2DL3A

Solution structure of the first sh3 domain of human sorbin and sh3 domain-containing protein 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
GSSGSSGRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing protein 1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion, signaling protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl3A00
4AFQC 2NUZA 2JS2A 1CKAA 1GL5A 4JZ3A 3EG1A 1ARKA 5L23A 2D1XA 2CREA 4CC3A 4J9GA 2O9VA 1T0HA 2J6FA 4AG1C 1FMKA 2JXBA 1UE9A 2YT6A 1TG0A 1BK2A 2VVKA 3JV3A 2MIOA 1M8MA 4IIOA 2ROLA 4RTUA 3VS2A 2J6KA 2LX7A 2CH4W 1KFZA 2EGEA 4OMQA 2LCSA 3REAB 5IXFA 3GBQA 4AG2C 1JO8A 1ZUYA 2GGRA 4ESRA 1G2BA 4Y92A 1K1ZA 2HEQA 2HSPA 1AWWA 2ECZA 3H0FA 3LH5A 2EQIA 1QLYA 1W1FA 2HDAA 2RPNA 2IIMA 1B3QA 2EVRA 2CSIA 4JJDA 2DILA 4LUDA 4Z89A 2M0YA 3ZL7C 2ESWA 1NLOC 2LJ0A 2LP5A 3EG3A 2LNHB 1HJDA 4J9HA 2DMOA 3M0PA 3NHNA 2XMFA 2DX1A 3PVLA 4AFUC 2DL4A 1WX6A 1M3BA 1PRLC 1VA7A 1EFNA 2KNBB 4AFSC 2JW4A 1UJYA 1RLQC 2D0NA 1YP5A 1JEGA 2A28A 1A0NB 3UF4A 1NG2A 1OEBA 2KE9A 4LN2A 2H8HA 2J6OA 2A08A 2ROTA 2KGTA 2RQTA 3EGUA 2FRWA 2HCKA 2LMJA 2O2OA 4RTYA 2O88A 4KRTA 4E6RA 3UA7A 4CC2A 3REBB 2KRSA 2KRNA 1H3HA 2RMOA 2FPFA 4JPBW 1UGVA 5IXBA 1ABQA 2DJQA 1E7OA 2F2VA 1ZBJA 2EGCA 1X2KA 2W0ZA 2EPDA 1MV0B 1UFFA 2EGAA 3VS6A 2A37A 4J9EA 3I35A 4HVVA 2JM8A 1I0CA 2YUPA 1K0SA 3EHRA 1NYGA 1NEBA 2KBTA 5FW9A 1K76A 2M51A 5GJVB 1OV3A 2L0AA 1PKSA 1T3LA 1UHFA 1T3SA 1G83A 2BTTA 2C0OA 1AVZC 1N5ZA 1WI7A 2RQWA 4RTZA 1KJWA 1WLPB 4OMLA 2HBWA 2QDLA 4OMNA 3I5SA 4M4ZA 1VYVA 1NEGA 3UA6A 1GRIA 3H0IA 4OMOA 2FRYA 2NWMA 3QWXX 2X3WD 4IIMA 1YNZA 2GNCA 1X6GA 4LNPA 4RTTA 2DRKA 5GJWB 1X43A 1W6XA 4HVWA 2L3SA 4LUEA 1QKWA 1RLPC 2CUBA 1ABOA 4GBQA 2LZ6B 1H92A 1OPKA 3PVQA 1BB9A 2EYXA 2LQNA 1Y57A 1M30A 1AZGB 1Z9QA 3VS0A 2AZVA 4J9IA 4RTVA 2VKNA 1U5SA 2LJ1A 1OOTA 4A63B 2JM9A 1YN8A 1GFCA 2C0TA 1U06A 3SEMA 1HD3A 3VS7A 1E6HA 1YCSB 1T0JA 1JU5C 2BZ8A 2V1RA 4K11A 1UTIA 2CT4A 1VYTA 1CKBA 1X69A 4Z88A 1KSWA 1AOJA 5FWBA 5FWCA 1SRLA 3UATA 2CUDA 1K0XA 1SHGA 1TUDA 1QWEA 2DE0X 3M0RA 1AWJA 2KXDA 1JXMA 1NLPC 2P4RA 1Y0MA 2G6FX 1WYXA 3CQTA 5EC7A 4ORZA 2SRCA 3ULRB 1NYFA 3THKA 4OMPA 3EG2A 2DBMA 5I22A 2JTEA 2K3BA 2PNIA 2BZYA 4RTXA 3NMZC 4FSSA 1UDLA 1WIEA 4J9CA 1QKXA 2RNAA 1X2QA 5ECAA 1SPKA 1UG1A 2EW3A 2RQRA 2V1QA 2A36A 2C0IA 1M27C 1KIKA 1SHFA 2YUOA 1W70A 4LE9A 4Z8AA 2JMCA 1SRMA 3NPFA 2AKKA 4R0KA 4X1VA 1K9AA 1ZX6A 2CT3A 4D8DA 2CSQA 4WCIA 1JXOA 5IHNA 3VRYA 1BU1A 1E6GA 1M3CA 4F16A 4AFZC 1UUEA 3RBBB 1U3OA 2SEMA 1WXBA 2EKHA 1NM7A 2D8HA 1OPLA 1MUZA 2DNUA 2DL5A 4OMMA 1LCKA 2K7AA 1FYNA 1PNJA 2MOXA 4JJBA 2YDLA 5IHIA 1XOVA 2DA9A 2DBKA 1H8KA 3VS3A 2PTKA 1Z9ZA 2K9GA 1VYUA 2ABLA 4DEXA 1GCQA 2ENMA 1GCPA 1AWXA 3R6NA 2OAWA 3EHQA 2ED0A 1AEYA 2RN8A 2CH4A 1UECA 2D8JA 2RQVA 4HVUA 3A98A 4J9FA 3TSZA 4D8KA 2DL3A 3H41A 2GBQA 1K4US 2LQWA 2EYWA 2YUNA 4CC4B 1JQQA 2FG0A 1ZLMA 2KXCA 1MV3A 2FPDA 1WXUA 2GTJA 4QT7A 1B07A 4RUGA 3M0SA 4JZ4A 3FJ5A 3M0UA 2KT8A 1I07A 1ZSGA 2I0NA 1PWTA 1ZUUA 1SSHA 1WXTA 3M0TA 4CC7A 3NGPA 2GQIA 2KYBA 2DL8A 3VS1A 2GTOA 3M0QA 2DRMA 3VRZA 4DEYA 1RUWA 1V1CA 4RTWA 2JMAA 5HCKA 1WFWA 2KRMA 3H0HA 2EYYA 2KT1A 1I1JA 1PHTA 1RI9A 1UJ0A 3I5RA 3O5ZA 2O31A 3PE0A 2DVJA 1YWPA 1PRMC 1IO6A 2E5KA 4HCKA 4J9DA 2L2PA 2MCNA 3I9QA 3RNJA 2B86A 2CDTA 2FEIA 2JS0A 3VS5A 2W10A 2J05A 1AWOA 1QCFA 2J06A 4EIKA 3TSWA 1GFDA 3TVTA 1ZUKA 1AD5A 2DYBA 1QWFA 2KR3A 3QWYA 1YWOA 1X6BA 1TUCA 2J7IA 2F2WA 2ED1A 1BBZA 2EYZA 5IHKA 2VWFA 4HXJA 3U23A 3EG0A 2AK5A 2K79A 1AZEA 1PKTA 1UHCA 3SHWA 3C0CA 4GLMA 2K2MA 2EBPA 4J9BA 2PZ1A 2DL7A 2RQUA 1J3TA 2DLPA 4JJCA 2KYMA 2AKLA 2DF6A 1SEMA 1GBQA 2FPEA 3IQLA 1WA7A 2RF0A 4F14A 2O9SA 1HSQA 2LJ3A 5IH2A 1S1NA 2KEAA 1GBRA 3KFVA 2BZXA 4ZNXA 1M3AA 1X27A 2JT4A 2FO0A 4F17A 5I11A 2KROA 1WDXA 2YUQA 2DM1A 1GCQC 2F2XA 2OJ2A 2YSQA 2AZSA 2L3PA 3VS4A 1CSKA 2K6DA 2L3QA 2X3XD 2OI3A
chains in the Genus database with same CATH superfamily
1IB8A 4AFQC 2QQ9A 1CKAA 2YXYA 1KHIA 4XTZA 2CREA 5IN1A 3M58A 4AG1C 1KQSS 3A8HB 4PJMA 2DEQA 2QQSA 2LT1A 1D0YA 1W2BA 1ZBXA 4PJOA 3CCMA 3EFSA 4D6WA 3A1PA 4IIOA 2ROLA 1LJOA 3I56Q 1VIEA 4OF1A 5LJ3d 4KGZB 1YJ9Q 2EGEA 2LCSA 3REAB 2KAFA 4ATOA 4N4IA 4NOYA 2A7YA 4ESRA 2HSPA 1TUGB 5CKHA 1XJWB 3ZEHA 1W1FA 2QTXA 2HDAA 1B3QA 2EVRA 2IIMA 2K4YA 4C0ZA 3HRSA 2DILA 4LUDA 2EIFA 2E41A 4LDUA 4M75F 4LDYA 2M0YA 2LJ0A 3EGDB 1S72Q 3VUZA 3L2VA 2CYZB 3PNWC 3G71Q 3CPWS 4LDXA 2CKKA 1ACMB 3LYIA 2KY9A 1VQOA 1M3BA 2KNBB 3EG9B 4AFSC 3CC2A 3R6OA 4M75E 1KQ1A 3FJPA 3HRUA 2AT1B 4BUGA 3CCQA 2J6OA 4E7HA 4MZMA 2E3IA 2KGTA 2E6ZA 3CPFA 2CZ0B 2CZ6B 4LDVA 4J6WA 1R0CB 1VQ9Q 2LMJA 2O2OA 4RTYA 5KCOA 4BE1A 1KG1A 2KRSA 3RUXA 4JPBW 2HKQB 3L1AA 2DD4A 4MZTA 1E7OA 2EGCA 3CCET 3INZA 2VGNA 5A0LA 4M75C 4JDSA 2YRDA 1MV0B 5EG2A 3VS6A 3MPUB 2FZKB 4J9EA 1UGRB 1FXXA 3X25B 4EPCA 4XTUA 4M7DF 2X4YA 5LJ5g 3EHRA 1NYGA 2E4HA 2RI3A 2JVVA 5GAN8 4LD9K 3EFRA 3RERA 1K9MC 2M51A 4C5HA 3VJPA 1MNEA 2L0AA 2XK0A 1PKSA 5J3BA 3OYBA 3LWHA 4F7UA 1JJ2S 1VQKA 2RQWA 2O4XA 1KJWA 1K73U 3H6ZA 2HBPA 5GAOm 3CC4T 3OW2S 3M56A 1GRIA 1VQLT 4M75B 2ZAEA 3CCSA 3SDZA 1YJNQ 3EGDA 2DRKA 2JTMA 3GNGA 3ZFJA 4EDUA 5KYUA 1YJWT 2RHZA 1YI2A 1QKWA 3G4ST 1RLPC 4BY6B 3AT1B 2LZ6B 2PVDB 4JS5A 1OPKA 1VQPA 4NL3A 2LQNA 1Q7YR 4M7DC 2YWWA 2QGFB 1Q81U 2PQWA 3CMAA 2VKNA 3QKJA 1U5SA 2HSEB 2DO3A 2XDDA 1YN8A 1GFCA 1OYXA 2C0TA 3SEMA 3M59A 4HA8A 2BE9B 3PT9A 4M78C 3CXCP 4EMKB 1JU5C 4MZPA 4OB2B 3V8KA 5LJ5e 2CT4A 1VYTA 3CCVQ 4OB3B 4C92A 4P5NA 2RI5A 1N8RC 1AOJA 1D0ZA 4J83A 3C95A 5GAMe 3UATA 4OGCA 2CUDA 1QWEA 4XU1A 2DE0X 4R55A 2KXDA 1NLPC 1WZOA 3LGLA 4M7AG 2ZPBB 3CCUA 5LL6S 4XTWA 2SRCA 3C94A 3MEUA 5I22A 3GNFB 3CMEQ 2K3BA 2PNIA 4BI4A 1D1BA 1K8AU 2DKGA 4LDWA 1OI1A 1UG1A 2XICA 4OVAA 2C0IA 1W70A 4Z8AA 3A8OB 2JMCA 3LGFA 1SF9A 2AKKA 1VQ8T 5J26A 5FU7B 2LCCA 1OQKA 5CQXA 1RI0A 1K9AA 2X51A 2E10A 4ZN3A 3CC4Q 2DTIA 2RK2A 3VRYA 1BU1A 4F16A 5LJ5h 3RBBB 1U3OA 2SEMA 2R5MA 3GPLA 5FRMA 1NM7A 3HHTB 1Q86C 4C92D 2HMAA 1FYNA 5GAMh 1PNJA 4C0GA 4DOVA 4OB1B 2OTJA 2L8DA 5IHIA 2KVQG 1Y96B 2DBKA 1VYUA 2E3HA 1AEYA 2YHTA 2ED0A 3DB3A 1UECA 1FX7A 2D8JA 4FSXA 2GF7A 4PFZA 2MI6A 4C8QA 1B34B 2DL3A 3UWNA 1IGUA 2AHJB 3ER0A 5DM7R 1K4US 2LQWA 1MMGA 1XTDA 1VQOQ 2MMPA 4QQDA 3CCRA 3F70A 3CC2Q 1JQQA 3BE3A 1YITA 3S3NA 1M8VA 2L3RA 3CD6T 4A4EA 5FU6B 1RAIB 3OMGA 3CCQQ 4KULA 3FJ5A 5A0DA 3M0UA 2KT8A 4L59A 2VC8A 3BW1A 5KCHA 4KGVB 1EZZB 5KH6A 1NBEB 4PK4A 5DLOA 1WGSA 3M0TA 2KYBA 2DL8A 2HQXA 3MEAA 5GANd 3JAME 1UGSB 5KYYB 1M2OA 2KRMA 4N4GA 3N5BB 2KT1A 1I1JA 4HCBA 1QVFP 1OZ2A 4MDXA 3O5ZA 1VQ8Q 1JBMA 4C8QD 4DBRA 3BDUA 5D6XA 4A54A 2K5LA 2B86A 1QCFA 2J06A 4ANJA 1EX4A 1ZUKA 4FT2A 2RH2A 2E5QA 4M75G 2J7IA 2QQAA 1BBZA 1VQKQ 1VQMA 3MKDA 4HXJA 3U23A 4C5GA 3DLMA 4JUVA 2CP7A 2K79A 1AZEA 4R56A 1Q82R 3CCSQ 4DQ2A 4QQ6A 3C0CA 2COYA 4J9BA 1Q81R 1IREB 1W4SA 2DZCA 1M1KR 5KE2A 1WPYA 3OYCA 1OZ3A 1J3TA 2DLPA 4JJCA 4C5IA 8ATCB 1SG5A 2MWOA 2AKLA 1WNLA 8AT1B 4PJOF 4M77A 3FRNA 1D1AA 1TH7A 1WA7A 2RF0A 3A8GB 4Y91A 1VQ6T 1H3ZA 2DD5A 1PC0A 3JCMd 1HSQA 4FIBA 2JJ9A 5IH2A 4FYWB 1M3AA 3CEYA 2FO0A 4Y28E 5CKBA 3OYJA 3CD6Q 1M90C 1HYOA 2CZ1B 4NS5A 4M7DG 3JSCA 3OA6A 5KYYA 3EG1A 1ARKA 5L23A 2J6FA 1BCMA 4E7JA 3PIPA 3HKSA 3JB9H 1FMKA 2HQEA 5GMKi 1BI0A 4M78G 2YT6A 1BK2A 1MGQA 4PJOC 3JCMV 3UT1A 1IXDA 1QP2A 5D6WA 4C0FA 2QEXT 3QG1A 1Q7YC 1WQWA 4M77D 1JO8A 1OX8A 2GGRA 1G2BA 3MJXA 3H0FA 3LH5A 5FRNA 2CSIA 4JJDA 3E9FA 2CP3A 3CCJA 2MPXC 2GFAA 3I56T 1IGQA 2ESWA 1RABB 1YJ9T 2P4TA 3L42A 1HJDA 4J9HA 3A8MB 2XMFA 2X9HA 1VA7A 2KK4A 1YP5A 1JEGA 2A28A 4X34A 3UF4A 3QO3A 4NL2A 2CP2A 1EIFA 2DTOA 5I2SA 4F7UF 2NUTA 1BIBA 2RQTA 3G7ZA 4KH1B 1S72T 3G71T 2FB7A 2M16A 1TU0B 3TREA 2XI9A 3REBB 3L2QA 4N0AA 4F7UE 5CO7A 2FZGB 1D09B 2F2VA 3C12A 3UDCA 2X4JA 3OYAA 5LJ5j 2W0ZA 3G6EQ 1VQ9T 3JCMP 3I35A 1RAAB 1I0CA 1K0SA 5GAMj 3VKIA 1NPRA 2A0FB 2NYSA 1VQ7A 5FW9A 5AT1B 1K76A 2X4WA 3SD4A 3HL8A 1C6VX 1T3LA 1I5OB 1YHQA 1RAEB 1AVZC 2QGGA 4DBQA 3VU3C 2DXTA 4O6JA 4BD3A 2DIQA 2HBWA 3QYHB 5KYXA 2QEXQ 3I5SA 3JCMW 1NEGA 4JRQA 4RCBA 3L2UA 5LJ3g 4C92F 3H0IA 4OMOA 1PM3A 1M4ZA 2FRYA 3T9NA 2DVEA 2RB6A 4QVCA 2EKOA 2QASA 3PGGA 1YNZA 1ZSZA 1X6GA 4RTTA 1KQSA 5GJWB 1X43A 3VYGA 4HVWA 1KK7A 2EQKA 1FMVA 3CCLA 3OYIA 3OYFA 2COZA 4C92E 1W2BP 1H92A 1M2VB 2XG8D 2C06A 1SKUB 1BB9A 4WF2A 1C1AA 2EYXA 2OTLA 1M30A 4VUBA 1U8RA 3JCMf 1Z9QA 2ZPHB 4F7UB 1YJNT 2LJ1A 3LW5E 2O4XB 2JM9A 1U06A 1VQMQ 2YRCA 3RIRA 1WJSA 2RHIA 2K57A 1T0JA 3RKWA 4IUPA 1UTIA 1H641 1VQ4T 4Z88A 5KYUB 4A53A 3CPWA 4LD6A 3MP1A 3QDFA 4XK8E 1K0XA 1TUDA 1HXDA 1UEBA 3M0RA 3OYYA 2P4RA 2G6FX 2CP5A 3CQTA 2RO0A 4BACA 4J5YA 2P84A 3ULRB 2HL3A 1K73C 4OMPA 2KI7A 2DBMA 3CCVT 2JTEA 4JLGA 1I5LA 4XTXA 2QTVA 3V8LA 2KQWA 1QKXA 3RMSA 2RNAA 2DIGA 1QVPA 1JB0E 1SPKA 2RQRA 2CZ7B 1TS9A 1SHFA 2YUOA 4C92B 3OSVA 4C8QF 3OBWA 5CKFA 2XIDA 3MEVA 4FYVB 2HKNA 2RJEA 1XQHA 4X9CA 4R0KA 1ZX6A 3CMET 2CT3A 1TWBA 2D0QB 2EFIA 1Q81C 1NJIR 3JB9G 5CCAA 1E6GA 1M3CA 4BY6C 4AFZC 4C8QE 2F1LA 1M2VA 1WHHA 5KYNA 4PLLA 3LWIA 2EQJA 2K7AA 2NUPB 3NTKA 2XDPA 3X26B 3S3OA 1PD1A 4ME7A 2ZZDA 5GAN5 4YTLA 1Z9ZA 3M5AA 1VQ5A 4PFOA 3OW2A 4EMKC 4PJOG 3CCJQ 5LJ3h 2CH4A 2RQVA 3I55A 2L5QA 5GAOn 3A98A 1I81A 5GAN6 1TTHB 3TSZA 1RAHB 3OYEA 5LJ5d 5GMKe 2B8AA 4E7KA 1NE8A 2GBQA 3OY9A 3PIOA 1Q82U 2YUNA 5GAMd 1K8AC 1VQ4Q 4M7AD 4QQGA 1M1KU 2HQHA 1AT1B 2RJFA 4QT7A 3J81E 1RL2A 4RUGA 3M0SA 2DERA 4OMFB 2QG9B 1I07A 1ZUUA 3MO8A 2ATCB 2CP0A 1SSHA 2PUKB 1LOJA 2BUDA 1VQOT 3NGPA 3E19A 3CC2T 3MCAB 3CBOA 3VRZA 3CXCS 4DEYA 1V1CA 1WHJA 4C8QB 1BCOA 1K9MU 3FB9A 1WFWA 3EGXA 3JCMQ 5FU7C 6AT1B 3CCQT 2EYYA 2IG0A 1YIJA 4KUIA 4M77F 1PHTA 4UC4A 4PLIA 4A4KA 2O31A 5CAIA 3OS1A 1PRMC 2BIVA 2MK5A 3G1JA 1VQ7Q 2L2PA 1G3YA 3I9QA 4L5GA 2FEIA 2CDTA 2NUPA 2JS0A 4PNOA 5GMKh 2W10A 1GFDA 3OS2A 4M77E 3M55A 1QWFA 2FZCB 2KR3A 1YWOA 1X6BA 1YHQQ 3OB9A 4E7LA 3HFOA 2EYZA 5IHKA 3CC7A 2VWFA 4IUVA 3EG0A 2HNIA 3SB2A 1TSFA 3M4GA 1WJRA 3OYNA 4ZTJA 2PZ1A 2RQUA 1RAGB 1ZA2B 2R58A 3CCMQ 3OYKA 1VQKT 2F5KA 1OU9A 2FPEA 2I2LA 5D6YA 5GAN3 2O9SA 3V7CA 2RI2A 3CCST 1S1NA 5FU6C 2FL7A 1N8RU 3KFVA 1KD1R 2BZXA 3V7RA 4OGEA 2JT4A 3JB9I 1VQNA 2FHDA 1WDXA 2DM1A 2GCXA 1GCQC 3S6WA 1YI2T 3VS4A 1CSKA 2K6DA 1IRXA 2L3QA 2X3XD 2WSEE 2NUZA 4PKCC 2JS2A 4J7FA 2QQBA 5C0MA 1GL5A 3CMAT 1VQ6A 2D1XA 1R8OB 4J9GA 4M77B 2HAXA 2JXBA 1UE9A 5GANg 2K3XA 2DXBA 2LX9A 2VVKA 3QXEB 3JV3A 2MIOA 7AT1B 3VS2A 2EQUA 1KFZA 2A3LA 1M5Q1 4OMQA 4M75D 2KMTA 3QZ5B 4AG2C 4JRKA 3OYDA 1K1ZA 2HEQA 1AWWA 1WHLA 2ECZA 4LXCA 1QLYA 2RPNA 2COWA 4M78A 3CCUT 3EAEA 3L2WA 2VXFA 4ELZC 2Y90A 4XQ3A 1U1SA 4PJJA 1UGPB 2LP5A 3EG3A 2CP6A 2LNHB 4KUDK 5LJ5f 2DMOA 1QVFS 4DOWA 2DX1A 4AFUC 2DL4A 2F5TX 1PRLC 3E1SA 1EFNA 2JW4A 5HY6A 4DBFA 2FVUA 5GAMf 3SWNB 3KBGA 2HL5C 1NG2A 1OEBA 4QVZA 5KYWB 2H8HA 4GLKA 2A08A 2ROTA 3QUIA 2VGMA 2V26A 2FRWA 1RADB 3I56A 1VQ5Q 2WSFE 4IUTA 5GANe 2ZPFB 1H3HA 2KRNA 4XTYA 4M7DD 2FPFA 2FYKA 4KBMB 4PFPA 5IXBA 1ABQA 2ZPIB 4N0AC 1YI2Q 1ZBJA 5J39A 4J7IA 3RKYA 1VQPQ 1UFFA 2EGAA 1G5VA 2A37A 4M78D 4HVVA 2JM8A 2YUPA 3CMAQ 1S72A 1N6AA 4BB7A 1MMNA 2V8KA 3QIIA 1NEBA 1Y07A 3OS5A 4QW2A 2NUTB 1K9MR 1X75C 2EJGA 2DTHA 4JRIA 5CKEA 3JB9J 1T3SA 1G83A 4KH0B 1WI7A 3G6ET 5LJ3j 2BE7D 1U1TA 2QA4A 2MF2A 2QDLA 3E9GA 4M4ZA 1VYVA 1VQ9A 3QJYA 2BKDN 2X3WD 4IIMA 1YIJQ 2GNCA 4GY5A 2DYIA 3MP6A 4FM4B 1W6XA 2QI2A 2L3SA 4LUEA 5GANh 3CCUQ 4XU0A 2CUBA 3FEOA 4GBQA 3SWNA 1OU8A 1FWZA 4XU3A 5GAOr 1Y57A 5KYWA 1NJIU 1I8FA 4E2FB 3OBYA 3VS0A 2AZVA 4J9IA 3JRZA 2IPOB 1OOTA 5HKCA 4HCZA 5KYXB 1OX9A 3CC7Q 1HD3A 3HRTA 1YCSB 3QDRB 2Y4YA 2F69A 2BZ8A 4M7AF 2V1RA 4ELYC 2ZPGB 1ZSZB 3M9QA 1Q95G 1C0MA 1X69A 1N8RR 2OAUA 1KSWA 3HSBA 5FWBA 2DK3A 5FWCA 1SRLA 5D7UA 1M90U 1VQMT 1F1BB 4M7AE 1AWJA 1YJNA 5GMKj 1ZA1B 2Y4XA 4A4GA 1Y0MA 2OTJQ 1WYXA 5EC7A 1NYFA 5CIUA 3THKA 1VOMA 3EG2A 3A5ZB 3NTHA 3RKXA 1VQNQ 5KE3A 1V29B 2DJZA 3NMZC 2AIRB 4J9CA 5ECAA 4RMOA 4CI0C 2EW3A 3L2RA 2RJCA 2A36A 2V1QA 2X35A 1SSFA 1P92A 4LE9A 1QVGA 3FIFA 1LNXA 3MP8A 1SRMA 3FC3A 1JRIA 2GFUA 1QVGP 3CCRQ 3LLRA 2RD1A 2V8IA 2EJ9A 1MMDA 3QHSA 1YITQ 5HK3A 2V8JA 1AHJB 3CCVA 2CSQA 1B7TA 1JXOA 5IHNA 3EFOB 4FW2A 1KC8U 2DFUA 1WXBA 2DAQA 2EKHA 2D8HA 1Q86R 3BFMA 2K5IA 3PMIA 1QCNA 3HFNA 5GAOp 2MOXA 3CCEA 1XOVA 2DA9A 4XTVA 3X20B 3QYGB 1GCPA 1AWXA 4M7AB 2OAWA 3EHQA 1V76A 3R6NA 2VXEA 3M53A 3ZBDA 2RN8A 2LDMA 2PVGB 5GAN7 2JUFA 4HVUA 2JOYA 3HPWA 4FT4A 2DXCA 1IZ6A 2E12A 2K3YA 1KQSP 4C5EA 3FLGA 4FU6A 5I21A 3QBYA 4QKUA 5L8RE 1ZLMA 2KXCA 2RHXA 3CC4A 1W2BS 1MV3A 3CCJT 2FPDA 1O75A 5DLQE 1HK9A 2GTJA 2LT4A 3WXMB 1VQLA 1B07A 1I4K1 3ME9A 4JZ4A 1YFNA 1UGQB 2LC4A 1ZSGA 1PWTA 1D3BB 1Y71A 1WXTA 4JRPA 1YJWA 2LQKA 3G4SA 1UB4A 4CC7A 2GQIA 5I2MA 3VS1A 2GTOA 1KD1U 1RUWA 4RTWA 2JMAA 4C92C 2L89A 2VYTA 3H0HA 3OYLA 4E47A 3CPWP 1RI9A 3P8BB 2XD0A 1M1FA 2P0PA 2QYZA 3EFOA 3JB9D 3I5RA 3PE0A 1GXIE 3EH1A 5GAN2 3V7SA 2E5KA 1N27A 3LH0A 4HCKA 1WJQA 4J9DA 2PUOB 2VASA 5CKDA 5LJ3e 1RAFB 3RNJA 3C4SA 1R0BG 1AWOA 2J05A 1WHMA 4BE0A 3TVTA 5IAYA 4JLIA 3JCMc 1N9SA 1MMAA 2DPPB 2D9TA 2O01E 1ZQ1A 3OMCA 2KSSA 5GMKm 1G3TA 2QA4Q 4M7AA 4PJOD 1Q82C 2QXFA 3EGXB 1PKTA 5A0GA 1VQ7T 3URGA 4B9WA 4GLMA 4WTOB 2EBPA 1WHKA 1OULA 4A4FA 1M1KC 4C0DC 4QVDA 1YHQT 2KYMA 3S3MA 1G3SA 2DF6A 1SEMA 4IKFA 3IQLA 2K2VA 4AT1B 4RG2A 3BY7A 2HZYA 3QJ6A 1LPLA 2LJ3A 1JJ2A 2KEAA 1VQ8A 1GBRA 2XU8A 2E1HA 4F17A 2KROA 1D3BA 1JJ2P 4J6YA 2G3RA 5GAMg 2OJ2A 2F2XA 3CCMT 1QP3A 5CVIA 2EAYA 3CCLT 1M90R 4PJLA 4M78F 3OW2P 2RHYA 4ZTFA 4M7DE 2WSCE 4FYYB 5GAOq 2OI3A 4C8QC 2GQVA 2OTLT 4C0DB 3X24B 1IHVA 4JZ3A 3PTAA 4EMHA 3J80E 3GLXA 4EMGA 4F04B 5GANj 4CC3A 2O9VA 1T0HA 2RM4A 4M78E 4HCCA 2RA2A 1WQ7A 3DKMA 4E7SA 1G8XA 3TQ7P 1TG0A 2XHCA 4XU2A 1M8MA 4RTUA 3EG9A 2XDBA 1YBYA 2J6KA 2CH4W 2LX7A 2CGHA 3DB4A 5IXFA 3GBQA 1ZUYA 3RR6A 1BI3A 2PU9B 4B6MA 4Y92A 3EH2A 2YLCA 3CXCA 2EQIA 1KC8R 3Q1JA 1WHGA 4FYXB 1BIAA 3CD6A 2JTFA 4ZGEB 4Z89A 3PFSA 1X01A 3ZL7C 2QK0A 5M9OA 1NLOC 4TVRA 2RJDA 3VUBA 3JCMb 5CQYA 3M0PA 4V2SA 3NHNA 2MYSA 3MHXA 3PVLA 1WX6A 3M57A 1O9SA 2E70A 5GMKl 1UJYA 2DETA 1RLQC 2D0NA 2D6FA 1VUBA 3OYGA 4M7DB 1A0NB 2E6NA 3CCEQ 2KE9A 4LN2A 4BDZA 3EGUA 3WVDB 2P0KA 2HCKA 4J6XA 3UPUA 5CR2A 4M78B 3VV0A 2O88A 5LJ3f 4KRTA 4E6RA 3UA7A 1MNDA 4CC2A 3GIBA 2RMOA 1D0XA 1UGVA 2QQRA 3NTIA 2DJQA 4F7UG 3CCLQ 1MHNA 4M75A 1X2KA 4M77C 2EPDA 3A8LB 2Z0WA 5CK9A 2OTLQ 2HD0A 1VQ5T 1PD0A 2IVWA 3TCJA 1VQLQ 3I55T 2KBTA 3J7AF 4Z02A 1FMWA 2R5AA 3L2ZA 3QSUA 5GJVB 1OV3A 1Y7XA 5GAOl 4IUUA 3OSSC 1UHFA 4KGXB 1YJWQ 2BTTA 3G4SQ 2H3JA 2C0OA 1VQPT 1N5ZA 5A2QE 4BE2A 4RTZA 3OQ5A 1WLPB 4OMLA 3VYHB 2ZCFB 4OMNA 5IT9E 3UA6A 3LX7A 4EMKA 2QDYB 3QPHA 2NWMA 3QWXX 1RACB 4LNPA 3FDRA 2LRQA 1M1GA 1NZ9A 1ABOA 4MDWA 3PVQA 4J8OA 1BKBA 4C92G 3G6EA 4M7DA 3SWNC 3RMQA 1AZGB 4Q5WA 4RTVA 1ZHIA 1YIJT 4A63B 2JZ2A 1Q86U 2CS7A 3ASKA 3VS7A 1E6HA 3D7SB 4MMLA 3H9NA 4K11A 2VV5A 2LQ8A 4RKUE 4KT0E 1CKBA 5HK0A 2QEXA 2LVMA 2LTOA 5FLXE 1QVFA 1SHGA 3CC7T 2DZ9A 1JXMA 4CRIA 1NPPA 2M1HA 4ORZA 3TU4K 1K73R 1KHCA 2BZYA 4RTXA 1YJ9A 4DA4A 4FSSA 1UDLA 1WIEA 3KXTA 4RCCA 3JCMg 1X2QA 3I55Q 3JB9F 2EYQA 1Y96A 1M27C 4JS4A 1KIKA 3BDLA 2OTJT 3JCMJ 1LVKA 1KQ2A 2MAMA 3NPFA 2JNGA 4BDYA 2EWNA 2RHUA 4FL6A 4X1VA 2VUBA 1VQNT 2VB6A 4D8DA 3OS0A 1B34A 1NJIC 4IUQA 3OYMA 4WCIA 3G71A 2KDSA 1UUEA 5FROA 4O5VA 4PL6A 1BI1A 2MWPA 4C8QG 1OPLA 1MUZA 2DNUA 3GP8A 2DL5A 4OMMA 1LCKA 2DEUA 3NFCA 4FCYA 4JJBA 3GOXA 2YDLA 3CCRT 3M54A 4L6V5 1YITT 1H8KA 3VS3A 2PTKA 3WVEB 2K9GA 4PJOE 2ABLA 4DEXA 1GCQA 2ENMA 4PJNA 1XNIA 3DLLA 2P0QA 4RG8A 3V8JA 3OYHA 4J9FA 1ZSZC 1TXQA 1QCOA 1TOVA 4D8KA 4OP0A 3H41A 2E64A 9ATCB 3GF5A 3RESA 4ZN1A 2EYWA 4A4HA 4CC4B 1BYMA 3JCMe 1PCXA 2XKOC 2FG0A 1K8AR 1R77A 1WXUA 3TEEA 4MMKA 3HTRA 1QQJA 1PG5B 1YCYA 2I0NA 2R57A 2M02A 3H8ZA 3RDVA 1M9SA 4OB0B 4HT9A 3X28B 2M0OA 4B9XA 3M0QA 2DRMA 4DBHA 4ZGDB 4JJNK 3QZ9B 3CBMA 5HCKA 3JCMX 1KC8C 2YRVA 1X6OA 3P8DA 4II1A 2ZPEB 5C6SA 4HT8A 3HP9A 1QMCA 2K5FA 2LNVA 1VIFA 1UJ0A 2DXUA 3O8VA 4N4HA 2DVJA 1YWPA 1G3WA 1IO6A 1PSEA 2ZGWA 3MEWA 1IHWA 4PJOB 2MCNA 3M4YA 1DJ7B 3VS5A 3KUFA 3CBPA 5DY9A 4EIKA 3TSWA 3E2UA 1VQ4A 4X9DA 2OX7A 1AD5A 4BI8B 2DYBA 3JCMh 4M77G 4E7IA 3QWYA 1TUCA 2JN0A 2F2WA 2ED1A 2LCLA 2WACA 2H3EB 2E65A 3PMTA 1VQ6Q 1N9RA 2YLBA 2X4XA 2AK5A 1QW1A 3P8HA 4M7AC 4XAXB 1Q7YU 1UHCA 4AMCA 3SHWA 4ZGJB 2K2MA 2EJFA 3META 2DL7A 5GANf 1QVGS 5GAN4 3SFMA 1GBQA 2NLUA 2QA4T 4F14A 2PVOB 1BI2A 4BI3A 1KD1C 4IURA 4ZNXA 1X27A 1PSFA 2M9UA 5I11A 2EQMA 3CMEA 3AHUA 2YUQA 4HKEA 1D1CA 2RK1A 2YSQA 4E7ZA 2AZSA 2L3PA 2QAZA 5AYFA 4FW1A
chains in the Genus database with same CATH topology
4AFQC 2NUZA 2JS2A 1CKAA 1GL5A 4JZ3A 3EG1A 1ARKA 5L23A 2D1XA 2CREA 4CC3A 4J9GA 2O9VA 1T0HA 2J6FA 4AG1C 1FMKA 2JXBA 1UE9A 2YT6A 1TG0A 1BK2A 2VVKA 3JV3A 2MIOA 1M8MA 4IIOA 2ROLA 4RTUA 3VS2A 2J6KA 2LX7A 2CH4W 1KFZA 2EGEA 4OMQA 2LCSA 3REAB 5IXFA 3GBQA 4AG2C 1JO8A 1ZUYA 2GGRA 4ESRA 1G2BA 4Y92A 1K1ZA 2HEQA 2HSPA 1AWWA 2ECZA 3H0FA 3LH5A 2EQIA 1QLYA 1W1FA 2HDAA 2RPNA 2IIMA 1B3QA 2EVRA 2CSIA 4JJDA 2DILA 4LUDA 4Z89A 2M0YA 3ZL7C 2ESWA 1NLOC 2LJ0A 2LP5A 3EG3A 2LNHB 1HJDA 4J9HA 2DMOA 3M0PA 3NHNA 2XMFA 2DX1A 3PVLA 4AFUC 2DL4A 1WX6A 1M3BA 1PRLC 1VA7A 1EFNA 2KNBB 4AFSC 2JW4A 1UJYA 1RLQC 2D0NA 1YP5A 1JEGA 2A28A 1A0NB 3UF4A 1NG2A 1OEBA 2KE9A 4LN2A 2H8HA 2J6OA 2A08A 2ROTA 2KGTA 2RQTA 3EGUA 2FRWA 2HCKA 2LMJA 2O2OA 4RTYA 2O88A 4KRTA 4E6RA 3UA7A 4CC2A 3REBB 2KRSA 2KRNA 1H3HA 2RMOA 2FPFA 4JPBW 1UGVA 5IXBA 1ABQA 2DJQA 1E7OA 2F2VA 1ZBJA 2EGCA 1X2KA 2W0ZA 2EPDA 1MV0B 1UFFA 2EGAA 3VS6A 2A37A 4J9EA 3I35A 4HVVA 2JM8A 1I0CA 2YUPA 1K0SA 3EHRA 1NYGA 1NEBA 2KBTA 5FW9A 1K76A 2M51A 5GJVB 1OV3A 2L0AA 1PKSA 1T3LA 1UHFA 1T3SA 1G83A 2BTTA 2C0OA 1AVZC 1N5ZA 1WI7A 2RQWA 4RTZA 1KJWA 1WLPB 4OMLA 2HBWA 2QDLA 4OMNA 3I5SA 4M4ZA 1VYVA 1NEGA 3UA6A 1GRIA 3H0IA 4OMOA 2FRYA 2NWMA 3QWXX 2X3WD 4IIMA 1YNZA 2GNCA 1X6GA 4LNPA 4RTTA 2DRKA 5GJWB 1X43A 1W6XA 4HVWA 2L3SA 4LUEA 1QKWA 1RLPC 2CUBA 1ABOA 4GBQA 2LZ6B 1H92A 1OPKA 3PVQA 1BB9A 2EYXA 2LQNA 1Y57A 1M30A 1AZGB 1Z9QA 3VS0A 2AZVA 4J9IA 4RTVA 2VKNA 1U5SA 2LJ1A 1OOTA 4A63B 2JM9A 1YN8A 1GFCA 2C0TA 1U06A 3SEMA 1HD3A 3VS7A 1E6HA 1YCSB 1T0JA 1JU5C 2BZ8A 2V1RA 4K11A 1UTIA 2CT4A 1VYTA 1CKBA 1X69A 4Z88A 1KSWA 1AOJA 5FWBA 5FWCA 1SRLA 3UATA 2CUDA 1K0XA 1SHGA 1TUDA 1QWEA 2DE0X 3M0RA 1AWJA 2KXDA 1JXMA 1NLPC 2P4RA 1Y0MA 2G6FX 1WYXA 3CQTA 5EC7A 4ORZA 2SRCA 3ULRB 1NYFA 3THKA 4OMPA 3EG2A 2DBMA 5I22A 2JTEA 2K3BA 2PNIA 2BZYA 4RTXA 3NMZC 4FSSA 1UDLA 1WIEA 4J9CA 1QKXA 2RNAA 1X2QA 5ECAA 1SPKA 1UG1A 2EW3A 2RQRA 2V1QA 2A36A 2C0IA 1M27C 1KIKA 1SHFA 2YUOA 1W70A 4LE9A 4Z8AA 2JMCA 1SRMA 3NPFA 2AKKA 4R0KA 4X1VA 1K9AA 1ZX6A 2CT3A 4D8DA 2CSQA 4WCIA 1JXOA 5IHNA 3VRYA 1BU1A 1E6GA 1M3CA 4F16A 4AFZC 1UUEA 3RBBB 1U3OA 2SEMA 1WXBA 2EKHA 1NM7A 2D8HA 1OPLA 1MUZA 2DNUA 2DL5A 4OMMA 1LCKA 2K7AA 1FYNA 1PNJA 2MOXA 4JJBA 2YDLA 5IHIA 1XOVA 2DA9A 2DBKA 1H8KA 3VS3A 2PTKA 1Z9ZA 2K9GA 1VYUA 2ABLA 4DEXA 1GCQA 2ENMA 1GCPA 1AWXA 3R6NA 2OAWA 3EHQA 2ED0A 1AEYA 2RN8A 2CH4A 1UECA 2D8JA 2RQVA 4HVUA 3A98A 4J9FA 3TSZA 4D8KA 2DL3A 3H41A 2GBQA 1K4US 2LQWA 2EYWA 2YUNA 4CC4B 1JQQA 2FG0A 1ZLMA 2KXCA 1MV3A 2FPDA 1WXUA 2GTJA 4QT7A 1B07A 4RUGA 3M0SA 4JZ4A 3FJ5A 3M0UA 2KT8A 1I07A 1ZSGA 2I0NA 1PWTA 1ZUUA 1SSHA 1WXTA 3M0TA 4CC7A 3NGPA 2GQIA 2KYBA 2DL8A 3VS1A 2GTOA 3M0QA 2DRMA 3VRZA 4DEYA 1RUWA 1V1CA 4RTWA 2JMAA 5HCKA 1WFWA 2KRMA 3H0HA 2EYYA 2KT1A 1I1JA 1PHTA 1RI9A 1UJ0A 3I5RA 3O5ZA 2O31A 3PE0A 2DVJA 1YWPA 1PRMC 1IO6A 2E5KA 4HCKA 4J9DA 2L2PA 2MCNA 3I9QA 3RNJA 2B86A 2CDTA 2FEIA 2JS0A 3VS5A 2W10A 2J05A 1AWOA 1QCFA 2J06A 4EIKA 3TSWA 1GFDA 3TVTA 1ZUKA 1AD5A 2DYBA 1QWFA 2KR3A 3QWYA 1YWOA 1X6BA 1TUCA 2J7IA 2F2WA 2ED1A 1BBZA 2EYZA 5IHKA 2VWFA 4HXJA 3U23A 3EG0A 2AK5A 2K79A 1AZEA 1PKTA 1UHCA 3SHWA 3C0CA 4GLMA 2K2MA 2EBPA 4J9BA 2PZ1A 2DL7A 2RQUA 1J3TA 2DLPA 4JJCA 2KYMA 2AKLA 2DF6A 1SEMA 1GBQA 2FPEA 3IQLA 1WA7A 2RF0A 4F14A 2O9SA 1HSQA 2LJ3A 5IH2A 1S1NA 2KEAA 1GBRA 3KFVA 2BZXA 4ZNXA 1M3AA 1X27A 2JT4A 2FO0A 4F17A 5I11A 2KROA 1WDXA 2YUQA 2DM1A 1GCQC 2F2XA 2OJ2A 2YSQA 2AZSA 2L3PA 3VS4A 1CSKA 2K6DA 2L3QA 2X3XD 2OI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFQ C;  2NUZ A;  2JS2 A;  1CKA A;  1GL5 A;  4JZ3 A;  3EG1 A;  1ARK A;  5L23 A;  2D1X A;  2CRE A;  4CC3 A;  4J9G A;  2O9V A;  1T0H A;  2J6F A;  4AG1 C;  1FMK A;  2JXB A;  1UE9 A;  2YT6 A;  1TG0 A;  1BK2 A;  2VVK A;  3JV3 A;  2MIO A;  1M8M A;  4IIO A;  2ROL A;  4RTU A;  3VS2 A;  2J6K A;  2LX7 A;  2CH4 W;  1KFZ A;  2EGE A;  4OMQ A;  2LCS A;  3REA B;  5IXF A;  3GBQ A;  4AG2 C;  1JO8 A;  1ZUY A;  2GGR A;  4ESR A;  1G2B A;  4Y92 A;  1K1Z A;  2HEQ A;  2HSP A;  1AWW A;  2ECZ A;  3H0F A;  3LH5 A;  2EQI A;  1QLY A;  1W1F A;  2HDA A;  2RPN A;  2IIM A;  1B3Q A;  2EVR A;  2CSI A;  4JJD A;  2DIL A;  4LUD A;  4Z89 A;  2M0Y A;  3ZL7 C;  2ESW A;  1NLO C;  2LJ0 A;  2LP5 A;  3EG3 A;  2LNH B;  1HJD A;  4J9H A;  2DMO A;  3M0P A;  3NHN A;  2XMF A;  2DX1 A;  3PVL A;  4AFU C;  2DL4 A;  1WX6 A;  1M3B A;  1PRL C;  1VA7 A;  1EFN A;  2KNB B;  4AFS C;  2JW4 A;  1UJY A;  1RLQ C;  2D0N A;  1YP5 A;  1JEG A;  2A28 A;  1A0N B;  3UF4 A;  1NG2 A;  1OEB A;  2KE9 A;  4LN2 A;  2H8H A;  2J6O A;  2A08 A;  2ROT A;  2KGT A;  2RQT A;  3EGU A;  2FRW A;  2HCK A;  2LMJ A;  2O2O A;  4RTY A;  2O88 A;  4KRT A;  4E6R A;  3UA7 A;  4CC2 A;  3REB B;  2KRS A;  2KRN A;  1H3H A;  2RMO A;  2FPF A;  4JPB W;  1UGV A;  5IXB A;  1ABQ A;  2DJQ A;  1E7O A;  2F2V A;  1ZBJ A;  2EGC A;  1X2K A;  2W0Z A;  2EPD A;  1MV0 B;  1UFF A;  2EGA A;  3VS6 A;  2A37 A;  4J9E A;  3I35 A;  4HVV A;  2JM8 A;  1I0C A;  2YUP A;  1K0S A;  3EHR A;  1NYG A;  1NEB A;  2KBT A;  5FW9 A;  1K76 A;  2M51 A;  5GJV B;  1OV3 A;  2L0A A;  1PKS A;  1T3L A;  1UHF A;  1T3S A;  1G83 A;  2BTT A;  2C0O A;  1AVZ C;  1N5Z A;  1WI7 A;  2RQW A;  4RTZ A;  1KJW A;  1WLP B;  4OML A;  2HBW A;  2QDL A;  4OMN A;  3I5S A;  4M4Z A;  1VYV A;  1NEG A;  3UA6 A;  1GRI A;  3H0I A;  4OMO A;  2FRY A;  2NWM A;  3QWX X;  2X3W D;  4IIM A;  1YNZ A;  2GNC A;  1X6G A;  4LNP A;  4RTT A;  2DRK A;  5GJW B;  1X43 A;  1W6X A;  4HVW A;  2L3S A;  4LUE A;  1QKW A;  1RLP C;  2CUB A;  1ABO A;  4GBQ A;  2LZ6 B;  1H92 A;  1OPK A;  3PVQ A;  1BB9 A;  2EYX A;  2LQN A;  1Y57 A;  1M30 A;  1AZG B;  1Z9Q A;  3VS0 A;  2AZV A;  4J9I A;  4RTV A;  2VKN A;  1U5S A;  2LJ1 A;  1OOT A;  4A63 B;  2JM9 A;  1YN8 A;  1GFC A;  2C0T A;  1U06 A;  3SEM A;  1HD3 A;  3VS7 A;  1E6H A;  1YCS B;  1T0J A;  1JU5 C;  2BZ8 A;  2V1R A;  4K11 A;  1UTI A;  2CT4 A;  1VYT A;  1CKB A;  1X69 A;  4Z88 A;  1KSW A;  1AOJ A;  5FWB A;  5FWC A;  1SRL A;  3UAT A;  2CUD A;  1K0X A;  1SHG A;  1TUD A;  1QWE A;  2DE0 X;  3M0R A;  1AWJ A;  2KXD A;  1JXM A;  1NLP C;  2P4R A;  1Y0M A;  2G6F X;  1WYX A;  3CQT A;  5EC7 A;  4ORZ A;  2SRC A;  3ULR B;  1NYF A;  3THK A;  4OMP A;  3EG2 A;  2DBM A;  5I22 A;  2JTE A;  2K3B A;  2PNI A;  2BZY A;  4RTX A;  3NMZ C;  4FSS A;  1UDL A;  1WIE A;  4J9C A;  1QKX A;  2RNA A;  1X2Q A;  5ECA A;  1SPK A;  1UG1 A;  2EW3 A;  2RQR A;  2V1Q A;  2A36 A;  2C0I A;  1M27 C;  1KIK A;  1SHF A;  2YUO A;  1W70 A;  4LE9 A;  4Z8A A;  2JMC A;  1SRM A;  3NPF A;  2AKK A;  4R0K A;  4X1V A;  1K9A A;  1ZX6 A;  2CT3 A;  4D8D A;  2CSQ A;  4WCI A;  1JXO A;  5IHN A;  3VRY A;  1BU1 A;  1E6G A;  1M3C A;  4F16 A;  4AFZ C;  1UUE A;  3RBB B;  1U3O A;  2SEM A;  1WXB A;  2EKH A;  1NM7 A;  2D8H A;  1OPL A;  1MUZ A;  2DNU A;  2DL5 A;  4OMM A;  1LCK A;  2K7A A;  1FYN A;  1PNJ A;  2MOX A;  4JJB A;  2YDL A;  5IHI A;  1XOV A;  2DA9 A;  2DBK A;  1H8K A;  3VS3 A;  2PTK A;  1Z9Z A;  2K9G A;  1VYU A;  2ABL A;  4DEX A;  1GCQ A;  2ENM A;  1GCP A;  1AWX A;  3R6N A;  2OAW A;  3EHQ A;  2ED0 A;  1AEY A;  2RN8 A;  2CH4 A;  1UEC A;  2D8J A;  2RQV A;  4HVU A;  3A98 A;  4J9F A;  3TSZ A;  4D8K A;  2DL3 A;  3H41 A;  2GBQ A;  1K4U S;  2LQW A;  2EYW A;  2YUN A;  4CC4 B;  1JQQ A;  2FG0 A;  1ZLM A;  2KXC A;  1MV3 A;  2FPD A;  1WXU A;  2GTJ A;  4QT7 A;  1B07 A;  4RUG A;  3M0S A;  4JZ4 A;  3FJ5 A;  3M0U A;  2KT8 A;  1I07 A;  1ZSG A;  2I0N A;  1PWT A;  1ZUU A;  1SSH A;  1WXT A;  3M0T A;  4CC7 A;  3NGP A;  2GQI A;  2KYB A;  2DL8 A;  3VS1 A;  2GTO A;  3M0Q A;  2DRM A;  3VRZ A;  4DEY A;  1RUW A;  1V1C A;  4RTW A;  2JMA A;  5HCK A;  1WFW A;  2KRM A;  3H0H A;  2EYY A;  2KT1 A;  1I1J A;  1PHT A;  1RI9 A;  1UJ0 A;  3I5R A;  3O5Z A;  2O31 A;  3PE0 A;  2DVJ A;  1YWP A;  1PRM C;  1IO6 A;  2E5K A;  4HCK A;  4J9D A;  2L2P A;  2MCN A;  3I9Q A;  3RNJ A;  2B86 A;  2CDT A;  2FEI A;  2JS0 A;  3VS5 A;  2W10 A;  2J05 A;  1AWO A;  1QCF A;  2J06 A;  4EIK A;  3TSW A;  1GFD A;  3TVT A;  1ZUK A;  1AD5 A;  2DYB A;  1QWF A;  2KR3 A;  3QWY A;  1YWO A;  1X6B A;  1TUC A;  2J7I A;  2F2W A;  2ED1 A;  1BBZ A;  2EYZ A;  5IHK A;  2VWF A;  4HXJ A;  3U23 A;  3EG0 A;  2AK5 A;  2K79 A;  1AZE A;  1PKT A;  1UHC A;  3SHW A;  3C0C A;  4GLM A;  2K2M A;  2EBP A;  4J9B A;  2PZ1 A;  2DL7 A;  2RQU A;  1J3T A;  2DLP A;  4JJC A;  2KYM A;  2AKL A;  2DF6 A;  1SEM A;  1GBQ A;  2FPE A;  3IQL A;  1WA7 A;  2RF0 A;  4F14 A;  2O9S A;  1HSQ A;  2LJ3 A;  5IH2 A;  1S1N A;  2KEA A;  1GBR A;  3KFV A;  2BZX A;  4ZNX A;  1M3A A;  1X27 A;  2JT4 A;  2FO0 A;  4F17 A;  5I11 A;  2KRO A;  1WDX A;  2YUQ A;  2DM1 A;  1GCQ C;  2F2X A;  2OJ2 A;  2YSQ A;  2AZS A;  2L3P A;  3VS4 A;  1CSK A;  2K6D A;  2L3Q A;  2X3X D;  2OI3 A; 
#chains in the Genus database with same CATH topology
 1IB8 A;  4AFQ C;  2QQ9 A;  1CKA A;  2YXY A;  1KHI A;  4XTZ A;  2CRE A;  5IN1 A;  3M58 A;  4AG1 C;  1KQS S;  3A8H B;  4PJM A;  2DEQ A;  2QQS A;  2LT1 A;  1D0Y A;  1W2B A;  1ZBX A;  4PJO A;  3CCM A;  3EFS A;  4D6W A;  3A1P A;  4IIO A;  2ROL A;  1LJO A;  3I56 Q;  1VIE A;  4OF1 A;  5LJ3 d;  4KGZ B;  1YJ9 Q;  2EGE A;  2LCS A;  3REA B;  2KAF A;  4ATO A;  4N4I A;  4NOY A;  2A7Y A;  4ESR A;  2HSP A;  1TUG B;  5CKH A;  1XJW B;  3ZEH A;  1W1F A;  2QTX A;  2HDA A;  1B3Q A;  2EVR A;  2IIM A;  2K4Y A;  4C0Z A;  3HRS A;  2DIL A;  4LUD A;  2EIF A;  2E41 A;  4LDU A;  4M75 F;  4LDY A;  2M0Y A;  2LJ0 A;  3EGD B;  1S72 Q;  3VUZ A;  3L2V A;  2CYZ B;  3PNW C;  3G71 Q;  3CPW S;  4LDX A;  2CKK A;  1ACM B;  3LYI A;  2KY9 A;  1VQO A;  1M3B A;  2KNB B;  3EG9 B;  4AFS C;  3CC2 A;  3R6O A;  4M75 E;  1KQ1 A;  3FJP A;  3HRU A;  2AT1 B;  4BUG A;  3CCQ A;  2J6O A;  4E7H A;  4MZM A;  2E3I A;  2KGT A;  2E6Z A;  3CPF A;  2CZ0 B;  2CZ6 B;  4LDV A;  4J6W A;  1R0C B;  1VQ9 Q;  2LMJ A;  2O2O A;  4RTY A;  5KCO A;  4BE1 A;  1KG1 A;  2KRS A;  3RUX A;  4JPB W;  2HKQ B;  3L1A A;  2DD4 A;  4MZT A;  1E7O A;  2EGC A;  3CCE T;  3INZ A;  2VGN A;  5A0L A;  4M75 C;  4JDS A;  2YRD A;  1MV0 B;  5EG2 A;  3VS6 A;  3MPU B;  2FZK B;  4J9E A;  1UGR B;  1FXX A;  3X25 B;  4EPC A;  4XTU A;  4M7D F;  2X4Y A;  5LJ5 g;  3EHR A;  1NYG A;  2E4H A;  2RI3 A;  2JVV A;  5GAN 8;  4LD9 K;  3EFR A;  3RER A;  1K9M C;  2M51 A;  4C5H A;  3VJP A;  1MNE A;  2L0A A;  2XK0 A;  1PKS A;  5J3B A;  3OYB A;  3LWH A;  4F7U A;  1JJ2 S;  1VQK A;  2RQW A;  2O4X A;  1KJW A;  1K73 U;  3H6Z A;  2HBP A;  5GAO m;  3CC4 T;  3OW2 S;  3M56 A;  1GRI A;  1VQL T;  4M75 B;  2ZAE A;  3CCS A;  3SDZ A;  1YJN Q;  3EGD A;  2DRK A;  2JTM A;  3GNG A;  3ZFJ A;  4EDU A;  5KYU A;  1YJW T;  2RHZ A;  1YI2 A;  1QKW A;  3G4S T;  1RLP C;  4BY6 B;  3AT1 B;  2LZ6 B;  2PVD B;  4JS5 A;  1OPK A;  1VQP A;  4NL3 A;  2LQN A;  1Q7Y R;  4M7D C;  2YWW A;  2QGF B;  1Q81 U;  2PQW A;  3CMA A;  2VKN A;  3QKJ A;  1U5S A;  2HSE B;  2DO3 A;  2XDD A;  1YN8 A;  1GFC A;  1OYX A;  2C0T A;  3SEM A;  3M59 A;  4HA8 A;  2BE9 B;  3PT9 A;  4M78 C;  3CXC P;  4EMK B;  1JU5 C;  4MZP A;  4OB2 B;  3V8K A;  5LJ5 e;  2CT4 A;  1VYT A;  3CCV Q;  4OB3 B;  4C92 A;  4P5N A;  2RI5 A;  1N8R C;  1AOJ A;  1D0Z A;  4J83 A;  3C95 A;  5GAM e;  3UAT A;  4OGC A;  2CUD A;  1QWE A;  4XU1 A;  2DE0 X;  4R55 A;  2KXD A;  1NLP C;  1WZO A;  3LGL A;  4M7A G;  2ZPB B;  3CCU A;  5LL6 S;  4XTW A;  2SRC A;  3C94 A;  3MEU A;  5I22 A;  3GNF B;  3CME Q;  2K3B A;  2PNI A;  4BI4 A;  1D1B A;  1K8A U;  2DKG A;  4LDW A;  1OI1 A;  1UG1 A;  2XIC A;  4OVA A;  2C0I A;  1W70 A;  4Z8A A;  3A8O B;  2JMC A;  3LGF A;  1SF9 A;  2AKK A;  1VQ8 T;  5J26 A;  5FU7 B;  2LCC A;  1OQK A;  5CQX A;  1RI0 A;  1K9A A;  2X51 A;  2E10 A;  4ZN3 A;  3CC4 Q;  2DTI A;  2RK2 A;  3VRY A;  1BU1 A;  4F16 A;  5LJ5 h;  3RBB B;  1U3O A;  2SEM A;  2R5M A;  3GPL A;  5FRM A;  1NM7 A;  3HHT B;  1Q86 C;  4C92 D;  2HMA A;  1FYN A;  5GAM h;  1PNJ A;  4C0G A;  4DOV A;  4OB1 B;  2OTJ A;  2L8D A;  5IHI A;  2KVQ G;  1Y96 B;  2DBK A;  1VYU A;  2E3H A;  1AEY A;  2YHT A;  2ED0 A;  3DB3 A;  1UEC A;  1FX7 A;  2D8J A;  4FSX A;  2GF7 A;  4PFZ A;  2MI6 A;  4C8Q A;  1B34 B;  2DL3 A;  3UWN A;  1IGU A;  2AHJ B;  3ER0 A;  5DM7 R;  1K4U S;  2LQW A;  1MMG A;  1XTD A;  1VQO Q;  2MMP A;  4QQD A;  3CCR A;  3F70 A;  3CC2 Q;  1JQQ A;  3BE3 A;  1YIT A;  3S3N A;  1M8V A;  2L3R A;  3CD6 T;  4A4E A;  5FU6 B;  1RAI B;  3OMG A;  3CCQ Q;  4KUL A;  3FJ5 A;  5A0D A;  3M0U A;  2KT8 A;  4L59 A;  2VC8 A;  3BW1 A;  5KCH A;  4KGV B;  1EZZ B;  5KH6 A;  1NBE B;  4PK4 A;  5DLO A;  1WGS A;  3M0T A;  2KYB A;  2DL8 A;  2HQX A;  3MEA A;  5GAN d;  3JAM E;  1UGS B;  5KYY B;  1M2O A;  2KRM A;  4N4G A;  3N5B B;  2KT1 A;  1I1J A;  4HCB A;  1QVF P;  1OZ2 A;  4MDX A;  3O5Z A;  1VQ8 Q;  1JBM A;  4C8Q D;  4DBR A;  3BDU A;  5D6X A;  4A54 A;  2K5L A;  2B86 A;  1QCF A;  2J06 A;  4ANJ A;  1EX4 A;  1ZUK A;  4FT2 A;  2RH2 A;  2E5Q A;  4M75 G;  2J7I A;  2QQA A;  1BBZ A;  1VQK Q;  1VQM A;  3MKD A;  4HXJ A;  3U23 A;  4C5G A;  3DLM A;  4JUV A;  2CP7 A;  2K79 A;  1AZE A;  4R56 A;  1Q82 R;  3CCS Q;  4DQ2 A;  4QQ6 A;  3C0C A;  2COY A;  4J9B A;  1Q81 R;  1IRE B;  1W4S A;  2DZC A;  1M1K R;  5KE2 A;  1WPY A;  3OYC A;  1OZ3 A;  1J3T A;  2DLP A;  4JJC A;  4C5I A;  8ATC B;  1SG5 A;  2MWO A;  2AKL A;  1WNL A;  8AT1 B;  4PJO F;  4M77 A;  3FRN A;  1D1A A;  1TH7 A;  1WA7 A;  2RF0 A;  3A8G B;  4Y91 A;  1VQ6 T;  1H3Z A;  2DD5 A;  1PC0 A;  3JCM d;  1HSQ A;  4FIB A;  2JJ9 A;  5IH2 A;  4FYW B;  1M3A A;  3CEY A;  2FO0 A;  4Y28 E;  5CKB A;  3OYJ A;  3CD6 Q;  1M90 C;  1HYO A;  2CZ1 B;  4NS5 A;  4M7D G;  3JSC A;  3OA6 A;  5KYY A;  3EG1 A;  1ARK A;  5L23 A;  2J6F A;  1BCM A;  4E7J A;  3PIP A;  3HKS A;  3JB9 H;  1FMK A;  2HQE A;  5GMK i;  1BI0 A;  4M78 G;  2YT6 A;  1BK2 A;  1MGQ A;  4PJO C;  3JCM V;  3UT1 A;  1IXD A;  1QP2 A;  5D6W A;  4C0F A;  2QEX T;  3QG1 A;  1Q7Y C;  1WQW A;  4M77 D;  1JO8 A;  1OX8 A;  2GGR A;  1G2B A;  3MJX A;  3H0F A;  3LH5 A;  5FRN A;  2CSI A;  4JJD A;  3E9F A;  2CP3 A;  3CCJ A;  2MPX C;  2GFA A;  3I56 T;  1IGQ A;  2ESW A;  1RAB B;  1YJ9 T;  2P4T A;  3L42 A;  1HJD A;  4J9H A;  3A8M B;  2XMF A;  2X9H A;  1VA7 A;  2KK4 A;  1YP5 A;  1JEG A;  2A28 A;  4X34 A;  3UF4 A;  3QO3 A;  4NL2 A;  2CP2 A;  1EIF A;  2DTO A;  5I2S A;  4F7U F;  2NUT A;  1BIB A;  2RQT A;  3G7Z A;  4KH1 B;  1S72 T;  3G71 T;  2FB7 A;  2M16 A;  1TU0 B;  3TRE A;  2XI9 A;  3REB B;  3L2Q A;  4N0A A;  4F7U E;  5CO7 A;  2FZG B;  1D09 B;  2F2V A;  3C12 A;  3UDC A;  2X4J A;  3OYA A;  5LJ5 j;  2W0Z A;  3G6E Q;  1VQ9 T;  3JCM P;  3I35 A;  1RAA B;  1I0C A;  1K0S A;  5GAM j;  3VKI A;  1NPR A;  2A0F B;  2NYS A;  1VQ7 A;  5FW9 A;  5AT1 B;  1K76 A;  2X4W A;  3SD4 A;  3HL8 A;  1C6V X;  1T3L A;  1I5O B;  1YHQ A;  1RAE B;  1AVZ C;  2QGG A;  4DBQ A;  3VU3 C;  2DXT A;  4O6J A;  4BD3 A;  2DIQ A;  2HBW A;  3QYH B;  5KYX A;  2QEX Q;  3I5S A;  3JCM W;  1NEG A;  4JRQ A;  4RCB A;  3L2U A;  5LJ3 g;  4C92 F;  3H0I A;  4OMO A;  1PM3 A;  1M4Z A;  2FRY A;  3T9N A;  2DVE A;  2RB6 A;  4QVC A;  2EKO A;  2QAS A;  3PGG A;  1YNZ A;  1ZSZ A;  1X6G A;  4RTT A;  1KQS A;  5GJW B;  1X43 A;  3VYG A;  4HVW A;  1KK7 A;  2EQK A;  1FMV A;  3CCL A;  3OYI A;  3OYF A;  2COZ A;  4C92 E;  1W2B P;  1H92 A;  1M2V B;  2XG8 D;  2C06 A;  1SKU B;  1BB9 A;  4WF2 A;  1C1A A;  2EYX A;  2OTL A;  1M30 A;  4VUB A;  1U8R A;  3JCM f;  1Z9Q A;  2ZPH B;  4F7U B;  1YJN T;  2LJ1 A;  3LW5 E;  2O4X B;  2JM9 A;  1U06 A;  1VQM Q;  2YRC A;  3RIR A;  1WJS A;  2RHI A;  2K57 A;  1T0J A;  3RKW A;  4IUP A;  1UTI A;  1H64 1;  1VQ4 T;  4Z88 A;  5KYU B;  4A53 A;  3CPW A;  4LD6 A;  3MP1 A;  3QDF A;  4XK8 E;  1K0X A;  1TUD A;  1HXD A;  1UEB A;  3M0R A;  3OYY A;  2P4R A;  2G6F X;  2CP5 A;  3CQT A;  2RO0 A;  4BAC A;  4J5Y A;  2P84 A;  3ULR B;  2HL3 A;  1K73 C;  4OMP A;  2KI7 A;  2DBM A;  3CCV T;  2JTE A;  4JLG A;  1I5L A;  4XTX A;  2QTV A;  3V8L A;  2KQW A;  1QKX A;  3RMS A;  2RNA A;  2DIG A;  1QVP A;  1JB0 E;  1SPK A;  2RQR A;  2CZ7 B;  1TS9 A;  1SHF A;  2YUO A;  4C92 B;  3OSV A;  4C8Q F;  3OBW A;  5CKF A;  2XID A;  3MEV A;  4FYV B;  2HKN A;  2RJE A;  1XQH A;  4X9C A;  4R0K A;  1ZX6 A;  3CME T;  2CT3 A;  1TWB A;  2D0Q B;  2EFI A;  1Q81 C;  1NJI R;  3JB9 G;  5CCA A;  1E6G A;  1M3C A;  4BY6 C;  4AFZ C;  4C8Q E;  2F1L A;  1M2V A;  1WHH A;  5KYN A;  4PLL A;  3LWI A;  2EQJ A;  2K7A A;  2NUP B;  3NTK A;  2XDP A;  3X26 B;  3S3O A;  1PD1 A;  4ME7 A;  2ZZD A;  5GAN 5;  4YTL A;  1Z9Z A;  3M5A A;  1VQ5 A;  4PFO A;  3OW2 A;  4EMK C;  4PJO G;  3CCJ Q;  5LJ3 h;  2CH4 A;  2RQV A;  3I55 A;  2L5Q A;  5GAO n;  3A98 A;  1I81 A;  5GAN 6;  1TTH B;  3TSZ A;  1RAH B;  3OYE A;  5LJ5 d;  5GMK e;  2B8A A;  4E7K A;  1NE8 A;  2GBQ A;  3OY9 A;  3PIO A;  1Q82 U;  2YUN A;  5GAM d;  1K8A C;  1VQ4 Q;  4M7A D;  4QQG A;  1M1K U;  2HQH A;  1AT1 B;  2RJF A;  4QT7 A;  3J81 E;  1RL2 A;  4RUG A;  3M0S A;  2DER A;  4OMF B;  2QG9 B;  1I07 A;  1ZUU A;  3MO8 A;  2ATC B;  2CP0 A;  1SSH A;  2PUK B;  1LOJ A;  2BUD A;  1VQO T;  3NGP A;  3E19 A;  3CC2 T;  3MCA B;  3CBO A;  3VRZ A;  3CXC S;  4DEY A;  1V1C A;  1WHJ A;  4C8Q B;  1BCO A;  1K9M U;  3FB9 A;  1WFW A;  3EGX A;  3JCM Q;  5FU7 C;  6AT1 B;  3CCQ T;  2EYY A;  2IG0 A;  1YIJ A;  4KUI A;  4M77 F;  1PHT A;  4UC4 A;  4PLI A;  4A4K A;  2O31 A;  5CAI A;  3OS1 A;  1PRM C;  2BIV A;  2MK5 A;  3G1J A;  1VQ7 Q;  2L2P A;  1G3Y A;  3I9Q A;  4L5G A;  2FEI A;  2CDT A;  2NUP A;  2JS0 A;  4PNO A;  5GMK h;  2W10 A;  1GFD A;  3OS2 A;  4M77 E;  3M55 A;  1QWF A;  2FZC B;  2KR3 A;  1YWO A;  1X6B A;  1YHQ Q;  3OB9 A;  4E7L A;  3HFO A;  2EYZ A;  5IHK A;  3CC7 A;  2VWF A;  4IUV A;  3EG0 A;  2HNI A;  3SB2 A;  1TSF A;  3M4G A;  1WJR A;  3OYN A;  4ZTJ A;  2PZ1 A;  2RQU A;  1RAG B;  1ZA2 B;  2R58 A;  3CCM Q;  3OYK A;  1VQK T;  2F5K A;  1OU9 A;  2FPE A;  2I2L A;  5D6Y A;  5GAN 3;  2O9S A;  3V7C A;  2RI2 A;  3CCS T;  1S1N A;  5FU6 C;  2FL7 A;  1N8R U;  3KFV A;  1KD1 R;  2BZX A;  3V7R A;  4OGE A;  2JT4 A;  3JB9 I;  1VQN A;  2FHD A;  1WDX A;  2DM1 A;  2GCX A;  1GCQ C;  3S6W A;  1YI2 T;  3VS4 A;  1CSK A;  2K6D A;  1IRX A;  2L3Q A;  2X3X D;  2WSE E;  2NUZ A;  4PKC C;  2JS2 A;  4J7F A;  2QQB A;  5C0M A;  1GL5 A;  3CMA T;  1VQ6 A;  2D1X A;  1R8O B;  4J9G A;  4M77 B;  2HAX A;  2JXB A;  1UE9 A;  5GAN g;  2K3X A;  2DXB A;  2LX9 A;  2VVK A;  3QXE B;  3JV3 A;  2MIO A;  7AT1 B;  3VS2 A;  2EQU A;  1KFZ A;  2A3L A;  1M5Q 1;  4OMQ A;  4M75 D;  2KMT A;  3QZ5 B;  4AG2 C;  4JRK A;  3OYD A;  1K1Z A;  2HEQ A;  1AWW A;  1WHL A;  2ECZ A;  4LXC A;  1QLY A;  2RPN A;  2COW A;  4M78 A;  3CCU T;  3EAE A;  3L2W A;  2VXF A;  4ELZ C;  2Y90 A;  4XQ3 A;  1U1S A;  4PJJ A;  1UGP B;  2LP5 A;  3EG3 A;  2CP6 A;  2LNH B;  4KUD K;  5LJ5 f;  2DMO A;  1QVF S;  4DOW A;  2DX1 A;  4AFU C;  2DL4 A;  2F5T X;  1PRL C;  3E1S A;  1EFN A;  2JW4 A;  5HY6 A;  4DBF A;  2FVU A;  5GAM f;  3SWN B;  3KBG A;  2HL5 C;  1NG2 A;  1OEB A;  4QVZ A;  5KYW B;  2H8H A;  4GLK A;  2A08 A;  2ROT A;  3QUI A;  2VGM A;  2V26 A;  2FRW A;  1RAD B;  3I56 A;  1VQ5 Q;  2WSF E;  4IUT A;  5GAN e;  2ZPF B;  1H3H A;  2KRN A;  4XTY A;  4M7D D;  2FPF A;  2FYK A;  4KBM B;  4PFP A;  5IXB A;  1ABQ A;  2ZPI B;  4N0A C;  1YI2 Q;  1ZBJ A;  5J39 A;  4J7I A;  3RKY A;  1VQP Q;  1UFF A;  2EGA A;  1G5V A;  2A37 A;  4M78 D;  4HVV A;  2JM8 A;  2YUP A;  3CMA Q;  1S72 A;  1N6A A;  4BB7 A;  1MMN A;  2V8K A;  3QII A;  1NEB A;  1Y07 A;  3OS5 A;  4QW2 A;  2NUT B;  1K9M R;  1X75 C;  2EJG A;  2DTH A;  4JRI A;  5CKE A;  3JB9 J;  1T3S A;  1G83 A;  4KH0 B;  1WI7 A;  3G6E T;  5LJ3 j;  2BE7 D;  1U1T A;  2QA4 A;  2MF2 A;  2QDL A;  3E9G A;  4M4Z A;  1VYV A;  1VQ9 A;  3QJY A;  2BKD N;  2X3W D;  4IIM A;  1YIJ Q;  2GNC A;  4GY5 A;  2DYI A;  3MP6 A;  4FM4 B;  1W6X A;  2QI2 A;  2L3S A;  4LUE A;  5GAN h;  3CCU Q;  4XU0 A;  2CUB A;  3FEO A;  4GBQ A;  3SWN A;  1OU8 A;  1FWZ A;  4XU3 A;  5GAO r;  1Y57 A;  5KYW A;  1NJI U;  1I8F A;  4E2F B;  3OBY A;  3VS0 A;  2AZV A;  4J9I A;  3JRZ A;  2IPO B;  1OOT A;  5HKC A;  4HCZ A;  5KYX B;  1OX9 A;  3CC7 Q;  1HD3 A;  3HRT A;  1YCS B;  3QDR B;  2Y4Y A;  2F69 A;  2BZ8 A;  4M7A F;  2V1R A;  4ELY C;  2ZPG B;  1ZSZ B;  3M9Q A;  1Q95 G;  1C0M A;  1X69 A;  1N8R R;  2OAU A;  1KSW A;  3HSB A;  5FWB A;  2DK3 A;  5FWC A;  1SRL A;  5D7U A;  1M90 U;  1VQM T;  1F1B B;  4M7A E;  1AWJ A;  1YJN A;  5GMK j;  1ZA1 B;  2Y4X A;  4A4G A;  1Y0M A;  2OTJ Q;  1WYX A;  5EC7 A;  1NYF A;  5CIU A;  3THK A;  1VOM A;  3EG2 A;  3A5Z B;  3NTH A;  3RKX A;  1VQN Q;  5KE3 A;  1V29 B;  2DJZ A;  3NMZ C;  2AIR B;  4J9C A;  5ECA A;  4RMO A;  4CI0 C;  2EW3 A;  3L2R A;  2RJC A;  2A36 A;  2V1Q A;  2X35 A;  1SSF A;  1P92 A;  4LE9 A;  1QVG A;  3FIF A;  1LNX A;  3MP8 A;  1SRM A;  3FC3 A;  1JRI A;  2GFU A;  1QVG P;  3CCR Q;  3LLR A;  2RD1 A;  2V8I A;  2EJ9 A;  1MMD A;  3QHS A;  1YIT Q;  5HK3 A;  2V8J A;  1AHJ B;  3CCV A;  2CSQ A;  1B7T A;  1JXO A;  5IHN A;  3EFO B;  4FW2 A;  1KC8 U;  2DFU A;  1WXB A;  2DAQ A;  2EKH A;  2D8H A;  1Q86 R;  3BFM A;  2K5I A;  3PMI A;  1QCN A;  3HFN A;  5GAO p;  2MOX A;  3CCE A;  1XOV A;  2DA9 A;  4XTV A;  3X20 B;  3QYG B;  1GCP A;  1AWX A;  4M7A B;  2OAW A;  3EHQ A;  1V76 A;  3R6N A;  2VXE A;  3M53 A;  3ZBD A;  2RN8 A;  2LDM A;  2PVG B;  5GAN 7;  2JUF A;  4HVU A;  2JOY A;  3HPW A;  4FT4 A;  2DXC A;  1IZ6 A;  2E12 A;  2K3Y A;  1KQS P;  4C5E A;  3FLG A;  4FU6 A;  5I21 A;  3QBY A;  4QKU A;  5L8R E;  1ZLM A;  2KXC A;  2RHX A;  3CC4 A;  1W2B S;  1MV3 A;  3CCJ T;  2FPD A;  1O75 A;  5DLQ E;  1HK9 A;  2GTJ A;  2LT4 A;  3WXM B;  1VQL A;  1B07 A;  1I4K 1;  3ME9 A;  4JZ4 A;  1YFN A;  1UGQ B;  2LC4 A;  1ZSG A;  1PWT A;  1D3B B;  1Y71 A;  1WXT A;  4JRP A;  1YJW A;  2LQK A;  3G4S A;  1UB4 A;  4CC7 A;  2GQI A;  5I2M A;  3VS1 A;  2GTO A;  1KD1 U;  1RUW A;  4RTW A;  2JMA A;  4C92 C;  2L89 A;  2VYT A;  3H0H A;  3OYL A;  4E47 A;  3CPW P;  1RI9 A;  3P8B B;  2XD0 A;  1M1F A;  2P0P A;  2QYZ A;  3EFO A;  3JB9 D;  3I5R A;  3PE0 A;  1GXI E;  3EH1 A;  5GAN 2;  3V7S A;  2E5K A;  1N27 A;  3LH0 A;  4HCK A;  1WJQ A;  4J9D A;  2PUO B;  2VAS A;  5CKD A;  5LJ3 e;  1RAF B;  3RNJ A;  3C4S A;  1R0B G;  1AWO A;  2J05 A;  1WHM A;  4BE0 A;  3TVT A;  5IAY A;  4JLI A;  3JCM c;  1N9S A;  1MMA A;  2DPP B;  2D9T A;  2O01 E;  1ZQ1 A;  3OMC A;  2KSS A;  5GMK m;  1G3T A;  2QA4 Q;  4M7A A;  4PJO D;  1Q82 C;  2QXF A;  3EGX B;  1PKT A;  5A0G A;  1VQ7 T;  3URG A;  4B9W A;  4GLM A;  4WTO B;  2EBP A;  1WHK A;  1OUL A;  4A4F A;  1M1K C;  4C0D C;  4QVD A;  1YHQ T;  2KYM A;  3S3M A;  1G3S A;  2DF6 A;  1SEM A;  4IKF A;  3IQL A;  2K2V A;  4AT1 B;  4RG2 A;  3BY7 A;  2HZY A;  3QJ6 A;  1LPL A;  2LJ3 A;  1JJ2 A;  2KEA A;  1VQ8 A;  1GBR A;  2XU8 A;  2E1H A;  4F17 A;  2KRO A;  1D3B A;  1JJ2 P;  4J6Y A;  2G3R A;  5GAM g;  2OJ2 A;  2F2X A;  3CCM T;  1QP3 A;  5CVI A;  2EAY A;  3CCL T;  1M90 R;  4PJL A;  4M78 F;  3OW2 P;  2RHY A;  4ZTF A;  4M7D E;  2WSC E;  4FYY B;  5GAO q;  2OI3 A;  4C8Q C;  2GQV A;  2OTL T;  4C0D B;  3X24 B;  1IHV A;  4JZ3 A;  3PTA A;  4EMH A;  3J80 E;  3GLX A;  4EMG A;  4F04 B;  5GAN j;  4CC3 A;  2O9V A;  1T0H A;  2RM4 A;  4M78 E;  4HCC A;  2RA2 A;  1WQ7 A;  3DKM A;  4E7S A;  1G8X A;  3TQ7 P;  1TG0 A;  2XHC A;  4XU2 A;  1M8M A;  4RTU A;  3EG9 A;  2XDB A;  1YBY A;  2J6K A;  2CH4 W;  2LX7 A;  2CGH A;  3DB4 A;  5IXF A;  3GBQ A;  1ZUY A;  3RR6 A;  1BI3 A;  2PU9 B;  4B6M A;  4Y92 A;  3EH2 A;  2YLC A;  3CXC A;  2EQI A;  1KC8 R;  3Q1J A;  1WHG A;  4FYX B;  1BIA A;  3CD6 A;  2JTF A;  4ZGE B;  4Z89 A;  3PFS A;  1X01 A;  3ZL7 C;  2QK0 A;  5M9O A;  1NLO C;  4TVR A;  2RJD A;  3VUB A;  3JCM b;  5CQY A;  3M0P A;  4V2S A;  3NHN A;  2MYS A;  3MHX A;  3PVL A;  1WX6 A;  3M57 A;  1O9S A;  2E70 A;  5GMK l;  1UJY A;  2DET A;  1RLQ C;  2D0N A;  2D6F A;  1VUB A;  3OYG A;  4M7D B;  1A0N B;  2E6N A;  3CCE Q;  2KE9 A;  4LN2 A;  4BDZ A;  3EGU A;  3WVD B;  2P0K A;  2HCK A;  4J6X A;  3UPU A;  5CR2 A;  4M78 B;  3VV0 A;  2O88 A;  5LJ3 f;  4KRT A;  4E6R A;  3UA7 A;  1MND A;  4CC2 A;  3GIB A;  2RMO A;  1D0X A;  1UGV A;  2QQR A;  3NTI A;  2DJQ A;  4F7U G;  3CCL Q;  1MHN A;  4M75 A;  1X2K A;  4M77 C;  2EPD A;  3A8L B;  2Z0W A;  5CK9 A;  2OTL Q;  2HD0 A;  1VQ5 T;  1PD0 A;  2IVW A;  3TCJ A;  1VQL Q;  3I55 T;  2KBT A;  3J7A F;  4Z02 A;  1FMW A;  2R5A A;  3L2Z A;  3QSU A;  5GJV B;  1OV3 A;  1Y7X A;  5GAO l;  4IUU A;  3OSS C;  1UHF A;  4KGX B;  1YJW Q;  2BTT A;  3G4S Q;  2H3J A;  2C0O A;  1VQP T;  1N5Z A;  5A2Q E;  4BE2 A;  4RTZ A;  3OQ5 A;  1WLP B;  4OML A;  3VYH B;  2ZCF B;  4OMN A;  5IT9 E;  3UA6 A;  3LX7 A;  4EMK A;  2QDY B;  3QPH A;  2NWM A;  3QWX X;  1RAC B;  4LNP A;  3FDR A;  2LRQ A;  1M1G A;  1NZ9 A;  1ABO A;  4MDW A;  3PVQ A;  4J8O A;  1BKB A;  4C92 G;  3G6E A;  4M7D A;  3SWN C;  3RMQ A;  1AZG B;  4Q5W A;  4RTV A;  1ZHI A;  1YIJ T;  4A63 B;  2JZ2 A;  1Q86 U;  2CS7 A;  3ASK A;  3VS7 A;  1E6H A;  3D7S B;  4MML A;  3H9N A;  4K11 A;  2VV5 A;  2LQ8 A;  4RKU E;  4KT0 E;  1CKB A;  5HK0 A;  2QEX A;  2LVM A;  2LTO A;  5FLX E;  1QVF A;  1SHG A;  3CC7 T;  2DZ9 A;  1JXM A;  4CRI A;  1NPP A;  2M1H A;  4ORZ A;  3TU4 K;  1K73 R;  1KHC A;  2BZY A;  4RTX A;  1YJ9 A;  4DA4 A;  4FSS A;  1UDL A;  1WIE A;  3KXT A;  4RCC A;  3JCM g;  1X2Q A;  3I55 Q;  3JB9 F;  2EYQ A;  1Y96 A;  1M27 C;  4JS4 A;  1KIK A;  3BDL A;  2OTJ T;  3JCM J;  1LVK A;  1KQ2 A;  2MAM A;  3NPF A;  2JNG A;  4BDY A;  2EWN A;  2RHU A;  4FL6 A;  4X1V A;  2VUB A;  1VQN T;  2VB6 A;  4D8D A;  3OS0 A;  1B34 A;  1NJI C;  4IUQ A;  3OYM A;  4WCI A;  3G71 A;  2KDS A;  1UUE A;  5FRO A;  4O5V A;  4PL6 A;  1BI1 A;  2MWP A;  4C8Q G;  1OPL A;  1MUZ A;  2DNU A;  3GP8 A;  2DL5 A;  4OMM A;  1LCK A;  2DEU A;  3NFC A;  4FCY A;  4JJB A;  3GOX A;  2YDL A;  3CCR T;  3M54 A;  4L6V 5;  1YIT T;  1H8K A;  3VS3 A;  2PTK A;  3WVE B;  2K9G A;  4PJO E;  2ABL A;  4DEX A;  1GCQ A;  2ENM A;  4PJN A;  1XNI A;  3DLL A;  2P0Q A;  4RG8 A;  3V8J A;  3OYH A;  4J9F A;  1ZSZ C;  1TXQ A;  1QCO A;  1TOV A;  4D8K A;  4OP0 A;  3H41 A;  2E64 A;  9ATC B;  3GF5 A;  3RES A;  4ZN1 A;  2EYW A;  4A4H A;  4CC4 B;  1BYM A;  3JCM e;  1PCX A;  2XKO C;  2FG0 A;  1K8A R;  1R77 A;  1WXU A;  3TEE A;  4MMK A;  3HTR A;  1QQJ A;  1PG5 B;  1YCY A;  2I0N A;  2R57 A;  2M02 A;  3H8Z A;  3RDV A;  1M9S A;  4OB0 B;  4HT9 A;  3X28 B;  2M0O A;  4B9X A;  3M0Q A;  2DRM A;  4DBH A;  4ZGD B;  4JJN K;  3QZ9 B;  3CBM A;  5HCK A;  3JCM X;  1KC8 C;  2YRV A;  1X6O A;  3P8D A;  4II1 A;  2ZPE B;  5C6S A;  4HT8 A;  3HP9 A;  1QMC A;  2K5F A;  2LNV A;  1VIF A;  1UJ0 A;  2DXU A;  3O8V A;  4N4H A;  2DVJ A;  1YWP A;  1G3W A;  1IO6 A;  1PSE A;  2ZGW A;  3MEW A;  1IHW A;  4PJO B;  2MCN A;  3M4Y A;  1DJ7 B;  3VS5 A;  3KUF A;  3CBP A;  5DY9 A;  4EIK A;  3TSW A;  3E2U A;  1VQ4 A;  4X9D A;  2OX7 A;  1AD5 A;  4BI8 B;  2DYB A;  3JCM h;  4M77 G;  4E7I A;  3QWY A;  1TUC A;  2JN0 A;  2F2W A;  2ED1 A;  2LCL A;  2WAC A;  2H3E B;  2E65 A;  3PMT A;  1VQ6 Q;  1N9R A;  2YLB A;  2X4X A;  2AK5 A;  1QW1 A;  3P8H A;  4M7A C;  4XAX B;  1Q7Y U;  1UHC A;  4AMC A;  3SHW A;  4ZGJ B;  2K2M A;  2EJF A;  3MET A;  2DL7 A;  5GAN f;  1QVG S;  5GAN 4;  3SFM A;  1GBQ A;  2NLU A;  2QA4 T;  4F14 A;  2PVO B;  1BI2 A;  4BI3 A;  1KD1 C;  4IUR A;  4ZNX A;  1X27 A;  1PSF A;  2M9U A;  5I11 A;  2EQM A;  3CME A;  3AHU A;  2YUQ A;  4HKE A;  1D1C A;  2RK1 A;  2YSQ A;  4E7Z A;  2AZS A;  2L3P A;  2QAZ A;  5AYF A;  4FW1 A; 
#chains in the Genus database with same CATH homology
 4AFQ C;  2NUZ A;  2JS2 A;  1CKA A;  1GL5 A;  4JZ3 A;  3EG1 A;  1ARK A;  5L23 A;  2D1X A;  2CRE A;  4CC3 A;  4J9G A;  2O9V A;  1T0H A;  2J6F A;  4AG1 C;  1FMK A;  2JXB A;  1UE9 A;  2YT6 A;  1TG0 A;  1BK2 A;  2VVK A;  3JV3 A;  2MIO A;  1M8M A;  4IIO A;  2ROL A;  4RTU A;  3VS2 A;  2J6K A;  2LX7 A;  2CH4 W;  1KFZ A;  2EGE A;  4OMQ A;  2LCS A;  3REA B;  5IXF A;  3GBQ A;  4AG2 C;  1JO8 A;  1ZUY A;  2GGR A;  4ESR A;  1G2B A;  4Y92 A;  1K1Z A;  2HEQ A;  2HSP A;  1AWW A;  2ECZ A;  3H0F A;  3LH5 A;  2EQI A;  1QLY A;  1W1F A;  2HDA A;  2RPN A;  2IIM A;  1B3Q A;  2EVR A;  2CSI A;  4JJD A;  2DIL A;  4LUD A;  4Z89 A;  2M0Y A;  3ZL7 C;  2ESW A;  1NLO C;  2LJ0 A;  2LP5 A;  3EG3 A;  2LNH B;  1HJD A;  4J9H A;  2DMO A;  3M0P A;  3NHN A;  2XMF A;  2DX1 A;  3PVL A;  4AFU C;  2DL4 A;  1WX6 A;  1M3B A;  1PRL C;  1VA7 A;  1EFN A;  2KNB B;  4AFS C;  2JW4 A;  1UJY A;  1RLQ C;  2D0N A;  1YP5 A;  1JEG A;  2A28 A;  1A0N B;  3UF4 A;  1NG2 A;  1OEB A;  2KE9 A;  4LN2 A;  2H8H A;  2J6O A;  2A08 A;  2ROT A;  2KGT A;  2RQT A;  3EGU A;  2FRW A;  2HCK A;  2LMJ A;  2O2O A;  4RTY A;  2O88 A;  4KRT A;  4E6R A;  3UA7 A;  4CC2 A;  3REB B;  2KRS A;  2KRN A;  1H3H A;  2RMO A;  2FPF A;  4JPB W;  1UGV A;  5IXB A;  1ABQ A;  2DJQ A;  1E7O A;  2F2V A;  1ZBJ A;  2EGC A;  1X2K A;  2W0Z A;  2EPD A;  1MV0 B;  1UFF A;  2EGA A;  3VS6 A;  2A37 A;  4J9E A;  3I35 A;  4HVV A;  2JM8 A;  1I0C A;  2YUP A;  1K0S A;  3EHR A;  1NYG A;  1NEB A;  2KBT A;  5FW9 A;  1K76 A;  2M51 A;  5GJV B;  1OV3 A;  2L0A A;  1PKS A;  1T3L A;  1UHF A;  1T3S A;  1G83 A;  2BTT A;  2C0O A;  1AVZ C;  1N5Z A;  1WI7 A;  2RQW A;  4RTZ A;  1KJW A;  1WLP B;  4OML A;  2HBW A;  2QDL A;  4OMN A;  3I5S A;  4M4Z A;  1VYV A;  1NEG A;  3UA6 A;  1GRI A;  3H0I A;  4OMO A;  2FRY A;  2NWM A;  3QWX X;  2X3W D;  4IIM A;  1YNZ A;  2GNC A;  1X6G A;  4LNP A;  4RTT A;  2DRK A;  5GJW B;  1X43 A;  1W6X A;  4HVW A;  2L3S A;  4LUE A;  1QKW A;  1RLP C;  2CUB A;  1ABO A;  4GBQ A;  2LZ6 B;  1H92 A;  1OPK A;  3PVQ A;  1BB9 A;  2EYX A;  2LQN A;  1Y57 A;  1M30 A;  1AZG B;  1Z9Q A;  3VS0 A;  2AZV A;  4J9I A;  4RTV A;  2VKN A;  1U5S A;  2LJ1 A;  1OOT A;  4A63 B;  2JM9 A;  1YN8 A;  1GFC A;  2C0T A;  1U06 A;  3SEM A;  1HD3 A;  3VS7 A;  1E6H A;  1YCS B;  1T0J A;  1JU5 C;  2BZ8 A;  2V1R A;  4K11 A;  1UTI A;  2CT4 A;  1VYT A;  1CKB A;  1X69 A;  4Z88 A;  1KSW A;  1AOJ A;  5FWB A;  5FWC A;  1SRL A;  3UAT A;  2CUD A;  1K0X A;  1SHG A;  1TUD A;  1QWE A;  2DE0 X;  3M0R A;  1AWJ A;  2KXD A;  1JXM A;  1NLP C;  2P4R A;  1Y0M A;  2G6F X;  1WYX A;  3CQT A;  5EC7 A;  4ORZ A;  2SRC A;  3ULR B;  1NYF A;  3THK A;  4OMP A;  3EG2 A;  2DBM A;  5I22 A;  2JTE A;  2K3B A;  2PNI A;  2BZY A;  4RTX A;  3NMZ C;  4FSS A;  1UDL A;  1WIE A;  4J9C A;  1QKX A;  2RNA A;  1X2Q A;  5ECA A;  1SPK A;  1UG1 A;  2EW3 A;  2RQR A;  2V1Q A;  2A36 A;  2C0I A;  1M27 C;  1KIK A;  1SHF A;  2YUO A;  1W70 A;  4LE9 A;  4Z8A A;  2JMC A;  1SRM A;  3NPF A;  2AKK A;  4R0K A;  4X1V A;  1K9A A;  1ZX6 A;  2CT3 A;  4D8D A;  2CSQ A;  4WCI A;  1JXO A;  5IHN A;  3VRY A;  1BU1 A;  1E6G A;  1M3C A;  4F16 A;  4AFZ C;  1UUE A;  3RBB B;  1U3O A;  2SEM A;  1WXB A;  2EKH A;  1NM7 A;  2D8H A;  1OPL A;  1MUZ A;  2DNU A;  2DL5 A;  4OMM A;  1LCK A;  2K7A A;  1FYN A;  1PNJ A;  2MOX A;  4JJB A;  2YDL A;  5IHI A;  1XOV A;  2DA9 A;  2DBK A;  1H8K A;  3VS3 A;  2PTK A;  1Z9Z A;  2K9G A;  1VYU A;  2ABL A;  4DEX A;  1GCQ A;  2ENM A;  1GCP A;  1AWX A;  3R6N A;  2OAW A;  3EHQ A;  2ED0 A;  1AEY A;  2RN8 A;  2CH4 A;  1UEC A;  2D8J A;  2RQV A;  4HVU A;  3A98 A;  4J9F A;  3TSZ A;  4D8K A;  2DL3 A;  3H41 A;  2GBQ A;  1K4U S;  2LQW A;  2EYW A;  2YUN A;  4CC4 B;  1JQQ A;  2FG0 A;  1ZLM A;  2KXC A;  1MV3 A;  2FPD A;  1WXU A;  2GTJ A;  4QT7 A;  1B07 A;  4RUG A;  3M0S A;  4JZ4 A;  3FJ5 A;  3M0U A;  2KT8 A;  1I07 A;  1ZSG A;  2I0N A;  1PWT A;  1ZUU A;  1SSH A;  1WXT A;  3M0T A;  4CC7 A;  3NGP A;  2GQI A;  2KYB A;  2DL8 A;  3VS1 A;  2GTO A;  3M0Q A;  2DRM A;  3VRZ A;  4DEY A;  1RUW A;  1V1C A;  4RTW A;  2JMA A;  5HCK A;  1WFW A;  2KRM A;  3H0H A;  2EYY A;  2KT1 A;  1I1J A;  1PHT A;  1RI9 A;  1UJ0 A;  3I5R A;  3O5Z A;  2O31 A;  3PE0 A;  2DVJ A;  1YWP A;  1PRM C;  1IO6 A;  2E5K A;  4HCK A;  4J9D A;  2L2P A;  2MCN A;  3I9Q A;  3RNJ A;  2B86 A;  2CDT A;  2FEI A;  2JS0 A;  3VS5 A;  2W10 A;  2J05 A;  1AWO A;  1QCF A;  2J06 A;  4EIK A;  3TSW A;  1GFD A;  3TVT A;  1ZUK A;  1AD5 A;  2DYB A;  1QWF A;  2KR3 A;  3QWY A;  1YWO A;  1X6B A;  1TUC A;  2J7I A;  2F2W A;  2ED1 A;  1BBZ A;  2EYZ A;  5IHK A;  2VWF A;  4HXJ A;  3U23 A;  3EG0 A;  2AK5 A;  2K79 A;  1AZE A;  1PKT A;  1UHC A;  3SHW A;  3C0C A;  4GLM A;  2K2M A;  2EBP A;  4J9B A;  2PZ1 A;  2DL7 A;  2RQU A;  1J3T A;  2DLP A;  4JJC A;  2KYM A;  2AKL A;  2DF6 A;  1SEM A;  1GBQ A;  2FPE A;  3IQL A;  1WA7 A;  2RF0 A;  4F14 A;  2O9S A;  1HSQ A;  2LJ3 A;  5IH2 A;  1S1N A;  2KEA A;  1GBR A;  3KFV A;  2BZX A;  4ZNX A;  1M3A A;  1X27 A;  2JT4 A;  2FO0 A;  4F17 A;  5I11 A;  2KRO A;  1WDX A;  2YUQ A;  2DM1 A;  1GCQ C;  2F2X A;  2OJ2 A;  2YSQ A;  2AZS A;  2L3P A;  3VS4 A;  1CSK A;  2K6D A;  2L3Q A;  2X3X D;  2OI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...