4A4GA

Solution structure of smn tudor domain in complex with asymmetrically dimethylated arginine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
NTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords SURVIVAL MOTOR NEURON PROTEIN
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4gA00
1WJSA 2LDMA 3L2WA 5FRMA 4N4IA 4RG2A 1H3ZA 4C5HA 4QW2A 2RJFA 2HQXA 3LGFA 4GY5A 5J26A 2RHYA 5D6WA 3OY9A 3E9FA 4QQ6A 1WJQA 3O8VA 5KE3A 1XNIA 3L2QA 4A4FA 2RHXA 2EQUA 2R57A 4A4HA 4E7IA 2LRQA 2M1HA 4PLLA 2HQEA 3KUFA 3MO8A 2RI3A 2EQJA 2XDPA 4NS5A 4IUPA 3LX7A 2LCCA 4FL6A 3OYGA 3GOXA 5KE2A 3OYCA 3QBYA 3PFSA 2X4YA 3OYEA 1OYXA 3NTKA 4A4GA 3FC3A 2O4XA 5M9OA 3LGLA 4L59A 4OVAA 2JZ2A 1RI0A 3LLRA 1N27A 5C6SA 3OYFA 3OQ5A 4PLIA 3OYIA 4UC4A 5J39A 2L89A 3L2UA 4C5IA 1KHCA 2GF7A 2F5KA 2M0OA 3MEUA 3SD4A 3MEAA 3E9GA 2B8AA 2RJEA 2LTOA 3QJ6A 2DAQA 1MHNA 2L3RA 3ASKA 2EFIA 2M16A 3FDRA 3S6WA 2MWOA 2E6NA 4X34A 3OYKA 1SSFA 2EKOA 3EAEA 4C5GA 2RJDA 1OI1A 3UWNA 4IUUA 2X4XA 3OYDA 4E7KA 4IUQA 2DIGA 3MP8A 1WGSA 5FROA 2CKKA 3NTHA 4QQDA 2X4WA 4CRIA 3OYJA 4PL6A 2GFAA 4QQGA 3OYBA 3OMGA 2RHUA 2RHZA 3F70A 4Q5WA 4ZTJA 4BDYA 3L42A 2JTFA 4N4GA 3OYLA 4BD3A 2GFUA 3OS2A 3CEYA 2BKDN 2E5QA 2PQWA 4IUVA 3ZEHA 3S3NA 5FRNA 4B9WA 3LYIA 4Z02A 2X35A 4BE0A 3OYAA 4IURA 4BE1A 2VYTA 3OS1A 2K3YA 3MEWA 3META 4ZTFA 3OMCA 5KCOA 2R5AA 3FLGA 2QQRA 3H6ZA 4E7HA 3PNWC 3H8ZA 3OS0A 2YRVA 2IG0A 4B9XA 3OYNA 3S3MA 2NLUA 2BUDA 4LD6A 3DB3A 2FHDA 4IUTA 2RHIA 3PMIA 2BIVA 4N4HA 3DB4A 3QIIA 2XK0A 3L2VA 2WACA 5C0MA 3PMTA 3P8HA 5CIUA 3MEVA 3UT1A 2L8DA 2EQMA 2MWPA 3FEOA 2R58A 4QVZA 3L2RA 2O4XB 2P0KA 3DLMA 3QKJA 2RI2A 1G5VA 3BDLA 1OZ3A 4FU6A 3MP1A 3OB9A 5D6XA 3M9QA 3MP6A 3OYMA 2D9TA 3Q1JA 3ME9A 5IAYA 4EDUA 4IKFA 2R5MA 3S3OA 4A4EA 3NTIA 3P8DA 2RI5A 4II1A 5KCHA 5IN1A 1WJRA 3C4SA 4BACA 2G3RA 3LH0A 4E7LA 2DIQA 2K3XA 2QQSA 3OYHA 4BE2A 4E7JA 1OZ2A 5KH6A 2LVMA 2RO0A 4HCZA 5D6YA 3OA6A 4BDZA 2EQKA 4C5EA 2RJCA
chains in the Genus database with same CATH superfamily
2XKOC 1PRLC 1VQ6A 3V7RA 3FJ5A 4F04B 2YUNA 3RMQA 4E7ZA 2RK1A 3U23A 2DZ9A 2DXUA 4M4ZA 4L5GA 3CCMQ 3HP9A 2HL5C 3EFOA 1HK9A 4M75E 1X2KA 1BCOA 3IQLA 1VQ8T 3OYGA 5KE2A 3QBYA 1VQMA 4M7AE 2LX7A 4C8QE 4M7AC 4C8QC 3QPHA 5GMKj 2DNUA 3I55Q 2E3HA 1YFNA 2KNBB 5CKDA 4XU1A 4C5IA 1ZQ1A 2EGEA 4RUGA 3RKWA 3CCUQ 4BY6C 3G6EQ 3I56A 1K0XA 2EFIA 2HKNA 1F1BB 1WHGA 2RA2A 3OSVA 2X4XA 1S72A 1UFFA 4XU2A 2X4WA 5KYWB 3OYBA 1KHIA 1OX8A 4BDYA 3RR6A 4BD3A 3CCSA 1QCFA 4KRTA 5GAOn 1YIJT 1AWJA 1TUCA 1SSHA 1X6GA 1SHFA 2SRCA 4LUDA 2EKHA 1UGQB 2YXYA 2K9GA 2CT4A 3V8LA 1YBYA 2BIVA 3DB4A 4KULA 1IHWA 2FPFA 4Z8AA 1M8VA 4DBHA 1RACB 2BTTA 2DPPB 2MWPA 4AT1B 1K73R 2YLCA 1YITT 1JJ2P 2HMAA 1UGRB 1K9MU 1I1JA 2H3JA 2P0PA 3CXCP 3WVDB 2RH2A 2HZYA 4ZGJB 1NJIC 2QQ9A 2FRYA 3CCQT 2YDLA 1OZ2A 2FRWA 1B3QA 4M7DD 5LJ5h 1WXTA 1D09B 2E65A 1VQPQ 2JW4A 5FRMA 3CMEQ 2J6FA 4PFZA 4EMGA 1VQ9Q 1HXDA 1OX9A 1UE9A 2K6DA 1IGUA 4C0FA 1U5SA 1M3CA 1Q82U 1D0YA 3O8VA 4LE9A 1T0HA 1WIEA 4E6RA 1MV0B 2J05A 4XAXB 3X25B 4F7UF 2EQJA 4IUPA 1H3ZA 1Q86C 3MCAB 4A4GA 4A63B 4ZN3A 4M77G 4PLIA 4UC4A 4D8DA 3JSCA 4J9FA 1GRIA 1PC0A 2KE9A 1ABOA 4Y28E 1KFZA 1C0MA 4RTUA 3CCJQ 3BY7A 4BUGA 2E6NA 4M77E 3MHXA 1NG2A 3MKDA 1H8KA 2KVQG 2A7YA 3CCRA 4J83A 1I07A 3CEYA 1W70A 5FRNA 3OBWA 4Z02A 5CVIA 1VQ5A 1KD1C 1BB9A 1UTIA 2O01E 2JNGA 3VJPA 2M9UA 4XQ3A 5KCOA 3GLXA 3L2ZA 1D1CA 2CREA 3QSUA 3WVEB 1MMDA 1KQSS 2DXBA 5CIUA 4KT0E 1TXQA 2MCNA 3BE3A 2C06A 3O5ZA 4HA8A 1M2OA 2RN8A 5D6XA 1FX7A 5IHNA 3CPWS 3VS4A 5I2SA 4X9CA 1GL5A 4OMLA 4JS5A 5GANd 2V8IA 2Y4YA 2LJ3A 4J9BA 1BI0A 4B6MA 1VQNA 1AD5A 4HCZA 4BDZA 2ZZDA 5KYNA 2EQKA 4OMOA 2D6FA 2OTLA 1Q81U 1Q7YC 4HCBA 4M78A 4RTZA 3JB9J 4QQ6A 5GAN2 2BE7D 1KQSA 2DM1A 2A3LA 4ELZC 1PRMC 1VQ4T 2RI3A 2XDPA 4LDYA 2EYZA 2F69A 3GOXA 3CMAA 1NJIU 2X9HA 2M02A 3QHSA 1VQOT 1UDLA 1P92A 2QTXA 1WNLA 2ED1A 4MZPA 1VYVA 3QJ6A 2AKKA 2A0FB 1D0XA 3S6WA 2MPXC 3UDCA 1U8RA 3M0TA 4IUUA 3CCMA 2NUPB 4E7KA 3JAME 1YJNA 3RIRA 1NYGA 3FIFA 1UJ0A 4OB0B 3X20B 3OYJA 1Q86U 1T3LA 2K4YA 2QXFA 3QG1A 5CKFA 2FG0A 3NFCA 2DO3A 3VS1A 1WHHA 2VXFA 4HVVA 5LJ5e 3I55A 4F7UB 1IB8A 5GANj 1YJ9Q 1PD1A 1BBZA 1NE8A 3CC7T 4RG8A 1M3AA 2IG0A 4B9XA 3CCUA 2NLUA 3JV3A 2H3EB 1KC8C 1UGSB 3JB9D 2FZKB 5IT9E 3MEVA 2DL4A 4JS4A 2F2XA 2R58A 4BI4A 4J6YA 2L2PA 2DL8A 4M78D 1IRXA 3DLMA 3QKJA 2KY9A 2HEQA 1NYFA 1YI2Q 2QEXA 1B34B 1KD1U 3EGXB 1M90R 4MMLA 4A4KA 1CSKA 5LL6S 3CCLA 1YHQQ 4C5EA 1M8MA 1YNZA 2CSQA 4LDWA 2DD4A 5D6WA 4TVRA 4RTVA 5D7UA 2E4HA 4JPBW 4C0ZA 2LT4A 4AG1C 2M1HA 5HK3A 2EAYA 2RQUA 3GBQA 3CC2T 3GP8A 4JJNK 4HXJA 3OYCA 4JRPA 1C6VX 6AT1B 2RQVA 2DFUA 2JZ2A 2QDLA 2DK3A 5GAOr 3OYFA 4RTTA 2MIOA 2F5KA 3I56Q 4KGZB 1UECA 1X6BA 1IREB 2GBQA 2QQAA 4MDWA 3CMEA 1Q7YU 4JJCA 2L3RA 2RM4A 1D0ZA 4C92D 2YRDA 4ZNXA 3VUZA 1WXUA 3CCET 3WXMB 1JXOA 1W2BA 1W4SA 4JDSA 4R55A 4RCCA 1Y96B 1CKAA 2RHUA 2O9SA 2RQWA 5ECAA 2X35A 3M57A 2K5FA 3JB9I 4OB3B 1PD0A 3UATA 3REAB 4PJMA 3CCJA 2GGRA 3THKA 2KQWA 1TWBA 1MMGA 5GJWB 5I11A 1W6XA 1YJWQ 1NEBA 2KDSA 4PK4A 2GTJA 2KXCA 3M0PA 3C94A 3JCMg 2PVDB 2D0QB 5GAMg 1VQLQ 2LP5A 2DXCA 4LNPA 4GLKA 2RI5A 2FEIA 1RAAB 4MZTA 3BDUA 4GLMA 2D1XA 2KT8A 5D6YA 2K3BA 1WQ7A 4RG2A 1PM3A 3LGFA 3UA6A 3OY9A 3PTAA 2KAFA 3E9FA 2CP7A 1NPPA 1X75C 2L3PA 3JCMd 4E7IA 1M1FA 4PNOA 2X4JA 3JB9H 1PHTA 5GAMd 1M3BA 1Y96A 2MYSA 3H0HA 1BYMA 3DLLA 2CP2A 2JTMA 2LNHB 2NUTB 2KR3A 3LLRA 5LJ3g 3PGGA 4ESRA 4PFOA 3CD6Q 3TREA 3G4SA 3HTRA 5GAOl 3CC4T 4DA4A 4RTYA 4LD9K 2QK0A 1IXDA 3HPWA 3AT1B 3NMZC 1BU1A 2LCLA 1WHMA 1MGQA 1AZEA 2VASA 2X3WD 3EG0A 3E1SA 1M5Q1 1QVPA 3HL8A 1IHVA 4PL6A 1ACMB 1WYXA 1QVFP 4K11A 4Q5WA 2KSSA 2OTJT 1RLQC 2DL5A 2ZPHB 2EPDA 1ZSZB 4LN2A 2JXBA 5LJ3d 3JRZA 4JRQA 3J81E 1RAEB 2GNCA 1A0NB 2COZA 1TTHB 1BI3A 3VRZA 3H8ZA 2PTKA 2E3IA 1AOJA 3M0UA 1LCKA 2KEAA 1YWOA 2E64A 1N9RA 2JJ9A 2W0ZA 3D7SB 1QVGS 2V8JA 4KH0B 1VQ7A 3CCVT 1SRLA 2ZPBB 3P8BB 2QGGA 1G5VA 3M9QA 2ROLA 1WX6A 2Y90A 3QYGB 1WDXA 4II1A 4E7LA 3HRTA 1H92A 5CKBA 2NUTA 1YJ9A 1VQ6T 3JCMf 2OTLQ 2QDYB 4DOVA 1HSQA 5KH6A 2LVMA 5GAMf 4AFUC 1K73U 4F7UE 3E19A 4ME7A 2LQNA 3REBB 4C5HA 2YUQA 3I5SA 2K5LA 2XG8D 5IHIA 1U1SA 3CMAQ 1QVGA 3JB9F 1YI2A 1NLOC 1KSWA 2EW3A 4M78F 1ZSZA 1RUWA 1N27A 3DKMA 1XJWB 4M75G 5KYYA 1N8RR 2HKQB 1YHQA 3HFNA 2MOXA 2VXEA 3EHQA 1VYUA 1ZUKA 1S72T 4M7AG 4C8QG 1N5ZA 1YJNQ 1M1KR 1M9SA 2SEMA 3JCMJ 1ZA1B 2LJ1A 2GQVA 3EG9A 2XD0A 1G8XA 2EBPA 2DEUA 4MDXA 1OPLA 3CCST 2AT1B 4FYVB 5FROA 4QQDA 1E6HA 5AT1B 4M7DA 1WPYA 1WI7A 4PKCC 3OYLA 2DL3A 4XTUA 2GFUA 1OV3A 2DRMA 1OU9A 5GMKm 2E1HA 3VS7A 3SB2A 2FZCB 2QA4Q 4Y91A 3VRYA 2CS7A 3OS0A 5CO7A 1T3SA 3ULRB 2EYYA 1SF9A 1VQKQ 2FHDA 3L1AA 4XTYA 2RHIA 2KK4A 4QVDA 5A0DA 2AZVA 1K8AR 3G1JA 4ZN1A 3I35A 2DXTA 4C92F 2QEXQ 1GBRA 4FYYB 4OF1A 1M90C 3NHNA 4R0KA 2EJ9A 2DTIA 4HVWA 4J6XA 1NPRA 4M77D 3C4SA 5GAN8 2KBTA 5GAOm 3J7AF 3CCLQ 1SKUB 2K3XA 4V2SA 4NOYA 4AFSC 4JZ3A 1Q81C 2RF0A 1LJOA 4J9HA 1T0JA 1VQ8A 1JQQA 5GMKi 4OGCA 5J26A 2RMOA 1YJWA 3R6NA 3L2QA 3M55A 4A4FA 2J6OA 2C0IA 4KGVB 1VQLA 5KYXA 2CP0A 2RQRA 2F5TX 5CK9A 3A8HB 2O31A 2EWNA 2KRNA 1RI0A 2DZCA 2ZGWA 2CT3A 4O5VA 2GF7A 1VOMA 4J5YA 1E7OA 3LWHA 2E41A 2EJGA 4PJOA 4F17A 3CCRT 2JTEA 4AG2C 2RJDA 5GAN6 9ATCB 1OI1A 2DMOA 3M59A 2RPNA 3MP8A 2CKKA 4QQGA 1PWTA 1SG5A 4BI3A 2FL7A 2E5QA 3ZEHA 1Y07A 5FU6C 1KQ2A 1GCQA 3OYAA 3CD6A 1YITA 4M78B 3JCMX 3TVTA 3G71Q 4LD6A 1UJYA 3URGA 2GTOA 2CP3A 3CCQA 4ZGDB 4QVZA 3L2RA 1M2VB 1QLYA 5CKEA 5DLOA 3TSWA 1E6GA 2DD5A 1VQNT 5GANg 3S3OA 1AHJB 4ANJA 5I22A 1JB0E 2HL3A 2YT6A 4D8KA 3C12A 1ZSZC 2QYZA 1LVKA 5CQYA 4J9DA 3NGPA 1JU5C 8ATCB 2M0YA 1K4US 2CUBA 4PJOD 3EGUA 4XTWA 1M90U 1AEYA 1B07A 2QI2A 2H8HA 3RDVA 1BKBA 1IO6A 4C92B 4M7DC 2X4YA 3LGLA 3G4SQ 1QWFA 1G3TA 4EPCA 1K9MR 3H0IA 3CCMT 4FT4A 2OJ2A 1Y0MA 3OYKA 3CQTA 3EAEA 3QXEB 2OAWA 4VUBA 1N6AA 1KQSP 4FYXB 3I5RA 1C1AA 3OMGA 3I55T 3PIOA 2E6ZA 2D8HA 1M2VA 2HNIA 3CPWA 1WZOA 2LZ6B 1XOVA 3CCUT 3G6ET 2LQWA 2LJ0A 3SEMA 4HCCA 2M51A 1G3YA 2GQIA 5DM7R 3H6ZA 3V8KA 1S1NA 1N9SA 2HBWA 1VQ7Q 1BI1A 1TOVA 2XK0A 1AT1B 4ATOA 4JRKA 1O75A 1ZUYA 2QQBA 1BIAA 2VGMA 4F16A 3CBMA 1U1TA 3RERA 4C92A 1V76A 1K9AA 2G3RA 2QA4A 1ZBXA 2DIQA 3QZ9B 3BFMA 3OA6A 1WJSA 1VQKA 5GANf 4HT9A 2LDMA 2OTJQ 2D8JA 5FWBA 4EMKA 4PJOC 1KK7A 3VUBA 1PSFA 2IVWA 3HRSA 2VGNA 4OGEA 5I2MA 1PG5B 4CC7A 2FO0A 2J6KA 2LCCA 3JCMh 3HFOA 4PJNA 3OYEA 1OYXA 1VQPT 5M9OA 5GAMh 3CMET 1VQ9T 5C6SA 1NM7A 1NZ9A 4GBQA 3JCMQ 4ELYC 1QP2A 1GCQC 3TSZA 5LJ5j 3HSBA 3LW5E 2VB6A 2YLBA 1OQKA 2EKOA 2L0AA 2EQIA 3UWNA 3X26B 2EGCA 2AK5A 3ZBDA 4FW2A 5EG2A 1WXBA 3CC7A 1YCYA 4C0DB 2GFAA 2DE0X 1UG1A 4OMQA 1M4ZA 1FMVA 2ATCB 4KUIA 2ZCFB 4LUEA 2YSQA 1D1AA 4FM4B 3CCJT 4BE0A 4FCYA 4JJBA 2A08A 4XU0A 2JOYA 3A8LB 1HD3A 2WSFE 4M7DF 2BUDA 4J7IA 5GAN7 1NJIR 4KH1B 3P8HA 3VS0A 3UT1A 1W2BP 1K0SA 4J9GA 2P0KA 2QG9B 2VUBA 1Z9QA 1WA7A 1GFCA 3KBGA 3JCMc 2VWFA 3VKIA 4E7JA 1K73C 3OW2S 1MUZA 3G71A 1VQ8Q 4O6JA 2RJCA 1YP5A 1Q86R 3KFVA 4M78E 3X24B 4M78C 2KI7A 2VKNA 1PCXA 2A36A 2RHYA 3V7SA 3E2UA 2K7AA 1WJQA 5KE3A 1XNIA 2RHXA 4JUVA 2V1QA 1CKBA 3TCJA 1ZBJA 1OEBA 4M75A 1SHGA 2JM8A 1M27C 4FL6A 2V1RA 2DYBA 5HY6A 2O4XA 4WTOB 5GMKl 5CCAA 4C0GA 3VYHB 2F1LA 2RQTA 2HSEB 2LCSA 2MI6A 1Y7XA 4XU3A 2RJEA 2LTOA 2HSPA 3CPFA 3V8JA 1YIJQ 1BK2A 2MWOA 3A1PA 1NEGA 3OW2A 2Y4XA 1KD1R 4J7FA 5FU6B 4OMMA 2MAMA 4PJLA 1QP3A 4RCBA 2LQKA 4IIOA 1QW1A 2EIFA 5IH2A 2RHZA 3C0CA 4ZTJA 3L42A 2JTFA 4N4GA 5AYFA 4PJOF 1N8RU 2BKDN 2NUZA 4IUVA 2ZAEA 3G7ZA 1YITQ 1G83A 4J9EA 1ZHIA 4BE1A 4IIMA 2LMJA 3RKXA 4C92E 2K3YA 2DERA 4C92C 3OMCA 1MMAA 2QQRA 4LDVA 3S3MA 5L23A 1LNXA 5L8RE 3PMIA 1UHFA 1M30A 2F2VA 2VV5A 3CCQQ 2CYZB 1U3OA 2CDTA 4EMKC 1D1BA 1X2QA 2DTOA 4X9DA 3JCMe 3QZ5B 5GAMe 3MP6A 1UEBA 2BZ8A 4FT2A 5KYYB 1QCOA 1Q7YR 3C95A 5IAYA 4J9IA 4M75D 1IGQA 1UGPB 3M4GA 2A28A 2PVGB 5GAN3 4KBMB 2LNVA 1K8AU 1OOTA 1MNEA 3N5BB 3EG9B 4M7AD 5IXFA 4C8QD 3SHWA 1IZ6A 4M7DB 1YI2T 1QWEA 2RD1A 1EIFA 1MV3A 5DY9A 3A98A 1TUGB 4XTVA 4F7UG 4A4HA 2KYMA 4PLLA 3CC4A 2DBKA 3GNFB 3MO8A 3EFSA 4KUDK 1JXMA 3EH1A 4PJJA 1YHQT 1B7TA 1FXXA 3GNGA 2XICA 5LJ3e 4OVAA 2L3SA 4BB7A 1BI2A 2I2LA 1TU0B 1I8FA 3M0RA 3MEAA 5HKCA 2B8AA 2KYBA 2OTJA 4CI0C 2KT1A 2ZPEB 2EYXA 1VQMT 2PZ1A 1RAHB 4F14A 2C0OA 2DX1A 4M77A 5FWCA 1I5LA 1M1GA 2DIGA 1WGSA 1TG0A 4JLIA 1QVGP 4OMPA 1DJ7B 5GMKe 2AKLA 2C0TA 1YCSB 1KC8R 3I56T 5GAOq 2PQWA 1RAGB 2K5IA 3CCVA 3M0QA 4E7HA 5LJ3f 3PNWC 2YRVA 2QGFB 3DB3A 1JRIA 5CAIA 3JCMW 5C0MA 3PMTA 5KYXB 5EC7A 4LXCA 4AMCA 1VYTA 5CKHA 2HQHA 2XU8A 3SWNA 3PT9A 1OZ3A 3MP1A 3OB9A 2CZ7B 4LDUA 2K57A 2L3QA 1PSEA 2EYWA 2CZ0B 4XTXA 4M75C 4C0DC 3NTIA 1UB4A 4FIBA 4RTXA 5KCHA 2COYA 1WJRA 2DA9A 2V8KA 2LQ8A 4PJOB 3OYHA 4BE2A 3H41A 1VQ4Q 2LT1A 1Q95G 1YJWT 4FW1A 1VQOQ 1ZSGA 4QW2A 1PKSA 1MNDA 1JJ2S 1VQLT 3QDFA 3A8GB 2EGAA 3CXCS 2EJFA 2KRSA 3EHRA 1R0BG 2E12A 4NS5A 2OI3A 1RABB 3VS6A 4L59A 1WHKA 5GANh 1I4K1 1ABQA 1BIBA 3MEUA 2E70A 2YUPA 4A53A 2DAQA 2PUOB 2VC8A 3ER0A 2LX9A 2M16A 3FDRA 2WSCE 3M4YA 2D0NA 3CC7Q 3PE0A 3OYDA 2ABLA 4DBQA 3NTHA 3HRUA 1R8OB 1JJ2A 3CD6T 2ZPIB 2P0QA 4N0AA 2XDBA 4XTZA 5FU7B 3CXCA 3S3NA 4B9WA 3GIBA 1R0CB 1KQ1A 1SRMA 4IURA 3MEWA 4ORZA 2K79A 5FW9A 3FLGA 5J3BA 3J80E 1YIJA 2DTHA 4L6V5 2JS0A 4N4HA 2BZXA 3QIIA 5IXBA 4PFPA 5HCKA 2JMCA 1WHJA 2HDAA 4DBFA 3M58A 1VQ5T 2JUFA 3FEOA 4OMFB 2MK5A 1KJWA 3GF5A 1I81A 1G3SA 3RMSA 3AHUA 3Q1JA 1I5OB 3M56A 1VUBA 1VA7A 4DOWA 5KYWA 5GJVB 1FMKA 2IIMA 3CC2Q 3EG3A 2W10A 2L5QA 2OX7A 3M53A 2J7IA 1OPKA 2HQXA 4RKUE 2NYSA 2DYIA 1Y71A 3OYYA 3X28B 3H9NA 3ZL7C 3JCMV 2YHTA 1SEMA 1V29B 2F2WA 4M77C 2HQEA 1EZZB 2OTLT 1KG1A 2ZPFB 3EGDB 3CCEQ 3NTKA 1G3WA 1JEGA 1H641 3FRNA 2P4TA 7AT1B 2JVVA 3RESA 3OYIA 5J39A 1WLPB 2L89A 1HJDA 1KHCA 5A2QE 4M75F 4M7DG 2X3XD 4FSSA 3CMAT 3CBOA 4E7SA 4QT7A 4M7AF 1VIEA 4C8QF 2MMPA 3KXTA 4IUQA 1OU8A 3QO3A 1WQWA 4M7DE 1I0CA 2QTVA 2RK2A 2Z0WA 1YWPA 2NWMA 1O9SA 3SWNC 2FZGB 3OS2A 2X51A 3QYHB 2ROTA 2CH4A 2O2OA 3LYIA 5LJ5g 4LDXA 2VYTA 1YJNT 4OMNA 2EVRA 4CC2A 3META 4EMKB 3A8MB 2O9VA 4QVCA 3M5AA 3TEEA 5KYUB 1NBEB 4OB2B 2CH4W 3HKSA 3L2VA 4CC3A 2CP6A 2AHJB 2EQMA 4JRIA 4CC4B 2BZYA 2K2VA 4OP0A 1RLPC 2DLPA 2RI2A 1JBMA 4FU6A 3CBPA 2CUDA 2QA4T 3CPWP 5IHKA 5GAN4 5GANe 1ZA2B 1Q82R 1GCPA 4EDUA 4HVUA 3EGDA 5LJ5d 1VQKT 3QUIA 1WHLA 3LH0A 1X43A 1PKTA 4OB1B 4NL3A 1MMNA 1YN8A 2VVKA 4AFZC 1KIKA 1ZX6A 4JLGA 4N4IA 2QEXT 1HYOA 2DJZA 2HD0A 3EG1A 2DL7A 2KGTA 1W1FA 4E2FB 3CC4Q 4EMHA 2LRQA 3BW1A 1Z9ZA 3CCLT 1H3HA 2MF2A 2KXDA 2JMAA 1K76A 3H0FA 3JCMb 2P84A 2FVUA 3LX7A 3NPFA 4PJOG 2ENMA 2KRMA 3FC3A 4N0AC 1X69A 2FYKA 1VQ4A 3UF4A 3SD4A 3RUXA 2CZ1B 2G6FX 1VQOA 4PJOE 3ASKA 5KYUA 3OSSC 1SSFA 3G6EA 1GXIE 2V26A 3EFRA 1N8RC 2HBPA 1ZLMA 3CCVQ 1JO8A 4J6WA 1M1KC 4M77F 3A8OB 3GPLA 4Z88A 2ZPGB 4YTLA 3OS1A 2AZSA 4WCIA 1TH7A 2R5AA 3PIPA 2XI9A 2DETA 3OYNA 4DQ2A 5I21A 2GCXA 4HT8A 3M0SA 1GFDA 5LJ5f 1SPKA 2JN0A 1VQ6Q 1EFNA 4M75B 4JJDA 2DEQA 1R77A 2L8DA 1UHCA 1BCMA 1ARKA 1W2BS 2KROA 2O4XB 1X6OA 2DJQA 1Q81R 4M7AB 3BDLA 4FYWB 4C8QB 2CZ6B 4X1VA 2K2MA 2NUPA 4WF2A 2P4RA 3G71T 1LPLA 1QMCA 3P8DA 2LC4A 3R6OA 5LJ3h 1VQMQ 1K8AC 4BY6B 2QQSA 3VV0A 5FU7C 2RO0A 1RAFB 2DRKA 2E10A 5GAN5 3L2WA 4F7UA 2I0NA 4R56A 4MZMA 4DBRA 1RL2A 2BE9B 1VQPA 1VQ9A 3QWXX 3JB9G 1S72Q 2EQUA 2HAXA 2HCKA 4J9CA 3KUFA 5GMKh 4M78G 1NLPC 1FWZA 4FSXA 5GAOp 4ZGEB 1OULA 3PFSA 3CCSQ 8AT1B 2XMFA 2XIDA 1J3TA 1QKXA 2YRCA 3SDZA 3QJYA 3OQ5A 5CQXA 5FLXE 2WSEE 4HCKA 3CC2A 3L2UA 3V7CA 1QQJA 1B34A 3ZFJA 3E9GA 1RAIB 1UUEA 3EGXA 1MHNA 4X34A 3RKYA 4C5GA 3EG2A 4XK8E 2DILA 3MPUB 5DLQE 1K1ZA 4BI8B 2PU9B 2IPOB 3SFMA 3G4ST 2ESWA 2XHCA 3F70A 3CCEA 3A5ZB 4M7AA 4E47A 2JS2A 4C8QA 4A54A 2PVOB 4JZ4A 1AWOA 1U06A 1Y57A 4D6WA 1XTDA 2CSIA 2JM9A 2FB7A 4Y92A 4ZTFA 1AWXA 5HK0A 3OW2P 4IUTA 3RNJA 4RMOA 2WACA 1KC8U 1ZUUA 4C92G 2DVEA 4Z89A 1QVFS 2B86A 1FMWA 2D9TA 1TS9A 2YUOA 3ME9A 1V1CA 2A37A 3LWIA 1M1KU 1D3BB 2QAZA 2AIRB 3EH2A 4IKFA 2YWWA 2FPDA 3MJXA 4P5NA 4BACA 1VQ7T 2J06A 3VYGA 3TQ7P 2DF6A 4DEYA 3QWYA 4M77B 3FJPA 3VS3A 1GBQA 1QCNA 2RJFA 4GY5A 2OAUA 3VS5A 3INZA 1RADB 2PNIA 1YJ9T 3UPUA 3OS5A 4KGXB 2PUKB 2R57A 3CCRQ 1X01A 5A0LA 2XDDA 1EX4A 1QVFA 4J8OA 5A0GA 3M54A 2FPEA 3FB9A 1TSFA 1VIFA 3T9NA 1VQ5Q 2M0OA 1AZGB 3PVQA 4NL2A 1G2BA 3SWNB 5CR2A 3EFOB 1PNJA 2RB6A 2COWA 4QKUA 4RTWA 2KMTA 3TU4K 1LOJA 2E5KA 2QASA 1K9MC 2DVJA 2DKGA 1FYNA 1D3BA 2RNAA 3VU3C 5GAMj 4EIKA 2DBMA 2CP5A 1TUDA 3I9QA 1VQNQ 1AVZC 4HKEA 1UGVA 2ECZA 3UA7A 1AWWA 2JT4A 2EYQA 2O88A 1Q82C 3QDRB 4DEXA 2ED0A 3OYMA 4AFQC 1X27A 2CGHA 4MMKA 2R5MA 3JCMP 4A4EA 3OBYA 3LH5A 5IN1A 3VS2A 1RI9A 3RBBB 1XQHA 3HHTB 1WFWA 3PVLA 1QKWA 5LJ3j 4CRIA
chains in the Genus database with same CATH topology
1WJSA 1VQKA 2XKOC 2L5QA 2LDMA 5GANf 4HT9A 1WQ7A 4RG2A 3M53A 3V7RA 1VQ6A 2HQXA 3LGFA 4EMKA 4RKUE 3RMQA 3OY9A 1Y71A 3OYYA 2KAFA 2RK1A 3E9FA 2DZ9A 2DXUA 3VUBA 3X28B 3PTAA 4PJOC 4L5GA 1PSFA 3HP9A 1NPPA 2IVWA 3HRSA 1NJIU 3JCMV 1X75C 2YHTA 1HK9A 1V29B 4M75E 3JCMd 4E7IA 1M1FA 4M77C 2VGNA 2X4JA 4PNOA 4OGEA 5I2MA 3JB9H 2HQEA 5GAMd 2OTLT 1KG1A 1Y96A 2ZPFB 2LCCA 1VQ8T 3OYGA 3JCMh 5KE2A 3DLLA 3QBYA 1VQMA 3HFOA 3OYEA 4M7AE 1OYXA 2JTMA 1G3WA 3NTKA 4C8QE 5M9OA 1VQPT 5GAMh 4M7AC 4C8QC 1H641 3CMET 3LLRA 3QPHA 5C6SA 5GMKj 1NZ9A 3FRNA 3PGGA 2P4TA 5LJ3g 3JCMQ 3TREA 2JVVA 3RESA 4ELYC 5J39A 3OYIA 5CKDA 2L89A 4XU1A 1QP2A 1KHCA 1ZQ1A 4C5IA 5A2QE 3G4SA 5LJ5j 3HSBA 4M75F 5GAOl 3LW5E 3CC4T 4DA4A 2YLBA 3RKWA 4M7DG 4LD9K 4BY6C 3I56A 2EFIA 3HPWA 3CMAT 3CBOA 2RA2A 2EKOA 3OSVA 2LCLA 4M7AF 1VIEA 4C8QF 3UWNA 1MGQA 2MMPA 3KXTA 3X26B 2X4XA 1S72A 3E1SA 4IUQA 1M5Q1 1QVPA 3QO3A 1WQWA 3ZBDA 4XU2A 5EG2A 3CC7A 4M7DE 2X4WA 1YCYA 3HL8A 4PL6A 4C0DB 2GFAA 3OYBA 1KHIA 2RK2A 4Q5WA 2KSSA 4BDYA 2OTJT 3SWNC 1O9SA 2ZPHB 4BD3A 1M4ZA 3CCSA 3OS2A 4KUIA 2ZCFB 3QYHB 5GAOn 5LJ3d 3LYIA 3JRZA 1YIJT 1VQLA 4FM4B 3CCJT 4JRQA 4BE0A 5LJ5g 3J81E 4LDXA 2VYTA 1YJNT 1VQNT 1UGQB 4XU0A 2JOYA 3A8LB 1BI3A 3META 2WSFE 4EMKB 3A8MB 4QVCA 3M5AA 3H8ZA 3TEEA 4M7DF 2BUDA 3V8LA 4OB2B 1YBYA 2BIVA 3HKSA 3DB4A 4J7IA 4KULA 2E64A 5GAN7 3L2VA 1N9RA 3P8HA 1M8VA 1QVGS 2V8JA 1VQ7A 3UT1A 3CCVT 2AHJB 2EQMA 2MWPA 2DPPB 2ZPBB 2YLCA 4JRIA 1YITT 3P8BB 2K2VA 4OP0A 2P0KA 1UGRB 2VUBA 1K9MU 2RI2A 1JBMA 1G5VA 4FU6A 2H3JA 2P0PA 3CBPA 3M9QA 2QA4T 5GAN4 5GANe 3KBGA 4IKFA 2Y90A 3JCMc 3QYGB 3WVDB 4EDUA 2RH2A 5LJ5d 4II1A 1VQKT 3QUIA 4E7LA 4ZGJB 3HRTA 3LH0A 1NJIC 2QQ9A 5CKBA 1YJ9A 3CCQT 3JCMf 3VKIA 1VQ6T 4E7JA 1OZ2A 2QDYB 4DOVA 5KH6A 5LJ5h 2LVMA 5GAMf 4OB1B 3OW2S 1K73C 3G71A 4NL3A 4O6JA 2E65A 1K73U 2RJCA 4F7UE 3E19A 4ME7A 1VQ9T 5FRMA 4JLGA 4N4IA 4EMGA 3X24B 4M78E 2QEXT 1HXDA 4C5HA 4M78C 2RHYA 3V7SA 2DJZA 2HD0A 4C0FA 1Q82U 1WJQA 3O8VA 5KE3A 1XNIA 2K5LA 2XG8D 2RHXA 4JUVA 1U1SA 4EMHA 2LRQA 3BW1A 4XAXB 3CCLT 3TCJA 2MF2A 1QVGA 1YI2A 3JB9F 4M75A 3X25B 3JCMb 4F7UF 2EQJA 2FVUA 4IUPA 3LX7A 1H3ZA 4FL6A 4PJOG 1Q86C 3MCAB 5HY6A 4M78F 4A4GA 3FC3A 2O4XA 4N0AC 5GMKl 5CCAA 2FYKA 4C0GA 3VYHB 1N27A 3DKMA 4ZN3A 4M77G 1VQ4A 4M75G 4PLIA 4UC4A 3JSCA 1YHQA 3HFNA 3SD4A 3RUXA 2CZ1B 2VXEA 2MI6A 4Y28E 1Y7XA 4XU3A 2RJEA 1VQOA 2LTOA 3CPFA 1S72T 4PJOE 3V8JA 4M7AG 3ASKA 3BY7A 4BUGA 4C8QG 3OSSC 2MWOA 2E6NA 3OW2A 1SSFA 4M77E 1M9SA 2Y4XA 3MHXA 3JCMJ 4J7FA 5FU6B 3G6EA 2GQVA 2XD0A 4MDXA 2KVQG 3CCST 2MAMA 1GXIE 1QP3A 5FROA 2A7YA 3EFRA 4QQDA 4RCBA 2LQKA 3CCRA 1QW1A 1N8RC 2EIFA 4J83A 1WPYA 2RHZA 2HBPA 3OS1A 4M7DA 4ZTJA 4PKCC 3L42A 2JTFA 4N4GA 5AYFA 4PJOF 3OYLA 1N8RU 4XTUA 2GFUA 3CEYA 2BKDN 4IUVA 5FRNA 3G7ZA 3OBWA 5GMKm 4J6WA 4Z02A 1M1KC 4M77F 1ZHIA 2E1HA 3A8OB 5CVIA 4BE1A 1KD1C 3SB2A 1VQ5A 3GPLA 3RKXA 2O01E 2JNGA 2ZPGB 4YTLA 2K3YA 4Y91A 3VJPA 4C92E 2M9UA 4XQ3A 4C92C 3OMCA 5KCOA 1TH7A 2R5AA 2QQRA 2XI9A 2CS7A 3GLXA 3L2ZA 3PIPA 4LDVA 3OS0A 5CO7A 3OYNA 3S3MA 4DQ2A 5I21A 2GCXA 3QSUA 2FHDA 1LNXA 3L1AA 4XTYA 2RHIA 2KK4A 3PMIA 5L8RE 3WVEB 5LJ5f 2VV5A 4QVDA 1KQSS 5A0DA 2JN0A 4M75B 2CYZB 2DXBA 5CIUA 2DEQA 4ZN1A 4KT0E 2L8DA 2DXTA 1W2BS 4EMKC 2C06A 2O4XB 1X6OA 2DTOA 4X9DA 3JCMe 4C92F 4HA8A 1JJ2A 4M7AB 3BDLA 4C8QB 3QZ5B 5D6XA 4OF1A 5GAMe 3MP6A 1FX7A 1M90C 1UEBA 4FT2A 2CZ6B 3CPWS 3C95A 2EJ9A 5IAYA 4WF2A 2DTIA 4J6XA 5I2SA 1NPRA 3G71T 4X9CA 4M77D 4JS5A 3P8DA 5LJ3h 4M75D 2LC4A 3R6OA 3C4SA 5GAN8 1UGPB 3M4GA 5GAOm 1K8AC 3J7AF 5GANd 2PVGB 4BY6B 2K3XA 2QQSA 4KBMB 5GAN3 2LNVA 2V8IA 2Y4YA 1K8AU 4NOYA 3VV0A 4V2SA 1BI0A 5FU7C 1VQNA 2RO0A 3N5BB 4HCZA 4BDZA 2E10A 2ZZDA 4M7AD 1Q81C 4C8QD 2EQKA 5GAN5 1LJOA 3L2WA 2D6FA 2OTLA 1Q81U 4F7UA 1VQ8A 1IZ6A 5GMKi 4R56A 4MZMA 1Q7YC 4HCBA 1RL2A 4OGCA 5J26A 1VQPA 4M78A 4M7DB 1YI2T 1YJWA 2RD1A 3JB9J 1VQ9A 4QQ6A 5GAN2 1EIFA 5DY9A 3L2QA 3M55A 3JB9G 4A4FA 1KQSA 2EQUA 4XTVA 4F7UG 4A4HA 2HAXA 4PLLA 2A3LA 3CC4A 3KUFA 5GMKh 4M78G 3GNFB 3MO8A 3EFSA 1FWZA 2RI3A 4FSXA 4ELZC 5GAOp 1VQ4T 4ZGEB 2XDPA 4KUDK 4LDYA 2F69A 2F5TX 5CK9A 3GOXA 1FXXA 3GNGA 3A8HB 3PFSA 3CMAA 1YHQT 2EWNA 2XICA 3QHSA 5LJ3e 1VQOT 2XIDA 1P92A 4OVAA 1RI0A 4BB7A 2QTXA 1BI2A 2I2LA 1WNLA 2DZCA 2ZGWA 3OQ5A 3QJYA 4O5VA 5CQXA 2WSEE 3SDZA 5FLXE 1I8FA 3CC2A 3L2UA 2GF7A 3V7CA 4MZPA 1B34A 3MEAA 3E9GA 4J5YA 3ZFJA 5HKCA 2B8AA 3QJ6A 3LWHA 2OTJA 2E41A 2EJGA 1MHNA 4CI0C 4PJOA 3S6WA 3CCRT 4X34A 2ZPEB 1VQMT 3RKYA 3UDCA 4C5GA 1U8RA 2RJDA 4XK8E 5GAN6 1OI1A 4IUUA 3M59A 4M77A 3CCMA 1I5LA 4E7KA 1M1GA 3JAME 1YJNA 2DIGA 3MP8A 3RIRA 3FIFA 5DLQE 1WGSA 2CKKA 4JLIA 4OB0B 3X20B 4BI8B 3OYJA 2PU9B 4QQGA 3SFMA 3G4ST 1DJ7B 5GMKe 1Q86U 2XHCA 3F70A 2K4YA 2QXFA 3A5ZB 3QG1A 4BI3A 4E47A 3CCEA 4C8QA 5CKFA 4M7AA 3NFCA 3I56T 2DO3A 4A54A 2PVOB 5GAOq 2FL7A 2E5QA 2PQWA 3ZEHA 1Y07A 2VXFA 5LJ5e 5FU6C 1KQ2A 2K5IA 3I55A 3OYAA 3CD6A 4D6WA 4F7UB 3CCVA 1XTDA 5GANj 2FB7A 1YITA 4ZTFA 4M78B 1NE8A 3JCMX 4E7HA 4RG8A 5LJ3f 3CC7T 3PNWC 2YRVA 2IG0A 4B9XA 3CCUA 5HK0A 2NLUA 4LD6A 3DB3A 1JRIA 5CAIA 4IUTA 3JCMW 4RMOA 1KC8C 1UGSB 2WACA 5C0MA 3PMTA 3JB9D 3URGA 1KC8U 5IT9E 3MEVA 4C92G 2DVEA 3CCQA 1QVFS 4JS4A 4ZGDB 2R58A 4QVZA 3L2RA 4BI4A 4J6YA 5CKHA 4M78D 3SWNA 2XU8A 3DLMA 3PT9A 3QKJA 1OZ3A 3MP1A 2KY9A 3OB9A 2CZ7B 5CKEA 2D9TA 5DLOA 4LDUA 2K57A 3ME9A 2QEXA 3LWIA 1M1KU 1D3BB 1PSEA 1B34B 2DD5A 2CZ0B 4XTXA 5GANg 1KD1U 4M75C 4C0DC 3NTIA 1UB4A 3S3OA 1AHJB 4FIBA 5KCHA 1WJRA 4P5NA 4BACA 2V8KA 2LQ8A 4MMLA 1VQ7T 1JB0E 4PJOB 4A4KA 3OYHA 4BE2A 3VYGA 3C12A 2LT1A 1YJWT 5LL6S 3CCLA 4M77B 4C5EA 3FJPA 5CQYA 4QW2A 2RJFA 4LDWA 4GY5A 2OAUA 2DD4A 5D6WA 4TVRA 1JJ2S 3INZA 1VQLT 4PJOD 4XTWA 1YJ9T 3UPUA 3A8GB 3OS5A 2PUKB 4C0ZA 1M90U 2R57A 2LT4A 3CXCS 2EJFA 2M1HA 2QI2A 1X01A 5A0LA 2EAYA 5HK3A 2XDDA 1BKBA 1QVFA 3CC2T 3GP8A 2E12A 4NS5A 4JJNK 4J8OA 4C92B 5A0GA 3OYCA 4JRPA 4M7DC 3M54A 2X4YA 3LGLA 4L59A 2JZ2A 3FB9A 5GANh 2DK3A 5GAOr 1VIFA 3OYFA 3T9NA 1I4K1 1BIBA 2F5KA 2M0OA 3MEUA 1G3TA 2E70A 4EPCA 1IREB 4A53A 3CCMT 2QQAA 4FT4A 2DAQA 4MDWA 4NL2A 3CMEA 1Q7YU 2PUOB 2L3RA 2RM4A 2VC8A 3ER0A 2LX9A 3SWNB 5CR2A 2M16A 3FDRA 2WSCE 4C92D 3OYKA 4HT8A 3M4YA 3VUZA 3EAEA 3QXEB 4VUBA 1N6AA 3CCET 3OYDA 3WXMB 2RB6A 1W2BA 3NTHA 1W4SA 4JDSA 4R55A 2KMTA 3HRUA 3OMGA 1R8OB 4RCCA 3I55T 1Y96B 2RHUA 3PIOA 3TU4K 2E6ZA 1LOJA 2P0QA 2ZPIB 3CD6T 4N0AA 1K9MC 2HNIA 3CPWA 2DKGA 2XDBA 4XTZA 5FU7B 3CXCA 3S3NA 1XOVA 4B9WA 3CCUT 1D3BA 3G6ET 2X35A 3M57A 3GIBA 2K5FA 3JB9I 3VU3C 1KQ1A 4IURA 5GAMj 4HCCA 1G3YA 3MEWA 4OB3B 5DM7R 3FLGA 3H6ZA 1BYMA 3V8KA 5J3BA 3J80E 1YIJA 3CCJA 2DTHA 1N9SA 4HKEA 4L6V5 4N4HA 3QIIA 1BI1A 2KQWA 2XK0A 4ATOA 4JRKA 1O75A 3M58A 1VQ5T 2JUFA 3FEOA 4OMFB 2EYQA 1Q82C 3QDRB 2KDSA 3GF5A 1I81A 1G3SA 2QQBA 3C94A 3RMSA 3JCMg 3AHUA 1BIAA 3OYMA 2PVDB 2D0QB 2VGMA 3Q1JA 5GAMg 3M56A 4M7DD 1VUBA 3CBMA 2CGHA 4MMKA 2DXCA 2R5MA 3JCMP 4GLKA 3OBYA 4A4EA 4DOWA 1U1TA 2RI5A 3RERA 5IN1A 4C92A 2G3RA 1XQHA 2QA4A 3HHTB 1ZBXA 2DIQA 4MZTA 3QZ9B 3BDUA 3BFMA 5D6YA 3OA6A 5LJ3j 4CRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJS A;  2LDM A;  3L2W A;  5FRM A;  4N4I A;  4RG2 A;  1H3Z A;  4C5H A;  4QW2 A;  2RJF A;  2HQX A;  3LGF A;  4GY5 A;  5J26 A;  2RHY A;  5D6W A;  3OY9 A;  3E9F A;  4QQ6 A;  1WJQ A;  3O8V A;  5KE3 A;  1XNI A;  3L2Q A;  4A4F A;  2RHX A;  2EQU A;  2R57 A;  4A4H A;  4E7I A;  2LRQ A;  2M1H A;  4PLL A;  2HQE A;  3KUF A;  3MO8 A;  2RI3 A;  2EQJ A;  2XDP A;  4NS5 A;  4IUP A;  3LX7 A;  2LCC A;  4FL6 A;  3OYG A;  3GOX A;  5KE2 A;  3OYC A;  3QBY A;  3PFS A;  2X4Y A;  3OYE A;  1OYX A;  3NTK A;  4A4G A;  3FC3 A;  2O4X A;  5M9O A;  3LGL A;  4L59 A;  4OVA A;  2JZ2 A;  1RI0 A;  3LLR A;  1N27 A;  5C6S A;  3OYF A;  3OQ5 A;  4PLI A;  3OYI A;  4UC4 A;  5J39 A;  2L89 A;  3L2U A;  4C5I A;  1KHC A;  2GF7 A;  2F5K A;  2M0O A;  3MEU A;  3SD4 A;  3MEA A;  3E9G A;  2B8A A;  2RJE A;  2LTO A;  3QJ6 A;  2DAQ A;  1MHN A;  2L3R A;  3ASK A;  2EFI A;  2M16 A;  3FDR A;  3S6W A;  2MWO A;  2E6N A;  4X34 A;  3OYK A;  1SSF A;  2EKO A;  3EAE A;  4C5G A;  2RJD A;  1OI1 A;  3UWN A;  4IUU A;  2X4X A;  3OYD A;  4E7K A;  4IUQ A;  2DIG A;  3MP8 A;  1WGS A;  5FRO A;  2CKK A;  3NTH A;  4QQD A;  2X4W A;  4CRI A;  3OYJ A;  4PL6 A;  2GFA A;  4QQG A;  3OYB A;  3OMG A;  2RHU A;  2RHZ A;  3F70 A;  4Q5W A;  4ZTJ A;  4BDY A;  3L42 A;  2JTF A;  4N4G A;  3OYL A;  4BD3 A;  2GFU A;  3OS2 A;  3CEY A;  2BKD N;  2E5Q A;  2PQW A;  4IUV A;  3ZEH A;  3S3N A;  5FRN A;  4B9W A;  3LYI A;  4Z02 A;  2X35 A;  4BE0 A;  3OYA A;  4IUR A;  4BE1 A;  2VYT A;  3OS1 A;  2K3Y A;  3MEW A;  3MET A;  4ZTF A;  3OMC A;  5KCO A;  2R5A A;  3FLG A;  2QQR A;  3H6Z A;  4E7H A;  3PNW C;  3H8Z A;  3OS0 A;  2YRV A;  2IG0 A;  4B9X A;  3OYN A;  3S3M A;  2NLU A;  2BUD A;  4LD6 A;  3DB3 A;  2FHD A;  4IUT A;  2RHI A;  3PMI A;  2BIV A;  4N4H A;  3DB4 A;  3QII A;  2XK0 A;  3L2V A;  2WAC A;  5C0M A;  3PMT A;  3P8H A;  5CIU A;  3MEV A;  3UT1 A;  2L8D A;  2EQM A;  2MWP A;  3FEO A;  2R58 A;  4QVZ A;  3L2R A;  2O4X B;  2P0K A;  3DLM A;  3QKJ A;  2RI2 A;  1G5V A;  3BDL A;  1OZ3 A;  4FU6 A;  3MP1 A;  3OB9 A;  5D6X A;  3M9Q A;  3MP6 A;  3OYM A;  2D9T A;  3Q1J A;  3ME9 A;  5IAY A;  4EDU A;  4IKF A;  2R5M A;  3S3O A;  4A4E A;  3NTI A;  3P8D A;  2RI5 A;  4II1 A;  5KCH A;  5IN1 A;  1WJR A;  3C4S A;  4BAC A;  2G3R A;  3LH0 A;  4E7L A;  2DIQ A;  2K3X A;  2QQS A;  3OYH A;  4BE2 A;  4E7J A;  1OZ2 A;  5KH6 A;  2LVM A;  2RO0 A;  4HCZ A;  5D6Y A;  3OA6 A;  4BDZ A;  2EQK A;  4C5E A;  2RJC A; 
#chains in the Genus database with same CATH topology
 2XKO C;  1PRL C;  1VQ6 A;  3V7R A;  3FJ5 A;  4F04 B;  2YUN A;  3RMQ A;  4E7Z A;  2RK1 A;  3U23 A;  2DZ9 A;  2DXU A;  4M4Z A;  4L5G A;  3CCM Q;  3HP9 A;  2HL5 C;  3EFO A;  1HK9 A;  4M75 E;  1X2K A;  1BCO A;  3IQL A;  1VQ8 T;  3OYG A;  5KE2 A;  3QBY A;  1VQM A;  4M7A E;  2LX7 A;  4C8Q E;  4M7A C;  4C8Q C;  3QPH A;  5GMK j;  2DNU A;  3I55 Q;  2E3H A;  1YFN A;  2KNB B;  5CKD A;  4XU1 A;  4C5I A;  1ZQ1 A;  2EGE A;  4RUG A;  3RKW A;  3CCU Q;  4BY6 C;  3G6E Q;  3I56 A;  1K0X A;  2EFI A;  2HKN A;  1F1B B;  1WHG A;  2RA2 A;  3OSV A;  2X4X A;  1S72 A;  1UFF A;  4XU2 A;  2X4W A;  5KYW B;  3OYB A;  1KHI A;  1OX8 A;  4BDY A;  3RR6 A;  4BD3 A;  3CCS A;  1QCF A;  4KRT A;  5GAO n;  1YIJ T;  1AWJ A;  1TUC A;  1SSH A;  1X6G A;  1SHF A;  2SRC A;  4LUD A;  2EKH A;  1UGQ B;  2YXY A;  2K9G A;  2CT4 A;  3V8L A;  1YBY A;  2BIV A;  3DB4 A;  4KUL A;  1IHW A;  2FPF A;  4Z8A A;  1M8V A;  4DBH A;  1RAC B;  2BTT A;  2DPP B;  2MWP A;  4AT1 B;  1K73 R;  2YLC A;  1YIT T;  1JJ2 P;  2HMA A;  1UGR B;  1K9M U;  1I1J A;  2H3J A;  2P0P A;  3CXC P;  3WVD B;  2RH2 A;  2HZY A;  4ZGJ B;  1NJI C;  2QQ9 A;  2FRY A;  3CCQ T;  2YDL A;  1OZ2 A;  2FRW A;  1B3Q A;  4M7D D;  5LJ5 h;  1WXT A;  1D09 B;  2E65 A;  1VQP Q;  2JW4 A;  5FRM A;  3CME Q;  2J6F A;  4PFZ A;  4EMG A;  1VQ9 Q;  1HXD A;  1OX9 A;  1UE9 A;  2K6D A;  1IGU A;  4C0F A;  1U5S A;  1M3C A;  1Q82 U;  1D0Y A;  3O8V A;  4LE9 A;  1T0H A;  1WIE A;  4E6R A;  1MV0 B;  2J05 A;  4XAX B;  3X25 B;  4F7U F;  2EQJ A;  4IUP A;  1H3Z A;  1Q86 C;  3MCA B;  4A4G A;  4A63 B;  4ZN3 A;  4M77 G;  4PLI A;  4UC4 A;  4D8D A;  3JSC A;  4J9F A;  1GRI A;  1PC0 A;  2KE9 A;  1ABO A;  4Y28 E;  1KFZ A;  1C0M A;  4RTU A;  3CCJ Q;  3BY7 A;  4BUG A;  2E6N A;  4M77 E;  3MHX A;  1NG2 A;  3MKD A;  1H8K A;  2KVQ G;  2A7Y A;  3CCR A;  4J83 A;  1I07 A;  3CEY A;  1W70 A;  5FRN A;  3OBW A;  4Z02 A;  5CVI A;  1VQ5 A;  1KD1 C;  1BB9 A;  1UTI A;  2O01 E;  2JNG A;  3VJP A;  2M9U A;  4XQ3 A;  5KCO A;  3GLX A;  3L2Z A;  1D1C A;  2CRE A;  3QSU A;  3WVE B;  1MMD A;  1KQS S;  2DXB A;  5CIU A;  4KT0 E;  1TXQ A;  2MCN A;  3BE3 A;  2C06 A;  3O5Z A;  4HA8 A;  1M2O A;  2RN8 A;  5D6X A;  1FX7 A;  5IHN A;  3CPW S;  3VS4 A;  5I2S A;  4X9C A;  1GL5 A;  4OML A;  4JS5 A;  5GAN d;  2V8I A;  2Y4Y A;  2LJ3 A;  4J9B A;  1BI0 A;  4B6M A;  1VQN A;  1AD5 A;  4HCZ A;  4BDZ A;  2ZZD A;  5KYN A;  2EQK A;  4OMO A;  2D6F A;  2OTL A;  1Q81 U;  1Q7Y C;  4HCB A;  4M78 A;  4RTZ A;  3JB9 J;  4QQ6 A;  5GAN 2;  2BE7 D;  1KQS A;  2DM1 A;  2A3L A;  4ELZ C;  1PRM C;  1VQ4 T;  2RI3 A;  2XDP A;  4LDY A;  2EYZ A;  2F69 A;  3GOX A;  3CMA A;  1NJI U;  2X9H A;  2M02 A;  3QHS A;  1VQO T;  1UDL A;  1P92 A;  2QTX A;  1WNL A;  2ED1 A;  4MZP A;  1VYV A;  3QJ6 A;  2AKK A;  2A0F B;  1D0X A;  3S6W A;  2MPX C;  3UDC A;  1U8R A;  3M0T A;  4IUU A;  3CCM A;  2NUP B;  4E7K A;  3JAM E;  1YJN A;  3RIR A;  1NYG A;  3FIF A;  1UJ0 A;  4OB0 B;  3X20 B;  3OYJ A;  1Q86 U;  1T3L A;  2K4Y A;  2QXF A;  3QG1 A;  5CKF A;  2FG0 A;  3NFC A;  2DO3 A;  3VS1 A;  1WHH A;  2VXF A;  4HVV A;  5LJ5 e;  3I55 A;  4F7U B;  1IB8 A;  5GAN j;  1YJ9 Q;  1PD1 A;  1BBZ A;  1NE8 A;  3CC7 T;  4RG8 A;  1M3A A;  2IG0 A;  4B9X A;  3CCU A;  2NLU A;  3JV3 A;  2H3E B;  1KC8 C;  1UGS B;  3JB9 D;  2FZK B;  5IT9 E;  3MEV A;  2DL4 A;  4JS4 A;  2F2X A;  2R58 A;  4BI4 A;  4J6Y A;  2L2P A;  2DL8 A;  4M78 D;  1IRX A;  3DLM A;  3QKJ A;  2KY9 A;  2HEQ A;  1NYF A;  1YI2 Q;  2QEX A;  1B34 B;  1KD1 U;  3EGX B;  1M90 R;  4MML A;  4A4K A;  1CSK A;  5LL6 S;  3CCL A;  1YHQ Q;  4C5E A;  1M8M A;  1YNZ A;  2CSQ A;  4LDW A;  2DD4 A;  5D6W A;  4TVR A;  4RTV A;  5D7U A;  2E4H A;  4JPB W;  4C0Z A;  2LT4 A;  4AG1 C;  2M1H A;  5HK3 A;  2EAY A;  2RQU A;  3GBQ A;  3CC2 T;  3GP8 A;  4JJN K;  4HXJ A;  3OYC A;  4JRP A;  1C6V X;  6AT1 B;  2RQV A;  2DFU A;  2JZ2 A;  2QDL A;  2DK3 A;  5GAO r;  3OYF A;  4RTT A;  2MIO A;  2F5K A;  3I56 Q;  4KGZ B;  1UEC A;  1X6B A;  1IRE B;  2GBQ A;  2QQA A;  4MDW A;  3CME A;  1Q7Y U;  4JJC A;  2L3R A;  2RM4 A;  1D0Z A;  4C92 D;  2YRD A;  4ZNX A;  3VUZ A;  1WXU A;  3CCE T;  3WXM B;  1JXO A;  1W2B A;  1W4S A;  4JDS A;  4R55 A;  4RCC A;  1Y96 B;  1CKA A;  2RHU A;  2O9S A;  2RQW A;  5ECA A;  2X35 A;  3M57 A;  2K5F A;  3JB9 I;  4OB3 B;  1PD0 A;  3UAT A;  3REA B;  4PJM A;  3CCJ A;  2GGR A;  3THK A;  2KQW A;  1TWB A;  1MMG A;  5GJW B;  5I11 A;  1W6X A;  1YJW Q;  1NEB A;  2KDS A;  4PK4 A;  2GTJ A;  2KXC A;  3M0P A;  3C94 A;  3JCM g;  2PVD B;  2D0Q B;  5GAM g;  1VQL Q;  2LP5 A;  2DXC A;  4LNP A;  4GLK A;  2RI5 A;  2FEI A;  1RAA B;  4MZT A;  3BDU A;  4GLM A;  2D1X A;  2KT8 A;  5D6Y A;  2K3B A;  1WQ7 A;  4RG2 A;  1PM3 A;  3LGF A;  3UA6 A;  3OY9 A;  3PTA A;  2KAF A;  3E9F A;  2CP7 A;  1NPP A;  1X75 C;  2L3P A;  3JCM d;  4E7I A;  1M1F A;  4PNO A;  2X4J A;  3JB9 H;  1PHT A;  5GAM d;  1M3B A;  1Y96 A;  2MYS A;  3H0H A;  1BYM A;  3DLL A;  2CP2 A;  2JTM A;  2LNH B;  2NUT B;  2KR3 A;  3LLR A;  5LJ3 g;  3PGG A;  4ESR A;  4PFO A;  3CD6 Q;  3TRE A;  3G4S A;  3HTR A;  5GAO l;  3CC4 T;  4DA4 A;  4RTY A;  4LD9 K;  2QK0 A;  1IXD A;  3HPW A;  3AT1 B;  3NMZ C;  1BU1 A;  2LCL A;  1WHM A;  1MGQ A;  1AZE A;  2VAS A;  2X3W D;  3EG0 A;  3E1S A;  1M5Q 1;  1QVP A;  3HL8 A;  1IHV A;  4PL6 A;  1ACM B;  1WYX A;  1QVF P;  4K11 A;  4Q5W A;  2KSS A;  2OTJ T;  1RLQ C;  2DL5 A;  2ZPH B;  2EPD A;  1ZSZ B;  4LN2 A;  2JXB A;  5LJ3 d;  3JRZ A;  4JRQ A;  3J81 E;  1RAE B;  2GNC A;  1A0N B;  2COZ A;  1TTH B;  1BI3 A;  3VRZ A;  3H8Z A;  2PTK A;  2E3I A;  1AOJ A;  3M0U A;  1LCK A;  2KEA A;  1YWO A;  2E64 A;  1N9R A;  2JJ9 A;  2W0Z A;  3D7S B;  1QVG S;  2V8J A;  4KH0 B;  1VQ7 A;  3CCV T;  1SRL A;  2ZPB B;  3P8B B;  2QGG A;  1G5V A;  3M9Q A;  2ROL A;  1WX6 A;  2Y90 A;  3QYG B;  1WDX A;  4II1 A;  4E7L A;  3HRT A;  1H92 A;  5CKB A;  2NUT A;  1YJ9 A;  1VQ6 T;  3JCM f;  2OTL Q;  2QDY B;  4DOV A;  1HSQ A;  5KH6 A;  2LVM A;  5GAM f;  4AFU C;  1K73 U;  4F7U E;  3E19 A;  4ME7 A;  2LQN A;  3REB B;  4C5H A;  2YUQ A;  3I5S A;  2K5L A;  2XG8 D;  5IHI A;  1U1S A;  3CMA Q;  1QVG A;  3JB9 F;  1YI2 A;  1NLO C;  1KSW A;  2EW3 A;  4M78 F;  1ZSZ A;  1RUW A;  1N27 A;  3DKM A;  1XJW B;  4M75 G;  5KYY A;  1N8R R;  2HKQ B;  1YHQ A;  3HFN A;  2MOX A;  2VXE A;  3EHQ A;  1VYU A;  1ZUK A;  1S72 T;  4M7A G;  4C8Q G;  1N5Z A;  1YJN Q;  1M1K R;  1M9S A;  2SEM A;  3JCM J;  1ZA1 B;  2LJ1 A;  2GQV A;  3EG9 A;  2XD0 A;  1G8X A;  2EBP A;  2DEU A;  4MDX A;  1OPL A;  3CCS T;  2AT1 B;  4FYV B;  5FRO A;  4QQD A;  1E6H A;  5AT1 B;  4M7D A;  1WPY A;  1WI7 A;  4PKC C;  3OYL A;  2DL3 A;  4XTU A;  2GFU A;  1OV3 A;  2DRM A;  1OU9 A;  5GMK m;  2E1H A;  3VS7 A;  3SB2 A;  2FZC B;  2QA4 Q;  4Y91 A;  3VRY A;  2CS7 A;  3OS0 A;  5CO7 A;  1T3S A;  3ULR B;  2EYY A;  1SF9 A;  1VQK Q;  2FHD A;  3L1A A;  4XTY A;  2RHI A;  2KK4 A;  4QVD A;  5A0D A;  2AZV A;  1K8A R;  3G1J A;  4ZN1 A;  3I35 A;  2DXT A;  4C92 F;  2QEX Q;  1GBR A;  4FYY B;  4OF1 A;  1M90 C;  3NHN A;  4R0K A;  2EJ9 A;  2DTI A;  4HVW A;  4J6X A;  1NPR A;  4M77 D;  3C4S A;  5GAN 8;  2KBT A;  5GAO m;  3J7A F;  3CCL Q;  1SKU B;  2K3X A;  4V2S A;  4NOY A;  4AFS C;  4JZ3 A;  1Q81 C;  2RF0 A;  1LJO A;  4J9H A;  1T0J A;  1VQ8 A;  1JQQ A;  5GMK i;  4OGC A;  5J26 A;  2RMO A;  1YJW A;  3R6N A;  3L2Q A;  3M55 A;  4A4F A;  2J6O A;  2C0I A;  4KGV B;  1VQL A;  5KYX A;  2CP0 A;  2RQR A;  2F5T X;  5CK9 A;  3A8H B;  2O31 A;  2EWN A;  2KRN A;  1RI0 A;  2DZC A;  2ZGW A;  2CT3 A;  4O5V A;  2GF7 A;  1VOM A;  4J5Y A;  1E7O A;  3LWH A;  2E41 A;  2EJG A;  4PJO A;  4F17 A;  3CCR T;  2JTE A;  4AG2 C;  2RJD A;  5GAN 6;  9ATC B;  1OI1 A;  2DMO A;  3M59 A;  2RPN A;  3MP8 A;  2CKK A;  4QQG A;  1PWT A;  1SG5 A;  4BI3 A;  2FL7 A;  2E5Q A;  3ZEH A;  1Y07 A;  5FU6 C;  1KQ2 A;  1GCQ A;  3OYA A;  3CD6 A;  1YIT A;  4M78 B;  3JCM X;  3TVT A;  3G71 Q;  4LD6 A;  1UJY A;  3URG A;  2GTO A;  2CP3 A;  3CCQ A;  4ZGD B;  4QVZ A;  3L2R A;  1M2V B;  1QLY A;  5CKE A;  5DLO A;  3TSW A;  1E6G A;  2DD5 A;  1VQN T;  5GAN g;  3S3O A;  1AHJ B;  4ANJ A;  5I22 A;  1JB0 E;  2HL3 A;  2YT6 A;  4D8K A;  3C12 A;  1ZSZ C;  2QYZ A;  1LVK A;  5CQY A;  4J9D A;  3NGP A;  1JU5 C;  8ATC B;  2M0Y A;  1K4U S;  2CUB A;  4PJO D;  3EGU A;  4XTW A;  1M90 U;  1AEY A;  1B07 A;  2QI2 A;  2H8H A;  3RDV A;  1BKB A;  1IO6 A;  4C92 B;  4M7D C;  2X4Y A;  3LGL A;  3G4S Q;  1QWF A;  1G3T A;  4EPC A;  1K9M R;  3H0I A;  3CCM T;  4FT4 A;  2OJ2 A;  1Y0M A;  3OYK A;  3CQT A;  3EAE A;  3QXE B;  2OAW A;  4VUB A;  1N6A A;  1KQS P;  4FYX B;  3I5R A;  1C1A A;  3OMG A;  3I55 T;  3PIO A;  2E6Z A;  2D8H A;  1M2V A;  2HNI A;  3CPW A;  1WZO A;  2LZ6 B;  1XOV A;  3CCU T;  3G6E T;  2LQW A;  2LJ0 A;  3SEM A;  4HCC A;  2M51 A;  1G3Y A;  2GQI A;  5DM7 R;  3H6Z A;  3V8K A;  1S1N A;  1N9S A;  2HBW A;  1VQ7 Q;  1BI1 A;  1TOV A;  2XK0 A;  1AT1 B;  4ATO A;  4JRK A;  1O75 A;  1ZUY A;  2QQB A;  1BIA A;  2VGM A;  4F16 A;  3CBM A;  1U1T A;  3RER A;  4C92 A;  1V76 A;  1K9A A;  2G3R A;  2QA4 A;  1ZBX A;  2DIQ A;  3QZ9 B;  3BFM A;  3OA6 A;  1WJS A;  1VQK A;  5GAN f;  4HT9 A;  2LDM A;  2OTJ Q;  2D8J A;  5FWB A;  4EMK A;  4PJO C;  1KK7 A;  3VUB A;  1PSF A;  2IVW A;  3HRS A;  2VGN A;  4OGE A;  5I2M A;  1PG5 B;  4CC7 A;  2FO0 A;  2J6K A;  2LCC A;  3JCM h;  3HFO A;  4PJN A;  3OYE A;  1OYX A;  1VQP T;  5M9O A;  5GAM h;  3CME T;  1VQ9 T;  5C6S A;  1NM7 A;  1NZ9 A;  4GBQ A;  3JCM Q;  4ELY C;  1QP2 A;  1GCQ C;  3TSZ A;  5LJ5 j;  3HSB A;  3LW5 E;  2VB6 A;  2YLB A;  1OQK A;  2EKO A;  2L0A A;  2EQI A;  3UWN A;  3X26 B;  2EGC A;  2AK5 A;  3ZBD A;  4FW2 A;  5EG2 A;  1WXB A;  3CC7 A;  1YCY A;  4C0D B;  2GFA A;  2DE0 X;  1UG1 A;  4OMQ A;  1M4Z A;  1FMV A;  2ATC B;  4KUI A;  2ZCF B;  4LUE A;  2YSQ A;  1D1A A;  4FM4 B;  3CCJ T;  4BE0 A;  4FCY A;  4JJB A;  2A08 A;  4XU0 A;  2JOY A;  3A8L B;  1HD3 A;  2WSF E;  4M7D F;  2BUD A;  4J7I A;  5GAN 7;  1NJI R;  4KH1 B;  3P8H A;  3VS0 A;  3UT1 A;  1W2B P;  1K0S A;  4J9G A;  2P0K A;  2QG9 B;  2VUB A;  1Z9Q A;  1WA7 A;  1GFC A;  3KBG A;  3JCM c;  2VWF A;  3VKI A;  4E7J A;  1K73 C;  3OW2 S;  1MUZ A;  3G71 A;  1VQ8 Q;  4O6J A;  2RJC A;  1YP5 A;  1Q86 R;  3KFV A;  4M78 E;  3X24 B;  4M78 C;  2KI7 A;  2VKN A;  1PCX A;  2A36 A;  2RHY A;  3V7S A;  3E2U A;  2K7A A;  1WJQ A;  5KE3 A;  1XNI A;  2RHX A;  4JUV A;  2V1Q A;  1CKB A;  3TCJ A;  1ZBJ A;  1OEB A;  4M75 A;  1SHG A;  2JM8 A;  1M27 C;  4FL6 A;  2V1R A;  2DYB A;  5HY6 A;  2O4X A;  4WTO B;  5GMK l;  5CCA A;  4C0G A;  3VYH B;  2F1L A;  2RQT A;  2HSE B;  2LCS A;  2MI6 A;  1Y7X A;  4XU3 A;  2RJE A;  2LTO A;  2HSP A;  3CPF A;  3V8J A;  1YIJ Q;  1BK2 A;  2MWO A;  3A1P A;  1NEG A;  3OW2 A;  2Y4X A;  1KD1 R;  4J7F A;  5FU6 B;  4OMM A;  2MAM A;  4PJL A;  1QP3 A;  4RCB A;  2LQK A;  4IIO A;  1QW1 A;  2EIF A;  5IH2 A;  2RHZ A;  3C0C A;  4ZTJ A;  3L42 A;  2JTF A;  4N4G A;  5AYF A;  4PJO F;  1N8R U;  2BKD N;  2NUZ A;  4IUV A;  2ZAE A;  3G7Z A;  1YIT Q;  1G83 A;  4J9E A;  1ZHI A;  4BE1 A;  4IIM A;  2LMJ A;  3RKX A;  4C92 E;  2K3Y A;  2DER A;  4C92 C;  3OMC A;  1MMA A;  2QQR A;  4LDV A;  3S3M A;  5L23 A;  1LNX A;  5L8R E;  3PMI A;  1UHF A;  1M30 A;  2F2V A;  2VV5 A;  3CCQ Q;  2CYZ B;  1U3O A;  2CDT A;  4EMK C;  1D1B A;  1X2Q A;  2DTO A;  4X9D A;  3JCM e;  3QZ5 B;  5GAM e;  3MP6 A;  1UEB A;  2BZ8 A;  4FT2 A;  5KYY B;  1QCO A;  1Q7Y R;  3C95 A;  5IAY A;  4J9I A;  4M75 D;  1IGQ A;  1UGP B;  3M4G A;  2A28 A;  2PVG B;  5GAN 3;  4KBM B;  2LNV A;  1K8A U;  1OOT A;  1MNE A;  3N5B B;  3EG9 B;  4M7A D;  5IXF A;  4C8Q D;  3SHW A;  1IZ6 A;  4M7D B;  1YI2 T;  1QWE A;  2RD1 A;  1EIF A;  1MV3 A;  5DY9 A;  3A98 A;  1TUG B;  4XTV A;  4F7U G;  4A4H A;  2KYM A;  4PLL A;  3CC4 A;  2DBK A;  3GNF B;  3MO8 A;  3EFS A;  4KUD K;  1JXM A;  3EH1 A;  4PJJ A;  1YHQ T;  1B7T A;  1FXX A;  3GNG A;  2XIC A;  5LJ3 e;  4OVA A;  2L3S A;  4BB7 A;  1BI2 A;  2I2L A;  1TU0 B;  1I8F A;  3M0R A;  3MEA A;  5HKC A;  2B8A A;  2KYB A;  2OTJ A;  4CI0 C;  2KT1 A;  2ZPE B;  2EYX A;  1VQM T;  2PZ1 A;  1RAH B;  4F14 A;  2C0O A;  2DX1 A;  4M77 A;  5FWC A;  1I5L A;  1M1G A;  2DIG A;  1WGS A;  1TG0 A;  4JLI A;  1QVG P;  4OMP A;  1DJ7 B;  5GMK e;  2AKL A;  2C0T A;  1YCS B;  1KC8 R;  3I56 T;  5GAO q;  2PQW A;  1RAG B;  2K5I A;  3CCV A;  3M0Q A;  4E7H A;  5LJ3 f;  3PNW C;  2YRV A;  2QGF B;  3DB3 A;  1JRI A;  5CAI A;  3JCM W;  5C0M A;  3PMT A;  5KYX B;  5EC7 A;  4LXC A;  4AMC A;  1VYT A;  5CKH A;  2HQH A;  2XU8 A;  3SWN A;  3PT9 A;  1OZ3 A;  3MP1 A;  3OB9 A;  2CZ7 B;  4LDU A;  2K57 A;  2L3Q A;  1PSE A;  2EYW A;  2CZ0 B;  4XTX A;  4M75 C;  4C0D C;  3NTI A;  1UB4 A;  4FIB A;  4RTX A;  5KCH A;  2COY A;  1WJR A;  2DA9 A;  2V8K A;  2LQ8 A;  4PJO B;  3OYH A;  4BE2 A;  3H41 A;  1VQ4 Q;  2LT1 A;  1Q95 G;  1YJW T;  4FW1 A;  1VQO Q;  1ZSG A;  4QW2 A;  1PKS A;  1MND A;  1JJ2 S;  1VQL T;  3QDF A;  3A8G B;  2EGA A;  3CXC S;  2EJF A;  2KRS A;  3EHR A;  1R0B G;  2E12 A;  4NS5 A;  2OI3 A;  1RAB B;  3VS6 A;  4L59 A;  1WHK A;  5GAN h;  1I4K 1;  1ABQ A;  1BIB A;  3MEU A;  2E70 A;  2YUP A;  4A53 A;  2DAQ A;  2PUO B;  2VC8 A;  3ER0 A;  2LX9 A;  2M16 A;  3FDR A;  2WSC E;  3M4Y A;  2D0N A;  3CC7 Q;  3PE0 A;  3OYD A;  2ABL A;  4DBQ A;  3NTH A;  3HRU A;  1R8O B;  1JJ2 A;  3CD6 T;  2ZPI B;  2P0Q A;  4N0A A;  2XDB A;  4XTZ A;  5FU7 B;  3CXC A;  3S3N A;  4B9W A;  3GIB A;  1R0C B;  1KQ1 A;  1SRM A;  4IUR A;  3MEW A;  4ORZ A;  2K79 A;  5FW9 A;  3FLG A;  5J3B A;  3J80 E;  1YIJ A;  2DTH A;  4L6V 5;  2JS0 A;  4N4H A;  2BZX A;  3QII A;  5IXB A;  4PFP A;  5HCK A;  2JMC A;  1WHJ A;  2HDA A;  4DBF A;  3M58 A;  1VQ5 T;  2JUF A;  3FEO A;  4OMF B;  2MK5 A;  1KJW A;  3GF5 A;  1I81 A;  1G3S A;  3RMS A;  3AHU A;  3Q1J A;  1I5O B;  3M56 A;  1VUB A;  1VA7 A;  4DOW A;  5KYW A;  5GJV B;  1FMK A;  2IIM A;  3CC2 Q;  3EG3 A;  2W10 A;  2L5Q A;  2OX7 A;  3M53 A;  2J7I A;  1OPK A;  2HQX A;  4RKU E;  2NYS A;  2DYI A;  1Y71 A;  3OYY A;  3X28 B;  3H9N A;  3ZL7 C;  3JCM V;  2YHT A;  1SEM A;  1V29 B;  2F2W A;  4M77 C;  2HQE A;  1EZZ B;  2OTL T;  1KG1 A;  2ZPF B;  3EGD B;  3CCE Q;  3NTK A;  1G3W A;  1JEG A;  1H64 1;  3FRN A;  2P4T A;  7AT1 B;  2JVV A;  3RES A;  3OYI A;  5J39 A;  1WLP B;  2L89 A;  1HJD A;  1KHC A;  5A2Q E;  4M75 F;  4M7D G;  2X3X D;  4FSS A;  3CMA T;  3CBO A;  4E7S A;  4QT7 A;  4M7A F;  1VIE A;  4C8Q F;  2MMP A;  3KXT A;  4IUQ A;  1OU8 A;  3QO3 A;  1WQW A;  4M7D E;  1I0C A;  2QTV A;  2RK2 A;  2Z0W A;  1YWP A;  2NWM A;  1O9S A;  3SWN C;  2FZG B;  3OS2 A;  2X51 A;  3QYH B;  2ROT A;  2CH4 A;  2O2O A;  3LYI A;  5LJ5 g;  4LDX A;  2VYT A;  1YJN T;  4OMN A;  2EVR A;  4CC2 A;  3MET A;  4EMK B;  3A8M B;  2O9V A;  4QVC A;  3M5A A;  3TEE A;  5KYU B;  1NBE B;  4OB2 B;  2CH4 W;  3HKS A;  3L2V A;  4CC3 A;  2CP6 A;  2AHJ B;  2EQM A;  4JRI A;  4CC4 B;  2BZY A;  2K2V A;  4OP0 A;  1RLP C;  2DLP A;  2RI2 A;  1JBM A;  4FU6 A;  3CBP A;  2CUD A;  2QA4 T;  3CPW P;  5IHK A;  5GAN 4;  5GAN e;  1ZA2 B;  1Q82 R;  1GCP A;  4EDU A;  4HVU A;  3EGD A;  5LJ5 d;  1VQK T;  3QUI A;  1WHL A;  3LH0 A;  1X43 A;  1PKT A;  4OB1 B;  4NL3 A;  1MMN A;  1YN8 A;  2VVK A;  4AFZ C;  1KIK A;  1ZX6 A;  4JLG A;  4N4I A;  2QEX T;  1HYO A;  2DJZ A;  2HD0 A;  3EG1 A;  2DL7 A;  2KGT A;  1W1F A;  4E2F B;  3CC4 Q;  4EMH A;  2LRQ A;  3BW1 A;  1Z9Z A;  3CCL T;  1H3H A;  2MF2 A;  2KXD A;  2JMA A;  1K76 A;  3H0F A;  3JCM b;  2P84 A;  2FVU A;  3LX7 A;  3NPF A;  4PJO G;  2ENM A;  2KRM A;  3FC3 A;  4N0A C;  1X69 A;  2FYK A;  1VQ4 A;  3UF4 A;  3SD4 A;  3RUX A;  2CZ1 B;  2G6F X;  1VQO A;  4PJO E;  3ASK A;  5KYU A;  3OSS C;  1SSF A;  3G6E A;  1GXI E;  2V26 A;  3EFR A;  1N8R C;  2HBP A;  1ZLM A;  3CCV Q;  1JO8 A;  4J6W A;  1M1K C;  4M77 F;  3A8O B;  3GPL A;  4Z88 A;  2ZPG B;  4YTL A;  3OS1 A;  2AZS A;  4WCI A;  1TH7 A;  2R5A A;  3PIP A;  2XI9 A;  2DET A;  3OYN A;  4DQ2 A;  5I21 A;  2GCX A;  4HT8 A;  3M0S A;  1GFD A;  5LJ5 f;  1SPK A;  2JN0 A;  1VQ6 Q;  1EFN A;  4M75 B;  4JJD A;  2DEQ A;  1R77 A;  2L8D A;  1UHC A;  1BCM A;  1ARK A;  1W2B S;  2KRO A;  2O4X B;  1X6O A;  2DJQ A;  1Q81 R;  4M7A B;  3BDL A;  4FYW B;  4C8Q B;  2CZ6 B;  4X1V A;  2K2M A;  2NUP A;  4WF2 A;  2P4R A;  3G71 T;  1LPL A;  1QMC A;  3P8D A;  2LC4 A;  3R6O A;  5LJ3 h;  1VQM Q;  1K8A C;  4BY6 B;  2QQS A;  3VV0 A;  5FU7 C;  2RO0 A;  1RAF B;  2DRK A;  2E10 A;  5GAN 5;  3L2W A;  4F7U A;  2I0N A;  4R56 A;  4MZM A;  4DBR A;  1RL2 A;  2BE9 B;  1VQP A;  1VQ9 A;  3QWX X;  3JB9 G;  1S72 Q;  2EQU A;  2HAX A;  2HCK A;  4J9C A;  3KUF A;  5GMK h;  4M78 G;  1NLP C;  1FWZ A;  4FSX A;  5GAO p;  4ZGE B;  1OUL A;  3PFS A;  3CCS Q;  8AT1 B;  2XMF A;  2XID A;  1J3T A;  1QKX A;  2YRC A;  3SDZ A;  3QJY A;  3OQ5 A;  5CQX A;  5FLX E;  2WSE E;  4HCK A;  3CC2 A;  3L2U A;  3V7C A;  1QQJ A;  1B34 A;  3ZFJ A;  3E9G A;  1RAI B;  1UUE A;  3EGX A;  1MHN A;  4X34 A;  3RKY A;  4C5G A;  3EG2 A;  4XK8 E;  2DIL A;  3MPU B;  5DLQ E;  1K1Z A;  4BI8 B;  2PU9 B;  2IPO B;  3SFM A;  3G4S T;  2ESW A;  2XHC A;  3F70 A;  3CCE A;  3A5Z B;  4M7A A;  4E47 A;  2JS2 A;  4C8Q A;  4A54 A;  2PVO B;  4JZ4 A;  1AWO A;  1U06 A;  1Y57 A;  4D6W A;  1XTD A;  2CSI A;  2JM9 A;  2FB7 A;  4Y92 A;  4ZTF A;  1AWX A;  5HK0 A;  3OW2 P;  4IUT A;  3RNJ A;  4RMO A;  2WAC A;  1KC8 U;  1ZUU A;  4C92 G;  2DVE A;  4Z89 A;  1QVF S;  2B86 A;  1FMW A;  2D9T A;  1TS9 A;  2YUO A;  3ME9 A;  1V1C A;  2A37 A;  3LWI A;  1M1K U;  1D3B B;  2QAZ A;  2AIR B;  3EH2 A;  4IKF A;  2YWW A;  2FPD A;  3MJX A;  4P5N A;  4BAC A;  1VQ7 T;  2J06 A;  3VYG A;  3TQ7 P;  2DF6 A;  4DEY A;  3QWY A;  4M77 B;  3FJP A;  3VS3 A;  1GBQ A;  1QCN A;  2RJF A;  4GY5 A;  2OAU A;  3VS5 A;  3INZ A;  1RAD B;  2PNI A;  1YJ9 T;  3UPU A;  3OS5 A;  4KGX B;  2PUK B;  2R57 A;  3CCR Q;  1X01 A;  5A0L A;  2XDD A;  1EX4 A;  1QVF A;  4J8O A;  5A0G A;  3M54 A;  2FPE A;  3FB9 A;  1TSF A;  1VIF A;  3T9N A;  1VQ5 Q;  2M0O A;  1AZG B;  3PVQ A;  4NL2 A;  1G2B A;  3SWN B;  5CR2 A;  3EFO B;  1PNJ A;  2RB6 A;  2COW A;  4QKU A;  4RTW A;  2KMT A;  3TU4 K;  1LOJ A;  2E5K A;  2QAS A;  1K9M C;  2DVJ A;  2DKG A;  1FYN A;  1D3B A;  2RNA A;  3VU3 C;  5GAM j;  4EIK A;  2DBM A;  2CP5 A;  1TUD A;  3I9Q A;  1VQN Q;  1AVZ C;  4HKE A;  1UGV A;  2ECZ A;  3UA7 A;  1AWW A;  2JT4 A;  2EYQ A;  2O88 A;  1Q82 C;  3QDR B;  4DEX A;  2ED0 A;  3OYM A;  4AFQ C;  1X27 A;  2CGH A;  4MMK A;  2R5M A;  3JCM P;  4A4E A;  3OBY A;  3LH5 A;  5IN1 A;  3VS2 A;  1RI9 A;  3RBB B;  1XQH A;  3HHT B;  1WFW A;  3PVL A;  1QKW A;  5LJ3 j;  4CRI A; 
#chains in the Genus database with same CATH homology
 1WJS A;  1VQK A;  2XKO C;  2L5Q A;  2LDM A;  5GAN f;  4HT9 A;  1WQ7 A;  4RG2 A;  3M53 A;  3V7R A;  1VQ6 A;  2HQX A;  3LGF A;  4EMK A;  4RKU E;  3RMQ A;  3OY9 A;  1Y71 A;  3OYY A;  2KAF A;  2RK1 A;  3E9F A;  2DZ9 A;  2DXU A;  3VUB A;  3X28 B;  3PTA A;  4PJO C;  4L5G A;  1PSF A;  3HP9 A;  1NPP A;  2IVW A;  3HRS A;  1NJI U;  3JCM V;  1X75 C;  2YHT A;  1HK9 A;  1V29 B;  4M75 E;  3JCM d;  4E7I A;  1M1F A;  4M77 C;  2VGN A;  2X4J A;  4PNO A;  4OGE A;  5I2M A;  3JB9 H;  2HQE A;  5GAM d;  2OTL T;  1KG1 A;  1Y96 A;  2ZPF B;  2LCC A;  1VQ8 T;  3OYG A;  3JCM h;  5KE2 A;  3DLL A;  3QBY A;  1VQM A;  3HFO A;  3OYE A;  4M7A E;  1OYX A;  2JTM A;  1G3W A;  3NTK A;  4C8Q E;  5M9O A;  1VQP T;  5GAM h;  4M7A C;  4C8Q C;  1H64 1;  3CME T;  3LLR A;  3QPH A;  5C6S A;  5GMK j;  1NZ9 A;  3FRN A;  3PGG A;  2P4T A;  5LJ3 g;  3JCM Q;  3TRE A;  2JVV A;  3RES A;  4ELY C;  5J39 A;  3OYI A;  5CKD A;  2L89 A;  4XU1 A;  1QP2 A;  1KHC A;  1ZQ1 A;  4C5I A;  5A2Q E;  3G4S A;  5LJ5 j;  3HSB A;  4M75 F;  5GAO l;  3LW5 E;  3CC4 T;  4DA4 A;  2YLB A;  3RKW A;  4M7D G;  4LD9 K;  4BY6 C;  3I56 A;  2EFI A;  3HPW A;  3CMA T;  3CBO A;  2RA2 A;  2EKO A;  3OSV A;  2LCL A;  4M7A F;  1VIE A;  4C8Q F;  3UWN A;  1MGQ A;  2MMP A;  3KXT A;  3X26 B;  2X4X A;  1S72 A;  3E1S A;  4IUQ A;  1M5Q 1;  1QVP A;  3QO3 A;  1WQW A;  3ZBD A;  4XU2 A;  5EG2 A;  3CC7 A;  4M7D E;  2X4W A;  1YCY A;  3HL8 A;  4PL6 A;  4C0D B;  2GFA A;  3OYB A;  1KHI A;  2RK2 A;  4Q5W A;  2KSS A;  4BDY A;  2OTJ T;  3SWN C;  1O9S A;  2ZPH B;  4BD3 A;  1M4Z A;  3CCS A;  3OS2 A;  4KUI A;  2ZCF B;  3QYH B;  5GAO n;  5LJ3 d;  3LYI A;  3JRZ A;  1YIJ T;  1VQL A;  4FM4 B;  3CCJ T;  4JRQ A;  4BE0 A;  5LJ5 g;  3J81 E;  4LDX A;  2VYT A;  1YJN T;  1VQN T;  1UGQ B;  4XU0 A;  2JOY A;  3A8L B;  1BI3 A;  3MET A;  2WSF E;  4EMK B;  3A8M B;  4QVC A;  3M5A A;  3H8Z A;  3TEE A;  4M7D F;  2BUD A;  3V8L A;  4OB2 B;  1YBY A;  2BIV A;  3HKS A;  3DB4 A;  4J7I A;  4KUL A;  2E64 A;  5GAN 7;  3L2V A;  1N9R A;  3P8H A;  1M8V A;  1QVG S;  2V8J A;  1VQ7 A;  3UT1 A;  3CCV T;  2AHJ B;  2EQM A;  2MWP A;  2DPP B;  2ZPB B;  2YLC A;  4JRI A;  1YIT T;  3P8B B;  2K2V A;  4OP0 A;  2P0K A;  1UGR B;  2VUB A;  1K9M U;  2RI2 A;  1JBM A;  1G5V A;  4FU6 A;  2H3J A;  2P0P A;  3CBP A;  3M9Q A;  2QA4 T;  5GAN 4;  5GAN e;  3KBG A;  4IKF A;  2Y90 A;  3JCM c;  3QYG B;  3WVD B;  4EDU A;  2RH2 A;  5LJ5 d;  4II1 A;  1VQK T;  3QUI A;  4E7L A;  4ZGJ B;  3HRT A;  3LH0 A;  1NJI C;  2QQ9 A;  5CKB A;  1YJ9 A;  3CCQ T;  3JCM f;  3VKI A;  1VQ6 T;  4E7J A;  1OZ2 A;  2QDY B;  4DOV A;  5KH6 A;  5LJ5 h;  2LVM A;  5GAM f;  4OB1 B;  3OW2 S;  1K73 C;  3G71 A;  4NL3 A;  4O6J A;  2E65 A;  1K73 U;  2RJC A;  4F7U E;  3E19 A;  4ME7 A;  1VQ9 T;  5FRM A;  4JLG A;  4N4I A;  4EMG A;  3X24 B;  4M78 E;  2QEX T;  1HXD A;  4C5H A;  4M78 C;  2RHY A;  3V7S A;  2DJZ A;  2HD0 A;  4C0F A;  1Q82 U;  1WJQ A;  3O8V A;  5KE3 A;  1XNI A;  2K5L A;  2XG8 D;  2RHX A;  4JUV A;  1U1S A;  4EMH A;  2LRQ A;  3BW1 A;  4XAX B;  3CCL T;  3TCJ A;  2MF2 A;  1QVG A;  1YI2 A;  3JB9 F;  4M75 A;  3X25 B;  3JCM b;  4F7U F;  2EQJ A;  2FVU A;  4IUP A;  3LX7 A;  1H3Z A;  4FL6 A;  4PJO G;  1Q86 C;  3MCA B;  5HY6 A;  4M78 F;  4A4G A;  3FC3 A;  2O4X A;  4N0A C;  5GMK l;  5CCA A;  2FYK A;  4C0G A;  3VYH B;  1N27 A;  3DKM A;  4ZN3 A;  4M77 G;  1VQ4 A;  4M75 G;  4PLI A;  4UC4 A;  3JSC A;  1YHQ A;  3HFN A;  3SD4 A;  3RUX A;  2CZ1 B;  2VXE A;  2MI6 A;  4Y28 E;  1Y7X A;  4XU3 A;  2RJE A;  1VQO A;  2LTO A;  3CPF A;  1S72 T;  4PJO E;  3V8J A;  4M7A G;  3ASK A;  3BY7 A;  4BUG A;  4C8Q G;  3OSS C;  2MWO A;  2E6N A;  3OW2 A;  1SSF A;  4M77 E;  1M9S A;  2Y4X A;  3MHX A;  3JCM J;  4J7F A;  5FU6 B;  3G6E A;  2GQV A;  2XD0 A;  4MDX A;  2KVQ G;  3CCS T;  2MAM A;  1GXI E;  1QP3 A;  5FRO A;  2A7Y A;  3EFR A;  4QQD A;  4RCB A;  2LQK A;  3CCR A;  1QW1 A;  1N8R C;  2EIF A;  4J83 A;  1WPY A;  2RHZ A;  2HBP A;  3OS1 A;  4M7D A;  4ZTJ A;  4PKC C;  3L42 A;  2JTF A;  4N4G A;  5AYF A;  4PJO F;  3OYL A;  1N8R U;  4XTU A;  2GFU A;  3CEY A;  2BKD N;  4IUV A;  5FRN A;  3G7Z A;  3OBW A;  5GMK m;  4J6W A;  4Z02 A;  1M1K C;  4M77 F;  1ZHI A;  2E1H A;  3A8O B;  5CVI A;  4BE1 A;  1KD1 C;  3SB2 A;  1VQ5 A;  3GPL A;  3RKX A;  2O01 E;  2JNG A;  2ZPG B;  4YTL A;  2K3Y A;  4Y91 A;  3VJP A;  4C92 E;  2M9U A;  4XQ3 A;  4C92 C;  3OMC A;  5KCO A;  1TH7 A;  2R5A A;  2QQR A;  2XI9 A;  2CS7 A;  3GLX A;  3L2Z A;  3PIP A;  4LDV A;  3OS0 A;  5CO7 A;  3OYN A;  3S3M A;  4DQ2 A;  5I21 A;  2GCX A;  3QSU A;  2FHD A;  1LNX A;  3L1A A;  4XTY A;  2RHI A;  2KK4 A;  3PMI A;  5L8R E;  3WVE B;  5LJ5 f;  2VV5 A;  4QVD A;  1KQS S;  5A0D A;  2JN0 A;  4M75 B;  2CYZ B;  2DXB A;  5CIU A;  2DEQ A;  4ZN1 A;  4KT0 E;  2L8D A;  2DXT A;  1W2B S;  4EMK C;  2C06 A;  2O4X B;  1X6O A;  2DTO A;  4X9D A;  3JCM e;  4C92 F;  4HA8 A;  1JJ2 A;  4M7A B;  3BDL A;  4C8Q B;  3QZ5 B;  5D6X A;  4OF1 A;  5GAM e;  3MP6 A;  1FX7 A;  1M90 C;  1UEB A;  4FT2 A;  2CZ6 B;  3CPW S;  3C95 A;  2EJ9 A;  5IAY A;  4WF2 A;  2DTI A;  4J6X A;  5I2S A;  1NPR A;  3G71 T;  4X9C A;  4M77 D;  4JS5 A;  3P8D A;  5LJ3 h;  4M75 D;  2LC4 A;  3R6O A;  3C4S A;  5GAN 8;  1UGP B;  3M4G A;  5GAO m;  1K8A C;  3J7A F;  5GAN d;  2PVG B;  4BY6 B;  2K3X A;  2QQS A;  4KBM B;  5GAN 3;  2LNV A;  2V8I A;  2Y4Y A;  1K8A U;  4NOY A;  3VV0 A;  4V2S A;  1BI0 A;  5FU7 C;  1VQN A;  2RO0 A;  3N5B B;  4HCZ A;  4BDZ A;  2E10 A;  2ZZD A;  4M7A D;  1Q81 C;  4C8Q D;  2EQK A;  5GAN 5;  1LJO A;  3L2W A;  2D6F A;  2OTL A;  1Q81 U;  4F7U A;  1VQ8 A;  1IZ6 A;  5GMK i;  4R56 A;  4MZM A;  1Q7Y C;  4HCB A;  1RL2 A;  4OGC A;  5J26 A;  1VQP A;  4M78 A;  4M7D B;  1YI2 T;  1YJW A;  2RD1 A;  3JB9 J;  1VQ9 A;  4QQ6 A;  5GAN 2;  1EIF A;  5DY9 A;  3L2Q A;  3M55 A;  3JB9 G;  4A4F A;  1KQS A;  2EQU A;  4XTV A;  4F7U G;  4A4H A;  2HAX A;  4PLL A;  2A3L A;  3CC4 A;  3KUF A;  5GMK h;  4M78 G;  3GNF B;  3MO8 A;  3EFS A;  1FWZ A;  2RI3 A;  4FSX A;  4ELZ C;  5GAO p;  1VQ4 T;  4ZGE B;  2XDP A;  4KUD K;  4LDY A;  2F69 A;  2F5T X;  5CK9 A;  3GOX A;  1FXX A;  3GNG A;  3A8H B;  3PFS A;  3CMA A;  1YHQ T;  2EWN A;  2XIC A;  3QHS A;  5LJ3 e;  1VQO T;  2XID A;  1P92 A;  4OVA A;  1RI0 A;  4BB7 A;  2QTX A;  1BI2 A;  2I2L A;  1WNL A;  2DZC A;  2ZGW A;  3OQ5 A;  3QJY A;  4O5V A;  5CQX A;  2WSE E;  3SDZ A;  5FLX E;  1I8F A;  3CC2 A;  3L2U A;  2GF7 A;  3V7C A;  4MZP A;  1B34 A;  3MEA A;  3E9G A;  4J5Y A;  3ZFJ A;  5HKC A;  2B8A A;  3QJ6 A;  3LWH A;  2OTJ A;  2E41 A;  2EJG A;  1MHN A;  4CI0 C;  4PJO A;  3S6W A;  3CCR T;  4X34 A;  2ZPE B;  1VQM T;  3RKY A;  3UDC A;  4C5G A;  1U8R A;  2RJD A;  4XK8 E;  5GAN 6;  1OI1 A;  4IUU A;  3M59 A;  4M77 A;  3CCM A;  1I5L A;  4E7K A;  1M1G A;  3JAM E;  1YJN A;  2DIG A;  3MP8 A;  3RIR A;  3FIF A;  5DLQ E;  1WGS A;  2CKK A;  4JLI A;  4OB0 B;  3X20 B;  4BI8 B;  3OYJ A;  2PU9 B;  4QQG A;  3SFM A;  3G4S T;  1DJ7 B;  5GMK e;  1Q86 U;  2XHC A;  3F70 A;  2K4Y A;  2QXF A;  3A5Z B;  3QG1 A;  4BI3 A;  4E47 A;  3CCE A;  4C8Q A;  5CKF A;  4M7A A;  3NFC A;  3I56 T;  2DO3 A;  4A54 A;  2PVO B;  5GAO q;  2FL7 A;  2E5Q A;  2PQW A;  3ZEH A;  1Y07 A;  2VXF A;  5LJ5 e;  5FU6 C;  1KQ2 A;  2K5I A;  3I55 A;  3OYA A;  3CD6 A;  4D6W A;  4F7U B;  3CCV A;  1XTD A;  5GAN j;  2FB7 A;  1YIT A;  4ZTF A;  4M78 B;  1NE8 A;  3JCM X;  4E7H A;  4RG8 A;  5LJ3 f;  3CC7 T;  3PNW C;  2YRV A;  2IG0 A;  4B9X A;  3CCU A;  5HK0 A;  2NLU A;  4LD6 A;  3DB3 A;  1JRI A;  5CAI A;  4IUT A;  3JCM W;  4RMO A;  1KC8 C;  1UGS B;  2WAC A;  5C0M A;  3PMT A;  3JB9 D;  3URG A;  1KC8 U;  5IT9 E;  3MEV A;  4C92 G;  2DVE A;  3CCQ A;  1QVF S;  4JS4 A;  4ZGD B;  2R58 A;  4QVZ A;  3L2R A;  4BI4 A;  4J6Y A;  5CKH A;  4M78 D;  3SWN A;  2XU8 A;  3DLM A;  3PT9 A;  3QKJ A;  1OZ3 A;  3MP1 A;  2KY9 A;  3OB9 A;  2CZ7 B;  5CKE A;  2D9T A;  5DLO A;  4LDU A;  2K57 A;  3ME9 A;  2QEX A;  3LWI A;  1M1K U;  1D3B B;  1PSE A;  1B34 B;  2DD5 A;  2CZ0 B;  4XTX A;  5GAN g;  1KD1 U;  4M75 C;  4C0D C;  3NTI A;  1UB4 A;  3S3O A;  1AHJ B;  4FIB A;  5KCH A;  1WJR A;  4P5N A;  4BAC A;  2V8K A;  2LQ8 A;  4MML A;  1VQ7 T;  1JB0 E;  4PJO B;  4A4K A;  3OYH A;  4BE2 A;  3VYG A;  3C12 A;  2LT1 A;  1YJW T;  5LL6 S;  3CCL A;  4M77 B;  4C5E A;  3FJP A;  5CQY A;  4QW2 A;  2RJF A;  4LDW A;  4GY5 A;  2OAU A;  2DD4 A;  5D6W A;  4TVR A;  1JJ2 S;  3INZ A;  1VQL T;  4PJO D;  4XTW A;  1YJ9 T;  3UPU A;  3A8G B;  3OS5 A;  2PUK B;  4C0Z A;  1M90 U;  2R57 A;  2LT4 A;  3CXC S;  2EJF A;  2M1H A;  2QI2 A;  1X01 A;  5A0L A;  2EAY A;  5HK3 A;  2XDD A;  1BKB A;  1QVF A;  3CC2 T;  3GP8 A;  2E12 A;  4NS5 A;  4JJN K;  4J8O A;  4C92 B;  5A0G A;  3OYC A;  4JRP A;  4M7D C;  3M54 A;  2X4Y A;  3LGL A;  4L59 A;  2JZ2 A;  3FB9 A;  5GAN h;  2DK3 A;  5GAO r;  1VIF A;  3OYF A;  3T9N A;  1I4K 1;  1BIB A;  2F5K A;  2M0O A;  3MEU A;  1G3T A;  2E70 A;  4EPC A;  1IRE B;  4A53 A;  3CCM T;  2QQA A;  4FT4 A;  2DAQ A;  4MDW A;  4NL2 A;  3CME A;  1Q7Y U;  2PUO B;  2L3R A;  2RM4 A;  2VC8 A;  3ER0 A;  2LX9 A;  3SWN B;  5CR2 A;  2M16 A;  3FDR A;  2WSC E;  4C92 D;  3OYK A;  4HT8 A;  3M4Y A;  3VUZ A;  3EAE A;  3QXE B;  4VUB A;  1N6A A;  3CCE T;  3OYD A;  3WXM B;  2RB6 A;  1W2B A;  3NTH A;  1W4S A;  4JDS A;  4R55 A;  2KMT A;  3HRU A;  3OMG A;  1R8O B;  4RCC A;  3I55 T;  1Y96 B;  2RHU A;  3PIO A;  3TU4 K;  2E6Z A;  1LOJ A;  2P0Q A;  2ZPI B;  3CD6 T;  4N0A A;  1K9M C;  2HNI A;  3CPW A;  2DKG A;  2XDB A;  4XTZ A;  5FU7 B;  3CXC A;  3S3N A;  1XOV A;  4B9W A;  3CCU T;  1D3B A;  3G6E T;  2X35 A;  3M57 A;  3GIB A;  2K5F A;  3JB9 I;  3VU3 C;  1KQ1 A;  4IUR A;  5GAM j;  4HCC A;  1G3Y A;  3MEW A;  4OB3 B;  5DM7 R;  3FLG A;  3H6Z A;  1BYM A;  3V8K A;  5J3B A;  3J80 E;  1YIJ A;  3CCJ A;  2DTH A;  1N9S A;  4HKE A;  4L6V 5;  4N4H A;  3QII A;  1BI1 A;  2KQW A;  2XK0 A;  4ATO A;  4JRK A;  1O75 A;  3M58 A;  1VQ5 T;  2JUF A;  3FEO A;  4OMF B;  2EYQ A;  1Q82 C;  3QDR B;  2KDS A;  3GF5 A;  1I81 A;  1G3S A;  2QQB A;  3C94 A;  3RMS A;  3JCM g;  3AHU A;  1BIA A;  3OYM A;  2PVD B;  2D0Q B;  2VGM A;  3Q1J A;  5GAM g;  3M56 A;  4M7D D;  1VUB A;  3CBM A;  2CGH A;  4MMK A;  2DXC A;  2R5M A;  3JCM P;  4GLK A;  3OBY A;  4A4E A;  4DOW A;  1U1T A;  2RI5 A;  3RER A;  5IN1 A;  4C92 A;  2G3R A;  1XQH A;  2QA4 A;  3HHT B;  1ZBX A;  2DIQ A;  4MZT A;  3QZ9 B;  3BDU A;  3BFM A;  5D6Y A;  3OA6 A;  5LJ3 j;  4CRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...