1JO8A

Structural analysis of the yeast actin binding protein abp1 sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
b'PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN BINDING PROTEIN
molecule tags Structural protein
source organism Saccharomyces cerevisiae
publication title Unusual binding properties of the SH3 domain of the yeast actin-binding protein Abp1: structural and functional analysis.
pubmed doi rcsb
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1jo8A00
2GGRA 2EYZA 1UJYA 1KJWA 2EW3A 2FRWA 1E6GA 2KE9A 4JPBW 1RLQC 1UG1A 1WXBA 3EG0A 3M0SA 4JJBA 1VYUA 2K2MA 2LNHB 1A0NB 2DX1A 1W70A 1RUWA 2AZVA 4EIKA 3TVTA 2E5KA 2LQWA 2JMCA 3R6NA 1FMKA 3QWYA 2SRCA 1WXUA 3UA7A 4HCKA 2C0OA 1T3SA 1JXOA 2EYXA 2JT4A 1XOVA 2L3PA 1HD3A 1NG2A 2KYBA 1UGVA 1ZUYA 2QDLA 2YUOA 1GL5A 1MV3A 2YT6A 2K3BA 4JJDA 1HSQA 4OMMA 1JXMA 1T3LA 3VS5A 1T0HA 2F2XA 1UHCA 2IIMA 1BB9A 4LUEA 2M51A 1AWJA 4D8DA 1Z9QA 2EGCA 4K11A 2CDTA 2X3XD 1QWEA 1PHTA 3PVQA 4RTXA 3NPFA 2CUBA 1NYGA 2YDLA 2ESWA 2KYMA 1WLPB 4IIOA 2C0IA 4Z8AA 1H8KA 2P4RA 2EVRA 1K1ZA 4J9IA 2OAWA 4DEYA 2DL8A 1WIEA 2AK5A 3H0FA 2CH4A 2DBMA 5IHNA 1X69A 1AOJA 1GFCA 1PRMC 2EKHA 2YUQA 1AZGB 1NYFA 1BK2A 4JZ4A 1OEBA 5IHKA 1NEBA 2A28A 2L2PA 5GJWB 1SHGA 2MCNA 4LE9A 4AG2C 4ORZA 1E7OA 1SHFA 2J7IA 1I07A 2O9VA 2DYBA 1UUEA 2K6DA 1M3AA 2DL3A 1RLPC 1ABOA 2A37A 1BU1A 1QWFA 2GNCA 1HJDA 4J9FA 4F14A 1WXTA 1T0JA 1VA7A 1ZLMA 3EGUA 1EFNA 1UHFA 2FG0A 4OMNA 1GCPA 3M0UA 3A98A 2VWFA 4WCIA 2DLPA 4AFQC 1PKTA 1J3TA 2H8HA 3O5ZA 1JO8A 1K76A 2DBKA 4AFZC 4OMPA 4AFSC 1OOTA 4FSSA 2J6FA 3IQLA 1AWXA 2DM1A 4JZ3A 3KFVA 1GBRA 2K7AA 2OJ2A 4ZNXA 2F2WA 2LQNA 1U3OA 1K9AA 2EYYA 2VVKA 1UECA 3VS3A 3LH5A 2L3QA 2DF6A 1QCFA 4CC7A 4E6RA 2CSQA 2L3SA 1KSWA 2MIOA 2NUZA 2LJ3A 2HDAA 1ZX6A 2V1RA 1YWPA 1TUCA 2DJQA 4HVUA 1AWOA 1JEGA 4Z89A 1AVZC 2DNUA 1JQQA 3PVLA 2CT4A 1CKAA 1OV3A 4RTTA 2KROA 2D1XA 3SEMA 2O2OA 2DL5A 1I1JA 2L0AA 2RQVA 3VS7A 4A63B 2JM8A 1X2KA 2YUNA 1M3BA 4IIMA 4JJCA 3JV3A 1GBQA 2KXCA 4RTZA 2ECZA 3EHQA 2HCKA 1U5SA 1I0CA 3C0CA 1QKXA 1ZUUA 3UF4A 3EG2A 1GFDA 2M0YA 2KXDA 2RF0A 3PE0A 3QWXX 4AG1C 2FO0A 1AD5A 1M3CA 3VRYA 4CC2A 1NLOC 1ARKA 2EGAA 2CREA 2KGTA 1YP5A 1WI7A 5ECAA 5I22A 2FPDA 2KNBB 2O31A 1PRLC 2KRMA 4Z88A 2CT3A 1AWWA 2I0NA 2KT8A 2RQWA 3EHRA 3VS2A 3U23A 4DEXA 4QT7A 1QKWA 3REBB 4J9EA 2VKNA 2KEAA 3UA6A 2JTEA 1GRIA 3H0HA 1WDXA 2D8JA 4LUDA 1SEMA 2AKKA 2MOXA 2AKLA 2LJ1A 5IHIA 3NHNA 4KRTA 3VS1A 2JS0A 1UDLA 3I35A 1YWOA 2OI3A 4LNPA 1AEYA 1X43A 2YUPA 1AZEA 5FWBA 3VS0A 1M30A 1TG0A 2J05A 4OMLA 1SPKA 1G2BA 1X2QA 2DMOA 1TUDA 1CKBA 1NLPC 2EBPA 1B07A 1K0XA 3I5RA 2D0NA 1K4US 4GBQA 1M8MA 1SSHA 2JMAA 2KBTA 2DRKA 1X27A 2LX7A 3M0TA 1UFFA 3H41A 2ROLA 3VRZA 1UJ0A 1NEGA 2JS2A 2BZXA 2V1QA 1W6XA 4X1VA 3REAB 2DE0X 2D8HA 3EG3A 3ZL7C 1WX6A 1ZSGA 4GLMA 2PZ1A 2PTKA 2BTTA 5I11A 1B3QA 1K0SA 1VYTA 4HVWA 2O88A 4OMQA 3FJ5A 1PWTA 3RNJA 2RQTA 3TSZA 1WA7A 2RQRA 4J9HA 3I9QA 2RNAA 1UTIA 1H92A 2ENMA 4LN2A 3VS6A 2J06A 3GBQA 4ESRA 3EG1A 2XMFA 2LMJA 1QLYA 4J9GA 2JM9A 2K79A 1E6HA 2K9GA 2BZYA 1MUZA 2A36A 2O9SA 1MV0B 2RPNA 2W10A 3ULRB 3M0QA 2GTOA 1JU5C 1WYXA 1G83A 2YSQA 2HSPA 3I5SA 2JXBA 1H3HA 1V1CA 5IXBA 2RN8A 1ABQA 2EYWA 2NWMA 2AZSA 1S1NA 2HEQA 4M4ZA 1Z9ZA 2LCSA 5L23A 2GBQA 3NGPA 2FPEA 1GCQC 1RI9A 3THKA 3M0PA 4Y92A 1OPLA 2FRYA 1SRLA 2SEMA 5GJVB 1PNJA 2GQIA 2W0ZA 1WFWA 2B86A 5EC7A 3M0RA 2KT1A 5FWCA 4F17A 2A08A 2LJ0A 4R0KA 4CC3A 4J9BA 1W1FA 2F2VA 3H0IA 3RBBB 4D8KA 2JW4A 2LZ6B 2FPFA 5IH2A 3SHWA 1CSKA 4RTVA 1GCQA 1BBZA 2G6FX 1YNZA 3NMZC 2KR3A 2KRSA 1SRMA 1U06A 1KIKA 4AFUC 2LP5A 1Y57A 2DRMA 2J6KA 2CH4W 1YCSB 2DL7A 2J6OA 2DA9A 3CQTA 1M27C 2RQUA 2DVJA 1YN8A 4HXJA 2ED0A 1X6BA 2PNIA 2CSIA 2CUDA 5FW9A 4J9DA 4F16A 4RUGA 1N5ZA 2X3WD 2BZ8A 4OMOA 2DILA 1ZBJA 2KRNA 1VYVA 1KFZA 2EGEA 1IO6A 1NM7A 2GTJA 1PKSA 2ROTA 4J9CA 5HCKA 1Y0MA 1FYNA 4RTUA 2FEIA 4HVVA 3TSWA 2HBWA 2C0TA 4CC4B 1OPKA 2DL4A 2ED1A 1LCKA 4RTYA 3VS4A 1ZUKA 2EPDA 5IXFA 2ABLA 2EQIA 1UE9A 4RTWA 1X6GA 3UATA 2RMOA
chains in the Genus database with same CATH superfamily
3VYHB 1Q82R 2X9HA 2FRWA 2LQ8A 1E6GA 1Y71A 2VXFA 2E12A 2GCXA 4JPBW 3RDVA 4PJNA 2K4YA 3JB9J 2RH2A 4XU1A 1VQ9A 2LNHB 1A0NB 3OYEA 3P8DA 1VQ5Q 4J6WA 3G7ZA 2FHDA 4JS4A 1BYMA 1KC8R 4V2SA 1D0XA 3Q1JA 2C0OA 2EYXA 1P92A 2L3PA 2NLUA 3CC4T 3E2UA 2QDLA 4N4HA 1KQ2A 1BI3A 1U1TA 4R55A 4PLIA 3CXCP 1YI2A 1WGSA 3JRZA 5KCHA 4JJDA 5LJ5j 4OMMA 2RA2A 1T3LA 3VS5A 4J7FA 2DTIA 2ZPBB 1KHIA 4EMGA 3I55T 4OMFB 3KBGA 5HK3A 1N8RC 4M78D 5HY6A 4X9CA 1I5LA 4PKCC 5L8RE 4K11A 2X3XD 1QWEA 3JCMb 4RTXA 4LD6A 1I5OB 2YDLA 1RACB 3A5ZB 1RAGB 4IIOA 1H8KA 1I81A 2P4RA 5A2QE 4M78C 2XHCA 4DA4A 1N8RU 4N0AC 4J6XA 2Y4XA 2RJDA 3H6ZA 2BIVA 4XTUA 4QVZA 1WIEA 4E7JA 2JZ2A 1X69A 2DXTA 1AOJA 3G6ET 1PG5B 1PRMC 1NJIC 4ZGEB 2YUQA 2CZ7B 9ATCB 3MJXA 1Q7YU 4BDYA 3CC2A 2A28A 3R6OA 2MCNA 3CCMA 4LE9A 5FU6B 1SHFA 4C92E 2MYSA 2DYBA 1M3AA 4O6JA 2X4YA 4RKUE 4M75B 3J7AF 3QHSA 2LC4A 1G8XA 1HJDA 3M57A 1ZSZA 1T0JA 1SG5A 2COYA 4M77A 1VQLQ 2FG0A 2OTJA 1AHJB 2MK5A 2DLPA 1PKTA 2DBKA 4AFZC 2RHXA 1D3BB 4OMPA 1VQ8T 4EMHA 1OOTA 5CQYA 5FROA 4XU3A 5FRNA 1ZA1B 2Y4YA 1GBRA 2VGMA 5GMKe 3EFRA 2F2WA 2LQNA 1VQ7A 2EYYA 2GF7A 4L6V5 5D7UA 2E64A 4C92F 4ELZC 3CCJA 3X20B 2LJ3A 2H3JA 3S3MA 4DOWA 3VUZA 5HK0A 3OYFA 4HVUA 1AWOA 5GAOq 4QVDA 1YBYA 5LJ5d 4M75D 4RTTA 2KROA 4XU2A 4JRIA 1O9SA 2QEXT 2L0AA 2RQVA 1QCNA 2RB6A 3PMTA 3L2QA 2D6FA 2PUKB 4IIMA 4EMKC 1BIAA 2DPPB 4M75C 2DIGA 4PFPA 3LLRA 5GAMf 3CCQA 1I0CA 1KQ1A 3HRUA 1Q7YR 1OU8A 4NL3A 2PQWA 4IURA 2CS7A 4PJOC 2KMTA 2KXDA 4C5GA 3VRYA 5LJ3j 3C94A 1JBMA 1TH7A 1YP5A 5I22A 2FPDA 2O31A 4AT1B 1ZSZC 1K73R 1RI0A 3BE3A 2RQWA 3EHRA 3O8VA 1K8AU 1EX4A 4PJOG 3FEOA 4IUVA 1YITQ 2GQVA 4MZPA 3OYIA 5DLOA 1XTDA 3E19A 5KYXA 1GRIA 3GNFB 1VQPA 3NTHA 1YJNA 1W2BP 1IREB 2YWWA 1WQ7A 1C0MA 2EJ9A 3CCLA 3NHNA 1K8AC 2JS0A 1YWOA 4LNPA 2DIQA 1AEYA 2YUPA 3L1AA 1AZEA 1FMVA 5FWBA 3RMSA 4GY5A 4OMLA 2DEQA 1WHGA 1TUDA 2E10A 1YJ9T 1B07A 1K4US 2VUBA 4GBQA 1M8MA 1VQ7Q 3OYHA 1U1SA 5C6SA 1X27A 3ZFJA 1QVFS 4OF1A 4C8QA 2A7YA 2QQAA 2AHJB 4R56A 4KUIA 3SFMA 3M5AA 3REAB 4E7HA 3S3NA 3KUFA 2QYZA 5GAMj 2DE0X 1MHNA 1V76A 5GMKi 1R77A 1KC8C 2PTKA 1VYTA 3CPWS 2E3HA 4OMQA 5DY9A 2XDBA 5CVIA 2NUPB 2QTXA 2DTOA 3RNJA 3MKDA 2RM4A 2RQRA 3MP1A 3OY9A 2CP6A 5GAOl 1M90C 2ZPHB 3CPWP 1YHQT 2HKNA 3HHTB 2LMJA 4HT8A 2WSFE 1IHVA 1E6HA 4C0GA 1Q81C 3ULRB 3FDRA 3JCMf 1LJOA 4PL6A 1VQ4T 4J7IA 2KDSA 1V1CA 2VYTA 5IXBA 5CK9A 3HKSA 2NUTA 2HEQA 3CBPA 2LCSA 1TSFA 3EH1A 3SWNC 1KD1R 2M02A 1QQJA 5GAOp 1RI9A 3THKA 3DB3A 3E1SA 1OPLA 3CMAT 2E70A 1VQ9Q 2DZCA 4OP0A 2EAYA 1HK9A 2W0ZA 1WFWA 5KYWA 4M78F 1Y07A 5FWCA 3HSBA 4RMOA 3QJYA 2F5KA 1S72Q 2DETA 2RJFA 3RMQA 4LXCA 4CC3A 1PD1A 1GXIE 2CP5A 2FVUA 3L2RA 3H0IA 2F2VA 2JW4A 2YRCA 1M2OA 3LGLA 3G6EQ 1GCQA 5LJ3f 5CKHA 3LWHA 3EG9A 4J83A 1VQOT 1Q86U 3JB9H 2DZ9A 2XDDA 2LP5A 1QVGA 2DA9A 1M27C 1YN8A 3PNWC 5GMKh 1W2BS 3CC7Q 1NJIU 4QQ6A 3EFOB 4M78E 4FIBA 1Q86C 5I2MA 1VYVA 3RKWA 1JB0E 3J80E 3TQ7P 4J9CA 4LDXA 3QYGB 3L2UA 1YITT 2JUFA 4RTUA 2QXFA 4C0ZA 4PFOA 1D09B 5GMKm 2DL4A 3LX7A 4PK4A 3CCUT 2ABLA 2E3IA 4E7IA 3TEEA 3M53A 1X6GA 2GGRA 2EYZA 1VQOA 1KJWA 3A8HB 3CCUQ 3M55A 4FSXA 5CAIA 1RLQC 3UT1A 1UG1A 1OU9A 1WXBA 2E5QA 3A8OB 1VYUA 2K2MA 3DB4A 4N4IA 1W70A 2L89A 1RUWA 3CCEQ 2K5IA 3TVTA 6AT1B 2RK2A 3OW2A 3VUBA 4C92D 4KUDK 2SRCA 3UA7A 2JT4A 3V7CA 1HD3A 3CMAA 2DXUA 4C92G 2KAFA 1ZUYA 2BE7D 3P8HA 2YUOA 4C0DB 1BI1A 4X34A 1RADB 3CCEA 2K3BA 3OMCA 1BIBA 3G4SQ 3AT1B 3CBOA 2IIMA 1QP2A 3OS1A 2QA4T 4JUVA 1BB9A 4RCBA 3OW2P 1VQ4A 3DLMA 1AWJA 4D8DA 4A4FA 3CCVQ 1Z9QA 1ACMB 2D9TA 3CCJQ 4KGZB 4BE1A 3NPFA 1PM3A 4MMLA 3CCRQ 4RG2A 2PVGB 5DLQE 2KY9A 2KYMA 2QK0A 2MPXC 1RAAB 5FU7B 3QZ9B 4C8QC 1LPLA 2I2LA 3VV0A 1G3SA 1OULA 3QPHA 3I56A 3LW5E 2HL5C 2CP0A 4ZTFA 2DBMA 5IHNA 1FWZA 2FZGB 1GFCA 1QP3A 4LDYA 4JZ4A 1G3WA 1NEBA 5KYWB 1VQNQ 3MO8A 2KSSA 4ORZA 2A0FB 4EPCA 1G3YA 5KYYA 5D6XA 4BY6B 2DL3A 4PFZA 1N9RA 3JCMe 2A37A 1PSFA 1BU1A 4J9FA 5KYXB 2E4HA 1ZLMA 3EGUA 1S72A 3PIOA 3CMAQ 4NS5A 1UHFA 3M0UA 2VWFA 1J3TA 4AFQC 4M75G 5GANd 4FSSA 1UGQB 3IQLA 5LJ3d 4M7AG 1VQPT 3KFVA 2X51A 3MP6A 2K7AA 2CP3A 1U3OA 4N0AA 2QQSA 2VVKA 1X6OA 3MCAB 1Q81R 1VQ8Q 2ZCFB 4E7KA 2M16A 4E6RA 3JCMW 4C5IA 2L3SA 5GAN2 2MIOA 2HDAA 4ZGJB 3TREA 4F7UA 1YJ9Q 5A0LA 3NTKA 3G4ST 4M7AE 1JEGA 2AIRB 4IUUA 5D6YA 1ZA2B 3HPWA 1AVZC 2DNUA 2R57A 5KH6A 2CT4A 4MMKA 3HFNA 2QAZA 5FLXE 3CCQQ 4ELYC 2OTLQ 2MI6A 3CMEQ 4M7AB 2QEXQ 3OMGA 4DBRA 3CCQT 4IUQA 5AT1B 4KH0B 4HT9A 2JM8A 1Q81U 1MMGA 1K9MR 2E65A 3JCMJ 1YJWQ 3OA6A 1VUBA 3JV3A 4ZTJA 2QDYB 3MHXA 3QSUA 2HCKA 2M9UA 3C0CA 2R5MA 1QKXA 1ZUUA 4PLLA 3EGXA 3RUXA 2QEXA 4RG8A 1GFDA 3PE0A 4AG1C 2PUOB 2FO0A 2JTFA 1M3CA 4CC2A 2EGAA 2COZA 2KGTA 3PGGA 1QVFP 3CCVT 4FW2A 4C92B 4II1A 1PRLC 2CT3A 3EGXB 1WJRA 2I0NA 4XTVA 4N4GA 3QZ5B 4J9EA 1VQKT 1VQNA 2VKNA 3V7RA 1AT1B 1KQSS 4WF2A 4C0DC 3UA6A 1HYOA 1ZSZB 1OZ3A 2JTEA 2ZPFB 3H8ZA 4XQ3A 4M7DC 1Q86R 3A8MB 1SF9A 3CC7T 1VQ8A 4C5HA 5IHIA 3I35A 2OI3A 1ZHIA 5CIUA 3M54A 1X43A 2EFIA 1VQ5A 1M30A 3VU3C 3BY7A 3OYJA 1TG0A 2J05A 2YLBA 5GAN4 3JCMV 1H3ZA 1G2BA 5CKBA 1X2QA 1NLPC 2X35A 3FIFA 2D0NA 3CMEA 1UGSB 2IG0A 2XK0A 1TTHB 3GLXA 3CBMA 4M78A 2O01E 4DOVA 3JCMP 2NUPA 1H641 1QMCA 1UJ0A 1NEGA 2JS2A 2BZXA 4JJNK 1W6XA 1TU0B 3QUIA 1NE8A 3G6EA 4OGEA 2DXCA 4GLKA 1WX6A 1K9MU 4LDWA 3RKXA 2PZ1A 3WVDB 3A8LB 5I11A 1B3QA 2LVMA 2O88A 4DQ2A 4E7ZA 3FJ5A 3MPUB 3TSZA 3AHUA 2CP2A 4XTYA 4J9HA 4A4GA 5GAMd 3I9QA 2CZ6B 2DVEA 4HCZA 2XIDA 4DBFA 3HRTA 1OQKA 4Q5WA 2DO3A 2J06A 4ATOA 5KYYB 4BDZA 2XMFA 4J9GA 2K79A 2CZ1B 4C92A 1M5Q1 2O9SA 2A36A 4Z02A 1MNEA 2RPNA 2W10A 1PSEA 2F5TX 3LWIA 1JU5C 1G83A 3RR6A 2YSQA 2QA4Q 2HSPA 1WHJA 3CD6Q 3I55A 3UDCA 2RN8A 1R0BG 1ABQA 4FYXB 3RKYA 1Z9ZA 2RHZA 3CC4Q 1MGQA 2K5LA 4M77D 2HMAA 1FX7A 2BUDA 3G1JA 2FL7A 4M77F 3CMET 2FRYA 2SEMA 2VV5A 3JCMd 4M7DE 2KK4A 4C8QD 1VQ5T 4YTLA 2B86A 5EG2A 4MDWA 4F17A 2A08A 2LJ0A 3QKJA 4OGCA 4PJMA 2DKGA 1VQ9T 2P4TA 3CC7A 7AT1B 2LZ6B 1CSKA 2JJ9A 4O5VA 1BBZA 2G6FX 4BE0A 4XK8E 3NMZC 2KR3A 2KRSA 1U06A 1KIKA 5AYFA 4DBHA 1VQKA 1VQNT 4BI3A 2HSEB 1JRIA 2DL7A 1M1KC 4RCCA 3OQ5A 3D7SB 1X6BA 3OYGA 2CSIA 2H3EB 5FW9A 3N5BB 1N9SA 1N5ZA 4RUGA 4A4EA 3CCVA 5GAMe 2LDMA 3OYAA 3P8BB 1D1AA 2HQHA 5J39A 1WZOA 3EH2A 1KFZA 4FT4A 1BKBA 3L2WA 1M1KU 2GTJA 4BUGA 3M56A 2HBPA 4Y91A 2FZKB 2C0TA 2E41A 2ED1A 1LCKA 2EPDA 5GAN6 4FL6A 2VC8A 5CKEA 1GCPA 3UATA 2RMOA 2BE9B 3HL8A 2KE9A 1IHWA 3OW2S 5KYUA 3EG0A 3QXEB 1RAEB 1Y96B 3X26B 2AZVA 4EIKA 1K73C 2OTLT 4QKUA 3CXCA 2E5KA 4B9WA 2JMCA 3G4SA 3R6NA 1G3TA 4HCKA 3MEUA 4WTOB 1W4SA 1M1KR 1NG2A 2LQKA 2KYBA 1KK7A 1FMWA 3F70A 2M1HA 4M77E 3CCSQ 4J5YA 2RK1A 2EJFA 2RHYA 1GL5A 1K73U 3OYNA 1MV3A 2YT6A 1C6VX 4KGVB 1JXMA 1Q82U 1M2VB 1SKUB 4LUEA 1RL2A 4E2FB 1KG1A 3L2VA 4M7DF 1YFNA 4MZTA 1S72T 2EGCA 1YJWA 1PHTA 4LDVA 3PVQA 1KC8U 1Q82C 2CUBA 1OYXA 3UPUA 1B34A 2C0IA 4Z8AA 1WJQA 4QQDA 3HRSA 1VQKQ 2EVRA 1UGRB 4HKEA 1K1ZA 2K3YA 2PVDB 2OAWA 1VQMQ 2RD1A 3I55Q 4DEYA 2DL8A 2VASA 4PJOB 2AK5A 3H0FA 2XI9A 1D1BA 2RJCA 2PU9B 3I56T 5A0GA 1RAFB 3MEWA 1VQLA 2EKHA 4KBMB 3JB9G 1NYFA 1M90R 2DD4A 3E9GA 2VXEA 3V7SA 1SHGA 2LCCA 4OB1B 3JCMg 2J7IA 2K3XA 1I07A 1JJ2P 2O9VA 2OX7A 1UUEA 5DM7R 3V8JA 1RLPC 3LGFA 2ZGWA 1ABOA 1YHQQ 1QWFA 2GNCA 4JDSA 3WVEB 4F14A 1VA7A 2RO0A 4FYYB 3SB2A 5KE2A 1RAIB 4EMKA 2HAXA 1PD0A 5IN1A 2ZZDA 3NFCA 4OB3B 2RI5A 1N8RR 2H8HA 1IGQA 1XJWB 1JO8A 1ZQ1A 1K76A 2QA4A 4AFSC 5GAN8 3ZBDA 2KVQG 5KE3A 2DM1A 2DERA 4HCCA 2L8DA 4M7DA 2QGGA 4ZNXA 1KQSA 3CCET 3BFMA 1BCOA 1K9AA 5GAOr 3VS3A 3LH5A 2DF6A 2DD5A 4CC7A 2MWOA 1KSWA 1ZX6A 1Q95G 2V1RA 2K57A 1D1CA 3PFSA 2QI2A 3GF5A 5CO7A 3FC3A 4OB2B 2D1XA 2O2OA 2DFUA 2CZ0B 4BACA 4BE2A 4A63B 3M4YA 3M9QA 2YUNA 4PJOD 1VQOQ 1Y96A 5IT9E 2EWNA 3CCUA 1GBQA 4RTZA 2ECZA 1WNLA 3EHQA 4JRQA 4M7AC 3M59A 3JB9I 1U5SA 2L3RA 1M90U 1YITA 8AT1B 2YLCA 4ZN1A 3QWXX 3KXTA 4E47A 1NLOC 2NYSA 3I56Q 2KQWA 4F04B 2KNBB 4Z88A 3G71Q 1AWWA 2Z0WA 2KT8A 4FM4B 3TU4K 2RHUA 4PJJA 4DEXA 5GANg 4QT7A 3REBB 2O4XA 3CPWA 1BI0A 2JNGA 2D8JA 3LYIA 4LUDA 2IPOB 3OYCA 4M7AF 1SEMA 3FRNA 4ZGDB 1ZBXA 3CD6T 2AKKA 2MOXA 3G71A 3OBYA 1UGPB 1JJ2S 3DKMA 3VS1A 2AT1B 1UDLA 4B6MA 5GAOn 2Y90A 3A1PA 3JCMc 1I4K1 5I2SA 3EG9B 1SPKA 1RABB 4M7DD 2DMOA 4F7UB 2ATCB 2EBPA 2XICA 3C95A 2QQRA 4DBQA 4C0FA 1SSHA 3X28B 1QW1A 2JTMA 2KBTA 5GANf 5GAMg 1TUGB 3H41A 3VRZA 5LL6S 4IKFA 1U8RA 2V1QA 5CR2A 3GIBA 2D8HA 4C8QG 2YRVA 2EIFA 3ZL7C 5GAN3 1BCMA 4GLMA 2BTTA 2HNIA 4HVWA 4C8QF 4M75A 3CC2Q 3S3OA 4M7AA 1PWTA 3OYYA 2DTHA 2RQTA 1WA7A 3JSCA 1UTIA 1Y7XA 4EMKB 1O75A 1YHQA 4LN2A 1EIFA 3VS6A 2D0QB 4ESRA 2IVWA 1QLYA 4FYWB 4C8QE 2BZYA 1MUZA 3JB9F 1M1GA 2CP7A 3ZEHA 3M0QA 2GTOA 1VQ6A 2MF2A 2V26A 1X75C 2JXBA 1VQMA 1H3HA 1WHLA 3GP8A 1D3BA 2E6NA 3C12A 1LNXA 3ASKA 2AZSA 1DJ7B 5LJ5h 1S1NA 2K2VA 4M4ZA 5L23A 1YIJA 3NGPA 1GCQC 3CCSA 3JCMh 3CPFA 2LTOA 4VUBA 2X4WA 3M0PA 4Y92A 5D6WA 1OX8A 5J26A 1D0YA 3PIPA 3V8KA 1SRLA 3FJPA 5GJVB 2RHIA 1PNJA 1YJ9A 4C5EA 2GQIA 2DJZA 1C1AA 4CI0C 4BI4A 5GAN7 3M0RA 3BDLA 1VQ4Q 2X4JA 1PC0A 1M1FA 3CCLT 5GMKl 3RBBB 2P0QA 2COWA 2FPFA 5IH2A 1JJ2A 4HCBA 1YJNT 3RIRA 2XU8A 4CRIA 4JS5A 1WPYA 1IZ6A 2EKOA 1Y57A 3LH0A 1QCOA 2J6OA 4HXJA 4KGXB 2ED0A 3WXMB 2PNIA 2MWPA 5C0MA 4C8QB 2CUDA 4F16A 3A8GB 4JLIA 2X3WD 2BZ8A 4OMOA 2DILA 1ZBJA 2HQXA 4KULA 2EGEA 4AMCA 3ME9A 4A53A 5HCKA 1NM7A 2QGFB 2JN0A 3ER0A 1UB4A 1VIFA 4D6WA 3TSWA 1VIEA 1N6AA 4CC4B 1M4ZA 3VS4A 3QG1A 2JOYA 1R0CB 1UE9A 4BB7A 1OX9A 4XU0A 3SDZA 1UJYA 2EW3A 1MMAA 2LRQA 2RJEA 4XTZA 4P5NA 2LCLA 5GMKj 4M77G 3T9NA 3M0SA 4JJBA 1F1BB 4QW2A 5LJ3g 2DX1A 1VQ6Q 2QTVA 1D0ZA 1IRXA 2LQWA 3OBWA 4M78G 1FMKA 2V8JA 3QWYA 3PT9A 5I21A 1WXUA 2FB7A 4M77C 1T3SA 1JXOA 1UEBA 3CCJT 2F1LA 1XOVA 5CCAA 5LJ5f 1IGUA 1EZZB 1UGVA 2O4XB 3HTRA 2CYZB 3CCST 4ANJA 1VQ7T 4M7AD 1YIJT 1BI2A 4A4HA 1HSQA 3L42A 5GANj 3BW1A 3URGA 1T0HA 2F2XA 3EGDB 1UHCA 4KT0E 2EQJA 1VQMT 2HZYA 2M51A 3OYMA 2OTJT 1VQ6T 5LJ5g 4NL2A 3PMIA 3VJPA 2CDTA 1WQWA 1QVGP 2WSEE 4IUTA 2GFUA 1NYGA 2ESWA 3V8LA 4L59A 5LJ3e 1WLPB 3CCMT 2P0PA 4C92C 5FU7C 4ZN3A 4M75E 3X25B 3CC2T 4J9IA 4A4KA 1K8AR 4J6YA 4FCYA 2C06A 2CH4A 2K5FA 3EGDA 1G5VA 1LOJA 1AZGB 2A3LA 2OTJQ 1BK2A 1IB8A 1OEBA 1WHKA 5IHKA 2L2PA 5GJWB 1KHCA 4AG2C 4PJOA 1E7OA 3JCMQ 1RAHB 4LD9K 4XTWA 2EQMA 2K6DA 2G3RA 3META 4BY6C 1WHHA 2EQUA 3C4SA 3UWNA 3L2ZA 1WXTA 4JRPA 3CCLQ 1EFNA 4M7DB 4FW1A 2R58A 4OMNA 3A98A 2QG9B 4WCIA 3O5ZA 1YI2Q 1WHMA 3G71T 3CEYA 3RERA 2J6FA 3CD6A 5GAMh 2NUTB 2YRDA 1AWXA 5GAOm 4JZ3A 3MP8A 2EYQA 1YI2T 1MMDA 1I8FA 8ATCB 2OJ2A 3SWNA 3J81E 1M2VA 1UECA 3CC4A 2R5AA 2L3QA 1QCFA 2CSQA 2HKQB 4OB0B 2CGHA 2NUZA 4OVAA 5FRMA 2YXYA 1YWPA 1NPPA 1TUCA 2DJQA 3EFOA 5HKCA 4Z89A 1JQQA 3PVLA 3NTIA 4QVCA 1CKAA 1OV3A 3OYLA 3DLLA 3SEMA 3H9NA 2L5QA 2DL5A 4M75F 1I1JA 5IAYA 3JAME 4L5GA 3VS7A 1M8VA 4Y28E 1M9SA 3SD4A 1X2KA 2E1HA 1M3BA 3OS2A 4JJCA 4EDUA 4M7DG 1OZ2A 2KXCA 4BI8B 2LT4A 4F7UF 2DYIA 2V8KA 5LJ5e 3OS5A 2WACA 3UF4A 3EG2A 2M0YA 2RF0A 1AD5A 3GPLA 1ARKA 2CREA 1WI7A 5ECAA 1YJNQ 4NOYA 2KRMA 3X24B 4FYVB 4LDUA 3VS2A 2ZPGB 2B8AA 3U23A 3EAEA 2QASA 5GANh 1QKWA 1MMNA 2P0KA 3GOXA 1V29B 3M4GA 1PCXA 4KH1B 3VYGA 5GANe 1Q7YC 2KEAA 1XQHA 3OS0A 2HD0A 2EJGA 4JRKA 2DAQA 4MZMA 4HA8A 3MEVA 3H0HA 1WDXA 3INZA 1NPRA 2RI2A 4M77B 4B9XA 4BD3A 2AKLA 2LJ1A 2MMPA 4KRTA 3S6WA 3EFSA 2VB6A 3BDUA 3VS0A 1VOMA 3CCRA 3VKIA 2VGNA 3OB9A 5A0DA 3TCJA 1CKBA 2M0OA 1VQPQ 1SSFA 3I5RA 1K0XA 3QJ6A 3HFOA 2JMAA 5CKDA 2XKOC 4ME7A 2DRKA 2LX7A 3M0TA 1UFFA 2JVVA 2ROLA 4PJOE 2OAUA 1N27A 2DXBA 2LT1A 4X1VA 1VQLT 2X4XA 2V8IA 3EG3A 4FT2A 1ZSGA 3OYDA 1K0SA 3FB9A 2CKKA 4TVRA 2KI7A 4M78B 1HXDA 5KCOA 2WSCE 2QQBA 3HP9A 2E6ZA 2FZCB 2RNAA 1H92A 2ENMA 1X01A 1R8OB 3GBQA 3FLGA 3EG1A 3OYKA 3JCMX 1YIJQ 2JM9A 1YJWT 2RI3A 2K9GA 1TWBA 1MV0B 4E7LA 5KYUB 4MDXA 3SWNB 2XDPA 5FU6C 1WYXA 1NJIR 3I5SA 5J3BA 1TOVA 1TS9A 2XG8D 3QYHB 2PVOB 3RESA 1MNDA 4JLGA 4X9DA 2EYWA 2NWMA 3QDFA 2ZAEA 3M58A 4F7UE 2GBQA 2FPEA 4E7SA 1QVFA 2ZPEB 5KYNA 2ZPIB 3CCMQ 1KD1U 3OSSC 2XD0A 1XNIA 3JB9D 2YHTA 5M9OA 3CCRT 2DEUA 5GAN5 5EC7A 2KT1A 4FU6A 2F69A 1B7TA 2BKDN 5CKFA 2OTLA 3QDRB 4R0KA 4J9BA 1KQSP 4J8OA 4QQGA 3MEAA 1W1FA 3E9FA 3OYBA 4D8KA 1LVKA 1KD1C 2QQ9A 3QO3A 3SHWA 5CQXA 4RTVA 2DK3A 2P84A 1YNZA 4A54A 1SRMA 4AFUC 1OI1A 4PNOA 5LJ3h 2DRMA 2J6KA 1B34B 2CH4W 1YCSB 3CQTA 4IUPA 2RQUA 2DVJA 1QVPA 1YCYA 2EQKA 4PJLA 1K9MC 2LX9A 2FYKA 1FXXA 3PTAA 4J9DA 3GNGA 1TXQA 3OSVA 2LNVA 1NBEB 2GFAA 1NZ9A 1IXDA 2KRNA 1WJSA 1IO6A 1W2BA 1PKSA 2ROTA 1Y0MA 3QIIA 1FYNA 2FEIA 4XTXA 4HVVA 4PJOF 3QBYA 4XAXB 4UC4A 2HBWA 4F7UG 2HL3A 1OPKA 2HQEA 1QVGS 4RTYA 1ZUKA 2MAMA 5IXFA 3CXCS 2EQIA 4RTWA
chains in the Genus database with same CATH topology
2GGRA 2EYZA 1UJYA 1KJWA 2EW3A 2FRWA 1E6GA 2KE9A 4JPBW 1RLQC 1UG1A 1WXBA 3EG0A 3M0SA 4JJBA 1VYUA 2K2MA 2LNHB 1A0NB 2DX1A 1W70A 1RUWA 2AZVA 4EIKA 3TVTA 2E5KA 2LQWA 2JMCA 3R6NA 1FMKA 3QWYA 2SRCA 1WXUA 3UA7A 4HCKA 2C0OA 1T3SA 1JXOA 2EYXA 2JT4A 1XOVA 2L3PA 1HD3A 1NG2A 2KYBA 1UGVA 1ZUYA 2QDLA 2YUOA 1GL5A 1MV3A 2YT6A 2K3BA 4JJDA 1HSQA 4OMMA 1JXMA 1T3LA 3VS5A 1T0HA 2F2XA 1UHCA 2IIMA 1BB9A 4LUEA 2M51A 1AWJA 4D8DA 1Z9QA 2EGCA 4K11A 2CDTA 2X3XD 1QWEA 1PHTA 3PVQA 4RTXA 3NPFA 2CUBA 1NYGA 2YDLA 2ESWA 2KYMA 1WLPB 4IIOA 2C0IA 4Z8AA 1H8KA 2P4RA 2EVRA 1K1ZA 4J9IA 2OAWA 4DEYA 2DL8A 1WIEA 2AK5A 3H0FA 2CH4A 2DBMA 5IHNA 1X69A 1AOJA 1GFCA 1PRMC 2EKHA 2YUQA 1AZGB 1NYFA 1BK2A 4JZ4A 1OEBA 5IHKA 1NEBA 2A28A 2L2PA 5GJWB 1SHGA 2MCNA 4LE9A 4AG2C 4ORZA 1E7OA 1SHFA 2J7IA 1I07A 2O9VA 2DYBA 1UUEA 2K6DA 1M3AA 2DL3A 1RLPC 1ABOA 2A37A 1BU1A 1QWFA 2GNCA 1HJDA 4J9FA 4F14A 1WXTA 1T0JA 1VA7A 1ZLMA 3EGUA 1EFNA 1UHFA 2FG0A 4OMNA 1GCPA 3M0UA 3A98A 2VWFA 4WCIA 2DLPA 4AFQC 1PKTA 1J3TA 2H8HA 3O5ZA 1JO8A 1K76A 2DBKA 4AFZC 4OMPA 4AFSC 1OOTA 4FSSA 2J6FA 3IQLA 1AWXA 2DM1A 4JZ3A 3KFVA 1GBRA 2K7AA 2OJ2A 4ZNXA 2F2WA 2LQNA 1U3OA 1K9AA 2EYYA 2VVKA 1UECA 3VS3A 3LH5A 2L3QA 2DF6A 1QCFA 4CC7A 4E6RA 2CSQA 2L3SA 1KSWA 2MIOA 2NUZA 2LJ3A 2HDAA 1ZX6A 2V1RA 1YWPA 1TUCA 2DJQA 4HVUA 1AWOA 1JEGA 4Z89A 1AVZC 2DNUA 1JQQA 3PVLA 2CT4A 1CKAA 1OV3A 4RTTA 2KROA 2D1XA 3SEMA 2O2OA 2DL5A 1I1JA 2L0AA 2RQVA 3VS7A 4A63B 2JM8A 1X2KA 2YUNA 1M3BA 4IIMA 4JJCA 3JV3A 1GBQA 2KXCA 4RTZA 2ECZA 3EHQA 2HCKA 1U5SA 1I0CA 3C0CA 1QKXA 1ZUUA 3UF4A 3EG2A 1GFDA 2M0YA 2KXDA 2RF0A 3PE0A 3QWXX 4AG1C 2FO0A 1AD5A 1M3CA 3VRYA 4CC2A 1NLOC 1ARKA 2EGAA 2CREA 2KGTA 1YP5A 1WI7A 5ECAA 5I22A 2FPDA 2KNBB 2O31A 1PRLC 2KRMA 4Z88A 2CT3A 1AWWA 2I0NA 2KT8A 2RQWA 3EHRA 3VS2A 3U23A 4DEXA 4QT7A 1QKWA 3REBB 4J9EA 2VKNA 2KEAA 3UA6A 2JTEA 1GRIA 3H0HA 1WDXA 2D8JA 4LUDA 1SEMA 2AKKA 2MOXA 2AKLA 2LJ1A 5IHIA 3NHNA 4KRTA 3VS1A 2JS0A 1UDLA 3I35A 1YWOA 2OI3A 4LNPA 1AEYA 1X43A 2YUPA 1AZEA 5FWBA 3VS0A 1M30A 1TG0A 2J05A 4OMLA 1SPKA 1G2BA 1X2QA 2DMOA 1TUDA 1CKBA 1NLPC 2EBPA 1B07A 1K0XA 3I5RA 2D0NA 1K4US 4GBQA 1M8MA 1SSHA 2JMAA 2KBTA 2DRKA 1X27A 2LX7A 3M0TA 1UFFA 3H41A 2ROLA 3VRZA 1UJ0A 1NEGA 2JS2A 2BZXA 2V1QA 1W6XA 4X1VA 3REAB 2DE0X 2D8HA 3EG3A 3ZL7C 1WX6A 1ZSGA 4GLMA 2PZ1A 2PTKA 2BTTA 5I11A 1B3QA 1K0SA 1VYTA 4HVWA 2O88A 4OMQA 3FJ5A 1PWTA 3RNJA 2RQTA 3TSZA 1WA7A 2RQRA 4J9HA 3I9QA 2RNAA 1UTIA 1H92A 2ENMA 4LN2A 3VS6A 2J06A 3GBQA 4ESRA 3EG1A 2XMFA 2LMJA 1QLYA 4J9GA 2JM9A 2K79A 1E6HA 2K9GA 2BZYA 1MUZA 2A36A 2O9SA 1MV0B 2RPNA 2W10A 3ULRB 3M0QA 2GTOA 1JU5C 1WYXA 1G83A 2YSQA 2HSPA 3I5SA 2JXBA 1H3HA 1V1CA 5IXBA 2RN8A 1ABQA 2EYWA 2NWMA 2AZSA 1S1NA 2HEQA 4M4ZA 1Z9ZA 2LCSA 5L23A 2GBQA 3NGPA 2FPEA 1GCQC 1RI9A 3THKA 3M0PA 4Y92A 1OPLA 2FRYA 1SRLA 2SEMA 5GJVB 1PNJA 2GQIA 2W0ZA 1WFWA 2B86A 5EC7A 3M0RA 2KT1A 5FWCA 4F17A 2A08A 2LJ0A 4R0KA 4CC3A 4J9BA 1W1FA 2F2VA 3H0IA 3RBBB 4D8KA 2JW4A 2LZ6B 2FPFA 5IH2A 3SHWA 1CSKA 4RTVA 1GCQA 1BBZA 2G6FX 1YNZA 3NMZC 2KR3A 2KRSA 1SRMA 1U06A 1KIKA 4AFUC 2LP5A 1Y57A 2DRMA 2J6KA 2CH4W 1YCSB 2DL7A 2J6OA 2DA9A 3CQTA 1M27C 2RQUA 2DVJA 1YN8A 4HXJA 2ED0A 1X6BA 2PNIA 2CSIA 2CUDA 5FW9A 4J9DA 4F16A 4RUGA 1N5ZA 2X3WD 2BZ8A 4OMOA 2DILA 1ZBJA 2KRNA 1VYVA 1KFZA 2EGEA 1IO6A 1NM7A 2GTJA 1PKSA 2ROTA 4J9CA 5HCKA 1Y0MA 1FYNA 4RTUA 2FEIA 4HVVA 3TSWA 2HBWA 2C0TA 4CC4B 1OPKA 2DL4A 2ED1A 1LCKA 4RTYA 3VS4A 1ZUKA 2EPDA 5IXFA 2ABLA 2EQIA 1UE9A 4RTWA 1X6GA 3UATA 2RMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGR A;  2EYZ A;  1UJY A;  1KJW A;  2EW3 A;  2FRW A;  1E6G A;  2KE9 A;  4JPB W;  1RLQ C;  1UG1 A;  1WXB A;  3EG0 A;  3M0S A;  4JJB A;  1VYU A;  2K2M A;  2LNH B;  1A0N B;  2DX1 A;  1W70 A;  1RUW A;  2AZV A;  4EIK A;  3TVT A;  2E5K A;  2LQW A;  2JMC A;  3R6N A;  1FMK A;  3QWY A;  2SRC A;  1WXU A;  3UA7 A;  4HCK A;  2C0O A;  1T3S A;  1JXO A;  2EYX A;  2JT4 A;  1XOV A;  2L3P A;  1HD3 A;  1NG2 A;  2KYB A;  1UGV A;  1ZUY A;  2QDL A;  2YUO A;  1GL5 A;  1MV3 A;  2YT6 A;  2K3B A;  4JJD A;  1HSQ A;  4OMM A;  1JXM A;  1T3L A;  3VS5 A;  1T0H A;  2F2X A;  1UHC A;  2IIM A;  1BB9 A;  4LUE A;  2M51 A;  1AWJ A;  4D8D A;  1Z9Q A;  2EGC A;  4K11 A;  2CDT A;  2X3X D;  1QWE A;  1PHT A;  3PVQ A;  4RTX A;  3NPF A;  2CUB A;  1NYG A;  2YDL A;  2ESW A;  2KYM A;  1WLP B;  4IIO A;  2C0I A;  4Z8A A;  1H8K A;  2P4R A;  2EVR A;  1K1Z A;  4J9I A;  2OAW A;  4DEY A;  2DL8 A;  1WIE A;  2AK5 A;  3H0F A;  2CH4 A;  2DBM A;  5IHN A;  1X69 A;  1AOJ A;  1GFC A;  1PRM C;  2EKH A;  2YUQ A;  1AZG B;  1NYF A;  1BK2 A;  4JZ4 A;  1OEB A;  5IHK A;  1NEB A;  2A28 A;  2L2P A;  5GJW B;  1SHG A;  2MCN A;  4LE9 A;  4AG2 C;  4ORZ A;  1E7O A;  1SHF A;  2J7I A;  1I07 A;  2O9V A;  2DYB A;  1UUE A;  2K6D A;  1M3A A;  2DL3 A;  1RLP C;  1ABO A;  2A37 A;  1BU1 A;  1QWF A;  2GNC A;  1HJD A;  4J9F A;  4F14 A;  1WXT A;  1T0J A;  1VA7 A;  1ZLM A;  3EGU A;  1EFN A;  1UHF A;  2FG0 A;  4OMN A;  1GCP A;  3M0U A;  3A98 A;  2VWF A;  4WCI A;  2DLP A;  4AFQ C;  1PKT A;  1J3T A;  2H8H A;  3O5Z A;  1JO8 A;  1K76 A;  2DBK A;  4AFZ C;  4OMP A;  4AFS C;  1OOT A;  4FSS A;  2J6F A;  3IQL A;  1AWX A;  2DM1 A;  4JZ3 A;  3KFV A;  1GBR A;  2K7A A;  2OJ2 A;  4ZNX A;  2F2W A;  2LQN A;  1U3O A;  1K9A A;  2EYY A;  2VVK A;  1UEC A;  3VS3 A;  3LH5 A;  2L3Q A;  2DF6 A;  1QCF A;  4CC7 A;  4E6R A;  2CSQ A;  2L3S A;  1KSW A;  2MIO A;  2NUZ A;  2LJ3 A;  2HDA A;  1ZX6 A;  2V1R A;  1YWP A;  1TUC A;  2DJQ A;  4HVU A;  1AWO A;  1JEG A;  4Z89 A;  1AVZ C;  2DNU A;  1JQQ A;  3PVL A;  2CT4 A;  1CKA A;  1OV3 A;  4RTT A;  2KRO A;  2D1X A;  3SEM A;  2O2O A;  2DL5 A;  1I1J A;  2L0A A;  2RQV A;  3VS7 A;  4A63 B;  2JM8 A;  1X2K A;  2YUN A;  1M3B A;  4IIM A;  4JJC A;  3JV3 A;  1GBQ A;  2KXC A;  4RTZ A;  2ECZ A;  3EHQ A;  2HCK A;  1U5S A;  1I0C A;  3C0C A;  1QKX A;  1ZUU A;  3UF4 A;  3EG2 A;  1GFD A;  2M0Y A;  2KXD A;  2RF0 A;  3PE0 A;  3QWX X;  4AG1 C;  2FO0 A;  1AD5 A;  1M3C A;  3VRY A;  4CC2 A;  1NLO C;  1ARK A;  2EGA A;  2CRE A;  2KGT A;  1YP5 A;  1WI7 A;  5ECA A;  5I22 A;  2FPD A;  2KNB B;  2O31 A;  1PRL C;  2KRM A;  4Z88 A;  2CT3 A;  1AWW A;  2I0N A;  2KT8 A;  2RQW A;  3EHR A;  3VS2 A;  3U23 A;  4DEX A;  4QT7 A;  1QKW A;  3REB B;  4J9E A;  2VKN A;  2KEA A;  3UA6 A;  2JTE A;  1GRI A;  3H0H A;  1WDX A;  2D8J A;  4LUD A;  1SEM A;  2AKK A;  2MOX A;  2AKL A;  2LJ1 A;  5IHI A;  3NHN A;  4KRT A;  3VS1 A;  2JS0 A;  1UDL A;  3I35 A;  1YWO A;  2OI3 A;  4LNP A;  1AEY A;  1X43 A;  2YUP A;  1AZE A;  5FWB A;  3VS0 A;  1M30 A;  1TG0 A;  2J05 A;  4OML A;  1SPK A;  1G2B A;  1X2Q A;  2DMO A;  1TUD A;  1CKB A;  1NLP C;  2EBP A;  1B07 A;  1K0X A;  3I5R A;  2D0N A;  1K4U S;  4GBQ A;  1M8M A;  1SSH A;  2JMA A;  2KBT A;  2DRK A;  1X27 A;  2LX7 A;  3M0T A;  1UFF A;  3H41 A;  2ROL A;  3VRZ A;  1UJ0 A;  1NEG A;  2JS2 A;  2BZX A;  2V1Q A;  1W6X A;  4X1V A;  3REA B;  2DE0 X;  2D8H A;  3EG3 A;  3ZL7 C;  1WX6 A;  1ZSG A;  4GLM A;  2PZ1 A;  2PTK A;  2BTT A;  5I11 A;  1B3Q A;  1K0S A;  1VYT A;  4HVW A;  2O88 A;  4OMQ A;  3FJ5 A;  1PWT A;  3RNJ A;  2RQT A;  3TSZ A;  1WA7 A;  2RQR A;  4J9H A;  3I9Q A;  2RNA A;  1UTI A;  1H92 A;  2ENM A;  4LN2 A;  3VS6 A;  2J06 A;  3GBQ A;  4ESR A;  3EG1 A;  2XMF A;  2LMJ A;  1QLY A;  4J9G A;  2JM9 A;  2K79 A;  1E6H A;  2K9G A;  2BZY A;  1MUZ A;  2A36 A;  2O9S A;  1MV0 B;  2RPN A;  2W10 A;  3ULR B;  3M0Q A;  2GTO A;  1JU5 C;  1WYX A;  1G83 A;  2YSQ A;  2HSP A;  3I5S A;  2JXB A;  1H3H A;  1V1C A;  5IXB A;  2RN8 A;  1ABQ A;  2EYW A;  2NWM A;  2AZS A;  1S1N A;  2HEQ A;  4M4Z A;  1Z9Z A;  2LCS A;  5L23 A;  2GBQ A;  3NGP A;  2FPE A;  1GCQ C;  1RI9 A;  3THK A;  3M0P A;  4Y92 A;  1OPL A;  2FRY A;  1SRL A;  2SEM A;  5GJV B;  1PNJ A;  2GQI A;  2W0Z A;  1WFW A;  2B86 A;  5EC7 A;  3M0R A;  2KT1 A;  5FWC A;  4F17 A;  2A08 A;  2LJ0 A;  4R0K A;  4CC3 A;  4J9B A;  1W1F A;  2F2V A;  3H0I A;  3RBB B;  4D8K A;  2JW4 A;  2LZ6 B;  2FPF A;  5IH2 A;  3SHW A;  1CSK A;  4RTV A;  1GCQ A;  1BBZ A;  2G6F X;  1YNZ A;  3NMZ C;  2KR3 A;  2KRS A;  1SRM A;  1U06 A;  1KIK A;  4AFU C;  2LP5 A;  1Y57 A;  2DRM A;  2J6K A;  2CH4 W;  1YCS B;  2DL7 A;  2J6O A;  2DA9 A;  3CQT A;  1M27 C;  2RQU A;  2DVJ A;  1YN8 A;  4HXJ A;  2ED0 A;  1X6B A;  2PNI A;  2CSI A;  2CUD A;  5FW9 A;  4J9D A;  4F16 A;  4RUG A;  1N5Z A;  2X3W D;  2BZ8 A;  4OMO A;  2DIL A;  1ZBJ A;  2KRN A;  1VYV A;  1KFZ A;  2EGE A;  1IO6 A;  1NM7 A;  2GTJ A;  1PKS A;  2ROT A;  4J9C A;  5HCK A;  1Y0M A;  1FYN A;  4RTU A;  2FEI A;  4HVV A;  3TSW A;  2HBW A;  2C0T A;  4CC4 B;  1OPK A;  2DL4 A;  2ED1 A;  1LCK A;  4RTY A;  3VS4 A;  1ZUK A;  2EPD A;  5IXF A;  2ABL A;  2EQI A;  1UE9 A;  4RTW A;  1X6G A;  3UAT A;  2RMO A; 
#chains in the Genus database with same CATH topology
 3VYH B;  1Q82 R;  2X9H A;  2FRW A;  2LQ8 A;  1E6G A;  1Y71 A;  2VXF A;  2E12 A;  2GCX A;  4JPB W;  3RDV A;  4PJN A;  2K4Y A;  3JB9 J;  2RH2 A;  4XU1 A;  1VQ9 A;  2LNH B;  1A0N B;  3OYE A;  3P8D A;  1VQ5 Q;  4J6W A;  3G7Z A;  2FHD A;  4JS4 A;  1BYM A;  1KC8 R;  4V2S A;  1D0X A;  3Q1J A;  2C0O A;  2EYX A;  1P92 A;  2L3P A;  2NLU A;  3CC4 T;  3E2U A;  2QDL A;  4N4H A;  1KQ2 A;  1BI3 A;  1U1T A;  4R55 A;  4PLI A;  3CXC P;  1YI2 A;  1WGS A;  3JRZ A;  5KCH A;  4JJD A;  5LJ5 j;  4OMM A;  2RA2 A;  1T3L A;  3VS5 A;  4J7F A;  2DTI A;  2ZPB B;  1KHI A;  4EMG A;  3I55 T;  4OMF B;  3KBG A;  5HK3 A;  1N8R C;  4M78 D;  5HY6 A;  4X9C A;  1I5L A;  4PKC C;  5L8R E;  4K11 A;  2X3X D;  1QWE A;  3JCM b;  4RTX A;  4LD6 A;  1I5O B;  2YDL A;  1RAC B;  3A5Z B;  1RAG B;  4IIO A;  1H8K A;  1I81 A;  2P4R A;  5A2Q E;  4M78 C;  2XHC A;  4DA4 A;  1N8R U;  4N0A C;  4J6X A;  2Y4X A;  2RJD A;  3H6Z A;  2BIV A;  4XTU A;  4QVZ A;  1WIE A;  4E7J A;  2JZ2 A;  1X69 A;  2DXT A;  1AOJ A;  3G6E T;  1PG5 B;  1PRM C;  1NJI C;  4ZGE B;  2YUQ A;  2CZ7 B;  9ATC B;  3MJX A;  1Q7Y U;  4BDY A;  3CC2 A;  2A28 A;  3R6O A;  2MCN A;  3CCM A;  4LE9 A;  5FU6 B;  1SHF A;  4C92 E;  2MYS A;  2DYB A;  1M3A A;  4O6J A;  2X4Y A;  4RKU E;  4M75 B;  3J7A F;  3QHS A;  2LC4 A;  1G8X A;  1HJD A;  3M57 A;  1ZSZ A;  1T0J A;  1SG5 A;  2COY A;  4M77 A;  1VQL Q;  2FG0 A;  2OTJ A;  1AHJ B;  2MK5 A;  2DLP A;  1PKT A;  2DBK A;  4AFZ C;  2RHX A;  1D3B B;  4OMP A;  1VQ8 T;  4EMH A;  1OOT A;  5CQY A;  5FRO A;  4XU3 A;  5FRN A;  1ZA1 B;  2Y4Y A;  1GBR A;  2VGM A;  5GMK e;  3EFR A;  2F2W A;  2LQN A;  1VQ7 A;  2EYY A;  2GF7 A;  4L6V 5;  5D7U A;  2E64 A;  4C92 F;  4ELZ C;  3CCJ A;  3X20 B;  2LJ3 A;  2H3J A;  3S3M A;  4DOW A;  3VUZ A;  5HK0 A;  3OYF A;  4HVU A;  1AWO A;  5GAO q;  4QVD A;  1YBY A;  5LJ5 d;  4M75 D;  4RTT A;  2KRO A;  4XU2 A;  4JRI A;  1O9S A;  2QEX T;  2L0A A;  2RQV A;  1QCN A;  2RB6 A;  3PMT A;  3L2Q A;  2D6F A;  2PUK B;  4IIM A;  4EMK C;  1BIA A;  2DPP B;  4M75 C;  2DIG A;  4PFP A;  3LLR A;  5GAM f;  3CCQ A;  1I0C A;  1KQ1 A;  3HRU A;  1Q7Y R;  1OU8 A;  4NL3 A;  2PQW A;  4IUR A;  2CS7 A;  4PJO C;  2KMT A;  2KXD A;  4C5G A;  3VRY A;  5LJ3 j;  3C94 A;  1JBM A;  1TH7 A;  1YP5 A;  5I22 A;  2FPD A;  2O31 A;  4AT1 B;  1ZSZ C;  1K73 R;  1RI0 A;  3BE3 A;  2RQW A;  3EHR A;  3O8V A;  1K8A U;  1EX4 A;  4PJO G;  3FEO A;  4IUV A;  1YIT Q;  2GQV A;  4MZP A;  3OYI A;  5DLO A;  1XTD A;  3E19 A;  5KYX A;  1GRI A;  3GNF B;  1VQP A;  3NTH A;  1YJN A;  1W2B P;  1IRE B;  2YWW A;  1WQ7 A;  1C0M A;  2EJ9 A;  3CCL A;  3NHN A;  1K8A C;  2JS0 A;  1YWO A;  4LNP A;  2DIQ A;  1AEY A;  2YUP A;  3L1A A;  1AZE A;  1FMV A;  5FWB A;  3RMS A;  4GY5 A;  4OML A;  2DEQ A;  1WHG A;  1TUD A;  2E10 A;  1YJ9 T;  1B07 A;  1K4U S;  2VUB A;  4GBQ A;  1M8M A;  1VQ7 Q;  3OYH A;  1U1S A;  5C6S A;  1X27 A;  3ZFJ A;  1QVF S;  4OF1 A;  4C8Q A;  2A7Y A;  2QQA A;  2AHJ B;  4R56 A;  4KUI A;  3SFM A;  3M5A A;  3REA B;  4E7H A;  3S3N A;  3KUF A;  2QYZ A;  5GAM j;  2DE0 X;  1MHN A;  1V76 A;  5GMK i;  1R77 A;  1KC8 C;  2PTK A;  1VYT A;  3CPW S;  2E3H A;  4OMQ A;  5DY9 A;  2XDB A;  5CVI A;  2NUP B;  2QTX A;  2DTO A;  3RNJ A;  3MKD A;  2RM4 A;  2RQR A;  3MP1 A;  3OY9 A;  2CP6 A;  5GAO l;  1M90 C;  2ZPH B;  3CPW P;  1YHQ T;  2HKN A;  3HHT B;  2LMJ A;  4HT8 A;  2WSF E;  1IHV A;  1E6H A;  4C0G A;  1Q81 C;  3ULR B;  3FDR A;  3JCM f;  1LJO A;  4PL6 A;  1VQ4 T;  4J7I A;  2KDS A;  1V1C A;  2VYT A;  5IXB A;  5CK9 A;  3HKS A;  2NUT A;  2HEQ A;  3CBP A;  2LCS A;  1TSF A;  3EH1 A;  3SWN C;  1KD1 R;  2M02 A;  1QQJ A;  5GAO p;  1RI9 A;  3THK A;  3DB3 A;  3E1S A;  1OPL A;  3CMA T;  2E70 A;  1VQ9 Q;  2DZC A;  4OP0 A;  2EAY A;  1HK9 A;  2W0Z A;  1WFW A;  5KYW A;  4M78 F;  1Y07 A;  5FWC A;  3HSB A;  4RMO A;  3QJY A;  2F5K A;  1S72 Q;  2DET A;  2RJF A;  3RMQ A;  4LXC A;  4CC3 A;  1PD1 A;  1GXI E;  2CP5 A;  2FVU A;  3L2R A;  3H0I A;  2F2V A;  2JW4 A;  2YRC A;  1M2O A;  3LGL A;  3G6E Q;  1GCQ A;  5LJ3 f;  5CKH A;  3LWH A;  3EG9 A;  4J83 A;  1VQO T;  1Q86 U;  3JB9 H;  2DZ9 A;  2XDD A;  2LP5 A;  1QVG A;  2DA9 A;  1M27 C;  1YN8 A;  3PNW C;  5GMK h;  1W2B S;  3CC7 Q;  1NJI U;  4QQ6 A;  3EFO B;  4M78 E;  4FIB A;  1Q86 C;  5I2M A;  1VYV A;  3RKW A;  1JB0 E;  3J80 E;  3TQ7 P;  4J9C A;  4LDX A;  3QYG B;  3L2U A;  1YIT T;  2JUF A;  4RTU A;  2QXF A;  4C0Z A;  4PFO A;  1D09 B;  5GMK m;  2DL4 A;  3LX7 A;  4PK4 A;  3CCU T;  2ABL A;  2E3I A;  4E7I A;  3TEE A;  3M53 A;  1X6G A;  2GGR A;  2EYZ A;  1VQO A;  1KJW A;  3A8H B;  3CCU Q;  3M55 A;  4FSX A;  5CAI A;  1RLQ C;  3UT1 A;  1UG1 A;  1OU9 A;  1WXB A;  2E5Q A;  3A8O B;  1VYU A;  2K2M A;  3DB4 A;  4N4I A;  1W70 A;  2L89 A;  1RUW A;  3CCE Q;  2K5I A;  3TVT A;  6AT1 B;  2RK2 A;  3OW2 A;  3VUB A;  4C92 D;  4KUD K;  2SRC A;  3UA7 A;  2JT4 A;  3V7C A;  1HD3 A;  3CMA A;  2DXU A;  4C92 G;  2KAF A;  1ZUY A;  2BE7 D;  3P8H A;  2YUO A;  4C0D B;  1BI1 A;  4X34 A;  1RAD B;  3CCE A;  2K3B A;  3OMC A;  1BIB A;  3G4S Q;  3AT1 B;  3CBO A;  2IIM A;  1QP2 A;  3OS1 A;  2QA4 T;  4JUV A;  1BB9 A;  4RCB A;  3OW2 P;  1VQ4 A;  3DLM A;  1AWJ A;  4D8D A;  4A4F A;  3CCV Q;  1Z9Q A;  1ACM B;  2D9T A;  3CCJ Q;  4KGZ B;  4BE1 A;  3NPF A;  1PM3 A;  4MML A;  3CCR Q;  4RG2 A;  2PVG B;  5DLQ E;  2KY9 A;  2KYM A;  2QK0 A;  2MPX C;  1RAA B;  5FU7 B;  3QZ9 B;  4C8Q C;  1LPL A;  2I2L A;  3VV0 A;  1G3S A;  1OUL A;  3QPH A;  3I56 A;  3LW5 E;  2HL5 C;  2CP0 A;  4ZTF A;  2DBM A;  5IHN A;  1FWZ A;  2FZG B;  1GFC A;  1QP3 A;  4LDY A;  4JZ4 A;  1G3W A;  1NEB A;  5KYW B;  1VQN Q;  3MO8 A;  2KSS A;  4ORZ A;  2A0F B;  4EPC A;  1G3Y A;  5KYY A;  5D6X A;  4BY6 B;  2DL3 A;  4PFZ A;  1N9R A;  3JCM e;  2A37 A;  1PSF A;  1BU1 A;  4J9F A;  5KYX B;  2E4H A;  1ZLM A;  3EGU A;  1S72 A;  3PIO A;  3CMA Q;  4NS5 A;  1UHF A;  3M0U A;  2VWF A;  1J3T A;  4AFQ C;  4M75 G;  5GAN d;  4FSS A;  1UGQ B;  3IQL A;  5LJ3 d;  4M7A G;  1VQP T;  3KFV A;  2X51 A;  3MP6 A;  2K7A A;  2CP3 A;  1U3O A;  4N0A A;  2QQS A;  2VVK A;  1X6O A;  3MCA B;  1Q81 R;  1VQ8 Q;  2ZCF B;  4E7K A;  2M16 A;  4E6R A;  3JCM W;  4C5I A;  2L3S A;  5GAN 2;  2MIO A;  2HDA A;  4ZGJ B;  3TRE A;  4F7U A;  1YJ9 Q;  5A0L A;  3NTK A;  3G4S T;  4M7A E;  1JEG A;  2AIR B;  4IUU A;  5D6Y A;  1ZA2 B;  3HPW A;  1AVZ C;  2DNU A;  2R57 A;  5KH6 A;  2CT4 A;  4MMK A;  3HFN A;  2QAZ A;  5FLX E;  3CCQ Q;  4ELY C;  2OTL Q;  2MI6 A;  3CME Q;  4M7A B;  2QEX Q;  3OMG A;  4DBR A;  3CCQ T;  4IUQ A;  5AT1 B;  4KH0 B;  4HT9 A;  2JM8 A;  1Q81 U;  1MMG A;  1K9M R;  2E65 A;  3JCM J;  1YJW Q;  3OA6 A;  1VUB A;  3JV3 A;  4ZTJ A;  2QDY B;  3MHX A;  3QSU A;  2HCK A;  2M9U A;  3C0C A;  2R5M A;  1QKX A;  1ZUU A;  4PLL A;  3EGX A;  3RUX A;  2QEX A;  4RG8 A;  1GFD A;  3PE0 A;  4AG1 C;  2PUO B;  2FO0 A;  2JTF A;  1M3C A;  4CC2 A;  2EGA A;  2COZ A;  2KGT A;  3PGG A;  1QVF P;  3CCV T;  4FW2 A;  4C92 B;  4II1 A;  1PRL C;  2CT3 A;  3EGX B;  1WJR A;  2I0N A;  4XTV A;  4N4G A;  3QZ5 B;  4J9E A;  1VQK T;  1VQN A;  2VKN A;  3V7R A;  1AT1 B;  1KQS S;  4WF2 A;  4C0D C;  3UA6 A;  1HYO A;  1ZSZ B;  1OZ3 A;  2JTE A;  2ZPF B;  3H8Z A;  4XQ3 A;  4M7D C;  1Q86 R;  3A8M B;  1SF9 A;  3CC7 T;  1VQ8 A;  4C5H A;  5IHI A;  3I35 A;  2OI3 A;  1ZHI A;  5CIU A;  3M54 A;  1X43 A;  2EFI A;  1VQ5 A;  1M30 A;  3VU3 C;  3BY7 A;  3OYJ A;  1TG0 A;  2J05 A;  2YLB A;  5GAN 4;  3JCM V;  1H3Z A;  1G2B A;  5CKB A;  1X2Q A;  1NLP C;  2X35 A;  3FIF A;  2D0N A;  3CME A;  1UGS B;  2IG0 A;  2XK0 A;  1TTH B;  3GLX A;  3CBM A;  4M78 A;  2O01 E;  4DOV A;  3JCM P;  2NUP A;  1H64 1;  1QMC A;  1UJ0 A;  1NEG A;  2JS2 A;  2BZX A;  4JJN K;  1W6X A;  1TU0 B;  3QUI A;  1NE8 A;  3G6E A;  4OGE A;  2DXC A;  4GLK A;  1WX6 A;  1K9M U;  4LDW A;  3RKX A;  2PZ1 A;  3WVD B;  3A8L B;  5I11 A;  1B3Q A;  2LVM A;  2O88 A;  4DQ2 A;  4E7Z A;  3FJ5 A;  3MPU B;  3TSZ A;  3AHU A;  2CP2 A;  4XTY A;  4J9H A;  4A4G A;  5GAM d;  3I9Q A;  2CZ6 B;  2DVE A;  4HCZ A;  2XID A;  4DBF A;  3HRT A;  1OQK A;  4Q5W A;  2DO3 A;  2J06 A;  4ATO A;  5KYY B;  4BDZ A;  2XMF A;  4J9G A;  2K79 A;  2CZ1 B;  4C92 A;  1M5Q 1;  2O9S A;  2A36 A;  4Z02 A;  1MNE A;  2RPN A;  2W10 A;  1PSE A;  2F5T X;  3LWI A;  1JU5 C;  1G83 A;  3RR6 A;  2YSQ A;  2QA4 Q;  2HSP A;  1WHJ A;  3CD6 Q;  3I55 A;  3UDC A;  2RN8 A;  1R0B G;  1ABQ A;  4FYX B;  3RKY A;  1Z9Z A;  2RHZ A;  3CC4 Q;  1MGQ A;  2K5L A;  4M77 D;  2HMA A;  1FX7 A;  2BUD A;  3G1J A;  2FL7 A;  4M77 F;  3CME T;  2FRY A;  2SEM A;  2VV5 A;  3JCM d;  4M7D E;  2KK4 A;  4C8Q D;  1VQ5 T;  4YTL A;  2B86 A;  5EG2 A;  4MDW A;  4F17 A;  2A08 A;  2LJ0 A;  3QKJ A;  4OGC A;  4PJM A;  2DKG A;  1VQ9 T;  2P4T A;  3CC7 A;  7AT1 B;  2LZ6 B;  1CSK A;  2JJ9 A;  4O5V A;  1BBZ A;  2G6F X;  4BE0 A;  4XK8 E;  3NMZ C;  2KR3 A;  2KRS A;  1U06 A;  1KIK A;  5AYF A;  4DBH A;  1VQK A;  1VQN T;  4BI3 A;  2HSE B;  1JRI A;  2DL7 A;  1M1K C;  4RCC A;  3OQ5 A;  3D7S B;  1X6B A;  3OYG A;  2CSI A;  2H3E B;  5FW9 A;  3N5B B;  1N9S A;  1N5Z A;  4RUG A;  4A4E A;  3CCV A;  5GAM e;  2LDM A;  3OYA A;  3P8B B;  1D1A A;  2HQH A;  5J39 A;  1WZO A;  3EH2 A;  1KFZ A;  4FT4 A;  1BKB A;  3L2W A;  1M1K U;  2GTJ A;  4BUG A;  3M56 A;  2HBP A;  4Y91 A;  2FZK B;  2C0T A;  2E41 A;  2ED1 A;  1LCK A;  2EPD A;  5GAN 6;  4FL6 A;  2VC8 A;  5CKE A;  1GCP A;  3UAT A;  2RMO A;  2BE9 B;  3HL8 A;  2KE9 A;  1IHW A;  3OW2 S;  5KYU A;  3EG0 A;  3QXE B;  1RAE B;  1Y96 B;  3X26 B;  2AZV A;  4EIK A;  1K73 C;  2OTL T;  4QKU A;  3CXC A;  2E5K A;  4B9W A;  2JMC A;  3G4S A;  3R6N A;  1G3T A;  4HCK A;  3MEU A;  4WTO B;  1W4S A;  1M1K R;  1NG2 A;  2LQK A;  2KYB A;  1KK7 A;  1FMW A;  3F70 A;  2M1H A;  4M77 E;  3CCS Q;  4J5Y A;  2RK1 A;  2EJF A;  2RHY A;  1GL5 A;  1K73 U;  3OYN A;  1MV3 A;  2YT6 A;  1C6V X;  4KGV B;  1JXM A;  1Q82 U;  1M2V B;  1SKU B;  4LUE A;  1RL2 A;  4E2F B;  1KG1 A;  3L2V A;  4M7D F;  1YFN A;  4MZT A;  1S72 T;  2EGC A;  1YJW A;  1PHT A;  4LDV A;  3PVQ A;  1KC8 U;  1Q82 C;  2CUB A;  1OYX A;  3UPU A;  1B34 A;  2C0I A;  4Z8A A;  1WJQ A;  4QQD A;  3HRS A;  1VQK Q;  2EVR A;  1UGR B;  4HKE A;  1K1Z A;  2K3Y A;  2PVD B;  2OAW A;  1VQM Q;  2RD1 A;  3I55 Q;  4DEY A;  2DL8 A;  2VAS A;  4PJO B;  2AK5 A;  3H0F A;  2XI9 A;  1D1B A;  2RJC A;  2PU9 B;  3I56 T;  5A0G A;  1RAF B;  3MEW A;  1VQL A;  2EKH A;  4KBM B;  3JB9 G;  1NYF A;  1M90 R;  2DD4 A;  3E9G A;  2VXE A;  3V7S A;  1SHG A;  2LCC A;  4OB1 B;  3JCM g;  2J7I A;  2K3X A;  1I07 A;  1JJ2 P;  2O9V A;  2OX7 A;  1UUE A;  5DM7 R;  3V8J A;  1RLP C;  3LGF A;  2ZGW A;  1ABO A;  1YHQ Q;  1QWF A;  2GNC A;  4JDS A;  3WVE B;  4F14 A;  1VA7 A;  2RO0 A;  4FYY B;  3SB2 A;  5KE2 A;  1RAI B;  4EMK A;  2HAX A;  1PD0 A;  5IN1 A;  2ZZD A;  3NFC A;  4OB3 B;  2RI5 A;  1N8R R;  2H8H A;  1IGQ A;  1XJW B;  1JO8 A;  1ZQ1 A;  1K76 A;  2QA4 A;  4AFS C;  5GAN 8;  3ZBD A;  2KVQ G;  5KE3 A;  2DM1 A;  2DER A;  4HCC A;  2L8D A;  4M7D A;  2QGG A;  4ZNX A;  1KQS A;  3CCE T;  3BFM A;  1BCO A;  1K9A A;  5GAO r;  3VS3 A;  3LH5 A;  2DF6 A;  2DD5 A;  4CC7 A;  2MWO A;  1KSW A;  1ZX6 A;  1Q95 G;  2V1R A;  2K57 A;  1D1C A;  3PFS A;  2QI2 A;  3GF5 A;  5CO7 A;  3FC3 A;  4OB2 B;  2D1X A;  2O2O A;  2DFU A;  2CZ0 B;  4BAC A;  4BE2 A;  4A63 B;  3M4Y A;  3M9Q A;  2YUN A;  4PJO D;  1VQO Q;  1Y96 A;  5IT9 E;  2EWN A;  3CCU A;  1GBQ A;  4RTZ A;  2ECZ A;  1WNL A;  3EHQ A;  4JRQ A;  4M7A C;  3M59 A;  3JB9 I;  1U5S A;  2L3R A;  1M90 U;  1YIT A;  8AT1 B;  2YLC A;  4ZN1 A;  3QWX X;  3KXT A;  4E47 A;  1NLO C;  2NYS A;  3I56 Q;  2KQW A;  4F04 B;  2KNB B;  4Z88 A;  3G71 Q;  1AWW A;  2Z0W A;  2KT8 A;  4FM4 B;  3TU4 K;  2RHU A;  4PJJ A;  4DEX A;  5GAN g;  4QT7 A;  3REB B;  2O4X A;  3CPW A;  1BI0 A;  2JNG A;  2D8J A;  3LYI A;  4LUD A;  2IPO B;  3OYC A;  4M7A F;  1SEM A;  3FRN A;  4ZGD B;  1ZBX A;  3CD6 T;  2AKK A;  2MOX A;  3G71 A;  3OBY A;  1UGP B;  1JJ2 S;  3DKM A;  3VS1 A;  2AT1 B;  1UDL A;  4B6M A;  5GAO n;  2Y90 A;  3A1P A;  3JCM c;  1I4K 1;  5I2S A;  3EG9 B;  1SPK A;  1RAB B;  4M7D D;  2DMO A;  4F7U B;  2ATC B;  2EBP A;  2XIC A;  3C95 A;  2QQR A;  4DBQ A;  4C0F A;  1SSH A;  3X28 B;  1QW1 A;  2JTM A;  2KBT A;  5GAN f;  5GAM g;  1TUG B;  3H41 A;  3VRZ A;  5LL6 S;  4IKF A;  1U8R A;  2V1Q A;  5CR2 A;  3GIB A;  2D8H A;  4C8Q G;  2YRV A;  2EIF A;  3ZL7 C;  5GAN 3;  1BCM A;  4GLM A;  2BTT A;  2HNI A;  4HVW A;  4C8Q F;  4M75 A;  3CC2 Q;  3S3O A;  4M7A A;  1PWT A;  3OYY A;  2DTH A;  2RQT A;  1WA7 A;  3JSC A;  1UTI A;  1Y7X A;  4EMK B;  1O75 A;  1YHQ A;  4LN2 A;  1EIF A;  3VS6 A;  2D0Q B;  4ESR A;  2IVW A;  1QLY A;  4FYW B;  4C8Q E;  2BZY A;  1MUZ A;  3JB9 F;  1M1G A;  2CP7 A;  3ZEH A;  3M0Q A;  2GTO A;  1VQ6 A;  2MF2 A;  2V26 A;  1X75 C;  2JXB A;  1VQM A;  1H3H A;  1WHL A;  3GP8 A;  1D3B A;  2E6N A;  3C12 A;  1LNX A;  3ASK A;  2AZS A;  1DJ7 B;  5LJ5 h;  1S1N A;  2K2V A;  4M4Z A;  5L23 A;  1YIJ A;  3NGP A;  1GCQ C;  3CCS A;  3JCM h;  3CPF A;  2LTO A;  4VUB A;  2X4W A;  3M0P A;  4Y92 A;  5D6W A;  1OX8 A;  5J26 A;  1D0Y A;  3PIP A;  3V8K A;  1SRL A;  3FJP A;  5GJV B;  2RHI A;  1PNJ A;  1YJ9 A;  4C5E A;  2GQI A;  2DJZ A;  1C1A A;  4CI0 C;  4BI4 A;  5GAN 7;  3M0R A;  3BDL A;  1VQ4 Q;  2X4J A;  1PC0 A;  1M1F A;  3CCL T;  5GMK l;  3RBB B;  2P0Q A;  2COW A;  2FPF A;  5IH2 A;  1JJ2 A;  4HCB A;  1YJN T;  3RIR A;  2XU8 A;  4CRI A;  4JS5 A;  1WPY A;  1IZ6 A;  2EKO A;  1Y57 A;  3LH0 A;  1QCO A;  2J6O A;  4HXJ A;  4KGX B;  2ED0 A;  3WXM B;  2PNI A;  2MWP A;  5C0M A;  4C8Q B;  2CUD A;  4F16 A;  3A8G B;  4JLI A;  2X3W D;  2BZ8 A;  4OMO A;  2DIL A;  1ZBJ A;  2HQX A;  4KUL A;  2EGE A;  4AMC A;  3ME9 A;  4A53 A;  5HCK A;  1NM7 A;  2QGF B;  2JN0 A;  3ER0 A;  1UB4 A;  1VIF A;  4D6W A;  3TSW A;  1VIE A;  1N6A A;  4CC4 B;  1M4Z A;  3VS4 A;  3QG1 A;  2JOY A;  1R0C B;  1UE9 A;  4BB7 A;  1OX9 A;  4XU0 A;  3SDZ A;  1UJY A;  2EW3 A;  1MMA A;  2LRQ A;  2RJE A;  4XTZ A;  4P5N A;  2LCL A;  5GMK j;  4M77 G;  3T9N A;  3M0S A;  4JJB A;  1F1B B;  4QW2 A;  5LJ3 g;  2DX1 A;  1VQ6 Q;  2QTV A;  1D0Z A;  1IRX A;  2LQW A;  3OBW A;  4M78 G;  1FMK A;  2V8J A;  3QWY A;  3PT9 A;  5I21 A;  1WXU A;  2FB7 A;  4M77 C;  1T3S A;  1JXO A;  1UEB A;  3CCJ T;  2F1L A;  1XOV A;  5CCA A;  5LJ5 f;  1IGU A;  1EZZ B;  1UGV A;  2O4X B;  3HTR A;  2CYZ B;  3CCS T;  4ANJ A;  1VQ7 T;  4M7A D;  1YIJ T;  1BI2 A;  4A4H A;  1HSQ A;  3L42 A;  5GAN j;  3BW1 A;  3URG A;  1T0H A;  2F2X A;  3EGD B;  1UHC A;  4KT0 E;  2EQJ A;  1VQM T;  2HZY A;  2M51 A;  3OYM A;  2OTJ T;  1VQ6 T;  5LJ5 g;  4NL2 A;  3PMI A;  3VJP A;  2CDT A;  1WQW A;  1QVG P;  2WSE E;  4IUT A;  2GFU A;  1NYG A;  2ESW A;  3V8L A;  4L59 A;  5LJ3 e;  1WLP B;  3CCM T;  2P0P A;  4C92 C;  5FU7 C;  4ZN3 A;  4M75 E;  3X25 B;  3CC2 T;  4J9I A;  4A4K A;  1K8A R;  4J6Y A;  4FCY A;  2C06 A;  2CH4 A;  2K5F A;  3EGD A;  1G5V A;  1LOJ A;  1AZG B;  2A3L A;  2OTJ Q;  1BK2 A;  1IB8 A;  1OEB A;  1WHK A;  5IHK A;  2L2P A;  5GJW B;  1KHC A;  4AG2 C;  4PJO A;  1E7O A;  3JCM Q;  1RAH B;  4LD9 K;  4XTW A;  2EQM A;  2K6D A;  2G3R A;  3MET A;  4BY6 C;  1WHH A;  2EQU A;  3C4S A;  3UWN A;  3L2Z A;  1WXT A;  4JRP A;  3CCL Q;  1EFN A;  4M7D B;  4FW1 A;  2R58 A;  4OMN A;  3A98 A;  2QG9 B;  4WCI A;  3O5Z A;  1YI2 Q;  1WHM A;  3G71 T;  3CEY A;  3RER A;  2J6F A;  3CD6 A;  5GAM h;  2NUT B;  2YRD A;  1AWX A;  5GAO m;  4JZ3 A;  3MP8 A;  2EYQ A;  1YI2 T;  1MMD A;  1I8F A;  8ATC B;  2OJ2 A;  3SWN A;  3J81 E;  1M2V A;  1UEC A;  3CC4 A;  2R5A A;  2L3Q A;  1QCF A;  2CSQ A;  2HKQ B;  4OB0 B;  2CGH A;  2NUZ A;  4OVA A;  5FRM A;  2YXY A;  1YWP A;  1NPP A;  1TUC A;  2DJQ A;  3EFO A;  5HKC A;  4Z89 A;  1JQQ A;  3PVL A;  3NTI A;  4QVC A;  1CKA A;  1OV3 A;  3OYL A;  3DLL A;  3SEM A;  3H9N A;  2L5Q A;  2DL5 A;  4M75 F;  1I1J A;  5IAY A;  3JAM E;  4L5G A;  3VS7 A;  1M8V A;  4Y28 E;  1M9S A;  3SD4 A;  1X2K A;  2E1H A;  1M3B A;  3OS2 A;  4JJC A;  4EDU A;  4M7D G;  1OZ2 A;  2KXC A;  4BI8 B;  2LT4 A;  4F7U F;  2DYI A;  2V8K A;  5LJ5 e;  3OS5 A;  2WAC A;  3UF4 A;  3EG2 A;  2M0Y A;  2RF0 A;  1AD5 A;  3GPL A;  1ARK A;  2CRE A;  1WI7 A;  5ECA A;  1YJN Q;  4NOY A;  2KRM A;  3X24 B;  4FYV B;  4LDU A;  3VS2 A;  2ZPG B;  2B8A A;  3U23 A;  3EAE A;  2QAS A;  5GAN h;  1QKW A;  1MMN A;  2P0K A;  3GOX A;  1V29 B;  3M4G A;  1PCX A;  4KH1 B;  3VYG A;  5GAN e;  1Q7Y C;  2KEA A;  1XQH A;  3OS0 A;  2HD0 A;  2EJG A;  4JRK A;  2DAQ A;  4MZM A;  4HA8 A;  3MEV A;  3H0H A;  1WDX A;  3INZ A;  1NPR A;  2RI2 A;  4M77 B;  4B9X A;  4BD3 A;  2AKL A;  2LJ1 A;  2MMP A;  4KRT A;  3S6W A;  3EFS A;  2VB6 A;  3BDU A;  3VS0 A;  1VOM A;  3CCR A;  3VKI A;  2VGN A;  3OB9 A;  5A0D A;  3TCJ A;  1CKB A;  2M0O A;  1VQP Q;  1SSF A;  3I5R A;  1K0X A;  3QJ6 A;  3HFO A;  2JMA A;  5CKD A;  2XKO C;  4ME7 A;  2DRK A;  2LX7 A;  3M0T A;  1UFF A;  2JVV A;  2ROL A;  4PJO E;  2OAU A;  1N27 A;  2DXB A;  2LT1 A;  4X1V A;  1VQL T;  2X4X A;  2V8I A;  3EG3 A;  4FT2 A;  1ZSG A;  3OYD A;  1K0S A;  3FB9 A;  2CKK A;  4TVR A;  2KI7 A;  4M78 B;  1HXD A;  5KCO A;  2WSC E;  2QQB A;  3HP9 A;  2E6Z A;  2FZC B;  2RNA A;  1H92 A;  2ENM A;  1X01 A;  1R8O B;  3GBQ A;  3FLG A;  3EG1 A;  3OYK A;  3JCM X;  1YIJ Q;  2JM9 A;  1YJW T;  2RI3 A;  2K9G A;  1TWB A;  1MV0 B;  4E7L A;  5KYU B;  4MDX A;  3SWN B;  2XDP A;  5FU6 C;  1WYX A;  1NJI R;  3I5S A;  5J3B A;  1TOV A;  1TS9 A;  2XG8 D;  3QYH B;  2PVO B;  3RES A;  1MND A;  4JLG A;  4X9D A;  2EYW A;  2NWM A;  3QDF A;  2ZAE A;  3M58 A;  4F7U E;  2GBQ A;  2FPE A;  4E7S A;  1QVF A;  2ZPE B;  5KYN A;  2ZPI B;  3CCM Q;  1KD1 U;  3OSS C;  2XD0 A;  1XNI A;  3JB9 D;  2YHT A;  5M9O A;  3CCR T;  2DEU A;  5GAN 5;  5EC7 A;  2KT1 A;  4FU6 A;  2F69 A;  1B7T A;  2BKD N;  5CKF A;  2OTL A;  3QDR B;  4R0K A;  4J9B A;  1KQS P;  4J8O A;  4QQG A;  3MEA A;  1W1F A;  3E9F A;  3OYB A;  4D8K A;  1LVK A;  1KD1 C;  2QQ9 A;  3QO3 A;  3SHW A;  5CQX A;  4RTV A;  2DK3 A;  2P84 A;  1YNZ A;  4A54 A;  1SRM A;  4AFU C;  1OI1 A;  4PNO A;  5LJ3 h;  2DRM A;  2J6K A;  1B34 B;  2CH4 W;  1YCS B;  3CQT A;  4IUP A;  2RQU A;  2DVJ A;  1QVP A;  1YCY A;  2EQK A;  4PJL A;  1K9M C;  2LX9 A;  2FYK A;  1FXX A;  3PTA A;  4J9D A;  3GNG A;  1TXQ A;  3OSV A;  2LNV A;  1NBE B;  2GFA A;  1NZ9 A;  1IXD A;  2KRN A;  1WJS A;  1IO6 A;  1W2B A;  1PKS A;  2ROT A;  1Y0M A;  3QII A;  1FYN A;  2FEI A;  4XTX A;  4HVV A;  4PJO F;  3QBY A;  4XAX B;  4UC4 A;  2HBW A;  4F7U G;  2HL3 A;  1OPK A;  2HQE A;  1QVG S;  4RTY A;  1ZUK A;  2MAM A;  5IXF A;  3CXC S;  2EQI A;  4RTW A; 
#chains in the Genus database with same CATH homology
 2GGR A;  2EYZ A;  1UJY A;  1KJW A;  2EW3 A;  2FRW A;  1E6G A;  2KE9 A;  4JPB W;  1RLQ C;  1UG1 A;  1WXB A;  3EG0 A;  3M0S A;  4JJB A;  1VYU A;  2K2M A;  2LNH B;  1A0N B;  2DX1 A;  1W70 A;  1RUW A;  2AZV A;  4EIK A;  3TVT A;  2E5K A;  2LQW A;  2JMC A;  3R6N A;  1FMK A;  3QWY A;  2SRC A;  1WXU A;  3UA7 A;  4HCK A;  2C0O A;  1T3S A;  1JXO A;  2EYX A;  2JT4 A;  1XOV A;  2L3P A;  1HD3 A;  1NG2 A;  2KYB A;  1UGV A;  1ZUY A;  2QDL A;  2YUO A;  1GL5 A;  1MV3 A;  2YT6 A;  2K3B A;  4JJD A;  1HSQ A;  4OMM A;  1JXM A;  1T3L A;  3VS5 A;  1T0H A;  2F2X A;  1UHC A;  2IIM A;  1BB9 A;  4LUE A;  2M51 A;  1AWJ A;  4D8D A;  1Z9Q A;  2EGC A;  4K11 A;  2CDT A;  2X3X D;  1QWE A;  1PHT A;  3PVQ A;  4RTX A;  3NPF A;  2CUB A;  1NYG A;  2YDL A;  2ESW A;  2KYM A;  1WLP B;  4IIO A;  2C0I A;  4Z8A A;  1H8K A;  2P4R A;  2EVR A;  1K1Z A;  4J9I A;  2OAW A;  4DEY A;  2DL8 A;  1WIE A;  2AK5 A;  3H0F A;  2CH4 A;  2DBM A;  5IHN A;  1X69 A;  1AOJ A;  1GFC A;  1PRM C;  2EKH A;  2YUQ A;  1AZG B;  1NYF A;  1BK2 A;  4JZ4 A;  1OEB A;  5IHK A;  1NEB A;  2A28 A;  2L2P A;  5GJW B;  1SHG A;  2MCN A;  4LE9 A;  4AG2 C;  4ORZ A;  1E7O A;  1SHF A;  2J7I A;  1I07 A;  2O9V A;  2DYB A;  1UUE A;  2K6D A;  1M3A A;  2DL3 A;  1RLP C;  1ABO A;  2A37 A;  1BU1 A;  1QWF A;  2GNC A;  1HJD A;  4J9F A;  4F14 A;  1WXT A;  1T0J A;  1VA7 A;  1ZLM A;  3EGU A;  1EFN A;  1UHF A;  2FG0 A;  4OMN A;  1GCP A;  3M0U A;  3A98 A;  2VWF A;  4WCI A;  2DLP A;  4AFQ C;  1PKT A;  1J3T A;  2H8H A;  3O5Z A;  1JO8 A;  1K76 A;  2DBK A;  4AFZ C;  4OMP A;  4AFS C;  1OOT A;  4FSS A;  2J6F A;  3IQL A;  1AWX A;  2DM1 A;  4JZ3 A;  3KFV A;  1GBR A;  2K7A A;  2OJ2 A;  4ZNX A;  2F2W A;  2LQN A;  1U3O A;  1K9A A;  2EYY A;  2VVK A;  1UEC A;  3VS3 A;  3LH5 A;  2L3Q A;  2DF6 A;  1QCF A;  4CC7 A;  4E6R A;  2CSQ A;  2L3S A;  1KSW A;  2MIO A;  2NUZ A;  2LJ3 A;  2HDA A;  1ZX6 A;  2V1R A;  1YWP A;  1TUC A;  2DJQ A;  4HVU A;  1AWO A;  1JEG A;  4Z89 A;  1AVZ C;  2DNU A;  1JQQ A;  3PVL A;  2CT4 A;  1CKA A;  1OV3 A;  4RTT A;  2KRO A;  2D1X A;  3SEM A;  2O2O A;  2DL5 A;  1I1J A;  2L0A A;  2RQV A;  3VS7 A;  4A63 B;  2JM8 A;  1X2K A;  2YUN A;  1M3B A;  4IIM A;  4JJC A;  3JV3 A;  1GBQ A;  2KXC A;  4RTZ A;  2ECZ A;  3EHQ A;  2HCK A;  1U5S A;  1I0C A;  3C0C A;  1QKX A;  1ZUU A;  3UF4 A;  3EG2 A;  1GFD A;  2M0Y A;  2KXD A;  2RF0 A;  3PE0 A;  3QWX X;  4AG1 C;  2FO0 A;  1AD5 A;  1M3C A;  3VRY A;  4CC2 A;  1NLO C;  1ARK A;  2EGA A;  2CRE A;  2KGT A;  1YP5 A;  1WI7 A;  5ECA A;  5I22 A;  2FPD A;  2KNB B;  2O31 A;  1PRL C;  2KRM A;  4Z88 A;  2CT3 A;  1AWW A;  2I0N A;  2KT8 A;  2RQW A;  3EHR A;  3VS2 A;  3U23 A;  4DEX A;  4QT7 A;  1QKW A;  3REB B;  4J9E A;  2VKN A;  2KEA A;  3UA6 A;  2JTE A;  1GRI A;  3H0H A;  1WDX A;  2D8J A;  4LUD A;  1SEM A;  2AKK A;  2MOX A;  2AKL A;  2LJ1 A;  5IHI A;  3NHN A;  4KRT A;  3VS1 A;  2JS0 A;  1UDL A;  3I35 A;  1YWO A;  2OI3 A;  4LNP A;  1AEY A;  1X43 A;  2YUP A;  1AZE A;  5FWB A;  3VS0 A;  1M30 A;  1TG0 A;  2J05 A;  4OML A;  1SPK A;  1G2B A;  1X2Q A;  2DMO A;  1TUD A;  1CKB A;  1NLP C;  2EBP A;  1B07 A;  1K0X A;  3I5R A;  2D0N A;  1K4U S;  4GBQ A;  1M8M A;  1SSH A;  2JMA A;  2KBT A;  2DRK A;  1X27 A;  2LX7 A;  3M0T A;  1UFF A;  3H41 A;  2ROL A;  3VRZ A;  1UJ0 A;  1NEG A;  2JS2 A;  2BZX A;  2V1Q A;  1W6X A;  4X1V A;  3REA B;  2DE0 X;  2D8H A;  3EG3 A;  3ZL7 C;  1WX6 A;  1ZSG A;  4GLM A;  2PZ1 A;  2PTK A;  2BTT A;  5I11 A;  1B3Q A;  1K0S A;  1VYT A;  4HVW A;  2O88 A;  4OMQ A;  3FJ5 A;  1PWT A;  3RNJ A;  2RQT A;  3TSZ A;  1WA7 A;  2RQR A;  4J9H A;  3I9Q A;  2RNA A;  1UTI A;  1H92 A;  2ENM A;  4LN2 A;  3VS6 A;  2J06 A;  3GBQ A;  4ESR A;  3EG1 A;  2XMF A;  2LMJ A;  1QLY A;  4J9G A;  2JM9 A;  2K79 A;  1E6H A;  2K9G A;  2BZY A;  1MUZ A;  2A36 A;  2O9S A;  1MV0 B;  2RPN A;  2W10 A;  3ULR B;  3M0Q A;  2GTO A;  1JU5 C;  1WYX A;  1G83 A;  2YSQ A;  2HSP A;  3I5S A;  2JXB A;  1H3H A;  1V1C A;  5IXB A;  2RN8 A;  1ABQ A;  2EYW A;  2NWM A;  2AZS A;  1S1N A;  2HEQ A;  4M4Z A;  1Z9Z A;  2LCS A;  5L23 A;  2GBQ A;  3NGP A;  2FPE A;  1GCQ C;  1RI9 A;  3THK A;  3M0P A;  4Y92 A;  1OPL A;  2FRY A;  1SRL A;  2SEM A;  5GJV B;  1PNJ A;  2GQI A;  2W0Z A;  1WFW A;  2B86 A;  5EC7 A;  3M0R A;  2KT1 A;  5FWC A;  4F17 A;  2A08 A;  2LJ0 A;  4R0K A;  4CC3 A;  4J9B A;  1W1F A;  2F2V A;  3H0I A;  3RBB B;  4D8K A;  2JW4 A;  2LZ6 B;  2FPF A;  5IH2 A;  3SHW A;  1CSK A;  4RTV A;  1GCQ A;  1BBZ A;  2G6F X;  1YNZ A;  3NMZ C;  2KR3 A;  2KRS A;  1SRM A;  1U06 A;  1KIK A;  4AFU C;  2LP5 A;  1Y57 A;  2DRM A;  2J6K A;  2CH4 W;  1YCS B;  2DL7 A;  2J6O A;  2DA9 A;  3CQT A;  1M27 C;  2RQU A;  2DVJ A;  1YN8 A;  4HXJ A;  2ED0 A;  1X6B A;  2PNI A;  2CSI A;  2CUD A;  5FW9 A;  4J9D A;  4F16 A;  4RUG A;  1N5Z A;  2X3W D;  2BZ8 A;  4OMO A;  2DIL A;  1ZBJ A;  2KRN A;  1VYV A;  1KFZ A;  2EGE A;  1IO6 A;  1NM7 A;  2GTJ A;  1PKS A;  2ROT A;  4J9C A;  5HCK A;  1Y0M A;  1FYN A;  4RTU A;  2FEI A;  4HVV A;  3TSW A;  2HBW A;  2C0T A;  4CC4 B;  1OPK A;  2DL4 A;  2ED1 A;  1LCK A;  4RTY A;  3VS4 A;  1ZUK A;  2EPD A;  5IXF A;  2ABL A;  2EQI A;  1UE9 A;  4RTW A;  1X6G A;  3UAT A;  2RMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...