4A4GA

Solution structure of smn tudor domain in complex with asymmetrically dimethylated arginine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords SURVIVAL MOTOR NEURON PROTEIN
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4gA00
1MHNA 2GFUA 3H8ZA 4CRIA 2RHUA 3PMIA 3EAEA 3L2UA 1XNIA 2FHDA 2PQWA 3FC3A 3OA6A 3PMTA 4B9WA 2L89A 3OY9A 3MEVA 3H6ZA 4II1A 2R58A 5M9OA 2EKOA 2X4YA 4IUQA 2BIVA 5D6XA 2YRVA 4OVAA 2M1HA 2EQKA 2HQXA 3DB4A 4E7KA 3CEYA 3NTKA 3L2WA 2K3YA 4BDZA 5C0MA 4ZTFA 1KHCA 2JZ2A 3L42A 4E7JA 4B9XA 2LTOA 3NTHA 2RI2A 4QVZA 3GOXA 1WGSA 4RG2A 4E7LA 4A4HA 3ME9A 3OYJA 3MO8A 3QJ6A 2LDMA 5D6WA 2X4XA 4IUVA 2EFIA 1WJQA 2QQSA 4QQGA 2RO0A 3OYFA 2DAQA 4QQDA 3OYGA 4Q5WA 1H3ZA 4N4IA 3P8DA 1WJRA 2QQRA 3OYIA 4QW2A 1OYXA 3OYBA 3META 2R5MA 1SSFA 4E7HA 2RJDA 2G3RA 2RI5A 3OMCA 2LVMA 3KUFA 4FL6A 2XDPA 1G5VA 4IUTA 3P8HA 5KCOA 3FLGA 4BACA 2DIQA 3SD4A 4PL6A 3FDRA 4ZTJA 4BE1A 5IN1A 3OQ5A 5KE3A 5FROA 2RJCA 4N4GA 3MEWA 2EQUA 3L2QA 2XK0A 3NTIA 4LD6A 3F70A 2M16A 5KE2A 3DLMA 2WACA 5FRNA 2JTFA 3M9QA 4IKFA 3S3MA 2E5QA 4BDYA 4L59A 4E7IA 2RHXA 3PFSA 2EQMA 2O4XA 2EQJA 3LLRA 3O8VA 3QBYA 4HCZA 4A4GA 2X4WA 3OS0A 2HQEA 3C4SA 3Q1JA 4A4FA 1OI1A 3LGFA 3S6WA 3MEUA 2BKDN 4IURA 3OYAA 2GFAA 1WJSA 4FU6A 4C5EA 3BDLA 4PLLA 4NS5A 3QIIA 2B8AA 3MP8A 2VYTA 3LGLA 2RHIA 2R5AA 3OYNA 2RJEA 3FEOA 3E9FA 5J26A 3LYIA 2RHYA 4A4EA 3OS1A 2X35A 3PNWC 3OS2A 4Z02A 3UT1A 4C5IA 3OYDA 3ASKA 4X34A 3OYLA 4BE2A 2LCCA 2RHZA 1OZ3A 2RI3A 3E9GA 1N27A 3MP6A 3S3NA 1OZ2A 3OYMA 3OYKA 2CKKA 4QQ6A 3MEAA 4GY5A 4UC4A 3OYHA 3LX7A 2DIGA 3OMGA 3UWNA 5KCHA 2IG0A 4IUUA 3DB3A 1RI0A 5C6SA 3L2VA 4EDUA 4C5GA 2RJFA 2K3XA 2L8DA 2O4XB 2GF7A 3OB9A 5CIUA 2MWPA 2MWOA 2BUDA 2NLUA 2P0KA 2E6NA 2L3RA 4N4HA 3L2RA 5FRMA 3S3OA 3ZEHA 5D6YA 2F5KA 3OYEA 3OYCA 2M0OA 3LH0A 4C5HA 4BE0A 3MP1A 5J39A 5KH6A 5IAYA 4IUPA 2R57A 2D9TA 4PLIA 4BD3A 3QKJA 2LRQA
chains in the Genus database with same CATH superfamily
3ZBDA 3JCMg 1M8VA 5GAN8 3FC3A 3H0FA 3EG1A 2EW3A 2QXFA 3OY9A 1R0CB 3BFMA 2F2VA 2YWWA 4OMLA 2BIVA 5GAN7 3LWIA 3CCVT 1K4US 3NTKA 5C0MA 1RLPC 1AWJA 4HVWA 3CMAQ 4A4HA 3OYJA 2MMPA 2A08A 2XDDA 2RQUA 1M1KR 5LJ5j 1U1TA 1WJQA 2E65A 4QQGA 3OYGA 4HT9A 2MCNA 4J9DA 5IXFA 1WYXA 3RKWA 5KYXA 2QQRA 2RA2A 2X51A 2AZVA 2DYBA 1TOVA 3KXTA 2RI5A 1YITA 2XDPA 3RERA 4IUTA 1G5VA 2GCXA 2DIQA 1UGVA 2X9HA 1NM7A 1OX9A 2V26A 1UTIA 1YCYA 2PU9B 5GAN4 4N4GA 5KYYB 2L3QA 1NEBA 2CZ6B 2IPOB 3CPWA 2EPDA 4EIKA 2ZCFB 3QYGB 1NJIU 4OB0B 1K9MR 3AHUA 2RHXA 2CZ1B 2CSIA 3O8VA 2DETA 3S6WA 2CP6A 1D0YA 1OOTA 1QCNA 4C5EA 1NZ9A 3CC2A 1Y96B 3THKA 4AFZC 2HAXA 2F2XA 1YJNT 2KR3A 3SFMA 2HDAA 3CC7A 1QP2A 2RI3A 3I5RA 4HCCA 5LJ5g 4M7AB 3TQ7P 1PSFA 3OYHA 1U06A 3LW5E 2IG0A 2M9UA 2DX1A 3JCMf 1XQHA 1ZA2B 3L2VA 1Y0MA 2DRMA 2XG8D 1N9SA 2YLCA 2LJ0A 4PNOA 3X26B 3EFSA 4NOYA 3JCMQ 1FMVA 4IIOA 4M77A 2D0NA 1X75C 2R57A 4C0GA 2QA4Q 4R56A 4N0AC 3CD6Q 3EFRA 3OA6A 4C8QA 3IQLA 2X4JA 5GMKi 2DD5A 5D6XA 4M75F 3G6ET 4M78G 1KHCA 2Y4YA 1WGSA 4E7LA 1PRMC 2EYWA 5I2MA 2J05A 4EMKA 4PKCC 1H3ZA 4EMKB 1KIKA 3PT9A 1VQLA 1RUWA 5DLQE 1NBEB 1HK9A 2V8KA 4OF1A 3M55A 1Y57A 2E3IA 4EMGA 4M75D 1KQSP 1D1AA 2CSQA 4PJOC 2LCLA 1N6AA 3MKDA 1OU9A 5KE2A 5A0DA 4C8QG 1UGRB 4BI3A 2YDLA 2CZ0B 2YXYA 3RUXA 1PD1A 4PJNA 2EQJA 2JS0A 3CCUA 4MDWA 1KD1R 4IURA 1P92A 2K5FA 3ULRB 1NJIR 4JDSA 4NS5A 1G3TA 2A7YA 4PLLA 4ZGDB 2IIMA 5J3BA 2FPDA 3CMET 2GTJA 2VKNA 4PFZA 2GTOA 3OS1A 3MJXA 2AK5A 4OMQA 1QQJA 4RG8A 2CKKA 2ED1A 2LC4A 1KFZA 1VQ8Q 1YP5A 3CD6A 4KGZB 2LMJA 1K9AA 4RTXA 1EIFA 1VYVA 4JUVA 1K73R 3JB9F 3ZEHA 2LJ1A 3RESA 4PLIA 2D9TA 1QWFA 1O75A 2AKKA 1CKAA 2K5LA 3QSUA 2CGHA 2JMAA 1VQKQ 2OJ2A 2RHUA 1W70A 3CC4T 1SHFA 2C06A 2LT1A 2L89A 4C0FA 2X4YA 4BI4A 1YWOA 4RTUA 1RADB 3TU4K 5A0LA 1C6VX 2QK0A 4M78B 3RKXA 3CXCP 4FCYA 4JJNK 4M78A 4FSXA 4WCIA 5GAN3 3JB9D 1VQKT 1TUCA 2DL5A 2W10A 2X4XA 1M1GA 4JRKA 4EMKC 1MMAA 2FPFA 2DFUA 4FT4A 1VQMA 4C92E 2AIRB 2QEXT 1UGSB 1MMNA 2HEQA 3EHRA 1WLPB 1BKBA 3A1PA 2Y4XA 1Y71A 5KE3A 3MEWA 2LQNA 3QZ9B 4LDXA 1RAGB 2RF0A 5GMKl 3TCJA 4N0AA 1YJ9Q 2CP5A 1I0CA 3E1SA 4OMOA 1Q86R 2RM4A 3M0PA 2ZPGB 4C92A 1KC8C 5GAMg 1JJ2A 3FEOA 3M59A 2V1QA 2FZGB 4JLGA 2LQWA 4FIBA 2M02A 1BK2A 2LQKA 3MEAA 1K9MU 4HCBA 5C6SA 5LL6S 5GANf 1KC8U 5LJ3f 3ZFJA 2C0IA 2KY9A 4AT1B 2DL7A 3OYEA 3LH0A 5IHIA 2DBMA 3A8HB 3MP1A 3R6NA 5IAYA 5IT9E 1NPRA 1W4SA 1AWXA 4RTZA 3VJPA 1NYFA 4AFUC 2VB6A 2DPPB 4PJJA 3EGXA 1U1SA 4J6YA 2E41A 3CEYA 1WQWA 4KULA 4QKUA 1YJWT 3X24B 4LNPA 1RAAB 2JOYA 2LTOA 2V8JA 4M7DG 2BZXA 4KBMB 4RG2A 2OAWA 2ZPFB 5CO7A 1G3YA 5GMKm 3OYFA 2DERA 3O5ZA 4PK4A 1VQOQ 3HRTA 5FW9A 9ATCB 2FRYA 1JJ2S 1NLOC 1T3SA 1X01A 1KG1A 3UA6A 2KBTA 4BE1A 5IN1A 4XU1A 2V1RA 1OULA 1ZSZB 2CT4A 1QKWA 1JEGA 3NTIA 3M0UA 5CKDA 3NMZC 2DXUA 3NPFA 4J9HA 4E2FB 4BDYA 3CCVQ 2OTLQ 5DY9A 4V2SA 1Z9ZA 3QBYA 4HCZA 5GAN6 4X9CA 1PM3A 1JB0E 1HSQA 3BDLA 4A63B 1N5ZA 1WHGA 1KD1C 2FB7A 5J26A 4HVUA 1N8RC 4FW1A 3CMEA 3WVDB 3CBMA 2EAYA 1MV3A 5ECAA 1VQNA 1OQKA 1VQMQ 3OYMA 1QVFS 1I8FA 4J6WA 1M3CA 4PJOD 2ECZA 3QJYA 4OGEA 5KYUA 3OB9A 1ZQ1A 1BI0A 2H3EB 1YI2Q 3SEMA 3OBWA 3EGDB 1D0ZA 5FRMA 4JRIA 2RK2A 3QPHA 2L3SA 3OYCA 2QGFB 1H8KA 2DLPA 4IUPA 1KHIA 3HPWA 2PZ1A 4HCKA 2QAZA 3I9QA 4Z89A 2EGEA 4Y91A 3T9NA 4AFQC 2VC8A 2ROTA 4XTZA 4E7KA 2M51A 3L42A 1O9SA 3M54A 4QVCA 2HKNA 4X1VA 2DBKA 4M78C 4C92C 2KI7A 1PHTA 3ME9A 3JCMJ 1WQ7A 2XICA 4J9IA 3PIOA 1D3BB 2KVQG 2QQSA 1Q82C 2LQ8A 3UPUA 3H41A 1G2BA 1NYGA 1WJRA 4PJOB 4M77E 3OYIA 3URGA 3META 2ZAEA 4L5GA 4FYVB 1YBYA 1VQMT 4NL2A 2ZPIB 2JNGA 3A8LB 1WZOA 1JXOA 2JM9A 4C92F 3V7SA 2NUPB 3EG0A 4ZTJA 1QVPA 2DF6A 1VQKA 5EC7A 1C1AA 1UEBA 4JS5A 1BCMA 1OPLA 4GLKA 2NUTB 3UF4A 4LN2A 1SRMA 4RCCA 1AVZC 3PFSA 1H92A 2RB6A 2X4WA 4E6RA 2PNIA 3MEUA 3CC4Q 2A37A 3I35A 1GCPA 2D8JA 1VQ8A 1VQ9T 5LJ3d 3OYNA 4J83A 4E7SA 2DZCA 4O6JA 2VUBA 2W0ZA 2E10A 3CC2T 1VQPA 3JCMe 3TSZA 2JVVA 1IGQA 3I55Q 3GPLA 2D8HA 1VQNT 1WNLA 4HA8A 3CCUQ 2YUPA 3CCLQ 1YJNQ 3G4ST 2F1LA 4XTVA 2CDTA 1RAEB 4C5HA 2LNHB 4M7AC 1LNXA 1B7TA 4EMHA 1GBRA 2EJGA 1NE8A 1MV0B 4M77B 4XAXB 1SKUB 2ABLA 2BZYA 2K4YA 2DNUA 1M1KC 3CCUT 5LJ5d 2J6FA 5HCKA 2BE7D 1Q7YU 4Y28E 2YRVA 2O01E 3VS4A 3CXCS 2AT1B 1TG0A 1TWBA 1YJNA 3CCJQ 3CXCA 3QDRB 1GCQC 4ZN3A 5EG2A 1VQ7Q 2J6KA 2RO0A 1B07A 4FYYB 5GAMh 2DM1A 4F16A 2R5MA 1VQPQ 5KYUB 1GBQA 4LDWA 1VQ6A 1RACB 2CP0A 2YRCA 3LH5A 1PKSA 3RMSA 3VYGA 3L2QA 2HL3A 1BIBA 1M4ZA 2QASA 4Z8AA 5GAMf 4IKFA 1WXUA 4L59A 2K3BA 3JAME 1WFWA 1BI2A 1SEMA 1T3LA 1PWTA 1UGQB 2DL4A 4C92G 5IXBA 4DEYA 4F7UA 2DEQA 3OYAA 4XTYA 1K0SA 1M5Q1 3QIIA 2RHIA 1X43A 2DZ9A 3X20B 3CC7Q 2RHYA 3JCMX 4A4EA 4X34A 4C0DB 2RHZA 2XKOC 3CCQQ 1N27A 3OYKA 1N8RU 2EGCA 1AT1B 2EKHA 1VQ6Q 1LCKA 1M3BA 3DB3A 2PUKB 2JJ9A 4R55A 1QVGS 5HY6A 3EG9B 3CCRA 2F5TX 1K73C 3I56T 5CIUA 3VRZA 2NLUA 3E2UA 1UGPB 1M27C 5D6YA 3CMAA 2DTIA 5IH2A 5J39A 4KH0B 3SDZA 4M77C 2ZPEB 3M5AA 1VQ7A 2JUFA 1VOMA 1Q82U 3PGGA 5FLXE 5FWBA 2P84A 2VVKA 2NUTA 4M77G 4BI8B 1D3BA 3CCMA 2NYSA 4DA4A 6AT1B 2DEUA 4JLIA 2J6OA 1K1ZA 5GAOr 2YUQA 1YITQ 3M56A 3PE0A 4OVAA 4DEXA 1OX8A 2K3YA 3BW1A 1ABQA 5GANh 4LUDA 1JRIA 1Z9QA 1RL2A 5CQYA 2MF2A 1M9SA 2FZKB 3HP9A 4IUVA 4QT7A 5KYYA 4RMOA 5GANe 2WSFE 4B6MA 2E3HA 5CVIA 1YITT 1TH7A 5LJ3e 3G71A 3CCEA 2EGAA 2RJDA 3QYHB 5CK9A 2JW4A 4KRTA 5KCOA 1MMGA 2EYZA 3GNGA 4P5NA 3NHNA 3QZ5B 3OQ5A 2KMTA 2J06A 3VU3C 4JJDA 3SWNC 2RJCA 5CKBA 4XTWA 3DLMA 4PJOA 2K2VA 4L6V5 3M9QA 1GL5A 2OTLA 1R0BG 1QVFA 2QEXQ 3JCMc 3JRZA 3CC4A 2JXBA 1M2VA 2NUPA 4CC2A 3HFOA 2HL5C 2LP5A 5CKEA 3JCMh 1Q7YC 5CAIA 3ZL7C 3LYIA 4M7DA 2X3XD 2KGTA 4M7DB 1OZ3A 2K6DA 3S3NA 4F04B 3LWHA 2DIGA 3OBYA 4EDUA 3VUBA 1Q7YR 2B86A 1IZ6A 2O4XB 2QQ9A 3VKIA 5L23A 3CQTA 1VQ4Q 4E47A 3TEEA 2C0OA 2DJQA 2M0OA 1UB4A 1PC0A 1H641 1A0NB 3OS5A 3D7SB 5FU6B 4Z88A 1X2KA 1Q81C 1W2BS 1LJOA 3TVTA 1M1FA 2GQIA 2DRKA 3C95A 1Q82R 1PCXA 4ZTFA 1YN8A 2EVRA 2JZ2A 2DO3A 4JJBA 2AZSA 4XU3A 4M78E 4M7DD 3DLLA 1JJ2P 2SEMA 5CR2A 1Y07A 1NJIC 2HSPA 2L3PA 2VXFA 4RKUE 3G6EQ 1AEYA 4E7HA 1UDLA 1KD1U 4YTLA 2DE0X 3J81E 4AMCA 3NGPA 3P8HA 1HJDA 2QYZA 3FDRA 4M75B 3QXEB 1E7OA 3AT1B 5LJ3j 4M75E 2NWMA 1SSHA 1ZSZA 5FRNA 4M7DF 4FM4B 1ZLMA 1YJ9A 2QA4T 1AZGB 1WDXA 1S1NA 4FU6A 3PTAA 1K73U 4D8DA 1HD3A 2KXCA 1ZBXA 3UDCA 1AWWA 5GJWB 3OYLA 5GMKe 3CCJT 2GQVA 4J9BA 3G7ZA 1BI3A 1IRXA 1PRLC 4GLMA 2CUDA 4LDUA 2ZPBB 1PG5B 1E6HA 2K3XA 2L8DA 2RD1A 3N5BB 1QLYA 4M78F 3GLXA 3V7CA 2P0KA 4KUIA 2ZPHB 2F5KA 5HK3A 4BE0A 2EWNA 4TVRA 3CBPA 3QKJA 1WIEA 1PKTA 1VQ4A 2LRQA 1MHNA 1VQ9A 4JZ3A 2BE9B 3EAEA 3L2UA 1MNDA 3VUZA 2PQWA 3PMTA 1WPYA 5M9OA 4IUQA 2COWA 3NFCA 2JM8A 4M7AE 2M1HA 4KT0E 3L2WA 4BDZA 4AFSC 1C0MA 2DVEA 4M78D 1VQ5Q 3EHQA 4QVZA 3DKMA 1W2BA 1JQQA 2MOXA 3I55T 1V76A 2QGGA 1S72T 2AHJB 2FO0A 4DOWA 1T0JA 5GMKh 3C12A 1G3SA 3GBQA 5GAOp 4JPBW 3G4SQ 3CCQT 3TSWA 5L8RE 1YHQA 2AKLA 2Z0WA 4DBQA 2GGRA 4ATOA 1D1CA 3JCMP 1M8MA 1IREB 1Q95G 2XK0A 3F70A 1QCOA 5GJVB 2LX9A 5KYWB 1KQSA 2QDYB 1R8OB 2FPEA 1WXBA 2EQMA 3LLRA 2E6ZA 1ZBJA 2E4HA 2DVJA 1GFDA 3L1AA 2XDBA 1VQ7T 1N8RR 4C8QD 4BY6B 2R5AA 4KH1B 3HRSA 3JB9G 4FYWB 1G8XA 3A8OB 1M30A 1VQLQ 3EFOB 4JRQA 4ZGJB 1TXQA 2YUNA 2K57A 1LOJA 1JO8A 1S72Q 2E1HA 1X6GA 2FL7A 2BUDA 5GMKj 2OTJT 2JN0A 2M0YA 4JS4A 1YJWQ 2DD4A 3QWXX 2P0QA 2F69A 3PVQA 1XNIA 3QWYA 3HTRA 3V8KA 2P4TA 2KSSA 1R77A 2E5KA 4MDXA 1ACMB 3V8LA 3DB4A 3SWNB 5LJ5f 4ORZA 4QVDA 4E7JA 4J9EA 4F7UG 1D1BA 1AZEA 1GCQA 3M0SA 4OMPA 4DBFA 1TTHB 1VQ6T 1IB8A 2IVWA 1YIJQ 2P4RA 1I07A 1PSEA 2LCSA 4A4KA 4KUDK 3OYBA 3HHTB 2E70A 4PJOE 4MZMA 1SPKA 2CT3A 3EGDA 4XTXA 1BB9A 1ZUYA 1X6OA 4HT8A 3CPWP 4WF2A 1AD5A 5I21A 1GXIE 3FB9A 2HD0A 2EYYA 1YJWA 2COZA 4GBQA 4RTVA 1BBZA 4HVVA 3G71T 3CCET 3OS0A 4OP0A 3EGXB 5FWCA 2KAFA 2HQEA 1LPLA 2ZZDA 3A8MB 1RAIB 1X2QA 1KJWA 3H9NA 4C0ZA 3CCST 2QDLA 1KC8R 1W1FA 3SB2A 4PJOF 3A98A 3OYDA 4R0KA 2YHTA 3UWNA 4ELYC 3RMQA 1I5OB 4OB2B 2MYSA 3CCSQ 1SF9A 3OSVA 1WA7A 1QMCA 5KH6A 1EX4A 1JXMA 3M4YA 2GFUA 2HSEB 3VS0A 3QG1A 2EYQA 3I56A 5CCAA 5GANj 3HRUA 3CCRT 1K8AU 2LT4A 4II1A 2R58A 3JB9H 4DQ2A 2HQXA 5DLOA 1KQ1A 2VGMA 3GOXA 1CKBA 5LJ3g 3OYYA 2LDMA 3JSCA 1VUBA 2MAMA 5GANg 1QW1A 2HMAA 4N4IA 2RQRA 3A5ZB 4J7IA 4C92D 1M90R 1OYXA 1ZHIA 4M75C 3GF5A 5GAN5 4FL6A 2DL3A 1VIFA 4F14A 4IIMA 4HXJA 3QUIA 4FT2A 4F7UF 4EPCA 4KGXB 4J9GA 1FXXA 4M7AF 4LD6A 3G4SA 4MZTA 1NG2A 3L2ZA 4XU0A 1OV3A 2H8HA 1W6XA 3CC2Q 3EG9A 4M7AA 3M0QA 4KGVB 2K79A 2ED0A 2XU8A 3REAB 2KROA 1PD0A 2GBQA 1OI1A 1FX7A 1WXTA 1M90U 3CCLT 3VRYA 2HBPA 3GP8A 1NPPA 4RTYA 1FMWA 3MHXA 4M7AD 1IXDA 1B34A 3OMGA 4XU2A 5KCHA 4E7ZA 4IUUA 1RAFB 2HCKA 2GF7A 3L2RA 3S3OA 3JCMV 1Q86C 1WI7A 3PIPA 2JT4A 1JBMA 2CP3A 4HKEA 1BIAA 3M53A 2CS7A 4M75G 1EZZB 1QVFP 3MCAB 3CPFA 2FHDA 4C8QC 2RPNA 1KQSS 1VQNQ 2VXEA 2FEIA 3VS3A 2RN8A 4XTUA 3FRNA 5GAOn 4LUEA 1VQPT 4VUBA 4B9XA 4BUGA 1XTDA 2YLBA 3A8GB 3JCMb 2DXCA 1KK7A 3EH1A 3PVLA 1D0XA 2JMCA 1I1JA 1VQ8T 3HKSA 2EFIA 4LDYA 3I5SA 4ZN1A 1ZSGA 1HXDA 4C8QB 4WTOB 1IGUA 3P8DA 3JCMW 2KXDA 1YI2A 4FSSA 1FYNA 1VQLT 1MMDA 2G3RA 2LVMA 3KUFA 2KYBA 1WHLA 4XQ3A 2DMOA 1X69A 5HKCA 1T0HA 3INZA 1M2OA 4RUGA 1K8AC 2DYIA 2KRMA 5CKHA 1ZSZC 2M16A 3OW2A 1UFFA 4J9CA 1W2BP 3S3MA 2E5QA 4NL3A 1WHMA 4E7IA 1XJWB 1X27A 1VQOA 2O4XA 5GAN2 2VASA 1UG1A 2D1XA 5D7UA 2BKDN 1JU5C 1MGQA 4OMNA 4M7AG 1WJSA 2MI6A 5LJ5h 2K5IA 2QI2A 2KRNA 2K2MA 2YT6A 3JB9J 1RI9A 1VYTA 2RJEA 3REBB 1FMKA 2X35A 2RQVA 3PNWC 2QQBA 3OS2A 4C5IA 1TU0B 4BE2A 2KK4A 3E9GA 1IHVA 1U8RA 4ME7A 2KE9A 3X28B 4DOVA 2QTVA 3RBBB 5FU7C 1RLQC 4RTWA 2E6NA 3CC7T 1B3QA 2EQIA 1IHWA 1WHJA 1D09B 2LZ6B 2DKGA 1V29B 4ZNXA 4C8QF 1UHCA 2NUZA 2VWFA 4LDVA 2MIOA 3KFVA 4B9WA 2EJ9A 3MPUB 3I56Q 2DXTA 3H6ZA 3VS2A 2EKOA 4Y92A 1MUZA 3M57A 2ZGWA 2RK1A 3H0IA 2ROLA 2ENMA 3G71Q 3CCEQ 1AHJB 3QDFA 2D6FA 1AWOA 2A28A 1QKXA 4D6WA 3CCSA 2VGNA 5D6WA 2A36A 2FZCB 3OW2P 2EIFA 3VV0A 1I5LA 2MPXC 4M77F 2QEXA 1E6GA 3CPWS 2O9SA 1K8AR 2BZ8A 2PVOB 1K0XA 1ZUKA 3ER0A 4J8OA 2CREA 2RMOA 5A2QE 4PFPA 2C0TA 5DM7R 4LE9A 2EQUA 5IHNA 1SG5A 1QWEA 2CP2A 2LX7A 3J7AF 1SRLA 2PTKA 2XMFA 3CCRQ 3HFNA 2CH4W 3GNFB 1F1BB 2KEAA 1VIEA 1OPKA 2EJFA 3KBGA 2XI9A 3ASKA 2EBPA 2CUBA 1OU8A 3QHSA 4DBRA 4GY5A 1KSWA 2CYZB 4O5VA 4UC4A 3CD6T 3CCMQ 2JTEA 4M7DC 1FWZA 1YIJA 4OMFB 3VS6A 4J5YA 2OI3A 4OGCA 3VYHB 4N4HA 3JCMd 5CKFA 3FJ5A 3M0RA 4J7FA 1IO6A 2OTJA 4J9FA 2YRDA 4A53A 3RDVA 4BB7A 1B34B 3BDUA 2E12A 3JB9I 4BY6C 1VQOT 3CCQA 2GNCA 3SWNA 1YCSB 3FIFA 4OMMA 2OTJQ 2K9GA 1TUDA 1GFCA 2K7AA 3NTHA 4A54A 5GAMe 3OSSC 2DTOA 4JZ4A 1G3WA 2RQWA 4PJLA 4X9DA 2O9VA 3EGUA 5I11A 1YI2T 2LJ3A 2CP7A 1UUEA 4MMKA 3R6OA 5GAOl 1N9RA 4PL6A 1WHKA 2I0NA 2YUOA 1VQ4T 1BCOA 5FROA 4OB3B 3HL8A 1UECA 5GANd 1Q81U 4D8KA 2HQHA 2RQTA 2I2LA 3V8JA 2FVUA 5CQXA 4A4GA 1ZA1B 3U23A 3VS7A 5AT1B 4CI0C 1S72A 1QVGP 4ZGEB 2DXBA 3CCJA 3I55A 1OEBA 1LVKA 2PVGB 3E9FA 3JV3A 1QVGA 1RAHB 1X6BA 3M58A 3MP6A 2KNBB 3SHWA 3RR6A 3LX7A 4M4ZA 2QA4A 2RJFA 4LD9K 1Y7XA 2MWPA 2MWOA 1GRIA 4JRPA 3WXMB 2L3RA 2RNAA 3CCLA 3QO3A 4M75A 1WX6A 1BI1A 2YSQA 2J7IA 4CC3A 2O2OA 2DK3A 5KYWA 3H8ZA 1NEGA 4RTTA 2ESWA 1ZUUA 3PMIA 4XK8E 4FYXB 2JTMA 5KYXB 4PJOG 5HK0A 2O31A 3MEVA 1YFNA 5I22A 1YHQQ 2G6FX 4J6XA 4ANJA 5GAOm 5IHKA 3VS1A 3P8BB 2HZYA 3WVEB 3CBOA 4LXCA 4F17A 8AT1B 3MO8A 2CZ7B 4C8QE 2WSEE 3J80E 2KYMA 1VA7A 3RIRA 1Q81R 4QQDA 1YWPA 4F7UE 4K11A 5KYNA 3UA7A 3EG3A 1VQ5A 1YHQT 1PNJA 2OX7A 3C0CA 5GAMj 2VV5A 2KT8A 4DBHA 4F7UB 1KQ2A 1VQ5T 2X3WD 3FLGA 3SD4A 2P0PA 2CH4A 5AYFA 3TREA 2KQWA 3EG2A 1NLPC 2E64A 2KDSA 1VQ9Q 2XD0A 3UATA 1BYMA 2WACA 2JTFA 2L2PA 3H0HA 4PFOA 3E19A 3EFOA 4ELZC 1U3OA 2XIDA 4A4FA 1ARKA 3LGFA 1SHGA 2F2WA 1TS9A 2FYKA 4MMLA 1QCFA 3RKYA 1QP3A 2LNVA 2DILA 4M7DE 3BY7A 1ABOA 5FU6C 1M1KU 2HBWA 1UHFA 4Z02A 2DA9A 3G6EA 2XHCA 1XOVA 1OZ2A 4QQ6A 2D0QB 2KT1A 3M4GA 3OW2S 5LJ3h 1AOJA 2DTHA 7AT1B 1I4K1 1V1CA 2WSCE 2L5QA 1K76A 4BD3A 2V8IA 5A0GA 2DJZA 4CRIA 3RNJA 4CC7A 5FU7B 1UJYA 4MZPA 1ZX6A 5LJ5e 1YJ9T 2EQKA 8ATCB 3CMEQ 4AG2C 1BU1A 1MNEA 4PJMA 1DJ7B 1UJ0A 2RI2A 2RH2A 1Y96A 3QJ6A 1M3AA 4FW2A 1U5SA 2DAQA 1HYOA 2A3LA 2KRSA 4Q5WA 2QQAA 3CCVA 4QW2A 2PUOB 4ESRA 1SSFA 1M2VB 2L0AA 3OMCA 2FRWA 4AG1C 2OTLT 2SRCA 4C92B 5GAOq 1Q86U 3CCMT 4BACA 4RCBA 3HSBA 5GAMd 1K9MC 2COYA 2O88A 3M0TA 2EYXA 2MK5A 3GIBA 2PVDB 2QTXA 2OAUA 3G1JA 1TSFA 1G83A 1YNZA 3C4SA 1WHHA 3Q1JA 1M90C 4M77D 1J3TA 2GFAA 4JJCA 3EH2A 3V7RA 2B8AA 3MP8A 2VYTA 3LGLA 3FJPA 2QG9B 2JS2A 3UT1A 2ATCB 1I81A 2LCCA 3BE3A 2HKQB 3C94A 2H3JA 1H3HA 2FG0A 1RABB 1RI0A 1YIJT 1CSKA 4C5GA 3X25B 1UE9A 1VYUA 2Y90A 2DL8A 2A0FB 2HNIA 1TUGB 5I2SA 1EFNA 4CC4B 3VS5A 4OB1B 3CMAT 4C0DC 2BTTA
chains in the Genus database with same CATH topology
1MHNA 4C8QF 3ZBDA 3EAEA 3L2UA 3JCMg 4Y91A 3VUZA 4LDVA 1M8VA 3T9NA 2PQWA 5GAN8 3FC3A 2VC8A 3PMTA 4B9WA 2EJ9A 2QXFA 1WPYA 3BFMA 3OY9A 2DXTA 3H6ZA 5M9OA 2EKOA 4IUQA 3NFCA 2BIVA 4XTZA 4M7AE 3M57A 2ZGWA 2M1HA 4KT0E 5GAN7 4E7KA 3LWIA 2RK1A 3CCVT 3NTKA 3L2WA 4BDZA 5C0MA 1AHJB 3L42A 1O9SA 3M54A 4QVCA 2DVEA 4M78D 4QVZA 2D6FA 4M78C 4A4HA 4C92C 3ME9A 3OYJA 2MMPA 4D6WA 3CCSA 3DKMA 1W2BA 2VGNA 2XDDA 5D6WA 3JCMJ 1WQ7A 2XICA 3PIOA 3I55T 5LJ5j 1U1TA 2EIFA 1D3BB 2KVQG 1WJQA 2E65A 2QQSA 4QQGA 1Q82C 2LQ8A 3UPUA 3VV0A 1S72T 1I5LA 3OYGA 2AHJB 4DOWA 4HT9A 4M77F 3RKWA 2QEXA 5GMKh 1WJRA 2QQRA 3CPWS 4M77E 4PJOB 2RA2A 3OYIA 3URGA 3C12A 1G3SA 3META 2PVOB 5GAOp 4L5GA 1YBYA 3ER0A 4J8OA 3KXTA 3CCQT 2RI5A 5L8RE 1VQMT 4NL2A 1YHQA 1YITA 2ZPIB 2XDPA 5A2QE 4IUTA 3RERA 2JNGA 3A8LB 2GCXA 4ATOA 1G5VA 2DIQA 4C92F 3V7SA 5DM7R 3JCMP 4ZTJA 1QVPA 1YCYA 2PU9B 5GAN4 4N4GA 1VQKA 1IREB 2EQUA 2CZ6B 2XK0A 1UEBA 3F70A 2LX9A 4JS5A 3CPWA 2ZCFB 3QYGB 1NJIU 2QDYB 1KQSA 1R8OB 4GLKA 4OB0B 3J7AF 3AHUA 2RHXA 2CZ1B 4RCCA 3PFSA 2EQMA 3LLRA 3O8VA 2E6ZA 2RB6A 2X4WA 3S6WA 3MEUA 3HFNA 3GNFB 3L1AA 4C5EA 1NZ9A 1VQ8A 2XDBA 1VQ7T 4C8QD 3CC2A 1Y96B 2HAXA 4BY6B 1VQ9T 5LJ3d 3OYNA 2R5AA 4J83A 3HRSA 1YJNT 3JB9G 2DZCA 4O6JA 2VUBA 3SFMA 1VIEA 2E10A 2EJFA 3KBGA 2XI9A 3A8OB 1QP2A 3ASKA 3CC7A 1VQPA 3JCMe 3CC2T 2RI3A 4HCCA 5LJ5g 3QHSA 2JVVA 4JRQA 4M7AB 1PSFA 4GY5A 2CYZB 4O5VA 4UC4A 4ZGJB 3OYHA 3CD6T 4M7DC 3GPLA 3LW5E 2IG0A 1FWZA 2K57A 1LOJA 1XQHA 2M9UA 3JCMf 4OMFB 3L2VA 1YIJA 2E1HA 2XG8D 4J5YA 1N9SA 4OGCA 1VQNT 1WNLA 2YLCA 4HA8A 2FL7A 2BUDA 4PNOA 3VYHB 4N4HA 5GMKj 4OB1B 3JCMd 2OTJT 3G4ST 3X26B 5CKFA 3EFSA 4NOYA 4XTVA 2JN0A 4C5HA 4M7AC 4JS4A 1LNXA 4EMHA 3JCMQ 4M77A 2R57A 2EJGA 1X75C 4J7FA 1NE8A 2DD4A 4C0GA 2OTJA 4M77B 4A53A 4XAXB 4R56A 4N0AC 2P0QA 4BB7A 1B34B 2F69A 1XNIA 3BDUA 2E12A 3EFRA 3V8KA 2P4TA 2KSSA 4BY6C 3JB9I 3OA6A 2K4YA 4C8QA 1VQOT 3CCQA 1M1KC 2X4JA 3CCUT 3SWNA 5LJ5d 5GMKi 2DD5A 4MDXA 3FIFA 5D6XA 4Y28E 3V8LA 2YRVA 4M75F 1Q7YU 3DB4A 3SWNB 5LJ5f 2O01E 3G6ET 4M78G 4QVDA 1KHCA 4E7JA 2Y4YA 3CXCS 3NTHA 4A54A 4BUGA 4F7UG 1WGSA 1YJNA 4E7LA 5GAMe 3OSSC 3CXCA 3QDRB 2DTOA 4ZN3A 5EG2A 1VQ6T 5I2MA 2IVWA 2RO0A 1G3WA 4EMKA 5GAMh 1PSEA 4X9DA 4PKCC 1H3ZA 4EMKB 4A4KA 4KUDK 3OYBA 3PT9A 1YI2T 1VQLA 2R5MA 3HHTB 5DLQE 1HK9A 2V8KA 2E70A 4OF1A 4LDWA 4MZMA 4MMKA 3M55A 3R6OA 4XTXA 4PJOE 5GAOl 1N9RA 1VQ6A 4PL6A 1X6OA 4M75D 4EMGA 4HT8A 4WF2A 1VQ4T 4PJOC 5I21A 5FROA 2LCLA 4OB3B 3RMSA 1GXIE 1N6AA 3HL8A 3FB9A 3VYGA 3L2QA 2HD0A 1BIBA 5KE2A 5GANd 1M4ZA 5A0DA 1Q81U 4C8QG 1UGRB 4BI3A 1YJWA 5GAMf 4IKFA 2CZ0B 4L59A 2I2LA 3RUXA 4M7AG 3V8JA 3G71T 3CCET 3JAME 2FVUA 1BI2A 5CQXA 3OS0A 2EQJA 4A4GA 1UGQB 3CCUA 4OP0A 4MDWA 2KAFA 2HQEA 4C92G 2ZZDA 4CI0C 4IURA 4F7UA 1P92A 2DEQA 4ZGEB 3A8MB 3OYAA 2K5FA 1S72A 2DXBA 4XTYA 3CCJA 4JDSA 1M5Q1 1G3TA 2A7YA 3QIIA 4NS5A 4PLLA 4C0ZA 4ZGDB 3I55A 3CCST 2RHIA 5J3BA 2DZ9A 3CMET 2PVGB 3E9FA 3X20B 2RHYA 3JCMX 3SB2A 4PJOF 4A4EA 3OS1A 1VQ9A 1QVGA 3OYDA 4X34A 4C0DB 2RHZA 2XKOC 1N27A 3M58A 3MP6A 4RG8A 2CKKA 3OYKA 1N8RU 2YHTA 2LC4A 3LX7A 3UWNA 4ELYC 3DB3A 2PUKB 3CD6A 4R55A 1QVGS 5HY6A 2QA4A 3CCRA 2RJFA 3RMQA 2F5TX 1K73C 4LD9K 4OB2B 3I56T 5CIUA 1EIFA 1Y7XA 2MWPA 2MWOA 4JRPA 2NLUA 4JUVA 3WXMB 1UGPB 2L3RA 3OSVA 3JB9F 3ZEHA 3CMAA 5D6YA 2DTIA 3RESA 3CCLA 5J39A 3QO3A 4M75A 5KH6A 1BI1A 3SDZA 4PLIA 2ZPEB 2D9TA 3M4YA 4M77C 1O75A 2K5LA 2DK3A 3M5AA 1VQ7A 3QSUA 2GFUA 2CGHA 2JUFA 3QG1A 1Q82U 3PGGA 2EYQA 3H8ZA 5FLXE 4M77G 4BI8B 5CCAA 2RHUA 3PMIA 1D3BA 3HRUA 4XK8E 3I56A 3CCMA 5GANj 3CCRT 2JTMA 4DA4A 3CC4T 1K8AU 4JLIA 2C06A 2LT1A 2L89A 2LT4A 5HK0A 4PJOG 3MEVA 4II1A 4C0FA 2R58A 2X4YA 5GAOr 4BI4A 3JB9H 3M56A 4OVAA 4DQ2A 2HQXA 4J6XA 5DLOA 1KQ1A 2VGMA 2K3YA 3BW1A 5GAOm 3TU4K 5A0LA 4M78B 3P8BB 3RKXA 3WVEB 5GANh 4JJNK 3GOXA 4M78A 1JRIA 3CBOA 5LJ3g 1RL2A 3OYYA 4FSXA 3JB9D 3MO8A 5CQYA 5GAN3 2LDMA 3JSCA 1VQKT 2CZ7B 1VUBA 4C8QE 2MAMA 2MF2A 1M9SA 2WSEE 2X4XA 3HP9A 4IUVA 3J80E 1M1GA 5GANe 2WSFE 5GANg 4RMOA 3RIRA 4JRKA 4EMKC 4QQDA 5CVIA 1QW1A 4F7UE 4N4IA 3A5ZB 4FT4A 4J7IA 4C92D 1YITT 1VQ5A 1YHQT 1VQMA 1OYXA 1ZHIA 4M75C 4C92E 1TH7A 5LJ3e 3G71A 5GAMj 3CCEA 2VV5A 4F7UB 2RJDA 3QYHB 2QEXT 3GF5A 1KQ2A 1UGSB 5CK9A 4FL6A 5GAN5 1VQ5T 1BKBA 5KCOA 3FLGA 1VIFA 3GNGA 4P5NA 3SD4A 2P0PA 3QUIA 3QZ5B 5AYFA 2Y4XA 1Y71A 2KMTA 3OQ5A 4FT2A 4F7UF 4EPCA 3VU3C 3TREA 5KE3A 3SWNC 2KQWA 2RJCA 5CKBA 3MEWA 1FXXA 2E64A 2KDSA 4XTWA 4M7AF 3QZ9B 4LD6A 4LDXA 2XD0A 3G4SA 3DLMA 5GMKl 4MZTA 1BYMA 2WACA 4PJOA 2K2VA 4L6V5 2JTFA 3M9QA 3TCJA 3L2ZA 4XU0A 2OTLA 4N0AA 1QVFA 3E19A 4ELZC 4M7AA 3JCMc 3JRZA 2XIDA 2XU8A 3CC4A 3E1SA 4A4FA 1OI1A 3LGFA 2FYKA 4MMLA 3HFOA 2RM4A 3RKYA 1QP3A 2LNVA 1FX7A 2ZPGB 4C92A 1KC8C 5CKEA 3JCMh 1M90U 5GAMg 1JJ2A 1Q7YC 3FEOA 4M7DE 3CCLT 3BY7A 5FU6C 3M59A 5CAIA 3LYIA 1M1KU 2HBPA 4M7DA 3GP8A 1NPPA 4Z02A 4M7DB 1OZ3A 3G6EA 3MHXA 4JLGA 3S3NA 4M7AD 2XHCA 1XOVA 1OZ2A 4FIBA 3LWHA 4QQ6A 2D0QB 2LQKA 1B34A 3MEAA 1K9MU 3OMGA 2DIGA 4XU2A 5KCHA 4HCBA 4IUUA 5C6SA 3OBYA 5LL6S 5GANf 4EDUA 1KC8U 3M4GA 3VUBA 3OW2S 3VKIA 1IZ6A 2O4XB 2QQ9A 5LJ3h 2DTHA 2GF7A 4E47A 3TEEA 5LJ3f 3L2RA 3ZFJA 2KY9A 1I4K1 3JCMV 3S3OA 3OYEA 1Q86C 2WSCE 2M0OA 3LH0A 1UB4A 3MP1A 2L5QA 3A8HB 1H641 5IAYA 3PIPA 1JBMA 4BD3A 4HKEA 5IT9E 1NPRA 2V8IA 1BIAA 3OS5A 3M53A 2CS7A 1W4SA 5A0GA 4M75G 2DJZA 3VJPA 4CRIA 3MCAB 5FU6B 2DPPB 3CPFA 2FHDA 1Q81C 1W2BS 1LJOA 4C8QC 1KQSS 5FU7B 1M1FA 1U1SA 2VXEA 4J6YA 4MZPA 2E41A 5LJ5e 4XTUA 1YJ9T 2EQKA 3C95A 3FRNA 5GAOn 3CEYA 1VQPT 1WQWA 4KULA 4ZTFA 1YJWT 2JZ2A 1DJ7B 4VUBA 2DO3A 2JOYA 1XTDA 2YLBA 3A8GB 2LTOA 2V8JA 3X24B 4B9XA 2RI2A 3JCMb 4M7DG 4KBMB 2DXCA 2RH2A 4RG2A 1Y96A 3QJ6A 2ZPFB 4XU3A 4M78E 5CO7A 4M7DD 3DLLA 1G3YA 1VQ8T 3HKSA 2EFIA 4LDYA 5CR2A 1Y07A 4ZN1A 5GMKm 3OYFA 2DAQA 1HXDA 1NJIC 2A3LA 4Q5WA 4C8QB 2QQAA 3HRTA 3CCVA 3P8DA 2VXFA 3JCMW 4QW2A 1YI2A 2PUOB 4RKUE 1SSFA 4E7HA 1VQLT 1JJ2S 2G3RA 3OMCA 1KD1U 2LVMA 3KUFA 2OTLT 4YTLA 3J81E 1Q86U 4C92B 3P8HA 5GAOq 1X01A 3CCMT 1KG1A 4BACA 3FDRA 4RCBA 4M75B 4XQ3A 4BE1A 5IN1A 3QXEB 5HKCA 3INZA 4XU1A 3HSBA 4C0DC 5GAMd 1K9MC 1K8AC 5LJ3j 4M75E 5CKHA 3NTIA 2M16A 5CKDA 3GIBA 2DXUA 2PVDB 3OW2A 5FRNA 4M7DF 2QTXA 4FM4B 2OAUA 3S3MA 2E5QA 4NL3A 4BDYA 4E7IA 1YJ9A 5DY9A 2QA4T 1VQOA 2O4XA 5GAN2 4V2SA 3QBYA 4HCZA 5GAN6 4X9CA 3C4SA 3Q1JA 1M90C 4M77D 2BKDN 1MGQA 2GFAA 1WJSA 1JB0E 2MI6A 4FU6A 5LJ5h 3PTAA 3BDLA 1K73U 2K5IA 2QI2A 3V7RA 2B8AA 3MP8A 2VYTA 3LGLA 3JB9J 3FJPA 2RJEA 1KD1C 2FB7A 5J26A 1ZBXA 1N8RC 3CMEA 3UDCA 3WVDB 2X35A 3CBMA 3PNWC 2QQBA 3OS2A 3UT1A 2EAYA 1I81A 4C5IA 3OYLA 5GMKe 2KK4A 2LCCA 3CCJT 2GQVA 3E9GA 4BE2A 1U8RA 1VQNA 3C94A 3G7ZA 1BI3A 4ME7A 3OYMA 2H3JA 4LDUA 1QVFS 1I8FA 1RI0A 4J6WA 1YIJT 2ZPBB 4PJOD 4C5GA 3X28B 2RD1A 2K3XA 2L8DA 3QJYA 4OGEA 3N5BB 3X25B 4DOVA 3OB9A 4M78F 1ZQ1A 3GLXA 3V7CA 5FU7C 1BI0A 2E6NA 2P0KA 3OBWA 4KUIA 5FRMA 2Y90A 2ZPHB 4JRIA 2F5KA 2HNIA 2RK2A 3CC7T 5HK3A 3QPHA 3OYCA 5I2SA 4BE0A 2EWNA 4TVRA 4IUPA 1KHIA 2DKGA 1V29B 3CBPA 3HPWA 3CMAT 3QKJA 1VQ4A 2LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHN A;  2GFU A;  3H8Z A;  4CRI A;  2RHU A;  3PMI A;  3EAE A;  3L2U A;  1XNI A;  2FHD A;  2PQW A;  3FC3 A;  3OA6 A;  3PMT A;  4B9W A;  2L89 A;  3OY9 A;  3MEV A;  3H6Z A;  4II1 A;  2R58 A;  5M9O A;  2EKO A;  2X4Y A;  4IUQ A;  2BIV A;  5D6X A;  2YRV A;  4OVA A;  2M1H A;  2EQK A;  2HQX A;  3DB4 A;  4E7K A;  3CEY A;  3NTK A;  3L2W A;  2K3Y A;  4BDZ A;  5C0M A;  4ZTF A;  1KHC A;  2JZ2 A;  3L42 A;  4E7J A;  4B9X A;  2LTO A;  3NTH A;  2RI2 A;  4QVZ A;  3GOX A;  1WGS A;  4RG2 A;  4E7L A;  4A4H A;  3ME9 A;  3OYJ A;  3MO8 A;  3QJ6 A;  2LDM A;  5D6W A;  2X4X A;  4IUV A;  2EFI A;  1WJQ A;  2QQS A;  4QQG A;  2RO0 A;  3OYF A;  2DAQ A;  4QQD A;  3OYG A;  4Q5W A;  1H3Z A;  4N4I A;  3P8D A;  1WJR A;  2QQR A;  3OYI A;  4QW2 A;  1OYX A;  3OYB A;  3MET A;  2R5M A;  1SSF A;  4E7H A;  2RJD A;  2G3R A;  2RI5 A;  3OMC A;  2LVM A;  3KUF A;  4FL6 A;  2XDP A;  1G5V A;  4IUT A;  3P8H A;  5KCO A;  3FLG A;  4BAC A;  2DIQ A;  3SD4 A;  4PL6 A;  3FDR A;  4ZTJ A;  4BE1 A;  5IN1 A;  3OQ5 A;  5KE3 A;  5FRO A;  2RJC A;  4N4G A;  3MEW A;  2EQU A;  3L2Q A;  2XK0 A;  3NTI A;  4LD6 A;  3F70 A;  2M16 A;  5KE2 A;  3DLM A;  2WAC A;  5FRN A;  2JTF A;  3M9Q A;  4IKF A;  3S3M A;  2E5Q A;  4BDY A;  4L59 A;  4E7I A;  2RHX A;  3PFS A;  2EQM A;  2O4X A;  2EQJ A;  3LLR A;  3O8V A;  3QBY A;  4HCZ A;  4A4G A;  2X4W A;  3OS0 A;  2HQE A;  3C4S A;  3Q1J A;  4A4F A;  1OI1 A;  3LGF A;  3S6W A;  3MEU A;  2BKD N;  4IUR A;  3OYA A;  2GFA A;  1WJS A;  4FU6 A;  4C5E A;  3BDL A;  4PLL A;  4NS5 A;  3QII A;  2B8A A;  3MP8 A;  2VYT A;  3LGL A;  2RHI A;  2R5A A;  3OYN A;  2RJE A;  3FEO A;  3E9F A;  5J26 A;  3LYI A;  2RHY A;  4A4E A;  3OS1 A;  2X35 A;  3PNW C;  3OS2 A;  4Z02 A;  3UT1 A;  4C5I A;  3OYD A;  3ASK A;  4X34 A;  3OYL A;  4BE2 A;  2LCC A;  2RHZ A;  1OZ3 A;  2RI3 A;  3E9G A;  1N27 A;  3MP6 A;  3S3N A;  1OZ2 A;  3OYM A;  3OYK A;  2CKK A;  4QQ6 A;  3MEA A;  4GY5 A;  4UC4 A;  3OYH A;  3LX7 A;  2DIG A;  3OMG A;  3UWN A;  5KCH A;  2IG0 A;  4IUU A;  3DB3 A;  1RI0 A;  5C6S A;  3L2V A;  4EDU A;  4C5G A;  2RJF A;  2K3X A;  2L8D A;  2O4X B;  2GF7 A;  3OB9 A;  5CIU A;  2MWP A;  2MWO A;  2BUD A;  2NLU A;  2P0K A;  2E6N A;  2L3R A;  4N4H A;  3L2R A;  5FRM A;  3S3O A;  3ZEH A;  5D6Y A;  2F5K A;  3OYE A;  3OYC A;  2M0O A;  3LH0 A;  4C5H A;  4BE0 A;  3MP1 A;  5J39 A;  5KH6 A;  5IAY A;  4IUP A;  2R57 A;  2D9T A;  4PLI A;  4BD3 A;  3QKJ A;  2LRQ A; 
#chains in the Genus database with same CATH topology
 3ZBD A;  3JCM g;  1M8V A;  5GAN 8;  3FC3 A;  3H0F A;  3EG1 A;  2EW3 A;  2QXF A;  3OY9 A;  1R0C B;  3BFM A;  2F2V A;  2YWW A;  4OML A;  2BIV A;  5GAN 7;  3LWI A;  3CCV T;  1K4U S;  3NTK A;  5C0M A;  1RLP C;  1AWJ A;  4HVW A;  3CMA Q;  4A4H A;  3OYJ A;  2MMP A;  2A08 A;  2XDD A;  2RQU A;  1M1K R;  5LJ5 j;  1U1T A;  1WJQ A;  2E65 A;  4QQG A;  3OYG A;  4HT9 A;  2MCN A;  4J9D A;  5IXF A;  1WYX A;  3RKW A;  5KYX A;  2QQR A;  2RA2 A;  2X51 A;  2AZV A;  2DYB A;  1TOV A;  3KXT A;  2RI5 A;  1YIT A;  2XDP A;  3RER A;  4IUT A;  1G5V A;  2GCX A;  2DIQ A;  1UGV A;  2X9H A;  1NM7 A;  1OX9 A;  2V26 A;  1UTI A;  1YCY A;  2PU9 B;  5GAN 4;  4N4G A;  5KYY B;  2L3Q A;  1NEB A;  2CZ6 B;  2IPO B;  3CPW A;  2EPD A;  4EIK A;  2ZCF B;  3QYG B;  1NJI U;  4OB0 B;  1K9M R;  3AHU A;  2RHX A;  2CZ1 B;  2CSI A;  3O8V A;  2DET A;  3S6W A;  2CP6 A;  1D0Y A;  1OOT A;  1QCN A;  4C5E A;  1NZ9 A;  3CC2 A;  1Y96 B;  3THK A;  4AFZ C;  2HAX A;  2F2X A;  1YJN T;  2KR3 A;  3SFM A;  2HDA A;  3CC7 A;  1QP2 A;  2RI3 A;  3I5R A;  4HCC A;  5LJ5 g;  4M7A B;  3TQ7 P;  1PSF A;  3OYH A;  1U06 A;  3LW5 E;  2IG0 A;  2M9U A;  2DX1 A;  3JCM f;  1XQH A;  1ZA2 B;  3L2V A;  1Y0M A;  2DRM A;  2XG8 D;  1N9S A;  2YLC A;  2LJ0 A;  4PNO A;  3X26 B;  3EFS A;  4NOY A;  3JCM Q;  1FMV A;  4IIO A;  4M77 A;  2D0N A;  1X75 C;  2R57 A;  4C0G A;  2QA4 Q;  4R56 A;  4N0A C;  3CD6 Q;  3EFR A;  3OA6 A;  4C8Q A;  3IQL A;  2X4J A;  5GMK i;  2DD5 A;  5D6X A;  4M75 F;  3G6E T;  4M78 G;  1KHC A;  2Y4Y A;  1WGS A;  4E7L A;  1PRM C;  2EYW A;  5I2M A;  2J05 A;  4EMK A;  4PKC C;  1H3Z A;  4EMK B;  1KIK A;  3PT9 A;  1VQL A;  1RUW A;  5DLQ E;  1NBE B;  1HK9 A;  2V8K A;  4OF1 A;  3M55 A;  1Y57 A;  2E3I A;  4EMG A;  4M75 D;  1KQS P;  1D1A A;  2CSQ A;  4PJO C;  2LCL A;  1N6A A;  3MKD A;  1OU9 A;  5KE2 A;  5A0D A;  4C8Q G;  1UGR B;  4BI3 A;  2YDL A;  2CZ0 B;  2YXY A;  3RUX A;  1PD1 A;  4PJN A;  2EQJ A;  2JS0 A;  3CCU A;  4MDW A;  1KD1 R;  4IUR A;  1P92 A;  2K5F A;  3ULR B;  1NJI R;  4JDS A;  4NS5 A;  1G3T A;  2A7Y A;  4PLL A;  4ZGD B;  2IIM A;  5J3B A;  2FPD A;  3CME T;  2GTJ A;  2VKN A;  4PFZ A;  2GTO A;  3OS1 A;  3MJX A;  2AK5 A;  4OMQ A;  1QQJ A;  4RG8 A;  2CKK A;  2ED1 A;  2LC4 A;  1KFZ A;  1VQ8 Q;  1YP5 A;  3CD6 A;  4KGZ B;  2LMJ A;  1K9A A;  4RTX A;  1EIF A;  1VYV A;  4JUV A;  1K73 R;  3JB9 F;  3ZEH A;  2LJ1 A;  3RES A;  4PLI A;  2D9T A;  1QWF A;  1O75 A;  2AKK A;  1CKA A;  2K5L A;  3QSU A;  2CGH A;  2JMA A;  1VQK Q;  2OJ2 A;  2RHU A;  1W70 A;  3CC4 T;  1SHF A;  2C06 A;  2LT1 A;  2L89 A;  4C0F A;  2X4Y A;  4BI4 A;  1YWO A;  4RTU A;  1RAD B;  3TU4 K;  5A0L A;  1C6V X;  2QK0 A;  4M78 B;  3RKX A;  3CXC P;  4FCY A;  4JJN K;  4M78 A;  4FSX A;  4WCI A;  5GAN 3;  3JB9 D;  1VQK T;  1TUC A;  2DL5 A;  2W10 A;  2X4X A;  1M1G A;  4JRK A;  4EMK C;  1MMA A;  2FPF A;  2DFU A;  4FT4 A;  1VQM A;  4C92 E;  2AIR B;  2QEX T;  1UGS B;  1MMN A;  2HEQ A;  3EHR A;  1WLP B;  1BKB A;  3A1P A;  2Y4X A;  1Y71 A;  5KE3 A;  3MEW A;  2LQN A;  3QZ9 B;  4LDX A;  1RAG B;  2RF0 A;  5GMK l;  3TCJ A;  4N0A A;  1YJ9 Q;  2CP5 A;  1I0C A;  3E1S A;  4OMO A;  1Q86 R;  2RM4 A;  3M0P A;  2ZPG B;  4C92 A;  1KC8 C;  5GAM g;  1JJ2 A;  3FEO A;  3M59 A;  2V1Q A;  2FZG B;  4JLG A;  2LQW A;  4FIB A;  2M02 A;  1BK2 A;  2LQK A;  3MEA A;  1K9M U;  4HCB A;  5C6S A;  5LL6 S;  5GAN f;  1KC8 U;  5LJ3 f;  3ZFJ A;  2C0I A;  2KY9 A;  4AT1 B;  2DL7 A;  3OYE A;  3LH0 A;  5IHI A;  2DBM A;  3A8H B;  3MP1 A;  3R6N A;  5IAY A;  5IT9 E;  1NPR A;  1W4S A;  1AWX A;  4RTZ A;  3VJP A;  1NYF A;  4AFU C;  2VB6 A;  2DPP B;  4PJJ A;  3EGX A;  1U1S A;  4J6Y A;  2E41 A;  3CEY A;  1WQW A;  4KUL A;  4QKU A;  1YJW T;  3X24 B;  4LNP A;  1RAA B;  2JOY A;  2LTO A;  2V8J A;  4M7D G;  2BZX A;  4KBM B;  4RG2 A;  2OAW A;  2ZPF B;  5CO7 A;  1G3Y A;  5GMK m;  3OYF A;  2DER A;  3O5Z A;  4PK4 A;  1VQO Q;  3HRT A;  5FW9 A;  9ATC B;  2FRY A;  1JJ2 S;  1NLO C;  1T3S A;  1X01 A;  1KG1 A;  3UA6 A;  2KBT A;  4BE1 A;  5IN1 A;  4XU1 A;  2V1R A;  1OUL A;  1ZSZ B;  2CT4 A;  1QKW A;  1JEG A;  3NTI A;  3M0U A;  5CKD A;  3NMZ C;  2DXU A;  3NPF A;  4J9H A;  4E2F B;  4BDY A;  3CCV Q;  2OTL Q;  5DY9 A;  4V2S A;  1Z9Z A;  3QBY A;  4HCZ A;  5GAN 6;  4X9C A;  1PM3 A;  1JB0 E;  1HSQ A;  3BDL A;  4A63 B;  1N5Z A;  1WHG A;  1KD1 C;  2FB7 A;  5J26 A;  4HVU A;  1N8R C;  4FW1 A;  3CME A;  3WVD B;  3CBM A;  2EAY A;  1MV3 A;  5ECA A;  1VQN A;  1OQK A;  1VQM Q;  3OYM A;  1QVF S;  1I8F A;  4J6W A;  1M3C A;  4PJO D;  2ECZ A;  3QJY A;  4OGE A;  5KYU A;  3OB9 A;  1ZQ1 A;  1BI0 A;  2H3E B;  1YI2 Q;  3SEM A;  3OBW A;  3EGD B;  1D0Z A;  5FRM A;  4JRI A;  2RK2 A;  3QPH A;  2L3S A;  3OYC A;  2QGF B;  1H8K A;  2DLP A;  4IUP A;  1KHI A;  3HPW A;  2PZ1 A;  4HCK A;  2QAZ A;  3I9Q A;  4Z89 A;  2EGE A;  4Y91 A;  3T9N A;  4AFQ C;  2VC8 A;  2ROT A;  4XTZ A;  4E7K A;  2M51 A;  3L42 A;  1O9S A;  3M54 A;  4QVC A;  2HKN A;  4X1V A;  2DBK A;  4M78 C;  4C92 C;  2KI7 A;  1PHT A;  3ME9 A;  3JCM J;  1WQ7 A;  2XIC A;  4J9I A;  3PIO A;  1D3B B;  2KVQ G;  2QQS A;  1Q82 C;  2LQ8 A;  3UPU A;  3H41 A;  1G2B A;  1NYG A;  1WJR A;  4PJO B;  4M77 E;  3OYI A;  3URG A;  3MET A;  2ZAE A;  4L5G A;  4FYV B;  1YBY A;  1VQM T;  4NL2 A;  2ZPI B;  2JNG A;  3A8L B;  1WZO A;  1JXO A;  2JM9 A;  4C92 F;  3V7S A;  2NUP B;  3EG0 A;  4ZTJ A;  1QVP A;  2DF6 A;  1VQK A;  5EC7 A;  1C1A A;  1UEB A;  4JS5 A;  1BCM A;  1OPL A;  4GLK A;  2NUT B;  3UF4 A;  4LN2 A;  1SRM A;  4RCC A;  1AVZ C;  3PFS A;  1H92 A;  2RB6 A;  2X4W A;  4E6R A;  2PNI A;  3MEU A;  3CC4 Q;  2A37 A;  3I35 A;  1GCP A;  2D8J A;  1VQ8 A;  1VQ9 T;  5LJ3 d;  3OYN A;  4J83 A;  4E7S A;  2DZC A;  4O6J A;  2VUB A;  2W0Z A;  2E10 A;  3CC2 T;  1VQP A;  3JCM e;  3TSZ A;  2JVV A;  1IGQ A;  3I55 Q;  3GPL A;  2D8H A;  1VQN T;  1WNL A;  4HA8 A;  3CCU Q;  2YUP A;  3CCL Q;  1YJN Q;  3G4S T;  2F1L A;  4XTV A;  2CDT A;  1RAE B;  4C5H A;  2LNH B;  4M7A C;  1LNX A;  1B7T A;  4EMH A;  1GBR A;  2EJG A;  1NE8 A;  1MV0 B;  4M77 B;  4XAX B;  1SKU B;  2ABL A;  2BZY A;  2K4Y A;  2DNU A;  1M1K C;  3CCU T;  5LJ5 d;  2J6F A;  5HCK A;  2BE7 D;  1Q7Y U;  4Y28 E;  2YRV A;  2O01 E;  3VS4 A;  3CXC S;  2AT1 B;  1TG0 A;  1TWB A;  1YJN A;  3CCJ Q;  3CXC A;  3QDR B;  1GCQ C;  4ZN3 A;  5EG2 A;  1VQ7 Q;  2J6K A;  2RO0 A;  1B07 A;  4FYY B;  5GAM h;  2DM1 A;  4F16 A;  2R5M A;  1VQP Q;  5KYU B;  1GBQ A;  4LDW A;  1VQ6 A;  1RAC B;  2CP0 A;  2YRC A;  3LH5 A;  1PKS A;  3RMS A;  3VYG A;  3L2Q A;  2HL3 A;  1BIB A;  1M4Z A;  2QAS A;  4Z8A A;  5GAM f;  4IKF A;  1WXU A;  4L59 A;  2K3B A;  3JAM E;  1WFW A;  1BI2 A;  1SEM A;  1T3L A;  1PWT A;  1UGQ B;  2DL4 A;  4C92 G;  5IXB A;  4DEY A;  4F7U A;  2DEQ A;  3OYA A;  4XTY A;  1K0S A;  1M5Q 1;  3QII A;  2RHI A;  1X43 A;  2DZ9 A;  3X20 B;  3CC7 Q;  2RHY A;  3JCM X;  4A4E A;  4X34 A;  4C0D B;  2RHZ A;  2XKO C;  3CCQ Q;  1N27 A;  3OYK A;  1N8R U;  2EGC A;  1AT1 B;  2EKH A;  1VQ6 Q;  1LCK A;  1M3B A;  3DB3 A;  2PUK B;  2JJ9 A;  4R55 A;  1QVG S;  5HY6 A;  3EG9 B;  3CCR A;  2F5T X;  1K73 C;  3I56 T;  5CIU A;  3VRZ A;  2NLU A;  3E2U A;  1UGP B;  1M27 C;  5D6Y A;  3CMA A;  2DTI A;  5IH2 A;  5J39 A;  4KH0 B;  3SDZ A;  4M77 C;  2ZPE B;  3M5A A;  1VQ7 A;  2JUF A;  1VOM A;  1Q82 U;  3PGG A;  5FLX E;  5FWB A;  2P84 A;  2VVK A;  2NUT A;  4M77 G;  4BI8 B;  1D3B A;  3CCM A;  2NYS A;  4DA4 A;  6AT1 B;  2DEU A;  4JLI A;  2J6O A;  1K1Z A;  5GAO r;  2YUQ A;  1YIT Q;  3M56 A;  3PE0 A;  4OVA A;  4DEX A;  1OX8 A;  2K3Y A;  3BW1 A;  1ABQ A;  5GAN h;  4LUD A;  1JRI A;  1Z9Q A;  1RL2 A;  5CQY A;  2MF2 A;  1M9S A;  2FZK B;  3HP9 A;  4IUV A;  4QT7 A;  5KYY A;  4RMO A;  5GAN e;  2WSF E;  4B6M A;  2E3H A;  5CVI A;  1YIT T;  1TH7 A;  5LJ3 e;  3G71 A;  3CCE A;  2EGA A;  2RJD A;  3QYH B;  5CK9 A;  2JW4 A;  4KRT A;  5KCO A;  1MMG A;  2EYZ A;  3GNG A;  4P5N A;  3NHN A;  3QZ5 B;  3OQ5 A;  2KMT A;  2J06 A;  3VU3 C;  4JJD A;  3SWN C;  2RJC A;  5CKB A;  4XTW A;  3DLM A;  4PJO A;  2K2V A;  4L6V 5;  3M9Q A;  1GL5 A;  2OTL A;  1R0B G;  1QVF A;  2QEX Q;  3JCM c;  3JRZ A;  3CC4 A;  2JXB A;  1M2V A;  2NUP A;  4CC2 A;  3HFO A;  2HL5 C;  2LP5 A;  5CKE A;  3JCM h;  1Q7Y C;  5CAI A;  3ZL7 C;  3LYI A;  4M7D A;  2X3X D;  2KGT A;  4M7D B;  1OZ3 A;  2K6D A;  3S3N A;  4F04 B;  3LWH A;  2DIG A;  3OBY A;  4EDU A;  3VUB A;  1Q7Y R;  2B86 A;  1IZ6 A;  2O4X B;  2QQ9 A;  3VKI A;  5L23 A;  3CQT A;  1VQ4 Q;  4E47 A;  3TEE A;  2C0O A;  2DJQ A;  2M0O A;  1UB4 A;  1PC0 A;  1H64 1;  1A0N B;  3OS5 A;  3D7S B;  5FU6 B;  4Z88 A;  1X2K A;  1Q81 C;  1W2B S;  1LJO A;  3TVT A;  1M1F A;  2GQI A;  2DRK A;  3C95 A;  1Q82 R;  1PCX A;  4ZTF A;  1YN8 A;  2EVR A;  2JZ2 A;  2DO3 A;  4JJB A;  2AZS A;  4XU3 A;  4M78 E;  4M7D D;  3DLL A;  1JJ2 P;  2SEM A;  5CR2 A;  1Y07 A;  1NJI C;  2HSP A;  2L3P A;  2VXF A;  4RKU E;  3G6E Q;  1AEY A;  4E7H A;  1UDL A;  1KD1 U;  4YTL A;  2DE0 X;  3J81 E;  4AMC A;  3NGP A;  3P8H A;  1HJD A;  2QYZ A;  3FDR A;  4M75 B;  3QXE B;  1E7O A;  3AT1 B;  5LJ3 j;  4M75 E;  2NWM A;  1SSH A;  1ZSZ A;  5FRN A;  4M7D F;  4FM4 B;  1ZLM A;  1YJ9 A;  2QA4 T;  1AZG B;  1WDX A;  1S1N A;  4FU6 A;  3PTA A;  1K73 U;  4D8D A;  1HD3 A;  2KXC A;  1ZBX A;  3UDC A;  1AWW A;  5GJW B;  3OYL A;  5GMK e;  3CCJ T;  2GQV A;  4J9B A;  3G7Z A;  1BI3 A;  1IRX A;  1PRL C;  4GLM A;  2CUD A;  4LDU A;  2ZPB B;  1PG5 B;  1E6H A;  2K3X A;  2L8D A;  2RD1 A;  3N5B B;  1QLY A;  4M78 F;  3GLX A;  3V7C A;  2P0K A;  4KUI A;  2ZPH B;  2F5K A;  5HK3 A;  4BE0 A;  2EWN A;  4TVR A;  3CBP A;  3QKJ A;  1WIE A;  1PKT A;  1VQ4 A;  2LRQ A;  1MHN A;  1VQ9 A;  4JZ3 A;  2BE9 B;  3EAE A;  3L2U A;  1MND A;  3VUZ A;  2PQW A;  3PMT A;  1WPY A;  5M9O A;  4IUQ A;  2COW A;  3NFC A;  2JM8 A;  4M7A E;  2M1H A;  4KT0 E;  3L2W A;  4BDZ A;  4AFS C;  1C0M A;  2DVE A;  4M78 D;  1VQ5 Q;  3EHQ A;  4QVZ A;  3DKM A;  1W2B A;  1JQQ A;  2MOX A;  3I55 T;  1V76 A;  2QGG A;  1S72 T;  2AHJ B;  2FO0 A;  4DOW A;  1T0J A;  5GMK h;  3C12 A;  1G3S A;  3GBQ A;  5GAO p;  4JPB W;  3G4S Q;  3CCQ T;  3TSW A;  5L8R E;  1YHQ A;  2AKL A;  2Z0W A;  4DBQ A;  2GGR A;  4ATO A;  1D1C A;  3JCM P;  1M8M A;  1IRE B;  1Q95 G;  2XK0 A;  3F70 A;  1QCO A;  5GJV B;  2LX9 A;  5KYW B;  1KQS A;  2QDY B;  1R8O B;  2FPE A;  1WXB A;  2EQM A;  3LLR A;  2E6Z A;  1ZBJ A;  2E4H A;  2DVJ A;  1GFD A;  3L1A A;  2XDB A;  1VQ7 T;  1N8R R;  4C8Q D;  4BY6 B;  2R5A A;  4KH1 B;  3HRS A;  3JB9 G;  4FYW B;  1G8X A;  3A8O B;  1M30 A;  1VQL Q;  3EFO B;  4JRQ A;  4ZGJ B;  1TXQ A;  2YUN A;  2K57 A;  1LOJ A;  1JO8 A;  1S72 Q;  2E1H A;  1X6G A;  2FL7 A;  2BUD A;  5GMK j;  2OTJ T;  2JN0 A;  2M0Y A;  4JS4 A;  1YJW Q;  2DD4 A;  3QWX X;  2P0Q A;  2F69 A;  3PVQ A;  1XNI A;  3QWY A;  3HTR A;  3V8K A;  2P4T A;  2KSS A;  1R77 A;  2E5K A;  4MDX A;  1ACM B;  3V8L A;  3DB4 A;  3SWN B;  5LJ5 f;  4ORZ A;  4QVD A;  4E7J A;  4J9E A;  4F7U G;  1D1B A;  1AZE A;  1GCQ A;  3M0S A;  4OMP A;  4DBF A;  1TTH B;  1VQ6 T;  1IB8 A;  2IVW A;  1YIJ Q;  2P4R A;  1I07 A;  1PSE A;  2LCS A;  4A4K A;  4KUD K;  3OYB A;  3HHT B;  2E70 A;  4PJO E;  4MZM A;  1SPK A;  2CT3 A;  3EGD A;  4XTX A;  1BB9 A;  1ZUY A;  1X6O A;  4HT8 A;  3CPW P;  4WF2 A;  1AD5 A;  5I21 A;  1GXI E;  3FB9 A;  2HD0 A;  2EYY A;  1YJW A;  2COZ A;  4GBQ A;  4RTV A;  1BBZ A;  4HVV A;  3G71 T;  3CCE T;  3OS0 A;  4OP0 A;  3EGX B;  5FWC A;  2KAF A;  2HQE A;  1LPL A;  2ZZD A;  3A8M B;  1RAI B;  1X2Q A;  1KJW A;  3H9N A;  4C0Z A;  3CCS T;  2QDL A;  1KC8 R;  1W1F A;  3SB2 A;  4PJO F;  3A98 A;  3OYD A;  4R0K A;  2YHT A;  3UWN A;  4ELY C;  3RMQ A;  1I5O B;  4OB2 B;  2MYS A;  3CCS Q;  1SF9 A;  3OSV A;  1WA7 A;  1QMC A;  5KH6 A;  1EX4 A;  1JXM A;  3M4Y A;  2GFU A;  2HSE B;  3VS0 A;  3QG1 A;  2EYQ A;  3I56 A;  5CCA A;  5GAN j;  3HRU A;  3CCR T;  1K8A U;  2LT4 A;  4II1 A;  2R58 A;  3JB9 H;  4DQ2 A;  2HQX A;  5DLO A;  1KQ1 A;  2VGM A;  3GOX A;  1CKB A;  5LJ3 g;  3OYY A;  2LDM A;  3JSC A;  1VUB A;  2MAM A;  5GAN g;  1QW1 A;  2HMA A;  4N4I A;  2RQR A;  3A5Z B;  4J7I A;  4C92 D;  1M90 R;  1OYX A;  1ZHI A;  4M75 C;  3GF5 A;  5GAN 5;  4FL6 A;  2DL3 A;  1VIF A;  4F14 A;  4IIM A;  4HXJ A;  3QUI A;  4FT2 A;  4F7U F;  4EPC A;  4KGX B;  4J9G A;  1FXX A;  4M7A F;  4LD6 A;  3G4S A;  4MZT A;  1NG2 A;  3L2Z A;  4XU0 A;  1OV3 A;  2H8H A;  1W6X A;  3CC2 Q;  3EG9 A;  4M7A A;  3M0Q A;  4KGV B;  2K79 A;  2ED0 A;  2XU8 A;  3REA B;  2KRO A;  1PD0 A;  2GBQ A;  1OI1 A;  1FX7 A;  1WXT A;  1M90 U;  3CCL T;  3VRY A;  2HBP A;  3GP8 A;  1NPP A;  4RTY A;  1FMW A;  3MHX A;  4M7A D;  1IXD A;  1B34 A;  3OMG A;  4XU2 A;  5KCH A;  4E7Z A;  4IUU A;  1RAF B;  2HCK A;  2GF7 A;  3L2R A;  3S3O A;  3JCM V;  1Q86 C;  1WI7 A;  3PIP A;  2JT4 A;  1JBM A;  2CP3 A;  4HKE A;  1BIA A;  3M53 A;  2CS7 A;  4M75 G;  1EZZ B;  1QVF P;  3MCA B;  3CPF A;  2FHD A;  4C8Q C;  2RPN A;  1KQS S;  1VQN Q;  2VXE A;  2FEI A;  3VS3 A;  2RN8 A;  4XTU A;  3FRN A;  5GAO n;  4LUE A;  1VQP T;  4VUB A;  4B9X A;  4BUG A;  1XTD A;  2YLB A;  3A8G B;  3JCM b;  2DXC A;  1KK7 A;  3EH1 A;  3PVL A;  1D0X A;  2JMC A;  1I1J A;  1VQ8 T;  3HKS A;  2EFI A;  4LDY A;  3I5S A;  4ZN1 A;  1ZSG A;  1HXD A;  4C8Q B;  4WTO B;  1IGU A;  3P8D A;  3JCM W;  2KXD A;  1YI2 A;  4FSS A;  1FYN A;  1VQL T;  1MMD A;  2G3R A;  2LVM A;  3KUF A;  2KYB A;  1WHL A;  4XQ3 A;  2DMO A;  1X69 A;  5HKC A;  1T0H A;  3INZ A;  1M2O A;  4RUG A;  1K8A C;  2DYI A;  2KRM A;  5CKH A;  1ZSZ C;  2M16 A;  3OW2 A;  1UFF A;  4J9C A;  1W2B P;  3S3M A;  2E5Q A;  4NL3 A;  1WHM A;  4E7I A;  1XJW B;  1X27 A;  1VQO A;  2O4X A;  5GAN 2;  2VAS A;  1UG1 A;  2D1X A;  5D7U A;  2BKD N;  1JU5 C;  1MGQ A;  4OMN A;  4M7A G;  1WJS A;  2MI6 A;  5LJ5 h;  2K5I A;  2QI2 A;  2KRN A;  2K2M A;  2YT6 A;  3JB9 J;  1RI9 A;  1VYT A;  2RJE A;  3REB B;  1FMK A;  2X35 A;  2RQV A;  3PNW C;  2QQB A;  3OS2 A;  4C5I A;  1TU0 B;  4BE2 A;  2KK4 A;  3E9G A;  1IHV A;  1U8R A;  4ME7 A;  2KE9 A;  3X28 B;  4DOV A;  2QTV A;  3RBB B;  5FU7 C;  1RLQ C;  4RTW A;  2E6N A;  3CC7 T;  1B3Q A;  2EQI A;  1IHW A;  1WHJ A;  1D09 B;  2LZ6 B;  2DKG A;  1V29 B;  4ZNX A;  4C8Q F;  1UHC A;  2NUZ A;  2VWF A;  4LDV A;  2MIO A;  3KFV A;  4B9W A;  2EJ9 A;  3MPU B;  3I56 Q;  2DXT A;  3H6Z A;  3VS2 A;  2EKO A;  4Y92 A;  1MUZ A;  3M57 A;  2ZGW A;  2RK1 A;  3H0I A;  2ROL A;  2ENM A;  3G71 Q;  3CCE Q;  1AHJ B;  3QDF A;  2D6F A;  1AWO A;  2A28 A;  1QKX A;  4D6W A;  3CCS A;  2VGN A;  5D6W A;  2A36 A;  2FZC B;  3OW2 P;  2EIF A;  3VV0 A;  1I5L A;  2MPX C;  4M77 F;  2QEX A;  1E6G A;  3CPW S;  2O9S A;  1K8A R;  2BZ8 A;  2PVO B;  1K0X A;  1ZUK A;  3ER0 A;  4J8O A;  2CRE A;  2RMO A;  5A2Q E;  4PFP A;  2C0T A;  5DM7 R;  4LE9 A;  2EQU A;  5IHN A;  1SG5 A;  1QWE A;  2CP2 A;  2LX7 A;  3J7A F;  1SRL A;  2PTK A;  2XMF A;  3CCR Q;  3HFN A;  2CH4 W;  3GNF B;  1F1B B;  2KEA A;  1VIE A;  1OPK A;  2EJF A;  3KBG A;  2XI9 A;  3ASK A;  2EBP A;  2CUB A;  1OU8 A;  3QHS A;  4DBR A;  4GY5 A;  1KSW A;  2CYZ B;  4O5V A;  4UC4 A;  3CD6 T;  3CCM Q;  2JTE A;  4M7D C;  1FWZ A;  1YIJ A;  4OMF B;  3VS6 A;  4J5Y A;  2OI3 A;  4OGC A;  3VYH B;  4N4H A;  3JCM d;  5CKF A;  3FJ5 A;  3M0R A;  4J7F A;  1IO6 A;  2OTJ A;  4J9F A;  2YRD A;  4A53 A;  3RDV A;  4BB7 A;  1B34 B;  3BDU A;  2E12 A;  3JB9 I;  4BY6 C;  1VQO T;  3CCQ A;  2GNC A;  3SWN A;  1YCS B;  3FIF A;  4OMM A;  2OTJ Q;  2K9G A;  1TUD A;  1GFC A;  2K7A A;  3NTH A;  4A54 A;  5GAM e;  3OSS C;  2DTO A;  4JZ4 A;  1G3W A;  2RQW A;  4PJL A;  4X9D A;  2O9V A;  3EGU A;  5I11 A;  1YI2 T;  2LJ3 A;  2CP7 A;  1UUE A;  4MMK A;  3R6O A;  5GAO l;  1N9R A;  4PL6 A;  1WHK A;  2I0N A;  2YUO A;  1VQ4 T;  1BCO A;  5FRO A;  4OB3 B;  3HL8 A;  1UEC A;  5GAN d;  1Q81 U;  4D8K A;  2HQH A;  2RQT A;  2I2L A;  3V8J A;  2FVU A;  5CQX A;  4A4G A;  1ZA1 B;  3U23 A;  3VS7 A;  5AT1 B;  4CI0 C;  1S72 A;  1QVG P;  4ZGE B;  2DXB A;  3CCJ A;  3I55 A;  1OEB A;  1LVK A;  2PVG B;  3E9F A;  3JV3 A;  1QVG A;  1RAH B;  1X6B A;  3M58 A;  3MP6 A;  2KNB B;  3SHW A;  3RR6 A;  3LX7 A;  4M4Z A;  2QA4 A;  2RJF A;  4LD9 K;  1Y7X A;  2MWP A;  2MWO A;  1GRI A;  4JRP A;  3WXM B;  2L3R A;  2RNA A;  3CCL A;  3QO3 A;  4M75 A;  1WX6 A;  1BI1 A;  2YSQ A;  2J7I A;  4CC3 A;  2O2O A;  2DK3 A;  5KYW A;  3H8Z A;  1NEG A;  4RTT A;  2ESW A;  1ZUU A;  3PMI A;  4XK8 E;  4FYX B;  2JTM A;  5KYX B;  4PJO G;  5HK0 A;  2O31 A;  3MEV A;  1YFN A;  5I22 A;  1YHQ Q;  2G6F X;  4J6X A;  4ANJ A;  5GAO m;  5IHK A;  3VS1 A;  3P8B B;  2HZY A;  3WVE B;  3CBO A;  4LXC A;  4F17 A;  8AT1 B;  3MO8 A;  2CZ7 B;  4C8Q E;  2WSE E;  3J80 E;  2KYM A;  1VA7 A;  3RIR A;  1Q81 R;  4QQD A;  1YWP A;  4F7U E;  4K11 A;  5KYN A;  3UA7 A;  3EG3 A;  1VQ5 A;  1YHQ T;  1PNJ A;  2OX7 A;  3C0C A;  5GAM j;  2VV5 A;  2KT8 A;  4DBH A;  4F7U B;  1KQ2 A;  1VQ5 T;  2X3W D;  3FLG A;  3SD4 A;  2P0P A;  2CH4 A;  5AYF A;  3TRE A;  2KQW A;  3EG2 A;  1NLP C;  2E64 A;  2KDS A;  1VQ9 Q;  2XD0 A;  3UAT A;  1BYM A;  2WAC A;  2JTF A;  2L2P A;  3H0H A;  4PFO A;  3E19 A;  3EFO A;  4ELZ C;  1U3O A;  2XID A;  4A4F A;  1ARK A;  3LGF A;  1SHG A;  2F2W A;  1TS9 A;  2FYK A;  4MML A;  1QCF A;  3RKY A;  1QP3 A;  2LNV A;  2DIL A;  4M7D E;  3BY7 A;  1ABO A;  5FU6 C;  1M1K U;  2HBW A;  1UHF A;  4Z02 A;  2DA9 A;  3G6E A;  2XHC A;  1XOV A;  1OZ2 A;  4QQ6 A;  2D0Q B;  2KT1 A;  3M4G A;  3OW2 S;  5LJ3 h;  1AOJ A;  2DTH A;  7AT1 B;  1I4K 1;  1V1C A;  2WSC E;  2L5Q A;  1K76 A;  4BD3 A;  2V8I A;  5A0G A;  2DJZ A;  4CRI A;  3RNJ A;  4CC7 A;  5FU7 B;  1UJY A;  4MZP A;  1ZX6 A;  5LJ5 e;  1YJ9 T;  2EQK A;  8ATC B;  3CME Q;  4AG2 C;  1BU1 A;  1MNE A;  4PJM A;  1DJ7 B;  1UJ0 A;  2RI2 A;  2RH2 A;  1Y96 A;  3QJ6 A;  1M3A A;  4FW2 A;  1U5S A;  2DAQ A;  1HYO A;  2A3L A;  2KRS A;  4Q5W A;  2QQA A;  3CCV A;  4QW2 A;  2PUO B;  4ESR A;  1SSF A;  1M2V B;  2L0A A;  3OMC A;  2FRW A;  4AG1 C;  2OTL T;  2SRC A;  4C92 B;  5GAO q;  1Q86 U;  3CCM T;  4BAC A;  4RCB A;  3HSB A;  5GAM d;  1K9M C;  2COY A;  2O88 A;  3M0T A;  2EYX A;  2MK5 A;  3GIB A;  2PVD B;  2QTX A;  2OAU A;  3G1J A;  1TSF A;  1G83 A;  1YNZ A;  3C4S A;  1WHH A;  3Q1J A;  1M90 C;  4M77 D;  1J3T A;  2GFA A;  4JJC A;  3EH2 A;  3V7R A;  2B8A A;  3MP8 A;  2VYT A;  3LGL A;  3FJP A;  2QG9 B;  2JS2 A;  3UT1 A;  2ATC B;  1I81 A;  2LCC A;  3BE3 A;  2HKQ B;  3C94 A;  2H3J A;  1H3H A;  2FG0 A;  1RAB B;  1RI0 A;  1YIJ T;  1CSK A;  4C5G A;  3X25 B;  1UE9 A;  1VYU A;  2Y90 A;  2DL8 A;  2A0F B;  2HNI A;  1TUG B;  5I2S A;  1EFN A;  4CC4 B;  3VS5 A;  4OB1 B;  3CMA T;  4C0D C;  2BTT A; 
#chains in the Genus database with same CATH homology
 1MHN A;  4C8Q F;  3ZBD A;  3EAE A;  3L2U A;  3JCM g;  4Y91 A;  3VUZ A;  4LDV A;  1M8V A;  3T9N A;  2PQW A;  5GAN 8;  3FC3 A;  2VC8 A;  3PMT A;  4B9W A;  2EJ9 A;  2QXF A;  1WPY A;  3BFM A;  3OY9 A;  2DXT A;  3H6Z A;  5M9O A;  2EKO A;  4IUQ A;  3NFC A;  2BIV A;  4XTZ A;  4M7A E;  3M57 A;  2ZGW A;  2M1H A;  4KT0 E;  5GAN 7;  4E7K A;  3LWI A;  2RK1 A;  3CCV T;  3NTK A;  3L2W A;  4BDZ A;  5C0M A;  1AHJ B;  3L42 A;  1O9S A;  3M54 A;  4QVC A;  2DVE A;  4M78 D;  4QVZ A;  2D6F A;  4M78 C;  4A4H A;  4C92 C;  3ME9 A;  3OYJ A;  2MMP A;  4D6W A;  3CCS A;  3DKM A;  1W2B A;  2VGN A;  2XDD A;  5D6W A;  3JCM J;  1WQ7 A;  2XIC A;  3PIO A;  3I55 T;  5LJ5 j;  1U1T A;  2EIF A;  1D3B B;  2KVQ G;  1WJQ A;  2E65 A;  2QQS A;  4QQG A;  1Q82 C;  2LQ8 A;  3UPU A;  3VV0 A;  1S72 T;  1I5L A;  3OYG A;  2AHJ B;  4DOW A;  4HT9 A;  4M77 F;  3RKW A;  2QEX A;  5GMK h;  1WJR A;  2QQR A;  3CPW S;  4M77 E;  4PJO B;  2RA2 A;  3OYI A;  3URG A;  3C12 A;  1G3S A;  3MET A;  2PVO B;  5GAO p;  4L5G A;  1YBY A;  3ER0 A;  4J8O A;  3KXT A;  3CCQ T;  2RI5 A;  5L8R E;  1VQM T;  4NL2 A;  1YHQ A;  1YIT A;  2ZPI B;  2XDP A;  5A2Q E;  4IUT A;  3RER A;  2JNG A;  3A8L B;  2GCX A;  4ATO A;  1G5V A;  2DIQ A;  4C92 F;  3V7S A;  5DM7 R;  3JCM P;  4ZTJ A;  1QVP A;  1YCY A;  2PU9 B;  5GAN 4;  4N4G A;  1VQK A;  1IRE B;  2EQU A;  2CZ6 B;  2XK0 A;  1UEB A;  3F70 A;  2LX9 A;  4JS5 A;  3CPW A;  2ZCF B;  3QYG B;  1NJI U;  2QDY B;  1KQS A;  1R8O B;  4GLK A;  4OB0 B;  3J7A F;  3AHU A;  2RHX A;  2CZ1 B;  4RCC A;  3PFS A;  2EQM A;  3LLR A;  3O8V A;  2E6Z A;  2RB6 A;  2X4W A;  3S6W A;  3MEU A;  3HFN A;  3GNF B;  3L1A A;  4C5E A;  1NZ9 A;  1VQ8 A;  2XDB A;  1VQ7 T;  4C8Q D;  3CC2 A;  1Y96 B;  2HAX A;  4BY6 B;  1VQ9 T;  5LJ3 d;  3OYN A;  2R5A A;  4J83 A;  3HRS A;  1YJN T;  3JB9 G;  2DZC A;  4O6J A;  2VUB A;  3SFM A;  1VIE A;  2E10 A;  2EJF A;  3KBG A;  2XI9 A;  3A8O B;  1QP2 A;  3ASK A;  3CC7 A;  1VQP A;  3JCM e;  3CC2 T;  2RI3 A;  4HCC A;  5LJ5 g;  3QHS A;  2JVV A;  4JRQ A;  4M7A B;  1PSF A;  4GY5 A;  2CYZ B;  4O5V A;  4UC4 A;  4ZGJ B;  3OYH A;  3CD6 T;  4M7D C;  3GPL A;  3LW5 E;  2IG0 A;  1FWZ A;  2K57 A;  1LOJ A;  1XQH A;  2M9U A;  3JCM f;  4OMF B;  3L2V A;  1YIJ A;  2E1H A;  2XG8 D;  4J5Y A;  1N9S A;  4OGC A;  1VQN T;  1WNL A;  2YLC A;  4HA8 A;  2FL7 A;  2BUD A;  4PNO A;  3VYH B;  4N4H A;  5GMK j;  4OB1 B;  3JCM d;  2OTJ T;  3G4S T;  3X26 B;  5CKF A;  3EFS A;  4NOY A;  4XTV A;  2JN0 A;  4C5H A;  4M7A C;  4JS4 A;  1LNX A;  4EMH A;  3JCM Q;  4M77 A;  2R57 A;  2EJG A;  1X75 C;  4J7F A;  1NE8 A;  2DD4 A;  4C0G A;  2OTJ A;  4M77 B;  4A53 A;  4XAX B;  4R56 A;  4N0A C;  2P0Q A;  4BB7 A;  1B34 B;  2F69 A;  1XNI A;  3BDU A;  2E12 A;  3EFR A;  3V8K A;  2P4T A;  2KSS A;  4BY6 C;  3JB9 I;  3OA6 A;  2K4Y A;  4C8Q A;  1VQO T;  3CCQ A;  1M1K C;  2X4J A;  3CCU T;  3SWN A;  5LJ5 d;  5GMK i;  2DD5 A;  4MDX A;  3FIF A;  5D6X A;  4Y28 E;  3V8L A;  2YRV A;  4M75 F;  1Q7Y U;  3DB4 A;  3SWN B;  5LJ5 f;  2O01 E;  3G6E T;  4M78 G;  4QVD A;  1KHC A;  4E7J A;  2Y4Y A;  3CXC S;  3NTH A;  4A54 A;  4BUG A;  4F7U G;  1WGS A;  1YJN A;  4E7L A;  5GAM e;  3OSS C;  3CXC A;  3QDR B;  2DTO A;  4ZN3 A;  5EG2 A;  1VQ6 T;  5I2M A;  2IVW A;  2RO0 A;  1G3W A;  4EMK A;  5GAM h;  1PSE A;  4X9D A;  4PKC C;  1H3Z A;  4EMK B;  4A4K A;  4KUD K;  3OYB A;  3PT9 A;  1YI2 T;  1VQL A;  2R5M A;  3HHT B;  5DLQ E;  1HK9 A;  2V8K A;  2E70 A;  4OF1 A;  4LDW A;  4MZM A;  4MMK A;  3M55 A;  3R6O A;  4XTX A;  4PJO E;  5GAO l;  1N9R A;  1VQ6 A;  4PL6 A;  1X6O A;  4M75 D;  4EMG A;  4HT8 A;  4WF2 A;  1VQ4 T;  4PJO C;  5I21 A;  5FRO A;  2LCL A;  4OB3 B;  3RMS A;  1GXI E;  1N6A A;  3HL8 A;  3FB9 A;  3VYG A;  3L2Q A;  2HD0 A;  1BIB A;  5KE2 A;  5GAN d;  1M4Z A;  5A0D A;  1Q81 U;  4C8Q G;  1UGR B;  4BI3 A;  1YJW A;  5GAM f;  4IKF A;  2CZ0 B;  4L59 A;  2I2L A;  3RUX A;  4M7A G;  3V8J A;  3G71 T;  3CCE T;  3JAM E;  2FVU A;  1BI2 A;  5CQX A;  3OS0 A;  2EQJ A;  4A4G A;  1UGQ B;  3CCU A;  4OP0 A;  4MDW A;  2KAF A;  2HQE A;  4C92 G;  2ZZD A;  4CI0 C;  4IUR A;  4F7U A;  1P92 A;  2DEQ A;  4ZGE B;  3A8M B;  3OYA A;  2K5F A;  1S72 A;  2DXB A;  4XTY A;  3CCJ A;  4JDS A;  1M5Q 1;  1G3T A;  2A7Y A;  3QII A;  4NS5 A;  4PLL A;  4C0Z A;  4ZGD B;  3I55 A;  3CCS T;  2RHI A;  5J3B A;  2DZ9 A;  3CME T;  2PVG B;  3E9F A;  3X20 B;  2RHY A;  3JCM X;  3SB2 A;  4PJO F;  4A4E A;  3OS1 A;  1VQ9 A;  1QVG A;  3OYD A;  4X34 A;  4C0D B;  2RHZ A;  2XKO C;  1N27 A;  3M58 A;  3MP6 A;  4RG8 A;  2CKK A;  3OYK A;  1N8R U;  2YHT A;  2LC4 A;  3LX7 A;  3UWN A;  4ELY C;  3DB3 A;  2PUK B;  3CD6 A;  4R55 A;  1QVG S;  5HY6 A;  2QA4 A;  3CCR A;  2RJF A;  3RMQ A;  2F5T X;  1K73 C;  4LD9 K;  4OB2 B;  3I56 T;  5CIU A;  1EIF A;  1Y7X A;  2MWP A;  2MWO A;  4JRP A;  2NLU A;  4JUV A;  3WXM B;  1UGP B;  2L3R A;  3OSV A;  3JB9 F;  3ZEH A;  3CMA A;  5D6Y A;  2DTI A;  3RES A;  3CCL A;  5J39 A;  3QO3 A;  4M75 A;  5KH6 A;  1BI1 A;  3SDZ A;  4PLI A;  2ZPE B;  2D9T A;  3M4Y A;  4M77 C;  1O75 A;  2K5L A;  2DK3 A;  3M5A A;  1VQ7 A;  3QSU A;  2GFU A;  2CGH A;  2JUF A;  3QG1 A;  1Q82 U;  3PGG A;  2EYQ A;  3H8Z A;  5FLX E;  4M77 G;  4BI8 B;  5CCA A;  2RHU A;  3PMI A;  1D3B A;  3HRU A;  4XK8 E;  3I56 A;  3CCM A;  5GAN j;  3CCR T;  2JTM A;  4DA4 A;  3CC4 T;  1K8A U;  4JLI A;  2C06 A;  2LT1 A;  2L89 A;  2LT4 A;  5HK0 A;  4PJO G;  3MEV A;  4II1 A;  4C0F A;  2R58 A;  2X4Y A;  5GAO r;  4BI4 A;  3JB9 H;  3M56 A;  4OVA A;  4DQ2 A;  2HQX A;  4J6X A;  5DLO A;  1KQ1 A;  2VGM A;  2K3Y A;  3BW1 A;  5GAO m;  3TU4 K;  5A0L A;  4M78 B;  3P8B B;  3RKX A;  3WVE B;  5GAN h;  4JJN K;  3GOX A;  4M78 A;  1JRI A;  3CBO A;  5LJ3 g;  1RL2 A;  3OYY A;  4FSX A;  3JB9 D;  3MO8 A;  5CQY A;  5GAN 3;  2LDM A;  3JSC A;  1VQK T;  2CZ7 B;  1VUB A;  4C8Q E;  2MAM A;  2MF2 A;  1M9S A;  2WSE E;  2X4X A;  3HP9 A;  4IUV A;  3J80 E;  1M1G A;  5GAN e;  2WSF E;  5GAN g;  4RMO A;  3RIR A;  4JRK A;  4EMK C;  4QQD A;  5CVI A;  1QW1 A;  4F7U E;  4N4I A;  3A5Z B;  4FT4 A;  4J7I A;  4C92 D;  1YIT T;  1VQ5 A;  1YHQ T;  1VQM A;  1OYX A;  1ZHI A;  4M75 C;  4C92 E;  1TH7 A;  5LJ3 e;  3G71 A;  5GAM j;  3CCE A;  2VV5 A;  4F7U B;  2RJD A;  3QYH B;  2QEX T;  3GF5 A;  1KQ2 A;  1UGS B;  5CK9 A;  4FL6 A;  5GAN 5;  1VQ5 T;  1BKB A;  5KCO A;  3FLG A;  1VIF A;  3GNG A;  4P5N A;  3SD4 A;  2P0P A;  3QUI A;  3QZ5 B;  5AYF A;  2Y4X A;  1Y71 A;  2KMT A;  3OQ5 A;  4FT2 A;  4F7U F;  4EPC A;  3VU3 C;  3TRE A;  5KE3 A;  3SWN C;  2KQW A;  2RJC A;  5CKB A;  3MEW A;  1FXX A;  2E64 A;  2KDS A;  4XTW A;  4M7A F;  3QZ9 B;  4LD6 A;  4LDX A;  2XD0 A;  3G4S A;  3DLM A;  5GMK l;  4MZT A;  1BYM A;  2WAC A;  4PJO A;  2K2V A;  4L6V 5;  2JTF A;  3M9Q A;  3TCJ A;  3L2Z A;  4XU0 A;  2OTL A;  4N0A A;  1QVF A;  3E19 A;  4ELZ C;  4M7A A;  3JCM c;  3JRZ A;  2XID A;  2XU8 A;  3CC4 A;  3E1S A;  4A4F A;  1OI1 A;  3LGF A;  2FYK A;  4MML A;  3HFO A;  2RM4 A;  3RKY A;  1QP3 A;  2LNV A;  1FX7 A;  2ZPG B;  4C92 A;  1KC8 C;  5CKE A;  3JCM h;  1M90 U;  5GAM g;  1JJ2 A;  1Q7Y C;  3FEO A;  4M7D E;  3CCL T;  3BY7 A;  5FU6 C;  3M59 A;  5CAI A;  3LYI A;  1M1K U;  2HBP A;  4M7D A;  3GP8 A;  1NPP A;  4Z02 A;  4M7D B;  1OZ3 A;  3G6E A;  3MHX A;  4JLG A;  3S3N A;  4M7A D;  2XHC A;  1XOV A;  1OZ2 A;  4FIB A;  3LWH A;  4QQ6 A;  2D0Q B;  2LQK A;  1B34 A;  3MEA A;  1K9M U;  3OMG A;  2DIG A;  4XU2 A;  5KCH A;  4HCB A;  4IUU A;  5C6S A;  3OBY A;  5LL6 S;  5GAN f;  4EDU A;  1KC8 U;  3M4G A;  3VUB A;  3OW2 S;  3VKI A;  1IZ6 A;  2O4X B;  2QQ9 A;  5LJ3 h;  2DTH A;  2GF7 A;  4E47 A;  3TEE A;  5LJ3 f;  3L2R A;  3ZFJ A;  2KY9 A;  1I4K 1;  3JCM V;  3S3O A;  3OYE A;  1Q86 C;  2WSC E;  2M0O A;  3LH0 A;  1UB4 A;  3MP1 A;  2L5Q A;  3A8H B;  1H64 1;  5IAY A;  3PIP A;  1JBM A;  4BD3 A;  4HKE A;  5IT9 E;  1NPR A;  2V8I A;  1BIA A;  3OS5 A;  3M53 A;  2CS7 A;  1W4S A;  5A0G A;  4M75 G;  2DJZ A;  3VJP A;  4CRI A;  3MCA B;  5FU6 B;  2DPP B;  3CPF A;  2FHD A;  1Q81 C;  1W2B S;  1LJO A;  4C8Q C;  1KQS S;  5FU7 B;  1M1F A;  1U1S A;  2VXE A;  4J6Y A;  4MZP A;  2E41 A;  5LJ5 e;  4XTU A;  1YJ9 T;  2EQK A;  3C95 A;  3FRN A;  5GAO n;  3CEY A;  1VQP T;  1WQW A;  4KUL A;  4ZTF A;  1YJW T;  2JZ2 A;  1DJ7 B;  4VUB A;  2DO3 A;  2JOY A;  1XTD A;  2YLB A;  3A8G B;  2LTO A;  2V8J A;  3X24 B;  4B9X A;  2RI2 A;  3JCM b;  4M7D G;  4KBM B;  2DXC A;  2RH2 A;  4RG2 A;  1Y96 A;  3QJ6 A;  2ZPF B;  4XU3 A;  4M78 E;  5CO7 A;  4M7D D;  3DLL A;  1G3Y A;  1VQ8 T;  3HKS A;  2EFI A;  4LDY A;  5CR2 A;  1Y07 A;  4ZN1 A;  5GMK m;  3OYF A;  2DAQ A;  1HXD A;  1NJI C;  2A3L A;  4Q5W A;  4C8Q B;  2QQA A;  3HRT A;  3CCV A;  3P8D A;  2VXF A;  3JCM W;  4QW2 A;  1YI2 A;  2PUO B;  4RKU E;  1SSF A;  4E7H A;  1VQL T;  1JJ2 S;  2G3R A;  3OMC A;  1KD1 U;  2LVM A;  3KUF A;  2OTL T;  4YTL A;  3J81 E;  1Q86 U;  4C92 B;  3P8H A;  5GAO q;  1X01 A;  3CCM T;  1KG1 A;  4BAC A;  3FDR A;  4RCB A;  4M75 B;  4XQ3 A;  4BE1 A;  5IN1 A;  3QXE B;  5HKC A;  3INZ A;  4XU1 A;  3HSB A;  4C0D C;  5GAM d;  1K9M C;  1K8A C;  5LJ3 j;  4M75 E;  5CKH A;  3NTI A;  2M16 A;  5CKD A;  3GIB A;  2DXU A;  2PVD B;  3OW2 A;  5FRN A;  4M7D F;  2QTX A;  4FM4 B;  2OAU A;  3S3M A;  2E5Q A;  4NL3 A;  4BDY A;  4E7I A;  1YJ9 A;  5DY9 A;  2QA4 T;  1VQO A;  2O4X A;  5GAN 2;  4V2S A;  3QBY A;  4HCZ A;  5GAN 6;  4X9C A;  3C4S A;  3Q1J A;  1M90 C;  4M77 D;  2BKD N;  1MGQ A;  2GFA A;  1WJS A;  1JB0 E;  2MI6 A;  4FU6 A;  5LJ5 h;  3PTA A;  3BDL A;  1K73 U;  2K5I A;  2QI2 A;  3V7R A;  2B8A A;  3MP8 A;  2VYT A;  3LGL A;  3JB9 J;  3FJP A;  2RJE A;  1KD1 C;  2FB7 A;  5J26 A;  1ZBX A;  1N8R C;  3CME A;  3UDC A;  3WVD B;  2X35 A;  3CBM A;  3PNW C;  2QQB A;  3OS2 A;  3UT1 A;  2EAY A;  1I81 A;  4C5I A;  3OYL A;  5GMK e;  2KK4 A;  2LCC A;  3CCJ T;  2GQV A;  3E9G A;  4BE2 A;  1U8R A;  1VQN A;  3C94 A;  3G7Z A;  1BI3 A;  4ME7 A;  3OYM A;  2H3J A;  4LDU A;  1QVF S;  1I8F A;  1RI0 A;  4J6W A;  1YIJ T;  2ZPB B;  4PJO D;  4C5G A;  3X28 B;  2RD1 A;  2K3X A;  2L8D A;  3QJY A;  4OGE A;  3N5B B;  3X25 B;  4DOV A;  3OB9 A;  4M78 F;  1ZQ1 A;  3GLX A;  3V7C A;  5FU7 C;  1BI0 A;  2E6N A;  2P0K A;  3OBW A;  4KUI A;  5FRM A;  2Y90 A;  2ZPH B;  4JRI A;  2F5K A;  2HNI A;  2RK2 A;  3CC7 T;  5HK3 A;  3QPH A;  3OYC A;  5I2S A;  4BE0 A;  2EWN A;  4TVR A;  4IUP A;  1KHI A;  2DKG A;  1V29 B;  3CBP A;  3HPW A;  3CMA T;  3QKJ A;  1VQ4 A;  2LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...