1Z9QA

Solution structure of sh3 domain of p40phox
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
b'DRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 4
publication title Solution structure of SH3 domain of p40phox
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase activator
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1z9qA00
2DE0X 4E6RA 1FYNA 2YSQA 2DMOA 2ABLA 4D8KA 1T0HA 2PZ1A 3CQTA 3QWXX 2X3WD 1Z9ZA 3NGPA 2NWMA 2KYMA 4K11A 1B3QA 2J6KA 3H0FA 4AFQC 1QKXA 2KROA 2JM9A 2ED1A 2FRWA 4J9IA 1SHFA 2CT3A 1WFWA 2RNAA 1SPKA 2QDLA 1AZGB 3H41A 1GFDA 4EIKA 1M8MA 3UF4A 4JJCA 1NEGA 5FW9A 1X27A 2K6DA 2VKNA 2YUNA 2KT1A 1E6HA 1G83A 2EGCA 2AKKA 1T3SA 2F2VA 2GTOA 2EGAA 1ZUYA 2RQTA 2FRYA 3I5SA 2IIMA 3VS6A 1UE9A 2KYBA 1WXBA 2HDAA 2L2PA 1OOTA 2M0YA 4RTTA 2EBPA 3NMZC 1NEBA 4RTZA 2DLPA 1RUWA 2D8HA 3UA6A 4LNPA 3GBQA 1BBZA 2OJ2A 3I9QA 4WCIA 4J9CA 4OMOA 2ENMA 2KXCA 2BZYA 5IH2A 1KIKA 1HJDA 5FWBA 3RNJA 2DL3A 2J6OA 4RTWA 2LZ6B 1AZEA 1SEMA 1WXUA 2XMFA 4ORZA 2RN8A 1M30A 2KT8A 1EFNA 4RTXA 2YT6A 4AG1C 1K0XA 1YWOA 2CDTA 2P4RA 1M3CA 1I1JA 2DVJA 4HXJA 3O5ZA 4IIOA 1NLOC 3EG0A 2JTEA 1ZLMA 2D8JA 1X6GA 3H0IA 4J9HA 1X69A 1X43A 5FWCA 3R6NA 4DEXA 1TUDA 4JZ3A 3EHQA 3NHNA 1E6GA 2D0NA 1X6BA 2C0IA 1MUZA 2O9VA 2BZXA 3H0HA 2HBWA 4RTUA 2YDLA 3VS3A 2X3XD 4LUEA 2F2WA 4HVVA 2O88A 3VS4A 2C0TA 4KRTA 1UUEA 4HCKA 2MCNA 3SHWA 3SEMA 2YUOA 4CC3A 3UA7A 2RQVA 1PRMC 1SSHA 4JPBW 2DRKA 1AVZC 2DA9A 1K4US 1KFZA 3M0PA 1AOJA 1ARKA 1S1NA 1SHGA 2K2MA 1N5ZA 4OMPA 4RTYA 2CH4W 1I07A 1T3LA 4OMQA 2C0OA 1T0JA 2LCSA 1X2KA 1QWFA 2LX7A 1GBQA 2AK5A 3M0SA 4D8DA 1NYGA 1H92A 2FPDA 2GGRA 1HD3A 2MIOA 4Z8AA 2FO0A 2KRSA 1U3OA 2B86A 1WI7A 2JS2A 1K9AA 2HEQA 1ZX6A 2DL4A 5HCKA 1QLYA 2AZSA 2LJ1A 4ZNXA 5EC7A 2KR3A 1X2QA 3VS7A 1RI9A 1GL5A 2H8HA 1KJWA 2JXBA 3NPFA 3M0TA 1NG2A 2CUBA 3QWYA 1AWWA 2A28A 1WXTA 1KSWA 1Y0MA 2CH4A 2ROTA 4OMMA 3IQLA 2LQWA 2CREA 3PVLA 1VYTA 2DBMA 2A37A 2DM1A 3M0UA 1OPKA 2KNBB 2ED0A 2FG0A 2LNHB 1OPLA 3I35A 2K9GA 1ZUKA 1K0SA 1VYUA 2EW3A 2CSQA 1YWPA 2DL7A 1K1ZA 5IXFA 2RMOA 4J9FA 4AFUC 2O9SA 2FEIA 1MV0B 4F14A 2ESWA 2DRMA 2GTJA 1ZUUA 3UATA 2DJQA 2JW4A 3EHRA 4F17A 1QCFA 1UHCA 1XOVA 2O2OA 1U5SA 1PRLC 2J7IA 2EYXA 4JJDA 1JEGA 4LE9A 1V1CA 1AD5A 5IHIA 2OAWA 1J3TA 2EPDA 4J9EA 3I5RA 4GBQA 3U23A 2BTTA 3TVTA 1GRIA 2CUDA 2V1QA 4OMNA 4JZ4A 1UJ0A 2YUPA 2JMCA 4HVWA 2DF6A 4Y92A 1I0CA 2NUZA 2DBKA 5ECAA 2JMAA 1BU1A 1UGVA 2SRCA 2D1XA 2SEMA 1YNZA 3THKA 1NYFA 3EG1A 4ESRA 2DL8A 4DEYA 3C0CA 3PVQA 2EYWA 1U06A 5IHKA 2PTKA 2EKHA 1UJYA 2FPFA 1OV3A 1GCQA 1SRLA 4A63B 2DNUA 1G2BA 2GNCA 1IO6A 3VS2A 1WLPB 2F2XA 2AZVA 2EVRA 2JT4A 2MOXA 2DYBA 1YCSB 4AFZC 2ECZA 1PHTA 3VRYA 2EYZA 1BB9A 2CSIA 2W10A 2J6FA 2LQNA 1A0NB 2K79A 1UFFA 3VRZA 1GBRA 2L0AA 3ULRB 3M0RA 5L23A 4RTVA 1M3AA 4JJBA 2KRMA 2JM8A 2HCKA 1AWOA 1GCPA 1AWJA 1PKSA 2RQWA 2EYYA 1K76A 2DILA 3KFVA 5IXBA 2KRNA 1UG1A 2KXDA 3EG3A 1UECA 4CC4B 4LUDA 1ABQA 2V1RA 2K7AA 4CC2A 4GLMA 2GQIA 1SRMA 1QWEA 2O31A 4RUGA 1JU5C 3FJ5A 4HVUA 1CSKA 1MV3A 4R0KA 2KGTA 2KE9A 1AWXA 3ZL7C 2K3BA 4AFSC 2FPEA 1WIEA 4QT7A 1JXOA 1E7OA 4Z88A 1JQQA 2DX1A 1NLPC 2L3PA 4M4ZA 2RPNA 2BZ8A 3JV3A 3TSZA 4AG2C 2L3SA 2L3QA 1H3HA 1GCQC 1JO8A 2VVKA 5GJWB 2RQUA 1M3BA 3PE0A 1GFCA 4FSSA 2HSPA 1AEYA 4J9DA 1FMKA 1NM7A 1QKWA 1RLPC 1TUCA 2CT4A 2RQRA 4LN2A 1ZSGA 1OEBA 1TG0A 3VS0A 3EG2A 1PKTA 2OI3A 4Z89A 1CKAA 2EGEA 1PNJA 2W0ZA 1PWTA 2VWFA 2J05A 3TSWA 3EGUA 3LH5A 1UHFA 2RF0A 3VS5A 1JXMA 2EQIA 2LMJA 1BK2A 3M0QA 3RBBB 1W70A 1LCKA 4J9BA 2M51A 1VA7A 1WDXA 1WA7A 2G6FX 1W1FA 1ZBJA 1RLQC 2LJ0A 5GJVB 3A98A 4X1VA 1UDLA 1YP5A 4CC7A 2KEAA 2JS0A 5I11A 4F16A 2A08A 1YN8A 1CKBA 2DL5A 2I0NA 1WYXA 2ROLA 3VS1A 2GBQA 2KBTA 2LP5A 1WX6A 1VYVA 2AKLA 5IHNA 2PNIA 1Y57A 1M27C 4J9GA 1Z9QA 3REBB 1H8KA 4IIMA 4OMLA 1W6XA 2J06A 2E5KA 2YUQA 1HSQA 1ABOA 1B07A 5I22A 2A36A 3REAB 1UTIA 2LJ3A
chains in the Genus database with same CATH superfamily
2DE0X 1FYNA 3ZBDA 4OF1A 2DMOA 2WSEE 4CRIA 4D8KA 2X9HA 5CK9A 5GAOp 2HAXA 4J7IA 1B3QA 1KQSP 4JRKA 4BACA 2XG8D 4DBHA 1Y7XA 2KAFA 4E7KA 3OA6A 2CT3A 2BKDN 4M77G 5EG2A 1SPKA 2C06A 1K9MR 2MPXC 1GFDA 4II1A 4OB3B 1UB4A 2YUNA 2KT1A 2OX7A 3QUIA 1JJ2A 3CCRQ 2EGAA 4PFZA 1BCOA 3PMIA 2RHIA 4D6WA 2K4YA 1HXDA 3RESA 1IGUA 4JRIA 3OMCA 2M0YA 4X34A 4PLIA 1NEBA 3META 3FDRA 4RTZA 2RH2A 5GMKj 1TXQA 1RUWA 1IHWA 4B9WA 2YWWA 1QQJA 4LNPA 3GBQA 4ZTFA 1RABB 4J9CA 4X9CA 5GAMg 1F1BB 2KXCA 1YCYA 2CP2A 1HJDA 5FWBA 1Q7YR 4A4KA 2OTJA 3C12A 1SEMA 4ORZA 2CGHA 1PD1A 3VUBA 4OP0A 5GMKe 1YWOA 1Q82C 1VQLQ 2MI6A 1KK7A 3O5ZA 2P4TA 3TEEA 1NLOC 4OB2B 2B8AA 4M77E 2D8JA 3HFOA 4XTVA 2XDBA 1X6GA 3QHSA 3V7CA 1C1AA 1X69A 1MNEA 5GANf 3H9NA 1TH7A 4DEXA 2ZZDA 2M9UA 2FB7A 2O4XA 1WNLA 1MUZA 2JN0A 4M78B 2QQSA 3H0HA 2HBWA 4WTOB 1OU9A 4LUEA 1NJIU 2DERA 4BE2A 1YJWT 1N9SA 4LDXA 2YUOA 3TREA 3CCUA 3UA7A 1WQ7A 2DA9A 1KFZA 2F1LA 3H6ZA 4KUIA 2X35A 1T3LA 4FIBA 2LCSA 1QWFA 2LX7A 2QQ9A 1H3ZA 1WQWA 2FPDA 2QGGA 2MIOA 2MK5A 4LDYA 1G3YA 3SB2A 4ZN3A 1N27A 2FO0A 1KC8C 2KRSA 3EFOB 3X25B 1MMAA 1Q81U 4KT0E 2QAZA 3CXCP 3FEOA 1QLYA 4JRPA 3HRUA 2AZSA 4BE1A 4ZNXA 1X2QA 3CCEA 2V26A 2PVGB 2H8HA 2JXBA 1KD1U 3M0TA 4HKEA 1HYOA 2CUBA 1W2BP 1WXTA 2CH4A 3MP8A 2K5LA 4M7DB 1YHQQ 4OMMA 1VQNA 2A37A 3I55A 1K73R 2VV5A 3OYMA 4HCCA 2ED0A 1OYXA 4M78A 2CZ1B 3I35A 1NPPA 1K0SA 5GMKl 1W2BS 1YWPA 1K1ZA 2FYKA 1XJWB 4LD9K 3E1SA 1WZOA 3V7RA 3OS5A 3CBPA 2FEIA 4B9XA 1I5LA 5GAOr 4A4EA 8AT1B 1EZZB 1YI2Q 2GTJA 3M55A 2K57A 1ZUUA 2DD4A 3OSVA 5FLXE 5KYNA 4F17A 4RCBA 4Y91A 1VQMQ 3M58A 2QDYB 5IT9E 2EYXA 1VQKQ 1JEGA 4BDYA 3CXCA 4E7LA 4MDXA 5IHIA 3AT1B 5CKFA 2EPDA 4HA8A 4J9EA 2COZA 3EFOA 3CCJQ 1VQ5Q 4KULA 3TVTA 1GRIA 2V1QA 2F5TX 2KI7A 1P92A 4BY6B 1K8AC 1W2BA 4XK8E 3WVEB 2OTLQ 4PJOB 1ZHIA 2JMCA 2ZPEB 1IB8A 2NUZA 4O6JA 4PFPA 3CCRA 1BU1A 2SRCA 2D1XA 2SEMA 1ZSZC 2DZ9A 3ER0A 3EG1A 4M7DA 2DL8A 2HL3A 4XTWA 1M90C 2PTKA 2QA4Q 1QVPA 3NTKA 1QP3A 3JCMb 1IO6A 3P8DA 4PJOF 1I8FA 2R58A 2V8JA 4EMGA 4C8QB 5GAOm 3CC2Q 3HRSA 4F7UF 3JCMd 2KMTA 1UFFA 1R8OB 1YITT 2XKOC 1XQHA 5L23A 4RTVA 3NTIA 4JJBA 1I5OB 3G4ST 2DTOA 1VQLA 3M9QA 1GCPA 1PKSA 2HNIA 1C0MA 1K76A 1VQ6Q 5IXBA 4C8QF 4CI0C 1R0BG 3VV0A 1ABQA 1NZ9A 4J6YA 2XU8A 2GQIA 4Y28E 3MJXA 1SRMA 4NL2A 3MCAB 1YIJT 4M75A 1JU5C 1VUBA 4IURA 2RI2A 3I56T 4QW2A 4PLLA 4R0KA 2K5IA 3RMQA 1AWXA 4PJOA 3ZL7C 1G3TA 1IREB 2K3BA 4AFSC 2WSFE 5HK3A 3OS0A 1SG5A 1E7OA 3GPLA 4KGVB 2L3PA 4E7IA 2BZ8A 4O5VA 3JV3A 1OX9A 5LJ3h 5CKEA 2EJFA 2AIRB 2L3SA 2EQUA 3X28B 1H3HA 3OY9A 2DKGA 1QMCA 2RO0A 3C94A 3JB9I 1G3WA 4J9DA 1FMKA 1TUCA 2CT4A 2RHZA 2G3RA 3EGXA 1JB0E 4LDWA 1PKTA 3OYGA 2K2VA 3RR6A 9ATCB 2OI3A 4Z89A 4QVDA 1RAIB 5IN1A 2W0ZA 4RG2A 3CCLT 2QXFA 3TSWA 1JXMA 2EQIA 2LMJA 1BK2A 3SFMA 4J7FA 1W70A 1LCKA 4J9BA 2X51A 2LRQA 3ZEHA 2LT4A 2HBPA 4OVAA 2VC8A 3OW2S 1YJNQ 2LQKA 4PJLA 4F16A 3OYKA 2A08A 4WF2A 2GFUA 1RAHB 1W4SA 2Y90A 2YLCA 3DLLA 4MZPA 3QYGB 4NL3A 2BIVA 1WGSA 5FU7C 1VYVA 1LNXA 1M27C 1Z9QA 1H8KA 2OTJT 3LX7A 1Y96A 1W6XA 2DJZA 4L5GA 4XAXB 1WHGA 5LJ3j 2EWNA 3QDFA 3TCJA 4UC4A 4E6RA 1D1BA 2KQWA 5J3BA 1T0HA 3CQTA 1Q86R 3QWXX 3OYBA 1BI3A 2KYMA 3QXEB 2F5KA 4AFQC 3MEUA 1BI1A 2KROA 4E47A 1N8RR 1IRXA 1VQMA 1EX4A 3NTHA 1SHFA 5LJ3e 1RADB 2XDPA 2QDLA 1VQKA 1AZGB 4C0DB 3H41A 1BKBA 1M8MA 3OW2A 2VASA 1NEGA 5FW9A 5CQXA 4XTYA 1OQKA 1VQ5A 1M9SA 2AKKA 2EGCA 2M16A 1G8XA 3I5SA 3VS6A 2KYBA 3CCUT 1WXBA 3HFNA 3M59A 4N0AC 2LQ8A 2OTLA 2X4WA 2EBPA 2VGNA 3FC3A 1BI2A 4N4HA 4C92G 2D8HA 5GANh 5DLOA 1U1SA 3I9QA 4WCIA 4XTXA 4OMOA 1MMGA 5IH2A 2E10A 1PCXA 2E65A 2QA4A 2A0FB 2DL3A 4GY5A 2J6OA 4RTWA 2LZ6B 1AZEA 3OS1A 2XMFA 2VXFA 2RN8A 1WPYA 3QPHA 3CC4Q 4AG1C 1Q95G 4MDWA 1M3CA 3CC2A 3QBYA 1TSFA 3CCET 4JJNK 3H0IA 5GAN3 4C5IA 5KCOA 4FM4B 5D6YA 1OULA 5FRNA 1JJ2P 3EHQA 3URGA 4QQ6A 3NHNA 3LGLA 4XTUA 2D0NA 4E7ZA 2VB6A 1VQNT 1MGQA 3X24B 2DXUA 2BE9B 2DPPB 3CBMA 4ELZC 2X3XD 4JS5A 3CMAQ 4HVVA 3L2QA 4JRQA 3VS4A 1YIJA 3M57A 3UPUA 4KRTA 4KGZB 5GAN7 4C92E 4CC3A 1RI0A 2RQVA 1PRMC 1N8RU 1M5Q1 2VGMA 1ARKA 1OU8A 1RAFB 4ELYC 3CPFA 3J7AF 5GANj 4OMPA 4RTYA 3BE3A 4XU3A 4BB7A 2XK0A 2DYIA 3CCSQ 1NJIR 1X6OA 3PT9A 1NYGA 3BDUA 3CCST 1BCMA 1PSFA 5LJ3g 2O4XB 2DD5A 3BDLA 1U3OA 2B86A 2JS2A 5GANe 1ZX6A 2DL4A 3OYYA 4HCZA 4L59A 4BI3A 3CC7Q 3EFSA 1RI9A 3RIRA 5GAMf 4GLKA 3CCLA 1D0YA 4M7AD 1NG2A 4R56A 4XQ3A 1M1GA 1KSWA 3MEAA 3CPWS 1K9MC 2MYSA 5GAN6 3ASKA 3CCRT 3ZFJA 1VYTA 1ZQ1A 1Q81R 5LJ5g 1OPKA 1ZSZA 1QP2A 2KNBB 2FG0A 3RUXA 2LNHB 2DK3A 1KD1R 2K9GA 3BY7A 2EW3A 4NS5A 2DL7A 1LVKA 1YJNA 3EGDB 2CZ6B 3JCMP 4C0FA 1AT1B 2HQEA 2ZPGB 3V7SA 4FW1A 4F14A 2ESWA 2RK2A 2DRMA 6AT1B 2JJ9A 2JW4A 1QCOA 3EHRA 1Q7YC 3LYIA 2H3EB 3G6EQ 1QCFA 1VQPQ 3CPWA 1VQLT 4QVZA 3QJYA 2J7IA 1OI1A 2HZYA 4OGEA 3G6ET 4JJDA 1M1KU 3JCMf 1V1CA 1AD5A 2OAWA 4Q5WA 4GBQA 3U23A 2KVQG 4M78G 2KSSA 3G1JA 2QGFB 1IGQA 4OMNA 4ZN1A 4V2SA 5FU7B 1I0CA 5ECAA 2JMAA 1UGSB 3EFRA 3SD4A 3MPUB 2RA2A 2RJEA 3E9GA 3OBYA 4M78F 4C5GA 4DEYA 1X01A 3C0CA 1N9RA 1U06A 2WACA 5C6SA 5CKBA 4M7AC 1M2VA 1UJYA 1I81A 2EJGA 2FPFA 4RCCA 4A63B 2FHDA 1VOMA 3JB9G 2EVRA 5GANg 2VYTA 4MMLA 1B34A 3HRTA 1YCSB 2CP3A 3EGDA 3G71Q 2ECZA 4Z02A 2Y4YA 2EYZA 1BB9A 2CSIA 1A0NB 2L0AA 3ULRB 1GXIE 2KRMA 3CC4A 3KXTA 4HCBA 2HCKA 3JB9F 1AWOA 3FJPA 3UWNA 3CCVQ 1TOVA 2YRVA 3OYFA 4M78E 4J6WA 2IVWA 2QQAA 2DILA 2XI9A 4KBMB 4M7DG 3EG3A 4CC4B 1D0XA 2V1RA 3P8HA 2K7AA 1YHQT 1WHMA 3GLXA 4J8OA 3GOXA 4E2FB 1QWEA 4A4HA 2O31A 3FJ5A 1Q82U 5D7UA 3CMAA 3Q1JA 1K73C 4JLIA 1MV3A 2KGTA 4PJNA 4M7DF 4JLGA 3DB4A 4A4FA 3A8MB 3PIOA 4BE0A 3VYGA 5I2SA 5J39A 3GNGA 4PL6A 3QG1A 3TSZA 1GCQC 3X26B 2COYA 2DXBA 1YI2T 2VVKA 3CCSA 1IHVA 5GAMd 2R5AA 2HSPA 1AEYA 2XHCA 1NM7A 1QVGP 2PUKB 5A0GA 7AT1B 1WHJA 1VQMT 3E9FA 3VS0A 4IUUA 4QKUA 4XU0A 2NYSA 4HT8A 2D9TA 4C92C 2O01E 4M77D 1VQKT 4N4IA 5DY9A 1M2OA 2PVDB 4M75B 2EAYA 4L6V5 2EYQA 2VWFA 4M7DE 2AHJB 3EGUA 3LH5A 3CCJT 1VQ5T 1UHFA 1QVGS 1M1FA 3RBBB 4PJOG 2JOYA 1RAEB 4EPCA 4N0AA 2OTLT 1ZBJA 5GJVB 1VQ7Q 4F7UG 1KC8U 3CD6Q 2MF2A 4M75F 4X1VA 5I11A 2KEAA 2JS0A 3OYDA 1YN8A 3LLRA 3PNWC 1CKBA 3ME9A 1WYXA 2QA4T 4E7HA 1WX6A 2AKLA 3EGXB 1Y57A 5FROA 4OMLA 5GMKm 3WXMB 2EQKA 3QDRB 2YUQA 4C8QG 1ABOA 1B07A 1PD0A 1BIAA 3MKDA 3REAB 2EQJA 2YSQA 2YHTA 3CC2T 1OZ3A 2ABLA 2R57A 2LDMA 3FLGA 4E7JA 2X3WD 1QVGA 1FMVA 1Z9ZA 1YBYA 4B6MA 2NWMA 4K11A 1NE8A 2AT1B 3H0FA 2BUDA 5LL6S 5GAN2 3G6EA 2JM9A 1VQPA 3HSBA 1YJ9Q 2PUOB 2MWOA 2QQRA 2HKNA 1RAAB 1V76A 1VQ6T 4EIKA 3QKJA 4JJCA 1M4ZA 4PJOE 2E41A 3JAME 2F2VA 2GTOA 1ZUYA 5GAN5 4F7UE 2HKQB 4J5YA 1Y96B 5A0LA 2E4HA 2L2PA 4M77C 2KDSA 3AHUA 3TQ7P 4YTLA 5FU6C 3OB9A 1VQ9Q 1BBZA 2OJ2A 1VQ4Q 4C8QE 2DO3A 2BZYA 4JDSA 5GAOn 2RHXA 4TVRA 1K8AU 1RACB 3CCQQ 1RAGB 3OYLA 2P0PA 3VJPA 3S3OA 5CAIA 2XD0A 1WXUA 5CVIA 3PMTA 2DEUA 1M30A 2KT8A 2RK1A 3G71A 4MZMA 2CDTA 1I1JA 2E6ZA 4XTZA 3A1PA 2ZPFB 1ZLMA 3OW2P 1M90U 5FWCA 3A8LB 3FB9A 1TUDA 1QW1A 3JCMW 1UGQB 3CCVA 2VXEA 1X6BA 2YXYA 2O9VA 2BZXA 1DJ7B 4M7AB 1I4K1 2YDLA 1YHQA 3VS3A 3L2RA 1YFNA 1SSFA 2FVUA 1QVFP 4ZGDB 2F2WA 2CZ7B 1U8RA 4HCKA 4C5EA 1YJNT 3HL8A 1SSHA 4JPBW 3T9NA 2DRKA 1Y07A 1AVZC 3HPWA 3M0PA 2K2MA 1N5ZA 5GAMh 4QQDA 2CH4W 4M7AF 3S3MA 2QEXQ 1I07A 4OMQA 2C0OA 1QVFS 4FT2A 1T0JA 1IXDA 1X2KA 3M0SA 3A8GB 1YI2A 1H92A 3FRNA 2RHUA 2V8KA 4Z8AA 5AT1B 3CMEQ 2ZPBB 1WI7A 1KQ1A 2FZGB 2PQWA 5D6WA 1VQOQ 2HEQA 2E6NA 1Q86C 3F70A 2LJ1A 5I21A 1ZA2B 4MMKA 3J80E 1GL5A 1KJWA 1WJRA 1N8RC 4R55A 3CCJA 3QWYA 2BE7D 1AWWA 2A28A 1Y0MA 2A3LA 2EJ9A 2ATCB 1BI0A 2ROTA 2R5MA 3IQLA 2LQWA 2CREA 5CR2A 3PVLA 2DBMA 2DETA 3M0UA 1B7TA 4EMHA 2CYZB 1QVFA 3JCMJ 5KYUA 3QSUA 1VQ8Q 2DEQA 4M7AA 3L2WA 4NOYA 4DBRA 3CD6A 1VYUA 3JCMh 4QVCA 2CSQA 1WHLA 5IXFA 2CP7A 2MAMA 2JUFA 2RMOA 4ANJA 5GAMj 4AFUC 2E64A 2O9SA 3HP9A 4FYWB 2QYZA 4DBFA 3L2ZA 3CCMQ 5GMKi 4C8QD 3UATA 2QG9B 4FU6A 3E2UA 3LWHA 2DJQA 2LCCA 3CC4T 4PFOA 3GNFB 1UHCA 2O2OA 5GAN8 2H3JA 1U5SA 3A8OB 5M9OA 2P0QA 1VIFA 1TUGB 5GAMe 4VUBA 4FT4A 1PM3A 3OYJA 1UGRB 1ZSZB 5DM7R 4FCYA 1J3TA 2JNGA 2VUBA 1PC0A 2JTFA 1VQ6A 1YJ9A 2M1HA 2CUDA 5KYXB 5CIUA 4BI4A 3KBGA 2MWPA 5KYWA 1UJ0A 3I55Q 3CMAT 2DF6A 4Y92A 4BI8B 2HD0A 4PJJA 3LWIA 1M1KR 1UGVA 3L42A 2CP6A 2RHYA 1NYFA 4ESRA 2DIGA 5CKHA 1Y71A 3D7SB 2XIDA 3JB9J 3OS2A 4IUPA 1M8VA 1OV3A 1GCQA 4PKCC 2QASA 1G2BA 2GNCA 2F2XA 3M5AA 1VQ9A 3HTRA 2MOXA 8ATCB 3QYHB 3CPWP 4OMFB 5LJ5f 1PHTA 3VRYA 1NJIC 2K79A 1SKUB 2M0OA 3JB9H 4PK4A 3JCMe 4C92A 2RI3A 3E19A 1JRIA 5D6XA 1M3AA 5CO7A 3JCMX 2JM8A 2K3YA 3V8JA 2DTIA 2P84A 5CQYA 1AWJA 3CC7T 3WVDB 4M77B 1UG1A 2E12A 4LXCA 2KXDA 2K3XA 1UECA 3VKIA 4LUDA 4C8QC 1M2VB 5FU6B 4CC2A 4GLMA 4E7SA 2HMAA 2X4XA 1UGPB 4RUGA 1TWBA 4DOWA 5KYXA 1B34B 2FL7A 1KQSS 4ZGEB 2CP5A 1G3SA 1Q81C 3M4GA 3P8BB 1FXXA 2ZPHB 3C4SA 2KE9A 4M77F 4PNOA 2DZCA 2A7YA 1C6VX 3QJ6A 1JXOA 1KD1C 2QTXA 2DX1A 4M4ZA 3DLMA 4A54A 3EG9B 1BIBA 2L3QA 3UT1A 2QEXA 1Q82R 2DIQA 5GJWB 2X4YA 4OGCA 3PE0A 3V8KA 2DAQA 1QKWA 2RQRA 3EAEA 1VQPT 1ZSGA 1OEBA 3EG2A 3CMEA 3CEYA 2EGEA 1PNJA 2HSEB 1VQOA 1PWTA 1MHNA 2EIFA 1MMNA 2JTMA 2D6FA 2J05A 2MMPA 1KQSA 3VS5A 2RM4A 2LT1A 1WDXA 3S3NA 3SDZA 5HY6A 2G6FX 2GF7A 1W1FA 3PIPA 5IAYA 3R6OA 4M77A 1YJWQ 3UDCA 2DXTA 1PSEA 4C92D 4CC7A 4BD3A 4FW2A 4EDUA 1VQ8A 4C0GA 2I0NA 2ROLA 3VS1A 4EMKC 2KBTA 2Y4XA 1XTDA 2NUTB 4J9GA 1N6AA 3JCMg 3L1AA 3TU4K 2J06A 1HSQA 2EKOA 1K9MU 1V29B 5I22A 2A36A 1KC8R 3G71T 2LJ3A 4AT1B 2PZ1A 3CCMA 4ZGJB 4XU1A 3EG9A 3NGPA 2RJDA 2J6KA 5KCHA 1QKXA 5LJ3d 2ED1A 2FRWA 1TTHB 4J9IA 2RJFA 3CCVT 1WFWA 2RNAA 4FSXA 1R0CB 2Z0WA 3UF4A 4ATOA 3EH2A 1X27A 2K6DA 2VKNA 1BYMA 4PJMA 4JS4A 2V8IA 1E6HA 1G83A 1QCNA 1T3SA 2RQTA 4A53A 2FRYA 2IIMA 1UE9A 1Q7YU 4ZTJA 1WJSA 2HDAA 2ZPIB 4KH0B 3CXCS 1OOTA 1D3BB 2KK4A 4RTTA 3NMZC 3OYNA 2DXCA 5LJ5d 2DLPA 4FYXB 2E70A 4C0DC 2QQBA 3UA6A 5A2QE 1SF9A 4X9DA 4C5HA 2L5QA 5GAOl 2F69A 4XU2A 1HK9A 2PU9B 2ENMA 3OBWA 1R77A 1KIKA 4J6XA 3RNJA 1LPLA 3SWNC 1NPRA 2NUTA 2E5QA 1EFNA 4RTXA 2EFIA 4ME7A 2YT6A 5J26A 3EH1A 1K0XA 2P4RA 2DVJA 2NLUA 4HXJA 4IIOA 1FX7A 3EG0A 2JTEA 4M75G 3X20B 1D0ZA 4J9HA 3QO3A 4RKUE 2IPOB 3CC7A 1TU0B 1X43A 1K8AR 3R6NA 4JZ3A 1E6GA 3DKMA 5FRMA 2C0IA 3VU3C 5CCAA 1MNDA 4RTUA 4LDUA 4FYVB 3GIBA 5KH6A 1RL2A 2O88A 3M54A 2C0TA 1M90R 1VQ7T 1UUEA 2MCNA 3CD6T 3SHWA 1FMWA 3RKXA 3SEMA 2CP0A 2JZ2A 2X4JA 3CBOA 1K4US 1AOJA 4F7UB 1S1NA 4P5NA 1SHGA 1KG1A 3RDVA 1S72Q 1D3BA 3MP1A 5A0DA 4KH1B 2LNVA 1IZ6A 4BUGA 3L2UA 1U1TA 4J83A 1GBQA 2AK5A 2EQMA 4D8DA 1S72T 3FIFA 2P0KA 2GGRA 1HD3A 3OYEA 4IUQA 3MEWA 5I2MA 5GANd 4M75E 2HQHA 1YITQ 1K73U 1K9AA 1WJQA 3BW1A 3G4SQ 5HCKA 2GFAA 1YJ9T 5EC7A 2KR3A 1VIEA 3KUFA 5CKDA 4M78D 3VS7A 3NPFA 5KYYB 1O75A 2ZGWA 3PGGA 3DB3A 2DM1A 2DVEA 5HK0A 1YIJQ 3NFCA 4AMCA 3I56Q 2RI5A 5DLQE 1D1CA 1OPLA 1YJWA 1ZUKA 4RMOA 4C0ZA 2LVMA 2RJCA 1D1AA 1ZBXA 3OYAA 1LOJA 4DBQA 1VQ9T 5L8RE 4J9FA 3JB9D 1VQ4T 1MV0B 1OX8A 4KGXB 2WSCE 3RKWA 3CCQT 4F7UA 2L89A 2GQVA 4DQ2A 2CZ0B 3LW5E 1XOVA 2XDDA 4IKFA 2M02A 3C95A 1PRLC 1KHCA 3HKSA 4DA4A 2D0QB 4LE9A 3OQ5A 4IUTA 4LD6A 1WHHA 3RMSA 2L3RA 5KYUB 2YRDA 3I5RA 3O8VA 3RKYA 4C8QA 3CCLQ 2NUPB 4M7DD 3S6WA 3PTAA 3GP8A 3JCMc 2BTTA 4M7AG 2RB6A 3L2VA 2FZCB 4JZ4A 5GAN4 4EMKB 5LJ5h 3M53A 2IG0A 2LC4A 2YUPA 4HVWA 2LCLA 2DBKA 1EIFA 2QK0A 5KYYA 5KE2A 1YNZA 3THKA 2QTVA 4HT9A 2KY9A 3PVQA 4M78C 4LDVA 2EYWA 5IHKA 3MP6A 4OB0B 3QZ9B 3A5ZB 2EKHA 2DFUA 2QEXT 1SRLA 1LJOA 2DNUA 3JRZA 2OTJQ 2COWA 3VS2A 3OYCA 1O9SA 1WLPB 2AZVA 2JT4A 1FWZA 2DYBA 4FYYB 1G5VA 1XNIA 4AFZC 5HKCA 2QI2A 2W10A 2YRCA 2J6FA 2LQNA 3CMET 3VRZA 5KE3A 1GBRA 3M0RA 4FL6A 4QQGA 5KYWB 1VQOT 1WHKA 3PFSA 2DTHA 4M75D 1PG5B 2HL5C 2FZKB 2RQWA 2EYYA 3OMGA 4M7AE 3KFVA 1AHJB 2JVVA 2KRNA 4IUVA 2ZCFB 4PJOD 3M56A 3RERA 3OYIA 1KQ2A 3J81E 3BFMA 1JBMA 5LJ5j 1ACMB 2NUPA 3CCUQ 2HQXA 4HVUA 1CSKA 1VQ7A 3OSSC 1TS9A 3JCMV 1VQ8T 3SWNB 4EMKA 2CKKA 1MMDA 2GCXA 2FPEA 4M7DC 1WIEA 2LTOA 4QT7A 4C92B 3VYHB 4A4GA 4Z88A 1JQQA 3M4YA 3JCMQ 1NLPC 4N4GA 2RPNA 5LJ5e 2ZAEA 4DOVA 2OAUA 3MO8A 3QIIA 4AG2C 3H8ZA 1S72A 3CCMT 1JO8A 4JUVA 2K5FA 2RQUA 2RD1A 1M3BA 4FSSA 1UEBA 1GFCA 2I2LA 1RLPC 2E3HA 4LN2A 1H641 4OB1B 2CS7A 3V8LA 2XICA 1TG0A 4F04B 4KUDK 3A8HB 4C92F 2L8DA 3CCEQ 3G7ZA 5C0MA 1CKAA 1NBEB 3OYHA 1YITA 4MZTA 3MHXA 3VUZA 2YLBA 3G4SA 2LX9A 1X75C 2RF0A 3M0QA 1VQNQ 5LJ3f 4RG8A 3QZ5B 3GF5A 2M51A 3N5BB 1VA7A 1WA7A 1OZ2A 3INZA 3I55T 1RLQC 2LJ0A 4BDZA 3A98A 3LH0A 3HHTB 1ZA1B 1KHIA 1UDLA 1YP5A 3MEVA 5GAOq 4M75C 5GMKh 1Q86U 1M1KC 2E3IA 3I56A 4BY6C 3LGFA 2DL5A 5AYFA 1JJ2S 2GBQA 2LP5A 2E1HA 5IHNA 2PNIA 3REBB 4PJOC 4IIMA 1VQ4A 3SWNA 2E5KA 2PVOB 1D09B 3JSCA 3CCQA 1UTIA
chains in the Genus database with same CATH topology
2DE0X 4E6RA 1FYNA 2YSQA 2DMOA 2ABLA 4D8KA 1T0HA 2PZ1A 3CQTA 3QWXX 2X3WD 1Z9ZA 3NGPA 2NWMA 2KYMA 4K11A 1B3QA 2J6KA 3H0FA 4AFQC 1QKXA 2KROA 2JM9A 2ED1A 2FRWA 4J9IA 1SHFA 2CT3A 1WFWA 2RNAA 1SPKA 2QDLA 1AZGB 3H41A 1GFDA 4EIKA 1M8MA 3UF4A 4JJCA 1NEGA 5FW9A 1X27A 2K6DA 2VKNA 2YUNA 2KT1A 1E6HA 1G83A 2EGCA 2AKKA 1T3SA 2F2VA 2GTOA 2EGAA 1ZUYA 2RQTA 2FRYA 3I5SA 2IIMA 3VS6A 1UE9A 2KYBA 1WXBA 2HDAA 2L2PA 1OOTA 2M0YA 4RTTA 2EBPA 3NMZC 1NEBA 4RTZA 2DLPA 1RUWA 2D8HA 3UA6A 4LNPA 3GBQA 1BBZA 2OJ2A 3I9QA 4WCIA 4J9CA 4OMOA 2ENMA 2KXCA 2BZYA 5IH2A 1KIKA 1HJDA 5FWBA 3RNJA 2DL3A 2J6OA 4RTWA 2LZ6B 1AZEA 1SEMA 1WXUA 2XMFA 4ORZA 2RN8A 1M30A 2KT8A 1EFNA 4RTXA 2YT6A 4AG1C 1K0XA 1YWOA 2CDTA 2P4RA 1M3CA 1I1JA 2DVJA 4HXJA 3O5ZA 4IIOA 1NLOC 3EG0A 2JTEA 1ZLMA 2D8JA 1X6GA 3H0IA 4J9HA 1X69A 1X43A 5FWCA 3R6NA 4DEXA 1TUDA 4JZ3A 3EHQA 3NHNA 1E6GA 2D0NA 1X6BA 2C0IA 1MUZA 2O9VA 2BZXA 3H0HA 2HBWA 4RTUA 2YDLA 3VS3A 2X3XD 4LUEA 2F2WA 4HVVA 2O88A 3VS4A 2C0TA 4KRTA 1UUEA 4HCKA 2MCNA 3SHWA 3SEMA 2YUOA 4CC3A 3UA7A 2RQVA 1PRMC 1SSHA 4JPBW 2DRKA 1AVZC 2DA9A 1K4US 1KFZA 3M0PA 1AOJA 1ARKA 1S1NA 1SHGA 2K2MA 1N5ZA 4OMPA 4RTYA 2CH4W 1I07A 1T3LA 4OMQA 2C0OA 1T0JA 2LCSA 1X2KA 1QWFA 2LX7A 1GBQA 2AK5A 3M0SA 4D8DA 1NYGA 1H92A 2FPDA 2GGRA 1HD3A 2MIOA 4Z8AA 2FO0A 2KRSA 1U3OA 2B86A 1WI7A 2JS2A 1K9AA 2HEQA 1ZX6A 2DL4A 5HCKA 1QLYA 2AZSA 2LJ1A 4ZNXA 5EC7A 2KR3A 1X2QA 3VS7A 1RI9A 1GL5A 2H8HA 1KJWA 2JXBA 3NPFA 3M0TA 1NG2A 2CUBA 3QWYA 1AWWA 2A28A 1WXTA 1KSWA 1Y0MA 2CH4A 2ROTA 4OMMA 3IQLA 2LQWA 2CREA 3PVLA 1VYTA 2DBMA 2A37A 2DM1A 3M0UA 1OPKA 2KNBB 2ED0A 2FG0A 2LNHB 1OPLA 3I35A 2K9GA 1ZUKA 1K0SA 1VYUA 2EW3A 2CSQA 1YWPA 2DL7A 1K1ZA 5IXFA 2RMOA 4J9FA 4AFUC 2O9SA 2FEIA 1MV0B 4F14A 2ESWA 2DRMA 2GTJA 1ZUUA 3UATA 2DJQA 2JW4A 3EHRA 4F17A 1QCFA 1UHCA 1XOVA 2O2OA 1U5SA 1PRLC 2J7IA 2EYXA 4JJDA 1JEGA 4LE9A 1V1CA 1AD5A 5IHIA 2OAWA 1J3TA 2EPDA 4J9EA 3I5RA 4GBQA 3U23A 2BTTA 3TVTA 1GRIA 2CUDA 2V1QA 4OMNA 4JZ4A 1UJ0A 2YUPA 2JMCA 4HVWA 2DF6A 4Y92A 1I0CA 2NUZA 2DBKA 5ECAA 2JMAA 1BU1A 1UGVA 2SRCA 2D1XA 2SEMA 1YNZA 3THKA 1NYFA 3EG1A 4ESRA 2DL8A 4DEYA 3C0CA 3PVQA 2EYWA 1U06A 5IHKA 2PTKA 2EKHA 1UJYA 2FPFA 1OV3A 1GCQA 1SRLA 4A63B 2DNUA 1G2BA 2GNCA 1IO6A 3VS2A 1WLPB 2F2XA 2AZVA 2EVRA 2JT4A 2MOXA 2DYBA 1YCSB 4AFZC 2ECZA 1PHTA 3VRYA 2EYZA 1BB9A 2CSIA 2W10A 2J6FA 2LQNA 1A0NB 2K79A 1UFFA 3VRZA 1GBRA 2L0AA 3ULRB 3M0RA 5L23A 4RTVA 1M3AA 4JJBA 2KRMA 2JM8A 2HCKA 1AWOA 1GCPA 1AWJA 1PKSA 2RQWA 2EYYA 1K76A 2DILA 3KFVA 5IXBA 2KRNA 1UG1A 2KXDA 3EG3A 1UECA 4CC4B 4LUDA 1ABQA 2V1RA 2K7AA 4CC2A 4GLMA 2GQIA 1SRMA 1QWEA 2O31A 4RUGA 1JU5C 3FJ5A 4HVUA 1CSKA 1MV3A 4R0KA 2KGTA 2KE9A 1AWXA 3ZL7C 2K3BA 4AFSC 2FPEA 1WIEA 4QT7A 1JXOA 1E7OA 4Z88A 1JQQA 2DX1A 1NLPC 2L3PA 4M4ZA 2RPNA 2BZ8A 3JV3A 3TSZA 4AG2C 2L3SA 2L3QA 1H3HA 1GCQC 1JO8A 2VVKA 5GJWB 2RQUA 1M3BA 3PE0A 1GFCA 4FSSA 2HSPA 1AEYA 4J9DA 1FMKA 1NM7A 1QKWA 1RLPC 1TUCA 2CT4A 2RQRA 4LN2A 1ZSGA 1OEBA 1TG0A 3VS0A 3EG2A 1PKTA 2OI3A 4Z89A 1CKAA 2EGEA 1PNJA 2W0ZA 1PWTA 2VWFA 2J05A 3TSWA 3EGUA 3LH5A 1UHFA 2RF0A 3VS5A 1JXMA 2EQIA 2LMJA 1BK2A 3M0QA 3RBBB 1W70A 1LCKA 4J9BA 2M51A 1VA7A 1WDXA 1WA7A 2G6FX 1W1FA 1ZBJA 1RLQC 2LJ0A 5GJVB 3A98A 4X1VA 1UDLA 1YP5A 4CC7A 2KEAA 2JS0A 5I11A 4F16A 2A08A 1YN8A 1CKBA 2DL5A 2I0NA 1WYXA 2ROLA 3VS1A 2GBQA 2KBTA 2LP5A 1WX6A 1VYVA 2AKLA 5IHNA 2PNIA 1Y57A 1M27C 4J9GA 1Z9QA 3REBB 1H8KA 4IIMA 4OMLA 1W6XA 2J06A 2E5KA 2YUQA 1HSQA 1ABOA 1B07A 5I22A 2A36A 3REAB 1UTIA 2LJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE0 X;  4E6R A;  1FYN A;  2YSQ A;  2DMO A;  2ABL A;  4D8K A;  1T0H A;  2PZ1 A;  3CQT A;  3QWX X;  2X3W D;  1Z9Z A;  3NGP A;  2NWM A;  2KYM A;  4K11 A;  1B3Q A;  2J6K A;  3H0F A;  4AFQ C;  1QKX A;  2KRO A;  2JM9 A;  2ED1 A;  2FRW A;  4J9I A;  1SHF A;  2CT3 A;  1WFW A;  2RNA A;  1SPK A;  2QDL A;  1AZG B;  3H41 A;  1GFD A;  4EIK A;  1M8M A;  3UF4 A;  4JJC A;  1NEG A;  5FW9 A;  1X27 A;  2K6D A;  2VKN A;  2YUN A;  2KT1 A;  1E6H A;  1G83 A;  2EGC A;  2AKK A;  1T3S A;  2F2V A;  2GTO A;  2EGA A;  1ZUY A;  2RQT A;  2FRY A;  3I5S A;  2IIM A;  3VS6 A;  1UE9 A;  2KYB A;  1WXB A;  2HDA A;  2L2P A;  1OOT A;  2M0Y A;  4RTT A;  2EBP A;  3NMZ C;  1NEB A;  4RTZ A;  2DLP A;  1RUW A;  2D8H A;  3UA6 A;  4LNP A;  3GBQ A;  1BBZ A;  2OJ2 A;  3I9Q A;  4WCI A;  4J9C A;  4OMO A;  2ENM A;  2KXC A;  2BZY A;  5IH2 A;  1KIK A;  1HJD A;  5FWB A;  3RNJ A;  2DL3 A;  2J6O A;  4RTW A;  2LZ6 B;  1AZE A;  1SEM A;  1WXU A;  2XMF A;  4ORZ A;  2RN8 A;  1M30 A;  2KT8 A;  1EFN A;  4RTX A;  2YT6 A;  4AG1 C;  1K0X A;  1YWO A;  2CDT A;  2P4R A;  1M3C A;  1I1J A;  2DVJ A;  4HXJ A;  3O5Z A;  4IIO A;  1NLO C;  3EG0 A;  2JTE A;  1ZLM A;  2D8J A;  1X6G A;  3H0I A;  4J9H A;  1X69 A;  1X43 A;  5FWC A;  3R6N A;  4DEX A;  1TUD A;  4JZ3 A;  3EHQ A;  3NHN A;  1E6G A;  2D0N A;  1X6B A;  2C0I A;  1MUZ A;  2O9V A;  2BZX A;  3H0H A;  2HBW A;  4RTU A;  2YDL A;  3VS3 A;  2X3X D;  4LUE A;  2F2W A;  4HVV A;  2O88 A;  3VS4 A;  2C0T A;  4KRT A;  1UUE A;  4HCK A;  2MCN A;  3SHW A;  3SEM A;  2YUO A;  4CC3 A;  3UA7 A;  2RQV A;  1PRM C;  1SSH A;  4JPB W;  2DRK A;  1AVZ C;  2DA9 A;  1K4U S;  1KFZ A;  3M0P A;  1AOJ A;  1ARK A;  1S1N A;  1SHG A;  2K2M A;  1N5Z A;  4OMP A;  4RTY A;  2CH4 W;  1I07 A;  1T3L A;  4OMQ A;  2C0O A;  1T0J A;  2LCS A;  1X2K A;  1QWF A;  2LX7 A;  1GBQ A;  2AK5 A;  3M0S A;  4D8D A;  1NYG A;  1H92 A;  2FPD A;  2GGR A;  1HD3 A;  2MIO A;  4Z8A A;  2FO0 A;  2KRS A;  1U3O A;  2B86 A;  1WI7 A;  2JS2 A;  1K9A A;  2HEQ A;  1ZX6 A;  2DL4 A;  5HCK A;  1QLY A;  2AZS A;  2LJ1 A;  4ZNX A;  5EC7 A;  2KR3 A;  1X2Q A;  3VS7 A;  1RI9 A;  1GL5 A;  2H8H A;  1KJW A;  2JXB A;  3NPF A;  3M0T A;  1NG2 A;  2CUB A;  3QWY A;  1AWW A;  2A28 A;  1WXT A;  1KSW A;  1Y0M A;  2CH4 A;  2ROT A;  4OMM A;  3IQL A;  2LQW A;  2CRE A;  3PVL A;  1VYT A;  2DBM A;  2A37 A;  2DM1 A;  3M0U A;  1OPK A;  2KNB B;  2ED0 A;  2FG0 A;  2LNH B;  1OPL A;  3I35 A;  2K9G A;  1ZUK A;  1K0S A;  1VYU A;  2EW3 A;  2CSQ A;  1YWP A;  2DL7 A;  1K1Z A;  5IXF A;  2RMO A;  4J9F A;  4AFU C;  2O9S A;  2FEI A;  1MV0 B;  4F14 A;  2ESW A;  2DRM A;  2GTJ A;  1ZUU A;  3UAT A;  2DJQ A;  2JW4 A;  3EHR A;  4F17 A;  1QCF A;  1UHC A;  1XOV A;  2O2O A;  1U5S A;  1PRL C;  2J7I A;  2EYX A;  4JJD A;  1JEG A;  4LE9 A;  1V1C A;  1AD5 A;  5IHI A;  2OAW A;  1J3T A;  2EPD A;  4J9E A;  3I5R A;  4GBQ A;  3U23 A;  2BTT A;  3TVT A;  1GRI A;  2CUD A;  2V1Q A;  4OMN A;  4JZ4 A;  1UJ0 A;  2YUP A;  2JMC A;  4HVW A;  2DF6 A;  4Y92 A;  1I0C A;  2NUZ A;  2DBK A;  5ECA A;  2JMA A;  1BU1 A;  1UGV A;  2SRC A;  2D1X A;  2SEM A;  1YNZ A;  3THK A;  1NYF A;  3EG1 A;  4ESR A;  2DL8 A;  4DEY A;  3C0C A;  3PVQ A;  2EYW A;  1U06 A;  5IHK A;  2PTK A;  2EKH A;  1UJY A;  2FPF A;  1OV3 A;  1GCQ A;  1SRL A;  4A63 B;  2DNU A;  1G2B A;  2GNC A;  1IO6 A;  3VS2 A;  1WLP B;  2F2X A;  2AZV A;  2EVR A;  2JT4 A;  2MOX A;  2DYB A;  1YCS B;  4AFZ C;  2ECZ A;  1PHT A;  3VRY A;  2EYZ A;  1BB9 A;  2CSI A;  2W10 A;  2J6F A;  2LQN A;  1A0N B;  2K79 A;  1UFF A;  3VRZ A;  1GBR A;  2L0A A;  3ULR B;  3M0R A;  5L23 A;  4RTV A;  1M3A A;  4JJB A;  2KRM A;  2JM8 A;  2HCK A;  1AWO A;  1GCP A;  1AWJ A;  1PKS A;  2RQW A;  2EYY A;  1K76 A;  2DIL A;  3KFV A;  5IXB A;  2KRN A;  1UG1 A;  2KXD A;  3EG3 A;  1UEC A;  4CC4 B;  4LUD A;  1ABQ A;  2V1R A;  2K7A A;  4CC2 A;  4GLM A;  2GQI A;  1SRM A;  1QWE A;  2O31 A;  4RUG A;  1JU5 C;  3FJ5 A;  4HVU A;  1CSK A;  1MV3 A;  4R0K A;  2KGT A;  2KE9 A;  1AWX A;  3ZL7 C;  2K3B A;  4AFS C;  2FPE A;  1WIE A;  4QT7 A;  1JXO A;  1E7O A;  4Z88 A;  1JQQ A;  2DX1 A;  1NLP C;  2L3P A;  4M4Z A;  2RPN A;  2BZ8 A;  3JV3 A;  3TSZ A;  4AG2 C;  2L3S A;  2L3Q A;  1H3H A;  1GCQ C;  1JO8 A;  2VVK A;  5GJW B;  2RQU A;  1M3B A;  3PE0 A;  1GFC A;  4FSS A;  2HSP A;  1AEY A;  4J9D A;  1FMK A;  1NM7 A;  1QKW A;  1RLP C;  1TUC A;  2CT4 A;  2RQR A;  4LN2 A;  1ZSG A;  1OEB A;  1TG0 A;  3VS0 A;  3EG2 A;  1PKT A;  2OI3 A;  4Z89 A;  1CKA A;  2EGE A;  1PNJ A;  2W0Z A;  1PWT A;  2VWF A;  2J05 A;  3TSW A;  3EGU A;  3LH5 A;  1UHF A;  2RF0 A;  3VS5 A;  1JXM A;  2EQI A;  2LMJ A;  1BK2 A;  3M0Q A;  3RBB B;  1W70 A;  1LCK A;  4J9B A;  2M51 A;  1VA7 A;  1WDX A;  1WA7 A;  2G6F X;  1W1F A;  1ZBJ A;  1RLQ C;  2LJ0 A;  5GJV B;  3A98 A;  4X1V A;  1UDL A;  1YP5 A;  4CC7 A;  2KEA A;  2JS0 A;  5I11 A;  4F16 A;  2A08 A;  1YN8 A;  1CKB A;  2DL5 A;  2I0N A;  1WYX A;  2ROL A;  3VS1 A;  2GBQ A;  2KBT A;  2LP5 A;  1WX6 A;  1VYV A;  2AKL A;  5IHN A;  2PNI A;  1Y57 A;  1M27 C;  4J9G A;  1Z9Q A;  3REB B;  1H8K A;  4IIM A;  4OML A;  1W6X A;  2J06 A;  2E5K A;  2YUQ A;  1HSQ A;  1ABO A;  1B07 A;  5I22 A;  2A36 A;  3REA B;  1UTI A;  2LJ3 A; 
#chains in the Genus database with same CATH topology
 2DE0 X;  1FYN A;  3ZBD A;  4OF1 A;  2DMO A;  2WSE E;  4CRI A;  4D8K A;  2X9H A;  5CK9 A;  5GAO p;  2HAX A;  4J7I A;  1B3Q A;  1KQS P;  4JRK A;  4BAC A;  2XG8 D;  4DBH A;  1Y7X A;  2KAF A;  4E7K A;  3OA6 A;  2CT3 A;  2BKD N;  4M77 G;  5EG2 A;  1SPK A;  2C06 A;  1K9M R;  2MPX C;  1GFD A;  4II1 A;  4OB3 B;  1UB4 A;  2YUN A;  2KT1 A;  2OX7 A;  3QUI A;  1JJ2 A;  3CCR Q;  2EGA A;  4PFZ A;  1BCO A;  3PMI A;  2RHI A;  4D6W A;  2K4Y A;  1HXD A;  3RES A;  1IGU A;  4JRI A;  3OMC A;  2M0Y A;  4X34 A;  4PLI A;  1NEB A;  3MET A;  3FDR A;  4RTZ A;  2RH2 A;  5GMK j;  1TXQ A;  1RUW A;  1IHW A;  4B9W A;  2YWW A;  1QQJ A;  4LNP A;  3GBQ A;  4ZTF A;  1RAB B;  4J9C A;  4X9C A;  5GAM g;  1F1B B;  2KXC A;  1YCY A;  2CP2 A;  1HJD A;  5FWB A;  1Q7Y R;  4A4K A;  2OTJ A;  3C12 A;  1SEM A;  4ORZ A;  2CGH A;  1PD1 A;  3VUB A;  4OP0 A;  5GMK e;  1YWO A;  1Q82 C;  1VQL Q;  2MI6 A;  1KK7 A;  3O5Z A;  2P4T A;  3TEE A;  1NLO C;  4OB2 B;  2B8A A;  4M77 E;  2D8J A;  3HFO A;  4XTV A;  2XDB A;  1X6G A;  3QHS A;  3V7C A;  1C1A A;  1X69 A;  1MNE A;  5GAN f;  3H9N A;  1TH7 A;  4DEX A;  2ZZD A;  2M9U A;  2FB7 A;  2O4X A;  1WNL A;  1MUZ A;  2JN0 A;  4M78 B;  2QQS A;  3H0H A;  2HBW A;  4WTO B;  1OU9 A;  4LUE A;  1NJI U;  2DER A;  4BE2 A;  1YJW T;  1N9S A;  4LDX A;  2YUO A;  3TRE A;  3CCU A;  3UA7 A;  1WQ7 A;  2DA9 A;  1KFZ A;  2F1L A;  3H6Z A;  4KUI A;  2X35 A;  1T3L A;  4FIB A;  2LCS A;  1QWF A;  2LX7 A;  2QQ9 A;  1H3Z A;  1WQW A;  2FPD A;  2QGG A;  2MIO A;  2MK5 A;  4LDY A;  1G3Y A;  3SB2 A;  4ZN3 A;  1N27 A;  2FO0 A;  1KC8 C;  2KRS A;  3EFO B;  3X25 B;  1MMA A;  1Q81 U;  4KT0 E;  2QAZ A;  3CXC P;  3FEO A;  1QLY A;  4JRP A;  3HRU A;  2AZS A;  4BE1 A;  4ZNX A;  1X2Q A;  3CCE A;  2V26 A;  2PVG B;  2H8H A;  2JXB A;  1KD1 U;  3M0T A;  4HKE A;  1HYO A;  2CUB A;  1W2B P;  1WXT A;  2CH4 A;  3MP8 A;  2K5L A;  4M7D B;  1YHQ Q;  4OMM A;  1VQN A;  2A37 A;  3I55 A;  1K73 R;  2VV5 A;  3OYM A;  4HCC A;  2ED0 A;  1OYX A;  4M78 A;  2CZ1 B;  3I35 A;  1NPP A;  1K0S A;  5GMK l;  1W2B S;  1YWP A;  1K1Z A;  2FYK A;  1XJW B;  4LD9 K;  3E1S A;  1WZO A;  3V7R A;  3OS5 A;  3CBP A;  2FEI A;  4B9X A;  1I5L A;  5GAO r;  4A4E A;  8AT1 B;  1EZZ B;  1YI2 Q;  2GTJ A;  3M55 A;  2K57 A;  1ZUU A;  2DD4 A;  3OSV A;  5FLX E;  5KYN A;  4F17 A;  4RCB A;  4Y91 A;  1VQM Q;  3M58 A;  2QDY B;  5IT9 E;  2EYX A;  1VQK Q;  1JEG A;  4BDY A;  3CXC A;  4E7L A;  4MDX A;  5IHI A;  3AT1 B;  5CKF A;  2EPD A;  4HA8 A;  4J9E A;  2COZ A;  3EFO A;  3CCJ Q;  1VQ5 Q;  4KUL A;  3TVT A;  1GRI A;  2V1Q A;  2F5T X;  2KI7 A;  1P92 A;  4BY6 B;  1K8A C;  1W2B A;  4XK8 E;  3WVE B;  2OTL Q;  4PJO B;  1ZHI A;  2JMC A;  2ZPE B;  1IB8 A;  2NUZ A;  4O6J A;  4PFP A;  3CCR A;  1BU1 A;  2SRC A;  2D1X A;  2SEM A;  1ZSZ C;  2DZ9 A;  3ER0 A;  3EG1 A;  4M7D A;  2DL8 A;  2HL3 A;  4XTW A;  1M90 C;  2PTK A;  2QA4 Q;  1QVP A;  3NTK A;  1QP3 A;  3JCM b;  1IO6 A;  3P8D A;  4PJO F;  1I8F A;  2R58 A;  2V8J A;  4EMG A;  4C8Q B;  5GAO m;  3CC2 Q;  3HRS A;  4F7U F;  3JCM d;  2KMT A;  1UFF A;  1R8O B;  1YIT T;  2XKO C;  1XQH A;  5L23 A;  4RTV A;  3NTI A;  4JJB A;  1I5O B;  3G4S T;  2DTO A;  1VQL A;  3M9Q A;  1GCP A;  1PKS A;  2HNI A;  1C0M A;  1K76 A;  1VQ6 Q;  5IXB A;  4C8Q F;  4CI0 C;  1R0B G;  3VV0 A;  1ABQ A;  1NZ9 A;  4J6Y A;  2XU8 A;  2GQI A;  4Y28 E;  3MJX A;  1SRM A;  4NL2 A;  3MCA B;  1YIJ T;  4M75 A;  1JU5 C;  1VUB A;  4IUR A;  2RI2 A;  3I56 T;  4QW2 A;  4PLL A;  4R0K A;  2K5I A;  3RMQ A;  1AWX A;  4PJO A;  3ZL7 C;  1G3T A;  1IRE B;  2K3B A;  4AFS C;  2WSF E;  5HK3 A;  3OS0 A;  1SG5 A;  1E7O A;  3GPL A;  4KGV B;  2L3P A;  4E7I A;  2BZ8 A;  4O5V A;  3JV3 A;  1OX9 A;  5LJ3 h;  5CKE A;  2EJF A;  2AIR B;  2L3S A;  2EQU A;  3X28 B;  1H3H A;  3OY9 A;  2DKG A;  1QMC A;  2RO0 A;  3C94 A;  3JB9 I;  1G3W A;  4J9D A;  1FMK A;  1TUC A;  2CT4 A;  2RHZ A;  2G3R A;  3EGX A;  1JB0 E;  4LDW A;  1PKT A;  3OYG A;  2K2V A;  3RR6 A;  9ATC B;  2OI3 A;  4Z89 A;  4QVD A;  1RAI B;  5IN1 A;  2W0Z A;  4RG2 A;  3CCL T;  2QXF A;  3TSW A;  1JXM A;  2EQI A;  2LMJ A;  1BK2 A;  3SFM A;  4J7F A;  1W70 A;  1LCK A;  4J9B A;  2X51 A;  2LRQ A;  3ZEH A;  2LT4 A;  2HBP A;  4OVA A;  2VC8 A;  3OW2 S;  1YJN Q;  2LQK A;  4PJL A;  4F16 A;  3OYK A;  2A08 A;  4WF2 A;  2GFU A;  1RAH B;  1W4S A;  2Y90 A;  2YLC A;  3DLL A;  4MZP A;  3QYG B;  4NL3 A;  2BIV A;  1WGS A;  5FU7 C;  1VYV A;  1LNX A;  1M27 C;  1Z9Q A;  1H8K A;  2OTJ T;  3LX7 A;  1Y96 A;  1W6X A;  2DJZ A;  4L5G A;  4XAX B;  1WHG A;  5LJ3 j;  2EWN A;  3QDF A;  3TCJ A;  4UC4 A;  4E6R A;  1D1B A;  2KQW A;  5J3B A;  1T0H A;  3CQT A;  1Q86 R;  3QWX X;  3OYB A;  1BI3 A;  2KYM A;  3QXE B;  2F5K A;  4AFQ C;  3MEU A;  1BI1 A;  2KRO A;  4E47 A;  1N8R R;  1IRX A;  1VQM A;  1EX4 A;  3NTH A;  1SHF A;  5LJ3 e;  1RAD B;  2XDP A;  2QDL A;  1VQK A;  1AZG B;  4C0D B;  3H41 A;  1BKB A;  1M8M A;  3OW2 A;  2VAS A;  1NEG A;  5FW9 A;  5CQX A;  4XTY A;  1OQK A;  1VQ5 A;  1M9S A;  2AKK A;  2EGC A;  2M16 A;  1G8X A;  3I5S A;  3VS6 A;  2KYB A;  3CCU T;  1WXB A;  3HFN A;  3M59 A;  4N0A C;  2LQ8 A;  2OTL A;  2X4W A;  2EBP A;  2VGN A;  3FC3 A;  1BI2 A;  4N4H A;  4C92 G;  2D8H A;  5GAN h;  5DLO A;  1U1S A;  3I9Q A;  4WCI A;  4XTX A;  4OMO A;  1MMG A;  5IH2 A;  2E10 A;  1PCX A;  2E65 A;  2QA4 A;  2A0F B;  2DL3 A;  4GY5 A;  2J6O A;  4RTW A;  2LZ6 B;  1AZE A;  3OS1 A;  2XMF A;  2VXF A;  2RN8 A;  1WPY A;  3QPH A;  3CC4 Q;  4AG1 C;  1Q95 G;  4MDW A;  1M3C A;  3CC2 A;  3QBY A;  1TSF A;  3CCE T;  4JJN K;  3H0I A;  5GAN 3;  4C5I A;  5KCO A;  4FM4 B;  5D6Y A;  1OUL A;  5FRN A;  1JJ2 P;  3EHQ A;  3URG A;  4QQ6 A;  3NHN A;  3LGL A;  4XTU A;  2D0N A;  4E7Z A;  2VB6 A;  1VQN T;  1MGQ A;  3X24 B;  2DXU A;  2BE9 B;  2DPP B;  3CBM A;  4ELZ C;  2X3X D;  4JS5 A;  3CMA Q;  4HVV A;  3L2Q A;  4JRQ A;  3VS4 A;  1YIJ A;  3M57 A;  3UPU A;  4KRT A;  4KGZ B;  5GAN 7;  4C92 E;  4CC3 A;  1RI0 A;  2RQV A;  1PRM C;  1N8R U;  1M5Q 1;  2VGM A;  1ARK A;  1OU8 A;  1RAF B;  4ELY C;  3CPF A;  3J7A F;  5GAN j;  4OMP A;  4RTY A;  3BE3 A;  4XU3 A;  4BB7 A;  2XK0 A;  2DYI A;  3CCS Q;  1NJI R;  1X6O A;  3PT9 A;  1NYG A;  3BDU A;  3CCS T;  1BCM A;  1PSF A;  5LJ3 g;  2O4X B;  2DD5 A;  3BDL A;  1U3O A;  2B86 A;  2JS2 A;  5GAN e;  1ZX6 A;  2DL4 A;  3OYY A;  4HCZ A;  4L59 A;  4BI3 A;  3CC7 Q;  3EFS A;  1RI9 A;  3RIR A;  5GAM f;  4GLK A;  3CCL A;  1D0Y A;  4M7A D;  1NG2 A;  4R56 A;  4XQ3 A;  1M1G A;  1KSW A;  3MEA A;  3CPW S;  1K9M C;  2MYS A;  5GAN 6;  3ASK A;  3CCR T;  3ZFJ A;  1VYT A;  1ZQ1 A;  1Q81 R;  5LJ5 g;  1OPK A;  1ZSZ A;  1QP2 A;  2KNB B;  2FG0 A;  3RUX A;  2LNH B;  2DK3 A;  1KD1 R;  2K9G A;  3BY7 A;  2EW3 A;  4NS5 A;  2DL7 A;  1LVK A;  1YJN A;  3EGD B;  2CZ6 B;  3JCM P;  4C0F A;  1AT1 B;  2HQE A;  2ZPG B;  3V7S A;  4FW1 A;  4F14 A;  2ESW A;  2RK2 A;  2DRM A;  6AT1 B;  2JJ9 A;  2JW4 A;  1QCO A;  3EHR A;  1Q7Y C;  3LYI A;  2H3E B;  3G6E Q;  1QCF A;  1VQP Q;  3CPW A;  1VQL T;  4QVZ A;  3QJY A;  2J7I A;  1OI1 A;  2HZY A;  4OGE A;  3G6E T;  4JJD A;  1M1K U;  3JCM f;  1V1C A;  1AD5 A;  2OAW A;  4Q5W A;  4GBQ A;  3U23 A;  2KVQ G;  4M78 G;  2KSS A;  3G1J A;  2QGF B;  1IGQ A;  4OMN A;  4ZN1 A;  4V2S A;  5FU7 B;  1I0C A;  5ECA A;  2JMA A;  1UGS B;  3EFR A;  3SD4 A;  3MPU B;  2RA2 A;  2RJE A;  3E9G A;  3OBY A;  4M78 F;  4C5G A;  4DEY A;  1X01 A;  3C0C A;  1N9R A;  1U06 A;  2WAC A;  5C6S A;  5CKB A;  4M7A C;  1M2V A;  1UJY A;  1I81 A;  2EJG A;  2FPF A;  4RCC A;  4A63 B;  2FHD A;  1VOM A;  3JB9 G;  2EVR A;  5GAN g;  2VYT A;  4MML A;  1B34 A;  3HRT A;  1YCS B;  2CP3 A;  3EGD A;  3G71 Q;  2ECZ A;  4Z02 A;  2Y4Y A;  2EYZ A;  1BB9 A;  2CSI A;  1A0N B;  2L0A A;  3ULR B;  1GXI E;  2KRM A;  3CC4 A;  3KXT A;  4HCB A;  2HCK A;  3JB9 F;  1AWO A;  3FJP A;  3UWN A;  3CCV Q;  1TOV A;  2YRV A;  3OYF A;  4M78 E;  4J6W A;  2IVW A;  2QQA A;  2DIL A;  2XI9 A;  4KBM B;  4M7D G;  3EG3 A;  4CC4 B;  1D0X A;  2V1R A;  3P8H A;  2K7A A;  1YHQ T;  1WHM A;  3GLX A;  4J8O A;  3GOX A;  4E2F B;  1QWE A;  4A4H A;  2O31 A;  3FJ5 A;  1Q82 U;  5D7U A;  3CMA A;  3Q1J A;  1K73 C;  4JLI A;  1MV3 A;  2KGT A;  4PJN A;  4M7D F;  4JLG A;  3DB4 A;  4A4F A;  3A8M B;  3PIO A;  4BE0 A;  3VYG A;  5I2S A;  5J39 A;  3GNG A;  4PL6 A;  3QG1 A;  3TSZ A;  1GCQ C;  3X26 B;  2COY A;  2DXB A;  1YI2 T;  2VVK A;  3CCS A;  1IHV A;  5GAM d;  2R5A A;  2HSP A;  1AEY A;  2XHC A;  1NM7 A;  1QVG P;  2PUK B;  5A0G A;  7AT1 B;  1WHJ A;  1VQM T;  3E9F A;  3VS0 A;  4IUU A;  4QKU A;  4XU0 A;  2NYS A;  4HT8 A;  2D9T A;  4C92 C;  2O01 E;  4M77 D;  1VQK T;  4N4I A;  5DY9 A;  1M2O A;  2PVD B;  4M75 B;  2EAY A;  4L6V 5;  2EYQ A;  2VWF A;  4M7D E;  2AHJ B;  3EGU A;  3LH5 A;  3CCJ T;  1VQ5 T;  1UHF A;  1QVG S;  1M1F A;  3RBB B;  4PJO G;  2JOY A;  1RAE B;  4EPC A;  4N0A A;  2OTL T;  1ZBJ A;  5GJV B;  1VQ7 Q;  4F7U G;  1KC8 U;  3CD6 Q;  2MF2 A;  4M75 F;  4X1V A;  5I11 A;  2KEA A;  2JS0 A;  3OYD A;  1YN8 A;  3LLR A;  3PNW C;  1CKB A;  3ME9 A;  1WYX A;  2QA4 T;  4E7H A;  1WX6 A;  2AKL A;  3EGX B;  1Y57 A;  5FRO A;  4OML A;  5GMK m;  3WXM B;  2EQK A;  3QDR B;  2YUQ A;  4C8Q G;  1ABO A;  1B07 A;  1PD0 A;  1BIA A;  3MKD A;  3REA B;  2EQJ A;  2YSQ A;  2YHT A;  3CC2 T;  1OZ3 A;  2ABL A;  2R57 A;  2LDM A;  3FLG A;  4E7J A;  2X3W D;  1QVG A;  1FMV A;  1Z9Z A;  1YBY A;  4B6M A;  2NWM A;  4K11 A;  1NE8 A;  2AT1 B;  3H0F A;  2BUD A;  5LL6 S;  5GAN 2;  3G6E A;  2JM9 A;  1VQP A;  3HSB A;  1YJ9 Q;  2PUO B;  2MWO A;  2QQR A;  2HKN A;  1RAA B;  1V76 A;  1VQ6 T;  4EIK A;  3QKJ A;  4JJC A;  1M4Z A;  4PJO E;  2E41 A;  3JAM E;  2F2V A;  2GTO A;  1ZUY A;  5GAN 5;  4F7U E;  2HKQ B;  4J5Y A;  1Y96 B;  5A0L A;  2E4H A;  2L2P A;  4M77 C;  2KDS A;  3AHU A;  3TQ7 P;  4YTL A;  5FU6 C;  3OB9 A;  1VQ9 Q;  1BBZ A;  2OJ2 A;  1VQ4 Q;  4C8Q E;  2DO3 A;  2BZY A;  4JDS A;  5GAO n;  2RHX A;  4TVR A;  1K8A U;  1RAC B;  3CCQ Q;  1RAG B;  3OYL A;  2P0P A;  3VJP A;  3S3O A;  5CAI A;  2XD0 A;  1WXU A;  5CVI A;  3PMT A;  2DEU A;  1M30 A;  2KT8 A;  2RK1 A;  3G71 A;  4MZM A;  2CDT A;  1I1J A;  2E6Z A;  4XTZ A;  3A1P A;  2ZPF B;  1ZLM A;  3OW2 P;  1M90 U;  5FWC A;  3A8L B;  3FB9 A;  1TUD A;  1QW1 A;  3JCM W;  1UGQ B;  3CCV A;  2VXE A;  1X6B A;  2YXY A;  2O9V A;  2BZX A;  1DJ7 B;  4M7A B;  1I4K 1;  2YDL A;  1YHQ A;  3VS3 A;  3L2R A;  1YFN A;  1SSF A;  2FVU A;  1QVF P;  4ZGD B;  2F2W A;  2CZ7 B;  1U8R A;  4HCK A;  4C5E A;  1YJN T;  3HL8 A;  1SSH A;  4JPB W;  3T9N A;  2DRK A;  1Y07 A;  1AVZ C;  3HPW A;  3M0P A;  2K2M A;  1N5Z A;  5GAM h;  4QQD A;  2CH4 W;  4M7A F;  3S3M A;  2QEX Q;  1I07 A;  4OMQ A;  2C0O A;  1QVF S;  4FT2 A;  1T0J A;  1IXD A;  1X2K A;  3M0S A;  3A8G B;  1YI2 A;  1H92 A;  3FRN A;  2RHU A;  2V8K A;  4Z8A A;  5AT1 B;  3CME Q;  2ZPB B;  1WI7 A;  1KQ1 A;  2FZG B;  2PQW A;  5D6W A;  1VQO Q;  2HEQ A;  2E6N A;  1Q86 C;  3F70 A;  2LJ1 A;  5I21 A;  1ZA2 B;  4MMK A;  3J80 E;  1GL5 A;  1KJW A;  1WJR A;  1N8R C;  4R55 A;  3CCJ A;  3QWY A;  2BE7 D;  1AWW A;  2A28 A;  1Y0M A;  2A3L A;  2EJ9 A;  2ATC B;  1BI0 A;  2ROT A;  2R5M A;  3IQL A;  2LQW A;  2CRE A;  5CR2 A;  3PVL A;  2DBM A;  2DET A;  3M0U A;  1B7T A;  4EMH A;  2CYZ B;  1QVF A;  3JCM J;  5KYU A;  3QSU A;  1VQ8 Q;  2DEQ A;  4M7A A;  3L2W A;  4NOY A;  4DBR A;  3CD6 A;  1VYU A;  3JCM h;  4QVC A;  2CSQ A;  1WHL A;  5IXF A;  2CP7 A;  2MAM A;  2JUF A;  2RMO A;  4ANJ A;  5GAM j;  4AFU C;  2E64 A;  2O9S A;  3HP9 A;  4FYW B;  2QYZ A;  4DBF A;  3L2Z A;  3CCM Q;  5GMK i;  4C8Q D;  3UAT A;  2QG9 B;  4FU6 A;  3E2U A;  3LWH A;  2DJQ A;  2LCC A;  3CC4 T;  4PFO A;  3GNF B;  1UHC A;  2O2O A;  5GAN 8;  2H3J A;  1U5S A;  3A8O B;  5M9O A;  2P0Q A;  1VIF A;  1TUG B;  5GAM e;  4VUB A;  4FT4 A;  1PM3 A;  3OYJ A;  1UGR B;  1ZSZ B;  5DM7 R;  4FCY A;  1J3T A;  2JNG A;  2VUB A;  1PC0 A;  2JTF A;  1VQ6 A;  1YJ9 A;  2M1H A;  2CUD A;  5KYX B;  5CIU A;  4BI4 A;  3KBG A;  2MWP A;  5KYW A;  1UJ0 A;  3I55 Q;  3CMA T;  2DF6 A;  4Y92 A;  4BI8 B;  2HD0 A;  4PJJ A;  3LWI A;  1M1K R;  1UGV A;  3L42 A;  2CP6 A;  2RHY A;  1NYF A;  4ESR A;  2DIG A;  5CKH A;  1Y71 A;  3D7S B;  2XID A;  3JB9 J;  3OS2 A;  4IUP A;  1M8V A;  1OV3 A;  1GCQ A;  4PKC C;  2QAS A;  1G2B A;  2GNC A;  2F2X A;  3M5A A;  1VQ9 A;  3HTR A;  2MOX A;  8ATC B;  3QYH B;  3CPW P;  4OMF B;  5LJ5 f;  1PHT A;  3VRY A;  1NJI C;  2K79 A;  1SKU B;  2M0O A;  3JB9 H;  4PK4 A;  3JCM e;  4C92 A;  2RI3 A;  3E19 A;  1JRI A;  5D6X A;  1M3A A;  5CO7 A;  3JCM X;  2JM8 A;  2K3Y A;  3V8J A;  2DTI A;  2P84 A;  5CQY A;  1AWJ A;  3CC7 T;  3WVD B;  4M77 B;  1UG1 A;  2E12 A;  4LXC A;  2KXD A;  2K3X A;  1UEC A;  3VKI A;  4LUD A;  4C8Q C;  1M2V B;  5FU6 B;  4CC2 A;  4GLM A;  4E7S A;  2HMA A;  2X4X A;  1UGP B;  4RUG A;  1TWB A;  4DOW A;  5KYX A;  1B34 B;  2FL7 A;  1KQS S;  4ZGE B;  2CP5 A;  1G3S A;  1Q81 C;  3M4G A;  3P8B B;  1FXX A;  2ZPH B;  3C4S A;  2KE9 A;  4M77 F;  4PNO A;  2DZC A;  2A7Y A;  1C6V X;  3QJ6 A;  1JXO A;  1KD1 C;  2QTX A;  2DX1 A;  4M4Z A;  3DLM A;  4A54 A;  3EG9 B;  1BIB A;  2L3Q A;  3UT1 A;  2QEX A;  1Q82 R;  2DIQ A;  5GJW B;  2X4Y A;  4OGC A;  3PE0 A;  3V8K A;  2DAQ A;  1QKW A;  2RQR A;  3EAE A;  1VQP T;  1ZSG A;  1OEB A;  3EG2 A;  3CME A;  3CEY A;  2EGE A;  1PNJ A;  2HSE B;  1VQO A;  1PWT A;  1MHN A;  2EIF A;  1MMN A;  2JTM A;  2D6F A;  2J05 A;  2MMP A;  1KQS A;  3VS5 A;  2RM4 A;  2LT1 A;  1WDX A;  3S3N A;  3SDZ A;  5HY6 A;  2G6F X;  2GF7 A;  1W1F A;  3PIP A;  5IAY A;  3R6O A;  4M77 A;  1YJW Q;  3UDC A;  2DXT A;  1PSE A;  4C92 D;  4CC7 A;  4BD3 A;  4FW2 A;  4EDU A;  1VQ8 A;  4C0G A;  2I0N A;  2ROL A;  3VS1 A;  4EMK C;  2KBT A;  2Y4X A;  1XTD A;  2NUT B;  4J9G A;  1N6A A;  3JCM g;  3L1A A;  3TU4 K;  2J06 A;  1HSQ A;  2EKO A;  1K9M U;  1V29 B;  5I22 A;  2A36 A;  1KC8 R;  3G71 T;  2LJ3 A;  4AT1 B;  2PZ1 A;  3CCM A;  4ZGJ B;  4XU1 A;  3EG9 A;  3NGP A;  2RJD A;  2J6K A;  5KCH A;  1QKX A;  5LJ3 d;  2ED1 A;  2FRW A;  1TTH B;  4J9I A;  2RJF A;  3CCV T;  1WFW A;  2RNA A;  4FSX A;  1R0C B;  2Z0W A;  3UF4 A;  4ATO A;  3EH2 A;  1X27 A;  2K6D A;  2VKN A;  1BYM A;  4PJM A;  4JS4 A;  2V8I A;  1E6H A;  1G83 A;  1QCN A;  1T3S A;  2RQT A;  4A53 A;  2FRY A;  2IIM A;  1UE9 A;  1Q7Y U;  4ZTJ A;  1WJS A;  2HDA A;  2ZPI B;  4KH0 B;  3CXC S;  1OOT A;  1D3B B;  2KK4 A;  4RTT A;  3NMZ C;  3OYN A;  2DXC A;  5LJ5 d;  2DLP A;  4FYX B;  2E70 A;  4C0D C;  2QQB A;  3UA6 A;  5A2Q E;  1SF9 A;  4X9D A;  4C5H A;  2L5Q A;  5GAO l;  2F69 A;  4XU2 A;  1HK9 A;  2PU9 B;  2ENM A;  3OBW A;  1R77 A;  1KIK A;  4J6X A;  3RNJ A;  1LPL A;  3SWN C;  1NPR A;  2NUT A;  2E5Q A;  1EFN A;  4RTX A;  2EFI A;  4ME7 A;  2YT6 A;  5J26 A;  3EH1 A;  1K0X A;  2P4R A;  2DVJ A;  2NLU A;  4HXJ A;  4IIO A;  1FX7 A;  3EG0 A;  2JTE A;  4M75 G;  3X20 B;  1D0Z A;  4J9H A;  3QO3 A;  4RKU E;  2IPO B;  3CC7 A;  1TU0 B;  1X43 A;  1K8A R;  3R6N A;  4JZ3 A;  1E6G A;  3DKM A;  5FRM A;  2C0I A;  3VU3 C;  5CCA A;  1MND A;  4RTU A;  4LDU A;  4FYV B;  3GIB A;  5KH6 A;  1RL2 A;  2O88 A;  3M54 A;  2C0T A;  1M90 R;  1VQ7 T;  1UUE A;  2MCN A;  3CD6 T;  3SHW A;  1FMW A;  3RKX A;  3SEM A;  2CP0 A;  2JZ2 A;  2X4J A;  3CBO A;  1K4U S;  1AOJ A;  4F7U B;  1S1N A;  4P5N A;  1SHG A;  1KG1 A;  3RDV A;  1S72 Q;  1D3B A;  3MP1 A;  5A0D A;  4KH1 B;  2LNV A;  1IZ6 A;  4BUG A;  3L2U A;  1U1T A;  4J83 A;  1GBQ A;  2AK5 A;  2EQM A;  4D8D A;  1S72 T;  3FIF A;  2P0K A;  2GGR A;  1HD3 A;  3OYE A;  4IUQ A;  3MEW A;  5I2M A;  5GAN d;  4M75 E;  2HQH A;  1YIT Q;  1K73 U;  1K9A A;  1WJQ A;  3BW1 A;  3G4S Q;  5HCK A;  2GFA A;  1YJ9 T;  5EC7 A;  2KR3 A;  1VIE A;  3KUF A;  5CKD A;  4M78 D;  3VS7 A;  3NPF A;  5KYY B;  1O75 A;  2ZGW A;  3PGG A;  3DB3 A;  2DM1 A;  2DVE A;  5HK0 A;  1YIJ Q;  3NFC A;  4AMC A;  3I56 Q;  2RI5 A;  5DLQ E;  1D1C A;  1OPL A;  1YJW A;  1ZUK A;  4RMO A;  4C0Z A;  2LVM A;  2RJC A;  1D1A A;  1ZBX A;  3OYA A;  1LOJ A;  4DBQ A;  1VQ9 T;  5L8R E;  4J9F A;  3JB9 D;  1VQ4 T;  1MV0 B;  1OX8 A;  4KGX B;  2WSC E;  3RKW A;  3CCQ T;  4F7U A;  2L89 A;  2GQV A;  4DQ2 A;  2CZ0 B;  3LW5 E;  1XOV A;  2XDD A;  4IKF A;  2M02 A;  3C95 A;  1PRL C;  1KHC A;  3HKS A;  4DA4 A;  2D0Q B;  4LE9 A;  3OQ5 A;  4IUT A;  4LD6 A;  1WHH A;  3RMS A;  2L3R A;  5KYU B;  2YRD A;  3I5R A;  3O8V A;  3RKY A;  4C8Q A;  3CCL Q;  2NUP B;  4M7D D;  3S6W A;  3PTA A;  3GP8 A;  3JCM c;  2BTT A;  4M7A G;  2RB6 A;  3L2V A;  2FZC B;  4JZ4 A;  5GAN 4;  4EMK B;  5LJ5 h;  3M53 A;  2IG0 A;  2LC4 A;  2YUP A;  4HVW A;  2LCL A;  2DBK A;  1EIF A;  2QK0 A;  5KYY A;  5KE2 A;  1YNZ A;  3THK A;  2QTV A;  4HT9 A;  2KY9 A;  3PVQ A;  4M78 C;  4LDV A;  2EYW A;  5IHK A;  3MP6 A;  4OB0 B;  3QZ9 B;  3A5Z B;  2EKH A;  2DFU A;  2QEX T;  1SRL A;  1LJO A;  2DNU A;  3JRZ A;  2OTJ Q;  2COW A;  3VS2 A;  3OYC A;  1O9S A;  1WLP B;  2AZV A;  2JT4 A;  1FWZ A;  2DYB A;  4FYY B;  1G5V A;  1XNI A;  4AFZ C;  5HKC A;  2QI2 A;  2W10 A;  2YRC A;  2J6F A;  2LQN A;  3CME T;  3VRZ A;  5KE3 A;  1GBR A;  3M0R A;  4FL6 A;  4QQG A;  5KYW B;  1VQO T;  1WHK A;  3PFS A;  2DTH A;  4M75 D;  1PG5 B;  2HL5 C;  2FZK B;  2RQW A;  2EYY A;  3OMG A;  4M7A E;  3KFV A;  1AHJ B;  2JVV A;  2KRN A;  4IUV A;  2ZCF B;  4PJO D;  3M56 A;  3RER A;  3OYI A;  1KQ2 A;  3J81 E;  3BFM A;  1JBM A;  5LJ5 j;  1ACM B;  2NUP A;  3CCU Q;  2HQX A;  4HVU A;  1CSK A;  1VQ7 A;  3OSS C;  1TS9 A;  3JCM V;  1VQ8 T;  3SWN B;  4EMK A;  2CKK A;  1MMD A;  2GCX A;  2FPE A;  4M7D C;  1WIE A;  2LTO A;  4QT7 A;  4C92 B;  3VYH B;  4A4G A;  4Z88 A;  1JQQ A;  3M4Y A;  3JCM Q;  1NLP C;  4N4G A;  2RPN A;  5LJ5 e;  2ZAE A;  4DOV A;  2OAU A;  3MO8 A;  3QII A;  4AG2 C;  3H8Z A;  1S72 A;  3CCM T;  1JO8 A;  4JUV A;  2K5F A;  2RQU A;  2RD1 A;  1M3B A;  4FSS A;  1UEB A;  1GFC A;  2I2L A;  1RLP C;  2E3H A;  4LN2 A;  1H64 1;  4OB1 B;  2CS7 A;  3V8L A;  2XIC A;  1TG0 A;  4F04 B;  4KUD K;  3A8H B;  4C92 F;  2L8D A;  3CCE Q;  3G7Z A;  5C0M A;  1CKA A;  1NBE B;  3OYH A;  1YIT A;  4MZT A;  3MHX A;  3VUZ A;  2YLB A;  3G4S A;  2LX9 A;  1X75 C;  2RF0 A;  3M0Q A;  1VQN Q;  5LJ3 f;  4RG8 A;  3QZ5 B;  3GF5 A;  2M51 A;  3N5B B;  1VA7 A;  1WA7 A;  1OZ2 A;  3INZ A;  3I55 T;  1RLQ C;  2LJ0 A;  4BDZ A;  3A98 A;  3LH0 A;  3HHT B;  1ZA1 B;  1KHI A;  1UDL A;  1YP5 A;  3MEV A;  5GAO q;  4M75 C;  5GMK h;  1Q86 U;  1M1K C;  2E3I A;  3I56 A;  4BY6 C;  3LGF A;  2DL5 A;  5AYF A;  1JJ2 S;  2GBQ A;  2LP5 A;  2E1H A;  5IHN A;  2PNI A;  3REB B;  4PJO C;  4IIM A;  1VQ4 A;  3SWN A;  2E5K A;  2PVO B;  1D09 B;  3JSC A;  3CCQ A;  1UTI A; 
#chains in the Genus database with same CATH homology
 2DE0 X;  4E6R A;  1FYN A;  2YSQ A;  2DMO A;  2ABL A;  4D8K A;  1T0H A;  2PZ1 A;  3CQT A;  3QWX X;  2X3W D;  1Z9Z A;  3NGP A;  2NWM A;  2KYM A;  4K11 A;  1B3Q A;  2J6K A;  3H0F A;  4AFQ C;  1QKX A;  2KRO A;  2JM9 A;  2ED1 A;  2FRW A;  4J9I A;  1SHF A;  2CT3 A;  1WFW A;  2RNA A;  1SPK A;  2QDL A;  1AZG B;  3H41 A;  1GFD A;  4EIK A;  1M8M A;  3UF4 A;  4JJC A;  1NEG A;  5FW9 A;  1X27 A;  2K6D A;  2VKN A;  2YUN A;  2KT1 A;  1E6H A;  1G83 A;  2EGC A;  2AKK A;  1T3S A;  2F2V A;  2GTO A;  2EGA A;  1ZUY A;  2RQT A;  2FRY A;  3I5S A;  2IIM A;  3VS6 A;  1UE9 A;  2KYB A;  1WXB A;  2HDA A;  2L2P A;  1OOT A;  2M0Y A;  4RTT A;  2EBP A;  3NMZ C;  1NEB A;  4RTZ A;  2DLP A;  1RUW A;  2D8H A;  3UA6 A;  4LNP A;  3GBQ A;  1BBZ A;  2OJ2 A;  3I9Q A;  4WCI A;  4J9C A;  4OMO A;  2ENM A;  2KXC A;  2BZY A;  5IH2 A;  1KIK A;  1HJD A;  5FWB A;  3RNJ A;  2DL3 A;  2J6O A;  4RTW A;  2LZ6 B;  1AZE A;  1SEM A;  1WXU A;  2XMF A;  4ORZ A;  2RN8 A;  1M30 A;  2KT8 A;  1EFN A;  4RTX A;  2YT6 A;  4AG1 C;  1K0X A;  1YWO A;  2CDT A;  2P4R A;  1M3C A;  1I1J A;  2DVJ A;  4HXJ A;  3O5Z A;  4IIO A;  1NLO C;  3EG0 A;  2JTE A;  1ZLM A;  2D8J A;  1X6G A;  3H0I A;  4J9H A;  1X69 A;  1X43 A;  5FWC A;  3R6N A;  4DEX A;  1TUD A;  4JZ3 A;  3EHQ A;  3NHN A;  1E6G A;  2D0N A;  1X6B A;  2C0I A;  1MUZ A;  2O9V A;  2BZX A;  3H0H A;  2HBW A;  4RTU A;  2YDL A;  3VS3 A;  2X3X D;  4LUE A;  2F2W A;  4HVV A;  2O88 A;  3VS4 A;  2C0T A;  4KRT A;  1UUE A;  4HCK A;  2MCN A;  3SHW A;  3SEM A;  2YUO A;  4CC3 A;  3UA7 A;  2RQV A;  1PRM C;  1SSH A;  4JPB W;  2DRK A;  1AVZ C;  2DA9 A;  1K4U S;  1KFZ A;  3M0P A;  1AOJ A;  1ARK A;  1S1N A;  1SHG A;  2K2M A;  1N5Z A;  4OMP A;  4RTY A;  2CH4 W;  1I07 A;  1T3L A;  4OMQ A;  2C0O A;  1T0J A;  2LCS A;  1X2K A;  1QWF A;  2LX7 A;  1GBQ A;  2AK5 A;  3M0S A;  4D8D A;  1NYG A;  1H92 A;  2FPD A;  2GGR A;  1HD3 A;  2MIO A;  4Z8A A;  2FO0 A;  2KRS A;  1U3O A;  2B86 A;  1WI7 A;  2JS2 A;  1K9A A;  2HEQ A;  1ZX6 A;  2DL4 A;  5HCK A;  1QLY A;  2AZS A;  2LJ1 A;  4ZNX A;  5EC7 A;  2KR3 A;  1X2Q A;  3VS7 A;  1RI9 A;  1GL5 A;  2H8H A;  1KJW A;  2JXB A;  3NPF A;  3M0T A;  1NG2 A;  2CUB A;  3QWY A;  1AWW A;  2A28 A;  1WXT A;  1KSW A;  1Y0M A;  2CH4 A;  2ROT A;  4OMM A;  3IQL A;  2LQW A;  2CRE A;  3PVL A;  1VYT A;  2DBM A;  2A37 A;  2DM1 A;  3M0U A;  1OPK A;  2KNB B;  2ED0 A;  2FG0 A;  2LNH B;  1OPL A;  3I35 A;  2K9G A;  1ZUK A;  1K0S A;  1VYU A;  2EW3 A;  2CSQ A;  1YWP A;  2DL7 A;  1K1Z A;  5IXF A;  2RMO A;  4J9F A;  4AFU C;  2O9S A;  2FEI A;  1MV0 B;  4F14 A;  2ESW A;  2DRM A;  2GTJ A;  1ZUU A;  3UAT A;  2DJQ A;  2JW4 A;  3EHR A;  4F17 A;  1QCF A;  1UHC A;  1XOV A;  2O2O A;  1U5S A;  1PRL C;  2J7I A;  2EYX A;  4JJD A;  1JEG A;  4LE9 A;  1V1C A;  1AD5 A;  5IHI A;  2OAW A;  1J3T A;  2EPD A;  4J9E A;  3I5R A;  4GBQ A;  3U23 A;  2BTT A;  3TVT A;  1GRI A;  2CUD A;  2V1Q A;  4OMN A;  4JZ4 A;  1UJ0 A;  2YUP A;  2JMC A;  4HVW A;  2DF6 A;  4Y92 A;  1I0C A;  2NUZ A;  2DBK A;  5ECA A;  2JMA A;  1BU1 A;  1UGV A;  2SRC A;  2D1X A;  2SEM A;  1YNZ A;  3THK A;  1NYF A;  3EG1 A;  4ESR A;  2DL8 A;  4DEY A;  3C0C A;  3PVQ A;  2EYW A;  1U06 A;  5IHK A;  2PTK A;  2EKH A;  1UJY A;  2FPF A;  1OV3 A;  1GCQ A;  1SRL A;  4A63 B;  2DNU A;  1G2B A;  2GNC A;  1IO6 A;  3VS2 A;  1WLP B;  2F2X A;  2AZV A;  2EVR A;  2JT4 A;  2MOX A;  2DYB A;  1YCS B;  4AFZ C;  2ECZ A;  1PHT A;  3VRY A;  2EYZ A;  1BB9 A;  2CSI A;  2W10 A;  2J6F A;  2LQN A;  1A0N B;  2K79 A;  1UFF A;  3VRZ A;  1GBR A;  2L0A A;  3ULR B;  3M0R A;  5L23 A;  4RTV A;  1M3A A;  4JJB A;  2KRM A;  2JM8 A;  2HCK A;  1AWO A;  1GCP A;  1AWJ A;  1PKS A;  2RQW A;  2EYY A;  1K76 A;  2DIL A;  3KFV A;  5IXB A;  2KRN A;  1UG1 A;  2KXD A;  3EG3 A;  1UEC A;  4CC4 B;  4LUD A;  1ABQ A;  2V1R A;  2K7A A;  4CC2 A;  4GLM A;  2GQI A;  1SRM A;  1QWE A;  2O31 A;  4RUG A;  1JU5 C;  3FJ5 A;  4HVU A;  1CSK A;  1MV3 A;  4R0K A;  2KGT A;  2KE9 A;  1AWX A;  3ZL7 C;  2K3B A;  4AFS C;  2FPE A;  1WIE A;  4QT7 A;  1JXO A;  1E7O A;  4Z88 A;  1JQQ A;  2DX1 A;  1NLP C;  2L3P A;  4M4Z A;  2RPN A;  2BZ8 A;  3JV3 A;  3TSZ A;  4AG2 C;  2L3S A;  2L3Q A;  1H3H A;  1GCQ C;  1JO8 A;  2VVK A;  5GJW B;  2RQU A;  1M3B A;  3PE0 A;  1GFC A;  4FSS A;  2HSP A;  1AEY A;  4J9D A;  1FMK A;  1NM7 A;  1QKW A;  1RLP C;  1TUC A;  2CT4 A;  2RQR A;  4LN2 A;  1ZSG A;  1OEB A;  1TG0 A;  3VS0 A;  3EG2 A;  1PKT A;  2OI3 A;  4Z89 A;  1CKA A;  2EGE A;  1PNJ A;  2W0Z A;  1PWT A;  2VWF A;  2J05 A;  3TSW A;  3EGU A;  3LH5 A;  1UHF A;  2RF0 A;  3VS5 A;  1JXM A;  2EQI A;  2LMJ A;  1BK2 A;  3M0Q A;  3RBB B;  1W70 A;  1LCK A;  4J9B A;  2M51 A;  1VA7 A;  1WDX A;  1WA7 A;  2G6F X;  1W1F A;  1ZBJ A;  1RLQ C;  2LJ0 A;  5GJV B;  3A98 A;  4X1V A;  1UDL A;  1YP5 A;  4CC7 A;  2KEA A;  2JS0 A;  5I11 A;  4F16 A;  2A08 A;  1YN8 A;  1CKB A;  2DL5 A;  2I0N A;  1WYX A;  2ROL A;  3VS1 A;  2GBQ A;  2KBT A;  2LP5 A;  1WX6 A;  1VYV A;  2AKL A;  5IHN A;  2PNI A;  1Y57 A;  1M27 C;  4J9G A;  1Z9Q A;  3REB B;  1H8K A;  4IIM A;  4OML A;  1W6X A;  2J06 A;  2E5K A;  2YUQ A;  1HSQ A;  1ABO A;  1B07 A;  5I22 A;  2A36 A;  3REA B;  1UTI A;  2LJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...