1Z9QA

Solution structure of sh3 domain of p40phox
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
DRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase activator
molecule keywords Neutrophil cytosol factor 4
publication title Solution structure of SH3 domain of p40phox
rcsb
source organism Homo sapiens
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1z9qA00
1A0NB 2AKKA 2DILA 3VRZA 2VWFA 3M0SA 1VA7A 3TSWA 4D8DA 1K0XA 2DL5A 2EGCA 1RLPC 2CT4A 3NPFA 1K4US 1YCSB 3IQLA 2W0ZA 3EHQA 1Y0MA 1YWPA 2KT8A 1K1ZA 2D0NA 3PVQA 2O31A 5IHNA 1AZEA 1PWTA 2GQIA 2DYBA 2PTKA 2JXBA 2RF0A 3QWYA 4DEXA 4F14A 1GBRA 1G83A 1ABQA 2CUBA 1UDLA 2ED0A 2LQNA 1BBZA 2W10A 2G6FX 1GFDA 1I07A 1GCPA 2FPEA 1M30A 3M0QA 1TUCA 1S1NA 4GLMA 4E6RA 2V1RA 1E7OA 5IXFA 2EGEA 2K2MA 2YT6A 4ESRA 3REAB 1X6BA 3I9QA 3VS6A 1FYNA 1ZBJA 1SSHA 2LJ3A 1NG2A 1WLPB 1AOJA 2OI3A 4Y92A 3H0IA 3H41A 4AFSC 2RQVA 1OPLA 1ZUUA 1HD3A 1OPKA 1XOVA 1AEYA 1UTIA 1TUDA 2FO0A 2LCSA 1AWXA 1WA7A 2OAWA 1JXMA 1NM7A 2DL7A 2DMOA 2JM9A 1NYFA 2EKHA 1WFWA 2JT4A 2KYBA 1T0HA 2SRCA 3ULRB 2O9VA 1CKAA 1Z9QA 2K6DA 2FRYA 4AG1C 1X2QA 2DL4A 2DNUA 3VS4A 4LUEA 2SEMA 2GNCA 2BZYA 2YUPA 3VS2A 1OOTA 2EYWA 1HJDA 3UATA 4FSSA 2CSQA 2J7IA 2CSIA 1KJWA 2PZ1A 4HCKA 4OMLA 1B07A 1PKSA 4J9IA 2MOXA 1GCQA 4RUGA 1U06A 2K3BA 2BZXA 1PNJA 1MUZA 1IO6A 1YN8A 1N5ZA 1ZUKA 2LNHB 1QKWA 2ABLA 4OMNA 1M8MA 1NEBA 2D8HA 4A63B 1U3OA 1W6XA 2ESWA 1SEMA 1SHFA 4R0KA 4CC4B 1PRLC 2O88A 2OJ2A 2EVRA 2D1XA 4JZ4A 1K76A 4J9HA 2M51A 2O2OA 2L0AA 4J9FA 4WCIA 1GFCA 1UJYA 4JJBA 2DF6A 1KIKA 4JJCA 2GBQA 1ARKA 2MIOA 3M0RA 3VS7A 2EYYA 1VYVA 1M3BA 1WXUA 1NLPC 1X27A 2F2VA 2DM1A 1PKTA 2B86A 1UG1A 3QWXX 3I5SA 3LH5A 4F16A 4RTUA 3VS0A 2YUQA 3I5RA 3ZL7C 1VYUA 1WYXA 2AK5A 4OMMA 1LCKA 2EQIA 1E6HA 2K79A 3THKA 4AFZC 1SPKA 4Z88A 2XMFA 4AG2C 1AWWA 3NHNA 2LMJA 3PVLA 4OMQA 4GBQA 1Z9ZA 2ED1A 1SHGA 3EG1A 2CT3A 2KRNA 3EG2A 2EW3A 2KBTA 3TSZA 2MCNA 1UE9A 4JJDA 3H0HA 2K9GA 2X3XD 2GTOA 1AD5A 1WIEA 2A08A 2E5KA 2IIMA 2J06A 2C0IA 2LQWA 1H8KA 1Y57A 4CC2A 1JEGA 4J9DA 4F17A 3GBQA 1UGVA 3U23A 1GL5A 1TG0A 5IHKA 1AVZC 2KR3A 2FRWA 1W1FA 1M3AA 1G2BA 4DEYA 1HSQA 1WDXA 3NGPA 2EBPA 2NUZA 1X2KA 3CQTA 2GTJA 2RQUA 2KE9A 2LJ1A 2RN8A 1VYTA 4HVUA 2VVKA 2VKNA 2HSPA 3A98A 4HVWA 3SEMA 3C0CA 1H3HA 2PNIA 3M0UA 2A28A 2DJQA 5I11A 2KXDA 3UA6A 2HCKA 2X3WD 2F2XA 3M0PA 1K0SA 4AFUC 1UJ0A 4LN2A 1WI7A 2A37A 2DE0X 2RQWA 1UFFA 3VS3A 2F2WA 4J9EA 1YNZA 2ROLA 2FG0A 2BTTA 4KRTA 1YWOA 3H0FA 2C0TA 4M4ZA 1ZLMA 1WXTA 2DRMA 2AZVA 1OV3A 2AKLA 2JMCA 2KRMA 2DLPA 1QKXA 2RMOA 4RTWA 4IIOA 2J6FA 1OEBA 4JPBW 2J05A 1QCFA 1ZSGA 1E6GA 2D8JA 3RBBB 1GBQA 1CSKA 2YUNA 1KSWA 1WXBA 1X43A 2KGTA 1SRLA 1PHTA 1WX6A 4EIKA 4LUDA 4RTTA 2RQTA 2JTEA 1X6GA 2LX7A 3EG0A 2CDTA 2L3SA 3JV3A 1JU5C 2KT1A 5FW9A 1JQQA 3I35A 2RPNA 1RI9A 5IXBA 1NEGA 2RQRA 2C0OA 4ZNXA 2JW4A 4X1VA 2DX1A 5FWCA 2JS0A 1EFNA 2CH4W 2FPDA 3KFVA 2FPFA 4J9BA 2AZSA 2EGAA 2ENMA 1H92A 1UHCA 2LZ6B 2EYZA 2KYMA 2BZ8A 2DBMA 1I0CA 1BU1A 2DRKA 4LNPA 1ABOA 2K7AA 2I0NA 1W70A 1PRMC 2FEIA 1BB9A 1T3SA 1RLQC 1UHFA 2J6KA 2KRSA 2M0YA 1AWOA 2EYXA 2GGRA 2KEAA 1UECA 2H8HA 3VS5A 2L2PA 4RTYA 3O5ZA 2V1QA 3UF4A 2DBKA 1RUWA 2ROTA 1M27C 5I22A 4Z8AA 2EPDA 2J6OA 5IH2A 3EHRA 1T0JA 2QDLA 3RNJA 3FJ5A 1T3LA 1ZUYA 2LP5A 1MV3A 3EGUA 4HVVA 2L3QA 4ORZA 3VS1A 4K11A 2KROA 4OMPA 1BK2A 1B3QA 1YP5A 1V1CA 1MV0B 2YUOA 2NWMA 2KXCA 2CREA 3M0TA 2DA9A 4IIMA 3TVTA 4HXJA 2JM8A 1QWFA 4LE9A 3PE0A 5GJVB 1QWEA 2HEQA 1UUEA 4J9CA 3REBB 2JS2A 1CKBA 1JXOA 5ECAA 2RNAA 1GRIA 3UA7A 5L23A 1AZGB 3NMZC 2KNBB 4AFQC 1QLYA 4RTXA 2YSQA 4Z89A 4RTVA 1I1JA 2DVJA 1GCQC 1M3CA 2A36A 1NLOC 5FWBA 5IHIA 5GJWB 4CC7A 1J3TA 1JO8A 4J9GA 2HDAA 2LJ0A 4OMOA 1ZX6A 1NYGA 3SHWA 1FMKA 1X69A 1KFZA 4RTZA 2P4RA 1SRMA 4QT7A 2JMAA 2DL8A 4JZ3A 4D8KA 2CUDA 1U5SA 1K9AA 3VRYA 2YDLA 5EC7A 2DL3A 1AWJA 2ECZA 2L3PA 2CH4A 2O9SA 3EG3A 3R6NA 2HBWA 4CC3A 5HCKA
chains in the Genus database with same CATH superfamily
1OQKA 2QI2A 3CCRQ 3M0SA 3EGXA 4DBFA 4EMKA 1RLPC 4FT4A 3NPFA 4PK4A 1K4US 5HY6A 1Y0MA 1YWPA 2KT8A 2D0NA 2JZ2A 4PJMA 3CCQA 3CC4Q 2GFUA 2XIDA 5GANj 4C0FA 2RF0A 3QWYA 1GBRA 1ZSZA 4C5IA 2HAXA 1R77A 4RG8A 2LT4A 2ED0A 3JB9D 2LQNA 2EYQA 3GP8A 2W10A 2CZ1B 4M7DF 3KBGA 2HL3A 3X26B 3LWHA 1VIFA 5LJ5e 4J6YA 1YJWT 1IXDA 1QVGA 1GCPA 3PT9A 2FYKA 3N5BB 4PLLA 4F7UG 2LQKA 5CKHA 3WVEB 2YRDA 2DETA 3JCMe 3SFMA 1G5VA 3REAB 5LJ5d 3I9QA 2PVOB 3OYLA 1FYNA 3MPUB 3SB2A 1K73R 2GFAA 4XTWA 4XU3A 2QQSA 3H0IA 5A0DA 3H41A 4NS5A 1OI1A 1K73C 3JCMf 1AEYA 4LD6A 3OMGA 2RI5A 2IVWA 2EJGA 1BI0A 2IG0A 1JXMA 1JBMA 1VQOQ 4X9CA 3CCMQ 3CD6A 1PSFA 2LTOA 1X6OA 2YXYA 2CZ7B 1K9MR 4EMHA 4XU1A 3OYBA 2K6DA 2JTFA 1Q82R 3CCRT 4C0DC 1K9MC 1Q82C 2YUPA 5DLQE 1OOTA 5KYXA 3OYFA 1NJIU 2CSQA 3RERA 2J7IA 4M7DB 1M2OA 5I2MA 4C8QD 1N6AA 3UPUA 1GCQA 2E6NA 1X01A 2BZXA 1MUZA 3CC4T 3CCST 1YN8A 1N5ZA 3A8MB 5KYWA 3CCJQ 1WJQA 1QKWA 4NL3A 1NEBA 2D8HA 3CMEA 1SHFA 4M7DC 2O88A 4L6V5 2FZKB 2D1XA 3OS0A 3QSUA 2O4XB 1K76A 1QVGP 2D9TA 2E6ZA 4C92E 2ZCFB 4M77C 5FRMA 1Y96B 1OU8A 3EG9B 1N8RR 1UJYA 2HMAA 5GMKh 3SWNB 2GBQA 2MIOA 3OS1A 1OZ2A 1GXIE 1N8RC 1VYVA 1NLPC 2DM1A 4N4HA 2CZ0B 5D6XA 3I5SA 2QG9B 2KK4A 4JJNK 4B9XA 1KD1R 4RTUA 3BW1A 3VS0A 3I5RA 3ZL7C 3SWNC 2EQIA 3THKA 2RJEA 4QKUA 4QQ6A 2HL5C 3PVLA 2V26A 4BE1A 2EWNA 2MWPA 4XTXA 1Z9ZA 5GAN8 1VQOT 1BKBA 3EG1A 2KRNA 2VXFA 3LH0A 3GIBA 4XK8E 4NOYA 1UE9A 4HT8A 2QQBA 1YJ9A 3LWIA 4C92A 2IIMA 2E5KA 1ZQ1A 2OTJQ 1KQSS 2C0IA 1H8KA 4P5NA 1Y96A 1JEGA 3OSVA 4J9DA 3RR6A 1WPYA 5GAN2 2VV5A 1GL5A 1TG0A 3C95A 1RAGB 4O6JA 2X35A 1WQWA 2P0PA 5CKEA 3A8HB 2FZCB 4VUBA 5LJ3e 1F1BB 1WHMA 3L2WA 2QASA 3RKXA 2YHTA 3CCJT 4M77G 1M2VB 2PNIA 3CCVA 1XNIA 2A28A 4FYXB 4LDWA 5I11A 3UA6A 4XTZA 5GAN3 2A7YA 3R6OA 4LD9K 2F2XA 5LJ3f 1K0SA 3GOXA 1VQLQ 2XDDA 2A37A 4IUUA 4M75D 2ROLA 1D0ZA 1KHIA 5GMKj 4M4ZA 1WXTA 2JMCA 3VYHB 3L2QA 2DLPA 1QKXA 2RMOA 5LJ5g 1H641 4IIOA 1OEBA 3CCUA 2J05A 1VQ7Q 1ZA1B 1ZSGA 2MK5A 4FU6A 4A4KA 2M16A 2YUNA 1X43A 3OYAA 4LUDA 5GAMh 1X6GA 1YI2A 3JCMg 2L3SA 3CCSA 2P4TA 3I35A 2RH2A 1RI9A 2RPNA 3SDZA 2L89A 3P8HA 2OAUA 2CYZB 2DX1A 3G4SA 3P8BB 2VASA 4PLIA 2OTJT 4A4HA 5GAOn 3LGLA 2BZ8A 1BU1A 3HFNA 2YLBA 3P8DA 2I0NA 1W70A 1PRMC 1T3SA 4PFOA 3AT1B 1I5OB 3UF4A 1VQMQ 1YITT 3CEYA 3PFSA 2J6OA 5IH2A 1T0JA 2QDLA 3RNJA 4IKFA 3E9FA 4Z02A 2RK2A 5GAMd 3V7RA 1MV3A 2Y4XA 1M1FA 2DEUA 4IUTA 1LJOA 2CKKA 3VS1A 1VQLT 2KROA 3GLXA 1YP5A 1VQ9A 1V1CA 4PJOF 3L2VA 3UT1A 5C6SA 1UGRB 1V76A 3J80E 5CK9A 3ER0A 3L1AA 4Y28E 3REBB 1RAEB 3CCLA 2JS2A 1QVGS 3S3OA 1AZGB 5KE3A 1VQKA 3HRUA 1VQ7T 2KNBB 1QLYA 2YSQA 4E7HA 4Z89A 2DVJA 1TUGB 3TEEA 2A36A 5KYNA 2DXTA 5IHIA 4CC7A 3CPWS 4OB0B 4X34A 4EMGA 4OMOA 3QXEB 1MMNA 2DKGA 1VQ8A 2DYIA 2PVGB 1VQPQ 2HBPA 1R0BG 1X69A 2XD0A 1KFZA 5AYFA 2IPOB 1SG5A 3EFRA 3JB9G 3T9NA 3GF5A 3VRYA 4HCZA 2L3RA 4A4FA 5GAOm 4ELYC 5EC7A 2HZYA 2DL3A 3G71Q 4ZN3A 4IURA 4MZMA 3R6NA 2DVEA 4F7UF 4KH0B 3JCMX 2AKKA 2A0FB 2OX7A 4PNOA 2VWFA 4DOVA 2AIRB 1D3BB 2L5QA 4JS5A 1VQMT 4PJOB 4X9DA 3TSWA 2X4JA 2EGCA 1KQSA 2V8KA 3MP1A 2W0ZA 1LPLA 3EHQA 2QAZA 2AHJB 3V7CA 2WACA 3L42A 1MNDA 1PWTA 2QA4Q 1D09B 2GQIA 2HD0A 2YRVA 2Y90A 5LJ3g 2JUFA 4F14A 4DEXA 1RAHB 3VYGA 1G83A 1Q81R 1ABQA 1SKUB 2BE7D 1YHQA 4C92D 1IREB 4FYVB 1Q81C 3JCMV 1I07A 2XHCA 1PD1A 2EJFA 2FPEA 1MMAA 1M30A 3E2UA 1WHHA 1S1NA 2YWWA 4E7ZA 4KH1B 2A3LA 4E7KA 2V1RA 2NLUA 1E7OA 4PJOA 1W2BP 3GNFB 3VS6A 1YITA 1RABB 1KC8R 1NG2A 1AOJA 4C8QG 4LXCA 3G7ZA 1K73U 4AFSC 4XU0A 5KCHA 2E64A 2DXUA 1ZUUA 1HD3A 1VQPT 1XOVA 1B34B 2E41A 2H3EB 1TUDA 3RIRA 4F7UB 3JSCA 3G6EQ 1AWXA 6AT1B 2Z0WA 1M8VA 4M7AC 2DMOA 2L8DA 2ZPGB 2EKHA 2JT4A 1Q95G 2HQEA 3G71T 2OTLQ 1FMVA 2E5QA 1MMDA 4KGXB 2O9VA 1CKAA 2PUOB 4M78E 4AG1C 5LL6S 1K9MU 3MKDA 4DOWA 2C06A 2DL4A 3CC7A 4BUGA 2VGMA 2VYTA 1Q82U 2QEXA 2GCXA 2SEMA 9ATCB 4BDZA 3VS2A 3AHUA 1BCOA 1RL2A 2JNGA 1OZ3A 1KQSP 4FSSA 2RHYA 5KYUA 3JCMb 5GANe 1B07A 1PSEA 2MOXA 4BD3A 1VQNA 4ZTFA 2QA4T 1IO6A 3X25B 5CKBA 1MGQA 1OX8A 2LNHB 4F7UA 3CCEQ 5EG2A 5CVIA 4OMNA 3CXCS 1M8MA 3PGGA 4A63B 5LJ5h 3CC2A 3C94A 1U3OA 5GANf 4QVZA 2OJ2A 1N9RA 1N9SA 4JZ4A 1LOJA 5CQYA 4WCIA 4JRQA 3L2UA 3QPHA 3OYGA 1GFCA 2QTXA 3DLMA 4M78A 1KIKA 2HQXA 4XU2A 4JJCA 5AT1B 3M0RA 1Y71A 2DERA 4C5EA 2RHUA 1YIJA 1XQHA 4JRIA 3VU3C 4M7AG 2F2VA 1RAAB 3OYNA 3OS5A 3J7AF 1UG1A 2HKNA 4F16A 3V7SA 2K4YA 1IHVA 2K79A 1E6HA 2RM4A 3G6ET 1SPKA 4M77F 2XMFA 3RKYA 2LMJA 4OMQA 1YJNQ 4GBQA 1SHGA 2CT3A 4LDVA 3EG2A 5IT9E 2EW3A 3QDRB 4Y91A 2KBTA 3A8OB 2OTLT 4DBHA 2ZPEB 4FM4B 3H0HA 2K9GA 4M75G 1AD5A 2E12A 1Q7YR 3CPWA 1R8OB 4KGZB 4F17A 1UGVA 3U23A 3X20B 3EH2A 5IHKA 1AVZC 2KR3A 2DD4A 3OYIA 3FDRA 2EKOA 1Q7YC 4ZGDB 3JCMd 1VQ4Q 3HSBA 3NFCA 4DEYA 4C0DB 2NUZA 2LJ1A 2RN8A 4HVUA 4TVRA 2VKNA 3JCMP 1G3WA 2HSPA 2XI9A 1G3YA 4IUVA 3A98A 3SEMA 3CCET 5LJ5j 3I56A 1HK9A 2X3WD 1RAFB 3ZEHA 1UJ0A 4LN2A 2ZPBB 4M7DE 1UFFA 3GNGA 2RK1A 4E7SA 3MO8A 2JJ9A 4KRTA 3M5AA 1QQJA 1M5Q1 3I55A 3H0FA 1OX9A 2DRMA 2AZVA 4N0AC 2KRMA 4M77B 3HL8A 3TCJA 1M1GA 2LNVA 2F5TX 2LRQA 2J6FA 2RHIA 1NBEB 3OYJA 3RUXA 2BUDA 1D0YA 3RBBB 1CSKA 3F70A 1KSWA 1SRLA 1R0CB 2JTEA 1W2BS 2VB6A 1JU5C 1YJNT 1JQQA 2DXCA 5DY9A 1BIAA 4GY5A 3OW2P 4O5VA 4JLIA 1IRXA 2WSCE 4X1VA 2JS0A 2FPDA 4XQ3A 1VOMA 2AZSA 4R56A 3CPWP 4M7DA 2EFIA 2EYZA 2DTOA 2KYMA 5I21A 3QIIA 1VQ6Q 4OGCA 3H6ZA 1Q86R 2FEIA 1BB9A 4M77A 1VQ4T 1WQ7A 2V8IA 2H3JA 3A5ZB 2J6KA 1KD1C 2M0YA 3CPFA 3M59A 2QDYB 3PIOA 2GGRA 3PNWC 3PMTA 3RKWA 2MYSA 2H8HA 3VS5A 1Q86C 1TS9A 3CCMT 5L8RE 5FLXE 4Z8AA 2O4XA 2JN0A 3S3MA 2KMTA 1YJWA 2FB7A 3EG9A 2X4WA 3ZFJA 3SWNA 4QVDA 3FB9A 3EGUA 4HVVA 5GMKi 5GAN5 4ORZA 5GANg 1PG5B 4OMPA 2RB6A 3ME9A 1B3QA 4FW1A 1MV0B 2YUOA 3TREA 3HP9A 4J5YA 4QQGA 3JB9F 2DA9A 3TVTA 1S72Q 5GJVB 2HEQA 4J6WA 2XU8A 3FJPA 3H9NA 3OB9A 3CXCA 2DZCA 3X28B 4AFQC 2COWA 3EGDB 5LJ3d 4C5GA 3TU4K 4RTVA 1I1JA 3E19A 3OYKA 4AMCA 3GPLA 4OF1A 1J3TA 3QDFA 4J9GA 2MAMA 3MJXA 2VXEA 3CCRA 1FX7A 2DPPB 3MEWA 3EAEA 7AT1B 1YBYA 2K3XA 4RTZA 2P4RA 4QT7A 2JMAA 2NYSA 2DL8A 2DJZA 4J6XA 4C92G 4D8KA 1ZBXA 5KYYB 1VQ6T 1U5SA 3RDVA 4M78D 2DFUA 1C1AA 3CMAQ 4KGVB 2CP7A 2COZA 3CC4A 1M2VA 3NTHA 2XG8D 2VGNA 2CH4A 1WHGA 1SSFA 2M1HA 2O9SA 3EG3A 4CC3A 5HCKA 1QMCA 2DILA 3LLRA 1I8FA 2DL5A 1IHWA 2CT4A 2QGFB 1YCSB 5DLOA 3WXMB 1K1ZA 2O31A 4C8QF 2PUKB 5J3BA 1VQ5Q 2JOYA 2PTKA 2JXBA 1V29B 3NTKA 4JUVA 2RO0A 4E7LA 5A0GA 3PTAA 5KYYA 5GAN7 3V8JA 5M9OA 1S72T 4OB1B 1LNXA 1HYOA 2JTMA 3QKJA 2MPXC 1GFDA 4AT1B 3CXCP 3QZ9B 2QQAA 4II1A 3M0QA 1TUCA 3MP6A 3RMQA 4E6RA 3CCQQ 2DIQA 4CI0C 1VQOA 1NPRA 2DAQA 2K2MA 3S3NA 2YT6A 3QHSA 4ESRA 3LYIA 1ZBJA 1SSHA 2E1HA 2OI3A 4Y92A 5GAMf 2EAYA 2KQWA 4RMOA 1OPKA 4PL6A 5HKCA 2FO0A 2LCSA 1UB4A 2DO3A 3G1JA 2WSFE 5FROA 3M54A 4IUQA 1NM7A 3OW2S 2RA2A 2ZZDA 5GAMj 1G8XA 2CP3A 1WFWA 2RI3A 3CMAT 4V2SA 2KYBA 1T0HA 1W2BA 3ULRB 3S6WA 4LDYA 3A8GB 2QGGA 3CCJA 1Z9QA 2FRYA 4C8QB 4CRIA 1WJSA 4E47A 3VS4A 1NPPA 2KSSA 4FYWB 1EZZB 4MZPA 2EYWA 2ZPIB 1KG1A 2NUTB 3E1SA 1M90R 2CSIA 1KJWA 4HCKA 4M7AF 1I4K1 4J9IA 2EQUA 4C8QC 4RUGA 3CD6Q 1BIBA 2K3BA 1VIEA 2F5KA 1VQ5T 1M90C 2X4XA 2R5MA 4J8OA 2RD1A 3I56Q 1JJ2S 1G3SA 4BDYA 4M7DD 2VC8A 4J7IA 1W6XA 2ESWA 4R0KA 1SEMA 4CC4B 2JVVA 1PRLC 4PJOE 4FIBA 1Y07A 3M57A 2EVRA 4FYYB 5A2QE 3QG1A 1QP2A 2E70A 4JRKA 5CIUA 4J9HA 2ZGWA 1OYXA 1ACMB 4R55A 4J9FA 3LGFA 4M75F 2HNIA 3CCQT 4JJBA 1ZA2B 2DF6A 1IB8A 1U1SA 4ZGJB 1WGSA 1WHLA 3MP8A 1M3BA 3L2RA 1X27A 3CMEQ 4DA4A 4OMFB 3V8KA 2B86A 2OTJA 5GAOr 3LH5A 4Q5WA 2YUQA 1X75C 2EQMA 1WYXA 2AK5A 1LCKA 1OU9A 2LVMA 2RHXA 4FW2A 4Z88A 1KQ1A 4AG2C 5FRNA 3NHNA 4XTYA 2E3IA 4JDSA 4B9WA 4XTVA 3OA6A 4MDWA 1D3BA 1NZ9A 4MDXA 2MCNA 4JJDA 2X3XD 4M7AB 3PMIA 1WIEA 2A08A 2LQWA 4CC2A 1Y57A 4OGEA 5GMKm 1QVPA 4BACA 1KC8C 2KY9A 4F7UE 4UC4A 1W1FA 1M3AA 1G2BA 4MMKA 1VQLA 4MZTA 4HA8A 2EBPA 1X2KA 3CQTA 2RQUA 4KBMB 2KE9A 2E4HA 1QW1A 2HQHA 1U8RA 3CD6T 1KK7A 1VYTA 2VVKA 5GAOq 3MCAB 3DLLA 1YJ9Q 1H3HA 3C0CA 4EDUA 2ZAEA 3M0UA 4M75B 2XDBA 5I2SA 2DJQA 2HCKA 3FLGA 1M9SA 2P0KA 1VQ7A 3M0PA 1UGSB 4N4IA 2X51A 1ZHIA 1BI2A 4AFUC 3EGXB 4B6MA 1WI7A 3FRNA 2RQWA 5A0LA 4J9EA 4ZTJA 4M7AA 2BTTA 2QK0A 4M75C 3LX7A 5IN1A 1ZLMA 1OV3A 2AKLA 3VUBA 3CCVQ 1B34A 3M4YA 2PQWA 5CO7A 1ZSZB 4EMKC 3CMET 4JPBW 1D1BA 3JCMJ 1E6GA 1H3ZA 1IGUA 2QXFA 4BI4A 1GBQA 5GANd 2RJFA 1WXBA 1MHNA 1WX6A 4EIKA 3OSSC 2KAFA 3UWNA 3EG0A 2YRCA 2KT1A 1FXXA 3JRZA 3JCMh 1ZSZC 5IXBA 3HKSA 1NEGA 2LQ8A 1N8RU 4A53A 2C0OA 4ZNXA 1IZ6A 2BIVA 4F04B 5FU6B 5GMKl 2CH4W 3JB9H 3CCUQ 4J9BA 1VQMA 2K3YA 1H92A 3BE3A 5D6WA 2LZ6B 3O8VA 3OYYA 3OYDA 1QCOA 2X4YA 4XTUA 1I0CA 3QZ5B 2DRKA 3QJ6A 4LNPA 1ABOA 1C6VX 4KULA 2EIFA 3EFOB 1YI2Q 1KD1U 2DXBA 1QP3A 3OYHA 3M58A 3CCSQ 1Q86U 1AWOA 5FU6C 2EYXA 2DZ9A 2KEAA 1UECA 2RJDA 2L2PA 4RTYA 2V1QA 3OW2A 2DBKA 1RUWA 2ROTA 1M27C 4ZGEB 3SD4A 3QJYA 2E3HA 2CGHA 3G4SQ 1YJ9T 1EIFA 2EPDA 2KDSA 1VUBA 2QQRA 3FJ5A 4MMLA 2LP5A 3QO3A 2FHDA 5HK3A 1K8AR 1BK2A 1RADB 3E9GA 5LJ5f 5KYXB 2NWMA 2KXCA 2BKDN 1K8AC 4C92F 4M78G 3BDUA 4LDUA 1QWFA 3PE0A 1QWEA 2GQVA 4J9CA 5HK0A 3OYCA 3CCVT 3EFOA 3HRTA 5IAYA 5KYWB 1CKBA 1JXOA 5ECAA 1GRIA 1VQPA 2EQJA 5KH6A 1JJ2A 1M1KR 3NMZC 3BY7A 4RTXA 1MNEA 4IUPA 1M1KC 4WTOB 1VQ9Q 1GCQC 1C0MA 3G71A 3QUIA 5FWBA 3X24B 1XJWB 4M77E 3FIFA 3EFSA 3RMSA 3CCLQ 4NL2A 3VJPA 2YLCA 3CCUT 3SHWA 1FMKA 2XKOC 4HKEA 1VQKQ 1SRMA 4JZ3A 1TSFA 2CUDA 4PJLA 1Y7XA 2LT1A 2FZGB 3OBYA 1YI2T 2ZPFB 1AWJA 2QA4A 2L3PA 2O01E 2HBWA 2LDMA 2E65A 2P84A 4N0AA 4E7JA 1A0NB 1VQ8Q 3VRZA 5J26A 3G4ST 1VA7A 2F69A 4N4GA 4D8DA 1K0XA 4C92B 3IQLA 1W4SA 2KI7A 2RJCA 3PVQA 5IHNA 1AZEA 2CP0A 1HXDA 2EQKA 4KUIA 2DYBA 4C0GA 1JRIA 4PJOD 2HSEB 2CP6A 1MMGA 5LJ3h 2MWOA 2CUBA 1AT1B 1UDLA 4L59A 1BBZA 4C92C 1WHJA 2DEQA 2G6FX 4XAXB 4KUDK 1TOVA 5GAN4 3A8LB 3HPWA 1JJ2P 2CS7A 1JB0E 4FSXA 3G6EA 4GLMA 2XK0A 2CZ6B 4GLKA 1M4ZA 5IXFA 2EGEA 1EX4A 2NUPB 3CBOA 5GMKe 1VQ9T 1X6BA 3ZBDA 2K57A 1YHQQ 5GAN6 2OTLA 2AT1B 2LJ3A 2D0QB 3FC3A 1OULA 1WLPB 4PFZA 1B7TA 3CCLT 2RQVA 1OPLA 5CKFA 2QQ9A 3M9QA 1UTIA 1VQKT 1WA7A 2OAWA 1QVFS 4DBQA 4A4GA 3HFOA 4M7AD 4M7DG 4ZN1A 2DTIA 4RCCA 4OP0A 2DTHA 2DL7A 4C0ZA 2JM9A 1NYFA 2D6FA 2DIGA 2SRCA 4EPCA 1YITQ 4BB7A 1N27A 2R57A 3CCEA 1TH7A 2MF2A 1X2QA 2DNUA 1VQ8T 1D0XA 8ATCB 3VUZA 2XICA 4LUEA 2G3RA 1NJIR 2GNCA 2NUPA 2BZYA 3QYHB 3MEUA 1HJDA 3UATA 1QCNA 3JAME 3KXTA 3QBYA 3URGA 1TWBA 2PZ1A 3DB4A 4OMLA 1NJIC 1PKSA 1M90U 1U06A 1PNJA 3NTIA 3J81E 1ZUKA 3ASKA 1FMWA 5LJ3j 1IGQA 1UEBA 2ABLA 4D6WA 3CC7Q 3MEAA 1D1CA 3JCMW 2QEXQ 4ANJA 3EGDA 4J7FA 2M51A 2O2OA 2L0AA 1WZOA 4QQDA 1RI0A 3FEOA 1U1TA 2LCLA 4ME7A 4E7IA 1VQNQ 4PFPA 1YJNA 3A1PA 1ARKA 4PJNA 5CCAA 3JCMQ 3OS2A 5CR2A 3M53A 3VS7A 3V8LA 4FT2A 3M56A 2EYYA 1YHQT 1WXUA 3CBPA 3CC2Q 1Q81U 1P92A 1PKTA 2LCCA 3QWXX 3OQ5A 2P0QA 1VYUA 4OMMA 4AFZC 1AWWA 4LDXA 5GAMe 1VQ4A 3DB3A 3L2ZA 1KQ2A 3JCMc 2ED1A 3JB9I 3KUFA 8AT1B 3H8ZA 3QYGB 5KCOA 3TQ7P 1RAIB 3TSZA 2KVQG 3CCMA 4KT0E 1BI3A 1YIJQ 3RESA 1RACB 2E10A 2GTOA 2J06A 3C12A 1KC8U 2M9UA 3GBQA 2B8AA 3MEVA 2MI6A 3JB9J 1O75A 2FRWA 4FL6A 1KHCA 3M55A 2M02A 3EH1A 1HSQA 1WDXA 3NGPA 3C4SA 2GTJA 4OB2B 2I2LA 1BYMA 4JRPA 1UGQB 5CAIA 1I81A 4HVWA 4C8QE 1YFNA 5GAOp 4BE0A 4C5HA 3CC7T 4RKUE 2KXDA 2FL7A 2QEXT 2RI2A 2MMPA 5FU7B 2DE0X 3VS3A 2F2WA 1UGPB 3OYEA 4RCBA 5CQXA 1YNZA 2FG0A 1VQNT 2F1LA 4HCCA 2WSEE 1YWOA 2C0TA 4OB3B 3OY9A 4BI8B 1WJRA 1TU0B 1PD0A 4L5GA 4YTLA 4RTWA 2FVUA 1LVKA 5FU7C 3CC2T 1QCFA 5J39A 2D8JA 4ELZC 2XDPA 2KGTA 1VQ6A 3OYMA 1PHTA 5D6YA 4RTTA 2RQTA 4M77D 2LX7A 2PVDB 2CDTA 3JV3A 5DM7R 3I55Q 5FW9A 2R5AA 4C8QA 2RQRA 1XTDA 2JW4A 1PM3A 5FWCA 1EFNA 1YIJT 2K2VA 4E2FB 3KFVA 1AHJB 2FPFA 2EGAA 1YCYA 2ENMA 1UHCA 4DBRA 2NUTA 2QYZA 4J83A 2ZPHB 1WNLA 4PJJA 2DBMA 4OVAA 2COYA 2K5IA 2K7AA 2V8JA 3M4GA 4M78F 1D1AA 1RLQC 1WHKA 1UHFA 3DKMA 5D7UA 3VKIA 4BI3A 2KRSA 1QVFA 1BCMA 2R58A 2VUBA 4QVCA 4PJOC 3MHXA 3O5ZA 4QW2A 5I22A 1S72A 4M7AE 3EHRA 1SF9A 3CBMA 1T3LA 1ZUYA 2K5FA 1Q7YU 4A4EA 2LX9A 1DJ7B 2L3QA 2M0OA 4K11A 4BY6B 5GANh 2PU9B 3OBWA 4A54A 3WVDB 2DD5A 5KYUB 1K8AU 2K5LA 2CREA 3BFMA 3HRSA 5KE2A 3M0TA 4IIMA 4PKCC 2CP2A 4LE9A 2JM8A 4HXJA 2Y4YA 1UUEA 1TTHB 4M75E 2QTVA 1YJWQ 3INZA 5GAOl 2RNAA 3I56T 4RG2A 2DK3A 3UA7A 5L23A 2ATCB 4BY6C 2CP5A 3HTRA 1M1KU 4DQ2A 4HT9A 1NE8A 1I5LA 1TXQA 1BI1A 4EMKB 3META 1PC0A 1M3CA 4ATOA 3CMAA 4BE2A 1NLOC 3I55T 4HCBA 3Q1JA 5GJWB 1PCXA 2BE9B 4M78B 3HHTB 1JO8A 3D7SB 2HDAA 2LJ0A 1ZX6A 2LC4A 3BDLA 1NYGA 3OMCA 4PJOG 3VV0A 2RHZA 3UDCA 5C0MA 1FWZA 2EJ9A 2HKQB 5GAMg 1K9AA 1G3TA 4JLGA 2X9HA 2YDLA 3PIPA 4JS4A 4M78C 4FCYA 1QVFP 1VQ5A 2GF7A 4M75A 1O9SA 2ECZA 5CKDA 3LW5E 4WF2A
chains in the Genus database with same CATH topology
1A0NB 2AKKA 2DILA 3VRZA 2VWFA 3M0SA 1VA7A 3TSWA 4D8DA 1K0XA 2DL5A 2EGCA 1RLPC 2CT4A 3NPFA 1K4US 1YCSB 3IQLA 2W0ZA 3EHQA 1Y0MA 1YWPA 2KT8A 1K1ZA 2D0NA 3PVQA 2O31A 5IHNA 1AZEA 1PWTA 2GQIA 2DYBA 2PTKA 2JXBA 2RF0A 3QWYA 4DEXA 4F14A 1GBRA 1G83A 1ABQA 2CUBA 1UDLA 2ED0A 2LQNA 1BBZA 2W10A 2G6FX 1GFDA 1I07A 1GCPA 2FPEA 1M30A 3M0QA 1TUCA 1S1NA 4GLMA 4E6RA 2V1RA 1E7OA 5IXFA 2EGEA 2K2MA 2YT6A 4ESRA 3REAB 1X6BA 3I9QA 3VS6A 1FYNA 1ZBJA 1SSHA 2LJ3A 1NG2A 1WLPB 1AOJA 2OI3A 4Y92A 3H0IA 3H41A 4AFSC 2RQVA 1OPLA 1ZUUA 1HD3A 1OPKA 1XOVA 1AEYA 1UTIA 1TUDA 2FO0A 2LCSA 1AWXA 1WA7A 2OAWA 1JXMA 1NM7A 2DL7A 2DMOA 2JM9A 1NYFA 2EKHA 1WFWA 2JT4A 2KYBA 1T0HA 2SRCA 3ULRB 2O9VA 1CKAA 1Z9QA 2K6DA 2FRYA 4AG1C 1X2QA 2DL4A 2DNUA 3VS4A 4LUEA 2SEMA 2GNCA 2BZYA 2YUPA 3VS2A 1OOTA 2EYWA 1HJDA 3UATA 4FSSA 2CSQA 2J7IA 2CSIA 1KJWA 2PZ1A 4HCKA 4OMLA 1B07A 1PKSA 4J9IA 2MOXA 1GCQA 4RUGA 1U06A 2K3BA 2BZXA 1PNJA 1MUZA 1IO6A 1YN8A 1N5ZA 1ZUKA 2LNHB 1QKWA 2ABLA 4OMNA 1M8MA 1NEBA 2D8HA 4A63B 1U3OA 1W6XA 2ESWA 1SEMA 1SHFA 4R0KA 4CC4B 1PRLC 2O88A 2OJ2A 2EVRA 2D1XA 4JZ4A 1K76A 4J9HA 2M51A 2O2OA 2L0AA 4J9FA 4WCIA 1GFCA 1UJYA 4JJBA 2DF6A 1KIKA 4JJCA 2GBQA 1ARKA 2MIOA 3M0RA 3VS7A 2EYYA 1VYVA 1M3BA 1WXUA 1NLPC 1X27A 2F2VA 2DM1A 1PKTA 2B86A 1UG1A 3QWXX 3I5SA 3LH5A 4F16A 4RTUA 3VS0A 2YUQA 3I5RA 3ZL7C 1VYUA 1WYXA 2AK5A 4OMMA 1LCKA 2EQIA 1E6HA 2K79A 3THKA 4AFZC 1SPKA 4Z88A 2XMFA 4AG2C 1AWWA 3NHNA 2LMJA 3PVLA 4OMQA 4GBQA 1Z9ZA 2ED1A 1SHGA 3EG1A 2CT3A 2KRNA 3EG2A 2EW3A 2KBTA 3TSZA 2MCNA 1UE9A 4JJDA 3H0HA 2K9GA 2X3XD 2GTOA 1AD5A 1WIEA 2A08A 2E5KA 2IIMA 2J06A 2C0IA 2LQWA 1H8KA 1Y57A 4CC2A 1JEGA 4J9DA 4F17A 3GBQA 1UGVA 3U23A 1GL5A 1TG0A 5IHKA 1AVZC 2KR3A 2FRWA 1W1FA 1M3AA 1G2BA 4DEYA 1HSQA 1WDXA 3NGPA 2EBPA 2NUZA 1X2KA 3CQTA 2GTJA 2RQUA 2KE9A 2LJ1A 2RN8A 1VYTA 4HVUA 2VVKA 2VKNA 2HSPA 3A98A 4HVWA 3SEMA 3C0CA 1H3HA 2PNIA 3M0UA 2A28A 2DJQA 5I11A 2KXDA 3UA6A 2HCKA 2X3WD 2F2XA 3M0PA 1K0SA 4AFUC 1UJ0A 4LN2A 1WI7A 2A37A 2DE0X 2RQWA 1UFFA 3VS3A 2F2WA 4J9EA 1YNZA 2ROLA 2FG0A 2BTTA 4KRTA 1YWOA 3H0FA 2C0TA 4M4ZA 1ZLMA 1WXTA 2DRMA 2AZVA 1OV3A 2AKLA 2JMCA 2KRMA 2DLPA 1QKXA 2RMOA 4RTWA 4IIOA 2J6FA 1OEBA 4JPBW 2J05A 1QCFA 1ZSGA 1E6GA 2D8JA 3RBBB 1GBQA 1CSKA 2YUNA 1KSWA 1WXBA 1X43A 2KGTA 1SRLA 1PHTA 1WX6A 4EIKA 4LUDA 4RTTA 2RQTA 2JTEA 1X6GA 2LX7A 3EG0A 2CDTA 2L3SA 3JV3A 1JU5C 2KT1A 5FW9A 1JQQA 3I35A 2RPNA 1RI9A 5IXBA 1NEGA 2RQRA 2C0OA 4ZNXA 2JW4A 4X1VA 2DX1A 5FWCA 2JS0A 1EFNA 2CH4W 2FPDA 3KFVA 2FPFA 4J9BA 2AZSA 2EGAA 2ENMA 1H92A 1UHCA 2LZ6B 2EYZA 2KYMA 2BZ8A 2DBMA 1I0CA 1BU1A 2DRKA 4LNPA 1ABOA 2K7AA 2I0NA 1W70A 1PRMC 2FEIA 1BB9A 1T3SA 1RLQC 1UHFA 2J6KA 2KRSA 2M0YA 1AWOA 2EYXA 2GGRA 2KEAA 1UECA 2H8HA 3VS5A 2L2PA 4RTYA 3O5ZA 2V1QA 3UF4A 2DBKA 1RUWA 2ROTA 1M27C 5I22A 4Z8AA 2EPDA 2J6OA 5IH2A 3EHRA 1T0JA 2QDLA 3RNJA 3FJ5A 1T3LA 1ZUYA 2LP5A 1MV3A 3EGUA 4HVVA 2L3QA 4ORZA 3VS1A 4K11A 2KROA 4OMPA 1BK2A 1B3QA 1YP5A 1V1CA 1MV0B 2YUOA 2NWMA 2KXCA 2CREA 3M0TA 2DA9A 4IIMA 3TVTA 4HXJA 2JM8A 1QWFA 4LE9A 3PE0A 5GJVB 1QWEA 2HEQA 1UUEA 4J9CA 3REBB 2JS2A 1CKBA 1JXOA 5ECAA 2RNAA 1GRIA 3UA7A 5L23A 1AZGB 3NMZC 2KNBB 4AFQC 1QLYA 4RTXA 2YSQA 4Z89A 4RTVA 1I1JA 2DVJA 1GCQC 1M3CA 2A36A 1NLOC 5FWBA 5IHIA 5GJWB 4CC7A 1J3TA 1JO8A 4J9GA 2HDAA 2LJ0A 4OMOA 1ZX6A 1NYGA 3SHWA 1FMKA 1X69A 1KFZA 4RTZA 2P4RA 1SRMA 4QT7A 2JMAA 2DL8A 4JZ3A 4D8KA 2CUDA 1U5SA 1K9AA 3VRYA 2YDLA 5EC7A 2DL3A 1AWJA 2ECZA 2L3PA 2CH4A 2O9SA 3EG3A 3R6NA 2HBWA 4CC3A 5HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0N B;  2AKK A;  2DIL A;  3VRZ A;  2VWF A;  3M0S A;  1VA7 A;  3TSW A;  4D8D A;  1K0X A;  2DL5 A;  2EGC A;  1RLP C;  2CT4 A;  3NPF A;  1K4U S;  1YCS B;  3IQL A;  2W0Z A;  3EHQ A;  1Y0M A;  1YWP A;  2KT8 A;  1K1Z A;  2D0N A;  3PVQ A;  2O31 A;  5IHN A;  1AZE A;  1PWT A;  2GQI A;  2DYB A;  2PTK A;  2JXB A;  2RF0 A;  3QWY A;  4DEX A;  4F14 A;  1GBR A;  1G83 A;  1ABQ A;  2CUB A;  1UDL A;  2ED0 A;  2LQN A;  1BBZ A;  2W10 A;  2G6F X;  1GFD A;  1I07 A;  1GCP A;  2FPE A;  1M30 A;  3M0Q A;  1TUC A;  1S1N A;  4GLM A;  4E6R A;  2V1R A;  1E7O A;  5IXF A;  2EGE A;  2K2M A;  2YT6 A;  4ESR A;  3REA B;  1X6B A;  3I9Q A;  3VS6 A;  1FYN A;  1ZBJ A;  1SSH A;  2LJ3 A;  1NG2 A;  1WLP B;  1AOJ A;  2OI3 A;  4Y92 A;  3H0I A;  3H41 A;  4AFS C;  2RQV A;  1OPL A;  1ZUU A;  1HD3 A;  1OPK A;  1XOV A;  1AEY A;  1UTI A;  1TUD A;  2FO0 A;  2LCS A;  1AWX A;  1WA7 A;  2OAW A;  1JXM A;  1NM7 A;  2DL7 A;  2DMO A;  2JM9 A;  1NYF A;  2EKH A;  1WFW A;  2JT4 A;  2KYB A;  1T0H A;  2SRC A;  3ULR B;  2O9V A;  1CKA A;  1Z9Q A;  2K6D A;  2FRY A;  4AG1 C;  1X2Q A;  2DL4 A;  2DNU A;  3VS4 A;  4LUE A;  2SEM A;  2GNC A;  2BZY A;  2YUP A;  3VS2 A;  1OOT A;  2EYW A;  1HJD A;  3UAT A;  4FSS A;  2CSQ A;  2J7I A;  2CSI A;  1KJW A;  2PZ1 A;  4HCK A;  4OML A;  1B07 A;  1PKS A;  4J9I A;  2MOX A;  1GCQ A;  4RUG A;  1U06 A;  2K3B A;  2BZX A;  1PNJ A;  1MUZ A;  1IO6 A;  1YN8 A;  1N5Z A;  1ZUK A;  2LNH B;  1QKW A;  2ABL A;  4OMN A;  1M8M A;  1NEB A;  2D8H A;  4A63 B;  1U3O A;  1W6X A;  2ESW A;  1SEM A;  1SHF A;  4R0K A;  4CC4 B;  1PRL C;  2O88 A;  2OJ2 A;  2EVR A;  2D1X A;  4JZ4 A;  1K76 A;  4J9H A;  2M51 A;  2O2O A;  2L0A A;  4J9F A;  4WCI A;  1GFC A;  1UJY A;  4JJB A;  2DF6 A;  1KIK A;  4JJC A;  2GBQ A;  1ARK A;  2MIO A;  3M0R A;  3VS7 A;  2EYY A;  1VYV A;  1M3B A;  1WXU A;  1NLP C;  1X27 A;  2F2V A;  2DM1 A;  1PKT A;  2B86 A;  1UG1 A;  3QWX X;  3I5S A;  3LH5 A;  4F16 A;  4RTU A;  3VS0 A;  2YUQ A;  3I5R A;  3ZL7 C;  1VYU A;  1WYX A;  2AK5 A;  4OMM A;  1LCK A;  2EQI A;  1E6H A;  2K79 A;  3THK A;  4AFZ C;  1SPK A;  4Z88 A;  2XMF A;  4AG2 C;  1AWW A;  3NHN A;  2LMJ A;  3PVL A;  4OMQ A;  4GBQ A;  1Z9Z A;  2ED1 A;  1SHG A;  3EG1 A;  2CT3 A;  2KRN A;  3EG2 A;  2EW3 A;  2KBT A;  3TSZ A;  2MCN A;  1UE9 A;  4JJD A;  3H0H A;  2K9G A;  2X3X D;  2GTO A;  1AD5 A;  1WIE A;  2A08 A;  2E5K A;  2IIM A;  2J06 A;  2C0I A;  2LQW A;  1H8K A;  1Y57 A;  4CC2 A;  1JEG A;  4J9D A;  4F17 A;  3GBQ A;  1UGV A;  3U23 A;  1GL5 A;  1TG0 A;  5IHK A;  1AVZ C;  2KR3 A;  2FRW A;  1W1F A;  1M3A A;  1G2B A;  4DEY A;  1HSQ A;  1WDX A;  3NGP A;  2EBP A;  2NUZ A;  1X2K A;  3CQT A;  2GTJ A;  2RQU A;  2KE9 A;  2LJ1 A;  2RN8 A;  1VYT A;  4HVU A;  2VVK A;  2VKN A;  2HSP A;  3A98 A;  4HVW A;  3SEM A;  3C0C A;  1H3H A;  2PNI A;  3M0U A;  2A28 A;  2DJQ A;  5I11 A;  2KXD A;  3UA6 A;  2HCK A;  2X3W D;  2F2X A;  3M0P A;  1K0S A;  4AFU C;  1UJ0 A;  4LN2 A;  1WI7 A;  2A37 A;  2DE0 X;  2RQW A;  1UFF A;  3VS3 A;  2F2W A;  4J9E A;  1YNZ A;  2ROL A;  2FG0 A;  2BTT A;  4KRT A;  1YWO A;  3H0F A;  2C0T A;  4M4Z A;  1ZLM A;  1WXT A;  2DRM A;  2AZV A;  1OV3 A;  2AKL A;  2JMC A;  2KRM A;  2DLP A;  1QKX A;  2RMO A;  4RTW A;  4IIO A;  2J6F A;  1OEB A;  4JPB W;  2J05 A;  1QCF A;  1ZSG A;  1E6G A;  2D8J A;  3RBB B;  1GBQ A;  1CSK A;  2YUN A;  1KSW A;  1WXB A;  1X43 A;  2KGT A;  1SRL A;  1PHT A;  1WX6 A;  4EIK A;  4LUD A;  4RTT A;  2RQT A;  2JTE A;  1X6G A;  2LX7 A;  3EG0 A;  2CDT A;  2L3S A;  3JV3 A;  1JU5 C;  2KT1 A;  5FW9 A;  1JQQ A;  3I35 A;  2RPN A;  1RI9 A;  5IXB A;  1NEG A;  2RQR A;  2C0O A;  4ZNX A;  2JW4 A;  4X1V A;  2DX1 A;  5FWC A;  2JS0 A;  1EFN A;  2CH4 W;  2FPD A;  3KFV A;  2FPF A;  4J9B A;  2AZS A;  2EGA A;  2ENM A;  1H92 A;  1UHC A;  2LZ6 B;  2EYZ A;  2KYM A;  2BZ8 A;  2DBM A;  1I0C A;  1BU1 A;  2DRK A;  4LNP A;  1ABO A;  2K7A A;  2I0N A;  1W70 A;  1PRM C;  2FEI A;  1BB9 A;  1T3S A;  1RLQ C;  1UHF A;  2J6K A;  2KRS A;  2M0Y A;  1AWO A;  2EYX A;  2GGR A;  2KEA A;  1UEC A;  2H8H A;  3VS5 A;  2L2P A;  4RTY A;  3O5Z A;  2V1Q A;  3UF4 A;  2DBK A;  1RUW A;  2ROT A;  1M27 C;  5I22 A;  4Z8A A;  2EPD A;  2J6O A;  5IH2 A;  3EHR A;  1T0J A;  2QDL A;  3RNJ A;  3FJ5 A;  1T3L A;  1ZUY A;  2LP5 A;  1MV3 A;  3EGU A;  4HVV A;  2L3Q A;  4ORZ A;  3VS1 A;  4K11 A;  2KRO A;  4OMP A;  1BK2 A;  1B3Q A;  1YP5 A;  1V1C A;  1MV0 B;  2YUO A;  2NWM A;  2KXC A;  2CRE A;  3M0T A;  2DA9 A;  4IIM A;  3TVT A;  4HXJ A;  2JM8 A;  1QWF A;  4LE9 A;  3PE0 A;  5GJV B;  1QWE A;  2HEQ A;  1UUE A;  4J9C A;  3REB B;  2JS2 A;  1CKB A;  1JXO A;  5ECA A;  2RNA A;  1GRI A;  3UA7 A;  5L23 A;  1AZG B;  3NMZ C;  2KNB B;  4AFQ C;  1QLY A;  4RTX A;  2YSQ A;  4Z89 A;  4RTV A;  1I1J A;  2DVJ A;  1GCQ C;  1M3C A;  2A36 A;  1NLO C;  5FWB A;  5IHI A;  5GJW B;  4CC7 A;  1J3T A;  1JO8 A;  4J9G A;  2HDA A;  2LJ0 A;  4OMO A;  1ZX6 A;  1NYG A;  3SHW A;  1FMK A;  1X69 A;  1KFZ A;  4RTZ A;  2P4R A;  1SRM A;  4QT7 A;  2JMA A;  2DL8 A;  4JZ3 A;  4D8K A;  2CUD A;  1U5S A;  1K9A A;  3VRY A;  2YDL A;  5EC7 A;  2DL3 A;  1AWJ A;  2ECZ A;  2L3P A;  2CH4 A;  2O9S A;  3EG3 A;  3R6N A;  2HBW A;  4CC3 A;  5HCK A; 
#chains in the Genus database with same CATH topology
 1OQK A;  2QI2 A;  3CCR Q;  3M0S A;  3EGX A;  4DBF A;  4EMK A;  1RLP C;  4FT4 A;  3NPF A;  4PK4 A;  1K4U S;  5HY6 A;  1Y0M A;  1YWP A;  2KT8 A;  2D0N A;  2JZ2 A;  4PJM A;  3CCQ A;  3CC4 Q;  2GFU A;  2XID A;  5GAN j;  4C0F A;  2RF0 A;  3QWY A;  1GBR A;  1ZSZ A;  4C5I A;  2HAX A;  1R77 A;  4RG8 A;  2LT4 A;  2ED0 A;  3JB9 D;  2LQN A;  2EYQ A;  3GP8 A;  2W10 A;  2CZ1 B;  4M7D F;  3KBG A;  2HL3 A;  3X26 B;  3LWH A;  1VIF A;  5LJ5 e;  4J6Y A;  1YJW T;  1IXD A;  1QVG A;  1GCP A;  3PT9 A;  2FYK A;  3N5B B;  4PLL A;  4F7U G;  2LQK A;  5CKH A;  3WVE B;  2YRD A;  2DET A;  3JCM e;  3SFM A;  1G5V A;  3REA B;  5LJ5 d;  3I9Q A;  2PVO B;  3OYL A;  1FYN A;  3MPU B;  3SB2 A;  1K73 R;  2GFA A;  4XTW A;  4XU3 A;  2QQS A;  3H0I A;  5A0D A;  3H41 A;  4NS5 A;  1OI1 A;  1K73 C;  3JCM f;  1AEY A;  4LD6 A;  3OMG A;  2RI5 A;  2IVW A;  2EJG A;  1BI0 A;  2IG0 A;  1JXM A;  1JBM A;  1VQO Q;  4X9C A;  3CCM Q;  3CD6 A;  1PSF A;  2LTO A;  1X6O A;  2YXY A;  2CZ7 B;  1K9M R;  4EMH A;  4XU1 A;  3OYB A;  2K6D A;  2JTF A;  1Q82 R;  3CCR T;  4C0D C;  1K9M C;  1Q82 C;  2YUP A;  5DLQ E;  1OOT A;  5KYX A;  3OYF A;  1NJI U;  2CSQ A;  3RER A;  2J7I A;  4M7D B;  1M2O A;  5I2M A;  4C8Q D;  1N6A A;  3UPU A;  1GCQ A;  2E6N A;  1X01 A;  2BZX A;  1MUZ A;  3CC4 T;  3CCS T;  1YN8 A;  1N5Z A;  3A8M B;  5KYW A;  3CCJ Q;  1WJQ A;  1QKW A;  4NL3 A;  1NEB A;  2D8H A;  3CME A;  1SHF A;  4M7D C;  2O88 A;  4L6V 5;  2FZK B;  2D1X A;  3OS0 A;  3QSU A;  2O4X B;  1K76 A;  1QVG P;  2D9T A;  2E6Z A;  4C92 E;  2ZCF B;  4M77 C;  5FRM A;  1Y96 B;  1OU8 A;  3EG9 B;  1N8R R;  1UJY A;  2HMA A;  5GMK h;  3SWN B;  2GBQ A;  2MIO A;  3OS1 A;  1OZ2 A;  1GXI E;  1N8R C;  1VYV A;  1NLP C;  2DM1 A;  4N4H A;  2CZ0 B;  5D6X A;  3I5S A;  2QG9 B;  2KK4 A;  4JJN K;  4B9X A;  1KD1 R;  4RTU A;  3BW1 A;  3VS0 A;  3I5R A;  3ZL7 C;  3SWN C;  2EQI A;  3THK A;  2RJE A;  4QKU A;  4QQ6 A;  2HL5 C;  3PVL A;  2V26 A;  4BE1 A;  2EWN A;  2MWP A;  4XTX A;  1Z9Z A;  5GAN 8;  1VQO T;  1BKB A;  3EG1 A;  2KRN A;  2VXF A;  3LH0 A;  3GIB A;  4XK8 E;  4NOY A;  1UE9 A;  4HT8 A;  2QQB A;  1YJ9 A;  3LWI A;  4C92 A;  2IIM A;  2E5K A;  1ZQ1 A;  2OTJ Q;  1KQS S;  2C0I A;  1H8K A;  4P5N A;  1Y96 A;  1JEG A;  3OSV A;  4J9D A;  3RR6 A;  1WPY A;  5GAN 2;  2VV5 A;  1GL5 A;  1TG0 A;  3C95 A;  1RAG B;  4O6J A;  2X35 A;  1WQW A;  2P0P A;  5CKE A;  3A8H B;  2FZC B;  4VUB A;  5LJ3 e;  1F1B B;  1WHM A;  3L2W A;  2QAS A;  3RKX A;  2YHT A;  3CCJ T;  4M77 G;  1M2V B;  2PNI A;  3CCV A;  1XNI A;  2A28 A;  4FYX B;  4LDW A;  5I11 A;  3UA6 A;  4XTZ A;  5GAN 3;  2A7Y A;  3R6O A;  4LD9 K;  2F2X A;  5LJ3 f;  1K0S A;  3GOX A;  1VQL Q;  2XDD A;  2A37 A;  4IUU A;  4M75 D;  2ROL A;  1D0Z A;  1KHI A;  5GMK j;  4M4Z A;  1WXT A;  2JMC A;  3VYH B;  3L2Q A;  2DLP A;  1QKX A;  2RMO A;  5LJ5 g;  1H64 1;  4IIO A;  1OEB A;  3CCU A;  2J05 A;  1VQ7 Q;  1ZA1 B;  1ZSG A;  2MK5 A;  4FU6 A;  4A4K A;  2M16 A;  2YUN A;  1X43 A;  3OYA A;  4LUD A;  5GAM h;  1X6G A;  1YI2 A;  3JCM g;  2L3S A;  3CCS A;  2P4T A;  3I35 A;  2RH2 A;  1RI9 A;  2RPN A;  3SDZ A;  2L89 A;  3P8H A;  2OAU A;  2CYZ B;  2DX1 A;  3G4S A;  3P8B B;  2VAS A;  4PLI A;  2OTJ T;  4A4H A;  5GAO n;  3LGL A;  2BZ8 A;  1BU1 A;  3HFN A;  2YLB A;  3P8D A;  2I0N A;  1W70 A;  1PRM C;  1T3S A;  4PFO A;  3AT1 B;  1I5O B;  3UF4 A;  1VQM Q;  1YIT T;  3CEY A;  3PFS A;  2J6O A;  5IH2 A;  1T0J A;  2QDL A;  3RNJ A;  4IKF A;  3E9F A;  4Z02 A;  2RK2 A;  5GAM d;  3V7R A;  1MV3 A;  2Y4X A;  1M1F A;  2DEU A;  4IUT A;  1LJO A;  2CKK A;  3VS1 A;  1VQL T;  2KRO A;  3GLX A;  1YP5 A;  1VQ9 A;  1V1C A;  4PJO F;  3L2V A;  3UT1 A;  5C6S A;  1UGR B;  1V76 A;  3J80 E;  5CK9 A;  3ER0 A;  3L1A A;  4Y28 E;  3REB B;  1RAE B;  3CCL A;  2JS2 A;  1QVG S;  3S3O A;  1AZG B;  5KE3 A;  1VQK A;  3HRU A;  1VQ7 T;  2KNB B;  1QLY A;  2YSQ A;  4E7H A;  4Z89 A;  2DVJ A;  1TUG B;  3TEE A;  2A36 A;  5KYN A;  2DXT A;  5IHI A;  4CC7 A;  3CPW S;  4OB0 B;  4X34 A;  4EMG A;  4OMO A;  3QXE B;  1MMN A;  2DKG A;  1VQ8 A;  2DYI A;  2PVG B;  1VQP Q;  2HBP A;  1R0B G;  1X69 A;  2XD0 A;  1KFZ A;  5AYF A;  2IPO B;  1SG5 A;  3EFR A;  3JB9 G;  3T9N A;  3GF5 A;  3VRY A;  4HCZ A;  2L3R A;  4A4F A;  5GAO m;  4ELY C;  5EC7 A;  2HZY A;  2DL3 A;  3G71 Q;  4ZN3 A;  4IUR A;  4MZM A;  3R6N A;  2DVE A;  4F7U F;  4KH0 B;  3JCM X;  2AKK A;  2A0F B;  2OX7 A;  4PNO A;  2VWF A;  4DOV A;  2AIR B;  1D3B B;  2L5Q A;  4JS5 A;  1VQM T;  4PJO B;  4X9D A;  3TSW A;  2X4J A;  2EGC A;  1KQS A;  2V8K A;  3MP1 A;  2W0Z A;  1LPL A;  3EHQ A;  2QAZ A;  2AHJ B;  3V7C A;  2WAC A;  3L42 A;  1MND A;  1PWT A;  2QA4 Q;  1D09 B;  2GQI A;  2HD0 A;  2YRV A;  2Y90 A;  5LJ3 g;  2JUF A;  4F14 A;  4DEX A;  1RAH B;  3VYG A;  1G83 A;  1Q81 R;  1ABQ A;  1SKU B;  2BE7 D;  1YHQ A;  4C92 D;  1IRE B;  4FYV B;  1Q81 C;  3JCM V;  1I07 A;  2XHC A;  1PD1 A;  2EJF A;  2FPE A;  1MMA A;  1M30 A;  3E2U A;  1WHH A;  1S1N A;  2YWW A;  4E7Z A;  4KH1 B;  2A3L A;  4E7K A;  2V1R A;  2NLU A;  1E7O A;  4PJO A;  1W2B P;  3GNF B;  3VS6 A;  1YIT A;  1RAB B;  1KC8 R;  1NG2 A;  1AOJ A;  4C8Q G;  4LXC A;  3G7Z A;  1K73 U;  4AFS C;  4XU0 A;  5KCH A;  2E64 A;  2DXU A;  1ZUU A;  1HD3 A;  1VQP T;  1XOV A;  1B34 B;  2E41 A;  2H3E B;  1TUD A;  3RIR A;  4F7U B;  3JSC A;  3G6E Q;  1AWX A;  6AT1 B;  2Z0W A;  1M8V A;  4M7A C;  2DMO A;  2L8D A;  2ZPG B;  2EKH A;  2JT4 A;  1Q95 G;  2HQE A;  3G71 T;  2OTL Q;  1FMV A;  2E5Q A;  1MMD A;  4KGX B;  2O9V A;  1CKA A;  2PUO B;  4M78 E;  4AG1 C;  5LL6 S;  1K9M U;  3MKD A;  4DOW A;  2C06 A;  2DL4 A;  3CC7 A;  4BUG A;  2VGM A;  2VYT A;  1Q82 U;  2QEX A;  2GCX A;  2SEM A;  9ATC B;  4BDZ A;  3VS2 A;  3AHU A;  1BCO A;  1RL2 A;  2JNG A;  1OZ3 A;  1KQS P;  4FSS A;  2RHY A;  5KYU A;  3JCM b;  5GAN e;  1B07 A;  1PSE A;  2MOX A;  4BD3 A;  1VQN A;  4ZTF A;  2QA4 T;  1IO6 A;  3X25 B;  5CKB A;  1MGQ A;  1OX8 A;  2LNH B;  4F7U A;  3CCE Q;  5EG2 A;  5CVI A;  4OMN A;  3CXC S;  1M8M A;  3PGG A;  4A63 B;  5LJ5 h;  3CC2 A;  3C94 A;  1U3O A;  5GAN f;  4QVZ A;  2OJ2 A;  1N9R A;  1N9S A;  4JZ4 A;  1LOJ A;  5CQY A;  4WCI A;  4JRQ A;  3L2U A;  3QPH A;  3OYG A;  1GFC A;  2QTX A;  3DLM A;  4M78 A;  1KIK A;  2HQX A;  4XU2 A;  4JJC A;  5AT1 B;  3M0R A;  1Y71 A;  2DER A;  4C5E A;  2RHU A;  1YIJ A;  1XQH A;  4JRI A;  3VU3 C;  4M7A G;  2F2V A;  1RAA B;  3OYN A;  3OS5 A;  3J7A F;  1UG1 A;  2HKN A;  4F16 A;  3V7S A;  2K4Y A;  1IHV A;  2K79 A;  1E6H A;  2RM4 A;  3G6E T;  1SPK A;  4M77 F;  2XMF A;  3RKY A;  2LMJ A;  4OMQ A;  1YJN Q;  4GBQ A;  1SHG A;  2CT3 A;  4LDV A;  3EG2 A;  5IT9 E;  2EW3 A;  3QDR B;  4Y91 A;  2KBT A;  3A8O B;  2OTL T;  4DBH A;  2ZPE B;  4FM4 B;  3H0H A;  2K9G A;  4M75 G;  1AD5 A;  2E12 A;  1Q7Y R;  3CPW A;  1R8O B;  4KGZ B;  4F17 A;  1UGV A;  3U23 A;  3X20 B;  3EH2 A;  5IHK A;  1AVZ C;  2KR3 A;  2DD4 A;  3OYI A;  3FDR A;  2EKO A;  1Q7Y C;  4ZGD B;  3JCM d;  1VQ4 Q;  3HSB A;  3NFC A;  4DEY A;  4C0D B;  2NUZ A;  2LJ1 A;  2RN8 A;  4HVU A;  4TVR A;  2VKN A;  3JCM P;  1G3W A;  2HSP A;  2XI9 A;  1G3Y A;  4IUV A;  3A98 A;  3SEM A;  3CCE T;  5LJ5 j;  3I56 A;  1HK9 A;  2X3W D;  1RAF B;  3ZEH A;  1UJ0 A;  4LN2 A;  2ZPB B;  4M7D E;  1UFF A;  3GNG A;  2RK1 A;  4E7S A;  3MO8 A;  2JJ9 A;  4KRT A;  3M5A A;  1QQJ A;  1M5Q 1;  3I55 A;  3H0F A;  1OX9 A;  2DRM A;  2AZV A;  4N0A C;  2KRM A;  4M77 B;  3HL8 A;  3TCJ A;  1M1G A;  2LNV A;  2F5T X;  2LRQ A;  2J6F A;  2RHI A;  1NBE B;  3OYJ A;  3RUX A;  2BUD A;  1D0Y A;  3RBB B;  1CSK A;  3F70 A;  1KSW A;  1SRL A;  1R0C B;  2JTE A;  1W2B S;  2VB6 A;  1JU5 C;  1YJN T;  1JQQ A;  2DXC A;  5DY9 A;  1BIA A;  4GY5 A;  3OW2 P;  4O5V A;  4JLI A;  1IRX A;  2WSC E;  4X1V A;  2JS0 A;  2FPD A;  4XQ3 A;  1VOM A;  2AZS A;  4R56 A;  3CPW P;  4M7D A;  2EFI A;  2EYZ A;  2DTO A;  2KYM A;  5I21 A;  3QII A;  1VQ6 Q;  4OGC A;  3H6Z A;  1Q86 R;  2FEI A;  1BB9 A;  4M77 A;  1VQ4 T;  1WQ7 A;  2V8I A;  2H3J A;  3A5Z B;  2J6K A;  1KD1 C;  2M0Y A;  3CPF A;  3M59 A;  2QDY B;  3PIO A;  2GGR A;  3PNW C;  3PMT A;  3RKW A;  2MYS A;  2H8H A;  3VS5 A;  1Q86 C;  1TS9 A;  3CCM T;  5L8R E;  5FLX E;  4Z8A A;  2O4X A;  2JN0 A;  3S3M A;  2KMT A;  1YJW A;  2FB7 A;  3EG9 A;  2X4W A;  3ZFJ A;  3SWN A;  4QVD A;  3FB9 A;  3EGU A;  4HVV A;  5GMK i;  5GAN 5;  4ORZ A;  5GAN g;  1PG5 B;  4OMP A;  2RB6 A;  3ME9 A;  1B3Q A;  4FW1 A;  1MV0 B;  2YUO A;  3TRE A;  3HP9 A;  4J5Y A;  4QQG A;  3JB9 F;  2DA9 A;  3TVT A;  1S72 Q;  5GJV B;  2HEQ A;  4J6W A;  2XU8 A;  3FJP A;  3H9N A;  3OB9 A;  3CXC A;  2DZC A;  3X28 B;  4AFQ C;  2COW A;  3EGD B;  5LJ3 d;  4C5G A;  3TU4 K;  4RTV A;  1I1J A;  3E19 A;  3OYK A;  4AMC A;  3GPL A;  4OF1 A;  1J3T A;  3QDF A;  4J9G A;  2MAM A;  3MJX A;  2VXE A;  3CCR A;  1FX7 A;  2DPP B;  3MEW A;  3EAE A;  7AT1 B;  1YBY A;  2K3X A;  4RTZ A;  2P4R A;  4QT7 A;  2JMA A;  2NYS A;  2DL8 A;  2DJZ A;  4J6X A;  4C92 G;  4D8K A;  1ZBX A;  5KYY B;  1VQ6 T;  1U5S A;  3RDV A;  4M78 D;  2DFU A;  1C1A A;  3CMA Q;  4KGV B;  2CP7 A;  2COZ A;  3CC4 A;  1M2V A;  3NTH A;  2XG8 D;  2VGN A;  2CH4 A;  1WHG A;  1SSF A;  2M1H A;  2O9S A;  3EG3 A;  4CC3 A;  5HCK A;  1QMC A;  2DIL A;  3LLR A;  1I8F A;  2DL5 A;  1IHW A;  2CT4 A;  2QGF B;  1YCS B;  5DLO A;  3WXM B;  1K1Z A;  2O31 A;  4C8Q F;  2PUK B;  5J3B A;  1VQ5 Q;  2JOY A;  2PTK A;  2JXB A;  1V29 B;  3NTK A;  4JUV A;  2RO0 A;  4E7L A;  5A0G A;  3PTA A;  5KYY A;  5GAN 7;  3V8J A;  5M9O A;  1S72 T;  4OB1 B;  1LNX A;  1HYO A;  2JTM A;  3QKJ A;  2MPX C;  1GFD A;  4AT1 B;  3CXC P;  3QZ9 B;  2QQA A;  4II1 A;  3M0Q A;  1TUC A;  3MP6 A;  3RMQ A;  4E6R A;  3CCQ Q;  2DIQ A;  4CI0 C;  1VQO A;  1NPR A;  2DAQ A;  2K2M A;  3S3N A;  2YT6 A;  3QHS A;  4ESR A;  3LYI A;  1ZBJ A;  1SSH A;  2E1H A;  2OI3 A;  4Y92 A;  5GAM f;  2EAY A;  2KQW A;  4RMO A;  1OPK A;  4PL6 A;  5HKC A;  2FO0 A;  2LCS A;  1UB4 A;  2DO3 A;  3G1J A;  2WSF E;  5FRO A;  3M54 A;  4IUQ A;  1NM7 A;  3OW2 S;  2RA2 A;  2ZZD A;  5GAM j;  1G8X A;  2CP3 A;  1WFW A;  2RI3 A;  3CMA T;  4V2S A;  2KYB A;  1T0H A;  1W2B A;  3ULR B;  3S6W A;  4LDY A;  3A8G B;  2QGG A;  3CCJ A;  1Z9Q A;  2FRY A;  4C8Q B;  4CRI A;  1WJS A;  4E47 A;  3VS4 A;  1NPP A;  2KSS A;  4FYW B;  1EZZ B;  4MZP A;  2EYW A;  2ZPI B;  1KG1 A;  2NUT B;  3E1S A;  1M90 R;  2CSI A;  1KJW A;  4HCK A;  4M7A F;  1I4K 1;  4J9I A;  2EQU A;  4C8Q C;  4RUG A;  3CD6 Q;  1BIB A;  2K3B A;  1VIE A;  2F5K A;  1VQ5 T;  1M90 C;  2X4X A;  2R5M A;  4J8O A;  2RD1 A;  3I56 Q;  1JJ2 S;  1G3S A;  4BDY A;  4M7D D;  2VC8 A;  4J7I A;  1W6X A;  2ESW A;  4R0K A;  1SEM A;  4CC4 B;  2JVV A;  1PRL C;  4PJO E;  4FIB A;  1Y07 A;  3M57 A;  2EVR A;  4FYY B;  5A2Q E;  3QG1 A;  1QP2 A;  2E70 A;  4JRK A;  5CIU A;  4J9H A;  2ZGW A;  1OYX A;  1ACM B;  4R55 A;  4J9F A;  3LGF A;  4M75 F;  2HNI A;  3CCQ T;  4JJB A;  1ZA2 B;  2DF6 A;  1IB8 A;  1U1S A;  4ZGJ B;  1WGS A;  1WHL A;  3MP8 A;  1M3B A;  3L2R A;  1X27 A;  3CME Q;  4DA4 A;  4OMF B;  3V8K A;  2B86 A;  2OTJ A;  5GAO r;  3LH5 A;  4Q5W A;  2YUQ A;  1X75 C;  2EQM A;  1WYX A;  2AK5 A;  1LCK A;  1OU9 A;  2LVM A;  2RHX A;  4FW2 A;  4Z88 A;  1KQ1 A;  4AG2 C;  5FRN A;  3NHN A;  4XTY A;  2E3I A;  4JDS A;  4B9W A;  4XTV A;  3OA6 A;  4MDW A;  1D3B A;  1NZ9 A;  4MDX A;  2MCN A;  4JJD A;  2X3X D;  4M7A B;  3PMI A;  1WIE A;  2A08 A;  2LQW A;  4CC2 A;  1Y57 A;  4OGE A;  5GMK m;  1QVP A;  4BAC A;  1KC8 C;  2KY9 A;  4F7U E;  4UC4 A;  1W1F A;  1M3A A;  1G2B A;  4MMK A;  1VQL A;  4MZT A;  4HA8 A;  2EBP A;  1X2K A;  3CQT A;  2RQU A;  4KBM B;  2KE9 A;  2E4H A;  1QW1 A;  2HQH A;  1U8R A;  3CD6 T;  1KK7 A;  1VYT A;  2VVK A;  5GAO q;  3MCA B;  3DLL A;  1YJ9 Q;  1H3H A;  3C0C A;  4EDU A;  2ZAE A;  3M0U A;  4M75 B;  2XDB A;  5I2S A;  2DJQ A;  2HCK A;  3FLG A;  1M9S A;  2P0K A;  1VQ7 A;  3M0P A;  1UGS B;  4N4I A;  2X51 A;  1ZHI A;  1BI2 A;  4AFU C;  3EGX B;  4B6M A;  1WI7 A;  3FRN A;  2RQW A;  5A0L A;  4J9E A;  4ZTJ A;  4M7A A;  2BTT A;  2QK0 A;  4M75 C;  3LX7 A;  5IN1 A;  1ZLM A;  1OV3 A;  2AKL A;  3VUB A;  3CCV Q;  1B34 A;  3M4Y A;  2PQW A;  5CO7 A;  1ZSZ B;  4EMK C;  3CME T;  4JPB W;  1D1B A;  3JCM J;  1E6G A;  1H3Z A;  1IGU A;  2QXF A;  4BI4 A;  1GBQ A;  5GAN d;  2RJF A;  1WXB A;  1MHN A;  1WX6 A;  4EIK A;  3OSS C;  2KAF A;  3UWN A;  3EG0 A;  2YRC A;  2KT1 A;  1FXX A;  3JRZ A;  3JCM h;  1ZSZ C;  5IXB A;  3HKS A;  1NEG A;  2LQ8 A;  1N8R U;  4A53 A;  2C0O A;  4ZNX A;  1IZ6 A;  2BIV A;  4F04 B;  5FU6 B;  5GMK l;  2CH4 W;  3JB9 H;  3CCU Q;  4J9B A;  1VQM A;  2K3Y A;  1H92 A;  3BE3 A;  5D6W A;  2LZ6 B;  3O8V A;  3OYY A;  3OYD A;  1QCO A;  2X4Y A;  4XTU A;  1I0C A;  3QZ5 B;  2DRK A;  3QJ6 A;  4LNP A;  1ABO A;  1C6V X;  4KUL A;  2EIF A;  3EFO B;  1YI2 Q;  1KD1 U;  2DXB A;  1QP3 A;  3OYH A;  3M58 A;  3CCS Q;  1Q86 U;  1AWO A;  5FU6 C;  2EYX A;  2DZ9 A;  2KEA A;  1UEC A;  2RJD A;  2L2P A;  4RTY A;  2V1Q A;  3OW2 A;  2DBK A;  1RUW A;  2ROT A;  1M27 C;  4ZGE B;  3SD4 A;  3QJY A;  2E3H A;  2CGH A;  3G4S Q;  1YJ9 T;  1EIF A;  2EPD A;  2KDS A;  1VUB A;  2QQR A;  3FJ5 A;  4MML A;  2LP5 A;  3QO3 A;  2FHD A;  5HK3 A;  1K8A R;  1BK2 A;  1RAD B;  3E9G A;  5LJ5 f;  5KYX B;  2NWM A;  2KXC A;  2BKD N;  1K8A C;  4C92 F;  4M78 G;  3BDU A;  4LDU A;  1QWF A;  3PE0 A;  1QWE A;  2GQV A;  4J9C A;  5HK0 A;  3OYC A;  3CCV T;  3EFO A;  3HRT A;  5IAY A;  5KYW B;  1CKB A;  1JXO A;  5ECA A;  1GRI A;  1VQP A;  2EQJ A;  5KH6 A;  1JJ2 A;  1M1K R;  3NMZ C;  3BY7 A;  4RTX A;  1MNE A;  4IUP A;  1M1K C;  4WTO B;  1VQ9 Q;  1GCQ C;  1C0M A;  3G71 A;  3QUI A;  5FWB A;  3X24 B;  1XJW B;  4M77 E;  3FIF A;  3EFS A;  3RMS A;  3CCL Q;  4NL2 A;  3VJP A;  2YLC A;  3CCU T;  3SHW A;  1FMK A;  2XKO C;  4HKE A;  1VQK Q;  1SRM A;  4JZ3 A;  1TSF A;  2CUD A;  4PJL A;  1Y7X A;  2LT1 A;  2FZG B;  3OBY A;  1YI2 T;  2ZPF B;  1AWJ A;  2QA4 A;  2L3P A;  2O01 E;  2HBW A;  2LDM A;  2E65 A;  2P84 A;  4N0A A;  4E7J A;  1A0N B;  1VQ8 Q;  3VRZ A;  5J26 A;  3G4S T;  1VA7 A;  2F69 A;  4N4G A;  4D8D A;  1K0X A;  4C92 B;  3IQL A;  1W4S A;  2KI7 A;  2RJC A;  3PVQ A;  5IHN A;  1AZE A;  2CP0 A;  1HXD A;  2EQK A;  4KUI A;  2DYB A;  4C0G A;  1JRI A;  4PJO D;  2HSE B;  2CP6 A;  1MMG A;  5LJ3 h;  2MWO A;  2CUB A;  1AT1 B;  1UDL A;  4L59 A;  1BBZ A;  4C92 C;  1WHJ A;  2DEQ A;  2G6F X;  4XAX B;  4KUD K;  1TOV A;  5GAN 4;  3A8L B;  3HPW A;  1JJ2 P;  2CS7 A;  1JB0 E;  4FSX A;  3G6E A;  4GLM A;  2XK0 A;  2CZ6 B;  4GLK A;  1M4Z A;  5IXF A;  2EGE A;  1EX4 A;  2NUP B;  3CBO A;  5GMK e;  1VQ9 T;  1X6B A;  3ZBD A;  2K57 A;  1YHQ Q;  5GAN 6;  2OTL A;  2AT1 B;  2LJ3 A;  2D0Q B;  3FC3 A;  1OUL A;  1WLP B;  4PFZ A;  1B7T A;  3CCL T;  2RQV A;  1OPL A;  5CKF A;  2QQ9 A;  3M9Q A;  1UTI A;  1VQK T;  1WA7 A;  2OAW A;  1QVF S;  4DBQ A;  4A4G A;  3HFO A;  4M7A D;  4M7D G;  4ZN1 A;  2DTI A;  4RCC A;  4OP0 A;  2DTH A;  2DL7 A;  4C0Z A;  2JM9 A;  1NYF A;  2D6F A;  2DIG A;  2SRC A;  4EPC A;  1YIT Q;  4BB7 A;  1N27 A;  2R57 A;  3CCE A;  1TH7 A;  2MF2 A;  1X2Q A;  2DNU A;  1VQ8 T;  1D0X A;  8ATC B;  3VUZ A;  2XIC A;  4LUE A;  2G3R A;  1NJI R;  2GNC A;  2NUP A;  2BZY A;  3QYH B;  3MEU A;  1HJD A;  3UAT A;  1QCN A;  3JAM E;  3KXT A;  3QBY A;  3URG A;  1TWB A;  2PZ1 A;  3DB4 A;  4OML A;  1NJI C;  1PKS A;  1M90 U;  1U06 A;  1PNJ A;  3NTI A;  3J81 E;  1ZUK A;  3ASK A;  1FMW A;  5LJ3 j;  1IGQ A;  1UEB A;  2ABL A;  4D6W A;  3CC7 Q;  3MEA A;  1D1C A;  3JCM W;  2QEX Q;  4ANJ A;  3EGD A;  4J7F A;  2M51 A;  2O2O A;  2L0A A;  1WZO A;  4QQD A;  1RI0 A;  3FEO A;  1U1T A;  2LCL A;  4ME7 A;  4E7I A;  1VQN Q;  4PFP A;  1YJN A;  3A1P A;  1ARK A;  4PJN A;  5CCA A;  3JCM Q;  3OS2 A;  5CR2 A;  3M53 A;  3VS7 A;  3V8L A;  4FT2 A;  3M56 A;  2EYY A;  1YHQ T;  1WXU A;  3CBP A;  3CC2 Q;  1Q81 U;  1P92 A;  1PKT A;  2LCC A;  3QWX X;  3OQ5 A;  2P0Q A;  1VYU A;  4OMM A;  4AFZ C;  1AWW A;  4LDX A;  5GAM e;  1VQ4 A;  3DB3 A;  3L2Z A;  1KQ2 A;  3JCM c;  2ED1 A;  3JB9 I;  3KUF A;  8AT1 B;  3H8Z A;  3QYG B;  5KCO A;  3TQ7 P;  1RAI B;  3TSZ A;  2KVQ G;  3CCM A;  4KT0 E;  1BI3 A;  1YIJ Q;  3RES A;  1RAC B;  2E10 A;  2GTO A;  2J06 A;  3C12 A;  1KC8 U;  2M9U A;  3GBQ A;  2B8A A;  3MEV A;  2MI6 A;  3JB9 J;  1O75 A;  2FRW A;  4FL6 A;  1KHC A;  3M55 A;  2M02 A;  3EH1 A;  1HSQ A;  1WDX A;  3NGP A;  3C4S A;  2GTJ A;  4OB2 B;  2I2L A;  1BYM A;  4JRP A;  1UGQ B;  5CAI A;  1I81 A;  4HVW A;  4C8Q E;  1YFN A;  5GAO p;  4BE0 A;  4C5H A;  3CC7 T;  4RKU E;  2KXD A;  2FL7 A;  2QEX T;  2RI2 A;  2MMP A;  5FU7 B;  2DE0 X;  3VS3 A;  2F2W A;  1UGP B;  3OYE A;  4RCB A;  5CQX A;  1YNZ A;  2FG0 A;  1VQN T;  2F1L A;  4HCC A;  2WSE E;  1YWO A;  2C0T A;  4OB3 B;  3OY9 A;  4BI8 B;  1WJR A;  1TU0 B;  1PD0 A;  4L5G A;  4YTL A;  4RTW A;  2FVU A;  1LVK A;  5FU7 C;  3CC2 T;  1QCF A;  5J39 A;  2D8J A;  4ELZ C;  2XDP A;  2KGT A;  1VQ6 A;  3OYM A;  1PHT A;  5D6Y A;  4RTT A;  2RQT A;  4M77 D;  2LX7 A;  2PVD B;  2CDT A;  3JV3 A;  5DM7 R;  3I55 Q;  5FW9 A;  2R5A A;  4C8Q A;  2RQR A;  1XTD A;  2JW4 A;  1PM3 A;  5FWC A;  1EFN A;  1YIJ T;  2K2V A;  4E2F B;  3KFV A;  1AHJ B;  2FPF A;  2EGA A;  1YCY A;  2ENM A;  1UHC A;  4DBR A;  2NUT A;  2QYZ A;  4J83 A;  2ZPH B;  1WNL A;  4PJJ A;  2DBM A;  4OVA A;  2COY A;  2K5I A;  2K7A A;  2V8J A;  3M4G A;  4M78 F;  1D1A A;  1RLQ C;  1WHK A;  1UHF A;  3DKM A;  5D7U A;  3VKI A;  4BI3 A;  2KRS A;  1QVF A;  1BCM A;  2R58 A;  2VUB A;  4QVC A;  4PJO C;  3MHX A;  3O5Z A;  4QW2 A;  5I22 A;  1S72 A;  4M7A E;  3EHR A;  1SF9 A;  3CBM A;  1T3L A;  1ZUY A;  2K5F A;  1Q7Y U;  4A4E A;  2LX9 A;  1DJ7 B;  2L3Q A;  2M0O A;  4K11 A;  4BY6 B;  5GAN h;  2PU9 B;  3OBW A;  4A54 A;  3WVD B;  2DD5 A;  5KYU B;  1K8A U;  2K5L A;  2CRE A;  3BFM A;  3HRS A;  5KE2 A;  3M0T A;  4IIM A;  4PKC C;  2CP2 A;  4LE9 A;  2JM8 A;  4HXJ A;  2Y4Y A;  1UUE A;  1TTH B;  4M75 E;  2QTV A;  1YJW Q;  3INZ A;  5GAO l;  2RNA A;  3I56 T;  4RG2 A;  2DK3 A;  3UA7 A;  5L23 A;  2ATC B;  4BY6 C;  2CP5 A;  3HTR A;  1M1K U;  4DQ2 A;  4HT9 A;  1NE8 A;  1I5L A;  1TXQ A;  1BI1 A;  4EMK B;  3MET A;  1PC0 A;  1M3C A;  4ATO A;  3CMA A;  4BE2 A;  1NLO C;  3I55 T;  4HCB A;  3Q1J A;  5GJW B;  1PCX A;  2BE9 B;  4M78 B;  3HHT B;  1JO8 A;  3D7S B;  2HDA A;  2LJ0 A;  1ZX6 A;  2LC4 A;  3BDL A;  1NYG A;  3OMC A;  4PJO G;  3VV0 A;  2RHZ A;  3UDC A;  5C0M A;  1FWZ A;  2EJ9 A;  2HKQ B;  5GAM g;  1K9A A;  1G3T A;  4JLG A;  2X9H A;  2YDL A;  3PIP A;  4JS4 A;  4M78 C;  4FCY A;  1QVF P;  1VQ5 A;  2GF7 A;  4M75 A;  1O9S A;  2ECZ A;  5CKD A;  3LW5 E;  4WF2 A; 
#chains in the Genus database with same CATH homology
 1A0N B;  2AKK A;  2DIL A;  3VRZ A;  2VWF A;  3M0S A;  1VA7 A;  3TSW A;  4D8D A;  1K0X A;  2DL5 A;  2EGC A;  1RLP C;  2CT4 A;  3NPF A;  1K4U S;  1YCS B;  3IQL A;  2W0Z A;  3EHQ A;  1Y0M A;  1YWP A;  2KT8 A;  1K1Z A;  2D0N A;  3PVQ A;  2O31 A;  5IHN A;  1AZE A;  1PWT A;  2GQI A;  2DYB A;  2PTK A;  2JXB A;  2RF0 A;  3QWY A;  4DEX A;  4F14 A;  1GBR A;  1G83 A;  1ABQ A;  2CUB A;  1UDL A;  2ED0 A;  2LQN A;  1BBZ A;  2W10 A;  2G6F X;  1GFD A;  1I07 A;  1GCP A;  2FPE A;  1M30 A;  3M0Q A;  1TUC A;  1S1N A;  4GLM A;  4E6R A;  2V1R A;  1E7O A;  5IXF A;  2EGE A;  2K2M A;  2YT6 A;  4ESR A;  3REA B;  1X6B A;  3I9Q A;  3VS6 A;  1FYN A;  1ZBJ A;  1SSH A;  2LJ3 A;  1NG2 A;  1WLP B;  1AOJ A;  2OI3 A;  4Y92 A;  3H0I A;  3H41 A;  4AFS C;  2RQV A;  1OPL A;  1ZUU A;  1HD3 A;  1OPK A;  1XOV A;  1AEY A;  1UTI A;  1TUD A;  2FO0 A;  2LCS A;  1AWX A;  1WA7 A;  2OAW A;  1JXM A;  1NM7 A;  2DL7 A;  2DMO A;  2JM9 A;  1NYF A;  2EKH A;  1WFW A;  2JT4 A;  2KYB A;  1T0H A;  2SRC A;  3ULR B;  2O9V A;  1CKA A;  1Z9Q A;  2K6D A;  2FRY A;  4AG1 C;  1X2Q A;  2DL4 A;  2DNU A;  3VS4 A;  4LUE A;  2SEM A;  2GNC A;  2BZY A;  2YUP A;  3VS2 A;  1OOT A;  2EYW A;  1HJD A;  3UAT A;  4FSS A;  2CSQ A;  2J7I A;  2CSI A;  1KJW A;  2PZ1 A;  4HCK A;  4OML A;  1B07 A;  1PKS A;  4J9I A;  2MOX A;  1GCQ A;  4RUG A;  1U06 A;  2K3B A;  2BZX A;  1PNJ A;  1MUZ A;  1IO6 A;  1YN8 A;  1N5Z A;  1ZUK A;  2LNH B;  1QKW A;  2ABL A;  4OMN A;  1M8M A;  1NEB A;  2D8H A;  4A63 B;  1U3O A;  1W6X A;  2ESW A;  1SEM A;  1SHF A;  4R0K A;  4CC4 B;  1PRL C;  2O88 A;  2OJ2 A;  2EVR A;  2D1X A;  4JZ4 A;  1K76 A;  4J9H A;  2M51 A;  2O2O A;  2L0A A;  4J9F A;  4WCI A;  1GFC A;  1UJY A;  4JJB A;  2DF6 A;  1KIK A;  4JJC A;  2GBQ A;  1ARK A;  2MIO A;  3M0R A;  3VS7 A;  2EYY A;  1VYV A;  1M3B A;  1WXU A;  1NLP C;  1X27 A;  2F2V A;  2DM1 A;  1PKT A;  2B86 A;  1UG1 A;  3QWX X;  3I5S A;  3LH5 A;  4F16 A;  4RTU A;  3VS0 A;  2YUQ A;  3I5R A;  3ZL7 C;  1VYU A;  1WYX A;  2AK5 A;  4OMM A;  1LCK A;  2EQI A;  1E6H A;  2K79 A;  3THK A;  4AFZ C;  1SPK A;  4Z88 A;  2XMF A;  4AG2 C;  1AWW A;  3NHN A;  2LMJ A;  3PVL A;  4OMQ A;  4GBQ A;  1Z9Z A;  2ED1 A;  1SHG A;  3EG1 A;  2CT3 A;  2KRN A;  3EG2 A;  2EW3 A;  2KBT A;  3TSZ A;  2MCN A;  1UE9 A;  4JJD A;  3H0H A;  2K9G A;  2X3X D;  2GTO A;  1AD5 A;  1WIE A;  2A08 A;  2E5K A;  2IIM A;  2J06 A;  2C0I A;  2LQW A;  1H8K A;  1Y57 A;  4CC2 A;  1JEG A;  4J9D A;  4F17 A;  3GBQ A;  1UGV A;  3U23 A;  1GL5 A;  1TG0 A;  5IHK A;  1AVZ C;  2KR3 A;  2FRW A;  1W1F A;  1M3A A;  1G2B A;  4DEY A;  1HSQ A;  1WDX A;  3NGP A;  2EBP A;  2NUZ A;  1X2K A;  3CQT A;  2GTJ A;  2RQU A;  2KE9 A;  2LJ1 A;  2RN8 A;  1VYT A;  4HVU A;  2VVK A;  2VKN A;  2HSP A;  3A98 A;  4HVW A;  3SEM A;  3C0C A;  1H3H A;  2PNI A;  3M0U A;  2A28 A;  2DJQ A;  5I11 A;  2KXD A;  3UA6 A;  2HCK A;  2X3W D;  2F2X A;  3M0P A;  1K0S A;  4AFU C;  1UJ0 A;  4LN2 A;  1WI7 A;  2A37 A;  2DE0 X;  2RQW A;  1UFF A;  3VS3 A;  2F2W A;  4J9E A;  1YNZ A;  2ROL A;  2FG0 A;  2BTT A;  4KRT A;  1YWO A;  3H0F A;  2C0T A;  4M4Z A;  1ZLM A;  1WXT A;  2DRM A;  2AZV A;  1OV3 A;  2AKL A;  2JMC A;  2KRM A;  2DLP A;  1QKX A;  2RMO A;  4RTW A;  4IIO A;  2J6F A;  1OEB A;  4JPB W;  2J05 A;  1QCF A;  1ZSG A;  1E6G A;  2D8J A;  3RBB B;  1GBQ A;  1CSK A;  2YUN A;  1KSW A;  1WXB A;  1X43 A;  2KGT A;  1SRL A;  1PHT A;  1WX6 A;  4EIK A;  4LUD A;  4RTT A;  2RQT A;  2JTE A;  1X6G A;  2LX7 A;  3EG0 A;  2CDT A;  2L3S A;  3JV3 A;  1JU5 C;  2KT1 A;  5FW9 A;  1JQQ A;  3I35 A;  2RPN A;  1RI9 A;  5IXB A;  1NEG A;  2RQR A;  2C0O A;  4ZNX A;  2JW4 A;  4X1V A;  2DX1 A;  5FWC A;  2JS0 A;  1EFN A;  2CH4 W;  2FPD A;  3KFV A;  2FPF A;  4J9B A;  2AZS A;  2EGA A;  2ENM A;  1H92 A;  1UHC A;  2LZ6 B;  2EYZ A;  2KYM A;  2BZ8 A;  2DBM A;  1I0C A;  1BU1 A;  2DRK A;  4LNP A;  1ABO A;  2K7A A;  2I0N A;  1W70 A;  1PRM C;  2FEI A;  1BB9 A;  1T3S A;  1RLQ C;  1UHF A;  2J6K A;  2KRS A;  2M0Y A;  1AWO A;  2EYX A;  2GGR A;  2KEA A;  1UEC A;  2H8H A;  3VS5 A;  2L2P A;  4RTY A;  3O5Z A;  2V1Q A;  3UF4 A;  2DBK A;  1RUW A;  2ROT A;  1M27 C;  5I22 A;  4Z8A A;  2EPD A;  2J6O A;  5IH2 A;  3EHR A;  1T0J A;  2QDL A;  3RNJ A;  3FJ5 A;  1T3L A;  1ZUY A;  2LP5 A;  1MV3 A;  3EGU A;  4HVV A;  2L3Q A;  4ORZ A;  3VS1 A;  4K11 A;  2KRO A;  4OMP A;  1BK2 A;  1B3Q A;  1YP5 A;  1V1C A;  1MV0 B;  2YUO A;  2NWM A;  2KXC A;  2CRE A;  3M0T A;  2DA9 A;  4IIM A;  3TVT A;  4HXJ A;  2JM8 A;  1QWF A;  4LE9 A;  3PE0 A;  5GJV B;  1QWE A;  2HEQ A;  1UUE A;  4J9C A;  3REB B;  2JS2 A;  1CKB A;  1JXO A;  5ECA A;  2RNA A;  1GRI A;  3UA7 A;  5L23 A;  1AZG B;  3NMZ C;  2KNB B;  4AFQ C;  1QLY A;  4RTX A;  2YSQ A;  4Z89 A;  4RTV A;  1I1J A;  2DVJ A;  1GCQ C;  1M3C A;  2A36 A;  1NLO C;  5FWB A;  5IHI A;  5GJW B;  4CC7 A;  1J3T A;  1JO8 A;  4J9G A;  2HDA A;  2LJ0 A;  4OMO A;  1ZX6 A;  1NYG A;  3SHW A;  1FMK A;  1X69 A;  1KFZ A;  4RTZ A;  2P4R A;  1SRM A;  4QT7 A;  2JMA A;  2DL8 A;  4JZ3 A;  4D8K A;  2CUD A;  1U5S A;  1K9A A;  3VRY A;  2YDL A;  5EC7 A;  2DL3 A;  1AWJ A;  2ECZ A;  2L3P A;  2CH4 A;  2O9S A;  3EG3 A;  3R6N A;  2HBW A;  4CC3 A;  5HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...