2RHXA

Crystal structure of the 3-mbt repeats from human l3mbtl1 bound to dimethyl-lysine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
325
structure length
325
Chain Sequence
b'ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA03
4ZTFA 1OI1A 4L59A 4N4IA 4N4HA 3MP8A 3L2VA 2JTFA 3OS0A 3OYKA 3LH0A 2E6NA 4QQDA 2RJDA 2XK0A 3GOXA 4IKFA 4C5IA 4BE0A 3OYGA 3QKJA 3L2UA 5J26A 4A4EA 4LD6A 3OYBA 2O4XB 2RHXA 3LGFA 4IUPA 2IG0A 2EFIA 4A4HA 2QQSA 5IAYA 4CRIA 2YRVA 5D6XA 4HCZA 4EDUA 2M0OA 2O4XA 3PFSA 5C0MA 2PQWA 3MP6A 4FU6A 4N4GA 2X4XA 3OYLA 2EKOA 2R5AA 2HQEA 3OYMA 1WGSA 3OYHA 3L2RA 2BUDA 4FL6A 2EQUA 3MO8A 2RJEA 3MEWA 3OYAA 2LDMA 3DLMA 4X34A 3OB9A 5KH6A 2HQXA 3NTKA 3P8DA 1SSFA 4E7KA 3FC3A 2DIQA 1OZ2A 3KUFA 3OYJA 2RHUA 3L2QA 3NTIA 3Q1JA 3LGLA 4Z02A 3OMCA 2BKDN 3CEYA 3BDLA 3UT1A 2RHZA 1G5VA 2LVMA 2RI3A 2LTOA 2CKKA 2DAQA 3M9QA 3FLGA 3PNWC 2EQKA 4QVZA 4A4GA 4B9XA 3OMGA 2EQJA 4RG2A 2P0KA 2MWPA 3C4SA 4B9WA 3FEOA 3OYFA 2GFAA 4C5EA 2BIVA 3UWNA 3DB3A 1H3ZA 2L89A 2K3XA 3H8ZA 4IURA 3S3NA 5FRNA 5M9OA 3OQ5A 4QQ6A 3OY9A 5FROA 3MP1A 3LYIA 4IUTA 4BACA 3ME9A 3META 2GF7A 2LCCA 2E5QA 1RI0A 3QJ6A 4PL6A 4Q5WA 4BDZA 4BE2A 3NTHA 5KE3A 2FHDA 2DIGA 4E7IA 2QQRA 2D9TA 4BDYA 3SD4A 1WJRA 3S6WA 5J39A 1N27A 2M1HA 2RJCA 3DB4A 4BD3A 4E7HA 2EQMA 1KHCA 5KE2A 3OS2A 3S3MA 1XNIA 2RJFA 3FDRA 2F5KA 2X35A 2JZ2A 3MEAA 2X4WA 2K3YA 5IN1A 3ZEHA 3PMTA 2G3RA 3LLRA 2R5MA 2XDPA 5D6WA 3OYEA 3E9FA 3E9GA 4IUUA 1MHNA 4UC4A 1WJSA 5CIUA 3L42A 3PMIA 4BE1A 2RHIA 2LRQA 2X4YA 3P8HA 4NS5A 4A4FA 5C6SA 3OS1A 2VYTA 5FRMA 4ZTJA 3MEVA 2RI2A 3OYIA 2R57A 1OYXA 2RO0A 3O8VA 2WACA 2GFUA 3EAEA 3MEUA 4C5GA 3S3OA 2R58A 3ASKA 4C5HA 5KCOA 3QIIA 4PLIA 3F70A 2RHYA 2MWOA 4GY5A 4IUVA 4OVAA 3OYNA 2L8DA 4QW2A 3QBYA 5D6YA 3OYDA 2M16A 4II1A 2RI5A 2B8AA 5KCHA 4QQGA 1WJQA 4E7JA 1OZ3A 3LX7A 2NLUA 3L2WA 3OA6A 3H6ZA 3OYCA 4E7LA 4PLLA 4IUQA 2L3RA
chains in the Genus database with same CATH superfamily
2HQHA 2HD0A 4JJCA 3OS0A 4J9DA 4J9BA 1T0JA 2NUZA 2RJDA 1WHJA 2OTJQ 2QAZA 3LGFA 2QDLA 1BU1A 5AYFA 4Y91A 3UA7A 4CRIA 1WIEA 4HCKA 2KRNA 3E2UA 2GBQA 1D3BA 2HSEB 1K9MU 3MEWA 1IHVA 3CCUQ 4F7UG 3CCSA 3OSVA 4LUEA 1SF9A 1UDLA 4M77D 5A0GA 3NTIA 1YCSB 4OMPA 3HSBA 1O9SA 2LVMA 1IO6A 3A5ZB 2DA9A 2K79A 1QVGS 2CP5A 1JJ2S 3EGXA 4RG2A 1RAEB 4B9WA 1NPRA 4PK4A 1K73R 2X3WD 1U3OA 3EG2A 3HRSA 5IHIA 2QQAA 3QDFA 3RERA 2J6KA 4ELYC 4JRPA 3FIFA 1UGQB 2KRSA 3NTHA 3CCVT 1LCKA 3OBWA 4F16A 2EGEA 4J6XA 2LJ0A 3FJ5A 1WZOA 4FYVB 1SEMA 2X4WA 3M53A 5IN1A 1VQOT 3RR6A 1K4US 5LJ3e 3CBMA 1J3TA 2RK1A 3VS6A 1OPKA 1W2BS 2LRQA 3OS1A 3PE0A 1M90R 3R6NA 1IZ6A 3PIPA 1OYXA 3VS5A 4J9CA 3S3OA 1TWBA 4RCCA 1VQPA 1KD1C 3CC4Q 1G3WA 3OYNA 2JT4A 1KSWA 2RM4A 4WCIA 3OYDA 4ESRA 2RI5A 1S72T 3G6ET 3JB9J 3JCMb 1PWTA 2EYWA 2F2WA 2L3RA 2EAYA 1ZUYA 1UUEA 4AFQC 1KC8U 4LDYA 1ZSZB 4C5IA 1VQ5A 1RAFB 1X69A 2JTMA 1BIAA 2RHXA 1PSEA 2YT6A 2F2VA 4EDUA 3KFVA 3G71A 3VS2A 2DE0X 2X4XA 3OYHA 1WHMA 2KI7A 2DD5A 1KK7A 5EG2A 1U8RA 3RESA 2HQXA 1HK9A 3A8LB 5GAOr 3X25B 1VQLQ 1UEBA 4C8QF 1RACB 2QQBA 4FT2A 2EYXA 1VYUA 2ABLA 3QZ9B 1KQSS 2JM9A 2D1XA 1RL2A 1M27C 3I56Q 2WSFE 5I2SA 3EG1A 3V7SA 3VRZA 3OQ5A 3OY9A 2KE9A 2DEQA 2P4TA 3M0QA 1YIJT 4ANJA 2KBTA 4LUDA 2JM8A 3M57A 1WJRA 3PT9A 4LD9K 1G3YA 1PSFA 2PVGB 4C0DC 4PKCC 4XQ3A 3V7CA 5CQYA 3EH2A 5GJWB 4IUUA 5LJ5e 5CAIA 5J3BA 3PMIA 3TREA 2DMOA 2LC4A 4XK8E 4M7DF 3VV0A 4XTYA 2WACA 4MZPA 5LJ3h 4C0FA 3CC2A 1E7OA 2KVQG 4IUVA 2YUOA 4PJOC 1Q82R 5GAMg 5GAOl 1AWOA 3L2WA 1Y7XA 4M77A 3H6ZA 1T3LA 4M75F 3UA6A 1U06A 2DZCA 2FYKA 3HL8A 4RMOA 5KYWB 3OYKA 2XHCA 3MCAB 2EJ9A 4A63B 2QQ9A 3EGXB 2HBPA 4BY6B 1K8AU 2CZ6B 1B34A 2L2PA 1M90C 2XU8A 2Y90A 4J5YA 2DTIA 2X3XD 4N4GA 1Y71A 4IIMA 3CMAA 4FL6A 1D09B 3CXCP 4X34A 2E41A 2V26A 2FZKB 1IHWA 4PFZA 1BCMA 1PM3A 3G71Q 5GAN2 8AT1B 2RI3A 4KGZB 2HEQA 1N5ZA 1QP2A 4XTVA 3CC7Q 4OB3B 2Y4YA 1YI2Q 1PC0A 4BI8B 1CSKA 1OOTA 2MIOA 1QCNA 2DIGA 3V8LA 5HK3A 2IIMA 3S6WA 2VGMA 3UF4A 4XU2A 1VQ7A 1YN8A 2QG9B 2JZ2A 2EJGA 3ZEHA 2F5TX 3LLRA 2JOYA 2RK2A 5A0LA 1RLPC 4PJJA 3MHXA 2HDAA 2DTOA 4KGVB 3WVDB 2H3JA 3MEUA 1VQMA 5CO7A 3HTRA 5LJ5h 3T9NA 2ECZA 3CMEQ 3OW2S 4A4KA 4GY5A 5IHKA 4Y92A 3PIOA 4AMCA 3E19A 5FU7B 3LH5A 4E7SA 1EZZB 4N0AA 1M4ZA 2DFUA 4PJOG 4WF2A 3MP8A 2FRYA 2CS7A 1VQNT 2OJ2A 3WVEB 4E7ZA 4QT7A 5DLQE 1D1CA 3VS7A 3GBQA 1U1SA 2DYBA 2FZCB 4LD6A 2EYYA 1VOMA 1VQKQ 6AT1B 1OEBA 1RI9A 1QWEA 4FU6A 1EIFA 1ZSGA 1ZUKA 3JCMe 2CZ0B 3QHSA 3NTKA 4M7DE 4E7KA 2XD0A 1JO8A 2CT4A 3RBBB 2GCXA 1MMGA 3L2QA 1M5Q1 4LN2A 3CCST 2BKDN 1TUGB 3QSUA 3CCET 4DBRA 1NYFA 2YXYA 2DL3A 2V8IA 1TH7A 4C0GA 4M75E 5CK9A 4QQ6A 1UGRB 1W1FA 3MP1A 4FIBA 1XOVA 1GXIE 3NPFA 1RI0A 1WXUA 2CP6A 2EQIA 3PGGA 1VQ6A 3HHTB 4C8QC 1DJ7B 4YTLA 4XTWA 3H0FA 2CZ1B 1NJIC 3I5SA 5LJ3j 2ROTA 1BCOA 5GAMf 2DL7A 4M7AC 2EPDA 1M1KU 4AT1B 3X28B 4EMKB 1KHIA 1X43A 3EFOA 2X51A 4Z8AA 2ROLA 4JUVA 4XU3A 3VS0A 2AZVA 4JRKA 1FX7A 5DY9A 1PRMC 1PNJA 2CUBA 4DA4A 2KXDA 2NLUA 2ZGWA 5GMKi 4JS5A 1AD5A 2FB7A 1VQMQ 1Q7YR 1FMVA 4ZGEB 2PU9B 2XK0A 4LDUA 1Z9ZA 1Z9QA 5GANd 8ATCB 2JUFA 4IUPA 1AWXA 4A4HA 2D8JA 4FYXB 3LWIA 5I11A 1X75C 3PFSA 3RMQA 4JRQA 4HVUA 1SRMA 1G2BA 1M2OA 4DOVA 3OYMA 4M75C 2BUDA 3CPWP 3MO8A 1YJNA 2LCSA 3KUFA 2OX7A 1AHJB 2XMFA 3CCUA 4X9CA 1GCQC 3N5BB 2YLBA 1VQ8T 3JCMh 3V7RA 1ABQA 4XTXA 3CCMA 1ABOA 4M78C 1Y96A 4DBFA 3RKWA 4PFPA 2CH4W 1S72Q 2O9VA 2HBWA 2QK0A 1X01A 2H8HA 1TXQA 4OMLA 4E7IA 5GAOp 2E3IA 1VUBA 1N8RR 2RJCA 1TSFA 2QGGA 2GTOA 4C8QG 1RUWA 3CBPA 5LJ5j 2L3SA 4D8DA 1P92A 1WJSA 4PJOD 4A4FA 2X4JA 1IB8A 3A98A 3VS4A 5CR2A 2RO0A 3C0CA 4R0KA 3EAEA 4J6WA 1AOJA 5KCOA 1W4SA 1YJWA 2EGAA 2D0QB 1JJ2P 4D8KA 2KEAA 2V8KA 3CC4A 1UTIA 2NWMA 4DOWA 2OAWA 4ZTFA 4N4IA 5EC7A 3SWNB 5GAN3 4KGXB 2AIRB 1X6GA 1D0YA 2K5FA 4IKFA 4OMMA 5HY6A 1QKXA 2O9SA 1WDXA 2HL5C 1YIJQ 2EVRA 4M7DG 4D6WA 3JAME 5A0DA 1MMNA 1BKBA 2DZ9A 1ZQ1A 5HK0A 3A8MB 3QWYA 2DVJA 2PQWA 2A36A 4F17A 2VVKA 4A54A 1W2BP 4EPCA 2L0AA 3P8DA 3BDUA 4RG8A 1WQWA 2VB6A 3OYJA 1I81A 4PJMA 4NL2A 5CKFA 4CC2A 3CCRT 3I5RA 3Q1JA 4Z02A 4M75G 1JBMA 4L5GA 1KFZA 2OI3A 3RIRA 3I55T 1NZ9A 3MJXA 3J7AF 1VQLA 2CT3A 1Q7YC 3OMGA 1YJNQ 3C4SA 3A8GB 1H8KA 1W6XA 2ATCB 5CKDA 4JRIA 2KSSA 3I56A 1GBQA 4Y28E 3JB9H 4EMHA 2HAXA 4M78G 2DXUA 1LVKA 3CCMQ 1K9AA 3OS5A 2FZGB 5KE2A 4DEYA 2VASA 5GMKe 2CSQA 4DEXA 2P0PA 1WPYA 2MOXA 4FM4B 3JB9G 1I1JA 2DM1A 2MCNA 2ZAEA 5C6SA 1X6BA 1KD1U 2VC8A 1WXTA 2C0OA 1KQ1A 4DBHA 1TUCA 2KYBA 3PVQA 4LDWA 2OTLA 1NYGA 2A7YA 3GIBA 1YHQT 2KROA 3QBYA 4RTWA 2M16A 1YITT 1VQ9A 1WA7A 2EBPA 5GANe 1N8RC 4A53A 1I8FA 1PCXA 1E6GA 3LH0A 1YJWQ 2BZ8A 4P5NA 2DLPA 1ZA1B 2DRKA 2FO0A 3TCJA 4IIOA 1Y96B 2JS2A 2YRCA 4OGCA 2M02A 2O01E 3NHNA 2QASA 5C0MA 2E5KA 1G8XA 2AT1B 3OYLA 3EG3A 4OB2B 3A1PA 1LJOA 2C0TA 3CCJA 1R0CB 3L2ZA 1SG5A 3AHUA 1AT1B 2RHUA 5KYUA 3CCLT 4LDXA 1ZUUA 2PVOB 5GAOm 2RHZA 3G4SQ 1VA7A 2QYZA 3M9QA 3TVTA 4PJOA 3CCQT 4C8QD 4QKUA 2K4YA 3GF5A 4MDWA 3CXCA 2G6FX 1VQ4Q 2D8HA 1Q81U 2DO3A 1WFWA 1BI1A 3CC7A 2LT4A 4BE2A 3X26B 4VUBA 9ATCB 1YI2A 3SD4A 5I21A 3QYGB 2ZZDA 3INZA 3QZ5B 1VQNQ 4M7AD 2DNUA 3HRUA 4MZTA 2VV5A 3H0IA 1IREB 3PMTA 1QVFP 2R5MA 4AFUC 4HT8A 3L42A 1N6AA 3M59A 4Z88A 3HPWA 5FRMA 2K5LA 5GMKh 2BE7D 1WQ7A 2IPOB 2MF2A 1M3BA 4ZGJB 2AK5A 4KH1B 4C92B 1AVZC 1M8VA 1RADB 1ACMB 3QPHA 4PJLA 4II1A 5D6YA 2LQ8A 3VYGA 5KYYA 1V1CA 3CMEA 3CCEQ 1BI0A 1UGPB 4OMFB 1I5OB 4CI0C 4KUIA 1PD1A 1WHHA 1M3AA 4RTYA 3I9QA 4N4HA 2JTFA 1YBYA 2OTLQ 4JPBW 4JDSA 4M75D 2QA4A 1M90U 4JZ3A 5GANh 1K73C 1VQ9Q 4OP0A 2OAUA 2L5QA 1D3BB 4HCZA 2KGTA 2GQVA 4EMGA 2LQWA 1OX8A 3ZFJA 1WGSA 3CD6Q 1GBRA 2ZPHB 1PKTA 2EQUA 2E1HA 1VQKA 2ESWA 2D0NA 1I0CA 2OTJT 1MMAA 3G1JA 3JCMX 4M78D 1HYOA 2DVEA 3OW2P 1EFNA 1YJ9A 2DAQA 3PNWC 2DX1A 2FPFA 4MMKA 3G7ZA 3CCUT 3CCJQ 3TU4K 3JB9D 4CC4B 1TOVA 3H8ZA 2DETA 4HKEA 1PKSA 2ZPEB 2ZPGB 3FB9A 4J9GA 4AFZC 1UHFA 1KG1A 5CKEA 1D1AA 2L3QA 1UJ0A 4FCYA 4BDYA 1Q86R 3QYHB 3MKDA 1QQJA 2M1HA 5GAOq 4BD3A 4E7HA 3H0HA 4RKUE 4AG1C 1W70A 2RJFA 2AKLA 1OULA 2B86A 2EGCA 2G3RA 2GGRA 1M1FA 3E9GA 1PG5B 3OSSC 2SEMA 5FW9A 4C5GA 2O88A 3GPLA 5GAMd 4J9EA 2SRCA 2MK5A 3RDVA 2MWOA 2HNIA 3JV3A 1RAAB 2KXCA 3LX7A 1ZX6A 3QJYA 4ELZC 1XTDA 3JCMf 2LQKA 5KYUB 1HSQA 3L2VA 5CVIA 2RNAA 2VWFA 4JJBA 4BE0A 3OYGA 3QKJA 1MGQA 4C8QA 4PJOB 3SFMA 1YP5A 1VYTA 1OV3A 2W0ZA 3HFOA 2PVDB 2QEXQ 2LNVA 1G83A 2O4XA 2YRDA 4J8OA 1QP3A 4XTZA 3CCVA 2EYZA 2QA4Q 2LDMA 1RAGB 4M7AA 3FC3A 2DIQA 4GBQA 2DD4A 3VU3C 3LGLA 1VQOA 5L8RE 4EMKC 3EGDA 1K1ZA 5A2QE 2MPXC 3R6OA 3KXTA 2O2OA 2YSQA 2P0KA 4RCBA 4XU0A 5HKCA 1YWPA 4C5EA 1H3ZA 2L89A 1SSHA 3CPWA 3NFCA 2FRWA 2LCCA 2WSCE 3REAB 2KT8A 1YJ9Q 1Q82C 1NJIU 5KE3A 1ZBJA 3JB9I 1S72A 3JCMW 4TVRA 2EW3A 5KYYB 2EQMA 5GMKj 1K0XA 3VS3A 2QTXA 5KYNA 1JB0E 4M75A 4WTOB 5GAN7 2A37A 4UC4A 5CCAA 1Y0MA 4NS5A 2COWA 1FMWA 4R55A 2EKHA 2RQVA 3FRNA 4F14A 1BIBA 1GCQA 1UHCA 1S1NA 3F70A 2HMAA 1MNEA 5LJ3g 2RQTA 3J80E 4B6MA 4M77B 4F7UA 3JCMV 4O5VA 2FPEA 3I55Q 1NE8A 3C95A 4M78A 3E1SA 1Q86C 2J06A 1PHTA 2PUOB 1B34B 1JXMA 4A4EA 3X20B 1JXOA 1C6VX 1T0HA 2ZPBB 2J05A 1BBZA 2P4RA 1JJ2A 3LW5E 4RTTA 4C92F 1VQPT 3CBOA 1YIJA 3L2RA 2EKOA 5CKBA 2LQNA 2ZPFB 1ARKA 2RJEA 4X9DA 2ZPIB 2M9UA 2DILA 3DLMA 4M7DC 1KQ2A 4RTUA 2RPNA 4MZMA 2C0IA 4F04B 1K76A 2BZYA 2XICA 3QWXX 4RTZA 3CEYA 5L23A 2MMPA 5I2MA 3OBYA 1VQ5T 1G3SA 4KBMB 3CCVQ 2DXCA 5FU6C 2XKOC 1W2BA 3G71T 4L6V5 5CQXA 1VQOQ 1JRIA 1MNDA 3H41A 5IT9E 4KT0E 2EJFA 1RLQC 3SWNC 2E3HA 2PNIA 4E2FB 1N27A 2KQWA 4K11A 3CC7T 2V1RA 1R8OB 3U23A 4HT9A 2QTVA 2FEIA 2EYQA 2YDLA 1UJYA 2M0YA 2CYZB 2QDYB 5GAMe 3OYEA 3O5ZA 4CC3A 2RA2A 1I5LA 2I2LA 4C8QB 2X4YA 1BI2A 3P8HA 2V1QA 4J7IA 3G6EQ 2DJQA 3URGA 1OPLA 2K57A 2ZCFB 3PVLA 4PLIA 1NPPA 4J9IA 4OVAA 1H641 2H3EB 1AWJA 1K9MR 4ZN3A 5LJ5g 4E7JA 2MI6A 4M7AB 1WNLA 2EWNA 1QW1A 3OYCA 4IUQA 1QKWA 3CCQQ 3UPUA 3VYHB 3QUIA 3LWHA 3JCMP 2DL4A 3EGDB 4EIKA 2J6FA 2XDDA 2HKQB 2KR3A 5IAYA 2QQSA 3M5AA 3J81E 1QVGP 1R0BG 2JVVA 2CH4A 1C1AA 3CC2T 3M4YA 2LZ6B 5KH6A 1NM7A 2LNHB 4ME7A 4NOYA 4OB0B 1BK2A 2HL3A 4O6JA 4HVWA 3OMCA 2HKNA 2DTHA 1M1GA 2COYA 2D6FA 4QVCA 2CKKA 4PJOF 5FLXE 4B9XA 2EQJA 2E12A 2RQUA 3G4SA 1NG2A 2GFAA 3MPUB 3CPWS 4IURA 5FRNA 2GTJA 4XU1A 1SHGA 2E5QA 3CMAT 3DKMA 4F7UB 1VQ4A 5J39A 1LNXA 3KBGA 4M78B 2NUTA 1GFDA 3L1AA 4C92E 4FYYB 5LJ3f 1VQNA 4HA8A 1FWZA 4LNPA 1KC8R 3M4GA 2E10A 2RH2A 2YUNA 2RHIA 3VKIA 3EFOB 3MEVA 4KUDK 1PRLC 2E64A 2GFUA 1OX9A 2O31A 1TTHB 5GAMh 1IGQA 4BI4A 3M0TA 1ZSZC 3P8BB 3QG1A 7AT1B 2JNGA 3RMSA 3DLLA 1N8RU 1Q81R 1QVFA 2FPDA 2A0FB 4FW1A 1VQ7T 4PLLA 4L59A 2VKNA 3CCEA 5GMKl 2K2MA 1AZEA 4QQDA 2K2VA 2GNCA 2CP3A 1R77A 2JMAA 1TUDA 5KYWA 5GAN8 1M30A 2YRVA 1KQSP 5D6XA 1VQMT 4J9FA 4FSXA 2BE9B 4OB1B 5IXBA 4M77F 1UE9A 4BB7A 2CZ7B 3BE3A 2DXBA 1K9MC 1N9RA 3PTAA 1Y57A 3CD6A 2KRMA 1SPKA 2YUPA 4J83A 3UT1A 1G5VA 4JLIA 3JCMJ 2LTOA 4E6RA 3EFSA 1GL5A 4C92C 4XAXB 3JCMg 2LT1A 2MWPA 2A3LA 3FEOA 2BIVA 3UWNA 3BW1A 4J6YA 1QWFA 3M0RA 1ZBXA 3EFRA 4BUGA 4V2SA 1TU0B 1SHFA 4Q5WA 1WX6A 3QXEB 1H3HA 2BTTA 5FWCA 2KNBB 2FHDA 5DLOA 2JXBA 3A8HB 3M56A 3OW2A 3NMZC 2JS0A 1KHCA 2Y4XA 3S3MA 1XNIA 2KDSA 1KJWA 2X35A 3FDRA 2K3YA 1TS9A 1QMCA 1M9SA 3TEEA 5LJ5f 2JJ9A 1WLPB 4E47A 1YNZA 1AWWA 1B3QA 5GJVB 4ZTJA 3RNJA 1K8AR 3OYIA 3O8VA 2MAMA 1OU9A 1XQHA 4C5HA 1E6HA 2DK3A 4QW2A 1X2QA 4PJOE 3UDCA 1VQ6T 4FSSA 4BY6C 4HCCA 2C06A 5ECAA 2F1LA 2RB6A 2LX7A 3I35A 1VQ8A 2I0NA 1LPLA 1K73U 1N9SA 3BFMA 3GOXA 1ZLMA 5J26A 1AZGB 3JCMd 2DBKA 1KC8C 2IG0A 4M7DD 1OQKA 2K5IA 3GNGA 3CCSQ 1WHLA 2DBMA 4HXJA 2QEXA 3FJPA 4OMOA 3VUZA 3OB9A 2CP7A 4M7AF 2J6OA 2JN0A 2XIDA 2NUTB 1Q81C 2ED0A 4HCBA 1SRLA 2DPPB 3BY7A 1UFFA 1D1BA 3C94A 3CPFA 3V8JA 3OYFA 1YWOA 4OF1A 2HZYA 4DBQA 4JJNK 1FXXA 1OU8A 1T3SA 4BACA 2K7AA 2GQIA 4C92G 3M0UA 2E6ZA 2VXFA 1YJNT 1QVPA 2QQRA 2LX9A 4ORZA 4LE9A 5GAN4 1IGUA 5LL6S 3SEMA 1G3TA 3NGPA 1MV0B 2F5KA 4RTXA 4RUGA 1QLYA 2CDTA 5GAMj 5D6WA 4M77E 2K3BA 4FT4A 2VXEA 1MHNA 1VQPQ 4PNOA 3X24B 3WXMB 5FU7C 3CCMT 2RQWA 1UG1A 2YLCA 1M2VA 4R56A 4EMKA 2RHYA 2HCKA 1A0NB 4F7UF 2CP2A 4PFOA 1WJQA 4ATOA 1OZ3A 2E4HA 1QVFS 4M78F 2NYSA 3M55A 1MUZA 2Z0WA 3CCRA 2RMOA 1UB4A 1NJIR 1VQ5Q 1B7TA 2A08A 1TG0A 3OYYA 3A8OB 3I55A 2PUKB 2CUDA 2K6DA 1QCFA 4OMQA 4GLMA 4XTUA 4C0DB 2NUPA 3JB9F 5DM7R 1BI3A 1M8MA 4X1VA 1Y07A 4KRTA 3QDRB 1K8AC 2RN8A 2V8JA 1VQ8Q 5IH2A 2HQEA 4NL3A 2DEUA 1YJWT 4OGEA 3RKXA 1ZHIA 1AEYA 4ZGDB 3CC4T 2JW4A 3EG9A 4DQ2A 5KYXA 3H9NA 1WI7A 4PJNA 1U5SA 5CKHA 4QVZA 5D7UA 4J7FA 1V76A 1O75A 4BI3A 2XG8D 3DB3A 4M77C 3VJPA 1M1KR 1Q82U 2DERA 1GRIA 3G4ST 4PL6A 2ED1A 3GLXA 1YCYA 1CKBA 1YHQA 4C8QE 1YITA 2FG0A 4GLKA 3DB4A 3RKYA 3OS2A 3JSCA 1VYVA 1D0XA 1I07A 2P84A 2DL8A 3V8KA 1VQ4T 1HD3A 1GCPA 1FYNA 4FYWB 3E9FA 1VQLT 3CXCS 2KYMA 5CIUA 4AG2C 4BE1A 1NEBA 4M7AE 4JZ4A 3CC2Q 4M7DA 4CC7A 2RI2A 1MV3A 5AT1B 2R57A 1SKUB 3HFNA 1LOJA 3AT1B 3ASKA 3QIIA 3I56T 3G6EA 1BB9A 5GAN6 1WXBA 3TQ7P 1Q86U 2LJ3A 2B8AA 3JRZA 2EIFA 1UECA 2L3PA 4ZNXA 3EG0A 3CCLA 1VIEA 4E7LA 2DYIA 4QVDA 2RF0A 2YHTA 1OI1A 1VIFA 2F69A 1M3CA 2M51A 2E6NA 1WHGA 2K9GA 4MDXA 5GAOn 1XJWB 3L2UA 3M0SA 3SWNA 3D7SB 3CCQA 3M58A 3OYBA 2WSEE 1X6OA 3CMAQ 1UGSB 3THKA 3CCRQ 3HRTA 2JTEA 5GANg 2M0OA 1D0ZA 2J7IA 3HP9A 2ENMA 5GANj 3SHWA 2AKKA 1HXDA 4MMLA 2OTLT 1HJDA 1K0SA 2DF6A 3OYAA 2LJ1A 4C92D 1SSFA 3SB2A 1VQ9T 1OZ2A 3C12A 1KIKA 2BZXA 4ZN1A 3VS1A 2VUBA 1BYMA 3CD6T 1PD0A 2RD1A 2FL7A 4F7UE 1QVGA 5GAN5 1IXDA 2QI2A 4JJDA 4J9HA 1WHKA 4JLGA 4M78E 1JQQA 2K3XA 3S3NA 4N0AC 4KH0B 5FROA 3JCMc 4IUTA 3LYIA 2HSPA 2RQRA 3ME9A 3META 2GF7A 1M2VB 3QJ6A 4BDZA 2CREA 2QGFB 1VQ7Q 4FW2A 3GP8A 4M77G 3CCJT 1FMKA 2F2XA 3GNFB 2CSIA 2PZ1A 3M54A 1WYXA 5IXFA 2XDPA 2FVUA 1YHQQ 1NBEB 4Z89A 1YITQ 2NUPB 1V29B 3ER0A 2KY9A 5LJ3d 3IQLA 2YUQA 1X2KA 3SDZA 2P0QA 1EX4A 3RUXA 2VGNA 1M1KC 3EGUA 1RAHB 4LDVA 2OTJA 1YI2T 3TSZA 4QQGA 3REBB 2DXTA 3EG9B 1ZA2B 1QCOA 5KYXB 3VUBA 3ZL7C 1Q95G 1F1BB 2JMCA 3VRYA 4JS4A 2AHJB 4RTVA 2E70A 2PTKA 1CKAA 3ZBDA 2CP0A 2LP5A 4AFSC 2O4XB 2EFIA 1U1TA 3CCLQ 2YWWA 3UATA 3MP6A 3TSWA 2R5AA 1H92A 3M0PA 1YFNA 4LXCA 5HCKA 1C0MA 2QEXT 2MYSA 3CMET 1B07A 2QXFA 2XDBA 3EHQA 2LMJA 1MMDA 1JEGA 3BDLA 1NLPC 1ZSZA 4M4ZA 3FLGA 1KQSA 2EQKA 4A4GA 4HVVA 2CGHA 2QA4T 2KMTA 2XI9A 3CQTA 5GMKm 3JCMQ 4M7DB 1KD1R 1JU5C 1NEGA 1VQ6Q 5M9OA 3QO3A 5IHNA 5FWBA 4OMNA 1GFCA 1NLOC 2KK4A 3HKSA 2A28A 1VQKT 2D9TA 1Q7YU 1IRXA 2KT1A 4M7AG 5FU6B 3EHRA 4C0ZA 3ULRB 2DRMA 4M75B 3MEAA 2IVWA 1I4K1 5I22A 1YJ9T 2E65A 2W10A 1RAIB 2DJZA 2VYTA 2LCLA 2KAFA 1RABB 2COZA 2DL5A 2R58A 5LJ5d 1X27A 2L8DA 1UGVA 4C92A 2AZSA 5KCHA 2DKGA 3OA6A 5GANf 3EH1A 4KULA 2X9HA
chains in the Genus database with same CATH topology
2FB7A 1VQ8A 2HD0A 3L2VA 5CVIA 3OS0A 4ZGEB 1K73U 2PU9B 1N9SA 2RJDA 2XK0A 3BFMA 4LDUA 3GOXA 4BE0A 3OYGA 3QKJA 1MGQA 5J26A 4C8QA 5GANd 4PJOB 3JCMd 3SFMA 3HFOA 3LGFA 1KC8C 2JUFA 4IUPA 2IG0A 2PVDB 5AYFA 4Y91A 4A4HA 4M7DD 4CRIA 2LNVA 3LWIA 2K5IA 1X75C 3GNGA 2O4XA 3PFSA 3RMQA 4JRQA 1D3BA 4DOVA 2QEXA 3OYMA 4J8OA 1QP3A 4XTZA 1K9MU 3FJPA 2BUDA 4M75C 3MO8A 1YJNA 3CCVA 3MEWA 3VUZA 2LDMA 4F7UG 3CCSA 3OB9A 3OSVA 4M7AA 4M7AF 3FC3A 2DIQA 3KUFA 1AHJB 2JN0A 2DD4A 4M77D 2XIDA 3NTIA 3VU3C 5A0GA 3LGLA 1Q81C 3CCUA 4X9CA 4HCBA 1VQOA 5L8RE 3N5BB 2DPPB 2YLBA 1VQ8T 3BY7A 3JCMh 3HSBA 1O9SA 4EMKC 2LVMA 3A5ZB 3V7RA 5A2QE 3R6OA 1QVGS 3KXTA 3C94A 1JJ2S 3CPFA 4XTXA 4RG2A 2P0KA 3V8JA 4B9WA 3CCMA 4RCBA 4XU0A 5HKCA 3OYFA 1NPRA 4C5EA 1H3ZA 4M78C 1Y96A 4OF1A 2L89A 3HRSA 3CPWA 3NFCA 2QQAA 3RKWA 4JJNK 1FXXA 4ELYC 3RERA 4JRPA 3FIFA 4BACA 1UGQB 4C92G 2LCCA 2WSCE 2E6ZA 2VXFA 1X01A 1Q82C 1NJIU 3NTHA 5KE3A 1YJNT 3CCVT 3JB9I 1QVPA 4E7IA 2QQRA 5GAOp 2LX9A 3JCMW 1S72A 3OBWA 4TVRA 1VUBA 2RJCA 2EQMA 5GMKj 5GAN4 4J6XA 5LL6S 1G3TA 2F5KA 2QTXA 2X4WA 3M53A 5IN1A 1VQOT 5GAMj 4C8QG 3CBPA 1JB0E 3CBMA 5LJ3e 5LJ5j 2RK1A 2LQKA 5D6WA 4M75A 4M77E 5GAN7 4FT4A 2VXEA 1P92A 1MHNA 4UC4A 1WJSA 5CCAA 1W2BS 4PJOD 4PNOA 3X24B 2LRQA 3WXMB 4NS5A 4A4FA 3OS1A 5FU7C 3CCMT 2X4JA 1KQ2A 4R55A 1IZ6A 5CR2A 3PIPA 1OYXA 2RO0A 3FRNA 3EAEA 3S3OA 4RCCA 1BIBA 1VQPA 4J6WA 5KCOA 2YLCA 1KD1C 4R56A 3F70A 1G3WA 1W4SA 2RHYA 4EMKA 3OYNA 5LJ3g 1YJWA 3J80E 2D0QB 4M77B 4F7UF 2RM4A 3JCMV 4F7UA 3OYDA 1S72T 2RI5A 4O5VA 3G6ET 1WJQA 3JB9J 4ATOA 1OZ3A 3JCMb 1QVFS 2V8KA 1NE8A 3C95A 3CC4A 4DOWA 4M78F 4M78A 3M55A 3CCRA 3E1SA 1UB4A 1Q86C 2L3RA 4ZTFA 4N4IA 2EAYA 3OYYA 3A8OB 3SWNB 2PUKB 5GAN3 3I55A 1KC8U 4LDYA 2PUOB 1B34B 2K5FA 4IKFA 4C5IA 1VQ5A 4XTUA 5HY6A 4A4EA 2JTMA 4C0DB 3X20B 3JB9F 5DM7R 1BIAA 1BI3A 2RHXA 1PSEA 2ZPBB 4M7DG 1Y07A 1JJ2A 3LW5E 4D6WA 4EDUA 3JAME 5A0DA 3G71A 1BKBA 3QDRB 1K8AC 2DZ9A 1ZQ1A 5HK0A 4C92F 1VQPT 3A8MB 2V8JA 2PQWA 3CBOA 1YIJA 3L2RA 2X4XA 2EKOA 2HQEA 5CKBA 4NL3A 3OYHA 1YJWT 2ZPFB 4OGEA 2DD5A 5EG2A 2RJEA 4X9DA 2ZPIB 4A54A 3RKXA 2M9UA 3DLMA 4EPCA 1U8RA 1ZHIA 3RESA 2HQXA 3P8DA 1HK9A 3BDUA 4RG8A 4M7DC 1WQWA 3A8LB 3OYJA 1I81A 5CKFA 4NL2A 4ZGDB 3CC4T 4DQ2A 5GAOr 4MZMA 3CCRT 3X25B 2XICA 3Q1JA 4Z02A 4M75G 3CEYA 1UEBA 4C8QF 1JBMA 2QQBA 4FT2A 4L5GA 2MMPA 3RIRA 3I55T 3QZ9B 1KQSS 1NZ9A 5I2MA 3J7AF 5CKHA 1VQLA 1RL2A 4QVZA 4J7FA 1Q7YC 3OBYA 3OMGA 1VQ5T 1G3SA 4KBMB 2DXCA 1O75A 3C4SA 2WSFE 5FU6C 3A8GB 4BI3A 5I2SA 2XG8D 3DB3A 4M77C 3VJPA 3V7SA 2XKOC 1Q82U 3OQ5A 3OY9A 1W2BA 3G71T 4L6V5 2DEQA 5CQXA 5CKDA 4JRIA 2KSSA 3I56A 2P4TA 3G4ST 4Y28E 4PL6A 1JRIA 1YIJT 3GLXA 5IT9E 3JB9H 4KT0E 1YCYA 4EMHA 2EJFA 2HAXA 1YHQA 4M78G 4C8QE 3SWNC 3M57A 2DXUA 1YITA 1WJRA 3PT9A 1N27A 4GLKA 2KQWA 3DB4A 3RKYA 3CC7T 4LD9K 1R8OB 3OS5A 1G3YA 5KE2A 3OS2A 1PSFA 2PVGB 3JSCA 4PKCC 4C0DC 4HT9A 3V8KA 5GMKe 4XQ3A 1VQ4T 3V7CA 2EYQA 2P0PA 1WPYA 4FM4B 5CQYA 3JB9G 2CYZB 2QDYB 5GAMe 3OYEA 3E9FA 5LJ5e 4IUUA 3CXCS 1VQLT 2RA2A 5CIUA 5CAIA 1I5LA 5J3BA 4BE1A 2I2LA 3PMIA 4C8QB 2X4YA 1BI2A 3P8HA 4J7IA 3TREA 5C6SA 4M7AE 2LC4A 1KD1U 2VC8A 4XK8E 4M7DA 2RI2A 3URGA 4M7DF 3VV0A 2R57A 2K57A 4XTYA 1KQ1A 2WACA 3HFNA 1LOJA 4MZPA 5LJ3h 4C0FA 2ZCFB 3ASKA 3QIIA 3I56T 3G6EA 3CC2A 4PLIA 2KVQG 4LDWA 1NPPA 2OTLA 4IUVA 4OVAA 1H641 2A7YA 5GAN6 3GIBA 4PJOC 4ZN3A 1YHQT 5GAMg 3QBYA 1Q86U 2M16A 5LJ5g 2B8AA 3JRZA 4E7JA 1YITT 2EIFA 5GAOl 1VQ9A 2MI6A 3L2WA 4M7AB 1WNLA 1Y7XA 2EWNA 1QW1A 4M77A 3H6ZA 3OYCA 5GANe 3CCLA 1VIEA 4E7LA 4IUQA 4M75F 4QVDA 2YHTA 1OI1A 1N8RC 1VIFA 2F69A 1I8FA 4A53A 3UPUA 2DZCA 3VYHB 3QUIA 2FYKA 3LWHA 3HL8A 4RMOA 3JCMP 3OYKA 3LH0A 2E6NA 2XHCA 3MCAB 2EJ9A 5GAOn 4P5NA 3L2UA 4MDXA 3SWNA 2QQ9A 3CCQA 2XDDA 2HBPA 4BY6B 1K8AU 3M58A 2CZ6B 3OYBA 1B34A 2WSEE 3TCJA 1X6OA 5IAYA 2QQSA 3M5AA 1Y96B 1UGSB 1M90C 3HRTA 5GANg 3J81E 2M0OA 4OGCA 2O01E 2JVVA 2XU8A 2Y90A 3HP9A 4J5YA 3M4YA 5C0MA 2DTIA 4N4GA 3OYLA 1Y71A 5GANj 2OTLT 3CC2T 1HXDA 4MMLA 4OB2B 4FL6A 3CMAA 1LJOA 3CCJA 4PJOA 3OYAA 4X34A 2E41A 5KH6A 4C92D 1SSFA 3L2ZA 3SB2A 4ME7A 1VQ9T 1OZ2A 4NOYA 3AHUA 2RHUA 4OB0B 3CCLT 4O6JA 4LDXA 3C12A 2PVOB 3OMCA 4ZN1A 5GAOm 5GAN2 2DTHA 2RHZA 1M1GA 2VUBA 4QVCA 2RI3A 2D6FA 1BYMA 2CKKA 3M9QA 3CD6T 2RD1A 2FL7A 4PJOF 5FLXE 4B9XA 4F7UE 5GAN5 1QVGA 2QI2A 1QP2A 2EQJA 3CCQT 4XTVA 4C8QD 2E12A 3G4SA 4JLGA 4M78E 2GFAA 2K4YA 3GF5A 4MDWA 3CPWS 2K3XA 4OB3B 4IURA 3S3NA 3CXCA 5FRNA 2Y4YA 4N0AC 5FROA 3JCMc 4IUTA 3LYIA 3ME9A 3META 4BI8B 2DO3A 1Q81U 4XU1A 2GF7A 1BI1A 2E5QA 3QJ6A 4BDZA 3CC7A 2LT4A 4BE2A 3X26B 4VUBA 3GP8A 3CMAT 3DKMA 4M77G 3CCJT 2DIGA 4F7UB 1YI2A 3V8LA 5HK3A 1VQ4A 3GNFB 3SD4A 3S6WA 5J39A 1LNXA 2VGMA 2ZZDA 3INZA 3KBGA 3QYGB 3QZ5B 5I21A 4M7AD 3M54A 4M78B 4XU2A 1VQ7A 3HRUA 4MZTA 2JZ2A 2VV5A 2EJGA 3L1AA 4C92E 3ZEHA 1IREB 3PMTA 2F5TX 5LJ3f 3LLRA 2R5MA 2XDPA 2JOYA 4HA8A 1VQNA 2RK2A 1FWZA 3M4GA 2FVUA 2E10A 4HT8A 2RH2A 3L42A 5A0LA 2RHIA 1N6AA 3M59A 3VKIA 3MHXA 3HPWA 5FRMA 1V29B 2K5LA 2DTOA 3MEVA 5GMKh 4KUDK 3ER0A 2E64A 2KY9A 1WQ7A 3WVDB 2MF2A 5LJ3d 2H3JA 2GFUA 3MEUA 1VQMA 5CO7A 4ZGJB 5GAMh 3SDZA 2P0QA 3RUXA 5LJ5h 2VGNA 4C92B 3T9NA 4BI4A 3OW2S 1M1KC 1M8VA 4A4KA 4GY5A 3P8BB 3QG1A 2JNGA 3PIOA 3RMSA 3QPHA 5D6YA 3DLLA 4II1A 4LDVA 2LQ8A 1YI2T 1N8RU 3VYGA 4QQGA 2OTJA 2DXTA 3E19A 3CMEA 1QVFA 1BI0A 1UGPB 4OMFB 5FU7B 4CI0C 1VQ7T 4KUIA 4PLLA 4N0AA 4L59A 3VUBA 1M4ZA 4N4HA 4PJOG 4JS4A 4WF2A 2AHJB 3MP8A 2JTFA 5GMKi 3CCEA 1YBYA 5GMKl 2E70A 2CS7A 4QQDA 3WVEB 1VQNT 2K2VA 3ZBDA 5DLQE 4JDSA 4M75D 2QA4A 1M90U 1U1SA 5GANh 5GAN8 4LD6A 1K73C 2O4XB 4M7AG 4OP0A 2EFIA 1U1TA 2OAUA 2L5QA 1D3BB 2YRVA 5D6XA 4HCZA 1VQMT 2GQVA 4EMGA 4FSXA 3ZFJA 3MP6A 4FU6A 2R5AA 1EIFA 4OB1B 1WGSA 4M77F 2ZPHB 2EQUA 4BB7A 2E1HA 1VQKA 2CZ7B 3JCMe 2OTJT 2CZ0B 2DXBA 3QHSA 3NTKA 4M7DE 4E7KA 2XD0A 2QEXT 1K9MC 3CMET 1N9RA 3PTAA 2GCXA 4M78D 3JCMX 3L2QA 3CD6A 1M5Q1 2QXFA 2XDBA 3CCST 2BKDN 2DVEA 4J83A 3BDLA 3UT1A 1G5VA 4JLIA 3QSUA 1YJ9A 3JCMJ 3CCET 2LTOA 2DAQA 3FLGA 3PNWC 2EQKA 3EFSA 4MMKA 1KQSA 4A4GA 3G7ZA 2CGHA 3CCUT 2QA4T 2KMTA 2XI9A 4C92C 4XAXB 3JCMg 2LT1A 2MWPA 2A3LA 5GMKm 2V8IA 3FEOA 3TU4K 3JB9D 1TH7A 2BIVA 3UWNA 4C0GA 3BW1A 3JCMQ 4M7DB 3H8ZA 4J6YA 4M75E 4HKEA 1ZBXA 5CK9A 4QQ6A 3EFRA 3QO3A 4BUGA 5M9OA 4V2SA 1UGRB 2ZPEB 3MP1A 4FIBA 2ZPGB 1XOVA 3FB9A 1GXIE 1RI0A 4Q5WA 1KG1A 3QXEB 2KK4A 3HKSA 5CKEA 3PGGA 1VQ6A 2FHDA 3HHTB 1VQKT 4C8QC 1DJ7B 2D9TA 4YTLA 5DLOA 3A8HB 4BDYA 3QYHB 1Q7YU 3M56A 3OW2A 2M1HA 4XTWA 4BD3A 5GAOq 5FU6B 4RKUE 1KHCA 2CZ1B 4C0ZA 4E7HA 1NJIC 2Y4XA 3S3MA 1XNIA 2KDSA 2RJFA 2X35A 3FDRA 4M75B 5LJ3j 3MEAA 2IVWA 2K3YA 1I4K1 1M9SA 2G3RA 3TEEA 1YJ9T 1M1FA 5GAMf 2E65A 5LJ5f 3E9GA 4E47A 2DJZA 4M7AC 3OSSC 2VYTA 4ZTJA 2LCLA 2KAFA 3OYIA 1M1KU 3O8VA 3X28B 4EMKB 2MAMA 4C5GA 1KHIA 3GPLA 1XQHA 2R58A 5GAMd 4C5HA 5LJ5d 4JUVA 4XU3A 2DK3A 2MWOA 4JRKA 2HNIA 1FX7A 2L8DA 4QW2A 4PJOE 3UDCA 1VQ6T 5DY9A 4BY6C 4C92A 4HCCA 2C06A 5KCHA 4DA4A 3LX7A 2NLUA 2DKGA 3QJYA 4ELZC 3OA6A 5GANf 1XTDA 4KULA 2ZGWA 3JCMf 2RB6A 4JS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZTF A;  1OI1 A;  4L59 A;  4N4I A;  4N4H A;  3MP8 A;  3L2V A;  2JTF A;  3OS0 A;  3OYK A;  3LH0 A;  2E6N A;  4QQD A;  2RJD A;  2XK0 A;  3GOX A;  4IKF A;  4C5I A;  4BE0 A;  3OYG A;  3QKJ A;  3L2U A;  5J26 A;  4A4E A;  4LD6 A;  3OYB A;  2O4X B;  2RHX A;  3LGF A;  4IUP A;  2IG0 A;  2EFI A;  4A4H A;  2QQS A;  5IAY A;  4CRI A;  2YRV A;  5D6X A;  4HCZ A;  4EDU A;  2M0O A;  2O4X A;  3PFS A;  5C0M A;  2PQW A;  3MP6 A;  4FU6 A;  4N4G A;  2X4X A;  3OYL A;  2EKO A;  2R5A A;  2HQE A;  3OYM A;  1WGS A;  3OYH A;  3L2R A;  2BUD A;  4FL6 A;  2EQU A;  3MO8 A;  2RJE A;  3MEW A;  3OYA A;  2LDM A;  3DLM A;  4X34 A;  3OB9 A;  5KH6 A;  2HQX A;  3NTK A;  3P8D A;  1SSF A;  4E7K A;  3FC3 A;  2DIQ A;  1OZ2 A;  3KUF A;  3OYJ A;  2RHU A;  3L2Q A;  3NTI A;  3Q1J A;  3LGL A;  4Z02 A;  3OMC A;  2BKD N;  3CEY A;  3BDL A;  3UT1 A;  2RHZ A;  1G5V A;  2LVM A;  2RI3 A;  2LTO A;  2CKK A;  2DAQ A;  3M9Q A;  3FLG A;  3PNW C;  2EQK A;  4QVZ A;  4A4G A;  4B9X A;  3OMG A;  2EQJ A;  4RG2 A;  2P0K A;  2MWP A;  3C4S A;  4B9W A;  3FEO A;  3OYF A;  2GFA A;  4C5E A;  2BIV A;  3UWN A;  3DB3 A;  1H3Z A;  2L89 A;  2K3X A;  3H8Z A;  4IUR A;  3S3N A;  5FRN A;  5M9O A;  3OQ5 A;  4QQ6 A;  3OY9 A;  5FRO A;  3MP1 A;  3LYI A;  4IUT A;  4BAC A;  3ME9 A;  3MET A;  2GF7 A;  2LCC A;  2E5Q A;  1RI0 A;  3QJ6 A;  4PL6 A;  4Q5W A;  4BDZ A;  4BE2 A;  3NTH A;  5KE3 A;  2FHD A;  2DIG A;  4E7I A;  2QQR A;  2D9T A;  4BDY A;  3SD4 A;  1WJR A;  3S6W A;  5J39 A;  1N27 A;  2M1H A;  2RJC A;  3DB4 A;  4BD3 A;  4E7H A;  2EQM A;  1KHC A;  5KE2 A;  3OS2 A;  3S3M A;  1XNI A;  2RJF A;  3FDR A;  2F5K A;  2X35 A;  2JZ2 A;  3MEA A;  2X4W A;  2K3Y A;  5IN1 A;  3ZEH A;  3PMT A;  2G3R A;  3LLR A;  2R5M A;  2XDP A;  5D6W A;  3OYE A;  3E9F A;  3E9G A;  4IUU A;  1MHN A;  4UC4 A;  1WJS A;  5CIU A;  3L42 A;  3PMI A;  4BE1 A;  2RHI A;  2LRQ A;  2X4Y A;  3P8H A;  4NS5 A;  4A4F A;  5C6S A;  3OS1 A;  2VYT A;  5FRM A;  4ZTJ A;  3MEV A;  2RI2 A;  3OYI A;  2R57 A;  1OYX A;  2RO0 A;  3O8V A;  2WAC A;  2GFU A;  3EAE A;  3MEU A;  4C5G A;  3S3O A;  2R58 A;  3ASK A;  4C5H A;  5KCO A;  3QII A;  4PLI A;  3F70 A;  2RHY A;  2MWO A;  4GY5 A;  4IUV A;  4OVA A;  3OYN A;  2L8D A;  4QW2 A;  3QBY A;  5D6Y A;  3OYD A;  2M16 A;  4II1 A;  2RI5 A;  2B8A A;  5KCH A;  4QQG A;  1WJQ A;  4E7J A;  1OZ3 A;  3LX7 A;  2NLU A;  3L2W A;  3OA6 A;  3H6Z A;  3OYC A;  4E7L A;  4PLL A;  4IUQ A;  2L3R A; 
#chains in the Genus database with same CATH topology
 2HQH A;  2HD0 A;  4JJC A;  3OS0 A;  4J9D A;  4J9B A;  1T0J A;  2NUZ A;  2RJD A;  1WHJ A;  2OTJ Q;  2QAZ A;  3LGF A;  2QDL A;  1BU1 A;  5AYF A;  4Y91 A;  3UA7 A;  4CRI A;  1WIE A;  4HCK A;  2KRN A;  3E2U A;  2GBQ A;  1D3B A;  2HSE B;  1K9M U;  3MEW A;  1IHV A;  3CCU Q;  4F7U G;  3CCS A;  3OSV A;  4LUE A;  1SF9 A;  1UDL A;  4M77 D;  5A0G A;  3NTI A;  1YCS B;  4OMP A;  3HSB A;  1O9S A;  2LVM A;  1IO6 A;  3A5Z B;  2DA9 A;  2K79 A;  1QVG S;  2CP5 A;  1JJ2 S;  3EGX A;  4RG2 A;  1RAE B;  4B9W A;  1NPR A;  4PK4 A;  1K73 R;  2X3W D;  1U3O A;  3EG2 A;  3HRS A;  5IHI A;  2QQA A;  3QDF A;  3RER A;  2J6K A;  4ELY C;  4JRP A;  3FIF A;  1UGQ B;  2KRS A;  3NTH A;  3CCV T;  1LCK A;  3OBW A;  4F16 A;  2EGE A;  4J6X A;  2LJ0 A;  3FJ5 A;  1WZO A;  4FYV B;  1SEM A;  2X4W A;  3M53 A;  5IN1 A;  1VQO T;  3RR6 A;  1K4U S;  5LJ3 e;  3CBM A;  1J3T A;  2RK1 A;  3VS6 A;  1OPK A;  1W2B S;  2LRQ A;  3OS1 A;  3PE0 A;  1M90 R;  3R6N A;  1IZ6 A;  3PIP A;  1OYX A;  3VS5 A;  4J9C A;  3S3O A;  1TWB A;  4RCC A;  1VQP A;  1KD1 C;  3CC4 Q;  1G3W A;  3OYN A;  2JT4 A;  1KSW A;  2RM4 A;  4WCI A;  3OYD A;  4ESR A;  2RI5 A;  1S72 T;  3G6E T;  3JB9 J;  3JCM b;  1PWT A;  2EYW A;  2F2W A;  2L3R A;  2EAY A;  1ZUY A;  1UUE A;  4AFQ C;  1KC8 U;  4LDY A;  1ZSZ B;  4C5I A;  1VQ5 A;  1RAF B;  1X69 A;  2JTM A;  1BIA A;  2RHX A;  1PSE A;  2YT6 A;  2F2V A;  4EDU A;  3KFV A;  3G71 A;  3VS2 A;  2DE0 X;  2X4X A;  3OYH A;  1WHM A;  2KI7 A;  2DD5 A;  1KK7 A;  5EG2 A;  1U8R A;  3RES A;  2HQX A;  1HK9 A;  3A8L B;  5GAO r;  3X25 B;  1VQL Q;  1UEB A;  4C8Q F;  1RAC B;  2QQB A;  4FT2 A;  2EYX A;  1VYU A;  2ABL A;  3QZ9 B;  1KQS S;  2JM9 A;  2D1X A;  1RL2 A;  1M27 C;  3I56 Q;  2WSF E;  5I2S A;  3EG1 A;  3V7S A;  3VRZ A;  3OQ5 A;  3OY9 A;  2KE9 A;  2DEQ A;  2P4T A;  3M0Q A;  1YIJ T;  4ANJ A;  2KBT A;  4LUD A;  2JM8 A;  3M57 A;  1WJR A;  3PT9 A;  4LD9 K;  1G3Y A;  1PSF A;  2PVG B;  4C0D C;  4PKC C;  4XQ3 A;  3V7C A;  5CQY A;  3EH2 A;  5GJW B;  4IUU A;  5LJ5 e;  5CAI A;  5J3B A;  3PMI A;  3TRE A;  2DMO A;  2LC4 A;  4XK8 E;  4M7D F;  3VV0 A;  4XTY A;  2WAC A;  4MZP A;  5LJ3 h;  4C0F A;  3CC2 A;  1E7O A;  2KVQ G;  4IUV A;  2YUO A;  4PJO C;  1Q82 R;  5GAM g;  5GAO l;  1AWO A;  3L2W A;  1Y7X A;  4M77 A;  3H6Z A;  1T3L A;  4M75 F;  3UA6 A;  1U06 A;  2DZC A;  2FYK A;  3HL8 A;  4RMO A;  5KYW B;  3OYK A;  2XHC A;  3MCA B;  2EJ9 A;  4A63 B;  2QQ9 A;  3EGX B;  2HBP A;  4BY6 B;  1K8A U;  2CZ6 B;  1B34 A;  2L2P A;  1M90 C;  2XU8 A;  2Y90 A;  4J5Y A;  2DTI A;  2X3X D;  4N4G A;  1Y71 A;  4IIM A;  3CMA A;  4FL6 A;  1D09 B;  3CXC P;  4X34 A;  2E41 A;  2V26 A;  2FZK B;  1IHW A;  4PFZ A;  1BCM A;  1PM3 A;  3G71 Q;  5GAN 2;  8AT1 B;  2RI3 A;  4KGZ B;  2HEQ A;  1N5Z A;  1QP2 A;  4XTV A;  3CC7 Q;  4OB3 B;  2Y4Y A;  1YI2 Q;  1PC0 A;  4BI8 B;  1CSK A;  1OOT A;  2MIO A;  1QCN A;  2DIG A;  3V8L A;  5HK3 A;  2IIM A;  3S6W A;  2VGM A;  3UF4 A;  4XU2 A;  1VQ7 A;  1YN8 A;  2QG9 B;  2JZ2 A;  2EJG A;  3ZEH A;  2F5T X;  3LLR A;  2JOY A;  2RK2 A;  5A0L A;  1RLP C;  4PJJ A;  3MHX A;  2HDA A;  2DTO A;  4KGV B;  3WVD B;  2H3J A;  3MEU A;  1VQM A;  5CO7 A;  3HTR A;  5LJ5 h;  3T9N A;  2ECZ A;  3CME Q;  3OW2 S;  4A4K A;  4GY5 A;  5IHK A;  4Y92 A;  3PIO A;  4AMC A;  3E19 A;  5FU7 B;  3LH5 A;  4E7S A;  1EZZ B;  4N0A A;  1M4Z A;  2DFU A;  4PJO G;  4WF2 A;  3MP8 A;  2FRY A;  2CS7 A;  1VQN T;  2OJ2 A;  3WVE B;  4E7Z A;  4QT7 A;  5DLQ E;  1D1C A;  3VS7 A;  3GBQ A;  1U1S A;  2DYB A;  2FZC B;  4LD6 A;  2EYY A;  1VOM A;  1VQK Q;  6AT1 B;  1OEB A;  1RI9 A;  1QWE A;  4FU6 A;  1EIF A;  1ZSG A;  1ZUK A;  3JCM e;  2CZ0 B;  3QHS A;  3NTK A;  4M7D E;  4E7K A;  2XD0 A;  1JO8 A;  2CT4 A;  3RBB B;  2GCX A;  1MMG A;  3L2Q A;  1M5Q 1;  4LN2 A;  3CCS T;  2BKD N;  1TUG B;  3QSU A;  3CCE T;  4DBR A;  1NYF A;  2YXY A;  2DL3 A;  2V8I A;  1TH7 A;  4C0G A;  4M75 E;  5CK9 A;  4QQ6 A;  1UGR B;  1W1F A;  3MP1 A;  4FIB A;  1XOV A;  1GXI E;  3NPF A;  1RI0 A;  1WXU A;  2CP6 A;  2EQI A;  3PGG A;  1VQ6 A;  3HHT B;  4C8Q C;  1DJ7 B;  4YTL A;  4XTW A;  3H0F A;  2CZ1 B;  1NJI C;  3I5S A;  5LJ3 j;  2ROT A;  1BCO A;  5GAM f;  2DL7 A;  4M7A C;  2EPD A;  1M1K U;  4AT1 B;  3X28 B;  4EMK B;  1KHI A;  1X43 A;  3EFO A;  2X51 A;  4Z8A A;  2ROL A;  4JUV A;  4XU3 A;  3VS0 A;  2AZV A;  4JRK A;  1FX7 A;  5DY9 A;  1PRM C;  1PNJ A;  2CUB A;  4DA4 A;  2KXD A;  2NLU A;  2ZGW A;  5GMK i;  4JS5 A;  1AD5 A;  2FB7 A;  1VQM Q;  1Q7Y R;  1FMV A;  4ZGE B;  2PU9 B;  2XK0 A;  4LDU A;  1Z9Z A;  1Z9Q A;  5GAN d;  8ATC B;  2JUF A;  4IUP A;  1AWX A;  4A4H A;  2D8J A;  4FYX B;  3LWI A;  5I11 A;  1X75 C;  3PFS A;  3RMQ A;  4JRQ A;  4HVU A;  1SRM A;  1G2B A;  1M2O A;  4DOV A;  3OYM A;  4M75 C;  2BUD A;  3CPW P;  3MO8 A;  1YJN A;  2LCS A;  3KUF A;  2OX7 A;  1AHJ B;  2XMF A;  3CCU A;  4X9C A;  1GCQ C;  3N5B B;  2YLB A;  1VQ8 T;  3JCM h;  3V7R A;  1ABQ A;  4XTX A;  3CCM A;  1ABO A;  4M78 C;  1Y96 A;  4DBF A;  3RKW A;  4PFP A;  2CH4 W;  1S72 Q;  2O9V A;  2HBW A;  2QK0 A;  1X01 A;  2H8H A;  1TXQ A;  4OML A;  4E7I A;  5GAO p;  2E3I A;  1VUB A;  1N8R R;  2RJC A;  1TSF A;  2QGG A;  2GTO A;  4C8Q G;  1RUW A;  3CBP A;  5LJ5 j;  2L3S A;  4D8D A;  1P92 A;  1WJS A;  4PJO D;  4A4F A;  2X4J A;  1IB8 A;  3A98 A;  3VS4 A;  5CR2 A;  2RO0 A;  3C0C A;  4R0K A;  3EAE A;  4J6W A;  1AOJ A;  5KCO A;  1W4S A;  1YJW A;  2EGA A;  2D0Q B;  1JJ2 P;  4D8K A;  2KEA A;  2V8K A;  3CC4 A;  1UTI A;  2NWM A;  4DOW A;  2OAW A;  4ZTF A;  4N4I A;  5EC7 A;  3SWN B;  5GAN 3;  4KGX B;  2AIR B;  1X6G A;  1D0Y A;  2K5F A;  4IKF A;  4OMM A;  5HY6 A;  1QKX A;  2O9S A;  1WDX A;  2HL5 C;  1YIJ Q;  2EVR A;  4M7D G;  4D6W A;  3JAM E;  5A0D A;  1MMN A;  1BKB A;  2DZ9 A;  1ZQ1 A;  5HK0 A;  3A8M B;  3QWY A;  2DVJ A;  2PQW A;  2A36 A;  4F17 A;  2VVK A;  4A54 A;  1W2B P;  4EPC A;  2L0A A;  3P8D A;  3BDU A;  4RG8 A;  1WQW A;  2VB6 A;  3OYJ A;  1I81 A;  4PJM A;  4NL2 A;  5CKF A;  4CC2 A;  3CCR T;  3I5R A;  3Q1J A;  4Z02 A;  4M75 G;  1JBM A;  4L5G A;  1KFZ A;  2OI3 A;  3RIR A;  3I55 T;  1NZ9 A;  3MJX A;  3J7A F;  1VQL A;  2CT3 A;  1Q7Y C;  3OMG A;  1YJN Q;  3C4S A;  3A8G B;  1H8K A;  1W6X A;  2ATC B;  5CKD A;  4JRI A;  2KSS A;  3I56 A;  1GBQ A;  4Y28 E;  3JB9 H;  4EMH A;  2HAX A;  4M78 G;  2DXU A;  1LVK A;  3CCM Q;  1K9A A;  3OS5 A;  2FZG B;  5KE2 A;  4DEY A;  2VAS A;  5GMK e;  2CSQ A;  4DEX A;  2P0P A;  1WPY A;  2MOX A;  4FM4 B;  3JB9 G;  1I1J A;  2DM1 A;  2MCN A;  2ZAE A;  5C6S A;  1X6B A;  1KD1 U;  2VC8 A;  1WXT A;  2C0O A;  1KQ1 A;  4DBH A;  1TUC A;  2KYB A;  3PVQ A;  4LDW A;  2OTL A;  1NYG A;  2A7Y A;  3GIB A;  1YHQ T;  2KRO A;  3QBY A;  4RTW A;  2M16 A;  1YIT T;  1VQ9 A;  1WA7 A;  2EBP A;  5GAN e;  1N8R C;  4A53 A;  1I8F A;  1PCX A;  1E6G A;  3LH0 A;  1YJW Q;  2BZ8 A;  4P5N A;  2DLP A;  1ZA1 B;  2DRK A;  2FO0 A;  3TCJ A;  4IIO A;  1Y96 B;  2JS2 A;  2YRC A;  4OGC A;  2M02 A;  2O01 E;  3NHN A;  2QAS A;  5C0M A;  2E5K A;  1G8X A;  2AT1 B;  3OYL A;  3EG3 A;  4OB2 B;  3A1P A;  1LJO A;  2C0T A;  3CCJ A;  1R0C B;  3L2Z A;  1SG5 A;  3AHU A;  1AT1 B;  2RHU A;  5KYU A;  3CCL T;  4LDX A;  1ZUU A;  2PVO B;  5GAO m;  2RHZ A;  3G4S Q;  1VA7 A;  2QYZ A;  3M9Q A;  3TVT A;  4PJO A;  3CCQ T;  4C8Q D;  4QKU A;  2K4Y A;  3GF5 A;  4MDW A;  3CXC A;  2G6F X;  1VQ4 Q;  2D8H A;  1Q81 U;  2DO3 A;  1WFW A;  1BI1 A;  3CC7 A;  2LT4 A;  4BE2 A;  3X26 B;  4VUB A;  9ATC B;  1YI2 A;  3SD4 A;  5I21 A;  3QYG B;  2ZZD A;  3INZ A;  3QZ5 B;  1VQN Q;  4M7A D;  2DNU A;  3HRU A;  4MZT A;  2VV5 A;  3H0I A;  1IRE B;  3PMT A;  1QVF P;  2R5M A;  4AFU C;  4HT8 A;  3L42 A;  1N6A A;  3M59 A;  4Z88 A;  3HPW A;  5FRM A;  2K5L A;  5GMK h;  2BE7 D;  1WQ7 A;  2IPO B;  2MF2 A;  1M3B A;  4ZGJ B;  2AK5 A;  4KH1 B;  4C92 B;  1AVZ C;  1M8V A;  1RAD B;  1ACM B;  3QPH A;  4PJL A;  4II1 A;  5D6Y A;  2LQ8 A;  3VYG A;  5KYY A;  1V1C A;  3CME A;  3CCE Q;  1BI0 A;  1UGP B;  4OMF B;  1I5O B;  4CI0 C;  4KUI A;  1PD1 A;  1WHH A;  1M3A A;  4RTY A;  3I9Q A;  4N4H A;  2JTF A;  1YBY A;  2OTL Q;  4JPB W;  4JDS A;  4M75 D;  2QA4 A;  1M90 U;  4JZ3 A;  5GAN h;  1K73 C;  1VQ9 Q;  4OP0 A;  2OAU A;  2L5Q A;  1D3B B;  4HCZ A;  2KGT A;  2GQV A;  4EMG A;  2LQW A;  1OX8 A;  3ZFJ A;  1WGS A;  3CD6 Q;  1GBR A;  2ZPH B;  1PKT A;  2EQU A;  2E1H A;  1VQK A;  2ESW A;  2D0N A;  1I0C A;  2OTJ T;  1MMA A;  3G1J A;  3JCM X;  4M78 D;  1HYO A;  2DVE A;  3OW2 P;  1EFN A;  1YJ9 A;  2DAQ A;  3PNW C;  2DX1 A;  2FPF A;  4MMK A;  3G7Z A;  3CCU T;  3CCJ Q;  3TU4 K;  3JB9 D;  4CC4 B;  1TOV A;  3H8Z A;  2DET A;  4HKE A;  1PKS A;  2ZPE B;  2ZPG B;  3FB9 A;  4J9G A;  4AFZ C;  1UHF A;  1KG1 A;  5CKE A;  1D1A A;  2L3Q A;  1UJ0 A;  4FCY A;  4BDY A;  1Q86 R;  3QYH B;  3MKD A;  1QQJ A;  2M1H A;  5GAO q;  4BD3 A;  4E7H A;  3H0H A;  4RKU E;  4AG1 C;  1W70 A;  2RJF A;  2AKL A;  1OUL A;  2B86 A;  2EGC A;  2G3R A;  2GGR A;  1M1F A;  3E9G A;  1PG5 B;  3OSS C;  2SEM A;  5FW9 A;  4C5G A;  2O88 A;  3GPL A;  5GAM d;  4J9E A;  2SRC A;  2MK5 A;  3RDV A;  2MWO A;  2HNI A;  3JV3 A;  1RAA B;  2KXC A;  3LX7 A;  1ZX6 A;  3QJY A;  4ELZ C;  1XTD A;  3JCM f;  2LQK A;  5KYU B;  1HSQ A;  3L2V A;  5CVI A;  2RNA A;  2VWF A;  4JJB A;  4BE0 A;  3OYG A;  3QKJ A;  1MGQ A;  4C8Q A;  4PJO B;  3SFM A;  1YP5 A;  1VYT A;  1OV3 A;  2W0Z A;  3HFO A;  2PVD B;  2QEX Q;  2LNV A;  1G83 A;  2O4X A;  2YRD A;  4J8O A;  1QP3 A;  4XTZ A;  3CCV A;  2EYZ A;  2QA4 Q;  2LDM A;  1RAG B;  4M7A A;  3FC3 A;  2DIQ A;  4GBQ A;  2DD4 A;  3VU3 C;  3LGL A;  1VQO A;  5L8R E;  4EMK C;  3EGD A;  1K1Z A;  5A2Q E;  2MPX C;  3R6O A;  3KXT A;  2O2O A;  2YSQ A;  2P0K A;  4RCB A;  4XU0 A;  5HKC A;  1YWP A;  4C5E A;  1H3Z A;  2L89 A;  1SSH A;  3CPW A;  3NFC A;  2FRW A;  2LCC A;  2WSC E;  3REA B;  2KT8 A;  1YJ9 Q;  1Q82 C;  1NJI U;  5KE3 A;  1ZBJ A;  3JB9 I;  1S72 A;  3JCM W;  4TVR A;  2EW3 A;  5KYY B;  2EQM A;  5GMK j;  1K0X A;  3VS3 A;  2QTX A;  5KYN A;  1JB0 E;  4M75 A;  4WTO B;  5GAN 7;  2A37 A;  4UC4 A;  5CCA A;  1Y0M A;  4NS5 A;  2COW A;  1FMW A;  4R55 A;  2EKH A;  2RQV A;  3FRN A;  4F14 A;  1BIB A;  1GCQ A;  1UHC A;  1S1N A;  3F70 A;  2HMA A;  1MNE A;  5LJ3 g;  2RQT A;  3J80 E;  4B6M A;  4M77 B;  4F7U A;  3JCM V;  4O5V A;  2FPE A;  3I55 Q;  1NE8 A;  3C95 A;  4M78 A;  3E1S A;  1Q86 C;  2J06 A;  1PHT A;  2PUO B;  1B34 B;  1JXM A;  4A4E A;  3X20 B;  1JXO A;  1C6V X;  1T0H A;  2ZPB B;  2J05 A;  1BBZ A;  2P4R A;  1JJ2 A;  3LW5 E;  4RTT A;  4C92 F;  1VQP T;  3CBO A;  1YIJ A;  3L2R A;  2EKO A;  5CKB A;  2LQN A;  2ZPF B;  1ARK A;  2RJE A;  4X9D A;  2ZPI B;  2M9U A;  2DIL A;  3DLM A;  4M7D C;  1KQ2 A;  4RTU A;  2RPN A;  4MZM A;  2C0I A;  4F04 B;  1K76 A;  2BZY A;  2XIC A;  3QWX X;  4RTZ A;  3CEY A;  5L23 A;  2MMP A;  5I2M A;  3OBY A;  1VQ5 T;  1G3S A;  4KBM B;  3CCV Q;  2DXC A;  5FU6 C;  2XKO C;  1W2B A;  3G71 T;  4L6V 5;  5CQX A;  1VQO Q;  1JRI A;  1MND A;  3H41 A;  5IT9 E;  4KT0 E;  2EJF A;  1RLQ C;  3SWN C;  2E3H A;  2PNI A;  4E2F B;  1N27 A;  2KQW A;  4K11 A;  3CC7 T;  2V1R A;  1R8O B;  3U23 A;  4HT9 A;  2QTV A;  2FEI A;  2EYQ A;  2YDL A;  1UJY A;  2M0Y A;  2CYZ B;  2QDY B;  5GAM e;  3OYE A;  3O5Z A;  4CC3 A;  2RA2 A;  1I5L A;  2I2L A;  4C8Q B;  2X4Y A;  1BI2 A;  3P8H A;  2V1Q A;  4J7I A;  3G6E Q;  2DJQ A;  3URG A;  1OPL A;  2K57 A;  2ZCF B;  3PVL A;  4PLI A;  1NPP A;  4J9I A;  4OVA A;  1H64 1;  2H3E B;  1AWJ A;  1K9M R;  4ZN3 A;  5LJ5 g;  4E7J A;  2MI6 A;  4M7A B;  1WNL A;  2EWN A;  1QW1 A;  3OYC A;  4IUQ A;  1QKW A;  3CCQ Q;  3UPU A;  3VYH B;  3QUI A;  3LWH A;  3JCM P;  2DL4 A;  3EGD B;  4EIK A;  2J6F A;  2XDD A;  2HKQ B;  2KR3 A;  5IAY A;  2QQS A;  3M5A A;  3J81 E;  1QVG P;  1R0B G;  2JVV A;  2CH4 A;  1C1A A;  3CC2 T;  3M4Y A;  2LZ6 B;  5KH6 A;  1NM7 A;  2LNH B;  4ME7 A;  4NOY A;  4OB0 B;  1BK2 A;  2HL3 A;  4O6J A;  4HVW A;  3OMC A;  2HKN A;  2DTH A;  1M1G A;  2COY A;  2D6F A;  4QVC A;  2CKK A;  4PJO F;  5FLX E;  4B9X A;  2EQJ A;  2E12 A;  2RQU A;  3G4S A;  1NG2 A;  2GFA A;  3MPU B;  3CPW S;  4IUR A;  5FRN A;  2GTJ A;  4XU1 A;  1SHG A;  2E5Q A;  3CMA T;  3DKM A;  4F7U B;  1VQ4 A;  5J39 A;  1LNX A;  3KBG A;  4M78 B;  2NUT A;  1GFD A;  3L1A A;  4C92 E;  4FYY B;  5LJ3 f;  1VQN A;  4HA8 A;  1FWZ A;  4LNP A;  1KC8 R;  3M4G A;  2E10 A;  2RH2 A;  2YUN A;  2RHI A;  3VKI A;  3EFO B;  3MEV A;  4KUD K;  1PRL C;  2E64 A;  2GFU A;  1OX9 A;  2O31 A;  1TTH B;  5GAM h;  1IGQ A;  4BI4 A;  3M0T A;  1ZSZ C;  3P8B B;  3QG1 A;  7AT1 B;  2JNG A;  3RMS A;  3DLL A;  1N8R U;  1Q81 R;  1QVF A;  2FPD A;  2A0F B;  4FW1 A;  1VQ7 T;  4PLL A;  4L59 A;  2VKN A;  3CCE A;  5GMK l;  2K2M A;  1AZE A;  4QQD A;  2K2V A;  2GNC A;  2CP3 A;  1R77 A;  2JMA A;  1TUD A;  5KYW A;  5GAN 8;  1M30 A;  2YRV A;  1KQS P;  5D6X A;  1VQM T;  4J9F A;  4FSX A;  2BE9 B;  4OB1 B;  5IXB A;  4M77 F;  1UE9 A;  4BB7 A;  2CZ7 B;  3BE3 A;  2DXB A;  1K9M C;  1N9R A;  3PTA A;  1Y57 A;  3CD6 A;  2KRM A;  1SPK A;  2YUP A;  4J83 A;  3UT1 A;  1G5V A;  4JLI A;  3JCM J;  2LTO A;  4E6R A;  3EFS A;  1GL5 A;  4C92 C;  4XAX B;  3JCM g;  2LT1 A;  2MWP A;  2A3L A;  3FEO A;  2BIV A;  3UWN A;  3BW1 A;  4J6Y A;  1QWF A;  3M0R A;  1ZBX A;  3EFR A;  4BUG A;  4V2S A;  1TU0 B;  1SHF A;  4Q5W A;  1WX6 A;  3QXE B;  1H3H A;  2BTT A;  5FWC A;  2KNB B;  2FHD A;  5DLO A;  2JXB A;  3A8H B;  3M56 A;  3OW2 A;  3NMZ C;  2JS0 A;  1KHC A;  2Y4X A;  3S3M A;  1XNI A;  2KDS A;  1KJW A;  2X35 A;  3FDR A;  2K3Y A;  1TS9 A;  1QMC A;  1M9S A;  3TEE A;  5LJ5 f;  2JJ9 A;  1WLP B;  4E47 A;  1YNZ A;  1AWW A;  1B3Q A;  5GJV B;  4ZTJ A;  3RNJ A;  1K8A R;  3OYI A;  3O8V A;  2MAM A;  1OU9 A;  1XQH A;  4C5H A;  1E6H A;  2DK3 A;  4QW2 A;  1X2Q A;  4PJO E;  3UDC A;  1VQ6 T;  4FSS A;  4BY6 C;  4HCC A;  2C06 A;  5ECA A;  2F1L A;  2RB6 A;  2LX7 A;  3I35 A;  1VQ8 A;  2I0N A;  1LPL A;  1K73 U;  1N9S A;  3BFM A;  3GOX A;  1ZLM A;  5J26 A;  1AZG B;  3JCM d;  2DBK A;  1KC8 C;  2IG0 A;  4M7D D;  1OQK A;  2K5I A;  3GNG A;  3CCS Q;  1WHL A;  2DBM A;  4HXJ A;  2QEX A;  3FJP A;  4OMO A;  3VUZ A;  3OB9 A;  2CP7 A;  4M7A F;  2J6O A;  2JN0 A;  2XID A;  2NUT B;  1Q81 C;  2ED0 A;  4HCB A;  1SRL A;  2DPP B;  3BY7 A;  1UFF A;  1D1B A;  3C94 A;  3CPF A;  3V8J A;  3OYF A;  1YWO A;  4OF1 A;  2HZY A;  4DBQ A;  4JJN K;  1FXX A;  1OU8 A;  1T3S A;  4BAC A;  2K7A A;  2GQI A;  4C92 G;  3M0U A;  2E6Z A;  2VXF A;  1YJN T;  1QVP A;  2QQR A;  2LX9 A;  4ORZ A;  4LE9 A;  5GAN 4;  1IGU A;  5LL6 S;  3SEM A;  1G3T A;  3NGP A;  1MV0 B;  2F5K A;  4RTX A;  4RUG A;  1QLY A;  2CDT A;  5GAM j;  5D6W A;  4M77 E;  2K3B A;  4FT4 A;  2VXE A;  1MHN A;  1VQP Q;  4PNO A;  3X24 B;  3WXM B;  5FU7 C;  3CCM T;  2RQW A;  1UG1 A;  2YLC A;  1M2V A;  4R56 A;  4EMK A;  2RHY A;  2HCK A;  1A0N B;  4F7U F;  2CP2 A;  4PFO A;  1WJQ A;  4ATO A;  1OZ3 A;  2E4H A;  1QVF S;  4M78 F;  2NYS A;  3M55 A;  1MUZ A;  2Z0W A;  3CCR A;  2RMO A;  1UB4 A;  1NJI R;  1VQ5 Q;  1B7T A;  2A08 A;  1TG0 A;  3OYY A;  3A8O B;  3I55 A;  2PUK B;  2CUD A;  2K6D A;  1QCF A;  4OMQ A;  4GLM A;  4XTU A;  4C0D B;  2NUP A;  3JB9 F;  5DM7 R;  1BI3 A;  1M8M A;  4X1V A;  1Y07 A;  4KRT A;  3QDR B;  1K8A C;  2RN8 A;  2V8J A;  1VQ8 Q;  5IH2 A;  2HQE A;  4NL3 A;  2DEU A;  1YJW T;  4OGE A;  3RKX A;  1ZHI A;  1AEY A;  4ZGD B;  3CC4 T;  2JW4 A;  3EG9 A;  4DQ2 A;  5KYX A;  3H9N A;  1WI7 A;  4PJN A;  1U5S A;  5CKH A;  4QVZ A;  5D7U A;  4J7F A;  1V76 A;  1O75 A;  4BI3 A;  2XG8 D;  3DB3 A;  4M77 C;  3VJP A;  1M1K R;  1Q82 U;  2DER A;  1GRI A;  3G4S T;  4PL6 A;  2ED1 A;  3GLX A;  1YCY A;  1CKB A;  1YHQ A;  4C8Q E;  1YIT A;  2FG0 A;  4GLK A;  3DB4 A;  3RKY A;  3OS2 A;  3JSC A;  1VYV A;  1D0X A;  1I07 A;  2P84 A;  2DL8 A;  3V8K A;  1VQ4 T;  1HD3 A;  1GCP A;  1FYN A;  4FYW B;  3E9F A;  1VQL T;  3CXC S;  2KYM A;  5CIU A;  4AG2 C;  4BE1 A;  1NEB A;  4M7A E;  4JZ4 A;  3CC2 Q;  4M7D A;  4CC7 A;  2RI2 A;  1MV3 A;  5AT1 B;  2R57 A;  1SKU B;  3HFN A;  1LOJ A;  3AT1 B;  3ASK A;  3QII A;  3I56 T;  3G6E A;  1BB9 A;  5GAN 6;  1WXB A;  3TQ7 P;  1Q86 U;  2LJ3 A;  2B8A A;  3JRZ A;  2EIF A;  1UEC A;  2L3P A;  4ZNX A;  3EG0 A;  3CCL A;  1VIE A;  4E7L A;  2DYI A;  4QVD A;  2RF0 A;  2YHT A;  1OI1 A;  1VIF A;  2F69 A;  1M3C A;  2M51 A;  2E6N A;  1WHG A;  2K9G A;  4MDX A;  5GAO n;  1XJW B;  3L2U A;  3M0S A;  3SWN A;  3D7S B;  3CCQ A;  3M58 A;  3OYB A;  2WSE E;  1X6O A;  3CMA Q;  1UGS B;  3THK A;  3CCR Q;  3HRT A;  2JTE A;  5GAN g;  2M0O A;  1D0Z A;  2J7I A;  3HP9 A;  2ENM A;  5GAN j;  3SHW A;  2AKK A;  1HXD A;  4MML A;  2OTL T;  1HJD A;  1K0S A;  2DF6 A;  3OYA A;  2LJ1 A;  4C92 D;  1SSF A;  3SB2 A;  1VQ9 T;  1OZ2 A;  3C12 A;  1KIK A;  2BZX A;  4ZN1 A;  3VS1 A;  2VUB A;  1BYM A;  3CD6 T;  1PD0 A;  2RD1 A;  2FL7 A;  4F7U E;  1QVG A;  5GAN 5;  1IXD A;  2QI2 A;  4JJD A;  4J9H A;  1WHK A;  4JLG A;  4M78 E;  1JQQ A;  2K3X A;  3S3N A;  4N0A C;  4KH0 B;  5FRO A;  3JCM c;  4IUT A;  3LYI A;  2HSP A;  2RQR A;  3ME9 A;  3MET A;  2GF7 A;  1M2V B;  3QJ6 A;  4BDZ A;  2CRE A;  2QGF B;  1VQ7 Q;  4FW2 A;  3GP8 A;  4M77 G;  3CCJ T;  1FMK A;  2F2X A;  3GNF B;  2CSI A;  2PZ1 A;  3M54 A;  1WYX A;  5IXF A;  2XDP A;  2FVU A;  1YHQ Q;  1NBE B;  4Z89 A;  1YIT Q;  2NUP B;  1V29 B;  3ER0 A;  2KY9 A;  5LJ3 d;  3IQL A;  2YUQ A;  1X2K A;  3SDZ A;  2P0Q A;  1EX4 A;  3RUX A;  2VGN A;  1M1K C;  3EGU A;  1RAH B;  4LDV A;  2OTJ A;  1YI2 T;  3TSZ A;  4QQG A;  3REB B;  2DXT A;  3EG9 B;  1ZA2 B;  1QCO A;  5KYX B;  3VUB A;  3ZL7 C;  1Q95 G;  1F1B B;  2JMC A;  3VRY A;  4JS4 A;  2AHJ B;  4RTV A;  2E70 A;  2PTK A;  1CKA A;  3ZBD A;  2CP0 A;  2LP5 A;  4AFS C;  2O4X B;  2EFI A;  1U1T A;  3CCL Q;  2YWW A;  3UAT A;  3MP6 A;  3TSW A;  2R5A A;  1H92 A;  3M0P A;  1YFN A;  4LXC A;  5HCK A;  1C0M A;  2QEX T;  2MYS A;  3CME T;  1B07 A;  2QXF A;  2XDB A;  3EHQ A;  2LMJ A;  1MMD A;  1JEG A;  3BDL A;  1NLP C;  1ZSZ A;  4M4Z A;  3FLG A;  1KQS A;  2EQK A;  4A4G A;  4HVV A;  2CGH A;  2QA4 T;  2KMT A;  2XI9 A;  3CQT A;  5GMK m;  3JCM Q;  4M7D B;  1KD1 R;  1JU5 C;  1NEG A;  1VQ6 Q;  5M9O A;  3QO3 A;  5IHN A;  5FWB A;  4OMN A;  1GFC A;  1NLO C;  2KK4 A;  3HKS A;  2A28 A;  1VQK T;  2D9T A;  1Q7Y U;  1IRX A;  2KT1 A;  4M7A G;  5FU6 B;  3EHR A;  4C0Z A;  3ULR B;  2DRM A;  4M75 B;  3MEA A;  2IVW A;  1I4K 1;  5I22 A;  1YJ9 T;  2E65 A;  2W10 A;  1RAI B;  2DJZ A;  2VYT A;  2LCL A;  2KAF A;  1RAB B;  2COZ A;  2DL5 A;  2R58 A;  5LJ5 d;  1X27 A;  2L8D A;  1UGV A;  4C92 A;  2AZS A;  5KCH A;  2DKG A;  3OA6 A;  5GAN f;  3EH1 A;  4KUL A;  2X9H A; 
#chains in the Genus database with same CATH homology
 2FB7 A;  1VQ8 A;  2HD0 A;  3L2V A;  5CVI A;  3OS0 A;  4ZGE B;  1K73 U;  2PU9 B;  1N9S A;  2RJD A;  2XK0 A;  3BFM A;  4LDU A;  3GOX A;  4BE0 A;  3OYG A;  3QKJ A;  1MGQ A;  5J26 A;  4C8Q A;  5GAN d;  4PJO B;  3JCM d;  3SFM A;  3HFO A;  3LGF A;  1KC8 C;  2JUF A;  4IUP A;  2IG0 A;  2PVD B;  5AYF A;  4Y91 A;  4A4H A;  4M7D D;  4CRI A;  2LNV A;  3LWI A;  2K5I A;  1X75 C;  3GNG A;  2O4X A;  3PFS A;  3RMQ A;  4JRQ A;  1D3B A;  4DOV A;  2QEX A;  3OYM A;  4J8O A;  1QP3 A;  4XTZ A;  1K9M U;  3FJP A;  2BUD A;  4M75 C;  3MO8 A;  1YJN A;  3CCV A;  3MEW A;  3VUZ A;  2LDM A;  4F7U G;  3CCS A;  3OB9 A;  3OSV A;  4M7A A;  4M7A F;  3FC3 A;  2DIQ A;  3KUF A;  1AHJ B;  2JN0 A;  2DD4 A;  4M77 D;  2XID A;  3NTI A;  3VU3 C;  5A0G A;  3LGL A;  1Q81 C;  3CCU A;  4X9C A;  4HCB A;  1VQO A;  5L8R E;  3N5B B;  2DPP B;  2YLB A;  1VQ8 T;  3BY7 A;  3JCM h;  3HSB A;  1O9S A;  4EMK C;  2LVM A;  3A5Z B;  3V7R A;  5A2Q E;  3R6O A;  1QVG S;  3KXT A;  3C94 A;  1JJ2 S;  3CPF A;  4XTX A;  4RG2 A;  2P0K A;  3V8J A;  4B9W A;  3CCM A;  4RCB A;  4XU0 A;  5HKC A;  3OYF A;  1NPR A;  4C5E A;  1H3Z A;  4M78 C;  1Y96 A;  4OF1 A;  2L89 A;  3HRS A;  3CPW A;  3NFC A;  2QQA A;  3RKW A;  4JJN K;  1FXX A;  4ELY C;  3RER A;  4JRP A;  3FIF A;  4BAC A;  1UGQ B;  4C92 G;  2LCC A;  2WSC E;  2E6Z A;  2VXF A;  1X01 A;  1Q82 C;  1NJI U;  3NTH A;  5KE3 A;  1YJN T;  3CCV T;  3JB9 I;  1QVP A;  4E7I A;  2QQR A;  5GAO p;  2LX9 A;  3JCM W;  1S72 A;  3OBW A;  4TVR A;  1VUB A;  2RJC A;  2EQM A;  5GMK j;  5GAN 4;  4J6X A;  5LL6 S;  1G3T A;  2F5K A;  2QTX A;  2X4W A;  3M53 A;  5IN1 A;  1VQO T;  5GAM j;  4C8Q G;  3CBP A;  1JB0 E;  3CBM A;  5LJ3 e;  5LJ5 j;  2RK1 A;  2LQK A;  5D6W A;  4M75 A;  4M77 E;  5GAN 7;  4FT4 A;  2VXE A;  1P92 A;  1MHN A;  4UC4 A;  1WJS A;  5CCA A;  1W2B S;  4PJO D;  4PNO A;  3X24 B;  2LRQ A;  3WXM B;  4NS5 A;  4A4F A;  3OS1 A;  5FU7 C;  3CCM T;  2X4J A;  1KQ2 A;  4R55 A;  1IZ6 A;  5CR2 A;  3PIP A;  1OYX A;  2RO0 A;  3FRN A;  3EAE A;  3S3O A;  4RCC A;  1BIB A;  1VQP A;  4J6W A;  5KCO A;  2YLC A;  1KD1 C;  4R56 A;  3F70 A;  1G3W A;  1W4S A;  2RHY A;  4EMK A;  3OYN A;  5LJ3 g;  1YJW A;  3J80 E;  2D0Q B;  4M77 B;  4F7U F;  2RM4 A;  3JCM V;  4F7U A;  3OYD A;  1S72 T;  2RI5 A;  4O5V A;  3G6E T;  1WJQ A;  3JB9 J;  4ATO A;  1OZ3 A;  3JCM b;  1QVF S;  2V8K A;  1NE8 A;  3C95 A;  3CC4 A;  4DOW A;  4M78 F;  4M78 A;  3M55 A;  3CCR A;  3E1S A;  1UB4 A;  1Q86 C;  2L3R A;  4ZTF A;  4N4I A;  2EAY A;  3OYY A;  3A8O B;  3SWN B;  2PUK B;  5GAN 3;  3I55 A;  1KC8 U;  4LDY A;  2PUO B;  1B34 B;  2K5F A;  4IKF A;  4C5I A;  1VQ5 A;  4XTU A;  5HY6 A;  4A4E A;  2JTM A;  4C0D B;  3X20 B;  3JB9 F;  5DM7 R;  1BIA A;  1BI3 A;  2RHX A;  1PSE A;  2ZPB B;  4M7D G;  1Y07 A;  1JJ2 A;  3LW5 E;  4D6W A;  4EDU A;  3JAM E;  5A0D A;  3G71 A;  1BKB A;  3QDR B;  1K8A C;  2DZ9 A;  1ZQ1 A;  5HK0 A;  4C92 F;  1VQP T;  3A8M B;  2V8J A;  2PQW A;  3CBO A;  1YIJ A;  3L2R A;  2X4X A;  2EKO A;  2HQE A;  5CKB A;  4NL3 A;  3OYH A;  1YJW T;  2ZPF B;  4OGE A;  2DD5 A;  5EG2 A;  2RJE A;  4X9D A;  2ZPI B;  4A54 A;  3RKX A;  2M9U A;  3DLM A;  4EPC A;  1U8R A;  1ZHI A;  3RES A;  2HQX A;  3P8D A;  1HK9 A;  3BDU A;  4RG8 A;  4M7D C;  1WQW A;  3A8L B;  3OYJ A;  1I81 A;  5CKF A;  4NL2 A;  4ZGD B;  3CC4 T;  4DQ2 A;  5GAO r;  4MZM A;  3CCR T;  3X25 B;  2XIC A;  3Q1J A;  4Z02 A;  4M75 G;  3CEY A;  1UEB A;  4C8Q F;  1JBM A;  2QQB A;  4FT2 A;  4L5G A;  2MMP A;  3RIR A;  3I55 T;  3QZ9 B;  1KQS S;  1NZ9 A;  5I2M A;  3J7A F;  5CKH A;  1VQL A;  1RL2 A;  4QVZ A;  4J7F A;  1Q7Y C;  3OBY A;  3OMG A;  1VQ5 T;  1G3S A;  4KBM B;  2DXC A;  1O75 A;  3C4S A;  2WSF E;  5FU6 C;  3A8G B;  4BI3 A;  5I2S A;  2XG8 D;  3DB3 A;  4M77 C;  3VJP A;  3V7S A;  2XKO C;  1Q82 U;  3OQ5 A;  3OY9 A;  1W2B A;  3G71 T;  4L6V 5;  2DEQ A;  5CQX A;  5CKD A;  4JRI A;  2KSS A;  3I56 A;  2P4T A;  3G4S T;  4Y28 E;  4PL6 A;  1JRI A;  1YIJ T;  3GLX A;  5IT9 E;  3JB9 H;  4KT0 E;  1YCY A;  4EMH A;  2EJF A;  2HAX A;  1YHQ A;  4M78 G;  4C8Q E;  3SWN C;  3M57 A;  2DXU A;  1YIT A;  1WJR A;  3PT9 A;  1N27 A;  4GLK A;  2KQW A;  3DB4 A;  3RKY A;  3CC7 T;  4LD9 K;  1R8O B;  3OS5 A;  1G3Y A;  5KE2 A;  3OS2 A;  1PSF A;  2PVG B;  3JSC A;  4PKC C;  4C0D C;  4HT9 A;  3V8K A;  5GMK e;  4XQ3 A;  1VQ4 T;  3V7C A;  2EYQ A;  2P0P A;  1WPY A;  4FM4 B;  5CQY A;  3JB9 G;  2CYZ B;  2QDY B;  5GAM e;  3OYE A;  3E9F A;  5LJ5 e;  4IUU A;  3CXC S;  1VQL T;  2RA2 A;  5CIU A;  5CAI A;  1I5L A;  5J3B A;  4BE1 A;  2I2L A;  3PMI A;  4C8Q B;  2X4Y A;  1BI2 A;  3P8H A;  4J7I A;  3TRE A;  5C6S A;  4M7A E;  2LC4 A;  1KD1 U;  2VC8 A;  4XK8 E;  4M7D A;  2RI2 A;  3URG A;  4M7D F;  3VV0 A;  2R57 A;  2K57 A;  4XTY A;  1KQ1 A;  2WAC A;  3HFN A;  1LOJ A;  4MZP A;  5LJ3 h;  4C0F A;  2ZCF B;  3ASK A;  3QII A;  3I56 T;  3G6E A;  3CC2 A;  4PLI A;  2KVQ G;  4LDW A;  1NPP A;  2OTL A;  4IUV A;  4OVA A;  1H64 1;  2A7Y A;  5GAN 6;  3GIB A;  4PJO C;  4ZN3 A;  1YHQ T;  5GAM g;  3QBY A;  1Q86 U;  2M16 A;  5LJ5 g;  2B8A A;  3JRZ A;  4E7J A;  1YIT T;  2EIF A;  5GAO l;  1VQ9 A;  2MI6 A;  3L2W A;  4M7A B;  1WNL A;  1Y7X A;  2EWN A;  1QW1 A;  4M77 A;  3H6Z A;  3OYC A;  5GAN e;  3CCL A;  1VIE A;  4E7L A;  4IUQ A;  4M75 F;  4QVD A;  2YHT A;  1OI1 A;  1N8R C;  1VIF A;  2F69 A;  1I8F A;  4A53 A;  3UPU A;  2DZC A;  3VYH B;  3QUI A;  2FYK A;  3LWH A;  3HL8 A;  4RMO A;  3JCM P;  3OYK A;  3LH0 A;  2E6N A;  2XHC A;  3MCA B;  2EJ9 A;  5GAO n;  4P5N A;  3L2U A;  4MDX A;  3SWN A;  2QQ9 A;  3CCQ A;  2XDD A;  2HBP A;  4BY6 B;  1K8A U;  3M58 A;  2CZ6 B;  3OYB A;  1B34 A;  2WSE E;  3TCJ A;  1X6O A;  5IAY A;  2QQS A;  3M5A A;  1Y96 B;  1UGS B;  1M90 C;  3HRT A;  5GAN g;  3J81 E;  2M0O A;  4OGC A;  2O01 E;  2JVV A;  2XU8 A;  2Y90 A;  3HP9 A;  4J5Y A;  3M4Y A;  5C0M A;  2DTI A;  4N4G A;  3OYL A;  1Y71 A;  5GAN j;  2OTL T;  3CC2 T;  1HXD A;  4MML A;  4OB2 B;  4FL6 A;  3CMA A;  1LJO A;  3CCJ A;  4PJO A;  3OYA A;  4X34 A;  2E41 A;  5KH6 A;  4C92 D;  1SSF A;  3L2Z A;  3SB2 A;  4ME7 A;  1VQ9 T;  1OZ2 A;  4NOY A;  3AHU A;  2RHU A;  4OB0 B;  3CCL T;  4O6J A;  4LDX A;  3C12 A;  2PVO B;  3OMC A;  4ZN1 A;  5GAO m;  5GAN 2;  2DTH A;  2RHZ A;  1M1G A;  2VUB A;  4QVC A;  2RI3 A;  2D6F A;  1BYM A;  2CKK A;  3M9Q A;  3CD6 T;  2RD1 A;  2FL7 A;  4PJO F;  5FLX E;  4B9X A;  4F7U E;  5GAN 5;  1QVG A;  2QI2 A;  1QP2 A;  2EQJ A;  3CCQ T;  4XTV A;  4C8Q D;  2E12 A;  3G4S A;  4JLG A;  4M78 E;  2GFA A;  2K4Y A;  3GF5 A;  4MDW A;  3CPW S;  2K3X A;  4OB3 B;  4IUR A;  3S3N A;  3CXC A;  5FRN A;  2Y4Y A;  4N0A C;  5FRO A;  3JCM c;  4IUT A;  3LYI A;  3ME9 A;  3MET A;  4BI8 B;  2DO3 A;  1Q81 U;  4XU1 A;  2GF7 A;  1BI1 A;  2E5Q A;  3QJ6 A;  4BDZ A;  3CC7 A;  2LT4 A;  4BE2 A;  3X26 B;  4VUB A;  3GP8 A;  3CMA T;  3DKM A;  4M77 G;  3CCJ T;  2DIG A;  4F7U B;  1YI2 A;  3V8L A;  5HK3 A;  1VQ4 A;  3GNF B;  3SD4 A;  3S6W A;  5J39 A;  1LNX A;  2VGM A;  2ZZD A;  3INZ A;  3KBG A;  3QYG B;  3QZ5 B;  5I21 A;  4M7A D;  3M54 A;  4M78 B;  4XU2 A;  1VQ7 A;  3HRU A;  4MZT A;  2JZ2 A;  2VV5 A;  2EJG A;  3L1A A;  4C92 E;  3ZEH A;  1IRE B;  3PMT A;  2F5T X;  5LJ3 f;  3LLR A;  2R5M A;  2XDP A;  2JOY A;  4HA8 A;  1VQN A;  2RK2 A;  1FWZ A;  3M4G A;  2FVU A;  2E10 A;  4HT8 A;  2RH2 A;  3L42 A;  5A0L A;  2RHI A;  1N6A A;  3M59 A;  3VKI A;  3MHX A;  3HPW A;  5FRM A;  1V29 B;  2K5L A;  2DTO A;  3MEV A;  5GMK h;  4KUD K;  3ER0 A;  2E64 A;  2KY9 A;  1WQ7 A;  3WVD B;  2MF2 A;  5LJ3 d;  2H3J A;  2GFU A;  3MEU A;  1VQM A;  5CO7 A;  4ZGJ B;  5GAM h;  3SDZ A;  2P0Q A;  3RUX A;  5LJ5 h;  2VGN A;  4C92 B;  3T9N A;  4BI4 A;  3OW2 S;  1M1K C;  1M8V A;  4A4K A;  4GY5 A;  3P8B B;  3QG1 A;  2JNG A;  3PIO A;  3RMS A;  3QPH A;  5D6Y A;  3DLL A;  4II1 A;  4LDV A;  2LQ8 A;  1YI2 T;  1N8R U;  3VYG A;  4QQG A;  2OTJ A;  2DXT A;  3E19 A;  3CME A;  1QVF A;  1BI0 A;  1UGP B;  4OMF B;  5FU7 B;  4CI0 C;  1VQ7 T;  4KUI A;  4PLL A;  4N0A A;  4L59 A;  3VUB A;  1M4Z A;  4N4H A;  4PJO G;  4JS4 A;  4WF2 A;  2AHJ B;  3MP8 A;  2JTF A;  5GMK i;  3CCE A;  1YBY A;  5GMK l;  2E70 A;  2CS7 A;  4QQD A;  3WVE B;  1VQN T;  2K2V A;  3ZBD A;  5DLQ E;  4JDS A;  4M75 D;  2QA4 A;  1M90 U;  1U1S A;  5GAN h;  5GAN 8;  4LD6 A;  1K73 C;  2O4X B;  4M7A G;  4OP0 A;  2EFI A;  1U1T A;  2OAU A;  2L5Q A;  1D3B B;  2YRV A;  5D6X A;  4HCZ A;  1VQM T;  2GQV A;  4EMG A;  4FSX A;  3ZFJ A;  3MP6 A;  4FU6 A;  2R5A A;  1EIF A;  4OB1 B;  1WGS A;  4M77 F;  2ZPH B;  2EQU A;  4BB7 A;  2E1H A;  1VQK A;  2CZ7 B;  3JCM e;  2OTJ T;  2CZ0 B;  2DXB A;  3QHS A;  3NTK A;  4M7D E;  4E7K A;  2XD0 A;  2QEX T;  1K9M C;  3CME T;  1N9R A;  3PTA A;  2GCX A;  4M78 D;  3JCM X;  3L2Q A;  3CD6 A;  1M5Q 1;  2QXF A;  2XDB A;  3CCS T;  2BKD N;  2DVE A;  4J83 A;  3BDL A;  3UT1 A;  1G5V A;  4JLI A;  3QSU A;  1YJ9 A;  3JCM J;  3CCE T;  2LTO A;  2DAQ A;  3FLG A;  3PNW C;  2EQK A;  3EFS A;  4MMK A;  1KQS A;  4A4G A;  3G7Z A;  2CGH A;  3CCU T;  2QA4 T;  2KMT A;  2XI9 A;  4C92 C;  4XAX B;  3JCM g;  2LT1 A;  2MWP A;  2A3L A;  5GMK m;  2V8I A;  3FEO A;  3TU4 K;  3JB9 D;  1TH7 A;  2BIV A;  3UWN A;  4C0G A;  3BW1 A;  3JCM Q;  4M7D B;  3H8Z A;  4J6Y A;  4M75 E;  4HKE A;  1ZBX A;  5CK9 A;  4QQ6 A;  3EFR A;  3QO3 A;  4BUG A;  5M9O A;  4V2S A;  1UGR B;  2ZPE B;  3MP1 A;  4FIB A;  2ZPG B;  1XOV A;  3FB9 A;  1GXI E;  1RI0 A;  4Q5W A;  1KG1 A;  3QXE B;  2KK4 A;  3HKS A;  5CKE A;  3PGG A;  1VQ6 A;  2FHD A;  3HHT B;  1VQK T;  4C8Q C;  1DJ7 B;  2D9T A;  4YTL A;  5DLO A;  3A8H B;  4BDY A;  3QYH B;  1Q7Y U;  3M56 A;  3OW2 A;  2M1H A;  4XTW A;  4BD3 A;  5GAO q;  5FU6 B;  4RKU E;  1KHC A;  2CZ1 B;  4C0Z A;  4E7H A;  1NJI C;  2Y4X A;  3S3M A;  1XNI A;  2KDS A;  2RJF A;  2X35 A;  3FDR A;  4M75 B;  5LJ3 j;  3MEA A;  2IVW A;  2K3Y A;  1I4K 1;  1M9S A;  2G3R A;  3TEE A;  1YJ9 T;  1M1F A;  5GAM f;  2E65 A;  5LJ5 f;  3E9G A;  4E47 A;  2DJZ A;  4M7A C;  3OSS C;  2VYT A;  4ZTJ A;  2LCL A;  2KAF A;  3OYI A;  1M1K U;  3O8V A;  3X28 B;  4EMK B;  2MAM A;  4C5G A;  1KHI A;  3GPL A;  1XQH A;  2R58 A;  5GAM d;  4C5H A;  5LJ5 d;  4JUV A;  4XU3 A;  2DK3 A;  2MWO A;  4JRK A;  2HNI A;  1FX7 A;  2L8D A;  4QW2 A;  4PJO E;  3UDC A;  1VQ6 T;  5DY9 A;  4BY6 C;  4C92 A;  4HCC A;  2C06 A;  5KCH A;  4DA4 A;  3LX7 A;  2NLU A;  2DKG A;  3QJY A;  4ELZ C;  3OA6 A;  5GAN f;  1XTD A;  4KUL A;  2ZGW A;  3JCM f;  2RB6 A;  4JS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...