2DL3A

Solution structure of the first sh3 domain of human sorbin and sh3 domain-containing protein 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
b'GSSGSSGRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorbin and SH3 domain-containing protein 1
molecule tags Cell adhesion, signaling protein
source organism Homo sapiens
publication title Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing protein 1
rcsb
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl3A00
1IO6A 3M0PA 3EG2A 1U06A 1VYTA 2A36A 4RUGA 2O31A 2HSPA 3REBB 3M0UA 2AZSA 3R6NA 3TVTA 2K9GA 1GCPA 3VS6A 1OEBA 3H0IA 1BK2A 3VS7A 2D8HA 2KR3A 1SPKA 2MOXA 1JXOA 1BU1A 2X3XD 3LH5A 4F17A 1M3BA 2YUQA 2X3WD 1GCQC 2FG0A 2EGCA 1PKTA 2J6FA 1MV3A 4IIMA 1UFFA 1JEGA 5L23A 1YWPA 4JZ4A 3NGPA 1YWOA 3EG1A 2O2OA 5EC7A 3UA7A 5I11A 1TG0A 2JT4A 4RTVA 2ROLA 3GBQA 2DYBA 2RQWA 2IIMA 3THKA 2HDAA 1AWWA 1WX6A 2DILA 3I35A 1V1CA 1VYVA 2VVKA 1KIKA 1X2QA 2AZVA 1M3CA 2DJQA 2EYXA 1NLOC 2C0TA 2D1XA 3EHRA 2KE9A 2KRSA 2YT6A 1AVZC 1M27C 2RQUA 2FRWA 2KXDA 1Z9ZA 1ZSGA 2EPDA 2J06A 3VRZA 2DL5A 2KT8A 2V1RA 1M30A 1ZLMA 1K76A 3VS4A 2JMCA 1E6GA 4OMPA 3PVLA 1RLPC 2EYZA 2GGRA 4WCIA 1YP5A 5IHKA 2D0NA 2NWMA 4RTWA 2J6KA 2O9VA 1SSHA 4HVVA 3QWXX 1GBQA 1WIEA 2D8JA 1LCKA 2SEMA 2YSQA 5IH2A 1TUDA 2A28A 3A98A 1PNJA 1SRLA 1RI9A 1UJ0A 3I5RA 3NHNA 2EYWA 4D8DA 3I5SA 2GNCA 2GTOA 4FSSA 4X1VA 4AFSC 2CDTA 2LX7A 4CC2A 1UG1A 2LCSA 1EFNA 3VS3A 2YDLA 3U23A 4IIOA 1WXUA 1X6GA 1JQQA 4CC3A 1UTIA 3UF4A 1TUCA 2L3PA 1X6BA 3NPFA 3C0CA 1PHTA 2YUPA 1UJYA 2ED0A 2DBMA 1WI7A 3H0FA 4D8KA 4LN2A 1K9AA 1YNZA 1VYUA 2HEQA 4J9DA 2DM1A 2FO0A 4J9FA 1JXMA 1AZEA 1XOVA 1QKWA 2RNAA 2EYYA 2W0ZA 1X69A 3TSWA 4OMMA 2BZXA 1WA7A 2DE0X 1AOJA 4J9EA 1ZUKA 5GJWB 4OMQA 5ECAA 4DEXA 2DVJA 4Z89A 4Z8AA 1N5ZA 4A63B 5HCKA 4LNPA 3EG0A 2O9SA 2V1QA 2M0YA 1NG2A 3PE0A 2M51A 1ZUUA 2K7AA 1QKXA 2A08A 1S1NA 1ABQA 1H92A 1FMKA 2K6DA 2CREA 1GRIA 2DX1A 5FW9A 1UHFA 4ORZA 2EVRA 2DBKA 1WFWA 2LJ1A 2I0NA 1T3SA 1VA7A 1QWEA 5GJVB 2KT1A 1T0HA 2K79A 1E6HA 1I0CA 3ZL7C 1KSWA 1T0JA 4AFQC 1CSKA 4Z88A 3VS0A 1PWTA 1X27A 1X2KA 2FRYA 1NM7A 2B86A 1SEMA 1K4US 2ESWA 4HVWA 4CC7A 2JTEA 4JJDA 2DRKA 3TSZA 1UECA 5IXBA 1B07A 2JM9A 3H41A 2G6FX 1QLYA 1MUZA 2JM8A 1HJDA 2LJ0A 5IXFA 4DEYA 3EHQA 2J6OA 2KEAA 2H8HA 2GQIA 2YUOA 3UATA 2RQTA 1OPKA 1M3AA 1G2BA 3REAB 2ABLA 4K11A 2GBQA 3SEMA 2CT3A 1B3QA 2K3BA 1H8KA 1PRLC 2KRNA 5I22A 1J3TA 1E7OA 2JS0A 4M4ZA 3SHWA 2XMFA 4ZNXA 2EW3A 4R0KA 2GTJA 1K0SA 3M0SA 2RPNA 2MIOA 2LNHB 1I07A 2EGAA 2K2MA 3I9QA 2OAWA 4GLMA 1CKBA 2NUZA 3KFVA 1ZX6A 3M0QA 4HXJA 2DA9A 2F2XA 1WYXA 2BZ8A 4RTYA 1H3HA 1OV3A 2MCNA 4LUEA 2KRMA 5IHNA 2ROTA 4RTZA 1NLPC 1KJWA 4JJBA 1M8MA 2W10A 4RTXA 1ARKA 2LQWA 2CUBA 2RQVA 3VS5A 2PTKA 2AK5A 1K0XA 2A37A 1JO8A 4OMOA 1YCSB 2F2VA 2YUNA 2JXBA 2PNIA 3VS1A 2DL3A 1GFDA 2FPDA 1WDXA 2LQNA 1PKSA 1W6XA 4OMNA 3JV3A 1UGVA 1JU5C 2VWFA 4QT7A 2LZ6B 1UDLA 1WLPB 4GBQA 4HCKA 1FYNA 2PZ1A 1X43A 3RNJA 2DL4A 3EG3A 3VRYA 4E6RA 2KXCA 1NEGA 3M0RA 1BB9A 1WXTA 2E5KA 2EQIA 2F2WA 2JS2A 1UHCA 3M0TA 2C0IA 3UA6A 4LE9A 3RBBB 2OI3A 3FJ5A 4JJCA 4LUDA 1RUWA 2EBPA 1UUEA 2LP5A 2DNUA 4RTTA 1GBRA 1HSQA 3NMZC 5FWBA 1AWJA 1AWOA 1ZBJA 2HBWA 3CQTA 4KRTA 2CSQA 2KBTA 1OOTA 2CH4W 2CSIA 4AFZC 1Y0MA 3H0HA 1G83A 1W70A 2JW4A 1U5SA 1NYGA 4Y92A 2ED1A 1W1FA 2BTTA 2JMAA 1QCFA 1PRMC 3IQLA 2L2PA 2LMJA 3VS2A 1SHGA 4J9CA 4J9BA 2EGEA 1MV0B 2FPEA 2LJ3A 4JPBW 4AFUC 2RN8A 4HVUA 4F14A 4EIKA 1NYFA 2DMOA 1AZGB 1GFCA 2CT4A 2VKNA 2EKHA 4OMLA 5IHIA 2CUDA 1AEYA 1I1JA 1U3OA 1NEBA 1Y57A 2FEIA 2C0OA 1AWXA 1KFZA 2J05A 5FWCA 2KYBA 2FPFA 3PVQA 2RF0A 3O5ZA 2L3QA 4ESRA 2O88A 3QWYA 2L0AA 4JZ3A 1YN8A 2CH4A 1RLQC 4J9GA 2SRCA 1GCQA 2AKKA 2ENMA 1T3LA 1UE9A 2DLPA 2DL7A 2BZYA 2HCKA 2AKLA 3EGUA 1A0NB 1SHFA 1BBZA 1QWFA 2QDLA 4AG1C 4CC4B 1GL5A 2DF6A 4AG2C 1AD5A 2OJ2A 1SRMA 1ABOA 1WXBA 1K1ZA 2DRMA 4J9IA 2RMOA 2KNBB 4J9HA 2RQRA 4F16A 1OPLA 2ECZA 2KGTA 2KROA 2J7IA 2L3SA 1HD3A 3ULRB 4RTUA 2KYMA 2DL8A 1ZUYA 1Z9QA 2P4RA 1CKAA
chains in the Genus database with same CATH superfamily
3CCMQ 1Y96A 3HHTB 3EG2A 3M0PA 4YTLA 2OTLA 1VYTA 4RUGA 1YJ9T 3REBB 2E1HA 2AZSA 1BKBA 1C6VX 3HL8A 3VS7A 5GAOm 1VQ8T 1U8RA 2MOXA 3QO3A 2VXFA 3JCMJ 4C0GA 1M8VA 1OZ2A 1MV3A 4IIMA 4M75B 1W4SA 1M90U 5CKBA 3T9NA 1JEGA 4JZ4A 3CCVT 2DEQA 3UA7A 2ZPEB 2JNGA 3A8LB 1TG0A 3RDVA 4NOYA 3CC2Q 2YXYA 3OBWA 4MZTA 3CPWS 1QCOA 3LGLA 1V1CA 2VVKA 5GAN3 1YITQ 1M3CA 1NE8A 2K5FA 3VYHB 4FYYB 1NLOC 2C0TA 4M78G 3OYGA 2KE9A 3CCJA 1M1KC 3CCUT 1IZ6A 1LNXA 4F7UB 1MMDA 1VQPQ 2KT8A 1XQHA 1VQOQ 2XKOC 5FU7B 1E6GA 1ZSZC 4E7ZA 2NUTB 4ANJA 4M75E 4QVDA 1YITT 3PFSA 4WCIA 1YP5A 3OYNA 2D0NA 2KK4A 2M9UA 2O9VA 2XK0A 2D8JA 3TEEA 3G6EQ 2SEMA 1IRXA 3A98A 1PNJA 3OQ5A 3I5RA 1KG1A 4D8DA 3I5SA 2HBPA 4FSSA 4P5NA 1QVGS 2LX7A 2QGFB 3CCLT 4NS5A 3FIFA 2DO3A 2HD0A 2CGHA 5GAN2 4PJOG 2HMAA 4PLIA 3EH1A 4FIBA 3C0CA 5GAN4 1MGQA 1UJYA 3P8HA 4OGEA 3JCMh 2DM1A 8AT1B 1KQ2A 3OW2A 1JXMA 2P0QA 1AZEA 1VUBA 4LDXA 4M7AA 2CZ6B 1VQNT 3PTAA 1QKWA 2RNAA 2X51A 2C06A 2QA4Q 2EQMA 4M7AG 1X69A 3TSWA 3JCMd 4OMMA 5KYYA 2QEXT 4JLGA 4J9EA 4C5HA 4M7DE 1M1KU 4A63B 1N5ZA 1WJQA 1Q81C 1MMNA 4LNPA 3QSUA 4C92E 5FU7C 1NG2A 4MDWA 3L42A 3PE0A 1ZSZB 2M51A 3X28B 2NUTA 4JS4A 3JB9H 4IUUA 1C0MA 1R8OB 4F7UF 2QQBA 1GRIA 1XNIA 1PD0A 2FYKA 4LDWA 5FU6C 5EG2A 3HRSA 4OB2B 5GJVB 1E6HA 3X25B 4BUGA 2PVGB 5KYUA 1TSFA 3ZL7C 2HAXA 4DBQA 2XD0A 1CSKA 4A4KA 4A53A 5KYWA 5GAN5 3TU4K 4FU6A 1YHQQ 1VQ8A 1YFNA 1X2KA 3M54A 1WJRA 2V8KA 4A4HA 4HVWA 2E70A 4E7HA 3LGFA 2E3IA 2JZ2A 3AT1B 3TSZA 3SWNA 3TREA 3CCMA 3RUXA 4QW2A 2G6FX 3MP1A 1MUZA 4RMOA 2LJ0A 2M16A 2GQIA 2YUOA 4XQ3A 4EMKC 3HKSA 5KYYB 1OPKA 4PJLA 1YJWQ 3CCJT 1G2BA 2KI7A 5GAMg 5CKDA 1B3QA 5AT1B 1H8KA 3M59A 2ZPIB 1IGQA 1E7OA 2JS0A 3SHWA 1WJSA 1VQ6T 3A1PA 1K0SA 2RPNA 2MIOA 1KD1U 1JBMA 4HT8A 5FROA 3ZFJA 2QQ9A 2EGAA 5KYXA 2K2MA 3D7SB 1MNDA 4GLMA 1QCNA 1G3YA 3I55A 4C8QB 3JB9G 5HY6A 2BZ8A 1M5Q1 5FLXE 2DTOA 4RTYA 3I56T 2O4XA 3ZEHA 3CCLA 4KGXB 1KJWA 1QP2A 3OYDA 1M8MA 1Q7YR 4RTXA 2V8JA 4QKUA 2PTKA 4J83A 2BE9B 3CMEA 2A37A 4KH1B 3JCMV 5GMKh 1WQ7A 2JXBA 1UB4A 2DL3A 1GFDA 5GMKe 1PKSA 3OYMA 2XU8A 1Q82U 2RJFA 3JV3A 2NUPA 2LCLA 5GAOn 1R77A 4LD9K 5LJ3h 2XDBA 2VWFA 2MAMA 5DM7R 1S72A 4HCKA 2DXBA 1VQOA 2JJ9A 3RNJA 2DL4A 1JB0E 3GNGA 1VQ4Q 1WHKA 5CVIA 2AHJB 4LDYA 1WNLA 1YIJA 1NZ9A 4JRKA 1UGRB 4L5GA 3M58A 2F2WA 3M0TA 4FCYA 1PD1A 4JJCA 2R58A 1RUWA 2YRDA 3DLMA 4X34A 1KQSS 1ZBXA 3CMAT 2KY9A 3NMZC 2CP2A 2H3EB 2FL7A 1ZBJA 4F04B 3CQTA 3CCVQ 3G7ZA 1VQ5Q 5CK9A 1IXDA 2WACA 3H0HA 1W70A 1U5SA 2CP6A 3J80E 1Q86R 2LC4A 2BTTA 3OYLA 3CCVA 3DLLA 1SHGA 2QK0A 2EGEA 2FPEA 4JPBW 2MF2A 4AFUC 4EIKA 3EGXA 2RHXA 2VKNA 1O9SA 1HXDA 4OMLA 3CCMT 1U3OA 2R5MA 4M7AB 4M7AC 2V8IA 4EMKA 1D3BB 4O5VA 1KFZA 1I8FA 2J05A 4M77C 1NJIU 4ZTFA 4PJMA 4ESRA 4JZ3A 4MMLA 3SWNB 2E10A 5HKCA 1RLQC 1D3BA 2AKKA 1D0YA 3KUFA 1YHQT 2ENMA 4J6YA 2DLPA 3MJXA 2BZYA 3C12A 3CCRQ 2X35A 5AYFA 1QWFA 2QDLA 2B8AA 4KT0E 2DERA 3OYEA 3RMQA 5GMKm 1WXBA 2DETA 2Z0WA 4LDUA 3S3OA 2WSCE 1QP3A 4J7FA 1VQ7A 2VXEA 4FW2A 3PT9A 4N4IA 2ECZA 4XTYA 2KGTA 4WTOB 5IAYA 2KYMA 4EMGA 2OTJQ 1YCYA 2IVWA 2P4RA 2V1RA 1IO6A 1D0ZA 1U06A 2L8DA 2QG9B 4D6WA 3R6NA 3TVTA 1ZSZA 3BE3A 4PFOA 3VS6A 5CQYA 3H0IA 4C5EA 4QQGA 4XU0A 1EX4A 3RKXA 2X3XD 3CMET 2X3WD 2FG0A 2EGCA 1Y7XA 1PKTA 4FYWB 2J6FA 3QDFA 1UFFA 2RI5A 2ZPBB 4IURA 3NGPA 3EG1A 4PLLA 1D0XA 3BDLA 2QEXA 3M56A 4XTZA 4L6V5 2DYBA 3OS2A 2P4TA 3EGDB 3THKA 4KH0B 2HDAA 2FZKB 1N6AA 1QVGA 5A2QE 1M9SA 1VYVA 3CCQA 1X2QA 2AZVA 3S3MA 1QVFS 2D1XA 3EHRA 2JN0A 2YT6A 4QVCA 4M78C 1M27C 1RADB 1Z9ZA 4RCBA 2KQWA 2EPDA 2J06A 1WHMA 4ZGDB 2DL5A 3GOXA 4JDSA 4B9WA 1H3ZA 4XU1A 1RABB 2RM4A 2E6ZA 3LH0A 3JB9D 2EYZA 2GGRA 3NTHA 4R55A 2F5KA 4J7IA 1UGSB 5CKHA 4PJOF 3UPUA 2EQKA 4E7IA 1D1BA 1ZQ1A 2YSQA 3EGXB 3PNWC 1QVFA 4N0AA 1IHWA 1K8AU 2RJEA 2E41A 1VIEA 1KHIA 4CC2A 1IGUA 3OS1A 2CP7A 1EFNA 2OX7A 3CC7T 3CC2T 1BIAA 4QQ6A 3CC4A 5KYXB 4IIOA 1JQQA 1C1AA 2CZ0B 5GAMd 4E2FB 4OB0B 1TUCA 4M75A 1UEBA 4PL6A 4FW1A 2OAUA 1WI7A 4BI8B 4D8KA 4M7DB 3META 4ZGJB 4B9XA 4J9DA 2LCCA 3MEWA 1GXIE 3JB9F 2FO0A 1PG5B 2E5QA 1XOVA 1IHVA 3RIRA 3CCET 3M4GA 4HCCA 3X24B 1K8AR 5J26A 2DE0X 1AOJA 3OW2S 1ZUKA 4EDUA 4JS5A 4DEXA 3QJYA 3P8BB 2DVJA 4Z8AA 2DAQA 1Q81R 5HCKA 1TUGB 2O9SA 4UC4A 3RKWA 1B7TA 1ZUUA 5A0GA 2K7AA 2EIFA 5A0LA 1FMKA 4LD6A 3CMEQ 2DX1A 5FW9A 4O6JA 2CP5A 1UHFA 4BE0A 2EVRA 4M77F 4M75F 2LJ1A 3HFNA 4XTVA 5KE3A 4C8QG 1VA7A 1QWEA 5D6YA 2K79A 1KSWA 4IUTA 1Q7YC 2RHYA 4AFQC 2HSEB 1PWTA 3C94A 4BI4A 3OYCA 3I55T 3G6EA 1X27A 2FRYA 5CQXA 3BFMA 3OS0A 3MP6A 3OMCA 1VOMA 4CC7A 2QQAA 5LJ5g 5GANd 4VUBA 2E6NA 2DRKA 2OTJT 1UECA 1TOVA 1B07A 3BDUA 3E19A 4C0ZA 2JM9A 2ZPHB 4M7DG 2JM8A 3EG9A 4IUVA 1HJDA 5IXFA 1WPYA 4DEYA 3EHQA 3LWIA 3O8VA 2DXTA 2KEAA 1X6OA 3E2UA 4C92A 1VQKT 2RQTA 3FEOA 2K2VA 3E9GA 3OB9A 1SF9A 3OYYA 1WZOA 4HCZA 4M78F 3REAB 1V76A 2QQSA 1FMWA 4BDZA 3JCMc 4M75G 4R0KA 5KCOA 1OX9A 2LNHB 3FRNA 5GAN8 3OYAA 1CKBA 4NL2A 1KD1R 3KFVA 1ZX6A 3JCMe 4HXJA 5KE2A 4FYVB 2RJDA 4J6XA 2F2XA 2R57A 3PMTA 1VQLA 1H3HA 1OV3A 2DXCA 3CEYA 4LUEA 3LX7A 4HA8A 2ROTA 5LJ3e 3L2WA 3QYGB 4JJBA 5L8RE 2LRQA 3OBYA 2CUBA 2NUPB 3VS5A 4BY6B 4N4GA 4BY6C 3BY7A 4M78D 3TQ7P 1K0XA 3QYHB 5KYNA 3S3NA 1KC8U 1V29B 1N8RU 3VS1A 1RL2A 2FPDA 1WHLA 4PFPA 1UGVA 4RG8A 4PJOC 1Y71A 2E3HA 3M9QA 1QMCA 1G8XA 1PSEA 3L2UA 1WLPB 3MO8A 2F5TX 2RA2A 5GAMf 3EG3A 1M90R 2DD5A 3VRYA 2WSEE 4C92F 2QXFA 2RH2A 2QTVA 4A4GA 4CRIA 4E7JA 2OTLT 2E5KA 3WVEB 4JRIA 1YHQA 3FDRA 5GAOp 2EQIA 2M0OA 5KYWB 5LL6S 1ZA1B 3RBBB 2AIRB 3FJ5A 4LUDA 3G71Q 1K73C 2EBPA 1W2BA 4JUVA 5HK0A 4DQ2A 4X9CA 4OB3B 3H6ZA 4J6WA 1HSQA 4ELYC 4PJJA 4FT4A 4BE2A 2E65A 2HBWA 3PGGA 1OOTA 2CH4W 2CSIA 1Q81U 4Y92A 4KULA 1TTHB 2CZ7B 3DB4A 3CCEA 2K57A 1PRMC 3IQLA 2L2PA 3LLRA 3ASKA 4J9BA 1NPRA 3JB9J 3CCUQ 2RN8A 4X9DA 2BIVA 2DMOA 2ZAEA 2EKHA 5IHIA 3JAME 3VJPA 1NEBA 1VQPA 3CCUA 1RAEB 3CBPA 2ZPFB 2MWPA 3O5ZA 5LJ5e 2L3QA 2DD4A 2A0FB 3QWYA 2JTFA 5J3BA 4C92D 4J9GA 1RAIB 1YITA 2SRCA 3V8KA 3QXEB 1T3LA 2DL7A 4JJNK 1LJOA 4B6MA 3EGUA 5C6SA 1BBZA 1W2BP 5GAMh 4EMKB 4E7LA 1YJWT 3HPWA 3CCQT 4AG2C 1YI2Q 1ABOA 2QTXA 3QBYA 2RMOA 2RQRA 1JJ2S 5LJ3f 1G5VA 2M1HA 2J7IA 5GANj 1MMAA 1HD3A 2EWNA 8ATCB 2COYA 3JRZA 2K4YA 1ZUYA 1YJ9A 4NL3A 1B34A 4MZPA 1TU0B 2PUKB 2PVOB 1YI2T 5GANg 5LJ5d 2A36A 1QVPA 3OMGA 1VQ4T 2HSPA 1RAFB 3M0UA 4M75D 1Q82R 2E64A 1VQKA 4J8OA 2K9GA 3GP8A 1GCPA 1RACB 1OEBA 5GMKj 2HNIA 1SPKA 1MHNA 3CCJQ 1JXOA 1BU1A 4F17A 3VUZA 1M3BA 3UDCA 4C92C 1KC8C 2COZA 3RKYA 4F7UE 1JJ2A 4FL6A 1Y96B 4E7KA 4FT2A 1HYOA 3CCQQ 4M7AD 2DIGA 1YWOA 2O2OA 3PIPA 3E1SA 5IT9E 2P0KA 4RTVA 3LWHA 4M7DA 2RQWA 2IIMA 4DBHA 3GIBA 1AWWA 3I35A 4GLKA 4PJOE 2F69A 2X4YA 2EYXA 2R5AA 4ATOA 1K9MU 2L3RA 1G3TA 5FRMA 2QAZA 2KRSA 3QZ5B 5IN1A 3CC7Q 2RQUA 5LJ3j 2X9HA 2FRWA 2KXDA 2EQUA 2LQ8A 1ZSGA 2A3LA 3CXCP 3QZ9B 3V7SA 3VRZA 1M30A 1ZLMA 3QJ6A 1XTDA 1Q86U 2JMCA 2HL5C 4OMPA 3PVLA 1RLPC 4C92B 5IHKA 4GY5A 1TXQA 4RTWA 2X4WA 4KGVB 4XU2A 3HSBA 3ZBDA 3A8MB 1VQMQ 1SSHA 4HVVA 1GBQA 1D1CA 1WIEA 2CS7A 5IH2A 2L5QA 2GCXA 1UJ0A 1SRLA 3NHNA 1K9MC 2EYWA 2ZCFB 3MPUB 4C0DC 2GNCA 3UWNA 3KBGA 2EJ9A 1RAGB 2LCSA 1NJIR 2E4HA 2JVVA 3VS3A 3U23A 2QEXQ 2DK3A 1X6GA 3SDZA 4CC3A 2VUBA 3NTKA 2DKGA 2PU9B 2HQXA 2L3PA 3A5ZB 4QVZA 1VQPT 4AMCA 2YUPA 2DBMA 4XTWA 2XIDA 4LN2A 1VQMA 1K9AA 2HZYA 1VYUA 2HEQA 2DFUA 3H8ZA 2MI6A 3R6OA 4FYXB 4J9FA 1M2OA 2VV5A 1RI0A 3CXCA 3JCMf 3I56Q 2FHDA 2HL3A 5I21A 2BZXA 3CD6T 5GJWB 1MNEA 4OMQA 1AT1B 4E47A 3GF5A 3G4SA 1N9RA 3CC7A 2V1QA 1OI1A 3M55A 1KQ1A 1R0BG 2A08A 1S1NA 4OF1A 1H92A 1M2VB 2K6DA 2CREA 1VQ5A 4M78B 4Y28E 4ORZA 2F1LA 1LVKA 2DBKA 2L89A 1FWZA 1WFWA 3OYHA 1Q7YU 3J7AF 4M7AF 2IG0A 2QDYB 1T3SA 3MCAB 2LQKA 3V7RA 4M78A 1I0CA 1YIJT 2YLCA 1T0JA 4Z88A 1VQNQ 2MMPA 3BW1A 5FRNA 4HKEA 2B86A 1X75C 1SEMA 2K3YA 1K4US 2QI2A 3QUIA 1VQKQ 3L1AA 4A4FA 2QASA 2JTMA 3UT1A 1YJNT 1K73U 2KAFA 3H41A 2LDMA 4M7DD 4EMHA 1QLYA 1RAAB 2DIQA 5LJ5f 5CKFA 2KDSA 4EPCA 2J6OA 4ELZC 3J81E 2LT1A 2KVQG 2FZGB 3UATA 5CIUA 1TWBA 1M3AA 1YI2A 3LW5E 2ABLA 2GBQA 3MP8A 3SEMA 2CT3A 5LJ5j 2CP3A 3EGDA 3G6ET 2YLBA 5I22A 1J3TA 4M4ZA 2XMFA 4C8QE 4PNOA 1OZ3A 1HK9A 2EW3A 1B34B 2VC8A 3M0SA 4C8QA 1I07A 4KBMB 2XICA 3I9QA 4RKUE 3WXMB 1KHCA 1QVFP 2H3JA 2NUZA 4PJNA 3VYGA 1I4K1 6AT1B 2DA9A 1KK7A 1WYXA 1XJWB 1OYXA 2MCNA 3L2QA 1OU8A 5IHNA 2VASA 2D9TA 2MK5A 2EJFA 4R56A 1TH7A 2LQWA 3OW2P 1PM3A 2A7YA 4DBRA 1U1SA 1WHGA 3CCEQ 2AK5A 5D6WA 1JO8A 4OMOA 3SB2A 2RJCA 1Q95G 1ZHIA 2YUNA 4Q5WA 2EQJA 2PNIA 1NJIC 1WDXA 2LQNA 1K73R 1VQMT 1IREB 4OMNA 3EG9B 4LXCA 4PKCC 1N8RC 3FC3A 4V2SA 3CCLQ 2LZ6B 3CXCS 4M77G 3SWNC 3EFOB 4GBQA 2GFUA 1FYNA 4PFZA 5CO7A 2PZ1A 1X43A 3P8DA 3CCSQ 1M90C 3I55Q 2P0PA 3M0RA 3MKDA 1WXTA 3A8GB 2EJGA 2RK1A 2JS2A 1VQ7Q 1QVGP 4MMKA 2C0IA 1OULA 3JCMX 2OI3A 1YJNQ 1ZA2B 1UUEA 4OMFB 2DNUA 4M77E 3H9NA 4RTTA 2ZPGB 5FWBA 1AWJA 3CPWP 2IPOB 3DB3A 2KBTA 3EFRA 4N4HA 4M7DF 3QPHA 1WHJA 2X4JA 4AFZC 2JW4A 2DYIA 3CBOA 2GF7A 2ED1A 1W1FA 4OP0A 1LPLA 2DZ9A 3HFOA 5GAMe 2JMAA 2VB6A 3JCMQ 2LMJA 4J9CA 1AHJB 4BB7A 2QGGA 3LYIA 2LJ3A 1P92A 4HVUA 4F14A 1Y07A 4C8QF 2PUOB 1NYFA 1GFCA 2CT4A 1YJNA 3QKJA 1AEYA 2CUDA 1VQLQ 1I1JA 2PVDB 4BE1A 1O75A 1Y57A 2FEIA 1YJ9Q 2C0OA 3L2RA 3V8LA 1Q82C 2XDPA 2KYBA 2FPFA 1VQ5T 2D6FA 3PVQA 5D7UA 2L0AA 3HRUA 4KUIA 1VQ8Q 2CH4A 2MPXC 2P84A 3CCSA 4OB1B 3CPWA 3OYJA 5KH6A 3AHUA 2HCKA 3RESA 1A0NB 1M4ZA 4AG1C 4CC4B 1H641 3QG1A 5DY9A 3OYIA 1SRMA 1M2VA 2DTHA 4J9IA 1K1ZA 4J9HA 3JSCA 5GANh 3G1JA 3FB9A 1D1AA 1OPLA 2KROA 2L3SA 5DLQE 3OYFA 3ULRB 4RTUA 2DL8A 3SFMA 1Z9QA 4FSXA 4BI3A 4M75C 3EFOA 2QA4A 3SD4A 1S72Q 2VYTA 2O31A 2V26A 4DBFA 2RI3A 1BK2A 3URGA 3CCRT 2D8HA 3GNFB 2KR3A 3VKIA 7AT1B 3LH5A 3MEVA 2EYQA 2YUQA 1VQOT 3QHSA 1GCQC 1VQ9T 2XDDA 5KCHA 2KMTA 4M77D 2FVUA 5L23A 1YWPA 1BCOA 2YHTA 4M77A 3OSSC 5EC7A 2RHZA 4C5GA 5I11A 2JT4A 2ROLA 1U1TA 3GBQA 2DXUA 9ATCB 1OQKA 4E7SA 1WX6A 2DILA 3OYKA 1KIKA 1LOJA 1ACMB 2DJQA 5LJ3d 1K8AC 1NBEB 1AVZC 4AT1B 4IUQA 1M1FA 1UGQB 3FJPA 5M9OA 3A8HB 3EAEA 1K76A 3INZA 3VS4A 2D0QB 2VGMA 5CR2A 5HK3A 2DPPB 2OTLQ 2NYSA 4C8QD 2BKDN 3CD6Q 2NWMA 1WQWA 2J6KA 4F7UA 1IB8A 2QQRA 3M4YA 3QWXX 1LCKA 1TUDA 1VQNA 3MEUA 2A28A 3L2ZA 4ZGEB 1RI9A 1FXXA 4ME7A 4MZMA 2GTOA 4X1VA 4AFSC 4TVRA 2CDTA 3JCMP 3CC2A 2BE7D 1UG1A 2AT1B 2CKKA 3F70A 1KD1C 2YDLA 2CZ1B 3FLGA 1WXUA 1W2BS 2DJZA 3M5AA 2RHUA 1UTIA 3HP9A 3UF4A 4HT9A 3MHXA 4M77B 1X6BA 2K5LA 3ME9A 3NPFA 1PHTA 2ED0A 2YRVA 4BD3A 3H0FA 2DZCA 3NTIA 3JCMb 3OA6A 1G3WA 1YNZA 3OSVA 3VUBA 2DTIA 3X20B 3G4SQ 2LNVA 4M7AE 3DKMA 2X4XA 2YRCA 2RK2A 1KQSP 4PJOA 2EYYA 2W0ZA 4KUDK 2ZGWA 5GAOl 4PJOD 1WA7A 5ECAA 4Z89A 2NLUA 2HQHA 3EG0A 4F7UG 5GANe 2M0YA 4DOVA 2XI9A 2LTOA 2Y4YA 4C0FA 1N8RR 1OX8A 1QKXA 3VV0A 1BI0A 1ABQA 3RR6A 3Q1JA 3RERA 3OY9A 3C4SA 2I0NA 2XG8D 3M53A 4L59A 4Y91A 1MMGA 1T0HA 2KT1A 1RAHB 1DJ7B 2O4XB 3RMSA 3CCST 1SG5A 3VS0A 3OS5A 3N5BB 4CI0C 3X26B 1PCXA 4JRPA 4BACA 2E12A 1JJ2P 4WF2A 4A4EA 2GFAA 1N9SA 2CYZB 2XHCA 3S6WA 1NM7A 3G4ST 5CKEA 1VQ9A 2ATCB 1TS9A 5I2MA 2ESWA 2JTEA 4OVAA 4JJDA 2Y4XA 5J39A 5GAMj 1K9MR 3G71T 5IXBA 2DVEA 5GMKl 1F1BB 2OTJA 1BI2A 1WGSA 2HKNA 4XU3A 3GPLA 1OU9A 2H8HA 4PJOB 4LDVA 2RB6A 1YBYA 3E9FA 1NPPA 4XTXA 3VU3C 5LJ5h 2LT4A 1VIFA 5CCAA 3QDRB 2O01E 3ER0A 4K11A 1I5LA 2RD1A 2K3BA 1PRLC 1M1KR 3GLXA 2KRNA 2FZCB 1KQSA 3CCRA 2DEUA 4ZNXA 3PIOA 2GTJA 2HQEA 2RO0A 4XTUA 4RCCA 3CC4T 2M02A 2OAWA 1SSFA 3M0QA 1VQLT 5GAN6 2KSSA 3JB9I 1VQ6Q 4II1A 2G3RA 5KYUB 5GAOq 3PMIA 2KRMA 4RTZA 1NLPC 3JCMg 3CC4Q 4HCBA 1Q86C 2W10A 2RI2A 1ARKA 2RQVA 1SKUB 1BI3A 5DLOA 4J5YA 3CMAQ 3WVDB 1YCSB 2F2VA 3L2VA 1BCMA 4XAXB 4Z02A 1W6XA 3V8JA 3CMAA 4PK4A 1JU5C 4ZN3A 2MYSA 1I5OB 4DA4A 4FM4B 2ZZDA 2PQWA 4QT7A 3A8OB 5GAOr 2CP0A 1UDLA 2GQVA 3C95A 1BIBA 1BYMA 2K5IA 3KXTA 1VQ6A 1FX7A 4E6RA 4MDXA 2KXCA 1VQ9Q 1NEGA 4OGCA 1YIJQ 1BB9A 2WSFE 5GAN7 2I2LA 1VQ4A 1UHCA 4N0AC 2EKOA 3UA6A 4XK8E 5C0MA 4LE9A 2LVMA 1UGPB 3EFSA 3M57A 4BDYA 1QQJA 4DOWA 2LP5A 3CBMA 2K3XA 1M1GA 5D6XA 2HKQB 1BI1A 1GBRA 3HTRA 3JCMW 1R0CB 1AWOA 4KRTA 1D09B 2CSQA 3QIIA 1QW1A 1FMVA 1Y0MA 2COWA 1G83A 3TCJA 1NYGA 4M78E 1QCFA 2RHIA 4QQDA 1WHHA 3VS2A 4C0DB 1X01A 2QA4T 1MV0B 4ZTJA 4C8QC 4A54A 4M7DC 3I56A 1AZGB 1VQ7T 1JRIA 1N27A 3G71A 5GMKi 4RG2A 3MEAA 1PSFA 4C92G 1S72T 1AWXA 3CPFA 3V7CA 5FWCA 2EFIA 2RF0A 2MWOA 2O88A 5FU6B 1YN8A 2YWWA 1GCQA 1EIFA 2VGNA 1UE9A 5CAIA 2JOYA 4IKFA 4KGZB 5I2SA 2AKLA 2LX9A 1SHFA 5GANf 2JUFA 4JRQA 1GL5A 2DF6A 4IUPA 1AD5A 2OJ2A 3OYBA 2DRMA 1YJWA 2KNBB 3NFCA 2Y90A 5LJ3g 3EH2A 4F16A 4ZN1A 4JLIA 1I81A 4C5IA 5A0DA 3HRTA 1PC0A 2QYZA 1EZZB 1G3SA 2BUDA 3CD6A 2EAYA 1KC8R 2FB7A 1CKAA
chains in the Genus database with same CATH topology
1IO6A 3M0PA 3EG2A 1U06A 1VYTA 2A36A 4RUGA 2O31A 2HSPA 3REBB 3M0UA 2AZSA 3R6NA 3TVTA 2K9GA 1GCPA 3VS6A 1OEBA 3H0IA 1BK2A 3VS7A 2D8HA 2KR3A 1SPKA 2MOXA 1JXOA 1BU1A 2X3XD 3LH5A 4F17A 1M3BA 2YUQA 2X3WD 1GCQC 2FG0A 2EGCA 1PKTA 2J6FA 1MV3A 4IIMA 1UFFA 1JEGA 5L23A 1YWPA 4JZ4A 3NGPA 1YWOA 3EG1A 2O2OA 5EC7A 3UA7A 5I11A 1TG0A 2JT4A 4RTVA 2ROLA 3GBQA 2DYBA 2RQWA 2IIMA 3THKA 2HDAA 1AWWA 1WX6A 2DILA 3I35A 1V1CA 1VYVA 2VVKA 1KIKA 1X2QA 2AZVA 1M3CA 2DJQA 2EYXA 1NLOC 2C0TA 2D1XA 3EHRA 2KE9A 2KRSA 2YT6A 1AVZC 1M27C 2RQUA 2FRWA 2KXDA 1Z9ZA 1ZSGA 2EPDA 2J06A 3VRZA 2DL5A 2KT8A 2V1RA 1M30A 1ZLMA 1K76A 3VS4A 2JMCA 1E6GA 4OMPA 3PVLA 1RLPC 2EYZA 2GGRA 4WCIA 1YP5A 5IHKA 2D0NA 2NWMA 4RTWA 2J6KA 2O9VA 1SSHA 4HVVA 3QWXX 1GBQA 1WIEA 2D8JA 1LCKA 2SEMA 2YSQA 5IH2A 1TUDA 2A28A 3A98A 1PNJA 1SRLA 1RI9A 1UJ0A 3I5RA 3NHNA 2EYWA 4D8DA 3I5SA 2GNCA 2GTOA 4FSSA 4X1VA 4AFSC 2CDTA 2LX7A 4CC2A 1UG1A 2LCSA 1EFNA 3VS3A 2YDLA 3U23A 4IIOA 1WXUA 1X6GA 1JQQA 4CC3A 1UTIA 3UF4A 1TUCA 2L3PA 1X6BA 3NPFA 3C0CA 1PHTA 2YUPA 1UJYA 2ED0A 2DBMA 1WI7A 3H0FA 4D8KA 4LN2A 1K9AA 1YNZA 1VYUA 2HEQA 4J9DA 2DM1A 2FO0A 4J9FA 1JXMA 1AZEA 1XOVA 1QKWA 2RNAA 2EYYA 2W0ZA 1X69A 3TSWA 4OMMA 2BZXA 1WA7A 2DE0X 1AOJA 4J9EA 1ZUKA 5GJWB 4OMQA 5ECAA 4DEXA 2DVJA 4Z89A 4Z8AA 1N5ZA 4A63B 5HCKA 4LNPA 3EG0A 2O9SA 2V1QA 2M0YA 1NG2A 3PE0A 2M51A 1ZUUA 2K7AA 1QKXA 2A08A 1S1NA 1ABQA 1H92A 1FMKA 2K6DA 2CREA 1GRIA 2DX1A 5FW9A 1UHFA 4ORZA 2EVRA 2DBKA 1WFWA 2LJ1A 2I0NA 1T3SA 1VA7A 1QWEA 5GJVB 2KT1A 1T0HA 2K79A 1E6HA 1I0CA 3ZL7C 1KSWA 1T0JA 4AFQC 1CSKA 4Z88A 3VS0A 1PWTA 1X27A 1X2KA 2FRYA 1NM7A 2B86A 1SEMA 1K4US 2ESWA 4HVWA 4CC7A 2JTEA 4JJDA 2DRKA 3TSZA 1UECA 5IXBA 1B07A 2JM9A 3H41A 2G6FX 1QLYA 1MUZA 2JM8A 1HJDA 2LJ0A 5IXFA 4DEYA 3EHQA 2J6OA 2KEAA 2H8HA 2GQIA 2YUOA 3UATA 2RQTA 1OPKA 1M3AA 1G2BA 3REAB 2ABLA 4K11A 2GBQA 3SEMA 2CT3A 1B3QA 2K3BA 1H8KA 1PRLC 2KRNA 5I22A 1J3TA 1E7OA 2JS0A 4M4ZA 3SHWA 2XMFA 4ZNXA 2EW3A 4R0KA 2GTJA 1K0SA 3M0SA 2RPNA 2MIOA 2LNHB 1I07A 2EGAA 2K2MA 3I9QA 2OAWA 4GLMA 1CKBA 2NUZA 3KFVA 1ZX6A 3M0QA 4HXJA 2DA9A 2F2XA 1WYXA 2BZ8A 4RTYA 1H3HA 1OV3A 2MCNA 4LUEA 2KRMA 5IHNA 2ROTA 4RTZA 1NLPC 1KJWA 4JJBA 1M8MA 2W10A 4RTXA 1ARKA 2LQWA 2CUBA 2RQVA 3VS5A 2PTKA 2AK5A 1K0XA 2A37A 1JO8A 4OMOA 1YCSB 2F2VA 2YUNA 2JXBA 2PNIA 3VS1A 2DL3A 1GFDA 2FPDA 1WDXA 2LQNA 1PKSA 1W6XA 4OMNA 3JV3A 1UGVA 1JU5C 2VWFA 4QT7A 2LZ6B 1UDLA 1WLPB 4GBQA 4HCKA 1FYNA 2PZ1A 1X43A 3RNJA 2DL4A 3EG3A 3VRYA 4E6RA 2KXCA 1NEGA 3M0RA 1BB9A 1WXTA 2E5KA 2EQIA 2F2WA 2JS2A 1UHCA 3M0TA 2C0IA 3UA6A 4LE9A 3RBBB 2OI3A 3FJ5A 4JJCA 4LUDA 1RUWA 2EBPA 1UUEA 2LP5A 2DNUA 4RTTA 1GBRA 1HSQA 3NMZC 5FWBA 1AWJA 1AWOA 1ZBJA 2HBWA 3CQTA 4KRTA 2CSQA 2KBTA 1OOTA 2CH4W 2CSIA 4AFZC 1Y0MA 3H0HA 1G83A 1W70A 2JW4A 1U5SA 1NYGA 4Y92A 2ED1A 1W1FA 2BTTA 2JMAA 1QCFA 1PRMC 3IQLA 2L2PA 2LMJA 3VS2A 1SHGA 4J9CA 4J9BA 2EGEA 1MV0B 2FPEA 2LJ3A 4JPBW 4AFUC 2RN8A 4HVUA 4F14A 4EIKA 1NYFA 2DMOA 1AZGB 1GFCA 2CT4A 2VKNA 2EKHA 4OMLA 5IHIA 2CUDA 1AEYA 1I1JA 1U3OA 1NEBA 1Y57A 2FEIA 2C0OA 1AWXA 1KFZA 2J05A 5FWCA 2KYBA 2FPFA 3PVQA 2RF0A 3O5ZA 2L3QA 4ESRA 2O88A 3QWYA 2L0AA 4JZ3A 1YN8A 2CH4A 1RLQC 4J9GA 2SRCA 1GCQA 2AKKA 2ENMA 1T3LA 1UE9A 2DLPA 2DL7A 2BZYA 2HCKA 2AKLA 3EGUA 1A0NB 1SHFA 1BBZA 1QWFA 2QDLA 4AG1C 4CC4B 1GL5A 2DF6A 4AG2C 1AD5A 2OJ2A 1SRMA 1ABOA 1WXBA 1K1ZA 2DRMA 4J9IA 2RMOA 2KNBB 4J9HA 2RQRA 4F16A 1OPLA 2ECZA 2KGTA 2KROA 2J7IA 2L3SA 1HD3A 3ULRB 4RTUA 2KYMA 2DL8A 1ZUYA 1Z9QA 2P4RA 1CKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO6 A;  3M0P A;  3EG2 A;  1U06 A;  1VYT A;  2A36 A;  4RUG A;  2O31 A;  2HSP A;  3REB B;  3M0U A;  2AZS A;  3R6N A;  3TVT A;  2K9G A;  1GCP A;  3VS6 A;  1OEB A;  3H0I A;  1BK2 A;  3VS7 A;  2D8H A;  2KR3 A;  1SPK A;  2MOX A;  1JXO A;  1BU1 A;  2X3X D;  3LH5 A;  4F17 A;  1M3B A;  2YUQ A;  2X3W D;  1GCQ C;  2FG0 A;  2EGC A;  1PKT A;  2J6F A;  1MV3 A;  4IIM A;  1UFF A;  1JEG A;  5L23 A;  1YWP A;  4JZ4 A;  3NGP A;  1YWO A;  3EG1 A;  2O2O A;  5EC7 A;  3UA7 A;  5I11 A;  1TG0 A;  2JT4 A;  4RTV A;  2ROL A;  3GBQ A;  2DYB A;  2RQW A;  2IIM A;  3THK A;  2HDA A;  1AWW A;  1WX6 A;  2DIL A;  3I35 A;  1V1C A;  1VYV A;  2VVK A;  1KIK A;  1X2Q A;  2AZV A;  1M3C A;  2DJQ A;  2EYX A;  1NLO C;  2C0T A;  2D1X A;  3EHR A;  2KE9 A;  2KRS A;  2YT6 A;  1AVZ C;  1M27 C;  2RQU A;  2FRW A;  2KXD A;  1Z9Z A;  1ZSG A;  2EPD A;  2J06 A;  3VRZ A;  2DL5 A;  2KT8 A;  2V1R A;  1M30 A;  1ZLM A;  1K76 A;  3VS4 A;  2JMC A;  1E6G A;  4OMP A;  3PVL A;  1RLP C;  2EYZ A;  2GGR A;  4WCI A;  1YP5 A;  5IHK A;  2D0N A;  2NWM A;  4RTW A;  2J6K A;  2O9V A;  1SSH A;  4HVV A;  3QWX X;  1GBQ A;  1WIE A;  2D8J A;  1LCK A;  2SEM A;  2YSQ A;  5IH2 A;  1TUD A;  2A28 A;  3A98 A;  1PNJ A;  1SRL A;  1RI9 A;  1UJ0 A;  3I5R A;  3NHN A;  2EYW A;  4D8D A;  3I5S A;  2GNC A;  2GTO A;  4FSS A;  4X1V A;  4AFS C;  2CDT A;  2LX7 A;  4CC2 A;  1UG1 A;  2LCS A;  1EFN A;  3VS3 A;  2YDL A;  3U23 A;  4IIO A;  1WXU A;  1X6G A;  1JQQ A;  4CC3 A;  1UTI A;  3UF4 A;  1TUC A;  2L3P A;  1X6B A;  3NPF A;  3C0C A;  1PHT A;  2YUP A;  1UJY A;  2ED0 A;  2DBM A;  1WI7 A;  3H0F A;  4D8K A;  4LN2 A;  1K9A A;  1YNZ A;  1VYU A;  2HEQ A;  4J9D A;  2DM1 A;  2FO0 A;  4J9F A;  1JXM A;  1AZE A;  1XOV A;  1QKW A;  2RNA A;  2EYY A;  2W0Z A;  1X69 A;  3TSW A;  4OMM A;  2BZX A;  1WA7 A;  2DE0 X;  1AOJ A;  4J9E A;  1ZUK A;  5GJW B;  4OMQ A;  5ECA A;  4DEX A;  2DVJ A;  4Z89 A;  4Z8A A;  1N5Z A;  4A63 B;  5HCK A;  4LNP A;  3EG0 A;  2O9S A;  2V1Q A;  2M0Y A;  1NG2 A;  3PE0 A;  2M51 A;  1ZUU A;  2K7A A;  1QKX A;  2A08 A;  1S1N A;  1ABQ A;  1H92 A;  1FMK A;  2K6D A;  2CRE A;  1GRI A;  2DX1 A;  5FW9 A;  1UHF A;  4ORZ A;  2EVR A;  2DBK A;  1WFW A;  2LJ1 A;  2I0N A;  1T3S A;  1VA7 A;  1QWE A;  5GJV B;  2KT1 A;  1T0H A;  2K79 A;  1E6H A;  1I0C A;  3ZL7 C;  1KSW A;  1T0J A;  4AFQ C;  1CSK A;  4Z88 A;  3VS0 A;  1PWT A;  1X27 A;  1X2K A;  2FRY A;  1NM7 A;  2B86 A;  1SEM A;  1K4U S;  2ESW A;  4HVW A;  4CC7 A;  2JTE A;  4JJD A;  2DRK A;  3TSZ A;  1UEC A;  5IXB A;  1B07 A;  2JM9 A;  3H41 A;  2G6F X;  1QLY A;  1MUZ A;  2JM8 A;  1HJD A;  2LJ0 A;  5IXF A;  4DEY A;  3EHQ A;  2J6O A;  2KEA A;  2H8H A;  2GQI A;  2YUO A;  3UAT A;  2RQT A;  1OPK A;  1M3A A;  1G2B A;  3REA B;  2ABL A;  4K11 A;  2GBQ A;  3SEM A;  2CT3 A;  1B3Q A;  2K3B A;  1H8K A;  1PRL C;  2KRN A;  5I22 A;  1J3T A;  1E7O A;  2JS0 A;  4M4Z A;  3SHW A;  2XMF A;  4ZNX A;  2EW3 A;  4R0K A;  2GTJ A;  1K0S A;  3M0S A;  2RPN A;  2MIO A;  2LNH B;  1I07 A;  2EGA A;  2K2M A;  3I9Q A;  2OAW A;  4GLM A;  1CKB A;  2NUZ A;  3KFV A;  1ZX6 A;  3M0Q A;  4HXJ A;  2DA9 A;  2F2X A;  1WYX A;  2BZ8 A;  4RTY A;  1H3H A;  1OV3 A;  2MCN A;  4LUE A;  2KRM A;  5IHN A;  2ROT A;  4RTZ A;  1NLP C;  1KJW A;  4JJB A;  1M8M A;  2W10 A;  4RTX A;  1ARK A;  2LQW A;  2CUB A;  2RQV A;  3VS5 A;  2PTK A;  2AK5 A;  1K0X A;  2A37 A;  1JO8 A;  4OMO A;  1YCS B;  2F2V A;  2YUN A;  2JXB A;  2PNI A;  3VS1 A;  2DL3 A;  1GFD A;  2FPD A;  1WDX A;  2LQN A;  1PKS A;  1W6X A;  4OMN A;  3JV3 A;  1UGV A;  1JU5 C;  2VWF A;  4QT7 A;  2LZ6 B;  1UDL A;  1WLP B;  4GBQ A;  4HCK A;  1FYN A;  2PZ1 A;  1X43 A;  3RNJ A;  2DL4 A;  3EG3 A;  3VRY A;  4E6R A;  2KXC A;  1NEG A;  3M0R A;  1BB9 A;  1WXT A;  2E5K A;  2EQI A;  2F2W A;  2JS2 A;  1UHC A;  3M0T A;  2C0I A;  3UA6 A;  4LE9 A;  3RBB B;  2OI3 A;  3FJ5 A;  4JJC A;  4LUD A;  1RUW A;  2EBP A;  1UUE A;  2LP5 A;  2DNU A;  4RTT A;  1GBR A;  1HSQ A;  3NMZ C;  5FWB A;  1AWJ A;  1AWO A;  1ZBJ A;  2HBW A;  3CQT A;  4KRT A;  2CSQ A;  2KBT A;  1OOT A;  2CH4 W;  2CSI A;  4AFZ C;  1Y0M A;  3H0H A;  1G83 A;  1W70 A;  2JW4 A;  1U5S A;  1NYG A;  4Y92 A;  2ED1 A;  1W1F A;  2BTT A;  2JMA A;  1QCF A;  1PRM C;  3IQL A;  2L2P A;  2LMJ A;  3VS2 A;  1SHG A;  4J9C A;  4J9B A;  2EGE A;  1MV0 B;  2FPE A;  2LJ3 A;  4JPB W;  4AFU C;  2RN8 A;  4HVU A;  4F14 A;  4EIK A;  1NYF A;  2DMO A;  1AZG B;  1GFC A;  2CT4 A;  2VKN A;  2EKH A;  4OML A;  5IHI A;  2CUD A;  1AEY A;  1I1J A;  1U3O A;  1NEB A;  1Y57 A;  2FEI A;  2C0O A;  1AWX A;  1KFZ A;  2J05 A;  5FWC A;  2KYB A;  2FPF A;  3PVQ A;  2RF0 A;  3O5Z A;  2L3Q A;  4ESR A;  2O88 A;  3QWY A;  2L0A A;  4JZ3 A;  1YN8 A;  2CH4 A;  1RLQ C;  4J9G A;  2SRC A;  1GCQ A;  2AKK A;  2ENM A;  1T3L A;  1UE9 A;  2DLP A;  2DL7 A;  2BZY A;  2HCK A;  2AKL A;  3EGU A;  1A0N B;  1SHF A;  1BBZ A;  1QWF A;  2QDL A;  4AG1 C;  4CC4 B;  1GL5 A;  2DF6 A;  4AG2 C;  1AD5 A;  2OJ2 A;  1SRM A;  1ABO A;  1WXB A;  1K1Z A;  2DRM A;  4J9I A;  2RMO A;  2KNB B;  4J9H A;  2RQR A;  4F16 A;  1OPL A;  2ECZ A;  2KGT A;  2KRO A;  2J7I A;  2L3S A;  1HD3 A;  3ULR B;  4RTU A;  2KYM A;  2DL8 A;  1ZUY A;  1Z9Q A;  2P4R A;  1CKA A; 
#chains in the Genus database with same CATH topology
 3CCM Q;  1Y96 A;  3HHT B;  3EG2 A;  3M0P A;  4YTL A;  2OTL A;  1VYT A;  4RUG A;  1YJ9 T;  3REB B;  2E1H A;  2AZS A;  1BKB A;  1C6V X;  3HL8 A;  3VS7 A;  5GAO m;  1VQ8 T;  1U8R A;  2MOX A;  3QO3 A;  2VXF A;  3JCM J;  4C0G A;  1M8V A;  1OZ2 A;  1MV3 A;  4IIM A;  4M75 B;  1W4S A;  1M90 U;  5CKB A;  3T9N A;  1JEG A;  4JZ4 A;  3CCV T;  2DEQ A;  3UA7 A;  2ZPE B;  2JNG A;  3A8L B;  1TG0 A;  3RDV A;  4NOY A;  3CC2 Q;  2YXY A;  3OBW A;  4MZT A;  3CPW S;  1QCO A;  3LGL A;  1V1C A;  2VVK A;  5GAN 3;  1YIT Q;  1M3C A;  1NE8 A;  2K5F A;  3VYH B;  4FYY B;  1NLO C;  2C0T A;  4M78 G;  3OYG A;  2KE9 A;  3CCJ A;  1M1K C;  3CCU T;  1IZ6 A;  1LNX A;  4F7U B;  1MMD A;  1VQP Q;  2KT8 A;  1XQH A;  1VQO Q;  2XKO C;  5FU7 B;  1E6G A;  1ZSZ C;  4E7Z A;  2NUT B;  4ANJ A;  4M75 E;  4QVD A;  1YIT T;  3PFS A;  4WCI A;  1YP5 A;  3OYN A;  2D0N A;  2KK4 A;  2M9U A;  2O9V A;  2XK0 A;  2D8J A;  3TEE A;  3G6E Q;  2SEM A;  1IRX A;  3A98 A;  1PNJ A;  3OQ5 A;  3I5R A;  1KG1 A;  4D8D A;  3I5S A;  2HBP A;  4FSS A;  4P5N A;  1QVG S;  2LX7 A;  2QGF B;  3CCL T;  4NS5 A;  3FIF A;  2DO3 A;  2HD0 A;  2CGH A;  5GAN 2;  4PJO G;  2HMA A;  4PLI A;  3EH1 A;  4FIB A;  3C0C A;  5GAN 4;  1MGQ A;  1UJY A;  3P8H A;  4OGE A;  3JCM h;  2DM1 A;  8AT1 B;  1KQ2 A;  3OW2 A;  1JXM A;  2P0Q A;  1AZE A;  1VUB A;  4LDX A;  4M7A A;  2CZ6 B;  1VQN T;  3PTA A;  1QKW A;  2RNA A;  2X51 A;  2C06 A;  2QA4 Q;  2EQM A;  4M7A G;  1X69 A;  3TSW A;  3JCM d;  4OMM A;  5KYY A;  2QEX T;  4JLG A;  4J9E A;  4C5H A;  4M7D E;  1M1K U;  4A63 B;  1N5Z A;  1WJQ A;  1Q81 C;  1MMN A;  4LNP A;  3QSU A;  4C92 E;  5FU7 C;  1NG2 A;  4MDW A;  3L42 A;  3PE0 A;  1ZSZ B;  2M51 A;  3X28 B;  2NUT A;  4JS4 A;  3JB9 H;  4IUU A;  1C0M A;  1R8O B;  4F7U F;  2QQB A;  1GRI A;  1XNI A;  1PD0 A;  2FYK A;  4LDW A;  5FU6 C;  5EG2 A;  3HRS A;  4OB2 B;  5GJV B;  1E6H A;  3X25 B;  4BUG A;  2PVG B;  5KYU A;  1TSF A;  3ZL7 C;  2HAX A;  4DBQ A;  2XD0 A;  1CSK A;  4A4K A;  4A53 A;  5KYW A;  5GAN 5;  3TU4 K;  4FU6 A;  1YHQ Q;  1VQ8 A;  1YFN A;  1X2K A;  3M54 A;  1WJR A;  2V8K A;  4A4H A;  4HVW A;  2E70 A;  4E7H A;  3LGF A;  2E3I A;  2JZ2 A;  3AT1 B;  3TSZ A;  3SWN A;  3TRE A;  3CCM A;  3RUX A;  4QW2 A;  2G6F X;  3MP1 A;  1MUZ A;  4RMO A;  2LJ0 A;  2M16 A;  2GQI A;  2YUO A;  4XQ3 A;  4EMK C;  3HKS A;  5KYY B;  1OPK A;  4PJL A;  1YJW Q;  3CCJ T;  1G2B A;  2KI7 A;  5GAM g;  5CKD A;  1B3Q A;  5AT1 B;  1H8K A;  3M59 A;  2ZPI B;  1IGQ A;  1E7O A;  2JS0 A;  3SHW A;  1WJS A;  1VQ6 T;  3A1P A;  1K0S A;  2RPN A;  2MIO A;  1KD1 U;  1JBM A;  4HT8 A;  5FRO A;  3ZFJ A;  2QQ9 A;  2EGA A;  5KYX A;  2K2M A;  3D7S B;  1MND A;  4GLM A;  1QCN A;  1G3Y A;  3I55 A;  4C8Q B;  3JB9 G;  5HY6 A;  2BZ8 A;  1M5Q 1;  5FLX E;  2DTO A;  4RTY A;  3I56 T;  2O4X A;  3ZEH A;  3CCL A;  4KGX B;  1KJW A;  1QP2 A;  3OYD A;  1M8M A;  1Q7Y R;  4RTX A;  2V8J A;  4QKU A;  2PTK A;  4J83 A;  2BE9 B;  3CME A;  2A37 A;  4KH1 B;  3JCM V;  5GMK h;  1WQ7 A;  2JXB A;  1UB4 A;  2DL3 A;  1GFD A;  5GMK e;  1PKS A;  3OYM A;  2XU8 A;  1Q82 U;  2RJF A;  3JV3 A;  2NUP A;  2LCL A;  5GAO n;  1R77 A;  4LD9 K;  5LJ3 h;  2XDB A;  2VWF A;  2MAM A;  5DM7 R;  1S72 A;  4HCK A;  2DXB A;  1VQO A;  2JJ9 A;  3RNJ A;  2DL4 A;  1JB0 E;  3GNG A;  1VQ4 Q;  1WHK A;  5CVI A;  2AHJ B;  4LDY A;  1WNL A;  1YIJ A;  1NZ9 A;  4JRK A;  1UGR B;  4L5G A;  3M58 A;  2F2W A;  3M0T A;  4FCY A;  1PD1 A;  4JJC A;  2R58 A;  1RUW A;  2YRD A;  3DLM A;  4X34 A;  1KQS S;  1ZBX A;  3CMA T;  2KY9 A;  3NMZ C;  2CP2 A;  2H3E B;  2FL7 A;  1ZBJ A;  4F04 B;  3CQT A;  3CCV Q;  3G7Z A;  1VQ5 Q;  5CK9 A;  1IXD A;  2WAC A;  3H0H A;  1W70 A;  1U5S A;  2CP6 A;  3J80 E;  1Q86 R;  2LC4 A;  2BTT A;  3OYL A;  3CCV A;  3DLL A;  1SHG A;  2QK0 A;  2EGE A;  2FPE A;  4JPB W;  2MF2 A;  4AFU C;  4EIK A;  3EGX A;  2RHX A;  2VKN A;  1O9S A;  1HXD A;  4OML A;  3CCM T;  1U3O A;  2R5M A;  4M7A B;  4M7A C;  2V8I A;  4EMK A;  1D3B B;  4O5V A;  1KFZ A;  1I8F A;  2J05 A;  4M77 C;  1NJI U;  4ZTF A;  4PJM A;  4ESR A;  4JZ3 A;  4MML A;  3SWN B;  2E10 A;  5HKC A;  1RLQ C;  1D3B A;  2AKK A;  1D0Y A;  3KUF A;  1YHQ T;  2ENM A;  4J6Y A;  2DLP A;  3MJX A;  2BZY A;  3C12 A;  3CCR Q;  2X35 A;  5AYF A;  1QWF A;  2QDL A;  2B8A A;  4KT0 E;  2DER A;  3OYE A;  3RMQ A;  5GMK m;  1WXB A;  2DET A;  2Z0W A;  4LDU A;  3S3O A;  2WSC E;  1QP3 A;  4J7F A;  1VQ7 A;  2VXE A;  4FW2 A;  3PT9 A;  4N4I A;  2ECZ A;  4XTY A;  2KGT A;  4WTO B;  5IAY A;  2KYM A;  4EMG A;  2OTJ Q;  1YCY A;  2IVW A;  2P4R A;  2V1R A;  1IO6 A;  1D0Z A;  1U06 A;  2L8D A;  2QG9 B;  4D6W A;  3R6N A;  3TVT A;  1ZSZ A;  3BE3 A;  4PFO A;  3VS6 A;  5CQY A;  3H0I A;  4C5E A;  4QQG A;  4XU0 A;  1EX4 A;  3RKX A;  2X3X D;  3CME T;  2X3W D;  2FG0 A;  2EGC A;  1Y7X A;  1PKT A;  4FYW B;  2J6F A;  3QDF A;  1UFF A;  2RI5 A;  2ZPB B;  4IUR A;  3NGP A;  3EG1 A;  4PLL A;  1D0X A;  3BDL A;  2QEX A;  3M56 A;  4XTZ A;  4L6V 5;  2DYB A;  3OS2 A;  2P4T A;  3EGD B;  3THK A;  4KH0 B;  2HDA A;  2FZK B;  1N6A A;  1QVG A;  5A2Q E;  1M9S A;  1VYV A;  3CCQ A;  1X2Q A;  2AZV A;  3S3M A;  1QVF S;  2D1X A;  3EHR A;  2JN0 A;  2YT6 A;  4QVC A;  4M78 C;  1M27 C;  1RAD B;  1Z9Z A;  4RCB A;  2KQW A;  2EPD A;  2J06 A;  1WHM A;  4ZGD B;  2DL5 A;  3GOX A;  4JDS A;  4B9W A;  1H3Z A;  4XU1 A;  1RAB B;  2RM4 A;  2E6Z A;  3LH0 A;  3JB9 D;  2EYZ A;  2GGR A;  3NTH A;  4R55 A;  2F5K A;  4J7I A;  1UGS B;  5CKH A;  4PJO F;  3UPU A;  2EQK A;  4E7I A;  1D1B A;  1ZQ1 A;  2YSQ A;  3EGX B;  3PNW C;  1QVF A;  4N0A A;  1IHW A;  1K8A U;  2RJE A;  2E41 A;  1VIE A;  1KHI A;  4CC2 A;  1IGU A;  3OS1 A;  2CP7 A;  1EFN A;  2OX7 A;  3CC7 T;  3CC2 T;  1BIA A;  4QQ6 A;  3CC4 A;  5KYX B;  4IIO A;  1JQQ A;  1C1A A;  2CZ0 B;  5GAM d;  4E2F B;  4OB0 B;  1TUC A;  4M75 A;  1UEB A;  4PL6 A;  4FW1 A;  2OAU A;  1WI7 A;  4BI8 B;  4D8K A;  4M7D B;  3MET A;  4ZGJ B;  4B9X A;  4J9D A;  2LCC A;  3MEW A;  1GXI E;  3JB9 F;  2FO0 A;  1PG5 B;  2E5Q A;  1XOV A;  1IHV A;  3RIR A;  3CCE T;  3M4G A;  4HCC A;  3X24 B;  1K8A R;  5J26 A;  2DE0 X;  1AOJ A;  3OW2 S;  1ZUK A;  4EDU A;  4JS5 A;  4DEX A;  3QJY A;  3P8B B;  2DVJ A;  4Z8A A;  2DAQ A;  1Q81 R;  5HCK A;  1TUG B;  2O9S A;  4UC4 A;  3RKW A;  1B7T A;  1ZUU A;  5A0G A;  2K7A A;  2EIF A;  5A0L A;  1FMK A;  4LD6 A;  3CME Q;  2DX1 A;  5FW9 A;  4O6J A;  2CP5 A;  1UHF A;  4BE0 A;  2EVR A;  4M77 F;  4M75 F;  2LJ1 A;  3HFN A;  4XTV A;  5KE3 A;  4C8Q G;  1VA7 A;  1QWE A;  5D6Y A;  2K79 A;  1KSW A;  4IUT A;  1Q7Y C;  2RHY A;  4AFQ C;  2HSE B;  1PWT A;  3C94 A;  4BI4 A;  3OYC A;  3I55 T;  3G6E A;  1X27 A;  2FRY A;  5CQX A;  3BFM A;  3OS0 A;  3MP6 A;  3OMC A;  1VOM A;  4CC7 A;  2QQA A;  5LJ5 g;  5GAN d;  4VUB A;  2E6N A;  2DRK A;  2OTJ T;  1UEC A;  1TOV A;  1B07 A;  3BDU A;  3E19 A;  4C0Z A;  2JM9 A;  2ZPH B;  4M7D G;  2JM8 A;  3EG9 A;  4IUV A;  1HJD A;  5IXF A;  1WPY A;  4DEY A;  3EHQ A;  3LWI A;  3O8V A;  2DXT A;  2KEA A;  1X6O A;  3E2U A;  4C92 A;  1VQK T;  2RQT A;  3FEO A;  2K2V A;  3E9G A;  3OB9 A;  1SF9 A;  3OYY A;  1WZO A;  4HCZ A;  4M78 F;  3REA B;  1V76 A;  2QQS A;  1FMW A;  4BDZ A;  3JCM c;  4M75 G;  4R0K A;  5KCO A;  1OX9 A;  2LNH B;  3FRN A;  5GAN 8;  3OYA A;  1CKB A;  4NL2 A;  1KD1 R;  3KFV A;  1ZX6 A;  3JCM e;  4HXJ A;  5KE2 A;  4FYV B;  2RJD A;  4J6X A;  2F2X A;  2R57 A;  3PMT A;  1VQL A;  1H3H A;  1OV3 A;  2DXC A;  3CEY A;  4LUE A;  3LX7 A;  4HA8 A;  2ROT A;  5LJ3 e;  3L2W A;  3QYG B;  4JJB A;  5L8R E;  2LRQ A;  3OBY A;  2CUB A;  2NUP B;  3VS5 A;  4BY6 B;  4N4G A;  4BY6 C;  3BY7 A;  4M78 D;  3TQ7 P;  1K0X A;  3QYH B;  5KYN A;  3S3N A;  1KC8 U;  1V29 B;  1N8R U;  3VS1 A;  1RL2 A;  2FPD A;  1WHL A;  4PFP A;  1UGV A;  4RG8 A;  4PJO C;  1Y71 A;  2E3H A;  3M9Q A;  1QMC A;  1G8X A;  1PSE A;  3L2U A;  1WLP B;  3MO8 A;  2F5T X;  2RA2 A;  5GAM f;  3EG3 A;  1M90 R;  2DD5 A;  3VRY A;  2WSE E;  4C92 F;  2QXF A;  2RH2 A;  2QTV A;  4A4G A;  4CRI A;  4E7J A;  2OTL T;  2E5K A;  3WVE B;  4JRI A;  1YHQ A;  3FDR A;  5GAO p;  2EQI A;  2M0O A;  5KYW B;  5LL6 S;  1ZA1 B;  3RBB B;  2AIR B;  3FJ5 A;  4LUD A;  3G71 Q;  1K73 C;  2EBP A;  1W2B A;  4JUV A;  5HK0 A;  4DQ2 A;  4X9C A;  4OB3 B;  3H6Z A;  4J6W A;  1HSQ A;  4ELY C;  4PJJ A;  4FT4 A;  4BE2 A;  2E65 A;  2HBW A;  3PGG A;  1OOT A;  2CH4 W;  2CSI A;  1Q81 U;  4Y92 A;  4KUL A;  1TTH B;  2CZ7 B;  3DB4 A;  3CCE A;  2K57 A;  1PRM C;  3IQL A;  2L2P A;  3LLR A;  3ASK A;  4J9B A;  1NPR A;  3JB9 J;  3CCU Q;  2RN8 A;  4X9D A;  2BIV A;  2DMO A;  2ZAE A;  2EKH A;  5IHI A;  3JAM E;  3VJP A;  1NEB A;  1VQP A;  3CCU A;  1RAE B;  3CBP A;  2ZPF B;  2MWP A;  3O5Z A;  5LJ5 e;  2L3Q A;  2DD4 A;  2A0F B;  3QWY A;  2JTF A;  5J3B A;  4C92 D;  4J9G A;  1RAI B;  1YIT A;  2SRC A;  3V8K A;  3QXE B;  1T3L A;  2DL7 A;  4JJN K;  1LJO A;  4B6M A;  3EGU A;  5C6S A;  1BBZ A;  1W2B P;  5GAM h;  4EMK B;  4E7L A;  1YJW T;  3HPW A;  3CCQ T;  4AG2 C;  1YI2 Q;  1ABO A;  2QTX A;  3QBY A;  2RMO A;  2RQR A;  1JJ2 S;  5LJ3 f;  1G5V A;  2M1H A;  2J7I A;  5GAN j;  1MMA A;  1HD3 A;  2EWN A;  8ATC B;  2COY A;  3JRZ A;  2K4Y A;  1ZUY A;  1YJ9 A;  4NL3 A;  1B34 A;  4MZP A;  1TU0 B;  2PUK B;  2PVO B;  1YI2 T;  5GAN g;  5LJ5 d;  2A36 A;  1QVP A;  3OMG A;  1VQ4 T;  2HSP A;  1RAF B;  3M0U A;  4M75 D;  1Q82 R;  2E64 A;  1VQK A;  4J8O A;  2K9G A;  3GP8 A;  1GCP A;  1RAC B;  1OEB A;  5GMK j;  2HNI A;  1SPK A;  1MHN A;  3CCJ Q;  1JXO A;  1BU1 A;  4F17 A;  3VUZ A;  1M3B A;  3UDC A;  4C92 C;  1KC8 C;  2COZ A;  3RKY A;  4F7U E;  1JJ2 A;  4FL6 A;  1Y96 B;  4E7K A;  4FT2 A;  1HYO A;  3CCQ Q;  4M7A D;  2DIG A;  1YWO A;  2O2O A;  3PIP A;  3E1S A;  5IT9 E;  2P0K A;  4RTV A;  3LWH A;  4M7D A;  2RQW A;  2IIM A;  4DBH A;  3GIB A;  1AWW A;  3I35 A;  4GLK A;  4PJO E;  2F69 A;  2X4Y A;  2EYX A;  2R5A A;  4ATO A;  1K9M U;  2L3R A;  1G3T A;  5FRM A;  2QAZ A;  2KRS A;  3QZ5 B;  5IN1 A;  3CC7 Q;  2RQU A;  5LJ3 j;  2X9H A;  2FRW A;  2KXD A;  2EQU A;  2LQ8 A;  1ZSG A;  2A3L A;  3CXC P;  3QZ9 B;  3V7S A;  3VRZ A;  1M30 A;  1ZLM A;  3QJ6 A;  1XTD A;  1Q86 U;  2JMC A;  2HL5 C;  4OMP A;  3PVL A;  1RLP C;  4C92 B;  5IHK A;  4GY5 A;  1TXQ A;  4RTW A;  2X4W A;  4KGV B;  4XU2 A;  3HSB A;  3ZBD A;  3A8M B;  1VQM Q;  1SSH A;  4HVV A;  1GBQ A;  1D1C A;  1WIE A;  2CS7 A;  5IH2 A;  2L5Q A;  2GCX A;  1UJ0 A;  1SRL A;  3NHN A;  1K9M C;  2EYW A;  2ZCF B;  3MPU B;  4C0D C;  2GNC A;  3UWN A;  3KBG A;  2EJ9 A;  1RAG B;  2LCS A;  1NJI R;  2E4H A;  2JVV A;  3VS3 A;  3U23 A;  2QEX Q;  2DK3 A;  1X6G A;  3SDZ A;  4CC3 A;  2VUB A;  3NTK A;  2DKG A;  2PU9 B;  2HQX A;  2L3P A;  3A5Z B;  4QVZ A;  1VQP T;  4AMC A;  2YUP A;  2DBM A;  4XTW A;  2XID A;  4LN2 A;  1VQM A;  1K9A A;  2HZY A;  1VYU A;  2HEQ A;  2DFU A;  3H8Z A;  2MI6 A;  3R6O A;  4FYX B;  4J9F A;  1M2O A;  2VV5 A;  1RI0 A;  3CXC A;  3JCM f;  3I56 Q;  2FHD A;  2HL3 A;  5I21 A;  2BZX A;  3CD6 T;  5GJW B;  1MNE A;  4OMQ A;  1AT1 B;  4E47 A;  3GF5 A;  3G4S A;  1N9R A;  3CC7 A;  2V1Q A;  1OI1 A;  3M55 A;  1KQ1 A;  1R0B G;  2A08 A;  1S1N A;  4OF1 A;  1H92 A;  1M2V B;  2K6D A;  2CRE A;  1VQ5 A;  4M78 B;  4Y28 E;  4ORZ A;  2F1L A;  1LVK A;  2DBK A;  2L89 A;  1FWZ A;  1WFW A;  3OYH A;  1Q7Y U;  3J7A F;  4M7A F;  2IG0 A;  2QDY B;  1T3S A;  3MCA B;  2LQK A;  3V7R A;  4M78 A;  1I0C A;  1YIJ T;  2YLC A;  1T0J A;  4Z88 A;  1VQN Q;  2MMP A;  3BW1 A;  5FRN A;  4HKE A;  2B86 A;  1X75 C;  1SEM A;  2K3Y A;  1K4U S;  2QI2 A;  3QUI A;  1VQK Q;  3L1A A;  4A4F A;  2QAS A;  2JTM A;  3UT1 A;  1YJN T;  1K73 U;  2KAF A;  3H41 A;  2LDM A;  4M7D D;  4EMH A;  1QLY A;  1RAA B;  2DIQ A;  5LJ5 f;  5CKF A;  2KDS A;  4EPC A;  2J6O A;  4ELZ C;  3J81 E;  2LT1 A;  2KVQ G;  2FZG B;  3UAT A;  5CIU A;  1TWB A;  1M3A A;  1YI2 A;  3LW5 E;  2ABL A;  2GBQ A;  3MP8 A;  3SEM A;  2CT3 A;  5LJ5 j;  2CP3 A;  3EGD A;  3G6E T;  2YLB A;  5I22 A;  1J3T A;  4M4Z A;  2XMF A;  4C8Q E;  4PNO A;  1OZ3 A;  1HK9 A;  2EW3 A;  1B34 B;  2VC8 A;  3M0S A;  4C8Q A;  1I07 A;  4KBM B;  2XIC A;  3I9Q A;  4RKU E;  3WXM B;  1KHC A;  1QVF P;  2H3J A;  2NUZ A;  4PJN A;  3VYG A;  1I4K 1;  6AT1 B;  2DA9 A;  1KK7 A;  1WYX A;  1XJW B;  1OYX A;  2MCN A;  3L2Q A;  1OU8 A;  5IHN A;  2VAS A;  2D9T A;  2MK5 A;  2EJF A;  4R56 A;  1TH7 A;  2LQW A;  3OW2 P;  1PM3 A;  2A7Y A;  4DBR A;  1U1S A;  1WHG A;  3CCE Q;  2AK5 A;  5D6W A;  1JO8 A;  4OMO A;  3SB2 A;  2RJC A;  1Q95 G;  1ZHI A;  2YUN A;  4Q5W A;  2EQJ A;  2PNI A;  1NJI C;  1WDX A;  2LQN A;  1K73 R;  1VQM T;  1IRE B;  4OMN A;  3EG9 B;  4LXC A;  4PKC C;  1N8R C;  3FC3 A;  4V2S A;  3CCL Q;  2LZ6 B;  3CXC S;  4M77 G;  3SWN C;  3EFO B;  4GBQ A;  2GFU A;  1FYN A;  4PFZ A;  5CO7 A;  2PZ1 A;  1X43 A;  3P8D A;  3CCS Q;  1M90 C;  3I55 Q;  2P0P A;  3M0R A;  3MKD A;  1WXT A;  3A8G B;  2EJG A;  2RK1 A;  2JS2 A;  1VQ7 Q;  1QVG P;  4MMK A;  2C0I A;  1OUL A;  3JCM X;  2OI3 A;  1YJN Q;  1ZA2 B;  1UUE A;  4OMF B;  2DNU A;  4M77 E;  3H9N A;  4RTT A;  2ZPG B;  5FWB A;  1AWJ A;  3CPW P;  2IPO B;  3DB3 A;  2KBT A;  3EFR A;  4N4H A;  4M7D F;  3QPH A;  1WHJ A;  2X4J A;  4AFZ C;  2JW4 A;  2DYI A;  3CBO A;  2GF7 A;  2ED1 A;  1W1F A;  4OP0 A;  1LPL A;  2DZ9 A;  3HFO A;  5GAM e;  2JMA A;  2VB6 A;  3JCM Q;  2LMJ A;  4J9C A;  1AHJ B;  4BB7 A;  2QGG A;  3LYI A;  2LJ3 A;  1P92 A;  4HVU A;  4F14 A;  1Y07 A;  4C8Q F;  2PUO B;  1NYF A;  1GFC A;  2CT4 A;  1YJN A;  3QKJ A;  1AEY A;  2CUD A;  1VQL Q;  1I1J A;  2PVD B;  4BE1 A;  1O75 A;  1Y57 A;  2FEI A;  1YJ9 Q;  2C0O A;  3L2R A;  3V8L A;  1Q82 C;  2XDP A;  2KYB A;  2FPF A;  1VQ5 T;  2D6F A;  3PVQ A;  5D7U A;  2L0A A;  3HRU A;  4KUI A;  1VQ8 Q;  2CH4 A;  2MPX C;  2P84 A;  3CCS A;  4OB1 B;  3CPW A;  3OYJ A;  5KH6 A;  3AHU A;  2HCK A;  3RES A;  1A0N B;  1M4Z A;  4AG1 C;  4CC4 B;  1H64 1;  3QG1 A;  5DY9 A;  3OYI A;  1SRM A;  1M2V A;  2DTH A;  4J9I A;  1K1Z A;  4J9H A;  3JSC A;  5GAN h;  3G1J A;  3FB9 A;  1D1A A;  1OPL A;  2KRO A;  2L3S A;  5DLQ E;  3OYF A;  3ULR B;  4RTU A;  2DL8 A;  3SFM A;  1Z9Q A;  4FSX A;  4BI3 A;  4M75 C;  3EFO A;  2QA4 A;  3SD4 A;  1S72 Q;  2VYT A;  2O31 A;  2V26 A;  4DBF A;  2RI3 A;  1BK2 A;  3URG A;  3CCR T;  2D8H A;  3GNF B;  2KR3 A;  3VKI A;  7AT1 B;  3LH5 A;  3MEV A;  2EYQ A;  2YUQ A;  1VQO T;  3QHS A;  1GCQ C;  1VQ9 T;  2XDD A;  5KCH A;  2KMT A;  4M77 D;  2FVU A;  5L23 A;  1YWP A;  1BCO A;  2YHT A;  4M77 A;  3OSS C;  5EC7 A;  2RHZ A;  4C5G A;  5I11 A;  2JT4 A;  2ROL A;  1U1T A;  3GBQ A;  2DXU A;  9ATC B;  1OQK A;  4E7S A;  1WX6 A;  2DIL A;  3OYK A;  1KIK A;  1LOJ A;  1ACM B;  2DJQ A;  5LJ3 d;  1K8A C;  1NBE B;  1AVZ C;  4AT1 B;  4IUQ A;  1M1F A;  1UGQ B;  3FJP A;  5M9O A;  3A8H B;  3EAE A;  1K76 A;  3INZ A;  3VS4 A;  2D0Q B;  2VGM A;  5CR2 A;  5HK3 A;  2DPP B;  2OTL Q;  2NYS A;  4C8Q D;  2BKD N;  3CD6 Q;  2NWM A;  1WQW A;  2J6K A;  4F7U A;  1IB8 A;  2QQR A;  3M4Y A;  3QWX X;  1LCK A;  1TUD A;  1VQN A;  3MEU A;  2A28 A;  3L2Z A;  4ZGE B;  1RI9 A;  1FXX A;  4ME7 A;  4MZM A;  2GTO A;  4X1V A;  4AFS C;  4TVR A;  2CDT A;  3JCM P;  3CC2 A;  2BE7 D;  1UG1 A;  2AT1 B;  2CKK A;  3F70 A;  1KD1 C;  2YDL A;  2CZ1 B;  3FLG A;  1WXU A;  1W2B S;  2DJZ A;  3M5A A;  2RHU A;  1UTI A;  3HP9 A;  3UF4 A;  4HT9 A;  3MHX A;  4M77 B;  1X6B A;  2K5L A;  3ME9 A;  3NPF A;  1PHT A;  2ED0 A;  2YRV A;  4BD3 A;  3H0F A;  2DZC A;  3NTI A;  3JCM b;  3OA6 A;  1G3W A;  1YNZ A;  3OSV A;  3VUB A;  2DTI A;  3X20 B;  3G4S Q;  2LNV A;  4M7A E;  3DKM A;  2X4X A;  2YRC A;  2RK2 A;  1KQS P;  4PJO A;  2EYY A;  2W0Z A;  4KUD K;  2ZGW A;  5GAO l;  4PJO D;  1WA7 A;  5ECA A;  4Z89 A;  2NLU A;  2HQH A;  3EG0 A;  4F7U G;  5GAN e;  2M0Y A;  4DOV A;  2XI9 A;  2LTO A;  2Y4Y A;  4C0F A;  1N8R R;  1OX8 A;  1QKX A;  3VV0 A;  1BI0 A;  1ABQ A;  3RR6 A;  3Q1J A;  3RER A;  3OY9 A;  3C4S A;  2I0N A;  2XG8 D;  3M53 A;  4L59 A;  4Y91 A;  1MMG A;  1T0H A;  2KT1 A;  1RAH B;  1DJ7 B;  2O4X B;  3RMS A;  3CCS T;  1SG5 A;  3VS0 A;  3OS5 A;  3N5B B;  4CI0 C;  3X26 B;  1PCX A;  4JRP A;  4BAC A;  2E12 A;  1JJ2 P;  4WF2 A;  4A4E A;  2GFA A;  1N9S A;  2CYZ B;  2XHC A;  3S6W A;  1NM7 A;  3G4S T;  5CKE A;  1VQ9 A;  2ATC B;  1TS9 A;  5I2M A;  2ESW A;  2JTE A;  4OVA A;  4JJD A;  2Y4X A;  5J39 A;  5GAM j;  1K9M R;  3G71 T;  5IXB A;  2DVE A;  5GMK l;  1F1B B;  2OTJ A;  1BI2 A;  1WGS A;  2HKN A;  4XU3 A;  3GPL A;  1OU9 A;  2H8H A;  4PJO B;  4LDV A;  2RB6 A;  1YBY A;  3E9F A;  1NPP A;  4XTX A;  3VU3 C;  5LJ5 h;  2LT4 A;  1VIF A;  5CCA A;  3QDR B;  2O01 E;  3ER0 A;  4K11 A;  1I5L A;  2RD1 A;  2K3B A;  1PRL C;  1M1K R;  3GLX A;  2KRN A;  2FZC B;  1KQS A;  3CCR A;  2DEU A;  4ZNX A;  3PIO A;  2GTJ A;  2HQE A;  2RO0 A;  4XTU A;  4RCC A;  3CC4 T;  2M02 A;  2OAW A;  1SSF A;  3M0Q A;  1VQL T;  5GAN 6;  2KSS A;  3JB9 I;  1VQ6 Q;  4II1 A;  2G3R A;  5KYU B;  5GAO q;  3PMI A;  2KRM A;  4RTZ A;  1NLP C;  3JCM g;  3CC4 Q;  4HCB A;  1Q86 C;  2W10 A;  2RI2 A;  1ARK A;  2RQV A;  1SKU B;  1BI3 A;  5DLO A;  4J5Y A;  3CMA Q;  3WVD B;  1YCS B;  2F2V A;  3L2V A;  1BCM A;  4XAX B;  4Z02 A;  1W6X A;  3V8J A;  3CMA A;  4PK4 A;  1JU5 C;  4ZN3 A;  2MYS A;  1I5O B;  4DA4 A;  4FM4 B;  2ZZD A;  2PQW A;  4QT7 A;  3A8O B;  5GAO r;  2CP0 A;  1UDL A;  2GQV A;  3C95 A;  1BIB A;  1BYM A;  2K5I A;  3KXT A;  1VQ6 A;  1FX7 A;  4E6R A;  4MDX A;  2KXC A;  1VQ9 Q;  1NEG A;  4OGC A;  1YIJ Q;  1BB9 A;  2WSF E;  5GAN 7;  2I2L A;  1VQ4 A;  1UHC A;  4N0A C;  2EKO A;  3UA6 A;  4XK8 E;  5C0M A;  4LE9 A;  2LVM A;  1UGP B;  3EFS A;  3M57 A;  4BDY A;  1QQJ A;  4DOW A;  2LP5 A;  3CBM A;  2K3X A;  1M1G A;  5D6X A;  2HKQ B;  1BI1 A;  1GBR A;  3HTR A;  3JCM W;  1R0C B;  1AWO A;  4KRT A;  1D09 B;  2CSQ A;  3QII A;  1QW1 A;  1FMV A;  1Y0M A;  2COW A;  1G83 A;  3TCJ A;  1NYG A;  4M78 E;  1QCF A;  2RHI A;  4QQD A;  1WHH A;  3VS2 A;  4C0D B;  1X01 A;  2QA4 T;  1MV0 B;  4ZTJ A;  4C8Q C;  4A54 A;  4M7D C;  3I56 A;  1AZG B;  1VQ7 T;  1JRI A;  1N27 A;  3G71 A;  5GMK i;  4RG2 A;  3MEA A;  1PSF A;  4C92 G;  1S72 T;  1AWX A;  3CPF A;  3V7C A;  5FWC A;  2EFI A;  2RF0 A;  2MWO A;  2O88 A;  5FU6 B;  1YN8 A;  2YWW A;  1GCQ A;  1EIF A;  2VGN A;  1UE9 A;  5CAI A;  2JOY A;  4IKF A;  4KGZ B;  5I2S A;  2AKL A;  2LX9 A;  1SHF A;  5GAN f;  2JUF A;  4JRQ A;  1GL5 A;  2DF6 A;  4IUP A;  1AD5 A;  2OJ2 A;  3OYB A;  2DRM A;  1YJW A;  2KNB B;  3NFC A;  2Y90 A;  5LJ3 g;  3EH2 A;  4F16 A;  4ZN1 A;  4JLI A;  1I81 A;  4C5I A;  5A0D A;  3HRT A;  1PC0 A;  2QYZ A;  1EZZ B;  1G3S A;  2BUD A;  3CD6 A;  2EAY A;  1KC8 R;  2FB7 A;  1CKA A; 
#chains in the Genus database with same CATH homology
 1IO6 A;  3M0P A;  3EG2 A;  1U06 A;  1VYT A;  2A36 A;  4RUG A;  2O31 A;  2HSP A;  3REB B;  3M0U A;  2AZS A;  3R6N A;  3TVT A;  2K9G A;  1GCP A;  3VS6 A;  1OEB A;  3H0I A;  1BK2 A;  3VS7 A;  2D8H A;  2KR3 A;  1SPK A;  2MOX A;  1JXO A;  1BU1 A;  2X3X D;  3LH5 A;  4F17 A;  1M3B A;  2YUQ A;  2X3W D;  1GCQ C;  2FG0 A;  2EGC A;  1PKT A;  2J6F A;  1MV3 A;  4IIM A;  1UFF A;  1JEG A;  5L23 A;  1YWP A;  4JZ4 A;  3NGP A;  1YWO A;  3EG1 A;  2O2O A;  5EC7 A;  3UA7 A;  5I11 A;  1TG0 A;  2JT4 A;  4RTV A;  2ROL A;  3GBQ A;  2DYB A;  2RQW A;  2IIM A;  3THK A;  2HDA A;  1AWW A;  1WX6 A;  2DIL A;  3I35 A;  1V1C A;  1VYV A;  2VVK A;  1KIK A;  1X2Q A;  2AZV A;  1M3C A;  2DJQ A;  2EYX A;  1NLO C;  2C0T A;  2D1X A;  3EHR A;  2KE9 A;  2KRS A;  2YT6 A;  1AVZ C;  1M27 C;  2RQU A;  2FRW A;  2KXD A;  1Z9Z A;  1ZSG A;  2EPD A;  2J06 A;  3VRZ A;  2DL5 A;  2KT8 A;  2V1R A;  1M30 A;  1ZLM A;  1K76 A;  3VS4 A;  2JMC A;  1E6G A;  4OMP A;  3PVL A;  1RLP C;  2EYZ A;  2GGR A;  4WCI A;  1YP5 A;  5IHK A;  2D0N A;  2NWM A;  4RTW A;  2J6K A;  2O9V A;  1SSH A;  4HVV A;  3QWX X;  1GBQ A;  1WIE A;  2D8J A;  1LCK A;  2SEM A;  2YSQ A;  5IH2 A;  1TUD A;  2A28 A;  3A98 A;  1PNJ A;  1SRL A;  1RI9 A;  1UJ0 A;  3I5R A;  3NHN A;  2EYW A;  4D8D A;  3I5S A;  2GNC A;  2GTO A;  4FSS A;  4X1V A;  4AFS C;  2CDT A;  2LX7 A;  4CC2 A;  1UG1 A;  2LCS A;  1EFN A;  3VS3 A;  2YDL A;  3U23 A;  4IIO A;  1WXU A;  1X6G A;  1JQQ A;  4CC3 A;  1UTI A;  3UF4 A;  1TUC A;  2L3P A;  1X6B A;  3NPF A;  3C0C A;  1PHT A;  2YUP A;  1UJY A;  2ED0 A;  2DBM A;  1WI7 A;  3H0F A;  4D8K A;  4LN2 A;  1K9A A;  1YNZ A;  1VYU A;  2HEQ A;  4J9D A;  2DM1 A;  2FO0 A;  4J9F A;  1JXM A;  1AZE A;  1XOV A;  1QKW A;  2RNA A;  2EYY A;  2W0Z A;  1X69 A;  3TSW A;  4OMM A;  2BZX A;  1WA7 A;  2DE0 X;  1AOJ A;  4J9E A;  1ZUK A;  5GJW B;  4OMQ A;  5ECA A;  4DEX A;  2DVJ A;  4Z89 A;  4Z8A A;  1N5Z A;  4A63 B;  5HCK A;  4LNP A;  3EG0 A;  2O9S A;  2V1Q A;  2M0Y A;  1NG2 A;  3PE0 A;  2M51 A;  1ZUU A;  2K7A A;  1QKX A;  2A08 A;  1S1N A;  1ABQ A;  1H92 A;  1FMK A;  2K6D A;  2CRE A;  1GRI A;  2DX1 A;  5FW9 A;  1UHF A;  4ORZ A;  2EVR A;  2DBK A;  1WFW A;  2LJ1 A;  2I0N A;  1T3S A;  1VA7 A;  1QWE A;  5GJV B;  2KT1 A;  1T0H A;  2K79 A;  1E6H A;  1I0C A;  3ZL7 C;  1KSW A;  1T0J A;  4AFQ C;  1CSK A;  4Z88 A;  3VS0 A;  1PWT A;  1X27 A;  1X2K A;  2FRY A;  1NM7 A;  2B86 A;  1SEM A;  1K4U S;  2ESW A;  4HVW A;  4CC7 A;  2JTE A;  4JJD A;  2DRK A;  3TSZ A;  1UEC A;  5IXB A;  1B07 A;  2JM9 A;  3H41 A;  2G6F X;  1QLY A;  1MUZ A;  2JM8 A;  1HJD A;  2LJ0 A;  5IXF A;  4DEY A;  3EHQ A;  2J6O A;  2KEA A;  2H8H A;  2GQI A;  2YUO A;  3UAT A;  2RQT A;  1OPK A;  1M3A A;  1G2B A;  3REA B;  2ABL A;  4K11 A;  2GBQ A;  3SEM A;  2CT3 A;  1B3Q A;  2K3B A;  1H8K A;  1PRL C;  2KRN A;  5I22 A;  1J3T A;  1E7O A;  2JS0 A;  4M4Z A;  3SHW A;  2XMF A;  4ZNX A;  2EW3 A;  4R0K A;  2GTJ A;  1K0S A;  3M0S A;  2RPN A;  2MIO A;  2LNH B;  1I07 A;  2EGA A;  2K2M A;  3I9Q A;  2OAW A;  4GLM A;  1CKB A;  2NUZ A;  3KFV A;  1ZX6 A;  3M0Q A;  4HXJ A;  2DA9 A;  2F2X A;  1WYX A;  2BZ8 A;  4RTY A;  1H3H A;  1OV3 A;  2MCN A;  4LUE A;  2KRM A;  5IHN A;  2ROT A;  4RTZ A;  1NLP C;  1KJW A;  4JJB A;  1M8M A;  2W10 A;  4RTX A;  1ARK A;  2LQW A;  2CUB A;  2RQV A;  3VS5 A;  2PTK A;  2AK5 A;  1K0X A;  2A37 A;  1JO8 A;  4OMO A;  1YCS B;  2F2V A;  2YUN A;  2JXB A;  2PNI A;  3VS1 A;  2DL3 A;  1GFD A;  2FPD A;  1WDX A;  2LQN A;  1PKS A;  1W6X A;  4OMN A;  3JV3 A;  1UGV A;  1JU5 C;  2VWF A;  4QT7 A;  2LZ6 B;  1UDL A;  1WLP B;  4GBQ A;  4HCK A;  1FYN A;  2PZ1 A;  1X43 A;  3RNJ A;  2DL4 A;  3EG3 A;  3VRY A;  4E6R A;  2KXC A;  1NEG A;  3M0R A;  1BB9 A;  1WXT A;  2E5K A;  2EQI A;  2F2W A;  2JS2 A;  1UHC A;  3M0T A;  2C0I A;  3UA6 A;  4LE9 A;  3RBB B;  2OI3 A;  3FJ5 A;  4JJC A;  4LUD A;  1RUW A;  2EBP A;  1UUE A;  2LP5 A;  2DNU A;  4RTT A;  1GBR A;  1HSQ A;  3NMZ C;  5FWB A;  1AWJ A;  1AWO A;  1ZBJ A;  2HBW A;  3CQT A;  4KRT A;  2CSQ A;  2KBT A;  1OOT A;  2CH4 W;  2CSI A;  4AFZ C;  1Y0M A;  3H0H A;  1G83 A;  1W70 A;  2JW4 A;  1U5S A;  1NYG A;  4Y92 A;  2ED1 A;  1W1F A;  2BTT A;  2JMA A;  1QCF A;  1PRM C;  3IQL A;  2L2P A;  2LMJ A;  3VS2 A;  1SHG A;  4J9C A;  4J9B A;  2EGE A;  1MV0 B;  2FPE A;  2LJ3 A;  4JPB W;  4AFU C;  2RN8 A;  4HVU A;  4F14 A;  4EIK A;  1NYF A;  2DMO A;  1AZG B;  1GFC A;  2CT4 A;  2VKN A;  2EKH A;  4OML A;  5IHI A;  2CUD A;  1AEY A;  1I1J A;  1U3O A;  1NEB A;  1Y57 A;  2FEI A;  2C0O A;  1AWX A;  1KFZ A;  2J05 A;  5FWC A;  2KYB A;  2FPF A;  3PVQ A;  2RF0 A;  3O5Z A;  2L3Q A;  4ESR A;  2O88 A;  3QWY A;  2L0A A;  4JZ3 A;  1YN8 A;  2CH4 A;  1RLQ C;  4J9G A;  2SRC A;  1GCQ A;  2AKK A;  2ENM A;  1T3L A;  1UE9 A;  2DLP A;  2DL7 A;  2BZY A;  2HCK A;  2AKL A;  3EGU A;  1A0N B;  1SHF A;  1BBZ A;  1QWF A;  2QDL A;  4AG1 C;  4CC4 B;  1GL5 A;  2DF6 A;  4AG2 C;  1AD5 A;  2OJ2 A;  1SRM A;  1ABO A;  1WXB A;  1K1Z A;  2DRM A;  4J9I A;  2RMO A;  2KNB B;  4J9H A;  2RQR A;  4F16 A;  1OPL A;  2ECZ A;  2KGT A;  2KRO A;  2J7I A;  2L3S A;  1HD3 A;  3ULR B;  4RTU A;  2KYM A;  2DL8 A;  1ZUY A;  1Z9Q A;  2P4R A;  1CKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...