1Z9QA

Solution structure of sh3 domain of p40phox
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
DRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 4
publication title Solution structure of SH3 domain of p40phox
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase activator
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1z9qA00
1UE9A 2K79A 2PZ1A 2VVKA 1RUWA 2DM1A 1RLPC 2ED1A 1PNJA 1W1FA 2MIOA 2XMFA 1UTIA 1T3SA 2C0IA 2LJ0A 4QT7A 3M0UA 3EHQA 1WDXA 2RF0A 2KR3A 2DRMA 3VS4A 2DBMA 2DLPA 2O88A 2EYWA 3EG0A 3UA7A 3VRYA 2AZVA 2AZSA 4HVUA 1PRLC 2DBKA 4RTVA 2IIMA 3NPFA 4JPBW 1H92A 2ENMA 2SEMA 2K7AA 1OPKA 2FPFA 4OMLA 3EG3A 2DYBA 2JS2A 4Z88A 3VRZA 4OMOA 2GQIA 3TVTA 1VA7A 3M0RA 2GBQA 1UHFA 1FYNA 4J9IA 1B3QA 2D8JA 2KE9A 2HSPA 1TUDA 4R0KA 2CH4W 2L0AA 2YUPA 5I11A 3UA6A 2KXCA 1Z9QA 1T3LA 1YWOA 4K11A 2J6FA 2AKKA 2M0YA 1QKXA 4WCIA 2H8HA 3JV3A 4AG1C 4RTWA 4CC4B 3ZL7C 1K1ZA 2JTEA 2EGEA 1PHTA 3H0IA 1SHFA 2RQVA 1M30A 3FJ5A 2BZYA 1GL5A 2G6FX 1WFWA 2CH4A 1ZUUA 2CT3A 4A63B 1Z9ZA 1KJWA 5EC7A 1H8KA 1PKSA 2VKNA 4HXJA 1Y57A 5IHKA 2ESWA 3REBB 1NLOC 1N5ZA 4J9GA 1ZSGA 2CSQA 1G2BA 1JXOA 2O9VA 1PKTA 4GLMA 2ECZA 1Y0MA 1I0CA 1U5SA 2V1RA 2RMOA 5FWCA 1AWWA 2RPNA 4JJDA 2D8HA 2KRMA 1ZUYA 2A37A 2L3QA 4M4ZA 4ZNXA 2L3PA 1WXBA 3I35A 2YT6A 1MUZA 2CUBA 1JU5C 1AEYA 1RI9A 1T0JA 2C0TA 3I5SA 3EGUA 1RLQC 2EKHA 2RNAA 1AOJA 1SEMA 3VS7A 1KFZA 2K3BA 2DL5A 3CQTA 5GJVB 1K4US 1AWOA 1AVZC 1NLPC 2FRWA 2LCSA 2BTTA 4J9BA 4JZ4A 1GCQA 2YDLA 4Z89A 3R6NA 1H3HA 2DF6A 5ECAA 1J3TA 1WXTA 2KGTA 1CKAA 2YUOA 1HSQA 1U3OA 3PVLA 4J9EA 5FW9A 2A08A 1ZX6A 2X3WD 2B86A 4RTYA 2KYMA 2K6DA 4J9CA 4HCKA 1WXUA 2FPEA 2EYZA 2CT4A 1K0SA 3LH5A 2RQTA 2HDAA 1E6HA 2RQRA 4AFQC 2J6KA 1I07A 2JS0A 1UUEA 2VWFA 2D1XA 1CSKA 4OMNA 1X2KA 4D8KA 1UJYA 3KFVA 4EIKA 3ULRB 4RTTA 4E6RA 2LX7A 1QLYA 1EFNA 3PE0A 2EGAA 2DILA 2JM8A 1X2QA 2RQUA 2EYXA 4OMPA 2ROTA 2GTJA 1GBQA 4AG2C 2FO0A 1S1NA 2EVRA 1KSWA 1ZUKA 4J9HA 3A98A 3VS0A 1K76A 2EYYA 1V1CA 4JZ3A 4OMQA 2LZ6B 1ARKA 1OV3A 3VS1A 1NYFA 2CUDA 3I5RA 2JMAA 1GRIA 4LNPA 1ZBJA 1X6BA 2YUQA 4OMMA 2J6OA 1XOVA 2DA9A 2OAWA 2CDTA 3VS2A 1AZEA 1M3CA 3M0PA 1OOTA 3NMZC 5IXBA 1UG1A 2KRNA 2L2PA 5GJWB 2DL4A 1AD5A 2MOXA 2GNCA 2D0NA 2KXDA 2JW4A 1M3BA 1M8MA 3O5ZA 1KIKA 2W0ZA 2YUNA 2NUZA 1SHGA 2DMOA 3H0HA 4LUDA 1GFDA 4Y92A 2EGCA 2KYBA 3TSWA 1JXMA 5IH2A 1T0HA 1UJ0A 1BK2A 1OEBA 1OPLA 2A36A 1VYTA 2O9SA 1WYXA 1E6GA 1I1JA 4CC3A 2AKLA 2A28A 4RUGA 2PNIA 2JM9A 2CSIA 1UHCA 2L3SA 3UATA 1W70A 1MV0B 4IIOA 2HCKA 4LUEA 3SEMA 2F2XA 1WLPB 1X27A 2QDLA 2JT4A 1X69A 1UFFA 1G83A 4AFUC 2KBTA 3EHRA 2LJ3A 2LQNA 2FG0A 4D8DA 1ABOA 2K9GA 2EBPA 2RQWA 3UF4A 2LJ1A 1WIEA 5IHIA 2ABLA 1NEBA 1GBRA 4GBQA 1TUCA 2KT8A 1WX6A 1FMKA 1YCSB 2EQIA 4F17A 1IO6A 3H0FA 2HEQA 2LNHB 4JJCA 4KRTA 4J9FA 4RTZA 2ROLA 1AWXA 1M27C 1GCQC 1YNZA 3RNJA 3THKA 2LP5A 2LMJA 4LE9A 1K9AA 4DEYA 1LCKA 2F2VA 2LQWA 1NYGA 2KT1A 1ABQA 1PRMC 4Z8AA 3NGPA 3H41A 1SRLA 3REAB 2FEIA 2KRSA 1NEGA 3M0QA 2DL7A 3C0CA 2W10A 5FWBA 3VS3A 3NHNA 4FSSA 3RBBB 1SSHA 2KNBB 4JJBA 5L23A 4AFZC 1UECA 1JQQA 1PWTA 1QWFA 2CREA 3VS5A 1K0XA 2M51A 2JMCA 2BZXA 3VS6A 1HD3A 1ZLMA 2GGRA 4IIMA 1QKWA 1B07A 4F14A 2DE0X 1UGVA 3QWXX 4HVWA 4RTUA 4LN2A 1CKBA 1U06A 1YWPA 2DL8A 5IHNA 1UDLA 1AZGB 1WI7A 2HBWA 1W6XA 2ED0A 1M3AA 3PVQA 3EG2A 1BB9A 2FRYA 2EPDA 1JEGA 2RN8A 4ESRA 2DVJA 3IQLA 2DL3A 2EW3A 1X6GA 4ORZA 2OJ2A 1E7OA 2K2MA 2JXBA 3SHWA 2C0OA 1JO8A 5HCKA 2DJQA 1WA7A 3M0TA 2NWMA 3U23A 2DNUA 5I22A 1YP5A 2SRCA 1X43A 2J05A 1VYUA 3GBQA 4RTXA 2V1QA 1QWEA 2O31A 2FPDA 2OI3A 2PTKA 2KROA 2YSQA 1QCFA 2DX1A 2MCNA 4CC2A 3M0SA 2DRKA 4F16A 4AFSC 2O2OA 1AWJA 4X1VA 1NM7A 2E5KA 5IXFA 3I9QA 3TSZA 1HJDA 2AK5A 1YN8A 1GCPA 1GFCA 1SPKA 2P4RA 1BBZA 1TG0A 3EG1A 4HVVA 2J7IA 4DEXA 1VYVA 2KEAA 4CC7A 4J9DA 2X3XD 3QWYA 2F2WA 1SRMA 1BU1A 1MV3A 1NG2A 2BZ8A 2I0NA 2GTOA 2J06A 1A0NB
chains in the Genus database with same CATH superfamily
2QTVA 2RJFA 4C92G 1WHKA 1RAFB 2LVMA 4V2SA 4PJOC 2ED1A 3LWIA 1PNJA 3EFOB 4EMKC 2EJFA 2XMFA 4YTLA 5DLOA 2LJ0A 4QT7A 4MMLA 3EHQA 3CD6T 1B34A 4F7UA 5GAN7 2EYQA 1IRXA 2DXBA 2DBMA 2M16A 2O88A 2CP7A 4HVUA 5GAMd 4RTVA 4IURA 2QQ9A 1JRIA 1M90U 1UGRB 2K7AA 5M9OA 1BI2A 2P0KA 4OMLA 2X4XA 1YJWT 3RMSA 1QVGP 1QVPA 2JS2A 5CVIA 3EGXB 2QI2A 1B3QA 3DB3A 1YIJT 3I55T 3M56A 2HSPA 1D09B 2LTOA 1TUDA 2E41A 4R0KA 2YUPA 3UDCA 1T3LA 1YWOA 4K11A 3EFOA 1D1BA 2M0YA 2L8DA 4EMGA 1JJ2P 1QKXA 2XDDA 1SF9A 4RTWA 4CC4B 2QEXA 1MHNA 2RM4A 1VQMT 4N0AA 2IPOB 4ELZC 4M7DG 3FJ5A 2M9UA 1VQOT 1MMGA 2EQUA 2CT3A 1KJWA 2B8AA 1PKSA 4HXJA 5LL6S 1Y57A 4PJOF 2FZCB 3OW2S 3REBB 1K73C 3QBYA 1JXOA 4J6WA 3CPWP 1R77A 4IUPA 4GLMA 1Y0MA 2V1RA 5FWCA 3E9GA 2K4YA 1NJIC 2EQKA 1ZUYA 2L3QA 2L3PA 5EG2A 2YT6A 2CUBA 1JU5C 3OYHA 4FYXB 3I5SA 4HKEA 2HSEB 2HD0A 3NTKA 3KBGA 4BY6B 1RLQC 4XU1A 2MK5A 3TCJA 2DTHA 1S72Q 1YJWA 1SEMA 2RJCA 1BI3A 5IAYA 3BW1A 2K3BA 1K4US 2EAYA 2BE7D 4J9BA 3CCJT 2Y4XA 1YCYA 4M75C 1YIJA 1H3HA 3OMCA 5ECAA 1WXTA 3MEAA 2QDYB 1U3OA 4J9EA 2A08A 5GAMh 3HFNA 1VIEA 1VQOA 1YITT 1R8OB 4C5GA 2FHDA 3MP6A 4AFQC 3OYLA 3OA6A 1I07A 5CKHA 2D1XA 4C8QE 1KHIA 3GOXA 1MNDA 1X2KA 1VQ8Q 1UJYA 2EKOA 1QP2A 4RTTA 4E6RA 3OYNA 3G71Q 2DERA 3QPHA 3PMTA 2YHTA 1X2QA 2RQUA 1X75C 1KC8R 3V7SA 2NUPA 2OTLQ 4J7FA 4C8QD 1IHWA 1K9MU 2XKOC 1GBQA 4AG2C 1UGPB 3H8ZA 3CPWA 1M1KR 1S1NA 2EVRA 1JBMA 1OYXA 1KSWA 4J9HA 5CKBA 2KQWA 2DTIA 1QQJA 1V1CA 4JZ3A 2LZ6B 1ARKA 2E12A 4M75F 4C0FA 2DZCA 2JUFA 3CCJA 3DB4A 3AHUA 3OYEA 1NPPA 3VS2A 1D1CA 1AZEA 1M3CA 3CCVQ 1OOTA 4E7KA 3HRUA 2X51A 2KRNA 5CQYA 2L2PA 4M78D 6AT1B 3BY7A 5J26A 1AD5A 2MOXA 1YITA 2KXDA 2BUDA 3WXMB 2QGFB 1KK7A 2GCXA 5GANf 3CCRA 4II1A 4X9DA 1KD1C 4D6WA 3M4YA 3FC3A 4CI0C 2WSCE 2KYBA 4KGZB 1PD0A 2D6FA 4N0AC 1OEBA 4C0DC 2YRDA 2D0QB 1N8RC 1IHVA 1M8VA 4KUDK 1WHGA 2KSSA 2LCCA 2AKLA 5DY9A 5C0MA 2QA4Q 3OW2P 2A28A 1UGSB 4QVZA 1YJ9Q 4RUGA 2JM9A 3X24B 2FL7A 4M7DE 2P84A 1VQLT 4IIOA 5KYYB 2HCKA 4OMFB 4EMHA 3QSUA 3QYGB 2M02A 1X69A 1UFFA 1OU8A 4GY5A 1G83A 3ZEHA 1U1TA 2LJ3A 2CP3A 3G4ST 2K9GA 2EBPA 3L2ZA 1QW1A 2WSFE 1K8AC 1FX7A 1YHQT 4PJMA 1TUCA 1VQ7Q 1I81A 2FYKA 3EAEA 1WX6A 3E19A 3HL8A 3J80E 4ATOA 3OYAA 1M27C 2OAUA 1TWBA 2EIFA 2EQMA 2LP5A 4DEYA 5LJ3f 2H3EB 3JCMf 5GANj 1M1GA 1WJQA 3NGPA 3REAB 3PMIA 1NEGA 5KYYA 2RHYA 2RA2A 2MF2A 2F1LA 2Y90A 1G3WA 2EFIA 1LOJA 4FSSA 3RBBB 3PFSA 1SSHA 2KNBB 3JCMb 5L23A 4AFZC 1PWTA 2DTOA 2L89A 4PJOB 2M51A 2JMCA 4EMKB 4M78A 3UT1A 1ZLMA 4AMCA 4ZGEB 3JCMQ 1QKWA 3FDRA 4WF2A 2DIQA 1TH7A 4IUVA 4HVWA 4BUGA 4C5IA 1RABB 4RTUA 1CKBA 1YI2Q 2K3XA 3MP8A 2AIRB 5FRNA 3G4SA 1UDLA 1VQKQ 1AZGB 4KT0E 1WI7A 3L2VA 1W6XA 2EPDA 2X35A 3EGDA 2DVJA 1ZHIA 2HQXA 4KGVB 4MZTA 2OJ2A 2XDBA 1OX9A 2QTXA 2VGNA 2BIVA 2C0OA 1JO8A 4QQGA 5HCKA 2DJQA 1WA7A 4M7AG 1K8AU 2QXFA 5I22A 2J05A 1VYUA 2QQSA 5KYXA 1QWEA 2O31A 2FPDA 2OI3A 2PTKA 3HTRA 5LJ3j 2RD1A 4Y28E 4ZN3A 2DRKA 3URGA 2PVGB 4BI8B 4X1VA 3P8BB 3CCET 1HJDA 4ZN1A 5GANd 2MWPA 1SG5A 1BBZA 1TG0A 2R57A 3EG1A 4OGEA 4JJNK 1G3TA 4DBFA 4EDUA 4JRIA 2X3XD 1BU1A 1FMWA 4OB2B 1VQ6T 4QVCA 2GTOA 2J06A 2K79A 4F04B 4E7IA 2PVDB 1RUWA 2DM1A 2VUBA 1PD1A 1ACMB 1RLPC 1W4SA 4C5HA 2QEXQ 2E4HA 4KULA 3L2UA 2BE9B 5FU7B 3CCSQ 1T3SA 3JCMP 4HT9A 2DD5A 2KR3A 3VS4A 2DLPA 2PQWA 4IUUA 3VU3C 2EYWA 3EG0A 3VRYA 2AZVA 2AZSA 1PRLC 3PIPA 4BDZA 1HYOA 4M75B 4JPBW 2QA4A 2SEMA 2HAXA 3PIOA 4MDWA 9ATCB 1OPKA 3C4SA 3CD6Q 3CPWS 4N4HA 3META 4FW1A 3JB9J 3EG3A 2DYBA 4Z88A 5GAOr 5DM7R 2YLBA 4OMOA 2GQIA 4FM4B 3CMAT 5KYNA 2D8JA 3RESA 1YFNA 4C8QC 4A4HA 3MPUB 1YJWQ 1BIBA 1WHMA 1OX8A 2KXCA 4ZGDB 2E70A 1Z9QA 2AKKA 5GMKl 2E3IA 4WCIA 4AG1C 4M77E 5LJ3d 5GAMj 3JCMd 1Q86C 1YIJQ 3H0IA 3I55Q 1SHFA 2RQVA 4OB1B 3M58A 1WPYA 1GL5A 3L2RA 2G6FX 2RHUA 1WFWA 4A63B 1YJNA 1Z9ZA 5EC7A 4A4KA 2VKNA 1NPRA 5IHKA 2ESWA 1BCMA 4M75A 1NLOC 1N5ZA 1ZSGA 4M77D 2CSQA 2CP5A 2HKNA 2E5QA 5A2QE 1PKTA 2V26A 2ECZA 5AT1B 1Q82C 1VQOQ 2RHZA 2RMOA 1AWWA 2RPNA 5KYUA 4JJDA 4ZTFA 1AT1B 5GANh 4RG2A 2HKQB 4E7HA 2KRMA 4HT8A 3M53A 4L5GA 2XDPA 1WXBA 3I35A 5HK0A 1RI9A 2C0TA 1RAEB 2RJDA 3EGUA 2RNAA 5C6SA 3NFCA 3X28B 4O6JA 2DAQA 2K5IA 3CQTA 5GJVB 2E64A 1AVZC 2LX9A 2OX7A 1VQPT 2F5TX 2QK0A 1YI2A 4JZ4A 4C8QF 3CMAA 1Q81R 2KVQG 1C1AA 2HL5C 2ZAEA 3R6NA 5L8RE 3CCUA 4LDUA 3CCLT 2HQHA 2YUOA 4C0GA 2X3WD 1ZX6A 3V8KA 1I5LA 1N6AA 3C94A 3I56T 2KYMA 3P8HA 3CCJQ 3GP8A 2RHIA 1OQKA 1OZ2A 4C0ZA 3A8HB 4DBHA 2RQTA 4OVAA 4UC4A 5GMKh 4C0DB 1PM3A 4M7AE 4FYWB 1UUEA 4M7DC 2E1HA 3CC7T 3M4GA 4D8KA 2QYZA 1LNXA 1PSFA 3SD4A 1YITQ 4M78F 4E2FB 5LJ5e 4PL6A 3CCRQ 1BCOA 3PE0A 5CKFA 2JM8A 2DILA 2XD0A 5LJ3h 3P8DA 3JCMh 2EJ9A 3QDRB 4HA8A 3G7ZA 3CCMA 3FIFA 1MMDA 2DYIA 3EG9B 4E7LA 2JN0A 2MI6A 3A98A 2YXYA 4NL2A 2F5KA 1LPLA 3VS1A 2CUDA 3I5RA 2JMAA 1Q81U 4LNPA 3CCSA 3FLGA 2YUQA 4OMMA 3QHSA 4PJOG 1XOVA 2ZPHB 4HCBA 3M0PA 4WTOB 5IXBA 3I56A 2DEUA 1UG1A 2XK0A 3S6WA 4IKFA 3JCMV 4XTUA 2VGMA 2DL4A 2X9HA 2GNCA 3EFRA 4B6MA 3QJ6A 4XAXB 2F69A 3QJYA 1M3BA 1M8MA 2QQBA 3CD6A 4A54A 1K73R 1SHGA 4M7DF 2DD4A 3UWNA 1WNLA 3WVDB 1K9MR 2EGCA 4XTVA 2H3JA 3QYHB 4OP0A 3EG9A 1JXMA 5CR2A 5IH2A 4BACA 3GNGA 1QCOA 4J6XA 1T0HA 1UJ0A 2X4WA 5LJ5g 4XK8E 1OPLA 3QUIA 2A36A 2HMAA 2DETA 1WYXA 2JOYA 2Y4YA 3MO8A 2NUPB 3I55A 3S3MA 5FLXE 1C6VX 4OGCA 3M9QA 1SKUB 1M1FA 1W70A 4RMOA 3JB9D 5HY6A 4XU2A 1QP3A 4DBQA 2F2XA 3EH2A 1WLPB 1VQMA 4NS5A 3BFMA 3QZ5B 3SWNC 4AFUC 3HHTB 3HKSA 3FRNA 1R0CB 2HL3A 3LW5E 3M59A 4D8DA 1ABOA 5A0LA 3UF4A 5IHIA 1NEBA 2YRCA 1FMKA 4F17A 2LNHB 1X01A 3X26B 4R55A 3QG1A 4JJCA 4KUIA 3G4SQ 3RNJA 1Q95G 2E65A 2VXFA 1MMNA 1V29B 1K73U 4LDYA 2FZGB 1YHQQ 1NYGA 2KT1A 4Q5WA 4RCCA 1KC8C 1SRLA 2EWNA 2WACA 2FEIA 2KRSA 3G6ET 1NJIU 3JCMX 1M1KC 5FWBA 1O9SA 1XTDA 4BI4A 2YRVA 2CREA 4QQDA 3VS5A 4C92E 2PUKB 2KK4A 3CMET 1HD3A 2GGRA 3PTAA 1B07A 4F14A 2MYSA 4BB7A 4GLKA 3SDZA 4LN2A 4C92D 1U06A 3OQ5A 1Q7YC 5I2SA 3LGFA 1YWPA 4JLGA 2DL8A 3MCAB 3RR6A 2LT1A 1F1BB 2ED0A 3JCMc 1N9SA 1JEGA 3CBOA 2R58A 2X4JA 3SB2A 2EW3A 1X6GA 1E7OA 1WGSA 5GAN4 4C8QB 4M77C 4E7SA 3CBMA 1KD1R 1WZOA 1S72T 3V8LA 1X43A 3L2QA 2MPXC 5FROA 3GBQA 1U8RA 2XI9A 3CC4T 1O75A 1WQWA 1KG1A 4XU0A 2OTJT 3CC2T 3G6EA 4MZMA 2MCNA 4F7UG 4F16A 1N8RR 2JJ9A 1IZ6A 4AFSC 4JS4A 4PJOE 1TXQA 3CMEA 1VYVA 3WVEB 4CC7A 1WHLA 4M7DD 3OSVA 1MV3A 4A53A 3CCEQ 4M78B 2BZ8A 3CCQT 2I0NA 1N9RA 2CZ7B 4C8QA 1W1FA 1P92A 2MIOA 4X9CA 2C0IA 1K8AR 2RF0A 4JLIA 8AT1B 5D7UA 1YJNQ 1VQ6Q 2DRMA 2E3HA 3OYMA 2XU8A 2V8KA 2LNVA 2CGHA 3M55A 3MEUA 3UA7A 3EGDB 4M77F 2DBKA 3OBYA 2VB6A 2ENMA 2KDSA 1XQHA 4FYYB 1KD1U 2FPFA 4FCYA 5I2MA 3CC4A 3VRZA 4DBRA 2VC8A 1NBEB 2QQAA 2M0OA 3M0RA 4OF1A 2GBQA 4C92A 1UHFA 1FYNA 5CAIA 4M7AC 3OYCA 5KYXB 1MMAA 3OS5A 2L0AA 5I11A 1N8RU 1VQLA 4J83A 2E6NA 3RKYA 5D6XA 2H8HA 3JV3A 3SFMA 4M7DB 3CMAQ 2EGEA 1PHTA 2NUTA 4BY6C 4QVDA 3OYDA 5GAN2 4ZTJA 3CCUQ 3HRTA 1UGQB 1HK9A 1YHQA 1ZUUA 3OYBA 1V76A 5GAN5 5GMKj 1G2BA 2O9VA 1KQSP 4LD6A 2HQEA 1I0CA 3BDUA 3KXTA 4KH0B 4PFPA 2XICA 5GANe 5KYWB 2A37A 2QQRA 4MDXA 2FZKB 2CYZB 1OZ3A 1AEYA 5CK9A 1T0JA 2MWOA 2HNIA 4C5EA 2DZ9A 4QKUA 1AOJA 1YJ9T 2DIGA 4M7DA 5FU6C 3BDLA 3MHXA 1AWOA 1NLPC 4M7AF 3GPLA 2BTTA 1GCQA 3HP9A 2YDLA 4Z89A 3CCMQ 2DF6A 5A0GA 1J3TA 1D1AA 3OY9A 1HSQA 3PVLA 5FW9A 1LVKA 4RTYA 1WJRA 1VQPQ 2V8IA 2K6DA 1VQ7T 1N27A 4HCKA 1EIFA 3C12A 5GAOq 3T9NA 1WJSA 1G5VA 4RG8A 2FPEA 3OS1A 3OYGA 2EYZA 5KYWA 1VQ5T 1PCXA 3CCLQ 2CT4A 1K0SA 3LLRA 2ZPEB 3F70A 1OU9A 4O5VA 2O4XA 1E6HA 2RQRA 1WHJA 1AHJB 3I56Q 2VWFA 1CSKA 1MNEA 4PNOA 4PJLA 4EIKA 4FU6A 5LJ5f 2COYA 2LX7A 1UEBA 5D6WA 3OYIA 1EFNA 4DA4A 5GANg 4F7UE 1VQ4T 5CO7A 2EYXA 5LJ3e 5KYUB 3VV0A 3JCMe 3CC7Q 1U1SA 1D3BB 1VQNT 2JTMA 4ANJA 1VQ9T 1KQSA 3SWNB 4LXCA 1RAGB 1M4ZA 5GMKi 3CCEA 3CXCP 3VS0A 2ZPGB 4QW2A 3J7AF 1OV3A 2JZ2A 3R6OA 3S3NA 1PC0A 2LDMA 2RB6A 3GNFB 2ZGWA 1GRIA 3X25B 3FJPA 1H3ZA 1X6BA 5KE2A 1VQKT 2J6OA 3GIBA 1VQ6A 2OAWA 2CDTA 3NMZC 3JB9H 4A4EA 5GAOl 3JB9F 5KH6A 1VQMQ 5GJWB 1UB4A 5GAOn 2D0NA 1VQ5A 2JW4A 4C92C 3MEVA 3O5ZA 1KIKA 1M90C 1D3BA 2EQJA 3H0HA 4LUDA 3SWNA 3N5BB 3TSWA 3O8VA 1Y71A 2QG9B 2WSEE 4B9XA 2ZPBB 2K5LA 1VQ4A 1TU0B 4A4GA 2LQKA 1VYTA 2O9SA 3JCMg 3C95A 1VQNA 1VQ9A 4CC3A 1I1JA 1GXIE 1W2BP 2VV5A 2ZPFB 1RADB 3QXEB 2CSIA 3UATA 1MV0B 5GMKm 1OULA 3PNWC 5GAMe 3ME9A 2K5FA 3MJXA 1X27A 4FIBA 2QEXT 5CQXA 4M77B 3RMQA 3CXCA 2RQWA 3CEYA 4MMKA 3V8JA 2CP2A 4JRPA 2DEQA 4PJNA 4HCCA 2KT8A 1VUBA 2YWWA 4M78G 1Q86U 2HEQA 4C92F 3FEOA 2ROLA 1AWXA 2DXUA 3A5ZB 1GCQC 1YNZA 2CP6A 3M54A 1K9AA 5IT9E 3VYHB 4M7AD 5AYFA 1LCKA 2DJZA 2F2VA 2LQWA 3QO3A 1X6OA 4NOYA 5HKCA 4FSXA 1ABQA 3A8MB 4L6V5 4FYVB 1Q82U 2HBPA 3H41A 4XTXA 2RJEA 1RAIB 2HZYA 2DL7A 3C0CA 2W10A 3HFOA 3NHNA 1IGQA 1VQPA 3LYIA 5IN1A 3L2WA 1UECA 1JQQA 5FRMA 4M77A 1K0XA 2GFAA 3EH1A 4IUQA 2BZXA 2I2LA 3VS6A 3G6EQ 3CCLA 3OB9A 1QMCA 2VASA 4OB3B 2DE0X 1UGVA 3RDVA 1TUGB 3A8LB 5LJ5d 5GAMg 3ER0A 4N4GA 2XIDA 5GAN6 1Y7XA 2LT4A 2R5AA 3CMEQ 1W2BA 1D0XA 2COWA 5J3BA 1OI1A 1BYMA 2DFUA 4OB0B 2FRYA 2RN8A 5HK3A 4RCBA 4J7IA 2P4TA 3IQLA 2ZCFB 2XHCA 3CC7A 2K2MA 1K9MC 4M7AB 3SHWA 2AHJB 4PFZA 1NJIR 2NWMA 3EGXA 2DNUA 1WQ7A 3PGGA 3U23A 1QVFA 1RI0A 1YP5A 2SRCA 1KQ2A 2K57A 4E47A 2RI2A 4Z02A 4RTXA 2V1QA 4MZPA 2KROA 5FU7C 1FXXA 2RK1A 1DJ7B 2LQ8A 3V7CA 1YBYA 3BE3A 2O2OA 1IGUA 2DO3A 1NM7A 2E5KA 3CC4Q 8ATCB 2AK5A 1C0MA 2OTJQ 4HVVA 3OMGA 3CC2Q 2J7IA 4DEXA 3VKIA 4XU3A 1XNIA 2KEAA 4J5YA 1EZZB 3QWYA 2F2WA 3OSSC 4PK4A 1NG2A 1VQLQ 1QVGA 2K3YA 1A0NB 1UE9A 4HCZA 4M7AA 2DXTA 2PZ1A 2VVKA 2GQVA 3ZBDA 3DLLA 3GF5A 1UTIA 1D0ZA 3M0UA 1WDXA 2QGGA 3INZA 1TS9A 3CCQQ 2C06A 3CCRT 5FU6B 4PJJA 1JJ2A 3RKWA 1TOVA 4XTZA 3EFSA 2IIMA 3NPFA 1H92A 4JRKA 1SSFA 1ZSZC 5LJ5h 3E9FA 4M75G 1IB8A 1KQSS 5J39A 3TU4K 3CPFA 3DLMA 4JDSA 2E6ZA 4DOVA 1VOMA 3E2UA 2RO0A 3TVTA 1VA7A 4BE1A 2E10A 4J9IA 2KE9A 3JCMJ 2CH4W 2KY9A 2GFUA 3UA6A 4J6YA 2NLUA 2J6FA 2PVOB 3GLXA 2JNGA 2M1HA 4QQ6A 1R0BG 3ZL7C 1K1ZA 2JTEA 2CKKA 4M78E 1M30A 2DPPB 2RI5A 3G1JA 1G8XA 2BZYA 4B9WA 4LD9K 5A0DA 4KBMB 2CH4A 4DQ2A 1H8KA 4FL6A 1PSEA 4PFOA 4J9GA 1Q7YR 4E7ZA 4PKCC 1ZA2B 2K2VA 1U5SA 3H9NA 2D8HA 1M2OA 4A4FA 4M4ZA 4ZNXA 3OYFA 2V8JA 2LC4A 1NZ9A 1MUZA 1G3SA 2EKHA 1Y07A 2XG8D 2IVWA 1H641 3VS7A 4IUTA 2AT1B 3D7SB 1RAAB 1KFZA 1RAHB 2DL5A 1KC8U 2FRWA 2LCSA 4N4IA 3UPUA 2DXCA 2CZ6B 3OYKA 2D9TA 4JRQA 4PLIA 1M1KU 2FB7A 2KGTA 3LX7A 4C92B 1CKAA 4PJOD 4LDXA 2KMTA 1D0YA 4F7UF 1Y96B 2B86A 3QDFA 2QAZA 1NE8A 3CXCS 4J9CA 3MP1A 1WXUA 2RK2A 3DKMA 5KE3A 3TREA 1VQ8T 1IXDA 3LH5A 4P5NA 2NUTB 3G71T 2HDAA 1JB0E 4AT1B 3VUZA 4FT4A 4M77G 2J6KA 1Q7YU 2JS0A 2OTLT 4OMNA 4E7JA 2ZPIB 3KFVA 1VQ5Q 3ULRB 2P0PA 1FMVA 4VUBA 1S72A 1QLYA 4R56A 3S3OA 2EGAA 2PUOB 3OS2A 4LDVA 1BI1A 4OMPA 2OTJA 2ROTA 5GAOp 3CC2A 2GTJA 2FO0A 1ZBXA 3M57A 5DLQE 1Y96A 1ZUKA 2X4YA 1K76A 2EYYA 1VQ4Q 4OMQA 3JRZA 3CCVT 1PG5B 3NTHA 1NYFA 4BI3A 4BD3A 2LCLA 1BIAA 1VQNQ 1VQ9Q 1WHHA 3V7RA 1ZBJA 3LGLA 3AT1B 1ZA1B 3J81E 3TEEA 3A8GB 3ZFJA 3E1SA 3CCQA 3A1PA 5CCAA 1W2BS 2L3RA 5GAN8 1VQ8A 3OYJA 3OW2A 3G71A 3ASKA 2W0ZA 2YUNA 3Q1JA 2NUZA 4ELYC 2DMOA 3MKDA 2KAFA 4M75E 2OTLA 1GFDA 4Y92A 2O4XB 1QVFS 2CS7A 4Y91A 3A8OB 4KH1B 2QA4T 4CRIA 1BK2A 4JS5A 5I21A 2GF7A 3RUXA 4M75D 4PJOA 3FB9A 2DVEA 4EMKA 2ZZDA 4J8OA 3MEWA 4XTWA 1E6GA 4DOWA 2JVVA 4ZGJB 3CBPA 1B7TA 2P0QA 2CZ1B 3LWHA 2PNIA 2G3RA 2L3SA 1UHCA 5CKEA 1TSFA 3VYGA 3CCVA 2O01E 5GAMf 3H6ZA 4LUEA 1BKBA 1RL2A 3SEMA 3JAME 2QDLA 2JT4A 1QVGS 2L5QA 3RIRA 2A7YA 2KBTA 2COZA 3EHRA 2LQNA 2FG0A 3HSBA 3LH0A 3JB9I 5CIUA 1WIEA 2LJ1A 5KCOA 2ABLA 1GBRA 1YJNT 5GMKe 4XQ3A 4GBQA 5CKDA 1M2VB 3QZ9B 2EQIA 1YCSB 1IO6A 3H0FA 4ME7A 4KRTA 2A3LA 4J9FA 4RTZA 3OYYA 3THKA 1JJ2S 2LMJA 4LE9A 2NYSA 2R5MA 1M9SA 3HRSA 3QIIA 1PRMC 4Z8AA 3JSCA 1M5Q1 3PT9A 2PU9B 1YJ9A 2MAMA 3M0QA 3NTIA 1I4K1 2IG0A 2QASA 1KQ1A 1TTHB 3VS3A 4FW2A 4XTYA 4JJBA 1QWFA 2ATCB 2CP0A 1XJWB 1KHCA 1YI2T 5D6YA 4JUVA 3M5AA 3HPWA 4IIMA 1M2VA 1BI0A 3CCUT 2BKDN 4EPCA 3JB9G 2DK3A 3QWXX 2YLCA 2A0FB 3KUFA 2Z0WA 1VQ7A 5KCHA 1Q86R 1I8FA 1ZQ1A 3RKXA 5IHNA 2JTFA 2RH2A 2HBWA 1ZSZB 3TQ7P 5GAN3 1M3AA 2DKGA 1HXDA 2KI7A 3EG2A 3PVQA 1BB9A 3OBWA 4ESRA 3VJPA 2DL3A 4BE0A 1FWZA 2FVUA 4ORZA 1Q82R 2RHXA 3X20B 2JXBA 2MMPA 1MGQA 1M90R 3JCMW 1LJOA 3L1AA 1QCNA 3M0TA 2CZ0B 2LRQA 1VIFA 4L59A 4M78C 4C8QG 2RI3A 4PLLA 5LJ3g 5LJ5j 4KGXB 3RERA 1B34B 4F7UB 2YSQA 1QCFA 2DX1A 1Q81C 2VXEA 4CC2A 3M0SA 1RACB 3CCMT 1IREB 1AWJA 4TVRA 5IXFA 2EJGA 3I9QA 3TSZA 1YN8A 1GCPA 3VUBA 1GFCA 1SPKA 1ZSZA 4X34A 2P4RA 7AT1B 4BDYA 1VQKA 3CCST 4FT2A 3OS0A 4J9DA 4BE2A 4RKUE 1SRMA 2VYTA 3QKJA 1QVFP 3L42A 5GAOm 1I5OB 4LDWA 1EX4A 2DA9A 1G3YA 4NL3A
chains in the Genus database with same CATH topology
1UE9A 2K79A 2PZ1A 2VVKA 1RUWA 2DM1A 1RLPC 2ED1A 1PNJA 1W1FA 2MIOA 2XMFA 1UTIA 1T3SA 2C0IA 2LJ0A 4QT7A 3M0UA 3EHQA 1WDXA 2RF0A 2KR3A 2DRMA 3VS4A 2DBMA 2DLPA 2O88A 2EYWA 3EG0A 3UA7A 3VRYA 2AZVA 2AZSA 4HVUA 1PRLC 2DBKA 4RTVA 2IIMA 3NPFA 4JPBW 1H92A 2ENMA 2SEMA 2K7AA 1OPKA 2FPFA 4OMLA 3EG3A 2DYBA 2JS2A 4Z88A 3VRZA 4OMOA 2GQIA 3TVTA 1VA7A 3M0RA 2GBQA 1UHFA 1FYNA 4J9IA 1B3QA 2D8JA 2KE9A 2HSPA 1TUDA 4R0KA 2CH4W 2L0AA 2YUPA 5I11A 3UA6A 2KXCA 1Z9QA 1T3LA 1YWOA 4K11A 2J6FA 2AKKA 2M0YA 1QKXA 4WCIA 2H8HA 3JV3A 4AG1C 4RTWA 4CC4B 3ZL7C 1K1ZA 2JTEA 2EGEA 1PHTA 3H0IA 1SHFA 2RQVA 1M30A 3FJ5A 2BZYA 1GL5A 2G6FX 1WFWA 2CH4A 1ZUUA 2CT3A 4A63B 1Z9ZA 1KJWA 5EC7A 1H8KA 1PKSA 2VKNA 4HXJA 1Y57A 5IHKA 2ESWA 3REBB 1NLOC 1N5ZA 4J9GA 1ZSGA 2CSQA 1G2BA 1JXOA 2O9VA 1PKTA 4GLMA 2ECZA 1Y0MA 1I0CA 1U5SA 2V1RA 2RMOA 5FWCA 1AWWA 2RPNA 4JJDA 2D8HA 2KRMA 1ZUYA 2A37A 2L3QA 4M4ZA 4ZNXA 2L3PA 1WXBA 3I35A 2YT6A 1MUZA 2CUBA 1JU5C 1AEYA 1RI9A 1T0JA 2C0TA 3I5SA 3EGUA 1RLQC 2EKHA 2RNAA 1AOJA 1SEMA 3VS7A 1KFZA 2K3BA 2DL5A 3CQTA 5GJVB 1K4US 1AWOA 1AVZC 1NLPC 2FRWA 2LCSA 2BTTA 4J9BA 4JZ4A 1GCQA 2YDLA 4Z89A 3R6NA 1H3HA 2DF6A 5ECAA 1J3TA 1WXTA 2KGTA 1CKAA 2YUOA 1HSQA 1U3OA 3PVLA 4J9EA 5FW9A 2A08A 1ZX6A 2X3WD 2B86A 4RTYA 2KYMA 2K6DA 4J9CA 4HCKA 1WXUA 2FPEA 2EYZA 2CT4A 1K0SA 3LH5A 2RQTA 2HDAA 1E6HA 2RQRA 4AFQC 2J6KA 1I07A 2JS0A 1UUEA 2VWFA 2D1XA 1CSKA 4OMNA 1X2KA 4D8KA 1UJYA 3KFVA 4EIKA 3ULRB 4RTTA 4E6RA 2LX7A 1QLYA 1EFNA 3PE0A 2EGAA 2DILA 2JM8A 1X2QA 2RQUA 2EYXA 4OMPA 2ROTA 2GTJA 1GBQA 4AG2C 2FO0A 1S1NA 2EVRA 1KSWA 1ZUKA 4J9HA 3A98A 3VS0A 1K76A 2EYYA 1V1CA 4JZ3A 4OMQA 2LZ6B 1ARKA 1OV3A 3VS1A 1NYFA 2CUDA 3I5RA 2JMAA 1GRIA 4LNPA 1ZBJA 1X6BA 2YUQA 4OMMA 2J6OA 1XOVA 2DA9A 2OAWA 2CDTA 3VS2A 1AZEA 1M3CA 3M0PA 1OOTA 3NMZC 5IXBA 1UG1A 2KRNA 2L2PA 5GJWB 2DL4A 1AD5A 2MOXA 2GNCA 2D0NA 2KXDA 2JW4A 1M3BA 1M8MA 3O5ZA 1KIKA 2W0ZA 2YUNA 2NUZA 1SHGA 2DMOA 3H0HA 4LUDA 1GFDA 4Y92A 2EGCA 2KYBA 3TSWA 1JXMA 5IH2A 1T0HA 1UJ0A 1BK2A 1OEBA 1OPLA 2A36A 1VYTA 2O9SA 1WYXA 1E6GA 1I1JA 4CC3A 2AKLA 2A28A 4RUGA 2PNIA 2JM9A 2CSIA 1UHCA 2L3SA 3UATA 1W70A 1MV0B 4IIOA 2HCKA 4LUEA 3SEMA 2F2XA 1WLPB 1X27A 2QDLA 2JT4A 1X69A 1UFFA 1G83A 4AFUC 2KBTA 3EHRA 2LJ3A 2LQNA 2FG0A 4D8DA 1ABOA 2K9GA 2EBPA 2RQWA 3UF4A 2LJ1A 1WIEA 5IHIA 2ABLA 1NEBA 1GBRA 4GBQA 1TUCA 2KT8A 1WX6A 1FMKA 1YCSB 2EQIA 4F17A 1IO6A 3H0FA 2HEQA 2LNHB 4JJCA 4KRTA 4J9FA 4RTZA 2ROLA 1AWXA 1M27C 1GCQC 1YNZA 3RNJA 3THKA 2LP5A 2LMJA 4LE9A 1K9AA 4DEYA 1LCKA 2F2VA 2LQWA 1NYGA 2KT1A 1ABQA 1PRMC 4Z8AA 3NGPA 3H41A 1SRLA 3REAB 2FEIA 2KRSA 1NEGA 3M0QA 2DL7A 3C0CA 2W10A 5FWBA 3VS3A 3NHNA 4FSSA 3RBBB 1SSHA 2KNBB 4JJBA 5L23A 4AFZC 1UECA 1JQQA 1PWTA 1QWFA 2CREA 3VS5A 1K0XA 2M51A 2JMCA 2BZXA 3VS6A 1HD3A 1ZLMA 2GGRA 4IIMA 1QKWA 1B07A 4F14A 2DE0X 1UGVA 3QWXX 4HVWA 4RTUA 4LN2A 1CKBA 1U06A 1YWPA 2DL8A 5IHNA 1UDLA 1AZGB 1WI7A 2HBWA 1W6XA 2ED0A 1M3AA 3PVQA 3EG2A 1BB9A 2FRYA 2EPDA 1JEGA 2RN8A 4ESRA 2DVJA 3IQLA 2DL3A 2EW3A 1X6GA 4ORZA 2OJ2A 1E7OA 2K2MA 2JXBA 3SHWA 2C0OA 1JO8A 5HCKA 2DJQA 1WA7A 3M0TA 2NWMA 3U23A 2DNUA 5I22A 1YP5A 2SRCA 1X43A 2J05A 1VYUA 3GBQA 4RTXA 2V1QA 1QWEA 2O31A 2FPDA 2OI3A 2PTKA 2KROA 2YSQA 1QCFA 2DX1A 2MCNA 4CC2A 3M0SA 2DRKA 4F16A 4AFSC 2O2OA 1AWJA 4X1VA 1NM7A 2E5KA 5IXFA 3I9QA 3TSZA 1HJDA 2AK5A 1YN8A 1GCPA 1GFCA 1SPKA 2P4RA 1BBZA 1TG0A 3EG1A 4HVVA 2J7IA 4DEXA 1VYVA 2KEAA 4CC7A 4J9DA 2X3XD 3QWYA 2F2WA 1SRMA 1BU1A 1MV3A 1NG2A 2BZ8A 2I0NA 2GTOA 2J06A 1A0NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE9 A;  2K79 A;  2PZ1 A;  2VVK A;  1RUW A;  2DM1 A;  1RLP C;  2ED1 A;  1PNJ A;  1W1F A;  2MIO A;  2XMF A;  1UTI A;  1T3S A;  2C0I A;  2LJ0 A;  4QT7 A;  3M0U A;  3EHQ A;  1WDX A;  2RF0 A;  2KR3 A;  2DRM A;  3VS4 A;  2DBM A;  2DLP A;  2O88 A;  2EYW A;  3EG0 A;  3UA7 A;  3VRY A;  2AZV A;  2AZS A;  4HVU A;  1PRL C;  2DBK A;  4RTV A;  2IIM A;  3NPF A;  4JPB W;  1H92 A;  2ENM A;  2SEM A;  2K7A A;  1OPK A;  2FPF A;  4OML A;  3EG3 A;  2DYB A;  2JS2 A;  4Z88 A;  3VRZ A;  4OMO A;  2GQI A;  3TVT A;  1VA7 A;  3M0R A;  2GBQ A;  1UHF A;  1FYN A;  4J9I A;  1B3Q A;  2D8J A;  2KE9 A;  2HSP A;  1TUD A;  4R0K A;  2CH4 W;  2L0A A;  2YUP A;  5I11 A;  3UA6 A;  2KXC A;  1Z9Q A;  1T3L A;  1YWO A;  4K11 A;  2J6F A;  2AKK A;  2M0Y A;  1QKX A;  4WCI A;  2H8H A;  3JV3 A;  4AG1 C;  4RTW A;  4CC4 B;  3ZL7 C;  1K1Z A;  2JTE A;  2EGE A;  1PHT A;  3H0I A;  1SHF A;  2RQV A;  1M30 A;  3FJ5 A;  2BZY A;  1GL5 A;  2G6F X;  1WFW A;  2CH4 A;  1ZUU A;  2CT3 A;  4A63 B;  1Z9Z A;  1KJW A;  5EC7 A;  1H8K A;  1PKS A;  2VKN A;  4HXJ A;  1Y57 A;  5IHK A;  2ESW A;  3REB B;  1NLO C;  1N5Z A;  4J9G A;  1ZSG A;  2CSQ A;  1G2B A;  1JXO A;  2O9V A;  1PKT A;  4GLM A;  2ECZ A;  1Y0M A;  1I0C A;  1U5S A;  2V1R A;  2RMO A;  5FWC A;  1AWW A;  2RPN A;  4JJD A;  2D8H A;  2KRM A;  1ZUY A;  2A37 A;  2L3Q A;  4M4Z A;  4ZNX A;  2L3P A;  1WXB A;  3I35 A;  2YT6 A;  1MUZ A;  2CUB A;  1JU5 C;  1AEY A;  1RI9 A;  1T0J A;  2C0T A;  3I5S A;  3EGU A;  1RLQ C;  2EKH A;  2RNA A;  1AOJ A;  1SEM A;  3VS7 A;  1KFZ A;  2K3B A;  2DL5 A;  3CQT A;  5GJV B;  1K4U S;  1AWO A;  1AVZ C;  1NLP C;  2FRW A;  2LCS A;  2BTT A;  4J9B A;  4JZ4 A;  1GCQ A;  2YDL A;  4Z89 A;  3R6N A;  1H3H A;  2DF6 A;  5ECA A;  1J3T A;  1WXT A;  2KGT A;  1CKA A;  2YUO A;  1HSQ A;  1U3O A;  3PVL A;  4J9E A;  5FW9 A;  2A08 A;  1ZX6 A;  2X3W D;  2B86 A;  4RTY A;  2KYM A;  2K6D A;  4J9C A;  4HCK A;  1WXU A;  2FPE A;  2EYZ A;  2CT4 A;  1K0S A;  3LH5 A;  2RQT A;  2HDA A;  1E6H A;  2RQR A;  4AFQ C;  2J6K A;  1I07 A;  2JS0 A;  1UUE A;  2VWF A;  2D1X A;  1CSK A;  4OMN A;  1X2K A;  4D8K A;  1UJY A;  3KFV A;  4EIK A;  3ULR B;  4RTT A;  4E6R A;  2LX7 A;  1QLY A;  1EFN A;  3PE0 A;  2EGA A;  2DIL A;  2JM8 A;  1X2Q A;  2RQU A;  2EYX A;  4OMP A;  2ROT A;  2GTJ A;  1GBQ A;  4AG2 C;  2FO0 A;  1S1N A;  2EVR A;  1KSW A;  1ZUK A;  4J9H A;  3A98 A;  3VS0 A;  1K76 A;  2EYY A;  1V1C A;  4JZ3 A;  4OMQ A;  2LZ6 B;  1ARK A;  1OV3 A;  3VS1 A;  1NYF A;  2CUD A;  3I5R A;  2JMA A;  1GRI A;  4LNP A;  1ZBJ A;  1X6B A;  2YUQ A;  4OMM A;  2J6O A;  1XOV A;  2DA9 A;  2OAW A;  2CDT A;  3VS2 A;  1AZE A;  1M3C A;  3M0P A;  1OOT A;  3NMZ C;  5IXB A;  1UG1 A;  2KRN A;  2L2P A;  5GJW B;  2DL4 A;  1AD5 A;  2MOX A;  2GNC A;  2D0N A;  2KXD A;  2JW4 A;  1M3B A;  1M8M A;  3O5Z A;  1KIK A;  2W0Z A;  2YUN A;  2NUZ A;  1SHG A;  2DMO A;  3H0H A;  4LUD A;  1GFD A;  4Y92 A;  2EGC A;  2KYB A;  3TSW A;  1JXM A;  5IH2 A;  1T0H A;  1UJ0 A;  1BK2 A;  1OEB A;  1OPL A;  2A36 A;  1VYT A;  2O9S A;  1WYX A;  1E6G A;  1I1J A;  4CC3 A;  2AKL A;  2A28 A;  4RUG A;  2PNI A;  2JM9 A;  2CSI A;  1UHC A;  2L3S A;  3UAT A;  1W70 A;  1MV0 B;  4IIO A;  2HCK A;  4LUE A;  3SEM A;  2F2X A;  1WLP B;  1X27 A;  2QDL A;  2JT4 A;  1X69 A;  1UFF A;  1G83 A;  4AFU C;  2KBT A;  3EHR A;  2LJ3 A;  2LQN A;  2FG0 A;  4D8D A;  1ABO A;  2K9G A;  2EBP A;  2RQW A;  3UF4 A;  2LJ1 A;  1WIE A;  5IHI A;  2ABL A;  1NEB A;  1GBR A;  4GBQ A;  1TUC A;  2KT8 A;  1WX6 A;  1FMK A;  1YCS B;  2EQI A;  4F17 A;  1IO6 A;  3H0F A;  2HEQ A;  2LNH B;  4JJC A;  4KRT A;  4J9F A;  4RTZ A;  2ROL A;  1AWX A;  1M27 C;  1GCQ C;  1YNZ A;  3RNJ A;  3THK A;  2LP5 A;  2LMJ A;  4LE9 A;  1K9A A;  4DEY A;  1LCK A;  2F2V A;  2LQW A;  1NYG A;  2KT1 A;  1ABQ A;  1PRM C;  4Z8A A;  3NGP A;  3H41 A;  1SRL A;  3REA B;  2FEI A;  2KRS A;  1NEG A;  3M0Q A;  2DL7 A;  3C0C A;  2W10 A;  5FWB A;  3VS3 A;  3NHN A;  4FSS A;  3RBB B;  1SSH A;  2KNB B;  4JJB A;  5L23 A;  4AFZ C;  1UEC A;  1JQQ A;  1PWT A;  1QWF A;  2CRE A;  3VS5 A;  1K0X A;  2M51 A;  2JMC A;  2BZX A;  3VS6 A;  1HD3 A;  1ZLM A;  2GGR A;  4IIM A;  1QKW A;  1B07 A;  4F14 A;  2DE0 X;  1UGV A;  3QWX X;  4HVW A;  4RTU A;  4LN2 A;  1CKB A;  1U06 A;  1YWP A;  2DL8 A;  5IHN A;  1UDL A;  1AZG B;  1WI7 A;  2HBW A;  1W6X A;  2ED0 A;  1M3A A;  3PVQ A;  3EG2 A;  1BB9 A;  2FRY A;  2EPD A;  1JEG A;  2RN8 A;  4ESR A;  2DVJ A;  3IQL A;  2DL3 A;  2EW3 A;  1X6G A;  4ORZ A;  2OJ2 A;  1E7O A;  2K2M A;  2JXB A;  3SHW A;  2C0O A;  1JO8 A;  5HCK A;  2DJQ A;  1WA7 A;  3M0T A;  2NWM A;  3U23 A;  2DNU A;  5I22 A;  1YP5 A;  2SRC A;  1X43 A;  2J05 A;  1VYU A;  3GBQ A;  4RTX A;  2V1Q A;  1QWE A;  2O31 A;  2FPD A;  2OI3 A;  2PTK A;  2KRO A;  2YSQ A;  1QCF A;  2DX1 A;  2MCN A;  4CC2 A;  3M0S A;  2DRK A;  4F16 A;  4AFS C;  2O2O A;  1AWJ A;  4X1V A;  1NM7 A;  2E5K A;  5IXF A;  3I9Q A;  3TSZ A;  1HJD A;  2AK5 A;  1YN8 A;  1GCP A;  1GFC A;  1SPK A;  2P4R A;  1BBZ A;  1TG0 A;  3EG1 A;  4HVV A;  2J7I A;  4DEX A;  1VYV A;  2KEA A;  4CC7 A;  4J9D A;  2X3X D;  3QWY A;  2F2W A;  1SRM A;  1BU1 A;  1MV3 A;  1NG2 A;  2BZ8 A;  2I0N A;  2GTO A;  2J06 A;  1A0N B; 
#chains in the Genus database with same CATH topology
 2QTV A;  2RJF A;  4C92 G;  1WHK A;  1RAF B;  2LVM A;  4V2S A;  4PJO C;  2ED1 A;  3LWI A;  1PNJ A;  3EFO B;  4EMK C;  2EJF A;  2XMF A;  4YTL A;  5DLO A;  2LJ0 A;  4QT7 A;  4MML A;  3EHQ A;  3CD6 T;  1B34 A;  4F7U A;  5GAN 7;  2EYQ A;  1IRX A;  2DXB A;  2DBM A;  2M16 A;  2O88 A;  2CP7 A;  4HVU A;  5GAM d;  4RTV A;  4IUR A;  2QQ9 A;  1JRI A;  1M90 U;  1UGR B;  2K7A A;  5M9O A;  1BI2 A;  2P0K A;  4OML A;  2X4X A;  1YJW T;  3RMS A;  1QVG P;  1QVP A;  2JS2 A;  5CVI A;  3EGX B;  2QI2 A;  1B3Q A;  3DB3 A;  1YIJ T;  3I55 T;  3M56 A;  2HSP A;  1D09 B;  2LTO A;  1TUD A;  2E41 A;  4R0K A;  2YUP A;  3UDC A;  1T3L A;  1YWO A;  4K11 A;  3EFO A;  1D1B A;  2M0Y A;  2L8D A;  4EMG A;  1JJ2 P;  1QKX A;  2XDD A;  1SF9 A;  4RTW A;  4CC4 B;  2QEX A;  1MHN A;  2RM4 A;  1VQM T;  4N0A A;  2IPO B;  4ELZ C;  4M7D G;  3FJ5 A;  2M9U A;  1VQO T;  1MMG A;  2EQU A;  2CT3 A;  1KJW A;  2B8A A;  1PKS A;  4HXJ A;  5LL6 S;  1Y57 A;  4PJO F;  2FZC B;  3OW2 S;  3REB B;  1K73 C;  3QBY A;  1JXO A;  4J6W A;  3CPW P;  1R77 A;  4IUP A;  4GLM A;  1Y0M A;  2V1R A;  5FWC A;  3E9G A;  2K4Y A;  1NJI C;  2EQK A;  1ZUY A;  2L3Q A;  2L3P A;  5EG2 A;  2YT6 A;  2CUB A;  1JU5 C;  3OYH A;  4FYX B;  3I5S A;  4HKE A;  2HSE B;  2HD0 A;  3NTK A;  3KBG A;  4BY6 B;  1RLQ C;  4XU1 A;  2MK5 A;  3TCJ A;  2DTH A;  1S72 Q;  1YJW A;  1SEM A;  2RJC A;  1BI3 A;  5IAY A;  3BW1 A;  2K3B A;  1K4U S;  2EAY A;  2BE7 D;  4J9B A;  3CCJ T;  2Y4X A;  1YCY A;  4M75 C;  1YIJ A;  1H3H A;  3OMC A;  5ECA A;  1WXT A;  3MEA A;  2QDY B;  1U3O A;  4J9E A;  2A08 A;  5GAM h;  3HFN A;  1VIE A;  1VQO A;  1YIT T;  1R8O B;  4C5G A;  2FHD A;  3MP6 A;  4AFQ C;  3OYL A;  3OA6 A;  1I07 A;  5CKH A;  2D1X A;  4C8Q E;  1KHI A;  3GOX A;  1MND A;  1X2K A;  1VQ8 Q;  1UJY A;  2EKO A;  1QP2 A;  4RTT A;  4E6R A;  3OYN A;  3G71 Q;  2DER A;  3QPH A;  3PMT A;  2YHT A;  1X2Q A;  2RQU A;  1X75 C;  1KC8 R;  3V7S A;  2NUP A;  2OTL Q;  4J7F A;  4C8Q D;  1IHW A;  1K9M U;  2XKO C;  1GBQ A;  4AG2 C;  1UGP B;  3H8Z A;  3CPW A;  1M1K R;  1S1N A;  2EVR A;  1JBM A;  1OYX A;  1KSW A;  4J9H A;  5CKB A;  2KQW A;  2DTI A;  1QQJ A;  1V1C A;  4JZ3 A;  2LZ6 B;  1ARK A;  2E12 A;  4M75 F;  4C0F A;  2DZC A;  2JUF A;  3CCJ A;  3DB4 A;  3AHU A;  3OYE A;  1NPP A;  3VS2 A;  1D1C A;  1AZE A;  1M3C A;  3CCV Q;  1OOT A;  4E7K A;  3HRU A;  2X51 A;  2KRN A;  5CQY A;  2L2P A;  4M78 D;  6AT1 B;  3BY7 A;  5J26 A;  1AD5 A;  2MOX A;  1YIT A;  2KXD A;  2BUD A;  3WXM B;  2QGF B;  1KK7 A;  2GCX A;  5GAN f;  3CCR A;  4II1 A;  4X9D A;  1KD1 C;  4D6W A;  3M4Y A;  3FC3 A;  4CI0 C;  2WSC E;  2KYB A;  4KGZ B;  1PD0 A;  2D6F A;  4N0A C;  1OEB A;  4C0D C;  2YRD A;  2D0Q B;  1N8R C;  1IHV A;  1M8V A;  4KUD K;  1WHG A;  2KSS A;  2LCC A;  2AKL A;  5DY9 A;  5C0M A;  2QA4 Q;  3OW2 P;  2A28 A;  1UGS B;  4QVZ A;  1YJ9 Q;  4RUG A;  2JM9 A;  3X24 B;  2FL7 A;  4M7D E;  2P84 A;  1VQL T;  4IIO A;  5KYY B;  2HCK A;  4OMF B;  4EMH A;  3QSU A;  3QYG B;  2M02 A;  1X69 A;  1UFF A;  1OU8 A;  4GY5 A;  1G83 A;  3ZEH A;  1U1T A;  2LJ3 A;  2CP3 A;  3G4S T;  2K9G A;  2EBP A;  3L2Z A;  1QW1 A;  2WSF E;  1K8A C;  1FX7 A;  1YHQ T;  4PJM A;  1TUC A;  1VQ7 Q;  1I81 A;  2FYK A;  3EAE A;  1WX6 A;  3E19 A;  3HL8 A;  3J80 E;  4ATO A;  3OYA A;  1M27 C;  2OAU A;  1TWB A;  2EIF A;  2EQM A;  2LP5 A;  4DEY A;  5LJ3 f;  2H3E B;  3JCM f;  5GAN j;  1M1G A;  1WJQ A;  3NGP A;  3REA B;  3PMI A;  1NEG A;  5KYY A;  2RHY A;  2RA2 A;  2MF2 A;  2F1L A;  2Y90 A;  1G3W A;  2EFI A;  1LOJ A;  4FSS A;  3RBB B;  3PFS A;  1SSH A;  2KNB B;  3JCM b;  5L23 A;  4AFZ C;  1PWT A;  2DTO A;  2L89 A;  4PJO B;  2M51 A;  2JMC A;  4EMK B;  4M78 A;  3UT1 A;  1ZLM A;  4AMC A;  4ZGE B;  3JCM Q;  1QKW A;  3FDR A;  4WF2 A;  2DIQ A;  1TH7 A;  4IUV A;  4HVW A;  4BUG A;  4C5I A;  1RAB B;  4RTU A;  1CKB A;  1YI2 Q;  2K3X A;  3MP8 A;  2AIR B;  5FRN A;  3G4S A;  1UDL A;  1VQK Q;  1AZG B;  4KT0 E;  1WI7 A;  3L2V A;  1W6X A;  2EPD A;  2X35 A;  3EGD A;  2DVJ A;  1ZHI A;  2HQX A;  4KGV B;  4MZT A;  2OJ2 A;  2XDB A;  1OX9 A;  2QTX A;  2VGN A;  2BIV A;  2C0O A;  1JO8 A;  4QQG A;  5HCK A;  2DJQ A;  1WA7 A;  4M7A G;  1K8A U;  2QXF A;  5I22 A;  2J05 A;  1VYU A;  2QQS A;  5KYX A;  1QWE A;  2O31 A;  2FPD A;  2OI3 A;  2PTK A;  3HTR A;  5LJ3 j;  2RD1 A;  4Y28 E;  4ZN3 A;  2DRK A;  3URG A;  2PVG B;  4BI8 B;  4X1V A;  3P8B B;  3CCE T;  1HJD A;  4ZN1 A;  5GAN d;  2MWP A;  1SG5 A;  1BBZ A;  1TG0 A;  2R57 A;  3EG1 A;  4OGE A;  4JJN K;  1G3T A;  4DBF A;  4EDU A;  4JRI A;  2X3X D;  1BU1 A;  1FMW A;  4OB2 B;  1VQ6 T;  4QVC A;  2GTO A;  2J06 A;  2K79 A;  4F04 B;  4E7I A;  2PVD B;  1RUW A;  2DM1 A;  2VUB A;  1PD1 A;  1ACM B;  1RLP C;  1W4S A;  4C5H A;  2QEX Q;  2E4H A;  4KUL A;  3L2U A;  2BE9 B;  5FU7 B;  3CCS Q;  1T3S A;  3JCM P;  4HT9 A;  2DD5 A;  2KR3 A;  3VS4 A;  2DLP A;  2PQW A;  4IUU A;  3VU3 C;  2EYW A;  3EG0 A;  3VRY A;  2AZV A;  2AZS A;  1PRL C;  3PIP A;  4BDZ A;  1HYO A;  4M75 B;  4JPB W;  2QA4 A;  2SEM A;  2HAX A;  3PIO A;  4MDW A;  9ATC B;  1OPK A;  3C4S A;  3CD6 Q;  3CPW S;  4N4H A;  3MET A;  4FW1 A;  3JB9 J;  3EG3 A;  2DYB A;  4Z88 A;  5GAO r;  5DM7 R;  2YLB A;  4OMO A;  2GQI A;  4FM4 B;  3CMA T;  5KYN A;  2D8J A;  3RES A;  1YFN A;  4C8Q C;  4A4H A;  3MPU B;  1YJW Q;  1BIB A;  1WHM A;  1OX8 A;  2KXC A;  4ZGD B;  2E70 A;  1Z9Q A;  2AKK A;  5GMK l;  2E3I A;  4WCI A;  4AG1 C;  4M77 E;  5LJ3 d;  5GAM j;  3JCM d;  1Q86 C;  1YIJ Q;  3H0I A;  3I55 Q;  1SHF A;  2RQV A;  4OB1 B;  3M58 A;  1WPY A;  1GL5 A;  3L2R A;  2G6F X;  2RHU A;  1WFW A;  4A63 B;  1YJN A;  1Z9Z A;  5EC7 A;  4A4K A;  2VKN A;  1NPR A;  5IHK A;  2ESW A;  1BCM A;  4M75 A;  1NLO C;  1N5Z A;  1ZSG A;  4M77 D;  2CSQ A;  2CP5 A;  2HKN A;  2E5Q A;  5A2Q E;  1PKT A;  2V26 A;  2ECZ A;  5AT1 B;  1Q82 C;  1VQO Q;  2RHZ A;  2RMO A;  1AWW A;  2RPN A;  5KYU A;  4JJD A;  4ZTF A;  1AT1 B;  5GAN h;  4RG2 A;  2HKQ B;  4E7H A;  2KRM A;  4HT8 A;  3M53 A;  4L5G A;  2XDP A;  1WXB A;  3I35 A;  5HK0 A;  1RI9 A;  2C0T A;  1RAE B;  2RJD A;  3EGU A;  2RNA A;  5C6S A;  3NFC A;  3X28 B;  4O6J A;  2DAQ A;  2K5I A;  3CQT A;  5GJV B;  2E64 A;  1AVZ C;  2LX9 A;  2OX7 A;  1VQP T;  2F5T X;  2QK0 A;  1YI2 A;  4JZ4 A;  4C8Q F;  3CMA A;  1Q81 R;  2KVQ G;  1C1A A;  2HL5 C;  2ZAE A;  3R6N A;  5L8R E;  3CCU A;  4LDU A;  3CCL T;  2HQH A;  2YUO A;  4C0G A;  2X3W D;  1ZX6 A;  3V8K A;  1I5L A;  1N6A A;  3C94 A;  3I56 T;  2KYM A;  3P8H A;  3CCJ Q;  3GP8 A;  2RHI A;  1OQK A;  1OZ2 A;  4C0Z A;  3A8H B;  4DBH A;  2RQT A;  4OVA A;  4UC4 A;  5GMK h;  4C0D B;  1PM3 A;  4M7A E;  4FYW B;  1UUE A;  4M7D C;  2E1H A;  3CC7 T;  3M4G A;  4D8K A;  2QYZ A;  1LNX A;  1PSF A;  3SD4 A;  1YIT Q;  4M78 F;  4E2F B;  5LJ5 e;  4PL6 A;  3CCR Q;  1BCO A;  3PE0 A;  5CKF A;  2JM8 A;  2DIL A;  2XD0 A;  5LJ3 h;  3P8D A;  3JCM h;  2EJ9 A;  3QDR B;  4HA8 A;  3G7Z A;  3CCM A;  3FIF A;  1MMD A;  2DYI A;  3EG9 B;  4E7L A;  2JN0 A;  2MI6 A;  3A98 A;  2YXY A;  4NL2 A;  2F5K A;  1LPL A;  3VS1 A;  2CUD A;  3I5R A;  2JMA A;  1Q81 U;  4LNP A;  3CCS A;  3FLG A;  2YUQ A;  4OMM A;  3QHS A;  4PJO G;  1XOV A;  2ZPH B;  4HCB A;  3M0P A;  4WTO B;  5IXB A;  3I56 A;  2DEU A;  1UG1 A;  2XK0 A;  3S6W A;  4IKF A;  3JCM V;  4XTU A;  2VGM A;  2DL4 A;  2X9H A;  2GNC A;  3EFR A;  4B6M A;  3QJ6 A;  4XAX B;  2F69 A;  3QJY A;  1M3B A;  1M8M A;  2QQB A;  3CD6 A;  4A54 A;  1K73 R;  1SHG A;  4M7D F;  2DD4 A;  3UWN A;  1WNL A;  3WVD B;  1K9M R;  2EGC A;  4XTV A;  2H3J A;  3QYH B;  4OP0 A;  3EG9 A;  1JXM A;  5CR2 A;  5IH2 A;  4BAC A;  3GNG A;  1QCO A;  4J6X A;  1T0H A;  1UJ0 A;  2X4W A;  5LJ5 g;  4XK8 E;  1OPL A;  3QUI A;  2A36 A;  2HMA A;  2DET A;  1WYX A;  2JOY A;  2Y4Y A;  3MO8 A;  2NUP B;  3I55 A;  3S3M A;  5FLX E;  1C6V X;  4OGC A;  3M9Q A;  1SKU B;  1M1F A;  1W70 A;  4RMO A;  3JB9 D;  5HY6 A;  4XU2 A;  1QP3 A;  4DBQ A;  2F2X A;  3EH2 A;  1WLP B;  1VQM A;  4NS5 A;  3BFM A;  3QZ5 B;  3SWN C;  4AFU C;  3HHT B;  3HKS A;  3FRN A;  1R0C B;  2HL3 A;  3LW5 E;  3M59 A;  4D8D A;  1ABO A;  5A0L A;  3UF4 A;  5IHI A;  1NEB A;  2YRC A;  1FMK A;  4F17 A;  2LNH B;  1X01 A;  3X26 B;  4R55 A;  3QG1 A;  4JJC A;  4KUI A;  3G4S Q;  3RNJ A;  1Q95 G;  2E65 A;  2VXF A;  1MMN A;  1V29 B;  1K73 U;  4LDY A;  2FZG B;  1YHQ Q;  1NYG A;  2KT1 A;  4Q5W A;  4RCC A;  1KC8 C;  1SRL A;  2EWN A;  2WAC A;  2FEI A;  2KRS A;  3G6E T;  1NJI U;  3JCM X;  1M1K C;  5FWB A;  1O9S A;  1XTD A;  4BI4 A;  2YRV A;  2CRE A;  4QQD A;  3VS5 A;  4C92 E;  2PUK B;  2KK4 A;  3CME T;  1HD3 A;  2GGR A;  3PTA A;  1B07 A;  4F14 A;  2MYS A;  4BB7 A;  4GLK A;  3SDZ A;  4LN2 A;  4C92 D;  1U06 A;  3OQ5 A;  1Q7Y C;  5I2S A;  3LGF A;  1YWP A;  4JLG A;  2DL8 A;  3MCA B;  3RR6 A;  2LT1 A;  1F1B B;  2ED0 A;  3JCM c;  1N9S A;  1JEG A;  3CBO A;  2R58 A;  2X4J A;  3SB2 A;  2EW3 A;  1X6G A;  1E7O A;  1WGS A;  5GAN 4;  4C8Q B;  4M77 C;  4E7S A;  3CBM A;  1KD1 R;  1WZO A;  1S72 T;  3V8L A;  1X43 A;  3L2Q A;  2MPX C;  5FRO A;  3GBQ A;  1U8R A;  2XI9 A;  3CC4 T;  1O75 A;  1WQW A;  1KG1 A;  4XU0 A;  2OTJ T;  3CC2 T;  3G6E A;  4MZM A;  2MCN A;  4F7U G;  4F16 A;  1N8R R;  2JJ9 A;  1IZ6 A;  4AFS C;  4JS4 A;  4PJO E;  1TXQ A;  3CME A;  1VYV A;  3WVE B;  4CC7 A;  1WHL A;  4M7D D;  3OSV A;  1MV3 A;  4A53 A;  3CCE Q;  4M78 B;  2BZ8 A;  3CCQ T;  2I0N A;  1N9R A;  2CZ7 B;  4C8Q A;  1W1F A;  1P92 A;  2MIO A;  4X9C A;  2C0I A;  1K8A R;  2RF0 A;  4JLI A;  8AT1 B;  5D7U A;  1YJN Q;  1VQ6 Q;  2DRM A;  2E3H A;  3OYM A;  2XU8 A;  2V8K A;  2LNV A;  2CGH A;  3M55 A;  3MEU A;  3UA7 A;  3EGD B;  4M77 F;  2DBK A;  3OBY A;  2VB6 A;  2ENM A;  2KDS A;  1XQH A;  4FYY B;  1KD1 U;  2FPF A;  4FCY A;  5I2M A;  3CC4 A;  3VRZ A;  4DBR A;  2VC8 A;  1NBE B;  2QQA A;  2M0O A;  3M0R A;  4OF1 A;  2GBQ A;  4C92 A;  1UHF A;  1FYN A;  5CAI A;  4M7A C;  3OYC A;  5KYX B;  1MMA A;  3OS5 A;  2L0A A;  5I11 A;  1N8R U;  1VQL A;  4J83 A;  2E6N A;  3RKY A;  5D6X A;  2H8H A;  3JV3 A;  3SFM A;  4M7D B;  3CMA Q;  2EGE A;  1PHT A;  2NUT A;  4BY6 C;  4QVD A;  3OYD A;  5GAN 2;  4ZTJ A;  3CCU Q;  3HRT A;  1UGQ B;  1HK9 A;  1YHQ A;  1ZUU A;  3OYB A;  1V76 A;  5GAN 5;  5GMK j;  1G2B A;  2O9V A;  1KQS P;  4LD6 A;  2HQE A;  1I0C A;  3BDU A;  3KXT A;  4KH0 B;  4PFP A;  2XIC A;  5GAN e;  5KYW B;  2A37 A;  2QQR A;  4MDX A;  2FZK B;  2CYZ B;  1OZ3 A;  1AEY A;  5CK9 A;  1T0J A;  2MWO A;  2HNI A;  4C5E A;  2DZ9 A;  4QKU A;  1AOJ A;  1YJ9 T;  2DIG A;  4M7D A;  5FU6 C;  3BDL A;  3MHX A;  1AWO A;  1NLP C;  4M7A F;  3GPL A;  2BTT A;  1GCQ A;  3HP9 A;  2YDL A;  4Z89 A;  3CCM Q;  2DF6 A;  5A0G A;  1J3T A;  1D1A A;  3OY9 A;  1HSQ A;  3PVL A;  5FW9 A;  1LVK A;  4RTY A;  1WJR A;  1VQP Q;  2V8I A;  2K6D A;  1VQ7 T;  1N27 A;  4HCK A;  1EIF A;  3C12 A;  5GAO q;  3T9N A;  1WJS A;  1G5V A;  4RG8 A;  2FPE A;  3OS1 A;  3OYG A;  2EYZ A;  5KYW A;  1VQ5 T;  1PCX A;  3CCL Q;  2CT4 A;  1K0S A;  3LLR A;  2ZPE B;  3F70 A;  1OU9 A;  4O5V A;  2O4X A;  1E6H A;  2RQR A;  1WHJ A;  1AHJ B;  3I56 Q;  2VWF A;  1CSK A;  1MNE A;  4PNO A;  4PJL A;  4EIK A;  4FU6 A;  5LJ5 f;  2COY A;  2LX7 A;  1UEB A;  5D6W A;  3OYI A;  1EFN A;  4DA4 A;  5GAN g;  4F7U E;  1VQ4 T;  5CO7 A;  2EYX A;  5LJ3 e;  5KYU B;  3VV0 A;  3JCM e;  3CC7 Q;  1U1S A;  1D3B B;  1VQN T;  2JTM A;  4ANJ A;  1VQ9 T;  1KQS A;  3SWN B;  4LXC A;  1RAG B;  1M4Z A;  5GMK i;  3CCE A;  3CXC P;  3VS0 A;  2ZPG B;  4QW2 A;  3J7A F;  1OV3 A;  2JZ2 A;  3R6O A;  3S3N A;  1PC0 A;  2LDM A;  2RB6 A;  3GNF B;  2ZGW A;  1GRI A;  3X25 B;  3FJP A;  1H3Z A;  1X6B A;  5KE2 A;  1VQK T;  2J6O A;  3GIB A;  1VQ6 A;  2OAW A;  2CDT A;  3NMZ C;  3JB9 H;  4A4E A;  5GAO l;  3JB9 F;  5KH6 A;  1VQM Q;  5GJW B;  1UB4 A;  5GAO n;  2D0N A;  1VQ5 A;  2JW4 A;  4C92 C;  3MEV A;  3O5Z A;  1KIK A;  1M90 C;  1D3B A;  2EQJ A;  3H0H A;  4LUD A;  3SWN A;  3N5B B;  3TSW A;  3O8V A;  1Y71 A;  2QG9 B;  2WSE E;  4B9X A;  2ZPB B;  2K5L A;  1VQ4 A;  1TU0 B;  4A4G A;  2LQK A;  1VYT A;  2O9S A;  3JCM g;  3C95 A;  1VQN A;  1VQ9 A;  4CC3 A;  1I1J A;  1GXI E;  1W2B P;  2VV5 A;  2ZPF B;  1RAD B;  3QXE B;  2CSI A;  3UAT A;  1MV0 B;  5GMK m;  1OUL A;  3PNW C;  5GAM e;  3ME9 A;  2K5F A;  3MJX A;  1X27 A;  4FIB A;  2QEX T;  5CQX A;  4M77 B;  3RMQ A;  3CXC A;  2RQW A;  3CEY A;  4MMK A;  3V8J A;  2CP2 A;  4JRP A;  2DEQ A;  4PJN A;  4HCC A;  2KT8 A;  1VUB A;  2YWW A;  4M78 G;  1Q86 U;  2HEQ A;  4C92 F;  3FEO A;  2ROL A;  1AWX A;  2DXU A;  3A5Z B;  1GCQ C;  1YNZ A;  2CP6 A;  3M54 A;  1K9A A;  5IT9 E;  3VYH B;  4M7A D;  5AYF A;  1LCK A;  2DJZ A;  2F2V A;  2LQW A;  3QO3 A;  1X6O A;  4NOY A;  5HKC A;  4FSX A;  1ABQ A;  3A8M B;  4L6V 5;  4FYV B;  1Q82 U;  2HBP A;  3H41 A;  4XTX A;  2RJE A;  1RAI B;  2HZY A;  2DL7 A;  3C0C A;  2W10 A;  3HFO A;  3NHN A;  1IGQ A;  1VQP A;  3LYI A;  5IN1 A;  3L2W A;  1UEC A;  1JQQ A;  5FRM A;  4M77 A;  1K0X A;  2GFA A;  3EH1 A;  4IUQ A;  2BZX A;  2I2L A;  3VS6 A;  3G6E Q;  3CCL A;  3OB9 A;  1QMC A;  2VAS A;  4OB3 B;  2DE0 X;  1UGV A;  3RDV A;  1TUG B;  3A8L B;  5LJ5 d;  5GAM g;  3ER0 A;  4N4G A;  2XID A;  5GAN 6;  1Y7X A;  2LT4 A;  2R5A A;  3CME Q;  1W2B A;  1D0X A;  2COW A;  5J3B A;  1OI1 A;  1BYM A;  2DFU A;  4OB0 B;  2FRY A;  2RN8 A;  5HK3 A;  4RCB A;  4J7I A;  2P4T A;  3IQL A;  2ZCF B;  2XHC A;  3CC7 A;  2K2M A;  1K9M C;  4M7A B;  3SHW A;  2AHJ B;  4PFZ A;  1NJI R;  2NWM A;  3EGX A;  2DNU A;  1WQ7 A;  3PGG A;  3U23 A;  1QVF A;  1RI0 A;  1YP5 A;  2SRC A;  1KQ2 A;  2K57 A;  4E47 A;  2RI2 A;  4Z02 A;  4RTX A;  2V1Q A;  4MZP A;  2KRO A;  5FU7 C;  1FXX A;  2RK1 A;  1DJ7 B;  2LQ8 A;  3V7C A;  1YBY A;  3BE3 A;  2O2O A;  1IGU A;  2DO3 A;  1NM7 A;  2E5K A;  3CC4 Q;  8ATC B;  2AK5 A;  1C0M A;  2OTJ Q;  4HVV A;  3OMG A;  3CC2 Q;  2J7I A;  4DEX A;  3VKI A;  4XU3 A;  1XNI A;  2KEA A;  4J5Y A;  1EZZ B;  3QWY A;  2F2W A;  3OSS C;  4PK4 A;  1NG2 A;  1VQL Q;  1QVG A;  2K3Y A;  1A0N B;  1UE9 A;  4HCZ A;  4M7A A;  2DXT A;  2PZ1 A;  2VVK A;  2GQV A;  3ZBD A;  3DLL A;  3GF5 A;  1UTI A;  1D0Z A;  3M0U A;  1WDX A;  2QGG A;  3INZ A;  1TS9 A;  3CCQ Q;  2C06 A;  3CCR T;  5FU6 B;  4PJJ A;  1JJ2 A;  3RKW A;  1TOV A;  4XTZ A;  3EFS A;  2IIM A;  3NPF A;  1H92 A;  4JRK A;  1SSF A;  1ZSZ C;  5LJ5 h;  3E9F A;  4M75 G;  1IB8 A;  1KQS S;  5J39 A;  3TU4 K;  3CPF A;  3DLM A;  4JDS A;  2E6Z A;  4DOV A;  1VOM A;  3E2U A;  2RO0 A;  3TVT A;  1VA7 A;  4BE1 A;  2E10 A;  4J9I A;  2KE9 A;  3JCM J;  2CH4 W;  2KY9 A;  2GFU A;  3UA6 A;  4J6Y A;  2NLU A;  2J6F A;  2PVO B;  3GLX A;  2JNG A;  2M1H A;  4QQ6 A;  1R0B G;  3ZL7 C;  1K1Z A;  2JTE A;  2CKK A;  4M78 E;  1M30 A;  2DPP B;  2RI5 A;  3G1J A;  1G8X A;  2BZY A;  4B9W A;  4LD9 K;  5A0D A;  4KBM B;  2CH4 A;  4DQ2 A;  1H8K A;  4FL6 A;  1PSE A;  4PFO A;  4J9G A;  1Q7Y R;  4E7Z A;  4PKC C;  1ZA2 B;  2K2V A;  1U5S A;  3H9N A;  2D8H A;  1M2O A;  4A4F A;  4M4Z A;  4ZNX A;  3OYF A;  2V8J A;  2LC4 A;  1NZ9 A;  1MUZ A;  1G3S A;  2EKH A;  1Y07 A;  2XG8 D;  2IVW A;  1H64 1;  3VS7 A;  4IUT A;  2AT1 B;  3D7S B;  1RAA B;  1KFZ A;  1RAH B;  2DL5 A;  1KC8 U;  2FRW A;  2LCS A;  4N4I A;  3UPU A;  2DXC A;  2CZ6 B;  3OYK A;  2D9T A;  4JRQ A;  4PLI A;  1M1K U;  2FB7 A;  2KGT A;  3LX7 A;  4C92 B;  1CKA A;  4PJO D;  4LDX A;  2KMT A;  1D0Y A;  4F7U F;  1Y96 B;  2B86 A;  3QDF A;  2QAZ A;  1NE8 A;  3CXC S;  4J9C A;  3MP1 A;  1WXU A;  2RK2 A;  3DKM A;  5KE3 A;  3TRE A;  1VQ8 T;  1IXD A;  3LH5 A;  4P5N A;  2NUT B;  3G71 T;  2HDA A;  1JB0 E;  4AT1 B;  3VUZ A;  4FT4 A;  4M77 G;  2J6K A;  1Q7Y U;  2JS0 A;  2OTL T;  4OMN A;  4E7J A;  2ZPI B;  3KFV A;  1VQ5 Q;  3ULR B;  2P0P A;  1FMV A;  4VUB A;  1S72 A;  1QLY A;  4R56 A;  3S3O A;  2EGA A;  2PUO B;  3OS2 A;  4LDV A;  1BI1 A;  4OMP A;  2OTJ A;  2ROT A;  5GAO p;  3CC2 A;  2GTJ A;  2FO0 A;  1ZBX A;  3M57 A;  5DLQ E;  1Y96 A;  1ZUK A;  2X4Y A;  1K76 A;  2EYY A;  1VQ4 Q;  4OMQ A;  3JRZ A;  3CCV T;  1PG5 B;  3NTH A;  1NYF A;  4BI3 A;  4BD3 A;  2LCL A;  1BIA A;  1VQN Q;  1VQ9 Q;  1WHH A;  3V7R A;  1ZBJ A;  3LGL A;  3AT1 B;  1ZA1 B;  3J81 E;  3TEE A;  3A8G B;  3ZFJ A;  3E1S A;  3CCQ A;  3A1P A;  5CCA A;  1W2B S;  2L3R A;  5GAN 8;  1VQ8 A;  3OYJ A;  3OW2 A;  3G71 A;  3ASK A;  2W0Z A;  2YUN A;  3Q1J A;  2NUZ A;  4ELY C;  2DMO A;  3MKD A;  2KAF A;  4M75 E;  2OTL A;  1GFD A;  4Y92 A;  2O4X B;  1QVF S;  2CS7 A;  4Y91 A;  3A8O B;  4KH1 B;  2QA4 T;  4CRI A;  1BK2 A;  4JS5 A;  5I21 A;  2GF7 A;  3RUX A;  4M75 D;  4PJO A;  3FB9 A;  2DVE A;  4EMK A;  2ZZD A;  4J8O A;  3MEW A;  4XTW A;  1E6G A;  4DOW A;  2JVV A;  4ZGJ B;  3CBP A;  1B7T A;  2P0Q A;  2CZ1 B;  3LWH A;  2PNI A;  2G3R A;  2L3S A;  1UHC A;  5CKE A;  1TSF A;  3VYG A;  3CCV A;  2O01 E;  5GAM f;  3H6Z A;  4LUE A;  1BKB A;  1RL2 A;  3SEM A;  3JAM E;  2QDL A;  2JT4 A;  1QVG S;  2L5Q A;  3RIR A;  2A7Y A;  2KBT A;  2COZ A;  3EHR A;  2LQN A;  2FG0 A;  3HSB A;  3LH0 A;  3JB9 I;  5CIU A;  1WIE A;  2LJ1 A;  5KCO A;  2ABL A;  1GBR A;  1YJN T;  5GMK e;  4XQ3 A;  4GBQ A;  5CKD A;  1M2V B;  3QZ9 B;  2EQI A;  1YCS B;  1IO6 A;  3H0F A;  4ME7 A;  4KRT A;  2A3L A;  4J9F A;  4RTZ A;  3OYY A;  3THK A;  1JJ2 S;  2LMJ A;  4LE9 A;  2NYS A;  2R5M A;  1M9S A;  3HRS A;  3QII A;  1PRM C;  4Z8A A;  3JSC A;  1M5Q 1;  3PT9 A;  2PU9 B;  1YJ9 A;  2MAM A;  3M0Q A;  3NTI A;  1I4K 1;  2IG0 A;  2QAS A;  1KQ1 A;  1TTH B;  3VS3 A;  4FW2 A;  4XTY A;  4JJB A;  1QWF A;  2ATC B;  2CP0 A;  1XJW B;  1KHC A;  1YI2 T;  5D6Y A;  4JUV A;  3M5A A;  3HPW A;  4IIM A;  1M2V A;  1BI0 A;  3CCU T;  2BKD N;  4EPC A;  3JB9 G;  2DK3 A;  3QWX X;  2YLC A;  2A0F B;  3KUF A;  2Z0W A;  1VQ7 A;  5KCH A;  1Q86 R;  1I8F A;  1ZQ1 A;  3RKX A;  5IHN A;  2JTF A;  2RH2 A;  2HBW A;  1ZSZ B;  3TQ7 P;  5GAN 3;  1M3A A;  2DKG A;  1HXD A;  2KI7 A;  3EG2 A;  3PVQ A;  1BB9 A;  3OBW A;  4ESR A;  3VJP A;  2DL3 A;  4BE0 A;  1FWZ A;  2FVU A;  4ORZ A;  1Q82 R;  2RHX A;  3X20 B;  2JXB A;  2MMP A;  1MGQ A;  1M90 R;  3JCM W;  1LJO A;  3L1A A;  1QCN A;  3M0T A;  2CZ0 B;  2LRQ A;  1VIF A;  4L59 A;  4M78 C;  4C8Q G;  2RI3 A;  4PLL A;  5LJ3 g;  5LJ5 j;  4KGX B;  3RER A;  1B34 B;  4F7U B;  2YSQ A;  1QCF A;  2DX1 A;  1Q81 C;  2VXE A;  4CC2 A;  3M0S A;  1RAC B;  3CCM T;  1IRE B;  1AWJ A;  4TVR A;  5IXF A;  2EJG A;  3I9Q A;  3TSZ A;  1YN8 A;  1GCP A;  3VUB A;  1GFC A;  1SPK A;  1ZSZ A;  4X34 A;  2P4R A;  7AT1 B;  4BDY A;  1VQK A;  3CCS T;  4FT2 A;  3OS0 A;  4J9D A;  4BE2 A;  4RKU E;  1SRM A;  2VYT A;  3QKJ A;  1QVF P;  3L42 A;  5GAO m;  1I5O B;  4LDW A;  1EX4 A;  2DA9 A;  1G3Y A;  4NL3 A; 
#chains in the Genus database with same CATH homology
 1UE9 A;  2K79 A;  2PZ1 A;  2VVK A;  1RUW A;  2DM1 A;  1RLP C;  2ED1 A;  1PNJ A;  1W1F A;  2MIO A;  2XMF A;  1UTI A;  1T3S A;  2C0I A;  2LJ0 A;  4QT7 A;  3M0U A;  3EHQ A;  1WDX A;  2RF0 A;  2KR3 A;  2DRM A;  3VS4 A;  2DBM A;  2DLP A;  2O88 A;  2EYW A;  3EG0 A;  3UA7 A;  3VRY A;  2AZV A;  2AZS A;  4HVU A;  1PRL C;  2DBK A;  4RTV A;  2IIM A;  3NPF A;  4JPB W;  1H92 A;  2ENM A;  2SEM A;  2K7A A;  1OPK A;  2FPF A;  4OML A;  3EG3 A;  2DYB A;  2JS2 A;  4Z88 A;  3VRZ A;  4OMO A;  2GQI A;  3TVT A;  1VA7 A;  3M0R A;  2GBQ A;  1UHF A;  1FYN A;  4J9I A;  1B3Q A;  2D8J A;  2KE9 A;  2HSP A;  1TUD A;  4R0K A;  2CH4 W;  2L0A A;  2YUP A;  5I11 A;  3UA6 A;  2KXC A;  1Z9Q A;  1T3L A;  1YWO A;  4K11 A;  2J6F A;  2AKK A;  2M0Y A;  1QKX A;  4WCI A;  2H8H A;  3JV3 A;  4AG1 C;  4RTW A;  4CC4 B;  3ZL7 C;  1K1Z A;  2JTE A;  2EGE A;  1PHT A;  3H0I A;  1SHF A;  2RQV A;  1M30 A;  3FJ5 A;  2BZY A;  1GL5 A;  2G6F X;  1WFW A;  2CH4 A;  1ZUU A;  2CT3 A;  4A63 B;  1Z9Z A;  1KJW A;  5EC7 A;  1H8K A;  1PKS A;  2VKN A;  4HXJ A;  1Y57 A;  5IHK A;  2ESW A;  3REB B;  1NLO C;  1N5Z A;  4J9G A;  1ZSG A;  2CSQ A;  1G2B A;  1JXO A;  2O9V A;  1PKT A;  4GLM A;  2ECZ A;  1Y0M A;  1I0C A;  1U5S A;  2V1R A;  2RMO A;  5FWC A;  1AWW A;  2RPN A;  4JJD A;  2D8H A;  2KRM A;  1ZUY A;  2A37 A;  2L3Q A;  4M4Z A;  4ZNX A;  2L3P A;  1WXB A;  3I35 A;  2YT6 A;  1MUZ A;  2CUB A;  1JU5 C;  1AEY A;  1RI9 A;  1T0J A;  2C0T A;  3I5S A;  3EGU A;  1RLQ C;  2EKH A;  2RNA A;  1AOJ A;  1SEM A;  3VS7 A;  1KFZ A;  2K3B A;  2DL5 A;  3CQT A;  5GJV B;  1K4U S;  1AWO A;  1AVZ C;  1NLP C;  2FRW A;  2LCS A;  2BTT A;  4J9B A;  4JZ4 A;  1GCQ A;  2YDL A;  4Z89 A;  3R6N A;  1H3H A;  2DF6 A;  5ECA A;  1J3T A;  1WXT A;  2KGT A;  1CKA A;  2YUO A;  1HSQ A;  1U3O A;  3PVL A;  4J9E A;  5FW9 A;  2A08 A;  1ZX6 A;  2X3W D;  2B86 A;  4RTY A;  2KYM A;  2K6D A;  4J9C A;  4HCK A;  1WXU A;  2FPE A;  2EYZ A;  2CT4 A;  1K0S A;  3LH5 A;  2RQT A;  2HDA A;  1E6H A;  2RQR A;  4AFQ C;  2J6K A;  1I07 A;  2JS0 A;  1UUE A;  2VWF A;  2D1X A;  1CSK A;  4OMN A;  1X2K A;  4D8K A;  1UJY A;  3KFV A;  4EIK A;  3ULR B;  4RTT A;  4E6R A;  2LX7 A;  1QLY A;  1EFN A;  3PE0 A;  2EGA A;  2DIL A;  2JM8 A;  1X2Q A;  2RQU A;  2EYX A;  4OMP A;  2ROT A;  2GTJ A;  1GBQ A;  4AG2 C;  2FO0 A;  1S1N A;  2EVR A;  1KSW A;  1ZUK A;  4J9H A;  3A98 A;  3VS0 A;  1K76 A;  2EYY A;  1V1C A;  4JZ3 A;  4OMQ A;  2LZ6 B;  1ARK A;  1OV3 A;  3VS1 A;  1NYF A;  2CUD A;  3I5R A;  2JMA A;  1GRI A;  4LNP A;  1ZBJ A;  1X6B A;  2YUQ A;  4OMM A;  2J6O A;  1XOV A;  2DA9 A;  2OAW A;  2CDT A;  3VS2 A;  1AZE A;  1M3C A;  3M0P A;  1OOT A;  3NMZ C;  5IXB A;  1UG1 A;  2KRN A;  2L2P A;  5GJW B;  2DL4 A;  1AD5 A;  2MOX A;  2GNC A;  2D0N A;  2KXD A;  2JW4 A;  1M3B A;  1M8M A;  3O5Z A;  1KIK A;  2W0Z A;  2YUN A;  2NUZ A;  1SHG A;  2DMO A;  3H0H A;  4LUD A;  1GFD A;  4Y92 A;  2EGC A;  2KYB A;  3TSW A;  1JXM A;  5IH2 A;  1T0H A;  1UJ0 A;  1BK2 A;  1OEB A;  1OPL A;  2A36 A;  1VYT A;  2O9S A;  1WYX A;  1E6G A;  1I1J A;  4CC3 A;  2AKL A;  2A28 A;  4RUG A;  2PNI A;  2JM9 A;  2CSI A;  1UHC A;  2L3S A;  3UAT A;  1W70 A;  1MV0 B;  4IIO A;  2HCK A;  4LUE A;  3SEM A;  2F2X A;  1WLP B;  1X27 A;  2QDL A;  2JT4 A;  1X69 A;  1UFF A;  1G83 A;  4AFU C;  2KBT A;  3EHR A;  2LJ3 A;  2LQN A;  2FG0 A;  4D8D A;  1ABO A;  2K9G A;  2EBP A;  2RQW A;  3UF4 A;  2LJ1 A;  1WIE A;  5IHI A;  2ABL A;  1NEB A;  1GBR A;  4GBQ A;  1TUC A;  2KT8 A;  1WX6 A;  1FMK A;  1YCS B;  2EQI A;  4F17 A;  1IO6 A;  3H0F A;  2HEQ A;  2LNH B;  4JJC A;  4KRT A;  4J9F A;  4RTZ A;  2ROL A;  1AWX A;  1M27 C;  1GCQ C;  1YNZ A;  3RNJ A;  3THK A;  2LP5 A;  2LMJ A;  4LE9 A;  1K9A A;  4DEY A;  1LCK A;  2F2V A;  2LQW A;  1NYG A;  2KT1 A;  1ABQ A;  1PRM C;  4Z8A A;  3NGP A;  3H41 A;  1SRL A;  3REA B;  2FEI A;  2KRS A;  1NEG A;  3M0Q A;  2DL7 A;  3C0C A;  2W10 A;  5FWB A;  3VS3 A;  3NHN A;  4FSS A;  3RBB B;  1SSH A;  2KNB B;  4JJB A;  5L23 A;  4AFZ C;  1UEC A;  1JQQ A;  1PWT A;  1QWF A;  2CRE A;  3VS5 A;  1K0X A;  2M51 A;  2JMC A;  2BZX A;  3VS6 A;  1HD3 A;  1ZLM A;  2GGR A;  4IIM A;  1QKW A;  1B07 A;  4F14 A;  2DE0 X;  1UGV A;  3QWX X;  4HVW A;  4RTU A;  4LN2 A;  1CKB A;  1U06 A;  1YWP A;  2DL8 A;  5IHN A;  1UDL A;  1AZG B;  1WI7 A;  2HBW A;  1W6X A;  2ED0 A;  1M3A A;  3PVQ A;  3EG2 A;  1BB9 A;  2FRY A;  2EPD A;  1JEG A;  2RN8 A;  4ESR A;  2DVJ A;  3IQL A;  2DL3 A;  2EW3 A;  1X6G A;  4ORZ A;  2OJ2 A;  1E7O A;  2K2M A;  2JXB A;  3SHW A;  2C0O A;  1JO8 A;  5HCK A;  2DJQ A;  1WA7 A;  3M0T A;  2NWM A;  3U23 A;  2DNU A;  5I22 A;  1YP5 A;  2SRC A;  1X43 A;  2J05 A;  1VYU A;  3GBQ A;  4RTX A;  2V1Q A;  1QWE A;  2O31 A;  2FPD A;  2OI3 A;  2PTK A;  2KRO A;  2YSQ A;  1QCF A;  2DX1 A;  2MCN A;  4CC2 A;  3M0S A;  2DRK A;  4F16 A;  4AFS C;  2O2O A;  1AWJ A;  4X1V A;  1NM7 A;  2E5K A;  5IXF A;  3I9Q A;  3TSZ A;  1HJD A;  2AK5 A;  1YN8 A;  1GCP A;  1GFC A;  1SPK A;  2P4R A;  1BBZ A;  1TG0 A;  3EG1 A;  4HVV A;  2J7I A;  4DEX A;  1VYV A;  2KEA A;  4CC7 A;  4J9D A;  2X3X D;  3QWY A;  2F2W A;  1SRM A;  1BU1 A;  1MV3 A;  1NG2 A;  2BZ8 A;  2I0N A;  2GTO A;  2J06 A;  1A0N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...