 4QQ6A 5ECAA 2LT1A 2E1HA 1W4SA 9ATCB 3SWNB 4FU6A 3H0HA 1ZSZC 4WCIA 2LVMA 5FRNA 3URGA 4NS5A 1V76A 5EG2A 2LC4A 1KC8C 1RACB 1YI2T 3DKMA 1OU8A 4JPBW 3JRZA 1S72Q 4PJOB 3QPHA 2W0ZA 3M0UA 1YITT 2RQTA 4QQDA 2COYA 3O5ZA 2LJ3A 4M77A 3G6ET 1D1AA 1GRIA 5L23A 2DBMA 5CQYA 4C0FA 3QSUA 3QJYA 3CCVA 1KHCA 3VUZA 3JB9D 2K5IA 3J80E 4EMKA 1UDLA 3MHXA 6AT1B 3OW2A 1E6HA 1RABB 4LDUA 1BIBA 2DIGA 2KBTA 3E2UA 2QI2A 1KC8U 1OPKA 1OI1A 3JCMJ 2EGAA 4M7DE 4AG2C 4C92D 1BBZA 4JRPA 1XJWB 4BE2A 1D1BA 2V8IA 1N8RC 1VQ8T 2EIFA 2LP5A 3OYBA 3JCMh 4M77F 4LE9A 2P0QA 1WHLA 4FYVB 1W1FA 2DK3A 2LJ1A 2XU8A 1QP2A 2NWMA 2QQ9A 3H0FA 1GXIE 2QEXQ 5LJ5j 4CC7A 2NUPA 3CXCA 1TH7A 4RG2A 4C5IA 2RI5A 3OYJA 3RDVA 5GJWB 2D8JA 1WHHA 1D0YA 4J6XA 3M57A 4JJDA 4QVZA 4PJOD 2M51A 1VQOT 4PJNA 2F2XA 2J7IA 4OB2B 2WSFE 2E10A 3OB9A 2DIQA 2VVKA 5LJ5h 1M3AA 3CMET 2R57A 1PD0A 1SRLA 2IVWA 2RN8A 3RMSA 4KT0E 1W70A 1GBQA 2EYXA 2AKKA 2KNBB 4B6MA 2M02A 2H3JA 2K3XA 1JU5C 2RB6A 2PTKA 1NE8A 3UDCA 2DO3A 1V1CA 4D8DA 2CKKA 3S3MA 1OPLA 3OYIA 3A1PA 1ZQ1A 4FW1A 4M7AA 3FJ5A 1W6XA 4CC3A 4E7ZA 4AG1C 2GQIA 2NUZA 3EGXB 3CQTA 1UTIA 3C0CA 2FPEA 1KC8R 1ZSGA 1VQNQ 1HSQA 3A8MB 2BKDN 2QDLA 4N4IA 2NLUA 1TSFA 1N6AA 3INZA 4C8QC 3JV3A 5GAN5 4BI8B 2I0NA 4OB0B 1N9SA 2KYBA
chains in the Genus database with same CATH topology
1N27A 2CZ1B 2ZPGB 1WNLA 2DVEA 2F5TX 1Q82U 5CCAA 2VV5A 4HKEA 1UGSB 2JTMA 1YBYA 1Y07A 3S6WA 4C5GA 4JLGA 4D6WA 1YJNA 3CD6T 4M7AF 1M1FA 4M75C 1M5Q1 1JJ2S 1I81A 4E7HA 3TU4K 3OYKA 1UGRB 2K2VA 2GF7A 5GMKj 1Q7YC 2EQJA 2DTOA 2PVGB 4R55A 2QEXA 3HSBA 2KQWA 2RM4A 5LJ5e 4V2SA 2X4XA 3OYFA 2CZ6B 2K4YA 2F69A 2K5LA 3CCVT 2V8JA 3GF5A 4E7JA 1M1KC 1FXXA 2CGHA 4C0GA 2QQSA 4BD3A 2MMPA 4XU1A 2EFIA 3GP8A 2M0OA 3CCRT 3NTHA 3VYGA 5KE2A 3VV0A 5I2MA 5GMKl 3M4YA 3E9FA 2HAXA 1X6OA 1ZBXA 1WJSA 3L1AA 5A0LA 1IZ6A 4C0ZA 2DD5A 4KULA 2A3LA 4MMKA 3M58A 4LDXA 3CBMA 1IREB 3GNFB 3M53A 2LTOA 3JCMb 5GAMj 1W2BS 2DPPB 2WACA 2WSEE 4JRKA 3CMAA 1M1GA 4LDWA 1KQSS 3JCMc 2L89A 4O5VA 5GANd 5GAN3 4M78A 1KG1A 1VQ5A 4M7AB 2DKGA 2OAUA 3CCLA 3RERA 3KXTA 5GMKm 3I56A 4NL3A 5DLOA 3A8OB 2P4TA 3PNWC 2L8DA 3QBYA 3PFSA 2ZGWA 4M78D 4M78G 4HT9A 2YLBA 4M78E 2EYQA 3I55T 2HD0A 3EFSA 4RCBA 1M1KU 3QYGB 5KH6A 3M59A 2F5KA 4FM4B 5FROA 5GANf 2XIDA 2QXFA 5CKHA 2E41A 3FC3A 1NPRA 2M16A 1VQMA 2EJ9A 4JS5A 4L5GA 3V8KA 5CKDA 1K8AU 3RIRA 1JB0E 1LNXA 3O8VA 1JBMA 4A54A 3QXEB 3QKJA 1I4K1 1G3WA 4HCCA 3JCMV 3LH0A 5KE3A 2P0KA 3QG1A 1VQNA 3WVEB 2RHZA 5CQXA 4A53A 3VKIA 1LOJA 5IT9E 4PNOA 2VXEA 4FIBA 3CC4A 1RI0A 5J39A 3ER0A 1VQ6A 4N0AC 3S3NA 1U1SA 2MF2A 2ZZDA 3MEWA 5GAMd 4ELZC 2DD4A 4M78F 4RG8A 2KSSA 4XQ3A 4M77C 2LNVA 5FU7C 3TEEA 2K3YA 5A2QE 2DXTA 4OVAA 3BY7A 3OW2S 3LW5E 2RA2A 4J7IA 4IUQA 4NL2A 3SB2A 3JAME 3JCMd 3HRUA 4EMGA 3OBWA 3GPLA 2QTXA 2E6NA 2ZPBB 1XTDA 2XKOC 3A8GB 2HNIA 3META 2HBPA 3MP8A 5GAMf 1BIAA 4XTXA 2R5AA 4EMKC 3MEUA 3TCJA 4FT2A 4R56A 1FWZA 1UB4A 2PVOB 3Q1JA 1BKBA 4Z02A 5LL6S 1Y96B 1VQLA 2MAMA 1Q82C 2LQKA 1WGSA 2LQ8A 3TREA 1M90U 1JJ2A 4QVCA 5HK3A 3OY9A 4OB3B 3GLXA 5GMKe 3OYLA 3JCMf 4XK8E 3QDRB 4J6WA 4J6YA 4M7DC 3C94A 3OYYA 3QHSA 4C0DC 1YJWA 4ZGDB 3P8BB 2E64A 4C92C 4II1A 5GANg 3HHTB 2RO0A 5CKBA 4ZTFA 2QQAA 2PVDB 4XTYA 1WJQA 3RKXA 3BFMA 1M4ZA 2EAYA 3SWNC 4JJNK 2QA4A 1H641 4LD6A 4M78B 4O6JA 5D6WA 4XTVA 1YHQA 3LX7A 4BY6C 2Y4YA 5HKCA 2FHDA 1BI2A 2LDMA 4OMFB 3J7AF 5GAOn 3CCST 2FB7A 1U8RA 2XDPA 4PKCC 5GAMe 3JCMQ 2RHXA 3V7CA 1KQSA 1SSFA 3H6ZA 3VU3C 2JNGA 5CR2A 2JOYA 4HCZA 5GANj 4ZTJA 1I5LA 2DJZA 2XHCA 3CCET 4PJOC 4XU0A 5FRMA 3L2RA 1BYMA 3M56A 1ZHIA 1P92A 5DY9A 4ZGEB 1YIJA 1KD1U 1O75A 4FT4A 2I2LA 1PSEA 1WQ7A 4IUTA 5GAMg 1YJNT 3G7ZA 4KUIA 1G5VA 1D3BB 1K9MU 1VQ7A 3JCMX 1G3YA 2JN0A 2CZ0B 2QEXT 1YI2A 2KVQG 5D6XA 4BACA 3QO3A 3WVDB 5I2SA 2KAFA 2D6FA 2M1HA 5GANh 1QP3A 5GAN8 3OYAA 1Y7XA 1YITA 4RKUE 1Y96A 2RJEA 1K8AC 1R8OB 5CO7A 3GIBA 4HT8A 3G6EA 3ME9A 2QDYB 3QZ9B 5J26A 1S72T 4M75B 3FDRA 5GMKh 3PMIA 2DXUA 4PLIA 3OS1A 4EMHA 1OZ3A 2VGMA 3OYGA 3CPFA 3GOXA 4N4GA 2P0PA 5LJ3j 2KY9A 3X26B 1QVGS 3L42A 2GCXA 3OSVA 3CPWA 1VQKA 1WQWA 2RI2A 5HK0A 1U1TA 3CMAT 1DJ7B 4DOVA 5CIUA 5GAOr 1VQPA 1M9SA 1VUBA 2LT4A 3E19A 4A4KA 2EJFA 1BI3A 1VQ5T 4M7AC 2O01E 4QVDA 5J3BA 3J81E 4B9XA 2HQEA 2JTFA 3I56T 5HY6A 1XQHA 2C06A 1M8VA 1H3ZA 3OA6A 2K57A 4LDYA 4XU2A 3CC2A 5FU6C 2DEQA 3ZFJA 1KHIA 5GAMh 3M5AA 4JRIA 2JZ2A 3A8HB 3CCUA 1VQ8A 2GFAA 4YTLA 3V8JA 3LLRA 4EDUA 3DLMA 1M90C 3QYHB 2CS7A 4A4EA 4Q5WA 3CBPA 3QIIA 4J83A 1VQMT 3RMQA 4C8QA 3A8LB 4MDWA 3M55A 4EPCA 1FX7A 4ATOA 2RHIA 4BDYA 1PSFA 1D3BA 1Q86U 1NJIU 3C95A 5GAN2 1YJ9A 3G4SA 2D0QB 4C8QG 4C8QD 1I8FA 2JUFA 4RCCA 3PGGA 3HPWA 4C8QE 4BUGA 4JS4A 1VQNT 3QUIA 3RESA 3NTKA 1XNIA 2OTLA 3PTAA 4C5HA 2KK4A 4J7FA 3MP1A 2KDSA 3CC4T 2JVVA 3P8HA 5LJ3d 1G3TA 4LDVA 4C5EA 1V29B 2MI6A 3OS2A 3LWHA 2O4XA 3UT1A 3S3OA 1VQ6T 1VQ4A 3BDLA 2DXCA 4OB1B 4M75A 4MZPA 1VQOA 4F7UA 4TVRA 4X34A 4X9CA 2E70A 3OS5A 3X20B 4ZN1A 4LD9K 4KBMB 4IUVA 4CRIA 5GANe 2RJDA 2DAQA 4M75G 4M75D 4F7UG 5I21A 3FB9A 3OYNA 1WPYA 5LJ3f 3CCMA 4M75E 3CMEA 4F7UE 5C0MA 3MCAB 2ZPEB 4DQ2A 2XDBA 3QJ6A 4BI3A 4FSXA 3PMTA 1N8RU 1VQLT 4KUDK 2BIVA 3FRNA 3X24B 2PQWA 4C8QF 1KD1C 1VQ9A 4M77B 3MEAA 5FU7B 2QQRA 4XAXB 2RK2A 1G3SA 1LJOA 2M9UA 1K9MC 1UEBA 3DB4A 5GAN4 1YJWT 3JB9I 3ZBDA 3OYHA 4HA8A 2KMTA 1HK9A 2RK1A 3VYHB 4B9WA 1YCYA 3C12A 3LWIA 4EMKB 4IURA 1RL2A 3OBYA 3OMCA 3OYCA 3CEYA 2OTJA 5GAOp 4JUVA 5LJ5d 2VGNA 4GY5A 2YHTA 2QA4T 3C4SA 4N4HA 4OGEA 4ZGJB 5C6SA 4M78C 1OZ2A 4M75F 3CXCS 4M7DB 2VUBA 4C0DB 4F7UF 1YHQT 2ZPFB 4P5NA 2XDDA 2RI3A 3CCQA 2EQKA 3WXMB 4QQ6A 1B34B 1W2BA 2LT1A 2QQBA 3R6OA 3L2ZA 4OGCA 5LJ3e 2E1HA 3E9GA 4HCBA 3SDZA 1W4SA 4E7IA 4OF1A 5LJ5f 3F70A 2XICA 3SWNB 4FU6A 4A4HA 4XTZA 3JCMe 4UC4A 5CKFA 1Q81U 3OYMA 4GLKA 3G71A 4C8QB 5GAOq 2LVMA 1BI0A 5GAN6 4BY6B 2YRVA 3URGA 1AHJB 4NS5A 3CC7A 1YIJT 5FRNA 2GFUA 5LJ3g 1QW1A 3V7RA 3EFRA 5EG2A 2LC4A 2XG8D 1KC8C 4E47A 2PUKB 1VQ7T 3CCJA 2VXFA 2R58A 1QVFS 1YI2T 3MO8A 2RJFA 2YLCA 3DKMA 3PT9A 2E6ZA 3JCMg 2XI9A 3JRZA 3JSCA 4PJOB 3RKWA 3QPHA 3M54A 4N0AA 3UPUA 3X25B 3OS0A 4A4GA 1YITT 3BW1A 2DZCA 2O4XB 2DXBA 4QQDA 2EKOA 4J5YA 3HL8A 4M77A 3G6ET 3CD6A 3ZEHA 4F7UB 4BDZA 5CQYA 1Q86C 1NJIC 2RD1A 4C0FA 2E5QA 2RHYA 3QSUA 4MZMA 3EAEA 3JB9H 4M77G 2CYZB 1NZ9A 4M77D 2A7YA 4MZTA 3QJYA 3CCVA 1KHCA 3VUZA 4M77E 3JB9D 1WJRA 1MHNA 2K5IA 3J80E 3JB9G 4EMKA 3MHXA 2RH2A 2DTHA 4PLLA 4L6V5 3AHUA 1VQKT 3CCRA 3MEVA 3PIPA 3OW2A 1KQ2A 2EQMA 4L59A 3PIOA 1VIEA 4FL6A 1VQPT 2D9TA 1BIBA 3KUFA 4J8OA 4LDUA 4M7DA 2DIGA 3OSSC 4ELYC 3CCLT 3P8DA 4C92A 5LJ5g 1B34A 2QI2A 5DM7R 1KC8U 2EQUA 4RMOA 2LCCA 4M7DG 1OI1A 4M7DD 4MDXA 4BB7A 3JCMJ 5LJ3h 4M7DE 3OQ5A 4C92G 4C92D 3CC2T 3OYEA 3OMGA 4C92E 4JRPA 4BE2A 4MMLA 3SWNA 2V8IA 3CCUT 3M4GA 2EIFA 2L5QA 2VYTA 3X28B 1N8RC 1VQ8T 1XOVA 4OP0A 5CAIA 3L2VA 3OYBA 3JCMh 4M77F 2E12A 1K73C 5A0DA 1Y71A 3HFNA 5DLQE 3JB9F 2VC8A 2P0QA 5L8RE 2ZPHB 1KQ1A 3UWNA 4E7LA 4NOYA 2DK3A 1MGQA 2FVUA 4IKFA 2XU8A 1YJ9T 1QP2A 1Q7YU 3G4ST 3RKYA 3FJPA 3HFOA 1VIFA 5FU6B 3I55A 2QQ9A 1HXDA 3H8ZA 1GXIE 5LJ5j 3VJPA 3HKSA 3N5BB 4BI4A 1EIFA 4XTWA 4PJOA 3CXCA 2OTLT 1TH7A 4RG2A 4C5IA 2RI5A 5IN1A 3OYJA 3V7SA 1N9RA 3NFCA 1JRIA 4J6XA 3M57A 4M7DF 4QVZA 5CVIA 1VQ4T 4PJOG 4DOWA 4IUUA 4BE0A 4PJOD 4C92F 2MWPA 3L2UA 1VQOT 4PJOE 5KCOA 3LGLA 4Y28E 1QVPA 4XU3A 2RJCA 3LGFA 4JLIA 2XK0A 2B8AA 1NPPA 3HRSA 4OB2B 2AHJB 2WSFE 2E10A 3OB9A 3JCMW 2DIQA 5LJ5h 3L2QA 3CCMT 2X4WA 2RHUA 3SFMA 1OYXA 3CMET 2LRQA 2L3RA 2R57A 3HRTA 1Q81C 2K5FA 5GAN7 2IVWA 5GAOl 4PL6A 2LX9A 3HP9A 3RMSA 3RUXA 2Y4XA 4CI0C 1K73U 3CPWS 2X4JA 3M9QA 4KT0E 5FLXE 1VQ9T 5D6YA 1BI1A 1QVFA 1X01A 4JRQA 2H3JA 2K3XA 3FEOA 2IG0A 2DTIA 2RB6A 5IAYA 2XD0A 1S72A 1NE8A 3DLLA 4A4FA 3UDCA 2ZCFB 2DO3A 2E65A 2EJGA 2X35A 2CKKA 2GQVA 4X9DA 1O9SA 1UGQB 2WSCE 4PJOF 3ASKA 3S3MA 2BUDA 5GMKi 4XTUA 3OYIA 3CBOA 3DB3A 2X4YA 3GNGA 2OTJT 5M9OA 1ZQ1A 5GAOm 3KBGA 2Y90A 2V8KA 3E1SA 3MP6A 4JDSA 4M7AA 5AYFA 4C92B 5A0GA 2CZ7B 3FIFA 2MWOA 3BDUA 3CCQT 4DA4A 1QVGA 2HQXA 4M7AG 4Y91A 2PUOB 4WF2A 3JB9J 4M7AD 5KCHA 3JCMP 4M7AE 4VUBA 2PU9B 4ME7A 1X75C 4ZN3A 3A8MB 4QQGA 2BKDN 3OYDA 5CKEA 4E7KA 4N4IA 3G71T 4IUPA 2NLUA 1N6AA 3INZA 3NTIA 4C8QC 3LYIA 3QZ5B 2R5MA 3A5ZB 3T9NA 5GAN5 3VUBA 1UGPB 2EWNA 3CC7T 3CCSA 3V8LA 4BI8B 2G3RA 2ZPIB 2FL7A 4QW2A 3FLGA 3CCJT 3SD4A 2DZ9A 4BE1A 2FYKA 5CK9A 3CCEA 4OB0B 1N9SA 3L2WA 2LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N27 A;  3OS2 A;  2EQU A;  2LCC A;  2O4X A;  3UT1 A;  1OI1 A;  3S3O A;  3BDL A;  3OQ5 A;  3S6W A;  4C5G A;  3OYE A;  1WJQ A;  3OMG A;  4X34 A;  4BE2 A;  1H3Z A;  4E7H A;  3OYK A;  2GF7 A;  2VYT A;  2EQJ A;  3L2V A;  2X4X A;  4IUV A;  4LD6 A;  5D6W A;  2RJD A;  2DAQ A;  4CRI A;  3OYB A;  3OYF A;  3OYN A;  4E7J A;  3LX7 A;  2FHD A;  2LDM A;  5C0M A;  3QJ6 A;  3UWN A;  4E7L A;  2QQS A;  4BD3 A;  3PMT A;  4IKF A;  2EFI A;  2XDP A;  2M0O A;  3NTH A;  2BIV A;  2RHX A;  2PQW A;  1SSF A;  3H6Z A;  3MEA A;  2QQR A;  3H8Z A;  5KE2 A;  4HCZ A;  4ZTJ A;  3E9F A;  3DB4 A;  1WJS A;  4RG2 A;  4C5I A;  2RI5 A;  5IN1 A;  3OYJ A;  5FRM A;  3OYH A;  3L2R A;  4B9W A;  4QVZ A;  4IUU A;  4BE0 A;  2LTO A;  4IUR A;  4IUT A;  2WAC A;  2MWP A;  3L2U A;  5KCO A;  3LGL A;  1G5V A;  3OMC A;  3OYC A;  3CEY A;  2RJC A;  3LGF A;  2L89 A;  2XK0 A;  2B8A A;  4GY5 A;  3C4S A;  4N4H A;  5D6X A;  4BAC A;  5C6S A;  3OB9 A;  1OZ2 A;  4ZTF A;  2DIQ A;  3L2Q A;  2M1H A;  2X4W A;  2RHU A;  1OYX A;  2RI3 A;  2EQK A;  2LRQ A;  2L3R A;  2R57 A;  4QQ6 A;  3OYA A;  2RJE A;  3PNW C;  2L8D A;  3QBY A;  3PFS A;  4PL6 A;  3E9G A;  3ME9 A;  5J26 A;  3M9Q A;  4E7I A;  3FDR A;  5KH6 A;  5D6Y A;  2F5K A;  3F70 A;  5FRO A;  3PMI A;  4PLI A;  3OS1 A;  4FU6 A;  4A4H A;  2M16 A;  1OZ3 A;  2K3X A;  3FEO A;  2IG0 A;  4UC4 A;  5IAY A;  3OYM A;  3OYG A;  4A4F A;  3FC3 A;  2LVM A;  3GOX A;  4N4G A;  5FRN A;  2YRV A;  4NS5 A;  2X35 A;  2CKK A;  2GFU A;  3O8V A;  3L42 A;  3ASK A;  3S3M A;  2BUD A;  2RI2 A;  3QKJ A;  3OYI A;  3DB3 A;  3LH0 A;  2X4Y A;  5CIU A;  2R58 A;  5KE3 A;  5M9O A;  3MO8 A;  2RJF A;  2P0K A;  2RHZ A;  3MP6 A;  1RI0 A;  4B9X A;  2HQE A;  2JTF A;  2MWO A;  5J39 A;  3OS0 A;  4A4G A;  3S3N A;  3OA6 A;  3MEW A;  2O4X B;  2HQX A;  4QQD A;  2EKO A;  5KCH A;  3ZEH A;  4BDZ A;  2K3Y A;  2JZ2 A;  4OVA A;  2GFA A;  2E5Q A;  2RHY A;  4IUQ A;  3LLR A;  4EDU A;  3DLM A;  3EAE A;  4QQG A;  2BKD N;  4A4E A;  4Q5W A;  3QII A;  3OYD A;  4E7K A;  4N4I A;  1KHC A;  2E6N A;  2NLU A;  3MET A;  1WJR A;  1MHN A;  3MP8 A;  3NTI A;  4IUP A;  3LYI A;  2R5M A;  2R5A A;  2RHI A;  3MEU A;  4BDY A;  4PLL A;  3Q1J A;  4Z02 A;  2G3R A;  3MEV A;  1WGS A;  4QW2 A;  3FLG A;  2EQM A;  4L59 A;  3SD4 A;  4FL6 A;  3OY9 A;  2D9T A;  3KUF A;  3OYL A;  4BE1 A;  2DIG A;  3NTK A;  1XNI A;  3P8D A;  4C5H A;  3MP1 A;  4II1 A;  3L2W A;  3P8H A;  4C5E A;  2RO0 A; 
#chains in the Genus database with same CATH topology
 2CZ1 B;  2CH4 W;  2DVE A;  2JTM A;  4M7A F;  4C5G A;  1RAD B;  2ROT A;  2EQJ A;  2DTO A;  2YRC A;  4R55 A;  5LJ5 e;  1YJW Q;  3CCV T;  1I07 A;  1FXX A;  2ROL A;  4C0G A;  1IRX A;  3NTH A;  2K2M A;  1ZUY A;  5KE2 A;  5I2M A;  3M4Y A;  1ZBX A;  4OMN A;  1IZ6 A;  4KUL A;  2A3L A;  2AK5 A;  3GNF B;  1IRE B;  2MK5 A;  3M53 A;  2WAC A;  2WSE E;  4LDW A;  2AT1 B;  4M78 A;  1ACM B;  1LPL A;  3CCL A;  3I56 A;  4ZNX A;  3A8O B;  2P4T A;  3PFS A;  1MV3 A;  3QWY A;  2OAW A;  1T0J A;  2O2O A;  5KH6 A;  2F5K A;  2XID A;  2QXF A;  5CKH A;  1TXQ A;  3RIR A;  1IHV A;  1LNX A;  2COW A;  3O8V A;  2KXD A;  1I4K 1;  3JCM V;  1LOJ A;  1PNJ A;  3ER0 A;  1VQ6 A;  4N0A C;  1G2B A;  4ELZ C;  4M78 F;  4RG8 A;  4XQ3 A;  2LNV A;  5A2Q E;  2DF6 A;  1VQP Q;  5FWC A;  3OW2 S;  3LW5 E;  2RA2 A;  4J7I A;  3MET A;  2HBP A;  2R5A A;  1PD1 A;  5IXB A;  3CC2 Q;  4Z02 A;  2MAM A;  2LQK A;  1AVZ C;  3JCM f;  3QDR B;  4J6W A;  4C0D C;  4ZGD B;  4C92 C;  5GAN g;  5GJV B;  2PVD B;  1YJ9 Q;  2YUN A;  1M4Z A;  2EAY A;  3SWN C;  4JJN K;  1H64 1;  2OTL Q;  4O6J A;  2ZAE A;  2FHD A;  1BI2 A;  4OMF B;  2QTV A;  5GAO n;  1Z9Q A;  3UF4 A;  2O88 A;  3SEM A;  2ENM A;  2L3P A;  3V7C A;  2X3X D;  4ZTJ A;  1ARK A;  2DJZ A;  2XHC A;  4PJO C;  4XU0 A;  2HZY A;  1YIJ A;  4EIK A;  1HD3 A;  1PSE A;  4OMM A;  4F04 B;  1K9M U;  1VQ7 A;  1G3Y A;  2JN0 A;  2RPN A;  5D6X A;  1QVG P;  1CSK A;  4HVU A;  4DBF A;  2CP2 A;  1K8A C;  3QZ9 B;  2LMJ A;  2C0O A;  2DXU A;  4PLI A;  2DL4 A;  1OZ3 A;  1KFZ A;  1WFW A;  1TTH B;  2P0P A;  2KEA A;  1PWT A;  5LJ3 j;  2KY9 A;  4HCK A;  3X26 B;  1B7T A;  1OUL A;  1WQW A;  2GBQ A;  1U1T A;  4DOV A;  5CIU A;  1VUB A;  1MUZ A;  2LT4 A;  2A0F B;  1BI3 A;  1OX9 A;  1GCQ C;  2YDL A;  5J3B A;  2HQE A;  3I56 T;  2C06 A;  1T3L A;  4LXC A;  4JZ4 A;  4XU2 A;  2JZ2 A;  3CCJ Q;  1RAI B;  3CCU A;  3DLM A;  4A4E A;  3QII A;  2CT3 A;  3M55 A;  4EPC A;  4ATO A;  2KR3 A;  1Q86 U;  3C95 A;  3G4S A;  4C8Q G;  2KRO A;  2M0Y A;  3VS2 A;  4C5H A;  4J7F A;  1K9A A;  3P8H A;  4LDV A;  3OS2 A;  5IHN A;  1V29 B;  1VQ6 T;  5HCK A;  5KYU B;  3CCR Q;  4F7U A;  3OS5 A;  4ZN1 A;  1RAF B;  1RAH B;  2DFU A;  2RJD A;  3CCM A;  1WPY A;  4M75 E;  3EG9 B;  5C0M A;  1AWJ A;  1K9M R;  3QJ6 A;  4BI3 A;  3FRN A;  2PQW A;  4OMP A;  4M77 B;  2QQR A;  1LVK A;  3EH1 A;  4Z89 A;  4XAX B;  1QLY A;  1UEB A;  3DB4 A;  5GAN 4;  1WYX A;  3ZBD A;  3OYH A;  2HSP A;  4PJJ A;  3VYH B;  1YCY A;  3C12 A;  4EMK B;  3OBY A;  8ATC B;  4J9F A;  2OTJ A;  1TWB A;  5C6S A;  2COZ A;  2VUB A;  4F7U F;  4PJL A;  2RI3 A;  1OOT A;  4J9C A;  5LJ3 e;  3L2Z A;  5KYY A;  3SDZ A;  4OF1 A;  3A98 A;  4XTZ A;  1Q81 U;  1WXB A;  5CKF A;  4F17 A;  4C8Q B;  5GAO q;  4BY6 B;  2YRV A;  1YIJ T;  5LJ3 g;  4RTU A;  1ZUU A;  2XG8 D;  1JJ2 P;  2PUK B;  1VQ7 T;  1TS9 A;  1M3B A;  2G6F X;  2E6Z A;  2HMA A;  2NUP B;  3M54 A;  3BW1 A;  3VS5 A;  2DXB A;  3UA7 A;  3HL8 A;  3CD6 A;  4BDZ A;  2EBP A;  2RD1 A;  2E5Q A;  2RHY A;  3MKD A;  2CYZ B;  4M77 D;  4MZT A;  3JB9 G;  1CKB A;  2DTH A;  1VA7 A;  3NPF A;  3EGD A;  1H92 A;  1KQS P;  2EQM A;  2D9T A;  4J8O A;  4M7D A;  3P8D A;  4JJC A;  1B34 A;  1LCK A;  1AWX A;  5FWB A;  3CCS Q;  1PHT A;  3OQ5 A;  4C92 G;  1OU9 A;  3OYE A;  3OMG A;  3CCU T;  1SHG A;  2XMF A;  1K0X A;  1K73 C;  5A0D A;  1KQ1 A;  4E7L A;  4CC4 B;  1MGQ A;  4IKF A;  1YJN Q;  2DRM A;  3G4S T;  4ORZ A;  1Q7Y U;  3RKY A;  3FJP A;  5FU6 B;  3I55 A;  1GCP A;  1HXD A;  3VJP A;  3HKS A;  3N5B B;  4XTW A;  8AT1 B;  2P4R A;  1AT1 B;  1N9R A;  1JRI A;  2DRK A;  2QK0 A;  2X3W D;  4M7D F;  4PJO G;  2FO0 A;  4Y28 E;  1QVP A;  4XU3 A;  1Q81 R;  4JLI A;  1R77 A;  1GL5 A;  2CP7 A;  1WHK A;  3L2Q A;  3CCM T;  2LRQ A;  2L3R A;  2K5F A;  3TQ7 P;  3RUX A;  2CSQ A;  1K73 U;  1TOV A;  2X4J A;  3M9Q A;  1QVF A;  1BI1 A;  1AWO A;  1X01 A;  2K7A A;  1VQ5 Q;  2QG9 B;  3FEO A;  2IG0 A;  2XD0 A;  2DYI A;  3DLL A;  4LN2 A;  4A4F A;  2ZCF B;  2E65 A;  2K9G A;  3TSZ A;  3ASK A;  5GMK i;  4XTU A;  3CBO A;  2X4Y A;  2OTJ T;  5M9O A;  2KE9 A;  2V8K A;  4JDS A;  4C92 B;  3VRZ A;  3FIF A;  2MWO A;  4DA4 A;  1X69 A;  2DL3 A;  1PKT A;  4WF2 A;  1YP5 A;  4M7A D;  4DEX A;  5KCH A;  2SEM A;  1KJW A;  2PU9 B;  4QQG A;  1RI9 A;  5CKE A;  1M3C A;  5KYW A;  3VUB A;  2EWN A;  2LX7 A;  2G3R A;  2ESW A;  2FL7 A;  4QW2 A;  2J6K A;  4BE1 A;  2B86 A;  3CCE A;  1KK7 A;  2LCL A;  2ZPG B;  1WNL A;  1Q82 U;  2VV5 A;  1VQL Q;  1YBY A;  1WX6 A;  3CD6 T;  1YFN A;  1D0X A;  1JJ2 S;  4E7H A;  2K2V A;  2GF7 A;  2YT6 A;  3HSB A;  1QWE A;  2KQW A;  2X4X A;  3OYF A;  2K5L A;  2V8J A;  3GF5 A;  2CGH A;  2MMP A;  4XU1 A;  1UHF A;  4QKU A;  3VV0 A;  2QA4 Q;  2RQU A;  3E9F A;  1X6O A;  1WJS A;  1YHQ Q;  1AD5 A;  2VAS A;  1K73 R;  3CBM A;  1JXM A;  2HKN A;  2LTO A;  4JRK A;  3CMA A;  1M1G A;  2KGT A;  4KH0 B;  1KQS S;  1K4U S;  1M8M A;  2L89 A;  5GAN d;  4FYW B;  2OAU A;  3KXT A;  2RMO A;  4HVV A;  2L8D A;  4M78 D;  2K6D A;  3I55 T;  4RCB A;  3QYG B;  1YI2 Q;  2FZK B;  2M16 A;  3RR6 A;  1VQM A;  2EJ9 A;  4L5G A;  1JQQ A;  1YIT Q;  1X2Q A;  2DYB A;  3G6E Q;  4A54 A;  2EVR A;  2DJQ A;  3OW2 P;  4HCC A;  1RLQ C;  2J6F A;  4J9B A;  2DA9 A;  4A53 A;  3VKI A;  3CC4 A;  4E6R A;  2J05 A;  3S3N A;  2ZZD A;  5KYX B;  2HL5 C;  2BTT A;  1PRL C;  2KSS A;  4M77 C;  2L2P A;  2K3Y A;  4PFO A;  3BY7 A;  4D8K A;  4IUQ A;  4EMG A;  2E6N A;  1XTD A;  4FSS A;  2FPF A;  5GAM f;  4EMK C;  3MEU A;  3TCJ A;  1FWZ A;  3Q1J A;  2JM8 A;  1M90 U;  4GLM A;  1VQ8 Q;  2OX7 A;  3OYL A;  4XK8 E;  3CXC P;  4J6Y A;  3C94 A;  3QHS A;  2V1R A;  3P8B B;  2E64 A;  1IO6 A;  2E3I A;  1WJQ A;  3RKX A;  2DM1 A;  4LD6 A;  1WZO A;  3LX7 A;  4BY6 C;  5HKC A;  2QGG A;  4IIO A;  2FB7 A;  4PKC C;  1VQO Q;  3H6Z A;  4A63 B;  5CR2 A;  5GAN j;  3CCE T;  2LZ6 B;  1BYM A;  3CME Q;  1ZHI A;  1AWW A;  1FMW A;  4PJM A;  1Q95 G;  1WIE A;  4FT4 A;  3QWX X;  2A37 A;  4AFQ C;  2KRS A;  2CP6 A;  3REB B;  3WVD B;  2M1H A;  5GAN h;  1QP3 A;  5GAN 8;  3OYA A;  1PM3 A;  1ZBJ A;  1Y96 A;  4RKU E;  5CO7 A;  4HT8 A;  1ZA1 B;  3ME9 A;  5J26 A;  3EFO A;  5IXF A;  1FMV A;  1NLP C;  3CPF A;  3GOX A;  3L42 A;  1M2V B;  3CPW A;  1VQK A;  5HK0 A;  2FPD A;  3CMA T;  2HEQ A;  1MMG A;  4AFU C;  4M7A C;  2D1X A;  4QVD A;  1SPK A;  1XQH A;  5HY6 A;  1M90 R;  2EW3 A;  1NBE B;  5FU6 C;  2DEQ A;  1KHI A;  1NYG A;  1ZX6 A;  3V8J A;  2D8H A;  1VQM T;  3CBP A;  4OML A;  1RAG B;  3RMQ A;  1UEC A;  4MDW A;  1SF9 A;  4BDY A;  1PSF A;  1NJI U;  4RTX A;  1I8F A;  5KYY B;  2EKH A;  2JUF A;  4C8Q E;  2EYY A;  3RES A;  3PTA A;  2KK4 A;  3CCV Q;  3CC4 T;  2JVV A;  3LWH A;  5LJ3 d;  1VQ4 A;  4OB1 B;  2KYM A;  4M75 A;  3CPW P;  4X34 A;  2E70 A;  2FZC B;  4KBM B;  4KGX B;  1BK2 A;  5GAN e;  5I21 A;  4E7S A;  3OYN A;  4DQ2 A;  4FSX A;  2CUB A;  3X24 B;  1VQ9 A;  3MEA A;  5FU7 B;  2M9U A;  1K9M C;  3VS3 A;  1MMN A;  4HA8 A;  2RK1 A;  3LWI A;  2VB6 A;  2MOX A;  3CEY A;  5GAO p;  1PRM C;  3H41 A;  4OGE A;  3CXC S;  4RTT A;  4M78 C;  1OZ2 A;  4M75 F;  4M7D B;  4P5N A;  3CCQ A;  1QWF A;  2ED1 A;  3WXM B;  2AZV A;  1B34 B;  1W2B A;  4OGC A;  3E9G A;  3IQL A;  1K1Z A;  1D1C A;  5LJ5 f;  3F70 A;  2XIC A;  1YN8 A;  2JTE A;  4GLK A;  2IPO B;  3G71 A;  1BI0 A;  5GAN 6;  1AHJ B;  3CC7 A;  1H8K A;  2F1L A;  2MPX C;  3HTR A;  1QW1 A;  3RBB B;  2VXF A;  2R58 A;  1U06 A;  2RJF A;  2YLC A;  1TUG B;  2XI9 A;  3JSC A;  1NJI R;  3X25 B;  4A4G A;  2DZC A;  2O4X B;  3M0Q A;  4J5Y A;  3I35 A;  2DL5 A;  1QMC A;  1UGV A;  1YWP A;  1Q86 C;  5KYN A;  4M77 G;  1NZ9 A;  3VS4 A;  1MHN A;  2DE0 X;  2JJ9 A;  4L6V 5;  3AHU A;  3PVQ A;  1VQK T;  1M2O A;  3MEV A;  3PIP A;  2D0N A;  4L59 A;  1VIE A;  3KUF A;  2JS0 A;  3OSS C;  3CCL T;  1GBR A;  4J9I A;  5DM7 R;  2EQU A;  2QGF B;  4RMO A;  3EGX A;  4M7D D;  5LJ3 h;  2A28 A;  2GNC A;  4LUD A;  4C92 E;  4MML A;  3X28 B;  1XOV A;  4OP0 A;  5CAI A;  4HXJ A;  1Y71 A;  4E2F B;  3HFN A;  3UA6 A;  1X6B A;  2ZPH B;  3UWN A;  2IIM A;  1AEY A;  4NOY A;  2FVU A;  2E5K A;  4BI4 A;  5IN1 A;  2J6O A;  3V7S A;  3QDF A;  1NEB A;  2AIR B;  1VQ4 T;  4DOW A;  2DEU A;  2MWP A;  4PK4 A;  4PJO E;  3LGL A;  1RLP C;  2RJC A;  1OX8 A;  4OMO A;  3LGF A;  2XK0 A;  2DER A;  3HRS A;  3JCM W;  1WDX A;  3SFM A;  3HRT A;  4IIM A;  1Q81 C;  4KH1 B;  3HP9 A;  1TUC A;  3CPW S;  1VQ9 T;  5D6Y A;  1ABO A;  1MND A;  2DIL A;  3U23 A;  3CCL Q;  1S72 A;  3I56 Q;  2X35 A;  4RTZ A;  1O9S A;  1UGQ B;  2BUD A;  2EQI A;  3DB3 A;  3GNG A;  2HL3 A;  3KBG A;  2Y90 A;  3E1S A;  3MP6 A;  2X9H A;  5AYF A;  3MJX A;  2CZ7 B;  1NM7 A;  3CCQ T;  2HQX A;  4M7A G;  3JB9 J;  3JCM P;  1WXT A;  4ME7 A;  1X75 C;  2V1Q A;  2K3B A;  1Y57 A;  3OYD A;  4E7K A;  4CC2 A;  3ZL7 C;  3G71 T;  4IUP A;  1VQ6 Q;  3LYI A;  3A5Z B;  3T9N A;  1R0C B;  3CC7 T;  1X27 A;  2BZY A;  3REA B;  3SD4 A;  1TU0 B;  2YRD A;  1Q86 R;  5CK9 A;  1QCO A;  1A0N B;  1C1A A;  4RTY A;  2F5T X;  1SEM A;  1Y07 A;  4D6W A;  1M1F A;  1M5Q 1;  2BZ8 A;  1I81 A;  3TU4 K;  1UGR B;  3AT1 B;  5GMK j;  1Q7Y C;  2QEX A;  4V2S A;  2AKL A;  1VYV A;  2F69 A;  5FW9 A;  1M1K C;  1UUE A;  2QQS A;  1M27 C;  4BD3 A;  2EFI A;  2M0O A;  3EG2 A;  5GMK l;  2HAX A;  3L1A A;  5A0L A;  4C0Z A;  3H0I A;  2DD5 A;  1MMD A;  4MMK A;  4LDX A;  2OJ2 A;  5GAM j;  1W2B S;  2DPP B;  1FMK A;  2QYZ A;  4K11 A;  4O5V A;  4M7A B;  3RER A;  5GMK m;  1EZZ B;  4NL3 A;  1YIJ Q;  3M0S A;  3PNW C;  2CT4 A;  4M78 G;  4F16 A;  1T0H A;  1VQ7 Q;  2HD0 A;  1M1K U;  3THK A;  2YXY A;  5FRO A;  2E41 A;  2EYZ A;  1ZSZ A;  3V8K A;  1ZLM A;  1JB0 E;  2FG0 A;  1QQJ A;  1G3W A;  1SHF A;  3EH2 A;  3LH0 A;  2KT1 A;  5KE3 A;  1FYN A;  3EG3 A;  1VQN A;  3WVE B;  1NG2 A;  2CP3 A;  2RHZ A;  5CQX A;  2VXE A;  4FIB A;  1RI0 A;  1YWO A;  5J39 A;  2A36 A;  4QT7 A;  1UHC A;  2MF2 A;  1C6V X;  3MEW A;  3TEE A;  5FU7 C;  3TVT A;  1X6G A;  2YWW A;  3SB2 A;  3JAM E;  3JCM d;  2QAZ A;  3HRU A;  3OBW A;  3GPL A;  1S72 T;  3MP8 A;  2XKO C;  1BIA A;  4R56 A;  1UB4 A;  2PVO B;  1K76 A;  1Y96 B;  1Q82 C;  2LQ8 A;  3CCU Q;  4QVC A;  3OY9 A;  4OB3 B;  5GMK e;  4M7D C;  3OYY A;  1WA7 A;  1YJW A;  4II1 A;  2RO0 A;  2QQA A;  2OI3 A;  3G4S Q;  1IGQ A;  3D7S B;  2A08 A;  1AOJ A;  4M78 B;  1ZUK A;  3ULR B;  2XDP A;  5GAM e;  3JCM Q;  2MIO A;  1SSF A;  1QVF P;  2JNG A;  2RQW A;  2JOY A;  2KI7 A;  1I5L A;  1Q7Y R;  3CCM Q;  3L2R A;  3M56 A;  2YUP A;  5DY9 A;  4ZGE B;  1KD1 U;  2JMC A;  1M1K R;  5KYU A;  2ATC B;  3M0R A;  1WQ7 A;  4IUT A;  5GAM g;  3G7Z A;  1MV0 B;  1NLO C;  3JCM X;  2QEX T;  4J9H A;  1PCX A;  2KVQ G;  5I2S A;  2D6F A;  2LQW A;  3EG9 A;  1Y7X A;  2FRW A;  1R8O B;  1QCF A;  5I22 A;  2YUQ A;  2OTJ Q;  4WTO B;  4M75 B;  3FDR A;  3OS1 A;  4N4G A;  2K79 A;  2ED0 A;  2KRM A;  1M30 A;  2GCX A;  3OSV A;  1SSH A;  1HJD A;  2DL8 A;  1DJ7 B;  1VQP A;  1YCS B;  3PVL A;  3E19 A;  4A4K A;  2EJF A;  2O01 E;  3J81 E;  4B9X A;  2JTF A;  1M8V A;  2K57 A;  4LDY A;  3CC2 A;  2RNA A;  3ZFJ A;  1AZG B;  4KRT A;  3M5A A;  3A8H B;  4YTL A;  1M90 C;  2CRE A;  4AT1 B;  1B3Q A;  4C8Q A;  2NUT A;  3NHN A;  3A8L B;  1D3B A;  3CD6 Q;  1YJ9 A;  2D0Q B;  2ABL A;  2JMA A;  3PGG A;  3HPW A;  4BUG A;  4JS4 A;  1S1N A;  1VQN T;  3NTK A;  2OTL A;  1OQK A;  1I5O B;  4C5E A;  1Y0M A;  1SRM A;  3S3O A;  1ZA2 B;  2DXC A;  2JXB A;  4X9C A;  3X20 B;  2DBK A;  1Q82 R;  2EGC A;  2KXC A;  4IUV A;  1KD1 R;  4CRI A;  4M75 D;  4F7U G;  1T3S A;  3MCA B;  2DVJ A;  2XDB A;  3PMT A;  3VS0 A;  1N8R U;  2GTO A;  2BE9 B;  4C8Q F;  4DBR A;  2W10 A;  2DX1 A;  2RK2 A;  1G3S A;  4Y92 A;  1YJW T;  2KMT A;  1BCM A;  3KFV A;  2O9V A;  3I55 Q;  3OMC A;  3OYC A;  1TUD A;  2YHT A;  3C4S A;  4N4H A;  2XDD A;  2EQK A;  2JT4 A;  2QQB A;  3R6O A;  4HCB A;  1TG0 A;  4E7I A;  5IHI A;  4A4H A;  4LNP A;  3JCM e;  4UC4 A;  3OYM A;  2O9S A;  2RF0 A;  3VS7 A;  2GFU A;  3V7R A;  3EFR A;  2YSQ A;  4E47 A;  3CCJ A;  4RTV A;  2CH4 A;  1QVF S;  4DBQ A;  3MO8 A;  4AFZ C;  1SG5 A;  3PT9 A;  3JCM g;  2LJ0 A;  3RKW A;  4N0A A;  3UPU A;  3OS0 A;  3VRY A;  2EKO A;  3ZEH A;  4F7U B;  1NJI C;  1WXU A;  4FYX B;  2BZX A;  2FRY A;  4MZM A;  3EAE A;  3JB9 H;  1IHW A;  2A7Y A;  2HQH A;  4M77 E;  1WJR A;  1G8X A;  2RH2 A;  4PLL A;  3CCR A;  1KQ2 A;  3PIO A;  4FL6 A;  1VQP T;  3NMZ C;  4ELY C;  4C92 A;  5LJ5 g;  1PKS A;  1N8R R;  1EX4 A;  1NEG A;  1U3O A;  1X2K A;  1UJY A;  2LCC A;  4M7D G;  4MDX A;  4BB7 A;  1WHJ A;  2KT8 A;  3CC2 T;  3SWN A;  3M4G A;  2L5Q A;  2VYT A;  1WI7 A;  3L2V A;  3CCE Q;  2GTJ A;  2E12 A;  3JB9 F;  5DLQ E;  2VC8 A;  1WHG A;  5L8R E;  5D7U A;  2HKQ B;  1YJ9 T;  3HFO A;  1VIF A;  4J9E A;  3H8Z A;  1I0C A;  1EIF A;  4PJO A;  2LNH B;  2OTL T;  4JJB A;  3SHW A;  3VS6 A;  3NFC A;  1PC0 A;  4HVW A;  5CVI A;  4IUU A;  4BE0 A;  4C92 F;  3L2U A;  5KCO A;  1RAA B;  2B8A A;  2CDT A;  1NPP A;  2AHJ B;  2SRC A;  1D0Z A;  2DMO A;  2X4W A;  2RHU A;  1OYX A;  5GAN 7;  5GAO l;  4PL6 A;  2LX9 A;  2Y4X A;  4CI0 C;  3CMA Q;  2YUO A;  1MNE A;  5FLX E;  2NYS A;  4JRQ A;  2C0T A;  4PFZ A;  4FCY A;  2DTI A;  1N5Z A;  5IAY A;  2HCK A;  3G1J A;  4LUE A;  3EG0 A;  2EJG A;  3GBQ A;  2GQV A;  2E3H A;  4X9D A;  4PJO F;  2EYW A;  2WSC E;  4GBQ A;  3EGD B;  4DBH A;  4F14 A;  2GGR A;  5GAO m;  1GCQ A;  1VQM Q;  5A0G A;  2AZS A;  3BDU A;  1QVG A;  2L3S A;  1X43 A;  4Y91 A;  2PUO B;  4FW2 A;  2H3E B;  3BE3 A;  4M7A E;  1Z9Z A;  4VUB A;  4ZN3 A;  3NGP A;  3CC4 Q;  2F2V A;  3I9Q A;  3NTI A;  3QZ5 B;  1U5S A;  2R5M A;  1UGP B;  3CCS A;  3V8L A;  2ZPI B;  2HSE B;  3FLG A;  3CCJ T;  2DZ9 A;  3M0P A;  1D09 B;  4R0K A;  2FYK A;  3LH5 A;  2ECZ A;  2JW4 A;  3L2W A;  1ZSZ B;  1N27 A;  5CCA A;  5KYX A;  4HKE A;  1UGS B;  3S6W A;  4JLG A;  1YJN A;  4M75 C;  1H3Z A;  1G83 A;  3OYK A;  1ABQ A;  2PVG B;  2RM4 A;  2CZ6 B;  2K4Y A;  4E7J A;  1W2B P;  1WHM A;  1OEB A;  7AT1 B;  3GP8 A;  3CCR T;  2H8H A;  2CP5 A;  3VYG A;  1K0S A;  3EHR A;  5I11 A;  2HDA A;  3M58 A;  1NYF A;  3JCM b;  2DL7 A;  1IGU A;  4J9D A;  3JCM c;  1UJ0 A;  2BE7 D;  5GAN 3;  1KG1 A;  1VQ5 A;  2JS2 A;  3M0T A;  2DKG A;  1F1B B;  5DLO A;  4Z8A A;  2Z0W A;  3R6N A;  3QBY A;  4HT9 A;  2ZGW A;  4JZ3 A;  1BU1 A;  2YLB A;  4M78 E;  2EYQ A;  3EFS A;  2L3Q A;  3EG1 A;  1JO8 A;  3M59 A;  4FM4 B;  5GAN f;  3FC3 A;  1NPR A;  2E4H A;  3EHQ A;  4JS5 A;  1K8A U;  5CKD A;  2P84 A;  5KYW B;  3H9N A;  1KIK A;  1RAE B;  1JBM A;  3QXE B;  3QKJ A;  1QKX A;  1C0M A;  1PG5 B;  5IHK A;  2P0K A;  3QG1 A;  2KRN A;  5IT9 E;  4PNO A;  1OV3 A;  1MMA A;  1U1S A;  5GAM d;  4ESR A;  2DD4 A;  1VQK Q;  2FZG B;  2VKN A;  2DXT A;  4OVA A;  4KGV B;  4NL2 A;  2QTX A;  2ZPB B;  3A8G B;  4PFP A;  2LCS A;  2HNI A;  4XTX A;  4FT2 A;  1M2V A;  4DEY A;  5LL6 S;  1BKB A;  2EPD A;  1VQL A;  3UAT A;  1WGS A;  3TRE A;  1JJ2 A;  5HK3 A;  3GLX A;  2PZ1 A;  1JXO A;  2LQN A;  3HHT B;  4ZTF A;  5CKB A;  4XTY A;  1I1J A;  3BFM A;  2RQR A;  2J06 A;  5IH2 A;  2QA4 A;  1GFD A;  5D6W A;  4XTV A;  1YHQ A;  2Y4Y A;  2LDM A;  1KSW A;  3EGU A;  1VQ4 Q;  3J7A F;  3CCS T;  1E6G A;  1U8R A;  4M4Z A;  1JEG A;  2RHX A;  1KQS A;  1J3T A;  3VU3 C;  1EFN A;  2MYS A;  4HCZ A;  5FRM A;  4RTW A;  1P92 A;  2NUT B;  1O75 A;  2CSI A;  2I2L A;  1YJN T;  4KUI A;  1G5V A;  1D3B B;  1VQ9 Q;  2X51 A;  1K8A R;  1YI2 A;  2CZ0 B;  1QKW A;  1R0B G;  2C0I A;  4BAC A;  3QO3 A;  2CP0 A;  2KAF A;  1YIT A;  5AT1 B;  2PNI A;  1UG1 A;  2RJE A;  4ANJ A;  3GIB A;  2VWF A;  4OMQ A;  2QDY B;  3G6E A;  5GMK h;  3PMI A;  4EMH A;  2VGM A;  3OYG A;  3CCQ Q;  2DLP A;  1QVG S;  1UE9 A;  2RI2 A;  4Z88 A;  2MCN A;  4J9G A;  5GAO r;  1M9S A;  1VQ5 T;  1VYT A;  3G71 Q;  1VYU A;  3CC7 Q;  3OA6 A;  1QCN A;  5GAM h;  4JRI A;  4KGZ B;  1VOM A;  1VQ8 A;  2GFA A;  4EDU A;  3LLR A;  3QYH B;  2CS7 A;  2O31 A;  4Q5W A;  4J83 A;  4AFS C;  2EGE A;  1FX7 A;  1IB8 A;  2RHI A;  1SKU B;  5GAN 2;  2RQV A;  2FEI A;  4C8Q D;  1AZE A;  4FYY B;  4RCC A;  1IXD A;  1GFC A;  1BCO A;  2QAS A;  3QUI A;  3VS1 A;  1XNI A;  1UFF A;  1H3H A;  3MP1 A;  2KDS A;  1G3T A;  2MI6 A;  2O4X A;  3UT1 A;  3BDL A;  2F2W A;  4MZP A;  1VQO A;  4TVR A;  4LD9 K;  2HBW A;  2V26 A;  3RNJ A;  4M75 G;  2DAQ A;  1E7O A;  1YNZ A;  3FB9 A;  5LJ3 f;  3I5R A;  3CME A;  4F7U E;  2ZPE B;  2JM9 A;  4AMC A;  1VQL T;  2DNU A;  4KUD K;  2BIV A;  1KD1 C;  3PE0 A;  2DET A;  3EFO B;  4X1V A;  5EC7 A;  1LJO A;  3JB9 I;  1HK9 A;  3MPU B;  4B9W A;  1BB9 A;  1B07 A;  1HYO A;  4IUR A;  1RL2 A;  2CUD A;  3I5S A;  4JUV A;  1CKA A;  2VGN A;  4GY5 A;  5LJ5 d;  2QA4 T;  3TSW A;  4ZGJ B;  2L0A A;  1WLP B;  4C0D B;  1YHQ T;  2ZPF B;  4RUG A;  1RUW A;  4QQ6 A;  5ECA A;  2LT1 A;  2E1H A;  1W4S A;  9ATC B;  3SWN B;  4FU6 A;  3H0H A;  1ZSZ C;  4WCI A;  2LVM A;  5FRN A;  3URG A;  4NS5 A;  1V76 A;  5EG2 A;  2LC4 A;  1KC8 C;  1RAC B;  1YI2 T;  3DKM A;  1OU8 A;  4JPB W;  3JRZ A;  1S72 Q;  4PJO B;  3QPH A;  2W0Z A;  3M0U A;  1YIT T;  2RQT A;  4QQD A;  2COY A;  3O5Z A;  2LJ3 A;  4M77 A;  3G6E T;  1D1A A;  1GRI A;  5L23 A;  2DBM A;  5CQY A;  4C0F A;  3QSU A;  3QJY A;  3CCV A;  1KHC A;  3VUZ A;  3JB9 D;  2K5I A;  3J80 E;  4EMK A;  1UDL A;  3MHX A;  6AT1 B;  3OW2 A;  1E6H A;  1RAB B;  4LDU A;  1BIB A;  2DIG A;  2KBT A;  3E2U A;  2QI2 A;  1KC8 U;  1OPK A;  1OI1 A;  3JCM J;  2EGA A;  4M7D E;  4AG2 C;  4C92 D;  1BBZ A;  4JRP A;  1XJW B;  4BE2 A;  1D1B A;  2V8I A;  1N8R C;  1VQ8 T;  2EIF A;  2LP5 A;  3OYB A;  3JCM h;  4M77 F;  4LE9 A;  2P0Q A;  1WHL A;  4FYV B;  1W1F A;  2DK3 A;  2LJ1 A;  2XU8 A;  1QP2 A;  2NWM A;  2QQ9 A;  3H0F A;  1GXI E;  2QEX Q;  5LJ5 j;  4CC7 A;  2NUP A;  3CXC A;  1TH7 A;  4RG2 A;  4C5I A;  2RI5 A;  3OYJ A;  3RDV A;  5GJW B;  2D8J A;  1WHH A;  1D0Y A;  4J6X A;  3M57 A;  4JJD A;  4QVZ A;  4PJO D;  2M51 A;  1VQO T;  4PJN A;  2F2X A;  2J7I A;  4OB2 B;  2WSF E;  2E10 A;  3OB9 A;  2DIQ A;  2VVK A;  5LJ5 h;  1M3A A;  3CME T;  2R57 A;  1PD0 A;  1SRL A;  2IVW A;  2RN8 A;  3RMS A;  4KT0 E;  1W70 A;  1GBQ A;  2EYX A;  2AKK A;  2KNB B;  4B6M A;  2M02 A;  2H3J A;  2K3X A;  1JU5 C;  2RB6 A;  2PTK A;  1NE8 A;  3UDC A;  2DO3 A;  1V1C A;  4D8D A;  2CKK A;  3S3M A;  1OPL A;  3OYI A;  3A1P A;  1ZQ1 A;  4FW1 A;  4M7A A;  3FJ5 A;  1W6X A;  4CC3 A;  4E7Z A;  4AG1 C;  2GQI A;  2NUZ A;  3EGX B;  3CQT A;  1UTI A;  3C0C A;  2FPE A;  1KC8 R;  1ZSG A;  1VQN Q;  1HSQ A;  3A8M B;  2BKD N;  2QDL A;  4N4I A;  2NLU A;  1TSF A;  1N6A A;  3INZ A;  4C8Q C;  3JV3 A;  5GAN 5;  4BI8 B;  2I0N A;  4OB0 B;  1N9S A;  2KYB A; 
#chains in the Genus database with same CATH homology
 1N27 A;  2CZ1 B;  2ZPG B;  1WNL A;  2DVE A;  2F5T X;  1Q82 U;  5CCA A;  2VV5 A;  4HKE A;  1UGS B;  2JTM A;  1YBY A;  1Y07 A;  3S6W A;  4C5G A;  4JLG A;  4D6W A;  1YJN A;  3CD6 T;  4M7A F;  1M1F A;  4M75 C;  1M5Q 1;  1JJ2 S;  1I81 A;  4E7H A;  3TU4 K;  3OYK A;  1UGR B;  2K2V A;  2GF7 A;  5GMK j;  1Q7Y C;  2EQJ A;  2DTO A;  2PVG B;  4R55 A;  2QEX A;  3HSB A;  2KQW A;  2RM4 A;  5LJ5 e;  4V2S A;  2X4X A;  3OYF A;  2CZ6 B;  2K4Y A;  2F69 A;  2K5L A;  3CCV T;  2V8J A;  3GF5 A;  4E7J A;  1M1K C;  1FXX A;  2CGH A;  4C0G A;  2QQS A;  4BD3 A;  2MMP A;  4XU1 A;  2EFI A;  3GP8 A;  2M0O A;  3CCR T;  3NTH A;  3VYG A;  5KE2 A;  3VV0 A;  5I2M A;  5GMK l;  3M4Y A;  3E9F A;  2HAX A;  1X6O A;  1ZBX A;  1WJS A;  3L1A A;  5A0L A;  1IZ6 A;  4C0Z A;  2DD5 A;  4KUL A;  2A3L A;  4MMK A;  3M58 A;  4LDX A;  3CBM A;  1IRE B;  3GNF B;  3M53 A;  2LTO A;  3JCM b;  5GAM j;  1W2B S;  2DPP B;  2WAC A;  2WSE E;  4JRK A;  3CMA A;  1M1G A;  4LDW A;  1KQS S;  3JCM c;  2L89 A;  4O5V A;  5GAN d;  5GAN 3;  4M78 A;  1KG1 A;  1VQ5 A;  4M7A B;  2DKG A;  2OAU A;  3CCL A;  3RER A;  3KXT A;  5GMK m;  3I56 A;  4NL3 A;  5DLO A;  3A8O B;  2P4T A;  3PNW C;  2L8D A;  3QBY A;  3PFS A;  2ZGW A;  4M78 D;  4M78 G;  4HT9 A;  2YLB A;  4M78 E;  2EYQ A;  3I55 T;  2HD0 A;  3EFS A;  4RCB A;  1M1K U;  3QYG B;  5KH6 A;  3M59 A;  2F5K A;  4FM4 B;  5FRO A;  5GAN f;  2XID A;  2QXF A;  5CKH A;  2E41 A;  3FC3 A;  1NPR A;  2M16 A;  1VQM A;  2EJ9 A;  4JS5 A;  4L5G A;  3V8K A;  5CKD A;  1K8A U;  3RIR A;  1JB0 E;  1LNX A;  3O8V A;  1JBM A;  4A54 A;  3QXE B;  3QKJ A;  1I4K 1;  1G3W A;  4HCC A;  3JCM V;  3LH0 A;  5KE3 A;  2P0K A;  3QG1 A;  1VQN A;  3WVE B;  2RHZ A;  5CQX A;  4A53 A;  3VKI A;  1LOJ A;  5IT9 E;  4PNO A;  2VXE A;  4FIB A;  3CC4 A;  1RI0 A;  5J39 A;  3ER0 A;  1VQ6 A;  4N0A C;  3S3N A;  1U1S A;  2MF2 A;  2ZZD A;  3MEW A;  5GAM d;  4ELZ C;  2DD4 A;  4M78 F;  4RG8 A;  2KSS A;  4XQ3 A;  4M77 C;  2LNV A;  5FU7 C;  3TEE A;  2K3Y A;  5A2Q E;  2DXT A;  4OVA A;  3BY7 A;  3OW2 S;  3LW5 E;  2RA2 A;  4J7I A;  4IUQ A;  4NL2 A;  3SB2 A;  3JAM E;  3JCM d;  3HRU A;  4EMG A;  3OBW A;  3GPL A;  2QTX A;  2E6N A;  2ZPB B;  1XTD A;  2XKO C;  3A8G B;  2HNI A;  3MET A;  2HBP A;  3MP8 A;  5GAM f;  1BIA A;  4XTX A;  2R5A A;  4EMK C;  3MEU A;  3TCJ A;  4FT2 A;  4R56 A;  1FWZ A;  1UB4 A;  2PVO B;  3Q1J A;  1BKB A;  4Z02 A;  5LL6 S;  1Y96 B;  1VQL A;  2MAM A;  1Q82 C;  2LQK A;  1WGS A;  2LQ8 A;  3TRE A;  1M90 U;  1JJ2 A;  4QVC A;  5HK3 A;  3OY9 A;  4OB3 B;  3GLX A;  5GMK e;  3OYL A;  3JCM f;  4XK8 E;  3QDR B;  4J6W A;  4J6Y A;  4M7D C;  3C94 A;  3OYY A;  3QHS A;  4C0D C;  1YJW A;  4ZGD B;  3P8B B;  2E64 A;  4C92 C;  4II1 A;  5GAN g;  3HHT B;  2RO0 A;  5CKB A;  4ZTF A;  2QQA A;  2PVD B;  4XTY A;  1WJQ A;  3RKX A;  3BFM A;  1M4Z A;  2EAY A;  3SWN C;  4JJN K;  2QA4 A;  1H64 1;  4LD6 A;  4M78 B;  4O6J A;  5D6W A;  4XTV A;  1YHQ A;  3LX7 A;  4BY6 C;  2Y4Y A;  5HKC A;  2FHD A;  1BI2 A;  2LDM A;  4OMF B;  3J7A F;  5GAO n;  3CCS T;  2FB7 A;  1U8R A;  2XDP A;  4PKC C;  5GAM e;  3JCM Q;  2RHX A;  3V7C A;  1KQS A;  1SSF A;  3H6Z A;  3VU3 C;  2JNG A;  5CR2 A;  2JOY A;  4HCZ A;  5GAN j;  4ZTJ A;  1I5L A;  2DJZ A;  2XHC A;  3CCE T;  4PJO C;  4XU0 A;  5FRM A;  3L2R A;  1BYM A;  3M56 A;  1ZHI A;  1P92 A;  5DY9 A;  4ZGE B;  1YIJ A;  1KD1 U;  1O75 A;  4FT4 A;  2I2L A;  1PSE A;  1WQ7 A;  4IUT A;  5GAM g;  1YJN T;  3G7Z A;  4KUI A;  1G5V A;  1D3B B;  1K9M U;  1VQ7 A;  3JCM X;  1G3Y A;  2JN0 A;  2CZ0 B;  2QEX T;  1YI2 A;  2KVQ G;  5D6X A;  4BAC A;  3QO3 A;  3WVD B;  5I2S A;  2KAF A;  2D6F A;  2M1H A;  5GAN h;  1QP3 A;  5GAN 8;  3OYA A;  1Y7X A;  1YIT A;  4RKU E;  1Y96 A;  2RJE A;  1K8A C;  1R8O B;  5CO7 A;  3GIB A;  4HT8 A;  3G6E A;  3ME9 A;  2QDY B;  3QZ9 B;  5J26 A;  1S72 T;  4M75 B;  3FDR A;  5GMK h;  3PMI A;  2DXU A;  4PLI A;  3OS1 A;  4EMH A;  1OZ3 A;  2VGM A;  3OYG A;  3CPF A;  3GOX A;  4N4G A;  2P0P A;  5LJ3 j;  2KY9 A;  3X26 B;  1QVG S;  3L42 A;  2GCX A;  3OSV A;  3CPW A;  1VQK A;  1WQW A;  2RI2 A;  5HK0 A;  1U1T A;  3CMA T;  1DJ7 B;  4DOV A;  5CIU A;  5GAO r;  1VQP A;  1M9S A;  1VUB A;  2LT4 A;  3E19 A;  4A4K A;  2EJF A;  1BI3 A;  1VQ5 T;  4M7A C;  2O01 E;  4QVD A;  5J3B A;  3J81 E;  4B9X A;  2HQE A;  2JTF A;  3I56 T;  5HY6 A;  1XQH A;  2C06 A;  1M8V A;  1H3Z A;  3OA6 A;  2K57 A;  4LDY A;  4XU2 A;  3CC2 A;  5FU6 C;  2DEQ A;  3ZFJ A;  1KHI A;  5GAM h;  3M5A A;  4JRI A;  2JZ2 A;  3A8H B;  3CCU A;  1VQ8 A;  2GFA A;  4YTL A;  3V8J A;  3LLR A;  4EDU A;  3DLM A;  1M90 C;  3QYH B;  2CS7 A;  4A4E A;  4Q5W A;  3CBP A;  3QII A;  4J83 A;  1VQM T;  3RMQ A;  4C8Q A;  3A8L B;  4MDW A;  3M55 A;  4EPC A;  1FX7 A;  4ATO A;  2RHI A;  4BDY A;  1PSF A;  1D3B A;  1Q86 U;  1NJI U;  3C95 A;  5GAN 2;  1YJ9 A;  3G4S A;  2D0Q B;  4C8Q G;  4C8Q D;  1I8F A;  2JUF A;  4RCC A;  3PGG A;  3HPW A;  4C8Q E;  4BUG A;  4JS4 A;  1VQN T;  3QUI A;  3RES A;  3NTK A;  1XNI A;  2OTL A;  3PTA A;  4C5H A;  2KK4 A;  4J7F A;  3MP1 A;  2KDS A;  3CC4 T;  2JVV A;  3P8H A;  5LJ3 d;  1G3T A;  4LDV A;  4C5E A;  1V29 B;  2MI6 A;  3OS2 A;  3LWH A;  2O4X A;  3UT1 A;  3S3O A;  1VQ6 T;  1VQ4 A;  3BDL A;  2DXC A;  4OB1 B;  4M75 A;  4MZP A;  1VQO A;  4F7U A;  4TVR A;  4X34 A;  4X9C A;  2E70 A;  3OS5 A;  3X20 B;  4ZN1 A;  4LD9 K;  4KBM B;  4IUV A;  4CRI A;  5GAN e;  2RJD A;  2DAQ A;  4M75 G;  4M75 D;  4F7U G;  5I21 A;  3FB9 A;  3OYN A;  1WPY A;  5LJ3 f;  3CCM A;  4M75 E;  3CME A;  4F7U E;  5C0M A;  3MCA B;  2ZPE B;  4DQ2 A;  2XDB A;  3QJ6 A;  4BI3 A;  4FSX A;  3PMT A;  1N8R U;  1VQL T;  4KUD K;  2BIV A;  3FRN A;  3X24 B;  2PQW A;  4C8Q F;  1KD1 C;  1VQ9 A;  4M77 B;  3MEA A;  5FU7 B;  2QQR A;  4XAX B;  2RK2 A;  1G3S A;  1LJO A;  2M9U A;  1K9M C;  1UEB A;  3DB4 A;  5GAN 4;  1YJW T;  3JB9 I;  3ZBD A;  3OYH A;  4HA8 A;  2KMT A;  1HK9 A;  2RK1 A;  3VYH B;  4B9W A;  1YCY A;  3C12 A;  3LWI A;  4EMK B;  4IUR A;  1RL2 A;  3OBY A;  3OMC A;  3OYC A;  3CEY A;  2OTJ A;  5GAO p;  4JUV A;  5LJ5 d;  2VGN A;  4GY5 A;  2YHT A;  2QA4 T;  3C4S A;  4N4H A;  4OGE A;  4ZGJ B;  5C6S A;  4M78 C;  1OZ2 A;  4M75 F;  3CXC S;  4M7D B;  2VUB A;  4C0D B;  4F7U F;  1YHQ T;  2ZPF B;  4P5N A;  2XDD A;  2RI3 A;  3CCQ A;  2EQK A;  3WXM B;  4QQ6 A;  1B34 B;  1W2B A;  2LT1 A;  2QQB A;  3R6O A;  3L2Z A;  4OGC A;  5LJ3 e;  2E1H A;  3E9G A;  4HCB A;  3SDZ A;  1W4S A;  4E7I A;  4OF1 A;  5LJ5 f;  3F70 A;  2XIC A;  3SWN B;  4FU6 A;  4A4H A;  4XTZ A;  3JCM e;  4UC4 A;  5CKF A;  1Q81 U;  3OYM A;  4GLK A;  3G71 A;  4C8Q B;  5GAO q;  2LVM A;  1BI0 A;  5GAN 6;  4BY6 B;  2YRV A;  3URG A;  1AHJ B;  4NS5 A;  3CC7 A;  1YIJ T;  5FRN A;  2GFU A;  5LJ3 g;  1QW1 A;  3V7R A;  3EFR A;  5EG2 A;  2LC4 A;  2XG8 D;  1KC8 C;  4E47 A;  2PUK B;  1VQ7 T;  3CCJ A;  2VXF A;  2R58 A;  1QVF S;  1YI2 T;  3MO8 A;  2RJF A;  2YLC A;  3DKM A;  3PT9 A;  2E6Z A;  3JCM g;  2XI9 A;  3JRZ A;  3JSC A;  4PJO B;  3RKW A;  3QPH A;  3M54 A;  4N0A A;  3UPU A;  3X25 B;  3OS0 A;  4A4G A;  1YIT T;  3BW1 A;  2DZC A;  2O4X B;  2DXB A;  4QQD A;  2EKO A;  4J5Y A;  3HL8 A;  4M77 A;  3G6E T;  3CD6 A;  3ZEH A;  4F7U B;  4BDZ A;  5CQY A;  1Q86 C;  1NJI C;  2RD1 A;  4C0F A;  2E5Q A;  2RHY A;  3QSU A;  4MZM A;  3EAE A;  3JB9 H;  4M77 G;  2CYZ B;  1NZ9 A;  4M77 D;  2A7Y A;  4MZT A;  3QJY A;  3CCV A;  1KHC A;  3VUZ A;  4M77 E;  3JB9 D;  1WJR A;  1MHN A;  2K5I A;  3J80 E;  3JB9 G;  4EMK A;  3MHX A;  2RH2 A;  2DTH A;  4PLL A;  4L6V 5;  3AHU A;  1VQK T;  3CCR A;  3MEV A;  3PIP A;  3OW2 A;  1KQ2 A;  2EQM A;  4L59 A;  3PIO A;  1VIE A;  4FL6 A;  1VQP T;  2D9T A;  1BIB A;  3KUF A;  4J8O A;  4LDU A;  4M7D A;  2DIG A;  3OSS C;  4ELY C;  3CCL T;  3P8D A;  4C92 A;  5LJ5 g;  1B34 A;  2QI2 A;  5DM7 R;  1KC8 U;  2EQU A;  4RMO A;  2LCC A;  4M7D G;  1OI1 A;  4M7D D;  4MDX A;  4BB7 A;  3JCM J;  5LJ3 h;  4M7D E;  3OQ5 A;  4C92 G;  4C92 D;  3CC2 T;  3OYE A;  3OMG A;  4C92 E;  4JRP A;  4BE2 A;  4MML A;  3SWN A;  2V8I A;  3CCU T;  3M4G A;  2EIF A;  2L5Q A;  2VYT A;  3X28 B;  1N8R C;  1VQ8 T;  1XOV A;  4OP0 A;  5CAI A;  3L2V A;  3OYB A;  3JCM h;  4M77 F;  2E12 A;  1K73 C;  5A0D A;  1Y71 A;  3HFN A;  5DLQ E;  3JB9 F;  2VC8 A;  2P0Q A;  5L8R E;  2ZPH B;  1KQ1 A;  3UWN A;  4E7L A;  4NOY A;  2DK3 A;  1MGQ A;  2FVU A;  4IKF A;  2XU8 A;  1YJ9 T;  1QP2 A;  1Q7Y U;  3G4S T;  3RKY A;  3FJP A;  3HFO A;  1VIF A;  5FU6 B;  3I55 A;  2QQ9 A;  1HXD A;  3H8Z A;  1GXI E;  5LJ5 j;  3VJP A;  3HKS A;  3N5B B;  4BI4 A;  1EIF A;  4XTW A;  4PJO A;  3CXC A;  2OTL T;  1TH7 A;  4RG2 A;  4C5I A;  2RI5 A;  5IN1 A;  3OYJ A;  3V7S A;  1N9R A;  3NFC A;  1JRI A;  4J6X A;  3M57 A;  4M7D F;  4QVZ A;  5CVI A;  1VQ4 T;  4PJO G;  4DOW A;  4IUU A;  4BE0 A;  4PJO D;  4C92 F;  2MWP A;  3L2U A;  1VQO T;  4PJO E;  5KCO A;  3LGL A;  4Y28 E;  1QVP A;  4XU3 A;  2RJC A;  3LGF A;  4JLI A;  2XK0 A;  2B8A A;  1NPP A;  3HRS A;  4OB2 B;  2AHJ B;  2WSF E;  2E10 A;  3OB9 A;  3JCM W;  2DIQ A;  5LJ5 h;  3L2Q A;  3CCM T;  2X4W A;  2RHU A;  3SFM A;  1OYX A;  3CME T;  2LRQ A;  2L3R A;  2R57 A;  3HRT A;  1Q81 C;  2K5F A;  5GAN 7;  2IVW A;  5GAO l;  4PL6 A;  2LX9 A;  3HP9 A;  3RMS A;  3RUX A;  2Y4X A;  4CI0 C;  1K73 U;  3CPW S;  2X4J A;  3M9Q A;  4KT0 E;  5FLX E;  1VQ9 T;  5D6Y A;  1BI1 A;  1QVF A;  1X01 A;  4JRQ A;  2H3J A;  2K3X A;  3FEO A;  2IG0 A;  2DTI A;  2RB6 A;  5IAY A;  2XD0 A;  1S72 A;  1NE8 A;  3DLL A;  4A4F A;  3UDC A;  2ZCF B;  2DO3 A;  2E65 A;  2EJG A;  2X35 A;  2CKK A;  2GQV A;  4X9D A;  1O9S A;  1UGQ B;  2WSC E;  4PJO F;  3ASK A;  3S3M A;  2BUD A;  5GMK i;  4XTU A;  3OYI A;  3CBO A;  3DB3 A;  2X4Y A;  3GNG A;  2OTJ T;  5M9O A;  1ZQ1 A;  5GAO m;  3KBG A;  2Y90 A;  2V8K A;  3E1S A;  3MP6 A;  4JDS A;  4M7A A;  5AYF A;  4C92 B;  5A0G A;  2CZ7 B;  3FIF A;  2MWO A;  3BDU A;  3CCQ T;  4DA4 A;  1QVG A;  2HQX A;  4M7A G;  4Y91 A;  2PUO B;  4WF2 A;  3JB9 J;  4M7A D;  5KCH A;  3JCM P;  4M7A E;  4VUB A;  2PU9 B;  4ME7 A;  1X75 C;  4ZN3 A;  3A8M B;  4QQG A;  2BKD N;  3OYD A;  5CKE A;  4E7K A;  4N4I A;  3G71 T;  4IUP A;  2NLU A;  1N6A A;  3INZ A;  3NTI A;  4C8Q C;  3LYI A;  3QZ5 B;  2R5M A;  3A5Z B;  3T9N A;  5GAN 5;  3VUB A;  1UGP B;  2EWN A;  3CC7 T;  3CCS A;  3V8L A;  4BI8 B;  2G3R A;  2ZPI B;  2FL7 A;  4QW2 A;  3FLG A;  3CCJ T;  3SD4 A;  2DZ9 A;  4BE1 A;  2FYK A;  5CK9 A;  3CCE A;  4OB0 B;  1N9S A;  3L2W A;  2LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...