1JO8A

Structural analysis of the yeast actin binding protein abp1 sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN BINDING PROTEIN
publication title Unusual binding properties of the SH3 domain of the yeast actin-binding protein Abp1: structural and functional analysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jo8A00
3QWYA 4WCIA 1ZX6A 2HSPA 2A08A 2DBMA 1B3QA 2VKNA 3NHNA 1H92A 4EIKA 2DRKA 2LNHB 2JT4A 2KYBA 2EYWA 3KFVA 4LE9A 2D8HA 1T0HA 4F16A 4RTTA 1GCQC 2F2XA 1Z9ZA 2H8HA 2PNIA 4AFZC 1A0NB 1JXOA 2LJ3A 1Y0MA 5EC7A 1T0JA 3SEMA 2FRWA 2VWFA 4M4ZA 2DYBA 1NG2A 1T3LA 2JM9A 1ZSGA 1YWOA 2DE0X 2KBTA 2MCNA 2BZXA 1GRIA 1PRMC 3NPFA 4KRTA 2YT6A 1YWPA 4HCKA 2RNAA 3EG1A 2D0NA 2KGTA 1UFFA 1OOTA 2KEAA 1K76A 2ED1A 3VS0A 1TUDA 2LJ1A 2G6FX 2EBPA 2OI3A 3REBB 2DILA 1FMKA 2ROLA 4OMLA 2M51A 1QLYA 2O31A 4Y92A 1PRLC 1X2QA 1AEYA 2F2WA 2KE9A 2GGRA 2YUOA 1YCSB 2O2OA 3NGPA 1KSWA 2YSQA 1JEGA 3EHQA 2L0AA 3EG3A 2RQUA 4A63B 3VS2A 2JS0A 4J9FA 1QWFA 2LCSA 2EGEA 2FPEA 1K9AA 4DEYA 4D8KA 2EYZA 2FG0A 1RI9A 2D1XA 4GLMA 4RTVA 3UA7A 1NEGA 1PNJA 2YUQA 5IHNA 1UGVA 1QCFA 3VRZA 4ESRA 5IXFA 2J6FA 1M30A 1NYGA 1SPKA 5FWBA 1I0CA 5IHKA 2MIOA 2JMCA 2AK5A 4OMNA 3QWXX 3EHRA 4Z8AA 3I5RA 2J6OA 2JM8A 2X3XD 3I5SA 2LQNA 2DVJA 4J9CA 1M3BA 3VS7A 2RQRA 1NLOC 1M3CA 3THKA 1PWTA 3I35A 1PKTA 2JXBA 4X1VA 1G2BA 1S1NA 2J06A 3CQTA 2DM1A 3UATA 4DEXA 1ARKA 3VS5A 2CUDA 1X6BA 2KRNA 1SEMA 2A28A 2AKKA 2K9GA 4CC4B 5FW9A 2IIMA 1UECA 2A36A 1UG1A 4CC3A 2DF6A 2HBWA 4J9GA 4JJDA 1J3TA 1I07A 2NWMA 1X69A 1WYXA 4J9EA 3UF4A 1UE9A 1VA7A 2CUBA 2DL8A 3VS6A 2L3PA 2FO0A 2ROTA 1WIEA 2DBKA 2GQIA 1OV3A 2J6KA 2K3BA 3EGUA 2RQTA 4D8DA 1K4US 4JJBA 2CDTA 2DLPA 1YN8A 2L2PA 1QWEA 4AG1C 1X6GA 5GJWB 1AZGB 2KT1A 3REAB 2YUNA 4E6RA 2NUZA 3C0CA 2O9VA 4OMPA 2GBQA 2KRMA 4F14A 2EYYA 3VS3A 1BK2A 4ZNXA 2K2MA 3ULRB 1U5SA 2AKLA 3TVTA 1ZBJA 2AZVA 2DRMA 1OEBA 2FRYA 2JTEA 1AOJA 3IQLA 3I9QA 2FPDA 3H0HA 1WI7A 1ZUUA 4LUDA 2EQIA 1TUCA 1OPLA 1M8MA 2I0NA 2KR3A 1UTIA 2V1QA 3NMZC 2LMJA 3VS4A 3M0TA 5IXBA 1UDLA 2K6DA 1W70A 1JQQA 3H41A 4K11A 1H3HA 2EVRA 4RTUA 2FPFA 1K0SA 1W6XA 2DX1A 1ABOA 5IHIA 4LUEA 1AWXA 1ZUYA 2RQVA 1JO8A 5GJVB 1M3AA 2RN8A 1K1ZA 1HSQA 2CH4A 2SEMA 1E6GA 1SHFA 2KROA 3SHWA 1GL5A 1SSHA 2DMOA 2ECZA 1AZEA 3TSZA 1QKWA 1KJWA 2F2VA 2EPDA 1H8KA 1VYVA 4R0KA 2DJQA 5L23A 2BZYA 2J7IA 2DA9A 2DL4A 2KNBB 1T3SA 2GNCA 1Z9QA 2EGAA 2CSQA 3VRYA 1SRMA 1NYFA 2KT8A 1BBZA 4LNPA 1GBQA 2O88A 3M0UA 3GBQA 4RTYA 2JMAA 2SRCA 3UA6A 1YP5A 1WA7A 1RUWA 1AWJA 3H0FA 1RLQC 2JS2A 3ZL7C 1GBRA 1U3OA 2LX7A 2X3WD 1N5ZA 5FWCA 1WXTA 2AZSA 4HVVA 3RBBB 1NLPC 2ESWA 2CT3A 2HEQA 1TG0A 1UHCA 1PHTA 2GTJA 1YNZA 1E7OA 1PKSA 1K0XA 1GCQA 4JZ3A 1KIKA 2CH4W 3O5ZA 1ZLMA 3R6NA 2HDAA 5IH2A 4JZ4A 1X43A 1HJDA 2KRSA 1AVZC 1FYNA 2ABLA 1UHFA 1WLPB 4RUGA 2EKHA 1NEBA 4J9IA 2DL5A 3M0PA 2RPNA 1GFDA 3PVQA 2ENMA 5HCKA 2PZ1A 4AFQC 3M0RA 1VYUA 1X2KA 1BU1A 2GTOA 1LCKA 2OAWA 4JPBW 2LZ6B 1X27A 2BZ8A 2LJ0A 2DNUA 1WX6A 2DL3A 2P4RA 1OPKA 3JV3A 2ED0A 2MOXA 4LN2A 1UJ0A 2EYXA 2L3SA 2BTTA 2DL7A 4RTWA 1AWOA 2XMFA 2B86A 4J9BA 3VS1A 1JU5C 2HCKA 4HXJA 1HD3A 2KXDA 2D8JA 4J9HA 1CKBA 4CC7A 2V1RA 1GCPA 2CSIA 4RTZA 1UJYA 2M0YA 2FEIA 1U06A 1UUEA 1KFZA 3FJ5A 4Z88A 2YUPA 2J05A 3EG2A 2EGCA 3PE0A 1M27C 3PVLA 2E5KA 5ECAA 3U23A 1IO6A 4Z89A 4OMOA 1SRLA 3H0IA 1W1FA 1QKXA 4IIMA 5I11A 2L3QA 3M0QA 1AWWA 2VVKA 4QT7A 1XOVA 2RF0A 2W10A 2JW4A 1WXBA 3TSWA 4CC2A 2LQWA 4AFUC 5I22A 3RNJA 2YDLA 4HVUA 4AG2C 1GFCA 1ZUKA 2CT4A 4JJCA 1V1CA 2PTKA 1SHGA 2W0ZA 1CKAA 4F17A 1I1JA 2OJ2A 2K7AA 1RLPC 2LP5A 2RMOA 3LH5A 1CSKA 1EFNA 2O9SA 4GBQA 4AFSC 3A98A 1E6HA 1WXUA 1Y57A 2EW3A 2CREA 2KXCA 1MV0B 1MV3A 2RQWA 2C0TA 1NM7A 1ABQA 4HVWA 4OMMA 4FSSA 2C0IA 1G83A 1MUZA 1WDXA 1JXMA 2C0OA 4IIOA 4RTXA 2A37A 1B07A 1BB9A 4ORZA 2KYMA 1WFWA 2QDLA 3EG0A 2K79A 1VYTA 3M0SA 4J9DA 4OMQA 1AD5A
chains in the Genus database with same CATH superfamily
1WQWA 3H6ZA 4JLIA 2A08A 1W2BP 4M78A 3OW2S 4FCYA 2KYBA 1KC8U 4LE9A 4F16A 3EAEA 3SWNB 1UB4A 1MGQA 3MJXA 2RJDA 1MMAA 2PNIA 3BDUA 4C8QF 2DD4A 4AFZC 5LJ5e 2QA4A 3VKIA 2LJ3A 1Y0MA 1T0JA 5J3BA 3SEMA 4BDYA 2FRWA 2VWFA 4M4ZA 1NG2A 5GAOm 1FMVA 1ZSGA 1TSFA 4LD9K 2KBTA 3H9NA 1IREB 2MCNA 3NPFA 1VQOT 2KGTA 2V8KA 5IN1A 1M2OA 4FYWB 3VUZA 1UFFA 4ANJA 3QXEB 5DY9A 4M78G 4HCBA 2LJ1A 2CZ6B 2NUPB 4PK4A 1VQ9Q 4XAXB 4X9CA 1M90U 3REBB 4C92A 1NPPA 3BE3A 4IUQA 2DAQA 1U8RA 2O31A 1ZSZA 4Y92A 4RCCA 4A4GA 4EMKC 3P8DA 5LJ3d 2YUOA 2LQKA 4C5GA 2YSQA 2OTJQ 1TU0B 2X51A 3VS2A 3EGXA 4J9FA 2QGGA 2O4XB 3FIFA 3SWNC 1K9AA 3SDZA 1TXQA 1UGQB 2K4YA 5A0LA 4M78B 4MZPA 1RI9A 1Y07A 2D1XA 4PJMA 4RTVA 1KD1C 1ZQ1A 1YJ9T 4C92G 4JDSA 3OYMA 1K8AR 3OW2P 1QCFA 1U1TA 1M30A 1I5LA 5LJ5j 4HCCA 2JMCA 2VASA 1M1FA 4Z8AA 4KT0E 4M78F 2CP7A 3JCMg 1YBYA 1V29B 4J9CA 1IB8A 2L3RA 3VS7A 4PJLA 1Q82R 1VQ9A 5GAMg 3THKA 3WXMB 1VQ8Q 3G71Q 1VQ4T 4II1A 2R5AA 3MKDA 4J6WA 2HD0A 1VQLQ 1NE8A 2JZ2A 4C92B 2CUDA 1X6BA 2KRNA 1ZSZB 3DB3A 4FIBA 2OTJA 2A28A 2AKKA 2K9GA 2QAZA 4CC4B 5FW9A 2IIMA 3CMAT 3V7SA 1UG1A 1S72T 4CC3A 2JN0A 4J9GA 2EYQA 3FB9A 4JJDA 2QDYB 1R8OB 4J9EA 3UF4A 1VA7A 4M78C 2PUKB 3L2RA 1BCOA 3EGXB 2Y4YA 2ZPFB 2FO0A 5LJ3h 3CCUQ 1PM3A 1KHIA 4YTLA 2RJCA 5GANg 5GMKe 5D6WA 1X6GA 3OYJA 5GJWB 3MPUB 5GAN2 1YI2T 2NUZA 3C0CA 2FZCB 2V8JA 2KRMA 2CP6A 2EIFA 1G3SA 1OX9A 4PLLA 1WHGA 4ZNXA 2QYZA 4RG8A 1ACMB 3LLRA 3CMEQ 3E1SA 2LCLA 3OYHA 4XU1A 3EFRA 1D3BA 4FYVB 5CKFA 2FPDA 1VQ8A 3G71A 4BE1A 3H0HA 1I8FA 1Q81C 1WI7A 1ZUUA 4LUDA 1D1AA 4WTOB 1VQLA 4C92C 4JUVA 2XHCA 3VS4A 3CC7Q 1UDLA 1ZSZC 4J7FA 1QVGA 3M56A 2R57A 4K11A 2MWPA 2KSSA 2F1LA 2P0PA 4M7DE 1W6XA 3PT9A 3CPWA 2EQKA 1EX4A 5IHIA 5FRMA 3CCRQ 2XKOC 1ZUYA 1JO8A 2R58A 5GJVB 2X9HA 3L2WA 2RN8A 2SEMA 1K1ZA 3OY9A 1SHFA 3SHWA 2VXEA 1W4SA 2DMOA 2ECZA 3CCUA 1TOVA 4J7IA 3TSZA 1QKWA 1KJWA 4A4KA 1K73R 1H8KA 1VYVA 4R0KA 4C5HA 2COWA 5GMKj 3CPFA 2E5QA 4UC4A 4XTUA 2CSQA 3VRYA 1VQNQ 1NYFA 2HKNA 3CMEA 3OYLA 5FRNA 2HMAA 4M7DD 1Q7YC 3M0UA 3GBQA 2SRCA 4BACA 3EH2A 1BI0A 1NPRA 2EAYA 3S6WA 3A8GB 1BI3A 3BDLA 3LW5E 1B7TA 1M1GA 4QQ6A 1QVGS 1RLQC 3QO3A 9ATCB 3CC7A 1D3BB 3LGFA 3QSUA 5D6XA 4PJOE 3CPWS 2JTFA 1D0ZA 3RBBB 3L2QA 2HEQA 2M02A 1PHTA 3A8HB 1E7OA 1PKSA 2DIQA 2P0KA 5KYYA 2QI2A 3CCRA 3R6NA 4FSXA 3CCMQ 4ATOA 2JUFA 1HJDA 2DEUA 5GMKl 4E7LA 3Q1JA 3PIPA 1UHFA 1WLPB 4RG2A 1NEBA 2XDDA 4J9IA 4KH1B 1FWZA 4CRIA 3HP9A 5HCKA 2K3YA 4ME7A 3ASKA 2VGNA 3PIOA 3L42A 1SG5A 2MPXC 1C6VX 1VQNA 4PJOD 2GTOA 1LCKA 3JCMX 4MMKA 1VQ9T 3OYEA 2DJZA 2QQSA 1OPKA 2K57A 1KD1R 2ED0A 2MI6A 4LN2A 1UJ0A 1QW1A 2B86A 3VS1A 2QQBA 2HCKA 1WPYA 4E7ZA 3E19A 2DFUA 4XTZA 4NS5A 3OYNA 3JCMW 2M0YA 1YCYA 3JCMV 2FEIA 2RI3A 4KUIA 2NUTA 2YUPA 1QVGP 2YRDA 2EWNA 5C6SA 2XG8D 1ZA2B 4JLGA 3JCMb 1G5VA 4LDWA 4XU2A 4HT9A 1N27A 1IO6A 2L89A 3H0IA 1K8AU 1W1FA 3CPWP 3CCMA 1FXXA 4BUGA 2L3QA 1AWWA 3V8JA 5I2SA 5KYUB 5KYYB 3TSWA 5I22A 1IHWA 2DEQA 2YDLA 1VQPQ 3X26B 4AG2C 1GFCA 1U1SA 3NFCA 5CKHA 2PTKA 3JRZA 2OJ2A 2K7AA 2CKKA 1EFNA 2O9SA 3G6EQ 1OU8A 1WXUA 3S3NA 2CREA 2KXCA 1MV0B 1MV3A 1KQ2A 3QJ6A 4PL6A 1G83A 1VQ8T 3G71T 2P84A 1JRIA 1IXDA 5LL6S 1VQLT 1VQ7Q 5GAN6 1G3YA 3EFOA 1WFWA 3EG0A 2K79A 3CXCS 4R56A 1WNLA 3R6OA 4J6YA 1AD5A 1X6OA 3QWYA 2Z0WA 2HSPA 3CCQQ 2FB7A 2YLCA 3MEAA 1M1KC 1H92A 1MNEA 4OB0B 4V2SA 2DRKA 6AT1B 2EYWA 3KFVA 2DD5A 3WVDB 4BI3A 5HY6A 2LNVA 5HK0A 4RTTA 2NUTB 2F2XA 1Z9ZA 4Y91A 2H8HA 2RB6A 3CCEQ 2D0QB 1A0NB 1JXOA 1VQPA 2V8IA 1YITQ 2FHDA 4E47A 2JVVA 1IGQA 2HAXA 1QP3A 4Q5WA 2RNAA 3CMET 3HSBA 3G6EA 3M4GA 1K76A 1VIEA 5J39A 4DBHA 1LVKA 3S3OA 4F7UE 2EBPA 2KI7A 1SKUB 4J83A 3DLMA 4OMLA 1VQ7A 2BE9B 3V7CA 3CC7T 1AEYA 2FYKA 1OI1A 1JBMA 2HNIA 1C1AA 2F2WA 5GAOq 4A4EA 1JEGA 3CC2Q 1LPLA 4FYYB 2XICA 2BE7D 3CCQA 2L0AA 7AT1B 3CCRT 3EFOB 4KGVB 4FYXB 4JRIA 5LJ5d 3HHTB 2LCSA 2EGEA 4MZTA 1K73U 4BI4A 4DEYA 1I81A 4RKUE 3LX7A 2EYZA 4D8KA 1PC0A 1G3WA 4IUPA 5FU7B 1M2VA 2L8DA 4OF1A 3CCEA 3LYIA 2YUQA 2GQVA 2RO0A 1M9SA 1XTDA 1YIJT 2ZPBB 1SSFA 4ESRA 1YITA 3FRNA 1QVFS 4QW2A 1SPKA 4ZGEB 1V76A 4OMNA 3CCLQ 1VQNT 3QWXX 2MMPA 5GAN5 1QVPA 1WHLA 2WACA 2COZA 2K5IA 3PNWC 4GLKA 2LQNA 2YWWA 5EG2A 1M3BA 3QIIA 2DTIA 1M3CA 2Y90A 1PWTA 1TWBA 2JXBA 4B9WA 1IZ6A 1G2BA 1ZHIA 5CVIA 4A54A 3CQTA 3UATA 5DM7R 1ARKA 2GF7A 5KYNA 1XNIA 2XDPA 2KMTA 3CCJQ 3CC2A 4M7DA 1UECA 2JNGA 1PG5B 1FMWA 2CGHA 4AT1B 4KUDK 2DF6A 2HBWA 2EFIA 3MP6A 3CCMT 1N8RC 1J3TA 1X69A 1Y7XA 4DBFA 5FU7C 2DL8A 3VS6A 2L3PA 3EGDB 2ROTA 1WIEA 2DBKA 1OV3A 2K3BA 1K4US 1QWEA 4AG1C 5GAN7 5HK3A 2AT1B 5KYXA 3CCLA 2E64A 5LJ5h 2EYYA 3BW1A 1KD1U 3FLGA 3VS3A 1PSEA 1BK2A 3CEYA 4M7DG 4EPCA 3GF5A 1U5SA 3TVTA 1YFNA 1QVFP 2AZVA 2DRMA 1OEBA 2Y4XA 3PTAA 3IQLA 4LD6A 5CK9A 3AT1B 2C06A 4E7KA 2EQIA 2QG9B 1TUCA 3G4SQ 5KCHA 4ZN1A 2MYSA 2RHZA 3JCMf 1M8MA 2KR3A 1UTIA 3NMZC 4PJOA 3M0TA 2MF2A 1N9SA 5GAMf 1PD1A 3CCJA 3RESA 3H41A 1H3HA 2OTLQ 4XK8E 2EVRA 4C0DB 1K0SA 4BD3A 2YRCA 3QZ5B 4PNOA 4LUEA 1AWXA 1LJOA 2EKOA 2RQVA 2A7YA 1M3AA 5KH6A 2WSEE 3O8VA 2KROA 1GL5A 4A4FA 2MK5A 1VQPT 4NL2A 4M77E 4JRPA 4E2FB 2RM4A 1WZOA 2EQUA 3VJPA 2DJQA 5L23A 1KQSS 3GIBA 4PJOG 3G6ET 2DA9A 2M0OA 1M1KR 2K5LA 4X34A 5GAOp 5GANf 1N6AA 3OBYA 2CP5A 4B6MA 5KYXB 5GAOn 4NOYA 4BB7A 1GBQA 3URGA 4M7AE 1VQ7T 3MEWA 3OYBA 1YP5A 1WJQA 5I2MA 2DERA 3G4SA 5LJ3g 4A53A 3CBPA 3ZL7C 3JCMe 2HSEB 1U3OA 2X3WD 4M77D 5IAYA 3CCQT 1N5ZA 4C8QE 1WXTA 1NLPC 4C0DC 2OTLA 1Q86C 1VQ5Q 1PCXA 1Q81U 3GNFB 1BI2A 4IURA 1YJNT 4C92F 1KIKA 4M7DC 5M9OA 3O5ZA 1ZLMA 4P5NA 3CCET 1M8VA 1VUBA 2DXCA 3X24B 4JZ4A 2QEXQ 3KBGA 1YITT 2EKHA 4M7AD 3FJPA 5A0GA 1K9MC 3PVQA 3JB9J 2ENMA 3OB9A 1DJ7B 1X75C 3M0RA 4QQDA 2E3IA 1TH7A 3OYCA 2VC8A 3RMQA 5GMKh 1BU1A 4C8QD 2P4TA 4JPBW 4A4HA 2LJ0A 4DBRA 3OS1A 1KQSP 4QVDA 2BTTA 3CCVQ 2FZGB 3UDCA 4J9BA 2OX7A 4MDXA 3UPUA 1HD3A 4J9HA 3CC2T 1G8XA 1RAGB 2V1RA 2QQAA 4L6V5 5DLQE 1Q7YU 4RTZA 3OSVA 2RI5A 1UUEA 1VQ5A 4PJOC 2OAUA 2VYTA 1FX7A 2E6NA 4E7HA 5GAMj 3MEUA 2J05A 2QA4T 3JB9G 1BYMA 5ECAA 3PVLA 3U23A 4LDYA 1SRLA 8AT1B 1WHKA 2QEXA 2ZZDA 4QT7A 3MP8A 4B9XA 1RAHB 3PGGA 5KYWA 2JW4A 3RKYA 4CC2A 2LQWA 5CAIA 1ZUKA 2CT4A 4JJCA 3M59A 5A2QE 3CCLT 1P92A 1CKAA 4FW1A 3GNGA 5DLOA 2XK0A 1LOJA 1RLPC 5GAN8 2RI2A 1CSKA 1N8RR 3A98A 1RAIB 1VQ6Q 2C0TA 4F7UA 4OMMA 4FSSA 1TUGB 1N9RA 4ZN3A 5CKDA 5GANj 1WDXA 3CCVA 2DXUA 1RL2A 2A37A 4KULA 4M78D 3CBOA 3PFSA 4O5VA 2BKDN 4J8OA 2KYMA 1QCOA 2QDLA 2E6ZA 1HYOA 2D6FA 1R0BG 4MZMA 4WCIA 3NTKA 3JB9F 1ZX6A 2BUDA 3DB4A 2QTVA 5GMKm 5IT9E 2PVOB 2DBMA 2GFUA 3NHNA 3JCMP 2LNHB 4OMFB 1NBEB 2D8HA 1QMCA 1T0HA 4F7UG 3V7RA 4JRQA 2ZGWA 2YXYA 1MMDA 2QXFA 2PQWA 2ZPHB 5EC7A 1D0XA 4C5EA 2DZ9A 3X20B 1T3LA 2JM9A 1YWOA 1PSFA 2DE0X 5KYWB 2PU9B 2BZXA 2YRVA 1PRMC 1KHCA 2YT6A 1YWPA 2DTOA 3EG1A 4RMOA 2D0NA 3EFSA 4OGCA 5A0DA 4XTYA 2FVUA 1NZ9A 3OS5A 1OOTA 2FL7A 3QBYA 4ZGDB 1VQ6A 4AMCA 2M1HA 3VS0A 5CCAA 1TUDA 2G6FX 2OI3A 3L1AA 2FZKB 4E7SA 3G4ST 1RAFB 4C0ZA 2M51A 2CZ7B 1PRLC 2OTJT 4F7UB 1X2QA 4L59A 3RR6A 3GPLA 2LT1A 2GGRA 3OMCA 2O2OA 3NGPA 2VXFA 1KSWA 3CXCA 2HL3A 2VV5A 2OTLT 2BIVA 3PMTA 3EHQA 4E7IA 3SB2A 3EG3A 2RQUA 3V8LA 2JS0A 3KUFA 3EG9A 1QWFA 4HCZA 3HFOA 4F7UF 1WGSA 3LWHA 4KBMB 4GLMA 3UA7A 3HRSA 1PNJA 3OYIA 2PVGB 1AT1B 1M1KU 1BKBA 2DVEA 2K5FA 5IHNA 1UGVA 1WHMA 3VRZA 2DYIA 1MHNA 2J6FA 1RI0A 1Q86R 3E2UA 2I2LA 5IHKA 4CI0C 2CP0A 1YJ9Q 3I5RA 3A8MB 3ER0A 2JM8A 5FROA 2X3XD 1WJRA 3MHXA 1KG1A 2DVJA 4FW2A 2RK2A 3HL8A 4TVRA 4JS5A 1YHQQ 3I35A 1TTHB 1PKTA 4QQGA 4X1VA 1K9MR 2J06A 2E4HA 2DM1A 2QQ9A 4Y28E 1F1BB 1D0YA 3SD4A 2E41A 1VQ5T 1ZA1B 2E1HA 3TREA 3QZ9B 1SEMA 3OYYA 1QP2A 1Q81R 3CCUT 5CR2A 1R77A 2QEXT 1WYXA 3CMAQ 2PUOB 2CUBA 4M77A 3EG9B 1MMNA 2RJFA 3I55Q 3GP8A 2GQIA 5FU6C 2J6KA 2RQTA 4MMLA 1UGPB 1YN8A 1Q82C 2HZYA 1MMGA 3OS2A 1OX8A 1G3TA 2O01E 1QVFA 3REAB 2YUNA 4N4HA 4OMPA 3GOXA 2GBQA 4FT4A 1YJ9A 4F14A 3A5ZB 2K2MA 1I4K1 2X4XA 4QVCA 4HA8A 2AKLA 4M7AA 2XDBA 3CCVT 1RACB 2FRYA 2JTEA 1YHQA 3OS0A 1AOJA 4BI8B 3I9QA 4XTVA 2X4JA 5CKBA 1OPLA 4M77G 2I0NA 4EMKA 2V1QA 4FL6A 2LMJA 5HKCA 4C8QA 2K6DA 1H641 5CIUA 2R5MA 1W70A 1JQQA 4OGEA 1Q7YR 3H8ZA 4RTUA 2FPFA 3CXCP 4C0FA 1GXIE 4LXCA 1VQKQ 4QVZA 3CMAA 3L2UA 1E6GA 3NTHA 4GY5A 4M7AG 2HQHA 3I55A 2ATCB 3OYAA 1SSHA 2KVQG 2NLUA 1AZEA 2F2VA 5D6YA 1OZ3A 2WSFE 1N8RU 2EPDA 4M77B 4PFPA 1X01A 2BZYA 3UT1A 2VUBA 2J7IA 3RIRA 4C8QG 2DL4A 3RDVA 1RADB 1VQ6T 3J80E 4OB1B 2KT8A 1BBZA 3QJYA 3C95A 5CQYA 4M75E 2XD0A 4HT8A 2JMAA 3PMIA 1WA7A 1RUWA 2ZPIB 2DETA 3H0FA 4M7AB 4LDUA 2JS2A 1RABB 3QYHB 2CYZB 3MO8A 2CZ1B 3QHSA 1WHJA 4ZTFA 2LX7A 4X9DA 3TCJA 2GCXA 1M5Q1 5FWCA 4HVVA 2ESWA 2EJ9A 2KAFA 1OU9A 1UHCA 5LJ5g 2GTJA 1GCQA 4C8QB 1YJWQ 4PJNA 4M7AF 1VQKA 2CH4W 2L5QA 2ZCFB 5CQXA 3JSCA 5GAN3 3QYGB 4N0AA 5IH2A 2IG0A 1X43A 4QKUA 4FT2A 1FYNA 4C0GA 4M75D 3V8KA 3VV0A 1M2VB 2B8AA 2DL5A 2RPNA 1GFDA 1Y71A 4M77C 2XIDA 3CC4Q 2PZ1A 1KQSA 2ZPGB 1NJIC 4AFQC 1M4ZA 3QDFA 2VGMA 3TQ7P 1VYUA 4E7JA 2RD1A 1ZBXA 5GAOl 2LZ6B 5I21A 2P4RA 2DNUA 1WX6A 2DL3A 3JV3A 3JCMd 3A1PA 2EQMA 2AIRB 5C0MA 2EYXA 3AHUA 4RTWA 1AWOA 2XMFA 4M7AC 5GAMd 1JU5C 2KXDA 4IUTA 1CKBA 1KC8C 4HKEA 3JCMQ 1GCPA 3M57A 1MNDA 1R0CB 2X35A 2G3RA 2KDSA 3M5AA 4PFOA 3HFNA 4ELZC 3C4SA 5FLXE 4C8QC 1O75A 3FJ5A 3RKXA 3TU4K 5LJ3f 4M7DB 3I56Q 2DXBA 1YJWA 2EGCA 3M53A 3PE0A 1M27C 3M4YA 2E5KA 2COYA 4RCBA 4Z89A 4OB2B 1QKXA 4WF2A 5I11A 3M0QA 2V26A 5CO7A 1Q86U 1XOVA 2W10A 5GAN4 1BIBA 3RNJA 4M7DF 4ZGJB 2CP2A 1JJ2A 3CC4A 1UEBA 5GANd 4BE0A 1M90C 2RMOA 3LH5A 3T9NA 1UGRB 4GBQA 4AFSC 2E70A 1E6HA 1Y57A 3A8OB 1K9MU 2IPOB 3M58A 1ABQA 3INZA 1YHQT 4JRKA 2C0IA 3P8BB 1KK7A 1MUZA 2AHJB 3OYKA 3JCMJ 2DZCA 1JXMA 3JB9H 3M54A 4J5YA 2C0OA 1IHVA 1VQMQ 5GAMe 4NL3A 4ZTJA 2CZ0B 2XI9A 3M0SA 3LWIA 2YLBA 4J9DA 4BE2A 4PJOB 4DOVA 3JCMh 1B3QA 5LJ3e 3I56A 2VKNA 4EIKA 2RA2A 1EZZB 2JT4A 2LDMA 5GAMh 5D7UA 2YHTA 3I55T 1GCQC 2DO3A 4L5GA 4PJOF 1RAAB 1JJ2S 2X4YA 4N0AC 2LRQA 4BY6B 3ZBDA 1H3ZA 3LGLA 1Y96A 2ZAEA 4MDWA 2DYBA 2M16A 1WJSA 2A3LA 3G7ZA 1GRIA 5GANe 1D1BA 4KRTA 4HCKA 3MEVA 2LT4A 2KEAA 1EIFA 2JJ9A 2ED1A 3HPWA 3JB9I 3HRUA 2HKQB 1KQ1A 1B34A 3UWNA 2DILA 1FMKA 2ROLA 3META 4BDZA 1QLYA 5GANh 2JTMA 1VQMA 2KE9A 4PJJA 4JJNK 1YCSB 3C12A 2GFAA 1OQKA 3VUBA 4A63B 1VQKT 5GMKi 4M78E 2FPEA 3FDRA 5LJ3j 4DQ2A 2FG0A 3E9GA 5KE3A 3FEOA 1XJWB 1NEGA 4LDXA 4XTXA 1PD0A 4BY6C 3QPHA 1Q95G 2E10A 2MWOA 4PKCC 1OULA 5IXFA 1NYGA 5AT1B 5FWBA 1I0CA 2P0QA 2MIOA 2HQEA 2AK5A 3EHRA 1Y96B 1YIJQ 1JJ2P 3CCSQ 2LVMA 2J6OA 2K3XA 4OP0A 3RMSA 2LTOA 3I5SA 2RH2A 5KCOA 2XU8A 2E3HA 2EQJA 3VYHB 2RQRA 3NTIA 1NLOC 3BY7A 3CD6Q 2KY9A 3CCJT 3M55A 3L2VA 4OB3B 4C92E 1JB0E 3RUXA 1S1NA 3FC3A 1IGUA 4EMGA 4DEXA 3VS5A 1NJIR 1B34B 2IVWA 4IKFA 2EJFA 3BFMA 3OYGA 1YJWT 2A36A 4IUVA 3OYFA 2QK0A 1WHHA 4F04B 3L2ZA 2QTXA 1I07A 2NWMA 3ZFJA 1QCNA 1HXDA 1O9SA 1UE9A 1VOMA 5KYUA 1RAEB 3RERA 1I5OB 2E12A 2RJEA 3SFMA 2DIGA 1KC8R 3EGUA 4D6WA 4D8DA 3G1JA 3EH1A 3OSSC 2CDTA 2DLPA 3QG1A 4JJBA 4O6JA 3CC4T 2L2PA 3P8HA 3JCMc 4C92D 1AZGB 2KT1A 4E6RA 2O9VA 1TS9A 1C0MA 2K2VA 5KE2A 2F5KA 1YIJA 3CCSA 2QQRA 3OQ5A 3WVEB 4N4IA 2NYSA 2LCCA 3F70A 1VQOQ 3ULRB 3C94A 4M75A 3OYDA 1ZBJA 3TEEA 4JS4A 3OA6A 3QKJA 3CD6A 4Z02A 4FM4B 4EDUA 1IRXA 2LC4A 1M90R 2DXTA 5IXBA 1OZ2A 4ELYC 3I56T 4C5IA 3KXTA 2RHXA 2DX1A 1SF9A 1ABOA 3D7SB 3X28B 1HSQA 2CH4A 3A8LB 4DBQA 4M75G 2VB6A 4IUUA 5FU6B 4KH0B 3J81E 2E65A 2HBPA 4DA4A 2CP3A 8ATCB 2F69A 2KNBB 1T3SA 3JAME 2GNCA 1Z9QA 2EGAA 1SRMA 1VQOA 1Q82U 4LNPA 2MAMA 2LX9A 4XU3A 2O88A 4RTYA 3UA6A 2RHYA 3QUIA 5AYFA 2EJGA 1AWJA 4XTWA 4XQ3A 1VIFA 1VQMT 4LDVA 3LH0A 4M75B 2A0FB 2RHIA 1VQ4Q 3VYGA 1GBRA 2QASA 4KGZB 1W2BA 1K8AC 2DPPB 2AZSA 2JOYA 2CT3A 1TG0A 4VUBA 2CS7A 1YNZA 1K0XA 4M75F 2DKGA 4JZ3A 1S72Q 2HDAA 4R55A 2PVDB 5J26A 2H3JA 2KRSA 1AVZC 1YJNQ 4PFZA 2ABLA 4PLIA 4N4GA 2KQWA 4RUGA 2HQXA 4OVAA 3N5BB 3JB9D 3M0PA 3J7AF 1UGSB 2DK3A 3QDRB 2HL5C 3DLLA 1YI2Q 1X2KA 2X4WA 2OAWA 3HKSA 1X27A 1QQJA 2BZ8A 3MP1A 2MOXA 2L3SA 2F5TX 2DL7A 3ZEHA 4M75C 3GLXA 1W2BS 1D1CA 4HXJA 1VQ4A 4DOWA 3E9FA 2D8JA 2M9UA 2RK1A 4CC7A 2LQ8A 1BI1A 2CSIA 1UJYA 1OYXA 3HTRA 1U06A 3SWNA 1KFZA 4Z88A 3HRTA 3EG2A 1S72A 5CKEA 3VU3C 3M9QA 4OMOA 1LNXA 4IIMA 3EGDA 3OW2A 1BCMA 1AHJB 2DTHA 2VVKA 3DKMA 1YJNA 4FU6A 5LJ5f 2RF0A 2QA4Q 2RHUA 1WXBA 4AFUC 3RKWA 2ZPEB 4HVUA 4KGXB 1V1CA 1WQ7A 1SHGA 2W0ZA 4F17A 1I1JA 1D09B 1BIAA 3S3MA 2LP5A 3CCST 2KK4A 4J6XA 4EMHA 3OMGA 1YI2A 2NUPA 2H3EB 2D9TA 1HK9A 2EW3A 4M77F 2RQWA 1NM7A 1XQHA 4HVWA 3CD6T 1NJIU 4XU0A 5L8RE 3X25B 5GAOr 4IIOA 2QGFB 4RTXA 2WSCE 1B07A 1BB9A 4ORZA 3ME9A 3OBWA 4EMKB 1VYTA 1K73C 4OMQA 3MCAB 3CBMA 2O4XA
chains in the Genus database with same CATH topology
3QWYA 4WCIA 1ZX6A 2HSPA 2A08A 2DBMA 1B3QA 2VKNA 3NHNA 1H92A 4EIKA 2DRKA 2LNHB 2JT4A 2KYBA 2EYWA 3KFVA 4LE9A 2D8HA 1T0HA 4F16A 4RTTA 1GCQC 2F2XA 1Z9ZA 2H8HA 2PNIA 4AFZC 1A0NB 1JXOA 2LJ3A 1Y0MA 5EC7A 1T0JA 3SEMA 2FRWA 2VWFA 4M4ZA 2DYBA 1NG2A 1T3LA 2JM9A 1ZSGA 1YWOA 2DE0X 2KBTA 2MCNA 2BZXA 1GRIA 1PRMC 3NPFA 4KRTA 2YT6A 1YWPA 4HCKA 2RNAA 3EG1A 2D0NA 2KGTA 1UFFA 1OOTA 2KEAA 1K76A 2ED1A 3VS0A 1TUDA 2LJ1A 2G6FX 2EBPA 2OI3A 3REBB 2DILA 1FMKA 2ROLA 4OMLA 2M51A 1QLYA 2O31A 4Y92A 1PRLC 1X2QA 1AEYA 2F2WA 2KE9A 2GGRA 2YUOA 1YCSB 2O2OA 3NGPA 1KSWA 2YSQA 1JEGA 3EHQA 2L0AA 3EG3A 2RQUA 4A63B 3VS2A 2JS0A 4J9FA 1QWFA 2LCSA 2EGEA 2FPEA 1K9AA 4DEYA 4D8KA 2EYZA 2FG0A 1RI9A 2D1XA 4GLMA 4RTVA 3UA7A 1NEGA 1PNJA 2YUQA 5IHNA 1UGVA 1QCFA 3VRZA 4ESRA 5IXFA 2J6FA 1M30A 1NYGA 1SPKA 5FWBA 1I0CA 5IHKA 2MIOA 2JMCA 2AK5A 4OMNA 3QWXX 3EHRA 4Z8AA 3I5RA 2J6OA 2JM8A 2X3XD 3I5SA 2LQNA 2DVJA 4J9CA 1M3BA 3VS7A 2RQRA 1NLOC 1M3CA 3THKA 1PWTA 3I35A 1PKTA 2JXBA 4X1VA 1G2BA 1S1NA 2J06A 3CQTA 2DM1A 3UATA 4DEXA 1ARKA 3VS5A 2CUDA 1X6BA 2KRNA 1SEMA 2A28A 2AKKA 2K9GA 4CC4B 5FW9A 2IIMA 1UECA 2A36A 1UG1A 4CC3A 2DF6A 2HBWA 4J9GA 4JJDA 1J3TA 1I07A 2NWMA 1X69A 1WYXA 4J9EA 3UF4A 1UE9A 1VA7A 2CUBA 2DL8A 3VS6A 2L3PA 2FO0A 2ROTA 1WIEA 2DBKA 2GQIA 1OV3A 2J6KA 2K3BA 3EGUA 2RQTA 4D8DA 1K4US 4JJBA 2CDTA 2DLPA 1YN8A 2L2PA 1QWEA 4AG1C 1X6GA 5GJWB 1AZGB 2KT1A 3REAB 2YUNA 4E6RA 2NUZA 3C0CA 2O9VA 4OMPA 2GBQA 2KRMA 4F14A 2EYYA 3VS3A 1BK2A 4ZNXA 2K2MA 3ULRB 1U5SA 2AKLA 3TVTA 1ZBJA 2AZVA 2DRMA 1OEBA 2FRYA 2JTEA 1AOJA 3IQLA 3I9QA 2FPDA 3H0HA 1WI7A 1ZUUA 4LUDA 2EQIA 1TUCA 1OPLA 1M8MA 2I0NA 2KR3A 1UTIA 2V1QA 3NMZC 2LMJA 3VS4A 3M0TA 5IXBA 1UDLA 2K6DA 1W70A 1JQQA 3H41A 4K11A 1H3HA 2EVRA 4RTUA 2FPFA 1K0SA 1W6XA 2DX1A 1ABOA 5IHIA 4LUEA 1AWXA 1ZUYA 2RQVA 1JO8A 5GJVB 1M3AA 2RN8A 1K1ZA 1HSQA 2CH4A 2SEMA 1E6GA 1SHFA 2KROA 3SHWA 1GL5A 1SSHA 2DMOA 2ECZA 1AZEA 3TSZA 1QKWA 1KJWA 2F2VA 2EPDA 1H8KA 1VYVA 4R0KA 2DJQA 5L23A 2BZYA 2J7IA 2DA9A 2DL4A 2KNBB 1T3SA 2GNCA 1Z9QA 2EGAA 2CSQA 3VRYA 1SRMA 1NYFA 2KT8A 1BBZA 4LNPA 1GBQA 2O88A 3M0UA 3GBQA 4RTYA 2JMAA 2SRCA 3UA6A 1YP5A 1WA7A 1RUWA 1AWJA 3H0FA 1RLQC 2JS2A 3ZL7C 1GBRA 1U3OA 2LX7A 2X3WD 1N5ZA 5FWCA 1WXTA 2AZSA 4HVVA 3RBBB 1NLPC 2ESWA 2CT3A 2HEQA 1TG0A 1UHCA 1PHTA 2GTJA 1YNZA 1E7OA 1PKSA 1K0XA 1GCQA 4JZ3A 1KIKA 2CH4W 3O5ZA 1ZLMA 3R6NA 2HDAA 5IH2A 4JZ4A 1X43A 1HJDA 2KRSA 1AVZC 1FYNA 2ABLA 1UHFA 1WLPB 4RUGA 2EKHA 1NEBA 4J9IA 2DL5A 3M0PA 2RPNA 1GFDA 3PVQA 2ENMA 5HCKA 2PZ1A 4AFQC 3M0RA 1VYUA 1X2KA 1BU1A 2GTOA 1LCKA 2OAWA 4JPBW 2LZ6B 1X27A 2BZ8A 2LJ0A 2DNUA 1WX6A 2DL3A 2P4RA 1OPKA 3JV3A 2ED0A 2MOXA 4LN2A 1UJ0A 2EYXA 2L3SA 2BTTA 2DL7A 4RTWA 1AWOA 2XMFA 2B86A 4J9BA 3VS1A 1JU5C 2HCKA 4HXJA 1HD3A 2KXDA 2D8JA 4J9HA 1CKBA 4CC7A 2V1RA 1GCPA 2CSIA 4RTZA 1UJYA 2M0YA 2FEIA 1U06A 1UUEA 1KFZA 3FJ5A 4Z88A 2YUPA 2J05A 3EG2A 2EGCA 3PE0A 1M27C 3PVLA 2E5KA 5ECAA 3U23A 1IO6A 4Z89A 4OMOA 1SRLA 3H0IA 1W1FA 1QKXA 4IIMA 5I11A 2L3QA 3M0QA 1AWWA 2VVKA 4QT7A 1XOVA 2RF0A 2W10A 2JW4A 1WXBA 3TSWA 4CC2A 2LQWA 4AFUC 5I22A 3RNJA 2YDLA 4HVUA 4AG2C 1GFCA 1ZUKA 2CT4A 4JJCA 1V1CA 2PTKA 1SHGA 2W0ZA 1CKAA 4F17A 1I1JA 2OJ2A 2K7AA 1RLPC 2LP5A 2RMOA 3LH5A 1CSKA 1EFNA 2O9SA 4GBQA 4AFSC 3A98A 1E6HA 1WXUA 1Y57A 2EW3A 2CREA 2KXCA 1MV0B 1MV3A 2RQWA 2C0TA 1NM7A 1ABQA 4HVWA 4OMMA 4FSSA 2C0IA 1G83A 1MUZA 1WDXA 1JXMA 2C0OA 4IIOA 4RTXA 2A37A 1B07A 1BB9A 4ORZA 2KYMA 1WFWA 2QDLA 3EG0A 2K79A 1VYTA 3M0SA 4J9DA 4OMQA 1AD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWY A;  4WCI A;  1ZX6 A;  2HSP A;  2A08 A;  2DBM A;  1B3Q A;  2VKN A;  3NHN A;  1H92 A;  4EIK A;  2DRK A;  2LNH B;  2JT4 A;  2KYB A;  2EYW A;  3KFV A;  4LE9 A;  2D8H A;  1T0H A;  4F16 A;  4RTT A;  1GCQ C;  2F2X A;  1Z9Z A;  2H8H A;  2PNI A;  4AFZ C;  1A0N B;  1JXO A;  2LJ3 A;  1Y0M A;  5EC7 A;  1T0J A;  3SEM A;  2FRW A;  2VWF A;  4M4Z A;  2DYB A;  1NG2 A;  1T3L A;  2JM9 A;  1ZSG A;  1YWO A;  2DE0 X;  2KBT A;  2MCN A;  2BZX A;  1GRI A;  1PRM C;  3NPF A;  4KRT A;  2YT6 A;  1YWP A;  4HCK A;  2RNA A;  3EG1 A;  2D0N A;  2KGT A;  1UFF A;  1OOT A;  2KEA A;  1K76 A;  2ED1 A;  3VS0 A;  1TUD A;  2LJ1 A;  2G6F X;  2EBP A;  2OI3 A;  3REB B;  2DIL A;  1FMK A;  2ROL A;  4OML A;  2M51 A;  1QLY A;  2O31 A;  4Y92 A;  1PRL C;  1X2Q A;  1AEY A;  2F2W A;  2KE9 A;  2GGR A;  2YUO A;  1YCS B;  2O2O A;  3NGP A;  1KSW A;  2YSQ A;  1JEG A;  3EHQ A;  2L0A A;  3EG3 A;  2RQU A;  4A63 B;  3VS2 A;  2JS0 A;  4J9F A;  1QWF A;  2LCS A;  2EGE A;  2FPE A;  1K9A A;  4DEY A;  4D8K A;  2EYZ A;  2FG0 A;  1RI9 A;  2D1X A;  4GLM A;  4RTV A;  3UA7 A;  1NEG A;  1PNJ A;  2YUQ A;  5IHN A;  1UGV A;  1QCF A;  3VRZ A;  4ESR A;  5IXF A;  2J6F A;  1M30 A;  1NYG A;  1SPK A;  5FWB A;  1I0C A;  5IHK A;  2MIO A;  2JMC A;  2AK5 A;  4OMN A;  3QWX X;  3EHR A;  4Z8A A;  3I5R A;  2J6O A;  2JM8 A;  2X3X D;  3I5S A;  2LQN A;  2DVJ A;  4J9C A;  1M3B A;  3VS7 A;  2RQR A;  1NLO C;  1M3C A;  3THK A;  1PWT A;  3I35 A;  1PKT A;  2JXB A;  4X1V A;  1G2B A;  1S1N A;  2J06 A;  3CQT A;  2DM1 A;  3UAT A;  4DEX A;  1ARK A;  3VS5 A;  2CUD A;  1X6B A;  2KRN A;  1SEM A;  2A28 A;  2AKK A;  2K9G A;  4CC4 B;  5FW9 A;  2IIM A;  1UEC A;  2A36 A;  1UG1 A;  4CC3 A;  2DF6 A;  2HBW A;  4J9G A;  4JJD A;  1J3T A;  1I07 A;  2NWM A;  1X69 A;  1WYX A;  4J9E A;  3UF4 A;  1UE9 A;  1VA7 A;  2CUB A;  2DL8 A;  3VS6 A;  2L3P A;  2FO0 A;  2ROT A;  1WIE A;  2DBK A;  2GQI A;  1OV3 A;  2J6K A;  2K3B A;  3EGU A;  2RQT A;  4D8D A;  1K4U S;  4JJB A;  2CDT A;  2DLP A;  1YN8 A;  2L2P A;  1QWE A;  4AG1 C;  1X6G A;  5GJW B;  1AZG B;  2KT1 A;  3REA B;  2YUN A;  4E6R A;  2NUZ A;  3C0C A;  2O9V A;  4OMP A;  2GBQ A;  2KRM A;  4F14 A;  2EYY A;  3VS3 A;  1BK2 A;  4ZNX A;  2K2M A;  3ULR B;  1U5S A;  2AKL A;  3TVT A;  1ZBJ A;  2AZV A;  2DRM A;  1OEB A;  2FRY A;  2JTE A;  1AOJ A;  3IQL A;  3I9Q A;  2FPD A;  3H0H A;  1WI7 A;  1ZUU A;  4LUD A;  2EQI A;  1TUC A;  1OPL A;  1M8M A;  2I0N A;  2KR3 A;  1UTI A;  2V1Q A;  3NMZ C;  2LMJ A;  3VS4 A;  3M0T A;  5IXB A;  1UDL A;  2K6D A;  1W70 A;  1JQQ A;  3H41 A;  4K11 A;  1H3H A;  2EVR A;  4RTU A;  2FPF A;  1K0S A;  1W6X A;  2DX1 A;  1ABO A;  5IHI A;  4LUE A;  1AWX A;  1ZUY A;  2RQV A;  1JO8 A;  5GJV B;  1M3A A;  2RN8 A;  1K1Z A;  1HSQ A;  2CH4 A;  2SEM A;  1E6G A;  1SHF A;  2KRO A;  3SHW A;  1GL5 A;  1SSH A;  2DMO A;  2ECZ A;  1AZE A;  3TSZ A;  1QKW A;  1KJW A;  2F2V A;  2EPD A;  1H8K A;  1VYV A;  4R0K A;  2DJQ A;  5L23 A;  2BZY A;  2J7I A;  2DA9 A;  2DL4 A;  2KNB B;  1T3S A;  2GNC A;  1Z9Q A;  2EGA A;  2CSQ A;  3VRY A;  1SRM A;  1NYF A;  2KT8 A;  1BBZ A;  4LNP A;  1GBQ A;  2O88 A;  3M0U A;  3GBQ A;  4RTY A;  2JMA A;  2SRC A;  3UA6 A;  1YP5 A;  1WA7 A;  1RUW A;  1AWJ A;  3H0F A;  1RLQ C;  2JS2 A;  3ZL7 C;  1GBR A;  1U3O A;  2LX7 A;  2X3W D;  1N5Z A;  5FWC A;  1WXT A;  2AZS A;  4HVV A;  3RBB B;  1NLP C;  2ESW A;  2CT3 A;  2HEQ A;  1TG0 A;  1UHC A;  1PHT A;  2GTJ A;  1YNZ A;  1E7O A;  1PKS A;  1K0X A;  1GCQ A;  4JZ3 A;  1KIK A;  2CH4 W;  3O5Z A;  1ZLM A;  3R6N A;  2HDA A;  5IH2 A;  4JZ4 A;  1X43 A;  1HJD A;  2KRS A;  1AVZ C;  1FYN A;  2ABL A;  1UHF A;  1WLP B;  4RUG A;  2EKH A;  1NEB A;  4J9I A;  2DL5 A;  3M0P A;  2RPN A;  1GFD A;  3PVQ A;  2ENM A;  5HCK A;  2PZ1 A;  4AFQ C;  3M0R A;  1VYU A;  1X2K A;  1BU1 A;  2GTO A;  1LCK A;  2OAW A;  4JPB W;  2LZ6 B;  1X27 A;  2BZ8 A;  2LJ0 A;  2DNU A;  1WX6 A;  2DL3 A;  2P4R A;  1OPK A;  3JV3 A;  2ED0 A;  2MOX A;  4LN2 A;  1UJ0 A;  2EYX A;  2L3S A;  2BTT A;  2DL7 A;  4RTW A;  1AWO A;  2XMF A;  2B86 A;  4J9B A;  3VS1 A;  1JU5 C;  2HCK A;  4HXJ A;  1HD3 A;  2KXD A;  2D8J A;  4J9H A;  1CKB A;  4CC7 A;  2V1R A;  1GCP A;  2CSI A;  4RTZ A;  1UJY A;  2M0Y A;  2FEI A;  1U06 A;  1UUE A;  1KFZ A;  3FJ5 A;  4Z88 A;  2YUP A;  2J05 A;  3EG2 A;  2EGC A;  3PE0 A;  1M27 C;  3PVL A;  2E5K A;  5ECA A;  3U23 A;  1IO6 A;  4Z89 A;  4OMO A;  1SRL A;  3H0I A;  1W1F A;  1QKX A;  4IIM A;  5I11 A;  2L3Q A;  3M0Q A;  1AWW A;  2VVK A;  4QT7 A;  1XOV A;  2RF0 A;  2W10 A;  2JW4 A;  1WXB A;  3TSW A;  4CC2 A;  2LQW A;  4AFU C;  5I22 A;  3RNJ A;  2YDL A;  4HVU A;  4AG2 C;  1GFC A;  1ZUK A;  2CT4 A;  4JJC A;  1V1C A;  2PTK A;  1SHG A;  2W0Z A;  1CKA A;  4F17 A;  1I1J A;  2OJ2 A;  2K7A A;  1RLP C;  2LP5 A;  2RMO A;  3LH5 A;  1CSK A;  1EFN A;  2O9S A;  4GBQ A;  4AFS C;  3A98 A;  1E6H A;  1WXU A;  1Y57 A;  2EW3 A;  2CRE A;  2KXC A;  1MV0 B;  1MV3 A;  2RQW A;  2C0T A;  1NM7 A;  1ABQ A;  4HVW A;  4OMM A;  4FSS A;  2C0I A;  1G83 A;  1MUZ A;  1WDX A;  1JXM A;  2C0O A;  4IIO A;  4RTX A;  2A37 A;  1B07 A;  1BB9 A;  4ORZ A;  2KYM A;  1WFW A;  2QDL A;  3EG0 A;  2K79 A;  1VYT A;  3M0S A;  4J9D A;  4OMQ A;  1AD5 A; 
#chains in the Genus database with same CATH topology
 1WQW A;  3H6Z A;  4JLI A;  2A08 A;  1W2B P;  4M78 A;  3OW2 S;  4FCY A;  2KYB A;  1KC8 U;  4LE9 A;  4F16 A;  3EAE A;  3SWN B;  1UB4 A;  1MGQ A;  3MJX A;  2RJD A;  1MMA A;  2PNI A;  3BDU A;  4C8Q F;  2DD4 A;  4AFZ C;  5LJ5 e;  2QA4 A;  3VKI A;  2LJ3 A;  1Y0M A;  1T0J A;  5J3B A;  3SEM A;  4BDY A;  2FRW A;  2VWF A;  4M4Z A;  1NG2 A;  5GAO m;  1FMV A;  1ZSG A;  1TSF A;  4LD9 K;  2KBT A;  3H9N A;  1IRE B;  2MCN A;  3NPF A;  1VQO T;  2KGT A;  2V8K A;  5IN1 A;  1M2O A;  4FYW B;  3VUZ A;  1UFF A;  4ANJ A;  3QXE B;  5DY9 A;  4M78 G;  4HCB A;  2LJ1 A;  2CZ6 B;  2NUP B;  4PK4 A;  1VQ9 Q;  4XAX B;  4X9C A;  1M90 U;  3REB B;  4C92 A;  1NPP A;  3BE3 A;  4IUQ A;  2DAQ A;  1U8R A;  2O31 A;  1ZSZ A;  4Y92 A;  4RCC A;  4A4G A;  4EMK C;  3P8D A;  5LJ3 d;  2YUO A;  2LQK A;  4C5G A;  2YSQ A;  2OTJ Q;  1TU0 B;  2X51 A;  3VS2 A;  3EGX A;  4J9F A;  2QGG A;  2O4X B;  3FIF A;  3SWN C;  1K9A A;  3SDZ A;  1TXQ A;  1UGQ B;  2K4Y A;  5A0L A;  4M78 B;  4MZP A;  1RI9 A;  1Y07 A;  2D1X A;  4PJM A;  4RTV A;  1KD1 C;  1ZQ1 A;  1YJ9 T;  4C92 G;  4JDS A;  3OYM A;  1K8A R;  3OW2 P;  1QCF A;  1U1T A;  1M30 A;  1I5L A;  5LJ5 j;  4HCC A;  2JMC A;  2VAS A;  1M1F A;  4Z8A A;  4KT0 E;  4M78 F;  2CP7 A;  3JCM g;  1YBY A;  1V29 B;  4J9C A;  1IB8 A;  2L3R A;  3VS7 A;  4PJL A;  1Q82 R;  1VQ9 A;  5GAM g;  3THK A;  3WXM B;  1VQ8 Q;  3G71 Q;  1VQ4 T;  4II1 A;  2R5A A;  3MKD A;  4J6W A;  2HD0 A;  1VQL Q;  1NE8 A;  2JZ2 A;  4C92 B;  2CUD A;  1X6B A;  2KRN A;  1ZSZ B;  3DB3 A;  4FIB A;  2OTJ A;  2A28 A;  2AKK A;  2K9G A;  2QAZ A;  4CC4 B;  5FW9 A;  2IIM A;  3CMA T;  3V7S A;  1UG1 A;  1S72 T;  4CC3 A;  2JN0 A;  4J9G A;  2EYQ A;  3FB9 A;  4JJD A;  2QDY B;  1R8O B;  4J9E A;  3UF4 A;  1VA7 A;  4M78 C;  2PUK B;  3L2R A;  1BCO A;  3EGX B;  2Y4Y A;  2ZPF B;  2FO0 A;  5LJ3 h;  3CCU Q;  1PM3 A;  1KHI A;  4YTL A;  2RJC A;  5GAN g;  5GMK e;  5D6W A;  1X6G A;  3OYJ A;  5GJW B;  3MPU B;  5GAN 2;  1YI2 T;  2NUZ A;  3C0C A;  2FZC B;  2V8J A;  2KRM A;  2CP6 A;  2EIF A;  1G3S A;  1OX9 A;  4PLL A;  1WHG A;  4ZNX A;  2QYZ A;  4RG8 A;  1ACM B;  3LLR A;  3CME Q;  3E1S A;  2LCL A;  3OYH A;  4XU1 A;  3EFR A;  1D3B A;  4FYV B;  5CKF A;  2FPD A;  1VQ8 A;  3G71 A;  4BE1 A;  3H0H A;  1I8F A;  1Q81 C;  1WI7 A;  1ZUU A;  4LUD A;  1D1A A;  4WTO B;  1VQL A;  4C92 C;  4JUV A;  2XHC A;  3VS4 A;  3CC7 Q;  1UDL A;  1ZSZ C;  4J7F A;  1QVG A;  3M56 A;  2R57 A;  4K11 A;  2MWP A;  2KSS A;  2F1L A;  2P0P A;  4M7D E;  1W6X A;  3PT9 A;  3CPW A;  2EQK A;  1EX4 A;  5IHI A;  5FRM A;  3CCR Q;  2XKO C;  1ZUY A;  1JO8 A;  2R58 A;  5GJV B;  2X9H A;  3L2W A;  2RN8 A;  2SEM A;  1K1Z A;  3OY9 A;  1SHF A;  3SHW A;  2VXE A;  1W4S A;  2DMO A;  2ECZ A;  3CCU A;  1TOV A;  4J7I A;  3TSZ A;  1QKW A;  1KJW A;  4A4K A;  1K73 R;  1H8K A;  1VYV A;  4R0K A;  4C5H A;  2COW A;  5GMK j;  3CPF A;  2E5Q A;  4UC4 A;  4XTU A;  2CSQ A;  3VRY A;  1VQN Q;  1NYF A;  2HKN A;  3CME A;  3OYL A;  5FRN A;  2HMA A;  4M7D D;  1Q7Y C;  3M0U A;  3GBQ A;  2SRC A;  4BAC A;  3EH2 A;  1BI0 A;  1NPR A;  2EAY A;  3S6W A;  3A8G B;  1BI3 A;  3BDL A;  3LW5 E;  1B7T A;  1M1G A;  4QQ6 A;  1QVG S;  1RLQ C;  3QO3 A;  9ATC B;  3CC7 A;  1D3B B;  3LGF A;  3QSU A;  5D6X A;  4PJO E;  3CPW S;  2JTF A;  1D0Z A;  3RBB B;  3L2Q A;  2HEQ A;  2M02 A;  1PHT A;  3A8H B;  1E7O A;  1PKS A;  2DIQ A;  2P0K A;  5KYY A;  2QI2 A;  3CCR A;  3R6N A;  4FSX A;  3CCM Q;  4ATO A;  2JUF A;  1HJD A;  2DEU A;  5GMK l;  4E7L A;  3Q1J A;  3PIP A;  1UHF A;  1WLP B;  4RG2 A;  1NEB A;  2XDD A;  4J9I A;  4KH1 B;  1FWZ A;  4CRI A;  3HP9 A;  5HCK A;  2K3Y A;  4ME7 A;  3ASK A;  2VGN A;  3PIO A;  3L42 A;  1SG5 A;  2MPX C;  1C6V X;  1VQN A;  4PJO D;  2GTO A;  1LCK A;  3JCM X;  4MMK A;  1VQ9 T;  3OYE A;  2DJZ A;  2QQS A;  1OPK A;  2K57 A;  1KD1 R;  2ED0 A;  2MI6 A;  4LN2 A;  1UJ0 A;  1QW1 A;  2B86 A;  3VS1 A;  2QQB A;  2HCK A;  1WPY A;  4E7Z A;  3E19 A;  2DFU A;  4XTZ A;  4NS5 A;  3OYN A;  3JCM W;  2M0Y A;  1YCY A;  3JCM V;  2FEI A;  2RI3 A;  4KUI A;  2NUT A;  2YUP A;  1QVG P;  2YRD A;  2EWN A;  5C6S A;  2XG8 D;  1ZA2 B;  4JLG A;  3JCM b;  1G5V A;  4LDW A;  4XU2 A;  4HT9 A;  1N27 A;  1IO6 A;  2L89 A;  3H0I A;  1K8A U;  1W1F A;  3CPW P;  3CCM A;  1FXX A;  4BUG A;  2L3Q A;  1AWW A;  3V8J A;  5I2S A;  5KYU B;  5KYY B;  3TSW A;  5I22 A;  1IHW A;  2DEQ A;  2YDL A;  1VQP Q;  3X26 B;  4AG2 C;  1GFC A;  1U1S A;  3NFC A;  5CKH A;  2PTK A;  3JRZ A;  2OJ2 A;  2K7A A;  2CKK A;  1EFN A;  2O9S A;  3G6E Q;  1OU8 A;  1WXU A;  3S3N A;  2CRE A;  2KXC A;  1MV0 B;  1MV3 A;  1KQ2 A;  3QJ6 A;  4PL6 A;  1G83 A;  1VQ8 T;  3G71 T;  2P84 A;  1JRI A;  1IXD A;  5LL6 S;  1VQL T;  1VQ7 Q;  5GAN 6;  1G3Y A;  3EFO A;  1WFW A;  3EG0 A;  2K79 A;  3CXC S;  4R56 A;  1WNL A;  3R6O A;  4J6Y A;  1AD5 A;  1X6O A;  3QWY A;  2Z0W A;  2HSP A;  3CCQ Q;  2FB7 A;  2YLC A;  3MEA A;  1M1K C;  1H92 A;  1MNE A;  4OB0 B;  4V2S A;  2DRK A;  6AT1 B;  2EYW A;  3KFV A;  2DD5 A;  3WVD B;  4BI3 A;  5HY6 A;  2LNV A;  5HK0 A;  4RTT A;  2NUT B;  2F2X A;  1Z9Z A;  4Y91 A;  2H8H A;  2RB6 A;  3CCE Q;  2D0Q B;  1A0N B;  1JXO A;  1VQP A;  2V8I A;  1YIT Q;  2FHD A;  4E47 A;  2JVV A;  1IGQ A;  2HAX A;  1QP3 A;  4Q5W A;  2RNA A;  3CME T;  3HSB A;  3G6E A;  3M4G A;  1K76 A;  1VIE A;  5J39 A;  4DBH A;  1LVK A;  3S3O A;  4F7U E;  2EBP A;  2KI7 A;  1SKU B;  4J83 A;  3DLM A;  4OML A;  1VQ7 A;  2BE9 B;  3V7C A;  3CC7 T;  1AEY A;  2FYK A;  1OI1 A;  1JBM A;  2HNI A;  1C1A A;  2F2W A;  5GAO q;  4A4E A;  1JEG A;  3CC2 Q;  1LPL A;  4FYY B;  2XIC A;  2BE7 D;  3CCQ A;  2L0A A;  7AT1 B;  3CCR T;  3EFO B;  4KGV B;  4FYX B;  4JRI A;  5LJ5 d;  3HHT B;  2LCS A;  2EGE A;  4MZT A;  1K73 U;  4BI4 A;  4DEY A;  1I81 A;  4RKU E;  3LX7 A;  2EYZ A;  4D8K A;  1PC0 A;  1G3W A;  4IUP A;  5FU7 B;  1M2V A;  2L8D A;  4OF1 A;  3CCE A;  3LYI A;  2YUQ A;  2GQV A;  2RO0 A;  1M9S A;  1XTD A;  1YIJ T;  2ZPB B;  1SSF A;  4ESR A;  1YIT A;  3FRN A;  1QVF S;  4QW2 A;  1SPK A;  4ZGE B;  1V76 A;  4OMN A;  3CCL Q;  1VQN T;  3QWX X;  2MMP A;  5GAN 5;  1QVP A;  1WHL A;  2WAC A;  2COZ A;  2K5I A;  3PNW C;  4GLK A;  2LQN A;  2YWW A;  5EG2 A;  1M3B A;  3QII A;  2DTI A;  1M3C A;  2Y90 A;  1PWT A;  1TWB A;  2JXB A;  4B9W A;  1IZ6 A;  1G2B A;  1ZHI A;  5CVI A;  4A54 A;  3CQT A;  3UAT A;  5DM7 R;  1ARK A;  2GF7 A;  5KYN A;  1XNI A;  2XDP A;  2KMT A;  3CCJ Q;  3CC2 A;  4M7D A;  1UEC A;  2JNG A;  1PG5 B;  1FMW A;  2CGH A;  4AT1 B;  4KUD K;  2DF6 A;  2HBW A;  2EFI A;  3MP6 A;  3CCM T;  1N8R C;  1J3T A;  1X69 A;  1Y7X A;  4DBF A;  5FU7 C;  2DL8 A;  3VS6 A;  2L3P A;  3EGD B;  2ROT A;  1WIE A;  2DBK A;  1OV3 A;  2K3B A;  1K4U S;  1QWE A;  4AG1 C;  5GAN 7;  5HK3 A;  2AT1 B;  5KYX A;  3CCL A;  2E64 A;  5LJ5 h;  2EYY A;  3BW1 A;  1KD1 U;  3FLG A;  3VS3 A;  1PSE A;  1BK2 A;  3CEY A;  4M7D G;  4EPC A;  3GF5 A;  1U5S A;  3TVT A;  1YFN A;  1QVF P;  2AZV A;  2DRM A;  1OEB A;  2Y4X A;  3PTA A;  3IQL A;  4LD6 A;  5CK9 A;  3AT1 B;  2C06 A;  4E7K A;  2EQI A;  2QG9 B;  1TUC A;  3G4S Q;  5KCH A;  4ZN1 A;  2MYS A;  2RHZ A;  3JCM f;  1M8M A;  2KR3 A;  1UTI A;  3NMZ C;  4PJO A;  3M0T A;  2MF2 A;  1N9S A;  5GAM f;  1PD1 A;  3CCJ A;  3RES A;  3H41 A;  1H3H A;  2OTL Q;  4XK8 E;  2EVR A;  4C0D B;  1K0S A;  4BD3 A;  2YRC A;  3QZ5 B;  4PNO A;  4LUE A;  1AWX A;  1LJO A;  2EKO A;  2RQV A;  2A7Y A;  1M3A A;  5KH6 A;  2WSE E;  3O8V A;  2KRO A;  1GL5 A;  4A4F A;  2MK5 A;  1VQP T;  4NL2 A;  4M77 E;  4JRP A;  4E2F B;  2RM4 A;  1WZO A;  2EQU A;  3VJP A;  2DJQ A;  5L23 A;  1KQS S;  3GIB A;  4PJO G;  3G6E T;  2DA9 A;  2M0O A;  1M1K R;  2K5L A;  4X34 A;  5GAO p;  5GAN f;  1N6A A;  3OBY A;  2CP5 A;  4B6M A;  5KYX B;  5GAO n;  4NOY A;  4BB7 A;  1GBQ A;  3URG A;  4M7A E;  1VQ7 T;  3MEW A;  3OYB A;  1YP5 A;  1WJQ A;  5I2M A;  2DER A;  3G4S A;  5LJ3 g;  4A53 A;  3CBP A;  3ZL7 C;  3JCM e;  2HSE B;  1U3O A;  2X3W D;  4M77 D;  5IAY A;  3CCQ T;  1N5Z A;  4C8Q E;  1WXT A;  1NLP C;  4C0D C;  2OTL A;  1Q86 C;  1VQ5 Q;  1PCX A;  1Q81 U;  3GNF B;  1BI2 A;  4IUR A;  1YJN T;  4C92 F;  1KIK A;  4M7D C;  5M9O A;  3O5Z A;  1ZLM A;  4P5N A;  3CCE T;  1M8V A;  1VUB A;  2DXC A;  3X24 B;  4JZ4 A;  2QEX Q;  3KBG A;  1YIT T;  2EKH A;  4M7A D;  3FJP A;  5A0G A;  1K9M C;  3PVQ A;  3JB9 J;  2ENM A;  3OB9 A;  1DJ7 B;  1X75 C;  3M0R A;  4QQD A;  2E3I A;  1TH7 A;  3OYC A;  2VC8 A;  3RMQ A;  5GMK h;  1BU1 A;  4C8Q D;  2P4T A;  4JPB W;  4A4H A;  2LJ0 A;  4DBR A;  3OS1 A;  1KQS P;  4QVD A;  2BTT A;  3CCV Q;  2FZG B;  3UDC A;  4J9B A;  2OX7 A;  4MDX A;  3UPU A;  1HD3 A;  4J9H A;  3CC2 T;  1G8X A;  1RAG B;  2V1R A;  2QQA A;  4L6V 5;  5DLQ E;  1Q7Y U;  4RTZ A;  3OSV A;  2RI5 A;  1UUE A;  1VQ5 A;  4PJO C;  2OAU A;  2VYT A;  1FX7 A;  2E6N A;  4E7H A;  5GAM j;  3MEU A;  2J05 A;  2QA4 T;  3JB9 G;  1BYM A;  5ECA A;  3PVL A;  3U23 A;  4LDY A;  1SRL A;  8AT1 B;  1WHK A;  2QEX A;  2ZZD A;  4QT7 A;  3MP8 A;  4B9X A;  1RAH B;  3PGG A;  5KYW A;  2JW4 A;  3RKY A;  4CC2 A;  2LQW A;  5CAI A;  1ZUK A;  2CT4 A;  4JJC A;  3M59 A;  5A2Q E;  3CCL T;  1P92 A;  1CKA A;  4FW1 A;  3GNG A;  5DLO A;  2XK0 A;  1LOJ A;  1RLP C;  5GAN 8;  2RI2 A;  1CSK A;  1N8R R;  3A98 A;  1RAI B;  1VQ6 Q;  2C0T A;  4F7U A;  4OMM A;  4FSS A;  1TUG B;  1N9R A;  4ZN3 A;  5CKD A;  5GAN j;  1WDX A;  3CCV A;  2DXU A;  1RL2 A;  2A37 A;  4KUL A;  4M78 D;  3CBO A;  3PFS A;  4O5V A;  2BKD N;  4J8O A;  2KYM A;  1QCO A;  2QDL A;  2E6Z A;  1HYO A;  2D6F A;  1R0B G;  4MZM A;  4WCI A;  3NTK A;  3JB9 F;  1ZX6 A;  2BUD A;  3DB4 A;  2QTV A;  5GMK m;  5IT9 E;  2PVO B;  2DBM A;  2GFU A;  3NHN A;  3JCM P;  2LNH B;  4OMF B;  1NBE B;  2D8H A;  1QMC A;  1T0H A;  4F7U G;  3V7R A;  4JRQ A;  2ZGW A;  2YXY A;  1MMD A;  2QXF A;  2PQW A;  2ZPH B;  5EC7 A;  1D0X A;  4C5E A;  2DZ9 A;  3X20 B;  1T3L A;  2JM9 A;  1YWO A;  1PSF A;  2DE0 X;  5KYW B;  2PU9 B;  2BZX A;  2YRV A;  1PRM C;  1KHC A;  2YT6 A;  1YWP A;  2DTO A;  3EG1 A;  4RMO A;  2D0N A;  3EFS A;  4OGC A;  5A0D A;  4XTY A;  2FVU A;  1NZ9 A;  3OS5 A;  1OOT A;  2FL7 A;  3QBY A;  4ZGD B;  1VQ6 A;  4AMC A;  2M1H A;  3VS0 A;  5CCA A;  1TUD A;  2G6F X;  2OI3 A;  3L1A A;  2FZK B;  4E7S A;  3G4S T;  1RAF B;  4C0Z A;  2M51 A;  2CZ7 B;  1PRL C;  2OTJ T;  4F7U B;  1X2Q A;  4L59 A;  3RR6 A;  3GPL A;  2LT1 A;  2GGR A;  3OMC A;  2O2O A;  3NGP A;  2VXF A;  1KSW A;  3CXC A;  2HL3 A;  2VV5 A;  2OTL T;  2BIV A;  3PMT A;  3EHQ A;  4E7I A;  3SB2 A;  3EG3 A;  2RQU A;  3V8L A;  2JS0 A;  3KUF A;  3EG9 A;  1QWF A;  4HCZ A;  3HFO A;  4F7U F;  1WGS A;  3LWH A;  4KBM B;  4GLM A;  3UA7 A;  3HRS A;  1PNJ A;  3OYI A;  2PVG B;  1AT1 B;  1M1K U;  1BKB A;  2DVE A;  2K5F A;  5IHN A;  1UGV A;  1WHM A;  3VRZ A;  2DYI A;  1MHN A;  2J6F A;  1RI0 A;  1Q86 R;  3E2U A;  2I2L A;  5IHK A;  4CI0 C;  2CP0 A;  1YJ9 Q;  3I5R A;  3A8M B;  3ER0 A;  2JM8 A;  5FRO A;  2X3X D;  1WJR A;  3MHX A;  1KG1 A;  2DVJ A;  4FW2 A;  2RK2 A;  3HL8 A;  4TVR A;  4JS5 A;  1YHQ Q;  3I35 A;  1TTH B;  1PKT A;  4QQG A;  4X1V A;  1K9M R;  2J06 A;  2E4H A;  2DM1 A;  2QQ9 A;  4Y28 E;  1F1B B;  1D0Y A;  3SD4 A;  2E41 A;  1VQ5 T;  1ZA1 B;  2E1H A;  3TRE A;  3QZ9 B;  1SEM A;  3OYY A;  1QP2 A;  1Q81 R;  3CCU T;  5CR2 A;  1R77 A;  2QEX T;  1WYX A;  3CMA Q;  2PUO B;  2CUB A;  4M77 A;  3EG9 B;  1MMN A;  2RJF A;  3I55 Q;  3GP8 A;  2GQI A;  5FU6 C;  2J6K A;  2RQT A;  4MML A;  1UGP B;  1YN8 A;  1Q82 C;  2HZY A;  1MMG A;  3OS2 A;  1OX8 A;  1G3T A;  2O01 E;  1QVF A;  3REA B;  2YUN A;  4N4H A;  4OMP A;  3GOX A;  2GBQ A;  4FT4 A;  1YJ9 A;  4F14 A;  3A5Z B;  2K2M A;  1I4K 1;  2X4X A;  4QVC A;  4HA8 A;  2AKL A;  4M7A A;  2XDB A;  3CCV T;  1RAC B;  2FRY A;  2JTE A;  1YHQ A;  3OS0 A;  1AOJ A;  4BI8 B;  3I9Q A;  4XTV A;  2X4J A;  5CKB A;  1OPL A;  4M77 G;  2I0N A;  4EMK A;  2V1Q A;  4FL6 A;  2LMJ A;  5HKC A;  4C8Q A;  2K6D A;  1H64 1;  5CIU A;  2R5M A;  1W70 A;  1JQQ A;  4OGE A;  1Q7Y R;  3H8Z A;  4RTU A;  2FPF A;  3CXC P;  4C0F A;  1GXI E;  4LXC A;  1VQK Q;  4QVZ A;  3CMA A;  3L2U A;  1E6G A;  3NTH A;  4GY5 A;  4M7A G;  2HQH A;  3I55 A;  2ATC B;  3OYA A;  1SSH A;  2KVQ G;  2NLU A;  1AZE A;  2F2V A;  5D6Y A;  1OZ3 A;  2WSF E;  1N8R U;  2EPD A;  4M77 B;  4PFP A;  1X01 A;  2BZY A;  3UT1 A;  2VUB A;  2J7I A;  3RIR A;  4C8Q G;  2DL4 A;  3RDV A;  1RAD B;  1VQ6 T;  3J80 E;  4OB1 B;  2KT8 A;  1BBZ A;  3QJY A;  3C95 A;  5CQY A;  4M75 E;  2XD0 A;  4HT8 A;  2JMA A;  3PMI A;  1WA7 A;  1RUW A;  2ZPI B;  2DET A;  3H0F A;  4M7A B;  4LDU A;  2JS2 A;  1RAB B;  3QYH B;  2CYZ B;  3MO8 A;  2CZ1 B;  3QHS A;  1WHJ A;  4ZTF A;  2LX7 A;  4X9D A;  3TCJ A;  2GCX A;  1M5Q 1;  5FWC A;  4HVV A;  2ESW A;  2EJ9 A;  2KAF A;  1OU9 A;  1UHC A;  5LJ5 g;  2GTJ A;  1GCQ A;  4C8Q B;  1YJW Q;  4PJN A;  4M7A F;  1VQK A;  2CH4 W;  2L5Q A;  2ZCF B;  5CQX A;  3JSC A;  5GAN 3;  3QYG B;  4N0A A;  5IH2 A;  2IG0 A;  1X43 A;  4QKU A;  4FT2 A;  1FYN A;  4C0G A;  4M75 D;  3V8K A;  3VV0 A;  1M2V B;  2B8A A;  2DL5 A;  2RPN A;  1GFD A;  1Y71 A;  4M77 C;  2XID A;  3CC4 Q;  2PZ1 A;  1KQS A;  2ZPG B;  1NJI C;  4AFQ C;  1M4Z A;  3QDF A;  2VGM A;  3TQ7 P;  1VYU A;  4E7J A;  2RD1 A;  1ZBX A;  5GAO l;  2LZ6 B;  5I21 A;  2P4R A;  2DNU A;  1WX6 A;  2DL3 A;  3JV3 A;  3JCM d;  3A1P A;  2EQM A;  2AIR B;  5C0M A;  2EYX A;  3AHU A;  4RTW A;  1AWO A;  2XMF A;  4M7A C;  5GAM d;  1JU5 C;  2KXD A;  4IUT A;  1CKB A;  1KC8 C;  4HKE A;  3JCM Q;  1GCP A;  3M57 A;  1MND A;  1R0C B;  2X35 A;  2G3R A;  2KDS A;  3M5A A;  4PFO A;  3HFN A;  4ELZ C;  3C4S A;  5FLX E;  4C8Q C;  1O75 A;  3FJ5 A;  3RKX A;  3TU4 K;  5LJ3 f;  4M7D B;  3I56 Q;  2DXB A;  1YJW A;  2EGC A;  3M53 A;  3PE0 A;  1M27 C;  3M4Y A;  2E5K A;  2COY A;  4RCB A;  4Z89 A;  4OB2 B;  1QKX A;  4WF2 A;  5I11 A;  3M0Q A;  2V26 A;  5CO7 A;  1Q86 U;  1XOV A;  2W10 A;  5GAN 4;  1BIB A;  3RNJ A;  4M7D F;  4ZGJ B;  2CP2 A;  1JJ2 A;  3CC4 A;  1UEB A;  5GAN d;  4BE0 A;  1M90 C;  2RMO A;  3LH5 A;  3T9N A;  1UGR B;  4GBQ A;  4AFS C;  2E70 A;  1E6H A;  1Y57 A;  3A8O B;  1K9M U;  2IPO B;  3M58 A;  1ABQ A;  3INZ A;  1YHQ T;  4JRK A;  2C0I A;  3P8B B;  1KK7 A;  1MUZ A;  2AHJ B;  3OYK A;  3JCM J;  2DZC A;  1JXM A;  3JB9 H;  3M54 A;  4J5Y A;  2C0O A;  1IHV A;  1VQM Q;  5GAM e;  4NL3 A;  4ZTJ A;  2CZ0 B;  2XI9 A;  3M0S A;  3LWI A;  2YLB A;  4J9D A;  4BE2 A;  4PJO B;  4DOV A;  3JCM h;  1B3Q A;  5LJ3 e;  3I56 A;  2VKN A;  4EIK A;  2RA2 A;  1EZZ B;  2JT4 A;  2LDM A;  5GAM h;  5D7U A;  2YHT A;  3I55 T;  1GCQ C;  2DO3 A;  4L5G A;  4PJO F;  1RAA B;  1JJ2 S;  2X4Y A;  4N0A C;  2LRQ A;  4BY6 B;  3ZBD A;  1H3Z A;  3LGL A;  1Y96 A;  2ZAE A;  4MDW A;  2DYB A;  2M16 A;  1WJS A;  2A3L A;  3G7Z A;  1GRI A;  5GAN e;  1D1B A;  4KRT A;  4HCK A;  3MEV A;  2LT4 A;  2KEA A;  1EIF A;  2JJ9 A;  2ED1 A;  3HPW A;  3JB9 I;  3HRU A;  2HKQ B;  1KQ1 A;  1B34 A;  3UWN A;  2DIL A;  1FMK A;  2ROL A;  3MET A;  4BDZ A;  1QLY A;  5GAN h;  2JTM A;  1VQM A;  2KE9 A;  4PJJ A;  4JJN K;  1YCS B;  3C12 A;  2GFA A;  1OQK A;  3VUB A;  4A63 B;  1VQK T;  5GMK i;  4M78 E;  2FPE A;  3FDR A;  5LJ3 j;  4DQ2 A;  2FG0 A;  3E9G A;  5KE3 A;  3FEO A;  1XJW B;  1NEG A;  4LDX A;  4XTX A;  1PD0 A;  4BY6 C;  3QPH A;  1Q95 G;  2E10 A;  2MWO A;  4PKC C;  1OUL A;  5IXF A;  1NYG A;  5AT1 B;  5FWB A;  1I0C A;  2P0Q A;  2MIO A;  2HQE A;  2AK5 A;  3EHR A;  1Y96 B;  1YIJ Q;  1JJ2 P;  3CCS Q;  2LVM A;  2J6O A;  2K3X A;  4OP0 A;  3RMS A;  2LTO A;  3I5S A;  2RH2 A;  5KCO A;  2XU8 A;  2E3H A;  2EQJ A;  3VYH B;  2RQR A;  3NTI A;  1NLO C;  3BY7 A;  3CD6 Q;  2KY9 A;  3CCJ T;  3M55 A;  3L2V A;  4OB3 B;  4C92 E;  1JB0 E;  3RUX A;  1S1N A;  3FC3 A;  1IGU A;  4EMG A;  4DEX A;  3VS5 A;  1NJI R;  1B34 B;  2IVW A;  4IKF A;  2EJF A;  3BFM A;  3OYG A;  1YJW T;  2A36 A;  4IUV A;  3OYF A;  2QK0 A;  1WHH A;  4F04 B;  3L2Z A;  2QTX A;  1I07 A;  2NWM A;  3ZFJ A;  1QCN A;  1HXD A;  1O9S A;  1UE9 A;  1VOM A;  5KYU A;  1RAE B;  3RER A;  1I5O B;  2E12 A;  2RJE A;  3SFM A;  2DIG A;  1KC8 R;  3EGU A;  4D6W A;  4D8D A;  3G1J A;  3EH1 A;  3OSS C;  2CDT A;  2DLP A;  3QG1 A;  4JJB A;  4O6J A;  3CC4 T;  2L2P A;  3P8H A;  3JCM c;  4C92 D;  1AZG B;  2KT1 A;  4E6R A;  2O9V A;  1TS9 A;  1C0M A;  2K2V A;  5KE2 A;  2F5K A;  1YIJ A;  3CCS A;  2QQR A;  3OQ5 A;  3WVE B;  4N4I A;  2NYS A;  2LCC A;  3F70 A;  1VQO Q;  3ULR B;  3C94 A;  4M75 A;  3OYD A;  1ZBJ A;  3TEE A;  4JS4 A;  3OA6 A;  3QKJ A;  3CD6 A;  4Z02 A;  4FM4 B;  4EDU A;  1IRX A;  2LC4 A;  1M90 R;  2DXT A;  5IXB A;  1OZ2 A;  4ELY C;  3I56 T;  4C5I A;  3KXT A;  2RHX A;  2DX1 A;  1SF9 A;  1ABO A;  3D7S B;  3X28 B;  1HSQ A;  2CH4 A;  3A8L B;  4DBQ A;  4M75 G;  2VB6 A;  4IUU A;  5FU6 B;  4KH0 B;  3J81 E;  2E65 A;  2HBP A;  4DA4 A;  2CP3 A;  8ATC B;  2F69 A;  2KNB B;  1T3S A;  3JAM E;  2GNC A;  1Z9Q A;  2EGA A;  1SRM A;  1VQO A;  1Q82 U;  4LNP A;  2MAM A;  2LX9 A;  4XU3 A;  2O88 A;  4RTY A;  3UA6 A;  2RHY A;  3QUI A;  5AYF A;  2EJG A;  1AWJ A;  4XTW A;  4XQ3 A;  1VIF A;  1VQM T;  4LDV A;  3LH0 A;  4M75 B;  2A0F B;  2RHI A;  1VQ4 Q;  3VYG A;  1GBR A;  2QAS A;  4KGZ B;  1W2B A;  1K8A C;  2DPP B;  2AZS A;  2JOY A;  2CT3 A;  1TG0 A;  4VUB A;  2CS7 A;  1YNZ A;  1K0X A;  4M75 F;  2DKG A;  4JZ3 A;  1S72 Q;  2HDA A;  4R55 A;  2PVD B;  5J26 A;  2H3J A;  2KRS A;  1AVZ C;  1YJN Q;  4PFZ A;  2ABL A;  4PLI A;  4N4G A;  2KQW A;  4RUG A;  2HQX A;  4OVA A;  3N5B B;  3JB9 D;  3M0P A;  3J7A F;  1UGS B;  2DK3 A;  3QDR B;  2HL5 C;  3DLL A;  1YI2 Q;  1X2K A;  2X4W A;  2OAW A;  3HKS A;  1X27 A;  1QQJ A;  2BZ8 A;  3MP1 A;  2MOX A;  2L3S A;  2F5T X;  2DL7 A;  3ZEH A;  4M75 C;  3GLX A;  1W2B S;  1D1C A;  4HXJ A;  1VQ4 A;  4DOW A;  3E9F A;  2D8J A;  2M9U A;  2RK1 A;  4CC7 A;  2LQ8 A;  1BI1 A;  2CSI A;  1UJY A;  1OYX A;  3HTR A;  1U06 A;  3SWN A;  1KFZ A;  4Z88 A;  3HRT A;  3EG2 A;  1S72 A;  5CKE A;  3VU3 C;  3M9Q A;  4OMO A;  1LNX A;  4IIM A;  3EGD A;  3OW2 A;  1BCM A;  1AHJ B;  2DTH A;  2VVK A;  3DKM A;  1YJN A;  4FU6 A;  5LJ5 f;  2RF0 A;  2QA4 Q;  2RHU A;  1WXB A;  4AFU C;  3RKW A;  2ZPE B;  4HVU A;  4KGX B;  1V1C A;  1WQ7 A;  1SHG A;  2W0Z A;  4F17 A;  1I1J A;  1D09 B;  1BIA A;  3S3M A;  2LP5 A;  3CCS T;  2KK4 A;  4J6X A;  4EMH A;  3OMG A;  1YI2 A;  2NUP A;  2H3E B;  2D9T A;  1HK9 A;  2EW3 A;  4M77 F;  2RQW A;  1NM7 A;  1XQH A;  4HVW A;  3CD6 T;  1NJI U;  4XU0 A;  5L8R E;  3X25 B;  5GAO r;  4IIO A;  2QGF B;  4RTX A;  2WSC E;  1B07 A;  1BB9 A;  4ORZ A;  3ME9 A;  3OBW A;  4EMK B;  1VYT A;  1K73 C;  4OMQ A;  3MCA B;  3CBM A;  2O4X A; 
#chains in the Genus database with same CATH homology
 3QWY A;  4WCI A;  1ZX6 A;  2HSP A;  2A08 A;  2DBM A;  1B3Q A;  2VKN A;  3NHN A;  1H92 A;  4EIK A;  2DRK A;  2LNH B;  2JT4 A;  2KYB A;  2EYW A;  3KFV A;  4LE9 A;  2D8H A;  1T0H A;  4F16 A;  4RTT A;  1GCQ C;  2F2X A;  1Z9Z A;  2H8H A;  2PNI A;  4AFZ C;  1A0N B;  1JXO A;  2LJ3 A;  1Y0M A;  5EC7 A;  1T0J A;  3SEM A;  2FRW A;  2VWF A;  4M4Z A;  2DYB A;  1NG2 A;  1T3L A;  2JM9 A;  1ZSG A;  1YWO A;  2DE0 X;  2KBT A;  2MCN A;  2BZX A;  1GRI A;  1PRM C;  3NPF A;  4KRT A;  2YT6 A;  1YWP A;  4HCK A;  2RNA A;  3EG1 A;  2D0N A;  2KGT A;  1UFF A;  1OOT A;  2KEA A;  1K76 A;  2ED1 A;  3VS0 A;  1TUD A;  2LJ1 A;  2G6F X;  2EBP A;  2OI3 A;  3REB B;  2DIL A;  1FMK A;  2ROL A;  4OML A;  2M51 A;  1QLY A;  2O31 A;  4Y92 A;  1PRL C;  1X2Q A;  1AEY A;  2F2W A;  2KE9 A;  2GGR A;  2YUO A;  1YCS B;  2O2O A;  3NGP A;  1KSW A;  2YSQ A;  1JEG A;  3EHQ A;  2L0A A;  3EG3 A;  2RQU A;  4A63 B;  3VS2 A;  2JS0 A;  4J9F A;  1QWF A;  2LCS A;  2EGE A;  2FPE A;  1K9A A;  4DEY A;  4D8K A;  2EYZ A;  2FG0 A;  1RI9 A;  2D1X A;  4GLM A;  4RTV A;  3UA7 A;  1NEG A;  1PNJ A;  2YUQ A;  5IHN A;  1UGV A;  1QCF A;  3VRZ A;  4ESR A;  5IXF A;  2J6F A;  1M30 A;  1NYG A;  1SPK A;  5FWB A;  1I0C A;  5IHK A;  2MIO A;  2JMC A;  2AK5 A;  4OMN A;  3QWX X;  3EHR A;  4Z8A A;  3I5R A;  2J6O A;  2JM8 A;  2X3X D;  3I5S A;  2LQN A;  2DVJ A;  4J9C A;  1M3B A;  3VS7 A;  2RQR A;  1NLO C;  1M3C A;  3THK A;  1PWT A;  3I35 A;  1PKT A;  2JXB A;  4X1V A;  1G2B A;  1S1N A;  2J06 A;  3CQT A;  2DM1 A;  3UAT A;  4DEX A;  1ARK A;  3VS5 A;  2CUD A;  1X6B A;  2KRN A;  1SEM A;  2A28 A;  2AKK A;  2K9G A;  4CC4 B;  5FW9 A;  2IIM A;  1UEC A;  2A36 A;  1UG1 A;  4CC3 A;  2DF6 A;  2HBW A;  4J9G A;  4JJD A;  1J3T A;  1I07 A;  2NWM A;  1X69 A;  1WYX A;  4J9E A;  3UF4 A;  1UE9 A;  1VA7 A;  2CUB A;  2DL8 A;  3VS6 A;  2L3P A;  2FO0 A;  2ROT A;  1WIE A;  2DBK A;  2GQI A;  1OV3 A;  2J6K A;  2K3B A;  3EGU A;  2RQT A;  4D8D A;  1K4U S;  4JJB A;  2CDT A;  2DLP A;  1YN8 A;  2L2P A;  1QWE A;  4AG1 C;  1X6G A;  5GJW B;  1AZG B;  2KT1 A;  3REA B;  2YUN A;  4E6R A;  2NUZ A;  3C0C A;  2O9V A;  4OMP A;  2GBQ A;  2KRM A;  4F14 A;  2EYY A;  3VS3 A;  1BK2 A;  4ZNX A;  2K2M A;  3ULR B;  1U5S A;  2AKL A;  3TVT A;  1ZBJ A;  2AZV A;  2DRM A;  1OEB A;  2FRY A;  2JTE A;  1AOJ A;  3IQL A;  3I9Q A;  2FPD A;  3H0H A;  1WI7 A;  1ZUU A;  4LUD A;  2EQI A;  1TUC A;  1OPL A;  1M8M A;  2I0N A;  2KR3 A;  1UTI A;  2V1Q A;  3NMZ C;  2LMJ A;  3VS4 A;  3M0T A;  5IXB A;  1UDL A;  2K6D A;  1W70 A;  1JQQ A;  3H41 A;  4K11 A;  1H3H A;  2EVR A;  4RTU A;  2FPF A;  1K0S A;  1W6X A;  2DX1 A;  1ABO A;  5IHI A;  4LUE A;  1AWX A;  1ZUY A;  2RQV A;  1JO8 A;  5GJV B;  1M3A A;  2RN8 A;  1K1Z A;  1HSQ A;  2CH4 A;  2SEM A;  1E6G A;  1SHF A;  2KRO A;  3SHW A;  1GL5 A;  1SSH A;  2DMO A;  2ECZ A;  1AZE A;  3TSZ A;  1QKW A;  1KJW A;  2F2V A;  2EPD A;  1H8K A;  1VYV A;  4R0K A;  2DJQ A;  5L23 A;  2BZY A;  2J7I A;  2DA9 A;  2DL4 A;  2KNB B;  1T3S A;  2GNC A;  1Z9Q A;  2EGA A;  2CSQ A;  3VRY A;  1SRM A;  1NYF A;  2KT8 A;  1BBZ A;  4LNP A;  1GBQ A;  2O88 A;  3M0U A;  3GBQ A;  4RTY A;  2JMA A;  2SRC A;  3UA6 A;  1YP5 A;  1WA7 A;  1RUW A;  1AWJ A;  3H0F A;  1RLQ C;  2JS2 A;  3ZL7 C;  1GBR A;  1U3O A;  2LX7 A;  2X3W D;  1N5Z A;  5FWC A;  1WXT A;  2AZS A;  4HVV A;  3RBB B;  1NLP C;  2ESW A;  2CT3 A;  2HEQ A;  1TG0 A;  1UHC A;  1PHT A;  2GTJ A;  1YNZ A;  1E7O A;  1PKS A;  1K0X A;  1GCQ A;  4JZ3 A;  1KIK A;  2CH4 W;  3O5Z A;  1ZLM A;  3R6N A;  2HDA A;  5IH2 A;  4JZ4 A;  1X43 A;  1HJD A;  2KRS A;  1AVZ C;  1FYN A;  2ABL A;  1UHF A;  1WLP B;  4RUG A;  2EKH A;  1NEB A;  4J9I A;  2DL5 A;  3M0P A;  2RPN A;  1GFD A;  3PVQ A;  2ENM A;  5HCK A;  2PZ1 A;  4AFQ C;  3M0R A;  1VYU A;  1X2K A;  1BU1 A;  2GTO A;  1LCK A;  2OAW A;  4JPB W;  2LZ6 B;  1X27 A;  2BZ8 A;  2LJ0 A;  2DNU A;  1WX6 A;  2DL3 A;  2P4R A;  1OPK A;  3JV3 A;  2ED0 A;  2MOX A;  4LN2 A;  1UJ0 A;  2EYX A;  2L3S A;  2BTT A;  2DL7 A;  4RTW A;  1AWO A;  2XMF A;  2B86 A;  4J9B A;  3VS1 A;  1JU5 C;  2HCK A;  4HXJ A;  1HD3 A;  2KXD A;  2D8J A;  4J9H A;  1CKB A;  4CC7 A;  2V1R A;  1GCP A;  2CSI A;  4RTZ A;  1UJY A;  2M0Y A;  2FEI A;  1U06 A;  1UUE A;  1KFZ A;  3FJ5 A;  4Z88 A;  2YUP A;  2J05 A;  3EG2 A;  2EGC A;  3PE0 A;  1M27 C;  3PVL A;  2E5K A;  5ECA A;  3U23 A;  1IO6 A;  4Z89 A;  4OMO A;  1SRL A;  3H0I A;  1W1F A;  1QKX A;  4IIM A;  5I11 A;  2L3Q A;  3M0Q A;  1AWW A;  2VVK A;  4QT7 A;  1XOV A;  2RF0 A;  2W10 A;  2JW4 A;  1WXB A;  3TSW A;  4CC2 A;  2LQW A;  4AFU C;  5I22 A;  3RNJ A;  2YDL A;  4HVU A;  4AG2 C;  1GFC A;  1ZUK A;  2CT4 A;  4JJC A;  1V1C A;  2PTK A;  1SHG A;  2W0Z A;  1CKA A;  4F17 A;  1I1J A;  2OJ2 A;  2K7A A;  1RLP C;  2LP5 A;  2RMO A;  3LH5 A;  1CSK A;  1EFN A;  2O9S A;  4GBQ A;  4AFS C;  3A98 A;  1E6H A;  1WXU A;  1Y57 A;  2EW3 A;  2CRE A;  2KXC A;  1MV0 B;  1MV3 A;  2RQW A;  2C0T A;  1NM7 A;  1ABQ A;  4HVW A;  4OMM A;  4FSS A;  2C0I A;  1G83 A;  1MUZ A;  1WDX A;  1JXM A;  2C0O A;  4IIO A;  4RTX A;  2A37 A;  1B07 A;  1BB9 A;  4ORZ A;  2KYM A;  1WFW A;  2QDL A;  3EG0 A;  2K79 A;  1VYT A;  3M0S A;  4J9D A;  4OMQ A;  1AD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...