2CT3A

Solution structure of the sh3 domain of the vinexin protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinexin
publication title Solution Structure of the SH3 domain of the Vinexin protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ct3A00
2JS0A 2OAWA 1T0HA 2JM8A 4J9BA 2JTEA 3EG1A 2DMOA 2LQNA 2YDLA 1Z9ZA 3JV3A 1UTIA 2AK5A 2OI3A 1TUDA 1X6BA 2HBWA 4F14A 2J6OA 1M3BA 2NWMA 1H8KA 4RTTA 1NLOC 2J6FA 2CDTA 2OJ2A 4RUGA 2EKHA 2P4RA 3EG0A 3RNJA 3U23A 2JMAA 1JU5C 2D8JA 1K1ZA 1FYNA 1JXOA 2CH4W 2EGAA 3TSWA 1SRMA 2FPEA 1GCPA 1ABOA 1PRLC 1AEYA 5FWBA 2FRWA 4OMNA 1AOJA 2KYBA 4AFQC 1M3AA 1KSWA 3I5RA 2ED0A 4Z88A 2O2OA 2KXDA 1AWXA 3PVLA 1M30A 3NHNA 4J9HA 4OMMA 1B07A 2KT8A 2CSIA 1ZUUA 1GRIA 2J05A 1MV3A 1LCKA 3VS1A 4IIOA 1RI9A 2EBPA 2K6DA 1HD3A 3FJ5A 1RLQC 1G2BA 1SHFA 1X43A 2A08A 4CC7A 1GFCA 2DNUA 1OEBA 2D0NA 2DM1A 5ECAA 3RBBB 1SHGA 2L3SA 1WYXA 1BBZA 1NEBA 4J9EA 2CUBA 3PE0A 4RTXA 1GFDA 5IHIA 2K3BA 5IHKA 2O31A 5HCKA 4OMPA 2FPDA 1U5SA 2C0TA 1JXMA 2M51A 4F16A 1X69A 1YCSB 1VYVA 1UHFA 3EG3A 4D8KA 1H92A 1W1FA 2RMOA 4D8DA 1UHCA 4LUEA 2RNAA 2ENMA 2RN8A 2NUZA 1ABQA 2HEQA 2SRCA 3SEMA 1GBQA 1T3LA 1NEGA 3EG2A 1WXUA 2KYMA 4HVVA 1KFZA 2DL7A 2VWFA 2DF6A 2J06A 3PVQA 3GBQA 2EGCA 2PZ1A 2YT6A 1UECA 4AG2C 2V1QA 4CC3A 1WDXA 3UATA 2JW4A 4J9CA 2AKKA 4HCKA 4OMLA 1X2QA 2LNHB 3KFVA 4F17A 1J3TA 4JZ3A 3A98A 1AWWA 1NYGA 1UGVA 4LN2A 1AVZC 1Y57A 2EYWA 2EYZA 2G6FX 1KJWA 4AFZC 4LUDA 1E6HA 3ULRB 1UG1A 2JM9A 2KRNA 2V1RA 4GBQA 3I9QA 3VS2A 5L23A 2LJ3A 1BB9A 1QCFA 2CT3A 2DILA 1VYTA 1YNZA 1MV0B 2DL5A 4QT7A 1PNJA 3M0TA 2X3WD 2KE9A 1E7OA 1SPKA 1ZBJA 4JZ4A 2VVKA 3VS3A 5FW9A 2KGTA 1YWOA 4FSSA 1I07A 4JPBW 1W6XA 1SSHA 1WXTA 2JMCA 3C0CA 2HSPA 2KNBB 1TUCA 2DRKA 1PRMC 2K79A 1JO8A 3H41A 5I22A 2SEMA 3TSZA 5IXBA 1WI7A 1ZUKA 1K76A 2EGEA 2O9VA 3CQTA 2CH4A 2K7AA 2AKLA 1UE9A 2I0NA 4ESRA 1OPKA 1YP5A 2GQIA 2L3PA 1WA7A 2B86A 2L3QA 3VRZA 2PTKA 1JEGA 1QKXA 4ZNXA 1QKWA 3NGPA 1K9AA 3VS4A 5I11A 2RQRA 2HCKA 1I1JA 2VKNA 3M0RA 1X27A 4X1VA 2ABLA 3I35A 2EVRA 4LNPA 2DRMA 2DVJA 2EYXA 2DL8A 2F2XA 3UF4A 1NM7A 2ECZA 1OV3A 1YN8A 2D1XA 2K2MA 2GTJA 4RTUA 2ROLA 1OOTA 1T3SA 1BU1A 1E6GA 1SEMA 1SRLA 2HDAA 4J9IA 1UJYA 1X6GA 3H0HA 5GJVB 1H3HA 2W10A 1ZSGA 2KROA 2RQTA 2EQIA 4JJDA 2KBTA 1AWOA 2FEIA 2CREA 2RQWA 3UA7A 3EHRA 1GBRA 2EYYA 2O9SA 3VS7A 2DE0X 4J9DA 2KEAA 1UDLA 2XMFA 4A63B 2DYBA 2C0OA 1GL5A 4AG1C 1VYUA 2GNCA 5GJWB 2RQVA 3H0IA 2ED1A 4KRTA 2BZYA 2RF0A 1AZEA 3R6NA 2DBKA 3THKA 2MCNA 3VS5A 1PKTA 3EHQA 5EC7A 1Y0MA 2DL4A 2E5KA 1MUZA 2DA9A 2A36A 1ZUYA 1RLPC 2DBMA 2DL3A 2ESWA 2RPNA 3VS6A 1K4US 4RTVA 1QWFA 3NPFA 4EIKA 1HJDA 2F2WA 1HSQA 2X3XD 2JS2A 2LJ0A 1X2KA 4LE9A 1KIKA 2LJ1A 2DLPA 4AFUC 1YWPA 2YUPA 1NYFA 4RTWA 3QWYA 4E6RA 4HVWA 4CC4B 1NG2A 3ZL7C 3EGUA 1U06A 4HXJA 3M0UA 4Y92A 1IO6A 2LMJA 1QLYA 2AZVA 4RTZA 2MIOA 1WLPB 1XOVA 1N5ZA 2JT4A 1WFWA 4AFSC 2FG0A 2A28A 2H8HA 2PNIA 2LCSA 2K9GA 2LX7A 1B3QA 4M4ZA 3M0SA 1UFFA 1JQQA 2GBQA 2C0IA 2AZSA 1GCQA 3UA6A 1QWEA 2CUDA 3VRYA 4J9GA 4K11A 5IHNA 5FWCA 2J6KA 5IH2A 3SHWA 1BK2A 4DEXA 1G83A 2DX1A 1CKBA 1CKAA 1K0SA 2BZXA 1K0XA 1A0NB 2CT4A 2YUNA 2MOXA 3M0QA 1M27C 1AWJA 2GGRA 3O5ZA 1AD5A 1EFNA 1PKSA 2W0ZA 2YSQA 1M8MA 4R0KA 2BZ8A 2YUOA 4GLMA 4JJBA 2IIMA 1U3OA 2FRYA 1VA7A 1NLPC 2ROTA 2A37A 2LP5A 1ZLMA 2RQUA 2D8HA 4IIMA 2GTOA 3REBB 2KT1A 4JJCA 2KRMA 1RUWA 3M0PA 4OMOA 3I5SA 3VS0A 3LH5A 2KRSA 2O88A 1S1NA 1FMKA 3TVTA 4J9FA 4ORZA 4Z89A 1I0CA 3QWXX 1UUEA 1WXBA 4HVUA 1AZGB 1ZX6A 1T0JA 2FO0A 4RTYA 1ARKA 1WX6A 2CSQA 2JXBA 2QDLA 1M3CA 2EW3A 1WIEA 2FPFA 2L2PA 1PWTA 2BTTA 3NMZC 2M0YA 4Z8AA 4DEYA 2L0AA 3H0FA 1Z9QA 2LZ6B 2F2VA 2LQWA 1UJ0A 2KXCA 2KR3A 2YUQA 1GCQC 1OPLA 4OMQA 2EPDA 1CSKA 1TG0A 3IQLA 3REAB 1PHTA 1V1CA 1W70A 4CC2A 5IXFA 4WCIA 2DJQA 2J7IA
chains in the Genus database with same CATH superfamily
4M75E 4DBRA 3G4ST 4J6XA 2QQSA 1M90C 1SSFA 2JM8A 5IN1A 3EG1A 4C8QG 1OQKA 5KCHA 2OI3A 3E19A 1M3BA 2PVDB 3P8HA 3RNJA 3CCMQ 5LJ3e 1NE8A 3OS0A 1I81A 1ZSZB 3QDFA 4JRQA 1M1KC 4E2FB 8ATCB 1GCPA 1ABOA 2DTIA 5GAOq 1XJWB 4OMNA 1Q82C 2OTLA 2KYBA 3OYCA 4BE2A 4Z02A 2VASA 2O4XA 4AMCA 2YXYA 4E7ZA 2ED0A 4Z88A 2O2OA 3TREA 1AWXA 3OYKA 2CSIA 4C5GA 2QTXA 4FM4B 5DLQE 2DIQA 4FCYA 4IIOA 1X75C 2K5LA 4JLIA 1W2BP 1X43A 2DNUA 3QYGB 1QVGA 1VQPA 5ECAA 3CCJT 3MP8A 1YJNA 1B7TA 1U1TA 1FWZA 3L1AA 3OB9A 1P92A 1NEBA 2CUBA 4RTXA 1D0ZA 1M2OA 2RO0A 4OGCA 2JTFA 3JSCA 2FPDA 1VQ6A 1YBYA 2CP3A 4F16A 1NJIR 1WJSA 1VYVA 2ZPFB 3EG3A 1O9SA 2OTJA 3CC7T 4BE1A 4D8DA 3BDUA 3HKSA 1MHNA 1VQMT 3QJ6A 1M1FA 1H3ZA 3LWHA 3SEMA 3OYLA 1T3LA 3GF5A 4PKCC 1WXUA 2WSCE 4BD3A 2VWFA 2DF6A 3VYHB 5CAIA 1W2BS 2RD1A 3GBQA 1IGQA 3VYGA 2DFUA 2YT6A 2V1QA 4J6YA 1WDXA 5I21A 1FX7A 1IB8A 2CZ1B 4DA4A 1JJ2A 3L2RA 1MMDA 3FDRA 3CMAT 3KFVA 2NUTB 4N4HA 1Q7YU 4PJOE 1AWWA 4PL6A 4LN2A 1RL2A 3CCSQ 2EYZA 1KG1A 1KJWA 3FIFA 4AFZC 3D7SB 4M78E 1UG1A 2KRNA 3ULRB 3LWIA 1K9MR 3AHUA 1B34A 2XIDA 1VQNT 4BDYA 5L23A 3CD6T 1MNEA 1AHJB 2L5QA 3CPFA 1KQSP 1FMWA 5CIUA 1BKBA 1SPKA 1RAGB 3PTAA 4VUBA 3G6EQ 1G5VA 2F5KA 1I07A 5HK3A 1VQLA 1BI1A 3ZFJA 1SSHA 1WXTA 2JMCA 2LDMA 3C0CA 3H41A 1JO8A 2FB7A 3RIRA 1OI1A 1WI7A 4ME7A 5EG2A 5D6YA 1Q81U 8AT1B 3QO3A 4EMKA 2QQAA 4XTZA 2AKLA 1BIBA 2I0NA 2QI2A 2M02A 1OPKA 2JZ2A 2L3PA 1WA7A 1WHHA 1WHMA 2JTMA 2COYA 2GF7A 3L2VA 2DTOA 4M77E 1QKXA 2RI2A 5FU6B 3OQ5A 1N6AA 3NGPA 4JS5A 4M75B 2HCKA 3BDLA 5GAOn 2RK2A 1KQSS 2CP0A 2VKNA 1X27A 1I5OB 2CZ0B 2G3RA 2XKOC 2DXTA 2ABLA 3I35A 2DRMA 2DVJA 3ZBDA 1GXIE 1N8RU 3C12A 2F2XA 2MK5A 1YN8A 2D1XA 3L2ZA 4RTUA 1T3SA 1BU1A 1SEMA 2DEQA 3OYMA 5HKCA 3H9NA 2HDAA 1XQHA 3H0HA 1X6OA 1H3HA 2NUPA 3PMIA 3C4SA 5M9OA 3OY9A 1VQ8A 2P84A 4PFOA 4JJDA 4M7DB 2COZA 2XD0A 1OYXA 2VYTA 4E7JA 2EYYA 2O9SA 1RADB 4J9DA 2VXEA 5GAN4 1K8AU 1YITQ 3WVDB 4A54A 1X01A 5CQYA 4M75F 3CMEA 3X28B 1AZEA 3QIIA 4XTXA 4M75G 3THKA 5GAN5 3FLGA 2QEXT 5GAMd 1M1KR 4MZPA 4FYXB 3A8MB 2A36A 1ZUYA 1RLPC 2DL3A 3LGFA 2QK0A 1Q82R 3M54A 1YHQT 3KBGA 1HSQA 1WQWA 1X2KA 4IUUA 1KIKA 4FYYB 3LH0A 4PJOA 4C8QE 3P8BB 3QWYA 1NG2A 2RI5A 1WQ7A 4HXJA 3VU3C 3GOXA 2KVQG 4M78A 2CP5A 5GAN8 4M7DF 4GLKA 1VQOA 1QLYA 4M7DG 1WHJA 1OU8A 3CC2A 2JT4A 4CRIA 2LCSA 4HT8A 2K9GA 2JOYA 3L2QA 4M4ZA 2Y4YA 5HK0A 4J9GA 4M7AA 1S72Q 5IHNA 5KYNA 4OGEA 1BK2A 1Y07A 1WNLA 1G83A 2DX1A 3UWNA 4OMFB 3JCMV 3EFOB 1K0SA 2MF2A 5FROA 2ZAEA 2VGNA 4PJNA 1NZ9A 2RHUA 1EFNA 4DBFA 1M8MA 2BZ8A 2YUOA 1YCYA 4C0DB 4GLMA 3OYGA 2RH2A 1V29B 3JCMf 2VC8A 2BKDN 2GQVA 3EGDB 1QVGP 3SWNC 2HBPA 2LQKA 1Q7YC 1KD1U 4M78B 4M77A 4J7IA 1D1AA 2KT1A 4JJCA 3CCEQ 3M0PA 4FU6A 3CCLT 2KRSA 4L6V5 4O6JA 2ZGWA 2Z0WA 1IXDA 4C92C 3ASKA 1T0JA 1VIFA 1PG5B 2EQMA 4BUGA 1UGQB 3G71T 1YFNA 2QDYB 1QQJA 2BE7D 5LJ3j 1QVFP 3H6ZA 2BTTA 3CCVT 2M0YA 1VQKA 4XTYA 4PJOF 2GFUA 2LQWA 2MYSA 1QVGS 3OMCA 3MEAA 2EPDA 4M78F 3M5AA 1TG0A 3IQLA 3FRNA 1JJ2P 1Q81C 4M78G 4ELZC 3M9QA 2KI7A 1W70A 2D0QB 3OSVA 5KYUA 4F04B 2HQXA 2HKQB 3SB2A 2QYZA 4ZTFA 2AK5A 1TUDA 1YI2T 2OTLQ 3HSBA 2JJ9A 3L2UA 2NWMA 4RTTA 1WHGA 4E7SA 2J6FA 3OYDA 2EKHA 2P4RA 3EG0A 3U23A 2RM4A 2JMAA 2KY9A 2AHJB 4OB2B 1I4K1 2D8JA 1FYNA 1K1ZA 1K73U 2B8AA 3JRZA 1QVFS 4C8QA 2D6FA 2EGAA 3F70A 1N8RC 2FPEA 1VQ4T 2GFAA 3RERA 1AEYA 2FRWA 3VUZA 4AFQC 1M3AA 4FYWB 2WSEE 3PGGA 1KSWA 5GMKm 1JJ2S 1M2VB 1C6VX 1TSFA 3A1PA 3RR6A 1VQPQ 3OSSC 1M30A 4M77F 2LCCA 3DB4A 2RA2A 3NHNA 4C0ZA 1B07A 2X35A 1YJNQ 4X34A 3X24B 1K8AC 2PQWA 2K6DA 1HD3A 3FJ5A 2Y90A 1RLQC 1VQ6Q 5I2MA 3VUBA 4DBQA 4CC7A 3CBPA 2D0NA 2EJGA 5CKDA 5GAOm 4LD6A 2DM1A 4DBHA 3JCMb 3OS2A 4ELYC 3URGA 4ZTJA 4FT2A 2OTJQ 4X9CA 4BDZA 2ZCFB 1VQ5A 1HXDA 2LRQA 5LJ3h 2CP7A 4OB1B 3CCUA 1GFDA 1D09B 5IHIA 5IHKA 2O31A 5HCKA 4E7LA 1LPLA 1TS9A 2F69A 3T9NA 2C0TA 2M51A 5KE2A 1YCSB 1ZSZA 2PVOB 4XU2A 3E9FA 1LVKA 4D8KA 1Y96B 1UHCA 5AYFA 1FXXA 2IG0A 3GP8A 2RN8A 2DAQA 4IUTA 3OYIA 5D7UA 1ABQA 1VQ9T 1OU9A 3BY7A 2DL7A 5KYXB 2RJFA 3AT1B 4XU0A 4KT0E 2E10A 2PZ1A 3E2UA 4AG2C 3M58A 3UATA 4IUQA 3MP6A 3RMQA 2JW4A 3JB9H 4ZGDB 3HFOA 4FW2A 4J9CA 4OMLA 4F17A 1NYGA 4C8QF 5CKFA 1Y57A 2EYWA 2AT1B 2FZGB 2JM9A 3JCMd 4GBQA 1IRXA 3RESA 2R58A 3I55T 5GANj 4LDUA 4EMKC 4MZMA 1UGSB 5CKBA 3X25B 5A2QE 1VQLQ 1QCFA 4KUDK 1KD1C 3CCQT 4N0AA 3CPWP 5D6XA 3CCJA 2RHIA 1WHKA 1MV0B 2DL5A 4M7DE 2X3WD 3CC4T 1E7OA 3LYIA 2CP2A 4OP0A 1ZBJA 3VS3A 1RAIB 2KGTA 2BE9B 1YWOA 1EX4A 4JPBW 1Q7YR 3SD4A 2KNBB 4QVZA 1PRMC 2K79A 3JCMc 2QG9B 4KH0B 5IXBA 1ZUKA 3C94A 1BI3A 2QQRA 1K76A 2EGEA 2ZPBB 3CC7A 2QA4T 2XDDA 3O8VA 4J83A 4E7KA 1VQMA 1UE9A 1PC0A 2GQIA 3M59A 1Q86U 2QEXQ 2L3QA 3VKIA 2PTKA 2NUTA 3EG9A 1KHCA 1QKWA 1TUGB 5GAMe 1K9AA 3VS4A 3CPWS 4KGVB 2RQRA 2CYZB 1VQ7T 5KYWB 4IURA 4C0GA 3CMAA 1VQ8Q 4X1VA 5IAYA 2KK4A 2EYXA 2XI9A 3UF4A 4J8OA 2ECZA 1OV3A 2GTJA 2DEUA 1E6GA 1Q81R 3CMEQ 1SRLA 1VQNA 1R77A 4J9IA 4QW2A 5GJVB 1JBMA 2RHYA 3CD6A 2KROA 1K73C 5LJ5d 2KBTA 5KYYA 2CREA 4A4KA 3META 2DE0X 3OS1A 1IREB 3M4GA 1D3BB 1MMGA 4C92D 4AG1C 3MCAB 2RQVA 2ED1A 2KSSA 5DM7R 4FSXA 1QP3A 3R6NA 3EG9B 2DBKA 2X9HA 3DKMA 2DXUA 3VS5A 1PKTA 3OBYA 1HYOA 5EC7A 3GLXA 4LXCA 2DL4A 1N8RR 4M7AC 1VQOQ 1W4SA 2ESWA 1YJWT 3CC2Q 1ZBXA 2DO3A 4JLGA 2ZZDA 2F2WA 2HNIA 3BW1A 4XU1A 4M75A 2LJ1A 4KH1B 4IKFA 1M4ZA 3Q1JA 4L59A 4J7FA 3EGUA 5GMKe 1IGUA 2XDBA 2YLCA 3JCMg 1I5LA 4ZGJB 2AZVA 4RTZA 1XOVA 1K8AR 1WFWA 5KYYB 3MO8A 3S3NA 1FMVA 1TXQA 5FU7C 2XU8A 3V8KA 1KQ2A 1B3QA 2XICA 1LNXA 1JQQA 1BCMA 5KH6A 1GCQA 3UA6A 1QWEA 2CUDA 5C0MA 3V8LA 1G3SA 2NYSA 1U1SA 3G71Q 2HL3A 3SFMA 1YJ9T 4PFZA 4M7DA 3SDZA 1CKBA 3HTRA 1CKAA 1RI0A 5GANe 4MMKA 4X9DA 2YUNA 2QXFA 2V8KA 1M8VA 1AD5A 2EQKA 1PKSA 1QP2A 2W0ZA 1WGSA 4TVRA 4EMHA 1G3YA 4LDVA 2K5FA 1OZ2A 2VUBA 1NLPC 2ROTA 2RHXA 1I8FA 2A37A 2LP5A 1ZLMA 2OX7A 1IHVA 3X26B 3M57A 2RJCA 3REBB 2QEXA 2HMAA 2JNGA 3MEVA 3MEWA 1YIJT 4DOWA 3I5SA 3LH5A 2O88A 1S1NA 3OYBA 1BI2A 5A0DA 1YHQA 3QWXX 1ACMB 3CCMT 1VQKQ 3QDRB 1BYMA 2PUKB 2YLBA 4PJMA 1ARKA 1WX6A 1ZA2B 3DLLA 2JXBA 3J7AF 2RK1A 1M3CA 2EW3A 3C95A 1VIEA 5LJ5g 2A3LA 2ZPHB 4A4GA 2KAFA 3HFNA 2LZ6B 2F2VA 3RUXA 3EFOA 2P0PA 1KD1R 3CEYA 2LT1A 5GMKi 3JB9F 5GAOr 3JB9G 3PIOA 4CC2A 2CP6A 2HKNA 4HCBA 4XTVA 4PLIA 3INZA 2OAWA 1T0HA 4J9BA 1Q86C 4N4IA 2LQNA 2YDLA 4BY6C 4B9XA 3EGDA 3JV3A 2XK0A 5A0LA 2HBWA 4F14A 2J6OA 1H8KA 1SKUB 1NLOC 3WXMB 3V7CA 2CDTA 2OJ2A 4A4FA 1JU5C 3EH2A 1WHLA 2ZPEB 2MPXC 2E41A 1SRMA 1G3TA 4JUVA 2PVGB 4D6WA 2DPPB 5FWBA 1D0YA 1LJOA 1AOJA 3E1SA 3CCLA 3GIBA 2X4WA 3I5RA 2KXDA 2FZCB 3NFCA 2VXFA 4J9HA 1KC8U 1RAHB 2V26A 3J81E 2M1HA 1ZUUA 1VQ5Q 3G71A 1H641 3S6WA 3CCUQ 1GRIA 2J05A 3MEUA 2A7YA 2JVVA 1RI9A 3G4SQ 3CCVA 1M90U 1G2BA 1SHFA 4IUPA 2HQHA 4HCZA 1K73R 3CCST 5CR2A 3RBBB 1SHGA 4KGXB 3CBMA 2L3SA 2E65A 1BBZA 4MDXA 4NOYA 4J9EA 2QQBA 1BCOA 5KE3A 4OMPA 2RB6A 1TH7A 1R0CB 4RCBA 1YI2A 1UHFA 4Y28E 1W1FA 4LUEA 2RNAA 5GAN6 3TQ7P 2FHDA 2ENMA 2NUZA 3G6ET 2D9TA 2P0QA 2XHCA 1PSFA 3CXCA 3EG2A 1R0BG 3VJPA 3A8GB 1KFZA 5CKHA 1M2VA 5AT1B 4MDWA 4N0AC 1QCOA 2J06A 3PVQA 4QVCA 1VQ4A 2EGCA 4A4EA 4V2SA 2ATCB 2EFIA 3L2WA 2FL7A 4C92E 3RKXA 4ZGEB 4HCKA 1X2QA 2LNHB 1J3TA 4HA8A 4UC4A 4E47A 4PJOD 3QUIA 3A98A 5J3BA 2MI6A 1AVZC 1MGQA 3CCJQ 2Y4XA 1XTDA 4M78D 1E6HA 4C0FA 1VQ7Q 3OYNA 2MMPA 4C92A 3I9QA 4XU3A 4ANJA 3OS5A 2LJ3A 3QHSA 2CS7A 4II1A 4WF2A 3MHXA 3RKWA 4M7AD 3E9GA 4C5HA 2EQUA 2RHZA 2DILA 5GAMj 1YNZA 2YHTA 4QT7A 1PNJA 3CC7Q 3LX7A 2KE9A 1VQMQ 1KQSA 2K5IA 1PCXA 1AT1B 1XNIA 3A8LB 1Y96A 3OYHA 3EH1A 2HSPA 1TUCA 5LJ5e 2KMTA 3M55A 2MWPA 3OW2A 5I22A 3OMGA 2DKGA 3CQTA 5KYXA 2CH4A 3I56T 2DIGA 2K7AA 1YITT 3CMAQ 4C5IA 4O5VA 1VQ9A 2B86A 4M77D 4NL2A 4ZNXA 2M0OA 3M4YA 2EAYA 3QBYA 2P0KA 1YJWQ 4MZTA 1RAFB 2V8JA 1I1JA 1VQNQ 3CD6Q 1PSEA 3G4SA 3G1JA 4BI3A 2DL8A 1NM7A 2QAZA 2CGHA 3QXEB 1MNDA 1RAAB 2K2MA 3PIPA 2E3HA 2FVUA 2ROLA 1OOTA 3QYHB 2EKOA 3I55A 5FU6C 3ER0A 2M16A 4MMLA 4M75C 5LL6S 4PFPA 5GMKj 4XTUA 1Q86R 3HP9A 4PNOA 1S72T 2YRDA 3EFRA 2K3YA 2KEAA 1UDLA 2XMFA 2DYBA 3CC4A 2C0OA 4BY6B 3QZ5B 6AT1B 4LDYA 1VYUA 2GNCA 1BIAA 3H0IA 4KRTA 5KCOA 2BZYA 2RJDA 3EHQA 1Y0MA 1KC8C 5GAMh 3JB9J 4FL6A 2KQWA 2DBMA 4RG2A 1K4US 4ATOA 3JCMW 2L89A 1RABB 4M7DC 3HHTB 4RTVA 3FEOA 2QA4A 1QWFA 2E4HA 3NPFA 4OB3B 4EIKA 1VOMA 2X3XD 2JS2A 2LJ0A 4LE9A 5LJ3f 3CCRT 2DLPA 4AFUC 4C8QD 2YUPA 5KYWA 1NYFA 4RTWA 4E6RA 2EIFA 5FRMA 4HVWA 3ZL7C 3P8DA 1YIJQ 3CCET 1OX8A 4Y92A 5D6WA 2LMJA 1WLPB 1VQ7A 1N5ZA 4AFSC 4E7HA 2FG0A 2H8HA 2YRVA 2PNIA 3FJPA 3JCMP 2DERA 4XTWA 3RMSA 4DQ2A 2LX7A 3M0SA 3EGXA 1UFFA 3UDCA 2GBQA 3HRTA 4B9WA 2H3EB 2AZSA 4F7UB 3A8HB 3VRYA 1Y7XA 5IH2A 3SWNB 3SHWA 4QQDA 2E70A 4DEXA 2CKKA 1SG5A 2GCXA 2X4JA 3FC3A 4JRIA 4R55A 2DYIA 3J80E 3HRSA 2BZXA 3A5ZB 1TWBA 1D0XA 1D3BA 3M0QA 4P5NA 3NTKA 1M27C 1AWJA 4PJJA 1WJQA 4C92B 5GAOp 4R0KA 5GAMf 5CKEA 1YHQQ 1R8OB 4R56A 2FRYA 1VA7A 1WZOA 2RQUA 2D8HA 1WPYA 4IIMA 1N9SA 1N9RA 5GMKh 2H3JA 1N27A 1QCNA 2KRMA 5GAN3 1RUWA 4OMOA 5I2SA 2PU9B 2OTLT 4F7UF 3VS0A 3CBOA 2RI3A 1YJWA 4F7UG 2R5AA 3EGXB 3TVTA 3BE3A 2BIVA 1WXBA 1AZGB 1G8XA 2FO0A 4RTYA 3KXTA 4C0DC 5DLOA 3WVEB 4PJOC 2A0FB 4OB0B 3LLRA 2O4XB 2DZ9A 2YWWA 2JN0A 3OYYA 3OYFA 4EPCA 1KHIA 2DD4A 4M78C 4FT4A 1WIEA 5GANh 2FPFA 2L2PA 4ZN1A 4C92F 4JJNK 2COWA 3CXCP 2XG8D 1PWTA 3NMZC 4C92G 2L0AA 4NL3A 1QVFA 1UJ0A 2KXCA 1VQPT 2KR3A 2YUQA 2X4XA 3UT1A 4XAXB 4OMQA 1CSKA 1YJNT 3JAME 1YJ9A 4XK8E 3M53A 1NPPA 5IXFA 4DOVA 2DJQA 2JS0A 2DXCA 3QPHA 1QVPA 1IZ6A 3JCMQ 3JCMJ 3RKYA 1VQ6T 2JTEA 2DMOA 2O01E 2HSEB 1Z9ZA 1TOVA 4XQ3A 1UTIA 5DY9A 1X6BA 1VUBA 3CCLQ 2OTJT 1IHWA 5CO7A 2HQEA 4RUGA 4KUIA 3V8JA 2K3XA 2EYQA 3PMTA 5A0GA 1JXOA 3CXCS 2CH4W 3TSWA 3PT9A 2YRCA 4M7AE 4M77C 1PRLC 3OYAA 2DZCA 1D1CA 1YIJA 4LDWA 1KQ1A 4A4HA 3CCVQ 3CCMA 1MMAA 4RKUE 1M9SA 5GANf 1O75A 2HL5C 3OW2P 3PVLA 1KK7A 4OMMA 3VV0A 1NJIU 1RAEB 2DVEA 3EAEA 2KT8A 3JCMX 1MV3A 1ZQ1A 4OF1A 3V7SA 1LCKA 3VS1A 4QVDA 3H8ZA 2EBPA 3KUFA 5J26A 2A08A 1GFCA 5CK9A 1B34B 1OEBA 2E6NA 2F1LA 3MKDA 1YI2Q 4J6WA 5GAN7 1PD1A 2V8IA 1WYXA 1F1BB 5LJ3d 2VV5A 3PNWC 4C5EA 3PE0A 2E12A 2K3BA 1QMCA 1QW1A 2VB6A 1VQLT 2LCLA 1U5SA 2E5QA 2R5MA 1JXMA 3M56A 2K2VA 1VQ4Q 1EIFA 1UGPB 1K9MU 3OW2S 2E6ZA 1X69A 1KC8R 1TU0B 1OX9A 2WSFE 3R6OA 1H92A 2RMOA 2FZKB 4JRKA 4HCCA 4B6MA 3OA6A 2X51A 2ZPIB 1UGRB 2JUFA 1C0MA 2HEQA 2LT4A 2SRCA 1GBQA 1NEGA 4FW1A 4BE0A 1M90R 2KYMA 3HPWA 4HVVA 4BACA 1NPRA 1UEBA 2CZ7B 2L3RA 4C8QC 4EMKB 1UB4A 2C06A 1UECA 3N5BB 4CC3A 3I56Q 3TU4K 2MWOA 2QGGA 2AKKA 4M75D 2QASA 4JZ3A 1UGVA 5LJ5j 3ZEHA 2G6FX 2R57A 3JB9D 4LUDA 2V1RA 2EJ9A 3JCMh 3UPUA 1Y71A 4JDSA 3VS2A 5GAN2 1LOJA 1BB9A 4L5GA 1VQ8T 4PK4A 4WTOB 4RCCA 2DXBA 4JRPA 4J5YA 2CT3A 3X20B 3CCSA 1VYTA 1EZZB 4M7DD 3CPWA 2DD5A 3M0TA 3HL8A 2IPOB 2NUPB 1WJRA 5CVIA 4JZ4A 3CMET 2VVKA 1D1BA 3MPUB 1VQ9Q 3TCJA 5FW9A 4KULA 4FSSA 1W6XA 2FYKA 4YTLA 2PUOB 1V76A 2QTVA 2DRKA 2K57A 2SEMA 4OVAA 3TSZA 3S3MA 3GNGA 3JB9I 2O9VA 1ZSZC 3LGLA 3OYJA 1G3WA 4HKEA 2LC4A 2KDSA 4ESRA 2HAXA 3G6EA 1YP5A 1RACB 3VRZA 4RMOA 1TTHB 1JEGA 1W2BA 4Q5WA 1VQOT 5I11A 3I55Q 4GY5A 4PJOB 3CC2T 4E7IA 3JCMe 3QJYA 3M0RA 3CCRQ 4LDXA 2EJFA 4AT1B 5J39A 3CCQQ 2MAMA 2DTHA 2I2LA 1M1KU 2EVRA 4LNPA 2K4YA 2BUDA 1Q82U 5LJ3g 1OULA 2EQJA 3NTIA 4EMGA 4F7UE 3CC4Q 3QZ9B 4PLLA 5L8RE 2X4YA 1UJYA 3LW5E 1X6GA 7AT1B 4M7AB 2W10A 1ZSGA 1BI0A 1MMNA 2LNVA 2RQTA 2EQIA 5LJ5h 3OBWA 1AWOA 2FEIA 2RQWA 1C1AA 2CZ6B 4QKUA 3UA7A 3EHRA 4BI8B 4N4GA 1GBRA 3VS7A 5HY6A 4LD9K 4RG8A 2QA4Q 4A63B 1PM3A 5GANd 2DETA 2F5TX 1GL5A 2WACA 5GJWB 2RF0A 2AIRB 2LVMA 2MCNA 4EDUA 1NBEB 4PJOG 1M1GA 4FYVB 5GMKl 3A8OB 1NJIC 5FU7B 2LX9A 1MUZA 2E5KA 2DA9A 2RPNA 3RDVA 3VS6A 5IT9E 2DK3A 1PD0A 2DJZA 5FLXE 1HK9A 3I56A 1HJDA 4M77B 1YITA 1Q95G 4IUVA 2EWNA 2HZYA 1ZA1B 3GPLA 4QQGA 1YWPA 3DB3A 5GAMg 4CC4B 4M7AF 1U06A 3V7RA 3QG1A 3M0UA 4M7AG 4KGZB 2HD0A 1IO6A 3FB9A 5GAOl 2MIOA 2A28A 3QKJA 1VQKT 3S3OA 4CI0C 3BFMA 2C0IA 3GNFB 3DLMA 4BI4A 4K11A 2LQ8A 4FIBA 5LJ5f 2VGMA 5FWCA 1K9MC 2J6KA 4PJLA 2OAUA 2M9UA 3MJXA 3TEEA 1K0XA 1A0NB 2CT4A 2MOXA 2GGRA 3O5ZA 4M77G 2YSQA 5CQXA 1S72A 1SF9A 3HRUA 5CCAA 2ZPGB 5KYUB 2QQ9A 4JJBA 2IIMA 3L42A 3G7ZA 1U3OA 5FRNA 4Y91A 2E1HA 1U8RA 4HT9A 2GTOA 2XDPA 1JRIA 3ME9A 3EFSA 5C6SA 3OYEA 4QQ6A 2E64A 2L8DA 3NTHA 1FMKA 4Z89A 4J9FA 4ORZA 1I0CA 4C8QB 1UUEA 2P4TA 2LTOA 4HVUA 2NLUA 1ZX6A 3CCRA 1DJ7B 4KBMB 3PFSA 2E3IA 3CCQA 4A53A 2CSQA 2QDLA 3QSUA 1YJ9Q 3CCEA 4F7UA 2RJEA 1M5Q1 3SWNA 4DEYA 4Z8AA 2IVWA 4BB7A 3H0FA 1Z9QA 4ZN3A 2QGFB 1OZ3A 1ZHIA 1JB0E 1GCQC 1OPLA 5GANg 3REAB 1VQ5T 1PHTA 9ATCB 3CCUT 1V1CA 4NS5A 3MP1A 4JS4A 4WCIA 2J7IA
chains in the Genus database with same CATH topology
2JS0A 2OAWA 1T0HA 2JM8A 4J9BA 2JTEA 3EG1A 2DMOA 2LQNA 2YDLA 1Z9ZA 3JV3A 1UTIA 2AK5A 2OI3A 1TUDA 1X6BA 2HBWA 4F14A 2J6OA 1M3BA 2NWMA 1H8KA 4RTTA 1NLOC 2J6FA 2CDTA 2OJ2A 4RUGA 2EKHA 2P4RA 3EG0A 3RNJA 3U23A 2JMAA 1JU5C 2D8JA 1K1ZA 1FYNA 1JXOA 2CH4W 2EGAA 3TSWA 1SRMA 2FPEA 1GCPA 1ABOA 1PRLC 1AEYA 5FWBA 2FRWA 4OMNA 1AOJA 2KYBA 4AFQC 1M3AA 1KSWA 3I5RA 2ED0A 4Z88A 2O2OA 2KXDA 1AWXA 3PVLA 1M30A 3NHNA 4J9HA 4OMMA 1B07A 2KT8A 2CSIA 1ZUUA 1GRIA 2J05A 1MV3A 1LCKA 3VS1A 4IIOA 1RI9A 2EBPA 2K6DA 1HD3A 3FJ5A 1RLQC 1G2BA 1SHFA 1X43A 2A08A 4CC7A 1GFCA 2DNUA 1OEBA 2D0NA 2DM1A 5ECAA 3RBBB 1SHGA 2L3SA 1WYXA 1BBZA 1NEBA 4J9EA 2CUBA 3PE0A 4RTXA 1GFDA 5IHIA 2K3BA 5IHKA 2O31A 5HCKA 4OMPA 2FPDA 1U5SA 2C0TA 1JXMA 2M51A 4F16A 1X69A 1YCSB 1VYVA 1UHFA 3EG3A 4D8KA 1H92A 1W1FA 2RMOA 4D8DA 1UHCA 4LUEA 2RNAA 2ENMA 2RN8A 2NUZA 1ABQA 2HEQA 2SRCA 3SEMA 1GBQA 1T3LA 1NEGA 3EG2A 1WXUA 2KYMA 4HVVA 1KFZA 2DL7A 2VWFA 2DF6A 2J06A 3PVQA 3GBQA 2EGCA 2PZ1A 2YT6A 1UECA 4AG2C 2V1QA 4CC3A 1WDXA 3UATA 2JW4A 4J9CA 2AKKA 4HCKA 4OMLA 1X2QA 2LNHB 3KFVA 4F17A 1J3TA 4JZ3A 3A98A 1AWWA 1NYGA 1UGVA 4LN2A 1AVZC 1Y57A 2EYWA 2EYZA 2G6FX 1KJWA 4AFZC 4LUDA 1E6HA 3ULRB 1UG1A 2JM9A 2KRNA 2V1RA 4GBQA 3I9QA 3VS2A 5L23A 2LJ3A 1BB9A 1QCFA 2CT3A 2DILA 1VYTA 1YNZA 1MV0B 2DL5A 4QT7A 1PNJA 3M0TA 2X3WD 2KE9A 1E7OA 1SPKA 1ZBJA 4JZ4A 2VVKA 3VS3A 5FW9A 2KGTA 1YWOA 4FSSA 1I07A 4JPBW 1W6XA 1SSHA 1WXTA 2JMCA 3C0CA 2HSPA 2KNBB 1TUCA 2DRKA 1PRMC 2K79A 1JO8A 3H41A 5I22A 2SEMA 3TSZA 5IXBA 1WI7A 1ZUKA 1K76A 2EGEA 2O9VA 3CQTA 2CH4A 2K7AA 2AKLA 1UE9A 2I0NA 4ESRA 1OPKA 1YP5A 2GQIA 2L3PA 1WA7A 2B86A 2L3QA 3VRZA 2PTKA 1JEGA 1QKXA 4ZNXA 1QKWA 3NGPA 1K9AA 3VS4A 5I11A 2RQRA 2HCKA 1I1JA 2VKNA 3M0RA 1X27A 4X1VA 2ABLA 3I35A 2EVRA 4LNPA 2DRMA 2DVJA 2EYXA 2DL8A 2F2XA 3UF4A 1NM7A 2ECZA 1OV3A 1YN8A 2D1XA 2K2MA 2GTJA 4RTUA 2ROLA 1OOTA 1T3SA 1BU1A 1E6GA 1SEMA 1SRLA 2HDAA 4J9IA 1UJYA 1X6GA 3H0HA 5GJVB 1H3HA 2W10A 1ZSGA 2KROA 2RQTA 2EQIA 4JJDA 2KBTA 1AWOA 2FEIA 2CREA 2RQWA 3UA7A 3EHRA 1GBRA 2EYYA 2O9SA 3VS7A 2DE0X 4J9DA 2KEAA 1UDLA 2XMFA 4A63B 2DYBA 2C0OA 1GL5A 4AG1C 1VYUA 2GNCA 5GJWB 2RQVA 3H0IA 2ED1A 4KRTA 2BZYA 2RF0A 1AZEA 3R6NA 2DBKA 3THKA 2MCNA 3VS5A 1PKTA 3EHQA 5EC7A 1Y0MA 2DL4A 2E5KA 1MUZA 2DA9A 2A36A 1ZUYA 1RLPC 2DBMA 2DL3A 2ESWA 2RPNA 3VS6A 1K4US 4RTVA 1QWFA 3NPFA 4EIKA 1HJDA 2F2WA 1HSQA 2X3XD 2JS2A 2LJ0A 1X2KA 4LE9A 1KIKA 2LJ1A 2DLPA 4AFUC 1YWPA 2YUPA 1NYFA 4RTWA 3QWYA 4E6RA 4HVWA 4CC4B 1NG2A 3ZL7C 3EGUA 1U06A 4HXJA 3M0UA 4Y92A 1IO6A 2LMJA 1QLYA 2AZVA 4RTZA 2MIOA 1WLPB 1XOVA 1N5ZA 2JT4A 1WFWA 4AFSC 2FG0A 2A28A 2H8HA 2PNIA 2LCSA 2K9GA 2LX7A 1B3QA 4M4ZA 3M0SA 1UFFA 1JQQA 2GBQA 2C0IA 2AZSA 1GCQA 3UA6A 1QWEA 2CUDA 3VRYA 4J9GA 4K11A 5IHNA 5FWCA 2J6KA 5IH2A 3SHWA 1BK2A 4DEXA 1G83A 2DX1A 1CKBA 1CKAA 1K0SA 2BZXA 1K0XA 1A0NB 2CT4A 2YUNA 2MOXA 3M0QA 1M27C 1AWJA 2GGRA 3O5ZA 1AD5A 1EFNA 1PKSA 2W0ZA 2YSQA 1M8MA 4R0KA 2BZ8A 2YUOA 4GLMA 4JJBA 2IIMA 1U3OA 2FRYA 1VA7A 1NLPC 2ROTA 2A37A 2LP5A 1ZLMA 2RQUA 2D8HA 4IIMA 2GTOA 3REBB 2KT1A 4JJCA 2KRMA 1RUWA 3M0PA 4OMOA 3I5SA 3VS0A 3LH5A 2KRSA 2O88A 1S1NA 1FMKA 3TVTA 4J9FA 4ORZA 4Z89A 1I0CA 3QWXX 1UUEA 1WXBA 4HVUA 1AZGB 1ZX6A 1T0JA 2FO0A 4RTYA 1ARKA 1WX6A 2CSQA 2JXBA 2QDLA 1M3CA 2EW3A 1WIEA 2FPFA 2L2PA 1PWTA 2BTTA 3NMZC 2M0YA 4Z8AA 4DEYA 2L0AA 3H0FA 1Z9QA 2LZ6B 2F2VA 2LQWA 1UJ0A 2KXCA 2KR3A 2YUQA 1GCQC 1OPLA 4OMQA 2EPDA 1CSKA 1TG0A 3IQLA 3REAB 1PHTA 1V1CA 1W70A 4CC2A 5IXFA 4WCIA 2DJQA 2J7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS0 A;  2OAW A;  1T0H A;  2JM8 A;  4J9B A;  2JTE A;  3EG1 A;  2DMO A;  2LQN A;  2YDL A;  1Z9Z A;  3JV3 A;  1UTI A;  2AK5 A;  2OI3 A;  1TUD A;  1X6B A;  2HBW A;  4F14 A;  2J6O A;  1M3B A;  2NWM A;  1H8K A;  4RTT A;  1NLO C;  2J6F A;  2CDT A;  2OJ2 A;  4RUG A;  2EKH A;  2P4R A;  3EG0 A;  3RNJ A;  3U23 A;  2JMA A;  1JU5 C;  2D8J A;  1K1Z A;  1FYN A;  1JXO A;  2CH4 W;  2EGA A;  3TSW A;  1SRM A;  2FPE A;  1GCP A;  1ABO A;  1PRL C;  1AEY A;  5FWB A;  2FRW A;  4OMN A;  1AOJ A;  2KYB A;  4AFQ C;  1M3A A;  1KSW A;  3I5R A;  2ED0 A;  4Z88 A;  2O2O A;  2KXD A;  1AWX A;  3PVL A;  1M30 A;  3NHN A;  4J9H A;  4OMM A;  1B07 A;  2KT8 A;  2CSI A;  1ZUU A;  1GRI A;  2J05 A;  1MV3 A;  1LCK A;  3VS1 A;  4IIO A;  1RI9 A;  2EBP A;  2K6D A;  1HD3 A;  3FJ5 A;  1RLQ C;  1G2B A;  1SHF A;  1X43 A;  2A08 A;  4CC7 A;  1GFC A;  2DNU A;  1OEB A;  2D0N A;  2DM1 A;  5ECA A;  3RBB B;  1SHG A;  2L3S A;  1WYX A;  1BBZ A;  1NEB A;  4J9E A;  2CUB A;  3PE0 A;  4RTX A;  1GFD A;  5IHI A;  2K3B A;  5IHK A;  2O31 A;  5HCK A;  4OMP A;  2FPD A;  1U5S A;  2C0T A;  1JXM A;  2M51 A;  4F16 A;  1X69 A;  1YCS B;  1VYV A;  1UHF A;  3EG3 A;  4D8K A;  1H92 A;  1W1F A;  2RMO A;  4D8D A;  1UHC A;  4LUE A;  2RNA A;  2ENM A;  2RN8 A;  2NUZ A;  1ABQ A;  2HEQ A;  2SRC A;  3SEM A;  1GBQ A;  1T3L A;  1NEG A;  3EG2 A;  1WXU A;  2KYM A;  4HVV A;  1KFZ A;  2DL7 A;  2VWF A;  2DF6 A;  2J06 A;  3PVQ A;  3GBQ A;  2EGC A;  2PZ1 A;  2YT6 A;  1UEC A;  4AG2 C;  2V1Q A;  4CC3 A;  1WDX A;  3UAT A;  2JW4 A;  4J9C A;  2AKK A;  4HCK A;  4OML A;  1X2Q A;  2LNH B;  3KFV A;  4F17 A;  1J3T A;  4JZ3 A;  3A98 A;  1AWW A;  1NYG A;  1UGV A;  4LN2 A;  1AVZ C;  1Y57 A;  2EYW A;  2EYZ A;  2G6F X;  1KJW A;  4AFZ C;  4LUD A;  1E6H A;  3ULR B;  1UG1 A;  2JM9 A;  2KRN A;  2V1R A;  4GBQ A;  3I9Q A;  3VS2 A;  5L23 A;  2LJ3 A;  1BB9 A;  1QCF A;  2CT3 A;  2DIL A;  1VYT A;  1YNZ A;  1MV0 B;  2DL5 A;  4QT7 A;  1PNJ A;  3M0T A;  2X3W D;  2KE9 A;  1E7O A;  1SPK A;  1ZBJ A;  4JZ4 A;  2VVK A;  3VS3 A;  5FW9 A;  2KGT A;  1YWO A;  4FSS A;  1I07 A;  4JPB W;  1W6X A;  1SSH A;  1WXT A;  2JMC A;  3C0C A;  2HSP A;  2KNB B;  1TUC A;  2DRK A;  1PRM C;  2K79 A;  1JO8 A;  3H41 A;  5I22 A;  2SEM A;  3TSZ A;  5IXB A;  1WI7 A;  1ZUK A;  1K76 A;  2EGE A;  2O9V A;  3CQT A;  2CH4 A;  2K7A A;  2AKL A;  1UE9 A;  2I0N A;  4ESR A;  1OPK A;  1YP5 A;  2GQI A;  2L3P A;  1WA7 A;  2B86 A;  2L3Q A;  3VRZ A;  2PTK A;  1JEG A;  1QKX A;  4ZNX A;  1QKW A;  3NGP A;  1K9A A;  3VS4 A;  5I11 A;  2RQR A;  2HCK A;  1I1J A;  2VKN A;  3M0R A;  1X27 A;  4X1V A;  2ABL A;  3I35 A;  2EVR A;  4LNP A;  2DRM A;  2DVJ A;  2EYX A;  2DL8 A;  2F2X A;  3UF4 A;  1NM7 A;  2ECZ A;  1OV3 A;  1YN8 A;  2D1X A;  2K2M A;  2GTJ A;  4RTU A;  2ROL A;  1OOT A;  1T3S A;  1BU1 A;  1E6G A;  1SEM A;  1SRL A;  2HDA A;  4J9I A;  1UJY A;  1X6G A;  3H0H A;  5GJV B;  1H3H A;  2W10 A;  1ZSG A;  2KRO A;  2RQT A;  2EQI A;  4JJD A;  2KBT A;  1AWO A;  2FEI A;  2CRE A;  2RQW A;  3UA7 A;  3EHR A;  1GBR A;  2EYY A;  2O9S A;  3VS7 A;  2DE0 X;  4J9D A;  2KEA A;  1UDL A;  2XMF A;  4A63 B;  2DYB A;  2C0O A;  1GL5 A;  4AG1 C;  1VYU A;  2GNC A;  5GJW B;  2RQV A;  3H0I A;  2ED1 A;  4KRT A;  2BZY A;  2RF0 A;  1AZE A;  3R6N A;  2DBK A;  3THK A;  2MCN A;  3VS5 A;  1PKT A;  3EHQ A;  5EC7 A;  1Y0M A;  2DL4 A;  2E5K A;  1MUZ A;  2DA9 A;  2A36 A;  1ZUY A;  1RLP C;  2DBM A;  2DL3 A;  2ESW A;  2RPN A;  3VS6 A;  1K4U S;  4RTV A;  1QWF A;  3NPF A;  4EIK A;  1HJD A;  2F2W A;  1HSQ A;  2X3X D;  2JS2 A;  2LJ0 A;  1X2K A;  4LE9 A;  1KIK A;  2LJ1 A;  2DLP A;  4AFU C;  1YWP A;  2YUP A;  1NYF A;  4RTW A;  3QWY A;  4E6R A;  4HVW A;  4CC4 B;  1NG2 A;  3ZL7 C;  3EGU A;  1U06 A;  4HXJ A;  3M0U A;  4Y92 A;  1IO6 A;  2LMJ A;  1QLY A;  2AZV A;  4RTZ A;  2MIO A;  1WLP B;  1XOV A;  1N5Z A;  2JT4 A;  1WFW A;  4AFS C;  2FG0 A;  2A28 A;  2H8H A;  2PNI A;  2LCS A;  2K9G A;  2LX7 A;  1B3Q A;  4M4Z A;  3M0S A;  1UFF A;  1JQQ A;  2GBQ A;  2C0I A;  2AZS A;  1GCQ A;  3UA6 A;  1QWE A;  2CUD A;  3VRY A;  4J9G A;  4K11 A;  5IHN A;  5FWC A;  2J6K A;  5IH2 A;  3SHW A;  1BK2 A;  4DEX A;  1G83 A;  2DX1 A;  1CKB A;  1CKA A;  1K0S A;  2BZX A;  1K0X A;  1A0N B;  2CT4 A;  2YUN A;  2MOX A;  3M0Q A;  1M27 C;  1AWJ A;  2GGR A;  3O5Z A;  1AD5 A;  1EFN A;  1PKS A;  2W0Z A;  2YSQ A;  1M8M A;  4R0K A;  2BZ8 A;  2YUO A;  4GLM A;  4JJB A;  2IIM A;  1U3O A;  2FRY A;  1VA7 A;  1NLP C;  2ROT A;  2A37 A;  2LP5 A;  1ZLM A;  2RQU A;  2D8H A;  4IIM A;  2GTO A;  3REB B;  2KT1 A;  4JJC A;  2KRM A;  1RUW A;  3M0P A;  4OMO A;  3I5S A;  3VS0 A;  3LH5 A;  2KRS A;  2O88 A;  1S1N A;  1FMK A;  3TVT A;  4J9F A;  4ORZ A;  4Z89 A;  1I0C A;  3QWX X;  1UUE A;  1WXB A;  4HVU A;  1AZG B;  1ZX6 A;  1T0J A;  2FO0 A;  4RTY A;  1ARK A;  1WX6 A;  2CSQ A;  2JXB A;  2QDL A;  1M3C A;  2EW3 A;  1WIE A;  2FPF A;  2L2P A;  1PWT A;  2BTT A;  3NMZ C;  2M0Y A;  4Z8A A;  4DEY A;  2L0A A;  3H0F A;  1Z9Q A;  2LZ6 B;  2F2V A;  2LQW A;  1UJ0 A;  2KXC A;  2KR3 A;  2YUQ A;  1GCQ C;  1OPL A;  4OMQ A;  2EPD A;  1CSK A;  1TG0 A;  3IQL A;  3REA B;  1PHT A;  1V1C A;  1W70 A;  4CC2 A;  5IXF A;  4WCI A;  2DJQ A;  2J7I A; 
#chains in the Genus database with same CATH topology
 4M75 E;  4DBR A;  3G4S T;  4J6X A;  2QQS A;  1M90 C;  1SSF A;  2JM8 A;  5IN1 A;  3EG1 A;  4C8Q G;  1OQK A;  5KCH A;  2OI3 A;  3E19 A;  1M3B A;  2PVD B;  3P8H A;  3RNJ A;  3CCM Q;  5LJ3 e;  1NE8 A;  3OS0 A;  1I81 A;  1ZSZ B;  3QDF A;  4JRQ A;  1M1K C;  4E2F B;  8ATC B;  1GCP A;  1ABO A;  2DTI A;  5GAO q;  1XJW B;  4OMN A;  1Q82 C;  2OTL A;  2KYB A;  3OYC A;  4BE2 A;  4Z02 A;  2VAS A;  2O4X A;  4AMC A;  2YXY A;  4E7Z A;  2ED0 A;  4Z88 A;  2O2O A;  3TRE A;  1AWX A;  3OYK A;  2CSI A;  4C5G A;  2QTX A;  4FM4 B;  5DLQ E;  2DIQ A;  4FCY A;  4IIO A;  1X75 C;  2K5L A;  4JLI A;  1W2B P;  1X43 A;  2DNU A;  3QYG B;  1QVG A;  1VQP A;  5ECA A;  3CCJ T;  3MP8 A;  1YJN A;  1B7T A;  1U1T A;  1FWZ A;  3L1A A;  3OB9 A;  1P92 A;  1NEB A;  2CUB A;  4RTX A;  1D0Z A;  1M2O A;  2RO0 A;  4OGC A;  2JTF A;  3JSC A;  2FPD A;  1VQ6 A;  1YBY A;  2CP3 A;  4F16 A;  1NJI R;  1WJS A;  1VYV A;  2ZPF B;  3EG3 A;  1O9S A;  2OTJ A;  3CC7 T;  4BE1 A;  4D8D A;  3BDU A;  3HKS A;  1MHN A;  1VQM T;  3QJ6 A;  1M1F A;  1H3Z A;  3LWH A;  3SEM A;  3OYL A;  1T3L A;  3GF5 A;  4PKC C;  1WXU A;  2WSC E;  4BD3 A;  2VWF A;  2DF6 A;  3VYH B;  5CAI A;  1W2B S;  2RD1 A;  3GBQ A;  1IGQ A;  3VYG A;  2DFU A;  2YT6 A;  2V1Q A;  4J6Y A;  1WDX A;  5I21 A;  1FX7 A;  1IB8 A;  2CZ1 B;  4DA4 A;  1JJ2 A;  3L2R A;  1MMD A;  3FDR A;  3CMA T;  3KFV A;  2NUT B;  4N4H A;  1Q7Y U;  4PJO E;  1AWW A;  4PL6 A;  4LN2 A;  1RL2 A;  3CCS Q;  2EYZ A;  1KG1 A;  1KJW A;  3FIF A;  4AFZ C;  3D7S B;  4M78 E;  1UG1 A;  2KRN A;  3ULR B;  3LWI A;  1K9M R;  3AHU A;  1B34 A;  2XID A;  1VQN T;  4BDY A;  5L23 A;  3CD6 T;  1MNE A;  1AHJ B;  2L5Q A;  3CPF A;  1KQS P;  1FMW A;  5CIU A;  1BKB A;  1SPK A;  1RAG B;  3PTA A;  4VUB A;  3G6E Q;  1G5V A;  2F5K A;  1I07 A;  5HK3 A;  1VQL A;  1BI1 A;  3ZFJ A;  1SSH A;  1WXT A;  2JMC A;  2LDM A;  3C0C A;  3H41 A;  1JO8 A;  2FB7 A;  3RIR A;  1OI1 A;  1WI7 A;  4ME7 A;  5EG2 A;  5D6Y A;  1Q81 U;  8AT1 B;  3QO3 A;  4EMK A;  2QQA A;  4XTZ A;  2AKL A;  1BIB A;  2I0N A;  2QI2 A;  2M02 A;  1OPK A;  2JZ2 A;  2L3P A;  1WA7 A;  1WHH A;  1WHM A;  2JTM A;  2COY A;  2GF7 A;  3L2V A;  2DTO A;  4M77 E;  1QKX A;  2RI2 A;  5FU6 B;  3OQ5 A;  1N6A A;  3NGP A;  4JS5 A;  4M75 B;  2HCK A;  3BDL A;  5GAO n;  2RK2 A;  1KQS S;  2CP0 A;  2VKN A;  1X27 A;  1I5O B;  2CZ0 B;  2G3R A;  2XKO C;  2DXT A;  2ABL A;  3I35 A;  2DRM A;  2DVJ A;  3ZBD A;  1GXI E;  1N8R U;  3C12 A;  2F2X A;  2MK5 A;  1YN8 A;  2D1X A;  3L2Z A;  4RTU A;  1T3S A;  1BU1 A;  1SEM A;  2DEQ A;  3OYM A;  5HKC A;  3H9N A;  2HDA A;  1XQH A;  3H0H A;  1X6O A;  1H3H A;  2NUP A;  3PMI A;  3C4S A;  5M9O A;  3OY9 A;  1VQ8 A;  2P84 A;  4PFO A;  4JJD A;  4M7D B;  2COZ A;  2XD0 A;  1OYX A;  2VYT A;  4E7J A;  2EYY A;  2O9S A;  1RAD B;  4J9D A;  2VXE A;  5GAN 4;  1K8A U;  1YIT Q;  3WVD B;  4A54 A;  1X01 A;  5CQY A;  4M75 F;  3CME A;  3X28 B;  1AZE A;  3QII A;  4XTX A;  4M75 G;  3THK A;  5GAN 5;  3FLG A;  2QEX T;  5GAM d;  1M1K R;  4MZP A;  4FYX B;  3A8M B;  2A36 A;  1ZUY A;  1RLP C;  2DL3 A;  3LGF A;  2QK0 A;  1Q82 R;  3M54 A;  1YHQ T;  3KBG A;  1HSQ A;  1WQW A;  1X2K A;  4IUU A;  1KIK A;  4FYY B;  3LH0 A;  4PJO A;  4C8Q E;  3P8B B;  3QWY A;  1NG2 A;  2RI5 A;  1WQ7 A;  4HXJ A;  3VU3 C;  3GOX A;  2KVQ G;  4M78 A;  2CP5 A;  5GAN 8;  4M7D F;  4GLK A;  1VQO A;  1QLY A;  4M7D G;  1WHJ A;  1OU8 A;  3CC2 A;  2JT4 A;  4CRI A;  2LCS A;  4HT8 A;  2K9G A;  2JOY A;  3L2Q A;  4M4Z A;  2Y4Y A;  5HK0 A;  4J9G A;  4M7A A;  1S72 Q;  5IHN A;  5KYN A;  4OGE A;  1BK2 A;  1Y07 A;  1WNL A;  1G83 A;  2DX1 A;  3UWN A;  4OMF B;  3JCM V;  3EFO B;  1K0S A;  2MF2 A;  5FRO A;  2ZAE A;  2VGN A;  4PJN A;  1NZ9 A;  2RHU A;  1EFN A;  4DBF A;  1M8M A;  2BZ8 A;  2YUO A;  1YCY A;  4C0D B;  4GLM A;  3OYG A;  2RH2 A;  1V29 B;  3JCM f;  2VC8 A;  2BKD N;  2GQV A;  3EGD B;  1QVG P;  3SWN C;  2HBP A;  2LQK A;  1Q7Y C;  1KD1 U;  4M78 B;  4M77 A;  4J7I A;  1D1A A;  2KT1 A;  4JJC A;  3CCE Q;  3M0P A;  4FU6 A;  3CCL T;  2KRS A;  4L6V 5;  4O6J A;  2ZGW A;  2Z0W A;  1IXD A;  4C92 C;  3ASK A;  1T0J A;  1VIF A;  1PG5 B;  2EQM A;  4BUG A;  1UGQ B;  3G71 T;  1YFN A;  2QDY B;  1QQJ A;  2BE7 D;  5LJ3 j;  1QVF P;  3H6Z A;  2BTT A;  3CCV T;  2M0Y A;  1VQK A;  4XTY A;  4PJO F;  2GFU A;  2LQW A;  2MYS A;  1QVG S;  3OMC A;  3MEA A;  2EPD A;  4M78 F;  3M5A A;  1TG0 A;  3IQL A;  3FRN A;  1JJ2 P;  1Q81 C;  4M78 G;  4ELZ C;  3M9Q A;  2KI7 A;  1W70 A;  2D0Q B;  3OSV A;  5KYU A;  4F04 B;  2HQX A;  2HKQ B;  3SB2 A;  2QYZ A;  4ZTF A;  2AK5 A;  1TUD A;  1YI2 T;  2OTL Q;  3HSB A;  2JJ9 A;  3L2U A;  2NWM A;  4RTT A;  1WHG A;  4E7S A;  2J6F A;  3OYD A;  2EKH A;  2P4R A;  3EG0 A;  3U23 A;  2RM4 A;  2JMA A;  2KY9 A;  2AHJ B;  4OB2 B;  1I4K 1;  2D8J A;  1FYN A;  1K1Z A;  1K73 U;  2B8A A;  3JRZ A;  1QVF S;  4C8Q A;  2D6F A;  2EGA A;  3F70 A;  1N8R C;  2FPE A;  1VQ4 T;  2GFA A;  3RER A;  1AEY A;  2FRW A;  3VUZ A;  4AFQ C;  1M3A A;  4FYW B;  2WSE E;  3PGG A;  1KSW A;  5GMK m;  1JJ2 S;  1M2V B;  1C6V X;  1TSF A;  3A1P A;  3RR6 A;  1VQP Q;  3OSS C;  1M30 A;  4M77 F;  2LCC A;  3DB4 A;  2RA2 A;  3NHN A;  4C0Z A;  1B07 A;  2X35 A;  1YJN Q;  4X34 A;  3X24 B;  1K8A C;  2PQW A;  2K6D A;  1HD3 A;  3FJ5 A;  2Y90 A;  1RLQ C;  1VQ6 Q;  5I2M A;  3VUB A;  4DBQ A;  4CC7 A;  3CBP A;  2D0N A;  2EJG A;  5CKD A;  5GAO m;  4LD6 A;  2DM1 A;  4DBH A;  3JCM b;  3OS2 A;  4ELY C;  3URG A;  4ZTJ A;  4FT2 A;  2OTJ Q;  4X9C A;  4BDZ A;  2ZCF B;  1VQ5 A;  1HXD A;  2LRQ A;  5LJ3 h;  2CP7 A;  4OB1 B;  3CCU A;  1GFD A;  1D09 B;  5IHI A;  5IHK A;  2O31 A;  5HCK A;  4E7L A;  1LPL A;  1TS9 A;  2F69 A;  3T9N A;  2C0T A;  2M51 A;  5KE2 A;  1YCS B;  1ZSZ A;  2PVO B;  4XU2 A;  3E9F A;  1LVK A;  4D8K A;  1Y96 B;  1UHC A;  5AYF A;  1FXX A;  2IG0 A;  3GP8 A;  2RN8 A;  2DAQ A;  4IUT A;  3OYI A;  5D7U A;  1ABQ A;  1VQ9 T;  1OU9 A;  3BY7 A;  2DL7 A;  5KYX B;  2RJF A;  3AT1 B;  4XU0 A;  4KT0 E;  2E10 A;  2PZ1 A;  3E2U A;  4AG2 C;  3M58 A;  3UAT A;  4IUQ A;  3MP6 A;  3RMQ A;  2JW4 A;  3JB9 H;  4ZGD B;  3HFO A;  4FW2 A;  4J9C A;  4OML A;  4F17 A;  1NYG A;  4C8Q F;  5CKF A;  1Y57 A;  2EYW A;  2AT1 B;  2FZG B;  2JM9 A;  3JCM d;  4GBQ A;  1IRX A;  3RES A;  2R58 A;  3I55 T;  5GAN j;  4LDU A;  4EMK C;  4MZM A;  1UGS B;  5CKB A;  3X25 B;  5A2Q E;  1VQL Q;  1QCF A;  4KUD K;  1KD1 C;  3CCQ T;  4N0A A;  3CPW P;  5D6X A;  3CCJ A;  2RHI A;  1WHK A;  1MV0 B;  2DL5 A;  4M7D E;  2X3W D;  3CC4 T;  1E7O A;  3LYI A;  2CP2 A;  4OP0 A;  1ZBJ A;  3VS3 A;  1RAI B;  2KGT A;  2BE9 B;  1YWO A;  1EX4 A;  4JPB W;  1Q7Y R;  3SD4 A;  2KNB B;  4QVZ A;  1PRM C;  2K79 A;  3JCM c;  2QG9 B;  4KH0 B;  5IXB A;  1ZUK A;  3C94 A;  1BI3 A;  2QQR A;  1K76 A;  2EGE A;  2ZPB B;  3CC7 A;  2QA4 T;  2XDD A;  3O8V A;  4J83 A;  4E7K A;  1VQM A;  1UE9 A;  1PC0 A;  2GQI A;  3M59 A;  1Q86 U;  2QEX Q;  2L3Q A;  3VKI A;  2PTK A;  2NUT A;  3EG9 A;  1KHC A;  1QKW A;  1TUG B;  5GAM e;  1K9A A;  3VS4 A;  3CPW S;  4KGV B;  2RQR A;  2CYZ B;  1VQ7 T;  5KYW B;  4IUR A;  4C0G A;  3CMA A;  1VQ8 Q;  4X1V A;  5IAY A;  2KK4 A;  2EYX A;  2XI9 A;  3UF4 A;  4J8O A;  2ECZ A;  1OV3 A;  2GTJ A;  2DEU A;  1E6G A;  1Q81 R;  3CME Q;  1SRL A;  1VQN A;  1R77 A;  4J9I A;  4QW2 A;  5GJV B;  1JBM A;  2RHY A;  3CD6 A;  2KRO A;  1K73 C;  5LJ5 d;  2KBT A;  5KYY A;  2CRE A;  4A4K A;  3MET A;  2DE0 X;  3OS1 A;  1IRE B;  3M4G A;  1D3B B;  1MMG A;  4C92 D;  4AG1 C;  3MCA B;  2RQV A;  2ED1 A;  2KSS A;  5DM7 R;  4FSX A;  1QP3 A;  3R6N A;  3EG9 B;  2DBK A;  2X9H A;  3DKM A;  2DXU A;  3VS5 A;  1PKT A;  3OBY A;  1HYO A;  5EC7 A;  3GLX A;  4LXC A;  2DL4 A;  1N8R R;  4M7A C;  1VQO Q;  1W4S A;  2ESW A;  1YJW T;  3CC2 Q;  1ZBX A;  2DO3 A;  4JLG A;  2ZZD A;  2F2W A;  2HNI A;  3BW1 A;  4XU1 A;  4M75 A;  2LJ1 A;  4KH1 B;  4IKF A;  1M4Z A;  3Q1J A;  4L59 A;  4J7F A;  3EGU A;  5GMK e;  1IGU A;  2XDB A;  2YLC A;  3JCM g;  1I5L A;  4ZGJ B;  2AZV A;  4RTZ A;  1XOV A;  1K8A R;  1WFW A;  5KYY B;  3MO8 A;  3S3N A;  1FMV A;  1TXQ A;  5FU7 C;  2XU8 A;  3V8K A;  1KQ2 A;  1B3Q A;  2XIC A;  1LNX A;  1JQQ A;  1BCM A;  5KH6 A;  1GCQ A;  3UA6 A;  1QWE A;  2CUD A;  5C0M A;  3V8L A;  1G3S A;  2NYS A;  1U1S A;  3G71 Q;  2HL3 A;  3SFM A;  1YJ9 T;  4PFZ A;  4M7D A;  3SDZ A;  1CKB A;  3HTR A;  1CKA A;  1RI0 A;  5GAN e;  4MMK A;  4X9D A;  2YUN A;  2QXF A;  2V8K A;  1M8V A;  1AD5 A;  2EQK A;  1PKS A;  1QP2 A;  2W0Z A;  1WGS A;  4TVR A;  4EMH A;  1G3Y A;  4LDV A;  2K5F A;  1OZ2 A;  2VUB A;  1NLP C;  2ROT A;  2RHX A;  1I8F A;  2A37 A;  2LP5 A;  1ZLM A;  2OX7 A;  1IHV A;  3X26 B;  3M57 A;  2RJC A;  3REB B;  2QEX A;  2HMA A;  2JNG A;  3MEV A;  3MEW A;  1YIJ T;  4DOW A;  3I5S A;  3LH5 A;  2O88 A;  1S1N A;  3OYB A;  1BI2 A;  5A0D A;  1YHQ A;  3QWX X;  1ACM B;  3CCM T;  1VQK Q;  3QDR B;  1BYM A;  2PUK B;  2YLB A;  4PJM A;  1ARK A;  1WX6 A;  1ZA2 B;  3DLL A;  2JXB A;  3J7A F;  2RK1 A;  1M3C A;  2EW3 A;  3C95 A;  1VIE A;  5LJ5 g;  2A3L A;  2ZPH B;  4A4G A;  2KAF A;  3HFN A;  2LZ6 B;  2F2V A;  3RUX A;  3EFO A;  2P0P A;  1KD1 R;  3CEY A;  2LT1 A;  5GMK i;  3JB9 F;  5GAO r;  3JB9 G;  3PIO A;  4CC2 A;  2CP6 A;  2HKN A;  4HCB A;  4XTV A;  4PLI A;  3INZ A;  2OAW A;  1T0H A;  4J9B A;  1Q86 C;  4N4I A;  2LQN A;  2YDL A;  4BY6 C;  4B9X A;  3EGD A;  3JV3 A;  2XK0 A;  5A0L A;  2HBW A;  4F14 A;  2J6O A;  1H8K A;  1SKU B;  1NLO C;  3WXM B;  3V7C A;  2CDT A;  2OJ2 A;  4A4F A;  1JU5 C;  3EH2 A;  1WHL A;  2ZPE B;  2MPX C;  2E41 A;  1SRM A;  1G3T A;  4JUV A;  2PVG B;  4D6W A;  2DPP B;  5FWB A;  1D0Y A;  1LJO A;  1AOJ A;  3E1S A;  3CCL A;  3GIB A;  2X4W A;  3I5R A;  2KXD A;  2FZC B;  3NFC A;  2VXF A;  4J9H A;  1KC8 U;  1RAH B;  2V26 A;  3J81 E;  2M1H A;  1ZUU A;  1VQ5 Q;  3G71 A;  1H64 1;  3S6W A;  3CCU Q;  1GRI A;  2J05 A;  3MEU A;  2A7Y A;  2JVV A;  1RI9 A;  3G4S Q;  3CCV A;  1M90 U;  1G2B A;  1SHF A;  4IUP A;  2HQH A;  4HCZ A;  1K73 R;  3CCS T;  5CR2 A;  3RBB B;  1SHG A;  4KGX B;  3CBM A;  2L3S A;  2E65 A;  1BBZ A;  4MDX A;  4NOY A;  4J9E A;  2QQB A;  1BCO A;  5KE3 A;  4OMP A;  2RB6 A;  1TH7 A;  1R0C B;  4RCB A;  1YI2 A;  1UHF A;  4Y28 E;  1W1F A;  4LUE A;  2RNA A;  5GAN 6;  3TQ7 P;  2FHD A;  2ENM A;  2NUZ A;  3G6E T;  2D9T A;  2P0Q A;  2XHC A;  1PSF A;  3CXC A;  3EG2 A;  1R0B G;  3VJP A;  3A8G B;  1KFZ A;  5CKH A;  1M2V A;  5AT1 B;  4MDW A;  4N0A C;  1QCO A;  2J06 A;  3PVQ A;  4QVC A;  1VQ4 A;  2EGC A;  4A4E A;  4V2S A;  2ATC B;  2EFI A;  3L2W A;  2FL7 A;  4C92 E;  3RKX A;  4ZGE B;  4HCK A;  1X2Q A;  2LNH B;  1J3T A;  4HA8 A;  4UC4 A;  4E47 A;  4PJO D;  3QUI A;  3A98 A;  5J3B A;  2MI6 A;  1AVZ C;  1MGQ A;  3CCJ Q;  2Y4X A;  1XTD A;  4M78 D;  1E6H A;  4C0F A;  1VQ7 Q;  3OYN A;  2MMP A;  4C92 A;  3I9Q A;  4XU3 A;  4ANJ A;  3OS5 A;  2LJ3 A;  3QHS A;  2CS7 A;  4II1 A;  4WF2 A;  3MHX A;  3RKW A;  4M7A D;  3E9G A;  4C5H A;  2EQU A;  2RHZ A;  2DIL A;  5GAM j;  1YNZ A;  2YHT A;  4QT7 A;  1PNJ A;  3CC7 Q;  3LX7 A;  2KE9 A;  1VQM Q;  1KQS A;  2K5I A;  1PCX A;  1AT1 B;  1XNI A;  3A8L B;  1Y96 A;  3OYH A;  3EH1 A;  2HSP A;  1TUC A;  5LJ5 e;  2KMT A;  3M55 A;  2MWP A;  3OW2 A;  5I22 A;  3OMG A;  2DKG A;  3CQT A;  5KYX A;  2CH4 A;  3I56 T;  2DIG A;  2K7A A;  1YIT T;  3CMA Q;  4C5I A;  4O5V A;  1VQ9 A;  2B86 A;  4M77 D;  4NL2 A;  4ZNX A;  2M0O A;  3M4Y A;  2EAY A;  3QBY A;  2P0K A;  1YJW Q;  4MZT A;  1RAF B;  2V8J A;  1I1J A;  1VQN Q;  3CD6 Q;  1PSE A;  3G4S A;  3G1J A;  4BI3 A;  2DL8 A;  1NM7 A;  2QAZ A;  2CGH A;  3QXE B;  1MND A;  1RAA B;  2K2M A;  3PIP A;  2E3H A;  2FVU A;  2ROL A;  1OOT A;  3QYH B;  2EKO A;  3I55 A;  5FU6 C;  3ER0 A;  2M16 A;  4MML A;  4M75 C;  5LL6 S;  4PFP A;  5GMK j;  4XTU A;  1Q86 R;  3HP9 A;  4PNO A;  1S72 T;  2YRD A;  3EFR A;  2K3Y A;  2KEA A;  1UDL A;  2XMF A;  2DYB A;  3CC4 A;  2C0O A;  4BY6 B;  3QZ5 B;  6AT1 B;  4LDY A;  1VYU A;  2GNC A;  1BIA A;  3H0I A;  4KRT A;  5KCO A;  2BZY A;  2RJD A;  3EHQ A;  1Y0M A;  1KC8 C;  5GAM h;  3JB9 J;  4FL6 A;  2KQW A;  2DBM A;  4RG2 A;  1K4U S;  4ATO A;  3JCM W;  2L89 A;  1RAB B;  4M7D C;  3HHT B;  4RTV A;  3FEO A;  2QA4 A;  1QWF A;  2E4H A;  3NPF A;  4OB3 B;  4EIK A;  1VOM A;  2X3X D;  2JS2 A;  2LJ0 A;  4LE9 A;  5LJ3 f;  3CCR T;  2DLP A;  4AFU C;  4C8Q D;  2YUP A;  5KYW A;  1NYF A;  4RTW A;  4E6R A;  2EIF A;  5FRM A;  4HVW A;  3ZL7 C;  3P8D A;  1YIJ Q;  3CCE T;  1OX8 A;  4Y92 A;  5D6W A;  2LMJ A;  1WLP B;  1VQ7 A;  1N5Z A;  4AFS C;  4E7H A;  2FG0 A;  2H8H A;  2YRV A;  2PNI A;  3FJP A;  3JCM P;  2DER A;  4XTW A;  3RMS A;  4DQ2 A;  2LX7 A;  3M0S A;  3EGX A;  1UFF A;  3UDC A;  2GBQ A;  3HRT A;  4B9W A;  2H3E B;  2AZS A;  4F7U B;  3A8H B;  3VRY A;  1Y7X A;  5IH2 A;  3SWN B;  3SHW A;  4QQD A;  2E70 A;  4DEX A;  2CKK A;  1SG5 A;  2GCX A;  2X4J A;  3FC3 A;  4JRI A;  4R55 A;  2DYI A;  3J80 E;  3HRS A;  2BZX A;  3A5Z B;  1TWB A;  1D0X A;  1D3B A;  3M0Q A;  4P5N A;  3NTK A;  1M27 C;  1AWJ A;  4PJJ A;  1WJQ A;  4C92 B;  5GAO p;  4R0K A;  5GAM f;  5CKE A;  1YHQ Q;  1R8O B;  4R56 A;  2FRY A;  1VA7 A;  1WZO A;  2RQU A;  2D8H A;  1WPY A;  4IIM A;  1N9S A;  1N9R A;  5GMK h;  2H3J A;  1N27 A;  1QCN A;  2KRM A;  5GAN 3;  1RUW A;  4OMO A;  5I2S A;  2PU9 B;  2OTL T;  4F7U F;  3VS0 A;  3CBO A;  2RI3 A;  1YJW A;  4F7U G;  2R5A A;  3EGX B;  3TVT A;  3BE3 A;  2BIV A;  1WXB A;  1AZG B;  1G8X A;  2FO0 A;  4RTY A;  3KXT A;  4C0D C;  5DLO A;  3WVE B;  4PJO C;  2A0F B;  4OB0 B;  3LLR A;  2O4X B;  2DZ9 A;  2YWW A;  2JN0 A;  3OYY A;  3OYF A;  4EPC A;  1KHI A;  2DD4 A;  4M78 C;  4FT4 A;  1WIE A;  5GAN h;  2FPF A;  2L2P A;  4ZN1 A;  4C92 F;  4JJN K;  2COW A;  3CXC P;  2XG8 D;  1PWT A;  3NMZ C;  4C92 G;  2L0A A;  4NL3 A;  1QVF A;  1UJ0 A;  2KXC A;  1VQP T;  2KR3 A;  2YUQ A;  2X4X A;  3UT1 A;  4XAX B;  4OMQ A;  1CSK A;  1YJN T;  3JAM E;  1YJ9 A;  4XK8 E;  3M53 A;  1NPP A;  5IXF A;  4DOV A;  2DJQ A;  2JS0 A;  2DXC A;  3QPH A;  1QVP A;  1IZ6 A;  3JCM Q;  3JCM J;  3RKY A;  1VQ6 T;  2JTE A;  2DMO A;  2O01 E;  2HSE B;  1Z9Z A;  1TOV A;  4XQ3 A;  1UTI A;  5DY9 A;  1X6B A;  1VUB A;  3CCL Q;  2OTJ T;  1IHW A;  5CO7 A;  2HQE A;  4RUG A;  4KUI A;  3V8J A;  2K3X A;  2EYQ A;  3PMT A;  5A0G A;  1JXO A;  3CXC S;  2CH4 W;  3TSW A;  3PT9 A;  2YRC A;  4M7A E;  4M77 C;  1PRL C;  3OYA A;  2DZC A;  1D1C A;  1YIJ A;  4LDW A;  1KQ1 A;  4A4H A;  3CCV Q;  3CCM A;  1MMA A;  4RKU E;  1M9S A;  5GAN f;  1O75 A;  2HL5 C;  3OW2 P;  3PVL A;  1KK7 A;  4OMM A;  3VV0 A;  1NJI U;  1RAE B;  2DVE A;  3EAE A;  2KT8 A;  3JCM X;  1MV3 A;  1ZQ1 A;  4OF1 A;  3V7S A;  1LCK A;  3VS1 A;  4QVD A;  3H8Z A;  2EBP A;  3KUF A;  5J26 A;  2A08 A;  1GFC A;  5CK9 A;  1B34 B;  1OEB A;  2E6N A;  2F1L A;  3MKD A;  1YI2 Q;  4J6W A;  5GAN 7;  1PD1 A;  2V8I A;  1WYX A;  1F1B B;  5LJ3 d;  2VV5 A;  3PNW C;  4C5E A;  3PE0 A;  2E12 A;  2K3B A;  1QMC A;  1QW1 A;  2VB6 A;  1VQL T;  2LCL A;  1U5S A;  2E5Q A;  2R5M A;  1JXM A;  3M56 A;  2K2V A;  1VQ4 Q;  1EIF A;  1UGP B;  1K9M U;  3OW2 S;  2E6Z A;  1X69 A;  1KC8 R;  1TU0 B;  1OX9 A;  2WSF E;  3R6O A;  1H92 A;  2RMO A;  2FZK B;  4JRK A;  4HCC A;  4B6M A;  3OA6 A;  2X51 A;  2ZPI B;  1UGR B;  2JUF A;  1C0M A;  2HEQ A;  2LT4 A;  2SRC A;  1GBQ A;  1NEG A;  4FW1 A;  4BE0 A;  1M90 R;  2KYM A;  3HPW A;  4HVV A;  4BAC A;  1NPR A;  1UEB A;  2CZ7 B;  2L3R A;  4C8Q C;  4EMK B;  1UB4 A;  2C06 A;  1UEC A;  3N5B B;  4CC3 A;  3I56 Q;  3TU4 K;  2MWO A;  2QGG A;  2AKK A;  4M75 D;  2QAS A;  4JZ3 A;  1UGV A;  5LJ5 j;  3ZEH A;  2G6F X;  2R57 A;  3JB9 D;  4LUD A;  2V1R A;  2EJ9 A;  3JCM h;  3UPU A;  1Y71 A;  4JDS A;  3VS2 A;  5GAN 2;  1LOJ A;  1BB9 A;  4L5G A;  1VQ8 T;  4PK4 A;  4WTO B;  4RCC A;  2DXB A;  4JRP A;  4J5Y A;  2CT3 A;  3X20 B;  3CCS A;  1VYT A;  1EZZ B;  4M7D D;  3CPW A;  2DD5 A;  3M0T A;  3HL8 A;  2IPO B;  2NUP B;  1WJR A;  5CVI A;  4JZ4 A;  3CME T;  2VVK A;  1D1B A;  3MPU B;  1VQ9 Q;  3TCJ A;  5FW9 A;  4KUL A;  4FSS A;  1W6X A;  2FYK A;  4YTL A;  2PUO B;  1V76 A;  2QTV A;  2DRK A;  2K57 A;  2SEM A;  4OVA A;  3TSZ A;  3S3M A;  3GNG A;  3JB9 I;  2O9V A;  1ZSZ C;  3LGL A;  3OYJ A;  1G3W A;  4HKE A;  2LC4 A;  2KDS A;  4ESR A;  2HAX A;  3G6E A;  1YP5 A;  1RAC B;  3VRZ A;  4RMO A;  1TTH B;  1JEG A;  1W2B A;  4Q5W A;  1VQO T;  5I11 A;  3I55 Q;  4GY5 A;  4PJO B;  3CC2 T;  4E7I A;  3JCM e;  3QJY A;  3M0R A;  3CCR Q;  4LDX A;  2EJF A;  4AT1 B;  5J39 A;  3CCQ Q;  2MAM A;  2DTH A;  2I2L A;  1M1K U;  2EVR A;  4LNP A;  2K4Y A;  2BUD A;  1Q82 U;  5LJ3 g;  1OUL A;  2EQJ A;  3NTI A;  4EMG A;  4F7U E;  3CC4 Q;  3QZ9 B;  4PLL A;  5L8R E;  2X4Y A;  1UJY A;  3LW5 E;  1X6G A;  7AT1 B;  4M7A B;  2W10 A;  1ZSG A;  1BI0 A;  1MMN A;  2LNV A;  2RQT A;  2EQI A;  5LJ5 h;  3OBW A;  1AWO A;  2FEI A;  2RQW A;  1C1A A;  2CZ6 B;  4QKU A;  3UA7 A;  3EHR A;  4BI8 B;  4N4G A;  1GBR A;  3VS7 A;  5HY6 A;  4LD9 K;  4RG8 A;  2QA4 Q;  4A63 B;  1PM3 A;  5GAN d;  2DET A;  2F5T X;  1GL5 A;  2WAC A;  5GJW B;  2RF0 A;  2AIR B;  2LVM A;  2MCN A;  4EDU A;  1NBE B;  4PJO G;  1M1G A;  4FYV B;  5GMK l;  3A8O B;  1NJI C;  5FU7 B;  2LX9 A;  1MUZ A;  2E5K A;  2DA9 A;  2RPN A;  3RDV A;  3VS6 A;  5IT9 E;  2DK3 A;  1PD0 A;  2DJZ A;  5FLX E;  1HK9 A;  3I56 A;  1HJD A;  4M77 B;  1YIT A;  1Q95 G;  4IUV A;  2EWN A;  2HZY A;  1ZA1 B;  3GPL A;  4QQG A;  1YWP A;  3DB3 A;  5GAM g;  4CC4 B;  4M7A F;  1U06 A;  3V7R A;  3QG1 A;  3M0U A;  4M7A G;  4KGZ B;  2HD0 A;  1IO6 A;  3FB9 A;  5GAO l;  2MIO A;  2A28 A;  3QKJ A;  1VQK T;  3S3O A;  4CI0 C;  3BFM A;  2C0I A;  3GNF B;  3DLM A;  4BI4 A;  4K11 A;  2LQ8 A;  4FIB A;  5LJ5 f;  2VGM A;  5FWC A;  1K9M C;  2J6K A;  4PJL A;  2OAU A;  2M9U A;  3MJX A;  3TEE A;  1K0X A;  1A0N B;  2CT4 A;  2MOX A;  2GGR A;  3O5Z A;  4M77 G;  2YSQ A;  5CQX A;  1S72 A;  1SF9 A;  3HRU A;  5CCA A;  2ZPG B;  5KYU B;  2QQ9 A;  4JJB A;  2IIM A;  3L42 A;  3G7Z A;  1U3O A;  5FRN A;  4Y91 A;  2E1H A;  1U8R A;  4HT9 A;  2GTO A;  2XDP A;  1JRI A;  3ME9 A;  3EFS A;  5C6S A;  3OYE A;  4QQ6 A;  2E64 A;  2L8D A;  3NTH A;  1FMK A;  4Z89 A;  4J9F A;  4ORZ A;  1I0C A;  4C8Q B;  1UUE A;  2P4T A;  2LTO A;  4HVU A;  2NLU A;  1ZX6 A;  3CCR A;  1DJ7 B;  4KBM B;  3PFS A;  2E3I A;  3CCQ A;  4A53 A;  2CSQ A;  2QDL A;  3QSU A;  1YJ9 Q;  3CCE A;  4F7U A;  2RJE A;  1M5Q 1;  3SWN A;  4DEY A;  4Z8A A;  2IVW A;  4BB7 A;  3H0F A;  1Z9Q A;  4ZN3 A;  2QGF B;  1OZ3 A;  1ZHI A;  1JB0 E;  1GCQ C;  1OPL A;  5GAN g;  3REA B;  1VQ5 T;  1PHT A;  9ATC B;  3CCU T;  1V1C A;  4NS5 A;  3MP1 A;  4JS4 A;  4WCI A;  2J7I A; 
#chains in the Genus database with same CATH homology
 2JS0 A;  2OAW A;  1T0H A;  2JM8 A;  4J9B A;  2JTE A;  3EG1 A;  2DMO A;  2LQN A;  2YDL A;  1Z9Z A;  3JV3 A;  1UTI A;  2AK5 A;  2OI3 A;  1TUD A;  1X6B A;  2HBW A;  4F14 A;  2J6O A;  1M3B A;  2NWM A;  1H8K A;  4RTT A;  1NLO C;  2J6F A;  2CDT A;  2OJ2 A;  4RUG A;  2EKH A;  2P4R A;  3EG0 A;  3RNJ A;  3U23 A;  2JMA A;  1JU5 C;  2D8J A;  1K1Z A;  1FYN A;  1JXO A;  2CH4 W;  2EGA A;  3TSW A;  1SRM A;  2FPE A;  1GCP A;  1ABO A;  1PRL C;  1AEY A;  5FWB A;  2FRW A;  4OMN A;  1AOJ A;  2KYB A;  4AFQ C;  1M3A A;  1KSW A;  3I5R A;  2ED0 A;  4Z88 A;  2O2O A;  2KXD A;  1AWX A;  3PVL A;  1M30 A;  3NHN A;  4J9H A;  4OMM A;  1B07 A;  2KT8 A;  2CSI A;  1ZUU A;  1GRI A;  2J05 A;  1MV3 A;  1LCK A;  3VS1 A;  4IIO A;  1RI9 A;  2EBP A;  2K6D A;  1HD3 A;  3FJ5 A;  1RLQ C;  1G2B A;  1SHF A;  1X43 A;  2A08 A;  4CC7 A;  1GFC A;  2DNU A;  1OEB A;  2D0N A;  2DM1 A;  5ECA A;  3RBB B;  1SHG A;  2L3S A;  1WYX A;  1BBZ A;  1NEB A;  4J9E A;  2CUB A;  3PE0 A;  4RTX A;  1GFD A;  5IHI A;  2K3B A;  5IHK A;  2O31 A;  5HCK A;  4OMP A;  2FPD A;  1U5S A;  2C0T A;  1JXM A;  2M51 A;  4F16 A;  1X69 A;  1YCS B;  1VYV A;  1UHF A;  3EG3 A;  4D8K A;  1H92 A;  1W1F A;  2RMO A;  4D8D A;  1UHC A;  4LUE A;  2RNA A;  2ENM A;  2RN8 A;  2NUZ A;  1ABQ A;  2HEQ A;  2SRC A;  3SEM A;  1GBQ A;  1T3L A;  1NEG A;  3EG2 A;  1WXU A;  2KYM A;  4HVV A;  1KFZ A;  2DL7 A;  2VWF A;  2DF6 A;  2J06 A;  3PVQ A;  3GBQ A;  2EGC A;  2PZ1 A;  2YT6 A;  1UEC A;  4AG2 C;  2V1Q A;  4CC3 A;  1WDX A;  3UAT A;  2JW4 A;  4J9C A;  2AKK A;  4HCK A;  4OML A;  1X2Q A;  2LNH B;  3KFV A;  4F17 A;  1J3T A;  4JZ3 A;  3A98 A;  1AWW A;  1NYG A;  1UGV A;  4LN2 A;  1AVZ C;  1Y57 A;  2EYW A;  2EYZ A;  2G6F X;  1KJW A;  4AFZ C;  4LUD A;  1E6H A;  3ULR B;  1UG1 A;  2JM9 A;  2KRN A;  2V1R A;  4GBQ A;  3I9Q A;  3VS2 A;  5L23 A;  2LJ3 A;  1BB9 A;  1QCF A;  2CT3 A;  2DIL A;  1VYT A;  1YNZ A;  1MV0 B;  2DL5 A;  4QT7 A;  1PNJ A;  3M0T A;  2X3W D;  2KE9 A;  1E7O A;  1SPK A;  1ZBJ A;  4JZ4 A;  2VVK A;  3VS3 A;  5FW9 A;  2KGT A;  1YWO A;  4FSS A;  1I07 A;  4JPB W;  1W6X A;  1SSH A;  1WXT A;  2JMC A;  3C0C A;  2HSP A;  2KNB B;  1TUC A;  2DRK A;  1PRM C;  2K79 A;  1JO8 A;  3H41 A;  5I22 A;  2SEM A;  3TSZ A;  5IXB A;  1WI7 A;  1ZUK A;  1K76 A;  2EGE A;  2O9V A;  3CQT A;  2CH4 A;  2K7A A;  2AKL A;  1UE9 A;  2I0N A;  4ESR A;  1OPK A;  1YP5 A;  2GQI A;  2L3P A;  1WA7 A;  2B86 A;  2L3Q A;  3VRZ A;  2PTK A;  1JEG A;  1QKX A;  4ZNX A;  1QKW A;  3NGP A;  1K9A A;  3VS4 A;  5I11 A;  2RQR A;  2HCK A;  1I1J A;  2VKN A;  3M0R A;  1X27 A;  4X1V A;  2ABL A;  3I35 A;  2EVR A;  4LNP A;  2DRM A;  2DVJ A;  2EYX A;  2DL8 A;  2F2X A;  3UF4 A;  1NM7 A;  2ECZ A;  1OV3 A;  1YN8 A;  2D1X A;  2K2M A;  2GTJ A;  4RTU A;  2ROL A;  1OOT A;  1T3S A;  1BU1 A;  1E6G A;  1SEM A;  1SRL A;  2HDA A;  4J9I A;  1UJY A;  1X6G A;  3H0H A;  5GJV B;  1H3H A;  2W10 A;  1ZSG A;  2KRO A;  2RQT A;  2EQI A;  4JJD A;  2KBT A;  1AWO A;  2FEI A;  2CRE A;  2RQW A;  3UA7 A;  3EHR A;  1GBR A;  2EYY A;  2O9S A;  3VS7 A;  2DE0 X;  4J9D A;  2KEA A;  1UDL A;  2XMF A;  4A63 B;  2DYB A;  2C0O A;  1GL5 A;  4AG1 C;  1VYU A;  2GNC A;  5GJW B;  2RQV A;  3H0I A;  2ED1 A;  4KRT A;  2BZY A;  2RF0 A;  1AZE A;  3R6N A;  2DBK A;  3THK A;  2MCN A;  3VS5 A;  1PKT A;  3EHQ A;  5EC7 A;  1Y0M A;  2DL4 A;  2E5K A;  1MUZ A;  2DA9 A;  2A36 A;  1ZUY A;  1RLP C;  2DBM A;  2DL3 A;  2ESW A;  2RPN A;  3VS6 A;  1K4U S;  4RTV A;  1QWF A;  3NPF A;  4EIK A;  1HJD A;  2F2W A;  1HSQ A;  2X3X D;  2JS2 A;  2LJ0 A;  1X2K A;  4LE9 A;  1KIK A;  2LJ1 A;  2DLP A;  4AFU C;  1YWP A;  2YUP A;  1NYF A;  4RTW A;  3QWY A;  4E6R A;  4HVW A;  4CC4 B;  1NG2 A;  3ZL7 C;  3EGU A;  1U06 A;  4HXJ A;  3M0U A;  4Y92 A;  1IO6 A;  2LMJ A;  1QLY A;  2AZV A;  4RTZ A;  2MIO A;  1WLP B;  1XOV A;  1N5Z A;  2JT4 A;  1WFW A;  4AFS C;  2FG0 A;  2A28 A;  2H8H A;  2PNI A;  2LCS A;  2K9G A;  2LX7 A;  1B3Q A;  4M4Z A;  3M0S A;  1UFF A;  1JQQ A;  2GBQ A;  2C0I A;  2AZS A;  1GCQ A;  3UA6 A;  1QWE A;  2CUD A;  3VRY A;  4J9G A;  4K11 A;  5IHN A;  5FWC A;  2J6K A;  5IH2 A;  3SHW A;  1BK2 A;  4DEX A;  1G83 A;  2DX1 A;  1CKB A;  1CKA A;  1K0S A;  2BZX A;  1K0X A;  1A0N B;  2CT4 A;  2YUN A;  2MOX A;  3M0Q A;  1M27 C;  1AWJ A;  2GGR A;  3O5Z A;  1AD5 A;  1EFN A;  1PKS A;  2W0Z A;  2YSQ A;  1M8M A;  4R0K A;  2BZ8 A;  2YUO A;  4GLM A;  4JJB A;  2IIM A;  1U3O A;  2FRY A;  1VA7 A;  1NLP C;  2ROT A;  2A37 A;  2LP5 A;  1ZLM A;  2RQU A;  2D8H A;  4IIM A;  2GTO A;  3REB B;  2KT1 A;  4JJC A;  2KRM A;  1RUW A;  3M0P A;  4OMO A;  3I5S A;  3VS0 A;  3LH5 A;  2KRS A;  2O88 A;  1S1N A;  1FMK A;  3TVT A;  4J9F A;  4ORZ A;  4Z89 A;  1I0C A;  3QWX X;  1UUE A;  1WXB A;  4HVU A;  1AZG B;  1ZX6 A;  1T0J A;  2FO0 A;  4RTY A;  1ARK A;  1WX6 A;  2CSQ A;  2JXB A;  2QDL A;  1M3C A;  2EW3 A;  1WIE A;  2FPF A;  2L2P A;  1PWT A;  2BTT A;  3NMZ C;  2M0Y A;  4Z8A A;  4DEY A;  2L0A A;  3H0F A;  1Z9Q A;  2LZ6 B;  2F2V A;  2LQW A;  1UJ0 A;  2KXC A;  2KR3 A;  2YUQ A;  1GCQ C;  1OPL A;  4OMQ A;  2EPD A;  1CSK A;  1TG0 A;  3IQL A;  3REA B;  1PHT A;  1V1C A;  1W70 A;  4CC2 A;  5IXF A;  4WCI A;  2DJQ A;  2J7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...