2CT3A

Solution structure of the sh3 domain of the vinexin protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Vinexin
publication title Solution Structure of the SH3 domain of the Vinexin protein
rcsb
source organism Homo sapiens
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ct3A00
1T0JA 2BTTA 2V1QA 1M27C 1GCPA 1UJ0A 2C0OA 2EPDA 2LQNA 2M51A 2V1RA 2O9VA 3THKA 4JJBA 1OPKA 2YUOA 2DF6A 1NLOC 1WA7A 4F14A 3H0FA 2LX7A 1M3CA 4Z88A 1E6GA 1WFWA 1ZLMA 1I1JA 2KYMA 3M0TA 4K11A 1TUDA 1NEBA 3VRYA 4LUDA 1AD5A 2EGEA 1B3QA 1KSWA 3M0UA 4J9IA 2BZYA 4HVVA 1FMKA 1E6HA 3H41A 1M30A 1X2KA 2JS2A 2KE9A 5ECAA 1K76A 1ZUYA 1JO8A 5IXFA 3I9QA 2K9GA 2EVRA 1QLYA 2AZSA 1CKBA 2CH4A 1GBQA 2DA9A 2J06A 2JM8A 4IIOA 4JZ4A 2MIOA 5IHKA 5I11A 2GTJA 1YCSB 1KIKA 2EYXA 4RTYA 2IIMA 2LJ3A 1UGVA 2HDAA 3REAB 2J7IA 1KJWA 1NLPC 3EG3A 2KRSA 1NG2A 1Z9ZA 2HSPA 2CT4A 3PVLA 3QWXX 2HBWA 4AFSC 1WXTA 3VS2A 3UATA 2DMOA 2ENMA 1U06A 2LJ0A 3NMZC 4ZNXA 1SSHA 4LN2A 2CSIA 1PHTA 3VS1A 1MUZA 2EYYA 2X3WD 2K2MA 4E6RA 1PRMC 1UHFA 1UFFA 2I0NA 3TSWA 4DEYA 1FYNA 4AFZC 1AWWA 2KT1A 1UTIA 2O9SA 3ULRB 4OMMA 1WLPB 2KYBA 2OI3A 2VKNA 4GBQA 1X43A 2DL3A 5FWBA 4FSSA 1UHCA 5FWCA 1X2QA 1WXUA 3CQTA 1T3LA 1MV3A 2LP5A 2C0IA 3VS5A 2J6FA 1UECA 2NUZA 2RQWA 1YN8A 1SEMA 4Z89A 1YP5A 2EGCA 1N5ZA 2EBPA 4JJDA 4QT7A 2DM1A 1UE9A 4RTXA 1Y57A 3UA6A 2QDLA 3NPFA 1QCFA 2FO0A 1Y0MA 5GJVB 2FG0A 1PRLC 4AFQC 1AZGB 4OMOA 1YWPA 2O2OA 2GQIA 4Z8AA 1LCKA 1Z9QA 1NEGA 2D1XA 4LE9A 4M4ZA 2AKLA 4RTZA 2KBTA 2W0ZA 1GRIA 1CKAA 1ZBJA 1WI7A 2L3QA 2ROTA 1BU1A 1H3HA 2KR3A 1SRLA 2KRNA 4LNPA 1NM7A 5HCKA 2JXBA 4RTWA 1CSKA 5GJWB 4AFUC 3UA7A 1AWJA 1G2BA 2DLPA 4RTUA 1VYTA 2JT4A 2CREA 2CUDA 4EIKA 1AWOA 1K9AA 3PE0A 4CC7A 1V1CA 2DBKA 1TG0A 1JXOA 2RMOA 1PKTA 3REBB 2EKHA 1U3OA 2HCKA 4OMQA 1AWXA 1JU5C 1E7OA 2FPEA 2FRYA 2C0TA 1GCQA 4J9GA 4AG1C 2L2PA 3GBQA 1W70A 2KNBB 2M0YA 1EFNA 1UG1A 2H8HA 2RQUA 1K0XA 3NHNA 2L0AA 2OJ2A 4OMNA 2RN8A 2PZ1A 5IXBA 1WYXA 2F2WA 4OMPA 1K0SA 2LZ6B 1ABQA 1M3BA 1ARKA 1ABOA 1QKXA 1AOJA 2KXDA 3U23A 2A37A 2DL4A 2AK5A 2BZ8A 3RNJA 3LH5A 1JQQA 2EYWA 2KGTA 1H8KA 1T0HA 3NGPA 2DX1A 1GL5A 2EW3A 2YDLA 2AKKA 1RI9A 1YWOA 2B86A 2DL7A 1QWFA 2J05A 2JTEA 1WIEA 1SPKA 2O88A 1J3TA 1QKWA 4CC4B 2RF0A 3I5SA 3TSZA 2RPNA 1S1NA 2F2VA 2PTKA 2SRCA 1B07A 2D0NA 1ZUKA 5EC7A 1OOTA 3M0QA 3VS4A 2YSQA 1AVZC 4HXJA 2YT6A 4IIMA 1W6XA 1SRMA 1RLPC 1X6GA 2A36A 2CT3A 2EYZA 4ESRA 3QWYA 4JPBW 2DE0X 4F16A 4R0KA 4DEXA 2ED0A 2HEQA 2RQRA 2JS0A 3EG2A 5IHIA 1YNZA 2OAWA 2LJ1A 1XOVA 1X6BA 2PNIA 2KXCA 2E5KA 4HCKA 2CDTA 4AG2C 4J9BA 1GCQC 1OEBA 2J6KA 1WDXA 1VYVA 3EHRA 3VS0A 2D8HA 1WXBA 4RUGA 4D8DA 1SHGA 2LCSA 2DYBA 1T3SA 2JM9A 1RUWA 2K79A 2RNAA 3VS6A 2LMJA 2ABLA 1OPLA 2J6OA 1HSQA 3IQLA 1W1FA 2EQIA 1NYGA 1GBRA 1I07A 2YUPA 3JV3A 3KFVA 5IH2A 3SEMA 2FPFA 1GFDA 3EG0A 3EG1A 1BBZA 2AZVA 2GTOA 4HVUA 3UF4A 3R6NA 1K4US 2RQTA 1WX6A 5FW9A 4J9FA 2F2XA 2P4RA 2DVJA 2FEIA 3VRZA 1GFCA 1NYFA 2DRMA 3I35A 2BZXA 2KROA 2ED1A 2YUQA 1PWTA 2W10A 4J9DA 2D8JA 3C0CA 2YUNA 2DNUA 2ESWA 3EHQA 1PKSA 4Y92A 2DBMA 4X1VA 2DILA 3I5RA 4OMLA 1AZEA 1BB9A 1UUEA 3SHWA 2XMFA 2CH4W 5L23A 2L3PA 2SEMA 1AEYA 4D8KA 1TUCA 3VS7A 2GGRA 2LQWA 2MCNA 2KT8A 1UDLA 3EGUA 3M0SA 4HVWA 2A08A 2DJQA 1X69A 4J9EA 1QWEA 3H0IA 1ZUUA 2RQVA 2EGAA 4LUEA 1M8MA 2GBQA 1H92A 1RLQC 4WCIA 2FRWA 4F17A 5IHNA 2DRKA 1M3AA 4ORZA 2K6DA 4CC2A 1X27A 2X3XD 2G6FX 4JJCA 3FJ5A 2JMCA 2GNCA 4KRTA 2O31A 2CSQA 3H0HA 1A0NB 2NWMA 2JW4A 3M0RA 3M0PA 3ZL7C 1G83A 2FPDA 4GLMA 1KFZA 1SHFA 1VYUA 4JZ3A 2L3SA 2MOXA 2A28A 4J9CA 4RTVA 1MV0B 3TVTA 5I22A 4CC3A 1HJDA 1JXMA 2K7AA 2ECZA 1UJYA 2KEAA 4A63B 1PNJA 2KRMA 2VVKA 3A98A 1OV3A 1I0CA 1HD3A 2DL8A 2JMAA 3PVQA 1U5SA 1ZX6A 4RTTA 2CUBA 2DL5A 1ZSGA 2K3BA 3VS3A 4J9HA 3RBBB 1K1ZA 2ROLA 1BK2A 3O5ZA 2VWFA 1VA7A 1IO6A 2LNHB 1JEGA
chains in the Genus database with same CATH superfamily
4XU1A 2M51A 1VQ5Q 4JJBA 1TTHB 3VUBA 3QYHB 2LT4A 4N0AC 2NLUA 2LX7A 4Z88A 3EH1A 1S72T 1S72A 2QAZA 2E64A 1VQ4T 1B3QA 4GLKA 3C94A 3H9NA 3BY7A 3M0UA 4XTVA 5I21A 4OP0A 4ZTFA 4EMKA 5J26A 1E6HA 4YTLA 1Q82C 1M30A 2XKOC 4KGXB 1K76A 5IXFA 4PJJA 3I9QA 4N4IA 5GAOp 4MMKA 5M9OA 4JZ4A 4PFPA 1NZ9A 5GMKi 1W4SA 3PNWC 1KIKA 2LJ3A 2HDAA 1IZ6A 3VYHB 4IKFA 5KYWA 3EG3A 3RKWA 1NG2A 1Z9ZA 3FB9A 2HSPA 4LDUA 5DLQE 3CCUQ 2HBWA 3G1JA 1WXTA 2QASA 2ENMA 1AT1B 2NUTB 5GAOl 3G4ST 2QQAA 3CC7Q 4ZNXA 1VQNT 2CSIA 5LL6S 3PIPA 2EYYA 2X3WD 4PL6A 1PRMC 2XU8A 1UHFA 2P0KA 4PLIA 2QEXQ 1BI2A 4IUVA 1IRXA 3OYBA 3OYNA 3RKYA 3KBGA 2QQSA 4FYVB 2DL3A 4DQ2A 3LGFA 3CCSQ 1DJ7B 2E70A 5FWCA 2F69A 3BFMA 1K73C 5FU6B 2FZCB 3HRSA 1UGQB 1BKBA 3EG9B 2RQWA 1NJIC 1YN8A 1LPLA 1MGQA 1SEMA 3BDUA 4RCCA 5FU7C 4M7AC 1WZOA 2KK4A 3SWNA 1N5ZA 3OS2A 2EBPA 4JJDA 4BE1A 1Y0MA 2FG0A 2RHIA 5GAMg 4OMFB 2K5IA 2O2OA 2GQIA 1FMWA 1LCKA 4NS5A 2KBTA 3JB9F 1GRIA 1ZBJA 5CVIA 3ME9A 3MEUA 2P84A 1BU1A 1H3HA 2KR3A 1VQ9Q 1HYOA 3EFRA 1FXXA 4BDYA 2R58A 5HCKA 3RESA 1VOMA 4PJLA 3QBYA 4RTWA 1CSKA 5GJWB 3H6ZA 3M54A 5HY6A 4AFUC 4MDWA 3UA7A 1AWJA 4O5VA 2MPXC 3UT1A 4M77B 1NPPA 1VYTA 2JT4A 2HMAA 1G3YA 3FC3A 2CZ7B 3CMAQ 4J6WA 2BUDA 5IT9E 5LJ5h 2EIFA 4DOVA 1VQOQ 3M56A 2FPEA 2Y4YA 2CZ0B 4J9GA 3META 4AG1C 2RK1A 3KXTA 2EKOA 3G71Q 3T9NA 3LWIA 3QHSA 1NPRA 5LJ3f 2P4TA 2RQUA 4LDWA 2FHDA 2FZKB 2OJ2A 5GAN4 4PJOC 1YCYA 3NTIA 4LDXA 4F7UB 1Y96B 1WYXA 4KH1B 4ZGEB 1ABQA 4M75A 1D1BA 1JRIA 3JRZA 5LJ5j 3U23A 3I55Q 2KMTA 2QA4A 3RNJA 3EGDA 1JQQA 5CK9A 2LDMA 4PJOF 5GAOq 5C0MA 3EH2A 2VXFA 4J7FA 3DKMA 3OS1A 2EFIA 1M9SA 2DTOA 3MEAA 1EIFA 3HTRA 4QVZA 2AKKA 1RI9A 4L59A 3CCJA 2QTVA 1QWFA 1VIEA 2J05A 3PMIA 4RMOA 1WIEA 1RAAB 1RAEB 1J3TA 4CC4B 2RF0A 2BKDN 2F2VA 1VQPT 1VQPA 3VKIA 5FLXE 1G3WA 1QP3A 1O75A 2RI3A 3M0QA 4II1A 4LD6A 3GOXA 3HSBA 4HXJA 2YT6A 4IIMA 1W6XA 1X6GA 4KBMB 2EYZA 1IREB 3MP6A 4ESRA 1RAHB 2DE0X 1UGRB 1OYXA 5LJ3e 2HEQA 1KC8C 5GMKh 3EG2A 4C92B 5IHIA 2K5LA 4BB7A 2KXCA 2E5KA 5KE3A 3QXEB 1M4ZA 4XTZA 5KYXB 3QO3A 2J6KA 2RO0A 1WDXA 4BY6B 1P92A 2EQUA 1JJ2S 3BW1A 2P0PA 2LCSA 5KCHA 3LLRA 1YIJT 4OB0B 5KYYB 3QYGB 2L8DA 1SG5A 1OPLA 2J6OA 2EQIA 2X4XA 1GBRA 1K73R 3MEWA 3VU3C 3JV3A 2CP0A 2NUTA 3SEMA 4E47A 3CBPA 4HVUA 4HCZA 5GAN7 1UB4A 3R6NA 1Q81U 2RQTA 1WX6A 1KQSS 1RACB 3M58A 3CMEQ 3GLXA 3OBWA 3CPWA 8ATCB 2YLCA 2ED1A 2YUQA 3CCUT 4A4FA 2K3XA 1KQ1A 2DNUA 4F7UE 1PSFA 4M75D 4Y92A 3CCLQ 2CP3A 2DILA 3I5RA 3MCAB 4E7LA 2DZ9A 4AMCA 3OA6A 4B6MA 5IN1A 3M55A 2E65A 1BB9A 3SHWA 1OULA 3JCMP 3CPFA 2XMFA 1QVFS 2L3PA 3SD4A 1WHMA 1ZSZB 4KUDK 2HKQB 4RG2A 2L5QA 1TUCA 1HXDA 2M9UA 2E5QA 1S72Q 4M75G 4LXCA 3M5AA 2L3RA 5KYUA 4EDUA 2LQWA 2F5TX 2KT8A 2RJDA 2YLBA 3CD6A 4N4GA 3CD6T 5GAMh 3EGUA 3QDFA 2JNGA 4NL2A 2A08A 1QWEA 3PT9A 3JCMf 4J8OA 4WCIA 2DRKA 2K6DA 2XI9A 4R55A 4CC2A 1U8RA 4FT2A 4V2SA 3OYGA 2NUPA 2X51A 4EMKB 1D1AA 2DIGA 4M77A 3A8HB 2DERA 3C12A 2CSQA 5CKBA 2KSSA 5GAMj 2EYQA 1VQ9T 2NWMA 2JW4A 3VYGA 1QVGA 2HQEA 4RTVA 1MV0B 4CC3A 2QGFB 3A8MB 4MZPA 3LGLA 2KEAA 1K8AU 4A63B 4B9WA 2WSEE 2KRMA 5KYNA 3CCVA 3CCVT 2DL8A 3L42A 4BDZA 1U5SA 1M90R 2CZ6B 4RTTA 2QXFA 1Y96A 5CR2A 2K3BA 3VS3A 2MYSA 2ROLA 3ER0A 2O01E 3G71T 2DXCA 2RA2A 3M4GA 4FT4A 3O5ZA 1LJOA 2E3HA 1M1KU 3JCMe 1MMDA 3HPWA 1VQLT 2BTTA 5GANh 2V1QA 2C0OA 4C0FA 3E9GA 5D6XA 5EG2A 4X34A 4M7AA 2VB6A 1OPKA 2YUOA 3J7AF 1KC8R 3JCMW 3H0FA 1WFWA 1TUDA 4BE2A 3SWNB 2CP6A 2COZA 3M53A 3DLMA 2V8IA 1AD5A 2DJZA 3DB3A 2Y4XA 3EGXA 4FW1A 3NTKA 2CYZB 1RAGB 1FMKA 5L8RE 1BIAA 1YJNA 4RKUE 5CKDA 3H41A 1X2KA 2JS2A 1JO8A 3CPWP 2LX9A 2PQWA 1V29B 2EVRA 4JS4A 1Y7XA 2D9TA 3HFNA 1B7TA 3EFOB 2J06A 2F5KA 1KHIA 2GTJA 4C92A 2IIMA 3JCMQ 3OYCA 1KJWA 3OYYA 1NLPC 2KRSA 3PVLA 4M77D 4QVCA 3A8LB 4IUTA 5GANe 3UATA 1Q86U 1U06A 6AT1B 2LVMA 2PUOB 3NMZC 3VJPA 3E2UA 2YHTA 4LN2A 4BI8B 4KULA 2B8AA 4M78B 1MUZA 2K2MA 1UFFA 4OF1A 2I0NA 4C5EA 3S3OA 1FYNA 1AWWA 3V8JA 1WHGA 3SDZA 4C0DC 1UTIA 1KHCA 1KG1A 4ELYC 1RAFB 4M77G 3X25B 4OMMA 3D7SB 4ZN1A 1VQMT 1VQMA 4FYYB 2AIRB 5FWBA 2QA4Q 4FSSA 4MZMA 4QKUA 4NL3A 1WXUA 3CQTA 1IB8A 3GIBA 1RI0A 1UECA 2NUZA 1G3SA 1YBYA 3CCJQ 2EGCA 1TS9A 4M75B 3UA6A 4RTXA 1Y57A 3VV0A 1ZHIA 2QQ9A 1I4K1 4JDSA 3OMCA 3QSUA 4JRIA 1VQPQ 4C5HA 4HT9A 3CMET 1YWPA 4PFZA 3E9FA 4C8QA 1QVGP 4M7AD 2D6FA 4VUBA 5KCOA 1CKAA 1Y71A 1WI7A 3X20B 1FMVA 1QQJA 3MP1A 2MWPA 4IURA 4HKEA 1TXQA 3CCRT 3CCRA 2XDBA 1OZ2A 1PD0A 5CO7A 1D09B 3RMSA 4BI3A 3V7SA 5FROA 4PK4A 4M7AG 1G2BA 2DK3A 3OYJA 4RTUA 2CUDA 1AWOA 4E2FB 3PE0A 4XTWA 3GNGA 2RMOA 3REBB 2GCXA 2YRVA 2HCKA 1Q7YU 1Q95G 4C92D 1YIJQ 1N8RR 1AWXA 2EJGA 1WHKA 3NFCA 5DLOA 1W70A 4JRPA 2D0QB 1RL2A 1RADB 4XK8E 2GFUA 3NHNA 3LH0A 3PGGA 4OMNA 4A53A 4C92G 1PG5B 1BI1A 1K0SA 5GAOr 1XTDA 1D0YA 1MMAA 1ARKA 1QKXA 9ATCB 1AOJA 3OYDA 1K8AC 3QUIA 1I81A 5CIUA 4IUPA 3NGPA 1WGSA 1O9SA 2DX1A 3RKXA 3MP8A 2XDPA 4JJNK 1XQHA 8AT1B 2KDSA 1YWOA 2B86A 2DIQA 1K9MR 4BI4A 3CXCA 5D6YA 1M1KC 2PVOB 3UWNA 2RPNA 2DEUA 3CD6Q 2L89A 5EC7A 3VS4A 4QW2A 1KD1U 4C8QD 2YSQA 2QG9B 3OYLA 4E7KA 1QW1A 1RLPC 3KUFA 2CT3A 2ZAEA 2ZPEB 4JPBW 5GMKm 3OYIA 5KYUB 4F7UF 2JJ9A 4XQ3A 1YNZA 2OAWA 2LJ1A 2QTXA 4C0GA 1XOVA 3V8KA 2PNIA 4HCKA 1R77A 2RB6A 4J9BA 4ELZC 4C8QG 2DVEA 3EFOA 1GCQC 1OEBA 4E7JA 4RG8A 4Y28E 3EHRA 3VS0A 2D8HA 3OW2A 1WXBA 4C5IA 1YITT 1YITA 3V8LA 1IGUA 2K79A 1WJSA 2QGGA 3VS6A 1TH7A 2NUPB 1HSQA 3J80E 1W1FA 1LVKA 2YUPA 2QI2A 4F04B 1GFDA 5LJ5f 2GTOA 3CCVQ 1Q86C 4M78A 1U1TA 5FW9A 1FX7A 1OU8A 2DVJA 1YJWT 1YJWA 1NYFA 3I35A 2NYSA 4TVRA 1X6OA 2W10A 2D8JA 3C0CA 3RUXA 2YUNA 3V7RA 2KY9A 4JLGA 3DLLA 2DBMA 3OQ5A 2RI5A 2Y90A 1TU0B 2LTOA 1VQLQ 4DOWA 1C0MA 2V26A 5C6SA 1AZEA 4J5YA 2RHYA 3CCMA 2ZPGB 2LCCA 5I2MA 4PNOA 4D8KA 4XU2A 3CCET 4NOYA 3CCEA 3QIIA 2QA4T 3JB9I 2RJCA 5AYFA 1N6AA 1MNEA 3TCJA 1KQ2A 2JOYA 5CCAA 2R5AA 1YJNQ 2LRQA 2CZ1B 1C1AA 5FU7B 4M7AB 2A0FB 3CCJT 2RM4A 3NTHA 1EX4A 1FWZA 1Q82R 1LNXA 1OX9A 5LJ5e 5J39A 3MKDA 2HQHA 4FSXA 4DBRA 2X3XD 1D1CA 3EGXB 1RABB 4HCCA 2K57A 2XDDA 2O31A 2XK0A 1A0NB 1G83A 2FPDA 3CXCP 1KFZA 1SHFA 1VQ7T 1VQ7A 1QP2A 1K9MU 5J3BA 1Q7YC 4J9CA 3FRNA 1H641 1HJDA 3CPWS 4C0ZA 2VYTA 4M7DA 1PNJA 2VVKA 1VQMQ 1XNIA 2OAUA 4M77E 1ZX6A 2V8JA 4FYWB 2CUBA 1W2BA 2DL5A 4M78D 3JB9J 1ZSGA 5HK0A 4XTXA 3RBBB 4MDXA 2ZPIB 2JTMA 1RAIB 1OI1A 2COYA 1VA7A 5A0LA 2LNHB 1LOJA 1NJIR 2K5FA 1JEGA 2E12A 2CKKA 3CC2A 1T0JA 1BYMA 2DKGA 1GCPA 1UJ0A 3OW2P 4M78G 2O9VA 3OB9A 3P8HA 1MMGA 3HHTB 3O8VA 3HRTA 3CCQT 3CCQA 1WA7A 2EQJA 1E6GA 1ZLMA 4KT0E 1YHQT 2KYMA 1YHQA 3L2RA 5GMKe 3VRYA 1VQ8T 1VQ8A 3CCRQ 4J9IA 2BZYA 4ATOA 2AT1B 3TEEA 4C8QB 3MO8A 1KD1C 4WTOB 1PM3A 1SSFA 4X9DA 5GAMf 2AZSA 1CKBA 1C6VX 1GBQA 2DA9A 4IIOA 2MIOA 5CKFA 4IUUA 5I11A 2HAXA 1YCSB 1M8VA 2EYXA 1UGVA 4N0AA 3C4SA 5GMKl 2KVQG 2HKNA 1QVGS 2CT4A 1YI2T 1YI2A 4AFSC 2KI7A 3F70A 2BE7D 2K3YA 2FB7A 2LJ0A 3SWNC 2ATCB 3PTAA 2E6ZA 1PHTA 3GNFB 4JRKA 2XD0A 1N9SA 4XTUA 3TQ7P 4E6RA 4DEYA 1R8OB 2DXBA 4AFZC 2VGMA 2O9SA 3ULRB 1X01A 2YXYA 4C92E 1WLPB 2OI3A 2VKNA 4GBQA 1X43A 4M7DD 2RJFA 1UHCA 3CC4A 2LQKA 1MV3A 2E10A 4J83A 2DXTA 1Q82U 2E6NA 4C5GA 3ZBDA 2J6FA 4FIBA 3MJXA 3MEVA 1YP5A 1YJ9T 1YJ9A 5GAMe 4M7DG 3NPFA 1QCFA 1I5LA 5GJVB 2OTJA 4AFQC 2FYKA 4OMOA 4Z8AA 2DETA 1Z9QA 2D1XA 1NEGA 2BIVA 5LJ3d 5GAOm 3QPHA 5GANf 1WQWA 2ROTA 1SRLA 4PJMA 4E7HA 1NM7A 2DTIA 2JXBA 5CQYA 5IAYA 1W2BP 4DBFA 3ASKA 2CREA 4P5NA 2XICA 1K9AA 4B9XA 1V1CA 2DBKA 5CQXA 2CGHA 5DY9A 4BD3A 4C8QE 1K73U 4Z02A 2LT1A 4BACA 1YITQ 1R0BG 1YJNT 1YFNA 2XHCA 1JU5C 1NJIU 2FRYA 1GCQA 1PC0A 2L2PA 1M1GA 4A4GA 2DD5A 4M75F 2M0YA 1SKUB 3FLGA 1KK7A 1UG1A 2MF2A 3JCMX 2H8HA 1K0XA 3M4YA 3ZEHA 5IXBA 1YJWQ 2F2WA 4OMPA 5KH6A 3M9QA 1M3BA 2QQBA 1TWBA 4MMLA 2E1HA 2KXDA 2A37A 2DL4A 3LH5A 1H8KA 3URGA 1T0HA 3EAEA 1MNDA 2HQXA 2C06A 4HA8A 1GL5A 1BCMA 2EW3A 2GFAA 5A0DA 3QG1A 3H8ZA 2DL7A 2JTEA 1N9RA 2K4YA 3I56A 2M02A 3CCEQ 2KAFA 4PJOA 3I5SA 2RD1A 3TSZA 4CI0C 5GAOn 2EQMA 2E41A 2SRCA 2G3RA 1BI3A 2RK2A 2GQVA 1B07A 1Q81C 4ZTJA 2CP5A 5FRMA 1OOTA 4CRIA 2CP2A 1PSEA 4N4HA 5CKHA 1G5VA 2HBPA 1NBEB 1ZQ1A 4F16A 4R0KA 4DEXA 4R56A 2RQRA 2IVWA 3RMQA 2H3EB 4Q5WA 1F1BB 5LJ3g 2CDTA 4AG2C 2X4JA 3JB9D 2I2LA 4ZN3A 3HRUA 1M1FA 3A5ZB 4FM4B 1VYVA 2LCLA 3X26B 1SHGA 2DYBA 1VQ7Q 2H3JA 1RUWA 1MHNA 3S3MA 5FU6C 3S3NA 3IQLA 1M90U 3JB9G 5IH2A 3P8DA 1PCXA 2FPFA 3OBYA 1UGSB 3EG0A 1VQKT 1VQKA 3OSSC 3UF4A 2DYIA 4J9FA 2DO3A 2F2XA 4JS5A 2P4RA 3JCMd 1GFCA 2DRMA 2BZXA 3GP8A 3JB9H 4J9DA 2HSEB 1N27A 3OYFA 1D3BA 2RJEA 4M7DB 1M5Q1 3CC2Q 1KC8U 2YWWA 3CXCS 2EJFA 1VQ4A 1OU9A 3OMGA 1PD1A 2KQWA 4C0DB 2AHJB 3CCQQ 1SF9A 1AEYA 3G6ET 3G6EA 4M78E 1YHQQ 4M77C 2XG8D 5GAN2 2P0QA 5CKEA 3J81E 2GGRA 2M16A 4PJOD 1VQ8Q 3MHXA 1UDLA 1WHHA 4EMGA 2FL7A 3M0SA 1JB0E 1X69A 3L1AA 3L2QA 4OVAA 1ZUUA 4M77F 3PIOA 1D0ZA 2RQVA 4LUEA 1M8MA 3OS0A 3A8OB 1I5OB 1RLQC 2CS7A 2FRWA 4FYXB 4OB3B 2HD0A 4F17A 5IHNA 1M3AA 4ORZA 3WVEB 3JCMb 1IHWA 3G4SA 2WSCE 4PJOG 1VQNA 5GANd 3WXMB 4M75E 4JJCA 3OW2S 1JBMA 2FVUA 3FJ5A 2GNCA 4DA4A 2O4XB 3OYEA 1YI2Q 1G8XA 2DZCA 3H0HA 5I2SA 1QMCA 3M0PA 3SFMA 1X75C 2YRDA 3E1SA 3ZL7C 1IHVA 2YRCA 2OTLT 2OTLA 1VQ6T 1VQ6A 1VYUA 4JZ3A 3A1PA 2MOXA 3FEOA 5FRNA 4KH0B 3MPUB 3OSVA 2A28A 3GPLA 5I22A 4PFOA 3N5BB 5CAIA 1WJRA 4KGVB 1M2OA 1UJYA 3A98A 1I0CA 1HD3A 3FJPA 3CC4Q 1V76A 3X24B 3A8GB 3RIRA 4M7AF 2X9HA 1IGQA 1Q81R 2JZ2A 2VWFA 2DEQA 2EWNA 1YJ9Q 2X4YA 4O6JA 1M27C 2PVGB 2OTJQ 2V8KA 5KE2A 2EPDA 2LQNA 3JCMg 2V1RA 1QCOA 3THKA 3QKJA 2PU9B 4M7DE 4JRQA 4LD9K 2DF6A 4C92C 3LX7A 1NLOC 4ZGDB 4F14A 3UPUA 1M3CA 4AT1B 3JAME 1I1JA 3M0TA 4K11A 3RDVA 5GAN3 1M2VA 1NEBA 2EJ9A 3OY9A 4LUDA 2MAMA 5GAN6 2EGEA 4BY6C 1KSWA 4C92F 4HVVA 3CCMT 1TUGB 2KE9A 5ECAA 3S6WA 1ZUYA 2K9GA 3BDLA 3LYIA 4QQ6A 2HZYA 1QLYA 1N8RU 2CH4A 2HL3A 2JM8A 3CBOA 5IHKA 3RERA 1TSFA 4FW2A 2VUBA 4RTYA 2MWOA 3REAB 2ZGWA 2J7IA 4Y91A 5LJ3h 4FL6A 3ZFJA 3QWXX 1OX8A 1Y07A 1WHJA 2PVDB 3GF5A 4EMHA 3VS2A 2DMOA 1TOVA 4X9CA 1SSHA 5GANg 3VS1A 2EAYA 2WACA 1W2BS 4DBQA 3BE3A 4FCYA 3OYAA 3OYKA 3TSWA 2KT1A 4XU3A 2A7YA 1M90C 1ZSZC 4QQGA 4C8QC 2ZPFB 1GXIE 2KYBA 2LNVA 3R6OA 5LJ3j 2MMPA 1D0XA 1X2QA 1T3LA 4OB2B 1K8AR 2LP5A 2C0IA 3VS5A 2JN0A 4C8QF 2FZGB 4A54A 2VGNA 3EFSA 4Z89A 3L2WA 4E7SA 3CEYA 4QT7A 2DM1A 1UE9A 1WPYA 3I56Q 2E3IA 2QDLA 2FO0A 1PRLC 1AZGB 2VXEA 1VQ5T 1VQ5A 3OYMA 1M1KR 3QZ5B 4LE9A 4M4ZA 2AKLA 2COWA 4RTZA 2W0ZA 4EMKC 3HL8A 3G7ZA 2L3QA 4JUVA 3CC2T 4HT8A 2KRNA 3TREA 4PJOB 4LNPA 4RCBA 1B34B 1YIJA 2WSFE 5DM7R 5GAN8 2CP7A 1WJQA 1XJWB 2DLPA 4EIKA 4CC7A 5GMKj 1TG0A 1JXOA 3M59A 1PKTA 2EKHA 1R0CB 1U3OA 3E19A 4OMQA 4E7IA 4BUGA 2O4XA 1E7OA 1BCOA 2ZPBB 2C0TA 3L2ZA 3P8BB 3TU4K 3CCUA 2RI2A 2QK0A 3GBQA 3M57A 4A4EA 2KNBB 2GF7A 1WHLA 1ZA1B 1EFNA 4M7AE 1JJ2A 1VQKQ 4FU6A 3CC7T 4UC4A 3JCMV 4E7ZA 3CC7A 1H3ZA 2IG0A 2ZPHB 2X4WA 2L0AA 3LW5E 4PKCC 1ZA2B 2R5MA 2RN8A 5AT1B 2PZ1A 3EG9A 4QQDA 1Q86R 2JVVA 4PLLA 2MI6A 2QEXT 2LZ6B 2QEXA 2BE9B 4J7IA 3QJYA 1ABOA 5D7UA 1IXDA 3INZA 2AK5A 2BZ8A 2DAQA 4HCBA 2EYWA 2KGTA 1I8FA 3CCSA 3CCST 1KQSA 1WNLA 1VQ4Q 2EQKA 4GY5A 3UDCA 4J6YA 3JCMc 3DB4A 1BI0A 3LWHA 3C95A 3JSCA 2YDLA 2Z0WA 3G6EQ 2DD4A 2K2VA 3AT1B 2DPPB 4KUIA 4L5GA 1SPKA 2O88A 2MK5A 1QKWA 5HK3A 3QZ9B 1D3BB 1WQ7A 3JCMh 1S1NA 2PTKA 1QVFA 2VV5A 3CC4T 1UEBA 2VASA 5LJ5d 2D0NA 1ZUKA 2RH2A 2DTHA 1AVZC 1SRMA 5D6WA 2A36A 2RHZA 3QDRB 4IUQA 1VQ9A 3QWYA 3G4SQ 2OTJT 1MMNA 5A2QE 2ED0A 3OYHA 4BE0A 7AT1B 1VQNQ 2A3LA 2JS0A 1X6BA 2DFUA 4M78C 4PJOE 4XAXB 5KYWB 4EPCA 2JTFA 3L2UA 1N8RC 1ACMB 3CMAT 3CMAA 5GAN5 2OTLQ 3HKSA 1VQ6Q 4RUGA 4D8DA 4M78F 4F7UA 1G3TA 2F1LA 1T3SA 2JM9A 1VQOT 1VQOA 2RNAA 2LMJA 2ABLA 4A4KA 3G71A 1NYGA 3FIFA 1I07A 3KFVA 1Q7YR 3EG1A 2M1HA 2R57A 4M75C 2VC8A 1VQLA 1BBZA 2AZVA 1K4US 5HKCA 2QYZA 3RR6A 3X28B 1VUBA 1OZ3A 2FEIA 3VRZA 2KROA 4A4HA 1ZBXA 4ME7A 1PWTA 3SB2A 1UGPB 3HFOA 4XTYA 2QQRA 3WVDB 2ESWA 2E4HA 2ZZDA 3EHQA 3I55T 3I55A 1PKSA 4X1VA 2JUFA 1QVPA 1HK9A 4OMLA 2RHXA 5A0GA 2IPOB 1UUEA 4QVDA 3PFSA 3AHUA 1EZZB 2CH4W 5L23A 1K9MC 2SEMA 3L2VA 5GANj 2LQ8A 3V7CA 4JLIA 4L6V5 3VS7A 2MCNA 4MZTA 1JJ2P 3OS5A 2X35A 4PJNA 3CCMQ 4HVWA 2DJQA 4J9EA 3H0IA 5KYXA 4J6XA 2EGAA 2GBQA 3FDRA 1H92A 2XIDA 4XU0A 3I56T 2PUKB 4DBHA 1M2VB 3PMTA 1KD1R 1B34A 2DXUA 1X27A 4M7DC 5KYYA 1KQSP 2G6FX 1QCNA 5LJ5g 4ZGJB 3HP9A 2ZCFB 1AHJB 2JMCA 4KRTA 1BIBA 4D6WA 4M7DF 1OQKA 3CBMA 3M0RA 1VIFA 4GLMA 2HNIA 3QJ6A 3VUZA 2L3SA 4OGCA 2LC4A 4LDVA 1U1SA 1QVFP 3TVTA 1JXMA 2K7AA 4OGEA 2QDYB 2ECZA 2RHUA 1OV3A 1NE8A 2HL5C 4LDYA 2JMAA 3PVQA 3EGDB 4OB1B 3CMEA 5GAMd 4F7UG 2OX7A 4WF2A 4J9HA 1K1ZA 1ZSZA 4KGZB 1BK2A 2M0OA 4ANJA 1IO6A 3CCLT 3CCLA 3JCMJ 3Q1JA
chains in the Genus database with same CATH topology
1T0JA 2BTTA 2V1QA 1M27C 1GCPA 1UJ0A 2C0OA 2EPDA 2LQNA 2M51A 2V1RA 2O9VA 3THKA 4JJBA 1OPKA 2YUOA 2DF6A 1NLOC 1WA7A 4F14A 3H0FA 2LX7A 1M3CA 4Z88A 1E6GA 1WFWA 1ZLMA 1I1JA 2KYMA 3M0TA 4K11A 1TUDA 1NEBA 3VRYA 4LUDA 1AD5A 2EGEA 1B3QA 1KSWA 3M0UA 4J9IA 2BZYA 4HVVA 1FMKA 1E6HA 3H41A 1M30A 1X2KA 2JS2A 2KE9A 5ECAA 1K76A 1ZUYA 1JO8A 5IXFA 3I9QA 2K9GA 2EVRA 1QLYA 2AZSA 1CKBA 2CH4A 1GBQA 2DA9A 2J06A 2JM8A 4IIOA 4JZ4A 2MIOA 5IHKA 5I11A 2GTJA 1YCSB 1KIKA 2EYXA 4RTYA 2IIMA 2LJ3A 1UGVA 2HDAA 3REAB 2J7IA 1KJWA 1NLPC 3EG3A 2KRSA 1NG2A 1Z9ZA 2HSPA 2CT4A 3PVLA 3QWXX 2HBWA 4AFSC 1WXTA 3VS2A 3UATA 2DMOA 2ENMA 1U06A 2LJ0A 3NMZC 4ZNXA 1SSHA 4LN2A 2CSIA 1PHTA 3VS1A 1MUZA 2EYYA 2X3WD 2K2MA 4E6RA 1PRMC 1UHFA 1UFFA 2I0NA 3TSWA 4DEYA 1FYNA 4AFZC 1AWWA 2KT1A 1UTIA 2O9SA 3ULRB 4OMMA 1WLPB 2KYBA 2OI3A 2VKNA 4GBQA 1X43A 2DL3A 5FWBA 4FSSA 1UHCA 5FWCA 1X2QA 1WXUA 3CQTA 1T3LA 1MV3A 2LP5A 2C0IA 3VS5A 2J6FA 1UECA 2NUZA 2RQWA 1YN8A 1SEMA 4Z89A 1YP5A 2EGCA 1N5ZA 2EBPA 4JJDA 4QT7A 2DM1A 1UE9A 4RTXA 1Y57A 3UA6A 2QDLA 3NPFA 1QCFA 2FO0A 1Y0MA 5GJVB 2FG0A 1PRLC 4AFQC 1AZGB 4OMOA 1YWPA 2O2OA 2GQIA 4Z8AA 1LCKA 1Z9QA 1NEGA 2D1XA 4LE9A 4M4ZA 2AKLA 4RTZA 2KBTA 2W0ZA 1GRIA 1CKAA 1ZBJA 1WI7A 2L3QA 2ROTA 1BU1A 1H3HA 2KR3A 1SRLA 2KRNA 4LNPA 1NM7A 5HCKA 2JXBA 4RTWA 1CSKA 5GJWB 4AFUC 3UA7A 1AWJA 1G2BA 2DLPA 4RTUA 1VYTA 2JT4A 2CREA 2CUDA 4EIKA 1AWOA 1K9AA 3PE0A 4CC7A 1V1CA 2DBKA 1TG0A 1JXOA 2RMOA 1PKTA 3REBB 2EKHA 1U3OA 2HCKA 4OMQA 1AWXA 1JU5C 1E7OA 2FPEA 2FRYA 2C0TA 1GCQA 4J9GA 4AG1C 2L2PA 3GBQA 1W70A 2KNBB 2M0YA 1EFNA 1UG1A 2H8HA 2RQUA 1K0XA 3NHNA 2L0AA 2OJ2A 4OMNA 2RN8A 2PZ1A 5IXBA 1WYXA 2F2WA 4OMPA 1K0SA 2LZ6B 1ABQA 1M3BA 1ARKA 1ABOA 1QKXA 1AOJA 2KXDA 3U23A 2A37A 2DL4A 2AK5A 2BZ8A 3RNJA 3LH5A 1JQQA 2EYWA 2KGTA 1H8KA 1T0HA 3NGPA 2DX1A 1GL5A 2EW3A 2YDLA 2AKKA 1RI9A 1YWOA 2B86A 2DL7A 1QWFA 2J05A 2JTEA 1WIEA 1SPKA 2O88A 1J3TA 1QKWA 4CC4B 2RF0A 3I5SA 3TSZA 2RPNA 1S1NA 2F2VA 2PTKA 2SRCA 1B07A 2D0NA 1ZUKA 5EC7A 1OOTA 3M0QA 3VS4A 2YSQA 1AVZC 4HXJA 2YT6A 4IIMA 1W6XA 1SRMA 1RLPC 1X6GA 2A36A 2CT3A 2EYZA 4ESRA 3QWYA 4JPBW 2DE0X 4F16A 4R0KA 4DEXA 2ED0A 2HEQA 2RQRA 2JS0A 3EG2A 5IHIA 1YNZA 2OAWA 2LJ1A 1XOVA 1X6BA 2PNIA 2KXCA 2E5KA 4HCKA 2CDTA 4AG2C 4J9BA 1GCQC 1OEBA 2J6KA 1WDXA 1VYVA 3EHRA 3VS0A 2D8HA 1WXBA 4RUGA 4D8DA 1SHGA 2LCSA 2DYBA 1T3SA 2JM9A 1RUWA 2K79A 2RNAA 3VS6A 2LMJA 2ABLA 1OPLA 2J6OA 1HSQA 3IQLA 1W1FA 2EQIA 1NYGA 1GBRA 1I07A 2YUPA 3JV3A 3KFVA 5IH2A 3SEMA 2FPFA 1GFDA 3EG0A 3EG1A 1BBZA 2AZVA 2GTOA 4HVUA 3UF4A 3R6NA 1K4US 2RQTA 1WX6A 5FW9A 4J9FA 2F2XA 2P4RA 2DVJA 2FEIA 3VRZA 1GFCA 1NYFA 2DRMA 3I35A 2BZXA 2KROA 2ED1A 2YUQA 1PWTA 2W10A 4J9DA 2D8JA 3C0CA 2YUNA 2DNUA 2ESWA 3EHQA 1PKSA 4Y92A 2DBMA 4X1VA 2DILA 3I5RA 4OMLA 1AZEA 1BB9A 1UUEA 3SHWA 2XMFA 2CH4W 5L23A 2L3PA 2SEMA 1AEYA 4D8KA 1TUCA 3VS7A 2GGRA 2LQWA 2MCNA 2KT8A 1UDLA 3EGUA 3M0SA 4HVWA 2A08A 2DJQA 1X69A 4J9EA 1QWEA 3H0IA 1ZUUA 2RQVA 2EGAA 4LUEA 1M8MA 2GBQA 1H92A 1RLQC 4WCIA 2FRWA 4F17A 5IHNA 2DRKA 1M3AA 4ORZA 2K6DA 4CC2A 1X27A 2X3XD 2G6FX 4JJCA 3FJ5A 2JMCA 2GNCA 4KRTA 2O31A 2CSQA 3H0HA 1A0NB 2NWMA 2JW4A 3M0RA 3M0PA 3ZL7C 1G83A 2FPDA 4GLMA 1KFZA 1SHFA 1VYUA 4JZ3A 2L3SA 2MOXA 2A28A 4J9CA 4RTVA 1MV0B 3TVTA 5I22A 4CC3A 1HJDA 1JXMA 2K7AA 2ECZA 1UJYA 2KEAA 4A63B 1PNJA 2KRMA 2VVKA 3A98A 1OV3A 1I0CA 1HD3A 2DL8A 2JMAA 3PVQA 1U5SA 1ZX6A 4RTTA 2CUBA 2DL5A 1ZSGA 2K3BA 3VS3A 4J9HA 3RBBB 1K1ZA 2ROLA 1BK2A 3O5ZA 2VWFA 1VA7A 1IO6A 2LNHB 1JEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0J A;  2BTT A;  2V1Q A;  1M27 C;  1GCP A;  1UJ0 A;  2C0O A;  2EPD A;  2LQN A;  2M51 A;  2V1R A;  2O9V A;  3THK A;  4JJB A;  1OPK A;  2YUO A;  2DF6 A;  1NLO C;  1WA7 A;  4F14 A;  3H0F A;  2LX7 A;  1M3C A;  4Z88 A;  1E6G A;  1WFW A;  1ZLM A;  1I1J A;  2KYM A;  3M0T A;  4K11 A;  1TUD A;  1NEB A;  3VRY A;  4LUD A;  1AD5 A;  2EGE A;  1B3Q A;  1KSW A;  3M0U A;  4J9I A;  2BZY A;  4HVV A;  1FMK A;  1E6H A;  3H41 A;  1M30 A;  1X2K A;  2JS2 A;  2KE9 A;  5ECA A;  1K76 A;  1ZUY A;  1JO8 A;  5IXF A;  3I9Q A;  2K9G A;  2EVR A;  1QLY A;  2AZS A;  1CKB A;  2CH4 A;  1GBQ A;  2DA9 A;  2J06 A;  2JM8 A;  4IIO A;  4JZ4 A;  2MIO A;  5IHK A;  5I11 A;  2GTJ A;  1YCS B;  1KIK A;  2EYX A;  4RTY A;  2IIM A;  2LJ3 A;  1UGV A;  2HDA A;  3REA B;  2J7I A;  1KJW A;  1NLP C;  3EG3 A;  2KRS A;  1NG2 A;  1Z9Z A;  2HSP A;  2CT4 A;  3PVL A;  3QWX X;  2HBW A;  4AFS C;  1WXT A;  3VS2 A;  3UAT A;  2DMO A;  2ENM A;  1U06 A;  2LJ0 A;  3NMZ C;  4ZNX A;  1SSH A;  4LN2 A;  2CSI A;  1PHT A;  3VS1 A;  1MUZ A;  2EYY A;  2X3W D;  2K2M A;  4E6R A;  1PRM C;  1UHF A;  1UFF A;  2I0N A;  3TSW A;  4DEY A;  1FYN A;  4AFZ C;  1AWW A;  2KT1 A;  1UTI A;  2O9S A;  3ULR B;  4OMM A;  1WLP B;  2KYB A;  2OI3 A;  2VKN A;  4GBQ A;  1X43 A;  2DL3 A;  5FWB A;  4FSS A;  1UHC A;  5FWC A;  1X2Q A;  1WXU A;  3CQT A;  1T3L A;  1MV3 A;  2LP5 A;  2C0I A;  3VS5 A;  2J6F A;  1UEC A;  2NUZ A;  2RQW A;  1YN8 A;  1SEM A;  4Z89 A;  1YP5 A;  2EGC A;  1N5Z A;  2EBP A;  4JJD A;  4QT7 A;  2DM1 A;  1UE9 A;  4RTX A;  1Y57 A;  3UA6 A;  2QDL A;  3NPF A;  1QCF A;  2FO0 A;  1Y0M A;  5GJV B;  2FG0 A;  1PRL C;  4AFQ C;  1AZG B;  4OMO A;  1YWP A;  2O2O A;  2GQI A;  4Z8A A;  1LCK A;  1Z9Q A;  1NEG A;  2D1X A;  4LE9 A;  4M4Z A;  2AKL A;  4RTZ A;  2KBT A;  2W0Z A;  1GRI A;  1CKA A;  1ZBJ A;  1WI7 A;  2L3Q A;  2ROT A;  1BU1 A;  1H3H A;  2KR3 A;  1SRL A;  2KRN A;  4LNP A;  1NM7 A;  5HCK A;  2JXB A;  4RTW A;  1CSK A;  5GJW B;  4AFU C;  3UA7 A;  1AWJ A;  1G2B A;  2DLP A;  4RTU A;  1VYT A;  2JT4 A;  2CRE A;  2CUD A;  4EIK A;  1AWO A;  1K9A A;  3PE0 A;  4CC7 A;  1V1C A;  2DBK A;  1TG0 A;  1JXO A;  2RMO A;  1PKT A;  3REB B;  2EKH A;  1U3O A;  2HCK A;  4OMQ A;  1AWX A;  1JU5 C;  1E7O A;  2FPE A;  2FRY A;  2C0T A;  1GCQ A;  4J9G A;  4AG1 C;  2L2P A;  3GBQ A;  1W70 A;  2KNB B;  2M0Y A;  1EFN A;  1UG1 A;  2H8H A;  2RQU A;  1K0X A;  3NHN A;  2L0A A;  2OJ2 A;  4OMN A;  2RN8 A;  2PZ1 A;  5IXB A;  1WYX A;  2F2W A;  4OMP A;  1K0S A;  2LZ6 B;  1ABQ A;  1M3B A;  1ARK A;  1ABO A;  1QKX A;  1AOJ A;  2KXD A;  3U23 A;  2A37 A;  2DL4 A;  2AK5 A;  2BZ8 A;  3RNJ A;  3LH5 A;  1JQQ A;  2EYW A;  2KGT A;  1H8K A;  1T0H A;  3NGP A;  2DX1 A;  1GL5 A;  2EW3 A;  2YDL A;  2AKK A;  1RI9 A;  1YWO A;  2B86 A;  2DL7 A;  1QWF A;  2J05 A;  2JTE A;  1WIE A;  1SPK A;  2O88 A;  1J3T A;  1QKW A;  4CC4 B;  2RF0 A;  3I5S A;  3TSZ A;  2RPN A;  1S1N A;  2F2V A;  2PTK A;  2SRC A;  1B07 A;  2D0N A;  1ZUK A;  5EC7 A;  1OOT A;  3M0Q A;  3VS4 A;  2YSQ A;  1AVZ C;  4HXJ A;  2YT6 A;  4IIM A;  1W6X A;  1SRM A;  1RLP C;  1X6G A;  2A36 A;  2CT3 A;  2EYZ A;  4ESR A;  3QWY A;  4JPB W;  2DE0 X;  4F16 A;  4R0K A;  4DEX A;  2ED0 A;  2HEQ A;  2RQR A;  2JS0 A;  3EG2 A;  5IHI A;  1YNZ A;  2OAW A;  2LJ1 A;  1XOV A;  1X6B A;  2PNI A;  2KXC A;  2E5K A;  4HCK A;  2CDT A;  4AG2 C;  4J9B A;  1GCQ C;  1OEB A;  2J6K A;  1WDX A;  1VYV A;  3EHR A;  3VS0 A;  2D8H A;  1WXB A;  4RUG A;  4D8D A;  1SHG A;  2LCS A;  2DYB A;  1T3S A;  2JM9 A;  1RUW A;  2K79 A;  2RNA A;  3VS6 A;  2LMJ A;  2ABL A;  1OPL A;  2J6O A;  1HSQ A;  3IQL A;  1W1F A;  2EQI A;  1NYG A;  1GBR A;  1I07 A;  2YUP A;  3JV3 A;  3KFV A;  5IH2 A;  3SEM A;  2FPF A;  1GFD A;  3EG0 A;  3EG1 A;  1BBZ A;  2AZV A;  2GTO A;  4HVU A;  3UF4 A;  3R6N A;  1K4U S;  2RQT A;  1WX6 A;  5FW9 A;  4J9F A;  2F2X A;  2P4R A;  2DVJ A;  2FEI A;  3VRZ A;  1GFC A;  1NYF A;  2DRM A;  3I35 A;  2BZX A;  2KRO A;  2ED1 A;  2YUQ A;  1PWT A;  2W10 A;  4J9D A;  2D8J A;  3C0C A;  2YUN A;  2DNU A;  2ESW A;  3EHQ A;  1PKS A;  4Y92 A;  2DBM A;  4X1V A;  2DIL A;  3I5R A;  4OML A;  1AZE A;  1BB9 A;  1UUE A;  3SHW A;  2XMF A;  2CH4 W;  5L23 A;  2L3P A;  2SEM A;  1AEY A;  4D8K A;  1TUC A;  3VS7 A;  2GGR A;  2LQW A;  2MCN A;  2KT8 A;  1UDL A;  3EGU A;  3M0S A;  4HVW A;  2A08 A;  2DJQ A;  1X69 A;  4J9E A;  1QWE A;  3H0I A;  1ZUU A;  2RQV A;  2EGA A;  4LUE A;  1M8M A;  2GBQ A;  1H92 A;  1RLQ C;  4WCI A;  2FRW A;  4F17 A;  5IHN A;  2DRK A;  1M3A A;  4ORZ A;  2K6D A;  4CC2 A;  1X27 A;  2X3X D;  2G6F X;  4JJC A;  3FJ5 A;  2JMC A;  2GNC A;  4KRT A;  2O31 A;  2CSQ A;  3H0H A;  1A0N B;  2NWM A;  2JW4 A;  3M0R A;  3M0P A;  3ZL7 C;  1G83 A;  2FPD A;  4GLM A;  1KFZ A;  1SHF A;  1VYU A;  4JZ3 A;  2L3S A;  2MOX A;  2A28 A;  4J9C A;  4RTV A;  1MV0 B;  3TVT A;  5I22 A;  4CC3 A;  1HJD A;  1JXM A;  2K7A A;  2ECZ A;  1UJY A;  2KEA A;  4A63 B;  1PNJ A;  2KRM A;  2VVK A;  3A98 A;  1OV3 A;  1I0C A;  1HD3 A;  2DL8 A;  2JMA A;  3PVQ A;  1U5S A;  1ZX6 A;  4RTT A;  2CUB A;  2DL5 A;  1ZSG A;  2K3B A;  3VS3 A;  4J9H A;  3RBB B;  1K1Z A;  2ROL A;  1BK2 A;  3O5Z A;  2VWF A;  1VA7 A;  1IO6 A;  2LNH B;  1JEG A; 
#chains in the Genus database with same CATH topology
 4XU1 A;  2M51 A;  1VQ5 Q;  4JJB A;  1TTH B;  3VUB A;  3QYH B;  2LT4 A;  4N0A C;  2NLU A;  2LX7 A;  4Z88 A;  3EH1 A;  1S72 T;  1S72 A;  2QAZ A;  2E64 A;  1VQ4 T;  1B3Q A;  4GLK A;  3C94 A;  3H9N A;  3BY7 A;  3M0U A;  4XTV A;  5I21 A;  4OP0 A;  4ZTF A;  4EMK A;  5J26 A;  1E6H A;  4YTL A;  1Q82 C;  1M30 A;  2XKO C;  4KGX B;  1K76 A;  5IXF A;  4PJJ A;  3I9Q A;  4N4I A;  5GAO p;  4MMK A;  5M9O A;  4JZ4 A;  4PFP A;  1NZ9 A;  5GMK i;  1W4S A;  3PNW C;  1KIK A;  2LJ3 A;  2HDA A;  1IZ6 A;  3VYH B;  4IKF A;  5KYW A;  3EG3 A;  3RKW A;  1NG2 A;  1Z9Z A;  3FB9 A;  2HSP A;  4LDU A;  5DLQ E;  3CCU Q;  2HBW A;  3G1J A;  1WXT A;  2QAS A;  2ENM A;  1AT1 B;  2NUT B;  5GAO l;  3G4S T;  2QQA A;  3CC7 Q;  4ZNX A;  1VQN T;  2CSI A;  5LL6 S;  3PIP A;  2EYY A;  2X3W D;  4PL6 A;  1PRM C;  2XU8 A;  1UHF A;  2P0K A;  4PLI A;  2QEX Q;  1BI2 A;  4IUV A;  1IRX A;  3OYB A;  3OYN A;  3RKY A;  3KBG A;  2QQS A;  4FYV B;  2DL3 A;  4DQ2 A;  3LGF A;  3CCS Q;  1DJ7 B;  2E70 A;  5FWC A;  2F69 A;  3BFM A;  1K73 C;  5FU6 B;  2FZC B;  3HRS A;  1UGQ B;  1BKB A;  3EG9 B;  2RQW A;  1NJI C;  1YN8 A;  1LPL A;  1MGQ A;  1SEM A;  3BDU A;  4RCC A;  5FU7 C;  4M7A C;  1WZO A;  2KK4 A;  3SWN A;  1N5Z A;  3OS2 A;  2EBP A;  4JJD A;  4BE1 A;  1Y0M A;  2FG0 A;  2RHI A;  5GAM g;  4OMF B;  2K5I A;  2O2O A;  2GQI A;  1FMW A;  1LCK A;  4NS5 A;  2KBT A;  3JB9 F;  1GRI A;  1ZBJ A;  5CVI A;  3ME9 A;  3MEU A;  2P84 A;  1BU1 A;  1H3H A;  2KR3 A;  1VQ9 Q;  1HYO A;  3EFR A;  1FXX A;  4BDY A;  2R58 A;  5HCK A;  3RES A;  1VOM A;  4PJL A;  3QBY A;  4RTW A;  1CSK A;  5GJW B;  3H6Z A;  3M54 A;  5HY6 A;  4AFU C;  4MDW A;  3UA7 A;  1AWJ A;  4O5V A;  2MPX C;  3UT1 A;  4M77 B;  1NPP A;  1VYT A;  2JT4 A;  2HMA A;  1G3Y A;  3FC3 A;  2CZ7 B;  3CMA Q;  4J6W A;  2BUD A;  5IT9 E;  5LJ5 h;  2EIF A;  4DOV A;  1VQO Q;  3M56 A;  2FPE A;  2Y4Y A;  2CZ0 B;  4J9G A;  3MET A;  4AG1 C;  2RK1 A;  3KXT A;  2EKO A;  3G71 Q;  3T9N A;  3LWI A;  3QHS A;  1NPR A;  5LJ3 f;  2P4T A;  2RQU A;  4LDW A;  2FHD A;  2FZK B;  2OJ2 A;  5GAN 4;  4PJO C;  1YCY A;  3NTI A;  4LDX A;  4F7U B;  1Y96 B;  1WYX A;  4KH1 B;  4ZGE B;  1ABQ A;  4M75 A;  1D1B A;  1JRI A;  3JRZ A;  5LJ5 j;  3U23 A;  3I55 Q;  2KMT A;  2QA4 A;  3RNJ A;  3EGD A;  1JQQ A;  5CK9 A;  2LDM A;  4PJO F;  5GAO q;  5C0M A;  3EH2 A;  2VXF A;  4J7F A;  3DKM A;  3OS1 A;  2EFI A;  1M9S A;  2DTO A;  3MEA A;  1EIF A;  3HTR A;  4QVZ A;  2AKK A;  1RI9 A;  4L59 A;  3CCJ A;  2QTV A;  1QWF A;  1VIE A;  2J05 A;  3PMI A;  4RMO A;  1WIE A;  1RAA B;  1RAE B;  1J3T A;  4CC4 B;  2RF0 A;  2BKD N;  2F2V A;  1VQP T;  1VQP A;  3VKI A;  5FLX E;  1G3W A;  1QP3 A;  1O75 A;  2RI3 A;  3M0Q A;  4II1 A;  4LD6 A;  3GOX A;  3HSB A;  4HXJ A;  2YT6 A;  4IIM A;  1W6X A;  1X6G A;  4KBM B;  2EYZ A;  1IRE B;  3MP6 A;  4ESR A;  1RAH B;  2DE0 X;  1UGR B;  1OYX A;  5LJ3 e;  2HEQ A;  1KC8 C;  5GMK h;  3EG2 A;  4C92 B;  5IHI A;  2K5L A;  4BB7 A;  2KXC A;  2E5K A;  5KE3 A;  3QXE B;  1M4Z A;  4XTZ A;  5KYX B;  3QO3 A;  2J6K A;  2RO0 A;  1WDX A;  4BY6 B;  1P92 A;  2EQU A;  1JJ2 S;  3BW1 A;  2P0P A;  2LCS A;  5KCH A;  3LLR A;  1YIJ T;  4OB0 B;  5KYY B;  3QYG B;  2L8D A;  1SG5 A;  1OPL A;  2J6O A;  2EQI A;  2X4X A;  1GBR A;  1K73 R;  3MEW A;  3VU3 C;  3JV3 A;  2CP0 A;  2NUT A;  3SEM A;  4E47 A;  3CBP A;  4HVU A;  4HCZ A;  5GAN 7;  1UB4 A;  3R6N A;  1Q81 U;  2RQT A;  1WX6 A;  1KQS S;  1RAC B;  3M58 A;  3CME Q;  3GLX A;  3OBW A;  3CPW A;  8ATC B;  2YLC A;  2ED1 A;  2YUQ A;  3CCU T;  4A4F A;  2K3X A;  1KQ1 A;  2DNU A;  4F7U E;  1PSF A;  4M75 D;  4Y92 A;  3CCL Q;  2CP3 A;  2DIL A;  3I5R A;  3MCA B;  4E7L A;  2DZ9 A;  4AMC A;  3OA6 A;  4B6M A;  5IN1 A;  3M55 A;  2E65 A;  1BB9 A;  3SHW A;  1OUL A;  3JCM P;  3CPF A;  2XMF A;  1QVF S;  2L3P A;  3SD4 A;  1WHM A;  1ZSZ B;  4KUD K;  2HKQ B;  4RG2 A;  2L5Q A;  1TUC A;  1HXD A;  2M9U A;  2E5Q A;  1S72 Q;  4M75 G;  4LXC A;  3M5A A;  2L3R A;  5KYU A;  4EDU A;  2LQW A;  2F5T X;  2KT8 A;  2RJD A;  2YLB A;  3CD6 A;  4N4G A;  3CD6 T;  5GAM h;  3EGU A;  3QDF A;  2JNG A;  4NL2 A;  2A08 A;  1QWE A;  3PT9 A;  3JCM f;  4J8O A;  4WCI A;  2DRK A;  2K6D A;  2XI9 A;  4R55 A;  4CC2 A;  1U8R A;  4FT2 A;  4V2S A;  3OYG A;  2NUP A;  2X51 A;  4EMK B;  1D1A A;  2DIG A;  4M77 A;  3A8H B;  2DER A;  3C12 A;  2CSQ A;  5CKB A;  2KSS A;  5GAM j;  2EYQ A;  1VQ9 T;  2NWM A;  2JW4 A;  3VYG A;  1QVG A;  2HQE A;  4RTV A;  1MV0 B;  4CC3 A;  2QGF B;  3A8M B;  4MZP A;  3LGL A;  2KEA A;  1K8A U;  4A63 B;  4B9W A;  2WSE E;  2KRM A;  5KYN A;  3CCV A;  3CCV T;  2DL8 A;  3L42 A;  4BDZ A;  1U5S A;  1M90 R;  2CZ6 B;  4RTT A;  2QXF A;  1Y96 A;  5CR2 A;  2K3B A;  3VS3 A;  2MYS A;  2ROL A;  3ER0 A;  2O01 E;  3G71 T;  2DXC A;  2RA2 A;  3M4G A;  4FT4 A;  3O5Z A;  1LJO A;  2E3H A;  1M1K U;  3JCM e;  1MMD A;  3HPW A;  1VQL T;  2BTT A;  5GAN h;  2V1Q A;  2C0O A;  4C0F A;  3E9G A;  5D6X A;  5EG2 A;  4X34 A;  4M7A A;  2VB6 A;  1OPK A;  2YUO A;  3J7A F;  1KC8 R;  3JCM W;  3H0F A;  1WFW A;  1TUD A;  4BE2 A;  3SWN B;  2CP6 A;  2COZ A;  3M53 A;  3DLM A;  2V8I A;  1AD5 A;  2DJZ A;  3DB3 A;  2Y4X A;  3EGX A;  4FW1 A;  3NTK A;  2CYZ B;  1RAG B;  1FMK A;  5L8R E;  1BIA A;  1YJN A;  4RKU E;  5CKD A;  3H41 A;  1X2K A;  2JS2 A;  1JO8 A;  3CPW P;  2LX9 A;  2PQW A;  1V29 B;  2EVR A;  4JS4 A;  1Y7X A;  2D9T A;  3HFN A;  1B7T A;  3EFO B;  2J06 A;  2F5K A;  1KHI A;  2GTJ A;  4C92 A;  2IIM A;  3JCM Q;  3OYC A;  1KJW A;  3OYY A;  1NLP C;  2KRS A;  3PVL A;  4M77 D;  4QVC A;  3A8L B;  4IUT A;  5GAN e;  3UAT A;  1Q86 U;  1U06 A;  6AT1 B;  2LVM A;  2PUO B;  3NMZ C;  3VJP A;  3E2U A;  2YHT A;  4LN2 A;  4BI8 B;  4KUL A;  2B8A A;  4M78 B;  1MUZ A;  2K2M A;  1UFF A;  4OF1 A;  2I0N A;  4C5E A;  3S3O A;  1FYN A;  1AWW A;  3V8J A;  1WHG A;  3SDZ A;  4C0D C;  1UTI A;  1KHC A;  1KG1 A;  4ELY C;  1RAF B;  4M77 G;  3X25 B;  4OMM A;  3D7S B;  4ZN1 A;  1VQM T;  1VQM A;  4FYY B;  2AIR B;  5FWB A;  2QA4 Q;  4FSS A;  4MZM A;  4QKU A;  4NL3 A;  1WXU A;  3CQT A;  1IB8 A;  3GIB A;  1RI0 A;  1UEC A;  2NUZ A;  1G3S A;  1YBY A;  3CCJ Q;  2EGC A;  1TS9 A;  4M75 B;  3UA6 A;  4RTX A;  1Y57 A;  3VV0 A;  1ZHI A;  2QQ9 A;  1I4K 1;  4JDS A;  3OMC A;  3QSU A;  4JRI A;  1VQP Q;  4C5H A;  4HT9 A;  3CME T;  1YWP A;  4PFZ A;  3E9F A;  4C8Q A;  1QVG P;  4M7A D;  2D6F A;  4VUB A;  5KCO A;  1CKA A;  1Y71 A;  1WI7 A;  3X20 B;  1FMV A;  1QQJ A;  3MP1 A;  2MWP A;  4IUR A;  4HKE A;  1TXQ A;  3CCR T;  3CCR A;  2XDB A;  1OZ2 A;  1PD0 A;  5CO7 A;  1D09 B;  3RMS A;  4BI3 A;  3V7S A;  5FRO A;  4PK4 A;  4M7A G;  1G2B A;  2DK3 A;  3OYJ A;  4RTU A;  2CUD A;  1AWO A;  4E2F B;  3PE0 A;  4XTW A;  3GNG A;  2RMO A;  3REB B;  2GCX A;  2YRV A;  2HCK A;  1Q7Y U;  1Q95 G;  4C92 D;  1YIJ Q;  1N8R R;  1AWX A;  2EJG A;  1WHK A;  3NFC A;  5DLO A;  1W70 A;  4JRP A;  2D0Q B;  1RL2 A;  1RAD B;  4XK8 E;  2GFU A;  3NHN A;  3LH0 A;  3PGG A;  4OMN A;  4A53 A;  4C92 G;  1PG5 B;  1BI1 A;  1K0S A;  5GAO r;  1XTD A;  1D0Y A;  1MMA A;  1ARK A;  1QKX A;  9ATC B;  1AOJ A;  3OYD A;  1K8A C;  3QUI A;  1I81 A;  5CIU A;  4IUP A;  3NGP A;  1WGS A;  1O9S A;  2DX1 A;  3RKX A;  3MP8 A;  2XDP A;  4JJN K;  1XQH A;  8AT1 B;  2KDS A;  1YWO A;  2B86 A;  2DIQ A;  1K9M R;  4BI4 A;  3CXC A;  5D6Y A;  1M1K C;  2PVO B;  3UWN A;  2RPN A;  2DEU A;  3CD6 Q;  2L89 A;  5EC7 A;  3VS4 A;  4QW2 A;  1KD1 U;  4C8Q D;  2YSQ A;  2QG9 B;  3OYL A;  4E7K A;  1QW1 A;  1RLP C;  3KUF A;  2CT3 A;  2ZAE A;  2ZPE B;  4JPB W;  5GMK m;  3OYI A;  5KYU B;  4F7U F;  2JJ9 A;  4XQ3 A;  1YNZ A;  2OAW A;  2LJ1 A;  2QTX A;  4C0G A;  1XOV A;  3V8K A;  2PNI A;  4HCK A;  1R77 A;  2RB6 A;  4J9B A;  4ELZ C;  4C8Q G;  2DVE A;  3EFO A;  1GCQ C;  1OEB A;  4E7J A;  4RG8 A;  4Y28 E;  3EHR A;  3VS0 A;  2D8H A;  3OW2 A;  1WXB A;  4C5I A;  1YIT T;  1YIT A;  3V8L A;  1IGU A;  2K79 A;  1WJS A;  2QGG A;  3VS6 A;  1TH7 A;  2NUP B;  1HSQ A;  3J80 E;  1W1F A;  1LVK A;  2YUP A;  2QI2 A;  4F04 B;  1GFD A;  5LJ5 f;  2GTO A;  3CCV Q;  1Q86 C;  4M78 A;  1U1T A;  5FW9 A;  1FX7 A;  1OU8 A;  2DVJ A;  1YJW T;  1YJW A;  1NYF A;  3I35 A;  2NYS A;  4TVR A;  1X6O A;  2W10 A;  2D8J A;  3C0C A;  3RUX A;  2YUN A;  3V7R A;  2KY9 A;  4JLG A;  3DLL A;  2DBM A;  3OQ5 A;  2RI5 A;  2Y90 A;  1TU0 B;  2LTO A;  1VQL Q;  4DOW A;  1C0M A;  2V26 A;  5C6S A;  1AZE A;  4J5Y A;  2RHY A;  3CCM A;  2ZPG B;  2LCC A;  5I2M A;  4PNO A;  4D8K A;  4XU2 A;  3CCE T;  4NOY A;  3CCE A;  3QII A;  2QA4 T;  3JB9 I;  2RJC A;  5AYF A;  1N6A A;  1MNE A;  3TCJ A;  1KQ2 A;  2JOY A;  5CCA A;  2R5A A;  1YJN Q;  2LRQ A;  2CZ1 B;  1C1A A;  5FU7 B;  4M7A B;  2A0F B;  3CCJ T;  2RM4 A;  3NTH A;  1EX4 A;  1FWZ A;  1Q82 R;  1LNX A;  1OX9 A;  5LJ5 e;  5J39 A;  3MKD A;  2HQH A;  4FSX A;  4DBR A;  2X3X D;  1D1C A;  3EGX B;  1RAB B;  4HCC A;  2K57 A;  2XDD A;  2O31 A;  2XK0 A;  1A0N B;  1G83 A;  2FPD A;  3CXC P;  1KFZ A;  1SHF A;  1VQ7 T;  1VQ7 A;  1QP2 A;  1K9M U;  5J3B A;  1Q7Y C;  4J9C A;  3FRN A;  1H64 1;  1HJD A;  3CPW S;  4C0Z A;  2VYT A;  4M7D A;  1PNJ A;  2VVK A;  1VQM Q;  1XNI A;  2OAU A;  4M77 E;  1ZX6 A;  2V8J A;  4FYW B;  2CUB A;  1W2B A;  2DL5 A;  4M78 D;  3JB9 J;  1ZSG A;  5HK0 A;  4XTX A;  3RBB B;  4MDX A;  2ZPI B;  2JTM A;  1RAI B;  1OI1 A;  2COY A;  1VA7 A;  5A0L A;  2LNH B;  1LOJ A;  1NJI R;  2K5F A;  1JEG A;  2E12 A;  2CKK A;  3CC2 A;  1T0J A;  1BYM A;  2DKG A;  1GCP A;  1UJ0 A;  3OW2 P;  4M78 G;  2O9V A;  3OB9 A;  3P8H A;  1MMG A;  3HHT B;  3O8V A;  3HRT A;  3CCQ T;  3CCQ A;  1WA7 A;  2EQJ A;  1E6G A;  1ZLM A;  4KT0 E;  1YHQ T;  2KYM A;  1YHQ A;  3L2R A;  5GMK e;  3VRY A;  1VQ8 T;  1VQ8 A;  3CCR Q;  4J9I A;  2BZY A;  4ATO A;  2AT1 B;  3TEE A;  4C8Q B;  3MO8 A;  1KD1 C;  4WTO B;  1PM3 A;  1SSF A;  4X9D A;  5GAM f;  2AZS A;  1CKB A;  1C6V X;  1GBQ A;  2DA9 A;  4IIO A;  2MIO A;  5CKF A;  4IUU A;  5I11 A;  2HAX A;  1YCS B;  1M8V A;  2EYX A;  1UGV A;  4N0A A;  3C4S A;  5GMK l;  2KVQ G;  2HKN A;  1QVG S;  2CT4 A;  1YI2 T;  1YI2 A;  4AFS C;  2KI7 A;  3F70 A;  2BE7 D;  2K3Y A;  2FB7 A;  2LJ0 A;  3SWN C;  2ATC B;  3PTA A;  2E6Z A;  1PHT A;  3GNF B;  4JRK A;  2XD0 A;  1N9S A;  4XTU A;  3TQ7 P;  4E6R A;  4DEY A;  1R8O B;  2DXB A;  4AFZ C;  2VGM A;  2O9S A;  3ULR B;  1X01 A;  2YXY A;  4C92 E;  1WLP B;  2OI3 A;  2VKN A;  4GBQ A;  1X43 A;  4M7D D;  2RJF A;  1UHC A;  3CC4 A;  2LQK A;  1MV3 A;  2E10 A;  4J83 A;  2DXT A;  1Q82 U;  2E6N A;  4C5G A;  3ZBD A;  2J6F A;  4FIB A;  3MJX A;  3MEV A;  1YP5 A;  1YJ9 T;  1YJ9 A;  5GAM e;  4M7D G;  3NPF A;  1QCF A;  1I5L A;  5GJV B;  2OTJ A;  4AFQ C;  2FYK A;  4OMO A;  4Z8A A;  2DET A;  1Z9Q A;  2D1X A;  1NEG A;  2BIV A;  5LJ3 d;  5GAO m;  3QPH A;  5GAN f;  1WQW A;  2ROT A;  1SRL A;  4PJM A;  4E7H A;  1NM7 A;  2DTI A;  2JXB A;  5CQY A;  5IAY A;  1W2B P;  4DBF A;  3ASK A;  2CRE A;  4P5N A;  2XIC A;  1K9A A;  4B9X A;  1V1C A;  2DBK A;  5CQX A;  2CGH A;  5DY9 A;  4BD3 A;  4C8Q E;  1K73 U;  4Z02 A;  2LT1 A;  4BAC A;  1YIT Q;  1R0B G;  1YJN T;  1YFN A;  2XHC A;  1JU5 C;  1NJI U;  2FRY A;  1GCQ A;  1PC0 A;  2L2P A;  1M1G A;  4A4G A;  2DD5 A;  4M75 F;  2M0Y A;  1SKU B;  3FLG A;  1KK7 A;  1UG1 A;  2MF2 A;  3JCM X;  2H8H A;  1K0X A;  3M4Y A;  3ZEH A;  5IXB A;  1YJW Q;  2F2W A;  4OMP A;  5KH6 A;  3M9Q A;  1M3B A;  2QQB A;  1TWB A;  4MML A;  2E1H A;  2KXD A;  2A37 A;  2DL4 A;  3LH5 A;  1H8K A;  3URG A;  1T0H A;  3EAE A;  1MND A;  2HQX A;  2C06 A;  4HA8 A;  1GL5 A;  1BCM A;  2EW3 A;  2GFA A;  5A0D A;  3QG1 A;  3H8Z A;  2DL7 A;  2JTE A;  1N9R A;  2K4Y A;  3I56 A;  2M02 A;  3CCE Q;  2KAF A;  4PJO A;  3I5S A;  2RD1 A;  3TSZ A;  4CI0 C;  5GAO n;  2EQM A;  2E41 A;  2SRC A;  2G3R A;  1BI3 A;  2RK2 A;  2GQV A;  1B07 A;  1Q81 C;  4ZTJ A;  2CP5 A;  5FRM A;  1OOT A;  4CRI A;  2CP2 A;  1PSE A;  4N4H A;  5CKH A;  1G5V A;  2HBP A;  1NBE B;  1ZQ1 A;  4F16 A;  4R0K A;  4DEX A;  4R56 A;  2RQR A;  2IVW A;  3RMQ A;  2H3E B;  4Q5W A;  1F1B B;  5LJ3 g;  2CDT A;  4AG2 C;  2X4J A;  3JB9 D;  2I2L A;  4ZN3 A;  3HRU A;  1M1F A;  3A5Z B;  4FM4 B;  1VYV A;  2LCL A;  3X26 B;  1SHG A;  2DYB A;  1VQ7 Q;  2H3J A;  1RUW A;  1MHN A;  3S3M A;  5FU6 C;  3S3N A;  3IQL A;  1M90 U;  3JB9 G;  5IH2 A;  3P8D A;  1PCX A;  2FPF A;  3OBY A;  1UGS B;  3EG0 A;  1VQK T;  1VQK A;  3OSS C;  3UF4 A;  2DYI A;  4J9F A;  2DO3 A;  2F2X A;  4JS5 A;  2P4R A;  3JCM d;  1GFC A;  2DRM A;  2BZX A;  3GP8 A;  3JB9 H;  4J9D A;  2HSE B;  1N27 A;  3OYF A;  1D3B A;  2RJE A;  4M7D B;  1M5Q 1;  3CC2 Q;  1KC8 U;  2YWW A;  3CXC S;  2EJF A;  1VQ4 A;  1OU9 A;  3OMG A;  1PD1 A;  2KQW A;  4C0D B;  2AHJ B;  3CCQ Q;  1SF9 A;  1AEY A;  3G6E T;  3G6E A;  4M78 E;  1YHQ Q;  4M77 C;  2XG8 D;  5GAN 2;  2P0Q A;  5CKE A;  3J81 E;  2GGR A;  2M16 A;  4PJO D;  1VQ8 Q;  3MHX A;  1UDL A;  1WHH A;  4EMG A;  2FL7 A;  3M0S A;  1JB0 E;  1X69 A;  3L1A A;  3L2Q A;  4OVA A;  1ZUU A;  4M77 F;  3PIO A;  1D0Z A;  2RQV A;  4LUE A;  1M8M A;  3OS0 A;  3A8O B;  1I5O B;  1RLQ C;  2CS7 A;  2FRW A;  4FYX B;  4OB3 B;  2HD0 A;  4F17 A;  5IHN A;  1M3A A;  4ORZ A;  3WVE B;  3JCM b;  1IHW A;  3G4S A;  2WSC E;  4PJO G;  1VQN A;  5GAN d;  3WXM B;  4M75 E;  4JJC A;  3OW2 S;  1JBM A;  2FVU A;  3FJ5 A;  2GNC A;  4DA4 A;  2O4X B;  3OYE A;  1YI2 Q;  1G8X A;  2DZC A;  3H0H A;  5I2S A;  1QMC A;  3M0P A;  3SFM A;  1X75 C;  2YRD A;  3E1S A;  3ZL7 C;  1IHV A;  2YRC A;  2OTL T;  2OTL A;  1VQ6 T;  1VQ6 A;  1VYU A;  4JZ3 A;  3A1P A;  2MOX A;  3FEO A;  5FRN A;  4KH0 B;  3MPU B;  3OSV A;  2A28 A;  3GPL A;  5I22 A;  4PFO A;  3N5B B;  5CAI A;  1WJR A;  4KGV B;  1M2O A;  1UJY A;  3A98 A;  1I0C A;  1HD3 A;  3FJP A;  3CC4 Q;  1V76 A;  3X24 B;  3A8G B;  3RIR A;  4M7A F;  2X9H A;  1IGQ A;  1Q81 R;  2JZ2 A;  2VWF A;  2DEQ A;  2EWN A;  1YJ9 Q;  2X4Y A;  4O6J A;  1M27 C;  2PVG B;  2OTJ Q;  2V8K A;  5KE2 A;  2EPD A;  2LQN A;  3JCM g;  2V1R A;  1QCO A;  3THK A;  3QKJ A;  2PU9 B;  4M7D E;  4JRQ A;  4LD9 K;  2DF6 A;  4C92 C;  3LX7 A;  1NLO C;  4ZGD B;  4F14 A;  3UPU A;  1M3C A;  4AT1 B;  3JAM E;  1I1J A;  3M0T A;  4K11 A;  3RDV A;  5GAN 3;  1M2V A;  1NEB A;  2EJ9 A;  3OY9 A;  4LUD A;  2MAM A;  5GAN 6;  2EGE A;  4BY6 C;  1KSW A;  4C92 F;  4HVV A;  3CCM T;  1TUG B;  2KE9 A;  5ECA A;  3S6W A;  1ZUY A;  2K9G A;  3BDL A;  3LYI A;  4QQ6 A;  2HZY A;  1QLY A;  1N8R U;  2CH4 A;  2HL3 A;  2JM8 A;  3CBO A;  5IHK A;  3RER A;  1TSF A;  4FW2 A;  2VUB A;  4RTY A;  2MWO A;  3REA B;  2ZGW A;  2J7I A;  4Y91 A;  5LJ3 h;  4FL6 A;  3ZFJ A;  3QWX X;  1OX8 A;  1Y07 A;  1WHJ A;  2PVD B;  3GF5 A;  4EMH A;  3VS2 A;  2DMO A;  1TOV A;  4X9C A;  1SSH A;  5GAN g;  3VS1 A;  2EAY A;  2WAC A;  1W2B S;  4DBQ A;  3BE3 A;  4FCY A;  3OYA A;  3OYK A;  3TSW A;  2KT1 A;  4XU3 A;  2A7Y A;  1M90 C;  1ZSZ C;  4QQG A;  4C8Q C;  2ZPF B;  1GXI E;  2KYB A;  2LNV A;  3R6O A;  5LJ3 j;  2MMP A;  1D0X A;  1X2Q A;  1T3L A;  4OB2 B;  1K8A R;  2LP5 A;  2C0I A;  3VS5 A;  2JN0 A;  4C8Q F;  2FZG B;  4A54 A;  2VGN A;  3EFS A;  4Z89 A;  3L2W A;  4E7S A;  3CEY A;  4QT7 A;  2DM1 A;  1UE9 A;  1WPY A;  3I56 Q;  2E3I A;  2QDL A;  2FO0 A;  1PRL C;  1AZG B;  2VXE A;  1VQ5 T;  1VQ5 A;  3OYM A;  1M1K R;  3QZ5 B;  4LE9 A;  4M4Z A;  2AKL A;  2COW A;  4RTZ A;  2W0Z A;  4EMK C;  3HL8 A;  3G7Z A;  2L3Q A;  4JUV A;  3CC2 T;  4HT8 A;  2KRN A;  3TRE A;  4PJO B;  4LNP A;  4RCB A;  1B34 B;  1YIJ A;  2WSF E;  5DM7 R;  5GAN 8;  2CP7 A;  1WJQ A;  1XJW B;  2DLP A;  4EIK A;  4CC7 A;  5GMK j;  1TG0 A;  1JXO A;  3M59 A;  1PKT A;  2EKH A;  1R0C B;  1U3O A;  3E19 A;  4OMQ A;  4E7I A;  4BUG A;  2O4X A;  1E7O A;  1BCO A;  2ZPB B;  2C0T A;  3L2Z A;  3P8B B;  3TU4 K;  3CCU A;  2RI2 A;  2QK0 A;  3GBQ A;  3M57 A;  4A4E A;  2KNB B;  2GF7 A;  1WHL A;  1ZA1 B;  1EFN A;  4M7A E;  1JJ2 A;  1VQK Q;  4FU6 A;  3CC7 T;  4UC4 A;  3JCM V;  4E7Z A;  3CC7 A;  1H3Z A;  2IG0 A;  2ZPH B;  2X4W A;  2L0A A;  3LW5 E;  4PKC C;  1ZA2 B;  2R5M A;  2RN8 A;  5AT1 B;  2PZ1 A;  3EG9 A;  4QQD A;  1Q86 R;  2JVV A;  4PLL A;  2MI6 A;  2QEX T;  2LZ6 B;  2QEX A;  2BE9 B;  4J7I A;  3QJY A;  1ABO A;  5D7U A;  1IXD A;  3INZ A;  2AK5 A;  2BZ8 A;  2DAQ A;  4HCB A;  2EYW A;  2KGT A;  1I8F A;  3CCS A;  3CCS T;  1KQS A;  1WNL A;  1VQ4 Q;  2EQK A;  4GY5 A;  3UDC A;  4J6Y A;  3JCM c;  3DB4 A;  1BI0 A;  3LWH A;  3C95 A;  3JSC A;  2YDL A;  2Z0W A;  3G6E Q;  2DD4 A;  2K2V A;  3AT1 B;  2DPP B;  4KUI A;  4L5G A;  1SPK A;  2O88 A;  2MK5 A;  1QKW A;  5HK3 A;  3QZ9 B;  1D3B B;  1WQ7 A;  3JCM h;  1S1N A;  2PTK A;  1QVF A;  2VV5 A;  3CC4 T;  1UEB A;  2VAS A;  5LJ5 d;  2D0N A;  1ZUK A;  2RH2 A;  2DTH A;  1AVZ C;  1SRM A;  5D6W A;  2A36 A;  2RHZ A;  3QDR B;  4IUQ A;  1VQ9 A;  3QWY A;  3G4S Q;  2OTJ T;  1MMN A;  5A2Q E;  2ED0 A;  3OYH A;  4BE0 A;  7AT1 B;  1VQN Q;  2A3L A;  2JS0 A;  1X6B A;  2DFU A;  4M78 C;  4PJO E;  4XAX B;  5KYW B;  4EPC A;  2JTF A;  3L2U A;  1N8R C;  1ACM B;  3CMA T;  3CMA A;  5GAN 5;  2OTL Q;  3HKS A;  1VQ6 Q;  4RUG A;  4D8D A;  4M78 F;  4F7U A;  1G3T A;  2F1L A;  1T3S A;  2JM9 A;  1VQO T;  1VQO A;  2RNA A;  2LMJ A;  2ABL A;  4A4K A;  3G71 A;  1NYG A;  3FIF A;  1I07 A;  3KFV A;  1Q7Y R;  3EG1 A;  2M1H A;  2R57 A;  4M75 C;  2VC8 A;  1VQL A;  1BBZ A;  2AZV A;  1K4U S;  5HKC A;  2QYZ A;  3RR6 A;  3X28 B;  1VUB A;  1OZ3 A;  2FEI A;  3VRZ A;  2KRO A;  4A4H A;  1ZBX A;  4ME7 A;  1PWT A;  3SB2 A;  1UGP B;  3HFO A;  4XTY A;  2QQR A;  3WVD B;  2ESW A;  2E4H A;  2ZZD A;  3EHQ A;  3I55 T;  3I55 A;  1PKS A;  4X1V A;  2JUF A;  1QVP A;  1HK9 A;  4OML A;  2RHX A;  5A0G A;  2IPO B;  1UUE A;  4QVD A;  3PFS A;  3AHU A;  1EZZ B;  2CH4 W;  5L23 A;  1K9M C;  2SEM A;  3L2V A;  5GAN j;  2LQ8 A;  3V7C A;  4JLI A;  4L6V 5;  3VS7 A;  2MCN A;  4MZT A;  1JJ2 P;  3OS5 A;  2X35 A;  4PJN A;  3CCM Q;  4HVW A;  2DJQ A;  4J9E A;  3H0I A;  5KYX A;  4J6X A;  2EGA A;  2GBQ A;  3FDR A;  1H92 A;  2XID A;  4XU0 A;  3I56 T;  2PUK B;  4DBH A;  1M2V B;  3PMT A;  1KD1 R;  1B34 A;  2DXU A;  1X27 A;  4M7D C;  5KYY A;  1KQS P;  2G6F X;  1QCN A;  5LJ5 g;  4ZGJ B;  3HP9 A;  2ZCF B;  1AHJ B;  2JMC A;  4KRT A;  1BIB A;  4D6W A;  4M7D F;  1OQK A;  3CBM A;  3M0R A;  1VIF A;  4GLM A;  2HNI A;  3QJ6 A;  3VUZ A;  2L3S A;  4OGC A;  2LC4 A;  4LDV A;  1U1S A;  1QVF P;  3TVT A;  1JXM A;  2K7A A;  4OGE A;  2QDY B;  2ECZ A;  2RHU A;  1OV3 A;  1NE8 A;  2HL5 C;  4LDY A;  2JMA A;  3PVQ A;  3EGD B;  4OB1 B;  3CME A;  5GAM d;  4F7U G;  2OX7 A;  4WF2 A;  4J9H A;  1K1Z A;  1ZSZ A;  4KGZ B;  1BK2 A;  2M0O A;  4ANJ A;  1IO6 A;  3CCL T;  3CCL A;  3JCM J;  3Q1J A; 
#chains in the Genus database with same CATH homology
 1T0J A;  2BTT A;  2V1Q A;  1M27 C;  1GCP A;  1UJ0 A;  2C0O A;  2EPD A;  2LQN A;  2M51 A;  2V1R A;  2O9V A;  3THK A;  4JJB A;  1OPK A;  2YUO A;  2DF6 A;  1NLO C;  1WA7 A;  4F14 A;  3H0F A;  2LX7 A;  1M3C A;  4Z88 A;  1E6G A;  1WFW A;  1ZLM A;  1I1J A;  2KYM A;  3M0T A;  4K11 A;  1TUD A;  1NEB A;  3VRY A;  4LUD A;  1AD5 A;  2EGE A;  1B3Q A;  1KSW A;  3M0U A;  4J9I A;  2BZY A;  4HVV A;  1FMK A;  1E6H A;  3H41 A;  1M30 A;  1X2K A;  2JS2 A;  2KE9 A;  5ECA A;  1K76 A;  1ZUY A;  1JO8 A;  5IXF A;  3I9Q A;  2K9G A;  2EVR A;  1QLY A;  2AZS A;  1CKB A;  2CH4 A;  1GBQ A;  2DA9 A;  2J06 A;  2JM8 A;  4IIO A;  4JZ4 A;  2MIO A;  5IHK A;  5I11 A;  2GTJ A;  1YCS B;  1KIK A;  2EYX A;  4RTY A;  2IIM A;  2LJ3 A;  1UGV A;  2HDA A;  3REA B;  2J7I A;  1KJW A;  1NLP C;  3EG3 A;  2KRS A;  1NG2 A;  1Z9Z A;  2HSP A;  2CT4 A;  3PVL A;  3QWX X;  2HBW A;  4AFS C;  1WXT A;  3VS2 A;  3UAT A;  2DMO A;  2ENM A;  1U06 A;  2LJ0 A;  3NMZ C;  4ZNX A;  1SSH A;  4LN2 A;  2CSI A;  1PHT A;  3VS1 A;  1MUZ A;  2EYY A;  2X3W D;  2K2M A;  4E6R A;  1PRM C;  1UHF A;  1UFF A;  2I0N A;  3TSW A;  4DEY A;  1FYN A;  4AFZ C;  1AWW A;  2KT1 A;  1UTI A;  2O9S A;  3ULR B;  4OMM A;  1WLP B;  2KYB A;  2OI3 A;  2VKN A;  4GBQ A;  1X43 A;  2DL3 A;  5FWB A;  4FSS A;  1UHC A;  5FWC A;  1X2Q A;  1WXU A;  3CQT A;  1T3L A;  1MV3 A;  2LP5 A;  2C0I A;  3VS5 A;  2J6F A;  1UEC A;  2NUZ A;  2RQW A;  1YN8 A;  1SEM A;  4Z89 A;  1YP5 A;  2EGC A;  1N5Z A;  2EBP A;  4JJD A;  4QT7 A;  2DM1 A;  1UE9 A;  4RTX A;  1Y57 A;  3UA6 A;  2QDL A;  3NPF A;  1QCF A;  2FO0 A;  1Y0M A;  5GJV B;  2FG0 A;  1PRL C;  4AFQ C;  1AZG B;  4OMO A;  1YWP A;  2O2O A;  2GQI A;  4Z8A A;  1LCK A;  1Z9Q A;  1NEG A;  2D1X A;  4LE9 A;  4M4Z A;  2AKL A;  4RTZ A;  2KBT A;  2W0Z A;  1GRI A;  1CKA A;  1ZBJ A;  1WI7 A;  2L3Q A;  2ROT A;  1BU1 A;  1H3H A;  2KR3 A;  1SRL A;  2KRN A;  4LNP A;  1NM7 A;  5HCK A;  2JXB A;  4RTW A;  1CSK A;  5GJW B;  4AFU C;  3UA7 A;  1AWJ A;  1G2B A;  2DLP A;  4RTU A;  1VYT A;  2JT4 A;  2CRE A;  2CUD A;  4EIK A;  1AWO A;  1K9A A;  3PE0 A;  4CC7 A;  1V1C A;  2DBK A;  1TG0 A;  1JXO A;  2RMO A;  1PKT A;  3REB B;  2EKH A;  1U3O A;  2HCK A;  4OMQ A;  1AWX A;  1JU5 C;  1E7O A;  2FPE A;  2FRY A;  2C0T A;  1GCQ A;  4J9G A;  4AG1 C;  2L2P A;  3GBQ A;  1W70 A;  2KNB B;  2M0Y A;  1EFN A;  1UG1 A;  2H8H A;  2RQU A;  1K0X A;  3NHN A;  2L0A A;  2OJ2 A;  4OMN A;  2RN8 A;  2PZ1 A;  5IXB A;  1WYX A;  2F2W A;  4OMP A;  1K0S A;  2LZ6 B;  1ABQ A;  1M3B A;  1ARK A;  1ABO A;  1QKX A;  1AOJ A;  2KXD A;  3U23 A;  2A37 A;  2DL4 A;  2AK5 A;  2BZ8 A;  3RNJ A;  3LH5 A;  1JQQ A;  2EYW A;  2KGT A;  1H8K A;  1T0H A;  3NGP A;  2DX1 A;  1GL5 A;  2EW3 A;  2YDL A;  2AKK A;  1RI9 A;  1YWO A;  2B86 A;  2DL7 A;  1QWF A;  2J05 A;  2JTE A;  1WIE A;  1SPK A;  2O88 A;  1J3T A;  1QKW A;  4CC4 B;  2RF0 A;  3I5S A;  3TSZ A;  2RPN A;  1S1N A;  2F2V A;  2PTK A;  2SRC A;  1B07 A;  2D0N A;  1ZUK A;  5EC7 A;  1OOT A;  3M0Q A;  3VS4 A;  2YSQ A;  1AVZ C;  4HXJ A;  2YT6 A;  4IIM A;  1W6X A;  1SRM A;  1RLP C;  1X6G A;  2A36 A;  2CT3 A;  2EYZ A;  4ESR A;  3QWY A;  4JPB W;  2DE0 X;  4F16 A;  4R0K A;  4DEX A;  2ED0 A;  2HEQ A;  2RQR A;  2JS0 A;  3EG2 A;  5IHI A;  1YNZ A;  2OAW A;  2LJ1 A;  1XOV A;  1X6B A;  2PNI A;  2KXC A;  2E5K A;  4HCK A;  2CDT A;  4AG2 C;  4J9B A;  1GCQ C;  1OEB A;  2J6K A;  1WDX A;  1VYV A;  3EHR A;  3VS0 A;  2D8H A;  1WXB A;  4RUG A;  4D8D A;  1SHG A;  2LCS A;  2DYB A;  1T3S A;  2JM9 A;  1RUW A;  2K79 A;  2RNA A;  3VS6 A;  2LMJ A;  2ABL A;  1OPL A;  2J6O A;  1HSQ A;  3IQL A;  1W1F A;  2EQI A;  1NYG A;  1GBR A;  1I07 A;  2YUP A;  3JV3 A;  3KFV A;  5IH2 A;  3SEM A;  2FPF A;  1GFD A;  3EG0 A;  3EG1 A;  1BBZ A;  2AZV A;  2GTO A;  4HVU A;  3UF4 A;  3R6N A;  1K4U S;  2RQT A;  1WX6 A;  5FW9 A;  4J9F A;  2F2X A;  2P4R A;  2DVJ A;  2FEI A;  3VRZ A;  1GFC A;  1NYF A;  2DRM A;  3I35 A;  2BZX A;  2KRO A;  2ED1 A;  2YUQ A;  1PWT A;  2W10 A;  4J9D A;  2D8J A;  3C0C A;  2YUN A;  2DNU A;  2ESW A;  3EHQ A;  1PKS A;  4Y92 A;  2DBM A;  4X1V A;  2DIL A;  3I5R A;  4OML A;  1AZE A;  1BB9 A;  1UUE A;  3SHW A;  2XMF A;  2CH4 W;  5L23 A;  2L3P A;  2SEM A;  1AEY A;  4D8K A;  1TUC A;  3VS7 A;  2GGR A;  2LQW A;  2MCN A;  2KT8 A;  1UDL A;  3EGU A;  3M0S A;  4HVW A;  2A08 A;  2DJQ A;  1X69 A;  4J9E A;  1QWE A;  3H0I A;  1ZUU A;  2RQV A;  2EGA A;  4LUE A;  1M8M A;  2GBQ A;  1H92 A;  1RLQ C;  4WCI A;  2FRW A;  4F17 A;  5IHN A;  2DRK A;  1M3A A;  4ORZ A;  2K6D A;  4CC2 A;  1X27 A;  2X3X D;  2G6F X;  4JJC A;  3FJ5 A;  2JMC A;  2GNC A;  4KRT A;  2O31 A;  2CSQ A;  3H0H A;  1A0N B;  2NWM A;  2JW4 A;  3M0R A;  3M0P A;  3ZL7 C;  1G83 A;  2FPD A;  4GLM A;  1KFZ A;  1SHF A;  1VYU A;  4JZ3 A;  2L3S A;  2MOX A;  2A28 A;  4J9C A;  4RTV A;  1MV0 B;  3TVT A;  5I22 A;  4CC3 A;  1HJD A;  1JXM A;  2K7A A;  2ECZ A;  1UJY A;  2KEA A;  4A63 B;  1PNJ A;  2KRM A;  2VVK A;  3A98 A;  1OV3 A;  1I0C A;  1HD3 A;  2DL8 A;  2JMA A;  3PVQ A;  1U5S A;  1ZX6 A;  4RTT A;  2CUB A;  2DL5 A;  1ZSG A;  2K3B A;  3VS3 A;  4J9H A;  3RBB B;  1K1Z A;  2ROL A;  1BK2 A;  3O5Z A;  2VWF A;  1VA7 A;  1IO6 A;  2LNH B;  1JEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...