2RHXA

Crystal structure of the 3-mbt repeats from human l3mbtl1 bound to dimethyl-lysine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
325
structure length
325
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 80
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA03
2XK0A 2EFIA 5IAYA 2BIVA 3FC3A 1SSFA 2X4YA 2L3RA 2O4XA 2P0KA 3MEUA 4QQ6A 2D9TA 3MEVA 1G5VA 2WACA 3EAEA 4N4GA 3MO8A 3S6WA 3OYEA 3UWNA 1N27A 2LCCA 4FU6A 3O8VA 4OVAA 2JZ2A 4E7JA 2EQJA 2R58A 3FLGA 3H6ZA 3OMCA 3OB9A 4A4HA 2M1HA 2NLUA 2RHXA 4UC4A 5D6XA 2DIGA 4PL6A 3OYMA 4BE1A 1XNIA 2GFAA 3L42A 4CRIA 3OY9A 3MEWA 3QJ6A 4E7IA 3LX7A 2RHYA 2LRQA 1KHCA 2EQKA 3NTHA 2RI2A 4E7LA 4QW2A 3OYGA 4BACA 3S3OA 3OYHA 2IG0A 4Q5WA 4RG2A 2EKOA 1OZ3A 2RJFA 3L2WA 2RI5A 5FROA 2VYTA 3OYJA 2F5KA 3ME9A 2DAQA 5C6SA 2PQWA 3FEOA 4X34A 4C5GA 3NTIA 4ZTJA 2X4WA 2HQEA 3DLMA 4PLLA 3OYIA 4II1A 3DB3A 3DB4A 4L59A 4BDZA 2RHIA 3OYCA 3Q1JA 3MP1A 5D6WA 4C5HA 3M9QA 4E7HA 2RHZA 3E9FA 3LLRA 2JTFA 2GF7A 4IUPA 5J39A 3OS0A 2R5MA 3OS1A 3P8HA 3LH0A 4A4GA 4E7KA 5J26A 5CIUA 3L2UA 2X4XA 3KUFA 2FHDA 3H8ZA 4B9XA 4BE2A 2LVMA 4QVZA 3LYIA 2L8DA 4LD6A 3E9GA 5KE2A 3OYBA 3S3NA 2QQRA 2MWOA 2RJCA 3C4SA 4IURA 4B9WA 4Z02A 4BD3A 4EDUA 2E5QA 5KE3A 4A4EA 3GOXA 4IUTA 3S3MA 2G3RA 5KH6A 3QKJA 3L2QA 2BKDN 3F70A 3MP8A 2RJDA 2RO0A 3ZEHA 4QQGA 3OYLA 3QBYA 2K3YA 2L89A 2MWPA 3PFSA 2BUDA 1WJQA 3PNWC 4NS5A 3PMIA 2GFUA 4IUVA 5C0MA 5FRMA 4C5EA 2E6NA 3OS2A 3OYAA 1OYXA 2RI3A 3PMTA 2R5AA 3OA6A 5KCHA 4N4HA 3OYFA 2EQUA 3UT1A 5FRNA 2DIQA 2HQXA 1WJRA 1OI1A 3OMGA 3P8DA 2X35A 2K3XA 3OQ5A 3FDRA 4ZTFA 2R57A 3ASKA 4FL6A 3L2VA 4BE0A 5M9OA 4IUUA 4C5IA 4PLIA 3BDLA 4A4FA 1WGSA 3CEYA 2LTOA 2XDPA 2B8AA 4BDYA 1OZ2A 3NTKA 2QQSA 2YRVA 3META 1WJSA 5IN1A 2RJEA 1MHNA 4IUQA 4IKFA 1H3ZA 2EQMA 2O4XB 4N4IA 5D6YA 3OYDA 3L2RA 3MEAA 3OYKA 4QQDA 2CKKA 3OYNA 3LGFA 3LGLA 3SD4A 3QIIA 4HCZA 2M16A 2LDMA 2M0OA 2RHUA 3MP6A 4GY5A 5KCOA 1RI0A
chains in the Genus database with same CATH superfamily
1E6HA 1HK9A 2V8IA 3PIOA 4XU3A 3OYEA 4J9BA 1ZQ1A 3JCMX 4ZN1A 3FLGA 5A2QE 1NEBA 3MKDA 2PU9B 2DEUA 1VQNQ 4F04B 1VQKQ 2WSFE 1BCMA 4RTTA 2EBPA 1K9MC 4QVDA 1WXBA 4BUGA 1PWTA 2XD0A 2DA9A 2HCKA 5FLXE 2FB7A 2JN0A 2HZYA 3EGXA 1W1FA 1ZHIA 3CCEA 3JAME 3OYIA 2A7YA 2K79A 4LDWA 4M77C 3OYCA 1YITQ 3E9FA 2ED0A 2CUDA 4FT2A 3OW2S 1IHWA 1ZSZB 5CO7A 4IIOA 4XTXA 1TXQA 2FHDA 2JUFA 1W2BP 1M2OA 5KYNA 4M7DC 4A4EA 1QKXA 4CI0C 4PFOA 3C95A 1RAAB 4JZ4A 5EG2A 4JJBA 3PMTA 3I5SA 5KCHA 2HMAA 3CCQT 4N0AC 3M59A 1BI3A 2KYBA 1MNDA 3CPFA 1D0XA 5CKHA 1PNJA 3V8LA 1WHKA 1NZ9A 5GAN2 1BI0A 4IKFA 4E7SA 2XHCA 3L2RA 1R8OB 2EYWA 2J7IA 3GNGA 5IHIA 4AT1B 5KCOA 1K8AU 2XK0A 3I55Q 2YRCA 1TUCA 3RNJA 1WHGA 3MO8A 1EX4A 4E7JA 1KC8U 1NM7A 2NLUA 1RAHB 2QQBA 4PL6A 3OYMA 2EGEA 2FYKA 3QZ5B 3I56T 1OPLA 3GIBA 4M77B 3L2ZA 3SWNC 1VQOT 4QW2A 3S3OA 1SG5A 2FG0A 2O88A 4ME7A 3CCVQ 2DTOA 1TG0A 3RR6A 5C6SA 1VQ4T 1M1FA 4BI3A 4QVCA 4OMNA 2KBTA 1UGQB 4EMKB 1NE8A 2AT1B 3MJXA 1VQ5Q 1UECA 1X6GA 4J9GA 1Q86U 5FU7B 2JTFA 2VWFA 1Z9QA 2DILA 3A8LB 1I4K1 2F2VA 3HP9A 3VUZA 1RAGB 5CIUA 3ER0A 3VS4A 5GAOl 1UB4A 5DLOA 3QHSA 1C0MA 2RQVA 3ULRB 1YFNA 3OSSC 5GMKi 3C4SA 1TS9A 2G3RA 3MP8A 2K3YA 2PNIA 4PFZA 3PNWC 2HDAA 2CGHA 1U3OA 3VV0A 3QJYA 1W4SA 2PUOB 1VQMA 3EG0A 1AWJA 2IPOB 2EVRA 2CP6A 1OX8A 3OW2A 1A0NB 4X9CA 3LW5E 5GAOq 4PJMA 1TU0B 3ASKA 3C0CA 4IUUA 1MNEA 1G3TA 2SEMA 2XDPA 3GBQA 2MPXC 1CSKA 3M0PA 1PSEA 1VQPA 5CKFA 1GBRA 3JB9F 5GMKl 1BI2A 1SEMA 2LC4A 4J5YA 3G6EQ 4PJOE 1OX9A 3MP6A 1Q95G 1X6OA 2GCXA 4L6V5 1IZ6A 2CREA 3WXMB 4XTVA 1G5VA 4QQ6A 1VYUA 2KROA 7AT1B 4MZMA 2MK5A 3QUIA 4RKUE 4A4HA 2FZCB 2HKQB 1G8XA 2OTJQ 1RADB 4WF2A 1NPRA 4KUDK 1JJ2S 2CZ6B 1T3LA 2DF6A 3NMZC 1YITA 1VQ8A 2F69A 4R56A 2QDYB 4J6YA 3VYHB 3TU4K 4F7UG 3H9NA 1V1CA 5J3BA 1KQSP 4YTLA 1WX6A 1DJ7B 1QCFA 5D6WA 3M9QA 4XU0A 1OOTA 3R6NA 2R5MA 3G7ZA 3CC4A 3EHQA 4EIKA 1HSQA 4XTWA 2CZ7B 3KUFA 2MAMA 4BE2A 2WSEE 3CMEA 2K4YA 4D6WA 1M2VB 5KYWA 1UGVA 3S3NA 1YJWT 2OTLA 1X01A 2HKNA 2KQWA 3V8JA 1W70A 3M0UA 2NUTB 3RKYA 2DXUA 5CAIA 1VQ6A 1Q82U 1WPYA 1WJQA 4C0FA 3PMIA 4OMLA 5GMKe 3CMET 3NPFA 2DXTA 1K8AR 5GAN4 2EQUA 5CKBA 2P4TA 3JRZA 2RMOA 1QMCA 1YCSB 2QASA 5KYWB 5GAMg 3OQ5A 3L2VA 3BDLA 1D09B 3HKSA 4RTWA 3EG2A 3NTKA 4MZPA 2K5LA 4FIBA 3G71T 4DA4A 3REBB 3NHNA 4OB0B 1Q7YU 1RUWA 2DM1A 2L3QA 4M78A 3EG3A 3M58A 1D1AA 4RTUA 1M3BA 4V2SA 4HCBA 4TVRA 4C0DC 4OP0A 1YHQA 4M7DB 4OB1B 4FW2A 1D1BA 2O4XA 2LNHB 4N4GA 2EQIA 1OULA 2RHXA 1BK2A 1C1AA 3IQLA 1VYTA 2LX7A 3VKIA 5GANd 3UA7A 4BY6C 3P8BB 4E7LA 3JB9I 2E12A 2DRMA 3QYHB 1JEGA 3OBYA 2P4RA 1VQ6Q 2HQHA 4KUIA 2ROTA 1RLQC 1B34B 1K76A 1X75C 5GAOr 3BW1A 1S1NA 4II1A 3DLLA 4M75G 3CD6Q 2ECZA 3I35A 1K73R 2QXFA 1QP3A 4F7UF 4ESRA 5ECAA 1IB8A 2K3BA 4EMKC 2QA4A 1VQKA 2DMOA 2MWOA 4BD3A 4M7AD 1YJWQ 4JLIA 4PFPA 3X25B 3NGPA 1UGSB 1FMKA 4ATOA 3QBYA 1N9RA 2V8KA 2WSCE 2LJ0A 3RKWA 2JVVA 1N8RR 1MMNA 4PJOB 3EGDA 4A54A 2Y4XA 2RK1A 1FYNA 1YNZA 2OTJA 4FSXA 4RTYA 4XTZA 1B7TA 2I0NA 2LCSA 2DJZA 4MMLA 2LMJA 1WHMA 1VQ8Q 4FW1A 1NEGA 2VASA 1Q86C 3QYGB 2J6FA 4CC4B 2VGNA 3HRUA 3SDZA 2FZGB 4PNOA 2DO3A 4IUQA 1UDLA 1Y07A 4N4IA 2CKKA 3OYNA 3SD4A 3QIIA 3JCMb 1MV0B 2LDMA 2PUKB 1G2BA 4DOWA 5IAYA 3JCMc 1LOJA 3O8VA 4KGVB 1UGPB 4HA8A 3BFMA 5DLQE 2DL5A 4OB2B 2DD4A 4M75B 2C0TA 1X2KA 1M8MA 2K7AA 2QEXA 2LRQA 2RI2A 1NPPA 2DETA 3L2WA 2P84A 2A0FB 1SRLA 3TEEA 5FWBA 1CKAA 1M8VA 1SPKA 1YI2T 1M9SA 3EG9A 2ZPFB 2CSIA 1U1SA 3VS7A 3REAB 1ZA1B 1BBZA 5GAOm 3AHUA 2JMCA 4MDXA 3P8HA 3JCMV 1H641 4EPCA 3FJ5A 3CCLT 3H8ZA 4LD6A 4M7DE 2VXEA 1GFDA 2FRWA 2K57A 2QQRA 4RUGA 2P0PA 5KE3A 2ZPEB 1Y96B 1M1KR 3HTRA 1RAIB 1Y57A 2FL7A 4KH1B 4NS5A 3CC2T 2EYXA 2ZPGB 3V7RA 3M54A 3OS2A 2HNIA 2MF2A 1KQSA 2M02A 4J9CA 4ZGJB 4M78E 2QDLA 3CCRT 1K1ZA 1RLPC 1ACMB 1Y71A 3CCUT 2HSEB 3RUXA 4D8DA 3CEYA 4BDYA 5HY6A 2GGRA 3GF5A 2E64A 3META 3I56Q 2OI3A 2A3LA 1X69A 4D8KA 5D6YA 1YI2Q 3LGFA 4DBRA 4X1VA 3KBGA 2X4JA 4C92B 2JXBA 1YJ9A 3MHXA 5HKCA 4MMKA 2DYBA 1YIJA 3QDFA 4M78C 2E10A 2DIGA 4RTXA 4C0DB 4JRPA 1ZLMA 1EFNA 4OGEA 2RHYA 3PT9A 1QCNA 3ZBDA 3HFOA 2GQIA 2RA2A 1S72T 1OZ3A 2COWA 2RI5A 2VYTA 2CZ0B 2RM4A 4QT7A 4C0ZA 2VV5A 4ZTJA 2X4WA 3I5RA 4PLLA 5GANe 1FMVA 2BTTA 1I8FA 4Z88A 2ZZDA 3HPWA 2H8HA 4C5HA 4NL3A 2X51A 1WIEA 2K2MA 1HD3A 4IUPA 4FCYA 1KSWA 5J26A 1FXXA 1ZUUA 1QWEA 2VXFA 1JJ2P 3E9GA 1K0XA 4LDYA 2VB6A 3RDVA 3WVDB 3HHTB 4B9WA 2YLCA 3CD6A 1ZSGA 3L2QA 2RJDA 4KH0B 3PFSA 2IIMA 4FT4A 1ZUKA 1YJ9Q 5FRMA 3EGXB 4FSSA 3QSUA 2L3SA 3M4YA 2EPDA 1WQWA 2DERA 3G6ET 4FYXB 5GAMh 1WNLA 2X35A 3CPWS 4HCCA 2K3XA 2R57A 2YRDA 2L3PA 1BKBA 2J06A 3E1SA 3PVLA 4ZGEB 2RJEA 2EKHA 1H3ZA 3PVQA 1AZEA 1ABOA 5LJ3g 1SRMA 4KGXB 5HK0A 1GRIA 1P92A 1X2QA 1Q82R 3D7SB 4LN2A 2QGGA 2LCCA 2DZCA 3OB9A 2EYQA 2DX1A 3SB2A 4UC4A 2YSQA 4OGCA 4F17A 5CK9A 1YCYA 1NLOC 2EJGA 1UHCA 4O6JA 4J9DA 2KNBB 5FROA 3ME9A 2DAQA 3G71Q 3DLMA 3EHRA 2E6ZA 4AMCA 2K5FA 3EGDB 4J9HA 2CP7A 1VQ4A 3EFOB 2CS7A 2LQNA 4DQ2A 4M77D 2JTMA 3VS1A 5L23A 4QKUA 4XTYA 1OQKA 1WHHA 4J7FA 1JJ2A 2FPEA 2O31A 3CMEQ 1QVFS 2A08A 2NUPB 2RB6A 1FWZA 4EDUA 4HKEA 4A4KA 1YWPA 3F70A 1I5LA 1LJOA 4JS4A 1UTIA 3HRSA 1UJ0A 2CT4A 1RABB 5C0MA 1KC8C 5GAOn 3OYAA 2GBQA 2E4HA 2K5IA 1Q86R 2LX9A 5GANf 2QQ9A 3A8MB 4BB7A 3CCMQ 2NUPA 2EYZA 2QQAA 2RQUA 3R6OA 4N0AA 1OU9A 4J6WA 2XICA 1VA7A 1IREB 2B8AA 3UA6A 2LT4A 5LJ3e 3M57A 4B6MA 4J6XA 4RCBA 3CCQQ 1S72Q 1I81A 5LJ5j 4HCZA 4HVVA 2RHUA 1YJNA 2BIVA 2DK3A 2OTJT 2D9TA 3I56A 4M78B 4AG1C 1G3SA 2DVEA 1U5SA 2YUQA 3SWNA 3CCSA 2JS0A 3LX7A 1MMAA 1QKWA 2E41A 1O9SA 3CCLA 3OYHA 5GANg 1N8RC 2RN8A 3BE3A 3OW2P 4E47A 2NYSA 2PZ1A 2OJ2A 2CP5A 1BIBA 3NTIA 4DBHA 1YBYA 1KK7A 1VYVA 1M90R 4HCKA 3HRTA 4M7DF 1VIEA 4HVWA 2W10A 2LZ6B 2LCLA 1CKBA 2DNUA 5GMKh 3OYYA 5GMKm 4JJNK 1AVZC 1O75A 3RMSA 1IXDA 1BB9A 2L8DA 3OYBA 3CC2A 1VQNT 2X3XD 4XK8E 1HXDA 2QEXQ 1WQ7A 4IUTA 3CXCA 1K9MU 1NG2A 4QQGA 2LNVA 2L89A 3JSCA 3TREA 2V1QA 3SFMA 1AEYA 2J05A 4XU2A 2XDBA 1WFWA 4Z8AA 3X20B 4J83A 3WVEB 2EGCA 3C94A 1GCQA 4JS5A 1K9AA 2HQXA 3VS5A 1UG1A 2A28A 2LT1A 1OI1A 1I5OB 1KQSS 2A36A 2C0IA 3UATA 3KFVA 3RIRA 3TVTA 3FJPA 4AFUC 4C8QD 1W2BA 4LNPA 3HSBA 3JB9H 1WJSA 2MI6A 3PIPA 5CKDA 1VQLQ 2FPFA 3X24B 1QCOA 4F16A 3G1JA 5GAMj 1VQ4Q 2KMTA 3CPWP 4Y91A 1AT1B 5IXFA 2DD5A 4M7AA 2EFIA 2FRYA 5D7UA 3OSVA 1U1TA 4DEXA 1VQMT 2KXDA 5I2SA 2WACA 2KT1A 3UWNA 2MMPA 2JM8A 1G3YA 2R58A 3OMCA 1AWWA 2DFUA 1WYXA 2H3JA 4M7DG 2LQKA 2RF0A 1BIAA 1IGQA 1YJWA 2CDTA 2ENMA 2OTLT 3GPLA 2FO0A 5I11A 5DY9A 3VRYA 4Q5WA 3OYJA 4M75A 5GMKj 1PRLC 2PQWA 3FEOA 1PG5B 2E1HA 2YUNA 2YWWA 4EMGA 2V8JA 1W2BS 3HL8A 1AWOA 1NJIC 5LL6S 2BE7D 4E7HA 4JJCA 4Y28E 3CXCP 1NLPC 5J39A 2AK5A 4ZN3A 3V7CA 4R55A 1N5ZA 2QYZA 1WDXA 2QG9B 2IVWA 4AG2C 2EYYA 4L5GA 3LYIA 3CCQA 1TUGB 1Q7YC 1ZBJA 2F1LA 2GNCA 2RJCA 2KDSA 3GOXA 4LDXA 1XTDA 3CCJT 2JM9A 4JRQA 2DL4A 1XOVA 2O2OA 1M27C 2JS2A 3QDRB 2GFUA 2OTLQ 4OMPA 2E6NA 1OYXA 3QZ9B 3OA6A 4M77G 2W0ZA 1M90U 3BDUA 3E2UA 2DYIA 4CC7A 2FPDA 3FDRA 4RG8A 1KC8R 2Z0WA 1KHIA 2F2WA 1IHVA 1QVGA 3M0QA 1IO6A 2JTEA 1WGSA 4OMFB 5AT1B 4M7AF 2O9VA 3TSZA 1PC0A 3A8HB 5IHKA 2M51A 4DBQA 1J3TA 3MEAA 1Y0MA 2KI7A 2M16A 1PKSA 3A8OB 2DTIA 2M0OA 2CP2A 1TOVA 3QPHA 1MGQA 2KAFA 3FC3A 2L3RA 2MYSA 3CXCS 4PJOF 1VUBA 2EW3A 1MMDA 4HT9A 4BE1A 3OS5A 4XAXB 2MCNA 4C8QF 2SRCA 5KYXB 4M7AE 3CCVA 4OB3B 2RJFA 2VC8A 4C92G 2DBKA 2ABLA 1NJIR 5IH2A 2BE9B 2CP0A 3BY7A 3RESA 1LCKA 4A53A 2L2PA 1D0ZA 2CP3A 1D3BB 2GF7A 4DOVA 2LJ1A 4C92F 1OU8A 3LH0A 1R0BG 1MUZA 2GTOA 2E3HA 4M75E 4NOYA 4JJDA 1VQOQ 4M7DA 5KYUB 4QVZA 4J9EA 1LNXA 4NL2A 4Z02A 5EC7A 5KH6A 8ATCB 4C92A 3QXEB 3INZA 4IIMA 4M75D 1M4ZA 3X26B 1VQNA 1BCOA 4M77E 3RMQA 5FWCA 2RI3A 2QA4T 2LQWA 3OYFA 1VQ7T 1R77A 4GLKA 1MMGA 2FVUA 3M0SA 1WJRA 2BZXA 2NWMA 3P8DA 2ROLA 2XDDA 1Q81R 1B34A 4O5VA 2HBWA 4PK4A 3QWXX 1JBMA 3QG1A 5A0DA 3CCUA 1M1KC 4PJOA 2PVOB 1SKUB 1AD5A 9ATCB 1VQ8T 3PGGA 1JQQA 2FZKB 2QI2A 1BU1A 2RK2A 3G4SQ 2DRKA 2P0KA 1HJDA 2EAYA 2RQRA 4JRKA 1VQLA 2ZPHB 2DTHA 3H6ZA 1LPLA 2CT3A 4RCCA 1PRMC 2GFAA 4EMHA 1ZSZA 2YHTA 3EG9B 3TCJA 2EKOA 1GBQA 3V7SA 5GAMe 2F5KA 5AYFA 2C06A 2DL7A 1VQPT 4M7AB 1GL5A 2A37A 4C5GA 4RTZA 3OBWA 1VQMQ 2KYMA 2QGFB 4Y92A 4FYYB 3X28B 3H0IA 2Y90A 2VVKA 3EH1A 3GP8A 1QQJA 5GJVB 1TSFA 1AHJB 1K73C 2HSPA 2QTXA 2KEAA 2XMFA 3SHWA 2QK0A 4M77F 1KQ1A 1YIJT 2X9HA 3ZEHA 4JDSA 1Q81C 2EWNA 3J81E 2V26A 4C0GA 1Y7XA 3G4SA 4XU1A 4JRIA 2HBPA 2M9UA 2OAWA 2JMAA 2QTVA 3UT1A 2AKKA 3OMGA 2HEQA 3RERA 1PD0A 5IT9E 4C5IA 4M7DD 1Y96A 4LUEA 4M78G 2OX7A 4KRTA 1RAFB 1JRIA 2ESWA 3VS6A 3THKA 5IN1A 1KJWA 3EGUA 4M77A 1JB0E 1MHNA 3FIFA 3OYDA 2AHJB 4J8OA 5L8RE 1AOJA 2PVGB 3MPUB 3CCVT 3H41A 1VQOA 3L1AA 1SSFA 4EMKA 1I1JA 2BZ8A 1VQ9A 1N27A 4M7AC 3PE0A 2D1XA 5GAN8 4ELZC 3I55T 1XNIA 4CRIA 1M30A 1H3HA 1VQLT 3QJ6A 1QVGS 1M90C 1QVFA 1I07A 3CQTA 3U23A 1X43A 1QVGP 4JUVA 3M0RA 4CC2A 1N6AA 4KULA 3TSWA 3DKMA 5LJ5d 2J6OA 5LJ3j 2NUZA 1ZBXA 2E65A 4BI4A 2AKLA 2DPPB 1G83A 2ED1A 4BDZA 2RHIA 3MP1A 4C8QA 5CVIA 4C92E 4LE9A 3N5BB 4HVUA 5CQXA 3JCMJ 5FU7C 5IHNA 1N8RU 1K4US 2X4XA 4ZNXA 4DEYA 4M78F 2GQVA 1VQ7A 4HXJA 3H0HA 2CUBA 3FB9A 3S3MA 1UJYA 1RI9A 3QKJA 2RPNA 1BI1A 3OYLA 3A98A 2MWPA 4AFSC 1VIFA 3CBMA 4IUVA 3CCEQ 2K2VA 8AT1B 3EFSA 4P5NA 5HK3A 3O5ZA 1K73U 2YLBA 2XU8A 1SSHA 1GCQC 4FL6A 5M9OA 2JW4A 3UPUA 1R0CB 5KYXA 3CCET 2QQSA 2YRVA 1WI7A 2M0YA 1Q7YR 1SF9A 2ZCFB 5FW9A 4XQ3A 3LGLA 4ELYC 3CCJQ 2Y4YA 1PKTA 2DXCA 4GBQA 5HCKA 3E19A 4M4ZA 1V76A 2LP5A 2HAXA 4OVAA 5GAOp 3ZFJA 2FEIA 3QWYA 2M1HA 1KD1C 5FU6B 1VQ6T 4JPBW 1OEBA 5KYUA 5GAN6 1QVFP 1EIFA 3T9NA 3MCAB 2IG0A 3CC4T 4LD9K 2CZ1B 4J7IA 1UHFA 3CMAT 2KR3A 3J7AF 4L59A 1RAEB 1YWOA 1PCXA 2XG8D 3URGA 3Q1JA 1F1BB 4F14A 3LLRA 5GANj 1WLPB 1B3QA 3AT1B 3CCRA 3OS1A 4E7KA 5KYYA 3SEMA 2V1RA 4AFZC 3JCMQ 5I21A 1ZUYA 5KE2A 2YT6A 3LWIA 5LJ3d 1S72A 4IURA 3CCST 2C0OA 4AFQC 2ZGWA 3ZL7C 2BKDN 4PKCC 2DZ9A 5GAN5 3CCJA 2E3IA 2MOXA 1M2VA 5I22A 1ZA2B 1VQ9Q 1W6XA 3JCMg 2HL3A 2LQ8A 2KY9A 2PVDB 4FYVB 4C5EA 2VUBA 2DLPA 1YJ9T 3CCSQ 2R5AA 1QWFA 1XJWB 5LJ5e 1VQ5A 1X27A 5FRNA 2DIQA 4C8QB 2EJ9A 1K8AC 1XQHA 1H92A 4MZTA 1BYMA 3A1PA 2LTOA 4M7AG 1OZ2A 4PJOC 4F7UB 1KIKA 2E70A 2EJFA 2EQMA 3KXTA 5LJ3f 3CCMA 3OYKA 2VGMA 3LWHA 2K6DA 5GJWB 1UEBA 3VS3A 4OMMA 2D8JA 3LH5A 3MEUA 2ZPBB 3JCMW 2YUPA 2YXYA 4FU6A 1YIJQ 4M75C 3CBOA 1SHFA 2CSQA 1WHJA 2YUOA 1UFFA 4PJNA 1ZX6A 4PJOD 3L42A 3JB9G 4C8QG 1M1GA 2D0QB 3JCMh 4C8QE 1YJNT 1WA7A 5GANh 2EQKA 2I2LA 1WHLA 4BACA 5LJ5f 2O9SA 4RG2A 3JCMf 3VS0A 2DKGA 2D6FA 1C6VX 1JXOA 1VQPQ 1JXMA 2RQTA 1KD1U 3DB4A 5CR2A 2VKNA 3PTAA 3EFRA 2GTJA 2RHZA 4F7UA 3CMAA 2COYA 2COZA 2HL5C 4X9DA 2RH2A 4LUDA 2BZYA 1AZGB 1UUEA 3NFCA 1TH7A 2RNAA 2KT8A 1YITT 3CPWA 5LJ3h 1M3AA 2RD1A 1HYOA 3G4ST 4M78D 2K9GA 2E5QA 3GLXA 1YP5A 2EIFA 3EH2A 2H3EB 4HT8A 2BUDA 2DL8A 1NYGA 1RL2A 4PJJA 5CKEA 2KVQG 4E7ZA 1I0CA 3CC2Q 1PD1A 2KRNA 4E2FB 3A8GB 1QW1A 1M5Q1 3VUBA 4XTUA 2XI9A 2ATCB 2KSSA 5LJ5h 1RACB 4ZTFA 3M53A 1E7OA 2YDLA 5KYYB 1KFZA 4DBFA 2DXBA 4A4FA 1MV3A 4WTOB 4OMQA 4KBMB 2DEQA 1NJIU 1VQ7Q 4QQDA 2OAUA 4R0KA 2QA4Q 4J9IA 2JJ9A 1TTHB 2KRMA 1G3WA 1VOMA 2PTKA 1D3BA 1T0JA 2D8HA 3CC7T 3UDCA 2X4YA 2XKOC 2XIDA 1PM3A 5GAN7 2EQJA 1QVPA 3TQ7P 2LJ3A 3A5ZB 3J80E 1VQ9T 2DVJA 4ZGDB 2MIOA 3OY9A 1SHGA 2F5TX 3JV3A 1ARKA 2QAZA 1GCPA 1KHCA 5GAMf 3NTHA 3CC7A 3JCMe 2DJQA 3CC7Q 1KQ2A 1UGRB 4LDUA 5GAMd 1YHQT 2JNGA 3EG1A 3G71A 4X34A 5LJ5g 3VYGA 4RTVA 4JZ3A 2O01E 1V29B 2ZPIB 4RMOA 1Q82C 4Z89A 2EGAA 4MDWA 3CC4Q 4A4GA 2L0AA 2X3WD 4C92C 1IGUA 3L2UA 2F2XA 2B86A 3JB9D 3V8KA 4B9XA 2LVMA 2P0QA 3M4GA 4OF1A 2QEXT 3VU3C 3M5AA 2E5KA 4GLMA 2AZVA 3I55A 3CCLQ 4F7UE 1T0HA 5A0LA 2ZAEA 2DL3A 1ZSZC 2CH4A 1NYFA 1QLYA 4M75F 3RKXA 1IRXA 1E6GA 1KD1R 2JOYA 1K0SA 1GXIE 4BI8B 6AT1B 4BE0A 1Q81U 4E6RA 3M0TA 5CCAA 3JCMP 2RQWA 1PSFA 4LXCA 5FU6C 2O4XB 1T3SA 3M55A 4C8QC 3UF4A 5GAN3 1WZOA 1YJNQ 3I9QA 4GY5A 1RI0A 1PHTA 1NBEB 3C12A 4FYWB 3MEVA 2DBMA 3EAEA 2J6KA 3S6WA 1TUDA 3CBPA 2JZ2A 1OV3A 1U06A 3HFNA 5D6XA 1WXTA 1N9SA 1D1CA 2KK4A 3MEWA 4E7IA 1X6BA 2AIRB 3JCMd 1VQKT 2CH4W 5I2MA 1LVKA 2KGTA 3OYGA 5A0GA 2KXCA 3CCMT 1ABQA 1K9MR 4WCIA 4J9FA 2HQEA 2L5QA 3DB3A 4K11A 1TWBA 3SWNB 1YI2A 4JLGA 4BY6B 3JB9J 1YN8A 3OS0A 1H8KA 1GFCA 4VUBA 1Z9ZA 5IXBA 3GNFB 1M3CA 3VRZA 3FRNA 1UE9A 1VQ5T 1FMWA 3H0FA 4FM4B 3M56A 3G6EA 4A63B 1M1KU 2KRSA 4C92D 4CC3A 1U8RA 2RO0A 1YHQQ 1OPKA 1WXUA 4ANJA 1FX7A 3CD6T 1QP2A 2JT4A 4LDVA 3VS2A 1D0YA 4N4HA 3CCUQ 2DE0X 3VJPA 3CCRQ 2KE9A 1KG1A 5DM7R 4PLIA 4PJOG 3CMAQ 2AZSA 2D0NA 3RBBB 2CYZB 3QO3A 4PJLA 4ORZA 1JU5C 1B07A 3EFOA 2HD0A 1EZZB 1JO8A 4KGZB 1AWXA 4KT0E 2NUTA 4OMOA 2G6FX 5CQYA
chains in the Genus database with same CATH topology
5IAYA 2EFIA 3OSVA 3JCMc 1U1TA 1VQMT 5I2SA 3E19A 2WACA 1HK9A 2V8IA 3PIOA 4XU3A 3OYEA 1LOJA 3UWNA 1ZQ1A 2MMPA 2HAXA 3O8VA 4OVAA 3JCMX 4ZN1A 1G3YA 1UGPB 2R58A 3FLGA 3OMCA 4HA8A 3ZFJA 3BFMA 5A2QE 5DLQE 2M1HA 1KD1C 2PU9B 5FU6B 1VQ6T 4OB2B 2DD4A 4M75B 2H3JA 4M7DG 2LQKA 2WSFE 5GAN6 1BIAA 2QEXA 1YJWA 1K9MC 2OTLT 2LRQA 4QVDA 1EIFA 3GPLA 3T9NA 2RI2A 1NPPA 3MCAB 4BUGA 2XD0A 2IG0A 5DY9A 4Q5WA 5FLXE 3CC4T 2FB7A 3L2WA 2JN0A 3OYJA 4M75A 5GMKj 3TEEA 4LD9K 2CZ1B 4J7IA 1ZHIA 2PQWA 3FEOA 1M8VA 1YI2T 3CCEA 1M9SA 2E1HA 4EMGA 2V8JA 3JAME 2ZPFB 3OYIA 1W2BS 3CMAT 3HL8A 1U1SA 2A7YA 1NJIC 3J7AF 5LL6S 4L59A 4LDWA 4M77C 3OYCA 2XG8D 3URGA 3Q1JA 4E7HA 3E9FA 4Y28E 3LLRA 5GANj 4FT2A 5J39A 5GAOm 3CCRA 3AHUA 4ZN3A 3OS1A 3V7CA 3OW2S 3P8HA 3JCMV 4MDXA 1H641 4R55A 4EPCA 4E7KA 5CO7A 4XTXA 3CCLT 3JCMQ 2FHDA 3H8ZA 2IVWA 5I21A 4L5GA 3LYIA 3CCQA 2JUFA 5KE2A 4LD6A 4M7DE 3LWIA 5LJ3d 1S72A 2VXEA 1Q7YC 2K57A 2QQRA 4IURA 2P0PA 2KDSA 2RJCA 5KE3A 3GOXA 2ZPEB 3CCST 4M7DC 4A4EA 1Y96B 2ZGWA 4CI0C 4LDXA 1XTDA 3CCJT 2BKDN 4PKCC 2DZ9A 3C95A 5GAN5 3CCJA 4JRQA 2FL7A 1XOVA 3JCMg 4NS5A 2LQ8A 3QDRB 2GFUA 3CC2T 2KY9A 2PVDB 2ZPGB 3V7RA 5EG2A 4C5EA 2VUBA 2E6NA 1YJ9T 3M54A 3OS2A 2HNIA 1OYXA 3PMTA 2MF2A 2R5AA 3QZ9B 1KQSA 3OA6A 5KCHA 4M77G 5LJ5e 4ZGJB 3CCQT 4M78E 1VQ5A 5GAOp 5FRNA 2DIQA 4C8QB 4N0AC 3CCRT 1M90U 3BDUA 2EJ9A 3M59A 1BI3A 1K8AC 1XQHA 1Y71A 3FDRA 3CCUT 3RUXA 4RG8A 3CPFA 1KHIA 4MZTA 1QVGA 1BYMA 4OMFB 1WGSA 3CEYA 2LTOA 4BDYA 5CKHA 4M7AG 5HY6A 3GF5A 4M7AF 1OZ2A 3V8LA 2E64A 4PJOC 1NZ9A 3META 4F7UB 5GAN2 1BI0A 2A3LA 3A8HB 4IKFA 2E70A 2EJFA 2EQMA 3KXTA 5D6YA 2XHCA 5LJ3f 3L2RA 3MEAA 3OYKA 3CCMA 1R8OB 3LGFA 2VGMA 3LWHA 3GNGA 1UEBA 2M16A 3A8OB 2DTIA 2M0OA 5KCOA 3KBGA 1K8AU 2X4JA 2XK0A 4C92B 3QPHA 1MGQA 2KAFA 3FC3A 3MEUA 2ZPBB 2L3RA 3MHXA 3JCMW 1YJ9A 5HKCA 3MO8A 4MMKA 3CXCS 4FU6A 4PJOF 4E7JA 1KC8U 1VUBA 4M75C 3CBOA 1YIJA 4M78C 2NLUA 4HT9A 2E10A 2QQBA 2DIGA 4PL6A 4PJOD 3OYMA 4BE1A 3L42A 3JB9G 3OS5A 4XAXB 4C0DB 4C8QG 1M1GA 2FYKA 4C8QF 3QZ5B 3I56T 2D0QB 3JCMh 4C8QE 4JRPA 4M77B 4OGEA 2RHYA 3PT9A 1YJNT 3L2ZA 3GIBA 5GANh 2EQKA 2I2LA 3SWNC 3ZBDA 1VQOT 4QW2A 3HFOA 4BACA 3S3OA 2RA2A 5LJ5f 4M7AE 1S72T 4RG2A 3CCVA 4OB3B 1OZ3A 2RJFA 4ME7A 2RI5A 2DTOA 2VYTA 3JCMf 2DKGA 2CZ0B 2RM4A 2VC8A 4C92G 5C6SA 2D6FA 4C0ZA 1VQ4T 2VV5A 4ZTJA 1M1FA 2X4WA 4BI3A 4QVCA 3BY7A 3RESA 4PLLA 5GANe 4A53A 1UGQB 4EMKB 1I8FA 3DB4A 1KD1U 5CR2A 2ZZDA 1NE8A 3HPWA 3PTAA 3EFRA 4C5HA 1D3BB 2RHZA 1Q86U 5FU7B 2JTFA 4F7UA 4NL3A 3CMAA 2GF7A 4DOVA 4X9DA 2RH2A 3A8LB 4IUPA 1I4K1 4C92F 3LH0A 3NFCA 3HP9A 3VUZA 5J26A 5CIUA 1FXXA 1TH7A 3ER0A 4M75E 4NOYA 5GAOl 1YITT 3CPWA 1UB4A 5LJ3h 3QHSA 4QVZA 2VXFA 5DLOA 4M7DA 2RD1A 3E9GA 1LNXA 4NL2A 3G4ST 4LDYA 4M78D 3OSSC 3WVDB 5GMKi 3C4SA 3HHTB 4B9WA 2YLCA 4Z02A 2E5QA 3GLXA 3CD6A 2G3RA 5KH6A 3L2QA 2EIFA 3MP8A 2RJDA 2K3YA 4C92A 3PFSA 4HT8A 2BUDA 3PNWC 1RL2A 4FT4A 5CKEA 2CGHA 2KVQG 3QXEB 3INZA 3VV0A 3QJYA 5FRMA 1W4SA 2PUOB 1VQMA 4M75D 3QSUA 1M4ZA 3X26B 3M4YA 1WQWA 4M77E 3RMQA 1VQNA 2RI3A 3G6ET 2QA4T 3A8GB 1QW1A 1M5Q1 3VUBA 3OW2A 3OYFA 4XTUA 2XI9A 1VQ7T 4GLKA 2FVUA 5GAMh 4X9CA 1WJRA 2KSSA 3LW5E 1WNLA 5LJ5h 3P8DA 5GAOq 2X35A 2XDDA 3CPWS 1B34A 4HCCA 2K3XA 4ZTFA 3M53A 2R57A 3ASKA 4O5VA 4IUUA 1BKBA 1JBMA 3QG1A 2DXBA 1G3TA 4A4FA 3E1SA 2XDPA 5A0DA 4ZGEB 4KBMB 1PSEA 2DEQA 2RJEA 1H3ZA 1VQPA 5CKFA 3CCUA 1M1KC 1NJIU 3JB9F 4QQDA 2OAUA 5GMKl 5LJ3g 1BI2A 2LC4A 4J5YA 2PVOB 4PJOA 1VQ8T 4PJOE 1X6OA 3MP6A 2GCXA 3PGGA 4L6V5 2QI2A 1G3WA 1P92A 5HK0A 1IZ6A 1D3BA 2RK2A 3CC7T 3WXMB 4XTVA 3UDCA 2X4YA 2XKOC 2P0KA 1G5VA 4QQ6A 2EAYA 4MZMA 4JRKA 1VQLA 2XIDA 2LCCA 2DZCA 2ZPHB 2DTHA 5GAN7 2EQJA 3H6ZA 1QVPA 3QUIA 4RKUE 4RCCA 3A5ZB 3OB9A 2EYQA 4A4HA 3SB2A 3J80E 1VQ9T 4UC4A 4OGCA 4WF2A 4ZGDB 2GFAA 3OY9A 1NPRA 4EMHA 2F5TX 4KUDK 5CK9A 1YCYA 1JJ2S 2EJGA 2CZ6B 2YHTA 1KHCA 5GAMf 3NTHA 4O6JA 1YITA 3TCJA 3CC7A 1VQ8A 3JCMe 2F69A 4R56A 2QDYB 4J6YA 3VYHB 3TU4K 1KQ2A 2EKOA 3V7SA 4F7UG 1UGRB 4LDUA 5GAMd 5FROA 5GAMe 1YHQT 2F5KA 2JNGA 2DAQA 3ME9A 5AYFA 4M7AB 1VQPT 2C06A 3G71A 4X34A 4C5GA 3OBWA 5LJ5g 3VYGA 3DLMA 2E6ZA 2K5FA 5J3BA 4YTLA 1DJ7B 2O01E 1V29B 2ZPIB 4RMOA 5D6WA 3M9QA 4XU0A 1VQ4A 1Q82C 2CS7A 3X28B 4DQ2A 4M77D 4MDWA 2R5MA 2Y90A 2JTMA 3G7ZA 4A4GA 3CC4A 4C92C 4XTYA 3L2UA 3GP8A 4XTWA 3JB9D 2CZ7B 3KUFA 4J7FA 1JJ2A 3V8KA 4B9XA 2MAMA 2LVMA 2P0QA 3M4GA 4OF1A 4BE2A 1QVFS 2WSEE 3CMEA 2K4YA 4D6WA 2QEXT 3S3NA 1YJWT 2OTLA 1AHJB 1X01A 2KQWA 1K73C 2RB6A 3VU3C 1FWZA 4EDUA 4HKEA 3M5AA 3V8JA 4A4KA 2QTXA 3I55A 4M77F 3F70A 1KQ1A 1YIJT 1I5LA 4F7UE 3ZEHA 5A0LA 3RKYA 2DXUA 4JDSA 5CAIA 1Q82U 1WPYA 1VQ6A 1LJOA 4JS4A 1Q81C 1WJQA 2EWNA 4C0FA 3J81E 3HRSA 4C0GA 1Y7XA 3PMIA 3G4SA 4XU1A 5C0MA 4JRIA 5GMKe 3CMET 1KC8C 2HBPA 2M9UA 5GAOn 3OYAA 2DXTA 2K5IA 4M75F 5GAN4 3RKXA 2LX9A 2EQUA 5CKBA 2P4TA 2QQ9A 3JRZA 3A8MB 3UT1A 4BB7A 5GANf 2JOYA 3OMGA 1GXIE 5GAMg 4BI8B 3OQ5A 3L2VA 3RERA 4BE0A 2QQAA 3R6OA 5IT9E 4N0AA 4C5IA 4M7DD 1Y96A 2XICA 3BDLA 4J6WA 4M78G 1Q81U 1IREB 3HKSA 5CCAA 2B8AA 3JCMP 1JRIA 3NTKA 4MZPA 2LT4A 1PSFA 5IN1A 2K5LA 4FIBA 5LJ3e 4M77A 3M57A 3G71T 1JB0E 1MHNA 4J6XA 4OB0B 4DA4A 5FU6C 1Q7YU 3FIFA 2O4XB 4RCBA 3M55A 4C8QC 3OYDA 2AHJB 4M78A 1I81A 3M58A 4J8OA 5L8RE 5LJ5j 5GAN3 4V2SA 4HCZA 4HCBA 4TVRA 2PVGB 4OP0A 4C0DC 1YHQA 4M7DB 2RHUA 4GY5A 3CCVT 1YJNA 4OB1B 1RI0A 1VQOA 2BIVA 2DK3A 3L1AA 2OTJT 3C12A 1SSFA 2O4XA 2D9TA 3MEVA 4EMKA 3EAEA 4N4GA 3I56A 4M78B 3S6WA 1VQ9A 1N27A 3CBPA 4M7AC 2JZ2A 1G3SA 2DVEA 5GAN8 3HFNA 2RHXA 3SWNA 5D6XA 3CCSA 4ELZC 3I55T 1N9SA 1XNIA 4CRIA 2KK4A 3MEWA 1VQLT 3QJ6A 1QVGS 3VKIA 5GANd 3LX7A 4E7IA 1M90C 1QVFA 4BY6C 3JCMd 3P8BB 4E7LA 3JB9I 2E12A 5I2MA 2E41A 3OYGA 1O9SA 3QYHB 4JUVA 3OYHA 5A0GA 3CCLA 3OBYA 5GANg 1N8RC 4KUIA 1N6AA 4KULA 4E47A 3DKMA 5LJ5d 3CCMT 1B34B 5LJ3j 1BIBA 1X75C 3NTIA 1ZBXA 1YBYA 2HQEA 2L5QA 5GAOr 3BW1A 2E65A 4BI4A 4II1A 2DPPB 3DB3A 4BDZA 2RHIA 3HRTA 3DLLA 4M75G 3MP1A 4C8QA 3SWNB 1YI2A 5CVIA 4M7DF 4JLGA 4BY6B 1VIEA 4C92E 3N5BB 3JB9J 5CQXA 3OS0A 3JCMJ 1VQKT 2LCLA 5FU7C 4VUBA 1N8RU 2X4XA 5GMKh 3OYYA 5GMKm 4JJNK 2QXFA 3GNFB 4M78F 1O75A 1QP3A 2GQVA 3FRNA 3RMSA 4F7UF 1VQ5T 1VQ7A 2L8DA 3OYBA 4FM4B 4EMKC 3CC2A 3M56A 3G6EA 2QA4A 1M1KU 1VQKA 1VQNT 2MWOA 4BD3A 3FB9A 4XK8E 1HXDA 4M7AD 3S3MA 4JLIA 1WQ7A 4IUTA 3CXCA 3X25B 3QKJA 4C92D 1UGSB 1K9MU 1BI1A 1U8RA 2RO0A 3OYLA 4QQGA 4ATOA 3QBYA 2LNVA 2L89A 2MWPA 3JSCA 1N9RA 1VIFA 2V8KA 2WSCE 3CBMA 4DOWA 3RKWA 3TREA 3SFMA 2JVVA 4XU2A 1FX7A 4IUVA 3CD6T 4PJOB 4A54A 2Y4XA 2RK1A 3X20B 2XDBA 2K2VA 2OTJA 4J83A 4FSXA 3WVEB 1QP2A 4LDVA 4N4HA 3C94A 4XTZA 3EFSA 4P5NA 4JS5A 5HK3A 2DJZA 4MMLA 1K73U 2YLBA 2HQXA 2LT1A 4M7AA 1OI1A 2XU8A 1KQSS 3VJPA 1Q86C 3QYGB 1KG1A 4FL6A 5DM7R 5M9OA 3RIRA 4PLIA 4PJOG 3UPUA 3FJPA 4C8QD 1W2BA 2VGNA 2CYZB 3QO3A 3HRUA 3HSBA 3JB9H 3SDZA 2QQSA 2YRVA 4PNOA 3CCET 2MI6A 1WJSA 2DO3A 5CKDA 3PIPA 2HD0A 3X24B 4IUQA 1Y07A 2ZCFB 4KT0E 4N4IA 5GAMj 2CKKA 4XQ3A 3OYNA 2KMTA 3LGLA 5CQYA 3SD4A 3QIIA 4Y91A 3JCMb 4ELYC 2Y4YA 2PUKB 2LDMA 2DXCA 2DD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XK0 A;  2EFI A;  5IAY A;  2BIV A;  3FC3 A;  1SSF A;  2X4Y A;  2L3R A;  2O4X A;  2P0K A;  3MEU A;  4QQ6 A;  2D9T A;  3MEV A;  1G5V A;  2WAC A;  3EAE A;  4N4G A;  3MO8 A;  3S6W A;  3OYE A;  3UWN A;  1N27 A;  2LCC A;  4FU6 A;  3O8V A;  4OVA A;  2JZ2 A;  4E7J A;  2EQJ A;  2R58 A;  3FLG A;  3H6Z A;  3OMC A;  3OB9 A;  4A4H A;  2M1H A;  2NLU A;  2RHX A;  4UC4 A;  5D6X A;  2DIG A;  4PL6 A;  3OYM A;  4BE1 A;  1XNI A;  2GFA A;  3L42 A;  4CRI A;  3OY9 A;  3MEW A;  3QJ6 A;  4E7I A;  3LX7 A;  2RHY A;  2LRQ A;  1KHC A;  2EQK A;  3NTH A;  2RI2 A;  4E7L A;  4QW2 A;  3OYG A;  4BAC A;  3S3O A;  3OYH A;  2IG0 A;  4Q5W A;  4RG2 A;  2EKO A;  1OZ3 A;  2RJF A;  3L2W A;  2RI5 A;  5FRO A;  2VYT A;  3OYJ A;  2F5K A;  3ME9 A;  2DAQ A;  5C6S A;  2PQW A;  3FEO A;  4X34 A;  4C5G A;  3NTI A;  4ZTJ A;  2X4W A;  2HQE A;  3DLM A;  4PLL A;  3OYI A;  4II1 A;  3DB3 A;  3DB4 A;  4L59 A;  4BDZ A;  2RHI A;  3OYC A;  3Q1J A;  3MP1 A;  5D6W A;  4C5H A;  3M9Q A;  4E7H A;  2RHZ A;  3E9F A;  3LLR A;  2JTF A;  2GF7 A;  4IUP A;  5J39 A;  3OS0 A;  2R5M A;  3OS1 A;  3P8H A;  3LH0 A;  4A4G A;  4E7K A;  5J26 A;  5CIU A;  3L2U A;  2X4X A;  3KUF A;  2FHD A;  3H8Z A;  4B9X A;  4BE2 A;  2LVM A;  4QVZ A;  3LYI A;  2L8D A;  4LD6 A;  3E9G A;  5KE2 A;  3OYB A;  3S3N A;  2QQR A;  2MWO A;  2RJC A;  3C4S A;  4IUR A;  4B9W A;  4Z02 A;  4BD3 A;  4EDU A;  2E5Q A;  5KE3 A;  4A4E A;  3GOX A;  4IUT A;  3S3M A;  2G3R A;  5KH6 A;  3QKJ A;  3L2Q A;  2BKD N;  3F70 A;  3MP8 A;  2RJD A;  2RO0 A;  3ZEH A;  4QQG A;  3OYL A;  3QBY A;  2K3Y A;  2L89 A;  2MWP A;  3PFS A;  2BUD A;  1WJQ A;  3PNW C;  4NS5 A;  3PMI A;  2GFU A;  4IUV A;  5C0M A;  5FRM A;  4C5E A;  2E6N A;  3OS2 A;  3OYA A;  1OYX A;  2RI3 A;  3PMT A;  2R5A A;  3OA6 A;  5KCH A;  4N4H A;  3OYF A;  2EQU A;  3UT1 A;  5FRN A;  2DIQ A;  2HQX A;  1WJR A;  1OI1 A;  3OMG A;  3P8D A;  2X35 A;  2K3X A;  3OQ5 A;  3FDR A;  4ZTF A;  2R57 A;  3ASK A;  4FL6 A;  3L2V A;  4BE0 A;  5M9O A;  4IUU A;  4C5I A;  4PLI A;  3BDL A;  4A4F A;  1WGS A;  3CEY A;  2LTO A;  2XDP A;  2B8A A;  4BDY A;  1OZ2 A;  3NTK A;  2QQS A;  2YRV A;  3MET A;  1WJS A;  5IN1 A;  2RJE A;  1MHN A;  4IUQ A;  4IKF A;  1H3Z A;  2EQM A;  2O4X B;  4N4I A;  5D6Y A;  3OYD A;  3L2R A;  3MEA A;  3OYK A;  4QQD A;  2CKK A;  3OYN A;  3LGF A;  3LGL A;  3SD4 A;  3QII A;  4HCZ A;  2M16 A;  2LDM A;  2M0O A;  2RHU A;  3MP6 A;  4GY5 A;  5KCO A;  1RI0 A; 
#chains in the Genus database with same CATH topology
 1E6H A;  1HK9 A;  2V8I A;  3PIO A;  4XU3 A;  3OYE A;  4J9B A;  1ZQ1 A;  3JCM X;  4ZN1 A;  3FLG A;  5A2Q E;  1NEB A;  3MKD A;  2PU9 B;  2DEU A;  1VQN Q;  4F04 B;  1VQK Q;  2WSF E;  1BCM A;  4RTT A;  2EBP A;  1K9M C;  4QVD A;  1WXB A;  4BUG A;  1PWT A;  2XD0 A;  2DA9 A;  2HCK A;  5FLX E;  2FB7 A;  2JN0 A;  2HZY A;  3EGX A;  1W1F A;  1ZHI A;  3CCE A;  3JAM E;  3OYI A;  2A7Y A;  2K79 A;  4LDW A;  4M77 C;  3OYC A;  1YIT Q;  3E9F A;  2ED0 A;  2CUD A;  4FT2 A;  3OW2 S;  1IHW A;  1ZSZ B;  5CO7 A;  4IIO A;  4XTX A;  1TXQ A;  2FHD A;  2JUF A;  1W2B P;  1M2O A;  5KYN A;  4M7D C;  4A4E A;  1QKX A;  4CI0 C;  4PFO A;  3C95 A;  1RAA B;  4JZ4 A;  5EG2 A;  4JJB A;  3PMT A;  3I5S A;  5KCH A;  2HMA A;  3CCQ T;  4N0A C;  3M59 A;  1BI3 A;  2KYB A;  1MND A;  3CPF A;  1D0X A;  5CKH A;  1PNJ A;  3V8L A;  1WHK A;  1NZ9 A;  5GAN 2;  1BI0 A;  4IKF A;  4E7S A;  2XHC A;  3L2R A;  1R8O B;  2EYW A;  2J7I A;  3GNG A;  5IHI A;  4AT1 B;  5KCO A;  1K8A U;  2XK0 A;  3I55 Q;  2YRC A;  1TUC A;  3RNJ A;  1WHG A;  3MO8 A;  1EX4 A;  4E7J A;  1KC8 U;  1NM7 A;  2NLU A;  1RAH B;  2QQB A;  4PL6 A;  3OYM A;  2EGE A;  2FYK A;  3QZ5 B;  3I56 T;  1OPL A;  3GIB A;  4M77 B;  3L2Z A;  3SWN C;  1VQO T;  4QW2 A;  3S3O A;  1SG5 A;  2FG0 A;  2O88 A;  4ME7 A;  3CCV Q;  2DTO A;  1TG0 A;  3RR6 A;  5C6S A;  1VQ4 T;  1M1F A;  4BI3 A;  4QVC A;  4OMN A;  2KBT A;  1UGQ B;  4EMK B;  1NE8 A;  2AT1 B;  3MJX A;  1VQ5 Q;  1UEC A;  1X6G A;  4J9G A;  1Q86 U;  5FU7 B;  2JTF A;  2VWF A;  1Z9Q A;  2DIL A;  3A8L B;  1I4K 1;  2F2V A;  3HP9 A;  3VUZ A;  1RAG B;  5CIU A;  3ER0 A;  3VS4 A;  5GAO l;  1UB4 A;  5DLO A;  3QHS A;  1C0M A;  2RQV A;  3ULR B;  1YFN A;  3OSS C;  5GMK i;  3C4S A;  1TS9 A;  2G3R A;  3MP8 A;  2K3Y A;  2PNI A;  4PFZ A;  3PNW C;  2HDA A;  2CGH A;  1U3O A;  3VV0 A;  3QJY A;  1W4S A;  2PUO B;  1VQM A;  3EG0 A;  1AWJ A;  2IPO B;  2EVR A;  2CP6 A;  1OX8 A;  3OW2 A;  1A0N B;  4X9C A;  3LW5 E;  5GAO q;  4PJM A;  1TU0 B;  3ASK A;  3C0C A;  4IUU A;  1MNE A;  1G3T A;  2SEM A;  2XDP A;  3GBQ A;  2MPX C;  1CSK A;  3M0P A;  1PSE A;  1VQP A;  5CKF A;  1GBR A;  3JB9 F;  5GMK l;  1BI2 A;  1SEM A;  2LC4 A;  4J5Y A;  3G6E Q;  4PJO E;  1OX9 A;  3MP6 A;  1Q95 G;  1X6O A;  2GCX A;  4L6V 5;  1IZ6 A;  2CRE A;  3WXM B;  4XTV A;  1G5V A;  4QQ6 A;  1VYU A;  2KRO A;  7AT1 B;  4MZM A;  2MK5 A;  3QUI A;  4RKU E;  4A4H A;  2FZC B;  2HKQ B;  1G8X A;  2OTJ Q;  1RAD B;  4WF2 A;  1NPR A;  4KUD K;  1JJ2 S;  2CZ6 B;  1T3L A;  2DF6 A;  3NMZ C;  1YIT A;  1VQ8 A;  2F69 A;  4R56 A;  2QDY B;  4J6Y A;  3VYH B;  3TU4 K;  4F7U G;  3H9N A;  1V1C A;  5J3B A;  1KQS P;  4YTL A;  1WX6 A;  1DJ7 B;  1QCF A;  5D6W A;  3M9Q A;  4XU0 A;  1OOT A;  3R6N A;  2R5M A;  3G7Z A;  3CC4 A;  3EHQ A;  4EIK A;  1HSQ A;  4XTW A;  2CZ7 B;  3KUF A;  2MAM A;  4BE2 A;  2WSE E;  3CME A;  2K4Y A;  4D6W A;  1M2V B;  5KYW A;  1UGV A;  3S3N A;  1YJW T;  2OTL A;  1X01 A;  2HKN A;  2KQW A;  3V8J A;  1W70 A;  3M0U A;  2NUT B;  3RKY A;  2DXU A;  5CAI A;  1VQ6 A;  1Q82 U;  1WPY A;  1WJQ A;  4C0F A;  3PMI A;  4OML A;  5GMK e;  3CME T;  3NPF A;  2DXT A;  1K8A R;  5GAN 4;  2EQU A;  5CKB A;  2P4T A;  3JRZ A;  2RMO A;  1QMC A;  1YCS B;  2QAS A;  5KYW B;  5GAM g;  3OQ5 A;  3L2V A;  3BDL A;  1D09 B;  3HKS A;  4RTW A;  3EG2 A;  3NTK A;  4MZP A;  2K5L A;  4FIB A;  3G71 T;  4DA4 A;  3REB B;  3NHN A;  4OB0 B;  1Q7Y U;  1RUW A;  2DM1 A;  2L3Q A;  4M78 A;  3EG3 A;  3M58 A;  1D1A A;  4RTU A;  1M3B A;  4V2S A;  4HCB A;  4TVR A;  4C0D C;  4OP0 A;  1YHQ A;  4M7D B;  4OB1 B;  4FW2 A;  1D1B A;  2O4X A;  2LNH B;  4N4G A;  2EQI A;  1OUL A;  2RHX A;  1BK2 A;  1C1A A;  3IQL A;  1VYT A;  2LX7 A;  3VKI A;  5GAN d;  3UA7 A;  4BY6 C;  3P8B B;  4E7L A;  3JB9 I;  2E12 A;  2DRM A;  3QYH B;  1JEG A;  3OBY A;  2P4R A;  1VQ6 Q;  2HQH A;  4KUI A;  2ROT A;  1RLQ C;  1B34 B;  1K76 A;  1X75 C;  5GAO r;  3BW1 A;  1S1N A;  4II1 A;  3DLL A;  4M75 G;  3CD6 Q;  2ECZ A;  3I35 A;  1K73 R;  2QXF A;  1QP3 A;  4F7U F;  4ESR A;  5ECA A;  1IB8 A;  2K3B A;  4EMK C;  2QA4 A;  1VQK A;  2DMO A;  2MWO A;  4BD3 A;  4M7A D;  1YJW Q;  4JLI A;  4PFP A;  3X25 B;  3NGP A;  1UGS B;  1FMK A;  4ATO A;  3QBY A;  1N9R A;  2V8K A;  2WSC E;  2LJ0 A;  3RKW A;  2JVV A;  1N8R R;  1MMN A;  4PJO B;  3EGD A;  4A54 A;  2Y4X A;  2RK1 A;  1FYN A;  1YNZ A;  2OTJ A;  4FSX A;  4RTY A;  4XTZ A;  1B7T A;  2I0N A;  2LCS A;  2DJZ A;  4MML A;  2LMJ A;  1WHM A;  1VQ8 Q;  4FW1 A;  1NEG A;  2VAS A;  1Q86 C;  3QYG B;  2J6F A;  4CC4 B;  2VGN A;  3HRU A;  3SDZ A;  2FZG B;  4PNO A;  2DO3 A;  4IUQ A;  1UDL A;  1Y07 A;  4N4I A;  2CKK A;  3OYN A;  3SD4 A;  3QII A;  3JCM b;  1MV0 B;  2LDM A;  2PUK B;  1G2B A;  4DOW A;  5IAY A;  3JCM c;  1LOJ A;  3O8V A;  4KGV B;  1UGP B;  4HA8 A;  3BFM A;  5DLQ E;  2DL5 A;  4OB2 B;  2DD4 A;  4M75 B;  2C0T A;  1X2K A;  1M8M A;  2K7A A;  2QEX A;  2LRQ A;  2RI2 A;  1NPP A;  2DET A;  3L2W A;  2P84 A;  2A0F B;  1SRL A;  3TEE A;  5FWB A;  1CKA A;  1M8V A;  1SPK A;  1YI2 T;  1M9S A;  3EG9 A;  2ZPF B;  2CSI A;  1U1S A;  3VS7 A;  3REA B;  1ZA1 B;  1BBZ A;  5GAO m;  3AHU A;  2JMC A;  4MDX A;  3P8H A;  3JCM V;  1H64 1;  4EPC A;  3FJ5 A;  3CCL T;  3H8Z A;  4LD6 A;  4M7D E;  2VXE A;  1GFD A;  2FRW A;  2K57 A;  2QQR A;  4RUG A;  2P0P A;  5KE3 A;  2ZPE B;  1Y96 B;  1M1K R;  3HTR A;  1RAI B;  1Y57 A;  2FL7 A;  4KH1 B;  4NS5 A;  3CC2 T;  2EYX A;  2ZPG B;  3V7R A;  3M54 A;  3OS2 A;  2HNI A;  2MF2 A;  1KQS A;  2M02 A;  4J9C A;  4ZGJ B;  4M78 E;  2QDL A;  3CCR T;  1K1Z A;  1RLP C;  1ACM B;  1Y71 A;  3CCU T;  2HSE B;  3RUX A;  4D8D A;  3CEY A;  4BDY A;  5HY6 A;  2GGR A;  3GF5 A;  2E64 A;  3MET A;  3I56 Q;  2OI3 A;  2A3L A;  1X69 A;  4D8K A;  5D6Y A;  1YI2 Q;  3LGF A;  4DBR A;  4X1V A;  3KBG A;  2X4J A;  4C92 B;  2JXB A;  1YJ9 A;  3MHX A;  5HKC A;  4MMK A;  2DYB A;  1YIJ A;  3QDF A;  4M78 C;  2E10 A;  2DIG A;  4RTX A;  4C0D B;  4JRP A;  1ZLM A;  1EFN A;  4OGE A;  2RHY A;  3PT9 A;  1QCN A;  3ZBD A;  3HFO A;  2GQI A;  2RA2 A;  1S72 T;  1OZ3 A;  2COW A;  2RI5 A;  2VYT A;  2CZ0 B;  2RM4 A;  4QT7 A;  4C0Z A;  2VV5 A;  4ZTJ A;  2X4W A;  3I5R A;  4PLL A;  5GAN e;  1FMV A;  2BTT A;  1I8F A;  4Z88 A;  2ZZD A;  3HPW A;  2H8H A;  4C5H A;  4NL3 A;  2X51 A;  1WIE A;  2K2M A;  1HD3 A;  4IUP A;  4FCY A;  1KSW A;  5J26 A;  1FXX A;  1ZUU A;  1QWE A;  2VXF A;  1JJ2 P;  3E9G A;  1K0X A;  4LDY A;  2VB6 A;  3RDV A;  3WVD B;  3HHT B;  4B9W A;  2YLC A;  3CD6 A;  1ZSG A;  3L2Q A;  2RJD A;  4KH0 B;  3PFS A;  2IIM A;  4FT4 A;  1ZUK A;  1YJ9 Q;  5FRM A;  3EGX B;  4FSS A;  3QSU A;  2L3S A;  3M4Y A;  2EPD A;  1WQW A;  2DER A;  3G6E T;  4FYX B;  5GAM h;  1WNL A;  2X35 A;  3CPW S;  4HCC A;  2K3X A;  2R57 A;  2YRD A;  2L3P A;  1BKB A;  2J06 A;  3E1S A;  3PVL A;  4ZGE B;  2RJE A;  2EKH A;  1H3Z A;  3PVQ A;  1AZE A;  1ABO A;  5LJ3 g;  1SRM A;  4KGX B;  5HK0 A;  1GRI A;  1P92 A;  1X2Q A;  1Q82 R;  3D7S B;  4LN2 A;  2QGG A;  2LCC A;  2DZC A;  3OB9 A;  2EYQ A;  2DX1 A;  3SB2 A;  4UC4 A;  2YSQ A;  4OGC A;  4F17 A;  5CK9 A;  1YCY A;  1NLO C;  2EJG A;  1UHC A;  4O6J A;  4J9D A;  2KNB B;  5FRO A;  3ME9 A;  2DAQ A;  3G71 Q;  3DLM A;  3EHR A;  2E6Z A;  4AMC A;  2K5F A;  3EGD B;  4J9H A;  2CP7 A;  1VQ4 A;  3EFO B;  2CS7 A;  2LQN A;  4DQ2 A;  4M77 D;  2JTM A;  3VS1 A;  5L23 A;  4QKU A;  4XTY A;  1OQK A;  1WHH A;  4J7F A;  1JJ2 A;  2FPE A;  2O31 A;  3CME Q;  1QVF S;  2A08 A;  2NUP B;  2RB6 A;  1FWZ A;  4EDU A;  4HKE A;  4A4K A;  1YWP A;  3F70 A;  1I5L A;  1LJO A;  4JS4 A;  1UTI A;  3HRS A;  1UJ0 A;  2CT4 A;  1RAB B;  5C0M A;  1KC8 C;  5GAO n;  3OYA A;  2GBQ A;  2E4H A;  2K5I A;  1Q86 R;  2LX9 A;  5GAN f;  2QQ9 A;  3A8M B;  4BB7 A;  3CCM Q;  2NUP A;  2EYZ A;  2QQA A;  2RQU A;  3R6O A;  4N0A A;  1OU9 A;  4J6W A;  2XIC A;  1VA7 A;  1IRE B;  2B8A A;  3UA6 A;  2LT4 A;  5LJ3 e;  3M57 A;  4B6M A;  4J6X A;  4RCB A;  3CCQ Q;  1S72 Q;  1I81 A;  5LJ5 j;  4HCZ A;  4HVV A;  2RHU A;  1YJN A;  2BIV A;  2DK3 A;  2OTJ T;  2D9T A;  3I56 A;  4M78 B;  4AG1 C;  1G3S A;  2DVE A;  1U5S A;  2YUQ A;  3SWN A;  3CCS A;  2JS0 A;  3LX7 A;  1MMA A;  1QKW A;  2E41 A;  1O9S A;  3CCL A;  3OYH A;  5GAN g;  1N8R C;  2RN8 A;  3BE3 A;  3OW2 P;  4E47 A;  2NYS A;  2PZ1 A;  2OJ2 A;  2CP5 A;  1BIB A;  3NTI A;  4DBH A;  1YBY A;  1KK7 A;  1VYV A;  1M90 R;  4HCK A;  3HRT A;  4M7D F;  1VIE A;  4HVW A;  2W10 A;  2LZ6 B;  2LCL A;  1CKB A;  2DNU A;  5GMK h;  3OYY A;  5GMK m;  4JJN K;  1AVZ C;  1O75 A;  3RMS A;  1IXD A;  1BB9 A;  2L8D A;  3OYB A;  3CC2 A;  1VQN T;  2X3X D;  4XK8 E;  1HXD A;  2QEX Q;  1WQ7 A;  4IUT A;  3CXC A;  1K9M U;  1NG2 A;  4QQG A;  2LNV A;  2L89 A;  3JSC A;  3TRE A;  2V1Q A;  3SFM A;  1AEY A;  2J05 A;  4XU2 A;  2XDB A;  1WFW A;  4Z8A A;  3X20 B;  4J83 A;  3WVE B;  2EGC A;  3C94 A;  1GCQ A;  4JS5 A;  1K9A A;  2HQX A;  3VS5 A;  1UG1 A;  2A28 A;  2LT1 A;  1OI1 A;  1I5O B;  1KQS S;  2A36 A;  2C0I A;  3UAT A;  3KFV A;  3RIR A;  3TVT A;  3FJP A;  4AFU C;  4C8Q D;  1W2B A;  4LNP A;  3HSB A;  3JB9 H;  1WJS A;  2MI6 A;  3PIP A;  5CKD A;  1VQL Q;  2FPF A;  3X24 B;  1QCO A;  4F16 A;  3G1J A;  5GAM j;  1VQ4 Q;  2KMT A;  3CPW P;  4Y91 A;  1AT1 B;  5IXF A;  2DD5 A;  4M7A A;  2EFI A;  2FRY A;  5D7U A;  3OSV A;  1U1T A;  4DEX A;  1VQM T;  2KXD A;  5I2S A;  2WAC A;  2KT1 A;  3UWN A;  2MMP A;  2JM8 A;  1G3Y A;  2R58 A;  3OMC A;  1AWW A;  2DFU A;  1WYX A;  2H3J A;  4M7D G;  2LQK A;  2RF0 A;  1BIA A;  1IGQ A;  1YJW A;  2CDT A;  2ENM A;  2OTL T;  3GPL A;  2FO0 A;  5I11 A;  5DY9 A;  3VRY A;  4Q5W A;  3OYJ A;  4M75 A;  5GMK j;  1PRL C;  2PQW A;  3FEO A;  1PG5 B;  2E1H A;  2YUN A;  2YWW A;  4EMG A;  2V8J A;  1W2B S;  3HL8 A;  1AWO A;  1NJI C;  5LL6 S;  2BE7 D;  4E7H A;  4JJC A;  4Y28 E;  3CXC P;  1NLP C;  5J39 A;  2AK5 A;  4ZN3 A;  3V7C A;  4R55 A;  1N5Z A;  2QYZ A;  1WDX A;  2QG9 B;  2IVW A;  4AG2 C;  2EYY A;  4L5G A;  3LYI A;  3CCQ A;  1TUG B;  1Q7Y C;  1ZBJ A;  2F1L A;  2GNC A;  2RJC A;  2KDS A;  3GOX A;  4LDX A;  1XTD A;  3CCJ T;  2JM9 A;  4JRQ A;  2DL4 A;  1XOV A;  2O2O A;  1M27 C;  2JS2 A;  3QDR B;  2GFU A;  2OTL Q;  4OMP A;  2E6N A;  1OYX A;  3QZ9 B;  3OA6 A;  4M77 G;  2W0Z A;  1M90 U;  3BDU A;  3E2U A;  2DYI A;  4CC7 A;  2FPD A;  3FDR A;  4RG8 A;  1KC8 R;  2Z0W A;  1KHI A;  2F2W A;  1IHV A;  1QVG A;  3M0Q A;  1IO6 A;  2JTE A;  1WGS A;  4OMF B;  5AT1 B;  4M7A F;  2O9V A;  3TSZ A;  1PC0 A;  3A8H B;  5IHK A;  2M51 A;  4DBQ A;  1J3T A;  3MEA A;  1Y0M A;  2KI7 A;  2M16 A;  1PKS A;  3A8O B;  2DTI A;  2M0O A;  2CP2 A;  1TOV A;  3QPH A;  1MGQ A;  2KAF A;  3FC3 A;  2L3R A;  2MYS A;  3CXC S;  4PJO F;  1VUB A;  2EW3 A;  1MMD A;  4HT9 A;  4BE1 A;  3OS5 A;  4XAX B;  2MCN A;  4C8Q F;  2SRC A;  5KYX B;  4M7A E;  3CCV A;  4OB3 B;  2RJF A;  2VC8 A;  4C92 G;  2DBK A;  2ABL A;  1NJI R;  5IH2 A;  2BE9 B;  2CP0 A;  3BY7 A;  3RES A;  1LCK A;  4A53 A;  2L2P A;  1D0Z A;  2CP3 A;  1D3B B;  2GF7 A;  4DOV A;  2LJ1 A;  4C92 F;  1OU8 A;  3LH0 A;  1R0B G;  1MUZ A;  2GTO A;  2E3H A;  4M75 E;  4NOY A;  4JJD A;  1VQO Q;  4M7D A;  5KYU B;  4QVZ A;  4J9E A;  1LNX A;  4NL2 A;  4Z02 A;  5EC7 A;  5KH6 A;  8ATC B;  4C92 A;  3QXE B;  3INZ A;  4IIM A;  4M75 D;  1M4Z A;  3X26 B;  1VQN A;  1BCO A;  4M77 E;  3RMQ A;  5FWC A;  2RI3 A;  2QA4 T;  2LQW A;  3OYF A;  1VQ7 T;  1R77 A;  4GLK A;  1MMG A;  2FVU A;  3M0S A;  1WJR A;  2BZX A;  2NWM A;  3P8D A;  2ROL A;  2XDD A;  1Q81 R;  1B34 A;  4O5V A;  2HBW A;  4PK4 A;  3QWX X;  1JBM A;  3QG1 A;  5A0D A;  3CCU A;  1M1K C;  4PJO A;  2PVO B;  1SKU B;  1AD5 A;  9ATC B;  1VQ8 T;  3PGG A;  1JQQ A;  2FZK B;  2QI2 A;  1BU1 A;  2RK2 A;  3G4S Q;  2DRK A;  2P0K A;  1HJD A;  2EAY A;  2RQR A;  4JRK A;  1VQL A;  2ZPH B;  2DTH A;  3H6Z A;  1LPL A;  2CT3 A;  4RCC A;  1PRM C;  2GFA A;  4EMH A;  1ZSZ A;  2YHT A;  3EG9 B;  3TCJ A;  2EKO A;  1GBQ A;  3V7S A;  5GAM e;  2F5K A;  5AYF A;  2C06 A;  2DL7 A;  1VQP T;  4M7A B;  1GL5 A;  2A37 A;  4C5G A;  4RTZ A;  3OBW A;  1VQM Q;  2KYM A;  2QGF B;  4Y92 A;  4FYY B;  3X28 B;  3H0I A;  2Y90 A;  2VVK A;  3EH1 A;  3GP8 A;  1QQJ A;  5GJV B;  1TSF A;  1AHJ B;  1K73 C;  2HSP A;  2QTX A;  2KEA A;  2XMF A;  3SHW A;  2QK0 A;  4M77 F;  1KQ1 A;  1YIJ T;  2X9H A;  3ZEH A;  4JDS A;  1Q81 C;  2EWN A;  3J81 E;  2V26 A;  4C0G A;  1Y7X A;  3G4S A;  4XU1 A;  4JRI A;  2HBP A;  2M9U A;  2OAW A;  2JMA A;  2QTV A;  3UT1 A;  2AKK A;  3OMG A;  2HEQ A;  3RER A;  1PD0 A;  5IT9 E;  4C5I A;  4M7D D;  1Y96 A;  4LUE A;  4M78 G;  2OX7 A;  4KRT A;  1RAF B;  1JRI A;  2ESW A;  3VS6 A;  3THK A;  5IN1 A;  1KJW A;  3EGU A;  4M77 A;  1JB0 E;  1MHN A;  3FIF A;  3OYD A;  2AHJ B;  4J8O A;  5L8R E;  1AOJ A;  2PVG B;  3MPU B;  3CCV T;  3H41 A;  1VQO A;  3L1A A;  1SSF A;  4EMK A;  1I1J A;  2BZ8 A;  1VQ9 A;  1N27 A;  4M7A C;  3PE0 A;  2D1X A;  5GAN 8;  4ELZ C;  3I55 T;  1XNI A;  4CRI A;  1M30 A;  1H3H A;  1VQL T;  3QJ6 A;  1QVG S;  1M90 C;  1QVF A;  1I07 A;  3CQT A;  3U23 A;  1X43 A;  1QVG P;  4JUV A;  3M0R A;  4CC2 A;  1N6A A;  4KUL A;  3TSW A;  3DKM A;  5LJ5 d;  2J6O A;  5LJ3 j;  2NUZ A;  1ZBX A;  2E65 A;  4BI4 A;  2AKL A;  2DPP B;  1G83 A;  2ED1 A;  4BDZ A;  2RHI A;  3MP1 A;  4C8Q A;  5CVI A;  4C92 E;  4LE9 A;  3N5B B;  4HVU A;  5CQX A;  3JCM J;  5FU7 C;  5IHN A;  1N8R U;  1K4U S;  2X4X A;  4ZNX A;  4DEY A;  4M78 F;  2GQV A;  1VQ7 A;  4HXJ A;  3H0H A;  2CUB A;  3FB9 A;  3S3M A;  1UJY A;  1RI9 A;  3QKJ A;  2RPN A;  1BI1 A;  3OYL A;  3A98 A;  2MWP A;  4AFS C;  1VIF A;  3CBM A;  4IUV A;  3CCE Q;  2K2V A;  8AT1 B;  3EFS A;  4P5N A;  5HK3 A;  3O5Z A;  1K73 U;  2YLB A;  2XU8 A;  1SSH A;  1GCQ C;  4FL6 A;  5M9O A;  2JW4 A;  3UPU A;  1R0C B;  5KYX A;  3CCE T;  2QQS A;  2YRV A;  1WI7 A;  2M0Y A;  1Q7Y R;  1SF9 A;  2ZCF B;  5FW9 A;  4XQ3 A;  3LGL A;  4ELY C;  3CCJ Q;  2Y4Y A;  1PKT A;  2DXC A;  4GBQ A;  5HCK A;  3E19 A;  4M4Z A;  1V76 A;  2LP5 A;  2HAX A;  4OVA A;  5GAO p;  3ZFJ A;  2FEI A;  3QWY A;  2M1H A;  1KD1 C;  5FU6 B;  1VQ6 T;  4JPB W;  1OEB A;  5KYU A;  5GAN 6;  1QVF P;  1EIF A;  3T9N A;  3MCA B;  2IG0 A;  3CC4 T;  4LD9 K;  2CZ1 B;  4J7I A;  1UHF A;  3CMA T;  2KR3 A;  3J7A F;  4L59 A;  1RAE B;  1YWO A;  1PCX A;  2XG8 D;  3URG A;  3Q1J A;  1F1B B;  4F14 A;  3LLR A;  5GAN j;  1WLP B;  1B3Q A;  3AT1 B;  3CCR A;  3OS1 A;  4E7K A;  5KYY A;  3SEM A;  2V1R A;  4AFZ C;  3JCM Q;  5I21 A;  1ZUY A;  5KE2 A;  2YT6 A;  3LWI A;  5LJ3 d;  1S72 A;  4IUR A;  3CCS T;  2C0O A;  4AFQ C;  2ZGW A;  3ZL7 C;  2BKD N;  4PKC C;  2DZ9 A;  5GAN 5;  3CCJ A;  2E3I A;  2MOX A;  1M2V A;  5I22 A;  1ZA2 B;  1VQ9 Q;  1W6X A;  3JCM g;  2HL3 A;  2LQ8 A;  2KY9 A;  2PVD B;  4FYV B;  4C5E A;  2VUB A;  2DLP A;  1YJ9 T;  3CCS Q;  2R5A A;  1QWF A;  1XJW B;  5LJ5 e;  1VQ5 A;  1X27 A;  5FRN A;  2DIQ A;  4C8Q B;  2EJ9 A;  1K8A C;  1XQH A;  1H92 A;  4MZT A;  1BYM A;  3A1P A;  2LTO A;  4M7A G;  1OZ2 A;  4PJO C;  4F7U B;  1KIK A;  2E70 A;  2EJF A;  2EQM A;  3KXT A;  5LJ3 f;  3CCM A;  3OYK A;  2VGM A;  3LWH A;  2K6D A;  5GJW B;  1UEB A;  3VS3 A;  4OMM A;  2D8J A;  3LH5 A;  3MEU A;  2ZPB B;  3JCM W;  2YUP A;  2YXY A;  4FU6 A;  1YIJ Q;  4M75 C;  3CBO A;  1SHF A;  2CSQ A;  1WHJ A;  2YUO A;  1UFF A;  4PJN A;  1ZX6 A;  4PJO D;  3L42 A;  3JB9 G;  4C8Q G;  1M1G A;  2D0Q B;  3JCM h;  4C8Q E;  1YJN T;  1WA7 A;  5GAN h;  2EQK A;  2I2L A;  1WHL A;  4BAC A;  5LJ5 f;  2O9S A;  4RG2 A;  3JCM f;  3VS0 A;  2DKG A;  2D6F A;  1C6V X;  1JXO A;  1VQP Q;  1JXM A;  2RQT A;  1KD1 U;  3DB4 A;  5CR2 A;  2VKN A;  3PTA A;  3EFR A;  2GTJ A;  2RHZ A;  4F7U A;  3CMA A;  2COY A;  2COZ A;  2HL5 C;  4X9D A;  2RH2 A;  4LUD A;  2BZY A;  1AZG B;  1UUE A;  3NFC A;  1TH7 A;  2RNA A;  2KT8 A;  1YIT T;  3CPW A;  5LJ3 h;  1M3A A;  2RD1 A;  1HYO A;  3G4S T;  4M78 D;  2K9G A;  2E5Q A;  3GLX A;  1YP5 A;  2EIF A;  3EH2 A;  2H3E B;  4HT8 A;  2BUD A;  2DL8 A;  1NYG A;  1RL2 A;  4PJJ A;  5CKE A;  2KVQ G;  4E7Z A;  1I0C A;  3CC2 Q;  1PD1 A;  2KRN A;  4E2F B;  3A8G B;  1QW1 A;  1M5Q 1;  3VUB A;  4XTU A;  2XI9 A;  2ATC B;  2KSS A;  5LJ5 h;  1RAC B;  4ZTF A;  3M53 A;  1E7O A;  2YDL A;  5KYY B;  1KFZ A;  4DBF A;  2DXB A;  4A4F A;  1MV3 A;  4WTO B;  4OMQ A;  4KBM B;  2DEQ A;  1NJI U;  1VQ7 Q;  4QQD A;  2OAU A;  4R0K A;  2QA4 Q;  4J9I A;  2JJ9 A;  1TTH B;  2KRM A;  1G3W A;  1VOM A;  2PTK A;  1D3B A;  1T0J A;  2D8H A;  3CC7 T;  3UDC A;  2X4Y A;  2XKO C;  2XID A;  1PM3 A;  5GAN 7;  2EQJ A;  1QVP A;  3TQ7 P;  2LJ3 A;  3A5Z B;  3J80 E;  1VQ9 T;  2DVJ A;  4ZGD B;  2MIO A;  3OY9 A;  1SHG A;  2F5T X;  3JV3 A;  1ARK A;  2QAZ A;  1GCP A;  1KHC A;  5GAM f;  3NTH A;  3CC7 A;  3JCM e;  2DJQ A;  3CC7 Q;  1KQ2 A;  1UGR B;  4LDU A;  5GAM d;  1YHQ T;  2JNG A;  3EG1 A;  3G71 A;  4X34 A;  5LJ5 g;  3VYG A;  4RTV A;  4JZ3 A;  2O01 E;  1V29 B;  2ZPI B;  4RMO A;  1Q82 C;  4Z89 A;  2EGA A;  4MDW A;  3CC4 Q;  4A4G A;  2L0A A;  2X3W D;  4C92 C;  1IGU A;  3L2U A;  2F2X A;  2B86 A;  3JB9 D;  3V8K A;  4B9X A;  2LVM A;  2P0Q A;  3M4G A;  4OF1 A;  2QEX T;  3VU3 C;  3M5A A;  2E5K A;  4GLM A;  2AZV A;  3I55 A;  3CCL Q;  4F7U E;  1T0H A;  5A0L A;  2ZAE A;  2DL3 A;  1ZSZ C;  2CH4 A;  1NYF A;  1QLY A;  4M75 F;  3RKX A;  1IRX A;  1E6G A;  1KD1 R;  2JOY A;  1K0S A;  1GXI E;  4BI8 B;  6AT1 B;  4BE0 A;  1Q81 U;  4E6R A;  3M0T A;  5CCA A;  3JCM P;  2RQW A;  1PSF A;  4LXC A;  5FU6 C;  2O4X B;  1T3S A;  3M55 A;  4C8Q C;  3UF4 A;  5GAN 3;  1WZO A;  1YJN Q;  3I9Q A;  4GY5 A;  1RI0 A;  1PHT A;  1NBE B;  3C12 A;  4FYW B;  3MEV A;  2DBM A;  3EAE A;  2J6K A;  3S6W A;  1TUD A;  3CBP A;  2JZ2 A;  1OV3 A;  1U06 A;  3HFN A;  5D6X A;  1WXT A;  1N9S A;  1D1C A;  2KK4 A;  3MEW A;  4E7I A;  1X6B A;  2AIR B;  3JCM d;  1VQK T;  2CH4 W;  5I2M A;  1LVK A;  2KGT A;  3OYG A;  5A0G A;  2KXC A;  3CCM T;  1ABQ A;  1K9M R;  4WCI A;  4J9F A;  2HQE A;  2L5Q A;  3DB3 A;  4K11 A;  1TWB A;  3SWN B;  1YI2 A;  4JLG A;  4BY6 B;  3JB9 J;  1YN8 A;  3OS0 A;  1H8K A;  1GFC A;  4VUB A;  1Z9Z A;  5IXB A;  3GNF B;  1M3C A;  3VRZ A;  3FRN A;  1UE9 A;  1VQ5 T;  1FMW A;  3H0F A;  4FM4 B;  3M56 A;  3G6E A;  4A63 B;  1M1K U;  2KRS A;  4C92 D;  4CC3 A;  1U8R A;  2RO0 A;  1YHQ Q;  1OPK A;  1WXU A;  4ANJ A;  1FX7 A;  3CD6 T;  1QP2 A;  2JT4 A;  4LDV A;  3VS2 A;  1D0Y A;  4N4H A;  3CCU Q;  2DE0 X;  3VJP A;  3CCR Q;  2KE9 A;  1KG1 A;  5DM7 R;  4PLI A;  4PJO G;  3CMA Q;  2AZS A;  2D0N A;  3RBB B;  2CYZ B;  3QO3 A;  4PJL A;  4ORZ A;  1JU5 C;  1B07 A;  3EFO A;  2HD0 A;  1EZZ B;  1JO8 A;  4KGZ B;  1AWX A;  4KT0 E;  2NUT A;  4OMO A;  2G6F X;  5CQY A; 
#chains in the Genus database with same CATH homology
 5IAY A;  2EFI A;  3OSV A;  3JCM c;  1U1T A;  1VQM T;  5I2S A;  3E19 A;  2WAC A;  1HK9 A;  2V8I A;  3PIO A;  4XU3 A;  3OYE A;  1LOJ A;  3UWN A;  1ZQ1 A;  2MMP A;  2HAX A;  3O8V A;  4OVA A;  3JCM X;  4ZN1 A;  1G3Y A;  1UGP B;  2R58 A;  3FLG A;  3OMC A;  4HA8 A;  3ZFJ A;  3BFM A;  5A2Q E;  5DLQ E;  2M1H A;  1KD1 C;  2PU9 B;  5FU6 B;  1VQ6 T;  4OB2 B;  2DD4 A;  4M75 B;  2H3J A;  4M7D G;  2LQK A;  2WSF E;  5GAN 6;  1BIA A;  2QEX A;  1YJW A;  1K9M C;  2OTL T;  2LRQ A;  4QVD A;  1EIF A;  3GPL A;  3T9N A;  2RI2 A;  1NPP A;  3MCA B;  4BUG A;  2XD0 A;  2IG0 A;  5DY9 A;  4Q5W A;  5FLX E;  3CC4 T;  2FB7 A;  3L2W A;  2JN0 A;  3OYJ A;  4M75 A;  5GMK j;  3TEE A;  4LD9 K;  2CZ1 B;  4J7I A;  1ZHI A;  2PQW A;  3FEO A;  1M8V A;  1YI2 T;  3CCE A;  1M9S A;  2E1H A;  4EMG A;  2V8J A;  3JAM E;  2ZPF B;  3OYI A;  1W2B S;  3CMA T;  3HL8 A;  1U1S A;  2A7Y A;  1NJI C;  3J7A F;  5LL6 S;  4L59 A;  4LDW A;  4M77 C;  3OYC A;  2XG8 D;  3URG A;  3Q1J A;  4E7H A;  3E9F A;  4Y28 E;  3LLR A;  5GAN j;  4FT2 A;  5J39 A;  5GAO m;  3CCR A;  3AHU A;  4ZN3 A;  3OS1 A;  3V7C A;  3OW2 S;  3P8H A;  3JCM V;  4MDX A;  1H64 1;  4R55 A;  4EPC A;  4E7K A;  5CO7 A;  4XTX A;  3CCL T;  3JCM Q;  2FHD A;  3H8Z A;  2IVW A;  5I21 A;  4L5G A;  3LYI A;  3CCQ A;  2JUF A;  5KE2 A;  4LD6 A;  4M7D E;  3LWI A;  5LJ3 d;  1S72 A;  2VXE A;  1Q7Y C;  2K57 A;  2QQR A;  4IUR A;  2P0P A;  2KDS A;  2RJC A;  5KE3 A;  3GOX A;  2ZPE B;  3CCS T;  4M7D C;  4A4E A;  1Y96 B;  2ZGW A;  4CI0 C;  4LDX A;  1XTD A;  3CCJ T;  2BKD N;  4PKC C;  2DZ9 A;  3C95 A;  5GAN 5;  3CCJ A;  4JRQ A;  2FL7 A;  1XOV A;  3JCM g;  4NS5 A;  2LQ8 A;  3QDR B;  2GFU A;  3CC2 T;  2KY9 A;  2PVD B;  2ZPG B;  3V7R A;  5EG2 A;  4C5E A;  2VUB A;  2E6N A;  1YJ9 T;  3M54 A;  3OS2 A;  2HNI A;  1OYX A;  3PMT A;  2MF2 A;  2R5A A;  3QZ9 B;  1KQS A;  3OA6 A;  5KCH A;  4M77 G;  5LJ5 e;  4ZGJ B;  3CCQ T;  4M78 E;  1VQ5 A;  5GAO p;  5FRN A;  2DIQ A;  4C8Q B;  4N0A C;  3CCR T;  1M90 U;  3BDU A;  2EJ9 A;  3M59 A;  1BI3 A;  1K8A C;  1XQH A;  1Y71 A;  3FDR A;  3CCU T;  3RUX A;  4RG8 A;  3CPF A;  1KHI A;  4MZT A;  1QVG A;  1BYM A;  4OMF B;  1WGS A;  3CEY A;  2LTO A;  4BDY A;  5CKH A;  4M7A G;  5HY6 A;  3GF5 A;  4M7A F;  1OZ2 A;  3V8L A;  2E64 A;  4PJO C;  1NZ9 A;  3MET A;  4F7U B;  5GAN 2;  1BI0 A;  2A3L A;  3A8H B;  4IKF A;  2E70 A;  2EJF A;  2EQM A;  3KXT A;  5D6Y A;  2XHC A;  5LJ3 f;  3L2R A;  3MEA A;  3OYK A;  3CCM A;  1R8O B;  3LGF A;  2VGM A;  3LWH A;  3GNG A;  1UEB A;  2M16 A;  3A8O B;  2DTI A;  2M0O A;  5KCO A;  3KBG A;  1K8A U;  2X4J A;  2XK0 A;  4C92 B;  3QPH A;  1MGQ A;  2KAF A;  3FC3 A;  3MEU A;  2ZPB B;  2L3R A;  3MHX A;  3JCM W;  1YJ9 A;  5HKC A;  3MO8 A;  4MMK A;  3CXC S;  4FU6 A;  4PJO F;  4E7J A;  1KC8 U;  1VUB A;  4M75 C;  3CBO A;  1YIJ A;  4M78 C;  2NLU A;  4HT9 A;  2E10 A;  2QQB A;  2DIG A;  4PL6 A;  4PJO D;  3OYM A;  4BE1 A;  3L42 A;  3JB9 G;  3OS5 A;  4XAX B;  4C0D B;  4C8Q G;  1M1G A;  2FYK A;  4C8Q F;  3QZ5 B;  3I56 T;  2D0Q B;  3JCM h;  4C8Q E;  4JRP A;  4M77 B;  4OGE A;  2RHY A;  3PT9 A;  1YJN T;  3L2Z A;  3GIB A;  5GAN h;  2EQK A;  2I2L A;  3SWN C;  3ZBD A;  1VQO T;  4QW2 A;  3HFO A;  4BAC A;  3S3O A;  2RA2 A;  5LJ5 f;  4M7A E;  1S72 T;  4RG2 A;  3CCV A;  4OB3 B;  1OZ3 A;  2RJF A;  4ME7 A;  2RI5 A;  2DTO A;  2VYT A;  3JCM f;  2DKG A;  2CZ0 B;  2RM4 A;  2VC8 A;  4C92 G;  5C6S A;  2D6F A;  4C0Z A;  1VQ4 T;  2VV5 A;  4ZTJ A;  1M1F A;  2X4W A;  4BI3 A;  4QVC A;  3BY7 A;  3RES A;  4PLL A;  5GAN e;  4A53 A;  1UGQ B;  4EMK B;  1I8F A;  3DB4 A;  1KD1 U;  5CR2 A;  2ZZD A;  1NE8 A;  3HPW A;  3PTA A;  3EFR A;  4C5H A;  1D3B B;  2RHZ A;  1Q86 U;  5FU7 B;  2JTF A;  4F7U A;  4NL3 A;  3CMA A;  2GF7 A;  4DOV A;  4X9D A;  2RH2 A;  3A8L B;  4IUP A;  1I4K 1;  4C92 F;  3LH0 A;  3NFC A;  3HP9 A;  3VUZ A;  5J26 A;  5CIU A;  1FXX A;  1TH7 A;  3ER0 A;  4M75 E;  4NOY A;  5GAO l;  1YIT T;  3CPW A;  1UB4 A;  5LJ3 h;  3QHS A;  4QVZ A;  2VXF A;  5DLO A;  4M7D A;  2RD1 A;  3E9G A;  1LNX A;  4NL2 A;  3G4S T;  4LDY A;  4M78 D;  3OSS C;  3WVD B;  5GMK i;  3C4S A;  3HHT B;  4B9W A;  2YLC A;  4Z02 A;  2E5Q A;  3GLX A;  3CD6 A;  2G3R A;  5KH6 A;  3L2Q A;  2EIF A;  3MP8 A;  2RJD A;  2K3Y A;  4C92 A;  3PFS A;  4HT8 A;  2BUD A;  3PNW C;  1RL2 A;  4FT4 A;  5CKE A;  2CGH A;  2KVQ G;  3QXE B;  3INZ A;  3VV0 A;  3QJY A;  5FRM A;  1W4S A;  2PUO B;  1VQM A;  4M75 D;  3QSU A;  1M4Z A;  3X26 B;  3M4Y A;  1WQW A;  4M77 E;  3RMQ A;  1VQN A;  2RI3 A;  3G6E T;  2QA4 T;  3A8G B;  1QW1 A;  1M5Q 1;  3VUB A;  3OW2 A;  3OYF A;  4XTU A;  2XI9 A;  1VQ7 T;  4GLK A;  2FVU A;  5GAM h;  4X9C A;  1WJR A;  2KSS A;  3LW5 E;  1WNL A;  5LJ5 h;  3P8D A;  5GAO q;  2X35 A;  2XDD A;  3CPW S;  1B34 A;  4HCC A;  2K3X A;  4ZTF A;  3M53 A;  2R57 A;  3ASK A;  4O5V A;  4IUU A;  1BKB A;  1JBM A;  3QG1 A;  2DXB A;  1G3T A;  4A4F A;  3E1S A;  2XDP A;  5A0D A;  4ZGE B;  4KBM B;  1PSE A;  2DEQ A;  2RJE A;  1H3Z A;  1VQP A;  5CKF A;  3CCU A;  1M1K C;  1NJI U;  3JB9 F;  4QQD A;  2OAU A;  5GMK l;  5LJ3 g;  1BI2 A;  2LC4 A;  4J5Y A;  2PVO B;  4PJO A;  1VQ8 T;  4PJO E;  1X6O A;  3MP6 A;  2GCX A;  3PGG A;  4L6V 5;  2QI2 A;  1G3W A;  1P92 A;  5HK0 A;  1IZ6 A;  1D3B A;  2RK2 A;  3CC7 T;  3WXM B;  4XTV A;  3UDC A;  2X4Y A;  2XKO C;  2P0K A;  1G5V A;  4QQ6 A;  2EAY A;  4MZM A;  4JRK A;  1VQL A;  2XID A;  2LCC A;  2DZC A;  2ZPH B;  2DTH A;  5GAN 7;  2EQJ A;  3H6Z A;  1QVP A;  3QUI A;  4RKU E;  4RCC A;  3A5Z B;  3OB9 A;  2EYQ A;  4A4H A;  3SB2 A;  3J80 E;  1VQ9 T;  4UC4 A;  4OGC A;  4WF2 A;  4ZGD B;  2GFA A;  3OY9 A;  1NPR A;  4EMH A;  2F5T X;  4KUD K;  5CK9 A;  1YCY A;  1JJ2 S;  2EJG A;  2CZ6 B;  2YHT A;  1KHC A;  5GAM f;  3NTH A;  4O6J A;  1YIT A;  3TCJ A;  3CC7 A;  1VQ8 A;  3JCM e;  2F69 A;  4R56 A;  2QDY B;  4J6Y A;  3VYH B;  3TU4 K;  1KQ2 A;  2EKO A;  3V7S A;  4F7U G;  1UGR B;  4LDU A;  5GAM d;  5FRO A;  5GAM e;  1YHQ T;  2F5K A;  2JNG A;  2DAQ A;  3ME9 A;  5AYF A;  4M7A B;  1VQP T;  2C06 A;  3G71 A;  4X34 A;  4C5G A;  3OBW A;  5LJ5 g;  3VYG A;  3DLM A;  2E6Z A;  2K5F A;  5J3B A;  4YTL A;  1DJ7 B;  2O01 E;  1V29 B;  2ZPI B;  4RMO A;  5D6W A;  3M9Q A;  4XU0 A;  1VQ4 A;  1Q82 C;  2CS7 A;  3X28 B;  4DQ2 A;  4M77 D;  4MDW A;  2R5M A;  2Y90 A;  2JTM A;  3G7Z A;  4A4G A;  3CC4 A;  4C92 C;  4XTY A;  3L2U A;  3GP8 A;  4XTW A;  3JB9 D;  2CZ7 B;  3KUF A;  4J7F A;  1JJ2 A;  3V8K A;  4B9X A;  2MAM A;  2LVM A;  2P0Q A;  3M4G A;  4OF1 A;  4BE2 A;  1QVF S;  2WSE E;  3CME A;  2K4Y A;  4D6W A;  2QEX T;  3S3N A;  1YJW T;  2OTL A;  1AHJ B;  1X01 A;  2KQW A;  1K73 C;  2RB6 A;  3VU3 C;  1FWZ A;  4EDU A;  4HKE A;  3M5A A;  3V8J A;  4A4K A;  2QTX A;  3I55 A;  4M77 F;  3F70 A;  1KQ1 A;  1YIJ T;  1I5L A;  4F7U E;  3ZEH A;  5A0L A;  3RKY A;  2DXU A;  4JDS A;  5CAI A;  1Q82 U;  1WPY A;  1VQ6 A;  1LJO A;  4JS4 A;  1Q81 C;  1WJQ A;  2EWN A;  4C0F A;  3J81 E;  3HRS A;  4C0G A;  1Y7X A;  3PMI A;  3G4S A;  4XU1 A;  5C0M A;  4JRI A;  5GMK e;  3CME T;  1KC8 C;  2HBP A;  2M9U A;  5GAO n;  3OYA A;  2DXT A;  2K5I A;  4M75 F;  5GAN 4;  3RKX A;  2LX9 A;  2EQU A;  5CKB A;  2P4T A;  2QQ9 A;  3JRZ A;  3A8M B;  3UT1 A;  4BB7 A;  5GAN f;  2JOY A;  3OMG A;  1GXI E;  5GAM g;  4BI8 B;  3OQ5 A;  3L2V A;  3RER A;  4BE0 A;  2QQA A;  3R6O A;  5IT9 E;  4N0A A;  4C5I A;  4M7D D;  1Y96 A;  2XIC A;  3BDL A;  4J6W A;  4M78 G;  1Q81 U;  1IRE B;  3HKS A;  5CCA A;  2B8A A;  3JCM P;  1JRI A;  3NTK A;  4MZP A;  2LT4 A;  1PSF A;  5IN1 A;  2K5L A;  4FIB A;  5LJ3 e;  4M77 A;  3M57 A;  3G71 T;  1JB0 E;  1MHN A;  4J6X A;  4OB0 B;  4DA4 A;  5FU6 C;  1Q7Y U;  3FIF A;  2O4X B;  4RCB A;  3M55 A;  4C8Q C;  3OYD A;  2AHJ B;  4M78 A;  1I81 A;  3M58 A;  4J8O A;  5L8R E;  5LJ5 j;  5GAN 3;  4V2S A;  4HCZ A;  4HCB A;  4TVR A;  2PVG B;  4OP0 A;  4C0D C;  1YHQ A;  4M7D B;  2RHU A;  4GY5 A;  3CCV T;  1YJN A;  4OB1 B;  1RI0 A;  1VQO A;  2BIV A;  2DK3 A;  3L1A A;  2OTJ T;  3C12 A;  1SSF A;  2O4X A;  2D9T A;  3MEV A;  4EMK A;  3EAE A;  4N4G A;  3I56 A;  4M78 B;  3S6W A;  1VQ9 A;  1N27 A;  3CBP A;  4M7A C;  2JZ2 A;  1G3S A;  2DVE A;  5GAN 8;  3HFN A;  2RHX A;  3SWN A;  5D6X A;  3CCS A;  4ELZ C;  3I55 T;  1N9S A;  1XNI A;  4CRI A;  2KK4 A;  3MEW A;  1VQL T;  3QJ6 A;  1QVG S;  3VKI A;  5GAN d;  3LX7 A;  4E7I A;  1M90 C;  1QVF A;  4BY6 C;  3JCM d;  3P8B B;  4E7L A;  3JB9 I;  2E12 A;  5I2M A;  2E41 A;  3OYG A;  1O9S A;  3QYH B;  4JUV A;  3OYH A;  5A0G A;  3CCL A;  3OBY A;  5GAN g;  1N8R C;  4KUI A;  1N6A A;  4KUL A;  4E47 A;  3DKM A;  5LJ5 d;  3CCM T;  1B34 B;  5LJ3 j;  1BIB A;  1X75 C;  3NTI A;  1ZBX A;  1YBY A;  2HQE A;  2L5Q A;  5GAO r;  3BW1 A;  2E65 A;  4BI4 A;  4II1 A;  2DPP B;  3DB3 A;  4BDZ A;  2RHI A;  3HRT A;  3DLL A;  4M75 G;  3MP1 A;  4C8Q A;  3SWN B;  1YI2 A;  5CVI A;  4M7D F;  4JLG A;  4BY6 B;  1VIE A;  4C92 E;  3N5B B;  3JB9 J;  5CQX A;  3OS0 A;  3JCM J;  1VQK T;  2LCL A;  5FU7 C;  4VUB A;  1N8R U;  2X4X A;  5GMK h;  3OYY A;  5GMK m;  4JJN K;  2QXF A;  3GNF B;  4M78 F;  1O75 A;  1QP3 A;  2GQV A;  3FRN A;  3RMS A;  4F7U F;  1VQ5 T;  1VQ7 A;  2L8D A;  3OYB A;  4FM4 B;  4EMK C;  3CC2 A;  3M56 A;  3G6E A;  2QA4 A;  1M1K U;  1VQK A;  1VQN T;  2MWO A;  4BD3 A;  3FB9 A;  4XK8 E;  1HXD A;  4M7A D;  3S3M A;  4JLI A;  1WQ7 A;  4IUT A;  3CXC A;  3X25 B;  3QKJ A;  4C92 D;  1UGS B;  1K9M U;  1BI1 A;  1U8R A;  2RO0 A;  3OYL A;  4QQG A;  4ATO A;  3QBY A;  2LNV A;  2L89 A;  2MWP A;  3JSC A;  1N9R A;  1VIF A;  2V8K A;  2WSC E;  3CBM A;  4DOW A;  3RKW A;  3TRE A;  3SFM A;  2JVV A;  4XU2 A;  1FX7 A;  4IUV A;  3CD6 T;  4PJO B;  4A54 A;  2Y4X A;  2RK1 A;  3X20 B;  2XDB A;  2K2V A;  2OTJ A;  4J83 A;  4FSX A;  3WVE B;  1QP2 A;  4LDV A;  4N4H A;  3C94 A;  4XTZ A;  3EFS A;  4P5N A;  4JS5 A;  5HK3 A;  2DJZ A;  4MML A;  1K73 U;  2YLB A;  2HQX A;  2LT1 A;  4M7A A;  1OI1 A;  2XU8 A;  1KQS S;  3VJP A;  1Q86 C;  3QYG B;  1KG1 A;  4FL6 A;  5DM7 R;  5M9O A;  3RIR A;  4PLI A;  4PJO G;  3UPU A;  3FJP A;  4C8Q D;  1W2B A;  2VGN A;  2CYZ B;  3QO3 A;  3HRU A;  3HSB A;  3JB9 H;  3SDZ A;  2QQS A;  2YRV A;  4PNO A;  3CCE T;  2MI6 A;  1WJS A;  2DO3 A;  5CKD A;  3PIP A;  2HD0 A;  3X24 B;  4IUQ A;  1Y07 A;  2ZCF B;  4KT0 E;  4N4I A;  5GAM j;  2CKK A;  4XQ3 A;  3OYN A;  2KMT A;  3LGL A;  5CQY A;  3SD4 A;  3QII A;  4Y91 A;  3JCM b;  4ELY C;  2Y4Y A;  2PUK B;  2LDM A;  2DXC A;  2DD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...