1JO8A

Structural analysis of the yeast actin binding protein abp1 sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN BINDING PROTEIN
publication title Unusual binding properties of the SH3 domain of the yeast actin-binding protein Abp1: structural and functional analysis.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jo8A00
1G2BA 1WXTA 2E5KA 2ED1A 2YUPA 1YCSB 2EYWA 1B3QA 1HD3A 1PHTA 2JXBA 1UE9A 2RPNA 5FW9A 1OV3A 1E6HA 2RN8A 2KROA 2ESWA 1OOTA 3PVLA 3TSWA 1VA7A 3REAB 1RLQC 1QCFA 1AOJA 1W6XA 2CREA 1VYTA 2AZVA 1QWFA 4F14A 4Z88A 4GBQA 1GCQA 1TG0A 2RQRA 2NWMA 2VKNA 4Z8AA 1UHFA 3M0QA 2CSIA 1SHFA 3EG0A 1SSHA 1U5SA 1RI9A 2O2OA 1YWOA 1MV3A 3M0RA 2LMJA 2A28A 2EPDA 1IO6A 1X6BA 2LZ6B 2DLPA 2A08A 4GLMA 4Y92A 1K4US 2DRMA 1UUEA 1HJDA 2FRYA 2YUNA 1UGVA 3ZL7C 2JS2A 1ZUYA 1VYVA 1OPLA 1PRLC 2C0OA 1JXOA 1AZGB 1JU5C 1NYGA 1CKBA 1YNZA 1AWXA 4JZ4A 1NLOC 2CDTA 1X27A 4JJBA 5GJWB 1B07A 1VYUA 2X3WD 1T3SA 2DJQA 4AFZC 1Y57A 4AFUC 2IIMA 2J05A 1QWEA 2GNCA 2F2VA 2HDAA 1KFZA 2KEAA 1Z9ZA 2CSQA 3VS3A 2SEMA 4LUEA 1WXBA 2K2MA 1UTIA 5I22A 1GL5A 1X69A 3ULRB 1QLYA 4M4ZA 4ORZA 2MIOA 1M3BA 2J7IA 2DVJA 2RQTA 2J6OA 2EYXA 4JPBW 5IHIA 2FPEA 2FPDA 2KBTA 2JS0A 4AFQC 1A0NB 1UG1A 1I0CA 1GBRA 2JT4A 1X6GA 1PKSA 3VS0A 4J9EA 3H0FA 1WFWA 2D1XA 1SHGA 2CH4A 3EG3A 5IXFA 4CC4B 2EQIA 5IHKA 2GBQA 2ED0A 1YN8A 2DL4A 2LJ1A 1AZEA 2LJ0A 3H0IA 4Z89A 3O5ZA 3TSZA 2BZYA 2P4RA 1ABOA 1BU1A 2FRWA 2ABLA 4OMMA 2DL3A 2JM9A 1WXUA 1WA7A 1ZX6A 2BZ8A 2PNIA 4JJCA 2C0IA 3QWYA 2O9SA 2KYBA 2FPFA 2RQUA 3R6NA 1Z9QA 1SRLA 4HVWA 3THKA 2AKLA 2DMOA 2DNUA 1E6GA 4HVVA 2O31A 1H92A 4OMLA 2O9VA 1WX6A 3UF4A 1CKAA 3VRZA 2MCNA 2HBWA 1NM7A 2A37A 3M0SA 4IIOA 2D0NA 2LQWA 5FWBA 3I5SA 5L23A 3VS6A 2C0TA 2KXCA 2HCKA 2L0AA 2KRSA 1TUCA 1OPKA 2O88A 1KSWA 4OMQA 1XOVA 3M0PA 4EIKA 4KRTA 1T0HA 2L3PA 4LNPA 3EG1A 2PTKA 4AG2C 4ESRA 1FYNA 5GJVB 4AFSC 2DRKA 2A36A 2DBKA 2KR3A 2K6DA 2DYBA 1ZUUA 2EKHA 4A63B 2NUZA 2V1RA 2DM1A 3VS7A 4R0KA 4DEYA 2DX1A 2KGTA 4OMPA 1FMKA 1E7OA 2EGAA 2KT8A 4J9FA 3VS5A 2PZ1A 4RTUA 1ZBJA 2KRNA 4F17A 1RLPC 4RTYA 4ZNXA 2CT3A 1M30A 4RUGA 1M3CA 3IQLA 4J9HA 1BK2A 1EFNA 4LN2A 2K79A 2J6FA 1NEBA 4JZ3A 4HCKA 4WCIA 3EHRA 1U06A 3M0UA 1GRIA 1JEGA 2YUOA 1KIKA 1J3TA 2CT4A 2JMCA 2ECZA 2K7AA 2YUQA 3I9QA 3NMZC 4F16A 2B86A 5I11A 2FEIA 2LP5A 3FJ5A 1AWJA 2AKKA 2XMFA 1ARKA 1H3HA 2EGCA 2EYZA 2RNAA 5HCKA 4OMNA 1ZLMA 2L3SA 2VVKA 3I35A 1SEMA 2LNHB 4D8DA 5FWCA 4LE9A 1K76A 2CH4W 2EGEA 2KRMA 2RQVA 1KJWA 3VS2A 2JM8A 5EC7A 3LH5A 3RNJA 1SPKA 2DL8A 2DBMA 2MOXA 4J9BA 1JQQA 1X2KA 1LCKA 1AVZC 1GBQA 4J9IA 1UDLA 2LQNA 3NGPA 1V1CA 2YT6A 4CC7A 2D8HA 2EW3A 2ROLA 5IHNA 1UHCA 1UECA 1W1FA 1YP5A 2YDLA 1I1JA 5IH2A 1MV0B 1WI7A 2HEQA 3C0CA 1AWOA 1K0SA 2GQIA 3VS1A 3EG2A 1K1ZA 4FSSA 3VRYA 4J9GA 2FG0A 1AD5A 3NHNA 2OAWA 1M3AA 4CC2A 1S1NA 2D8JA 1PKTA 2EBPA 3H0HA 2JTEA 2KXDA 4D8KA 3QWXX 1GCPA 3JV3A 2K9GA 2BTTA 3REBB 2DILA 2LCSA 2BZXA 2GTJA 1OEBA 1X2QA 2RMOA 2HSPA 2K3BA 1T0JA 3EHQA 2CUBA 4IIMA 2DA9A 2LX7A 3NPFA 2KE9A 1BBZA 1T3LA 1CSKA 1WYXA 2X3XD 1ABQA 1UJYA 1PRMC 1NYFA 4E6RA 1JO8A 4DEXA 3UA7A 2G6FX 4CC3A 1M8MA 2DL7A 2JW4A 1K0XA 2V1QA 3H41A 1PNJA 2J6KA 4HVUA 3U23A 2KNBB 2FO0A 3CQTA 3GBQA 1U3OA 4JJDA 1H8KA 1HSQA 3VS4A 3SHWA 1RUWA 4RTTA 4RTXA 2KYMA 4OMOA 2L2PA 3A98A 1PWTA 3PVQA 1GFDA 3PE0A 4J9CA 2EVRA 1M27C 2AK5A 1X43A 4RTWA 3I5RA 1YWPA 1ZUKA 4LUDA 1NLPC 2DE0X 2H8HA 2I0NA 1NG2A 1GFCA 1QKWA 2RQWA 2ENMA 5ECAA 1QKXA 1WDXA 2JMAA 3KFVA 3SEMA 3UA6A 3UATA 1WIEA 4K11A 1K9AA 5IXBA 1UFFA 2F2XA 1AWWA 2W0ZA 4X1VA 1UJ0A 4RTVA 2ROTA 3EGUA 2OJ2A 2AZSA 4J9DA 1BB9A 2M0YA 2L3QA 1N5ZA 1NEGA 2CUDA 3TVTA 2F2WA 1GCQC 1Y0MA 4HXJA 4RTZA 2OI3A 1I07A 2GTOA 2RF0A 4AG1C 3M0TA 3RBBB 1WLPB 4QT7A 2W10A 2QDLA 1ZSGA 1JXMA 2LJ3A 2J06A 2EYYA 2VWFA 2YSQA 2M51A 2SRCA 2DF6A 1MUZA 1W70A 1SRMA 1G83A 2GGRA 2KT1A 1TUDA 2DL5A 1AEYA
chains in the Genus database with same CATH superfamily
1G2BA 1YJNQ 4M75B 4RCCA 5D7UA 3VV0A 4F7UF 1YCSB 5GANd 1B3QA 2YLBA 1NPRA 1XQHA 2CZ6B 2QDYB 1HD3A 4LD9K 5J26A 3UT1A 2WSFE 5FW9A 1IRXA 1E6HA 2K5FA 2ESWA 2KROA 2LT1A 5LL6S 3EG9A 1M90C 2KVQG 3CCST 2EFIA 3REAB 1YITA 1RLQC 4F04B 2PVOB 1AOJA 1S72A 2DPPB 1LJOA 2P4TA 2CREA 1M9SA 1M2VB 3NTHA 4F14A 1BI2A 4YTLA 4XU2A 2OTJA 2MWPA 4Z88A 2F5TX 1YHQA 1YJWA 1JRIA 3M4YA 2O2OA 1YWOA 3QIIA 1IO6A 1V29B 1X6BA 2LZ6B 4M7DC 5GAMe 2DRMA 1YIJA 3PMIA 1OULA 1WHJA 1HJDA 1TWBA 3CPWS 2XI9A 4C5EA 2JS2A 2L5QA 1I4K1 3E9FA 4PFZA 1D1AA 2E41A 1Q7YR 1YNZA 3EFOA 5FU6B 3CCMQ 5GANg 1MMGA 1X27A 1Q86C 1BIAA 1P92A 1T3SA 1FWZA 2DJQA 4AFZC 1Y96B 2DXCA 3UWNA 3JB9F 2COWA 2DD5A 4C0FA 1M8VA 4GY5A 3CCLA 2HNIA 5KCHA 4LUEA 1NZ9A 1GL5A 1QLYA 5LJ5j 2WACA 3JRZA 2J7IA 4AT1B 2RQTA 1FMVA 4F7UB 4AFQC 1GBRA 4FYWB 2JT4A 5CKEA 5I2SA 1X6GA 3T9NA 3QYHB 4FM4B 2QYZA 2CH4A 2IVWA 3GP8A 4HCCA 3H0IA 2NUPA 3RDVA 3TSZA 3MEWA 1ZSZB 1BU1A 2ABLA 4D6WA 2P0KA 2PNIA 3I55A 2EAYA 5CIUA 5LJ5h 1GXIE 3CCVQ 4QVZA 1G3WA 8ATCB 3VYHB 3M55A 2O9VA 4M78G 3UF4A 3VRZA 3ASKA 3G4SA 1QCOA 1QQJA 5FRMA 2GCXA 1NM7A 1IB8A 2CKKA 1RAAB 2HBPA 4FU6A 5FWBA 2PU9B 3VS6A 2KXCA 3BY7A 1FMWA 1TU0B 5DY9A 3JCMc 1OPKA 4M77E 5DM7R 2O88A 4OMQA 4J8OA 3D7SB 3QBYA 3CCJQ 2L3PA 4FYXB 1ZQ1A 4M7DF 1FYNA 1UEBA 3CMET 2DRKA 2A36A 2RB6A 1VQ6T 3MHXA 2DYBA 2CZ7B 2ZPHB 3GNFB 1Q82R 2QGFB 4II1A 3MKDA 3VS7A 2DTIA 2KGTA 2R5MA 1Q7YC 2YRCA 1ZBJA 5A0DA 4F17A 2K2VA 4BE1A 1KQSP 3ZBDA 3JSCA 4RUGA 4L6V5 1EFNA 4LN2A 5GAOm 1NEBA 3CCSQ 3R6OA 4R55A 1Q82U 4HCKA 3EHRA 4C0DC 3RESA 1U06A 2CGHA 3CD6Q 3OYCA 1JEGA 1VQPT 1PD1A 2OTLA 4IUPA 3JAME 1KIKA 2M1HA 1J3TA 2ECZA 1OI1A 2ZGWA 2XDDA 3TCJA 1N8RR 1YJ9A 4F16A 4P5NA 2B86A 2FEIA 1W4SA 2EYZA 1ZLMA 2FL7A 2VVKA 3I35A 5GAOr 3GPLA 2RA2A 4BDYA 2QA4T 3OYGA 2CH4W 3OYMA 2RQVA 2QXFA 2BUDA 2JM8A 3HFNA 4EPCA 5J39A 3INZA 4FIBA 3RNJA 1SPKA 3OYEA 4M7AD 2PVGB 1BIBA 2DL8A 4KGVB 2DBMA 1I8FA 1X75C 3G71T 1X2KA 4FW1A 3OMGA 1AVZC 4J9IA 4M78D 2LQNA 3E2UA 1MGQA 1R8OB 3GF5A 4M7DB 3QDRB 4PJLA 1UECA 1YP5A 1I1JA 2CP3A 3V8KA 1M2VA 4BUGA 2CS7A 3CCRA 4QW2A 2JVVA 2EKOA 1K1ZA 2LCLA 1AD5A 4CC2A 1S1NA 3H0HA 3RKXA 5IT9E 2K9GA 1RADB 5KYUB 1IHVA 2BZXA 1LNXA 2GTJA 1OEBA 2VASA 1X2QA 2PUOB 1JJ2A 4C92A 3AHUA 1VQ4T 2YLCA 2DA9A 2KE9A 4M75E 3I56A 3EAEA 2DXUA 3EG9B 1T3LA 2RJFA 1CSKA 1Q82C 1Y96A 1TOVA 2DIQA 4FT4A 4C8QA 1IREB 4DEXA 4CC3A 1VIEA 4BE2A 2BE9B 2FZGB 1FX7A 1MNEA 2D0QB 1LPLA 2IPOB 2RJDA 3JB9J 1PNJA 3N5BB 3CXCS 3OW2S 5FU7C 3GBQA 4J5YA 4IUTA 1HSQA 2EWNA 3M58A 4OMOA 4FL6A 3TU4K 1OX8A 3BW1A 2VB6A 1TUGB 5GAOq 3PE0A 3CCQA 4J9CA 3L2VA 2YXYA 1O75A 3I5RA 1YWPA 1N8RC 5L8RE 4C0ZA 1C0MA 3EFOB 5D6XA 3CMEQ 1NG2A 1GFCA 2RQWA 3PMTA 2LNVA 5CQYA 1VQ6Q 3H6ZA 2JMAA 3KFVA 3CC2Q 4C92E 4IUQA 3UATA 1WIEA 4K11A 1K9AA 5IXBA 4LD6A 1K8AU 2W0ZA 4X1VA 1M5Q1 1UJ0A 2DZ9A 4RTVA 2ROTA 5LJ3d 3MEUA 4C92C 2OX7A 4C8QE 1OU9A 4C5IA 5FU6C 2L3QA 1N5ZA 3TVTA 2F2WA 1GCQC 2AHJB 4MMKA 3BE3A 4R56A 3M0TA 4CRIA 1WLPB 3M54A 3CMAA 2QDLA 1HYOA 1JXMA 2LJ3A 4C8QC 4JS4A 2J06A 3HP9A 1VQPQ 4F7UE 1MUZA 3FEOA 4M7AF 1NJIR 3HRTA 4JUVA 2DL5A 2ED1A 2KQWA 3PFSA 2YUPA 1LOJA 1WHLA 4M78F 1U1SA 2Y4XA 2NUPB 2QI2A 1UE9A 2RPNA 2DIGA 1KD1R 3TSWA 3VJPA 4C0DB 1VA7A 2HD0A 2LQ8A 2QA4Q 3UDCA 1JB0E 2DD4A 3L2WA 2M02A 1QCFA 1G3YA 1W6XA 2X4JA 3M9QA 2LCCA 3NTKA 5GAMd 4FYVB 3ME9A 4GBQA 4X9DA 5LJ3g 2XG8D 4Z8AA 3M0QA 2CSIA 3MP6A 4JRIA 1KD1U 1D0YA 1IGUA 1VQ7Q 1VQKT 2QEXA 1M1KR 4Y92A 2D6FA 1PM3A 2VXFA 5KH6A 2EJ9A 2YUNA 3JCMe 4FT2A 2RH2A 1ZUYA 1VYVA 1OPLA 1PRLC 1JU5C 3A8HB 1AWXA 5CR2A 1NLOC 3KXTA 2X3WD 3J7AF 1M1KU 3HRUA 2COZA 1RAGB 1Y57A 1K8AC 2J05A 2LT4A 1QWEA 4IURA 1ZA1B 2YRVA 3KUFA 5CAIA 4RMOA 4OB2B 4ELZC 2KEAA 3CCVT 4PNOA 2SEMA 1WXBA 4A4FA 5I22A 1VQ4Q 2JUFA 4M4ZA 3G6EA 2XHCA 5GAN7 3CBPA 3E19A 1V76A 4M7AB 4Y28E 5KCOA 1VQ9A 2RJCA 4XTUA 2E65A 2DVJA 1WHHA 4M78B 2FPEA 2FPDA 2KBTA 2JS0A 3G71A 4M7DA 4C92F 3PT9A 2E4HA 5GAN4 4HCBA 3QO3A 4E47A 1EZZB 1JJ2P 2E70A 1R0BG 2D1XA 3TREA 3CCJT 1SHGA 3JCMQ 3RIRA 4C8QF 3OYDA 2RK2A 5A0GA 2ZPIB 1YN8A 2O4XB 4QQ6A 5C6SA 3LW5E 1C1AA 3GNGA 4IUUA 3CPWA 2NLUA 5KYUA 3QJ6A 3URGA 5LJ5d 1YIJQ 1NJIC 4OMMA 2Z0WA 3V8LA 5GAN6 3S6WA 1Z9QA 3EGXA 2M16A 2DNUA 1VQNA 1KD1C 4OMLA 5FU7B 3MP1A 4XU3A 2KY9A 4J6YA 3EFRA 3KBGA 2HZYA 3CD6T 2D0NA 2C0TA 3QXEB 3WVDB 4BB7A 2KRSA 3CCET 4M7DE 5GAMh 3OSSC 1BCMA 2L3RA 1YI2A 2HQXA 3MJXA 2DK3A 4LNPA 4Y91A 5DLOA 4AG2C 3DKMA 5GJVB 4AFSC 1IZ6A 2V8JA 5CKFA 4LDUA 1M1KC 1R77A 4DOVA 3X28B 2EKHA 2NUZA 3QG1A 4XTWA 1QP2A 4M77G 1OX9A 2DM1A 2YHTA 5LJ5g 4C92B 2DX1A 2JJ9A 4OMPA 1FMKA 4EMKC 4RTUA 2KRNA 1YJNA 2CT3A 3LGFA 3OYNA 2K5LA 4BI8B 2J6FA 4C8QB 2A7YA 4JRPA 1TTHB 3OSVA 4WCIA 4QQGA 1VQLT 1YCYA 3M0UA 3A8MB 2JZ2A 3JCMf 2JMCA 4L5GA 3X24B 3I9QA 4EMHA 3HFOA 2RI5A 2JTFA 3G1JA 2KDSA 4E7SA 3FJ5A 1VQKQ 1VQ8T 1H3HA 2ZPFB 3G4SQ 1ARKA 1M1FA 4D8DA 5CVIA 2NUTA 3CCUT 1VQ5T 1RI0A 4PL6A 1KJWA 2CP0A 1QMCA 2KSSA 3CC4T 1M4ZA 5GAN3 1JQQA 1W2BS 3CC7T 1UDLA 2DFUA 4L59A 1G5VA 4OMFB 3NGPA 1V1CA 3QKJA 2EIFA 3M5AA 2ROLA 3CCMA 5IHNA 2E10A 1BKBA 4HA8A 1H641 2YDLA 1MV0B 1WI7A 2HEQA 2RI2A 2GQIA 5I2MA 2EQMA 2RHXA 4XAXB 2KAFA 3VS1A 2V26A 3VRYA 3BFMA 3OYKA 1PKTA 5C0MA 3QPHA 2XU8A 4M77D 1VQMT 1X6OA 2R5AA 2HSEB 2VXEA 1QVFS 4QQDA 2RMOA 2RHUA 2HSPA 5GANe 3HRSA 2V8KA 3QYGB 4IIMA 3JCMW 2RK1A 3CC2T 1IHWA 1BI1A 1YBYA 2GFAA 4ZTJA 1WYXA 2HKQB 2MF2A 2DTHA 2XD0A 1NYFA 1B34B 2NYSA 4HKEA 2GFUA 4ZTFA 3UA7A 4N4IA 2QQAA 2V1QA 4M7AA 4M75G 4HVUA 4MZTA 3CPWP 3CCVA 3CQTA 4M78A 1U3OA 5AT1B 3MEVA 1VUBA 1NPPA 1R0CB 3OYLA 1IXDA 1GFDA 3CCEQ 4OVAA 2XIDA 4LDWA 4O6JA 2ATCB 3M59A 1PD0A 1M27C 3M4GA 2AK5A 4RTWA 1KG1A 4QKUA 2DE0X 2O4XA 2DXBA 3AT1B 5ECAA 1QKXA 3CCJA 4E2FB 3SEMA 3EH1A 3UA6A 2JNGA 2ZAEA 4A4KA 1QVGS 2C06A 3EGUA 2XICA 1PCXA 2DEUA 1WJQA 2GQVA 1NEGA 3OS2A 4DOWA 3P8HA 5IN1A 4HXJA 1VQ7T 1RL2A 2OI3A 2GTOA 2RF0A 3RBBB 3HSBA 4QT7A 4M7AE 1ZSGA 1FXXA 5GMKj 1VQLQ 3V8JA 4AMCA 2VWFA 2YSQA 4X34A 1M2OA 2M51A 3M57A 2KT1A 1KC8U 4M78E 4NOYA 3CXCA 3OW2A 3CCSA 2A0FB 2E3HA 1G83A 3WVEB 2DERA 4DBQA 4C5GA 4M7AC 4RKUE 1AEYA 3CD6A 4EMKB 2EYWA 2MYSA 2ZCFB 4M78C 1VQ8Q 1PHTA 2JXBA 3PNWC 1OV3A 3A8LB 4NL3A 2MWOA 2BKDN 4F7UG 3CCUQ 1VQ5Q 7AT1B 5CKDA 3PIPA 3L2UA 2QEXT 4PFPA 3H9NA 3FLGA 3C4SA 3EGXB 3FB9A 1VYTA 3CC4Q 1F1BB 2AZVA 1QWFA 3F70A 4E7KA 4M75D 3CC7Q 3Q1JA 3OY9A 1GCQA 1TG0A 2RQRA 1MMAA 5I21A 3EG0A 1SSHA 2QG9B 4XU0A 2X51A 2LMJA 2A28A 5KYWA 1YITT 2DLPA 2A08A 1OYXA 1S72T 5GMKe 4MDWA 4VUBA 1OU8A 2FRYA 3RMSA 2OTJT 3HTRA 1UGVA 4PJOG 3OA6A 1N9RA 1YHQT 1EX4A 2X35A 1JXOA 1NYGA 1VIFA 5GANf 1KHIA 2FYKA 3CPFA 4JZ4A 3OYFA 4DBFA 2K5IA 1K8AR 1VYUA 4Q5WA 1K73R 2DZCA 1YIJT 1VQMQ 3OS0A 2GNCA 2F2VA 4ZGJB 2L8DA 1Z9ZA 2QTVA 2CP2A 3VS3A 3FDRA 2K2MA 4LDXA 1MNDA 1D1BA 2EQKA 2HAXA 1X69A 3ULRB 1BCOA 4ORZA 2MIOA 2X4YA 4OF1A 3OBWA 2EYXA 5IHIA 1K73U 1Y71A 1A0NB 1RAFB 1WHMA 1KC8C 3QUIA 3OYHA 1WPYA 4QVCA 4A53A 1Y7XA 4KGZB 2E12A 5FLXE 4IUVA 3VS0A 2HMAA 1WFWA 2EQUA 4CC4B 5IHKA 2QQSA 3GIBA 2GBQA 2LX9A 1M1GA 2QAZA 2DL4A 2LJ1A 5GAN5 2LJ0A 1WHKA 4Z89A 3LLRA 1TXQA 4XTYA 3OS5A 4IKFA 2NUTB 2K4YA 3NTIA 2BZYA 1D0ZA 2DL3A 2JM9A 1WXUA 4JJCA 2C0IA 1PSEA 2D9TA 2O9SA 2FPFA 4OGCA 3R6NA 4HVWA 2AKLA 1JBMA 1E6GA 2HKNA 4DA4A 3LWIA 1H92A 2H3JA 5GAN2 3OQ5A 4A4HA 1OZ3A 1WX6A 2RHYA 2HBWA 2CZ1B 4PJJA 3CMEA 1VQOQ 1VQ6A 4IIOA 4JLIA 2LQWA 3I55T 1B34A 2HCKA 5HKCA 2L0AA 4PJOD 3L2QA 1TUCA 4OB1B 1ACMB 5A2QE 1XOVA 3ZFJA 4KRTA 5HY6A 1T0HA 3EG1A 3JCMh 3G4ST 3G7ZA 3MO8A 4OB0B 3GOXA 3A8GB 2DBKA 4C0GA 4DBRA 3M56A 2XK0A 3A8OB 1ZUUA 2EJFA 4JRQA 2COYA 4E7IA 5GMKl 1WQWA 2M9UA 2V1RA 4PJNA 4M7DG 4R0KA 1M90U 1BI0A 4DEYA 2EGAA 1E7OA 1VQPA 2WSEE 1Q81R 4E7HA 3VS5A 1RLPC 4RTYA 4ZNXA 4J6WA 5HK3A 2JTMA 3IQLA 4JJNK 1K73C 4KT0E 2K79A 2LRQA 3QHSA 1KK7A 4JZ3A 3OW2P 1Y07A 2QEXQ 1MHNA 2QA4A 2YUOA 1UGQB 3FRNA 5GAMg 2RO0A 1Q81U 1BYMA 2HQHA 4B6MA 3NMZC 4HT9A 5I11A 5CK9A 2LP5A 5KE3A 3HL8A 2AKKA 6AT1B 3OYAA 1YITQ 3SWNA 2KMTA 3JCMJ 4BD3A 2FZKB 2VV5A 1S72Q 3J81E 2OTLT 1VQ7A 3J80E 2OTJQ 2KRMA 2I2LA 4JLGA 4KGXB 3VS2A 1YHQQ 3LH5A 4EMKA 1YJWQ 1YJ9T 2DETA 2MOXA 4J9BA 2KI7A 1LCKA 1GBQA 3DB3A 3QDFA 5D6YA 3L1AA 2HL5C 2YT6A 4CC7A 3S3NA 3TQ7P 3C0CA 4PFOA 5LJ3e 4XTVA 3OB9A 1RAIB 3P8DA 1SG5A 1PC0A 3OMCA 3CEYA 2LTOA 4FSSA 4J9GA 2FG0A 1VQ4A 2RM4A 2OAWA 1QP3A 2DEQA 4GLKA 1I5OB 1MMNA 1N9SA 2KXDA 4D8KA 3QWXX 1GCPA 3CCLQ 2RJEA 3JB9H 1G8XA 3JV3A 3L2ZA 5GAOl 2BTTA 1N27A 3REBB 3WXMB 4OB3B 4M7DD 2LCSA 2LVMA 9ATCB 1I81A 3CCRT 1HK9A 2K3BA 1T0JA 3EHQA 1IGQA 1UGPB 3BDLA 5KYYB 1D1CA 1KQ2A 2CUBA 2LX7A 3C12A 3SWNC 4PJMA 1XTDA 2XDPA 4Z02A 2AT1B 3OS1A 1W2BA 2OAUA 1ZBXA 1TSFA 1PRMC 4PJOF 1AHJB 8AT1B 2B8AA 4PLIA 2G6FX 2V8IA 3VU3C 5KYXA 1Q81C 2DL7A 1KQSS 3RKWA 1X01A 2WSCE 4WF2A 1KHCA 4E7LA 2DAQA 4V2SA 3I56T 4KH0B 3U23A 5CKBA 4KH1B 4E7JA 5KYWB 1SSFA 2RHIA 3DLMA 3VS4A 1WJRA 1RUWA 3I55Q 1PG5B 2KYMA 3A98A 3DB4A 1ZA2B 1PWTA 1RABB 4RCBA 2F5KA 3QZ9B 4LDYA 2EVRA 2K3XA 5KE2A 3CBMA 4MDXA 1ZUKA 1NLPC 2E6ZA 2QQRA 5HK0A 1YFNA 1QKWA 1QVFA 4O5VA 2ENMA 5KYNA 1WDXA 2VUBA 4ZGEB 1I5LA 4X9CA 1Q7YU 5J3BA 5M9OA 5D6WA 2ZPGB 5GANj 1ZHIA 3CCQT 5GMKm 4M77A 2E1HA 2AZSA 4E7ZA 4J9DA 3C95A 1BB9A 2M0YA 2IG0A 2X9HA 2CUDA 3MCAB 2E64A 3VYGA 4XTXA 3X20B 5AYFA 2EYYA 1QCNA 2CP7A 4BY6C 2SRCA 2DF6A 3C94A 1W70A 2PVDB 3RERA 4XTZA 3PGGA 1WXTA 2E5KA 4PJOB 4CI0C 2EQJA 2JOYA 2MI6A 1WZOA 4N4GA 2FVUA 4ZN1A 3CMAT 2DVEA 4M7AG 4JRKA 5GANh 2RN8A 1OOTA 3PVLA 2OTLQ 5LJ5e 1VQKA 2ZPEB 5CKHA 2BE7D 1YJ9Q 2PUKB 2ZZDA 5LJ3f 1QVGA 2K57A 2NWMA 2VKNA 4B9WA 1UHFA 4DBHA 4HT8A 1SHFA 1U5SA 1RI9A 1KQ1A 1MV3A 3M0RA 2EPDA 2DO3A 3VUBA 3V7RA 4GLMA 3LGLA 3E9GA 4M77C 1K4US 1UUEA 2RD1A 4XQ3A 1RACB 2O01E 3EFSA 4N0AA 3PIOA 3ZL7C 1WGSA 1NBEB 2KK4A 2C0OA 1AZGB 3OYIA 1CKBA 2HL3A 4LXCA 1RAEB 1U8RA 2CDTA 4JJBA 2QGGA 2M0OA 5GJWB 2FZCB 1B07A 2A3LA 1SKUB 4XU1A 1UGSB 4RG8A 3L2RA 4AFUC 2IIMA 3CCRQ 1N6AA 1KFZA 2HDAA 1Q95G 2CSQA 4DQ2A 4J7FA 1UTIA 5GAMf 1K9MR 1H3ZA 2G3RA 4ZN3A 3JB9I 4BE0A 1M3BA 4KUIA 2ZPBB 2P0QA 2J6OA 4MZPA 4KUDK 1VQOT 4JPBW 3GLXA 1KC8R 1UG1A 4FCYA 1C6VX 2LC4A 4FW2A 1I0CA 1D3BA 2RHZA 1PKSA 4J9EA 3H0FA 3G6ET 2K3YA 1VQ9T 4C92G 1K9MU 4EDUA 3EG3A 3I56Q 5IXFA 3JCMP 2EQIA 4M75A 1HXDA 2ED0A 3SWNB 2VGNA 1AZEA 1W2BP 5CO7A 1N8RU 3O5ZA 3P8BB 4QVDA 3NFCA 4ME7A 1QW1A 2P4RA 1ABOA 3LX7A 4C8QG 2FRWA 4N0AC 4BI3A 3DLLA 1WA7A 1ZX6A 2BZ8A 3QWYA 2VGMA 2KYBA 2RQUA 3EH2A 1VOMA 5KYYA 3CCEA 1SRLA 2LQKA 3THKA 2DMOA 2H3EB 3OYBA 4MMLA 4HVVA 2O31A 3CBOA 4ZGDB 1CKAA 2YRDA 1WJSA 3EGDB 2MCNA 2CP6A 1LVKA 2YWWA 2A37A 3M0SA 3META 3CCQQ 3LWHA 5L23A 1OQKA 3I5SA 4ATOA 3JCMd 3SFMA 2HQEA 4EMGA 1KSWA 3M53A 5GMKh 1NE8A 3M0PA 4EIKA 1VQNT 1QVFP 1PSFA 5GAN8 2PTKA 4J7IA 4M77F 2CP5A 4B9XA 4ESRA 3PTAA 2Y90A 2KR3A 2K6DA 1SF9A 4BDZA 3LH0A 1RAHB 3S3MA 4A63B 4A54A 5LJ5f 4A4GA 1VQLA 4PK4A 1YJWT 1YI2T 2F69A 1DJ7B 2KT8A 2QK0A 3A1PA 4M75C 3VUZA 4J9FA 4FYYB 2PZ1A 3CMAQ 4TVRA 1M30A 2E5QA 1M3CA 4J9HA 3QSUA 1BK2A 3HKSA 4N4HA 1WQ7A 3RKYA 1VQ8A 5GMKi 4F7UA 1TS9A 1QVPA 4BY6B 3RMQA 1GRIA 3SDZA 5KYXB 3MP8A 3CCUA 1VQ5A 2DJZA 3JB9G 4C92D 1B7TA 1G3TA 1MMDA 1XNIA 1K9MC 2CT4A 5FROA 2K7AA 2YUQA 1YJNT 3CC4A 2LDMA 3JCMg 2E3IA 1EIFA 4MZMA 1AWJA 3CC7A 3FIFA 3CCLT 5IAYA 2XMFA 2EGCA 3MEAA 5CCAA 2RNAA 3JCMV 1JJ2S 5HCKA 4OMNA 3X26B 4C8QD 2L3SA 1SEMA 2LNHB 5FWCA 4LE9A 3FC3A 1K76A 4HCZA 1ZSZA 2EGEA 3HPWA 2BIVA 1QVGP 5EC7A 4PJOA 1UB4A 3V7SA 2XDBA 4FSXA 3TEEA 2MK5A 2DTOA 5GAOn 4J83A 4BACA 2QQBA 1TH7A 4ANJA 2QTXA 2DXTA 3BDUA 1BI3A 2QASA 2D8HA 2EW3A 4M77B 1UHCA 1W1FA 2FHDA 2VC8A 3RUXA 5IH2A 2DYIA 2P84A 3SD4A 1AWOA 1VQMA 4RG2A 3RR6A 4ELYC 1K0SA 3X25B 2X4WA 3ER0A 3EG2A 5DLQE 2EYQA 3NHNA 1M3AA 2PQWA 2D8JA 3LYIA 2EBPA 3CC2A 2JTEA 3CCMT 3MPUB 2DKGA 3JCMX 2F1LA 4A4EA 1G3SA 2DILA 3H8ZA 2EJGA 1M90R 3FJPA 3L42A 2MMPA 4WTOB 3G6EQ 2CZ0B 1VQ9Q 1NJIU 1WHGA 3JCMb 1WNLA 2E6NA 2AIRB 2MPXC 3NPFA 3G71Q 2JN0A 1BBZA 4PJOE 2MAMA 2Y4YA 3A5ZB 3OBYA 4BI4A 1U1TA 1XJWB 2X3XD 3E1SA 4JDSA 1ABQA 1UJYA 1ZSZC 4M75F 2L89A 4E6RA 1JO8A 4PJOC 3V7CA 3JB9D 1M8MA 1OZ2A 5GAOp 2JW4A 1K0XA 4J6XA 3H41A 2J6KA 3HHTB 3CXCP 2KNBB 2FO0A 1D0XA 2X4XA 3S3OA 5LJ3j 4JJDA 1H8KA 3OYYA 1Q86R 3SHWA 4RTTA 4RTXA 2L2PA 4OP0A 4LDVA 3PVQA 1VQOA 4XK8E 5FRNA 1UGRB 4NS5A 5CQXA 3SB2A 4PKCC 1VQNQ 1X43A 4LUDA 2R57A 5EG2A 2H8HA 2VYTA 2I0NA 3UPUA 1Q86U 2FB7A 1UFFA 2F2XA 1AWWA 1YI2Q 3ZEHA 4JS5A 4UC4A 2OJ2A 2R58A 2GF7A 3OYJA 3QJYA 5LJ3h 2QQ9A 1Y0MA 3EGDA 4RTZA 1I07A 2XKOC 4C5HA 4AG1C 2RI3A 1AT1B 2CYZB 2W10A 5GAMj 1KQSA 3O8VA 5A0LA 1D3BB 4PLLA 3QZ5B 4KULA 4NL2A 1O9SA 4KBMB 2P0PA 1D09B 1SRMA 2GGRA 4OGEA 1TUDA 3VKIA
chains in the Genus database with same CATH topology
1G2BA 1WXTA 2E5KA 2ED1A 2YUPA 1YCSB 2EYWA 1B3QA 1HD3A 1PHTA 2JXBA 1UE9A 2RPNA 5FW9A 1OV3A 1E6HA 2RN8A 2KROA 2ESWA 1OOTA 3PVLA 3TSWA 1VA7A 3REAB 1RLQC 1QCFA 1AOJA 1W6XA 2CREA 1VYTA 2AZVA 1QWFA 4F14A 4Z88A 4GBQA 1GCQA 1TG0A 2RQRA 2NWMA 2VKNA 4Z8AA 1UHFA 3M0QA 2CSIA 1SHFA 3EG0A 1SSHA 1U5SA 1RI9A 2O2OA 1YWOA 1MV3A 3M0RA 2LMJA 2A28A 2EPDA 1IO6A 1X6BA 2LZ6B 2DLPA 2A08A 4GLMA 4Y92A 1K4US 2DRMA 1UUEA 1HJDA 2FRYA 2YUNA 1UGVA 3ZL7C 2JS2A 1ZUYA 1VYVA 1OPLA 1PRLC 2C0OA 1JXOA 1AZGB 1JU5C 1NYGA 1CKBA 1YNZA 1AWXA 4JZ4A 1NLOC 2CDTA 1X27A 4JJBA 5GJWB 1B07A 1VYUA 2X3WD 1T3SA 2DJQA 4AFZC 1Y57A 4AFUC 2IIMA 2J05A 1QWEA 2GNCA 2F2VA 2HDAA 1KFZA 2KEAA 1Z9ZA 2CSQA 3VS3A 2SEMA 4LUEA 1WXBA 2K2MA 1UTIA 5I22A 1GL5A 1X69A 3ULRB 1QLYA 4M4ZA 4ORZA 2MIOA 1M3BA 2J7IA 2DVJA 2RQTA 2J6OA 2EYXA 4JPBW 5IHIA 2FPEA 2FPDA 2KBTA 2JS0A 4AFQC 1A0NB 1UG1A 1I0CA 1GBRA 2JT4A 1X6GA 1PKSA 3VS0A 4J9EA 3H0FA 1WFWA 2D1XA 1SHGA 2CH4A 3EG3A 5IXFA 4CC4B 2EQIA 5IHKA 2GBQA 2ED0A 1YN8A 2DL4A 2LJ1A 1AZEA 2LJ0A 3H0IA 4Z89A 3O5ZA 3TSZA 2BZYA 2P4RA 1ABOA 1BU1A 2FRWA 2ABLA 4OMMA 2DL3A 2JM9A 1WXUA 1WA7A 1ZX6A 2BZ8A 2PNIA 4JJCA 2C0IA 3QWYA 2O9SA 2KYBA 2FPFA 2RQUA 3R6NA 1Z9QA 1SRLA 4HVWA 3THKA 2AKLA 2DMOA 2DNUA 1E6GA 4HVVA 2O31A 1H92A 4OMLA 2O9VA 1WX6A 3UF4A 1CKAA 3VRZA 2MCNA 2HBWA 1NM7A 2A37A 3M0SA 4IIOA 2D0NA 2LQWA 5FWBA 3I5SA 5L23A 3VS6A 2C0TA 2KXCA 2HCKA 2L0AA 2KRSA 1TUCA 1OPKA 2O88A 1KSWA 4OMQA 1XOVA 3M0PA 4EIKA 4KRTA 1T0HA 2L3PA 4LNPA 3EG1A 2PTKA 4AG2C 4ESRA 1FYNA 5GJVB 4AFSC 2DRKA 2A36A 2DBKA 2KR3A 2K6DA 2DYBA 1ZUUA 2EKHA 4A63B 2NUZA 2V1RA 2DM1A 3VS7A 4R0KA 4DEYA 2DX1A 2KGTA 4OMPA 1FMKA 1E7OA 2EGAA 2KT8A 4J9FA 3VS5A 2PZ1A 4RTUA 1ZBJA 2KRNA 4F17A 1RLPC 4RTYA 4ZNXA 2CT3A 1M30A 4RUGA 1M3CA 3IQLA 4J9HA 1BK2A 1EFNA 4LN2A 2K79A 2J6FA 1NEBA 4JZ3A 4HCKA 4WCIA 3EHRA 1U06A 3M0UA 1GRIA 1JEGA 2YUOA 1KIKA 1J3TA 2CT4A 2JMCA 2ECZA 2K7AA 2YUQA 3I9QA 3NMZC 4F16A 2B86A 5I11A 2FEIA 2LP5A 3FJ5A 1AWJA 2AKKA 2XMFA 1ARKA 1H3HA 2EGCA 2EYZA 2RNAA 5HCKA 4OMNA 1ZLMA 2L3SA 2VVKA 3I35A 1SEMA 2LNHB 4D8DA 5FWCA 4LE9A 1K76A 2CH4W 2EGEA 2KRMA 2RQVA 1KJWA 3VS2A 2JM8A 5EC7A 3LH5A 3RNJA 1SPKA 2DL8A 2DBMA 2MOXA 4J9BA 1JQQA 1X2KA 1LCKA 1AVZC 1GBQA 4J9IA 1UDLA 2LQNA 3NGPA 1V1CA 2YT6A 4CC7A 2D8HA 2EW3A 2ROLA 5IHNA 1UHCA 1UECA 1W1FA 1YP5A 2YDLA 1I1JA 5IH2A 1MV0B 1WI7A 2HEQA 3C0CA 1AWOA 1K0SA 2GQIA 3VS1A 3EG2A 1K1ZA 4FSSA 3VRYA 4J9GA 2FG0A 1AD5A 3NHNA 2OAWA 1M3AA 4CC2A 1S1NA 2D8JA 1PKTA 2EBPA 3H0HA 2JTEA 2KXDA 4D8KA 3QWXX 1GCPA 3JV3A 2K9GA 2BTTA 3REBB 2DILA 2LCSA 2BZXA 2GTJA 1OEBA 1X2QA 2RMOA 2HSPA 2K3BA 1T0JA 3EHQA 2CUBA 4IIMA 2DA9A 2LX7A 3NPFA 2KE9A 1BBZA 1T3LA 1CSKA 1WYXA 2X3XD 1ABQA 1UJYA 1PRMC 1NYFA 4E6RA 1JO8A 4DEXA 3UA7A 2G6FX 4CC3A 1M8MA 2DL7A 2JW4A 1K0XA 2V1QA 3H41A 1PNJA 2J6KA 4HVUA 3U23A 2KNBB 2FO0A 3CQTA 3GBQA 1U3OA 4JJDA 1H8KA 1HSQA 3VS4A 3SHWA 1RUWA 4RTTA 4RTXA 2KYMA 4OMOA 2L2PA 3A98A 1PWTA 3PVQA 1GFDA 3PE0A 4J9CA 2EVRA 1M27C 2AK5A 1X43A 4RTWA 3I5RA 1YWPA 1ZUKA 4LUDA 1NLPC 2DE0X 2H8HA 2I0NA 1NG2A 1GFCA 1QKWA 2RQWA 2ENMA 5ECAA 1QKXA 1WDXA 2JMAA 3KFVA 3SEMA 3UA6A 3UATA 1WIEA 4K11A 1K9AA 5IXBA 1UFFA 2F2XA 1AWWA 2W0ZA 4X1VA 1UJ0A 4RTVA 2ROTA 3EGUA 2OJ2A 2AZSA 4J9DA 1BB9A 2M0YA 2L3QA 1N5ZA 1NEGA 2CUDA 3TVTA 2F2WA 1GCQC 1Y0MA 4HXJA 4RTZA 2OI3A 1I07A 2GTOA 2RF0A 4AG1C 3M0TA 3RBBB 1WLPB 4QT7A 2W10A 2QDLA 1ZSGA 1JXMA 2LJ3A 2J06A 2EYYA 2VWFA 2YSQA 2M51A 2SRCA 2DF6A 1MUZA 1W70A 1SRMA 1G83A 2GGRA 2KT1A 1TUDA 2DL5A 1AEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2B A;  1WXT A;  2E5K A;  2ED1 A;  2YUP A;  1YCS B;  2EYW A;  1B3Q A;  1HD3 A;  1PHT A;  2JXB A;  1UE9 A;  2RPN A;  5FW9 A;  1OV3 A;  1E6H A;  2RN8 A;  2KRO A;  2ESW A;  1OOT A;  3PVL A;  3TSW A;  1VA7 A;  3REA B;  1RLQ C;  1QCF A;  1AOJ A;  1W6X A;  2CRE A;  1VYT A;  2AZV A;  1QWF A;  4F14 A;  4Z88 A;  4GBQ A;  1GCQ A;  1TG0 A;  2RQR A;  2NWM A;  2VKN A;  4Z8A A;  1UHF A;  3M0Q A;  2CSI A;  1SHF A;  3EG0 A;  1SSH A;  1U5S A;  1RI9 A;  2O2O A;  1YWO A;  1MV3 A;  3M0R A;  2LMJ A;  2A28 A;  2EPD A;  1IO6 A;  1X6B A;  2LZ6 B;  2DLP A;  2A08 A;  4GLM A;  4Y92 A;  1K4U S;  2DRM A;  1UUE A;  1HJD A;  2FRY A;  2YUN A;  1UGV A;  3ZL7 C;  2JS2 A;  1ZUY A;  1VYV A;  1OPL A;  1PRL C;  2C0O A;  1JXO A;  1AZG B;  1JU5 C;  1NYG A;  1CKB A;  1YNZ A;  1AWX A;  4JZ4 A;  1NLO C;  2CDT A;  1X27 A;  4JJB A;  5GJW B;  1B07 A;  1VYU A;  2X3W D;  1T3S A;  2DJQ A;  4AFZ C;  1Y57 A;  4AFU C;  2IIM A;  2J05 A;  1QWE A;  2GNC A;  2F2V A;  2HDA A;  1KFZ A;  2KEA A;  1Z9Z A;  2CSQ A;  3VS3 A;  2SEM A;  4LUE A;  1WXB A;  2K2M A;  1UTI A;  5I22 A;  1GL5 A;  1X69 A;  3ULR B;  1QLY A;  4M4Z A;  4ORZ A;  2MIO A;  1M3B A;  2J7I A;  2DVJ A;  2RQT A;  2J6O A;  2EYX A;  4JPB W;  5IHI A;  2FPE A;  2FPD A;  2KBT A;  2JS0 A;  4AFQ C;  1A0N B;  1UG1 A;  1I0C A;  1GBR A;  2JT4 A;  1X6G A;  1PKS A;  3VS0 A;  4J9E A;  3H0F A;  1WFW A;  2D1X A;  1SHG A;  2CH4 A;  3EG3 A;  5IXF A;  4CC4 B;  2EQI A;  5IHK A;  2GBQ A;  2ED0 A;  1YN8 A;  2DL4 A;  2LJ1 A;  1AZE A;  2LJ0 A;  3H0I A;  4Z89 A;  3O5Z A;  3TSZ A;  2BZY A;  2P4R A;  1ABO A;  1BU1 A;  2FRW A;  2ABL A;  4OMM A;  2DL3 A;  2JM9 A;  1WXU A;  1WA7 A;  1ZX6 A;  2BZ8 A;  2PNI A;  4JJC A;  2C0I A;  3QWY A;  2O9S A;  2KYB A;  2FPF A;  2RQU A;  3R6N A;  1Z9Q A;  1SRL A;  4HVW A;  3THK A;  2AKL A;  2DMO A;  2DNU A;  1E6G A;  4HVV A;  2O31 A;  1H92 A;  4OML A;  2O9V A;  1WX6 A;  3UF4 A;  1CKA A;  3VRZ A;  2MCN A;  2HBW A;  1NM7 A;  2A37 A;  3M0S A;  4IIO A;  2D0N A;  2LQW A;  5FWB A;  3I5S A;  5L23 A;  3VS6 A;  2C0T A;  2KXC A;  2HCK A;  2L0A A;  2KRS A;  1TUC A;  1OPK A;  2O88 A;  1KSW A;  4OMQ A;  1XOV A;  3M0P A;  4EIK A;  4KRT A;  1T0H A;  2L3P A;  4LNP A;  3EG1 A;  2PTK A;  4AG2 C;  4ESR A;  1FYN A;  5GJV B;  4AFS C;  2DRK A;  2A36 A;  2DBK A;  2KR3 A;  2K6D A;  2DYB A;  1ZUU A;  2EKH A;  4A63 B;  2NUZ A;  2V1R A;  2DM1 A;  3VS7 A;  4R0K A;  4DEY A;  2DX1 A;  2KGT A;  4OMP A;  1FMK A;  1E7O A;  2EGA A;  2KT8 A;  4J9F A;  3VS5 A;  2PZ1 A;  4RTU A;  1ZBJ A;  2KRN A;  4F17 A;  1RLP C;  4RTY A;  4ZNX A;  2CT3 A;  1M30 A;  4RUG A;  1M3C A;  3IQL A;  4J9H A;  1BK2 A;  1EFN A;  4LN2 A;  2K79 A;  2J6F A;  1NEB A;  4JZ3 A;  4HCK A;  4WCI A;  3EHR A;  1U06 A;  3M0U A;  1GRI A;  1JEG A;  2YUO A;  1KIK A;  1J3T A;  2CT4 A;  2JMC A;  2ECZ A;  2K7A A;  2YUQ A;  3I9Q A;  3NMZ C;  4F16 A;  2B86 A;  5I11 A;  2FEI A;  2LP5 A;  3FJ5 A;  1AWJ A;  2AKK A;  2XMF A;  1ARK A;  1H3H A;  2EGC A;  2EYZ A;  2RNA A;  5HCK A;  4OMN A;  1ZLM A;  2L3S A;  2VVK A;  3I35 A;  1SEM A;  2LNH B;  4D8D A;  5FWC A;  4LE9 A;  1K76 A;  2CH4 W;  2EGE A;  2KRM A;  2RQV A;  1KJW A;  3VS2 A;  2JM8 A;  5EC7 A;  3LH5 A;  3RNJ A;  1SPK A;  2DL8 A;  2DBM A;  2MOX A;  4J9B A;  1JQQ A;  1X2K A;  1LCK A;  1AVZ C;  1GBQ A;  4J9I A;  1UDL A;  2LQN A;  3NGP A;  1V1C A;  2YT6 A;  4CC7 A;  2D8H A;  2EW3 A;  2ROL A;  5IHN A;  1UHC A;  1UEC A;  1W1F A;  1YP5 A;  2YDL A;  1I1J A;  5IH2 A;  1MV0 B;  1WI7 A;  2HEQ A;  3C0C A;  1AWO A;  1K0S A;  2GQI A;  3VS1 A;  3EG2 A;  1K1Z A;  4FSS A;  3VRY A;  4J9G A;  2FG0 A;  1AD5 A;  3NHN A;  2OAW A;  1M3A A;  4CC2 A;  1S1N A;  2D8J A;  1PKT A;  2EBP A;  3H0H A;  2JTE A;  2KXD A;  4D8K A;  3QWX X;  1GCP A;  3JV3 A;  2K9G A;  2BTT A;  3REB B;  2DIL A;  2LCS A;  2BZX A;  2GTJ A;  1OEB A;  1X2Q A;  2RMO A;  2HSP A;  2K3B A;  1T0J A;  3EHQ A;  2CUB A;  4IIM A;  2DA9 A;  2LX7 A;  3NPF A;  2KE9 A;  1BBZ A;  1T3L A;  1CSK A;  1WYX A;  2X3X D;  1ABQ A;  1UJY A;  1PRM C;  1NYF A;  4E6R A;  1JO8 A;  4DEX A;  3UA7 A;  2G6F X;  4CC3 A;  1M8M A;  2DL7 A;  2JW4 A;  1K0X A;  2V1Q A;  3H41 A;  1PNJ A;  2J6K A;  4HVU A;  3U23 A;  2KNB B;  2FO0 A;  3CQT A;  3GBQ A;  1U3O A;  4JJD A;  1H8K A;  1HSQ A;  3VS4 A;  3SHW A;  1RUW A;  4RTT A;  4RTX A;  2KYM A;  4OMO A;  2L2P A;  3A98 A;  1PWT A;  3PVQ A;  1GFD A;  3PE0 A;  4J9C A;  2EVR A;  1M27 C;  2AK5 A;  1X43 A;  4RTW A;  3I5R A;  1YWP A;  1ZUK A;  4LUD A;  1NLP C;  2DE0 X;  2H8H A;  2I0N A;  1NG2 A;  1GFC A;  1QKW A;  2RQW A;  2ENM A;  5ECA A;  1QKX A;  1WDX A;  2JMA A;  3KFV A;  3SEM A;  3UA6 A;  3UAT A;  1WIE A;  4K11 A;  1K9A A;  5IXB A;  1UFF A;  2F2X A;  1AWW A;  2W0Z A;  4X1V A;  1UJ0 A;  4RTV A;  2ROT A;  3EGU A;  2OJ2 A;  2AZS A;  4J9D A;  1BB9 A;  2M0Y A;  2L3Q A;  1N5Z A;  1NEG A;  2CUD A;  3TVT A;  2F2W A;  1GCQ C;  1Y0M A;  4HXJ A;  4RTZ A;  2OI3 A;  1I07 A;  2GTO A;  2RF0 A;  4AG1 C;  3M0T A;  3RBB B;  1WLP B;  4QT7 A;  2W10 A;  2QDL A;  1ZSG A;  1JXM A;  2LJ3 A;  2J06 A;  2EYY A;  2VWF A;  2YSQ A;  2M51 A;  2SRC A;  2DF6 A;  1MUZ A;  1W70 A;  1SRM A;  1G83 A;  2GGR A;  2KT1 A;  1TUD A;  2DL5 A;  1AEY A; 
#chains in the Genus database with same CATH topology
 1G2B A;  1YJN Q;  4M75 B;  4RCC A;  5D7U A;  3VV0 A;  4F7U F;  1YCS B;  5GAN d;  1B3Q A;  2YLB A;  1NPR A;  1XQH A;  2CZ6 B;  2QDY B;  1HD3 A;  4LD9 K;  5J26 A;  3UT1 A;  2WSF E;  5FW9 A;  1IRX A;  1E6H A;  2K5F A;  2ESW A;  2KRO A;  2LT1 A;  5LL6 S;  3EG9 A;  1M90 C;  2KVQ G;  3CCS T;  2EFI A;  3REA B;  1YIT A;  1RLQ C;  4F04 B;  2PVO B;  1AOJ A;  1S72 A;  2DPP B;  1LJO A;  2P4T A;  2CRE A;  1M9S A;  1M2V B;  3NTH A;  4F14 A;  1BI2 A;  4YTL A;  4XU2 A;  2OTJ A;  2MWP A;  4Z88 A;  2F5T X;  1YHQ A;  1YJW A;  1JRI A;  3M4Y A;  2O2O A;  1YWO A;  3QII A;  1IO6 A;  1V29 B;  1X6B A;  2LZ6 B;  4M7D C;  5GAM e;  2DRM A;  1YIJ A;  3PMI A;  1OUL A;  1WHJ A;  1HJD A;  1TWB A;  3CPW S;  2XI9 A;  4C5E A;  2JS2 A;  2L5Q A;  1I4K 1;  3E9F A;  4PFZ A;  1D1A A;  2E41 A;  1Q7Y R;  1YNZ A;  3EFO A;  5FU6 B;  3CCM Q;  5GAN g;  1MMG A;  1X27 A;  1Q86 C;  1BIA A;  1P92 A;  1T3S A;  1FWZ A;  2DJQ A;  4AFZ C;  1Y96 B;  2DXC A;  3UWN A;  3JB9 F;  2COW A;  2DD5 A;  4C0F A;  1M8V A;  4GY5 A;  3CCL A;  2HNI A;  5KCH A;  4LUE A;  1NZ9 A;  1GL5 A;  1QLY A;  5LJ5 j;  2WAC A;  3JRZ A;  2J7I A;  4AT1 B;  2RQT A;  1FMV A;  4F7U B;  4AFQ C;  1GBR A;  4FYW B;  2JT4 A;  5CKE A;  5I2S A;  1X6G A;  3T9N A;  3QYH B;  4FM4 B;  2QYZ A;  2CH4 A;  2IVW A;  3GP8 A;  4HCC A;  3H0I A;  2NUP A;  3RDV A;  3TSZ A;  3MEW A;  1ZSZ B;  1BU1 A;  2ABL A;  4D6W A;  2P0K A;  2PNI A;  3I55 A;  2EAY A;  5CIU A;  5LJ5 h;  1GXI E;  3CCV Q;  4QVZ A;  1G3W A;  8ATC B;  3VYH B;  3M55 A;  2O9V A;  4M78 G;  3UF4 A;  3VRZ A;  3ASK A;  3G4S A;  1QCO A;  1QQJ A;  5FRM A;  2GCX A;  1NM7 A;  1IB8 A;  2CKK A;  1RAA B;  2HBP A;  4FU6 A;  5FWB A;  2PU9 B;  3VS6 A;  2KXC A;  3BY7 A;  1FMW A;  1TU0 B;  5DY9 A;  3JCM c;  1OPK A;  4M77 E;  5DM7 R;  2O88 A;  4OMQ A;  4J8O A;  3D7S B;  3QBY A;  3CCJ Q;  2L3P A;  4FYX B;  1ZQ1 A;  4M7D F;  1FYN A;  1UEB A;  3CME T;  2DRK A;  2A36 A;  2RB6 A;  1VQ6 T;  3MHX A;  2DYB A;  2CZ7 B;  2ZPH B;  3GNF B;  1Q82 R;  2QGF B;  4II1 A;  3MKD A;  3VS7 A;  2DTI A;  2KGT A;  2R5M A;  1Q7Y C;  2YRC A;  1ZBJ A;  5A0D A;  4F17 A;  2K2V A;  4BE1 A;  1KQS P;  3ZBD A;  3JSC A;  4RUG A;  4L6V 5;  1EFN A;  4LN2 A;  5GAO m;  1NEB A;  3CCS Q;  3R6O A;  4R55 A;  1Q82 U;  4HCK A;  3EHR A;  4C0D C;  3RES A;  1U06 A;  2CGH A;  3CD6 Q;  3OYC A;  1JEG A;  1VQP T;  1PD1 A;  2OTL A;  4IUP A;  3JAM E;  1KIK A;  2M1H A;  1J3T A;  2ECZ A;  1OI1 A;  2ZGW A;  2XDD A;  3TCJ A;  1N8R R;  1YJ9 A;  4F16 A;  4P5N A;  2B86 A;  2FEI A;  1W4S A;  2EYZ A;  1ZLM A;  2FL7 A;  2VVK A;  3I35 A;  5GAO r;  3GPL A;  2RA2 A;  4BDY A;  2QA4 T;  3OYG A;  2CH4 W;  3OYM A;  2RQV A;  2QXF A;  2BUD A;  2JM8 A;  3HFN A;  4EPC A;  5J39 A;  3INZ A;  4FIB A;  3RNJ A;  1SPK A;  3OYE A;  4M7A D;  2PVG B;  1BIB A;  2DL8 A;  4KGV B;  2DBM A;  1I8F A;  1X75 C;  3G71 T;  1X2K A;  4FW1 A;  3OMG A;  1AVZ C;  4J9I A;  4M78 D;  2LQN A;  3E2U A;  1MGQ A;  1R8O B;  3GF5 A;  4M7D B;  3QDR B;  4PJL A;  1UEC A;  1YP5 A;  1I1J A;  2CP3 A;  3V8K A;  1M2V A;  4BUG A;  2CS7 A;  3CCR A;  4QW2 A;  2JVV A;  2EKO A;  1K1Z A;  2LCL A;  1AD5 A;  4CC2 A;  1S1N A;  3H0H A;  3RKX A;  5IT9 E;  2K9G A;  1RAD B;  5KYU B;  1IHV A;  2BZX A;  1LNX A;  2GTJ A;  1OEB A;  2VAS A;  1X2Q A;  2PUO B;  1JJ2 A;  4C92 A;  3AHU A;  1VQ4 T;  2YLC A;  2DA9 A;  2KE9 A;  4M75 E;  3I56 A;  3EAE A;  2DXU A;  3EG9 B;  1T3L A;  2RJF A;  1CSK A;  1Q82 C;  1Y96 A;  1TOV A;  2DIQ A;  4FT4 A;  4C8Q A;  1IRE B;  4DEX A;  4CC3 A;  1VIE A;  4BE2 A;  2BE9 B;  2FZG B;  1FX7 A;  1MNE A;  2D0Q B;  1LPL A;  2IPO B;  2RJD A;  3JB9 J;  1PNJ A;  3N5B B;  3CXC S;  3OW2 S;  5FU7 C;  3GBQ A;  4J5Y A;  4IUT A;  1HSQ A;  2EWN A;  3M58 A;  4OMO A;  4FL6 A;  3TU4 K;  1OX8 A;  3BW1 A;  2VB6 A;  1TUG B;  5GAO q;  3PE0 A;  3CCQ A;  4J9C A;  3L2V A;  2YXY A;  1O75 A;  3I5R A;  1YWP A;  1N8R C;  5L8R E;  4C0Z A;  1C0M A;  3EFO B;  5D6X A;  3CME Q;  1NG2 A;  1GFC A;  2RQW A;  3PMT A;  2LNV A;  5CQY A;  1VQ6 Q;  3H6Z A;  2JMA A;  3KFV A;  3CC2 Q;  4C92 E;  4IUQ A;  3UAT A;  1WIE A;  4K11 A;  1K9A A;  5IXB A;  4LD6 A;  1K8A U;  2W0Z A;  4X1V A;  1M5Q 1;  1UJ0 A;  2DZ9 A;  4RTV A;  2ROT A;  5LJ3 d;  3MEU A;  4C92 C;  2OX7 A;  4C8Q E;  1OU9 A;  4C5I A;  5FU6 C;  2L3Q A;  1N5Z A;  3TVT A;  2F2W A;  1GCQ C;  2AHJ B;  4MMK A;  3BE3 A;  4R56 A;  3M0T A;  4CRI A;  1WLP B;  3M54 A;  3CMA A;  2QDL A;  1HYO A;  1JXM A;  2LJ3 A;  4C8Q C;  4JS4 A;  2J06 A;  3HP9 A;  1VQP Q;  4F7U E;  1MUZ A;  3FEO A;  4M7A F;  1NJI R;  3HRT A;  4JUV A;  2DL5 A;  2ED1 A;  2KQW A;  3PFS A;  2YUP A;  1LOJ A;  1WHL A;  4M78 F;  1U1S A;  2Y4X A;  2NUP B;  2QI2 A;  1UE9 A;  2RPN A;  2DIG A;  1KD1 R;  3TSW A;  3VJP A;  4C0D B;  1VA7 A;  2HD0 A;  2LQ8 A;  2QA4 Q;  3UDC A;  1JB0 E;  2DD4 A;  3L2W A;  2M02 A;  1QCF A;  1G3Y A;  1W6X A;  2X4J A;  3M9Q A;  2LCC A;  3NTK A;  5GAM d;  4FYV B;  3ME9 A;  4GBQ A;  4X9D A;  5LJ3 g;  2XG8 D;  4Z8A A;  3M0Q A;  2CSI A;  3MP6 A;  4JRI A;  1KD1 U;  1D0Y A;  1IGU A;  1VQ7 Q;  1VQK T;  2QEX A;  1M1K R;  4Y92 A;  2D6F A;  1PM3 A;  2VXF A;  5KH6 A;  2EJ9 A;  2YUN A;  3JCM e;  4FT2 A;  2RH2 A;  1ZUY A;  1VYV A;  1OPL A;  1PRL C;  1JU5 C;  3A8H B;  1AWX A;  5CR2 A;  1NLO C;  3KXT A;  2X3W D;  3J7A F;  1M1K U;  3HRU A;  2COZ A;  1RAG B;  1Y57 A;  1K8A C;  2J05 A;  2LT4 A;  1QWE A;  4IUR A;  1ZA1 B;  2YRV A;  3KUF A;  5CAI A;  4RMO A;  4OB2 B;  4ELZ C;  2KEA A;  3CCV T;  4PNO A;  2SEM A;  1WXB A;  4A4F A;  5I22 A;  1VQ4 Q;  2JUF A;  4M4Z A;  3G6E A;  2XHC A;  5GAN 7;  3CBP A;  3E19 A;  1V76 A;  4M7A B;  4Y28 E;  5KCO A;  1VQ9 A;  2RJC A;  4XTU A;  2E65 A;  2DVJ A;  1WHH A;  4M78 B;  2FPE A;  2FPD A;  2KBT A;  2JS0 A;  3G71 A;  4M7D A;  4C92 F;  3PT9 A;  2E4H A;  5GAN 4;  4HCB A;  3QO3 A;  4E47 A;  1EZZ B;  1JJ2 P;  2E70 A;  1R0B G;  2D1X A;  3TRE A;  3CCJ T;  1SHG A;  3JCM Q;  3RIR A;  4C8Q F;  3OYD A;  2RK2 A;  5A0G A;  2ZPI B;  1YN8 A;  2O4X B;  4QQ6 A;  5C6S A;  3LW5 E;  1C1A A;  3GNG A;  4IUU A;  3CPW A;  2NLU A;  5KYU A;  3QJ6 A;  3URG A;  5LJ5 d;  1YIJ Q;  1NJI C;  4OMM A;  2Z0W A;  3V8L A;  5GAN 6;  3S6W A;  1Z9Q A;  3EGX A;  2M16 A;  2DNU A;  1VQN A;  1KD1 C;  4OML A;  5FU7 B;  3MP1 A;  4XU3 A;  2KY9 A;  4J6Y A;  3EFR A;  3KBG A;  2HZY A;  3CD6 T;  2D0N A;  2C0T A;  3QXE B;  3WVD B;  4BB7 A;  2KRS A;  3CCE T;  4M7D E;  5GAM h;  3OSS C;  1BCM A;  2L3R A;  1YI2 A;  2HQX A;  3MJX A;  2DK3 A;  4LNP A;  4Y91 A;  5DLO A;  4AG2 C;  3DKM A;  5GJV B;  4AFS C;  1IZ6 A;  2V8J A;  5CKF A;  4LDU A;  1M1K C;  1R77 A;  4DOV A;  3X28 B;  2EKH A;  2NUZ A;  3QG1 A;  4XTW A;  1QP2 A;  4M77 G;  1OX9 A;  2DM1 A;  2YHT A;  5LJ5 g;  4C92 B;  2DX1 A;  2JJ9 A;  4OMP A;  1FMK A;  4EMK C;  4RTU A;  2KRN A;  1YJN A;  2CT3 A;  3LGF A;  3OYN A;  2K5L A;  4BI8 B;  2J6F A;  4C8Q B;  2A7Y A;  4JRP A;  1TTH B;  3OSV A;  4WCI A;  4QQG A;  1VQL T;  1YCY A;  3M0U A;  3A8M B;  2JZ2 A;  3JCM f;  2JMC A;  4L5G A;  3X24 B;  3I9Q A;  4EMH A;  3HFO A;  2RI5 A;  2JTF A;  3G1J A;  2KDS A;  4E7S A;  3FJ5 A;  1VQK Q;  1VQ8 T;  1H3H A;  2ZPF B;  3G4S Q;  1ARK A;  1M1F A;  4D8D A;  5CVI A;  2NUT A;  3CCU T;  1VQ5 T;  1RI0 A;  4PL6 A;  1KJW A;  2CP0 A;  1QMC A;  2KSS A;  3CC4 T;  1M4Z A;  5GAN 3;  1JQQ A;  1W2B S;  3CC7 T;  1UDL A;  2DFU A;  4L59 A;  1G5V A;  4OMF B;  3NGP A;  1V1C A;  3QKJ A;  2EIF A;  3M5A A;  2ROL A;  3CCM A;  5IHN A;  2E10 A;  1BKB A;  4HA8 A;  1H64 1;  2YDL A;  1MV0 B;  1WI7 A;  2HEQ A;  2RI2 A;  2GQI A;  5I2M A;  2EQM A;  2RHX A;  4XAX B;  2KAF A;  3VS1 A;  2V26 A;  3VRY A;  3BFM A;  3OYK A;  1PKT A;  5C0M A;  3QPH A;  2XU8 A;  4M77 D;  1VQM T;  1X6O A;  2R5A A;  2HSE B;  2VXE A;  1QVF S;  4QQD A;  2RMO A;  2RHU A;  2HSP A;  5GAN e;  3HRS A;  2V8K A;  3QYG B;  4IIM A;  3JCM W;  2RK1 A;  3CC2 T;  1IHW A;  1BI1 A;  1YBY A;  2GFA A;  4ZTJ A;  1WYX A;  2HKQ B;  2MF2 A;  2DTH A;  2XD0 A;  1NYF A;  1B34 B;  2NYS A;  4HKE A;  2GFU A;  4ZTF A;  3UA7 A;  4N4I A;  2QQA A;  2V1Q A;  4M7A A;  4M75 G;  4HVU A;  4MZT A;  3CPW P;  3CCV A;  3CQT A;  4M78 A;  1U3O A;  5AT1 B;  3MEV A;  1VUB A;  1NPP A;  1R0C B;  3OYL A;  1IXD A;  1GFD A;  3CCE Q;  4OVA A;  2XID A;  4LDW A;  4O6J A;  2ATC B;  3M59 A;  1PD0 A;  1M27 C;  3M4G A;  2AK5 A;  4RTW A;  1KG1 A;  4QKU A;  2DE0 X;  2O4X A;  2DXB A;  3AT1 B;  5ECA A;  1QKX A;  3CCJ A;  4E2F B;  3SEM A;  3EH1 A;  3UA6 A;  2JNG A;  2ZAE A;  4A4K A;  1QVG S;  2C06 A;  3EGU A;  2XIC A;  1PCX A;  2DEU A;  1WJQ A;  2GQV A;  1NEG A;  3OS2 A;  4DOW A;  3P8H A;  5IN1 A;  4HXJ A;  1VQ7 T;  1RL2 A;  2OI3 A;  2GTO A;  2RF0 A;  3RBB B;  3HSB A;  4QT7 A;  4M7A E;  1ZSG A;  1FXX A;  5GMK j;  1VQL Q;  3V8J A;  4AMC A;  2VWF A;  2YSQ A;  4X34 A;  1M2O A;  2M51 A;  3M57 A;  2KT1 A;  1KC8 U;  4M78 E;  4NOY A;  3CXC A;  3OW2 A;  3CCS A;  2A0F B;  2E3H A;  1G83 A;  3WVE B;  2DER A;  4DBQ A;  4C5G A;  4M7A C;  4RKU E;  1AEY A;  3CD6 A;  4EMK B;  2EYW A;  2MYS A;  2ZCF B;  4M78 C;  1VQ8 Q;  1PHT A;  2JXB A;  3PNW C;  1OV3 A;  3A8L B;  4NL3 A;  2MWO A;  2BKD N;  4F7U G;  3CCU Q;  1VQ5 Q;  7AT1 B;  5CKD A;  3PIP A;  3L2U A;  2QEX T;  4PFP A;  3H9N A;  3FLG A;  3C4S A;  3EGX B;  3FB9 A;  1VYT A;  3CC4 Q;  1F1B B;  2AZV A;  1QWF A;  3F70 A;  4E7K A;  4M75 D;  3CC7 Q;  3Q1J A;  3OY9 A;  1GCQ A;  1TG0 A;  2RQR A;  1MMA A;  5I21 A;  3EG0 A;  1SSH A;  2QG9 B;  4XU0 A;  2X51 A;  2LMJ A;  2A28 A;  5KYW A;  1YIT T;  2DLP A;  2A08 A;  1OYX A;  1S72 T;  5GMK e;  4MDW A;  4VUB A;  1OU8 A;  2FRY A;  3RMS A;  2OTJ T;  3HTR A;  1UGV A;  4PJO G;  3OA6 A;  1N9R A;  1YHQ T;  1EX4 A;  2X35 A;  1JXO A;  1NYG A;  1VIF A;  5GAN f;  1KHI A;  2FYK A;  3CPF A;  4JZ4 A;  3OYF A;  4DBF A;  2K5I A;  1K8A R;  1VYU A;  4Q5W A;  1K73 R;  2DZC A;  1YIJ T;  1VQM Q;  3OS0 A;  2GNC A;  2F2V A;  4ZGJ B;  2L8D A;  1Z9Z A;  2QTV A;  2CP2 A;  3VS3 A;  3FDR A;  2K2M A;  4LDX A;  1MND A;  1D1B A;  2EQK A;  2HAX A;  1X69 A;  3ULR B;  1BCO A;  4ORZ A;  2MIO A;  2X4Y A;  4OF1 A;  3OBW A;  2EYX A;  5IHI A;  1K73 U;  1Y71 A;  1A0N B;  1RAF B;  1WHM A;  1KC8 C;  3QUI A;  3OYH A;  1WPY A;  4QVC A;  4A53 A;  1Y7X A;  4KGZ B;  2E12 A;  5FLX E;  4IUV A;  3VS0 A;  2HMA A;  1WFW A;  2EQU A;  4CC4 B;  5IHK A;  2QQS A;  3GIB A;  2GBQ A;  2LX9 A;  1M1G A;  2QAZ A;  2DL4 A;  2LJ1 A;  5GAN 5;  2LJ0 A;  1WHK A;  4Z89 A;  3LLR A;  1TXQ A;  4XTY A;  3OS5 A;  4IKF A;  2NUT B;  2K4Y A;  3NTI A;  2BZY A;  1D0Z A;  2DL3 A;  2JM9 A;  1WXU A;  4JJC A;  2C0I A;  1PSE A;  2D9T A;  2O9S A;  2FPF A;  4OGC A;  3R6N A;  4HVW A;  2AKL A;  1JBM A;  1E6G A;  2HKN A;  4DA4 A;  3LWI A;  1H92 A;  2H3J A;  5GAN 2;  3OQ5 A;  4A4H A;  1OZ3 A;  1WX6 A;  2RHY A;  2HBW A;  2CZ1 B;  4PJJ A;  3CME A;  1VQO Q;  1VQ6 A;  4IIO A;  4JLI A;  2LQW A;  3I55 T;  1B34 A;  2HCK A;  5HKC A;  2L0A A;  4PJO D;  3L2Q A;  1TUC A;  4OB1 B;  1ACM B;  5A2Q E;  1XOV A;  3ZFJ A;  4KRT A;  5HY6 A;  1T0H A;  3EG1 A;  3JCM h;  3G4S T;  3G7Z A;  3MO8 A;  4OB0 B;  3GOX A;  3A8G B;  2DBK A;  4C0G A;  4DBR A;  3M56 A;  2XK0 A;  3A8O B;  1ZUU A;  2EJF A;  4JRQ A;  2COY A;  4E7I A;  5GMK l;  1WQW A;  2M9U A;  2V1R A;  4PJN A;  4M7D G;  4R0K A;  1M90 U;  1BI0 A;  4DEY A;  2EGA A;  1E7O A;  1VQP A;  2WSE E;  1Q81 R;  4E7H A;  3VS5 A;  1RLP C;  4RTY A;  4ZNX A;  4J6W A;  5HK3 A;  2JTM A;  3IQL A;  4JJN K;  1K73 C;  4KT0 E;  2K79 A;  2LRQ A;  3QHS A;  1KK7 A;  4JZ3 A;  3OW2 P;  1Y07 A;  2QEX Q;  1MHN A;  2QA4 A;  2YUO A;  1UGQ B;  3FRN A;  5GAM g;  2RO0 A;  1Q81 U;  1BYM A;  2HQH A;  4B6M A;  3NMZ C;  4HT9 A;  5I11 A;  5CK9 A;  2LP5 A;  5KE3 A;  3HL8 A;  2AKK A;  6AT1 B;  3OYA A;  1YIT Q;  3SWN A;  2KMT A;  3JCM J;  4BD3 A;  2FZK B;  2VV5 A;  1S72 Q;  3J81 E;  2OTL T;  1VQ7 A;  3J80 E;  2OTJ Q;  2KRM A;  2I2L A;  4JLG A;  4KGX B;  3VS2 A;  1YHQ Q;  3LH5 A;  4EMK A;  1YJW Q;  1YJ9 T;  2DET A;  2MOX A;  4J9B A;  2KI7 A;  1LCK A;  1GBQ A;  3DB3 A;  3QDF A;  5D6Y A;  3L1A A;  2HL5 C;  2YT6 A;  4CC7 A;  3S3N A;  3TQ7 P;  3C0C A;  4PFO A;  5LJ3 e;  4XTV A;  3OB9 A;  1RAI B;  3P8D A;  1SG5 A;  1PC0 A;  3OMC A;  3CEY A;  2LTO A;  4FSS A;  4J9G A;  2FG0 A;  1VQ4 A;  2RM4 A;  2OAW A;  1QP3 A;  2DEQ A;  4GLK A;  1I5O B;  1MMN A;  1N9S A;  2KXD A;  4D8K A;  3QWX X;  1GCP A;  3CCL Q;  2RJE A;  3JB9 H;  1G8X A;  3JV3 A;  3L2Z A;  5GAO l;  2BTT A;  1N27 A;  3REB B;  3WXM B;  4OB3 B;  4M7D D;  2LCS A;  2LVM A;  9ATC B;  1I81 A;  3CCR T;  1HK9 A;  2K3B A;  1T0J A;  3EHQ A;  1IGQ A;  1UGP B;  3BDL A;  5KYY B;  1D1C A;  1KQ2 A;  2CUB A;  2LX7 A;  3C12 A;  3SWN C;  4PJM A;  1XTD A;  2XDP A;  4Z02 A;  2AT1 B;  3OS1 A;  1W2B A;  2OAU A;  1ZBX A;  1TSF A;  1PRM C;  4PJO F;  1AHJ B;  8AT1 B;  2B8A A;  4PLI A;  2G6F X;  2V8I A;  3VU3 C;  5KYX A;  1Q81 C;  2DL7 A;  1KQS S;  3RKW A;  1X01 A;  2WSC E;  4WF2 A;  1KHC A;  4E7L A;  2DAQ A;  4V2S A;  3I56 T;  4KH0 B;  3U23 A;  5CKB A;  4KH1 B;  4E7J A;  5KYW B;  1SSF A;  2RHI A;  3DLM A;  3VS4 A;  1WJR A;  1RUW A;  3I55 Q;  1PG5 B;  2KYM A;  3A98 A;  3DB4 A;  1ZA2 B;  1PWT A;  1RAB B;  4RCB A;  2F5K A;  3QZ9 B;  4LDY A;  2EVR A;  2K3X A;  5KE2 A;  3CBM A;  4MDX A;  1ZUK A;  1NLP C;  2E6Z A;  2QQR A;  5HK0 A;  1YFN A;  1QKW A;  1QVF A;  4O5V A;  2ENM A;  5KYN A;  1WDX A;  2VUB A;  4ZGE B;  1I5L A;  4X9C A;  1Q7Y U;  5J3B A;  5M9O A;  5D6W A;  2ZPG B;  5GAN j;  1ZHI A;  3CCQ T;  5GMK m;  4M77 A;  2E1H A;  2AZS A;  4E7Z A;  4J9D A;  3C95 A;  1BB9 A;  2M0Y A;  2IG0 A;  2X9H A;  2CUD A;  3MCA B;  2E64 A;  3VYG A;  4XTX A;  3X20 B;  5AYF A;  2EYY A;  1QCN A;  2CP7 A;  4BY6 C;  2SRC A;  2DF6 A;  3C94 A;  1W70 A;  2PVD B;  3RER A;  4XTZ A;  3PGG A;  1WXT A;  2E5K A;  4PJO B;  4CI0 C;  2EQJ A;  2JOY A;  2MI6 A;  1WZO A;  4N4G A;  2FVU A;  4ZN1 A;  3CMA T;  2DVE A;  4M7A G;  4JRK A;  5GAN h;  2RN8 A;  1OOT A;  3PVL A;  2OTL Q;  5LJ5 e;  1VQK A;  2ZPE B;  5CKH A;  2BE7 D;  1YJ9 Q;  2PUK B;  2ZZD A;  5LJ3 f;  1QVG A;  2K57 A;  2NWM A;  2VKN A;  4B9W A;  1UHF A;  4DBH A;  4HT8 A;  1SHF A;  1U5S A;  1RI9 A;  1KQ1 A;  1MV3 A;  3M0R A;  2EPD A;  2DO3 A;  3VUB A;  3V7R A;  4GLM A;  3LGL A;  3E9G A;  4M77 C;  1K4U S;  1UUE A;  2RD1 A;  4XQ3 A;  1RAC B;  2O01 E;  3EFS A;  4N0A A;  3PIO A;  3ZL7 C;  1WGS A;  1NBE B;  2KK4 A;  2C0O A;  1AZG B;  3OYI A;  1CKB A;  2HL3 A;  4LXC A;  1RAE B;  1U8R A;  2CDT A;  4JJB A;  2QGG A;  2M0O A;  5GJW B;  2FZC B;  1B07 A;  2A3L A;  1SKU B;  4XU1 A;  1UGS B;  4RG8 A;  3L2R A;  4AFU C;  2IIM A;  3CCR Q;  1N6A A;  1KFZ A;  2HDA A;  1Q95 G;  2CSQ A;  4DQ2 A;  4J7F A;  1UTI A;  5GAM f;  1K9M R;  1H3Z A;  2G3R A;  4ZN3 A;  3JB9 I;  4BE0 A;  1M3B A;  4KUI A;  2ZPB B;  2P0Q A;  2J6O A;  4MZP A;  4KUD K;  1VQO T;  4JPB W;  3GLX A;  1KC8 R;  1UG1 A;  4FCY A;  1C6V X;  2LC4 A;  4FW2 A;  1I0C A;  1D3B A;  2RHZ A;  1PKS A;  4J9E A;  3H0F A;  3G6E T;  2K3Y A;  1VQ9 T;  4C92 G;  1K9M U;  4EDU A;  3EG3 A;  3I56 Q;  5IXF A;  3JCM P;  2EQI A;  4M75 A;  1HXD A;  2ED0 A;  3SWN B;  2VGN A;  1AZE A;  1W2B P;  5CO7 A;  1N8R U;  3O5Z A;  3P8B B;  4QVD A;  3NFC A;  4ME7 A;  1QW1 A;  2P4R A;  1ABO A;  3LX7 A;  4C8Q G;  2FRW A;  4N0A C;  4BI3 A;  3DLL A;  1WA7 A;  1ZX6 A;  2BZ8 A;  3QWY A;  2VGM A;  2KYB A;  2RQU A;  3EH2 A;  1VOM A;  5KYY A;  3CCE A;  1SRL A;  2LQK A;  3THK A;  2DMO A;  2H3E B;  3OYB A;  4MML A;  4HVV A;  2O31 A;  3CBO A;  4ZGD B;  1CKA A;  2YRD A;  1WJS A;  3EGD B;  2MCN A;  2CP6 A;  1LVK A;  2YWW A;  2A37 A;  3M0S A;  3MET A;  3CCQ Q;  3LWH A;  5L23 A;  1OQK A;  3I5S A;  4ATO A;  3JCM d;  3SFM A;  2HQE A;  4EMG A;  1KSW A;  3M53 A;  5GMK h;  1NE8 A;  3M0P A;  4EIK A;  1VQN T;  1QVF P;  1PSF A;  5GAN 8;  2PTK A;  4J7I A;  4M77 F;  2CP5 A;  4B9X A;  4ESR A;  3PTA A;  2Y90 A;  2KR3 A;  2K6D A;  1SF9 A;  4BDZ A;  3LH0 A;  1RAH B;  3S3M A;  4A63 B;  4A54 A;  5LJ5 f;  4A4G A;  1VQL A;  4PK4 A;  1YJW T;  1YI2 T;  2F69 A;  1DJ7 B;  2KT8 A;  2QK0 A;  3A1P A;  4M75 C;  3VUZ A;  4J9F A;  4FYY B;  2PZ1 A;  3CMA Q;  4TVR A;  1M30 A;  2E5Q A;  1M3C A;  4J9H A;  3QSU A;  1BK2 A;  3HKS A;  4N4H A;  1WQ7 A;  3RKY A;  1VQ8 A;  5GMK i;  4F7U A;  1TS9 A;  1QVP A;  4BY6 B;  3RMQ A;  1GRI A;  3SDZ A;  5KYX B;  3MP8 A;  3CCU A;  1VQ5 A;  2DJZ A;  3JB9 G;  4C92 D;  1B7T A;  1G3T A;  1MMD A;  1XNI A;  1K9M C;  2CT4 A;  5FRO A;  2K7A A;  2YUQ A;  1YJN T;  3CC4 A;  2LDM A;  3JCM g;  2E3I A;  1EIF A;  4MZM A;  1AWJ A;  3CC7 A;  3FIF A;  3CCL T;  5IAY A;  2XMF A;  2EGC A;  3MEA A;  5CCA A;  2RNA A;  3JCM V;  1JJ2 S;  5HCK A;  4OMN A;  3X26 B;  4C8Q D;  2L3S A;  1SEM A;  2LNH B;  5FWC A;  4LE9 A;  3FC3 A;  1K76 A;  4HCZ A;  1ZSZ A;  2EGE A;  3HPW A;  2BIV A;  1QVG P;  5EC7 A;  4PJO A;  1UB4 A;  3V7S A;  2XDB A;  4FSX A;  3TEE A;  2MK5 A;  2DTO A;  5GAO n;  4J83 A;  4BAC A;  2QQB A;  1TH7 A;  4ANJ A;  2QTX A;  2DXT A;  3BDU A;  1BI3 A;  2QAS A;  2D8H A;  2EW3 A;  4M77 B;  1UHC A;  1W1F A;  2FHD A;  2VC8 A;  3RUX A;  5IH2 A;  2DYI A;  2P84 A;  3SD4 A;  1AWO A;  1VQM A;  4RG2 A;  3RR6 A;  4ELY C;  1K0S A;  3X25 B;  2X4W A;  3ER0 A;  3EG2 A;  5DLQ E;  2EYQ A;  3NHN A;  1M3A A;  2PQW A;  2D8J A;  3LYI A;  2EBP A;  3CC2 A;  2JTE A;  3CCM T;  3MPU B;  2DKG A;  3JCM X;  2F1L A;  4A4E A;  1G3S A;  2DIL A;  3H8Z A;  2EJG A;  1M90 R;  3FJP A;  3L42 A;  2MMP A;  4WTO B;  3G6E Q;  2CZ0 B;  1VQ9 Q;  1NJI U;  1WHG A;  3JCM b;  1WNL A;  2E6N A;  2AIR B;  2MPX C;  3NPF A;  3G71 Q;  2JN0 A;  1BBZ A;  4PJO E;  2MAM A;  2Y4Y A;  3A5Z B;  3OBY A;  4BI4 A;  1U1T A;  1XJW B;  2X3X D;  3E1S A;  4JDS A;  1ABQ A;  1UJY A;  1ZSZ C;  4M75 F;  2L89 A;  4E6R A;  1JO8 A;  4PJO C;  3V7C A;  3JB9 D;  1M8M A;  1OZ2 A;  5GAO p;  2JW4 A;  1K0X A;  4J6X A;  3H41 A;  2J6K A;  3HHT B;  3CXC P;  2KNB B;  2FO0 A;  1D0X A;  2X4X A;  3S3O A;  5LJ3 j;  4JJD A;  1H8K A;  3OYY A;  1Q86 R;  3SHW A;  4RTT A;  4RTX A;  2L2P A;  4OP0 A;  4LDV A;  3PVQ A;  1VQO A;  4XK8 E;  5FRN A;  1UGR B;  4NS5 A;  5CQX A;  3SB2 A;  4PKC C;  1VQN Q;  1X43 A;  4LUD A;  2R57 A;  5EG2 A;  2H8H A;  2VYT A;  2I0N A;  3UPU A;  1Q86 U;  2FB7 A;  1UFF A;  2F2X A;  1AWW A;  1YI2 Q;  3ZEH A;  4JS5 A;  4UC4 A;  2OJ2 A;  2R58 A;  2GF7 A;  3OYJ A;  3QJY A;  5LJ3 h;  2QQ9 A;  1Y0M A;  3EGD A;  4RTZ A;  1I07 A;  2XKO C;  4C5H A;  4AG1 C;  2RI3 A;  1AT1 B;  2CYZ B;  2W10 A;  5GAM j;  1KQS A;  3O8V A;  5A0L A;  1D3B B;  4PLL A;  3QZ5 B;  4KUL A;  4NL2 A;  1O9S A;  4KBM B;  2P0P A;  1D09 B;  1SRM A;  2GGR A;  4OGE A;  1TUD A;  3VKI A; 
#chains in the Genus database with same CATH homology
 1G2B A;  1WXT A;  2E5K A;  2ED1 A;  2YUP A;  1YCS B;  2EYW A;  1B3Q A;  1HD3 A;  1PHT A;  2JXB A;  1UE9 A;  2RPN A;  5FW9 A;  1OV3 A;  1E6H A;  2RN8 A;  2KRO A;  2ESW A;  1OOT A;  3PVL A;  3TSW A;  1VA7 A;  3REA B;  1RLQ C;  1QCF A;  1AOJ A;  1W6X A;  2CRE A;  1VYT A;  2AZV A;  1QWF A;  4F14 A;  4Z88 A;  4GBQ A;  1GCQ A;  1TG0 A;  2RQR A;  2NWM A;  2VKN A;  4Z8A A;  1UHF A;  3M0Q A;  2CSI A;  1SHF A;  3EG0 A;  1SSH A;  1U5S A;  1RI9 A;  2O2O A;  1YWO A;  1MV3 A;  3M0R A;  2LMJ A;  2A28 A;  2EPD A;  1IO6 A;  1X6B A;  2LZ6 B;  2DLP A;  2A08 A;  4GLM A;  4Y92 A;  1K4U S;  2DRM A;  1UUE A;  1HJD A;  2FRY A;  2YUN A;  1UGV A;  3ZL7 C;  2JS2 A;  1ZUY A;  1VYV A;  1OPL A;  1PRL C;  2C0O A;  1JXO A;  1AZG B;  1JU5 C;  1NYG A;  1CKB A;  1YNZ A;  1AWX A;  4JZ4 A;  1NLO C;  2CDT A;  1X27 A;  4JJB A;  5GJW B;  1B07 A;  1VYU A;  2X3W D;  1T3S A;  2DJQ A;  4AFZ C;  1Y57 A;  4AFU C;  2IIM A;  2J05 A;  1QWE A;  2GNC A;  2F2V A;  2HDA A;  1KFZ A;  2KEA A;  1Z9Z A;  2CSQ A;  3VS3 A;  2SEM A;  4LUE A;  1WXB A;  2K2M A;  1UTI A;  5I22 A;  1GL5 A;  1X69 A;  3ULR B;  1QLY A;  4M4Z A;  4ORZ A;  2MIO A;  1M3B A;  2J7I A;  2DVJ A;  2RQT A;  2J6O A;  2EYX A;  4JPB W;  5IHI A;  2FPE A;  2FPD A;  2KBT A;  2JS0 A;  4AFQ C;  1A0N B;  1UG1 A;  1I0C A;  1GBR A;  2JT4 A;  1X6G A;  1PKS A;  3VS0 A;  4J9E A;  3H0F A;  1WFW A;  2D1X A;  1SHG A;  2CH4 A;  3EG3 A;  5IXF A;  4CC4 B;  2EQI A;  5IHK A;  2GBQ A;  2ED0 A;  1YN8 A;  2DL4 A;  2LJ1 A;  1AZE A;  2LJ0 A;  3H0I A;  4Z89 A;  3O5Z A;  3TSZ A;  2BZY A;  2P4R A;  1ABO A;  1BU1 A;  2FRW A;  2ABL A;  4OMM A;  2DL3 A;  2JM9 A;  1WXU A;  1WA7 A;  1ZX6 A;  2BZ8 A;  2PNI A;  4JJC A;  2C0I A;  3QWY A;  2O9S A;  2KYB A;  2FPF A;  2RQU A;  3R6N A;  1Z9Q A;  1SRL A;  4HVW A;  3THK A;  2AKL A;  2DMO A;  2DNU A;  1E6G A;  4HVV A;  2O31 A;  1H92 A;  4OML A;  2O9V A;  1WX6 A;  3UF4 A;  1CKA A;  3VRZ A;  2MCN A;  2HBW A;  1NM7 A;  2A37 A;  3M0S A;  4IIO A;  2D0N A;  2LQW A;  5FWB A;  3I5S A;  5L23 A;  3VS6 A;  2C0T A;  2KXC A;  2HCK A;  2L0A A;  2KRS A;  1TUC A;  1OPK A;  2O88 A;  1KSW A;  4OMQ A;  1XOV A;  3M0P A;  4EIK A;  4KRT A;  1T0H A;  2L3P A;  4LNP A;  3EG1 A;  2PTK A;  4AG2 C;  4ESR A;  1FYN A;  5GJV B;  4AFS C;  2DRK A;  2A36 A;  2DBK A;  2KR3 A;  2K6D A;  2DYB A;  1ZUU A;  2EKH A;  4A63 B;  2NUZ A;  2V1R A;  2DM1 A;  3VS7 A;  4R0K A;  4DEY A;  2DX1 A;  2KGT A;  4OMP A;  1FMK A;  1E7O A;  2EGA A;  2KT8 A;  4J9F A;  3VS5 A;  2PZ1 A;  4RTU A;  1ZBJ A;  2KRN A;  4F17 A;  1RLP C;  4RTY A;  4ZNX A;  2CT3 A;  1M30 A;  4RUG A;  1M3C A;  3IQL A;  4J9H A;  1BK2 A;  1EFN A;  4LN2 A;  2K79 A;  2J6F A;  1NEB A;  4JZ3 A;  4HCK A;  4WCI A;  3EHR A;  1U06 A;  3M0U A;  1GRI A;  1JEG A;  2YUO A;  1KIK A;  1J3T A;  2CT4 A;  2JMC A;  2ECZ A;  2K7A A;  2YUQ A;  3I9Q A;  3NMZ C;  4F16 A;  2B86 A;  5I11 A;  2FEI A;  2LP5 A;  3FJ5 A;  1AWJ A;  2AKK A;  2XMF A;  1ARK A;  1H3H A;  2EGC A;  2EYZ A;  2RNA A;  5HCK A;  4OMN A;  1ZLM A;  2L3S A;  2VVK A;  3I35 A;  1SEM A;  2LNH B;  4D8D A;  5FWC A;  4LE9 A;  1K76 A;  2CH4 W;  2EGE A;  2KRM A;  2RQV A;  1KJW A;  3VS2 A;  2JM8 A;  5EC7 A;  3LH5 A;  3RNJ A;  1SPK A;  2DL8 A;  2DBM A;  2MOX A;  4J9B A;  1JQQ A;  1X2K A;  1LCK A;  1AVZ C;  1GBQ A;  4J9I A;  1UDL A;  2LQN A;  3NGP A;  1V1C A;  2YT6 A;  4CC7 A;  2D8H A;  2EW3 A;  2ROL A;  5IHN A;  1UHC A;  1UEC A;  1W1F A;  1YP5 A;  2YDL A;  1I1J A;  5IH2 A;  1MV0 B;  1WI7 A;  2HEQ A;  3C0C A;  1AWO A;  1K0S A;  2GQI A;  3VS1 A;  3EG2 A;  1K1Z A;  4FSS A;  3VRY A;  4J9G A;  2FG0 A;  1AD5 A;  3NHN A;  2OAW A;  1M3A A;  4CC2 A;  1S1N A;  2D8J A;  1PKT A;  2EBP A;  3H0H A;  2JTE A;  2KXD A;  4D8K A;  3QWX X;  1GCP A;  3JV3 A;  2K9G A;  2BTT A;  3REB B;  2DIL A;  2LCS A;  2BZX A;  2GTJ A;  1OEB A;  1X2Q A;  2RMO A;  2HSP A;  2K3B A;  1T0J A;  3EHQ A;  2CUB A;  4IIM A;  2DA9 A;  2LX7 A;  3NPF A;  2KE9 A;  1BBZ A;  1T3L A;  1CSK A;  1WYX A;  2X3X D;  1ABQ A;  1UJY A;  1PRM C;  1NYF A;  4E6R A;  1JO8 A;  4DEX A;  3UA7 A;  2G6F X;  4CC3 A;  1M8M A;  2DL7 A;  2JW4 A;  1K0X A;  2V1Q A;  3H41 A;  1PNJ A;  2J6K A;  4HVU A;  3U23 A;  2KNB B;  2FO0 A;  3CQT A;  3GBQ A;  1U3O A;  4JJD A;  1H8K A;  1HSQ A;  3VS4 A;  3SHW A;  1RUW A;  4RTT A;  4RTX A;  2KYM A;  4OMO A;  2L2P A;  3A98 A;  1PWT A;  3PVQ A;  1GFD A;  3PE0 A;  4J9C A;  2EVR A;  1M27 C;  2AK5 A;  1X43 A;  4RTW A;  3I5R A;  1YWP A;  1ZUK A;  4LUD A;  1NLP C;  2DE0 X;  2H8H A;  2I0N A;  1NG2 A;  1GFC A;  1QKW A;  2RQW A;  2ENM A;  5ECA A;  1QKX A;  1WDX A;  2JMA A;  3KFV A;  3SEM A;  3UA6 A;  3UAT A;  1WIE A;  4K11 A;  1K9A A;  5IXB A;  1UFF A;  2F2X A;  1AWW A;  2W0Z A;  4X1V A;  1UJ0 A;  4RTV A;  2ROT A;  3EGU A;  2OJ2 A;  2AZS A;  4J9D A;  1BB9 A;  2M0Y A;  2L3Q A;  1N5Z A;  1NEG A;  2CUD A;  3TVT A;  2F2W A;  1GCQ C;  1Y0M A;  4HXJ A;  4RTZ A;  2OI3 A;  1I07 A;  2GTO A;  2RF0 A;  4AG1 C;  3M0T A;  3RBB B;  1WLP B;  4QT7 A;  2W10 A;  2QDL A;  1ZSG A;  1JXM A;  2LJ3 A;  2J06 A;  2EYY A;  2VWF A;  2YSQ A;  2M51 A;  2SRC A;  2DF6 A;  1MUZ A;  1W70 A;  1SRM A;  1G83 A;  2GGR A;  2KT1 A;  1TUD A;  2DL5 A;  1AEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...