2RHXA

Crystal structure of the 3-mbt repeats from human l3mbtl1 bound to dimethyl-lysine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
325
structure length
325
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2007-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rhxA03
3QBYA 2WACA 5KE3A 4E7KA 4QQ6A 2JZ2A 3O8VA 3ME9A 3M9QA 2LTOA 3KUFA 3PNWC 2DIGA 3LGLA 2F5KA 2RJDA 3QKJA 4HCZA 3S3OA 3LX7A 2RI2A 4N4GA 2NLUA 4ZTFA 2FHDA 2G3RA 2M0OA 3OS0A 4C5GA 2BKDN 5J26A 2P0KA 3S6WA 3LH0A 1N27A 2BUDA 3OMGA 4Q5WA 5J39A 3L2RA 1OI1A 1WJQA 4L59A 3MEVA 3L2VA 3FDRA 3DB4A 5FRNA 5IAYA 2VYTA 2X4WA 4FL6A 1RI0A 2L89A 2RI5A 4QVZA 4II1A 4E7LA 2O4XB 5KE2A 5KH6A 3S3NA 3ASKA 3F70A 5D6YA 2RHUA 4IURA 3OS1A 3ZEHA 2X35A 4UC4A 2RHZA 3PMIA 4EDUA 3OYEA 3MEUA 3MO8A 1H3ZA 4LD6A 3OYMA 3E9GA 2RO0A 2R5MA 4IUUA 3OYIA 1G5VA 4N4IA 4A4EA 1OYXA 3NTHA 3H6ZA 3MP1A 2JTFA 4QQGA 5D6XA 1WJSA 5D6WA 2RHYA 2GFUA 4ZTJA 2XDPA 3LGFA 2DIQA 4B9WA 2QQRA 3OYDA 3META 3H8ZA 5FROA 2YRVA 3L2QA 2EKOA 2LDMA 3PFSA 3OYJA 3BDLA 2BIVA 2DAQA 1SSFA 4E7HA 3MP6A 4IUQA 4N4HA 2LCCA 4OVAA 5KCHA 3MP8A 4E7IA 4C5HA 5CIUA 4BDYA 3UT1A 4BACA 3NTKA 4NS5A 2XK0A 2EQKA 2E5QA 5C6SA 3OYBA 3Q1JA 4BD3A 3OYAA 2LRQA 2M16A 1OZ3A 5KCOA 2M1HA 3S3MA 3UWNA 2K3XA 5M9OA 2RHIA 2O4XA 2EFIA 1WJRA 3OYCA 3OMCA 4A4HA 4CRIA 4C5IA 4GY5A 4FU6A 1OZ2A 2HQEA 4QQDA 4X34A 3LYIA 4A4FA 5C0MA 4C5EA 2RJCA 3OYLA 2R57A 3E9FA 2L3RA 4RG2A 4Z02A 2IG0A 2R58A 3OYGA 4IUVA 4IUPA 4IKFA 1XNIA 3OYHA 4BE1A 2L8DA 3OYKA 1WGSA 2GF7A 3OB9A 5FRMA 2RJEA 2MWOA 3MEWA 3L2UA 4E7JA 4PLLA 3CEYA 5IN1A 2MWPA 2GFAA 3FLGA 1KHCA 3MEAA 3PMTA 2X4YA 2R5AA 3OY9A 3OS2A 3GOXA 2PQWA 3OYFA 3OYNA 4QW2A 2RJFA 2HQXA 4BDZA 3QIIA 2B8AA 2RHXA 4BE0A 3DB3A 2RI3A 3NTIA 3OQ5A 4PLIA 2K3YA 3FC3A 3QJ6A 2EQJA 3C4SA 2CKKA 3FEOA 3LLRA 3SD4A 3L42A 2D9TA 2EQUA 1MHNA 4A4GA 2X4XA 3P8HA 2E6NA 3P8DA 2LVMA 4PL6A 3OA6A 3EAEA 3DLMA 2QQSA 3L2WA 4BE2A 4B9XA 2EQMA 4IUTA
chains in the Genus database with same CATH superfamily
4M75E 2F1LA 3QKJA 1YITT 4C5GA 1DJ7B 4PJOG 1MMDA 2VASA 1PD1A 4JRIA 5DM7R 1X01A 4Y91A 2FRWA 2V8KA 3EFRA 3EG9A 2CT4A 2V8JA 5KH6A 2OTJA 4GLMA 1W6XA 2LZ6B 3HRTA 2FO0A 1UE9A 2RO0A 4IUUA 2OI3A 2M02A 1YJWA 2K57A 3JCMP 3OW2S 3JCMh 2GFUA 4C92A 3VS2A 3LGFA 3J80E 3UA6A 2LQWA 3PFSA 2NYSA 4XQ3A 4IUQA 2IPOB 2GQIA 2DXBA 3BFMA 4M77C 2W10A 3MHXA 1PRLC 2M0YA 2M1HA 3M58A 4RTTA 1ZQ1A 5CKEA 5GANf 3VYGA 3P8BB 3CCST 1YIJA 2R58A 4IKFA 2JN0A 4BE1A 4IIOA 2RJEA 3MEWA 4E7JA 1O9SA 2PVGB 2DEQA 2IIMA 3VU3C 3OY9A 2CYZB 1EX4A 3QYHB 2MOXA 1RUWA 2QQBA 5FU7C 4GBQA 3VS1A 1WHGA 4X9CA 3HKSA 4D6WA 4PLIA 3RKWA 4OMQA 1TUCA 3T9NA 7AT1B 4M7AG 3L42A 2LCLA 5HK0A 3C0CA 4DEXA 2CH4A 2QG9B 3HTRA 4KH1B 3PNWC 1HSQA 3CCQQ 2K5LA 1S72T 5IXBA 3CCMT 2V26A 2JXBA 2FEIA 2K79A 2DF6A 2L0AA 4PNOA 4JUVA 3CXCP 2RM4A 2MF2A 2L89A 3RMQA 2E65A 5KE2A 3GBQA 1WFWA 5DY9A 3RKYA 3RKXA 1QVFS 2VVKA 4M75D 5CKBA 5LJ3d 2CP2A 3MO8A 1H3ZA 2KGTA 2DJQA 2RF0A 3E9GA 3CCLQ 2HMAA 2JS0A 3AT1B 3QZ5B 4O6JA 2HKNA 2RA2A 2ZAEA 3TEEA 1EIFA 1K8AC 1HJDA 2AIRB 2YRVA 2GCXA 1T0HA 3I56Q 4F17A 2LCCA 3J81E 1VQ6T 5KYUA 2DYBA 2CSIA 4E7IA 1GFDA 1KQSA 3OSSC 2KYBA 4AFZC 4JZ3A 2MI6A 5IH2A 2Y4XA 4Z89A 5KCOA 3CCVA 4RG8A 3UWNA 3SB2A 1WJRA 2F2XA 2NWMA 2JUFA 4A4FA 4M7DF 4XTUA 5DLQE 2JNGA 2KRMA 1NLOC 3JB9D 5I22A 2DBMA 3CMAQ 3UPUA 3M53A 1PD0A 2KSSA 1LPLA 3VUZA 1JXOA 5HK3A 4KBMB 4K11A 4M77D 4JRKA 3G4SQ 1MNEA 3JCMf 1K0SA 4FM4B 3HFOA 2RJFA 1OQKA 3EG1A 3CC2Q 3EHRA 3GNGA 4KRTA 3EGDB 4J9EA 1M2VA 4L6V5 1YNZA 1U1TA 2LMJA 2D9TA 1MV3A 2LVMA 1JB0E 2DFUA 1VQMQ 1PKSA 5GANe 1YJ9A 1IRXA 1KG1A 1JRIA 2JZ2A 3JCMV 3U23A 5GAMd 1GXIE 4PJOC 2HSEB 4ZTFA 4KGVB 4QKUA 1G3SA 5ECAA 2QQ9A 4M7DE 1BB9A 2EPDA 5GAOn 1KFZA 2K9GA 3VS7A 4II1A 3ZEHA 2X35A 1D09B 2LNHB 3OYEA 1KIKA 1KD1C 1X27A 3NTHA 3REBB 1H3HA 2KXCA 2PUKB 2RQRA 2QTXA 3D7SB 2DK3A 2Y90A 5FROA 3M0UA 1WQWA 1YJNA 5HKCA 4N4HA 4JZ4A 5GANg 1X2QA 3CD6T 1Y0MA 1N8RC 3E2UA 3CC7A 2COYA 1VQ8Q 3CCEQ 1A0NB 5LJ5d 2M16A 3N5BB 2ZPEB 1UECA 3H0FA 2GBQA 1SRLA 2RHIA 4RTZA 4CRIA 1VQKQ 1Y57A 1OZ2A 4QQDA 1UHCA 1GL5A 4AG2C 5CQXA 3UA7A 5DLOA 4RG2A 5J3BA 4FSXA 4OP0A 1UB4A 1Y96B 4KH0B 2ZGWA 1AWOA 4J9DA 2EBPA 2MWOA 1QVGS 1WYXA 2SEMA 4Z88A 1Q86U 1X75C 4NOYA 2EAYA 1PWTA 2M51A 3TQ7P 3SWNC 3OYNA 2HQXA 2YRDA 4C0ZA 2YUPA 2JTEA 1GCQC 3LH5A 5FW9A 2EQJA 4DBFA 2QAZA 4GLKA 1ABOA 1XTDA 4M7AA 3EAEA 2V1QA 4X9DA 2BE7D 1QVPA 1Q7YC 4KUIA 1QCOA 2FVUA 1HD3A 4J9HA 1XOVA 2DIGA 4BY6C 1CSKA 2FHDA 2KBTA 4BI4A 2G6FX 2QEXQ 1M8MA 1N27A 3LH0A 4Q5WA 1JJ2P 4PK4A 4MMLA 2MMPA 3FDRA 2KDSA 5IAYA 3JCMe 3CCRA 4JS5A 3G1JA 4QVZA 1UFFA 4OMLA 1VQ4A 2DEUA 5CR2A 2ZCFB 4CC7A 2H3EB 2ESWA 2ZPIB 4RMOA 1OEBA 2CT3A 4M75G 3I56T 4ELYC 4F04B 2QA4Q 2O01E 1AHJB 2RPNA 3JSCA 3H8ZA 1IO6A 4OB1B 1WHHA 1BI0A 1SSFA 4N0AA 4BACA 4CI0C 1M3AA 3PIPA 4F7UB 5LJ3h 1WLPB 4WCIA 4PJJA 3HL8A 1UGVA 1M1KU 3CMAT 3TSZA 3JCMg 2AZVA 3OYLA 1M1GA 2J6KA 2OTLQ 3H41A 5FLXE 2RQUA 3G71Q 1X6BA 1VUBA 1VQPQ 1I5LA 1B34B 2NUPB 4C0DC 3JB9G 4ANJA 1H641 1ARKA 1YI2Q 4B6MA 3QWYA 1Q82U 1UGSB 1Q81R 4M77G 3DKMA 4R55A 1VQMT 1SF9A 3DB3A 2RI3A 1RADB 1UGPB 2K6DA 4F7UA 2XDDA 2VXEA 5L23A 2E3HA 4LUDA 4PFPA 1UJYA 5IHIA 2BZXA 3CCUQ 2ZPGB 3HSBA 3OS5A 3VRZA 5KE3A 3QG1A 4C8QC 4LXCA 2NLUA 5I21A 1SSHA 1N9SA 3S6WA 1R8OB 4EMKC 4C8QE 3GIBA 2BUDA 1GRIA 3ZFJA 3CXCA 2AKKA 2MPXC 1KJWA 2DKGA 4ORZA 1NPPA 1UDLA 2JJ9A 2EYZA 2DJZA 4O5VA 3ULRB 4IURA 3PE0A 1W2BP 4Y92A 3OYIA 1Q7YU 1D1BA 1C0MA 3UATA 5CQYA 2A08A 3QUIA 4MDWA 1AEYA 3GPLA 1FMVA 4M78C 4BUGA 2EKOA 1VQ8T 3CCET 2DXUA 2I2LA 4PJMA 2KEAA 4OVAA 1VOMA 2HKQB 2KE9A 2XK0A 1VQKT 4FW2A 1YJWQ 3Q1JA 4FW1A 5IT9E 2DPPB 2GQVA 2XIDA 3PGGA 4FT4A 2ROLA 3G6EA 2JM9A 1NJIC 2D1XA 4J9BA 1VQLT 2DZ9A 1NYFA 2YRCA 1HYOA 1HK9A 2ZZDA 5IN1A 2O9VA 1WIEA 2MWPA 1KHCA 3CC4Q 5GMKm 5LJ5h 2CP5A 4JRQA 2H8HA 4JJDA 1MMNA 1KC8U 2KT8A 2JOYA 1WA7A 1YIJQ 2Y4YA 1FXXA 2YUNA 2LP5A 4OMNA 5FU6C 4AT1B 2KRSA 5GAN4 3M4YA 4RKUE 4BI3A 1ZX6A 2QEXT 1TOVA 1NBEB 3M54A 5I2SA 1M27C 5D7UA 3VJPA 3QWXX 1QKWA 5GMKh 2RH2A 2KK4A 2LT1A 3BW1A 2P84A 1X6GA 2LX7A 2RMOA 3L2VA 2CREA 1V76A 2CDTA 1OULA 3NMZC 3M59A 2QA4T 2COZA 3I55Q 4ZGEB 4XU0A 4J5YA 1VIEA 2XD0A 4C92F 1M3CA 2DX1A 3CCSA 4M75A 4C8QD 2ECZA 5D6XA 1K4US 2RHYA 3OW2P 1SPKA 2PNIA 4PJLA 2DL8A 3JRZA 5CO7A 4CC4B 1FWZA 4E47A 4ZGDB 5CIUA 1X69A 4NS5A 2L3SA 1BK2A 1BBZA 3WXMB 3OYBA 1O75A 1GBRA 1QWEA 2YLBA 4J7FA 4F14A 3G71T 4V2SA 1NPRA 1MGQA 2FZCB 1RABB 4M78D 5I11A 3QYGB 1WPYA 4LUEA 2LCSA 2IG0A 1YHQA 1XNIA 3A8HB 1WGSA 4WF2A 4PFOA 3CCVQ 4J9IA 1M90U 2DETA 2J6FA 1UJ0A 3I5RA 1RACB 3CPFA 2YUOA 4HT8A 3ZBDA 3PMTA 2R5AA 5FU7B 4C92E 1ACMB 3OYFA 3V7SA 1Q86R 4M77A 2EGAA 4BDZA 3EHQA 3NHNA 2FZGB 3WVEB 3DLLA 1VYUA 5CKDA 2KR3A 1UUEA 4AFUC 3NPFA 1MMGA 4XTXA 3CCJQ 1TXQA 1TWBA 2E1HA 2JTMA 3QBYA 4QVCA 4L5GA 4QVDA 1ZSGA 1WXUA 5CVIA 4ELZC 5A2QE 1C1AA 2KMTA 2M0OA 1X43A 2CP3A 1VQ6A 5J26A 3M0TA 2DLPA 1YWOA 1JJ2A 4LDXA 2BE9B 2QDYB 1PC0A 2RI5A 5GAN2 5L8RE 5GAOr 1YJ9Q 2X4JA 2ATCB 3MEUA 4LD6A 3EH2A 2CUBA 1QVFP 4FYXB 1VQ7Q 5LJ3j 4VUBA 5KYUB 2JTFA 4JRPA 1AWXA 1NM7A 2RQTA 2XHCA 2HQHA 2BIVA 2DAQA 1K9MU 1JQQA 6AT1B 2PTKA 2YHTA 2P4RA 3UT1A 2A7YA 1MNDA 2FPEA 2AKLA 2LX9A 3X26B 1G8XA 1YCYA 2VGMA 1X2KA 3CMEA 3HHTB 4FU6A 3QZ9B 4DOWA 1M1KR 4LDUA 3CC4T 1KHIA 1GFCA 2L8DA 2F2VA 5FRMA 2DZCA 1U8RA 2EYWA 4RCCA 3L2UA 2EWNA 4PLLA 2JVVA 4FYYB 5LJ3g 3IQLA 1MV0B 3TVTA 1M2VB 1Q82R 3OS2A 1OX9A 2WSFE 5CAIA 2DL5A 3FC3A 1ZSZC 2AT1B 3CPWP 1WNLA 1G3YA 2EJGA 1QKXA 3VKIA 3BE3A 1MHNA 4XU1A 1BYMA 1GBQA 5AT1B 4IIMA 2ZPFB 2DE0X 4PJOB 1M3BA 3ME9A 4PJOF 1E6HA 2LQNA 3S3OA 2RN8A 3OS0A 5GAMj 3I55T 2K5IA 4ZN3A 3CD6A 4L59A 1SEMA 2K3BA 2YXYA 1BIAA 3DB4A 1VQOA 1NEBA 1PHTA 1N5ZA 3R6OA 4MZTA 2HNIA 5KYYA 2XDBA 4E7LA 2L5QA 4OGCA 4UC4A 3L2ZA 3LWIA 1W2BA 2K2MA 1I81A 2DTHA 2FB7A 1G5VA 2K2VA 2PU9B 4KT0E 1BCMA 2AHJB 1Q7YR 3MP1A 4RCBA 1K0XA 2J6OA 3TREA 4M7DC 5CKHA 4PJOA 4C8QG 1VQ4Q 2A3LA 1VQ5Q 4BDYA 1SHFA 3RESA 4HVVA 3JCMQ 3GLXA 5LJ5j 1B3QA 2CH4W 1M8VA 2KI7A 2VWFA 4GY5A 1K9AA 2RJCA 3JB9I 2J05A 5GANd 3QHSA 1NE8A 4M78G 1LVKA 2D0NA 1VA7A 2GFAA 3FLGA 1QVGP 1C6VX 3SWNB 2O31A 1IXDA 2LC4A 4OB2B 4M7AB 5GMKj 3CCJT 4M7AF 3QIIA 3PTAA 1SHGA 4HVUA 3NTIA 2E64A 3OQ5A 1KC8R 3QJ6A 3KBGA 1K8AU 3LLRA 1RAIB 2GNCA 1EZZB 8AT1B 2E6NA 1I07A 3ER0A 3DLMA 2QQSA 2DBKA 3EG2A 3QXEB 3EG3A 3O8VA 2KQWA 3VUBA 1I8FA 4HCZA 5LJ5g 4XAXB 5A0GA 1YJ9T 1R77A 2P0KA 2L3QA 3OMGA 1J3TA 1WHKA 3X25B 2X4WA 3BY7A 3SWNA 3HRUA 1VQ7T 2O9SA 2ZPHB 3CCQT 2O4XB 4RTVA 1GCQA 3F70A 2RHUA 4RTUA 3OS1A 1AD5A 1QP2A 2RHZA 4JDSA 4JJNK 3PMIA 2YWWA 2EKHA 2R5MA 2X9HA 4HVWA 1VIFA 4OMPA 2E70A 4XTYA 4FT2A 1D0ZA 5CCAA 2YT6A 2K5FA 2MYSA 4XU3A 1WJSA 1Z9QA 3OW2A 2FYKA 1TS9A 2H3JA 2LDMA 3BDLA 1G3TA 2Z0WA 2D0QB 2FPFA 3CCLT 4JPBW 3NTKA 1I4K1 3X20B 2EJFA 1VQMA 2VB6A 2RQVA 1IHVA 3V7RA 5GAN3 3MCAB 4YTLA 2O4XA 3OYCA 4A4HA 2CUDA 4HA8A 4M7DD 1G3WA 1VQNQ 3E9FA 1AT1B 4C0DB 3OYGA 4IUVA 1I5OB 2RB6A 3HFNA 2QXFA 2GF7A 3RR6A 1SRMA 3EFOA 1M2OA 2DRMA 2RQWA 1JU5C 1TTHB 5A0LA 1JJ2S 4LDWA 1M90R 2XICA 1KD1U 1VQ9Q 4F7UF 3GOXA 2IVWA 3JCMd 3OBWA 3G6EQ 3SHWA 2VKNA 4X1VA 2AZSA 3EFSA 4JS4A 5GMKl 4LD9K 2KROA 1RAGB 3G4ST 2NUTA 3M0SA 5GAN8 1WX6A 2K4YA 3P8DA 3I9QA 4BE2A 4A63B 4B9XA 1ZLMA 3CC2T 3ZL7C 5GJVB 2K7AA 5GMKi 1N8RU 3M9QA 1NEGA 4KULA 2F5KA 2RJDA 3CCEA 1VQ8A 1FMKA 2HSPA 2G3RA 2J7IA 3FB9A 2BKDN 1RAEB 1PNJA 1OU8A 3QDFA 2KVQG 2EJ9A 5FRNA 1VQKA 2EW3A 1B7TA 4FL6A 3VS5A 1QLYA 4R56A 3R6NA 3PT9A 1AVZC 4BI8B 4P5NA 4DEYA 2CZ6B 3VYHB 1CKBA 5AYFA 1ZA2B 1QVFA 3O5ZA 2LQKA 4A4EA 2YDLA 4EIKA 3H6ZA 2B86A 1VQ5T 4F7UE 4JJCA 1VQLA 4RTYA 3KXTA 1D0XA 3VRYA 4HKEA 1UTIA 3L2QA 2AK5A 4Y28E 4C8QA 3A8GB 4PFZA 2BZYA 1KQSS 2YLCA 4EMKA 1K9MR 2LQ8A 2RNAA 3CCSQ 5EG2A 1AWWA 4BD3A 2GTOA 5GAMh 2YSQA 3NGPA 4C5IA 9ATCB 5C0MA 1ZUUA 5CKFA 2HBWA 3VS0A 3QSUA 3M0RA 3QPHA 4IUPA 2OTJQ 4M78A 1OU9A 5KYWB 1WI7A 2V1RA 4D8DA 3JAME 2D8JA 3I5SA 1WZOA 2KAFA 5GAOq 3AHUA 4MDXA 1ZBXA 2QA4A 2B8AA 1RAFB 3RDVA 3CPWA 2JW4A 2DTIA 1YHQQ 3JCMW 2HEQA 2CKKA 4PL6A 1S1NA 4CC3A 5GAOm 2COWA 1YITA 2JM8A 1WHLA 1YBYA 1W1FA 2XI9A 1D3BA 3CBOA 4LNPA 4FIBA 2A0FB 1ZA1B 2MAMA 5KYWA 3VS4A 3V7CA 2VYTA 1PRMC 5HCKA 1X6OA 2PVOB 4HCKA 4M75B 1K73C 5LJ3f 4J8OA 2QK0A 4M75F 1Q81C 3M55A 3MJXA 4OB0B 2LJ1A 2VXFA 2VUBA 1VQ6Q 3UDCA 2O2OA 1WXBA 2ED1A 4JLIA 4D8KA 4QQGA 2KRNA 5D6WA 4RTXA 1U3OA 2C06A 4ESRA 2JT4A 1YWPA 1RLPC 1GCPA 1E7OA 2DTOA 4XU2A 1VQNT 4OMFB 4LDVA 3OYAA 2F2WA 1ZHIA 2GGRA 1MMAA 3OMCA 2E3IA 2HD0A 4XTVA 2DD4A 2QTVA 2ROTA 4C5EA 2D6FA 1BIBA 2CSQA 2ED0A 2QDLA 4M7DG 1VQ9T 3OYKA 1WXTA 2DXTA 4M77B 2E5KA 4ZNXA 4PKCC 4M77F 3VS3A 1V1CA 1QVGA 2OTLT 3CMEQ 4FSSA 4AFSC 3L1AA 1QCNA 2DO3A 1VQPT 5GAN6 2DERA 4LDYA 3PIOA 3GP8A 1YI2T 1JEGA 2K3YA 3V8JA 2PUOB 2PZ1A 3CQTA 1K8AR 5CK9A 1M5Q1 1Z9ZA 1S72A 5GAMf 1UG1A 4OMMA 1BCOA 1U06A 3CCMA 4A53A 4C92C 3RERA 2OAUA 3LW5E 4DBQA 1LOJA 2A37A 3JV3A 1PG5B 3CCUT 2ZPBB 2EYQA 3FIFA 4FYVB 1K1ZA 3FJPA 1IGUA 1NJIU 3RUXA 5GAN5 3S3NA 3ASKA 5D6YA 1M4ZA 2XU8A 4M77E 1KQ2A 3M57A 4N4IA 1QCFA 1IHWA 3CC4A 4AMCA 2HZYA 3CD6Q 1VQOQ 1Y07A 1ZUKA 2C0OA 3E19A 3UF4A 4B9WA 4HT9A 2L2PA 1ZUYA 3QO3A 3OYJA 4J6XA 4KGXB 2WSEE 1TUDA 5KCHA 4C5HA 5KYXB 1K73U 5LJ5f 2EQKA 2DRKA 1Q81U 4J6WA 2I0NA 1IB8A 3NFCA 3A8MB 2E12A 5LJ3e 2EFIA 2OTJT 3JB9H 1NG2A 2R57A 5EC7A 1YJWT 5IHNA 1TH7A 1KSWA 2L3PA 4HCCA 1PSEA 2PVDB 1OPLA 3CEYA 3I55A 5GJWB 3EH1A 2DL4A 4NL3A 1YHQT 2A28A 2PQWA 1WHMA 5KYXA 1ZSZB 1TU0B 1KD1R 1YJNQ 1B07A 3M0QA 3SD4A 3FEOA 2DM1A 2E41A 1KQ1A 5LL6S 2DL7A 1QQJA 2C0IA 3A98A 2LJ0A 3CC7Q 3TSWA 3CBPA 3GF5A 1OOTA 2WACA 1W4SA 1YIJT 1QWFA 3LX7A 2CGHA 1OPKA 1N8RR 2CS7A 4DBHA 5KYYB 5FWBA 3CXCS 1RAAB 4AFQC 2QYZA 1I1JA 1MUZA 1RI0A 4J9GA 1AWJA 3FRNA 2JS2A 3MKDA 1ZSZA 1D0YA 1Q86C 1R0CB 2NUZA 2DXCA 4C92D 1G2BA 4HCBA 1BI2A 4WTOB 5A0DA 4M7DB 3KFVA 5GAMe 1V29B 2KXDA 4KUDK 4ZTJA 1QMCA 2XDPA 2QQRA 3META 1D1AA 1N9RA 3MP6A 2KY9A 2CP6A 1NYGA 2P0PA 1RI9A 3CCJA 2EGEA 4F16A 1RLQC 2HDAA 5GAOp 3TCJA 3QDRB 3CPWS 1P92A 1QW1A 1FX7A 4F7UG 3CCRQ 2DD5A 3RMSA 3CMET 3MPUB 3OYHA 4M7DA 2GTJA 3A1PA 3EGUA 1IREB 4FCYA 5GANj 1JXMA 2HAXA 1TG0A 3JB9J 2SRCA 1IZ6A 2OJ2A 2RK1A 2HL3A 2QASA 4XTWA 4A54A 5GAMg 2F5TX 2EQIA 4PJOE 2E6ZA 4QW2A 1VQ7A 5LJ5e 4TVRA 1G83A 3CCQA 2OX7A 1LCKA 2ENMA 4MZPA 4PJNA 2RK2A 2BTTA 2M9UA 3X28B 3CCVT 1OX8A 2MK5A 4E2FB 4J9CA 2X4XA 3P8HA 2KYMA 2XG8D 3OSVA 1LNXA 2F69A 3EGDA 1OV3A 2V8IA 1EFNA 3KUFA 2CZ0B 2W0ZA 3LGLA 1M1KC 1HXDA 3CCLA 2DVJA 5GMKe 4OMOA 3M4GA 1WQ7A 5J39A 3RBBB 3RIRA 3A8OB 5FWCA 1U1SA 3HP9A 3I56A 2QGFB 1VQOT 1Q82C 2LT4A 1M1FA 2EVRA 5IXFA 1YCSB 4BY6B 4LE9A 2X51A 1IGQA 1LJOA 8ATCB 4MMKA 3JCMb 4DBRA 3HPWA 4C0FA 3MP8A 3QJYA 3X24B 1ABQA 3A5ZB 2EGCA 3CMAA 2LRQA 1ZBJA 2VV5A 3S3MA 1VQLQ 3G4SA 1I0CA 4Z8AA 4M7AC 2HQEA 4C0GA 1D1CA 3EFOB 1SG5A 4M7AE 3CC2A 1TSFA 1W70A 2DILA 3VS6A 2DA9A 1YJNT 2DL3A 2CP0A 3C94A 1YP5A 2FG0A 2E4HA 3FJ5A 1Y96A 2NUTB 1VYVA 2HL5C 2JMAA 3TU4K 2KT1A 5IHKA 4FYWB 2KNBB 4E7SA 3CC7T 1QP3A 3PVQA 1AZGB 2XKOC 1AZEA 2EQUA 1JBMA 3C95A 1N6AA 2XMFA 3L2WA 1VQ5A 4E7KA 4CC2A 2WSCE 2LTOA 4PJOD 2MIOA 4N4GA 5GAOl 4N0AC 1T0JA 2QQAA 1VYTA 3G7ZA 3H0IA 3WVDB 4XK8E 1XQHA 4DOVA 3L2RA 1WHJA 2LNVA 1OI1A 4BB7A 3PVLA 1YITQ 2DYIA 3J7AF 1NJIR 2DNUA 3OYMA 4EPCA 4C8QB 1KC8C 4C8QF 1XJWB 2RD1A 2HBPA 4M4ZA 2FZKB 4EMKB 4C92G 2EYYA 2DIQA 4A4KA 1E6GA 2X3XD 4ATOA 4E7HA 2FL7A 3SDZA 2LJ3A 2VC8A 2X3WD 3M5AA 1Q95G 1KQSP 1Y7XA 3CCRT 3THKA 2JMCA 1K73R 1NLPC 1OZ3A 1VQ4T 1CKAA 4DA4A 2K3XA 2EIFA 3JCMc 4EMGA 4J7IA 2QGGA 2YUQA 4M78B 3LYIA 2CZ7B 4M78F 2E10A 2HCKA 4QT7A 2O88A 3OBYA 2CZ1B 4LN2A 4JJBA 4EMHA 1M9SA 3V8KA 4NL2A 3HRSA 2P0QA 3RNJA 1KK7A 3MEAA 4J6YA 2X4YA 1B34A 1PCXA 2NUPA 1FYNA 5GAN7 4MZMA 1F1BB 4M7AD 2QEXA 1H8KA 4RTWA 3C4SA 4JLGA 1D3BB 1PKTA 4A4GA 3OA6A 1T3LA 3BDUA 2EQMA 1BI3A 4OB3B 1WDXA 4QQ6A 2D8HA 1UHFA 2FRYA 3OYYA 5HY6A 3H0HA 2RI2A 1NZ9A 4XTZA 1WJQA 3MEVA 5FU6B 2C0TA 3M0PA 4M78E 1VQNA 1S72Q 2A36A 1W2BS 5GANh 2VGNA 3CCMQ 1YN8A 3LWHA 1M90C 4J83A 4AG1C 4EDUA 1BKBA 3CBMA 3EGXB 4HXJA 2FPDA 1OYXA 1Y71A 2CP7A 1VQ9A 1JO8A 1H92A 4ZGJB 1RAHB 2ABLA 3OYDA 4OF1A 1UGQB 3V8LA 4R0KA 1BU1A 2OTLA 3INZA 3G71A 3H9NA 1VQPA 2E5QA 5C6SA 3EG0A 1YI2A 4ZN1A 1UEBA 1M30A 4ME7A 2QI2A 3M56A 2DVEA 5M9OA 2P4TA 5I2MA 4RUGA 4X34A 3URGA 4J9FA 5KYNA 2L3RA 3E1SA 3EGXA 1PSFA 4Z02A 1YFNA 1UGRB 1AOJA 1FMWA 1T3SA 3OB9A 1K76A 1SKUB 2J06A 3C12A 1U5SA 1RL2A 1BI1A 3CCUA 2MCNA 4DQ2A 3SFMA 3JCMJ 3EG9B 3SEMA 1R0BG 4E6RA 2RHXA 4BE0A 4E7ZA 1K9MC 3JCMX 3I35A 2DMOA 2BZ8A 3JB9F 3GNFB 3REAB 3VV0A 2EYXA 4KGZB 2OAWA 1TUGB 1PM3A 4OGEA 3A8LB 4M75C 4C92B 4IUTA 3G6ET
chains in the Genus database with same CATH topology
2WACA 3QXEB 5KE3A 1W4SA 3O8VA 2KQWA 4M75E 1YIJT 3VUBA 1I8FA 4HCZA 5LJ5g 3QKJA 3QG1A 3LX7A 4C8QC 2CGHA 1YITT 2NLUA 2CS7A 4XAXB 5A0GA 1YJ9T 4C5GA 1DJ7B 4PJOG 5I21A 3CXCS 1N9SA 2P0KA 1R8OB 3S6WA 4EMKC 4C8QE 4JRIA 3GIBA 2BUDA 3OMGA 3ZFJA 5DM7R 1X01A 3CXCA 3X25B 4Y91A 2X4WA 1RI0A 2V8KA 3BY7A 3SWNA 2DKGA 3EFRA 3FRNA 1NPPA 3HRUA 1VQ7T 2ZPHB 2V8JA 3CCQT 2O4XB 5KH6A 2DJZA 4O5VA 3F70A 2RHUA 4IURA 2OTJA 3OS1A 4MMLA 1QP2A 2RHZA 4JDSA 4JJNK 3PMIA 1Q86C 3HRTA 3OYIA 2RO0A 2DXCA 2R5MA 4IUUA 1Q7YU 4C92D 1VIFA 2E70A 1BI2A 4XTYA 1YJWA 2K57A 4FT2A 4HCBA 3JCMP 5CQYA 5A0DA 4MDWA 3QUIA 5CCAA 3OW2S 4M7DB 5GAMe 2K5FA 1V29B 4XU3A 1WJSA 3JCMh 2GFUA 4KUDK 4C92A 3GPLA 3OW2A 4ZTJA 2XDPA 3LGFA 4M78C 2QQRA 3J80E 2FYKA 3META 4BUGA 2H3JA 2LDMA 2EKOA 3PFSA 1VQ8T 1N9RA 3BDLA 4XQ3A 3CCET 2DXUA 3MP6A 1G3TA 2KY9A 2I2LA 4IUQA 2D0QB 3CCLT 4OVAA 2P0PA 2DXBA 3NTKA 2XK0A 3BFMA 1I4K1 3CCJA 1VQKT 3X20B 4M77C 2EJFA 1VQMA 5GAOp 3Q1JA 3MHXA 5IT9E 1Q82C 2M1HA 2DPPB 3M58A 3TCJA 3V7RA 5GAN3 3MCAB 3QDRB 3CPWS 4YTLA 1P92A 1QW1A 2GQVA 2O4XA 2XIDA 3OYCA 1FX7A 4A4HA 3PGGA 4F7UG 4HA8A 1ZQ1A 5CKEA 2DD5A 1G3WA 5GANf 4FT4A 3VYGA 4M7DD 3E9FA 3P8BB 3RMSA 3G6EA 3CCST 1NJIC 4C0DB 3CMET 1YIJA 2R58A 3OYGA 4IKFA 4IUVA 2JN0A 2RB6A 3HFNA 3OYHA 4BE1A 4M7DA 2QXFA 1IREB 2GF7A 1VQLT 2DZ9A 2RJEA 5GANj 3MEWA 1QVGS 2HAXA 4E7JA 1HK9A 1O9SA 2ZZDA 5IN1A 3JB9J 2MWPA 1IZ6A 2PVGB 1KHCA 2RK1A 4XTWA 2DEQA 5A0LA 5GMKm 5LJ5h 3VU3C 4LDWA 1JJ2S 4A54A 5GAMg 2XICA 2F5TX 2CYZB 4F7UF 3OY9A 3QYHB 3GOXA 1KD1U 4JRQA 2IVWA 4PJOE 3JCMd 2E6ZA 4QW2A 2QQBA 5FU7C 1KC8U 5LJ5e 1VQ7A 3OBWA 4TVRA 3CCQA 3CD6A 2JOYA 4JS4A 3EFSA 4X9CA 3HKSA 4D6WA 4PLIA 4MZPA 3RKWA 2Y4YA 1FXXA 2RK2A 5GMKl 2M9UA 3X28B 3CCVT 3T9NA 4LD9K 5FU6C 4M7AG 3L42A 3G4ST 2LCLA 5GAN4 5GAN8 2X4XA 3M4YA 3P8HA 2K4YA 3P8DA 4RKUE 2XG8D 3OSVA 4BI3A 5HK0A 2QEXT 4BE2A 4B9XA 3CCUT 2F69A 1LNXA 3M54A 3CC2T 2V8IA 5I2SA 3VJPA 5GMKi 1N8RU 3M9QA 3KUFA 2CZ0B 3PNWC 4KULA 3LGLA 2F5KA 2RJDA 5GMKh 3CCEA 1VQ8A 1M1KC 2RH2A 1HXDA 2K5LA 1S72T 2KK4A 2G3RA 2LT1A 3CCLA 3BW1A 3FB9A 2BKDN 5GMKe 3CCMT 3M4GA 1WQ7A 2KVQG 5J39A 2EJ9A 3L2VA 5FRNA 4PNOA 1VQKA 4JUVA 3RIRA 3A8OB 2RM4A 4FL6A 2MF2A 2L89A 3RMQA 4R56A 1U1SA 2E65A 3M59A 3PT9A 2QA4T 5KE2A 3HP9A 5DY9A 3I56A 1VQOT 4BI8B 3RKYA 4P5NA 2LT4A 2CZ6B 3RKXA 1M1FA 3VYHB 4XU0A 4M75D 4ZGEB 1QVFS 4J5YA 5CKBA 1VIEA 5AYFA 5LJ3d 1H3ZA 3MO8A 4BY6B 3E9GA 2XD0A 4C92F 1QVFA 2LQKA 3QZ5B 4A4EA 4O6JA 3CCSA 4M75A 3H6ZA 4C8QD 1VQ5T 2RA2A 4F7UE 3TEEA 5D6XA 2RHYA 1VQLA 1EIFA 3KXTA 1K8AC 4HKEA 1LJOA 2YRVA 3L2QA 4Y28E 2GCXA 4C8QA 4MMKA 3A8GB 3JCMb 3HPWA 4C0FA 1KQSS 2YLCA 2LCCA 3J81E 1VQ6T 4EMKA 3JRZA 3MP8A 5CO7A 4E7IA 4ZGDB 1FWZA 3QJYA 4C92B 5CIUA 4E47A 2LQ8A 3X24B 1KQSA 4NS5A 3OSSC 3A5ZB 3CMAA 2MI6A 5EG2A 3WXMB 3OYBA 4BD3A 2LRQA 2Y4XA 1O75A 2VV5A 5KCOA 3CCVA 3S3MA 4J7FA 2YLBA 5GAMh 4RG8A 3UWNA 3G71T 4V2SA 3G4SA 3SB2A 1WJRA 1NPRA 1MGQA 4M7AC 4C5IA 5C0MA 2HQEA 2JUFA 4A4FA 4M7DF 4C0GA 5CKFA 4M78D 4XTUA 4M7AE 5DLQE 2JNGA 3CC2A 3JB9D 3QSUA 3QYGB 1WPYA 2IG0A 3QPHA 1YHQA 4IUPA 1XNIA 3A8HB 1WGSA 3UPUA 3M53A 4M78A 2KSSA 4WF2A 3VUZA 5HK3A 1YJNT 4KBMB 1M90U 3JAME 4M77D 4JRKA 3C94A 3CPFA 3JCMf 4HT8A 3ZBDA 3PMTA 1Y96A 2KAFA 2R5AA 5FU7B 4C92E 5GAOq 3AHUA 4MDXA 4FM4B 1ZBXA 3HFOA 3OYFA 3V7SA 2RJFA 3TU4K 4M77A 4BDZA 2QA4A 3WVEB 2B8AA 3CC7T 3DLLA 3GNGA 3CPWA 1QP3A 2DTIA 5CKDA 3JCMW 2CKKA 4L6V5 1U1TA 2XKOC 2D9TA 2EQUA 1JBMA 3C95A 4PL6A 2LVMA 4XTXA 1JB0E 5GAOm 1N6AA 3L2WA 1YITA 2E1HA 1YBYA 1VQ5A 5GANe 2JTMA 1YJ9A 3QBYA 4QVCA 4E7KA 1KG1A 4L5GA 4QVDA 1JRIA 2JZ2A 3JCMV 2XI9A 5GAMd 1D3BA 2WSCE 2LTOA 4PJOC 4PJOD 1GXIE 3CBOA 5CVIA 4ELZC 4N4GA 4FIBA 5GAOl 5A2QE 4ZTFA 2KMTA 2M0OA 2QQAA 3G7ZA 4N0AC 1VQ6A 2MAMA 5J26A 3WVDB 4XK8E 1XQHA 1JJ2A 4DOVA 3L2RA 4LDXA 1G3SA 2QDYB 2LNVA 4BB7A 1OI1A 2QQ9A 3V7CA 4M7DE 2VYTA 5GAOn 2RI5A 1X6OA 5GAN2 2PVOB 5L8RE 4II1A 5GAOr 4M75B 1K73C 5LJ3f 3J7AF 4J8OA 3ZEHA 2X35A 4M75F 1Q81C 2X4JA 3M55A 2OTJT 4OB0B 3OYEA 3MEUA 4LD6A 3OYMA 4EPCA 2VXFA 1KD1C 2VUBA 4C8QB 3UDCA 1KC8C 5LJ3j 3NTHA 4C8QF 4JLIA 2RD1A 2HBPA 4VUBA 4EMKB 4C92G 2JTFA 4QQGA 2PUKB 4JRPA 5D6WA 2QTXA 2DIQA 4A4KA 2DK3A 2Y90A 5FROA 2XHCA 2C06A 1WQWA 4ATOA 1YJNA 2BIVA 2DAQA 1K9MU 5HKCA 4E7HA 2FL7A 4N4HA 3SDZA 5GANg 2VC8A 3M5AA 2YHTA 3UT1A 2DTOA 3CD6T 4XU2A 2A7YA 1Y7XA 1N8RC 3CCRT 3CC7A 4OMFB 1VQNT 4LDVA 3OYAA 5LJ5d 2M16A 2LX9A 3N5BB 3X26B 1OZ3A 1YCYA 1ZHIA 2VGMA 1VQ4T 4DA4A 2ZPEB 2K3XA 2EIFA 2RHIA 3JCMc 4EMGA 3CMEA 3OMCA 3HHTB 4CRIA 2HD0A 4J7IA 4M78B 4FU6A 1OZ2A 4QQDA 4XTVA 3LYIA 2CZ7B 2DD4A 3QZ9B 4C5EA 4DOWA 2D6FA 4M78F 1BIBA 5CQXA 4LDUA 2E10A 5DLOA 4RG2A 5J3BA 3CC4T 1KHIA 4FSXA 4OP0A 4M7DG 1UB4A 1Y96B 1VQ9T 2L8DA 2ZGWA 2CZ1B 3OBYA 3OYKA 4EMHA 2DZCA 1U8RA 5FRMA 2MWOA 1M9SA 2DXTA 4M77B 4RCCA 2EWNA 3V8KA 4NL2A 4PLLA 2JVVA 2P0QA 3HRSA 3L2UA 4PKCC 4M77F 1QVGA 5LJ3g 3MEAA 1Q86U 2OTLT 4J6YA 2X4YA 1B34A 1X75C 2EAYA 4NOYA 3OS2A 3L1AA 2DO3A 1VQPT 3SWNC 5GAN6 3OYNA 2HQXA 4C0ZA 5GAN7 4MZMA 2WSFE 4LDYA 3PIOA 3GP8A 5CAIA 4M7AD 1YI2T 3FC3A 2K3YA 1WNLA 2QEXA 3V8JA 1G3YA 2EQJA 3C4SA 4JLGA 2PUOB 2EJGA 4GLKA 1D3BB 3VKIA 1MHNA 1XTDA 4XU1A 4A4GA 4M7AA 1BYMA 3OA6A 3EAEA 5CK9A 1M5Q1 4IUTA 1S72A 5GAMf 3BDUA 4X9DA 2EQMA 1BI3A 2ZPFB 4OB3B 4PJOB 1QVPA 3CCMA 4QQ6A 4A53A 1Q7YC 4KUIA 3ME9A 4C92C 4PJOF 2FVUA 3OYYA 1XOVA 2DIGA 5HY6A 4BY6C 3S3OA 2RI2A 2FHDA 3OS0A 5GAMj 1NZ9A 3HSBA 3RERA 2OAUA 3LW5E 4BI4A 3I55T 2K5IA 1LOJA 1N27A 3LH0A 4Q5WA 4XTZA 4ZN3A 1WJQA 2MMPA 2ZPBB 3MEVA 4L59A 3FDRA 1BIAA 2EYQA 3DB4A 2KDSA 3FIFA 5FU6B 5IAYA 3JCMe 3CCRA 1VQOA 4M78E 1VQNA 3FJPA 4JS5A 3R6OA 4MZTA 4QVZA 3RUXA 2HNIA 1NJIU 1W2BS 1VQ4A 2XDBA 5GANh 5GAN5 4E7LA 2L5QA 2VGNA 3S3NA 3ASKA 4OGCA 5D6YA 3LWHA 1M90C 5CR2A 2ZCFB 3L2ZA 4UC4A 3LWIA 1W2BA 4J83A 4EDUA 1I81A 1BKBA 2ZPIB 3CBMA 1M4ZA 2XU8A 4RMOA 2DTHA 2FB7A 4M77E 4M75G 1G5VA 1KQ2A 2K2VA 2PU9B 3M57A 4KT0E 4N4IA 4ELYC 1OYXA 1Y71A 3I56T 3CC4A 2AHJB 2O01E 3MP1A 1VQ9A 1Y07A 1AHJB 4RCBA 3TREA 4M7DC 5CKHA 3E19A 4ZGJB 4PJOA 4B9WA 4C8QG 3JSCA 3OYDA 4HT9A 3H8ZA 4OB1B 3QO3A 2A3LA 3OYJA 1BI0A 1SSFA 4J6XA 4N0AA 1UGQB 2WSEE 4OF1A 3V8LA 2OTLA 5KCHA 3INZA 4C5HA 3G71A 4BDYA 4BACA 1K73U 4CI0C 5LJ5f 1VQPA 2EQKA 2E5QA 1Q81U 3RESA 5C6SA 4J6WA 3JCMQ 3PIPA 4F7UB 5LJ3h 1YI2A 4ZN1A 1UEBA 3GLXA 4ME7A 2QI2A 3HL8A 2DVEA 3M56A 3A8MB 2E12A 3NFCA 2EFIA 2P4TA 5M9OA 5LJ3e 5LJ5j 1M1KU 3CMAT 1M8VA 3JB9H 5I2MA 4GY5A 4X34A 3JCMg 3URGA 2RJCA 3OYLA 3JB9I 1M1GA 2R57A 5FLXE 2L3RA 1YJWT 3E1SA 1PSFA 4Z02A 1UGRB 1VUBA 3QHSA 5GANd 1NE8A 1TH7A 1I5LA 4M78G 1B34B 4HCCA 4C0DC 1PSEA 2PVDB 3OB9A 1H641 3JB9G 3C12A 3CEYA 3I55A 1Q82U 4NL3A 1RL2A 2GFAA 1BI1A 1YHQT 3CCUA 3FLGA 1UGSB 4DQ2A 3SFMA 3SWNB 3JCMJ 4M77G 2LC4A 2PQWA 4OB2B 4M7AB 5GMKj 3CCJT 3DKMA 4R55A 4M7AF 3QIIA 2RHXA 3PTAA 1VQMT 4BE0A 3DB3A 2RI3A 2E64A 3NTIA 3OQ5A 1UGPB 3JCMX 1K9MC 4F7UA 3KBGA 2VXEA 3QJ6A 3LLRA 3FEOA 3SD4A 2XDDA 1K8AU 3JB9F 2E41A 1KQ1A 3GNFB 5LL6S 3VV0A 2E6NA 3ER0A 3DLMA 2QQSA 4OGEA 3A8LB 4M75C 3CBPA 2ZPGB 3GF5A 3OS5A 3G6ET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBY A;  2WAC A;  5KE3 A;  4E7K A;  4QQ6 A;  2JZ2 A;  3O8V A;  3ME9 A;  3M9Q A;  2LTO A;  3KUF A;  3PNW C;  2DIG A;  3LGL A;  2F5K A;  2RJD A;  3QKJ A;  4HCZ A;  3S3O A;  3LX7 A;  2RI2 A;  4N4G A;  2NLU A;  4ZTF A;  2FHD A;  2G3R A;  2M0O A;  3OS0 A;  4C5G A;  2BKD N;  5J26 A;  2P0K A;  3S6W A;  3LH0 A;  1N27 A;  2BUD A;  3OMG A;  4Q5W A;  5J39 A;  3L2R A;  1OI1 A;  1WJQ A;  4L59 A;  3MEV A;  3L2V A;  3FDR A;  3DB4 A;  5FRN A;  5IAY A;  2VYT A;  2X4W A;  4FL6 A;  1RI0 A;  2L89 A;  2RI5 A;  4QVZ A;  4II1 A;  4E7L A;  2O4X B;  5KE2 A;  5KH6 A;  3S3N A;  3ASK A;  3F70 A;  5D6Y A;  2RHU A;  4IUR A;  3OS1 A;  3ZEH A;  2X35 A;  4UC4 A;  2RHZ A;  3PMI A;  4EDU A;  3OYE A;  3MEU A;  3MO8 A;  1H3Z A;  4LD6 A;  3OYM A;  3E9G A;  2RO0 A;  2R5M A;  4IUU A;  3OYI A;  1G5V A;  4N4I A;  4A4E A;  1OYX A;  3NTH A;  3H6Z A;  3MP1 A;  2JTF A;  4QQG A;  5D6X A;  1WJS A;  5D6W A;  2RHY A;  2GFU A;  4ZTJ A;  2XDP A;  3LGF A;  2DIQ A;  4B9W A;  2QQR A;  3OYD A;  3MET A;  3H8Z A;  5FRO A;  2YRV A;  3L2Q A;  2EKO A;  2LDM A;  3PFS A;  3OYJ A;  3BDL A;  2BIV A;  2DAQ A;  1SSF A;  4E7H A;  3MP6 A;  4IUQ A;  4N4H A;  2LCC A;  4OVA A;  5KCH A;  3MP8 A;  4E7I A;  4C5H A;  5CIU A;  4BDY A;  3UT1 A;  4BAC A;  3NTK A;  4NS5 A;  2XK0 A;  2EQK A;  2E5Q A;  5C6S A;  3OYB A;  3Q1J A;  4BD3 A;  3OYA A;  2LRQ A;  2M16 A;  1OZ3 A;  5KCO A;  2M1H A;  3S3M A;  3UWN A;  2K3X A;  5M9O A;  2RHI A;  2O4X A;  2EFI A;  1WJR A;  3OYC A;  3OMC A;  4A4H A;  4CRI A;  4C5I A;  4GY5 A;  4FU6 A;  1OZ2 A;  2HQE A;  4QQD A;  4X34 A;  3LYI A;  4A4F A;  5C0M A;  4C5E A;  2RJC A;  3OYL A;  2R57 A;  3E9F A;  2L3R A;  4RG2 A;  4Z02 A;  2IG0 A;  2R58 A;  3OYG A;  4IUV A;  4IUP A;  4IKF A;  1XNI A;  3OYH A;  4BE1 A;  2L8D A;  3OYK A;  1WGS A;  2GF7 A;  3OB9 A;  5FRM A;  2RJE A;  2MWO A;  3MEW A;  3L2U A;  4E7J A;  4PLL A;  3CEY A;  5IN1 A;  2MWP A;  2GFA A;  3FLG A;  1KHC A;  3MEA A;  3PMT A;  2X4Y A;  2R5A A;  3OY9 A;  3OS2 A;  3GOX A;  2PQW A;  3OYF A;  3OYN A;  4QW2 A;  2RJF A;  2HQX A;  4BDZ A;  3QII A;  2B8A A;  2RHX A;  4BE0 A;  3DB3 A;  2RI3 A;  3NTI A;  3OQ5 A;  4PLI A;  2K3Y A;  3FC3 A;  3QJ6 A;  2EQJ A;  3C4S A;  2CKK A;  3FEO A;  3LLR A;  3SD4 A;  3L42 A;  2D9T A;  2EQU A;  1MHN A;  4A4G A;  2X4X A;  3P8H A;  2E6N A;  3P8D A;  2LVM A;  4PL6 A;  3OA6 A;  3EAE A;  3DLM A;  2QQS A;  3L2W A;  4BE2 A;  4B9X A;  2EQM A;  4IUT A; 
#chains in the Genus database with same CATH topology
 4M75 E;  2F1L A;  3QKJ A;  1YIT T;  4C5G A;  1DJ7 B;  4PJO G;  1MMD A;  2VAS A;  1PD1 A;  4JRI A;  5DM7 R;  1X01 A;  4Y91 A;  2FRW A;  2V8K A;  3EFR A;  3EG9 A;  2CT4 A;  2V8J A;  5KH6 A;  2OTJ A;  4GLM A;  1W6X A;  2LZ6 B;  3HRT A;  2FO0 A;  1UE9 A;  2RO0 A;  4IUU A;  2OI3 A;  2M02 A;  1YJW A;  2K57 A;  3JCM P;  3OW2 S;  3JCM h;  2GFU A;  4C92 A;  3VS2 A;  3LGF A;  3J80 E;  3UA6 A;  2LQW A;  3PFS A;  2NYS A;  4XQ3 A;  4IUQ A;  2IPO B;  2GQI A;  2DXB A;  3BFM A;  4M77 C;  2W10 A;  3MHX A;  1PRL C;  2M0Y A;  2M1H A;  3M58 A;  4RTT A;  1ZQ1 A;  5CKE A;  5GAN f;  3VYG A;  3P8B B;  3CCS T;  1YIJ A;  2R58 A;  4IKF A;  2JN0 A;  4BE1 A;  4IIO A;  2RJE A;  3MEW A;  4E7J A;  1O9S A;  2PVG B;  2DEQ A;  2IIM A;  3VU3 C;  3OY9 A;  2CYZ B;  1EX4 A;  3QYH B;  2MOX A;  1RUW A;  2QQB A;  5FU7 C;  4GBQ A;  3VS1 A;  1WHG A;  4X9C A;  3HKS A;  4D6W A;  4PLI A;  3RKW A;  4OMQ A;  1TUC A;  3T9N A;  7AT1 B;  4M7A G;  3L42 A;  2LCL A;  5HK0 A;  3C0C A;  4DEX A;  2CH4 A;  2QG9 B;  3HTR A;  4KH1 B;  3PNW C;  1HSQ A;  3CCQ Q;  2K5L A;  1S72 T;  5IXB A;  3CCM T;  2V26 A;  2JXB A;  2FEI A;  2K79 A;  2DF6 A;  2L0A A;  4PNO A;  4JUV A;  3CXC P;  2RM4 A;  2MF2 A;  2L89 A;  3RMQ A;  2E65 A;  5KE2 A;  3GBQ A;  1WFW A;  5DY9 A;  3RKY A;  3RKX A;  1QVF S;  2VVK A;  4M75 D;  5CKB A;  5LJ3 d;  2CP2 A;  3MO8 A;  1H3Z A;  2KGT A;  2DJQ A;  2RF0 A;  3E9G A;  3CCL Q;  2HMA A;  2JS0 A;  3AT1 B;  3QZ5 B;  4O6J A;  2HKN A;  2RA2 A;  2ZAE A;  3TEE A;  1EIF A;  1K8A C;  1HJD A;  2AIR B;  2YRV A;  2GCX A;  1T0H A;  3I56 Q;  4F17 A;  2LCC A;  3J81 E;  1VQ6 T;  5KYU A;  2DYB A;  2CSI A;  4E7I A;  1GFD A;  1KQS A;  3OSS C;  2KYB A;  4AFZ C;  4JZ3 A;  2MI6 A;  5IH2 A;  2Y4X A;  4Z89 A;  5KCO A;  3CCV A;  4RG8 A;  3UWN A;  3SB2 A;  1WJR A;  2F2X A;  2NWM A;  2JUF A;  4A4F A;  4M7D F;  4XTU A;  5DLQ E;  2JNG A;  2KRM A;  1NLO C;  3JB9 D;  5I22 A;  2DBM A;  3CMA Q;  3UPU A;  3M53 A;  1PD0 A;  2KSS A;  1LPL A;  3VUZ A;  1JXO A;  5HK3 A;  4KBM B;  4K11 A;  4M77 D;  4JRK A;  3G4S Q;  1MNE A;  3JCM f;  1K0S A;  4FM4 B;  3HFO A;  2RJF A;  1OQK A;  3EG1 A;  3CC2 Q;  3EHR A;  3GNG A;  4KRT A;  3EGD B;  4J9E A;  1M2V A;  4L6V 5;  1YNZ A;  1U1T A;  2LMJ A;  2D9T A;  1MV3 A;  2LVM A;  1JB0 E;  2DFU A;  1VQM Q;  1PKS A;  5GAN e;  1YJ9 A;  1IRX A;  1KG1 A;  1JRI A;  2JZ2 A;  3JCM V;  3U23 A;  5GAM d;  1GXI E;  4PJO C;  2HSE B;  4ZTF A;  4KGV B;  4QKU A;  1G3S A;  5ECA A;  2QQ9 A;  4M7D E;  1BB9 A;  2EPD A;  5GAO n;  1KFZ A;  2K9G A;  3VS7 A;  4II1 A;  3ZEH A;  2X35 A;  1D09 B;  2LNH B;  3OYE A;  1KIK A;  1KD1 C;  1X27 A;  3NTH A;  3REB B;  1H3H A;  2KXC A;  2PUK B;  2RQR A;  2QTX A;  3D7S B;  2DK3 A;  2Y90 A;  5FRO A;  3M0U A;  1WQW A;  1YJN A;  5HKC A;  4N4H A;  4JZ4 A;  5GAN g;  1X2Q A;  3CD6 T;  1Y0M A;  1N8R C;  3E2U A;  3CC7 A;  2COY A;  1VQ8 Q;  3CCE Q;  1A0N B;  5LJ5 d;  2M16 A;  3N5B B;  2ZPE B;  1UEC A;  3H0F A;  2GBQ A;  1SRL A;  2RHI A;  4RTZ A;  4CRI A;  1VQK Q;  1Y57 A;  1OZ2 A;  4QQD A;  1UHC A;  1GL5 A;  4AG2 C;  5CQX A;  3UA7 A;  5DLO A;  4RG2 A;  5J3B A;  4FSX A;  4OP0 A;  1UB4 A;  1Y96 B;  4KH0 B;  2ZGW A;  1AWO A;  4J9D A;  2EBP A;  2MWO A;  1QVG S;  1WYX A;  2SEM A;  4Z88 A;  1Q86 U;  1X75 C;  4NOY A;  2EAY A;  1PWT A;  2M51 A;  3TQ7 P;  3SWN C;  3OYN A;  2HQX A;  2YRD A;  4C0Z A;  2YUP A;  2JTE A;  1GCQ C;  3LH5 A;  5FW9 A;  2EQJ A;  4DBF A;  2QAZ A;  4GLK A;  1ABO A;  1XTD A;  4M7A A;  3EAE A;  2V1Q A;  4X9D A;  2BE7 D;  1QVP A;  1Q7Y C;  4KUI A;  1QCO A;  2FVU A;  1HD3 A;  4J9H A;  1XOV A;  2DIG A;  4BY6 C;  1CSK A;  2FHD A;  2KBT A;  4BI4 A;  2G6F X;  2QEX Q;  1M8M A;  1N27 A;  3LH0 A;  4Q5W A;  1JJ2 P;  4PK4 A;  4MML A;  2MMP A;  3FDR A;  2KDS A;  5IAY A;  3JCM e;  3CCR A;  4JS5 A;  3G1J A;  4QVZ A;  1UFF A;  4OML A;  1VQ4 A;  2DEU A;  5CR2 A;  2ZCF B;  4CC7 A;  2H3E B;  2ESW A;  2ZPI B;  4RMO A;  1OEB A;  2CT3 A;  4M75 G;  3I56 T;  4ELY C;  4F04 B;  2QA4 Q;  2O01 E;  1AHJ B;  2RPN A;  3JSC A;  3H8Z A;  1IO6 A;  4OB1 B;  1WHH A;  1BI0 A;  1SSF A;  4N0A A;  4BAC A;  4CI0 C;  1M3A A;  3PIP A;  4F7U B;  5LJ3 h;  1WLP B;  4WCI A;  4PJJ A;  3HL8 A;  1UGV A;  1M1K U;  3CMA T;  3TSZ A;  3JCM g;  2AZV A;  3OYL A;  1M1G A;  2J6K A;  2OTL Q;  3H41 A;  5FLX E;  2RQU A;  3G71 Q;  1X6B A;  1VUB A;  1VQP Q;  1I5L A;  1B34 B;  2NUP B;  4C0D C;  3JB9 G;  4ANJ A;  1H64 1;  1ARK A;  1YI2 Q;  4B6M A;  3QWY A;  1Q82 U;  1UGS B;  1Q81 R;  4M77 G;  3DKM A;  4R55 A;  1VQM T;  1SF9 A;  3DB3 A;  2RI3 A;  1RAD B;  1UGP B;  2K6D A;  4F7U A;  2XDD A;  2VXE A;  5L23 A;  2E3H A;  4LUD A;  4PFP A;  1UJY A;  5IHI A;  2BZX A;  3CCU Q;  2ZPG B;  3HSB A;  3OS5 A;  3VRZ A;  5KE3 A;  3QG1 A;  4C8Q C;  4LXC A;  2NLU A;  5I21 A;  1SSH A;  1N9S A;  3S6W A;  1R8O B;  4EMK C;  4C8Q E;  3GIB A;  2BUD A;  1GRI A;  3ZFJ A;  3CXC A;  2AKK A;  2MPX C;  1KJW A;  2DKG A;  4ORZ A;  1NPP A;  1UDL A;  2JJ9 A;  2EYZ A;  2DJZ A;  4O5V A;  3ULR B;  4IUR A;  3PE0 A;  1W2B P;  4Y92 A;  3OYI A;  1Q7Y U;  1D1B A;  1C0M A;  3UAT A;  5CQY A;  2A08 A;  3QUI A;  4MDW A;  1AEY A;  3GPL A;  1FMV A;  4M78 C;  4BUG A;  2EKO A;  1VQ8 T;  3CCE T;  2DXU A;  2I2L A;  4PJM A;  2KEA A;  4OVA A;  1VOM A;  2HKQ B;  2KE9 A;  2XK0 A;  1VQK T;  4FW2 A;  1YJW Q;  3Q1J A;  4FW1 A;  5IT9 E;  2DPP B;  2GQV A;  2XID A;  3PGG A;  4FT4 A;  2ROL A;  3G6E A;  2JM9 A;  1NJI C;  2D1X A;  4J9B A;  1VQL T;  2DZ9 A;  1NYF A;  2YRC A;  1HYO A;  1HK9 A;  2ZZD A;  5IN1 A;  2O9V A;  1WIE A;  2MWP A;  1KHC A;  3CC4 Q;  5GMK m;  5LJ5 h;  2CP5 A;  4JRQ A;  2H8H A;  4JJD A;  1MMN A;  1KC8 U;  2KT8 A;  2JOY A;  1WA7 A;  1YIJ Q;  2Y4Y A;  1FXX A;  2YUN A;  2LP5 A;  4OMN A;  5FU6 C;  4AT1 B;  2KRS A;  5GAN 4;  3M4Y A;  4RKU E;  4BI3 A;  1ZX6 A;  2QEX T;  1TOV A;  1NBE B;  3M54 A;  5I2S A;  1M27 C;  5D7U A;  3VJP A;  3QWX X;  1QKW A;  5GMK h;  2RH2 A;  2KK4 A;  2LT1 A;  3BW1 A;  2P84 A;  1X6G A;  2LX7 A;  2RMO A;  3L2V A;  2CRE A;  1V76 A;  2CDT A;  1OUL A;  3NMZ C;  3M59 A;  2QA4 T;  2COZ A;  3I55 Q;  4ZGE B;  4XU0 A;  4J5Y A;  1VIE A;  2XD0 A;  4C92 F;  1M3C A;  2DX1 A;  3CCS A;  4M75 A;  4C8Q D;  2ECZ A;  5D6X A;  1K4U S;  2RHY A;  3OW2 P;  1SPK A;  2PNI A;  4PJL A;  2DL8 A;  3JRZ A;  5CO7 A;  4CC4 B;  1FWZ A;  4E47 A;  4ZGD B;  5CIU A;  1X69 A;  4NS5 A;  2L3S A;  1BK2 A;  1BBZ A;  3WXM B;  3OYB A;  1O75 A;  1GBR A;  1QWE A;  2YLB A;  4J7F A;  4F14 A;  3G71 T;  4V2S A;  1NPR A;  1MGQ A;  2FZC B;  1RAB B;  4M78 D;  5I11 A;  3QYG B;  1WPY A;  4LUE A;  2LCS A;  2IG0 A;  1YHQ A;  1XNI A;  3A8H B;  1WGS A;  4WF2 A;  4PFO A;  3CCV Q;  4J9I A;  1M90 U;  2DET A;  2J6F A;  1UJ0 A;  3I5R A;  1RAC B;  3CPF A;  2YUO A;  4HT8 A;  3ZBD A;  3PMT A;  2R5A A;  5FU7 B;  4C92 E;  1ACM B;  3OYF A;  3V7S A;  1Q86 R;  4M77 A;  2EGA A;  4BDZ A;  3EHQ A;  3NHN A;  2FZG B;  3WVE B;  3DLL A;  1VYU A;  5CKD A;  2KR3 A;  1UUE A;  4AFU C;  3NPF A;  1MMG A;  4XTX A;  3CCJ Q;  1TXQ A;  1TWB A;  2E1H A;  2JTM A;  3QBY A;  4QVC A;  4L5G A;  4QVD A;  1ZSG A;  1WXU A;  5CVI A;  4ELZ C;  5A2Q E;  1C1A A;  2KMT A;  2M0O A;  1X43 A;  2CP3 A;  1VQ6 A;  5J26 A;  3M0T A;  2DLP A;  1YWO A;  1JJ2 A;  4LDX A;  2BE9 B;  2QDY B;  1PC0 A;  2RI5 A;  5GAN 2;  5L8R E;  5GAO r;  1YJ9 Q;  2X4J A;  2ATC B;  3MEU A;  4LD6 A;  3EH2 A;  2CUB A;  1QVF P;  4FYX B;  1VQ7 Q;  5LJ3 j;  4VUB A;  5KYU B;  2JTF A;  4JRP A;  1AWX A;  1NM7 A;  2RQT A;  2XHC A;  2HQH A;  2BIV A;  2DAQ A;  1K9M U;  1JQQ A;  6AT1 B;  2PTK A;  2YHT A;  2P4R A;  3UT1 A;  2A7Y A;  1MND A;  2FPE A;  2AKL A;  2LX9 A;  3X26 B;  1G8X A;  1YCY A;  2VGM A;  1X2K A;  3CME A;  3HHT B;  4FU6 A;  3QZ9 B;  4DOW A;  1M1K R;  4LDU A;  3CC4 T;  1KHI A;  1GFC A;  2L8D A;  2F2V A;  5FRM A;  2DZC A;  1U8R A;  2EYW A;  4RCC A;  3L2U A;  2EWN A;  4PLL A;  2JVV A;  4FYY B;  5LJ3 g;  3IQL A;  1MV0 B;  3TVT A;  1M2V B;  1Q82 R;  3OS2 A;  1OX9 A;  2WSF E;  5CAI A;  2DL5 A;  3FC3 A;  1ZSZ C;  2AT1 B;  3CPW P;  1WNL A;  1G3Y A;  2EJG A;  1QKX A;  3VKI A;  3BE3 A;  1MHN A;  4XU1 A;  1BYM A;  1GBQ A;  5AT1 B;  4IIM A;  2ZPF B;  2DE0 X;  4PJO B;  1M3B A;  3ME9 A;  4PJO F;  1E6H A;  2LQN A;  3S3O A;  2RN8 A;  3OS0 A;  5GAM j;  3I55 T;  2K5I A;  4ZN3 A;  3CD6 A;  4L59 A;  1SEM A;  2K3B A;  2YXY A;  1BIA A;  3DB4 A;  1VQO A;  1NEB A;  1PHT A;  1N5Z A;  3R6O A;  4MZT A;  2HNI A;  5KYY A;  2XDB A;  4E7L A;  2L5Q A;  4OGC A;  4UC4 A;  3L2Z A;  3LWI A;  1W2B A;  2K2M A;  1I81 A;  2DTH A;  2FB7 A;  1G5V A;  2K2V A;  2PU9 B;  4KT0 E;  1BCM A;  2AHJ B;  1Q7Y R;  3MP1 A;  4RCB A;  1K0X A;  2J6O A;  3TRE A;  4M7D C;  5CKH A;  4PJO A;  4C8Q G;  1VQ4 Q;  2A3L A;  1VQ5 Q;  4BDY A;  1SHF A;  3RES A;  4HVV A;  3JCM Q;  3GLX A;  5LJ5 j;  1B3Q A;  2CH4 W;  1M8V A;  2KI7 A;  2VWF A;  4GY5 A;  1K9A A;  2RJC A;  3JB9 I;  2J05 A;  5GAN d;  3QHS A;  1NE8 A;  4M78 G;  1LVK A;  2D0N A;  1VA7 A;  2GFA A;  3FLG A;  1QVG P;  1C6V X;  3SWN B;  2O31 A;  1IXD A;  2LC4 A;  4OB2 B;  4M7A B;  5GMK j;  3CCJ T;  4M7A F;  3QII A;  3PTA A;  1SHG A;  4HVU A;  3NTI A;  2E64 A;  3OQ5 A;  1KC8 R;  3QJ6 A;  3KBG A;  1K8A U;  3LLR A;  1RAI B;  2GNC A;  1EZZ B;  8AT1 B;  2E6N A;  1I07 A;  3ER0 A;  3DLM A;  2QQS A;  2DBK A;  3EG2 A;  3QXE B;  3EG3 A;  3O8V A;  2KQW A;  3VUB A;  1I8F A;  4HCZ A;  5LJ5 g;  4XAX B;  5A0G A;  1YJ9 T;  1R77 A;  2P0K A;  2L3Q A;  3OMG A;  1J3T A;  1WHK A;  3X25 B;  2X4W A;  3BY7 A;  3SWN A;  3HRU A;  1VQ7 T;  2O9S A;  2ZPH B;  3CCQ T;  2O4X B;  4RTV A;  1GCQ A;  3F70 A;  2RHU A;  4RTU A;  3OS1 A;  1AD5 A;  1QP2 A;  2RHZ A;  4JDS A;  4JJN K;  3PMI A;  2YWW A;  2EKH A;  2R5M A;  2X9H A;  4HVW A;  1VIF A;  4OMP A;  2E70 A;  4XTY A;  4FT2 A;  1D0Z A;  5CCA A;  2YT6 A;  2K5F A;  2MYS A;  4XU3 A;  1WJS A;  1Z9Q A;  3OW2 A;  2FYK A;  1TS9 A;  2H3J A;  2LDM A;  3BDL A;  1G3T A;  2Z0W A;  2D0Q B;  2FPF A;  3CCL T;  4JPB W;  3NTK A;  1I4K 1;  3X20 B;  2EJF A;  1VQM A;  2VB6 A;  2RQV A;  1IHV A;  3V7R A;  5GAN 3;  3MCA B;  4YTL A;  2O4X A;  3OYC A;  4A4H A;  2CUD A;  4HA8 A;  4M7D D;  1G3W A;  1VQN Q;  3E9F A;  1AT1 B;  4C0D B;  3OYG A;  4IUV A;  1I5O B;  2RB6 A;  3HFN A;  2QXF A;  2GF7 A;  3RR6 A;  1SRM A;  3EFO A;  1M2O A;  2DRM A;  2RQW A;  1JU5 C;  1TTH B;  5A0L A;  1JJ2 S;  4LDW A;  1M90 R;  2XIC A;  1KD1 U;  1VQ9 Q;  4F7U F;  3GOX A;  2IVW A;  3JCM d;  3OBW A;  3G6E Q;  3SHW A;  2VKN A;  4X1V A;  2AZS A;  3EFS A;  4JS4 A;  5GMK l;  4LD9 K;  2KRO A;  1RAG B;  3G4S T;  2NUT A;  3M0S A;  5GAN 8;  1WX6 A;  2K4Y A;  3P8D A;  3I9Q A;  4BE2 A;  4A63 B;  4B9X A;  1ZLM A;  3CC2 T;  3ZL7 C;  5GJV B;  2K7A A;  5GMK i;  1N8R U;  3M9Q A;  1NEG A;  4KUL A;  2F5K A;  2RJD A;  3CCE A;  1VQ8 A;  1FMK A;  2HSP A;  2G3R A;  2J7I A;  3FB9 A;  2BKD N;  1RAE B;  1PNJ A;  1OU8 A;  3QDF A;  2KVQ G;  2EJ9 A;  5FRN A;  1VQK A;  2EW3 A;  1B7T A;  4FL6 A;  3VS5 A;  1QLY A;  4R56 A;  3R6N A;  3PT9 A;  1AVZ C;  4BI8 B;  4P5N A;  4DEY A;  2CZ6 B;  3VYH B;  1CKB A;  5AYF A;  1ZA2 B;  1QVF A;  3O5Z A;  2LQK A;  4A4E A;  2YDL A;  4EIK A;  3H6Z A;  2B86 A;  1VQ5 T;  4F7U E;  4JJC A;  1VQL A;  4RTY A;  3KXT A;  1D0X A;  3VRY A;  4HKE A;  1UTI A;  3L2Q A;  2AK5 A;  4Y28 E;  4C8Q A;  3A8G B;  4PFZ A;  2BZY A;  1KQS S;  2YLC A;  4EMK A;  1K9M R;  2LQ8 A;  2RNA A;  3CCS Q;  5EG2 A;  1AWW A;  4BD3 A;  2GTO A;  5GAM h;  2YSQ A;  3NGP A;  4C5I A;  9ATC B;  5C0M A;  1ZUU A;  5CKF A;  2HBW A;  3VS0 A;  3QSU A;  3M0R A;  3QPH A;  4IUP A;  2OTJ Q;  4M78 A;  1OU9 A;  5KYW B;  1WI7 A;  2V1R A;  4D8D A;  3JAM E;  2D8J A;  3I5S A;  1WZO A;  2KAF A;  5GAO q;  3AHU A;  4MDX A;  1ZBX A;  2QA4 A;  2B8A A;  1RAF B;  3RDV A;  3CPW A;  2JW4 A;  2DTI A;  1YHQ Q;  3JCM W;  2HEQ A;  2CKK A;  4PL6 A;  1S1N A;  4CC3 A;  5GAO m;  2COW A;  1YIT A;  2JM8 A;  1WHL A;  1YBY A;  1W1F A;  2XI9 A;  1D3B A;  3CBO A;  4LNP A;  4FIB A;  2A0F B;  1ZA1 B;  2MAM A;  5KYW A;  3VS4 A;  3V7C A;  2VYT A;  1PRM C;  5HCK A;  1X6O A;  2PVO B;  4HCK A;  4M75 B;  1K73 C;  5LJ3 f;  4J8O A;  2QK0 A;  4M75 F;  1Q81 C;  3M55 A;  3MJX A;  4OB0 B;  2LJ1 A;  2VXF A;  2VUB A;  1VQ6 Q;  3UDC A;  2O2O A;  1WXB A;  2ED1 A;  4JLI A;  4D8K A;  4QQG A;  2KRN A;  5D6W A;  4RTX A;  1U3O A;  2C06 A;  4ESR A;  2JT4 A;  1YWP A;  1RLP C;  1GCP A;  1E7O A;  2DTO A;  4XU2 A;  1VQN T;  4OMF B;  4LDV A;  3OYA A;  2F2W A;  1ZHI A;  2GGR A;  1MMA A;  3OMC A;  2E3I A;  2HD0 A;  4XTV A;  2DD4 A;  2QTV A;  2ROT A;  4C5E A;  2D6F A;  1BIB A;  2CSQ A;  2ED0 A;  2QDL A;  4M7D G;  1VQ9 T;  3OYK A;  1WXT A;  2DXT A;  4M77 B;  2E5K A;  4ZNX A;  4PKC C;  4M77 F;  3VS3 A;  1V1C A;  1QVG A;  2OTL T;  3CME Q;  4FSS A;  4AFS C;  3L1A A;  1QCN A;  2DO3 A;  1VQP T;  5GAN 6;  2DER A;  4LDY A;  3PIO A;  3GP8 A;  1YI2 T;  1JEG A;  2K3Y A;  3V8J A;  2PUO B;  2PZ1 A;  3CQT A;  1K8A R;  5CK9 A;  1M5Q 1;  1Z9Z A;  1S72 A;  5GAM f;  1UG1 A;  4OMM A;  1BCO A;  1U06 A;  3CCM A;  4A53 A;  4C92 C;  3RER A;  2OAU A;  3LW5 E;  4DBQ A;  1LOJ A;  2A37 A;  3JV3 A;  1PG5 B;  3CCU T;  2ZPB B;  2EYQ A;  3FIF A;  4FYV B;  1K1Z A;  3FJP A;  1IGU A;  1NJI U;  3RUX A;  5GAN 5;  3S3N A;  3ASK A;  5D6Y A;  1M4Z A;  2XU8 A;  4M77 E;  1KQ2 A;  3M57 A;  4N4I A;  1QCF A;  1IHW A;  3CC4 A;  4AMC A;  2HZY A;  3CD6 Q;  1VQO Q;  1Y07 A;  1ZUK A;  2C0O A;  3E19 A;  3UF4 A;  4B9W A;  4HT9 A;  2L2P A;  1ZUY A;  3QO3 A;  3OYJ A;  4J6X A;  4KGX B;  2WSE E;  1TUD A;  5KCH A;  4C5H A;  5KYX B;  1K73 U;  5LJ5 f;  2EQK A;  2DRK A;  1Q81 U;  4J6W A;  2I0N A;  1IB8 A;  3NFC A;  3A8M B;  2E12 A;  5LJ3 e;  2EFI A;  2OTJ T;  3JB9 H;  1NG2 A;  2R57 A;  5EC7 A;  1YJW T;  5IHN A;  1TH7 A;  1KSW A;  2L3P A;  4HCC A;  1PSE A;  2PVD B;  1OPL A;  3CEY A;  3I55 A;  5GJW B;  3EH1 A;  2DL4 A;  4NL3 A;  1YHQ T;  2A28 A;  2PQW A;  1WHM A;  5KYX A;  1ZSZ B;  1TU0 B;  1KD1 R;  1YJN Q;  1B07 A;  3M0Q A;  3SD4 A;  3FEO A;  2DM1 A;  2E41 A;  1KQ1 A;  5LL6 S;  2DL7 A;  1QQJ A;  2C0I A;  3A98 A;  2LJ0 A;  3CC7 Q;  3TSW A;  3CBP A;  3GF5 A;  1OOT A;  2WAC A;  1W4S A;  1YIJ T;  1QWF A;  3LX7 A;  2CGH A;  1OPK A;  1N8R R;  2CS7 A;  4DBH A;  5KYY B;  5FWB A;  3CXC S;  1RAA B;  4AFQ C;  2QYZ A;  1I1J A;  1MUZ A;  1RI0 A;  4J9G A;  1AWJ A;  3FRN A;  2JS2 A;  3MKD A;  1ZSZ A;  1D0Y A;  1Q86 C;  1R0C B;  2NUZ A;  2DXC A;  4C92 D;  1G2B A;  4HCB A;  1BI2 A;  4WTO B;  5A0D A;  4M7D B;  3KFV A;  5GAM e;  1V29 B;  2KXD A;  4KUD K;  4ZTJ A;  1QMC A;  2XDP A;  2QQR A;  3MET A;  1D1A A;  1N9R A;  3MP6 A;  2KY9 A;  2CP6 A;  1NYG A;  2P0P A;  1RI9 A;  3CCJ A;  2EGE A;  4F16 A;  1RLQ C;  2HDA A;  5GAO p;  3TCJ A;  3QDR B;  3CPW S;  1P92 A;  1QW1 A;  1FX7 A;  4F7U G;  3CCR Q;  2DD5 A;  3RMS A;  3CME T;  3MPU B;  3OYH A;  4M7D A;  2GTJ A;  3A1P A;  3EGU A;  1IRE B;  4FCY A;  5GAN j;  1JXM A;  2HAX A;  1TG0 A;  3JB9 J;  2SRC A;  1IZ6 A;  2OJ2 A;  2RK1 A;  2HL3 A;  2QAS A;  4XTW A;  4A54 A;  5GAM g;  2F5T X;  2EQI A;  4PJO E;  2E6Z A;  4QW2 A;  1VQ7 A;  5LJ5 e;  4TVR A;  1G83 A;  3CCQ A;  2OX7 A;  1LCK A;  2ENM A;  4MZP A;  4PJN A;  2RK2 A;  2BTT A;  2M9U A;  3X28 B;  3CCV T;  1OX8 A;  2MK5 A;  4E2F B;  4J9C A;  2X4X A;  3P8H A;  2KYM A;  2XG8 D;  3OSV A;  1LNX A;  2F69 A;  3EGD A;  1OV3 A;  2V8I A;  1EFN A;  3KUF A;  2CZ0 B;  2W0Z A;  3LGL A;  1M1K C;  1HXD A;  3CCL A;  2DVJ A;  5GMK e;  4OMO A;  3M4G A;  1WQ7 A;  5J39 A;  3RBB B;  3RIR A;  3A8O B;  5FWC A;  1U1S A;  3HP9 A;  3I56 A;  2QGF B;  1VQO T;  1Q82 C;  2LT4 A;  1M1F A;  2EVR A;  5IXF A;  1YCS B;  4BY6 B;  4LE9 A;  2X51 A;  1IGQ A;  1LJO A;  8ATC B;  4MMK A;  3JCM b;  4DBR A;  3HPW A;  4C0F A;  3MP8 A;  3QJY A;  3X24 B;  1ABQ A;  3A5Z B;  2EGC A;  3CMA A;  2LRQ A;  1ZBJ A;  2VV5 A;  3S3M A;  1VQL Q;  3G4S A;  1I0C A;  4Z8A A;  4M7A C;  2HQE A;  4C0G A;  1D1C A;  3EFO B;  1SG5 A;  4M7A E;  3CC2 A;  1TSF A;  1W70 A;  2DIL A;  3VS6 A;  2DA9 A;  1YJN T;  2DL3 A;  2CP0 A;  3C94 A;  1YP5 A;  2FG0 A;  2E4H A;  3FJ5 A;  1Y96 A;  2NUT B;  1VYV A;  2HL5 C;  2JMA A;  3TU4 K;  2KT1 A;  5IHK A;  4FYW B;  2KNB B;  4E7S A;  3CC7 T;  1QP3 A;  3PVQ A;  1AZG B;  2XKO C;  1AZE A;  2EQU A;  1JBM A;  3C95 A;  1N6A A;  2XMF A;  3L2W A;  1VQ5 A;  4E7K A;  4CC2 A;  2WSC E;  2LTO A;  4PJO D;  2MIO A;  4N4G A;  5GAO l;  4N0A C;  1T0J A;  2QQA A;  1VYT A;  3G7Z A;  3H0I A;  3WVD B;  4XK8 E;  1XQH A;  4DOV A;  3L2R A;  1WHJ A;  2LNV A;  1OI1 A;  4BB7 A;  3PVL A;  1YIT Q;  2DYI A;  3J7A F;  1NJI R;  2DNU A;  3OYM A;  4EPC A;  4C8Q B;  1KC8 C;  4C8Q F;  1XJW B;  2RD1 A;  2HBP A;  4M4Z A;  2FZK B;  4EMK B;  4C92 G;  2EYY A;  2DIQ A;  4A4K A;  1E6G A;  2X3X D;  4ATO A;  4E7H A;  2FL7 A;  3SDZ A;  2LJ3 A;  2VC8 A;  2X3W D;  3M5A A;  1Q95 G;  1KQS P;  1Y7X A;  3CCR T;  3THK A;  2JMC A;  1K73 R;  1NLP C;  1OZ3 A;  1VQ4 T;  1CKA A;  4DA4 A;  2K3X A;  2EIF A;  3JCM c;  4EMG A;  4J7I A;  2QGG A;  2YUQ A;  4M78 B;  3LYI A;  2CZ7 B;  4M78 F;  2E10 A;  2HCK A;  4QT7 A;  2O88 A;  3OBY A;  2CZ1 B;  4LN2 A;  4JJB A;  4EMH A;  1M9S A;  3V8K A;  4NL2 A;  3HRS A;  2P0Q A;  3RNJ A;  1KK7 A;  3MEA A;  4J6Y A;  2X4Y A;  1B34 A;  1PCX A;  2NUP A;  1FYN A;  5GAN 7;  4MZM A;  1F1B B;  4M7A D;  2QEX A;  1H8K A;  4RTW A;  3C4S A;  4JLG A;  1D3B B;  1PKT A;  4A4G A;  3OA6 A;  1T3L A;  3BDU A;  2EQM A;  1BI3 A;  4OB3 B;  1WDX A;  4QQ6 A;  2D8H A;  1UHF A;  2FRY A;  3OYY A;  5HY6 A;  3H0H A;  2RI2 A;  1NZ9 A;  4XTZ A;  1WJQ A;  3MEV A;  5FU6 B;  2C0T A;  3M0P A;  4M78 E;  1VQN A;  1S72 Q;  2A36 A;  1W2B S;  5GAN h;  2VGN A;  3CCM Q;  1YN8 A;  3LWH A;  1M90 C;  4J83 A;  4AG1 C;  4EDU A;  1BKB A;  3CBM A;  3EGX B;  4HXJ A;  2FPD A;  1OYX A;  1Y71 A;  2CP7 A;  1VQ9 A;  1JO8 A;  1H92 A;  4ZGJ B;  1RAH B;  2ABL A;  3OYD A;  4OF1 A;  1UGQ B;  3V8L A;  4R0K A;  1BU1 A;  2OTL A;  3INZ A;  3G71 A;  3H9N A;  1VQP A;  2E5Q A;  5C6S A;  3EG0 A;  1YI2 A;  4ZN1 A;  1UEB A;  1M30 A;  4ME7 A;  2QI2 A;  3M56 A;  2DVE A;  5M9O A;  2P4T A;  5I2M A;  4RUG A;  4X34 A;  3URG A;  4J9F A;  5KYN A;  2L3R A;  3E1S A;  3EGX A;  1PSF A;  4Z02 A;  1YFN A;  1UGR B;  1AOJ A;  1FMW A;  1T3S A;  3OB9 A;  1K76 A;  1SKU B;  2J06 A;  3C12 A;  1U5S A;  1RL2 A;  1BI1 A;  3CCU A;  2MCN A;  4DQ2 A;  3SFM A;  3JCM J;  3EG9 B;  3SEM A;  1R0B G;  4E6R A;  2RHX A;  4BE0 A;  4E7Z A;  1K9M C;  3JCM X;  3I35 A;  2DMO A;  2BZ8 A;  3JB9 F;  3GNF B;  3REA B;  3VV0 A;  2EYX A;  4KGZ B;  2OAW A;  1TUG B;  1PM3 A;  4OGE A;  3A8L B;  4M75 C;  4C92 B;  4IUT A;  3G6E T; 
#chains in the Genus database with same CATH homology
 2WAC A;  3QXE B;  5KE3 A;  1W4S A;  3O8V A;  2KQW A;  4M75 E;  1YIJ T;  3VUB A;  1I8F A;  4HCZ A;  5LJ5 g;  3QKJ A;  3QG1 A;  3LX7 A;  4C8Q C;  2CGH A;  1YIT T;  2NLU A;  2CS7 A;  4XAX B;  5A0G A;  1YJ9 T;  4C5G A;  1DJ7 B;  4PJO G;  5I21 A;  3CXC S;  1N9S A;  2P0K A;  1R8O B;  3S6W A;  4EMK C;  4C8Q E;  4JRI A;  3GIB A;  2BUD A;  3OMG A;  3ZFJ A;  5DM7 R;  1X01 A;  3CXC A;  3X25 B;  4Y91 A;  2X4W A;  1RI0 A;  2V8K A;  3BY7 A;  3SWN A;  2DKG A;  3EFR A;  3FRN A;  1NPP A;  3HRU A;  1VQ7 T;  2ZPH B;  2V8J A;  3CCQ T;  2O4X B;  5KH6 A;  2DJZ A;  4O5V A;  3F70 A;  2RHU A;  4IUR A;  2OTJ A;  3OS1 A;  4MML A;  1QP2 A;  2RHZ A;  4JDS A;  4JJN K;  3PMI A;  1Q86 C;  3HRT A;  3OYI A;  2RO0 A;  2DXC A;  2R5M A;  4IUU A;  1Q7Y U;  4C92 D;  1VIF A;  2E70 A;  1BI2 A;  4XTY A;  1YJW A;  2K57 A;  4FT2 A;  4HCB A;  3JCM P;  5CQY A;  5A0D A;  4MDW A;  3QUI A;  5CCA A;  3OW2 S;  4M7D B;  5GAM e;  2K5F A;  1V29 B;  4XU3 A;  1WJS A;  3JCM h;  2GFU A;  4KUD K;  4C92 A;  3GPL A;  3OW2 A;  4ZTJ A;  2XDP A;  3LGF A;  4M78 C;  2QQR A;  3J80 E;  2FYK A;  3MET A;  4BUG A;  2H3J A;  2LDM A;  2EKO A;  3PFS A;  1VQ8 T;  1N9R A;  3BDL A;  4XQ3 A;  3CCE T;  2DXU A;  3MP6 A;  1G3T A;  2KY9 A;  2I2L A;  4IUQ A;  2D0Q B;  3CCL T;  4OVA A;  2P0P A;  2DXB A;  3NTK A;  2XK0 A;  3BFM A;  1I4K 1;  3CCJ A;  1VQK T;  3X20 B;  4M77 C;  2EJF A;  1VQM A;  5GAO p;  3Q1J A;  3MHX A;  5IT9 E;  1Q82 C;  2M1H A;  2DPP B;  3M58 A;  3TCJ A;  3V7R A;  5GAN 3;  3MCA B;  3QDR B;  3CPW S;  4YTL A;  1P92 A;  1QW1 A;  2GQV A;  2O4X A;  2XID A;  3OYC A;  1FX7 A;  4A4H A;  3PGG A;  4F7U G;  4HA8 A;  1ZQ1 A;  5CKE A;  2DD5 A;  1G3W A;  5GAN f;  4FT4 A;  3VYG A;  4M7D D;  3E9F A;  3P8B B;  3RMS A;  3G6E A;  3CCS T;  1NJI C;  4C0D B;  3CME T;  1YIJ A;  2R58 A;  3OYG A;  4IKF A;  4IUV A;  2JN0 A;  2RB6 A;  3HFN A;  3OYH A;  4BE1 A;  4M7D A;  2QXF A;  1IRE B;  2GF7 A;  1VQL T;  2DZ9 A;  2RJE A;  5GAN j;  3MEW A;  1QVG S;  2HAX A;  4E7J A;  1HK9 A;  1O9S A;  2ZZD A;  5IN1 A;  3JB9 J;  2MWP A;  1IZ6 A;  2PVG B;  1KHC A;  2RK1 A;  4XTW A;  2DEQ A;  5A0L A;  5GMK m;  5LJ5 h;  3VU3 C;  4LDW A;  1JJ2 S;  4A54 A;  5GAM g;  2XIC A;  2F5T X;  2CYZ B;  4F7U F;  3OY9 A;  3QYH B;  3GOX A;  1KD1 U;  4JRQ A;  2IVW A;  4PJO E;  3JCM d;  2E6Z A;  4QW2 A;  2QQB A;  5FU7 C;  1KC8 U;  5LJ5 e;  1VQ7 A;  3OBW A;  4TVR A;  3CCQ A;  3CD6 A;  2JOY A;  4JS4 A;  3EFS A;  4X9C A;  3HKS A;  4D6W A;  4PLI A;  4MZP A;  3RKW A;  2Y4Y A;  1FXX A;  2RK2 A;  5GMK l;  2M9U A;  3X28 B;  3CCV T;  3T9N A;  4LD9 K;  5FU6 C;  4M7A G;  3L42 A;  3G4S T;  2LCL A;  5GAN 4;  5GAN 8;  2X4X A;  3M4Y A;  3P8H A;  2K4Y A;  3P8D A;  4RKU E;  2XG8 D;  3OSV A;  4BI3 A;  5HK0 A;  2QEX T;  4BE2 A;  4B9X A;  3CCU T;  2F69 A;  1LNX A;  3M54 A;  3CC2 T;  2V8I A;  5I2S A;  3VJP A;  5GMK i;  1N8R U;  3M9Q A;  3KUF A;  2CZ0 B;  3PNW C;  4KUL A;  3LGL A;  2F5K A;  2RJD A;  5GMK h;  3CCE A;  1VQ8 A;  1M1K C;  2RH2 A;  1HXD A;  2K5L A;  1S72 T;  2KK4 A;  2G3R A;  2LT1 A;  3CCL A;  3BW1 A;  3FB9 A;  2BKD N;  5GMK e;  3CCM T;  3M4G A;  1WQ7 A;  2KVQ G;  5J39 A;  2EJ9 A;  3L2V A;  5FRN A;  4PNO A;  1VQK A;  4JUV A;  3RIR A;  3A8O B;  2RM4 A;  4FL6 A;  2MF2 A;  2L89 A;  3RMQ A;  4R56 A;  1U1S A;  2E65 A;  3M59 A;  3PT9 A;  2QA4 T;  5KE2 A;  3HP9 A;  5DY9 A;  3I56 A;  1VQO T;  4BI8 B;  3RKY A;  4P5N A;  2LT4 A;  2CZ6 B;  3RKX A;  1M1F A;  3VYH B;  4XU0 A;  4M75 D;  4ZGE B;  1QVF S;  4J5Y A;  5CKB A;  1VIE A;  5AYF A;  5LJ3 d;  1H3Z A;  3MO8 A;  4BY6 B;  3E9G A;  2XD0 A;  4C92 F;  1QVF A;  2LQK A;  3QZ5 B;  4A4E A;  4O6J A;  3CCS A;  4M75 A;  3H6Z A;  4C8Q D;  1VQ5 T;  2RA2 A;  4F7U E;  3TEE A;  5D6X A;  2RHY A;  1VQL A;  1EIF A;  3KXT A;  1K8A C;  4HKE A;  1LJO A;  2YRV A;  3L2Q A;  4Y28 E;  2GCX A;  4C8Q A;  4MMK A;  3A8G B;  3JCM b;  3HPW A;  4C0F A;  1KQS S;  2YLC A;  2LCC A;  3J81 E;  1VQ6 T;  4EMK A;  3JRZ A;  3MP8 A;  5CO7 A;  4E7I A;  4ZGD B;  1FWZ A;  3QJY A;  4C92 B;  5CIU A;  4E47 A;  2LQ8 A;  3X24 B;  1KQS A;  4NS5 A;  3OSS C;  3A5Z B;  3CMA A;  2MI6 A;  5EG2 A;  3WXM B;  3OYB A;  4BD3 A;  2LRQ A;  2Y4X A;  1O75 A;  2VV5 A;  5KCO A;  3CCV A;  3S3M A;  4J7F A;  2YLB A;  5GAM h;  4RG8 A;  3UWN A;  3G71 T;  4V2S A;  3G4S A;  3SB2 A;  1WJR A;  1NPR A;  1MGQ A;  4M7A C;  4C5I A;  5C0M A;  2HQE A;  2JUF A;  4A4F A;  4M7D F;  4C0G A;  5CKF A;  4M78 D;  4XTU A;  4M7A E;  5DLQ E;  2JNG A;  3CC2 A;  3JB9 D;  3QSU A;  3QYG B;  1WPY A;  2IG0 A;  3QPH A;  1YHQ A;  4IUP A;  1XNI A;  3A8H B;  1WGS A;  3UPU A;  3M53 A;  4M78 A;  2KSS A;  4WF2 A;  3VUZ A;  5HK3 A;  1YJN T;  4KBM B;  1M90 U;  3JAM E;  4M77 D;  4JRK A;  3C94 A;  3CPF A;  3JCM f;  4HT8 A;  3ZBD A;  3PMT A;  1Y96 A;  2KAF A;  2R5A A;  5FU7 B;  4C92 E;  5GAO q;  3AHU A;  4MDX A;  4FM4 B;  1ZBX A;  3HFO A;  3OYF A;  3V7S A;  2RJF A;  3TU4 K;  4M77 A;  4BDZ A;  2QA4 A;  3WVE B;  2B8A A;  3CC7 T;  3DLL A;  3GNG A;  3CPW A;  1QP3 A;  2DTI A;  5CKD A;  3JCM W;  2CKK A;  4L6V 5;  1U1T A;  2XKO C;  2D9T A;  2EQU A;  1JBM A;  3C95 A;  4PL6 A;  2LVM A;  4XTX A;  1JB0 E;  5GAO m;  1N6A A;  3L2W A;  1YIT A;  2E1H A;  1YBY A;  1VQ5 A;  5GAN e;  2JTM A;  1YJ9 A;  3QBY A;  4QVC A;  4E7K A;  1KG1 A;  4L5G A;  4QVD A;  1JRI A;  2JZ2 A;  3JCM V;  2XI9 A;  5GAM d;  1D3B A;  2WSC E;  2LTO A;  4PJO C;  4PJO D;  1GXI E;  3CBO A;  5CVI A;  4ELZ C;  4N4G A;  4FIB A;  5GAO l;  5A2Q E;  4ZTF A;  2KMT A;  2M0O A;  2QQA A;  3G7Z A;  4N0A C;  1VQ6 A;  2MAM A;  5J26 A;  3WVD B;  4XK8 E;  1XQH A;  1JJ2 A;  4DOV A;  3L2R A;  4LDX A;  1G3S A;  2QDY B;  2LNV A;  4BB7 A;  1OI1 A;  2QQ9 A;  3V7C A;  4M7D E;  2VYT A;  5GAO n;  2RI5 A;  1X6O A;  5GAN 2;  2PVO B;  5L8R E;  4II1 A;  5GAO r;  4M75 B;  1K73 C;  5LJ3 f;  3J7A F;  4J8O A;  3ZEH A;  2X35 A;  4M75 F;  1Q81 C;  2X4J A;  3M55 A;  2OTJ T;  4OB0 B;  3OYE A;  3MEU A;  4LD6 A;  3OYM A;  4EPC A;  2VXF A;  1KD1 C;  2VUB A;  4C8Q B;  3UDC A;  1KC8 C;  5LJ3 j;  3NTH A;  4C8Q F;  4JLI A;  2RD1 A;  2HBP A;  4VUB A;  4EMK B;  4C92 G;  2JTF A;  4QQG A;  2PUK B;  4JRP A;  5D6W A;  2QTX A;  2DIQ A;  4A4K A;  2DK3 A;  2Y90 A;  5FRO A;  2XHC A;  2C06 A;  1WQW A;  4ATO A;  1YJN A;  2BIV A;  2DAQ A;  1K9M U;  5HKC A;  4E7H A;  2FL7 A;  4N4H A;  3SDZ A;  5GAN g;  2VC8 A;  3M5A A;  2YHT A;  3UT1 A;  2DTO A;  3CD6 T;  4XU2 A;  2A7Y A;  1Y7X A;  1N8R C;  3CCR T;  3CC7 A;  4OMF B;  1VQN T;  4LDV A;  3OYA A;  5LJ5 d;  2M16 A;  2LX9 A;  3N5B B;  3X26 B;  1OZ3 A;  1YCY A;  1ZHI A;  2VGM A;  1VQ4 T;  4DA4 A;  2ZPE B;  2K3X A;  2EIF A;  2RHI A;  3JCM c;  4EMG A;  3CME A;  3OMC A;  3HHT B;  4CRI A;  2HD0 A;  4J7I A;  4M78 B;  4FU6 A;  1OZ2 A;  4QQD A;  4XTV A;  3LYI A;  2CZ7 B;  2DD4 A;  3QZ9 B;  4C5E A;  4DOW A;  2D6F A;  4M78 F;  1BIB A;  5CQX A;  4LDU A;  2E10 A;  5DLO A;  4RG2 A;  5J3B A;  3CC4 T;  1KHI A;  4FSX A;  4OP0 A;  4M7D G;  1UB4 A;  1Y96 B;  1VQ9 T;  2L8D A;  2ZGW A;  2CZ1 B;  3OBY A;  3OYK A;  4EMH A;  2DZC A;  1U8R A;  5FRM A;  2MWO A;  1M9S A;  2DXT A;  4M77 B;  4RCC A;  2EWN A;  3V8K A;  4NL2 A;  4PLL A;  2JVV A;  2P0Q A;  3HRS A;  3L2U A;  4PKC C;  4M77 F;  1QVG A;  5LJ3 g;  3MEA A;  1Q86 U;  2OTL T;  4J6Y A;  2X4Y A;  1B34 A;  1X75 C;  2EAY A;  4NOY A;  3OS2 A;  3L1A A;  2DO3 A;  1VQP T;  3SWN C;  5GAN 6;  3OYN A;  2HQX A;  4C0Z A;  5GAN 7;  4MZM A;  2WSF E;  4LDY A;  3PIO A;  3GP8 A;  5CAI A;  4M7A D;  1YI2 T;  3FC3 A;  2K3Y A;  1WNL A;  2QEX A;  3V8J A;  1G3Y A;  2EQJ A;  3C4S A;  4JLG A;  2PUO B;  2EJG A;  4GLK A;  1D3B B;  3VKI A;  1MHN A;  1XTD A;  4XU1 A;  4A4G A;  4M7A A;  1BYM A;  3OA6 A;  3EAE A;  5CK9 A;  1M5Q 1;  4IUT A;  1S72 A;  5GAM f;  3BDU A;  4X9D A;  2EQM A;  1BI3 A;  2ZPF B;  4OB3 B;  4PJO B;  1QVP A;  3CCM A;  4QQ6 A;  4A53 A;  1Q7Y C;  4KUI A;  3ME9 A;  4C92 C;  4PJO F;  2FVU A;  3OYY A;  1XOV A;  2DIG A;  5HY6 A;  4BY6 C;  3S3O A;  2RI2 A;  2FHD A;  3OS0 A;  5GAM j;  1NZ9 A;  3HSB A;  3RER A;  2OAU A;  3LW5 E;  4BI4 A;  3I55 T;  2K5I A;  1LOJ A;  1N27 A;  3LH0 A;  4Q5W A;  4XTZ A;  4ZN3 A;  1WJQ A;  2MMP A;  2ZPB B;  3MEV A;  4L59 A;  3FDR A;  1BIA A;  2EYQ A;  3DB4 A;  2KDS A;  3FIF A;  5FU6 B;  5IAY A;  3JCM e;  3CCR A;  1VQO A;  4M78 E;  1VQN A;  3FJP A;  4JS5 A;  3R6O A;  4MZT A;  4QVZ A;  3RUX A;  2HNI A;  1NJI U;  1W2B S;  1VQ4 A;  2XDB A;  5GAN h;  5GAN 5;  4E7L A;  2L5Q A;  2VGN A;  3S3N A;  3ASK A;  4OGC A;  5D6Y A;  3LWH A;  1M90 C;  5CR2 A;  2ZCF B;  3L2Z A;  4UC4 A;  3LWI A;  1W2B A;  4J83 A;  4EDU A;  1I81 A;  1BKB A;  2ZPI B;  3CBM A;  1M4Z A;  2XU8 A;  4RMO A;  2DTH A;  2FB7 A;  4M77 E;  4M75 G;  1G5V A;  1KQ2 A;  2K2V A;  2PU9 B;  3M57 A;  4KT0 E;  4N4I A;  4ELY C;  1OYX A;  1Y71 A;  3I56 T;  3CC4 A;  2AHJ B;  2O01 E;  3MP1 A;  1VQ9 A;  1Y07 A;  1AHJ B;  4RCB A;  3TRE A;  4M7D C;  5CKH A;  3E19 A;  4ZGJ B;  4PJO A;  4B9W A;  4C8Q G;  3JSC A;  3OYD A;  4HT9 A;  3H8Z A;  4OB1 B;  3QO3 A;  2A3L A;  3OYJ A;  1BI0 A;  1SSF A;  4J6X A;  4N0A A;  1UGQ B;  2WSE E;  4OF1 A;  3V8L A;  2OTL A;  5KCH A;  3INZ A;  4C5H A;  3G71 A;  4BDY A;  4BAC A;  1K73 U;  4CI0 C;  5LJ5 f;  1VQP A;  2EQK A;  2E5Q A;  1Q81 U;  3RES A;  5C6S A;  4J6W A;  3JCM Q;  3PIP A;  4F7U B;  5LJ3 h;  1YI2 A;  4ZN1 A;  1UEB A;  3GLX A;  4ME7 A;  2QI2 A;  3HL8 A;  2DVE A;  3M56 A;  3A8M B;  2E12 A;  3NFC A;  2EFI A;  2P4T A;  5M9O A;  5LJ3 e;  5LJ5 j;  1M1K U;  3CMA T;  1M8V A;  3JB9 H;  5I2M A;  4GY5 A;  4X34 A;  3JCM g;  3URG A;  2RJC A;  3OYL A;  3JB9 I;  1M1G A;  2R57 A;  5FLX E;  2L3R A;  1YJW T;  3E1S A;  1PSF A;  4Z02 A;  1UGR B;  1VUB A;  3QHS A;  5GAN d;  1NE8 A;  1TH7 A;  1I5L A;  4M78 G;  1B34 B;  4HCC A;  4C0D C;  1PSE A;  2PVD B;  3OB9 A;  1H64 1;  3JB9 G;  3C12 A;  3CEY A;  3I55 A;  1Q82 U;  4NL3 A;  1RL2 A;  2GFA A;  1BI1 A;  1YHQ T;  3CCU A;  3FLG A;  1UGS B;  4DQ2 A;  3SFM A;  3SWN B;  3JCM J;  4M77 G;  2LC4 A;  2PQW A;  4OB2 B;  4M7A B;  5GMK j;  3CCJ T;  3DKM A;  4R55 A;  4M7A F;  3QII A;  2RHX A;  3PTA A;  1VQM T;  4BE0 A;  3DB3 A;  2RI3 A;  2E64 A;  3NTI A;  3OQ5 A;  1UGP B;  3JCM X;  1K9M C;  4F7U A;  3KBG A;  2VXE A;  3QJ6 A;  3LLR A;  3FEO A;  3SD4 A;  2XDD A;  1K8A U;  3JB9 F;  2E41 A;  1KQ1 A;  3GNF B;  5LL6 S;  3VV0 A;  2E6N A;  3ER0 A;  3DLM A;  2QQS A;  4OGE A;  3A8L B;  4M75 C;  3CBP A;  2ZPG B;  3GF5 A;  3OS5 A;  3G6E T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...