1Z9QA

Solution structure of sh3 domain of p40phox
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
66
structure length
66
Chain Sequence
b'DRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 4
molecule tags Oxidoreductase activator
source organism Homo sapiens
publication title Solution structure of SH3 domain of p40phox
rcsb
total genus 7
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1z9qA00
4J9DA 2FG0A 2V1RA 2ROLA 4KRTA 2A28A 1AD5A 1IO6A 5GJWB 2L3PA 1T3LA 4J9BA 1U5SA 4D8DA 2KYMA 3UA6A 1WIEA 2LZ6B 1GFCA 2G6FX 2DILA 4Y92A 3UA7A 2LP5A 4Z88A 2A37A 2CUDA 2NUZA 3JV3A 2JM9A 2D1XA 2KT1A 2JTEA 1ZX6A 2RQWA 3REBB 3VS4A 4JPBW 1PNJA 3UATA 1PKTA 2EGEA 1WX6A 4J9EA 2CH4A 3VS7A 1AWWA 1RLQC 2NWMA 4K11A 4F16A 1AEYA 4D8KA 1B07A 2YUPA 2YUNA 2KE9A 1RI9A 1QKXA 2EBPA 3ZL7C 1U3OA 2KT8A 3H41A 2C0IA 1YCSB 4AFQC 2DYBA 2K9GA 4HXJA 1A0NB 1NM7A 2X3WD 2YT6A 2J06A 1GL5A 3VS2A 3H0HA 5ECAA 5FWBA 2GNCA 2DNUA 2RNAA 1LCKA 4QT7A 1QWFA 4RUGA 4WCIA 4ZNXA 2CH4W 1UHFA 4AG1C 2DM1A 2BZXA 4OMNA 1JXOA 3EHRA 4LUDA 2DMOA 1FMKA 2DA9A 2JMCA 1SSHA 2M51A 2EYWA 2DL3A 1BBZA 2DX1A 1ZLMA 5IXFA 2OI3A 2LQNA 2YUQA 1OV3A 1W70A 2RN8A 2ESWA 2EGCA 3NHNA 2JM8A 3R6NA 1I1JA 1OOTA 4J9HA 1HJDA 1ARKA 1WXTA 5L23A 1HSQA 2RQRA 5IHIA 2JXBA 2RQUA 3TVTA 5IH2A 1CSKA 2P4RA 1SEMA 2YDLA 1NEBA 3GBQA 1JO8A 4LE9A 2K6DA 4X1VA 2D0NA 5IHKA 5EC7A 1KIKA 2CT4A 4RTWA 2RPNA 5IHNA 1K1ZA 1WLPB 1H92A 2J7IA 3ULRB 2J6FA 1UECA 1X2QA 2SRCA 3SEMA 1SPKA 2DRMA 2EYYA 2LCSA 1V1CA 3RBBB 4CC2A 2F2VA 4CC4B 1WYXA 4E6RA 1I0CA 3EG1A 4JZ3A 1YP5A 1QCFA 1OPKA 2KRNA 4GBQA 2LJ0A 1K4US 2J6KA 1NYFA 1ZSGA 1K0SA 2O88A 2F2XA 2YUOA 2QDLA 1NEGA 1ZUKA 2DJQA 2A36A 4JJDA 1SRLA 2EYXA 2ED1A 1MUZA 2V1QA 2DL8A 1NG2A 1TUCA 4R0KA 1Z9ZA 5I11A 2EGAA 2DL4A 2LMJA 1NYGA 3H0FA 1G2BA 1UDLA 4GLMA 1UJYA 3I35A 1Z9QA 3LH5A 2E5KA 3VS0A 1UE9A 4CC7A 4HVWA 4J9CA 2CT3A 3O5ZA 1VYUA 3TSWA 2X3XD 2LQWA 3VRZA 1X2KA 2J6OA 2RMOA 2AZVA 4RTVA 3CQTA 2CSIA 2CREA 2OJ2A 1VA7A 3M0RA 2CUBA 3I9QA 5FWCA 2JS2A 1T3SA 4F14A 1YWOA 1X6BA 3SHWA 5I22A 4RTUA 5GJVB 3EHQA 2CSQA 4AFZC 3EG0A 1VYVA 1ABQA 2C0TA 1PKSA 4JJCA 2RQVA 3M0TA 2VKNA 1X43A 1WXBA 2DL5A 1Y0MA 1FYNA 4AG2C 2YSQA 1BK2A 2EKHA 2KEAA 1S1NA 1KSWA 1WI7A 2C0OA 1EFNA 1NLPC 4OMPA 4AFSC 2LNHB 1K9AA 3C0CA 2AKKA 2W0ZA 1UFFA 1BB9A 2GTOA 2JS0A 2ABLA 2KBTA 2OAWA 2EPDA 2KROA 2HDAA 3REAB 2B86A 2O9VA 4ESRA 2MIOA 1M3AA 2GQIA 2DRKA 1PRMC 4ORZA 4Z8AA 1E7OA 1G83A 1GCPA 2FO0A 2L3SA 2KNBB 2DBKA 3THKA 2FPDA 1KJWA 3EG2A 1ABOA 3UF4A 4OMOA 2PNIA 3RNJA 1T0JA 2ECZA 2JW4A 4J9FA 2IIMA 2K2MA 4LN2A 3PE0A 4J9GA 3VS6A 2DVJA 4HCKA 1HD3A 1ZUUA 1PRLC 1MV0B 1WFWA 2D8JA 1Y57A 1JU5C 1UHCA 3A98A 1CKBA 3VRYA 1SRMA 1I07A 2JMAA 1AZEA 1AWOA 3U23A 2A08A 3NPFA 4AFUC 1AWJA 1H3HA 4J9IA 2KRSA 4RTXA 1WXUA 2FRYA 1WDXA 1UJ0A 2L0AA 1BU1A 2GGRA 3EGUA 1UG1A 1JEGA 2O31A 3QWYA 2FPEA 2EQIA 1AOJA 4DEYA 2MOXA 3PVLA 4EIKA 1UUEA 2FPFA 2HEQA 2KXCA 2AKLA 2VVKA 3QWXX 3PVQA 2DL7A 1X27A 2BZ8A 1M27C 2RQTA 2EVRA 2I0NA 1RLPC 1M30A 1E6HA 1QWEA 4JJBA 4A63B 4HVVA 2L3QA 1X69A 1GCQC 1UTIA 1N5ZA 1OEBA 1U06A 2PZ1A 2BZYA 2EYZA 1WA7A 2LJ1A 1OPLA 2BTTA 2F2WA 2ROTA 1W6XA 1X6GA 2SEMA 2O9SA 1AVZC 4LNPA 2PTKA 1GRIA 3VS1A 1B3QA 3M0PA 4IIMA 3TSZA 1ZUYA 2DF6A 2VWFA 2KR3A 2K3BA 1PHTA 1MV3A 2K7AA 1AZGB 2DE0X 3H0IA 2AZSA 2LJ3A 3M0QA 2HCKA 1YWPA 1JXMA 3VS5A 1PWTA 4OMQA 2ENMA 1SHFA 2XMFA 3VS3A 2CDTA 3NGPA 1VYTA 2RF0A 2HBWA 3IQLA 3I5RA 5HCKA 4OMMA 2L2PA 4RTTA 1GBQA 2AK5A 2KGTA 1GCQA 2KXDA 1T0HA 2J05A 4M4ZA 1GBRA 1TG0A 2K79A 3I5SA 1J3TA 2DBMA 1RUWA 4RTYA 1M3BA 2ED0A 5FW9A 2KYBA 2GTJA 1TUDA 3FJ5A 1QLYA 3EG3A 4Z89A 1K0XA 4FSSA 4JZ4A 3KFVA 1YNZA 1JQQA 1XOVA 2EW3A 1KFZA 1UGVA 2FEIA 1M8MA 2MCNA 2KRMA 3NMZC 1GFDA 2D8HA 2M0YA 1NLOC 5IXBA 1ZBJA 4LUEA 2LX7A 4DEXA 1YN8A 3M0UA 2DLPA 2H8HA 1M3CA 2FRWA 1H8KA 1K76A 3M0SA 1SHGA 2O2OA 1AWXA 4IIOA 2GBQA 1QKWA 4RTZA 1CKAA 1E6GA 2JT4A 2HSPA 4CC3A 4OMLA 4F17A 1W1FA 4HVUA 2W10A
chains in the Genus database with same CATH superfamily
4J9DA 5FU7B 3V8LA 4M78C 3BW1A 2FG0A 1QVFS 4KRTA 4HA8A 1AD5A 4X9CA 2MWPA 5GAMe 5HY6A 1U5SA 2EJFA 1KC8C 2DKGA 1WIEA 2OTJQ 2GQVA 2X51A 4Y92A 4C8QC 2CUDA 1UGPB 1I81A 1VQ7T 2JTEA 1EX4A 2K3XA 3LGFA 1VQMT 2QTXA 2EGEA 3QDFA 1RI0A 1UGRB 1VQPQ 4RKUE 4F7UG 1Q82C 2HD0A 5GAN3 4FW1A 4K11A 3G7ZA 2OX7A 2XHCA 4M7AB 3TEEA 2K4YA 2LT4A 1B07A 2YUPA 1QVPA 2YUNA 5KE3A 4M7DE 5FU6B 1RI9A 1U3OA 3LH0A 1IZ6A 3SWNC 1K9MC 1Q86R 2K9GA 2LQKA 2E1HA 1D1CA 2J06A 2E6ZA 2LX9A 2CP7A 2QI2A 5FWBA 1VQOA 1LCKA 1M1GA 3I56A 4WCIA 7AT1B 3CBPA 2DM1A 1FWZA 1OYXA 1EIFA 2BZXA 3EGDA 1JXOA 1YITT 2JMCA 4O6JA 2DL3A 4M75E 5IXFA 3OYLA 2EIFA 3TQ7P 3BE3A 1W70A 3CCUT 1RAAB 1UEBA 1JRIA 1IGUA 1RABB 3RMSA 3JCMe 2RM4A 5FU6C 1I1JA 1HJDA 1ARKA 2V8KA 1HK9A 3RIRA 2YDLA 1PG5B 1BKBA 2DEQA 3E1SA 4KGVB 2QASA 1M1KC 4BACA 2CT4A 1ZSZB 4OVAA 2RPNA 5IHNA 2R5AA 3E19A 1K1ZA 1WLPB 2DVEA 3CBOA 4C0DB 1X2QA 3VJPA 4E7HA 3OYFA 3OYKA 1YI2T 4IUQA 4OMFB 1I0CA 4L5GA 4PJLA 2WACA 1Y7XA 4GBQA 2DIGA 4UC4A 4PK4A 1K4US 1NYFA 4XTUA 1QCOA 1Q81U 2YUOA 2QDLA 4YTLA 2NLUA 1NEGA 4KGZB 5IT9E 2OTJA 2A36A 1M1FA 1SRLA 1RAGB 4M78B 3G1JA 3L2QA 1FX7A 2DL8A 4L6V5 3CCMA 4R0KA 1Z9ZA 2DL4A 1C0MA 1NYGA 3H0FA 1UDLA 4GLMA 3A5ZB 3EGDB 1YITQ 3CCST 4PJOB 3OYCA 1TUGB 1VQ4T 2CT3A 3O5ZA 5GAN7 1NPPA 1VIEA 2LQWA 2J6OA 2RMOA 3HP9A 2F69A 1YBYA 2ZPEB 2CSIA 2F1LA 1OQKA 3I9QA 4HCZA 5I22A 2EWNA 3EHQA 3MP8A 4AFZC 2C06A 3M0TA 5FROA 1FXXA 2VKNA 4F7UA 3OS0A 1VQOQ 1FYNA 4AG2C 5GAOn 1KSWA 1WI7A 5A0DA 1K9AA 4ZTFA 2AKKA 1UFFA 2JS0A 2ABLA 3RMQA 2L8DA 2MAMA 2NUPA 5IN1A 3HRSA 1D09B 1SF9A 3H6ZA 4L59A 2MIOA 2GQIA 2DRKA 4DOWA 1W2BP 3MPUB 4MZPA 4IUTA 4LD6A 5J26A 3UF4A 2VV5A 4KUIA 5GMKj 1B7TA 5A0GA 1NJIR 3DLMA 1PD0A 2E65A 3PNWC 3PE0A 3CMEA 4XTZA 1VQ5T 3VS6A 1VUBA 4HCKA 3CCSA 3P8BB 3CBMA 3G6EA 1D0XA 3QZ9B 4A4GA 3OBWA 3BDLA 8ATCB 2VXFA 3JB9J 2GFUA 3FJPA 5LJ5f 1WHHA 2R5MA 2KSSA 1M1KR 1Q7YC 1VQ9Q 2Z0WA 3U23A 2A08A 1WHKA 1H3HA 2KRSA 2QK0A 1XQHA 5C6SA 3SB2A 1Q82R 1G3TA 2L0AA 3INZA 3LWIA 3X20B 4ZGEB 3CCJQ 2RI5A 1QP2A 2EQIA 4HT9A 2XI9A 4FCYA 4EIKA 5KH6A 4MDXA 4JRKA 2KXCA 2AKLA 2MF2A 3QWXX 3PVQA 2DEUA 1X27A 4B9WA 1LNXA 1M27C 1W4SA 1M30A 3VUZA 4HVVA 2A0FB 1X69A 4Y91A 3OYGA 3QIIA 2V26A 3L42A 4QVDA 3HSBA 4JLIA 2FZCB 2H3JA 2EYZA 2E4HA 2QEXA 1OPLA 2K57A 1DJ7B 2MPXC 2O9SA 1GRIA 1NPRA 1QVGA 1G3WA 4RMOA 5CKFA 5I21A 3SD4A 3TSZA 4IIMA 1KHCA 2DF6A 1PHTA 1MV3A 2K7AA 5LJ5g 1JJ2A 3BFMA 1LPLA 3OYBA 3CMET 4J6WA 1M2OA 1IB8A 1VQ4Q 1PWTA 3CCLA 3KXTA 5A2QE 2P4TA 2CDTA 5KCHA 2RF0A 3I5RA 4OMMA 2AT1B 1AT1B 2CKKA 2KXDA 1X01A 3ME9A 1MMNA 1GBRA 5CKBA 2NYSA 2QGFB 3EH1A 1MMAA 3LYIA 2DERA 1N27A 2RI3A 3CCSQ 4RTYA 2V8IA 2VASA 4FSXA 5HKCA 3EG3A 4Z89A 4XQ3A 4LDXA 4FSSA 4EPCA 1KQSP 5GAMd 3OYHA 4X9DA 2ZPBB 5CAIA 1R0BG 5CQXA 5FLXE 2M0OA 1KFZA 1UGVA 2FEIA 3OS1A 2D8HA 2M0YA 1ZBJA 2D6FA 1WGSA 4C0DC 3CPWP 5GAMj 1VQOT 3HL8A 4N4GA 1IREB 3HHTB 3FIFA 1OX9A 4IIOA 2GBQA 1QKWA 4M7DC 2NUPB 4CC3A 4PLIA 4AMCA 3ER0A 1W1FA 2W10A 4P5NA 3M53A 3CPWS 1UGSB 2XD0A 1V76A 2HBPA 5IAYA 5KE2A 4QW2A 4BDYA 2A28A 1YIJT 1IO6A 2L3PA 1T3LA 3CCMT 2LT1A 3TREA 1LJOA 4J9BA 1I5OB 2K3YA 2QEXQ 4V2SA 3UA6A 2VB6A 1I4K1 2EAYA 5CCAA 2LZ6B 5GAN4 2LQ8A 5GANg 2DILA 4C8QG 4F04B 4Z88A 4NL3A 1SKUB 3CPFA 3JV3A 2JM9A 2D1XA 3QUIA 1PNJA 1PKTA 5D6XA 2DD5A 2RJDA 1WX6A 5KYXA 3CC2Q 1AWWA 1RLQC 2HL5C 3EGXB 1ZQ1A 4M75F 2OTLT 1AEYA 4D8KA 1VQ4A 3OYAA 2KE9A 4C8QA 5CO7A 4ZTJA 4M77G 3DB4A 2QQAA 4Y28E 1EZZB 1G3YA 4JS4A 4ELZC 4LDUA 1PD1A 3QPHA 3EH2A 2A3LA 1TU0B 3H0HA 5ECAA 1S72A 2DD4A 2IG0A 4QT7A 2ZPIB 1M2VB 2DZ9A 3X26B 1ZSZA 3EHRA 3V8JA 2DA9A 3WXMB 3VU3C 1Q95G 2EYWA 2ATCB 3AHUA 3CCQA 4M77A 3OY9A 4KGXB 1ZLMA 3FDRA 1OV3A 1VQ6Q 3F70A 1QMCA 2V8JA 1G5VA 2EGCA 3NHNA 2JN0A 2JM8A 1VQ9A 1XNIA 4KT0E 1OOTA 1YJWQ 2DO3A 4FM4B 2JTFA 3JAME 2KK4A 5GAMg 2ZPGB 3RDVA 5L23A 1VQNQ 2RQRA 2JXBA 2RQUA 3JB9I 1CSKA 4RG8A 2O4XA 3CCJA 1SEMA 3G4SQ 4AT1B 1ZBXA 3OYIA 2LCLA 4JJNK 3C94A 4FU6A 4M75B 5HK0A 2XICA 1H92A 4XU0A 1M90U 2JOYA 4OP0A 2J6FA 3SEMA 1SPKA 2E5QA 3RBBB 4CC2A 2F2VA 4FYVB 2D0QB 2CZ6B 4E47A 4E6RA 3EG1A 2DTIA 4LD9K 4XK8E 9ATCB 5GAOp 4J7FA 4MDWA 2NUTA 1ZUKA 3TU4K 1YHQQ 2RO0A 3HTRA 2EYXA 2ED1A 5D6YA 2RJFA 1OZ2A 2PU9B 1NG2A 2E3HA 4PJOD 1LOJA 2CP6A 5I11A 1K8AR 3G71T 2EKOA 1G2BA 3JCMb 2E5KA 4OB0B 1RAIB 2QA4T 4DBRA 3C95A 4BE2A 4HVWA 4JRQA 5CIUA 1VQ6T 1X2KA 1U8RA 1OULA 4A54A 1KD1R 3CQTA 2OJ2A 1VA7A 3M0RA 1YJ9A 2CUBA 5FWCA 1T3SA 1YWOA 4JUVA 3SHWA 1VQMA 4KBMB 3QG1A 1VQNT 5GJVB 2WSEE 3EG0A 1YIJQ 3OA6A 3A8OB 1PKSA 3PT9A 2O4XB 1WXBA 2DL5A 1WHLA 3E2UA 5I2MA 1PCXA 3CCVA 1BYMA 2YSQA 1BK2A 2EKHA 1VQPA 2KEAA 4BB7A 1S1NA 2C0OA 4JDSA 2F5KA 4AFSC 3RKXA 2W0ZA 2GTOA 2KBTA 2YLCA 2HAXA 2OAWA 2LRQA 4DQ2A 1NJIC 1KD1U 2HDAA 2BKDN 1PRMC 1VIFA 4ORZA 1G83A 1GCPA 2FO0A 3S3NA 3CD6A 2KNBB 4D6WA 5GANh 2RK1A 2HKQB 3EG2A 3CCRQ 5J39A 2CZ0B 4DOVA 2MWOA 2CP2A 4J8OA 3V7SA 1T0JA 2ECZA 4OGEA 3J80E 2YLBA 4QVZA 5KYYA 2JW4A 3I56Q 2IIMA 3GIBA 1JJ2P 2K2MA 4M7AE 1MMGA 2HZYA 1W2BS 2DVJA 1NZ9A 3LLRA 3MEVA 1ZUUA 1G3SA 1MV0B 2E64A 1WFWA 2D8JA 3CC2T 1Y57A 5CK9A 1Y07A 1UHCA 2QXFA 3ZEHA 3OYEA 2X9HA 2O01E 4J7IA 1WQWA 4M78A 1OU8A 2LDMA 4J9IA 3CCEQ 3PTAA 2FVUA 1QCNA 1WXUA 4DBQA 3OB9A 1YHQA 3CMAT 1WDXA 1UJ0A 1BU1A 1F1BB 4CRIA 3EGUA 4BI4A 3JCMX 1UG1A 2ZPFB 2RI2A 5FRNA 2FPEA 4N4HA 2LVMA 3PVLA 1R77A 3RKWA 2E6NA 3CCUQ 1KHIA 3MKDA 2BZ8A 2RQTA 2EVRA 4A53A 3PMTA 1Q7YU 1QWEA 4JJBA 4FW2A 1UTIA 4M78D 3L2RA 4FT4A 2PZ1A 2IPOB 1WA7A 1Q81C 5GMKh 1VQMQ 5GAMh 2LJ1A 3MHXA 3MEWA 2F2WA 1VQPT 2ROTA 5CKEA 4XU2A 2RJEA 4C0GA 1AVZC 3CCMQ 2EQJA 2VGMA 1S72Q 3ZFJA 1M90C 3V8KA 2JVVA 2VUBA 2BE9B 5CQYA 1D0ZA 4PLLA 1Q82U 2DE0X 1SG5A 2QQ9A 3GF5A 3MP1A 1KC8U 2AZSA 3M4YA 1R8OB 2HCKA 1BI3A 4Z02A 3QKJA 3M55A 2WSCE 4E7JA 1VQ6A 2ENMA 3VS3A 4F7UE 3RR6A 3CCET 3CD6Q 3EGXA 2CP3A 1O75A 1RAFB 1K9MU 4M7AD 3A8HB 1W2BA 4RTTA 1SSFA 3CXCP 2KGTA 4RG2A 4C8QB 2KDSA 2COZA 5LJ5e 1TG0A 1TH7A 1XTDA 3G71Q 1QP3A 4M7DB 3OQ5A 2ED0A 2KYBA 2XKOC 3A8MB 2GTJA 5LJ3j 2DFUA 3KFVA 3M54A 1YNZA 1BIBA 1KG1A 1JQQA 1XOVA 4M77B 3DKMA 4XTXA 4ZN3A 3PMIA 2MCNA 2XIDA 1N6AA 2HQXA 5J3BA 1YCYA 2OTLQ 1WZOA 3HFOA 2QYZA 1VQ5Q 4NL2A 3C12A 1YJWT 1M3CA 2FRWA 2B8AA 3JRZA 3M0SA 1KK7A 4C5EA 1CKAA 2X4YA 5GAOm 2JT4A 3OYNA 4HVUA 3OW2A 2E12A 1D1AA 1OX8A 2F5TX 2H3EB 3E9GA 5GJWB 1BI0A 1PSFA 4D8DA 4EDUA 3CCRT 4N4IA 5LL6S 4JLGA 2G6FX 3UA7A 2LP5A 2HL3A 5GMKm 2NUZA 4M7AC 2KT1A 2L89A 1ZX6A 2RQWA 3REBB 2GF7A 2HQHA 2ZAEA 1IXDA 2QQRA 4M75A 4A4FA 4J9EA 3VS7A 1IHVA 4C92A 2XDDA 3RESA 1Q81R 2NWMA 3CC4A 4N0AC 4WTOB 4BDZA 2D9TA 3CCVT 4FYWB 1VQKA 3EG9A 3ZL7C 2KT8A 2CGHA 3H41A 1YCSB 4ELYC 3FB9A 1VQ8T 8AT1B 4NS5A 4QQDA 2QGGA 4ZGJB 1A0NB 2YT6A 3CPWA 5DLQE 4J83A 1GL5A 3AT1B 4M75C 2GNCA 2DNUA 4HT8A 1QWFA 4RUGA 4ZNXA 2CH4W 1UHFA 3X28B 3URGA 4M7AG 2JZ2A 1WHMA 3P8DA 5A0LA 2M51A 1YHQT 3RUXA 1M8VA 3QJ6A 1BBZA 4MZTA 3EFSA 2DX1A 4PJOA 4C92E 2LQNA 2FHDA 1BI2A 2MYSA 4PFPA 4C8QD 4BD3A 2RN8A 2BUDA 3HFNA 4E7LA 3M57A 3OW2P 4EMKC 4MMLA 3TVTA 3CXCS 2Y4XA 3L2VA 2X4XA 2P4RA 1VQ5A 3JCMd 2OAUA 3UDCA 4J6YA 3GBQA 3CMEQ 1JO8A 4WF2A 5KYNA 4LE9A 2D0NA 5IHKA 1X75C 5EC7A 2VGNA 3G6EQ 3RERA 3CCUA 1M1KU 1OU9A 4X34A 2J7IA 1K9MR 1Y96A 4ME7A 1IGQA 2JTMA 1N8RC 3EG9B 2SRCA 1Q86U 2EYYA 1X6OA 2CP0A 4EMKA 3QXEB 3MCAB 1WYXA 4C92F 4JZ3A 1YP5A 2LNVA 1VQLT 1QCFA 5GANd 2LJ0A 3WVEB 1JB0E 3I56T 4XU1A 3V7CA 2EJGA 2DJQA 3L1AA 1QVGP 1MUZA 2DIQA 1TSFA 5KYYB 2BE7D 2QDYB 4BY6B 3I55A 1G8XA 2EGAA 2LMJA 4C5GA 1IRXA 1UJYA 4O5VA 5LJ3f 1Z9QA 4PL6A 1H641 1HXDA 1UE9A 1TWBA 4CC7A 4J9CA 3CCLT 3GOXA 4XTWA 1VYUA 1XJWB 2E70A 4R56A 2QAZA 2AZVA 3FC3A 4E7SA 2EYQA 4C8QF 2FB7A 2CREA 1U1TA 1H3ZA 5KYWA 1QVFP 2JS2A 4F14A 4EMKB 1Q7YR 1WJQA 1N8RR 4M7DF 3NTIA 3CC7Q 3UT1A 4XTYA 1VYVA 2NUTB 1ABQA 2DPPB 2C0TA 1MNDA 3ASKA 3O8VA 3L2ZA 4R55A 4M75G 4C0ZA 3NTHA 3MO8A 3G71A 2G3RA 1K73R 6AT1B 1UGQB 2KY9A 3JCMJ 4LDWA 5GAOq 2E41A 2LCCA 4M77F 2LNHB 3C0CA 3M5AA 4IUVA 2YRDA 1BB9A 4JRPA 4FYYB 5C0MA 2RHUA 3EFOB 3PFSA 4C92B 1M3AA 3PGGA 4Z8AA 4LXCA 1WNLA 3THKA 1KJWA 4OGCA 5FRMA 2YHTA 5GAN6 1ABOA 1AHJB 4OMOA 3VKIA 3RNJA 4E2FB 3S3MA 4QQGA 3UPUA 1BI1A 2L3RA 4IUPA 3PIOA 1ZSZC 4LN2A 3R6OA 4PNOA 5CVIA 1HD3A 5LJ3e 1PRLC 3JCMf 4PJMA 1CKBA 3A8GB 3VRYA 1D3BB 2JMAA 1AZEA 2AIRB 2M16A 4LDYA 3LGLA 3NPFA 4B6MA 2EJ9A 3META 3JCMQ 1VQ8Q 1MHNA 5GAN2 4C5IA 2GGRA 1TS9A 3MP6A 3GP8A 2K2VA 1JEGA 2O31A 1YI2Q 4DEYA 2MOXA 2FPFA 4DBFA 2HEQA 3QJYA 2VVKA 1B34A 2DL7A 3L2UA 1Y71A 1N9RA 3OYMA 1RLPC 4PKCC 1M9SA 1R0CB 2DXUA 3EFOA 2L3QA 3GNGA 1N5ZA 1OEBA 1U06A 2DYIA 4XTVA 3FLGA 2BZYA 1RL2A 3N5BB 4F7UF 3CC7A 2DK3A 2BTTA 2EFIA 1K73U 2RHYA 2SEMA 3GLXA 4CI0C 3DLLA 4PFOA 2XDPA 4LNPA 1MMDA 4Q5WA 2PTKA 4KH1B 4FYXB 3VS1A 3KUFA 5GANj 2DXCA 3MEUA 2QA4Q 1K8AU 4VUBA 4C92G 1N8RU 1ZUYA 2K3BA 3C4SA 3CC2A 1AZGB 1ZA2B 3H0IA 3JCMg 3QHSA 3M0QA 1NE8A 1S72T 2ZZDA 4PJNA 1YWPA 2HKNA 5AYFA 2XDBA 4OMQA 2RHXA 5LJ5h 1VQLQ 1VYTA 2HBWA 1M90R 3IQLA 5HCKA 2L2PA 1GBQA 1GCQA 1YFNA 4EMGA 2J05A 4QKUA 4M4ZA 5D7UA 5LJ3d 2DETA 1P92A 3I5SA 3CD6T 1J3TA 2DBMA 1I5LA 4JS5A 4MZMA 1B34B 2PUKB 1M3BA 1YJNA 3HRUA 4M7DG 2CYZB 1TUDA 1QLYA 3CCQQ 4BUGA 3QBYA 5KYXB 2DAQA 3J81E 2Y4YA 1C1AA 2PVOB 3CCRA 3A8LB 2KMTA 1OZ3A 2MI6A 2MK5A 4GLKA 4IKFA 1VQNA 5IXBA 4LUEA 3M56A 3M0UA 3E9FA 1K76A 2O2OA 1AWXA 2L5QA 2QG9B 1HYOA 1KQSA 2WSFE 4RTZA 1IHWA 4EMHA 4A4EA 1E6GA 2RK2A 2HQEA 4KUDK 4ATOA 1QVGS 2JJ9A 1K8AC 2V1RA 2ROLA 2LTOA 5GAOl 3SFMA 3J7AF 4ZGDB 3QO3A 1UB4A 1ZA1B 3I55T 3LW5E 2KYMA 4KH0B 2AHJB 2JUFA 1O9SA 1GFCA 5DM7R 4TVRA 2P0KA 2EQMA 3OSSC 4C5HA 2A37A 2P0PA 5KYUA 4PJOF 3VS4A 4C92C 5GMKl 1Q86C 4JPBW 3UATA 2FYKA 2COYA 2CH4A 1WJRA 1D0YA 1I8FA 3UWNA 2LC4A 2RB6A 2COWA 3WVDB 2QEXT 1TXQA 4F16A 4RCCA 1ACMB 3CMAA 3OYYA 1YJ9Q 3CCLQ 1QKXA 2EBPA 3JCMP 4A4KA 3OYJA 2C0IA 2X4WA 4FIBA 4AFQC 2DYBA 2FZKB 4HXJA 4M78E 4FL6A 1NM7A 2X3WD 5GAN5 3SWNA 3DB3A 3VS2A 1VQ9T 1JJ2S 1PC0A 2RNAA 5LJ5j 3X25B 5FU7C 4AG1C 3A1PA 3LWHA 1YJNQ 4OMNA 2FZGB 3BDUA 4LUDA 2DMOA 1FMKA 1SSHA 2PVGB 4OF1A 2I2LA 2OI3A 2YUQA 2VYTA 3OS2A 2KAFA 2K5LA 1U1SA 3VYHB 3JCMh 2CS7A 2ESWA 4BY6C 3QYHB 4A4HA 3R6NA 4C0FA 3FRNA 4J9HA 2X4JA 1PM3A 1VQ8A 1WXTA 3QSUA 1HSQA 2ZPHB 5IHIA 1N9SA 5IH2A 1FMVA 1M4ZA 2KQWA 2PVDB 3JSCA 1BCMA 3SWNB 5LJ3g 1V29B 3G4ST 4HKEA 3JB9D 1NEBA 1YI2A 2K6DA 4X1VA 3ZBDA 1KIKA 4RTWA 4M77D 1M2VA 1VQ7Q 5GMKi 2A7YA 2YWWA 3ULRB 1UECA 2DTHA 2DRMA 2LCSA 1V1CA 3LX7A 4HCBA 4CC4B 3SDZA 4JRIA 3CCJT 2DTOA 2E3IA 3JCMc 3L2WA 1OPKA 2JNGA 2KRNA 2J6KA 3OBYA 1ZSGA 2PUOB 1K0SA 1D3BA 2XG8D 1OI1A 2F2XA 1KQSS 2O88A 2M1HA 4JJDA 2V1QA 2E10A 4PJJA 1TUCA 3HPWA 2ZCFB 2YXYA 3V7RA 5CKDA 1KQ1A 2QA4A 3I35A 2RH2A 3LH5A 2GCXA 3VS0A 4MMKA 2K5IA 3M9QA 4IUUA 3MEAA 5I2SA 3H9NA 3TSWA 1Y96B 2X3XD 3VRZA 4E7ZA 4RTVA 4M78F 3BY7A 4DA4A 1KC8R 4J5YA 1X6BA 4E7KA 4E7IA 1VQLA 4RTUA 2CSQA 1WHJA 4QQ6A 3S6WA 4JJCA 2RQVA 5GANe 5HK3A 1X43A 3JB9H 3VUBA 3JB9F 1Y0MA 1QVFA 5GAN8 4B9XA 1WJSA 1EFNA 1NLPC 4OMPA 4OB2B 4DBHA 3EAEA 3CC4Q 2EPDA 2VXEA 2KROA 3X24B 3REAB 2B86A 2RD1A 2O9VA 3P8HA 4ESRA 1D1BA 2PQWA 1E7OA 5KYWB 4PJOG 2L3SA 2DBKA 4GY5A 2FPDA 4FT2A 4IURA 2K5FA 3S3OA 5M9OA 1YJWA 1JBMA 2PNIA 1YJ9T 2P0QA 3VV0A 4M7AF 2YRVA 4M77E 5CR2A 1MNEA 2QTVA 4J9FA 5GAOr 3G4SA 4HCCA 3OW2S 4J9GA 4QVCA 1NJIU 1KD1C 5KCOA 3HKSA 5L8RE 2HNIA 4PFZA 1RADB 2VC8A 1JU5C 3OS5A 3A98A 3M58A 2ZGWA 1SRMA 1I07A 5GAMf 4BI8B 3FEOA 3CXCA 4XU3A 2OTJT 1AWOA 4RCBA 1WPYA 3G6ET 4C92D 4AFUC 1AWJA 1C6VX 4C8QE 1VQKT 4RTXA 2HSEB 3QDRB 2FRYA 2OTLA 4ZN1A 1QW1A 1ZHIA 3CC4T 3OMGA 3QWYA 3Q1JA 1AOJA 4F7UB 2YRCA 1UUEA 3QYGB 2RHIA 3H8ZA 3PIPA 2DXTA 3KBGA 5DY9A 1NBEB 1RACB 3QZ5B 2I0NA 4OB1B 1E6HA 1TTHB 2MMPA 4A63B 1GCQC 3OMCA 3CMAQ 3NTKA 1WHGA 2RJCA 2R57A 5D6WA 2CP5A 1W6XA 2QQBA 3RKYA 1X6GA 1YIJA 3GPLA 2DJZA 2Y90A 5CKHA 1RAEB 3I55Q 2P84A 4M7DA 3VYGA 1B3QA 3M0PA 3CCVQ 1YITA 5AT1B 3CC7T 3CEYA 3GNFB 3JCMV 2EQUA 5LJ3h 1QQJA 2XU8A 2VWFA 2KR3A 4LDVA 2KVQG 2LJ3A 1VOMA 1WQ7A 3HRTA 1M5Q1 4NOYA 5GANf 1JXMA 3VS5A 1SHFA 2XMFA 4XAXB 3TCJA 1VQKQ 1MGQA 3NGPA 1K73C 2AK5A 4BE0A 2X35A 2CZ7B 1PSEA 1T0HA 4M7DD 4BE1A 3JCMW 1TOVA 2DZCA 5GMKe 1KQ2A 1BIAA 2K79A 5KYUB 4ANJA 3EFRA 2RHZA 4M78G 3T9NA 1RUWA 2HMAA 4N0AA 3OYDA 5FW9A 5LJ5d 4OB3B 2BIVA 3MJXA 2FL7A 2RA2A 3FJ5A 2QQSA 1K0XA 1VQ7A 4II1A 2KI7A 4JZ4A 1FMWA 4BI3A 3M4GA 4KULA 2M9UA 1GXIE 1RAHB 3NFCA 3JB9G 2EW3A 4M75D 4M7AA 3CCEA 4PJOE 3M59A 3CCQT 2M02A 1M8MA 2CZ1B 2KRMA 3NMZC 1GFDA 3D7SB 2EQKA 1BCOA 2GFAA 1NLOC 1YJNT 2LX7A 2R58A 4DEXA 1YN8A 2DLPA 2H8HA 3OSVA 1LVKA 2IVWA 5DLOA 4M77C 1H8KA 5EG2A 4PJOC 1SHGA 4J6XA 2DXBA 2HSPA 2XK0A 4OMLA 4F17A
chains in the Genus database with same CATH topology
4J9DA 2FG0A 2V1RA 2ROLA 4KRTA 2A28A 1AD5A 1IO6A 5GJWB 2L3PA 1T3LA 4J9BA 1U5SA 4D8DA 2KYMA 3UA6A 1WIEA 2LZ6B 1GFCA 2G6FX 2DILA 4Y92A 3UA7A 2LP5A 4Z88A 2A37A 2CUDA 2NUZA 3JV3A 2JM9A 2D1XA 2KT1A 2JTEA 1ZX6A 2RQWA 3REBB 3VS4A 4JPBW 1PNJA 3UATA 1PKTA 2EGEA 1WX6A 4J9EA 2CH4A 3VS7A 1AWWA 1RLQC 2NWMA 4K11A 4F16A 1AEYA 4D8KA 1B07A 2YUPA 2YUNA 2KE9A 1RI9A 1QKXA 2EBPA 3ZL7C 1U3OA 2KT8A 3H41A 2C0IA 1YCSB 4AFQC 2DYBA 2K9GA 4HXJA 1A0NB 1NM7A 2X3WD 2YT6A 2J06A 1GL5A 3VS2A 3H0HA 5ECAA 5FWBA 2GNCA 2DNUA 2RNAA 1LCKA 4QT7A 1QWFA 4RUGA 4WCIA 4ZNXA 2CH4W 1UHFA 4AG1C 2DM1A 2BZXA 4OMNA 1JXOA 3EHRA 4LUDA 2DMOA 1FMKA 2DA9A 2JMCA 1SSHA 2M51A 2EYWA 2DL3A 1BBZA 2DX1A 1ZLMA 5IXFA 2OI3A 2LQNA 2YUQA 1OV3A 1W70A 2RN8A 2ESWA 2EGCA 3NHNA 2JM8A 3R6NA 1I1JA 1OOTA 4J9HA 1HJDA 1ARKA 1WXTA 5L23A 1HSQA 2RQRA 5IHIA 2JXBA 2RQUA 3TVTA 5IH2A 1CSKA 2P4RA 1SEMA 2YDLA 1NEBA 3GBQA 1JO8A 4LE9A 2K6DA 4X1VA 2D0NA 5IHKA 5EC7A 1KIKA 2CT4A 4RTWA 2RPNA 5IHNA 1K1ZA 1WLPB 1H92A 2J7IA 3ULRB 2J6FA 1UECA 1X2QA 2SRCA 3SEMA 1SPKA 2DRMA 2EYYA 2LCSA 1V1CA 3RBBB 4CC2A 2F2VA 4CC4B 1WYXA 4E6RA 1I0CA 3EG1A 4JZ3A 1YP5A 1QCFA 1OPKA 2KRNA 4GBQA 2LJ0A 1K4US 2J6KA 1NYFA 1ZSGA 1K0SA 2O88A 2F2XA 2YUOA 2QDLA 1NEGA 1ZUKA 2DJQA 2A36A 4JJDA 1SRLA 2EYXA 2ED1A 1MUZA 2V1QA 2DL8A 1NG2A 1TUCA 4R0KA 1Z9ZA 5I11A 2EGAA 2DL4A 2LMJA 1NYGA 3H0FA 1G2BA 1UDLA 4GLMA 1UJYA 3I35A 1Z9QA 3LH5A 2E5KA 3VS0A 1UE9A 4CC7A 4HVWA 4J9CA 2CT3A 3O5ZA 1VYUA 3TSWA 2X3XD 2LQWA 3VRZA 1X2KA 2J6OA 2RMOA 2AZVA 4RTVA 3CQTA 2CSIA 2CREA 2OJ2A 1VA7A 3M0RA 2CUBA 3I9QA 5FWCA 2JS2A 1T3SA 4F14A 1YWOA 1X6BA 3SHWA 5I22A 4RTUA 5GJVB 3EHQA 2CSQA 4AFZC 3EG0A 1VYVA 1ABQA 2C0TA 1PKSA 4JJCA 2RQVA 3M0TA 2VKNA 1X43A 1WXBA 2DL5A 1Y0MA 1FYNA 4AG2C 2YSQA 1BK2A 2EKHA 2KEAA 1S1NA 1KSWA 1WI7A 2C0OA 1EFNA 1NLPC 4OMPA 4AFSC 2LNHB 1K9AA 3C0CA 2AKKA 2W0ZA 1UFFA 1BB9A 2GTOA 2JS0A 2ABLA 2KBTA 2OAWA 2EPDA 2KROA 2HDAA 3REAB 2B86A 2O9VA 4ESRA 2MIOA 1M3AA 2GQIA 2DRKA 1PRMC 4ORZA 4Z8AA 1E7OA 1G83A 1GCPA 2FO0A 2L3SA 2KNBB 2DBKA 3THKA 2FPDA 1KJWA 3EG2A 1ABOA 3UF4A 4OMOA 2PNIA 3RNJA 1T0JA 2ECZA 2JW4A 4J9FA 2IIMA 2K2MA 4LN2A 3PE0A 4J9GA 3VS6A 2DVJA 4HCKA 1HD3A 1ZUUA 1PRLC 1MV0B 1WFWA 2D8JA 1Y57A 1JU5C 1UHCA 3A98A 1CKBA 3VRYA 1SRMA 1I07A 2JMAA 1AZEA 1AWOA 3U23A 2A08A 3NPFA 4AFUC 1AWJA 1H3HA 4J9IA 2KRSA 4RTXA 1WXUA 2FRYA 1WDXA 1UJ0A 2L0AA 1BU1A 2GGRA 3EGUA 1UG1A 1JEGA 2O31A 3QWYA 2FPEA 2EQIA 1AOJA 4DEYA 2MOXA 3PVLA 4EIKA 1UUEA 2FPFA 2HEQA 2KXCA 2AKLA 2VVKA 3QWXX 3PVQA 2DL7A 1X27A 2BZ8A 1M27C 2RQTA 2EVRA 2I0NA 1RLPC 1M30A 1E6HA 1QWEA 4JJBA 4A63B 4HVVA 2L3QA 1X69A 1GCQC 1UTIA 1N5ZA 1OEBA 1U06A 2PZ1A 2BZYA 2EYZA 1WA7A 2LJ1A 1OPLA 2BTTA 2F2WA 2ROTA 1W6XA 1X6GA 2SEMA 2O9SA 1AVZC 4LNPA 2PTKA 1GRIA 3VS1A 1B3QA 3M0PA 4IIMA 3TSZA 1ZUYA 2DF6A 2VWFA 2KR3A 2K3BA 1PHTA 1MV3A 2K7AA 1AZGB 2DE0X 3H0IA 2AZSA 2LJ3A 3M0QA 2HCKA 1YWPA 1JXMA 3VS5A 1PWTA 4OMQA 2ENMA 1SHFA 2XMFA 3VS3A 2CDTA 3NGPA 1VYTA 2RF0A 2HBWA 3IQLA 3I5RA 5HCKA 4OMMA 2L2PA 4RTTA 1GBQA 2AK5A 2KGTA 1GCQA 2KXDA 1T0HA 2J05A 4M4ZA 1GBRA 1TG0A 2K79A 3I5SA 1J3TA 2DBMA 1RUWA 4RTYA 1M3BA 2ED0A 5FW9A 2KYBA 2GTJA 1TUDA 3FJ5A 1QLYA 3EG3A 4Z89A 1K0XA 4FSSA 4JZ4A 3KFVA 1YNZA 1JQQA 1XOVA 2EW3A 1KFZA 1UGVA 2FEIA 1M8MA 2MCNA 2KRMA 3NMZC 1GFDA 2D8HA 2M0YA 1NLOC 5IXBA 1ZBJA 4LUEA 2LX7A 4DEXA 1YN8A 3M0UA 2DLPA 2H8HA 1M3CA 2FRWA 1H8KA 1K76A 3M0SA 1SHGA 2O2OA 1AWXA 4IIOA 2GBQA 1QKWA 4RTZA 1CKAA 1E6GA 2JT4A 2HSPA 4CC3A 4OMLA 4F17A 1W1FA 4HVUA 2W10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9D A;  2FG0 A;  2V1R A;  2ROL A;  4KRT A;  2A28 A;  1AD5 A;  1IO6 A;  5GJW B;  2L3P A;  1T3L A;  4J9B A;  1U5S A;  4D8D A;  2KYM A;  3UA6 A;  1WIE A;  2LZ6 B;  1GFC A;  2G6F X;  2DIL A;  4Y92 A;  3UA7 A;  2LP5 A;  4Z88 A;  2A37 A;  2CUD A;  2NUZ A;  3JV3 A;  2JM9 A;  2D1X A;  2KT1 A;  2JTE A;  1ZX6 A;  2RQW A;  3REB B;  3VS4 A;  4JPB W;  1PNJ A;  3UAT A;  1PKT A;  2EGE A;  1WX6 A;  4J9E A;  2CH4 A;  3VS7 A;  1AWW A;  1RLQ C;  2NWM A;  4K11 A;  4F16 A;  1AEY A;  4D8K A;  1B07 A;  2YUP A;  2YUN A;  2KE9 A;  1RI9 A;  1QKX A;  2EBP A;  3ZL7 C;  1U3O A;  2KT8 A;  3H41 A;  2C0I A;  1YCS B;  4AFQ C;  2DYB A;  2K9G A;  4HXJ A;  1A0N B;  1NM7 A;  2X3W D;  2YT6 A;  2J06 A;  1GL5 A;  3VS2 A;  3H0H A;  5ECA A;  5FWB A;  2GNC A;  2DNU A;  2RNA A;  1LCK A;  4QT7 A;  1QWF A;  4RUG A;  4WCI A;  4ZNX A;  2CH4 W;  1UHF A;  4AG1 C;  2DM1 A;  2BZX A;  4OMN A;  1JXO A;  3EHR A;  4LUD A;  2DMO A;  1FMK A;  2DA9 A;  2JMC A;  1SSH A;  2M51 A;  2EYW A;  2DL3 A;  1BBZ A;  2DX1 A;  1ZLM A;  5IXF A;  2OI3 A;  2LQN A;  2YUQ A;  1OV3 A;  1W70 A;  2RN8 A;  2ESW A;  2EGC A;  3NHN A;  2JM8 A;  3R6N A;  1I1J A;  1OOT A;  4J9H A;  1HJD A;  1ARK A;  1WXT A;  5L23 A;  1HSQ A;  2RQR A;  5IHI A;  2JXB A;  2RQU A;  3TVT A;  5IH2 A;  1CSK A;  2P4R A;  1SEM A;  2YDL A;  1NEB A;  3GBQ A;  1JO8 A;  4LE9 A;  2K6D A;  4X1V A;  2D0N A;  5IHK A;  5EC7 A;  1KIK A;  2CT4 A;  4RTW A;  2RPN A;  5IHN A;  1K1Z A;  1WLP B;  1H92 A;  2J7I A;  3ULR B;  2J6F A;  1UEC A;  1X2Q A;  2SRC A;  3SEM A;  1SPK A;  2DRM A;  2EYY A;  2LCS A;  1V1C A;  3RBB B;  4CC2 A;  2F2V A;  4CC4 B;  1WYX A;  4E6R A;  1I0C A;  3EG1 A;  4JZ3 A;  1YP5 A;  1QCF A;  1OPK A;  2KRN A;  4GBQ A;  2LJ0 A;  1K4U S;  2J6K A;  1NYF A;  1ZSG A;  1K0S A;  2O88 A;  2F2X A;  2YUO A;  2QDL A;  1NEG A;  1ZUK A;  2DJQ A;  2A36 A;  4JJD A;  1SRL A;  2EYX A;  2ED1 A;  1MUZ A;  2V1Q A;  2DL8 A;  1NG2 A;  1TUC A;  4R0K A;  1Z9Z A;  5I11 A;  2EGA A;  2DL4 A;  2LMJ A;  1NYG A;  3H0F A;  1G2B A;  1UDL A;  4GLM A;  1UJY A;  3I35 A;  1Z9Q A;  3LH5 A;  2E5K A;  3VS0 A;  1UE9 A;  4CC7 A;  4HVW A;  4J9C A;  2CT3 A;  3O5Z A;  1VYU A;  3TSW A;  2X3X D;  2LQW A;  3VRZ A;  1X2K A;  2J6O A;  2RMO A;  2AZV A;  4RTV A;  3CQT A;  2CSI A;  2CRE A;  2OJ2 A;  1VA7 A;  3M0R A;  2CUB A;  3I9Q A;  5FWC A;  2JS2 A;  1T3S A;  4F14 A;  1YWO A;  1X6B A;  3SHW A;  5I22 A;  4RTU A;  5GJV B;  3EHQ A;  2CSQ A;  4AFZ C;  3EG0 A;  1VYV A;  1ABQ A;  2C0T A;  1PKS A;  4JJC A;  2RQV A;  3M0T A;  2VKN A;  1X43 A;  1WXB A;  2DL5 A;  1Y0M A;  1FYN A;  4AG2 C;  2YSQ A;  1BK2 A;  2EKH A;  2KEA A;  1S1N A;  1KSW A;  1WI7 A;  2C0O A;  1EFN A;  1NLP C;  4OMP A;  4AFS C;  2LNH B;  1K9A A;  3C0C A;  2AKK A;  2W0Z A;  1UFF A;  1BB9 A;  2GTO A;  2JS0 A;  2ABL A;  2KBT A;  2OAW A;  2EPD A;  2KRO A;  2HDA A;  3REA B;  2B86 A;  2O9V A;  4ESR A;  2MIO A;  1M3A A;  2GQI A;  2DRK A;  1PRM C;  4ORZ A;  4Z8A A;  1E7O A;  1G83 A;  1GCP A;  2FO0 A;  2L3S A;  2KNB B;  2DBK A;  3THK A;  2FPD A;  1KJW A;  3EG2 A;  1ABO A;  3UF4 A;  4OMO A;  2PNI A;  3RNJ A;  1T0J A;  2ECZ A;  2JW4 A;  4J9F A;  2IIM A;  2K2M A;  4LN2 A;  3PE0 A;  4J9G A;  3VS6 A;  2DVJ A;  4HCK A;  1HD3 A;  1ZUU A;  1PRL C;  1MV0 B;  1WFW A;  2D8J A;  1Y57 A;  1JU5 C;  1UHC A;  3A98 A;  1CKB A;  3VRY A;  1SRM A;  1I07 A;  2JMA A;  1AZE A;  1AWO A;  3U23 A;  2A08 A;  3NPF A;  4AFU C;  1AWJ A;  1H3H A;  4J9I A;  2KRS A;  4RTX A;  1WXU A;  2FRY A;  1WDX A;  1UJ0 A;  2L0A A;  1BU1 A;  2GGR A;  3EGU A;  1UG1 A;  1JEG A;  2O31 A;  3QWY A;  2FPE A;  2EQI A;  1AOJ A;  4DEY A;  2MOX A;  3PVL A;  4EIK A;  1UUE A;  2FPF A;  2HEQ A;  2KXC A;  2AKL A;  2VVK A;  3QWX X;  3PVQ A;  2DL7 A;  1X27 A;  2BZ8 A;  1M27 C;  2RQT A;  2EVR A;  2I0N A;  1RLP C;  1M30 A;  1E6H A;  1QWE A;  4JJB A;  4A63 B;  4HVV A;  2L3Q A;  1X69 A;  1GCQ C;  1UTI A;  1N5Z A;  1OEB A;  1U06 A;  2PZ1 A;  2BZY A;  2EYZ A;  1WA7 A;  2LJ1 A;  1OPL A;  2BTT A;  2F2W A;  2ROT A;  1W6X A;  1X6G A;  2SEM A;  2O9S A;  1AVZ C;  4LNP A;  2PTK A;  1GRI A;  3VS1 A;  1B3Q A;  3M0P A;  4IIM A;  3TSZ A;  1ZUY A;  2DF6 A;  2VWF A;  2KR3 A;  2K3B A;  1PHT A;  1MV3 A;  2K7A A;  1AZG B;  2DE0 X;  3H0I A;  2AZS A;  2LJ3 A;  3M0Q A;  2HCK A;  1YWP A;  1JXM A;  3VS5 A;  1PWT A;  4OMQ A;  2ENM A;  1SHF A;  2XMF A;  3VS3 A;  2CDT A;  3NGP A;  1VYT A;  2RF0 A;  2HBW A;  3IQL A;  3I5R A;  5HCK A;  4OMM A;  2L2P A;  4RTT A;  1GBQ A;  2AK5 A;  2KGT A;  1GCQ A;  2KXD A;  1T0H A;  2J05 A;  4M4Z A;  1GBR A;  1TG0 A;  2K79 A;  3I5S A;  1J3T A;  2DBM A;  1RUW A;  4RTY A;  1M3B A;  2ED0 A;  5FW9 A;  2KYB A;  2GTJ A;  1TUD A;  3FJ5 A;  1QLY A;  3EG3 A;  4Z89 A;  1K0X A;  4FSS A;  4JZ4 A;  3KFV A;  1YNZ A;  1JQQ A;  1XOV A;  2EW3 A;  1KFZ A;  1UGV A;  2FEI A;  1M8M A;  2MCN A;  2KRM A;  3NMZ C;  1GFD A;  2D8H A;  2M0Y A;  1NLO C;  5IXB A;  1ZBJ A;  4LUE A;  2LX7 A;  4DEX A;  1YN8 A;  3M0U A;  2DLP A;  2H8H A;  1M3C A;  2FRW A;  1H8K A;  1K76 A;  3M0S A;  1SHG A;  2O2O A;  1AWX A;  4IIO A;  2GBQ A;  1QKW A;  4RTZ A;  1CKA A;  1E6G A;  2JT4 A;  2HSP A;  4CC3 A;  4OML A;  4F17 A;  1W1F A;  4HVU A;  2W10 A; 
#chains in the Genus database with same CATH topology
 4J9D A;  5FU7 B;  3V8L A;  4M78 C;  3BW1 A;  2FG0 A;  1QVF S;  4KRT A;  4HA8 A;  1AD5 A;  4X9C A;  2MWP A;  5GAM e;  5HY6 A;  1U5S A;  2EJF A;  1KC8 C;  2DKG A;  1WIE A;  2OTJ Q;  2GQV A;  2X51 A;  4Y92 A;  4C8Q C;  2CUD A;  1UGP B;  1I81 A;  1VQ7 T;  2JTE A;  1EX4 A;  2K3X A;  3LGF A;  1VQM T;  2QTX A;  2EGE A;  3QDF A;  1RI0 A;  1UGR B;  1VQP Q;  4RKU E;  4F7U G;  1Q82 C;  2HD0 A;  5GAN 3;  4FW1 A;  4K11 A;  3G7Z A;  2OX7 A;  2XHC A;  4M7A B;  3TEE A;  2K4Y A;  2LT4 A;  1B07 A;  2YUP A;  1QVP A;  2YUN A;  5KE3 A;  4M7D E;  5FU6 B;  1RI9 A;  1U3O A;  3LH0 A;  1IZ6 A;  3SWN C;  1K9M C;  1Q86 R;  2K9G A;  2LQK A;  2E1H A;  1D1C A;  2J06 A;  2E6Z A;  2LX9 A;  2CP7 A;  2QI2 A;  5FWB A;  1VQO A;  1LCK A;  1M1G A;  3I56 A;  4WCI A;  7AT1 B;  3CBP A;  2DM1 A;  1FWZ A;  1OYX A;  1EIF A;  2BZX A;  3EGD A;  1JXO A;  1YIT T;  2JMC A;  4O6J A;  2DL3 A;  4M75 E;  5IXF A;  3OYL A;  2EIF A;  3TQ7 P;  3BE3 A;  1W70 A;  3CCU T;  1RAA B;  1UEB A;  1JRI A;  1IGU A;  1RAB B;  3RMS A;  3JCM e;  2RM4 A;  5FU6 C;  1I1J A;  1HJD A;  1ARK A;  2V8K A;  1HK9 A;  3RIR A;  2YDL A;  1PG5 B;  1BKB A;  2DEQ A;  3E1S A;  4KGV B;  2QAS A;  1M1K C;  4BAC A;  2CT4 A;  1ZSZ B;  4OVA A;  2RPN A;  5IHN A;  2R5A A;  3E19 A;  1K1Z A;  1WLP B;  2DVE A;  3CBO A;  4C0D B;  1X2Q A;  3VJP A;  4E7H A;  3OYF A;  3OYK A;  1YI2 T;  4IUQ A;  4OMF B;  1I0C A;  4L5G A;  4PJL A;  2WAC A;  1Y7X A;  4GBQ A;  2DIG A;  4UC4 A;  4PK4 A;  1K4U S;  1NYF A;  4XTU A;  1QCO A;  1Q81 U;  2YUO A;  2QDL A;  4YTL A;  2NLU A;  1NEG A;  4KGZ B;  5IT9 E;  2OTJ A;  2A36 A;  1M1F A;  1SRL A;  1RAG B;  4M78 B;  3G1J A;  3L2Q A;  1FX7 A;  2DL8 A;  4L6V 5;  3CCM A;  4R0K A;  1Z9Z A;  2DL4 A;  1C0M A;  1NYG A;  3H0F A;  1UDL A;  4GLM A;  3A5Z B;  3EGD B;  1YIT Q;  3CCS T;  4PJO B;  3OYC A;  1TUG B;  1VQ4 T;  2CT3 A;  3O5Z A;  5GAN 7;  1NPP A;  1VIE A;  2LQW A;  2J6O A;  2RMO A;  3HP9 A;  2F69 A;  1YBY A;  2ZPE B;  2CSI A;  2F1L A;  1OQK A;  3I9Q A;  4HCZ A;  5I22 A;  2EWN A;  3EHQ A;  3MP8 A;  4AFZ C;  2C06 A;  3M0T A;  5FRO A;  1FXX A;  2VKN A;  4F7U A;  3OS0 A;  1VQO Q;  1FYN A;  4AG2 C;  5GAO n;  1KSW A;  1WI7 A;  5A0D A;  1K9A A;  4ZTF A;  2AKK A;  1UFF A;  2JS0 A;  2ABL A;  3RMQ A;  2L8D A;  2MAM A;  2NUP A;  5IN1 A;  3HRS A;  1D09 B;  1SF9 A;  3H6Z A;  4L59 A;  2MIO A;  2GQI A;  2DRK A;  4DOW A;  1W2B P;  3MPU B;  4MZP A;  4IUT A;  4LD6 A;  5J26 A;  3UF4 A;  2VV5 A;  4KUI A;  5GMK j;  1B7T A;  5A0G A;  1NJI R;  3DLM A;  1PD0 A;  2E65 A;  3PNW C;  3PE0 A;  3CME A;  4XTZ A;  1VQ5 T;  3VS6 A;  1VUB A;  4HCK A;  3CCS A;  3P8B B;  3CBM A;  3G6E A;  1D0X A;  3QZ9 B;  4A4G A;  3OBW A;  3BDL A;  8ATC B;  2VXF A;  3JB9 J;  2GFU A;  3FJP A;  5LJ5 f;  1WHH A;  2R5M A;  2KSS A;  1M1K R;  1Q7Y C;  1VQ9 Q;  2Z0W A;  3U23 A;  2A08 A;  1WHK A;  1H3H A;  2KRS A;  2QK0 A;  1XQH A;  5C6S A;  3SB2 A;  1Q82 R;  1G3T A;  2L0A A;  3INZ A;  3LWI A;  3X20 B;  4ZGE B;  3CCJ Q;  2RI5 A;  1QP2 A;  2EQI A;  4HT9 A;  2XI9 A;  4FCY A;  4EIK A;  5KH6 A;  4MDX A;  4JRK A;  2KXC A;  2AKL A;  2MF2 A;  3QWX X;  3PVQ A;  2DEU A;  1X27 A;  4B9W A;  1LNX A;  1M27 C;  1W4S A;  1M30 A;  3VUZ A;  4HVV A;  2A0F B;  1X69 A;  4Y91 A;  3OYG A;  3QII A;  2V26 A;  3L42 A;  4QVD A;  3HSB A;  4JLI A;  2FZC B;  2H3J A;  2EYZ A;  2E4H A;  2QEX A;  1OPL A;  2K57 A;  1DJ7 B;  2MPX C;  2O9S A;  1GRI A;  1NPR A;  1QVG A;  1G3W A;  4RMO A;  5CKF A;  5I21 A;  3SD4 A;  3TSZ A;  4IIM A;  1KHC A;  2DF6 A;  1PHT A;  1MV3 A;  2K7A A;  5LJ5 g;  1JJ2 A;  3BFM A;  1LPL A;  3OYB A;  3CME T;  4J6W A;  1M2O A;  1IB8 A;  1VQ4 Q;  1PWT A;  3CCL A;  3KXT A;  5A2Q E;  2P4T A;  2CDT A;  5KCH A;  2RF0 A;  3I5R A;  4OMM A;  2AT1 B;  1AT1 B;  2CKK A;  2KXD A;  1X01 A;  3ME9 A;  1MMN A;  1GBR A;  5CKB A;  2NYS A;  2QGF B;  3EH1 A;  1MMA A;  3LYI A;  2DER A;  1N27 A;  2RI3 A;  3CCS Q;  4RTY A;  2V8I A;  2VAS A;  4FSX A;  5HKC A;  3EG3 A;  4Z89 A;  4XQ3 A;  4LDX A;  4FSS A;  4EPC A;  1KQS P;  5GAM d;  3OYH A;  4X9D A;  2ZPB B;  5CAI A;  1R0B G;  5CQX A;  5FLX E;  2M0O A;  1KFZ A;  1UGV A;  2FEI A;  3OS1 A;  2D8H A;  2M0Y A;  1ZBJ A;  2D6F A;  1WGS A;  4C0D C;  3CPW P;  5GAM j;  1VQO T;  3HL8 A;  4N4G A;  1IRE B;  3HHT B;  3FIF A;  1OX9 A;  4IIO A;  2GBQ A;  1QKW A;  4M7D C;  2NUP B;  4CC3 A;  4PLI A;  4AMC A;  3ER0 A;  1W1F A;  2W10 A;  4P5N A;  3M53 A;  3CPW S;  1UGS B;  2XD0 A;  1V76 A;  2HBP A;  5IAY A;  5KE2 A;  4QW2 A;  4BDY A;  2A28 A;  1YIJ T;  1IO6 A;  2L3P A;  1T3L A;  3CCM T;  2LT1 A;  3TRE A;  1LJO A;  4J9B A;  1I5O B;  2K3Y A;  2QEX Q;  4V2S A;  3UA6 A;  2VB6 A;  1I4K 1;  2EAY A;  5CCA A;  2LZ6 B;  5GAN 4;  2LQ8 A;  5GAN g;  2DIL A;  4C8Q G;  4F04 B;  4Z88 A;  4NL3 A;  1SKU B;  3CPF A;  3JV3 A;  2JM9 A;  2D1X A;  3QUI A;  1PNJ A;  1PKT A;  5D6X A;  2DD5 A;  2RJD A;  1WX6 A;  5KYX A;  3CC2 Q;  1AWW A;  1RLQ C;  2HL5 C;  3EGX B;  1ZQ1 A;  4M75 F;  2OTL T;  1AEY A;  4D8K A;  1VQ4 A;  3OYA A;  2KE9 A;  4C8Q A;  5CO7 A;  4ZTJ A;  4M77 G;  3DB4 A;  2QQA A;  4Y28 E;  1EZZ B;  1G3Y A;  4JS4 A;  4ELZ C;  4LDU A;  1PD1 A;  3QPH A;  3EH2 A;  2A3L A;  1TU0 B;  3H0H A;  5ECA A;  1S72 A;  2DD4 A;  2IG0 A;  4QT7 A;  2ZPI B;  1M2V B;  2DZ9 A;  3X26 B;  1ZSZ A;  3EHR A;  3V8J A;  2DA9 A;  3WXM B;  3VU3 C;  1Q95 G;  2EYW A;  2ATC B;  3AHU A;  3CCQ A;  4M77 A;  3OY9 A;  4KGX B;  1ZLM A;  3FDR A;  1OV3 A;  1VQ6 Q;  3F70 A;  1QMC A;  2V8J A;  1G5V A;  2EGC A;  3NHN A;  2JN0 A;  2JM8 A;  1VQ9 A;  1XNI A;  4KT0 E;  1OOT A;  1YJW Q;  2DO3 A;  4FM4 B;  2JTF A;  3JAM E;  2KK4 A;  5GAM g;  2ZPG B;  3RDV A;  5L23 A;  1VQN Q;  2RQR A;  2JXB A;  2RQU A;  3JB9 I;  1CSK A;  4RG8 A;  2O4X A;  3CCJ A;  1SEM A;  3G4S Q;  4AT1 B;  1ZBX A;  3OYI A;  2LCL A;  4JJN K;  3C94 A;  4FU6 A;  4M75 B;  5HK0 A;  2XIC A;  1H92 A;  4XU0 A;  1M90 U;  2JOY A;  4OP0 A;  2J6F A;  3SEM A;  1SPK A;  2E5Q A;  3RBB B;  4CC2 A;  2F2V A;  4FYV B;  2D0Q B;  2CZ6 B;  4E47 A;  4E6R A;  3EG1 A;  2DTI A;  4LD9 K;  4XK8 E;  9ATC B;  5GAO p;  4J7F A;  4MDW A;  2NUT A;  1ZUK A;  3TU4 K;  1YHQ Q;  2RO0 A;  3HTR A;  2EYX A;  2ED1 A;  5D6Y A;  2RJF A;  1OZ2 A;  2PU9 B;  1NG2 A;  2E3H A;  4PJO D;  1LOJ A;  2CP6 A;  5I11 A;  1K8A R;  3G71 T;  2EKO A;  1G2B A;  3JCM b;  2E5K A;  4OB0 B;  1RAI B;  2QA4 T;  4DBR A;  3C95 A;  4BE2 A;  4HVW A;  4JRQ A;  5CIU A;  1VQ6 T;  1X2K A;  1U8R A;  1OUL A;  4A54 A;  1KD1 R;  3CQT A;  2OJ2 A;  1VA7 A;  3M0R A;  1YJ9 A;  2CUB A;  5FWC A;  1T3S A;  1YWO A;  4JUV A;  3SHW A;  1VQM A;  4KBM B;  3QG1 A;  1VQN T;  5GJV B;  2WSE E;  3EG0 A;  1YIJ Q;  3OA6 A;  3A8O B;  1PKS A;  3PT9 A;  2O4X B;  1WXB A;  2DL5 A;  1WHL A;  3E2U A;  5I2M A;  1PCX A;  3CCV A;  1BYM A;  2YSQ A;  1BK2 A;  2EKH A;  1VQP A;  2KEA A;  4BB7 A;  1S1N A;  2C0O A;  4JDS A;  2F5K A;  4AFS C;  3RKX A;  2W0Z A;  2GTO A;  2KBT A;  2YLC A;  2HAX A;  2OAW A;  2LRQ A;  4DQ2 A;  1NJI C;  1KD1 U;  2HDA A;  2BKD N;  1PRM C;  1VIF A;  4ORZ A;  1G83 A;  1GCP A;  2FO0 A;  3S3N A;  3CD6 A;  2KNB B;  4D6W A;  5GAN h;  2RK1 A;  2HKQ B;  3EG2 A;  3CCR Q;  5J39 A;  2CZ0 B;  4DOV A;  2MWO A;  2CP2 A;  4J8O A;  3V7S A;  1T0J A;  2ECZ A;  4OGE A;  3J80 E;  2YLB A;  4QVZ A;  5KYY A;  2JW4 A;  3I56 Q;  2IIM A;  3GIB A;  1JJ2 P;  2K2M A;  4M7A E;  1MMG A;  2HZY A;  1W2B S;  2DVJ A;  1NZ9 A;  3LLR A;  3MEV A;  1ZUU A;  1G3S A;  1MV0 B;  2E64 A;  1WFW A;  2D8J A;  3CC2 T;  1Y57 A;  5CK9 A;  1Y07 A;  1UHC A;  2QXF A;  3ZEH A;  3OYE A;  2X9H A;  2O01 E;  4J7I A;  1WQW A;  4M78 A;  1OU8 A;  2LDM A;  4J9I A;  3CCE Q;  3PTA A;  2FVU A;  1QCN A;  1WXU A;  4DBQ A;  3OB9 A;  1YHQ A;  3CMA T;  1WDX A;  1UJ0 A;  1BU1 A;  1F1B B;  4CRI A;  3EGU A;  4BI4 A;  3JCM X;  1UG1 A;  2ZPF B;  2RI2 A;  5FRN A;  2FPE A;  4N4H A;  2LVM A;  3PVL A;  1R77 A;  3RKW A;  2E6N A;  3CCU Q;  1KHI A;  3MKD A;  2BZ8 A;  2RQT A;  2EVR A;  4A53 A;  3PMT A;  1Q7Y U;  1QWE A;  4JJB A;  4FW2 A;  1UTI A;  4M78 D;  3L2R A;  4FT4 A;  2PZ1 A;  2IPO B;  1WA7 A;  1Q81 C;  5GMK h;  1VQM Q;  5GAM h;  2LJ1 A;  3MHX A;  3MEW A;  2F2W A;  1VQP T;  2ROT A;  5CKE A;  4XU2 A;  2RJE A;  4C0G A;  1AVZ C;  3CCM Q;  2EQJ A;  2VGM A;  1S72 Q;  3ZFJ A;  1M90 C;  3V8K A;  2JVV A;  2VUB A;  2BE9 B;  5CQY A;  1D0Z A;  4PLL A;  1Q82 U;  2DE0 X;  1SG5 A;  2QQ9 A;  3GF5 A;  3MP1 A;  1KC8 U;  2AZS A;  3M4Y A;  1R8O B;  2HCK A;  1BI3 A;  4Z02 A;  3QKJ A;  3M55 A;  2WSC E;  4E7J A;  1VQ6 A;  2ENM A;  3VS3 A;  4F7U E;  3RR6 A;  3CCE T;  3CD6 Q;  3EGX A;  2CP3 A;  1O75 A;  1RAF B;  1K9M U;  4M7A D;  3A8H B;  1W2B A;  4RTT A;  1SSF A;  3CXC P;  2KGT A;  4RG2 A;  4C8Q B;  2KDS A;  2COZ A;  5LJ5 e;  1TG0 A;  1TH7 A;  1XTD A;  3G71 Q;  1QP3 A;  4M7D B;  3OQ5 A;  2ED0 A;  2KYB A;  2XKO C;  3A8M B;  2GTJ A;  5LJ3 j;  2DFU A;  3KFV A;  3M54 A;  1YNZ A;  1BIB A;  1KG1 A;  1JQQ A;  1XOV A;  4M77 B;  3DKM A;  4XTX A;  4ZN3 A;  3PMI A;  2MCN A;  2XID A;  1N6A A;  2HQX A;  5J3B A;  1YCY A;  2OTL Q;  1WZO A;  3HFO A;  2QYZ A;  1VQ5 Q;  4NL2 A;  3C12 A;  1YJW T;  1M3C A;  2FRW A;  2B8A A;  3JRZ A;  3M0S A;  1KK7 A;  4C5E A;  1CKA A;  2X4Y A;  5GAO m;  2JT4 A;  3OYN A;  4HVU A;  3OW2 A;  2E12 A;  1D1A A;  1OX8 A;  2F5T X;  2H3E B;  3E9G A;  5GJW B;  1BI0 A;  1PSF A;  4D8D A;  4EDU A;  3CCR T;  4N4I A;  5LL6 S;  4JLG A;  2G6F X;  3UA7 A;  2LP5 A;  2HL3 A;  5GMK m;  2NUZ A;  4M7A C;  2KT1 A;  2L89 A;  1ZX6 A;  2RQW A;  3REB B;  2GF7 A;  2HQH A;  2ZAE A;  1IXD A;  2QQR A;  4M75 A;  4A4F A;  4J9E A;  3VS7 A;  1IHV A;  4C92 A;  2XDD A;  3RES A;  1Q81 R;  2NWM A;  3CC4 A;  4N0A C;  4WTO B;  4BDZ A;  2D9T A;  3CCV T;  4FYW B;  1VQK A;  3EG9 A;  3ZL7 C;  2KT8 A;  2CGH A;  3H41 A;  1YCS B;  4ELY C;  3FB9 A;  1VQ8 T;  8AT1 B;  4NS5 A;  4QQD A;  2QGG A;  4ZGJ B;  1A0N B;  2YT6 A;  3CPW A;  5DLQ E;  4J83 A;  1GL5 A;  3AT1 B;  4M75 C;  2GNC A;  2DNU A;  4HT8 A;  1QWF A;  4RUG A;  4ZNX A;  2CH4 W;  1UHF A;  3X28 B;  3URG A;  4M7A G;  2JZ2 A;  1WHM A;  3P8D A;  5A0L A;  2M51 A;  1YHQ T;  3RUX A;  1M8V A;  3QJ6 A;  1BBZ A;  4MZT A;  3EFS A;  2DX1 A;  4PJO A;  4C92 E;  2LQN A;  2FHD A;  1BI2 A;  2MYS A;  4PFP A;  4C8Q D;  4BD3 A;  2RN8 A;  2BUD A;  3HFN A;  4E7L A;  3M57 A;  3OW2 P;  4EMK C;  4MML A;  3TVT A;  3CXC S;  2Y4X A;  3L2V A;  2X4X A;  2P4R A;  1VQ5 A;  3JCM d;  2OAU A;  3UDC A;  4J6Y A;  3GBQ A;  3CME Q;  1JO8 A;  4WF2 A;  5KYN A;  4LE9 A;  2D0N A;  5IHK A;  1X75 C;  5EC7 A;  2VGN A;  3G6E Q;  3RER A;  3CCU A;  1M1K U;  1OU9 A;  4X34 A;  2J7I A;  1K9M R;  1Y96 A;  4ME7 A;  1IGQ A;  2JTM A;  1N8R C;  3EG9 B;  2SRC A;  1Q86 U;  2EYY A;  1X6O A;  2CP0 A;  4EMK A;  3QXE B;  3MCA B;  1WYX A;  4C92 F;  4JZ3 A;  1YP5 A;  2LNV A;  1VQL T;  1QCF A;  5GAN d;  2LJ0 A;  3WVE B;  1JB0 E;  3I56 T;  4XU1 A;  3V7C A;  2EJG A;  2DJQ A;  3L1A A;  1QVG P;  1MUZ A;  2DIQ A;  1TSF A;  5KYY B;  2BE7 D;  2QDY B;  4BY6 B;  3I55 A;  1G8X A;  2EGA A;  2LMJ A;  4C5G A;  1IRX A;  1UJY A;  4O5V A;  5LJ3 f;  1Z9Q A;  4PL6 A;  1H64 1;  1HXD A;  1UE9 A;  1TWB A;  4CC7 A;  4J9C A;  3CCL T;  3GOX A;  4XTW A;  1VYU A;  1XJW B;  2E70 A;  4R56 A;  2QAZ A;  2AZV A;  3FC3 A;  4E7S A;  2EYQ A;  4C8Q F;  2FB7 A;  2CRE A;  1U1T A;  1H3Z A;  5KYW A;  1QVF P;  2JS2 A;  4F14 A;  4EMK B;  1Q7Y R;  1WJQ A;  1N8R R;  4M7D F;  3NTI A;  3CC7 Q;  3UT1 A;  4XTY A;  1VYV A;  2NUT B;  1ABQ A;  2DPP B;  2C0T A;  1MND A;  3ASK A;  3O8V A;  3L2Z A;  4R55 A;  4M75 G;  4C0Z A;  3NTH A;  3MO8 A;  3G71 A;  2G3R A;  1K73 R;  6AT1 B;  1UGQ B;  2KY9 A;  3JCM J;  4LDW A;  5GAO q;  2E41 A;  2LCC A;  4M77 F;  2LNH B;  3C0C A;  3M5A A;  4IUV A;  2YRD A;  1BB9 A;  4JRP A;  4FYY B;  5C0M A;  2RHU A;  3EFO B;  3PFS A;  4C92 B;  1M3A A;  3PGG A;  4Z8A A;  4LXC A;  1WNL A;  3THK A;  1KJW A;  4OGC A;  5FRM A;  2YHT A;  5GAN 6;  1ABO A;  1AHJ B;  4OMO A;  3VKI A;  3RNJ A;  4E2F B;  3S3M A;  4QQG A;  3UPU A;  1BI1 A;  2L3R A;  4IUP A;  3PIO A;  1ZSZ C;  4LN2 A;  3R6O A;  4PNO A;  5CVI A;  1HD3 A;  5LJ3 e;  1PRL C;  3JCM f;  4PJM A;  1CKB A;  3A8G B;  3VRY A;  1D3B B;  2JMA A;  1AZE A;  2AIR B;  2M16 A;  4LDY A;  3LGL A;  3NPF A;  4B6M A;  2EJ9 A;  3MET A;  3JCM Q;  1VQ8 Q;  1MHN A;  5GAN 2;  4C5I A;  2GGR A;  1TS9 A;  3MP6 A;  3GP8 A;  2K2V A;  1JEG A;  2O31 A;  1YI2 Q;  4DEY A;  2MOX A;  2FPF A;  4DBF A;  2HEQ A;  3QJY A;  2VVK A;  1B34 A;  2DL7 A;  3L2U A;  1Y71 A;  1N9R A;  3OYM A;  1RLP C;  4PKC C;  1M9S A;  1R0C B;  2DXU A;  3EFO A;  2L3Q A;  3GNG A;  1N5Z A;  1OEB A;  1U06 A;  2DYI A;  4XTV A;  3FLG A;  2BZY A;  1RL2 A;  3N5B B;  4F7U F;  3CC7 A;  2DK3 A;  2BTT A;  2EFI A;  1K73 U;  2RHY A;  2SEM A;  3GLX A;  4CI0 C;  3DLL A;  4PFO A;  2XDP A;  4LNP A;  1MMD A;  4Q5W A;  2PTK A;  4KH1 B;  4FYX B;  3VS1 A;  3KUF A;  5GAN j;  2DXC A;  3MEU A;  2QA4 Q;  1K8A U;  4VUB A;  4C92 G;  1N8R U;  1ZUY A;  2K3B A;  3C4S A;  3CC2 A;  1AZG B;  1ZA2 B;  3H0I A;  3JCM g;  3QHS A;  3M0Q A;  1NE8 A;  1S72 T;  2ZZD A;  4PJN A;  1YWP A;  2HKN A;  5AYF A;  2XDB A;  4OMQ A;  2RHX A;  5LJ5 h;  1VQL Q;  1VYT A;  2HBW A;  1M90 R;  3IQL A;  5HCK A;  2L2P A;  1GBQ A;  1GCQ A;  1YFN A;  4EMG A;  2J05 A;  4QKU A;  4M4Z A;  5D7U A;  5LJ3 d;  2DET A;  1P92 A;  3I5S A;  3CD6 T;  1J3T A;  2DBM A;  1I5L A;  4JS5 A;  4MZM A;  1B34 B;  2PUK B;  1M3B A;  1YJN A;  3HRU A;  4M7D G;  2CYZ B;  1TUD A;  1QLY A;  3CCQ Q;  4BUG A;  3QBY A;  5KYX B;  2DAQ A;  3J81 E;  2Y4Y A;  1C1A A;  2PVO B;  3CCR A;  3A8L B;  2KMT A;  1OZ3 A;  2MI6 A;  2MK5 A;  4GLK A;  4IKF A;  1VQN A;  5IXB A;  4LUE A;  3M56 A;  3M0U A;  3E9F A;  1K76 A;  2O2O A;  1AWX A;  2L5Q A;  2QG9 B;  1HYO A;  1KQS A;  2WSF E;  4RTZ A;  1IHW A;  4EMH A;  4A4E A;  1E6G A;  2RK2 A;  2HQE A;  4KUD K;  4ATO A;  1QVG S;  2JJ9 A;  1K8A C;  2V1R A;  2ROL A;  2LTO A;  5GAO l;  3SFM A;  3J7A F;  4ZGD B;  3QO3 A;  1UB4 A;  1ZA1 B;  3I55 T;  3LW5 E;  2KYM A;  4KH0 B;  2AHJ B;  2JUF A;  1O9S A;  1GFC A;  5DM7 R;  4TVR A;  2P0K A;  2EQM A;  3OSS C;  4C5H A;  2A37 A;  2P0P A;  5KYU A;  4PJO F;  3VS4 A;  4C92 C;  5GMK l;  1Q86 C;  4JPB W;  3UAT A;  2FYK A;  2COY A;  2CH4 A;  1WJR A;  1D0Y A;  1I8F A;  3UWN A;  2LC4 A;  2RB6 A;  2COW A;  3WVD B;  2QEX T;  1TXQ A;  4F16 A;  4RCC A;  1ACM B;  3CMA A;  3OYY A;  1YJ9 Q;  3CCL Q;  1QKX A;  2EBP A;  3JCM P;  4A4K A;  3OYJ A;  2C0I A;  2X4W A;  4FIB A;  4AFQ C;  2DYB A;  2FZK B;  4HXJ A;  4M78 E;  4FL6 A;  1NM7 A;  2X3W D;  5GAN 5;  3SWN A;  3DB3 A;  3VS2 A;  1VQ9 T;  1JJ2 S;  1PC0 A;  2RNA A;  5LJ5 j;  3X25 B;  5FU7 C;  4AG1 C;  3A1P A;  3LWH A;  1YJN Q;  4OMN A;  2FZG B;  3BDU A;  4LUD A;  2DMO A;  1FMK A;  1SSH A;  2PVG B;  4OF1 A;  2I2L A;  2OI3 A;  2YUQ A;  2VYT A;  3OS2 A;  2KAF A;  2K5L A;  1U1S A;  3VYH B;  3JCM h;  2CS7 A;  2ESW A;  4BY6 C;  3QYH B;  4A4H A;  3R6N A;  4C0F A;  3FRN A;  4J9H A;  2X4J A;  1PM3 A;  1VQ8 A;  1WXT A;  3QSU A;  1HSQ A;  2ZPH B;  5IHI A;  1N9S A;  5IH2 A;  1FMV A;  1M4Z A;  2KQW A;  2PVD B;  3JSC A;  1BCM A;  3SWN B;  5LJ3 g;  1V29 B;  3G4S T;  4HKE A;  3JB9 D;  1NEB A;  1YI2 A;  2K6D A;  4X1V A;  3ZBD A;  1KIK A;  4RTW A;  4M77 D;  1M2V A;  1VQ7 Q;  5GMK i;  2A7Y A;  2YWW A;  3ULR B;  1UEC A;  2DTH A;  2DRM A;  2LCS A;  1V1C A;  3LX7 A;  4HCB A;  4CC4 B;  3SDZ A;  4JRI A;  3CCJ T;  2DTO A;  2E3I A;  3JCM c;  3L2W A;  1OPK A;  2JNG A;  2KRN A;  2J6K A;  3OBY A;  1ZSG A;  2PUO B;  1K0S A;  1D3B A;  2XG8 D;  1OI1 A;  2F2X A;  1KQS S;  2O88 A;  2M1H A;  4JJD A;  2V1Q A;  2E10 A;  4PJJ A;  1TUC A;  3HPW A;  2ZCF B;  2YXY A;  3V7R A;  5CKD A;  1KQ1 A;  2QA4 A;  3I35 A;  2RH2 A;  3LH5 A;  2GCX A;  3VS0 A;  4MMK A;  2K5I A;  3M9Q A;  4IUU A;  3MEA A;  5I2S A;  3H9N A;  3TSW A;  1Y96 B;  2X3X D;  3VRZ A;  4E7Z A;  4RTV A;  4M78 F;  3BY7 A;  4DA4 A;  1KC8 R;  4J5Y A;  1X6B A;  4E7K A;  4E7I A;  1VQL A;  4RTU A;  2CSQ A;  1WHJ A;  4QQ6 A;  3S6W A;  4JJC A;  2RQV A;  5GAN e;  5HK3 A;  1X43 A;  3JB9 H;  3VUB A;  3JB9 F;  1Y0M A;  1QVF A;  5GAN 8;  4B9X A;  1WJS A;  1EFN A;  1NLP C;  4OMP A;  4OB2 B;  4DBH A;  3EAE A;  3CC4 Q;  2EPD A;  2VXE A;  2KRO A;  3X24 B;  3REA B;  2B86 A;  2RD1 A;  2O9V A;  3P8H A;  4ESR A;  1D1B A;  2PQW A;  1E7O A;  5KYW B;  4PJO G;  2L3S A;  2DBK A;  4GY5 A;  2FPD A;  4FT2 A;  4IUR A;  2K5F A;  3S3O A;  5M9O A;  1YJW A;  1JBM A;  2PNI A;  1YJ9 T;  2P0Q A;  3VV0 A;  4M7A F;  2YRV A;  4M77 E;  5CR2 A;  1MNE A;  2QTV A;  4J9F A;  5GAO r;  3G4S A;  4HCC A;  3OW2 S;  4J9G A;  4QVC A;  1NJI U;  1KD1 C;  5KCO A;  3HKS A;  5L8R E;  2HNI A;  4PFZ A;  1RAD B;  2VC8 A;  1JU5 C;  3OS5 A;  3A98 A;  3M58 A;  2ZGW A;  1SRM A;  1I07 A;  5GAM f;  4BI8 B;  3FEO A;  3CXC A;  4XU3 A;  2OTJ T;  1AWO A;  4RCB A;  1WPY A;  3G6E T;  4C92 D;  4AFU C;  1AWJ A;  1C6V X;  4C8Q E;  1VQK T;  4RTX A;  2HSE B;  3QDR B;  2FRY A;  2OTL A;  4ZN1 A;  1QW1 A;  1ZHI A;  3CC4 T;  3OMG A;  3QWY A;  3Q1J A;  1AOJ A;  4F7U B;  2YRC A;  1UUE A;  3QYG B;  2RHI A;  3H8Z A;  3PIP A;  2DXT A;  3KBG A;  5DY9 A;  1NBE B;  1RAC B;  3QZ5 B;  2I0N A;  4OB1 B;  1E6H A;  1TTH B;  2MMP A;  4A63 B;  1GCQ C;  3OMC A;  3CMA Q;  3NTK A;  1WHG A;  2RJC A;  2R57 A;  5D6W A;  2CP5 A;  1W6X A;  2QQB A;  3RKY A;  1X6G A;  1YIJ A;  3GPL A;  2DJZ A;  2Y90 A;  5CKH A;  1RAE B;  3I55 Q;  2P84 A;  4M7D A;  3VYG A;  1B3Q A;  3M0P A;  3CCV Q;  1YIT A;  5AT1 B;  3CC7 T;  3CEY A;  3GNF B;  3JCM V;  2EQU A;  5LJ3 h;  1QQJ A;  2XU8 A;  2VWF A;  2KR3 A;  4LDV A;  2KVQ G;  2LJ3 A;  1VOM A;  1WQ7 A;  3HRT A;  1M5Q 1;  4NOY A;  5GAN f;  1JXM A;  3VS5 A;  1SHF A;  2XMF A;  4XAX B;  3TCJ A;  1VQK Q;  1MGQ A;  3NGP A;  1K73 C;  2AK5 A;  4BE0 A;  2X35 A;  2CZ7 B;  1PSE A;  1T0H A;  4M7D D;  4BE1 A;  3JCM W;  1TOV A;  2DZC A;  5GMK e;  1KQ2 A;  1BIA A;  2K79 A;  5KYU B;  4ANJ A;  3EFR A;  2RHZ A;  4M78 G;  3T9N A;  1RUW A;  2HMA A;  4N0A A;  3OYD A;  5FW9 A;  5LJ5 d;  4OB3 B;  2BIV A;  3MJX A;  2FL7 A;  2RA2 A;  3FJ5 A;  2QQS A;  1K0X A;  1VQ7 A;  4II1 A;  2KI7 A;  4JZ4 A;  1FMW A;  4BI3 A;  3M4G A;  4KUL A;  2M9U A;  1GXI E;  1RAH B;  3NFC A;  3JB9 G;  2EW3 A;  4M75 D;  4M7A A;  3CCE A;  4PJO E;  3M59 A;  3CCQ T;  2M02 A;  1M8M A;  2CZ1 B;  2KRM A;  3NMZ C;  1GFD A;  3D7S B;  2EQK A;  1BCO A;  2GFA A;  1NLO C;  1YJN T;  2LX7 A;  2R58 A;  4DEX A;  1YN8 A;  2DLP A;  2H8H A;  3OSV A;  1LVK A;  2IVW A;  5DLO A;  4M77 C;  1H8K A;  5EG2 A;  4PJO C;  1SHG A;  4J6X A;  2DXB A;  2HSP A;  2XK0 A;  4OML A;  4F17 A; 
#chains in the Genus database with same CATH homology
 4J9D A;  2FG0 A;  2V1R A;  2ROL A;  4KRT A;  2A28 A;  1AD5 A;  1IO6 A;  5GJW B;  2L3P A;  1T3L A;  4J9B A;  1U5S A;  4D8D A;  2KYM A;  3UA6 A;  1WIE A;  2LZ6 B;  1GFC A;  2G6F X;  2DIL A;  4Y92 A;  3UA7 A;  2LP5 A;  4Z88 A;  2A37 A;  2CUD A;  2NUZ A;  3JV3 A;  2JM9 A;  2D1X A;  2KT1 A;  2JTE A;  1ZX6 A;  2RQW A;  3REB B;  3VS4 A;  4JPB W;  1PNJ A;  3UAT A;  1PKT A;  2EGE A;  1WX6 A;  4J9E A;  2CH4 A;  3VS7 A;  1AWW A;  1RLQ C;  2NWM A;  4K11 A;  4F16 A;  1AEY A;  4D8K A;  1B07 A;  2YUP A;  2YUN A;  2KE9 A;  1RI9 A;  1QKX A;  2EBP A;  3ZL7 C;  1U3O A;  2KT8 A;  3H41 A;  2C0I A;  1YCS B;  4AFQ C;  2DYB A;  2K9G A;  4HXJ A;  1A0N B;  1NM7 A;  2X3W D;  2YT6 A;  2J06 A;  1GL5 A;  3VS2 A;  3H0H A;  5ECA A;  5FWB A;  2GNC A;  2DNU A;  2RNA A;  1LCK A;  4QT7 A;  1QWF A;  4RUG A;  4WCI A;  4ZNX A;  2CH4 W;  1UHF A;  4AG1 C;  2DM1 A;  2BZX A;  4OMN A;  1JXO A;  3EHR A;  4LUD A;  2DMO A;  1FMK A;  2DA9 A;  2JMC A;  1SSH A;  2M51 A;  2EYW A;  2DL3 A;  1BBZ A;  2DX1 A;  1ZLM A;  5IXF A;  2OI3 A;  2LQN A;  2YUQ A;  1OV3 A;  1W70 A;  2RN8 A;  2ESW A;  2EGC A;  3NHN A;  2JM8 A;  3R6N A;  1I1J A;  1OOT A;  4J9H A;  1HJD A;  1ARK A;  1WXT A;  5L23 A;  1HSQ A;  2RQR A;  5IHI A;  2JXB A;  2RQU A;  3TVT A;  5IH2 A;  1CSK A;  2P4R A;  1SEM A;  2YDL A;  1NEB A;  3GBQ A;  1JO8 A;  4LE9 A;  2K6D A;  4X1V A;  2D0N A;  5IHK A;  5EC7 A;  1KIK A;  2CT4 A;  4RTW A;  2RPN A;  5IHN A;  1K1Z A;  1WLP B;  1H92 A;  2J7I A;  3ULR B;  2J6F A;  1UEC A;  1X2Q A;  2SRC A;  3SEM A;  1SPK A;  2DRM A;  2EYY A;  2LCS A;  1V1C A;  3RBB B;  4CC2 A;  2F2V A;  4CC4 B;  1WYX A;  4E6R A;  1I0C A;  3EG1 A;  4JZ3 A;  1YP5 A;  1QCF A;  1OPK A;  2KRN A;  4GBQ A;  2LJ0 A;  1K4U S;  2J6K A;  1NYF A;  1ZSG A;  1K0S A;  2O88 A;  2F2X A;  2YUO A;  2QDL A;  1NEG A;  1ZUK A;  2DJQ A;  2A36 A;  4JJD A;  1SRL A;  2EYX A;  2ED1 A;  1MUZ A;  2V1Q A;  2DL8 A;  1NG2 A;  1TUC A;  4R0K A;  1Z9Z A;  5I11 A;  2EGA A;  2DL4 A;  2LMJ A;  1NYG A;  3H0F A;  1G2B A;  1UDL A;  4GLM A;  1UJY A;  3I35 A;  1Z9Q A;  3LH5 A;  2E5K A;  3VS0 A;  1UE9 A;  4CC7 A;  4HVW A;  4J9C A;  2CT3 A;  3O5Z A;  1VYU A;  3TSW A;  2X3X D;  2LQW A;  3VRZ A;  1X2K A;  2J6O A;  2RMO A;  2AZV A;  4RTV A;  3CQT A;  2CSI A;  2CRE A;  2OJ2 A;  1VA7 A;  3M0R A;  2CUB A;  3I9Q A;  5FWC A;  2JS2 A;  1T3S A;  4F14 A;  1YWO A;  1X6B A;  3SHW A;  5I22 A;  4RTU A;  5GJV B;  3EHQ A;  2CSQ A;  4AFZ C;  3EG0 A;  1VYV A;  1ABQ A;  2C0T A;  1PKS A;  4JJC A;  2RQV A;  3M0T A;  2VKN A;  1X43 A;  1WXB A;  2DL5 A;  1Y0M A;  1FYN A;  4AG2 C;  2YSQ A;  1BK2 A;  2EKH A;  2KEA A;  1S1N A;  1KSW A;  1WI7 A;  2C0O A;  1EFN A;  1NLP C;  4OMP A;  4AFS C;  2LNH B;  1K9A A;  3C0C A;  2AKK A;  2W0Z A;  1UFF A;  1BB9 A;  2GTO A;  2JS0 A;  2ABL A;  2KBT A;  2OAW A;  2EPD A;  2KRO A;  2HDA A;  3REA B;  2B86 A;  2O9V A;  4ESR A;  2MIO A;  1M3A A;  2GQI A;  2DRK A;  1PRM C;  4ORZ A;  4Z8A A;  1E7O A;  1G83 A;  1GCP A;  2FO0 A;  2L3S A;  2KNB B;  2DBK A;  3THK A;  2FPD A;  1KJW A;  3EG2 A;  1ABO A;  3UF4 A;  4OMO A;  2PNI A;  3RNJ A;  1T0J A;  2ECZ A;  2JW4 A;  4J9F A;  2IIM A;  2K2M A;  4LN2 A;  3PE0 A;  4J9G A;  3VS6 A;  2DVJ A;  4HCK A;  1HD3 A;  1ZUU A;  1PRL C;  1MV0 B;  1WFW A;  2D8J A;  1Y57 A;  1JU5 C;  1UHC A;  3A98 A;  1CKB A;  3VRY A;  1SRM A;  1I07 A;  2JMA A;  1AZE A;  1AWO A;  3U23 A;  2A08 A;  3NPF A;  4AFU C;  1AWJ A;  1H3H A;  4J9I A;  2KRS A;  4RTX A;  1WXU A;  2FRY A;  1WDX A;  1UJ0 A;  2L0A A;  1BU1 A;  2GGR A;  3EGU A;  1UG1 A;  1JEG A;  2O31 A;  3QWY A;  2FPE A;  2EQI A;  1AOJ A;  4DEY A;  2MOX A;  3PVL A;  4EIK A;  1UUE A;  2FPF A;  2HEQ A;  2KXC A;  2AKL A;  2VVK A;  3QWX X;  3PVQ A;  2DL7 A;  1X27 A;  2BZ8 A;  1M27 C;  2RQT A;  2EVR A;  2I0N A;  1RLP C;  1M30 A;  1E6H A;  1QWE A;  4JJB A;  4A63 B;  4HVV A;  2L3Q A;  1X69 A;  1GCQ C;  1UTI A;  1N5Z A;  1OEB A;  1U06 A;  2PZ1 A;  2BZY A;  2EYZ A;  1WA7 A;  2LJ1 A;  1OPL A;  2BTT A;  2F2W A;  2ROT A;  1W6X A;  1X6G A;  2SEM A;  2O9S A;  1AVZ C;  4LNP A;  2PTK A;  1GRI A;  3VS1 A;  1B3Q A;  3M0P A;  4IIM A;  3TSZ A;  1ZUY A;  2DF6 A;  2VWF A;  2KR3 A;  2K3B A;  1PHT A;  1MV3 A;  2K7A A;  1AZG B;  2DE0 X;  3H0I A;  2AZS A;  2LJ3 A;  3M0Q A;  2HCK A;  1YWP A;  1JXM A;  3VS5 A;  1PWT A;  4OMQ A;  2ENM A;  1SHF A;  2XMF A;  3VS3 A;  2CDT A;  3NGP A;  1VYT A;  2RF0 A;  2HBW A;  3IQL A;  3I5R A;  5HCK A;  4OMM A;  2L2P A;  4RTT A;  1GBQ A;  2AK5 A;  2KGT A;  1GCQ A;  2KXD A;  1T0H A;  2J05 A;  4M4Z A;  1GBR A;  1TG0 A;  2K79 A;  3I5S A;  1J3T A;  2DBM A;  1RUW A;  4RTY A;  1M3B A;  2ED0 A;  5FW9 A;  2KYB A;  2GTJ A;  1TUD A;  3FJ5 A;  1QLY A;  3EG3 A;  4Z89 A;  1K0X A;  4FSS A;  4JZ4 A;  3KFV A;  1YNZ A;  1JQQ A;  1XOV A;  2EW3 A;  1KFZ A;  1UGV A;  2FEI A;  1M8M A;  2MCN A;  2KRM A;  3NMZ C;  1GFD A;  2D8H A;  2M0Y A;  1NLO C;  5IXB A;  1ZBJ A;  4LUE A;  2LX7 A;  4DEX A;  1YN8 A;  3M0U A;  2DLP A;  2H8H A;  1M3C A;  2FRW A;  1H8K A;  1K76 A;  3M0S A;  1SHG A;  2O2O A;  1AWX A;  4IIO A;  2GBQ A;  1QKW A;  4RTZ A;  1CKA A;  1E6G A;  2JT4 A;  2HSP A;  4CC3 A;  4OML A;  4F17 A;  1W1F A;  4HVU A;  2W10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...