1JO8A

Structural analysis of the yeast actin binding protein abp1 sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN BINDING PROTEIN
publication title Unusual binding properties of the SH3 domain of the yeast actin-binding protein Abp1: structural and functional analysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jo8A00
3I35A 2EVRA 2EPDA 1JO8A 2X3XD 2HBWA 2EGAA 2YSQA 1FMKA 3A98A 2YUQA 3EHRA 3UATA 4QT7A 1EFNA 1T0HA 2BZXA 2O9VA 1UDLA 2CH4A 2DL8A 2FRYA 4OMQA 1IO6A 1PKTA 2EW3A 2DMOA 4HVUA 3VS6A 4Z89A 2J05A 4RTWA 1GRIA 1QWFA 1PRMC 1H3HA 1SEMA 2V1RA 2LQWA 4AFQC 3EGUA 1OPKA 1E6HA 1RI9A 2JM8A 1OOTA 3RNJA 2NWMA 2ESWA 4KRTA 1QWEA 2KROA 2ABLA 5GJWB 2C0TA 4J9BA 2DF6A 1JU5C 3M0SA 2KXCA 1ZLMA 1GBQA 5FWBA 2L2PA 4Z8AA 2QDLA 1JEGA 4F17A 2DE0X 1J3TA 1X69A 1QLYA 5IHKA 1K9AA 1GL5A 3I5SA 2EYYA 4HVWA 4CC3A 3FJ5A 2FG0A 1RUWA 2ECZA 1ZUUA 3VRZA 2L3QA 3VS4A 1MV0B 1SSHA 1ZSGA 1AOJA 5FWCA 2CUBA 2JW4A 2CSQA 1AVZC 2DVJA 2AZSA 3M0PA 1X43A 2OI3A 4LNPA 2RQRA 1V1CA 1TUCA 2MOXA 2L3SA 1CSKA 2HSPA 1AEYA 4JZ3A 1WYXA 1UECA 2W0ZA 4CC4B 1YWPA 1GFDA 1ARKA 2DL5A 2X3WD 3VS0A 2CREA 2LZ6B 1SHGA 3I5RA 1H8KA 1M3AA 1HSQA 2DA9A 2BTTA 2CSIA 2I0NA 1B07A 2O2OA 3EG0A 2ROLA 1H92A 4GBQA 1VYTA 1WA7A 2EBPA 2LJ1A 2AK5A 2DBKA 1K76A 2ENMA 2MIOA 1E6GA 4JPBW 1ABOA 4AG1C 1GCPA 5HCKA 2JTEA 5I22A 1AZEA 1W70A 1BU1A 2GTOA 3NMZC 1A0NB 2J7IA 1TUDA 2LJ0A 4IIOA 2L3PA 3QWXX 2KXDA 1Y0MA 2PTKA 1N5ZA 2HDAA 2YUOA 4J9IA 3M0UA 2M51A 5IH2A 1WXBA 2DL7A 2KYMA 2KBTA 2KYBA 2M0YA 3UF4A 2LJ3A 4A63B 1UG1A 1RLQC 2DLPA 1PKSA 2JS2A 2FPDA 4RTTA 3M0QA 2GGRA 2JS0A 2LX7A 1VYUA 3VS3A 2A28A 4JJDA 4M4ZA 1K1ZA 1QCFA 2EGCA 5FW9A 1M3CA 2VKNA 1I1JA 1OV3A 4JJCA 4RTVA 1ZX6A 2K7AA 2AKLA 3UA7A 3REAB 2EYXA 1YN8A 2JT4A 3PVLA 4OMMA 3TSWA 2B86A 2H8HA 2RN8A 1ZUKA 5IHNA 1AD5A 1LCKA 2ED1A 2D1XA 1KFZA 1SRMA 2FRWA 1UE9A 1X2QA 1FYNA 5GJVB 1ZBJA 1ZUYA 3NGPA 5IXBA 2KRMA 3U23A 1NEGA 2DILA 1ABQA 2K2MA 4J9EA 3VS7A 1JXOA 1M8MA 1YCSB 2J6FA 2OJ2A 3EG3A 1X27A 1M30A 2EGEA 5L23A 2BZ8A 1T3SA 4OMOA 1QKXA 2YUPA 1OPLA 2LMJA 3QWYA 1AWWA 3GBQA 2DJQA 2IIMA 3THKA 2CH4W 2DBMA 2DX1A 4JJBA 1GCQC 2AKKA 1WLPB 3VRYA 2JMAA 1M3BA 1JXMA 4AG2C 2KEAA 1M27C 1X6BA 2YDLA 1KIKA 1UTIA 2EQIA 3PE0A 2RNAA 2NUZA 4CC2A 4WCIA 2V1QA 2J06A 1QKWA 2LCSA 1E7OA 2CDTA 4Y92A 2D8HA 3KFVA 2DNUA 1UJYA 2GTJA 3PVQA 2G6FX 2P4RA 4AFUC 4RTZA 2RQVA 3EHQA 3M0TA 2L0AA 2KE9A 2ROTA 2SRCA 3CQTA 4DEXA 3ZL7C 4ZNXA 2FPEA 2RMOA 1MV3A 2DRKA 2J6OA 2EYZA 4OMPA 5IXFA 2CUDA 2RQWA 1UUEA 2KNBB 2FPFA 3REBB 3VS2A 1GCQA 2D0NA 1W1FA 4HCKA 4OMNA 3C0CA 3SEMA 1K0XA 1G2BA 1NYGA 2CT4A 2DL4A 3M0RA 3SHWA 4RTUA 1WI7A 2F2WA 3H0HA 2C0OA 1G83A 4GLMA 1SPKA 3RBBB 1SHFA 1KSWA 2KRNA 3VS1A 1UFFA 4RTXA 4X1VA 1VYVA 2O9SA 4LN2A 2GBQA 1NYFA 2RQTA 4AFSC 4D8DA 1HD3A 2HEQA 1UJ0A 2E5KA 2O88A 4LUEA 4E6RA 2MCNA 1S1NA 3ULRB 2EKHA 4JZ4A 3TSZA 2K6DA 5IHIA 1NLPC 4RTYA 1CKBA 3H0FA 2F2XA 4D8KA 2GQIA 2DM1A 2CT3A 1GBRA 1UHCA 2YT6A 4RUGA 1SRLA 2JM9A 1NLOC 2D8JA 4R0KA 3VS5A 1KJWA 2K79A 3JV3A 1VA7A 4HXJA 2XMFA 2LQNA 2RQUA 4K11A 1AWOA 2KRSA 4Z88A 4ESRA 1AZGB 3R6NA 2LNHB 2GNCA 2JMCA 4J9CA 1WXTA 2PNIA 1T3LA 1BBZA 2A37A 1W6XA 4EIKA 1JQQA 2RPNA 1UHFA 4LE9A 5ECAA 2ED0A 1MUZA 2O31A 1TG0A 2LP5A 3EG2A 1WX6A 4IIMA 3NHNA 2DYBA 1X6GA 1BK2A 2A08A 1K0SA 1U06A 3I9QA 3IQLA 2BZYA 1BB9A 2W10A 3UA6A 3LH5A 1WXUA 1CKAA 1AWXA 1Z9ZA 1PWTA 2KR3A 2PZ1A 4J9DA 1B3QA 1Z9QA 3H0IA 2AZVA 1PRLC 5EC7A 2RF0A 2OAWA 4CC7A 4F14A 3H41A 5I11A 4J9FA 2VVKA 1OEBA 1NG2A 1YWOA 2HCKA 2YUNA 3O5ZA 1XOVA 3NPFA 1WFWA 2KT8A 2VWFA 2F2VA 2K3BA 1I0CA 1T0JA 2A36A 1PHTA 1YP5A 2DL3A 1U5SA 3EG1A 1WIEA 2SEMA 4OMLA 1U3OA 4LUDA 2EYWA 4FSSA 2J6KA 1UGVA 1NM7A 2JXBA 2FEIA 1PNJA 2K9GA 1AWJA 2FO0A 2KGTA 4DEYA 1K4US 4J9HA 1Y57A 2C0IA 2KT1A 2DRMA 1NEBA 1GFCA 4ORZA 3TVTA 1YNZA 4AFZC 1X2KA 4HVVA 4J9GA 4F16A 1I07A 1WDXA 1RLPC 1HJDA
chains in the Genus database with same CATH superfamily
3I35A 3G71A 3OY9A 3M59A 2X3XD 2HBWA 3QXEB 2HZYA 1UGQB 1WJRA 1VUBA 4M75C 4QT7A 1WHHA 5CCAA 1YITA 2HQHA 2BZXA 2EJFA 2R5AA 1PKTA 3CCUT 2C06A 4RTWA 2EQJA 4PJOC 1QWFA 1H3HA 4OF1A 2LQWA 1VQMT 1WHJA 2XD0A 2JM8A 2DO3A 1VQ4T 3I56Q 3CCEA 2ABLA 2D6FA 4J9BA 3I55Q 1JU5C 2KVQG 4M7AA 2EFIA 1GBQA 3JCMQ 4PFZA 1KHCA 4C92A 1JEGA 3QJYA 5LJ5g 4ZGJB 5IHKA 2X35A 4LDWA 5LJ5h 1KQSP 5LJ3g 1I5LA 3TEEA 5A0GA 1C1AA 1MMNA 5LJ3h 3L2UA 5FWCA 5GMKi 1KD1C 4BI8B 4O6JA 5HK0A 4MMLA 3OYFA 1YI2A 3M0PA 2QTVA 4HKEA 2ZGWA 1V1CA 1FX7A 2MOXA 3OSVA 2L3SA 2BUDA 1CSKA 1AEYA 3CC7Q 3OQ5A 1IB8A 5HK3A 5J3BA 3VYHB 5GAN8 2PVDB 3QZ9B 2W0ZA 2CP3A 4M7AE 3VS0A 2QQSA 4C92E 1SHGA 3I5RA 5DY9A 2L89A 2RI5A 3RR6A 1HSQA 2CSIA 1G8XA 4XTWA 1QVGA 2QQAA 3A8MB 1H92A 1R0BG 4QVZA 1YIJA 1K9MU 3CPWP 2HQEA 1X6OA 2MIOA 5DLQE 4E7ZA 4ZGDB 5EG2A 4JPBW 1ABOA 1GCPA 5KCHA 2HQXA 3NMZC 4OMFB 4C0FA 3UPUA 2LJ0A 1WGSA 3MEVA 2L3PA 5KCOA 1Y0MA 1N5ZA 3OW2P 5HKCA 1BCOA 1VQPA 1SKUB 3SB2A 6AT1B 2DL7A 2KYMA 2YLCA 2H3JA 1QP3A 2WSEE 1UG1A 2F69A 4B6MA 2DLPA 3JCMJ 4M78G 3A8LB 2K5FA 3CXCP 3M0QA 4B9WA 3CCJQ 1QVFA 3JCMX 5CK9A 3VS3A 1JJ2P 2K57A 2EGCA 7AT1B 2YWWA 1VQ9T 4MDWA 4RTVA 2K7AA 2JNGA 2AKLA 1ZQ1A 2ATCB 4BI4A 2DETA 1LJOA 4C8QB 4N4IA 3TSWA 1VQ6T 5L8RE 3CCUA 3OBYA 3A8HB 1R77A 5KH6A 4PNOA 2ED1A 3GP8A 3GF5A 1UE9A 5GJVB 1N8RC 1ZBJA 1VQMA 3NGPA 2CKKA 5IXBA 2M1HA 3U23A 1UB4A 3CCQT 1NZ9A 4J9EA 1JXOA 1M8MA 1M8VA 1YCSB 2QDYB 2O01E 2NUPB 4DBRA 2KK4A 1M30A 2LCLA 4E7IA 3OMCA 5L23A 1WHGA 2E10A 2YUPA 2M9UA 2R57A 1OPLA 1OX9A 4A4FA 4M7DB 3RESA 2IIMA 2VXFA 3CCRT 4JRPA 1RAIB 1GCQC 1WLPB 4LDYA 5KE2A 5J39A 3GNFB 4AG2C 2KEAA 1M27C 2LCCA 2YDLA 4RMOA 1KIKA 1UTIA 3PT9A 5LJ5j 4BE1A 3PE0A 1YJNT 3ER0A 1MHNA 3LH0A 2LCSA 1KQ2A 3RMQA 5LJ3j 5GAN7 3J7AF 2DNUA 2GTJA 2PVGB 1G3YA 4EMKC 2G6FX 2P4RA 3QYHB 3EHQA 1WQ7A 1RAHB 2KE9A 4M77G 2ZPIB 4M7DD 2PQWA 3ZL7C 2FPEA 3OYYA 2RMOA 2DRKA 2K5LA 2YRDA 4OMPA 5IXFA 3CCLA 3VS2A 1RAAB 2D0NA 1WHKA 1W1FA 4HCKA 3C0CA 4BB7A 3J81E 1K0XA 1G2BA 3JCMd 1NYGA 2K3YA 5A0LA 3SHWA 3UWNA 4RTUA 1QMCA 4XU2A 3H0HA 5GAMe 1TS9A 2PUKB 2G3RA 3EH2A 5I2MA 4RKUE 3GPLA 4LD6A 4X1VA 2QK0A 3OYGA 4DA4A 2M0OA 1MMAA 2K5IA 1QQJA 1ZSZB 1HD3A 2HEQA 3BDUA 1K9MC 2V8KA 2VV5A 4E6RA 2CP6A 2GCXA 2HL5C 3ULRB 3OA6A 3A5ZB 1NLPC 1CKBA 1Q81U 4OB3B 3EGXB 2YT6A 1SRLA 4DBHA 3MPUB 2K79A 1VA7A 1KK7A 2F1LA 1Q7YR 1MNDA 4EPCA 2RQUA 2QQBA 3G7ZA 4Z88A 1KQSS 1BIAA 1VQ6A 4M75B 1WXTA 5I21A 1O75A 1W6XA 4PJLA 3OYKA 2RPNA 4E7KA 1XNIA 4LE9A 4IUQA 1TG0A 1WX6A 5DM7R 2PVOB 4R55A 1K8AR 1OULA 1K0SA 4PJOB 4ELZC 3G4SQ 5GMKe 3CXCA 1BB9A 3LH5A 1B34A 4KBMB 3QJ6A 1CKAA 2RHZA 2V8IA 2NUTA 5LJ5d 1AWXA 2D0QB 3JSCA 4XU1A 4V2SA 2PZ1A 1W4SA 4E2FB 4J9DA 1Z9QA 2Y4XA 3X20B 3CMAT 1S72Q 2OAUA 1VQ8Q 3H0IA 2AZVA 3CBPA 5GAOp 1SG5A 3OS1A 4M75D 3CCRA 4CC7A 2E65A 2E3HA 5I11A 1FMWA 4HCCA 1YWOA 3CBMA 4LDXA 1U8RA 2HCKA 1UEBA 5GMKl 2DVEA 2ZPBB 1WFWA 2VWFA 5IT9E 2K3BA 1YJNA 4PJOD 3M58A 4MZTA 3M54A 2QI2A 4KULA 2EYWA 3META 2Z0WA 5CIUA 4XTYA 5GAOq 2RA2A 1PNJA 4M7DE 4BE2A 5I2SA 4DEYA 2ZPHB 4J9HA 1QCNA 5GAMf 2DD5A 4PJMA 2VGMA 2DRMA 1GFCA 4FYWB 1KD1R 4HVVA 2MYSA 1RI0A 3LYIA 3G71Q 2MPXC 2BIVA 3HSBA 4ZTFA 1PSEA 5HCKA 4EDUA 3BDLA 1JJ2S 5GAOm 3KBGA 1BYMA 5KE3A 2E6ZA 4JUVA 3A98A 2DL8A 4BI3A 1VQKT 4HCZA 4OMQA 3V7SA 1IO6A 1X01A 2EW3A 4HVUA 1V29B 2JZ2A 1G5VA 4XTVA 2J05A 5GAOr 1QVGP 5CKEA 5FU7C 1KG1A 4AFQC 4M7AB 2XK0A 3EH1A 3SD4A 1OOTA 2NWMA 4KRTA 1QWEA 2COZA 3M5AA 3JB9F 2DF6A 1M5Q1 3M0SA 4IUPA 1VQ5T 5GMKm 2NLUA 3MO8A 2K4YA 2DE0X 1NE8A 2E4HA 4M75A 2OX7A 2XDBA 4HVWA 2WACA 2LX9A 5FRNA 2ECZA 1YI2Q 2L3QA 2MF2A 2XKOC 1ZSGA 3TU4K 4JRKA 2CSQA 2OTLA 2PUOB 1ACMB 1X43A 4PJOA 2RK1A 1Q95G 1Q81C 5KYXB 1TUCA 1R0CB 1Y96B 2KI7A 1QVFP 1TUGB 2DTHA 4JZ3A 3JCMb 2E1HA 1UECA 1YWPA 3BW1A 5GAN5 4IUVA 2LZ6B 4NOYA 1H8KA 1YIJQ 1FXXA 2DA9A 2EJGA 4M75E 3CC4Q 2RK2A 2K3XA 2QEXQ 5GANe 4BDYA 2MMPA 3CMEQ 3EG0A 4QW2A 4BDZA 1PM3A 4GBQA 2LJ1A 4HT8A 2AK5A 3QSUA 3WVEB 1ZA2B 3PNWC 3EGDA 4YTLA 5I22A 1N8RR 1W70A 4PJOE 2GTOA 4C5HA 2FYKA 2ZAEA 1BI1A 3WVDB 3CCST 4C8QG 1TUDA 1MGQA 4KGXB 1VQPQ 3QWXX 3JCMW 1OYXA 2XICA 3L2QA 1M1KU 2YRCA 3OYBA 2HDAA 3OYIA 1IXDA 2M51A 3CCMT 1WXBA 2MI6A 4F7UF 3V8JA 5KYWA 1VOMA 2LJ3A 2JS2A 4L59A 1PKSA 2FPDA 1B7TA 3CD6A 1D1CA 2RI3A 4FL6A 4X9CA 1QCFA 2BE7D 1NPRA 4M7DG 4HCBA 1I1JA 2DERA 4IUUA 3CCUQ 4M78C 1VQOQ 3SWNA 2EQUA 1VQKA 1Q82C 2JT4A 4HT9A 4WTOB 4OMMA 3MHXA 3FEOA 1N9RA 2B86A 2CS7A 3ZBDA 4FM4B 3I56T 1IHVA 3M55A 5FU6B 3E9FA 1D3BB 2P0QA 4HA8A 2D1XA 3I55T 1FYNA 5GAMg 2DXCA 5LL6S 3G6EQ 1K73C 4PK4A 2DILA 5GAMh 1ABQA 4XTZA 4JRIA 2X9HA 1VQ5A 1AT1B 4CRIA 3C4SA 5CKBA 3URGA 2OJ2A 2LQ8A 2HKQB 1X27A 2EGEA 1T3SA 4B9XA 2XG8D 5DLOA 2KQWA 3S3OA 3JCMV 4A4GA 3GBQA 4BUGA 2KAFA 3JCMc 5KYXA 1Y96A 1Y71A 2DBMA 2Y90A 3OS2A 1M90C 2DX1A 5CR2A 2AKKA 4OB0B 2ZZDA 1K9MR 3CC7T 1M3BA 4JLGA 3X28B 3Q1JA 1RADB 1G3TA 2DAQA 5GANf 2LNVA 8AT1B 2RNAA 2NUZA 4C0DC 4WCIA 4A54A 1D1BA 1QKWA 3AT1B 2O4XA 2D8HA 3KFVA 3MJXA 3RUXA 3L2VA 3GIBA 2P0KA 4EMHA 4LD9K 1FMVA 3R6OA 1C0MA 2ROTA 3CCLQ 3CQTA 1I5OB 2FZGB 3SWNC 2J6OA 2CP7A 1UUEA 1D0YA 3CEYA 1GCQA 4KGVB 3V7CA 1YHQQ 5A2QE 3FJPA 1PC0A 3CCSA 2YLBA 3M0RA 3KUFA 1LOJA 1TXQA 1WI7A 2F2WA 4M77C 1G83A 2A7YA 3EFRA 1SPKA 4MMKA 2OTJQ 4P5NA 3RBBB 1YJWQ 1SHFA 3VS1A 2RD1A 4F7UA 1TSFA 4RTXA 2A0FB 4EMKA 2O9SA 2GBQA 3CCJT 2RQTA 4AFSC 3CPFA 4D8DA 1VQ7Q 2E5KA 2AIRB 1YFNA 1M1GA 2MCNA 3M57A 1OX8A 2DXUA 1VQLQ 1OQKA 2K6DA 2E70A 3HFNA 3ASKA 3H0FA 4QQ6A 3M56A 2CT3A 1UHCA 3HPWA 3JB9H 3LW5E 4RUGA 4A53A 4OB1B 3SDZA 1M1KC 2D8JA 1W2BS 3CCVQ 3JV3A 3QIIA 1OZ3A 2QGFB 2EYQA 2LT1A 3LWHA 1AWOA 2QXFA 1VQ4A 1MMDA 2DIQA 1AZGB 3R6NA 2LNHB 4LDUA 1D3BA 2PNIA 1T3LA 2A37A 4QKUA 1P92A 4EIKA 3I56A 1JQQA 5ECAA 3RKWA 4J5YA 1Q86U 4IURA 3CBOA 4IIMA 1B34B 3JCMe 2NUTB 1M2VB 3NHNA 3DKMA 1X6GA 1BK2A 5D6XA 5HY6A 3F70A 1U06A 1XTDA 1QVFS 3RKYA 2CGHA 2GQVA 3EFOB 4AT1B 5FU7B 1YCYA 1SF9A 2W10A 3UA6A 4KH1B 2A3LA 3QO3A 3HKSA 2RJCA 3X24B 3E9GA 3H8ZA 1YJ9Q 1Z9ZA 1PWTA 1DJ7B 3OYAA 1HK9A 2DJZA 5D7UA 2CZ6B 3QYGB 5CKHA 5GAMj 5EC7A 2RF0A 2QQRA 2DFUA 1IGUA 2OAWA 1QW1A 4OP0A 2EAYA 2VVKA 3PIPA 1NG2A 4L5GA 4GLKA 4AMCA 2DIGA 1O9SA 2F2VA 3OYLA 3OMGA 2A36A 4XQ3A 3OYEA 1PHTA 1WZOA 2RI2A 3OYMA 1WIEA 4OVAA 1MNEA 4FT2A 4FSSA 2FZCB 2J6KA 4MZMA 4M7AG 3A1PA 3HHTB 3MKDA 4C92G 1U1TA 1NJIR 1K4US 4NS5A 2C0IA 2KT1A 4ORZA 1YNZA 4AFZC 1PD1A 2RHXA 1WPYA 2JVVA 1I07A 1BIBA 2P0PA 3JRZA 1KHIA 2VUBA 3H9NA 4DOWA 5C0MA 2FZKB 3J80E 2EVRA 4FSXA 2EPDA 2EGAA 2QA4Q 4Z02A 2YSQA 5LJ5e 5GANg 4TVRA 3EHRA 1OU9A 3UATA 1EFNA 2O9VA 4PJNA 5GANh 1UGSB 2FRYA 3M4GA 1KC8U 1SSFA 1RAEB 2DMOA 3VS6A 4MZPA 4Z89A 4KT0E 1M2OA 3CCJA 1GRIA 2F5TX 4ANJA 1VQ9A 1GXIE 1WJSA 2ZPFB 3A8OB 2DEQA 1OPKA 1RI9A 2VXEA 3RNJA 2IVWA 4IKFA 1I8FA 2KROA 2C0TA 4QVCA 2KXCA 4JS4A 1ZLMA 4L6V5 2H3EB 4JDSA 2L2PA 4A4HA 2QDLA 2HAXA 4F17A 3FC3A 1K9AA 2EYYA 4QVDA 4CC3A 2FG0A 3CCQA 1RUWA 2OTLQ 3QKJA 1ZUUA 3VRZA 3VS4A 1SSHA 2QASA 4M78F 2CZ0B 2CUBA 2JW4A 2DVJA 2AZSA 1M2VA 1V76A 4A4EA 2OI3A 4LDVA 4LNPA 1Q7YU 1TWBA 5GAMd 3EFOA 5LJ3d 3CC2Q 4F04B 2HSPA 2V26A 4GY5A 2RHIA 2V8JA 4CC4B 1VQ8T 1D09B 3CPWS 1ARKA 2DL5A 3DB3A 2CP5A 3FB9A 3NTIA 3OS0A 1TTHB 1VQNQ 5KYNA 1K8AU 2E6NA 1Q82R 1B07A 1YBYA 2O2OA 2L3RA 3EGDB 2DTOA 2ROLA 1Q86C 1VYTA 3OW2S 1K76A 2F5KA 1E6GA 4AG1C 5IN1A 2JTEA 4XU3A 2DKGA 1ZBXA 1K73R 3OS5A 2AT1B 5KYWB 2PTKA 1LPLA 3CXCS 1BCMA 5GAN4 1M9SA 3M0UA 5IH2A 2M0YA 2HKNA 1YITQ 3CD6Q 3G71T 2QQ9A 2I2LA 2LRQA 4KH0B 1RLQC 4C8QC 3FRNA 3X26B 4PJJA 2LT4A 2ZPGB 3SFMA 1M90R 2GGRA 2CZ1B 4JJNK 4JJDA 3L1AA 3OYJA 3SWNB 4II1A 2VKNA 3CCEQ 2L8DA 2XIDA 3QDRB 1OV3A 9ATCB 4JJCA 5CQXA 3O8VA 4KUDK 3D7SB 1WJQA 2EYXA 1YN8A 4M77F 2DD4A 1EX4A 2RN8A 3HRSA 3P8BB 5IHNA 3EAEA 4M7DC 1ZUYA 4C92F 4ATOA 2HD0A 5GANj 1NEGA 3M9QA 4LXCA 2J6FA 1IRXA 3MCAB 3P8DA 5KYYA 1YI2T 2FB7A 1KC8C 1X75C 2MAMA 4OMOA 1QKXA 1VIEA 3C12A 2JOYA 4M78A 3T9NA 2LMJA 2VB6A 1AWWA 5GAOn 3HP9A 2DJQA 4M77D 4ZGEB 3JB9D 2CH4W 2DZCA 3GLXA 4JJBA 2COWA 2LC4A 2JMAA 2VGNA 4R56A 1EIFA 4C0ZA 3MEWA 1JXMA 2O4XB 1UGPB 2LDMA 3LGLA 3CMAA 1X6BA 5CQYA 2XDDA 4N4GA 2RHYA 4CC2A 2V1QA 2J06A 1YIJT 1E7OA 5C6SA 1VQ8A 3CC4T 1M1KR 4PFOA 1UJYA 3NFCA 1ZHIA 2QEXT 3CMET 3PVQA 1FWZA 4RTZA 3KXTA 2L0AA 4FIBA 4E7SA 3JCMg 1BKBA 2M02A 4ZNXA 3JCMh 1Q7YC 1M1FA 2EYZA 5FLXE 2KNBB 3BFMA 2FPFA 1BI2A 1VQPT 2X4XA 3ME9A 1LNXA 4J83A 3SEMA 1R8OB 4FYVB 3FLGA 4F7UB 3JCMP 3RDVA 2CT4A 2DL4A 2YXYA 3E1SA 4EMKB 3QUIA 4NL3A 3C94A 3OYDA 1KSWA 2KRNA 3P8HA 1UFFA 5CKFA 1K8AC 2MK5A 4XTXA 1C6VX 2HNIA 4LN2A 4RG8A 3HRTA 4QQGA 2O88A 2EKHA 4JZ4A 1WHMA 3TSZA 5IHIA 4RTYA 1OZ2A 2GQIA 4X9DA 2DM1A 1VQMQ 4ZTJA 1VQOT 1NLOC 1VQ4Q 4R0KA 4PLIA 5GANd 2LVMA 1KJWA 2KDSA 4HXJA 4M77A 1RAGB 2LQNA 4K11A 3S3NA 4FW2A 3MP6A 5D6WA 2GNCA 2JMCA 3V7RA 4J9CA 4PKCC 4KUIA 1BBZA 5KYUA 3G6ET 4J6XA 1UHFA 2ED0A 2QAZA 1MUZA 3EFSA 2LP5A 3HRUA 3EG2A 2CYZB 2GFUA 3VU3C 2DYBA 3MEUA 2A08A 2HSEB 2X4YA 4XTUA 2RJFA 3IQLA 2BZYA 1RAFB 4FT4A 2MWOA 1RACB 4BY6C 2R58A 2CP2A 3VV0A 2KR3A 3L42A 2COYA 4M77E 4FU6A 4ZN3A 2JTFA 5CVIA 2EQMA 1UGRB 1PRLC 4RCCA 1NPPA 2LTOA 1Y7XA 4N0AC 4F14A 2PU9B 3DLLA 3V8KA 4E7HA 4J6YA 1QCOA 2FHDA 3QPHA 2YUNA 3O5ZA 3NPFA 3LLRA 2EKOA 3PMIA 3VYGA 1I0CA 4E7LA 1U3OA 4ELYC 3CC4A 4LUDA 2QEXA 5GMKh 3CCLT 3CMEA 1NM7A 2JJ9A 3RMSA 1N6AA 2JXBA 1AWJA 5IAYA 4C5EA 3M53A 2KGTA 4J6WA 4NL2A 2B8AA 2DXBA 4FYYB 1W2BA 4M75G 1Y57A 2CZ7B 1YHQT 2M16A 3TVTA 4E47A 1WQWA 4F16A 2E64A 3CCMA 3PGGA 1RLPC 1HJDA 4OGEA 4M7AC 3LGFA 2OTJT 4PJOG 1PSFA 1YJWT 1JO8A 1N9SA 4C92C 2X4WA 1WNLA 2QGGA 1FMKA 1QVGS 2YUQA 2DPPB 3M4YA 1G3SA 1T0HA 2X51A 3GOXA 1UDLA 2CH4A 2YHTA 1VQ7T 2JUFA 2DEUA 2VC8A 1VQ9Q 1VQLT 1D0ZA 4BD3A 4J8OA 1PCXA 1D0XA 1WHLA 2QYZA 4UC4A 1PRMC 1HXDA 2P84A 3RIRA 1SEMA 2V1RA 4DOVA 1VQ6Q 1Q86R 3EGUA 3QG1A 1E6HA 4OB2B 3N5BB 2ESWA 4C8QF 2HL3A 3PTAA 4F7UE 3CCVT 5GJWB 2DXTA 1VQOA 2RB6A 5FWBA 3A8GB 4Z8AA 3CCQQ 3I55A 1J3TA 1X69A 1QLYA 1GL5A 2MWPA 3I5SA 3FJ5A 3JB9I 4MDXA 3VJPA 1MV0B 1AOJA 2RHUA 3G6EA 1H3ZA 1AVZC 1F1BB 2E41A 2XU8A 5GAN3 2RQRA 4WF2A 3CCRQ 3VKIA 1EZZB 4M7DF 1YJ9T 4C8QD 1IZ6A 1WYXA 4EMGA 4RG2A 1GFDA 2X3WD 3CC7A 5CAIA 2CREA 1YJNQ 1XJWB 4FW1A 1QP2A 2XHCA 1M3AA 2BTTA 2RM4A 3EG9B 2I0NA 2VASA 2JN0A 3MP1A 3AHUA 4Y91A 1WA7A 2EBPA 2IG0A 2DBKA 3E19A 3DLMA 2ENMA 3OB9A 1ZA1B 3QHSA 1TH7A 1Y07A 1AZEA 1BU1A 1A0NB 2CP0A 2J7IA 1KQ1A 3JB9G 4IIOA 4D6WA 2KXDA 2P4TA 4PFPA 2BKDN 5D6YA 2YUOA 1KQSA 4J9IA 2EQKA 2JTMA 1Q81R 2KBTA 1KC8R 2KYBA 3L2ZA 4QQDA 3UF4A 1OI1A 4A63B 1D1AA 2WSCE 1YHQA 4RTTA 3OSSC 5A0DA 2ZCFB 3ZFJA 2EJ9A 5LJ3e 5FU6C 2QA4T 4FYXB 2JS0A 3TQ7P 2LX7A 1VYUA 3GNGA 4XU0A 2A28A 5GMKj 1LVKA 4M4ZA 1K1ZA 3VUBA 1NJIU 2OTJA 4RCBA 5FW9A 2DTIA 1M3CA 1YJWA 1IREB 2HMAA 1TOVA 2DK3A 1I4K1 1ZX6A 3UA7A 3REAB 3LWIA 1VQ7A 3E2UA 3PVLA 3NTHA 3JAME 1VQLA 2H8HA 1ZUKA 3BE3A 3CPWA 1AD5A 3FIFA 3INZA 1LCKA 1KFZA 1SRMA 2FRWA 1X2QA 4J7IA 4C8QA 3JCMf 1XQHA 2KRMA 4N4HA 5KYYB 3CCVA 2GF7A 4M75F 4OGCA 2K2MA 3VS7A 3OW2A 1U1SA 2EWNA 4M78B 3TREA 4ZN1A 3UDCA 2OTLT 3EG3A 3TCJA 3G4ST 1IGQA 1JB0E 2NYSA 2BZ8A 5GAOl 4PJOF 2ZPEB 2NUPA 4JRQA 3QWYA 3L2RA 3THKA 4F7UG 3CC2T 1S72T 3CMAQ 3VRYA 2KSSA 2KMTA 1JJ2A 4M7DA 2FVUA 4C8QE 3DB4A 2QTXA 4ME7A 3HFOA 1QVPA 2EQIA 5GAN6 1YJ9A 2IPOB 3V8LA 1VQNT 1N27A 4M78D 3MP8A 2CDTA 4Y92A 3EG9A 2DZ9A 3HTRA 2VYTA 2HBPA 4AFUC 2RQVA 3M0TA 2R5MA 4BY6B 4DBFA 2SRCA 3RKXA 4DEXA 1MV3A 2XI9A 2CUDA 2RQWA 4C5GA 3FDRA 5AT1B 3REBB 3G1JA 5AYFA 1G3WA 4C0DB 4OMNA 2RO0A 1JRIA 4C5IA 1Q82U 2DYIA 5LJ5f 2WSFE 4O5VA 3NTKA 3OYHA 5CKDA 2C0OA 4GLMA 2GFAA 2X4JA 5LJ3f 1YITT 2BE9B 2FL7A 2Y4YA 8ATCB 3CD6T 3S6WA 3PIOA 3RERA 3UT1A 1BI3A 1PG5B 1K73U 1VYVA 2RH2A 1NYFA 2K2VA 1VQKQ 1UJ0A 1TU0B 4LUEA 1KD1U 1S1NA 1HYOA 2QA4A 3CCET 3X25B 4FCYA 1ZSZA 4Q5WA 2F2XA 4D8KA 4M77B 1GBRA 2LQKA 2RJDA 2AHJB 4IUTA 2JM9A 1I81A 1BI0A 3VS5A 4A4KA 4M7AF 5KYUB 1VQ5Q 2XMFA 1M90U 1VIFA 3EGXA 2KRSA 3H6ZA 4XAXB 4ESRA 3BY7A 4C92B 2QG9B 4J7FA 2RJEA 1AHJB 5FRMA 3LX7A 3OYNA 3VUZA 4CI0C 1W2BP 3L2WA 2O31A 5GAN2 1RABB 2KY9A 5CO7A 1NJIC 1PD0A 3WXMB 3I9QA 1M4ZA 3PFSA 3ZEHA 4BE0A 3OBWA 1NBEB 1WXUA 3MEAA 2E5QA 3S3MA 5FROA 3G4SA 4DBQA 3HL8A 1H641 4M7AD 2E12A 1B3QA 3QDFA 3QZ5B 4KGZB 4C92D 2XDPA 3CC2A 1S72A 4Y28E 3H41A 2D9TA 4J9FA 1JBMA 1OEBA 4C0GA 4X34A 1XOVA 1RL2A 3C95A 4BACA 2KT8A 4M78E 2YRVA 1T0JA 4PLLA 1OU8A 2DL3A 1YP5A 1U5SA 3EG1A 1MMGA 2E3IA 2SEMA 4OMLA 1VQNA 3OYCA 3CCSQ 1ZSZC 1UGVA 3PMTA 5M9OA 4E7JA 4JS5A 2FEIA 2K9GA 1IHWA 2FO0A 4DQ2A 3JB9J 2L5QA 3CCMQ 4PL6A 4JLIA 1NEBA 2EIFA 1X2KA 4J9GA 4VUBA 4XK8E 3QBYA 4N0AA 5J26A 1WDXA 1N8RU
chains in the Genus database with same CATH topology
3I35A 2EVRA 2EPDA 1JO8A 2X3XD 2HBWA 2EGAA 2YSQA 1FMKA 3A98A 2YUQA 3EHRA 3UATA 4QT7A 1EFNA 1T0HA 2BZXA 2O9VA 1UDLA 2CH4A 2DL8A 2FRYA 4OMQA 1IO6A 1PKTA 2EW3A 2DMOA 4HVUA 3VS6A 4Z89A 2J05A 4RTWA 1GRIA 1QWFA 1PRMC 1H3HA 1SEMA 2V1RA 2LQWA 4AFQC 3EGUA 1OPKA 1E6HA 1RI9A 2JM8A 1OOTA 3RNJA 2NWMA 2ESWA 4KRTA 1QWEA 2KROA 2ABLA 5GJWB 2C0TA 4J9BA 2DF6A 1JU5C 3M0SA 2KXCA 1ZLMA 1GBQA 5FWBA 2L2PA 4Z8AA 2QDLA 1JEGA 4F17A 2DE0X 1J3TA 1X69A 1QLYA 5IHKA 1K9AA 1GL5A 3I5SA 2EYYA 4HVWA 4CC3A 3FJ5A 2FG0A 1RUWA 2ECZA 1ZUUA 3VRZA 2L3QA 3VS4A 1MV0B 1SSHA 1ZSGA 1AOJA 5FWCA 2CUBA 2JW4A 2CSQA 1AVZC 2DVJA 2AZSA 3M0PA 1X43A 2OI3A 4LNPA 2RQRA 1V1CA 1TUCA 2MOXA 2L3SA 1CSKA 2HSPA 1AEYA 4JZ3A 1WYXA 1UECA 2W0ZA 4CC4B 1YWPA 1GFDA 1ARKA 2DL5A 2X3WD 3VS0A 2CREA 2LZ6B 1SHGA 3I5RA 1H8KA 1M3AA 1HSQA 2DA9A 2BTTA 2CSIA 2I0NA 1B07A 2O2OA 3EG0A 2ROLA 1H92A 4GBQA 1VYTA 1WA7A 2EBPA 2LJ1A 2AK5A 2DBKA 1K76A 2ENMA 2MIOA 1E6GA 4JPBW 1ABOA 4AG1C 1GCPA 5HCKA 2JTEA 5I22A 1AZEA 1W70A 1BU1A 2GTOA 3NMZC 1A0NB 2J7IA 1TUDA 2LJ0A 4IIOA 2L3PA 3QWXX 2KXDA 1Y0MA 2PTKA 1N5ZA 2HDAA 2YUOA 4J9IA 3M0UA 2M51A 5IH2A 1WXBA 2DL7A 2KYMA 2KBTA 2KYBA 2M0YA 3UF4A 2LJ3A 4A63B 1UG1A 1RLQC 2DLPA 1PKSA 2JS2A 2FPDA 4RTTA 3M0QA 2GGRA 2JS0A 2LX7A 1VYUA 3VS3A 2A28A 4JJDA 4M4ZA 1K1ZA 1QCFA 2EGCA 5FW9A 1M3CA 2VKNA 1I1JA 1OV3A 4JJCA 4RTVA 1ZX6A 2K7AA 2AKLA 3UA7A 3REAB 2EYXA 1YN8A 2JT4A 3PVLA 4OMMA 3TSWA 2B86A 2H8HA 2RN8A 1ZUKA 5IHNA 1AD5A 1LCKA 2ED1A 2D1XA 1KFZA 1SRMA 2FRWA 1UE9A 1X2QA 1FYNA 5GJVB 1ZBJA 1ZUYA 3NGPA 5IXBA 2KRMA 3U23A 1NEGA 2DILA 1ABQA 2K2MA 4J9EA 3VS7A 1JXOA 1M8MA 1YCSB 2J6FA 2OJ2A 3EG3A 1X27A 1M30A 2EGEA 5L23A 2BZ8A 1T3SA 4OMOA 1QKXA 2YUPA 1OPLA 2LMJA 3QWYA 1AWWA 3GBQA 2DJQA 2IIMA 3THKA 2CH4W 2DBMA 2DX1A 4JJBA 1GCQC 2AKKA 1WLPB 3VRYA 2JMAA 1M3BA 1JXMA 4AG2C 2KEAA 1M27C 1X6BA 2YDLA 1KIKA 1UTIA 2EQIA 3PE0A 2RNAA 2NUZA 4CC2A 4WCIA 2V1QA 2J06A 1QKWA 2LCSA 1E7OA 2CDTA 4Y92A 2D8HA 3KFVA 2DNUA 1UJYA 2GTJA 3PVQA 2G6FX 2P4RA 4AFUC 4RTZA 2RQVA 3EHQA 3M0TA 2L0AA 2KE9A 2ROTA 2SRCA 3CQTA 4DEXA 3ZL7C 4ZNXA 2FPEA 2RMOA 1MV3A 2DRKA 2J6OA 2EYZA 4OMPA 5IXFA 2CUDA 2RQWA 1UUEA 2KNBB 2FPFA 3REBB 3VS2A 1GCQA 2D0NA 1W1FA 4HCKA 4OMNA 3C0CA 3SEMA 1K0XA 1G2BA 1NYGA 2CT4A 2DL4A 3M0RA 3SHWA 4RTUA 1WI7A 2F2WA 3H0HA 2C0OA 1G83A 4GLMA 1SPKA 3RBBB 1SHFA 1KSWA 2KRNA 3VS1A 1UFFA 4RTXA 4X1VA 1VYVA 2O9SA 4LN2A 2GBQA 1NYFA 2RQTA 4AFSC 4D8DA 1HD3A 2HEQA 1UJ0A 2E5KA 2O88A 4LUEA 4E6RA 2MCNA 1S1NA 3ULRB 2EKHA 4JZ4A 3TSZA 2K6DA 5IHIA 1NLPC 4RTYA 1CKBA 3H0FA 2F2XA 4D8KA 2GQIA 2DM1A 2CT3A 1GBRA 1UHCA 2YT6A 4RUGA 1SRLA 2JM9A 1NLOC 2D8JA 4R0KA 3VS5A 1KJWA 2K79A 3JV3A 1VA7A 4HXJA 2XMFA 2LQNA 2RQUA 4K11A 1AWOA 2KRSA 4Z88A 4ESRA 1AZGB 3R6NA 2LNHB 2GNCA 2JMCA 4J9CA 1WXTA 2PNIA 1T3LA 1BBZA 2A37A 1W6XA 4EIKA 1JQQA 2RPNA 1UHFA 4LE9A 5ECAA 2ED0A 1MUZA 2O31A 1TG0A 2LP5A 3EG2A 1WX6A 4IIMA 3NHNA 2DYBA 1X6GA 1BK2A 2A08A 1K0SA 1U06A 3I9QA 3IQLA 2BZYA 1BB9A 2W10A 3UA6A 3LH5A 1WXUA 1CKAA 1AWXA 1Z9ZA 1PWTA 2KR3A 2PZ1A 4J9DA 1B3QA 1Z9QA 3H0IA 2AZVA 1PRLC 5EC7A 2RF0A 2OAWA 4CC7A 4F14A 3H41A 5I11A 4J9FA 2VVKA 1OEBA 1NG2A 1YWOA 2HCKA 2YUNA 3O5ZA 1XOVA 3NPFA 1WFWA 2KT8A 2VWFA 2F2VA 2K3BA 1I0CA 1T0JA 2A36A 1PHTA 1YP5A 2DL3A 1U5SA 3EG1A 1WIEA 2SEMA 4OMLA 1U3OA 4LUDA 2EYWA 4FSSA 2J6KA 1UGVA 1NM7A 2JXBA 2FEIA 1PNJA 2K9GA 1AWJA 2FO0A 2KGTA 4DEYA 1K4US 4J9HA 1Y57A 2C0IA 2KT1A 2DRMA 1NEBA 1GFCA 4ORZA 3TVTA 1YNZA 4AFZC 1X2KA 4HVVA 4J9GA 4F16A 1I07A 1WDXA 1RLPC 1HJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I35 A;  2EVR A;  2EPD A;  1JO8 A;  2X3X D;  2HBW A;  2EGA A;  2YSQ A;  1FMK A;  3A98 A;  2YUQ A;  3EHR A;  3UAT A;  4QT7 A;  1EFN A;  1T0H A;  2BZX A;  2O9V A;  1UDL A;  2CH4 A;  2DL8 A;  2FRY A;  4OMQ A;  1IO6 A;  1PKT A;  2EW3 A;  2DMO A;  4HVU A;  3VS6 A;  4Z89 A;  2J05 A;  4RTW A;  1GRI A;  1QWF A;  1PRM C;  1H3H A;  1SEM A;  2V1R A;  2LQW A;  4AFQ C;  3EGU A;  1OPK A;  1E6H A;  1RI9 A;  2JM8 A;  1OOT A;  3RNJ A;  2NWM A;  2ESW A;  4KRT A;  1QWE A;  2KRO A;  2ABL A;  5GJW B;  2C0T A;  4J9B A;  2DF6 A;  1JU5 C;  3M0S A;  2KXC A;  1ZLM A;  1GBQ A;  5FWB A;  2L2P A;  4Z8A A;  2QDL A;  1JEG A;  4F17 A;  2DE0 X;  1J3T A;  1X69 A;  1QLY A;  5IHK A;  1K9A A;  1GL5 A;  3I5S A;  2EYY A;  4HVW A;  4CC3 A;  3FJ5 A;  2FG0 A;  1RUW A;  2ECZ A;  1ZUU A;  3VRZ A;  2L3Q A;  3VS4 A;  1MV0 B;  1SSH A;  1ZSG A;  1AOJ A;  5FWC A;  2CUB A;  2JW4 A;  2CSQ A;  1AVZ C;  2DVJ A;  2AZS A;  3M0P A;  1X43 A;  2OI3 A;  4LNP A;  2RQR A;  1V1C A;  1TUC A;  2MOX A;  2L3S A;  1CSK A;  2HSP A;  1AEY A;  4JZ3 A;  1WYX A;  1UEC A;  2W0Z A;  4CC4 B;  1YWP A;  1GFD A;  1ARK A;  2DL5 A;  2X3W D;  3VS0 A;  2CRE A;  2LZ6 B;  1SHG A;  3I5R A;  1H8K A;  1M3A A;  1HSQ A;  2DA9 A;  2BTT A;  2CSI A;  2I0N A;  1B07 A;  2O2O A;  3EG0 A;  2ROL A;  1H92 A;  4GBQ A;  1VYT A;  1WA7 A;  2EBP A;  2LJ1 A;  2AK5 A;  2DBK A;  1K76 A;  2ENM A;  2MIO A;  1E6G A;  4JPB W;  1ABO A;  4AG1 C;  1GCP A;  5HCK A;  2JTE A;  5I22 A;  1AZE A;  1W70 A;  1BU1 A;  2GTO A;  3NMZ C;  1A0N B;  2J7I A;  1TUD A;  2LJ0 A;  4IIO A;  2L3P A;  3QWX X;  2KXD A;  1Y0M A;  2PTK A;  1N5Z A;  2HDA A;  2YUO A;  4J9I A;  3M0U A;  2M51 A;  5IH2 A;  1WXB A;  2DL7 A;  2KYM A;  2KBT A;  2KYB A;  2M0Y A;  3UF4 A;  2LJ3 A;  4A63 B;  1UG1 A;  1RLQ C;  2DLP A;  1PKS A;  2JS2 A;  2FPD A;  4RTT A;  3M0Q A;  2GGR A;  2JS0 A;  2LX7 A;  1VYU A;  3VS3 A;  2A28 A;  4JJD A;  4M4Z A;  1K1Z A;  1QCF A;  2EGC A;  5FW9 A;  1M3C A;  2VKN A;  1I1J A;  1OV3 A;  4JJC A;  4RTV A;  1ZX6 A;  2K7A A;  2AKL A;  3UA7 A;  3REA B;  2EYX A;  1YN8 A;  2JT4 A;  3PVL A;  4OMM A;  3TSW A;  2B86 A;  2H8H A;  2RN8 A;  1ZUK A;  5IHN A;  1AD5 A;  1LCK A;  2ED1 A;  2D1X A;  1KFZ A;  1SRM A;  2FRW A;  1UE9 A;  1X2Q A;  1FYN A;  5GJV B;  1ZBJ A;  1ZUY A;  3NGP A;  5IXB A;  2KRM A;  3U23 A;  1NEG A;  2DIL A;  1ABQ A;  2K2M A;  4J9E A;  3VS7 A;  1JXO A;  1M8M A;  1YCS B;  2J6F A;  2OJ2 A;  3EG3 A;  1X27 A;  1M30 A;  2EGE A;  5L23 A;  2BZ8 A;  1T3S A;  4OMO A;  1QKX A;  2YUP A;  1OPL A;  2LMJ A;  3QWY A;  1AWW A;  3GBQ A;  2DJQ A;  2IIM A;  3THK A;  2CH4 W;  2DBM A;  2DX1 A;  4JJB A;  1GCQ C;  2AKK A;  1WLP B;  3VRY A;  2JMA A;  1M3B A;  1JXM A;  4AG2 C;  2KEA A;  1M27 C;  1X6B A;  2YDL A;  1KIK A;  1UTI A;  2EQI A;  3PE0 A;  2RNA A;  2NUZ A;  4CC2 A;  4WCI A;  2V1Q A;  2J06 A;  1QKW A;  2LCS A;  1E7O A;  2CDT A;  4Y92 A;  2D8H A;  3KFV A;  2DNU A;  1UJY A;  2GTJ A;  3PVQ A;  2G6F X;  2P4R A;  4AFU C;  4RTZ A;  2RQV A;  3EHQ A;  3M0T A;  2L0A A;  2KE9 A;  2ROT A;  2SRC A;  3CQT A;  4DEX A;  3ZL7 C;  4ZNX A;  2FPE A;  2RMO A;  1MV3 A;  2DRK A;  2J6O A;  2EYZ A;  4OMP A;  5IXF A;  2CUD A;  2RQW A;  1UUE A;  2KNB B;  2FPF A;  3REB B;  3VS2 A;  1GCQ A;  2D0N A;  1W1F A;  4HCK A;  4OMN A;  3C0C A;  3SEM A;  1K0X A;  1G2B A;  1NYG A;  2CT4 A;  2DL4 A;  3M0R A;  3SHW A;  4RTU A;  1WI7 A;  2F2W A;  3H0H A;  2C0O A;  1G83 A;  4GLM A;  1SPK A;  3RBB B;  1SHF A;  1KSW A;  2KRN A;  3VS1 A;  1UFF A;  4RTX A;  4X1V A;  1VYV A;  2O9S A;  4LN2 A;  2GBQ A;  1NYF A;  2RQT A;  4AFS C;  4D8D A;  1HD3 A;  2HEQ A;  1UJ0 A;  2E5K A;  2O88 A;  4LUE A;  4E6R A;  2MCN A;  1S1N A;  3ULR B;  2EKH A;  4JZ4 A;  3TSZ A;  2K6D A;  5IHI A;  1NLP C;  4RTY A;  1CKB A;  3H0F A;  2F2X A;  4D8K A;  2GQI A;  2DM1 A;  2CT3 A;  1GBR A;  1UHC A;  2YT6 A;  4RUG A;  1SRL A;  2JM9 A;  1NLO C;  2D8J A;  4R0K A;  3VS5 A;  1KJW A;  2K79 A;  3JV3 A;  1VA7 A;  4HXJ A;  2XMF A;  2LQN A;  2RQU A;  4K11 A;  1AWO A;  2KRS A;  4Z88 A;  4ESR A;  1AZG B;  3R6N A;  2LNH B;  2GNC A;  2JMC A;  4J9C A;  1WXT A;  2PNI A;  1T3L A;  1BBZ A;  2A37 A;  1W6X A;  4EIK A;  1JQQ A;  2RPN A;  1UHF A;  4LE9 A;  5ECA A;  2ED0 A;  1MUZ A;  2O31 A;  1TG0 A;  2LP5 A;  3EG2 A;  1WX6 A;  4IIM A;  3NHN A;  2DYB A;  1X6G A;  1BK2 A;  2A08 A;  1K0S A;  1U06 A;  3I9Q A;  3IQL A;  2BZY A;  1BB9 A;  2W10 A;  3UA6 A;  3LH5 A;  1WXU A;  1CKA A;  1AWX A;  1Z9Z A;  1PWT A;  2KR3 A;  2PZ1 A;  4J9D A;  1B3Q A;  1Z9Q A;  3H0I A;  2AZV A;  1PRL C;  5EC7 A;  2RF0 A;  2OAW A;  4CC7 A;  4F14 A;  3H41 A;  5I11 A;  4J9F A;  2VVK A;  1OEB A;  1NG2 A;  1YWO A;  2HCK A;  2YUN A;  3O5Z A;  1XOV A;  3NPF A;  1WFW A;  2KT8 A;  2VWF A;  2F2V A;  2K3B A;  1I0C A;  1T0J A;  2A36 A;  1PHT A;  1YP5 A;  2DL3 A;  1U5S A;  3EG1 A;  1WIE A;  2SEM A;  4OML A;  1U3O A;  4LUD A;  2EYW A;  4FSS A;  2J6K A;  1UGV A;  1NM7 A;  2JXB A;  2FEI A;  1PNJ A;  2K9G A;  1AWJ A;  2FO0 A;  2KGT A;  4DEY A;  1K4U S;  4J9H A;  1Y57 A;  2C0I A;  2KT1 A;  2DRM A;  1NEB A;  1GFC A;  4ORZ A;  3TVT A;  1YNZ A;  4AFZ C;  1X2K A;  4HVV A;  4J9G A;  4F16 A;  1I07 A;  1WDX A;  1RLP C;  1HJD A; 
#chains in the Genus database with same CATH topology
 3I35 A;  3G71 A;  3OY9 A;  3M59 A;  2X3X D;  2HBW A;  3QXE B;  2HZY A;  1UGQ B;  1WJR A;  1VUB A;  4M75 C;  4QT7 A;  1WHH A;  5CCA A;  1YIT A;  2HQH A;  2BZX A;  2EJF A;  2R5A A;  1PKT A;  3CCU T;  2C06 A;  4RTW A;  2EQJ A;  4PJO C;  1QWF A;  1H3H A;  4OF1 A;  2LQW A;  1VQM T;  1WHJ A;  2XD0 A;  2JM8 A;  2DO3 A;  1VQ4 T;  3I56 Q;  3CCE A;  2ABL A;  2D6F A;  4J9B A;  3I55 Q;  1JU5 C;  2KVQ G;  4M7A A;  2EFI A;  1GBQ A;  3JCM Q;  4PFZ A;  1KHC A;  4C92 A;  1JEG A;  3QJY A;  5LJ5 g;  4ZGJ B;  5IHK A;  2X35 A;  4LDW A;  5LJ5 h;  1KQS P;  5LJ3 g;  1I5L A;  3TEE A;  5A0G A;  1C1A A;  1MMN A;  5LJ3 h;  3L2U A;  5FWC A;  5GMK i;  1KD1 C;  4BI8 B;  4O6J A;  5HK0 A;  4MML A;  3OYF A;  1YI2 A;  3M0P A;  2QTV A;  4HKE A;  2ZGW A;  1V1C A;  1FX7 A;  2MOX A;  3OSV A;  2L3S A;  2BUD A;  1CSK A;  1AEY A;  3CC7 Q;  3OQ5 A;  1IB8 A;  5HK3 A;  5J3B A;  3VYH B;  5GAN 8;  2PVD B;  3QZ9 B;  2W0Z A;  2CP3 A;  4M7A E;  3VS0 A;  2QQS A;  4C92 E;  1SHG A;  3I5R A;  5DY9 A;  2L89 A;  2RI5 A;  3RR6 A;  1HSQ A;  2CSI A;  1G8X A;  4XTW A;  1QVG A;  2QQA A;  3A8M B;  1H92 A;  1R0B G;  4QVZ A;  1YIJ A;  1K9M U;  3CPW P;  2HQE A;  1X6O A;  2MIO A;  5DLQ E;  4E7Z A;  4ZGD B;  5EG2 A;  4JPB W;  1ABO A;  1GCP A;  5KCH A;  2HQX A;  3NMZ C;  4OMF B;  4C0F A;  3UPU A;  2LJ0 A;  1WGS A;  3MEV A;  2L3P A;  5KCO A;  1Y0M A;  1N5Z A;  3OW2 P;  5HKC A;  1BCO A;  1VQP A;  1SKU B;  3SB2 A;  6AT1 B;  2DL7 A;  2KYM A;  2YLC A;  2H3J A;  1QP3 A;  2WSE E;  1UG1 A;  2F69 A;  4B6M A;  2DLP A;  3JCM J;  4M78 G;  3A8L B;  2K5F A;  3CXC P;  3M0Q A;  4B9W A;  3CCJ Q;  1QVF A;  3JCM X;  5CK9 A;  3VS3 A;  1JJ2 P;  2K57 A;  2EGC A;  7AT1 B;  2YWW A;  1VQ9 T;  4MDW A;  4RTV A;  2K7A A;  2JNG A;  2AKL A;  1ZQ1 A;  2ATC B;  4BI4 A;  2DET A;  1LJO A;  4C8Q B;  4N4I A;  3TSW A;  1VQ6 T;  5L8R E;  3CCU A;  3OBY A;  3A8H B;  1R77 A;  5KH6 A;  4PNO A;  2ED1 A;  3GP8 A;  3GF5 A;  1UE9 A;  5GJV B;  1N8R C;  1ZBJ A;  1VQM A;  3NGP A;  2CKK A;  5IXB A;  2M1H A;  3U23 A;  1UB4 A;  3CCQ T;  1NZ9 A;  4J9E A;  1JXO A;  1M8M A;  1M8V A;  1YCS B;  2QDY B;  2O01 E;  2NUP B;  4DBR A;  2KK4 A;  1M30 A;  2LCL A;  4E7I A;  3OMC A;  5L23 A;  1WHG A;  2E10 A;  2YUP A;  2M9U A;  2R57 A;  1OPL A;  1OX9 A;  4A4F A;  4M7D B;  3RES A;  2IIM A;  2VXF A;  3CCR T;  4JRP A;  1RAI B;  1GCQ C;  1WLP B;  4LDY A;  5KE2 A;  5J39 A;  3GNF B;  4AG2 C;  2KEA A;  1M27 C;  2LCC A;  2YDL A;  4RMO A;  1KIK A;  1UTI A;  3PT9 A;  5LJ5 j;  4BE1 A;  3PE0 A;  1YJN T;  3ER0 A;  1MHN A;  3LH0 A;  2LCS A;  1KQ2 A;  3RMQ A;  5LJ3 j;  5GAN 7;  3J7A F;  2DNU A;  2GTJ A;  2PVG B;  1G3Y A;  4EMK C;  2G6F X;  2P4R A;  3QYH B;  3EHQ A;  1WQ7 A;  1RAH B;  2KE9 A;  4M77 G;  2ZPI B;  4M7D D;  2PQW A;  3ZL7 C;  2FPE A;  3OYY A;  2RMO A;  2DRK A;  2K5L A;  2YRD A;  4OMP A;  5IXF A;  3CCL A;  3VS2 A;  1RAA B;  2D0N A;  1WHK A;  1W1F A;  4HCK A;  3C0C A;  4BB7 A;  3J81 E;  1K0X A;  1G2B A;  3JCM d;  1NYG A;  2K3Y A;  5A0L A;  3SHW A;  3UWN A;  4RTU A;  1QMC A;  4XU2 A;  3H0H A;  5GAM e;  1TS9 A;  2PUK B;  2G3R A;  3EH2 A;  5I2M A;  4RKU E;  3GPL A;  4LD6 A;  4X1V A;  2QK0 A;  3OYG A;  4DA4 A;  2M0O A;  1MMA A;  2K5I A;  1QQJ A;  1ZSZ B;  1HD3 A;  2HEQ A;  3BDU A;  1K9M C;  2V8K A;  2VV5 A;  4E6R A;  2CP6 A;  2GCX A;  2HL5 C;  3ULR B;  3OA6 A;  3A5Z B;  1NLP C;  1CKB A;  1Q81 U;  4OB3 B;  3EGX B;  2YT6 A;  1SRL A;  4DBH A;  3MPU B;  2K79 A;  1VA7 A;  1KK7 A;  2F1L A;  1Q7Y R;  1MND A;  4EPC A;  2RQU A;  2QQB A;  3G7Z A;  4Z88 A;  1KQS S;  1BIA A;  1VQ6 A;  4M75 B;  1WXT A;  5I21 A;  1O75 A;  1W6X A;  4PJL A;  3OYK A;  2RPN A;  4E7K A;  1XNI A;  4LE9 A;  4IUQ A;  1TG0 A;  1WX6 A;  5DM7 R;  2PVO B;  4R55 A;  1K8A R;  1OUL A;  1K0S A;  4PJO B;  4ELZ C;  3G4S Q;  5GMK e;  3CXC A;  1BB9 A;  3LH5 A;  1B34 A;  4KBM B;  3QJ6 A;  1CKA A;  2RHZ A;  2V8I A;  2NUT A;  5LJ5 d;  1AWX A;  2D0Q B;  3JSC A;  4XU1 A;  4V2S A;  2PZ1 A;  1W4S A;  4E2F B;  4J9D A;  1Z9Q A;  2Y4X A;  3X20 B;  3CMA T;  1S72 Q;  2OAU A;  1VQ8 Q;  3H0I A;  2AZV A;  3CBP A;  5GAO p;  1SG5 A;  3OS1 A;  4M75 D;  3CCR A;  4CC7 A;  2E65 A;  2E3H A;  5I11 A;  1FMW A;  4HCC A;  1YWO A;  3CBM A;  4LDX A;  1U8R A;  2HCK A;  1UEB A;  5GMK l;  2DVE A;  2ZPB B;  1WFW A;  2VWF A;  5IT9 E;  2K3B A;  1YJN A;  4PJO D;  3M58 A;  4MZT A;  3M54 A;  2QI2 A;  4KUL A;  2EYW A;  3MET A;  2Z0W A;  5CIU A;  4XTY A;  5GAO q;  2RA2 A;  1PNJ A;  4M7D E;  4BE2 A;  5I2S A;  4DEY A;  2ZPH B;  4J9H A;  1QCN A;  5GAM f;  2DD5 A;  4PJM A;  2VGM A;  2DRM A;  1GFC A;  4FYW B;  1KD1 R;  4HVV A;  2MYS A;  1RI0 A;  3LYI A;  3G71 Q;  2MPX C;  2BIV A;  3HSB A;  4ZTF A;  1PSE A;  5HCK A;  4EDU A;  3BDL A;  1JJ2 S;  5GAO m;  3KBG A;  1BYM A;  5KE3 A;  2E6Z A;  4JUV A;  3A98 A;  2DL8 A;  4BI3 A;  1VQK T;  4HCZ A;  4OMQ A;  3V7S A;  1IO6 A;  1X01 A;  2EW3 A;  4HVU A;  1V29 B;  2JZ2 A;  1G5V A;  4XTV A;  2J05 A;  5GAO r;  1QVG P;  5CKE A;  5FU7 C;  1KG1 A;  4AFQ C;  4M7A B;  2XK0 A;  3EH1 A;  3SD4 A;  1OOT A;  2NWM A;  4KRT A;  1QWE A;  2COZ A;  3M5A A;  3JB9 F;  2DF6 A;  1M5Q 1;  3M0S A;  4IUP A;  1VQ5 T;  5GMK m;  2NLU A;  3MO8 A;  2K4Y A;  2DE0 X;  1NE8 A;  2E4H A;  4M75 A;  2OX7 A;  2XDB A;  4HVW A;  2WAC A;  2LX9 A;  5FRN A;  2ECZ A;  1YI2 Q;  2L3Q A;  2MF2 A;  2XKO C;  1ZSG A;  3TU4 K;  4JRK A;  2CSQ A;  2OTL A;  2PUO B;  1ACM B;  1X43 A;  4PJO A;  2RK1 A;  1Q95 G;  1Q81 C;  5KYX B;  1TUC A;  1R0C B;  1Y96 B;  2KI7 A;  1QVF P;  1TUG B;  2DTH A;  4JZ3 A;  3JCM b;  2E1H A;  1UEC A;  1YWP A;  3BW1 A;  5GAN 5;  4IUV A;  2LZ6 B;  4NOY A;  1H8K A;  1YIJ Q;  1FXX A;  2DA9 A;  2EJG A;  4M75 E;  3CC4 Q;  2RK2 A;  2K3X A;  2QEX Q;  5GAN e;  4BDY A;  2MMP A;  3CME Q;  3EG0 A;  4QW2 A;  4BDZ A;  1PM3 A;  4GBQ A;  2LJ1 A;  4HT8 A;  2AK5 A;  3QSU A;  3WVE B;  1ZA2 B;  3PNW C;  3EGD A;  4YTL A;  5I22 A;  1N8R R;  1W70 A;  4PJO E;  2GTO A;  4C5H A;  2FYK A;  2ZAE A;  1BI1 A;  3WVD B;  3CCS T;  4C8Q G;  1TUD A;  1MGQ A;  4KGX B;  1VQP Q;  3QWX X;  3JCM W;  1OYX A;  2XIC A;  3L2Q A;  1M1K U;  2YRC A;  3OYB A;  2HDA A;  3OYI A;  1IXD A;  2M51 A;  3CCM T;  1WXB A;  2MI6 A;  4F7U F;  3V8J A;  5KYW A;  1VOM A;  2LJ3 A;  2JS2 A;  4L59 A;  1PKS A;  2FPD A;  1B7T A;  3CD6 A;  1D1C A;  2RI3 A;  4FL6 A;  4X9C A;  1QCF A;  2BE7 D;  1NPR A;  4M7D G;  4HCB A;  1I1J A;  2DER A;  4IUU A;  3CCU Q;  4M78 C;  1VQO Q;  3SWN A;  2EQU A;  1VQK A;  1Q82 C;  2JT4 A;  4HT9 A;  4WTO B;  4OMM A;  3MHX A;  3FEO A;  1N9R A;  2B86 A;  2CS7 A;  3ZBD A;  4FM4 B;  3I56 T;  1IHV A;  3M55 A;  5FU6 B;  3E9F A;  1D3B B;  2P0Q A;  4HA8 A;  2D1X A;  3I55 T;  1FYN A;  5GAM g;  2DXC A;  5LL6 S;  3G6E Q;  1K73 C;  4PK4 A;  2DIL A;  5GAM h;  1ABQ A;  4XTZ A;  4JRI A;  2X9H A;  1VQ5 A;  1AT1 B;  4CRI A;  3C4S A;  5CKB A;  3URG A;  2OJ2 A;  2LQ8 A;  2HKQ B;  1X27 A;  2EGE A;  1T3S A;  4B9X A;  2XG8 D;  5DLO A;  2KQW A;  3S3O A;  3JCM V;  4A4G A;  3GBQ A;  4BUG A;  2KAF A;  3JCM c;  5KYX A;  1Y96 A;  1Y71 A;  2DBM A;  2Y90 A;  3OS2 A;  1M90 C;  2DX1 A;  5CR2 A;  2AKK A;  4OB0 B;  2ZZD A;  1K9M R;  3CC7 T;  1M3B A;  4JLG A;  3X28 B;  3Q1J A;  1RAD B;  1G3T A;  2DAQ A;  5GAN f;  2LNV A;  8AT1 B;  2RNA A;  2NUZ A;  4C0D C;  4WCI A;  4A54 A;  1D1B A;  1QKW A;  3AT1 B;  2O4X A;  2D8H A;  3KFV A;  3MJX A;  3RUX A;  3L2V A;  3GIB A;  2P0K A;  4EMH A;  4LD9 K;  1FMV A;  3R6O A;  1C0M A;  2ROT A;  3CCL Q;  3CQT A;  1I5O B;  2FZG B;  3SWN C;  2J6O A;  2CP7 A;  1UUE A;  1D0Y A;  3CEY A;  1GCQ A;  4KGV B;  3V7C A;  1YHQ Q;  5A2Q E;  3FJP A;  1PC0 A;  3CCS A;  2YLB A;  3M0R A;  3KUF A;  1LOJ A;  1TXQ A;  1WI7 A;  2F2W A;  4M77 C;  1G83 A;  2A7Y A;  3EFR A;  1SPK A;  4MMK A;  2OTJ Q;  4P5N A;  3RBB B;  1YJW Q;  1SHF A;  3VS1 A;  2RD1 A;  4F7U A;  1TSF A;  4RTX A;  2A0F B;  4EMK A;  2O9S A;  2GBQ A;  3CCJ T;  2RQT A;  4AFS C;  3CPF A;  4D8D A;  1VQ7 Q;  2E5K A;  2AIR B;  1YFN A;  1M1G A;  2MCN A;  3M57 A;  1OX8 A;  2DXU A;  1VQL Q;  1OQK A;  2K6D A;  2E70 A;  3HFN A;  3ASK A;  3H0F A;  4QQ6 A;  3M56 A;  2CT3 A;  1UHC A;  3HPW A;  3JB9 H;  3LW5 E;  4RUG A;  4A53 A;  4OB1 B;  3SDZ A;  1M1K C;  2D8J A;  1W2B S;  3CCV Q;  3JV3 A;  3QII A;  1OZ3 A;  2QGF B;  2EYQ A;  2LT1 A;  3LWH A;  1AWO A;  2QXF A;  1VQ4 A;  1MMD A;  2DIQ A;  1AZG B;  3R6N A;  2LNH B;  4LDU A;  1D3B A;  2PNI A;  1T3L A;  2A37 A;  4QKU A;  1P92 A;  4EIK A;  3I56 A;  1JQQ A;  5ECA A;  3RKW A;  4J5Y A;  1Q86 U;  4IUR A;  3CBO A;  4IIM A;  1B34 B;  3JCM e;  2NUT B;  1M2V B;  3NHN A;  3DKM A;  1X6G A;  1BK2 A;  5D6X A;  5HY6 A;  3F70 A;  1U06 A;  1XTD A;  1QVF S;  3RKY A;  2CGH A;  2GQV A;  3EFO B;  4AT1 B;  5FU7 B;  1YCY A;  1SF9 A;  2W10 A;  3UA6 A;  4KH1 B;  2A3L A;  3QO3 A;  3HKS A;  2RJC A;  3X24 B;  3E9G A;  3H8Z A;  1YJ9 Q;  1Z9Z A;  1PWT A;  1DJ7 B;  3OYA A;  1HK9 A;  2DJZ A;  5D7U A;  2CZ6 B;  3QYG B;  5CKH A;  5GAM j;  5EC7 A;  2RF0 A;  2QQR A;  2DFU A;  1IGU A;  2OAW A;  1QW1 A;  4OP0 A;  2EAY A;  2VVK A;  3PIP A;  1NG2 A;  4L5G A;  4GLK A;  4AMC A;  2DIG A;  1O9S A;  2F2V A;  3OYL A;  3OMG A;  2A36 A;  4XQ3 A;  3OYE A;  1PHT A;  1WZO A;  2RI2 A;  3OYM A;  1WIE A;  4OVA A;  1MNE A;  4FT2 A;  4FSS A;  2FZC B;  2J6K A;  4MZM A;  4M7A G;  3A1P A;  3HHT B;  3MKD A;  4C92 G;  1U1T A;  1NJI R;  1K4U S;  4NS5 A;  2C0I A;  2KT1 A;  4ORZ A;  1YNZ A;  4AFZ C;  1PD1 A;  2RHX A;  1WPY A;  2JVV A;  1I07 A;  1BIB A;  2P0P A;  3JRZ A;  1KHI A;  2VUB A;  3H9N A;  4DOW A;  5C0M A;  2FZK B;  3J80 E;  2EVR A;  4FSX A;  2EPD A;  2EGA A;  2QA4 Q;  4Z02 A;  2YSQ A;  5LJ5 e;  5GAN g;  4TVR A;  3EHR A;  1OU9 A;  3UAT A;  1EFN A;  2O9V A;  4PJN A;  5GAN h;  1UGS B;  2FRY A;  3M4G A;  1KC8 U;  1SSF A;  1RAE B;  2DMO A;  3VS6 A;  4MZP A;  4Z89 A;  4KT0 E;  1M2O A;  3CCJ A;  1GRI A;  2F5T X;  4ANJ A;  1VQ9 A;  1GXI E;  1WJS A;  2ZPF B;  3A8O B;  2DEQ A;  1OPK A;  1RI9 A;  2VXE A;  3RNJ A;  2IVW A;  4IKF A;  1I8F A;  2KRO A;  2C0T A;  4QVC A;  2KXC A;  4JS4 A;  1ZLM A;  4L6V 5;  2H3E B;  4JDS A;  2L2P A;  4A4H A;  2QDL A;  2HAX A;  4F17 A;  3FC3 A;  1K9A A;  2EYY A;  4QVD A;  4CC3 A;  2FG0 A;  3CCQ A;  1RUW A;  2OTL Q;  3QKJ A;  1ZUU A;  3VRZ A;  3VS4 A;  1SSH A;  2QAS A;  4M78 F;  2CZ0 B;  2CUB A;  2JW4 A;  2DVJ A;  2AZS A;  1M2V A;  1V76 A;  4A4E A;  2OI3 A;  4LDV A;  4LNP A;  1Q7Y U;  1TWB A;  5GAM d;  3EFO A;  5LJ3 d;  3CC2 Q;  4F04 B;  2HSP A;  2V26 A;  4GY5 A;  2RHI A;  2V8J A;  4CC4 B;  1VQ8 T;  1D09 B;  3CPW S;  1ARK A;  2DL5 A;  3DB3 A;  2CP5 A;  3FB9 A;  3NTI A;  3OS0 A;  1TTH B;  1VQN Q;  5KYN A;  1K8A U;  2E6N A;  1Q82 R;  1B07 A;  1YBY A;  2O2O A;  2L3R A;  3EGD B;  2DTO A;  2ROL A;  1Q86 C;  1VYT A;  3OW2 S;  1K76 A;  2F5K A;  1E6G A;  4AG1 C;  5IN1 A;  2JTE A;  4XU3 A;  2DKG A;  1ZBX A;  1K73 R;  3OS5 A;  2AT1 B;  5KYW B;  2PTK A;  1LPL A;  3CXC S;  1BCM A;  5GAN 4;  1M9S A;  3M0U A;  5IH2 A;  2M0Y A;  2HKN A;  1YIT Q;  3CD6 Q;  3G71 T;  2QQ9 A;  2I2L A;  2LRQ A;  4KH0 B;  1RLQ C;  4C8Q C;  3FRN A;  3X26 B;  4PJJ A;  2LT4 A;  2ZPG B;  3SFM A;  1M90 R;  2GGR A;  2CZ1 B;  4JJN K;  4JJD A;  3L1A A;  3OYJ A;  3SWN B;  4II1 A;  2VKN A;  3CCE Q;  2L8D A;  2XID A;  3QDR B;  1OV3 A;  9ATC B;  4JJC A;  5CQX A;  3O8V A;  4KUD K;  3D7S B;  1WJQ A;  2EYX A;  1YN8 A;  4M77 F;  2DD4 A;  1EX4 A;  2RN8 A;  3HRS A;  3P8B B;  5IHN A;  3EAE A;  4M7D C;  1ZUY A;  4C92 F;  4ATO A;  2HD0 A;  5GAN j;  1NEG A;  3M9Q A;  4LXC A;  2J6F A;  1IRX A;  3MCA B;  3P8D A;  5KYY A;  1YI2 T;  2FB7 A;  1KC8 C;  1X75 C;  2MAM A;  4OMO A;  1QKX A;  1VIE A;  3C12 A;  2JOY A;  4M78 A;  3T9N A;  2LMJ A;  2VB6 A;  1AWW A;  5GAO n;  3HP9 A;  2DJQ A;  4M77 D;  4ZGE B;  3JB9 D;  2CH4 W;  2DZC A;  3GLX A;  4JJB A;  2COW A;  2LC4 A;  2JMA A;  2VGN A;  4R56 A;  1EIF A;  4C0Z A;  3MEW A;  1JXM A;  2O4X B;  1UGP B;  2LDM A;  3LGL A;  3CMA A;  1X6B A;  5CQY A;  2XDD A;  4N4G A;  2RHY A;  4CC2 A;  2V1Q A;  2J06 A;  1YIJ T;  1E7O A;  5C6S A;  1VQ8 A;  3CC4 T;  1M1K R;  4PFO A;  1UJY A;  3NFC A;  1ZHI A;  2QEX T;  3CME T;  3PVQ A;  1FWZ A;  4RTZ A;  3KXT A;  2L0A A;  4FIB A;  4E7S A;  3JCM g;  1BKB A;  2M02 A;  4ZNX A;  3JCM h;  1Q7Y C;  1M1F A;  2EYZ A;  5FLX E;  2KNB B;  3BFM A;  2FPF A;  1BI2 A;  1VQP T;  2X4X A;  3ME9 A;  1LNX A;  4J83 A;  3SEM A;  1R8O B;  4FYV B;  3FLG A;  4F7U B;  3JCM P;  3RDV A;  2CT4 A;  2DL4 A;  2YXY A;  3E1S A;  4EMK B;  3QUI A;  4NL3 A;  3C94 A;  3OYD A;  1KSW A;  2KRN A;  3P8H A;  1UFF A;  5CKF A;  1K8A C;  2MK5 A;  4XTX A;  1C6V X;  2HNI A;  4LN2 A;  4RG8 A;  3HRT A;  4QQG A;  2O88 A;  2EKH A;  4JZ4 A;  1WHM A;  3TSZ A;  5IHI A;  4RTY A;  1OZ2 A;  2GQI A;  4X9D A;  2DM1 A;  1VQM Q;  4ZTJ A;  1VQO T;  1NLO C;  1VQ4 Q;  4R0K A;  4PLI A;  5GAN d;  2LVM A;  1KJW A;  2KDS A;  4HXJ A;  4M77 A;  1RAG B;  2LQN A;  4K11 A;  3S3N A;  4FW2 A;  3MP6 A;  5D6W A;  2GNC A;  2JMC A;  3V7R A;  4J9C A;  4PKC C;  4KUI A;  1BBZ A;  5KYU A;  3G6E T;  4J6X A;  1UHF A;  2ED0 A;  2QAZ A;  1MUZ A;  3EFS A;  2LP5 A;  3HRU A;  3EG2 A;  2CYZ B;  2GFU A;  3VU3 C;  2DYB A;  3MEU A;  2A08 A;  2HSE B;  2X4Y A;  4XTU A;  2RJF A;  3IQL A;  2BZY A;  1RAF B;  4FT4 A;  2MWO A;  1RAC B;  4BY6 C;  2R58 A;  2CP2 A;  3VV0 A;  2KR3 A;  3L42 A;  2COY A;  4M77 E;  4FU6 A;  4ZN3 A;  2JTF A;  5CVI A;  2EQM A;  1UGR B;  1PRL C;  4RCC A;  1NPP A;  2LTO A;  1Y7X A;  4N0A C;  4F14 A;  2PU9 B;  3DLL A;  3V8K A;  4E7H A;  4J6Y A;  1QCO A;  2FHD A;  3QPH A;  2YUN A;  3O5Z A;  3NPF A;  3LLR A;  2EKO A;  3PMI A;  3VYG A;  1I0C A;  4E7L A;  1U3O A;  4ELY C;  3CC4 A;  4LUD A;  2QEX A;  5GMK h;  3CCL T;  3CME A;  1NM7 A;  2JJ9 A;  3RMS A;  1N6A A;  2JXB A;  1AWJ A;  5IAY A;  4C5E A;  3M53 A;  2KGT A;  4J6W A;  4NL2 A;  2B8A A;  2DXB A;  4FYY B;  1W2B A;  4M75 G;  1Y57 A;  2CZ7 B;  1YHQ T;  2M16 A;  3TVT A;  4E47 A;  1WQW A;  4F16 A;  2E64 A;  3CCM A;  3PGG A;  1RLP C;  1HJD A;  4OGE A;  4M7A C;  3LGF A;  2OTJ T;  4PJO G;  1PSF A;  1YJW T;  1JO8 A;  1N9S A;  4C92 C;  2X4W A;  1WNL A;  2QGG A;  1FMK A;  1QVG S;  2YUQ A;  2DPP B;  3M4Y A;  1G3S A;  1T0H A;  2X51 A;  3GOX A;  1UDL A;  2CH4 A;  2YHT A;  1VQ7 T;  2JUF A;  2DEU A;  2VC8 A;  1VQ9 Q;  1VQL T;  1D0Z A;  4BD3 A;  4J8O A;  1PCX A;  1D0X A;  1WHL A;  2QYZ A;  4UC4 A;  1PRM C;  1HXD A;  2P84 A;  3RIR A;  1SEM A;  2V1R A;  4DOV A;  1VQ6 Q;  1Q86 R;  3EGU A;  3QG1 A;  1E6H A;  4OB2 B;  3N5B B;  2ESW A;  4C8Q F;  2HL3 A;  3PTA A;  4F7U E;  3CCV T;  5GJW B;  2DXT A;  1VQO A;  2RB6 A;  5FWB A;  3A8G B;  4Z8A A;  3CCQ Q;  3I55 A;  1J3T A;  1X69 A;  1QLY A;  1GL5 A;  2MWP A;  3I5S A;  3FJ5 A;  3JB9 I;  4MDX A;  3VJP A;  1MV0 B;  1AOJ A;  2RHU A;  3G6E A;  1H3Z A;  1AVZ C;  1F1B B;  2E41 A;  2XU8 A;  5GAN 3;  2RQR A;  4WF2 A;  3CCR Q;  3VKI A;  1EZZ B;  4M7D F;  1YJ9 T;  4C8Q D;  1IZ6 A;  1WYX A;  4EMG A;  4RG2 A;  1GFD A;  2X3W D;  3CC7 A;  5CAI A;  2CRE A;  1YJN Q;  1XJW B;  4FW1 A;  1QP2 A;  2XHC A;  1M3A A;  2BTT A;  2RM4 A;  3EG9 B;  2I0N A;  2VAS A;  2JN0 A;  3MP1 A;  3AHU A;  4Y91 A;  1WA7 A;  2EBP A;  2IG0 A;  2DBK A;  3E19 A;  3DLM A;  2ENM A;  3OB9 A;  1ZA1 B;  3QHS A;  1TH7 A;  1Y07 A;  1AZE A;  1BU1 A;  1A0N B;  2CP0 A;  2J7I A;  1KQ1 A;  3JB9 G;  4IIO A;  4D6W A;  2KXD A;  2P4T A;  4PFP A;  2BKD N;  5D6Y A;  2YUO A;  1KQS A;  4J9I A;  2EQK A;  2JTM A;  1Q81 R;  2KBT A;  1KC8 R;  2KYB A;  3L2Z A;  4QQD A;  3UF4 A;  1OI1 A;  4A63 B;  1D1A A;  2WSC E;  1YHQ A;  4RTT A;  3OSS C;  5A0D A;  2ZCF B;  3ZFJ A;  2EJ9 A;  5LJ3 e;  5FU6 C;  2QA4 T;  4FYX B;  2JS0 A;  3TQ7 P;  2LX7 A;  1VYU A;  3GNG A;  4XU0 A;  2A28 A;  5GMK j;  1LVK A;  4M4Z A;  1K1Z A;  3VUB A;  1NJI U;  2OTJ A;  4RCB A;  5FW9 A;  2DTI A;  1M3C A;  1YJW A;  1IRE B;  2HMA A;  1TOV A;  2DK3 A;  1I4K 1;  1ZX6 A;  3UA7 A;  3REA B;  3LWI A;  1VQ7 A;  3E2U A;  3PVL A;  3NTH A;  3JAM E;  1VQL A;  2H8H A;  1ZUK A;  3BE3 A;  3CPW A;  1AD5 A;  3FIF A;  3INZ A;  1LCK A;  1KFZ A;  1SRM A;  2FRW A;  1X2Q A;  4J7I A;  4C8Q A;  3JCM f;  1XQH A;  2KRM A;  4N4H A;  5KYY B;  3CCV A;  2GF7 A;  4M75 F;  4OGC A;  2K2M A;  3VS7 A;  3OW2 A;  1U1S A;  2EWN A;  4M78 B;  3TRE A;  4ZN1 A;  3UDC A;  2OTL T;  3EG3 A;  3TCJ A;  3G4S T;  1IGQ A;  1JB0 E;  2NYS A;  2BZ8 A;  5GAO l;  4PJO F;  2ZPE B;  2NUP A;  4JRQ A;  3QWY A;  3L2R A;  3THK A;  4F7U G;  3CC2 T;  1S72 T;  3CMA Q;  3VRY A;  2KSS A;  2KMT A;  1JJ2 A;  4M7D A;  2FVU A;  4C8Q E;  3DB4 A;  2QTX A;  4ME7 A;  3HFO A;  1QVP A;  2EQI A;  5GAN 6;  1YJ9 A;  2IPO B;  3V8L A;  1VQN T;  1N27 A;  4M78 D;  3MP8 A;  2CDT A;  4Y92 A;  3EG9 A;  2DZ9 A;  3HTR A;  2VYT A;  2HBP A;  4AFU C;  2RQV A;  3M0T A;  2R5M A;  4BY6 B;  4DBF A;  2SRC A;  3RKX A;  4DEX A;  1MV3 A;  2XI9 A;  2CUD A;  2RQW A;  4C5G A;  3FDR A;  5AT1 B;  3REB B;  3G1J A;  5AYF A;  1G3W A;  4C0D B;  4OMN A;  2RO0 A;  1JRI A;  4C5I A;  1Q82 U;  2DYI A;  5LJ5 f;  2WSF E;  4O5V A;  3NTK A;  3OYH A;  5CKD A;  2C0O A;  4GLM A;  2GFA A;  2X4J A;  5LJ3 f;  1YIT T;  2BE9 B;  2FL7 A;  2Y4Y A;  8ATC B;  3CD6 T;  3S6W A;  3PIO A;  3RER A;  3UT1 A;  1BI3 A;  1PG5 B;  1K73 U;  1VYV A;  2RH2 A;  1NYF A;  2K2V A;  1VQK Q;  1UJ0 A;  1TU0 B;  4LUE A;  1KD1 U;  1S1N A;  1HYO A;  2QA4 A;  3CCE T;  3X25 B;  4FCY A;  1ZSZ A;  4Q5W A;  2F2X A;  4D8K A;  4M77 B;  1GBR A;  2LQK A;  2RJD A;  2AHJ B;  4IUT A;  2JM9 A;  1I81 A;  1BI0 A;  3VS5 A;  4A4K A;  4M7A F;  5KYU B;  1VQ5 Q;  2XMF A;  1M90 U;  1VIF A;  3EGX A;  2KRS A;  3H6Z A;  4XAX B;  4ESR A;  3BY7 A;  4C92 B;  2QG9 B;  4J7F A;  2RJE A;  1AHJ B;  5FRM A;  3LX7 A;  3OYN A;  3VUZ A;  4CI0 C;  1W2B P;  3L2W A;  2O31 A;  5GAN 2;  1RAB B;  2KY9 A;  5CO7 A;  1NJI C;  1PD0 A;  3WXM B;  3I9Q A;  1M4Z A;  3PFS A;  3ZEH A;  4BE0 A;  3OBW A;  1NBE B;  1WXU A;  3MEA A;  2E5Q A;  3S3M A;  5FRO A;  3G4S A;  4DBQ A;  3HL8 A;  1H64 1;  4M7A D;  2E12 A;  1B3Q A;  3QDF A;  3QZ5 B;  4KGZ B;  4C92 D;  2XDP A;  3CC2 A;  1S72 A;  4Y28 E;  3H41 A;  2D9T A;  4J9F A;  1JBM A;  1OEB A;  4C0G A;  4X34 A;  1XOV A;  1RL2 A;  3C95 A;  4BAC A;  2KT8 A;  4M78 E;  2YRV A;  1T0J A;  4PLL A;  1OU8 A;  2DL3 A;  1YP5 A;  1U5S A;  3EG1 A;  1MMG A;  2E3I A;  2SEM A;  4OML A;  1VQN A;  3OYC A;  3CCS Q;  1ZSZ C;  1UGV A;  3PMT A;  5M9O A;  4E7J A;  4JS5 A;  2FEI A;  2K9G A;  1IHW A;  2FO0 A;  4DQ2 A;  3JB9 J;  2L5Q A;  3CCM Q;  4PL6 A;  4JLI A;  1NEB A;  2EIF A;  1X2K A;  4J9G A;  4VUB A;  4XK8 E;  3QBY A;  4N0A A;  5J26 A;  1WDX A;  1N8R U; 
#chains in the Genus database with same CATH homology
 3I35 A;  2EVR A;  2EPD A;  1JO8 A;  2X3X D;  2HBW A;  2EGA A;  2YSQ A;  1FMK A;  3A98 A;  2YUQ A;  3EHR A;  3UAT A;  4QT7 A;  1EFN A;  1T0H A;  2BZX A;  2O9V A;  1UDL A;  2CH4 A;  2DL8 A;  2FRY A;  4OMQ A;  1IO6 A;  1PKT A;  2EW3 A;  2DMO A;  4HVU A;  3VS6 A;  4Z89 A;  2J05 A;  4RTW A;  1GRI A;  1QWF A;  1PRM C;  1H3H A;  1SEM A;  2V1R A;  2LQW A;  4AFQ C;  3EGU A;  1OPK A;  1E6H A;  1RI9 A;  2JM8 A;  1OOT A;  3RNJ A;  2NWM A;  2ESW A;  4KRT A;  1QWE A;  2KRO A;  2ABL A;  5GJW B;  2C0T A;  4J9B A;  2DF6 A;  1JU5 C;  3M0S A;  2KXC A;  1ZLM A;  1GBQ A;  5FWB A;  2L2P A;  4Z8A A;  2QDL A;  1JEG A;  4F17 A;  2DE0 X;  1J3T A;  1X69 A;  1QLY A;  5IHK A;  1K9A A;  1GL5 A;  3I5S A;  2EYY A;  4HVW A;  4CC3 A;  3FJ5 A;  2FG0 A;  1RUW A;  2ECZ A;  1ZUU A;  3VRZ A;  2L3Q A;  3VS4 A;  1MV0 B;  1SSH A;  1ZSG A;  1AOJ A;  5FWC A;  2CUB A;  2JW4 A;  2CSQ A;  1AVZ C;  2DVJ A;  2AZS A;  3M0P A;  1X43 A;  2OI3 A;  4LNP A;  2RQR A;  1V1C A;  1TUC A;  2MOX A;  2L3S A;  1CSK A;  2HSP A;  1AEY A;  4JZ3 A;  1WYX A;  1UEC A;  2W0Z A;  4CC4 B;  1YWP A;  1GFD A;  1ARK A;  2DL5 A;  2X3W D;  3VS0 A;  2CRE A;  2LZ6 B;  1SHG A;  3I5R A;  1H8K A;  1M3A A;  1HSQ A;  2DA9 A;  2BTT A;  2CSI A;  2I0N A;  1B07 A;  2O2O A;  3EG0 A;  2ROL A;  1H92 A;  4GBQ A;  1VYT A;  1WA7 A;  2EBP A;  2LJ1 A;  2AK5 A;  2DBK A;  1K76 A;  2ENM A;  2MIO A;  1E6G A;  4JPB W;  1ABO A;  4AG1 C;  1GCP A;  5HCK A;  2JTE A;  5I22 A;  1AZE A;  1W70 A;  1BU1 A;  2GTO A;  3NMZ C;  1A0N B;  2J7I A;  1TUD A;  2LJ0 A;  4IIO A;  2L3P A;  3QWX X;  2KXD A;  1Y0M A;  2PTK A;  1N5Z A;  2HDA A;  2YUO A;  4J9I A;  3M0U A;  2M51 A;  5IH2 A;  1WXB A;  2DL7 A;  2KYM A;  2KBT A;  2KYB A;  2M0Y A;  3UF4 A;  2LJ3 A;  4A63 B;  1UG1 A;  1RLQ C;  2DLP A;  1PKS A;  2JS2 A;  2FPD A;  4RTT A;  3M0Q A;  2GGR A;  2JS0 A;  2LX7 A;  1VYU A;  3VS3 A;  2A28 A;  4JJD A;  4M4Z A;  1K1Z A;  1QCF A;  2EGC A;  5FW9 A;  1M3C A;  2VKN A;  1I1J A;  1OV3 A;  4JJC A;  4RTV A;  1ZX6 A;  2K7A A;  2AKL A;  3UA7 A;  3REA B;  2EYX A;  1YN8 A;  2JT4 A;  3PVL A;  4OMM A;  3TSW A;  2B86 A;  2H8H A;  2RN8 A;  1ZUK A;  5IHN A;  1AD5 A;  1LCK A;  2ED1 A;  2D1X A;  1KFZ A;  1SRM A;  2FRW A;  1UE9 A;  1X2Q A;  1FYN A;  5GJV B;  1ZBJ A;  1ZUY A;  3NGP A;  5IXB A;  2KRM A;  3U23 A;  1NEG A;  2DIL A;  1ABQ A;  2K2M A;  4J9E A;  3VS7 A;  1JXO A;  1M8M A;  1YCS B;  2J6F A;  2OJ2 A;  3EG3 A;  1X27 A;  1M30 A;  2EGE A;  5L23 A;  2BZ8 A;  1T3S A;  4OMO A;  1QKX A;  2YUP A;  1OPL A;  2LMJ A;  3QWY A;  1AWW A;  3GBQ A;  2DJQ A;  2IIM A;  3THK A;  2CH4 W;  2DBM A;  2DX1 A;  4JJB A;  1GCQ C;  2AKK A;  1WLP B;  3VRY A;  2JMA A;  1M3B A;  1JXM A;  4AG2 C;  2KEA A;  1M27 C;  1X6B A;  2YDL A;  1KIK A;  1UTI A;  2EQI A;  3PE0 A;  2RNA A;  2NUZ A;  4CC2 A;  4WCI A;  2V1Q A;  2J06 A;  1QKW A;  2LCS A;  1E7O A;  2CDT A;  4Y92 A;  2D8H A;  3KFV A;  2DNU A;  1UJY A;  2GTJ A;  3PVQ A;  2G6F X;  2P4R A;  4AFU C;  4RTZ A;  2RQV A;  3EHQ A;  3M0T A;  2L0A A;  2KE9 A;  2ROT A;  2SRC A;  3CQT A;  4DEX A;  3ZL7 C;  4ZNX A;  2FPE A;  2RMO A;  1MV3 A;  2DRK A;  2J6O A;  2EYZ A;  4OMP A;  5IXF A;  2CUD A;  2RQW A;  1UUE A;  2KNB B;  2FPF A;  3REB B;  3VS2 A;  1GCQ A;  2D0N A;  1W1F A;  4HCK A;  4OMN A;  3C0C A;  3SEM A;  1K0X A;  1G2B A;  1NYG A;  2CT4 A;  2DL4 A;  3M0R A;  3SHW A;  4RTU A;  1WI7 A;  2F2W A;  3H0H A;  2C0O A;  1G83 A;  4GLM A;  1SPK A;  3RBB B;  1SHF A;  1KSW A;  2KRN A;  3VS1 A;  1UFF A;  4RTX A;  4X1V A;  1VYV A;  2O9S A;  4LN2 A;  2GBQ A;  1NYF A;  2RQT A;  4AFS C;  4D8D A;  1HD3 A;  2HEQ A;  1UJ0 A;  2E5K A;  2O88 A;  4LUE A;  4E6R A;  2MCN A;  1S1N A;  3ULR B;  2EKH A;  4JZ4 A;  3TSZ A;  2K6D A;  5IHI A;  1NLP C;  4RTY A;  1CKB A;  3H0F A;  2F2X A;  4D8K A;  2GQI A;  2DM1 A;  2CT3 A;  1GBR A;  1UHC A;  2YT6 A;  4RUG A;  1SRL A;  2JM9 A;  1NLO C;  2D8J A;  4R0K A;  3VS5 A;  1KJW A;  2K79 A;  3JV3 A;  1VA7 A;  4HXJ A;  2XMF A;  2LQN A;  2RQU A;  4K11 A;  1AWO A;  2KRS A;  4Z88 A;  4ESR A;  1AZG B;  3R6N A;  2LNH B;  2GNC A;  2JMC A;  4J9C A;  1WXT A;  2PNI A;  1T3L A;  1BBZ A;  2A37 A;  1W6X A;  4EIK A;  1JQQ A;  2RPN A;  1UHF A;  4LE9 A;  5ECA A;  2ED0 A;  1MUZ A;  2O31 A;  1TG0 A;  2LP5 A;  3EG2 A;  1WX6 A;  4IIM A;  3NHN A;  2DYB A;  1X6G A;  1BK2 A;  2A08 A;  1K0S A;  1U06 A;  3I9Q A;  3IQL A;  2BZY A;  1BB9 A;  2W10 A;  3UA6 A;  3LH5 A;  1WXU A;  1CKA A;  1AWX A;  1Z9Z A;  1PWT A;  2KR3 A;  2PZ1 A;  4J9D A;  1B3Q A;  1Z9Q A;  3H0I A;  2AZV A;  1PRL C;  5EC7 A;  2RF0 A;  2OAW A;  4CC7 A;  4F14 A;  3H41 A;  5I11 A;  4J9F A;  2VVK A;  1OEB A;  1NG2 A;  1YWO A;  2HCK A;  2YUN A;  3O5Z A;  1XOV A;  3NPF A;  1WFW A;  2KT8 A;  2VWF A;  2F2V A;  2K3B A;  1I0C A;  1T0J A;  2A36 A;  1PHT A;  1YP5 A;  2DL3 A;  1U5S A;  3EG1 A;  1WIE A;  2SEM A;  4OML A;  1U3O A;  4LUD A;  2EYW A;  4FSS A;  2J6K A;  1UGV A;  1NM7 A;  2JXB A;  2FEI A;  1PNJ A;  2K9G A;  1AWJ A;  2FO0 A;  2KGT A;  4DEY A;  1K4U S;  4J9H A;  1Y57 A;  2C0I A;  2KT1 A;  2DRM A;  1NEB A;  1GFC A;  4ORZ A;  3TVT A;  1YNZ A;  4AFZ C;  1X2K A;  4HVV A;  4J9G A;  4F16 A;  1I07 A;  1WDX A;  1RLP C;  1HJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...