2DL3A

Solution structure of the first sh3 domain of human sorbin and sh3 domain-containing protein 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
GSSGSSGRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Solution structure of the first SH3 domain of human sorbin and Sh3 domain-containing protein 1
rcsb
source organism Homo sapiens
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl3A00
4X1VA 4AG2C 4J9DA 3EHRA 1YP5A 4JZ3A 1VYVA 2ECZA 1GBQA 2DM1A 2RNAA 2GNCA 2D8JA 2LQNA 3SEMA 2M0YA 2MOXA 2HEQA 2J7IA 3NGPA 2EW3A 4ZNXA 1X6BA 1PKSA 1MV0B 1GBRA 3EGUA 1NYGA 2AK5A 4GLMA 4J9HA 5L23A 1KIKA 1GCQC 1AWJA 1JO8A 4AFZC 2ROTA 1AEYA 1QLYA 1WI7A 2YT6A 2ED1A 1E7OA 1IO6A 1UJYA 3UF4A 2L2PA 2JW4A 1UUEA 4D8KA 2L0AA 4J9GA 1J3TA 2KXDA 1JEGA 4CC3A 4F14A 3VS6A 2JT4A 3VRYA 1UHFA 1B07A 2JMAA 2CH4W 1VYTA 1LCKA 2DJQA 1ZUYA 1GFDA 3NHNA 2O9SA 2BTTA 1OEBA 2KYBA 1UTIA 4RTZA 1K0SA 1K9AA 4RTYA 4RTUA 2K2MA 1BBZA 1I0CA 3VS2A 2QDLA 4LN2A 1QKXA 4AFUC 1OPKA 1NLPC 1FYNA 2KYMA 2CT3A 4OMNA 4DEXA 1VYUA 3UA6A 4HCKA 2BZ8A 4RUGA 4CC7A 1OV3A 1ZUKA 3VS5A 1VA7A 2ED0A 4OMLA 1AVZC 1ZBJA 1AOJA 2LNHB 3M0QA 1KSWA 2C0OA 4JJBA 1RI9A 2YUPA 1T3SA 2LP5A 4Z88A 3ZL7C 2ABLA 2J06A 1ABOA 2LZ6B 2KNBB 1WXBA 2LJ0A 1B3QA 1KFZA 3I5RA 2F2VA 2K79A 2DL8A 2LCSA 2JTEA 2AZSA 4AFQC 5FW9A 1NEGA 1YWPA 1NM7A 5IHIA 2DRKA 1SRLA 1WDXA 2CDTA 4CC4B 5ECAA 1AWWA 1HJDA 4JJCA 2CH4A 2NWMA 2DMOA 2IIMA 2KBTA 2D8HA 1YNZA 2B86A 5IHKA 4A63B 2LQWA 2DA9A 3VS4A 4Y92A 1SHGA 2DX1A 1QKWA 4RTTA 1SEMA 3H41A 1X2KA 1NG2A 3EG2A 4ESRA 3REBB 1NLOC 3VS7A 4RTVA 4LNPA 1W1FA 2PNIA 1PRMC 2J6FA 1K1ZA 1MUZA 3KFVA 2K7AA 1Y57A 2GBQA 4J9CA 1H3HA 1GL5A 1GRIA 1UGVA 1OPLA 5IXBA 3ULRB 1GCQA 1RUWA 1XOVA 1JXOA 1MV3A 2XMFA 4Z89A 1U5SA 2FO0A 2MIOA 3VS3A 1X2QA 4KRTA 3THKA 3REAB 1W70A 3H0HA 1T0HA 1QCFA 3O5ZA 4LE9A 4ORZA 1WYXA 1SPKA 1GFCA 3I35A 2O9VA 2FRYA 4RTWA 2FEIA 2EKHA 2YUQA 1UDLA 2VWFA 2KROA 4Z8AA 2DE0X 4FSSA 2J05A 3VRZA 1AZEA 1K76A 1ZLMA 2CSIA 1UG1A 1ZX6A 2AKLA 2V1RA 3A98A 5IXFA 2VVKA 2JXBA 4M4ZA 1UJ0A 1H8KA 1U3OA 1KJWA 1K0XA 3PVQA 2CT4A 2CREA 1AZGB 4CC2A 1NEBA 3NMZC 1ABQA 2KRSA 4WCIA 3R6NA 2KXCA 3U23A 2H8HA 1PRLC 3SHWA 1TUCA 2KEAA 1SRMA 2C0TA 2GTJA 3H0FA 5GJWB 4LUEA 1UHCA 2M51A 2YDLA 2EGCA 1ZUUA 3EHQA 2J6OA 4LUDA 2W10A 3TSZA 1M8MA 2OI3A 1NYFA 2ENMA 2JM8A 5I11A 1X6GA 2CUBA 2NUZA 1YCSB 3I5SA 1AD5A 2X3WD 4F17A 1JU5C 2FPEA 1M3AA 2A36A 2RQTA 2DVJA 1UE9A 1M3CA 2K6DA 2A28A 2G6FX 2DBMA 2FG0A 3TSWA 3NPFA 1QWFA 4J9BA 4OMOA 3RBBB 2V1QA 1WIEA 2DNUA 2PZ1A 4DEYA 2CUDA 2VKNA 3FJ5A 3M0UA 2FRWA 5FWBA 2DL3A 5IHNA 2C0IA 1TUDA 2AZVA 1M27C 2GTOA 1GCPA 2KR3A 3LH5A 2BZYA 1K4US 1WXTA 1PWTA 1SSHA 1HSQA 2RF0A 2A37A 2EYYA 2EYWA 1OOTA 3H0IA 1WA7A 4HVUA 4K11A 4HVWA 2JM9A 2W0ZA 2EQIA 2YUOA 1N5ZA 4E6RA 4OMMA 1FMKA 5I22A 2F2XA 4HVVA 2KE9A 3UA7A 2LX7A 3TVTA 1AWOA 3VS1A 1WLPB 1X69A 4IIOA 1Z9ZA 2KGTA 3UATA 2FPFA 2K9GA 1H92A 2A08A 2P4RA 5HCKA 1I07A 1UECA 2K3BA 4OMQA 1Z9QA 2X3XD 2GGRA 1M30A 2D1XA 2YUNA 2YSQA 2DL4A 2HDAA 1SHFA 1YN8A 2DRMA 5FWCA 1G83A 3QWYA 4JZ4A 3JV3A 1WX6A 1G2BA 3QWXX 3EG0A 2EYZA 1X27A 2J6KA 2DILA 2RQWA 3M0TA 1PNJA 2EBPA 1CSKA 2D0NA 2EGEA 4J9EA 2GQIA 2PTKA 3CQTA 1BB9A 1I1JA 1M3BA 3VS0A 1W6XA 2FPDA 4F16A 4R0KA 1JXMA 2RMOA 1CKAA 1YWOA 2LMJA 3C0CA 3RNJA 2DLPA 1U06A 4OMPA 3PVLA 5EC7A 2EVRA 2RQVA 3M0SA 4J9IA 2F2WA 1A0NB 3IQLA 2L3SA 1Y0MA 1T3LA 1ARKA 2JS0A 5IH2A 2O88A 4QT7A 2O31A 2EGAA 1WFWA 2HBWA 4J9FA 4JJDA 3EG1A 1PHTA 2O2OA 4AG1C 1JQQA 2DYBA 3PE0A 2AKKA 2EPDA 2RQUA 1TG0A 1E6HA 2ESWA 1ZSGA 4HXJA 4GBQA 3I9QA 2SEMA 1BK2A 1AWXA 2JS2A 2KRMA 1PKTA 2L3QA 2RN8A 2E5KA 2KT1A 4D8DA 1QWEA 2LJ1A 2RPNA 1HD3A 2I0NA 4EIKA 1EFNA 2RQRA 1T0JA 2HCKA 1UFFA 1RLQC 2OJ2A 2MCNA 2SRCA 2EYXA 2L3PA 2HSPA 2DF6A 2KRNA 2DL5A 2CSQA 3M0PA 2BZXA 3GBQA 1E6GA 2OAWA 2DBKA 2KT8A 4JPBW 2DL7A 1X43A 2LJ3A 1BU1A 1S1NA 4IIMA 1V1CA 3M0RA 4AFSC 5GJVB 2JMCA 2ROLA 1RLPC 3EG3A 1WXUA 1CKBA 4RTXA
chains in the Genus database with same CATH superfamily
3P8DA 5GAN7 1VQKT 3SDZA 2DM1A 5CQXA 3QZ5B 2KMTA 2QI2A 8AT1B 4DOVA 1YJ9T 1XTDA 4J7IA 5EG2A 4QQGA 1VQ8T 2QASA 4BI8B 1IXDA 3CPFA 1VQ9T 1AWJA 4Z02A 4AFZC 2ROTA 5KE2A 1QLYA 2ED1A 1Q7YC 4F7UG 3RKXA 2L2PA 1VQNT 3SFMA 2O4XA 1VIEA 3DKMA 1YI2Q 1LJOA 3EFOB 3VS6A 1JB0E 4ZN1A 5CQYA 2VV5A 1M9SA 1B07A 3PFSA 3UPUA 3RMQA 1VQOT 2MYSA 2QA4A 1ZUYA 4C0FA 5KYNA 4C92D 4DBHA 3HTRA 2BTTA 3CXCS 3KBGA 4RTZA 1K0SA 1K9AA 1NPPA 1KC8U 1N9SA 4M7DA 1BBZA 4QVDA 3HKSA 3QKJA 4E47A 3TCJA 2LQKA 5KYYB 3RR6A 3PIPA 2WSFE 2JNGA 4PFOA 2ZZDA 1VYUA 2RK2A 5GAN4 3UA6A 2LNVA 1K8AU 2BZ8A 4M77B 4EPCA 4OMLA 1ZBJA 3CCLQ 2D6FA 4FL6A 3CCVA 4JJBA 2LP5A 1C1AA 1RAAB 2V8KA 3HRUA 2DVEA 4M77E 3QG1A 2LJ0A 1M8VA 2F2VA 1F1BB 1ACMB 5GAN2 4AFQC 5IHIA 1LVKA 2DD5A 4ME7A 5GAN6 3JCMQ 3CD6A 1SRLA 4PJOF 2K3XA 3DB4A 5ECAA 2RHIA 1K8AR 2VASA 2QAZA 2KK4A 2DMOA 2DZ9A 3FLGA 1H641 4BDZA 3EH2A 2QA4T 4A63B 5GAOn 3ER0A 1BCOA 2DA9A 5GANf 5GAN5 1PSFA 3E9FA 4Y92A 1SHGA 4C8QD 3EFOA 3H41A 4ZGJB 1OULA 1X2KA 2VYTA 3EG2A 1NLOC 4RTVA 3L1AA 2CP7A 1K1ZA 3G71Q 2K7AA 5DM7R 2GBQA 1GL5A 1GRIA 1HYOA 3ULRB 4HCZA 2JVVA 1RUWA 2HMAA 3GP8A 5KYYA 1UB4A 2FB7A 2MIOA 1O9SA 3THKA 3CMEQ 4L6V5 3H0HA 1T0HA 3C94A 4NOYA 1QP2A 1GFCA 5CAIA 4XTVA 1TUGB 3CCVT 1D0XA 4M75E 4DA4A 4M77C 2EKHA 1UDLA 4ELYC 3C95A 4M77A 5CIUA 3VRZA 2ZPBB 2PVOB 1RAIB 1UG1A 4JS4A 2AKLA 3JCMb 2VVKA 4JRKA 4M4ZA 3GPLA 3UDCA 3O8VA 3PVQA 3NFCA 2CREA 4J6XA 2E6NA 3JB9G 2M0OA 3GOXA 4JS5A 1JJ2P 1NEBA 1QCOA 3NMZC 3QBYA 5DLQE 2K5LA 3U23A 3CCRA 2YWWA 4GY5A 3SHWA 2KEAA 1SRMA 1Y71A 3RDVA 2HSEB 3H0FA 2P0PA 3MP8A 3NTIA 2W10A 4N0AC 2CS7A 2EKOA 3OY9A 3M5AA 2NUZA 3I5SA 1W2BP 4M77G 2X3WD 4F17A 3OYJA 1IGUA 3CC7A 1IHVA 4N0AA 3MHXA 2DVJA 3RUXA 4LDXA 5KH6A 2A28A 1WPYA 2XI9A 5IAYA 4JUVA 4DBQA 1M2VB 3RBBB 2CZ1B 2PZ1A 2ZGWA 2EJGA 1TUDA 2AZVA 2GTOA 1V76A 5IT9E 5HY6A 2KR3A 3E19A 3OMGA 5HKCA 4J5YA 1Q7YU 1SSHA 2EYYA 1OOTA 5LJ5g 2RK1A 4HVWA 2JM9A 3VUZA 3OYEA 2M9UA 2EQIA 4E6RA 4BY6C 4HVVA 1YHQT 2KE9A 2LX7A 1Z9ZA 2COZA 2FPFA 2K9GA 2A08A 1XQHA 5HCKA 3FIFA 5C6SA 1I07A 2YLCA 4M78D 2RO0A 4ZTFA 1WJRA 2X4YA 3CCRT 1YJWT 4OF1A 1NE8A 1VQ8Q 4N4GA 2L3RA 2ATCB 1Q7YR 1SHFA 2X4XA 3PNWC 3OYAA 3CC4T 3OW2S 2FZKB 4J83A 2EYZA 4PJMA 3CC7T 2VXEA 2RQWA 4E7IA 3PMIA 3H6ZA 2D0NA 4RCCA 3JRZA 4J9EA 4BI3A 3E1SA 1I4K1 1I1JA 1OX8A 4C0DC 4XTXA 1W6XA 5GAMg 2FPDA 4F16A 5KCOA 3CCJA 1CKAA 3RNJA 1VQOQ 3SWNC 5A0GA 3URGA 3HL8A 1K9MC 4OMPA 2EVRA 1HXDA 2XDDA 2HBPA 1A0NB 5CVIA 2MF2A 1M2VA 2DJZA 3VYGA 1Y0MA 1TSFA 4PJOE 1ARKA 5IH2A 2K57A 2RJFA 4B9XA 2EGAA 1WFWA 2GCXA 4J9FA 3CXCA 1YFNA 4JJDA 2O2OA 4AG1C 4MDWA 1Y07A 1ZA1B 2JTMA 2AKKA 4MMLA 4PKCC 2HZYA 3HFOA 2RQUA 1QQJA 1UGQB 1KD1R 2Y4XA 3MP6A 4PL6A 3X24B 3N5BB 4LD6A 3CCMA 4JJNK 5LJ5h 1PKTA 5I2MA 1KQ1A 2RPNA 4IUPA 2RQRA 1VQ6A 1WJSA 3VUBA 2MK5A 3M59A 4GLKA 3JB9F 2BZXA 1NPRA 4FIBA 2DBKA 2EQKA 1OZ3A 2E3HA 1BU1A 1S1NA 3G4SQ 4Y91A 1BIAA 1YJNT 1BCMA 3EG3A 1WXUA 1LOJA 3CCJT 1C0MA 3V8KA 4J9DA 4C0GA 2Z0WA 1R0BG 1WQWA 3G7ZA 4N4HA 2QA4Q 1D09B 1GBQA 4PJOC 1IZ6A 3CCSQ 2H3JA 2RHYA 2AHJB 5FU7B 1NBEB 5GMKm 2HEQA 3LX7A 2J7IA 3NGPA 4ZNXA 1PKSA 2E5QA 1VQ4A 2AK5A 4J9HA 5L23A 5LJ3f 1AEYA 2EFIA 5FROA 5GAMh 2XU8A 3OYNA 3RIRA 3UF4A 1I5LA 4Y28E 9ATCB 3LYIA 1VOMA 1N8RU 4MZMA 1D3BB 2KXDA 4IUTA 4CC3A 3CCEQ 4F14A 3VRYA 2LC4A 1UHFA 2CH4W 2HL3A 2DJQA 5LJ5f 5KCHA 1GFDA 1WHJA 2FYKA 3EFRA 3NHNA 4JRQA 2LT4A 2RB6A 3TQ7P 1VQ6T 4PJOG 1OX9A 2GQVA 1I0CA 1G3SA 4KUIA 1QKXA 3EAEA 3AT1B 4FSXA 1OPKA 7AT1B 5GANg 2KQWA 1U8RA 1KHCA 2CP3A 4DEXA 1RAEB 1RAHB 4M75F 1N8RR 3ZEHA 4BE2A 2DXBA 1GXIE 1B7TA 3GF5A 4XU0A 3OS2A 1VA7A 1QVPA 1UGRB 3EH1A 2YUPA 1QMCA 3CCUA 1I5OB 3OBWA 3ZL7C 1VQ4T 4RCBA 1FXXA 1ZSZC 2KNBB 1B3QA 3HPWA 1KFZA 3I5RA 3OSSC 5GAMf 1QVGA 2QEXA 4B9WA 1TTHB 1G3TA 2CDTA 2IPOB 3JCMV 3INZA 3M9QA 3G6EQ 2PVGB 2IIMA 2K4YA 3S3MA 5IHKA 2LQWA 3EGDB 2BE9B 1D3BA 1VQ7A 2F5TX 5KE3A 4RTTA 1SEMA 4NL2A 1D1CA 1NG2A 4ESRA 1YHQQ 2PNIA 2J6FA 2C06A 3MPUB 1YITA 4PK4A 2NYSA 2MPXC 1K9MU 3M58A 1Q81U 1OPLA 3OS1A 5IXBA 4M7AD 1S72Q 3A1PA 3P8BB 4R55A 1MV3A 3JB9J 3CCRQ 2P0QA 1M90R 1U5SA 3C4SA 2XKOC 2FO0A 1IRXA 4MZPA 1YJWQ 3VS3A 2QQBA 3REAB 3O5ZA 1Y96B 2RM4A 4ORZA 1X6OA 4J7FA 3A8GB 2ZPFB 3I35A 5CKHA 4XQ3A 2FEIA 2YUQA 3CCUT 3CC4Q 3ZFJA 2ZCFB 5GANh 1WHHA 2H3EB 1MMDA 3FJPA 4RG2A 4XTUA 2P0KA 4M78E 2CSIA 3DLLA 3JCMf 2V1RA 3A98A 5IXFA 1K9MR 2QGFB 3PGGA 1WQ7A 1Q81R 2QEXT 1MGQA 1G3YA 4QW2A 1H8KA 3OW2A 1KJWA 5LJ5d 2YXYA 4EDUA 3BY7A 3OYIA 4NS5A 3DB3A 4XU3A 1P92A 2PVDB 4LDUA 1RADB 1TUCA 2ZPGB 1FWZA 4LUEA 2M51A 2QYZA 2YDLA 3I55Q 2M1HA 2EGCA 3V8JA 3S6WA 2OI3A 2ENMA 5I11A 1OQKA 4FYVB 1KD1C 1AD5A 1JU5C 3QYGB 4FYXB 1VQMQ 1M3AA 3EGDA 1YITT 1VQLA 2DKGA 3CEYA 2EQJA 2G6FX 3MO8A 2DBMA 3M53A 4J9BA 4OMOA 2EIFA 5CKDA 1WIEA 3EG9B 2CUDA 4JRPA 3FJ5A 3ZBDA 1RACB 1RAFB 1MMGA 2QQ9A 1K73U 2C0IA 1M27C 5D7UA 2F69A 1TWBA 3LH5A 2FZGB 1X01A 1K4US 5GAMd 4M78C 2RI2A 4E7LA 1X75C 4FW1A 1RL2A 2A37A 2COYA 5AYFA 4L59A 4C92F 4HVUA 2W0ZA 1Y96A 2ZPHB 3OS0A 2WSCE 2YUOA 1N5ZA 2RJEA 4HA8A 2LTOA 4IKFA 2F2XA 5DY9A 4ZGDB 2NLUA 1RABB 1YJNQ 2CP2A 4JDSA 3VS1A 4IIOA 1X69A 1TS9A 3BW1A 3UATA 1IREB 1H92A 2P4RA 3JCMX 2G3RA 5FRMA 1TH7A 1TOVA 2X4JA 4M75B 2WACA 1WNLA 1KQSS 1N9RA 2K3BA 2E65A 4MDXA 3QYHB 1Z9QA 3L42A 5C0MA 1K73R 3MP1A 4XAXB 3CC2A 1M30A 2K3YA 2YSQA 4PFZA 5J26A 2DL4A 2HDAA 2AIRB 5FWCA 3CMAQ 1G83A 2DPPB 2VGMA 4KT0E 1G2BA 4C5GA 3WVEB 4M78G 4KH0B 4BY6B 2DTOA 2A7YA 2CZ6B 1VQLT 4XU1A 2LQ8A 2QQRA 3OYBA 2AT1B 3JCMJ 4BD3A 3CXCP 3PMTA 1CSKA 2L5QA 3J80E 4OB3B 2CYZB 5D6XA 3OSVA 3V7CA 4R0KA 1JXMA 2RMOA 3OYKA 3CD6T 1MHNA 2DLPA 5L8RE 1OYXA 3PVLA 1PD1A 4ZTJA 3M56A 2RQVA 2DTIA 3M0SA 1C6VX 1R8OB 1WHLA 2K5FA 2L3SA 4E7KA 4BDYA 4PJJA 3TREA 2OTLA 3I56A 3QJYA 3EG9A 1G3WA 1T3LA 2QDYB 2JS0A 3QHSA 4L5GA 3L2VA 1N8RC 2HKNA 4QT7A 5CR2A 4WF2A 3CBMA 2O31A 2DXTA 1M1KC 2YRVA 4C8QF 1PD0A 1QVGS 4C5EA 2I2LA 1ZBXA 5A2QE 2DYBA 4M7DD 3MKDA 2EPDA 5CCAA 4C0DB 2VB6A 1TG0A 1E6HA 3T9NA 1YIJQ 5LJ3g 4HXJA 4EMHA 2X4WA 3SWNB 2SEMA 2CP6A 1AHJB 3OB9A 4M75C 3PIOA 3DLMA 2RN8A 3CC2T 3OQ5A 3L2ZA 2KT1A 3LLRA 2LJ1A 1EFNA 4M75A 2OAUA 3RERA 1D0ZA 1T0JA 2HCKA 1RLQC 3LH0A 2EYXA 2L3PA 2HSPA 5A0LA 2DF6A 3M0PA 4QQ6A 1VQPQ 4JPBW 2DL7A 2HQEA 1X43A 3M0RA 5GJVB 1FX7A 5J39A 2JUFA 4LXCA 1YBYA 1V29B 2JN0A 4X1VA 4AG2C 1I81A 4C5HA 3J7AF 5GANd 1UGSB 2ECZA 4PJLA 1VQKQ 2MI6A 4FW2A 1JBMA 1IGQA 2RNAA 1D0YA 1PM3A 4EMKB 1KQ2A 2D9TA 2GNCA 2D8JA 2LQNA 3SEMA 1YJ9Q 2OTLT 2M0YA 3I56T 2MOXA 2MWPA 2EW3A 4JRIA 2E10A 1YCYA 4M75G 2DIQA 4LDVA 3EGUA 2XDPA 1KIKA 1GCQC 2GFAA 1SKUB 4C5IA 1VQ9Q 4RMOA 2X51A 3L2QA 1M90C 2YT6A 2HQXA 1E7OA 5GMKh 4A53A 1Q95G 5HK3A 5LL6S 2XG8D 1VQNQ 1UUEA 3BDUA 3JSCA 1J3TA 3QO3A 2EYQA 1LPLA 2E12A 2JT4A 4PLIA 1ZHIA 1KD1U 4PJOB 2L89A 2JMAA 2E3IA 2EJFA 4WTOB 1VYTA 1HK9A 3G1JA 3CBPA 2O9SA 5CO7A 1Q81C 3TU4K 2IVWA 2LX9A 4M7AE 3SWNA 2RJCA 3VS2A 4LN2A 1EZZB 3G71A 2QG9B 3E2UA 5LJ3h 1NLPC 1FYNA 1MMNA 4PLLA 2CP5A 4M77D 1QVGP 4LD9K 2NUTB 1OZ2A 2ZPIB 2CZ0B 3S3OA 4RUGA 4CI0C 4C92E 2PQWA 3CPWA 1ZUKA 3CMEA 4M78F 1BI3A 2LNHB 3M0QA 3VU3C 2C0OA 1T3SA 2JOYA 3NTHA 2DEQA 1AT1B 4EMKC 2ABLA 5GAN3 2J06A 1ABOA 5HK0A 4MZTA 4EMKA 2E41A 4MMKA 2K79A 5KYXB 2LCSA 3QSUA 2QK0A 1YWPA 1NM7A 2DRKA 1WDXA 1AWWA 1W4SA 3MJXA 4JJCA 2FHDA 3A5ZB 2CH4A 4XTYA 3JCMg 1KHIA 3P8HA 1OI1A 4KULA 4OMFB 2EWNA 4BE0A 2D8HA 4ZN3A 1YNZA 4M7AC 1G5VA 2GFUA 2K5IA 2DEUA 1PCXA 4VUBA 3VS4A 1R77A 3JB9H 1U1SA 3RESA 1ZSZB 4PJOA 1PRMC 2V8IA 3G71T 3VKIA 3RKWA 3KFVA 2QQSA 1EX4A 3MEWA 4C8QB 2RHXA 1H3HA 4ZGEB 1QVFA 1UGVA 4C92C 1K73C 2R57A 3CCQA 2QTVA 2DD4A 1WHMA 1XOVA 2NUPB 3MEVA 3OW2P 2XMFA 4Z89A 1X2QA 3CMET 4C8QE 1M1KU 1W70A 1MNEA 3OYYA 1WYXA 2V26A 2NUTA 2DFUA 3CCVQ 3CCMT 1KQSA 3Q1JA 1M5Q1 2DK3A 2OTJA 4A4FA 4OVAA 4M7AG 4QQDA 2HD0A 2D0QB 2DE0X 4FSSA 4X9CA 1K76A 1EIFA 1VQLQ 4X9DA 1N6AA 1ZX6A 3X20B 2JXBA 1IB8A 2FL7A 1DJ7B 3L2UA 2QXFA 1U3OA 3CD6Q 4NL3A 4OGEA 3QZ9B 4CC2A 2VXFA 4C92G 2E4HA 5KYXA 4AT1B 2KRSA 1IHWA 4WCIA 2KXCA 1M1KR 1PRLC 2KSSA 4A4KA 3FB9A 4FM4B 4O6JA 3R6OA 3SB2A 1VQ8A 2GTJA 1BKBA 5GJWB 2V8JA 1SF9A 1SSFA 2J6OA 4LUDA 1G8XA 3ME9A 3TSZA 1M8MA 3CBOA 1NYFA 2JM8A 1X6GA 3QDRB 1YCSB 4R56A 2FPEA 2RHUA 2EQUA 1Q82U 1UE9A 5GMKe 4OB1B 3JCMh 1RAGB 3CCQT 1M3CA 2K6DA 3V7SA 1ZSZA 4C8QC 2KDSA 1LNXA 4TVRA 2V1QA 2DNUA 5CKEA 5GAMj 4DEYA 2VKNA 3A8OB 4HT8A 1M1FA 4C8QA 5DLOA 2DL3A 3CC2Q 3MCAB 1XJWB 1M90U 2NUPA 1GCPA 2RJDA 2BZYA 2COWA 1WXTA 1HSQA 2OTJT 1VQ5A 4M7DE 4DBFA 2EYWA 3H0IA 1Y7XA 4OMMA 1Q82R 5I22A 4OB2B 2X9HA 2JZ2A 1BI0A 1PSEA 3TVTA 5M9OA 2KGTA 2MWOA 2B8AA 5KYWB 1UECA 3NTKA 4PFPA 4OMQA 5CKBA 2DO3A 2QTXA 1WJQA 1U1TA 4C8QG 2OTLQ 3QXEB 3I56Q 1ZQ1A 1BYMA 3WVDB 5LJ5e 4DOWA 4M78B 5LJ3d 4PNOA 3EGXB 4A4HA 3RMSA 2DRMA 3V8LA 3QWYA 4JZ4A 3QWXX 3EG0A 5CKFA 1MMAA 4IUVA 4FT4A 3OA6A 3CC7Q 4KBMB 1X27A 2DILA 4PJOD 3OYCA 2R5MA 3G4SA 2EBPA 2ZPEB 2MAMA 2GQIA 2VGNA 2Y90A 4IURA 3CQTA 3FEOA 1BB9A 1M3BA 3VS0A 1D1AA 3JCMc 1FMWA 3CPWS 3META 1YWOA 1OU9A 5CK9A 3AHUA 2F5KA 1NJIU 1U06A 4M7DC 2YRCA 4J9IA 3CCSA 2F2WA 3M57A 3IQLA 3SD4A 1WHGA 5D6WA 5GAOq 2BKDN 2LCCA 1VQ5T 2LRQA 2O88A 1VQ7T 2CKKA 2K2VA 3J81E 3M4GA 3OBYA 1JJ2S 4ATOA 1PHTA 5GAMe 5GAOm 2ZAEA 3LWIA 2PUOB 1RI0A 2ESWA 1BI2A 1ZSGA 2XK0A 4GBQA 3I9QA 4M7AF 3CCEA 1NJIR 4F04B 5FLXE 1BK2A 2JS2A 3M54A 1W2BS 2RHZA 4LDWA 2BIVA 2L3QA 1KC8R 2E5KA 4D8DA 4OP0A 1QWEA 2LT1A 4EIKA 5KYWA 4QKUA 3FC3A 1UFFA 4M7DG 4EMGA 5GAOr 2EQMA 2HL5C 2VC8A 2CSQA 3GBQA 1QVFS 2OAWA 2KT8A 4M78A 2LJ3A 2P4TA 3EGXA 3G4ST 5GANj 5FU6B 4IIMA 1V1CA 4AFSC 1RLPC 3JCMP 4RTXA 3CCJQ 1QW1A 3EHRA 1YP5A 3GLXA 4JZ3A 1VYVA 4J8OA 3CCST 3S3NA 3QDFA 4FU6A 1VUBA 4YTLA 2KAFA 2YRDA 3OYFA 3OYDA 3JB9I 3A8MB 5GMKl 1X6BA 5I21A 1MV0B 1GBRA 1NYGA 4GLMA 1R0CB 1JO8A 4KGZB 1WI7A 3JCMe 1OU8A 1IO6A 1UJYA 3VJPA 2XD0A 3QUIA 2JW4A 4D8KA 2L0AA 4J9GA 3G6EA 2RI3A 1JEGA 3CCET 1UEBA 2FZCB 2L8DA 1Q86C 3GIBA 3X26B 1TXQA 1ZA2B 2EAYA 3CPWP 3CCMQ 1LCKA 2KVQG 3OMCA 1OEBA 2E1HA 2KYBA 1UTIA 3JCMd 1VQ6Q 4RTYA 2E64A 2DZCA 4RTUA 4KH1B 1PG5B 2K2MA 1YHQA 2DXCA 2QDLA 4E2FB 4FYWB 3MEUA 2DETA 4AFUC 3KUFA 1JRIA 2KYMA 2CT3A 4OMNA 4A54A 2XICA 3FDRA 1S72A 4IUQA 2XHCA 4HCKA 4BB7A 1KG1A 5FU6C 2DERA 1BIBA 4CC7A 1WHKA 2BUDA 1YJWA 4QVCA 3LGFA 1OV3A 3HRTA 3VS5A 1YI2A 4JLIA 2M16A 2RA2A 4F7UF 2ED0A 3FRNA 1AVZC 1AOJA 3ASKA 2WSEE 1KSWA 1D1BA 1RI9A 3CC4A 2QGGA 4Z88A 4KGVB 1BI1A 1VQ4Q 4ELZC 5FRNA 3A8HB 2LZ6B 2PU9B 5GANe 1WXBA 3M4YA 3M55A 4Q5WA 1VIFA 3CCQQ 2EJ9A 2F1LA 2DL8A 3QJ6A 3HFNA 2JTEA 2AZSA 4O5VA 5FW9A 1NEGA 5KYUB 4A4GA 3C12A 4CC4B 1QVFP 1HJDA 4FCYA 2NWMA 3G6ET 4C0ZA 2BE7D 2KI7A 2KBTA 2B86A 4HT9A 3EFSA 1Q82C 3L2RA 2OTJQ 3I55A 2DX1A 3CCLA 1QKWA 3JAME 1KQSP 1UGPB 6AT1B 4XTZA 3REBB 3VS7A 3L2WA 4LNPA 1W1FA 3UT1A 3OYMA 1MUZA 3HHTB 1VQMA 1H3ZA 1M2OA 1Y57A 4XTWA 5GMKi 4J9CA 3E9GA 3PT9A 2GF7A 2HQHA 3HP9A 3X28B 4QVZA 3OS5A 1S72T 1QP3A 3TEEA 1GCQA 1JXOA 4FYYB 2QQAA 5GAOp 2XIDA 4M7DF 4CRIA 2M02A 1YI2T 4KRTA 4M7AB 4LE9A 1QCFA 1SPKA 2CP0A 2A3LA 4E7ZA 2O9VA 3HRSA 3JB9D 2FRYA 4RTWA 2VWFA 2KROA 3CCUQ 4Z8AA 3D7SB 4KGXB 2J05A 2IG0A 1AZEA 4DBRA 1WZOA 4A4EA 1ZLMA 2DIGA 3BFMA 3LW5E 3OYGA 2FVUA 2O01E 4AMCA 1YJNA 1I8FA 1UJ0A 4C92B 2QEXQ 1SG5A 1K0XA 4XU2A 1QCNA 2CT4A 1AZGB 2R58A 1ABQA 4UC4A 3R6NA 2H8HA 3QPHA 2P84A 5KYUA 2C0TA 1VQ5Q 1UHCA 3I55T 1ZUUA 3EHQA 1VQ7Q 3CCLT 4HCBA 4B6MA 3CMAA 1KK7A 2CUBA 1VQMT 4XK8E 5GAOl 4E7HA 4D6WA 1B34B 1M1GA 2A36A 1NJIC 1N27A 1YITQ 2RQTA 2R5AA 2E6ZA 4E7JA 3GNFB 1KC8C 2FG0A 1JJ2A 3TSWA 2OX7A 3JCMW 3NPFA 1QWFA 1WGSA 1XNIA 2KY9A 2PUKB 2Y4YA 3VV0A 2MMPA 2A0FB 3M0UA 4FT2A 2FRWA 5FWBA 5GMKj 5IHNA 4RG8A 2HNIA 4BACA 1PWTA 4HKEA 2RF0A 1K8AC 2RD1A 1W2BA 1WA7A 1NZ9A 2VUBA 2HKQB 3RKYA 4K11A 4M7AA 1FMKA 2LCLA 4DQ2A 1Q86U 4LDYA 2RI5A 4M75D 3UA7A 4BE1A 2X35A 1AWOA 1WLPB 4BI4A 5I2SA 3F70A 1YIJA 2RH2A 5LJ3j 1O75A 4M77F 3UWNA 2LDMA 3OYLA 4C92A 5J3BA 2X3XD 2GGRA 4P5NA 2D1XA 2YUNA 4F7UB 1FMVA 2DXUA 1YN8A 3X25B 3CMAT 3JV3A 1WX6A 1PC0A 2JJ9A 2CZ7B 4J6WA 5D6YA 1VQPA 2J6KA 5LJ5j 1Q86R 3QIIA 4F7UE 3M0TA 1PNJA 2EGEA 4E7SA 2CGHA 3H8ZA 4X34A 2PTKA 1M4ZA 5IN1A 2LMJA 5A0DA 3C0CA 4V2SA 1B34A 3BDLA 1TU0B 4OB0B 1VQKA 5EC7A 5AT1B 3V7RA 4PJNA 3LGLA 3OYHA 1YJ9A 3LWHA 2O4XB 1VQ9A 3MEAA 2XDBA 2HBWA 3EG1A 4II1A 1JQQA 2DYIA 2E70A 2YLBA 3PE0A 1VQNA 5GAN8 1YIJT 2YHTA 3KXTA 4N4IA 3VYHB 4RKUE 3BE3A 1AWXA 3PTAA 2HAXA 4M7DB 2KRMA 1VQOA 4IUUA 5FU7C 4KUDK 1HD3A 1MNDA 2I0NA 4JLGA 3HSBA 4OGCA 2OJ2A 2MCNA 3A8LB 4ANJA 2SRCA 2DAQA 2LVMA 4HCCA 2KRNA 2DL5A 1VQPT 3GNGA 2JTFA 1E6GA 4F7UA 3WXMB 4J6YA 5LJ3e 2DTHA 2JMCA 2ROLA 4BUGA 8ATCB 1CKBA 3H9NA
chains in the Genus database with same CATH topology
4X1VA 4AG2C 4J9DA 3EHRA 1YP5A 4JZ3A 1VYVA 2ECZA 1GBQA 2DM1A 2RNAA 2GNCA 2D8JA 2LQNA 3SEMA 2M0YA 2MOXA 2HEQA 2J7IA 3NGPA 2EW3A 4ZNXA 1X6BA 1PKSA 1MV0B 1GBRA 3EGUA 1NYGA 2AK5A 4GLMA 4J9HA 5L23A 1KIKA 1GCQC 1AWJA 1JO8A 4AFZC 2ROTA 1AEYA 1QLYA 1WI7A 2YT6A 2ED1A 1E7OA 1IO6A 1UJYA 3UF4A 2L2PA 2JW4A 1UUEA 4D8KA 2L0AA 4J9GA 1J3TA 2KXDA 1JEGA 4CC3A 4F14A 3VS6A 2JT4A 3VRYA 1UHFA 1B07A 2JMAA 2CH4W 1VYTA 1LCKA 2DJQA 1ZUYA 1GFDA 3NHNA 2O9SA 2BTTA 1OEBA 2KYBA 1UTIA 4RTZA 1K0SA 1K9AA 4RTYA 4RTUA 2K2MA 1BBZA 1I0CA 3VS2A 2QDLA 4LN2A 1QKXA 4AFUC 1OPKA 1NLPC 1FYNA 2KYMA 2CT3A 4OMNA 4DEXA 1VYUA 3UA6A 4HCKA 2BZ8A 4RUGA 4CC7A 1OV3A 1ZUKA 3VS5A 1VA7A 2ED0A 4OMLA 1AVZC 1ZBJA 1AOJA 2LNHB 3M0QA 1KSWA 2C0OA 4JJBA 1RI9A 2YUPA 1T3SA 2LP5A 4Z88A 3ZL7C 2ABLA 2J06A 1ABOA 2LZ6B 2KNBB 1WXBA 2LJ0A 1B3QA 1KFZA 3I5RA 2F2VA 2K79A 2DL8A 2LCSA 2JTEA 2AZSA 4AFQC 5FW9A 1NEGA 1YWPA 1NM7A 5IHIA 2DRKA 1SRLA 1WDXA 2CDTA 4CC4B 5ECAA 1AWWA 1HJDA 4JJCA 2CH4A 2NWMA 2DMOA 2IIMA 2KBTA 2D8HA 1YNZA 2B86A 5IHKA 4A63B 2LQWA 2DA9A 3VS4A 4Y92A 1SHGA 2DX1A 1QKWA 4RTTA 1SEMA 3H41A 1X2KA 1NG2A 3EG2A 4ESRA 3REBB 1NLOC 3VS7A 4RTVA 4LNPA 1W1FA 2PNIA 1PRMC 2J6FA 1K1ZA 1MUZA 3KFVA 2K7AA 1Y57A 2GBQA 4J9CA 1H3HA 1GL5A 1GRIA 1UGVA 1OPLA 5IXBA 3ULRB 1GCQA 1RUWA 1XOVA 1JXOA 1MV3A 2XMFA 4Z89A 1U5SA 2FO0A 2MIOA 3VS3A 1X2QA 4KRTA 3THKA 3REAB 1W70A 3H0HA 1T0HA 1QCFA 3O5ZA 4LE9A 4ORZA 1WYXA 1SPKA 1GFCA 3I35A 2O9VA 2FRYA 4RTWA 2FEIA 2EKHA 2YUQA 1UDLA 2VWFA 2KROA 4Z8AA 2DE0X 4FSSA 2J05A 3VRZA 1AZEA 1K76A 1ZLMA 2CSIA 1UG1A 1ZX6A 2AKLA 2V1RA 3A98A 5IXFA 2VVKA 2JXBA 4M4ZA 1UJ0A 1H8KA 1U3OA 1KJWA 1K0XA 3PVQA 2CT4A 2CREA 1AZGB 4CC2A 1NEBA 3NMZC 1ABQA 2KRSA 4WCIA 3R6NA 2KXCA 3U23A 2H8HA 1PRLC 3SHWA 1TUCA 2KEAA 1SRMA 2C0TA 2GTJA 3H0FA 5GJWB 4LUEA 1UHCA 2M51A 2YDLA 2EGCA 1ZUUA 3EHQA 2J6OA 4LUDA 2W10A 3TSZA 1M8MA 2OI3A 1NYFA 2ENMA 2JM8A 5I11A 1X6GA 2CUBA 2NUZA 1YCSB 3I5SA 1AD5A 2X3WD 4F17A 1JU5C 2FPEA 1M3AA 2A36A 2RQTA 2DVJA 1UE9A 1M3CA 2K6DA 2A28A 2G6FX 2DBMA 2FG0A 3TSWA 3NPFA 1QWFA 4J9BA 4OMOA 3RBBB 2V1QA 1WIEA 2DNUA 2PZ1A 4DEYA 2CUDA 2VKNA 3FJ5A 3M0UA 2FRWA 5FWBA 2DL3A 5IHNA 2C0IA 1TUDA 2AZVA 1M27C 2GTOA 1GCPA 2KR3A 3LH5A 2BZYA 1K4US 1WXTA 1PWTA 1SSHA 1HSQA 2RF0A 2A37A 2EYYA 2EYWA 1OOTA 3H0IA 1WA7A 4HVUA 4K11A 4HVWA 2JM9A 2W0ZA 2EQIA 2YUOA 1N5ZA 4E6RA 4OMMA 1FMKA 5I22A 2F2XA 4HVVA 2KE9A 3UA7A 2LX7A 3TVTA 1AWOA 3VS1A 1WLPB 1X69A 4IIOA 1Z9ZA 2KGTA 3UATA 2FPFA 2K9GA 1H92A 2A08A 2P4RA 5HCKA 1I07A 1UECA 2K3BA 4OMQA 1Z9QA 2X3XD 2GGRA 1M30A 2D1XA 2YUNA 2YSQA 2DL4A 2HDAA 1SHFA 1YN8A 2DRMA 5FWCA 1G83A 3QWYA 4JZ4A 3JV3A 1WX6A 1G2BA 3QWXX 3EG0A 2EYZA 1X27A 2J6KA 2DILA 2RQWA 3M0TA 1PNJA 2EBPA 1CSKA 2D0NA 2EGEA 4J9EA 2GQIA 2PTKA 3CQTA 1BB9A 1I1JA 1M3BA 3VS0A 1W6XA 2FPDA 4F16A 4R0KA 1JXMA 2RMOA 1CKAA 1YWOA 2LMJA 3C0CA 3RNJA 2DLPA 1U06A 4OMPA 3PVLA 5EC7A 2EVRA 2RQVA 3M0SA 4J9IA 2F2WA 1A0NB 3IQLA 2L3SA 1Y0MA 1T3LA 1ARKA 2JS0A 5IH2A 2O88A 4QT7A 2O31A 2EGAA 1WFWA 2HBWA 4J9FA 4JJDA 3EG1A 1PHTA 2O2OA 4AG1C 1JQQA 2DYBA 3PE0A 2AKKA 2EPDA 2RQUA 1TG0A 1E6HA 2ESWA 1ZSGA 4HXJA 4GBQA 3I9QA 2SEMA 1BK2A 1AWXA 2JS2A 2KRMA 1PKTA 2L3QA 2RN8A 2E5KA 2KT1A 4D8DA 1QWEA 2LJ1A 2RPNA 1HD3A 2I0NA 4EIKA 1EFNA 2RQRA 1T0JA 2HCKA 1UFFA 1RLQC 2OJ2A 2MCNA 2SRCA 2EYXA 2L3PA 2HSPA 2DF6A 2KRNA 2DL5A 2CSQA 3M0PA 2BZXA 3GBQA 1E6GA 2OAWA 2DBKA 2KT8A 4JPBW 2DL7A 1X43A 2LJ3A 1BU1A 1S1NA 4IIMA 1V1CA 3M0RA 4AFSC 5GJVB 2JMCA 2ROLA 1RLPC 3EG3A 1WXUA 1CKBA 4RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X1V A;  4AG2 C;  4J9D A;  3EHR A;  1YP5 A;  4JZ3 A;  1VYV A;  2ECZ A;  1GBQ A;  2DM1 A;  2RNA A;  2GNC A;  2D8J A;  2LQN A;  3SEM A;  2M0Y A;  2MOX A;  2HEQ A;  2J7I A;  3NGP A;  2EW3 A;  4ZNX A;  1X6B A;  1PKS A;  1MV0 B;  1GBR A;  3EGU A;  1NYG A;  2AK5 A;  4GLM A;  4J9H A;  5L23 A;  1KIK A;  1GCQ C;  1AWJ A;  1JO8 A;  4AFZ C;  2ROT A;  1AEY A;  1QLY A;  1WI7 A;  2YT6 A;  2ED1 A;  1E7O A;  1IO6 A;  1UJY A;  3UF4 A;  2L2P A;  2JW4 A;  1UUE A;  4D8K A;  2L0A A;  4J9G A;  1J3T A;  2KXD A;  1JEG A;  4CC3 A;  4F14 A;  3VS6 A;  2JT4 A;  3VRY A;  1UHF A;  1B07 A;  2JMA A;  2CH4 W;  1VYT A;  1LCK A;  2DJQ A;  1ZUY A;  1GFD A;  3NHN A;  2O9S A;  2BTT A;  1OEB A;  2KYB A;  1UTI A;  4RTZ A;  1K0S A;  1K9A A;  4RTY A;  4RTU A;  2K2M A;  1BBZ A;  1I0C A;  3VS2 A;  2QDL A;  4LN2 A;  1QKX A;  4AFU C;  1OPK A;  1NLP C;  1FYN A;  2KYM A;  2CT3 A;  4OMN A;  4DEX A;  1VYU A;  3UA6 A;  4HCK A;  2BZ8 A;  4RUG A;  4CC7 A;  1OV3 A;  1ZUK A;  3VS5 A;  1VA7 A;  2ED0 A;  4OML A;  1AVZ C;  1ZBJ A;  1AOJ A;  2LNH B;  3M0Q A;  1KSW A;  2C0O A;  4JJB A;  1RI9 A;  2YUP A;  1T3S A;  2LP5 A;  4Z88 A;  3ZL7 C;  2ABL A;  2J06 A;  1ABO A;  2LZ6 B;  2KNB B;  1WXB A;  2LJ0 A;  1B3Q A;  1KFZ A;  3I5R A;  2F2V A;  2K79 A;  2DL8 A;  2LCS A;  2JTE A;  2AZS A;  4AFQ C;  5FW9 A;  1NEG A;  1YWP A;  1NM7 A;  5IHI A;  2DRK A;  1SRL A;  1WDX A;  2CDT A;  4CC4 B;  5ECA A;  1AWW A;  1HJD A;  4JJC A;  2CH4 A;  2NWM A;  2DMO A;  2IIM A;  2KBT A;  2D8H A;  1YNZ A;  2B86 A;  5IHK A;  4A63 B;  2LQW A;  2DA9 A;  3VS4 A;  4Y92 A;  1SHG A;  2DX1 A;  1QKW A;  4RTT A;  1SEM A;  3H41 A;  1X2K A;  1NG2 A;  3EG2 A;  4ESR A;  3REB B;  1NLO C;  3VS7 A;  4RTV A;  4LNP A;  1W1F A;  2PNI A;  1PRM C;  2J6F A;  1K1Z A;  1MUZ A;  3KFV A;  2K7A A;  1Y57 A;  2GBQ A;  4J9C A;  1H3H A;  1GL5 A;  1GRI A;  1UGV A;  1OPL A;  5IXB A;  3ULR B;  1GCQ A;  1RUW A;  1XOV A;  1JXO A;  1MV3 A;  2XMF A;  4Z89 A;  1U5S A;  2FO0 A;  2MIO A;  3VS3 A;  1X2Q A;  4KRT A;  3THK A;  3REA B;  1W70 A;  3H0H A;  1T0H A;  1QCF A;  3O5Z A;  4LE9 A;  4ORZ A;  1WYX A;  1SPK A;  1GFC A;  3I35 A;  2O9V A;  2FRY A;  4RTW A;  2FEI A;  2EKH A;  2YUQ A;  1UDL A;  2VWF A;  2KRO A;  4Z8A A;  2DE0 X;  4FSS A;  2J05 A;  3VRZ A;  1AZE A;  1K76 A;  1ZLM A;  2CSI A;  1UG1 A;  1ZX6 A;  2AKL A;  2V1R A;  3A98 A;  5IXF A;  2VVK A;  2JXB A;  4M4Z A;  1UJ0 A;  1H8K A;  1U3O A;  1KJW A;  1K0X A;  3PVQ A;  2CT4 A;  2CRE A;  1AZG B;  4CC2 A;  1NEB A;  3NMZ C;  1ABQ A;  2KRS A;  4WCI A;  3R6N A;  2KXC A;  3U23 A;  2H8H A;  1PRL C;  3SHW A;  1TUC A;  2KEA A;  1SRM A;  2C0T A;  2GTJ A;  3H0F A;  5GJW B;  4LUE A;  1UHC A;  2M51 A;  2YDL A;  2EGC A;  1ZUU A;  3EHQ A;  2J6O A;  4LUD A;  2W10 A;  3TSZ A;  1M8M A;  2OI3 A;  1NYF A;  2ENM A;  2JM8 A;  5I11 A;  1X6G A;  2CUB A;  2NUZ A;  1YCS B;  3I5S A;  1AD5 A;  2X3W D;  4F17 A;  1JU5 C;  2FPE A;  1M3A A;  2A36 A;  2RQT A;  2DVJ A;  1UE9 A;  1M3C A;  2K6D A;  2A28 A;  2G6F X;  2DBM A;  2FG0 A;  3TSW A;  3NPF A;  1QWF A;  4J9B A;  4OMO A;  3RBB B;  2V1Q A;  1WIE A;  2DNU A;  2PZ1 A;  4DEY A;  2CUD A;  2VKN A;  3FJ5 A;  3M0U A;  2FRW A;  5FWB A;  2DL3 A;  5IHN A;  2C0I A;  1TUD A;  2AZV A;  1M27 C;  2GTO A;  1GCP A;  2KR3 A;  3LH5 A;  2BZY A;  1K4U S;  1WXT A;  1PWT A;  1SSH A;  1HSQ A;  2RF0 A;  2A37 A;  2EYY A;  2EYW A;  1OOT A;  3H0I A;  1WA7 A;  4HVU A;  4K11 A;  4HVW A;  2JM9 A;  2W0Z A;  2EQI A;  2YUO A;  1N5Z A;  4E6R A;  4OMM A;  1FMK A;  5I22 A;  2F2X A;  4HVV A;  2KE9 A;  3UA7 A;  2LX7 A;  3TVT A;  1AWO A;  3VS1 A;  1WLP B;  1X69 A;  4IIO A;  1Z9Z A;  2KGT A;  3UAT A;  2FPF A;  2K9G A;  1H92 A;  2A08 A;  2P4R A;  5HCK A;  1I07 A;  1UEC A;  2K3B A;  4OMQ A;  1Z9Q A;  2X3X D;  2GGR A;  1M30 A;  2D1X A;  2YUN A;  2YSQ A;  2DL4 A;  2HDA A;  1SHF A;  1YN8 A;  2DRM A;  5FWC A;  1G83 A;  3QWY A;  4JZ4 A;  3JV3 A;  1WX6 A;  1G2B A;  3QWX X;  3EG0 A;  2EYZ A;  1X27 A;  2J6K A;  2DIL A;  2RQW A;  3M0T A;  1PNJ A;  2EBP A;  1CSK A;  2D0N A;  2EGE A;  4J9E A;  2GQI A;  2PTK A;  3CQT A;  1BB9 A;  1I1J A;  1M3B A;  3VS0 A;  1W6X A;  2FPD A;  4F16 A;  4R0K A;  1JXM A;  2RMO A;  1CKA A;  1YWO A;  2LMJ A;  3C0C A;  3RNJ A;  2DLP A;  1U06 A;  4OMP A;  3PVL A;  5EC7 A;  2EVR A;  2RQV A;  3M0S A;  4J9I A;  2F2W A;  1A0N B;  3IQL A;  2L3S A;  1Y0M A;  1T3L A;  1ARK A;  2JS0 A;  5IH2 A;  2O88 A;  4QT7 A;  2O31 A;  2EGA A;  1WFW A;  2HBW A;  4J9F A;  4JJD A;  3EG1 A;  1PHT A;  2O2O A;  4AG1 C;  1JQQ A;  2DYB A;  3PE0 A;  2AKK A;  2EPD A;  2RQU A;  1TG0 A;  1E6H A;  2ESW A;  1ZSG A;  4HXJ A;  4GBQ A;  3I9Q A;  2SEM A;  1BK2 A;  1AWX A;  2JS2 A;  2KRM A;  1PKT A;  2L3Q A;  2RN8 A;  2E5K A;  2KT1 A;  4D8D A;  1QWE A;  2LJ1 A;  2RPN A;  1HD3 A;  2I0N A;  4EIK A;  1EFN A;  2RQR A;  1T0J A;  2HCK A;  1UFF A;  1RLQ C;  2OJ2 A;  2MCN A;  2SRC A;  2EYX A;  2L3P A;  2HSP A;  2DF6 A;  2KRN A;  2DL5 A;  2CSQ A;  3M0P A;  2BZX A;  3GBQ A;  1E6G A;  2OAW A;  2DBK A;  2KT8 A;  4JPB W;  2DL7 A;  1X43 A;  2LJ3 A;  1BU1 A;  1S1N A;  4IIM A;  1V1C A;  3M0R A;  4AFS C;  5GJV B;  2JMC A;  2ROL A;  1RLP C;  3EG3 A;  1WXU A;  1CKB A;  4RTX A; 
#chains in the Genus database with same CATH topology
 3P8D A;  5GAN 7;  1VQK T;  3SDZ A;  2DM1 A;  5CQX A;  3QZ5 B;  2KMT A;  2QI2 A;  8AT1 B;  4DOV A;  1YJ9 T;  1XTD A;  4J7I A;  5EG2 A;  4QQG A;  1VQ8 T;  2QAS A;  4BI8 B;  1IXD A;  3CPF A;  1VQ9 T;  1AWJ A;  4Z02 A;  4AFZ C;  2ROT A;  5KE2 A;  1QLY A;  2ED1 A;  1Q7Y C;  4F7U G;  3RKX A;  2L2P A;  1VQN T;  3SFM A;  2O4X A;  1VIE A;  3DKM A;  1YI2 Q;  1LJO A;  3EFO B;  3VS6 A;  1JB0 E;  4ZN1 A;  5CQY A;  2VV5 A;  1M9S A;  1B07 A;  3PFS A;  3UPU A;  3RMQ A;  1VQO T;  2MYS A;  2QA4 A;  1ZUY A;  4C0F A;  5KYN A;  4C92 D;  4DBH A;  3HTR A;  2BTT A;  3CXC S;  3KBG A;  4RTZ A;  1K0S A;  1K9A A;  1NPP A;  1KC8 U;  1N9S A;  4M7D A;  1BBZ A;  4QVD A;  3HKS A;  3QKJ A;  4E47 A;  3TCJ A;  2LQK A;  5KYY B;  3RR6 A;  3PIP A;  2WSF E;  2JNG A;  4PFO A;  2ZZD A;  1VYU A;  2RK2 A;  5GAN 4;  3UA6 A;  2LNV A;  1K8A U;  2BZ8 A;  4M77 B;  4EPC A;  4OML A;  1ZBJ A;  3CCL Q;  2D6F A;  4FL6 A;  3CCV A;  4JJB A;  2LP5 A;  1C1A A;  1RAA B;  2V8K A;  3HRU A;  2DVE A;  4M77 E;  3QG1 A;  2LJ0 A;  1M8V A;  2F2V A;  1F1B B;  1ACM B;  5GAN 2;  4AFQ C;  5IHI A;  1LVK A;  2DD5 A;  4ME7 A;  5GAN 6;  3JCM Q;  3CD6 A;  1SRL A;  4PJO F;  2K3X A;  3DB4 A;  5ECA A;  2RHI A;  1K8A R;  2VAS A;  2QAZ A;  2KK4 A;  2DMO A;  2DZ9 A;  3FLG A;  1H64 1;  4BDZ A;  3EH2 A;  2QA4 T;  4A63 B;  5GAO n;  3ER0 A;  1BCO A;  2DA9 A;  5GAN f;  5GAN 5;  1PSF A;  3E9F A;  4Y92 A;  1SHG A;  4C8Q D;  3EFO A;  3H41 A;  4ZGJ B;  1OUL A;  1X2K A;  2VYT A;  3EG2 A;  1NLO C;  4RTV A;  3L1A A;  2CP7 A;  1K1Z A;  3G71 Q;  2K7A A;  5DM7 R;  2GBQ A;  1GL5 A;  1GRI A;  1HYO A;  3ULR B;  4HCZ A;  2JVV A;  1RUW A;  2HMA A;  3GP8 A;  5KYY A;  1UB4 A;  2FB7 A;  2MIO A;  1O9S A;  3THK A;  3CME Q;  4L6V 5;  3H0H A;  1T0H A;  3C94 A;  4NOY A;  1QP2 A;  1GFC A;  5CAI A;  4XTV A;  1TUG B;  3CCV T;  1D0X A;  4M75 E;  4DA4 A;  4M77 C;  2EKH A;  1UDL A;  4ELY C;  3C95 A;  4M77 A;  5CIU A;  3VRZ A;  2ZPB B;  2PVO B;  1RAI B;  1UG1 A;  4JS4 A;  2AKL A;  3JCM b;  2VVK A;  4JRK A;  4M4Z A;  3GPL A;  3UDC A;  3O8V A;  3PVQ A;  3NFC A;  2CRE A;  4J6X A;  2E6N A;  3JB9 G;  2M0O A;  3GOX A;  4JS5 A;  1JJ2 P;  1NEB A;  1QCO A;  3NMZ C;  3QBY A;  5DLQ E;  2K5L A;  3U23 A;  3CCR A;  2YWW A;  4GY5 A;  3SHW A;  2KEA A;  1SRM A;  1Y71 A;  3RDV A;  2HSE B;  3H0F A;  2P0P A;  3MP8 A;  3NTI A;  2W10 A;  4N0A C;  2CS7 A;  2EKO A;  3OY9 A;  3M5A A;  2NUZ A;  3I5S A;  1W2B P;  4M77 G;  2X3W D;  4F17 A;  3OYJ A;  1IGU A;  3CC7 A;  1IHV A;  4N0A A;  3MHX A;  2DVJ A;  3RUX A;  4LDX A;  5KH6 A;  2A28 A;  1WPY A;  2XI9 A;  5IAY A;  4JUV A;  4DBQ A;  1M2V B;  3RBB B;  2CZ1 B;  2PZ1 A;  2ZGW A;  2EJG A;  1TUD A;  2AZV A;  2GTO A;  1V76 A;  5IT9 E;  5HY6 A;  2KR3 A;  3E19 A;  3OMG A;  5HKC A;  4J5Y A;  1Q7Y U;  1SSH A;  2EYY A;  1OOT A;  5LJ5 g;  2RK1 A;  4HVW A;  2JM9 A;  3VUZ A;  3OYE A;  2M9U A;  2EQI A;  4E6R A;  4BY6 C;  4HVV A;  1YHQ T;  2KE9 A;  2LX7 A;  1Z9Z A;  2COZ A;  2FPF A;  2K9G A;  2A08 A;  1XQH A;  5HCK A;  3FIF A;  5C6S A;  1I07 A;  2YLC A;  4M78 D;  2RO0 A;  4ZTF A;  1WJR A;  2X4Y A;  3CCR T;  1YJW T;  4OF1 A;  1NE8 A;  1VQ8 Q;  4N4G A;  2L3R A;  2ATC B;  1Q7Y R;  1SHF A;  2X4X A;  3PNW C;  3OYA A;  3CC4 T;  3OW2 S;  2FZK B;  4J83 A;  2EYZ A;  4PJM A;  3CC7 T;  2VXE A;  2RQW A;  4E7I A;  3PMI A;  3H6Z A;  2D0N A;  4RCC A;  3JRZ A;  4J9E A;  4BI3 A;  3E1S A;  1I4K 1;  1I1J A;  1OX8 A;  4C0D C;  4XTX A;  1W6X A;  5GAM g;  2FPD A;  4F16 A;  5KCO A;  3CCJ A;  1CKA A;  3RNJ A;  1VQO Q;  3SWN C;  5A0G A;  3URG A;  3HL8 A;  1K9M C;  4OMP A;  2EVR A;  1HXD A;  2XDD A;  2HBP A;  1A0N B;  5CVI A;  2MF2 A;  1M2V A;  2DJZ A;  3VYG A;  1Y0M A;  1TSF A;  4PJO E;  1ARK A;  5IH2 A;  2K57 A;  2RJF A;  4B9X A;  2EGA A;  1WFW A;  2GCX A;  4J9F A;  3CXC A;  1YFN A;  4JJD A;  2O2O A;  4AG1 C;  4MDW A;  1Y07 A;  1ZA1 B;  2JTM A;  2AKK A;  4MML A;  4PKC C;  2HZY A;  3HFO A;  2RQU A;  1QQJ A;  1UGQ B;  1KD1 R;  2Y4X A;  3MP6 A;  4PL6 A;  3X24 B;  3N5B B;  4LD6 A;  3CCM A;  4JJN K;  5LJ5 h;  1PKT A;  5I2M A;  1KQ1 A;  2RPN A;  4IUP A;  2RQR A;  1VQ6 A;  1WJS A;  3VUB A;  2MK5 A;  3M59 A;  4GLK A;  3JB9 F;  2BZX A;  1NPR A;  4FIB A;  2DBK A;  2EQK A;  1OZ3 A;  2E3H A;  1BU1 A;  1S1N A;  3G4S Q;  4Y91 A;  1BIA A;  1YJN T;  1BCM A;  3EG3 A;  1WXU A;  1LOJ A;  3CCJ T;  1C0M A;  3V8K A;  4J9D A;  4C0G A;  2Z0W A;  1R0B G;  1WQW A;  3G7Z A;  4N4H A;  2QA4 Q;  1D09 B;  1GBQ A;  4PJO C;  1IZ6 A;  3CCS Q;  2H3J A;  2RHY A;  2AHJ B;  5FU7 B;  1NBE B;  5GMK m;  2HEQ A;  3LX7 A;  2J7I A;  3NGP A;  4ZNX A;  1PKS A;  2E5Q A;  1VQ4 A;  2AK5 A;  4J9H A;  5L23 A;  5LJ3 f;  1AEY A;  2EFI A;  5FRO A;  5GAM h;  2XU8 A;  3OYN A;  3RIR A;  3UF4 A;  1I5L A;  4Y28 E;  9ATC B;  3LYI A;  1VOM A;  1N8R U;  4MZM A;  1D3B B;  2KXD A;  4IUT A;  4CC3 A;  3CCE Q;  4F14 A;  3VRY A;  2LC4 A;  1UHF A;  2CH4 W;  2HL3 A;  2DJQ A;  5LJ5 f;  5KCH A;  1GFD A;  1WHJ A;  2FYK A;  3EFR A;  3NHN A;  4JRQ A;  2LT4 A;  2RB6 A;  3TQ7 P;  1VQ6 T;  4PJO G;  1OX9 A;  2GQV A;  1I0C A;  1G3S A;  4KUI A;  1QKX A;  3EAE A;  3AT1 B;  4FSX A;  1OPK A;  7AT1 B;  5GAN g;  2KQW A;  1U8R A;  1KHC A;  2CP3 A;  4DEX A;  1RAE B;  1RAH B;  4M75 F;  1N8R R;  3ZEH A;  4BE2 A;  2DXB A;  1GXI E;  1B7T A;  3GF5 A;  4XU0 A;  3OS2 A;  1VA7 A;  1QVP A;  1UGR B;  3EH1 A;  2YUP A;  1QMC A;  3CCU A;  1I5O B;  3OBW A;  3ZL7 C;  1VQ4 T;  4RCB A;  1FXX A;  1ZSZ C;  2KNB B;  1B3Q A;  3HPW A;  1KFZ A;  3I5R A;  3OSS C;  5GAM f;  1QVG A;  2QEX A;  4B9W A;  1TTH B;  1G3T A;  2CDT A;  2IPO B;  3JCM V;  3INZ A;  3M9Q A;  3G6E Q;  2PVG B;  2IIM A;  2K4Y A;  3S3M A;  5IHK A;  2LQW A;  3EGD B;  2BE9 B;  1D3B A;  1VQ7 A;  2F5T X;  5KE3 A;  4RTT A;  1SEM A;  4NL2 A;  1D1C A;  1NG2 A;  4ESR A;  1YHQ Q;  2PNI A;  2J6F A;  2C06 A;  3MPU B;  1YIT A;  4PK4 A;  2NYS A;  2MPX C;  1K9M U;  3M58 A;  1Q81 U;  1OPL A;  3OS1 A;  5IXB A;  4M7A D;  1S72 Q;  3A1P A;  3P8B B;  4R55 A;  1MV3 A;  3JB9 J;  3CCR Q;  2P0Q A;  1M90 R;  1U5S A;  3C4S A;  2XKO C;  2FO0 A;  1IRX A;  4MZP A;  1YJW Q;  3VS3 A;  2QQB A;  3REA B;  3O5Z A;  1Y96 B;  2RM4 A;  4ORZ A;  1X6O A;  4J7F A;  3A8G B;  2ZPF B;  3I35 A;  5CKH A;  4XQ3 A;  2FEI A;  2YUQ A;  3CCU T;  3CC4 Q;  3ZFJ A;  2ZCF B;  5GAN h;  1WHH A;  2H3E B;  1MMD A;  3FJP A;  4RG2 A;  4XTU A;  2P0K A;  4M78 E;  2CSI A;  3DLL A;  3JCM f;  2V1R A;  3A98 A;  5IXF A;  1K9M R;  2QGF B;  3PGG A;  1WQ7 A;  1Q81 R;  2QEX T;  1MGQ A;  1G3Y A;  4QW2 A;  1H8K A;  3OW2 A;  1KJW A;  5LJ5 d;  2YXY A;  4EDU A;  3BY7 A;  3OYI A;  4NS5 A;  3DB3 A;  4XU3 A;  1P92 A;  2PVD B;  4LDU A;  1RAD B;  1TUC A;  2ZPG B;  1FWZ A;  4LUE A;  2M51 A;  2QYZ A;  2YDL A;  3I55 Q;  2M1H A;  2EGC A;  3V8J A;  3S6W A;  2OI3 A;  2ENM A;  5I11 A;  1OQK A;  4FYV B;  1KD1 C;  1AD5 A;  1JU5 C;  3QYG B;  4FYX B;  1VQM Q;  1M3A A;  3EGD A;  1YIT T;  1VQL A;  2DKG A;  3CEY A;  2EQJ A;  2G6F X;  3MO8 A;  2DBM A;  3M53 A;  4J9B A;  4OMO A;  2EIF A;  5CKD A;  1WIE A;  3EG9 B;  2CUD A;  4JRP A;  3FJ5 A;  3ZBD A;  1RAC B;  1RAF B;  1MMG A;  2QQ9 A;  1K73 U;  2C0I A;  1M27 C;  5D7U A;  2F69 A;  1TWB A;  3LH5 A;  2FZG B;  1X01 A;  1K4U S;  5GAM d;  4M78 C;  2RI2 A;  4E7L A;  1X75 C;  4FW1 A;  1RL2 A;  2A37 A;  2COY A;  5AYF A;  4L59 A;  4C92 F;  4HVU A;  2W0Z A;  1Y96 A;  2ZPH B;  3OS0 A;  2WSC E;  2YUO A;  1N5Z A;  2RJE A;  4HA8 A;  2LTO A;  4IKF A;  2F2X A;  5DY9 A;  4ZGD B;  2NLU A;  1RAB B;  1YJN Q;  2CP2 A;  4JDS A;  3VS1 A;  4IIO A;  1X69 A;  1TS9 A;  3BW1 A;  3UAT A;  1IRE B;  1H92 A;  2P4R A;  3JCM X;  2G3R A;  5FRM A;  1TH7 A;  1TOV A;  2X4J A;  4M75 B;  2WAC A;  1WNL A;  1KQS S;  1N9R A;  2K3B A;  2E65 A;  4MDX A;  3QYH B;  1Z9Q A;  3L42 A;  5C0M A;  1K73 R;  3MP1 A;  4XAX B;  3CC2 A;  1M30 A;  2K3Y A;  2YSQ A;  4PFZ A;  5J26 A;  2DL4 A;  2HDA A;  2AIR B;  5FWC A;  3CMA Q;  1G83 A;  2DPP B;  2VGM A;  4KT0 E;  1G2B A;  4C5G A;  3WVE B;  4M78 G;  4KH0 B;  4BY6 B;  2DTO A;  2A7Y A;  2CZ6 B;  1VQL T;  4XU1 A;  2LQ8 A;  2QQR A;  3OYB A;  2AT1 B;  3JCM J;  4BD3 A;  3CXC P;  3PMT A;  1CSK A;  2L5Q A;  3J80 E;  4OB3 B;  2CYZ B;  5D6X A;  3OSV A;  3V7C A;  4R0K A;  1JXM A;  2RMO A;  3OYK A;  3CD6 T;  1MHN A;  2DLP A;  5L8R E;  1OYX A;  3PVL A;  1PD1 A;  4ZTJ A;  3M56 A;  2RQV A;  2DTI A;  3M0S A;  1C6V X;  1R8O B;  1WHL A;  2K5F A;  2L3S A;  4E7K A;  4BDY A;  4PJJ A;  3TRE A;  2OTL A;  3I56 A;  3QJY A;  3EG9 A;  1G3W A;  1T3L A;  2QDY B;  2JS0 A;  3QHS A;  4L5G A;  3L2V A;  1N8R C;  2HKN A;  4QT7 A;  5CR2 A;  4WF2 A;  3CBM A;  2O31 A;  2DXT A;  1M1K C;  2YRV A;  4C8Q F;  1PD0 A;  1QVG S;  4C5E A;  2I2L A;  1ZBX A;  5A2Q E;  2DYB A;  4M7D D;  3MKD A;  2EPD A;  5CCA A;  4C0D B;  2VB6 A;  1TG0 A;  1E6H A;  3T9N A;  1YIJ Q;  5LJ3 g;  4HXJ A;  4EMH A;  2X4W A;  3SWN B;  2SEM A;  2CP6 A;  1AHJ B;  3OB9 A;  4M75 C;  3PIO A;  3DLM A;  2RN8 A;  3CC2 T;  3OQ5 A;  3L2Z A;  2KT1 A;  3LLR A;  2LJ1 A;  1EFN A;  4M75 A;  2OAU A;  3RER A;  1D0Z A;  1T0J A;  2HCK A;  1RLQ C;  3LH0 A;  2EYX A;  2L3P A;  2HSP A;  5A0L A;  2DF6 A;  3M0P A;  4QQ6 A;  1VQP Q;  4JPB W;  2DL7 A;  2HQE A;  1X43 A;  3M0R A;  5GJV B;  1FX7 A;  5J39 A;  2JUF A;  4LXC A;  1YBY A;  1V29 B;  2JN0 A;  4X1V A;  4AG2 C;  1I81 A;  4C5H A;  3J7A F;  5GAN d;  1UGS B;  2ECZ A;  4PJL A;  1VQK Q;  2MI6 A;  4FW2 A;  1JBM A;  1IGQ A;  2RNA A;  1D0Y A;  1PM3 A;  4EMK B;  1KQ2 A;  2D9T A;  2GNC A;  2D8J A;  2LQN A;  3SEM A;  1YJ9 Q;  2OTL T;  2M0Y A;  3I56 T;  2MOX A;  2MWP A;  2EW3 A;  4JRI A;  2E10 A;  1YCY A;  4M75 G;  2DIQ A;  4LDV A;  3EGU A;  2XDP A;  1KIK A;  1GCQ C;  2GFA A;  1SKU B;  4C5I A;  1VQ9 Q;  4RMO A;  2X51 A;  3L2Q A;  1M90 C;  2YT6 A;  2HQX A;  1E7O A;  5GMK h;  4A53 A;  1Q95 G;  5HK3 A;  5LL6 S;  2XG8 D;  1VQN Q;  1UUE A;  3BDU A;  3JSC A;  1J3T A;  3QO3 A;  2EYQ A;  1LPL A;  2E12 A;  2JT4 A;  4PLI A;  1ZHI A;  1KD1 U;  4PJO B;  2L89 A;  2JMA A;  2E3I A;  2EJF A;  4WTO B;  1VYT A;  1HK9 A;  3G1J A;  3CBP A;  2O9S A;  5CO7 A;  1Q81 C;  3TU4 K;  2IVW A;  2LX9 A;  4M7A E;  3SWN A;  2RJC A;  3VS2 A;  4LN2 A;  1EZZ B;  3G71 A;  2QG9 B;  3E2U A;  5LJ3 h;  1NLP C;  1FYN A;  1MMN A;  4PLL A;  2CP5 A;  4M77 D;  1QVG P;  4LD9 K;  2NUT B;  1OZ2 A;  2ZPI B;  2CZ0 B;  3S3O A;  4RUG A;  4CI0 C;  4C92 E;  2PQW A;  3CPW A;  1ZUK A;  3CME A;  4M78 F;  1BI3 A;  2LNH B;  3M0Q A;  3VU3 C;  2C0O A;  1T3S A;  2JOY A;  3NTH A;  2DEQ A;  1AT1 B;  4EMK C;  2ABL A;  5GAN 3;  2J06 A;  1ABO A;  5HK0 A;  4MZT A;  4EMK A;  2E41 A;  4MMK A;  2K79 A;  5KYX B;  2LCS A;  3QSU A;  2QK0 A;  1YWP A;  1NM7 A;  2DRK A;  1WDX A;  1AWW A;  1W4S A;  3MJX A;  4JJC A;  2FHD A;  3A5Z B;  2CH4 A;  4XTY A;  3JCM g;  1KHI A;  3P8H A;  1OI1 A;  4KUL A;  4OMF B;  2EWN A;  4BE0 A;  2D8H A;  4ZN3 A;  1YNZ A;  4M7A C;  1G5V A;  2GFU A;  2K5I A;  2DEU A;  1PCX A;  4VUB A;  3VS4 A;  1R77 A;  3JB9 H;  1U1S A;  3RES A;  1ZSZ B;  4PJO A;  1PRM C;  2V8I A;  3G71 T;  3VKI A;  3RKW A;  3KFV A;  2QQS A;  1EX4 A;  3MEW A;  4C8Q B;  2RHX A;  1H3H A;  4ZGE B;  1QVF A;  1UGV A;  4C92 C;  1K73 C;  2R57 A;  3CCQ A;  2QTV A;  2DD4 A;  1WHM A;  1XOV A;  2NUP B;  3MEV A;  3OW2 P;  2XMF A;  4Z89 A;  1X2Q A;  3CME T;  4C8Q E;  1M1K U;  1W70 A;  1MNE A;  3OYY A;  1WYX A;  2V26 A;  2NUT A;  2DFU A;  3CCV Q;  3CCM T;  1KQS A;  3Q1J A;  1M5Q 1;  2DK3 A;  2OTJ A;  4A4F A;  4OVA A;  4M7A G;  4QQD A;  2HD0 A;  2D0Q B;  2DE0 X;  4FSS A;  4X9C A;  1K76 A;  1EIF A;  1VQL Q;  4X9D A;  1N6A A;  1ZX6 A;  3X20 B;  2JXB A;  1IB8 A;  2FL7 A;  1DJ7 B;  3L2U A;  2QXF A;  1U3O A;  3CD6 Q;  4NL3 A;  4OGE A;  3QZ9 B;  4CC2 A;  2VXF A;  4C92 G;  2E4H A;  5KYX A;  4AT1 B;  2KRS A;  1IHW A;  4WCI A;  2KXC A;  1M1K R;  1PRL C;  2KSS A;  4A4K A;  3FB9 A;  4FM4 B;  4O6J A;  3R6O A;  3SB2 A;  1VQ8 A;  2GTJ A;  1BKB A;  5GJW B;  2V8J A;  1SF9 A;  1SSF A;  2J6O A;  4LUD A;  1G8X A;  3ME9 A;  3TSZ A;  1M8M A;  3CBO A;  1NYF A;  2JM8 A;  1X6G A;  3QDR B;  1YCS B;  4R56 A;  2FPE A;  2RHU A;  2EQU A;  1Q82 U;  1UE9 A;  5GMK e;  4OB1 B;  3JCM h;  1RAG B;  3CCQ T;  1M3C A;  2K6D A;  3V7S A;  1ZSZ A;  4C8Q C;  2KDS A;  1LNX A;  4TVR A;  2V1Q A;  2DNU A;  5CKE A;  5GAM j;  4DEY A;  2VKN A;  3A8O B;  4HT8 A;  1M1F A;  4C8Q A;  5DLO A;  2DL3 A;  3CC2 Q;  3MCA B;  1XJW B;  1M90 U;  2NUP A;  1GCP A;  2RJD A;  2BZY A;  2COW A;  1WXT A;  1HSQ A;  2OTJ T;  1VQ5 A;  4M7D E;  4DBF A;  2EYW A;  3H0I A;  1Y7X A;  4OMM A;  1Q82 R;  5I22 A;  4OB2 B;  2X9H A;  2JZ2 A;  1BI0 A;  1PSE A;  3TVT A;  5M9O A;  2KGT A;  2MWO A;  2B8A A;  5KYW B;  1UEC A;  3NTK A;  4PFP A;  4OMQ A;  5CKB A;  2DO3 A;  2QTX A;  1WJQ A;  1U1T A;  4C8Q G;  2OTL Q;  3QXE B;  3I56 Q;  1ZQ1 A;  1BYM A;  3WVD B;  5LJ5 e;  4DOW A;  4M78 B;  5LJ3 d;  4PNO A;  3EGX B;  4A4H A;  3RMS A;  2DRM A;  3V8L A;  3QWY A;  4JZ4 A;  3QWX X;  3EG0 A;  5CKF A;  1MMA A;  4IUV A;  4FT4 A;  3OA6 A;  3CC7 Q;  4KBM B;  1X27 A;  2DIL A;  4PJO D;  3OYC A;  2R5M A;  3G4S A;  2EBP A;  2ZPE B;  2MAM A;  2GQI A;  2VGN A;  2Y90 A;  4IUR A;  3CQT A;  3FEO A;  1BB9 A;  1M3B A;  3VS0 A;  1D1A A;  3JCM c;  1FMW A;  3CPW S;  3MET A;  1YWO A;  1OU9 A;  5CK9 A;  3AHU A;  2F5K A;  1NJI U;  1U06 A;  4M7D C;  2YRC A;  4J9I A;  3CCS A;  2F2W A;  3M57 A;  3IQL A;  3SD4 A;  1WHG A;  5D6W A;  5GAO q;  2BKD N;  2LCC A;  1VQ5 T;  2LRQ A;  2O88 A;  1VQ7 T;  2CKK A;  2K2V A;  3J81 E;  3M4G A;  3OBY A;  1JJ2 S;  4ATO A;  1PHT A;  5GAM e;  5GAO m;  2ZAE A;  3LWI A;  2PUO B;  1RI0 A;  2ESW A;  1BI2 A;  1ZSG A;  2XK0 A;  4GBQ A;  3I9Q A;  4M7A F;  3CCE A;  1NJI R;  4F04 B;  5FLX E;  1BK2 A;  2JS2 A;  3M54 A;  1W2B S;  2RHZ A;  4LDW A;  2BIV A;  2L3Q A;  1KC8 R;  2E5K A;  4D8D A;  4OP0 A;  1QWE A;  2LT1 A;  4EIK A;  5KYW A;  4QKU A;  3FC3 A;  1UFF A;  4M7D G;  4EMG A;  5GAO r;  2EQM A;  2HL5 C;  2VC8 A;  2CSQ A;  3GBQ A;  1QVF S;  2OAW A;  2KT8 A;  4M78 A;  2LJ3 A;  2P4T A;  3EGX A;  3G4S T;  5GAN j;  5FU6 B;  4IIM A;  1V1C A;  4AFS C;  1RLP C;  3JCM P;  4RTX A;  3CCJ Q;  1QW1 A;  3EHR A;  1YP5 A;  3GLX A;  4JZ3 A;  1VYV A;  4J8O A;  3CCS T;  3S3N A;  3QDF A;  4FU6 A;  1VUB A;  4YTL A;  2KAF A;  2YRD A;  3OYF A;  3OYD A;  3JB9 I;  3A8M B;  5GMK l;  1X6B A;  5I21 A;  1MV0 B;  1GBR A;  1NYG A;  4GLM A;  1R0C B;  1JO8 A;  4KGZ B;  1WI7 A;  3JCM e;  1OU8 A;  1IO6 A;  1UJY A;  3VJP A;  2XD0 A;  3QUI A;  2JW4 A;  4D8K A;  2L0A A;  4J9G A;  3G6E A;  2RI3 A;  1JEG A;  3CCE T;  1UEB A;  2FZC B;  2L8D A;  1Q86 C;  3GIB A;  3X26 B;  1TXQ A;  1ZA2 B;  2EAY A;  3CPW P;  3CCM Q;  1LCK A;  2KVQ G;  3OMC A;  1OEB A;  2E1H A;  2KYB A;  1UTI A;  3JCM d;  1VQ6 Q;  4RTY A;  2E64 A;  2DZC A;  4RTU A;  4KH1 B;  1PG5 B;  2K2M A;  1YHQ A;  2DXC A;  2QDL A;  4E2F B;  4FYW B;  3MEU A;  2DET A;  4AFU C;  3KUF A;  1JRI A;  2KYM A;  2CT3 A;  4OMN A;  4A54 A;  2XIC A;  3FDR A;  1S72 A;  4IUQ A;  2XHC A;  4HCK A;  4BB7 A;  1KG1 A;  5FU6 C;  2DER A;  1BIB A;  4CC7 A;  1WHK A;  2BUD A;  1YJW A;  4QVC A;  3LGF A;  1OV3 A;  3HRT A;  3VS5 A;  1YI2 A;  4JLI A;  2M16 A;  2RA2 A;  4F7U F;  2ED0 A;  3FRN A;  1AVZ C;  1AOJ A;  3ASK A;  2WSE E;  1KSW A;  1D1B A;  1RI9 A;  3CC4 A;  2QGG A;  4Z88 A;  4KGV B;  1BI1 A;  1VQ4 Q;  4ELZ C;  5FRN A;  3A8H B;  2LZ6 B;  2PU9 B;  5GAN e;  1WXB A;  3M4Y A;  3M55 A;  4Q5W A;  1VIF A;  3CCQ Q;  2EJ9 A;  2F1L A;  2DL8 A;  3QJ6 A;  3HFN A;  2JTE A;  2AZS A;  4O5V A;  5FW9 A;  1NEG A;  5KYU B;  4A4G A;  3C12 A;  4CC4 B;  1QVF P;  1HJD A;  4FCY A;  2NWM A;  3G6E T;  4C0Z A;  2BE7 D;  2KI7 A;  2KBT A;  2B86 A;  4HT9 A;  3EFS A;  1Q82 C;  3L2R A;  2OTJ Q;  3I55 A;  2DX1 A;  3CCL A;  1QKW A;  3JAM E;  1KQS P;  1UGP B;  6AT1 B;  4XTZ A;  3REB B;  3VS7 A;  3L2W A;  4LNP A;  1W1F A;  3UT1 A;  3OYM A;  1MUZ A;  3HHT B;  1VQM A;  1H3Z A;  1M2O A;  1Y57 A;  4XTW A;  5GMK i;  4J9C A;  3E9G A;  3PT9 A;  2GF7 A;  2HQH A;  3HP9 A;  3X28 B;  4QVZ A;  3OS5 A;  1S72 T;  1QP3 A;  3TEE A;  1GCQ A;  1JXO A;  4FYY B;  2QQA A;  5GAO p;  2XID A;  4M7D F;  4CRI A;  2M02 A;  1YI2 T;  4KRT A;  4M7A B;  4LE9 A;  1QCF A;  1SPK A;  2CP0 A;  2A3L A;  4E7Z A;  2O9V A;  3HRS A;  3JB9 D;  2FRY A;  4RTW A;  2VWF A;  2KRO A;  3CCU Q;  4Z8A A;  3D7S B;  4KGX B;  2J05 A;  2IG0 A;  1AZE A;  4DBR A;  1WZO A;  4A4E A;  1ZLM A;  2DIG A;  3BFM A;  3LW5 E;  3OYG A;  2FVU A;  2O01 E;  4AMC A;  1YJN A;  1I8F A;  1UJ0 A;  4C92 B;  2QEX Q;  1SG5 A;  1K0X A;  4XU2 A;  1QCN A;  2CT4 A;  1AZG B;  2R58 A;  1ABQ A;  4UC4 A;  3R6N A;  2H8H A;  3QPH A;  2P84 A;  5KYU A;  2C0T A;  1VQ5 Q;  1UHC A;  3I55 T;  1ZUU A;  3EHQ A;  1VQ7 Q;  3CCL T;  4HCB A;  4B6M A;  3CMA A;  1KK7 A;  2CUB A;  1VQM T;  4XK8 E;  5GAO l;  4E7H A;  4D6W A;  1B34 B;  1M1G A;  2A36 A;  1NJI C;  1N27 A;  1YIT Q;  2RQT A;  2R5A A;  2E6Z A;  4E7J A;  3GNF B;  1KC8 C;  2FG0 A;  1JJ2 A;  3TSW A;  2OX7 A;  3JCM W;  3NPF A;  1QWF A;  1WGS A;  1XNI A;  2KY9 A;  2PUK B;  2Y4Y A;  3VV0 A;  2MMP A;  2A0F B;  3M0U A;  4FT2 A;  2FRW A;  5FWB A;  5GMK j;  5IHN A;  4RG8 A;  2HNI A;  4BAC A;  1PWT A;  4HKE A;  2RF0 A;  1K8A C;  2RD1 A;  1W2B A;  1WA7 A;  1NZ9 A;  2VUB A;  2HKQ B;  3RKY A;  4K11 A;  4M7A A;  1FMK A;  2LCL A;  4DQ2 A;  1Q86 U;  4LDY A;  2RI5 A;  4M75 D;  3UA7 A;  4BE1 A;  2X35 A;  1AWO A;  1WLP B;  4BI4 A;  5I2S A;  3F70 A;  1YIJ A;  2RH2 A;  5LJ3 j;  1O75 A;  4M77 F;  3UWN A;  2LDM A;  3OYL A;  4C92 A;  5J3B A;  2X3X D;  2GGR A;  4P5N A;  2D1X A;  2YUN A;  4F7U B;  1FMV A;  2DXU A;  1YN8 A;  3X25 B;  3CMA T;  3JV3 A;  1WX6 A;  1PC0 A;  2JJ9 A;  2CZ7 B;  4J6W A;  5D6Y A;  1VQP A;  2J6K A;  5LJ5 j;  1Q86 R;  3QII A;  4F7U E;  3M0T A;  1PNJ A;  2EGE A;  4E7S A;  2CGH A;  3H8Z A;  4X34 A;  2PTK A;  1M4Z A;  5IN1 A;  2LMJ A;  5A0D A;  3C0C A;  4V2S A;  1B34 A;  3BDL A;  1TU0 B;  4OB0 B;  1VQK A;  5EC7 A;  5AT1 B;  3V7R A;  4PJN A;  3LGL A;  3OYH A;  1YJ9 A;  3LWH A;  2O4X B;  1VQ9 A;  3MEA A;  2XDB A;  2HBW A;  3EG1 A;  4II1 A;  1JQQ A;  2DYI A;  2E70 A;  2YLB A;  3PE0 A;  1VQN A;  5GAN 8;  1YIJ T;  2YHT A;  3KXT A;  4N4I A;  3VYH B;  4RKU E;  3BE3 A;  1AWX A;  3PTA A;  2HAX A;  4M7D B;  2KRM A;  1VQO A;  4IUU A;  5FU7 C;  4KUD K;  1HD3 A;  1MND A;  2I0N A;  4JLG A;  3HSB A;  4OGC A;  2OJ2 A;  2MCN A;  3A8L B;  4ANJ A;  2SRC A;  2DAQ A;  2LVM A;  4HCC A;  2KRN A;  2DL5 A;  1VQP T;  3GNG A;  2JTF A;  1E6G A;  4F7U A;  3WXM B;  4J6Y A;  5LJ3 e;  2DTH A;  2JMC A;  2ROL A;  4BUG A;  8ATC B;  1CKB A;  3H9N A; 
#chains in the Genus database with same CATH homology
 4X1V A;  4AG2 C;  4J9D A;  3EHR A;  1YP5 A;  4JZ3 A;  1VYV A;  2ECZ A;  1GBQ A;  2DM1 A;  2RNA A;  2GNC A;  2D8J A;  2LQN A;  3SEM A;  2M0Y A;  2MOX A;  2HEQ A;  2J7I A;  3NGP A;  2EW3 A;  4ZNX A;  1X6B A;  1PKS A;  1MV0 B;  1GBR A;  3EGU A;  1NYG A;  2AK5 A;  4GLM A;  4J9H A;  5L23 A;  1KIK A;  1GCQ C;  1AWJ A;  1JO8 A;  4AFZ C;  2ROT A;  1AEY A;  1QLY A;  1WI7 A;  2YT6 A;  2ED1 A;  1E7O A;  1IO6 A;  1UJY A;  3UF4 A;  2L2P A;  2JW4 A;  1UUE A;  4D8K A;  2L0A A;  4J9G A;  1J3T A;  2KXD A;  1JEG A;  4CC3 A;  4F14 A;  3VS6 A;  2JT4 A;  3VRY A;  1UHF A;  1B07 A;  2JMA A;  2CH4 W;  1VYT A;  1LCK A;  2DJQ A;  1ZUY A;  1GFD A;  3NHN A;  2O9S A;  2BTT A;  1OEB A;  2KYB A;  1UTI A;  4RTZ A;  1K0S A;  1K9A A;  4RTY A;  4RTU A;  2K2M A;  1BBZ A;  1I0C A;  3VS2 A;  2QDL A;  4LN2 A;  1QKX A;  4AFU C;  1OPK A;  1NLP C;  1FYN A;  2KYM A;  2CT3 A;  4OMN A;  4DEX A;  1VYU A;  3UA6 A;  4HCK A;  2BZ8 A;  4RUG A;  4CC7 A;  1OV3 A;  1ZUK A;  3VS5 A;  1VA7 A;  2ED0 A;  4OML A;  1AVZ C;  1ZBJ A;  1AOJ A;  2LNH B;  3M0Q A;  1KSW A;  2C0O A;  4JJB A;  1RI9 A;  2YUP A;  1T3S A;  2LP5 A;  4Z88 A;  3ZL7 C;  2ABL A;  2J06 A;  1ABO A;  2LZ6 B;  2KNB B;  1WXB A;  2LJ0 A;  1B3Q A;  1KFZ A;  3I5R A;  2F2V A;  2K79 A;  2DL8 A;  2LCS A;  2JTE A;  2AZS A;  4AFQ C;  5FW9 A;  1NEG A;  1YWP A;  1NM7 A;  5IHI A;  2DRK A;  1SRL A;  1WDX A;  2CDT A;  4CC4 B;  5ECA A;  1AWW A;  1HJD A;  4JJC A;  2CH4 A;  2NWM A;  2DMO A;  2IIM A;  2KBT A;  2D8H A;  1YNZ A;  2B86 A;  5IHK A;  4A63 B;  2LQW A;  2DA9 A;  3VS4 A;  4Y92 A;  1SHG A;  2DX1 A;  1QKW A;  4RTT A;  1SEM A;  3H41 A;  1X2K A;  1NG2 A;  3EG2 A;  4ESR A;  3REB B;  1NLO C;  3VS7 A;  4RTV A;  4LNP A;  1W1F A;  2PNI A;  1PRM C;  2J6F A;  1K1Z A;  1MUZ A;  3KFV A;  2K7A A;  1Y57 A;  2GBQ A;  4J9C A;  1H3H A;  1GL5 A;  1GRI A;  1UGV A;  1OPL A;  5IXB A;  3ULR B;  1GCQ A;  1RUW A;  1XOV A;  1JXO A;  1MV3 A;  2XMF A;  4Z89 A;  1U5S A;  2FO0 A;  2MIO A;  3VS3 A;  1X2Q A;  4KRT A;  3THK A;  3REA B;  1W70 A;  3H0H A;  1T0H A;  1QCF A;  3O5Z A;  4LE9 A;  4ORZ A;  1WYX A;  1SPK A;  1GFC A;  3I35 A;  2O9V A;  2FRY A;  4RTW A;  2FEI A;  2EKH A;  2YUQ A;  1UDL A;  2VWF A;  2KRO A;  4Z8A A;  2DE0 X;  4FSS A;  2J05 A;  3VRZ A;  1AZE A;  1K76 A;  1ZLM A;  2CSI A;  1UG1 A;  1ZX6 A;  2AKL A;  2V1R A;  3A98 A;  5IXF A;  2VVK A;  2JXB A;  4M4Z A;  1UJ0 A;  1H8K A;  1U3O A;  1KJW A;  1K0X A;  3PVQ A;  2CT4 A;  2CRE A;  1AZG B;  4CC2 A;  1NEB A;  3NMZ C;  1ABQ A;  2KRS A;  4WCI A;  3R6N A;  2KXC A;  3U23 A;  2H8H A;  1PRL C;  3SHW A;  1TUC A;  2KEA A;  1SRM A;  2C0T A;  2GTJ A;  3H0F A;  5GJW B;  4LUE A;  1UHC A;  2M51 A;  2YDL A;  2EGC A;  1ZUU A;  3EHQ A;  2J6O A;  4LUD A;  2W10 A;  3TSZ A;  1M8M A;  2OI3 A;  1NYF A;  2ENM A;  2JM8 A;  5I11 A;  1X6G A;  2CUB A;  2NUZ A;  1YCS B;  3I5S A;  1AD5 A;  2X3W D;  4F17 A;  1JU5 C;  2FPE A;  1M3A A;  2A36 A;  2RQT A;  2DVJ A;  1UE9 A;  1M3C A;  2K6D A;  2A28 A;  2G6F X;  2DBM A;  2FG0 A;  3TSW A;  3NPF A;  1QWF A;  4J9B A;  4OMO A;  3RBB B;  2V1Q A;  1WIE A;  2DNU A;  2PZ1 A;  4DEY A;  2CUD A;  2VKN A;  3FJ5 A;  3M0U A;  2FRW A;  5FWB A;  2DL3 A;  5IHN A;  2C0I A;  1TUD A;  2AZV A;  1M27 C;  2GTO A;  1GCP A;  2KR3 A;  3LH5 A;  2BZY A;  1K4U S;  1WXT A;  1PWT A;  1SSH A;  1HSQ A;  2RF0 A;  2A37 A;  2EYY A;  2EYW A;  1OOT A;  3H0I A;  1WA7 A;  4HVU A;  4K11 A;  4HVW A;  2JM9 A;  2W0Z A;  2EQI A;  2YUO A;  1N5Z A;  4E6R A;  4OMM A;  1FMK A;  5I22 A;  2F2X A;  4HVV A;  2KE9 A;  3UA7 A;  2LX7 A;  3TVT A;  1AWO A;  3VS1 A;  1WLP B;  1X69 A;  4IIO A;  1Z9Z A;  2KGT A;  3UAT A;  2FPF A;  2K9G A;  1H92 A;  2A08 A;  2P4R A;  5HCK A;  1I07 A;  1UEC A;  2K3B A;  4OMQ A;  1Z9Q A;  2X3X D;  2GGR A;  1M30 A;  2D1X A;  2YUN A;  2YSQ A;  2DL4 A;  2HDA A;  1SHF A;  1YN8 A;  2DRM A;  5FWC A;  1G83 A;  3QWY A;  4JZ4 A;  3JV3 A;  1WX6 A;  1G2B A;  3QWX X;  3EG0 A;  2EYZ A;  1X27 A;  2J6K A;  2DIL A;  2RQW A;  3M0T A;  1PNJ A;  2EBP A;  1CSK A;  2D0N A;  2EGE A;  4J9E A;  2GQI A;  2PTK A;  3CQT A;  1BB9 A;  1I1J A;  1M3B A;  3VS0 A;  1W6X A;  2FPD A;  4F16 A;  4R0K A;  1JXM A;  2RMO A;  1CKA A;  1YWO A;  2LMJ A;  3C0C A;  3RNJ A;  2DLP A;  1U06 A;  4OMP A;  3PVL A;  5EC7 A;  2EVR A;  2RQV A;  3M0S A;  4J9I A;  2F2W A;  1A0N B;  3IQL A;  2L3S A;  1Y0M A;  1T3L A;  1ARK A;  2JS0 A;  5IH2 A;  2O88 A;  4QT7 A;  2O31 A;  2EGA A;  1WFW A;  2HBW A;  4J9F A;  4JJD A;  3EG1 A;  1PHT A;  2O2O A;  4AG1 C;  1JQQ A;  2DYB A;  3PE0 A;  2AKK A;  2EPD A;  2RQU A;  1TG0 A;  1E6H A;  2ESW A;  1ZSG A;  4HXJ A;  4GBQ A;  3I9Q A;  2SEM A;  1BK2 A;  1AWX A;  2JS2 A;  2KRM A;  1PKT A;  2L3Q A;  2RN8 A;  2E5K A;  2KT1 A;  4D8D A;  1QWE A;  2LJ1 A;  2RPN A;  1HD3 A;  2I0N A;  4EIK A;  1EFN A;  2RQR A;  1T0J A;  2HCK A;  1UFF A;  1RLQ C;  2OJ2 A;  2MCN A;  2SRC A;  2EYX A;  2L3P A;  2HSP A;  2DF6 A;  2KRN A;  2DL5 A;  2CSQ A;  3M0P A;  2BZX A;  3GBQ A;  1E6G A;  2OAW A;  2DBK A;  2KT8 A;  4JPB W;  2DL7 A;  1X43 A;  2LJ3 A;  1BU1 A;  1S1N A;  4IIM A;  1V1C A;  3M0R A;  4AFS C;  5GJV B;  2JMC A;  2ROL A;  1RLP C;  3EG3 A;  1WXU A;  1CKB A;  4RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...