2CT3A

Solution structure of the sh3 domain of the vinexin protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the SH3 domain of the Vinexin protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Vinexin
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ct3A00
2ENMA 4KRTA 2LP5A 1WDXA 1WLPB 2DL8A 1H8KA 2E5KA 1AWWA 3QWYA 4F17A 1OOTA 4LE9A 2HBWA 2GBQA 2KXDA 4LUDA 1JQQA 4OMOA 5FWCA 1JU5C 4JJCA 2CH4W 1BB9A 5IXBA 3ZL7C 1GCQC 2BTTA 1SRMA 2DJQA 2KR3A 2O88A 1BU1A 2LMJA 2QDLA 4J9GA 2JM9A 1U06A 1SPKA 4ESRA 1YWOA 2A37A 1T0JA 3PVQA 1N5ZA 4AFSC 2EYYA 1GRIA 2KGTA 3VS1A 1SSHA 2J6KA 2L3PA 2CUDA 2OJ2A 4HVUA 2HSPA 4M4ZA 2C0TA 3RBBB 2B86A 1I07A 5FWBA 1RUWA 2L3SA 2EKHA 2NUZA 2KXCA 3NMZC 1T0HA 5ECAA 4AFUC 5I22A 2K9GA 5GJWB 1ARKA 1CKBA 3UA7A 2CT4A 5EC7A 2FPFA 3EG3A 4LNPA 4CC2A 4A63B 3IQLA 2SEMA 1WIEA 2DA9A 4CC4B 1AZGB 2M51A 2JMAA 1CSKA 3KFVA 3H0FA 2CSIA 1X69A 3M0QA 2M0YA 1MV3A 1NM7A 4ZNXA 1JXMA 1ZLMA 2CSQA 1UDLA 2XMFA 2JMCA 1H92A 4HVWA 1UG1A 1FMKA 4AG1C 1T3SA 2KNBB 4X1VA 4J9CA 2JS2A 1Y57A 2EGEA 3NHNA 2GGRA 4ORZA 1YP5A 4J9BA 1UE9A 2DF6A 3M0SA 4IIMA 1WFWA 4Y92A 1JXOA 1PHTA 1UHCA 4J9HA 2OAWA 1GBRA 1GFDA 2FPDA 3I5RA 1H3HA 1M3BA 5IH2A 3EG1A 1QKWA 1NG2A 1X43A 1W1FA 4HCKA 1TG0A 2KBTA 1WX6A 2DMOA 1KSWA 1UJYA 2YUOA 1X6GA 2K3BA 4GBQA 1EFNA 3VS0A 3TVTA 1T3LA 3EG0A 1I1JA 2HDAA 1YN8A 3H0IA 4CC3A 3VRZA 1RLPC 2RF0A 2LZ6B 2JTEA 2O2OA 2PZ1A 4RTYA 4J9DA 4J9FA 1WXTA 2CH4A 1GFCA 1Y0MA 4IIOA 3SEMA 1QKXA 2BZYA 2LNHB 3JV3A 2YSQA 1KFZA 3H41A 3O5ZA 2AK5A 2CREA 1ZBJA 3NPFA 1UGVA 1W6XA 1BK2A 2K6DA 3EHQA 4F14A 2JS0A 4QT7A 2D1XA 1VYUA 2DLPA 2J7IA 1UECA 4OMQA 2DILA 2P4RA 1E6GA 2AZVA 1RLQC 4D8KA 2DE0X 2RQRA 2RMOA 1NEGA 2KT8A 3C0CA 1K0XA 3UATA 5IHKA 3EHRA 2ECZA 2CDTA 4JZ3A 2EGCA 1X2KA 1QCFA 4E6RA 3PE0A 2EYXA 2F2WA 2ABLA 2DX1A 1LCKA 4Z8AA 2YUNA 2EGAA 2FEIA 2JT4A 3M0UA 3EG2A 2FPEA 2V1QA 3VS5A 2W10A 2J06A 2VKNA 1K1ZA 3RNJA 1WXUA 4OMNA 1NYFA 4Z88A 1M30A 2GTJA 1NLPC 5IHIA 2YUPA 2X3WD 3PVLA 2KROA 1PNJA 1OV3A 2JW4A 2RQUA 4JJBA 2KRNA 1K76A 3VS2A 4R0KA 1PKTA 2A08A 2EBPA 1J3TA 1B3QA 1KIKA 2PNIA 1QWFA 1U5SA 1AWOA 1X2QA 2K7AA 1A0NB 1ZUKA 4DEXA 1K4US 1ABOA 3M0RA 3VS3A 4LUEA 5GJVB 5I11A 2J6FA 1K0SA 2RQTA 2KYMA 1VYVA 3I35A 1Z9QA 2DRKA 2OI3A 2H8HA 3LH5A 2DL3A 3NGPA 3REBB 2ROLA 2D0NA 3M0PA 4RTUA 2MCNA 1G2BA 1TUDA 1SEMA 1K9AA 1YNZA 1V1CA 1E6HA 2BZ8A 1B07A 1W70A 1AZEA 1ABQA 2F2XA 2YDLA 1M3AA 1AWXA 4RTXA 1GCQA 2D8HA 2W0ZA 2HCKA 1OEBA 4OMPA 2DBMA 4OMMA 1IO6A 1WXBA 2K79A 4CC7A 1ZSGA 2L2PA 4Z89A 1NLOC 2KEAA 1GL5A 1PWTA 2V1RA 1AOJA 3VS4A 4WCIA 2I0NA 1UHFA 1VYTA 2ED1A 2LX7A 2VVKA 3R6NA 1NEBA 3I9QA 4HXJA 2JXBA 2YUQA 2ROTA 3I5SA 4LN2A 2CT3A 1M8MA 4OMLA 2DM1A 1AD5A 2DL5A 2G6FX 5FW9A 3REAB 2ED0A 3ULRB 2RQWA 1BBZA 1AVZC 4RTTA 1M27C 2L0AA 1MUZA 2LJ0A 1AWJA 1UJ0A 1X27A 2FRWA 1VA7A 4RUGA 2A36A 2RN8A 2RQVA 2DNUA 2X3XD 1XOVA 4J9EA 3U23A 2J6OA 2EYZA 1MV0B 3SHWA 4DEYA 4JJDA 2LQWA 1UUEA 1Z9ZA 2KRSA 2LJ1A 1E7OA 1UTIA 3TSZA 2NWMA 4JPBW 5IHNA 2MOXA 2RNAA 1X6BA 1KJWA 1AEYA 1QLYA 3QWXX 2D8JA 3THKA 1I0CA 4J9IA 1HJDA 2ESWA 2GQIA 1PRMC 4HVVA 2SRCA 2RPNA 3VS7A 1HD3A 2A28A 4D8DA 2FG0A 4RTWA 4AFQC 1RI9A 2KYBA 1PKSA 2LCSA 4EIKA 2MIOA 2EQIA 1WYXA 2O9SA 1JEGA 2GTOA 2LQNA 3M0TA 2AKKA 2AZSA 2LJ3A 2K2MA 3VRYA 2F2VA 3TSWA 1OPKA 2EPDA 1YCSB 3UF4A 1GBQA 4K11A 1JO8A 3EGUA 2FO0A 1FYNA 2C0IA 1ZUYA 3CQTA 1PRLC 2EW3A 2AKLA 3A98A 2PTKA 2VWFA 1CKAA 3FJ5A 3VS6A 2IIMA 1GCPA 4GLMA 5HCKA 4AG2C 1YWPA 1M3CA 4RTVA 4AFZC 2HEQA 2O9VA 1ZUUA 2EYWA 2JM8A 1NYGA 2BZXA 2FRYA 3UA6A 2CUBA 2KT1A 1G83A 2KE9A 4JZ4A 1WI7A 1SRLA 4FSSA 1QWEA 2YT6A 4F16A 1U3OA 2DRMA 2DYBA 1SHFA 1ZX6A 2DL4A 1UFFA 2DBKA 2GNCA 5L23A 2KRMA 2DVJA 1TUCA 1HSQA 1SHGA 4RTZA 2L3QA 2DL7A 2J05A 5IXFA 3GBQA 1WA7A 1OPLA 3H0HA 2C0OA 2O31A 2EVRA 1S1NA
chains in the Genus database with same CATH superfamily
5KE3A 4C0DB 1P92A 3OSVA 2RB6A 1WLPB 2DL8A 1B34B 2HAXA 3CCEQ 1BCOA 2EFIA 2DIQA 1AWWA 3SWNC 4F17A 1H641 3OSSC 4LE9A 2DXTA 4C0GA 1YJNQ 4LUDA 1JQQA 3L2RA 2LT1A 5GAMf 2DPPB 4NL2A 4JJCA 3JSCA 3CCLQ 3G7ZA 2E3HA 1BB9A 1Y07A 3ZL7C 1GCQC 2QQSA 1KC8C 2DJQA 4GLKA 1QP3A 1VQ8Q 2OTLA 1SPKA 4ESRA 2XICA 2A37A 3PVQA 3G71A 2EYYA 3E9GA 1NZ9A 1PSEA 4M77B 2J6KA 3EGXB 1PD1A 3CCQA 1Q7YR 4A4EA 2HSPA 3RBBB 2B86A 1I07A 3NMZC 2AT1B 4QW2A 4ELYC 2FZGB 3LX7A 5KCHA 1IGUA 5GAOp 1TTHB 1BI2A 3IQLA 4X34A 4JLIA 2SEMA 2DA9A 1AZGB 2H3EB 4FYVB 4EDUA 1N6AA 3M57A 3I56T 1X69A 1MV3A 1Q86U 2CSQA 4HCZA 1M90U 1ZA1B 3EH2A 4Q5WA 5CKDA 2JMCA 1H3ZA 2E70A 4HVWA 3META 2MPXC 4PJOC 1M1GA 1N27A 4J9CA 1Y57A 3NHNA 1VQKA 1PSFA 1YP5A 5GAN5 3N5BB 1NJIU 2DF6A 4IIMA 1WFWA 1SSFA 4Y92A 1JXOA 1PHTA 1UHCA 3J80E 3CCMQ 1GBRA 1GFDA 3C4SA 3LWHA 3CCRA 2WSEE 2L5QA 3OYKA 1NG2A 3VJPA 4ZTJA 2QGGA 2OX7A 4N4GA 1WX6A 2ZPBB 1LPLA 1VOMA 4E7HA 4PJOE 1EFNA 3TVTA 1MMAA 2DEQA 2K5IA 4M7AA 3EGXA 1VQMT 1NE8A 4RCCA 5FU6C 3CCQQ 3H0IA 4CC3A 3CCMT 4M77C 3MO8A 4Y91A 2ZZDA 1WXTA 1GFCA 4PK4A 2LNHB 3DKMA 6AT1B 2YHTA 1KFZA 3GNFB 4IUTA 5GANg 1BK2A 2K6DA 5LJ3f 4WF2A 1LVKA 3OS1A 1W2BA 2J7IA 2PVGB 3E9FA 2P4RA 1QQJA 3CCEA 2LC4A 1E6GA 2AZVA 4RG8A 2GF7A 2OTLT 1RLQC 4PJOB 3CC4Q 2COZA 1U1TA 3SB2A 3CXCP 2DE0X 2E65A 1TOVA 2RQRA 2KT8A 3KXTA 3PFSA 3JCMP 1RAFB 3JRZA 3EHRA 2ECZA 2DTHA 4JZ3A 4L59A 2EYXA 3G4SQ 2F2WA 4Z8AA 3A1PA 1MMGA 2YUNA 3HFNA 4F7UA 1WPYA 3RDVA 3EG2A 4ZGJB 5KYUA 3VS5A 1M9SA 3S6WA 1VQ5A 1K1ZA 3RKYA 1VQ6A 1NLPC 1RAAB 4M77D 2X3WD 1M1KC 1EX4A 4C5GA 4C8QG 1K76A 2FHDA 2A08A 3G4ST 3CPFA 1B3QA 3T9NA 2DJZA 2PNIA 4BDZA 3VKIA 1F1BB 1QWFA 2V8KA 4FU6A 1WJSA 1A0NB 4XU1A 1K4US 2R5MA 3M0RA 5A0LA 2DXCA 2J6FA 4BE1A 3V8JA 2VUBA 1VYVA 3EFOB 2HMAA 2RH2A 5KYYB 3NGPA 1TWBA 4HCBA 4B6MA 2GCXA 3HRSA 2HBPA 1V1CA 3L2QA 1WJQA 4JRKA 4PJOG 4RMOA 2BZ8A 1B07A 1W70A 1AZEA 3M56A 5GAMe 5GMKm 4RTXA 4ZN3A 1GCQA 1XQHA 1KHCA 5GAN3 5FRNA 2CZ7B 1MMNA 4R56A 1M5Q1 2QDYB 3UWNA 2L2PA 4Z89A 3OS0A 1I4K1 4O5VA 2KEAA 3RR6A 2DZCA 3M5AA 2I0NA 3FLGA 3CMAA 4ZTFA 5AT1B 5CKFA 1WGSA 1WQWA 2HZYA 1K73R 4LN2A 4XQ3A 1PD0A 4M75A 5FW9A 2DFUA 4XTUA 5LJ5g 1M90C 2MMPA 3L42A 4RTTA 4E7JA 1VQ5Q 4C92G 3X28B 5DY9A 2QGFB 3V7RA 2F1LA 2QK0A 1PM3A 1K8AC 2WSCE 1NJIC 1XOVA 1IZ6A 4M7AB 3DLLA 2GFAA 3SHWA 4DEYA 1UUEA 2HKQB 1MNEA 4JLGA 2EQJA 2LJ1A 2DETA 3TSZA 2NWMA 3CCSA 3RIRA 1VQ7A 1VQ5T 2V8JA 2HNIA 2LT4A 3JB9F 3OW2P 4IUPA 3QWXX 3VUBA 4J9IA 2BIVA 1QCOA 2NUPB 1ZA2B 3E1SA 2GQIA 4FIBA 1UGQB 4E7SA 3OQ5A 4M78D 3C12A 4J6XA 1BCMA 4C0ZA 4C8QE 4RTWA 1XNIA 2KK4A 4C0FA 3EFSA 2LCSA 1Y96A 2MWPA 5CAIA 5GMKl 5GAN2 4A53A 2O9SA 3QJYA 1AT1B 1YHQA 2CP3A 2AKKA 4JRIA 3HRTA 3LLRA 1QMCA 5I2MA 3S3NA 2AZSA 2XDPA 2HL3A 4C92A 4LD9K 2IPOB 3QYHB 1OPKA 1EZZB 3G71Q 4RG2A 2YWWA 3QUIA 4UC4A 3CCVA 2P84A 2A3LA 3OMCA 4M77G 1FYNA 2C0IA 1VQ6Q 1NBEB 1YI2T 1PRLC 2EW3A 2VWFA 5CKEA 3FDRA 4BUGA 1GCPA 2QQ9A 4MZTA 3HTRA 1YITT 1UGSB 5J26A 4EMHA 3CD6A 3HL8A 1QVGA 1K9MR 2JM8A 2FRYA 1OQKA 3CC4T 5KYXB 3LW5E 4FSSA 1YJ9T 2K3XA 2P4TA 5D7UA 1SHFA 1ZX6A 4PFPA 4VUBA 2NLUA 3CC2A 1UFFA 2DBKA 2GNCA 1OI1A 2JJ9A 2RJDA 1VQ9A 3CPWP 5L8RE 2KVQG 1SHGA 2DL7A 1FWZA 1M1KR 2O31A 2AKLA 1S1NA 1RADB 1IRXA 2X4XA 3QJ6A 2AHJB 3QPHA 1OOTA 2C06A 4OMOA 4C8QA 3JCMJ 5FWCA 3QZ9B 5LJ3g 2K5FA 5IXBA 2E1HA 1VQOT 3OYMA 3M58A 4F04B 4FT4A 3OS2A 2LMJA 3CCET 4J9GA 2X4JA 1U06A 4XTXA 5CQXA 2K4YA 3BY7A 1N5ZA 4J6WA 2KGTA 2DTOA 3HFOA 2CP7A 2L3PA 2JVVA 3ME9A 4HVUA 4F7UG 1VQPA 3ZBDA 2C0TA 3CCUQ 3OS5A 2QYZA 1KQ1A 2L3SA 2EKHA 1I5LA 2NUZA 2E10A 2KXCA 5ECAA 5I22A 3VUZA 1ARKA 3CCVQ 4PFOA 5J3BA 1WIEA 3QSUA 4M75G 1C6VX 4FT2A 1M1FA 2M51A 1YHQT 1D3BA 2JMAA 2IG0A 3H0FA 2CSIA 2ZGWA 1HYOA 2ZPHB 1IGQA 2PUKB 3CCUT 3RKWA 2DEUA 4PKCC 3VU3C 2HQXA 1Q7YU 1H92A 1UG1A 4AG1C 2E41A 2QA4A 1G3YA 3A8MB 2EGEA 4ORZA 3SD4A 9ATCB 3S3OA 3M4YA 5KYXA 1UE9A 3M0SA 1YJWT 1JJ2A 2OAWA 3I5RA 2DVEA 4LDVA 3EG1A 3J7AF 1PG5B 1VQKQ 2Y4YA 4QQDA 1W1FA 1M2OA 4M78F 2KBTA 4C0DC 5CKBA 2I2LA 1KSWA 2YUOA 2M0OA 2PQWA 4DBFA 2GQVA 2COYA 1T3LA 3EG0A 1W2BP 1I1JA 2CZ0B 2YRDA 3QG1A 3MP8A 2OTLQ 1VQMA 5D6WA 4M77A 4OB1B 5CCAA 4L6V5 3VRZA 2LZ6B 2PZ1A 3V7SA 2EJFA 2O4XA 4M7AC 1VQLQ 3OYNA 2CH4A 3SEMA 1Y0MA 3FJPA 5KYWB 3L2VA 2E4HA 2CZ1B 3L1AA 4J6YA 3QDRB 1QVFP 3M59A 2OTJQ 2LX9A 2RHXA 3OYHA 1KG1A 3H41A 4M78G 4PNOA 1R0BG 3LGFA 1ZBJA 3NPFA 1UGVA 1W6XA 2DXBA 3A8HB 3EHQA 4F14A 5I21A 3OYGA 2XK0A 2D1XA 1VYUA 2DLPA 4OMQA 3CBOA 4QQGA 3CCLA 5HKCA 2RM4A 4P5NA 3CXCS 5LJ5j 2WSFE 4C92C 1LNXA 2R5AA 4D8KA 1NEGA 3C0CA 1K0XA 2K2VA 2CGHA 2E3IA 2CDTA 5KYNA 2FZKB 4J8OA 1K73U 3PE0A 4PJOF 1FXXA 2JN0A 4M7AF 1XTDA 5GANh 1U1SA 5GAN7 4BY6B 2QASA 4BDYA 5GANj 4YTLA 2HSEB 2FEIA 3C95A 1BIBA 3M0UA 2FPEA 1Q81U 1WHJA 4M75E 1QVGP 3GF5A 2VKNA 3OMGA 1Q86R 1NPRA 3V8LA 4OMNA 4E7LA 1NYFA 1B7TA 4A4GA 3QO3A 3PVLA 3OB9A 1PNJA 4JJNK 5LJ5f 2EWNA 4KUIA 2CP2A 2EYQA 4FW1A 2RQUA 3VS2A 2EBPA 1N9SA 4QVDA 5CR2A 4A54A 1J3TA 1VQ4Q 4OB2B 2RJEA 1TUGB 1U5SA 2K7AA 1ZUKA 3L2ZA 2NYSA 4DEXA 1ABOA 4EPCA 5GJVB 4M75C 4HT9A 3CMAQ 4ZGDB 1I8FA 2HQEA 4RTUA 1VQOA 1LJOA 3CMET 1K9AA 1D1AA 1YNZA 2VV5A 5GANf 2RHYA 1YFNA 3QIIA 1AWXA 3Q1JA 5GAN4 1MNDA 2D8HA 5DLOA 4X9CA 2W0ZA 2RO0A 3JB9I 4OMPA 1I5OB 4BD3A 1WXBA 2K79A 3NFCA 1HXDA 4HT8A 1C1AA 1VQOQ 1ZSGA 3CBPA 4GY5A 2EIFA 1YJWQ 4JDSA 3FIFA 1PWTA 3WVDB 4XU3A 2X4YA 3BDLA 4E7ZA 2YUQA 4II1A 2ROTA 2L8DA 4M78E 3JCMQ 1M8MA 4OMLA 3I56A 2CS7A 3EG9A 3X25B 2G6FX 3SWNB 3ULRB 4FW2A 4JRPA 2BE9B 2JNGA 2Z0WA 3CXCA 1OU8A 2KY9A 1TH7A 4OGCA 4XTVA 2FRWA 1VA7A 3P8HA 4BACA 4PJLA 2A36A 2RN8A 2A0FB 4XAXB 2DNUA 2X3XD 4J9EA 3U23A 1ZBXA 2MF2A 2HKNA 4JJDA 2ZPIB 3CMAT 4KULA 4M78C 1E7OA 1UTIA 5FLXE 4JPBW 5DLQE 3EH1A 1AEYA 3PT9A 5A0DA 1Y71A 3X24B 3WVEB 5GAOl 2XIDA 5A0GA 3JAME 3QKJA 2ESWA 3PTAA 4E7KA 2SRCA 1OULA 2RPNA 1VQKT 4Y28E 1HD3A 1QCNA 2A28A 4IKFA 3PIPA 3JCMf 2X4WA 3MEUA 2VGNA 1S72Q 4TVRA 5IAYA 2A7YA 1EIFA 4HCCA 4EIKA 5LJ3e 2MIOA 1Q7YC 1O9SA 1Q82C 1YBYA 3PGGA 2DERA 1RI0A 4PL6A 3CEYA 2MI6A 2CP6A 2VYTA 3VRYA 3TSWA 1KC8R 1S72T 2RJCA 1DJ7B 1YCSB 3S3MA 1GBQA 2VXFA 2Y90A 1G8XA 2LVMA 3M55A 2DKGA 4PJOD 5GAMg 3A98A 2YLBA 2PTKA 1CKAA 3FJ5A 3UT1A 5C6SA 2IIMA 5GANd 1YWPA 1N8RR 2YRCA 4LD6A 4RTVA 5GAOn 2HEQA 4ELZC 3L2WA 2KDSA 3M4GA 1MMDA 5A2QE 1ZUUA 3MP1A 4OVAA 3UA6A 1MHNA 2CUBA 4XU0A 5GAMd 2KE9A 1SRLA 2YT6A 4F16A 1TS9A 1Q81C 3F70A 2LQ8A 2FZCB 1D0ZA 1OX9A 1PC0A 1M8VA 1UGRB 2DVJA 1HSQA 4RTZA 3RERA 2JOYA 2KMTA 1WA7A 2VGMA 2C0OA 3H9NA 4KRTA 2LP5A 3MHXA 4M78A 5M9OA 3I55A 4KH0B 5GAOr 2F5KA 2LTOA 2QQAA 4IURA 3ZEHA 2HBWA 1Q95G 1WHKA 3PMIA 4V2SA 4D6WA 2LQKA 2LCLA 1NJIR 3CC7Q 1BU1A 2QDLA 4JS5A 2JM9A 1YWOA 5KYUB 1KQSP 2O01E 1GRIA 1LOJA 2E12A 5EG2A 2CUDA 2OJ2A 4M4ZA 2X51A 5FWBA 4C8QC 1RUWA 1QVGS 1JJ2P 1D1BA 5D6XA 4AFUC 1K8AR 5AYFA 2GFUA 1CKBA 3CCJT 3UA7A 2CT4A 5EC7A 4B9XA 2FPFA 4CC2A 1B34A 4LNPA 4A63B 2PU9B 3KFVA 1Y7XA 4BI8B 2JTFA 3M0QA 2HD0A 1NM7A 4ZNXA 2WACA 4KH1B 4X9DA 3OYFA 1YITQ 1ZLMA 4DQ2A 1UDLA 4QVZA 1T3SA 1QW1A 3KUFA 3I55Q 4X1VA 3CC2T 1IXDA 2E6ZA 1RAHB 3CCJQ 1VQNA 4J9BA 5J39A 4M75F 4EMKC 4OB3B 5GMKe 3V8KA 1H3HA 1M3BA 1IHWA 1YITA 2XU8A 3C94A 1QKWA 1TU0B 4L5GA 1WZOA 1UJYA 1X6GA 3CPWA 3I56Q 4CRIA 2NUTB 4GBQA 3DB3A 3EFOA 2L89A 2YLCA 4DA4A 2P0QA 3CCQT 3EFRA 1V29B 2HDAA 1QVFS 4FL6A 1YN8A 2CP5A 1YJWA 4DBRA 2RF0A 1X75C 3EG9B 4J7FA 2O2OA 4M7DE 3EGDA 4J9DA 2QQBA 3CD6Q 4J9FA 1C0MA 4OMFB 1Q82U 3JV3A 1Y96B 4DBQA 4QQ6A 2M9UA 4M7DB 1W4SA 1BKBA 2ATCB 2X35A 3G6EA 4Z02A 3OYCA 1BI1A 4OF1A 4F7UB 2JS0A 3ASKA 3M53A 4QT7A 3OY9A 1QVPA 1X6OA 1YIJQ 1UECA 2F69A 4KUDK 7AT1B 3OYLA 1VQ9T 5DM7R 2EJ9A 2RMOA 3LGLA 3UATA 1M90R 1K9MU 4XU2A 4LDYA 5FROA 2EGCA 2CKKA 1G5VA 2D9TA 1PCXA 2D0QB 2ABLA 1WJRA 1LCKA 1D0YA 2EGAA 4KGVB 4PLIA 2JT4A 2ZPEB 4LDXA 3QBYA 3TEEA 1SKUB 4C5IA 1VIEA 5CKHA 2W10A 1K73C 2E6NA 2PUOB 4J83A 3RNJA 2HQHA 1SG5A 1WXUA 5IHIA 2DXUA 1KQSS 3MP6A 2JW4A 4M75B 2FB7A 2M1HA 4J7IA 2QTVA 4JJBA 2P0KA 2KRNA 1PKTA 1K8AU 1TXQA 5LJ3j 3BFMA 1OU9A 1FX7A 3OYEA 1AWOA 2RK2A 3ER0A 3CCRQ 1XJWB 5I11A 1K0SA 2RQTA 3ZFJA 3LH5A 2H8HA 2DL3A 3REBB 3M0PA 4ANJA 2MCNA 1G2BA 1TUDA 3JB9D 2MAMA 3TQ7P 1E6HA 5IT9E 2M16A 2YDLA 1M3AA 2AIRB 1S72A 2OTJT 3P8DA 4IUQA 2HCKA 5GAOm 1OEBA 4OMMA 3CD6T 1WHLA 4CC7A 3CMEQ 1N8RU 1WHGA 1NLOC 4XTYA 2JUFA 2DAQA 3VS4A 1KD1R 4WCIA 1VQMQ 2D6FA 3JCMe 1VYTA 4E7IA 2ED1A 2VVKA 1NEBA 3I9QA 5KYWA 2KAFA 2JXBA 4ZN1A 5LJ3d 2DM1A 1AD5A 1IB8A 3OYYA 2RQWA 1BBZA 2XDDA 2QXFA 1WQ7A 2LJ0A 2KSSA 1UJ0A 1VQ4A 1X27A 1VQNT 4RUGA 4PFZA 2RD1A 4DOWA 3CC7T 3RKXA 1MV0B 2F5TX 1Z9ZA 2KRSA 4QKUA 4BE2A 2ZAEA 5GANe 3CCRT 1R8OB 5IHNA 2RNAA 3CMEA 1X6BA 3A5ZB 1KJWA 4MMLA 2QEXA 2D8JA 3THKA 1I0CA 4C8QB 1YIJA 2PVOB 5GMKh 1BYMA 4C92D 3VS7A 1X01A 2QG9B 1RAIB 2FG0A 3BDUA 4C8QF 5KYYA 2KYBA 5GMKj 2K3YA 1WHHA 1PKSA 4BI4A 2RI2A 3MPUB 1VQPT 1YJ9Q 3JB9J 3I55T 3HSBA 2MK5A 2LQNA 3M0TA 2QEXT 4MZMA 4BI3A 4CI0C 3PIOA 2OTJA 2EPDA 1JB0E 3UDCA 2VXEA 3VYHB 1JO8A 3CCVT 3EGUA 3CCUA 3CC7A 1ZUYA 1I81A 3CQTA 3G71T 4AT1B 4F7UE 2L3RA 4MDXA 5HCKA 4AG2C 1N9RA 4EMGA 1M3CA 1VQ4T 2FVUA 2QTXA 1TSFA 3PNWC 2RHZA 1RL2A 3BW1A 2RI5A 4OB0B 2EYWA 1NYGA 3FC3A 2E5QA 1VQ9Q 2EQUA 3CC4A 4JZ4A 5LJ5e 1VQLT 3FB9A 1ZHIA 2DYBA 5GAN6 2IVWA 4N0AA 4PJOA 3WXMB 4FYWB 2KRMA 2G3RA 1TUCA 3JCMc 3M54A 4M7DG 2ZPFB 3QYGB 2DD4A 1OPLA 2LRQA 1ZQ1A 2EVRA 4M7DC 2ENMA 1WDXA 2RJFA 3FEOA 3JCMW 1H8KA 3LYIA 4MZPA 2E5KA 3MJXA 4PJMA 2E64A 3QWYA 2DIGA 3X26B 4N4HA 2O4XB 3NTKA 1OX8A 2GBQA 2KXDA 4B9WA 2NUPA 4JUVA 3OBYA 1JU5C 1YIJT 4KGXB 2CH4W 2K5LA 4OP0A 5I2SA 1K9MC 4M77F 4M7DF 2BTTA 3MEAA 2DK3A 1SRMA 2KR3A 3TREA 2O88A 2K57A 4PJNA 1T0JA 3G6ET 4AFSC 3H6ZA 1M1KU 3VS1A 3JCMd 3AHUA 1SSHA 4DOVA 3E19A 3D7SB 3GIBA 4FYYB 3OW2A 5CO7A 1VQ8A 2DTIA 1VQPQ 1HK9A 4M7AD 3OW2S 1T0HA 2K9GA 5GJWB 5LJ3h 3DLMA 1OYXA 3EG3A 4C5HA 2BUDA 3CCST 4CC4B 1CSKA 4A4FA 3TU4K 2R58A 2M0YA 1KC8U 1JXMA 3BE3A 4LDWA 2XMFA 3LH0A 3MCAB 3CCSQ 1FMKA 3L2UA 2FYKA 2KNBB 5CQYA 2ZCFB 1BI3A 2JS2A 3JCMh 1BI0A 2GGRA 4M7DA 4XK8E 4DBHA 2XHCA 2RI3A 2DD5A 2V8IA 1YJNA 3MEVA 4J9HA 3GNGA 3JCMV 2FPDA 5IH2A 5KCOA 4N0AC 2FL7A 4M7AE 3CC2Q 1X43A 2B8AA 4HCKA 1TG0A 1VQ7Q 2DMOA 3NTHA 4MMKA 2RK1A 1UB4A 3A8GB 3PMTA 2EJGA 8ATCB 2K3BA 2MYSA 3OYAA 1N8RC 3OYIA 1UEBA 4OGEA 1Q86C 3VS0A 2LNVA 5GAMh 3RMSA 2LDMA 3OA6A 1VQ6T 3MEWA 3R6OA 3J81E 4N4IA 4NL3A 2XI9A 4XTZA 5GAN8 4MDWA 4A4KA 1RLPC 2JTEA 1Q81R 4RKUE 4RTYA 1IHVA 8AT1B 4IIOA 1QKXA 3JB9H 2BZYA 1BIAA 2DYIA 2YSQA 4NS5A 2VASA 1D1CA 3O5ZA 5GMKi 2AK5A 2CREA 2QI2A 1G3SA 3AT1B 1UGPB 1YHQQ 1YCYA 4NOYA 2RHUA 1OZ3A 3GPLA 3A8OB 2X9HA 2DILA 1YI2Q 1KD1U 3SDZA 5FU7B 4QVCA 1YI2A 4IUVA 1YJNT 3JCMb 2CYZB 4F7UF 4HKEA 1ZSZA 5IHKA 5CIUA 1WHMA 1X2KA 1QCFA 2CP0A 4E6RA 1U8RA 2DX1A 2QEXQ 2JZ2A 2R57A 2PVDB 3FRNA 3JB9G 1OZ2A 4O6JA 3OBWA 2V1QA 4JS4A 4IUUA 2J06A 4KT0E 4AMCA 4C92E 2VB6A 3CCLT 2YXYA 4Z88A 1M30A 2GTJA 2YUPA 2KROA 1OV3A 4C92B 4FCYA 2CZ6B 1W2BS 5GAOq 2JTMA 4R0KA 2QQRA 5LJ5h 4C8QD 1FMWA 4BE0A 1VQ8T 1KIKA 4LDUA 4M7AG 1X2QA 1RAEB 4C92F 3VS3A 4HA8A 4LUEA 3GOXA 1WNLA 2KYMA 3I35A 1Z9QA 2DRKA 2OI3A 1R77A 2ROLA 2D0NA 1G3WA 1SEMA 3HHTB 4E2FB 1SF9A 2M02A 3H8ZA 1ABQA 2F2XA 3OYJA 5GAMj 4FM4B 2BKDN 3X20B 5HK0A 2EQKA 2DBMA 3TCJA 1D09B 1VUBA 1IO6A 5FRMA 2ZPGB 3OYDA 4M77E 1M4ZA 3LWIA 1GL5A 3QXEB 3INZA 2V1RA 1AOJA 3OYBA 3O8VA 1UHFA 1VQLA 5KH6A 2LX7A 3R6NA 2XDBA 1FMVA 4HXJA 4A4HA 3CBMA 3I5SA 1VIFA 2CT3A 5KE2A 2DL5A 1MGQA 3REAB 2ED0A 3SFMA 4BB7A 2COWA 1QVFA 1ACMB 1AVZC 1M27C 2L0AA 1AHJB 1MUZA 3UPUA 3EGDB 1AWJA 4C5EA 2H3JA 3DB4A 3NTIA 3GLXA 4FSXA 3VV0A 2RQVA 4R55A 5FU6B 2Y4XA 3V7CA 2J6OA 2DO3A 1RAGB 4XTWA 2EYZA 3SWNA 2V26A 2LCCA 4E47A 2LQWA 2OAUA 2XKOC 3M9QA 4LXCA 1JBMA 3JCMX 3P8BB 2KQWA 1KQSA 4PJJA 2MOXA 3HKSA 1ZSZC 2QAZA 5CK9A 3G6EQ 1QLYA 3URGA 1HJDA 3E2UA 4KBMB 5LJ5d 1PRMC 3G1JA 4HVVA 2DZ9A 5IN1A 5HK3A 3G4SA 1KK7A 2P0PA 2RA2A 3MKDA 4ZGEB 2EKOA 4D8DA 4ATOA 2KI7A 4AFQC 1G3TA 1RI9A 1KHIA 1GXIE 3QDFA 4EMKB 4WTOB 2EQIA 1WYXA 1R0CB 1M2VB 2VC8A 4M75D 1JEGA 4J5YA 2GTOA 3RMQA 4FYXB 1D3BB 2LJ3A 3GP8A 2K2MA 2BE7D 2F2VA 3QHSA 2EAYA 2EQMA 3RESA 4RCBA 3HRUA 2QA4T 3UF4A 4K11A 1JJ2S 2HL5C 1JRIA 4BY6C 2NUTA 2FO0A 1KD1C 4PLLA 5LL6S 5CVIA 5HY6A 1D0XA 1IREB 2YRVA 4JRQA 3VS6A 1KQ2A 4GLMA 1RABB 5C0MA 3CCJA 4ME7A 4AFZC 3A8LB 2O9VA 1QP2A 5D6YA 3EAEA 1VQ7T 3VYGA 2XD0A 5FU7C 1NPPA 3RUXA 2BZXA 1Q82R 2KT1A 1G83A 1YJ9A 1WI7A 1ZSZB 4KGZB 2MWOA 2XG8D 3HPWA 1QWEA 1U3OA 2DRMA 2QA4Q 3CPWS 1RACB 2DL4A 3KBGA 1V76A 5L23A 3HP9A 1M2VA 4M7DD 1VQNQ 3QZ5B 1O75A 2RHIA 4M78B 3JCMg 3CCMA 2L3QA 4EMKA 2J05A 5IXFA 3GBQA 3H0HA
chains in the Genus database with same CATH topology
2ENMA 4KRTA 2LP5A 1WDXA 1WLPB 2DL8A 1H8KA 2E5KA 1AWWA 3QWYA 4F17A 1OOTA 4LE9A 2HBWA 2GBQA 2KXDA 4LUDA 1JQQA 4OMOA 5FWCA 1JU5C 4JJCA 2CH4W 1BB9A 5IXBA 3ZL7C 1GCQC 2BTTA 1SRMA 2DJQA 2KR3A 2O88A 1BU1A 2LMJA 2QDLA 4J9GA 2JM9A 1U06A 1SPKA 4ESRA 1YWOA 2A37A 1T0JA 3PVQA 1N5ZA 4AFSC 2EYYA 1GRIA 2KGTA 3VS1A 1SSHA 2J6KA 2L3PA 2CUDA 2OJ2A 4HVUA 2HSPA 4M4ZA 2C0TA 3RBBB 2B86A 1I07A 5FWBA 1RUWA 2L3SA 2EKHA 2NUZA 2KXCA 3NMZC 1T0HA 5ECAA 4AFUC 5I22A 2K9GA 5GJWB 1ARKA 1CKBA 3UA7A 2CT4A 5EC7A 2FPFA 3EG3A 4LNPA 4CC2A 4A63B 3IQLA 2SEMA 1WIEA 2DA9A 4CC4B 1AZGB 2M51A 2JMAA 1CSKA 3KFVA 3H0FA 2CSIA 1X69A 3M0QA 2M0YA 1MV3A 1NM7A 4ZNXA 1JXMA 1ZLMA 2CSQA 1UDLA 2XMFA 2JMCA 1H92A 4HVWA 1UG1A 1FMKA 4AG1C 1T3SA 2KNBB 4X1VA 4J9CA 2JS2A 1Y57A 2EGEA 3NHNA 2GGRA 4ORZA 1YP5A 4J9BA 1UE9A 2DF6A 3M0SA 4IIMA 1WFWA 4Y92A 1JXOA 1PHTA 1UHCA 4J9HA 2OAWA 1GBRA 1GFDA 2FPDA 3I5RA 1H3HA 1M3BA 5IH2A 3EG1A 1QKWA 1NG2A 1X43A 1W1FA 4HCKA 1TG0A 2KBTA 1WX6A 2DMOA 1KSWA 1UJYA 2YUOA 1X6GA 2K3BA 4GBQA 1EFNA 3VS0A 3TVTA 1T3LA 3EG0A 1I1JA 2HDAA 1YN8A 3H0IA 4CC3A 3VRZA 1RLPC 2RF0A 2LZ6B 2JTEA 2O2OA 2PZ1A 4RTYA 4J9DA 4J9FA 1WXTA 2CH4A 1GFCA 1Y0MA 4IIOA 3SEMA 1QKXA 2BZYA 2LNHB 3JV3A 2YSQA 1KFZA 3H41A 3O5ZA 2AK5A 2CREA 1ZBJA 3NPFA 1UGVA 1W6XA 1BK2A 2K6DA 3EHQA 4F14A 2JS0A 4QT7A 2D1XA 1VYUA 2DLPA 2J7IA 1UECA 4OMQA 2DILA 2P4RA 1E6GA 2AZVA 1RLQC 4D8KA 2DE0X 2RQRA 2RMOA 1NEGA 2KT8A 3C0CA 1K0XA 3UATA 5IHKA 3EHRA 2ECZA 2CDTA 4JZ3A 2EGCA 1X2KA 1QCFA 4E6RA 3PE0A 2EYXA 2F2WA 2ABLA 2DX1A 1LCKA 4Z8AA 2YUNA 2EGAA 2FEIA 2JT4A 3M0UA 3EG2A 2FPEA 2V1QA 3VS5A 2W10A 2J06A 2VKNA 1K1ZA 3RNJA 1WXUA 4OMNA 1NYFA 4Z88A 1M30A 2GTJA 1NLPC 5IHIA 2YUPA 2X3WD 3PVLA 2KROA 1PNJA 1OV3A 2JW4A 2RQUA 4JJBA 2KRNA 1K76A 3VS2A 4R0KA 1PKTA 2A08A 2EBPA 1J3TA 1B3QA 1KIKA 2PNIA 1QWFA 1U5SA 1AWOA 1X2QA 2K7AA 1A0NB 1ZUKA 4DEXA 1K4US 1ABOA 3M0RA 3VS3A 4LUEA 5GJVB 5I11A 2J6FA 1K0SA 2RQTA 2KYMA 1VYVA 3I35A 1Z9QA 2DRKA 2OI3A 2H8HA 3LH5A 2DL3A 3NGPA 3REBB 2ROLA 2D0NA 3M0PA 4RTUA 2MCNA 1G2BA 1TUDA 1SEMA 1K9AA 1YNZA 1V1CA 1E6HA 2BZ8A 1B07A 1W70A 1AZEA 1ABQA 2F2XA 2YDLA 1M3AA 1AWXA 4RTXA 1GCQA 2D8HA 2W0ZA 2HCKA 1OEBA 4OMPA 2DBMA 4OMMA 1IO6A 1WXBA 2K79A 4CC7A 1ZSGA 2L2PA 4Z89A 1NLOC 2KEAA 1GL5A 1PWTA 2V1RA 1AOJA 3VS4A 4WCIA 2I0NA 1UHFA 1VYTA 2ED1A 2LX7A 2VVKA 3R6NA 1NEBA 3I9QA 4HXJA 2JXBA 2YUQA 2ROTA 3I5SA 4LN2A 2CT3A 1M8MA 4OMLA 2DM1A 1AD5A 2DL5A 2G6FX 5FW9A 3REAB 2ED0A 3ULRB 2RQWA 1BBZA 1AVZC 4RTTA 1M27C 2L0AA 1MUZA 2LJ0A 1AWJA 1UJ0A 1X27A 2FRWA 1VA7A 4RUGA 2A36A 2RN8A 2RQVA 2DNUA 2X3XD 1XOVA 4J9EA 3U23A 2J6OA 2EYZA 1MV0B 3SHWA 4DEYA 4JJDA 2LQWA 1UUEA 1Z9ZA 2KRSA 2LJ1A 1E7OA 1UTIA 3TSZA 2NWMA 4JPBW 5IHNA 2MOXA 2RNAA 1X6BA 1KJWA 1AEYA 1QLYA 3QWXX 2D8JA 3THKA 1I0CA 4J9IA 1HJDA 2ESWA 2GQIA 1PRMC 4HVVA 2SRCA 2RPNA 3VS7A 1HD3A 2A28A 4D8DA 2FG0A 4RTWA 4AFQC 1RI9A 2KYBA 1PKSA 2LCSA 4EIKA 2MIOA 2EQIA 1WYXA 2O9SA 1JEGA 2GTOA 2LQNA 3M0TA 2AKKA 2AZSA 2LJ3A 2K2MA 3VRYA 2F2VA 3TSWA 1OPKA 2EPDA 1YCSB 3UF4A 1GBQA 4K11A 1JO8A 3EGUA 2FO0A 1FYNA 2C0IA 1ZUYA 3CQTA 1PRLC 2EW3A 2AKLA 3A98A 2PTKA 2VWFA 1CKAA 3FJ5A 3VS6A 2IIMA 1GCPA 4GLMA 5HCKA 4AG2C 1YWPA 1M3CA 4RTVA 4AFZC 2HEQA 2O9VA 1ZUUA 2EYWA 2JM8A 1NYGA 2BZXA 2FRYA 3UA6A 2CUBA 2KT1A 1G83A 2KE9A 4JZ4A 1WI7A 1SRLA 4FSSA 1QWEA 2YT6A 4F16A 1U3OA 2DRMA 2DYBA 1SHFA 1ZX6A 2DL4A 1UFFA 2DBKA 2GNCA 5L23A 2KRMA 2DVJA 1TUCA 1HSQA 1SHGA 4RTZA 2L3QA 2DL7A 2J05A 5IXFA 3GBQA 1WA7A 1OPLA 3H0HA 2C0OA 2O31A 2EVRA 1S1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENM A;  4KRT A;  2LP5 A;  1WDX A;  1WLP B;  2DL8 A;  1H8K A;  2E5K A;  1AWW A;  3QWY A;  4F17 A;  1OOT A;  4LE9 A;  2HBW A;  2GBQ A;  2KXD A;  4LUD A;  1JQQ A;  4OMO A;  5FWC A;  1JU5 C;  4JJC A;  2CH4 W;  1BB9 A;  5IXB A;  3ZL7 C;  1GCQ C;  2BTT A;  1SRM A;  2DJQ A;  2KR3 A;  2O88 A;  1BU1 A;  2LMJ A;  2QDL A;  4J9G A;  2JM9 A;  1U06 A;  1SPK A;  4ESR A;  1YWO A;  2A37 A;  1T0J A;  3PVQ A;  1N5Z A;  4AFS C;  2EYY A;  1GRI A;  2KGT A;  3VS1 A;  1SSH A;  2J6K A;  2L3P A;  2CUD A;  2OJ2 A;  4HVU A;  2HSP A;  4M4Z A;  2C0T A;  3RBB B;  2B86 A;  1I07 A;  5FWB A;  1RUW A;  2L3S A;  2EKH A;  2NUZ A;  2KXC A;  3NMZ C;  1T0H A;  5ECA A;  4AFU C;  5I22 A;  2K9G A;  5GJW B;  1ARK A;  1CKB A;  3UA7 A;  2CT4 A;  5EC7 A;  2FPF A;  3EG3 A;  4LNP A;  4CC2 A;  4A63 B;  3IQL A;  2SEM A;  1WIE A;  2DA9 A;  4CC4 B;  1AZG B;  2M51 A;  2JMA A;  1CSK A;  3KFV A;  3H0F A;  2CSI A;  1X69 A;  3M0Q A;  2M0Y A;  1MV3 A;  1NM7 A;  4ZNX A;  1JXM A;  1ZLM A;  2CSQ A;  1UDL A;  2XMF A;  2JMC A;  1H92 A;  4HVW A;  1UG1 A;  1FMK A;  4AG1 C;  1T3S A;  2KNB B;  4X1V A;  4J9C A;  2JS2 A;  1Y57 A;  2EGE A;  3NHN A;  2GGR A;  4ORZ A;  1YP5 A;  4J9B A;  1UE9 A;  2DF6 A;  3M0S A;  4IIM A;  1WFW A;  4Y92 A;  1JXO A;  1PHT A;  1UHC A;  4J9H A;  2OAW A;  1GBR A;  1GFD A;  2FPD A;  3I5R A;  1H3H A;  1M3B A;  5IH2 A;  3EG1 A;  1QKW A;  1NG2 A;  1X43 A;  1W1F A;  4HCK A;  1TG0 A;  2KBT A;  1WX6 A;  2DMO A;  1KSW A;  1UJY A;  2YUO A;  1X6G A;  2K3B A;  4GBQ A;  1EFN A;  3VS0 A;  3TVT A;  1T3L A;  3EG0 A;  1I1J A;  2HDA A;  1YN8 A;  3H0I A;  4CC3 A;  3VRZ A;  1RLP C;  2RF0 A;  2LZ6 B;  2JTE A;  2O2O A;  2PZ1 A;  4RTY A;  4J9D A;  4J9F A;  1WXT A;  2CH4 A;  1GFC A;  1Y0M A;  4IIO A;  3SEM A;  1QKX A;  2BZY A;  2LNH B;  3JV3 A;  2YSQ A;  1KFZ A;  3H41 A;  3O5Z A;  2AK5 A;  2CRE A;  1ZBJ A;  3NPF A;  1UGV A;  1W6X A;  1BK2 A;  2K6D A;  3EHQ A;  4F14 A;  2JS0 A;  4QT7 A;  2D1X A;  1VYU A;  2DLP A;  2J7I A;  1UEC A;  4OMQ A;  2DIL A;  2P4R A;  1E6G A;  2AZV A;  1RLQ C;  4D8K A;  2DE0 X;  2RQR A;  2RMO A;  1NEG A;  2KT8 A;  3C0C A;  1K0X A;  3UAT A;  5IHK A;  3EHR A;  2ECZ A;  2CDT A;  4JZ3 A;  2EGC A;  1X2K A;  1QCF A;  4E6R A;  3PE0 A;  2EYX A;  2F2W A;  2ABL A;  2DX1 A;  1LCK A;  4Z8A A;  2YUN A;  2EGA A;  2FEI A;  2JT4 A;  3M0U A;  3EG2 A;  2FPE A;  2V1Q A;  3VS5 A;  2W10 A;  2J06 A;  2VKN A;  1K1Z A;  3RNJ A;  1WXU A;  4OMN A;  1NYF A;  4Z88 A;  1M30 A;  2GTJ A;  1NLP C;  5IHI A;  2YUP A;  2X3W D;  3PVL A;  2KRO A;  1PNJ A;  1OV3 A;  2JW4 A;  2RQU A;  4JJB A;  2KRN A;  1K76 A;  3VS2 A;  4R0K A;  1PKT A;  2A08 A;  2EBP A;  1J3T A;  1B3Q A;  1KIK A;  2PNI A;  1QWF A;  1U5S A;  1AWO A;  1X2Q A;  2K7A A;  1A0N B;  1ZUK A;  4DEX A;  1K4U S;  1ABO A;  3M0R A;  3VS3 A;  4LUE A;  5GJV B;  5I11 A;  2J6F A;  1K0S A;  2RQT A;  2KYM A;  1VYV A;  3I35 A;  1Z9Q A;  2DRK A;  2OI3 A;  2H8H A;  3LH5 A;  2DL3 A;  3NGP A;  3REB B;  2ROL A;  2D0N A;  3M0P A;  4RTU A;  2MCN A;  1G2B A;  1TUD A;  1SEM A;  1K9A A;  1YNZ A;  1V1C A;  1E6H A;  2BZ8 A;  1B07 A;  1W70 A;  1AZE A;  1ABQ A;  2F2X A;  2YDL A;  1M3A A;  1AWX A;  4RTX A;  1GCQ A;  2D8H A;  2W0Z A;  2HCK A;  1OEB A;  4OMP A;  2DBM A;  4OMM A;  1IO6 A;  1WXB A;  2K79 A;  4CC7 A;  1ZSG A;  2L2P A;  4Z89 A;  1NLO C;  2KEA A;  1GL5 A;  1PWT A;  2V1R A;  1AOJ A;  3VS4 A;  4WCI A;  2I0N A;  1UHF A;  1VYT A;  2ED1 A;  2LX7 A;  2VVK A;  3R6N A;  1NEB A;  3I9Q A;  4HXJ A;  2JXB A;  2YUQ A;  2ROT A;  3I5S A;  4LN2 A;  2CT3 A;  1M8M A;  4OML A;  2DM1 A;  1AD5 A;  2DL5 A;  2G6F X;  5FW9 A;  3REA B;  2ED0 A;  3ULR B;  2RQW A;  1BBZ A;  1AVZ C;  4RTT A;  1M27 C;  2L0A A;  1MUZ A;  2LJ0 A;  1AWJ A;  1UJ0 A;  1X27 A;  2FRW A;  1VA7 A;  4RUG A;  2A36 A;  2RN8 A;  2RQV A;  2DNU A;  2X3X D;  1XOV A;  4J9E A;  3U23 A;  2J6O A;  2EYZ A;  1MV0 B;  3SHW A;  4DEY A;  4JJD A;  2LQW A;  1UUE A;  1Z9Z A;  2KRS A;  2LJ1 A;  1E7O A;  1UTI A;  3TSZ A;  2NWM A;  4JPB W;  5IHN A;  2MOX A;  2RNA A;  1X6B A;  1KJW A;  1AEY A;  1QLY A;  3QWX X;  2D8J A;  3THK A;  1I0C A;  4J9I A;  1HJD A;  2ESW A;  2GQI A;  1PRM C;  4HVV A;  2SRC A;  2RPN A;  3VS7 A;  1HD3 A;  2A28 A;  4D8D A;  2FG0 A;  4RTW A;  4AFQ C;  1RI9 A;  2KYB A;  1PKS A;  2LCS A;  4EIK A;  2MIO A;  2EQI A;  1WYX A;  2O9S A;  1JEG A;  2GTO A;  2LQN A;  3M0T A;  2AKK A;  2AZS A;  2LJ3 A;  2K2M A;  3VRY A;  2F2V A;  3TSW A;  1OPK A;  2EPD A;  1YCS B;  3UF4 A;  1GBQ A;  4K11 A;  1JO8 A;  3EGU A;  2FO0 A;  1FYN A;  2C0I A;  1ZUY A;  3CQT A;  1PRL C;  2EW3 A;  2AKL A;  3A98 A;  2PTK A;  2VWF A;  1CKA A;  3FJ5 A;  3VS6 A;  2IIM A;  1GCP A;  4GLM A;  5HCK A;  4AG2 C;  1YWP A;  1M3C A;  4RTV A;  4AFZ C;  2HEQ A;  2O9V A;  1ZUU A;  2EYW A;  2JM8 A;  1NYG A;  2BZX A;  2FRY A;  3UA6 A;  2CUB A;  2KT1 A;  1G83 A;  2KE9 A;  4JZ4 A;  1WI7 A;  1SRL A;  4FSS A;  1QWE A;  2YT6 A;  4F16 A;  1U3O A;  2DRM A;  2DYB A;  1SHF A;  1ZX6 A;  2DL4 A;  1UFF A;  2DBK A;  2GNC A;  5L23 A;  2KRM A;  2DVJ A;  1TUC A;  1HSQ A;  1SHG A;  4RTZ A;  2L3Q A;  2DL7 A;  2J05 A;  5IXF A;  3GBQ A;  1WA7 A;  1OPL A;  3H0H A;  2C0O A;  2O31 A;  2EVR A;  1S1N A; 
#chains in the Genus database with same CATH topology
 5KE3 A;  4C0D B;  1P92 A;  3OSV A;  2RB6 A;  1WLP B;  2DL8 A;  1B34 B;  2HAX A;  3CCE Q;  1BCO A;  2EFI A;  2DIQ A;  1AWW A;  3SWN C;  4F17 A;  1H64 1;  3OSS C;  4LE9 A;  2DXT A;  4C0G A;  1YJN Q;  4LUD A;  1JQQ A;  3L2R A;  2LT1 A;  5GAM f;  2DPP B;  4NL2 A;  4JJC A;  3JSC A;  3CCL Q;  3G7Z A;  2E3H A;  1BB9 A;  1Y07 A;  3ZL7 C;  1GCQ C;  2QQS A;  1KC8 C;  2DJQ A;  4GLK A;  1QP3 A;  1VQ8 Q;  2OTL A;  1SPK A;  4ESR A;  2XIC A;  2A37 A;  3PVQ A;  3G71 A;  2EYY A;  3E9G A;  1NZ9 A;  1PSE A;  4M77 B;  2J6K A;  3EGX B;  1PD1 A;  3CCQ A;  1Q7Y R;  4A4E A;  2HSP A;  3RBB B;  2B86 A;  1I07 A;  3NMZ C;  2AT1 B;  4QW2 A;  4ELY C;  2FZG B;  3LX7 A;  5KCH A;  1IGU A;  5GAO p;  1TTH B;  1BI2 A;  3IQL A;  4X34 A;  4JLI A;  2SEM A;  2DA9 A;  1AZG B;  2H3E B;  4FYV B;  4EDU A;  1N6A A;  3M57 A;  3I56 T;  1X69 A;  1MV3 A;  1Q86 U;  2CSQ A;  4HCZ A;  1M90 U;  1ZA1 B;  3EH2 A;  4Q5W A;  5CKD A;  2JMC A;  1H3Z A;  2E70 A;  4HVW A;  3MET A;  2MPX C;  4PJO C;  1M1G A;  1N27 A;  4J9C A;  1Y57 A;  3NHN A;  1VQK A;  1PSF A;  1YP5 A;  5GAN 5;  3N5B B;  1NJI U;  2DF6 A;  4IIM A;  1WFW A;  1SSF A;  4Y92 A;  1JXO A;  1PHT A;  1UHC A;  3J80 E;  3CCM Q;  1GBR A;  1GFD A;  3C4S A;  3LWH A;  3CCR A;  2WSE E;  2L5Q A;  3OYK A;  1NG2 A;  3VJP A;  4ZTJ A;  2QGG A;  2OX7 A;  4N4G A;  1WX6 A;  2ZPB B;  1LPL A;  1VOM A;  4E7H A;  4PJO E;  1EFN A;  3TVT A;  1MMA A;  2DEQ A;  2K5I A;  4M7A A;  3EGX A;  1VQM T;  1NE8 A;  4RCC A;  5FU6 C;  3CCQ Q;  3H0I A;  4CC3 A;  3CCM T;  4M77 C;  3MO8 A;  4Y91 A;  2ZZD A;  1WXT A;  1GFC A;  4PK4 A;  2LNH B;  3DKM A;  6AT1 B;  2YHT A;  1KFZ A;  3GNF B;  4IUT A;  5GAN g;  1BK2 A;  2K6D A;  5LJ3 f;  4WF2 A;  1LVK A;  3OS1 A;  1W2B A;  2J7I A;  2PVG B;  3E9F A;  2P4R A;  1QQJ A;  3CCE A;  2LC4 A;  1E6G A;  2AZV A;  4RG8 A;  2GF7 A;  2OTL T;  1RLQ C;  4PJO B;  3CC4 Q;  2COZ A;  1U1T A;  3SB2 A;  3CXC P;  2DE0 X;  2E65 A;  1TOV A;  2RQR A;  2KT8 A;  3KXT A;  3PFS A;  3JCM P;  1RAF B;  3JRZ A;  3EHR A;  2ECZ A;  2DTH A;  4JZ3 A;  4L59 A;  2EYX A;  3G4S Q;  2F2W A;  4Z8A A;  3A1P A;  1MMG A;  2YUN A;  3HFN A;  4F7U A;  1WPY A;  3RDV A;  3EG2 A;  4ZGJ B;  5KYU A;  3VS5 A;  1M9S A;  3S6W A;  1VQ5 A;  1K1Z A;  3RKY A;  1VQ6 A;  1NLP C;  1RAA B;  4M77 D;  2X3W D;  1M1K C;  1EX4 A;  4C5G A;  4C8Q G;  1K76 A;  2FHD A;  2A08 A;  3G4S T;  3CPF A;  1B3Q A;  3T9N A;  2DJZ A;  2PNI A;  4BDZ A;  3VKI A;  1F1B B;  1QWF A;  2V8K A;  4FU6 A;  1WJS A;  1A0N B;  4XU1 A;  1K4U S;  2R5M A;  3M0R A;  5A0L A;  2DXC A;  2J6F A;  4BE1 A;  3V8J A;  2VUB A;  1VYV A;  3EFO B;  2HMA A;  2RH2 A;  5KYY B;  3NGP A;  1TWB A;  4HCB A;  4B6M A;  2GCX A;  3HRS A;  2HBP A;  1V1C A;  3L2Q A;  1WJQ A;  4JRK A;  4PJO G;  4RMO A;  2BZ8 A;  1B07 A;  1W70 A;  1AZE A;  3M56 A;  5GAM e;  5GMK m;  4RTX A;  4ZN3 A;  1GCQ A;  1XQH A;  1KHC A;  5GAN 3;  5FRN A;  2CZ7 B;  1MMN A;  4R56 A;  1M5Q 1;  2QDY B;  3UWN A;  2L2P A;  4Z89 A;  3OS0 A;  1I4K 1;  4O5V A;  2KEA A;  3RR6 A;  2DZC A;  3M5A A;  2I0N A;  3FLG A;  3CMA A;  4ZTF A;  5AT1 B;  5CKF A;  1WGS A;  1WQW A;  2HZY A;  1K73 R;  4LN2 A;  4XQ3 A;  1PD0 A;  4M75 A;  5FW9 A;  2DFU A;  4XTU A;  5LJ5 g;  1M90 C;  2MMP A;  3L42 A;  4RTT A;  4E7J A;  1VQ5 Q;  4C92 G;  3X28 B;  5DY9 A;  2QGF B;  3V7R A;  2F1L A;  2QK0 A;  1PM3 A;  1K8A C;  2WSC E;  1NJI C;  1XOV A;  1IZ6 A;  4M7A B;  3DLL A;  2GFA A;  3SHW A;  4DEY A;  1UUE A;  2HKQ B;  1MNE A;  4JLG A;  2EQJ A;  2LJ1 A;  2DET A;  3TSZ A;  2NWM A;  3CCS A;  3RIR A;  1VQ7 A;  1VQ5 T;  2V8J A;  2HNI A;  2LT4 A;  3JB9 F;  3OW2 P;  4IUP A;  3QWX X;  3VUB A;  4J9I A;  2BIV A;  1QCO A;  2NUP B;  1ZA2 B;  3E1S A;  2GQI A;  4FIB A;  1UGQ B;  4E7S A;  3OQ5 A;  4M78 D;  3C12 A;  4J6X A;  1BCM A;  4C0Z A;  4C8Q E;  4RTW A;  1XNI A;  2KK4 A;  4C0F A;  3EFS A;  2LCS A;  1Y96 A;  2MWP A;  5CAI A;  5GMK l;  5GAN 2;  4A53 A;  2O9S A;  3QJY A;  1AT1 B;  1YHQ A;  2CP3 A;  2AKK A;  4JRI A;  3HRT A;  3LLR A;  1QMC A;  5I2M A;  3S3N A;  2AZS A;  2XDP A;  2HL3 A;  4C92 A;  4LD9 K;  2IPO B;  3QYH B;  1OPK A;  1EZZ B;  3G71 Q;  4RG2 A;  2YWW A;  3QUI A;  4UC4 A;  3CCV A;  2P84 A;  2A3L A;  3OMC A;  4M77 G;  1FYN A;  2C0I A;  1VQ6 Q;  1NBE B;  1YI2 T;  1PRL C;  2EW3 A;  2VWF A;  5CKE A;  3FDR A;  4BUG A;  1GCP A;  2QQ9 A;  4MZT A;  3HTR A;  1YIT T;  1UGS B;  5J26 A;  4EMH A;  3CD6 A;  3HL8 A;  1QVG A;  1K9M R;  2JM8 A;  2FRY A;  1OQK A;  3CC4 T;  5KYX B;  3LW5 E;  4FSS A;  1YJ9 T;  2K3X A;  2P4T A;  5D7U A;  1SHF A;  1ZX6 A;  4PFP A;  4VUB A;  2NLU A;  3CC2 A;  1UFF A;  2DBK A;  2GNC A;  1OI1 A;  2JJ9 A;  2RJD A;  1VQ9 A;  3CPW P;  5L8R E;  2KVQ G;  1SHG A;  2DL7 A;  1FWZ A;  1M1K R;  2O31 A;  2AKL A;  1S1N A;  1RAD B;  1IRX A;  2X4X A;  3QJ6 A;  2AHJ B;  3QPH A;  1OOT A;  2C06 A;  4OMO A;  4C8Q A;  3JCM J;  5FWC A;  3QZ9 B;  5LJ3 g;  2K5F A;  5IXB A;  2E1H A;  1VQO T;  3OYM A;  3M58 A;  4F04 B;  4FT4 A;  3OS2 A;  2LMJ A;  3CCE T;  4J9G A;  2X4J A;  1U06 A;  4XTX A;  5CQX A;  2K4Y A;  3BY7 A;  1N5Z A;  4J6W A;  2KGT A;  2DTO A;  3HFO A;  2CP7 A;  2L3P A;  2JVV A;  3ME9 A;  4HVU A;  4F7U G;  1VQP A;  3ZBD A;  2C0T A;  3CCU Q;  3OS5 A;  2QYZ A;  1KQ1 A;  2L3S A;  2EKH A;  1I5L A;  2NUZ A;  2E10 A;  2KXC A;  5ECA A;  5I22 A;  3VUZ A;  1ARK A;  3CCV Q;  4PFO A;  5J3B A;  1WIE A;  3QSU A;  4M75 G;  1C6V X;  4FT2 A;  1M1F A;  2M51 A;  1YHQ T;  1D3B A;  2JMA A;  2IG0 A;  3H0F A;  2CSI A;  2ZGW A;  1HYO A;  2ZPH B;  1IGQ A;  2PUK B;  3CCU T;  3RKW A;  2DEU A;  4PKC C;  3VU3 C;  2HQX A;  1Q7Y U;  1H92 A;  1UG1 A;  4AG1 C;  2E41 A;  2QA4 A;  1G3Y A;  3A8M B;  2EGE A;  4ORZ A;  3SD4 A;  9ATC B;  3S3O A;  3M4Y A;  5KYX A;  1UE9 A;  3M0S A;  1YJW T;  1JJ2 A;  2OAW A;  3I5R A;  2DVE A;  4LDV A;  3EG1 A;  3J7A F;  1PG5 B;  1VQK Q;  2Y4Y A;  4QQD A;  1W1F A;  1M2O A;  4M78 F;  2KBT A;  4C0D C;  5CKB A;  2I2L A;  1KSW A;  2YUO A;  2M0O A;  2PQW A;  4DBF A;  2GQV A;  2COY A;  1T3L A;  3EG0 A;  1W2B P;  1I1J A;  2CZ0 B;  2YRD A;  3QG1 A;  3MP8 A;  2OTL Q;  1VQM A;  5D6W A;  4M77 A;  4OB1 B;  5CCA A;  4L6V 5;  3VRZ A;  2LZ6 B;  2PZ1 A;  3V7S A;  2EJF A;  2O4X A;  4M7A C;  1VQL Q;  3OYN A;  2CH4 A;  3SEM A;  1Y0M A;  3FJP A;  5KYW B;  3L2V A;  2E4H A;  2CZ1 B;  3L1A A;  4J6Y A;  3QDR B;  1QVF P;  3M59 A;  2OTJ Q;  2LX9 A;  2RHX A;  3OYH A;  1KG1 A;  3H41 A;  4M78 G;  4PNO A;  1R0B G;  3LGF A;  1ZBJ A;  3NPF A;  1UGV A;  1W6X A;  2DXB A;  3A8H B;  3EHQ A;  4F14 A;  5I21 A;  3OYG A;  2XK0 A;  2D1X A;  1VYU A;  2DLP A;  4OMQ A;  3CBO A;  4QQG A;  3CCL A;  5HKC A;  2RM4 A;  4P5N A;  3CXC S;  5LJ5 j;  2WSF E;  4C92 C;  1LNX A;  2R5A A;  4D8K A;  1NEG A;  3C0C A;  1K0X A;  2K2V A;  2CGH A;  2E3I A;  2CDT A;  5KYN A;  2FZK B;  4J8O A;  1K73 U;  3PE0 A;  4PJO F;  1FXX A;  2JN0 A;  4M7A F;  1XTD A;  5GAN h;  1U1S A;  5GAN 7;  4BY6 B;  2QAS A;  4BDY A;  5GAN j;  4YTL A;  2HSE B;  2FEI A;  3C95 A;  1BIB A;  3M0U A;  2FPE A;  1Q81 U;  1WHJ A;  4M75 E;  1QVG P;  3GF5 A;  2VKN A;  3OMG A;  1Q86 R;  1NPR A;  3V8L A;  4OMN A;  4E7L A;  1NYF A;  1B7T A;  4A4G A;  3QO3 A;  3PVL A;  3OB9 A;  1PNJ A;  4JJN K;  5LJ5 f;  2EWN A;  4KUI A;  2CP2 A;  2EYQ A;  4FW1 A;  2RQU A;  3VS2 A;  2EBP A;  1N9S A;  4QVD A;  5CR2 A;  4A54 A;  1J3T A;  1VQ4 Q;  4OB2 B;  2RJE A;  1TUG B;  1U5S A;  2K7A A;  1ZUK A;  3L2Z A;  2NYS A;  4DEX A;  1ABO A;  4EPC A;  5GJV B;  4M75 C;  4HT9 A;  3CMA Q;  4ZGD B;  1I8F A;  2HQE A;  4RTU A;  1VQO A;  1LJO A;  3CME T;  1K9A A;  1D1A A;  1YNZ A;  2VV5 A;  5GAN f;  2RHY A;  1YFN A;  3QII A;  1AWX A;  3Q1J A;  5GAN 4;  1MND A;  2D8H A;  5DLO A;  4X9C A;  2W0Z A;  2RO0 A;  3JB9 I;  4OMP A;  1I5O B;  4BD3 A;  1WXB A;  2K79 A;  3NFC A;  1HXD A;  4HT8 A;  1C1A A;  1VQO Q;  1ZSG A;  3CBP A;  4GY5 A;  2EIF A;  1YJW Q;  4JDS A;  3FIF A;  1PWT A;  3WVD B;  4XU3 A;  2X4Y A;  3BDL A;  4E7Z A;  2YUQ A;  4II1 A;  2ROT A;  2L8D A;  4M78 E;  3JCM Q;  1M8M A;  4OML A;  3I56 A;  2CS7 A;  3EG9 A;  3X25 B;  2G6F X;  3SWN B;  3ULR B;  4FW2 A;  4JRP A;  2BE9 B;  2JNG A;  2Z0W A;  3CXC A;  1OU8 A;  2KY9 A;  1TH7 A;  4OGC A;  4XTV A;  2FRW A;  1VA7 A;  3P8H A;  4BAC A;  4PJL A;  2A36 A;  2RN8 A;  2A0F B;  4XAX B;  2DNU A;  2X3X D;  4J9E A;  3U23 A;  1ZBX A;  2MF2 A;  2HKN A;  4JJD A;  2ZPI B;  3CMA T;  4KUL A;  4M78 C;  1E7O A;  1UTI A;  5FLX E;  4JPB W;  5DLQ E;  3EH1 A;  1AEY A;  3PT9 A;  5A0D A;  1Y71 A;  3X24 B;  3WVE B;  5GAO l;  2XID A;  5A0G A;  3JAM E;  3QKJ A;  2ESW A;  3PTA A;  4E7K A;  2SRC A;  1OUL A;  2RPN A;  1VQK T;  4Y28 E;  1HD3 A;  1QCN A;  2A28 A;  4IKF A;  3PIP A;  3JCM f;  2X4W A;  3MEU A;  2VGN A;  1S72 Q;  4TVR A;  5IAY A;  2A7Y A;  1EIF A;  4HCC A;  4EIK A;  5LJ3 e;  2MIO A;  1Q7Y C;  1O9S A;  1Q82 C;  1YBY A;  3PGG A;  2DER A;  1RI0 A;  4PL6 A;  3CEY A;  2MI6 A;  2CP6 A;  2VYT A;  3VRY A;  3TSW A;  1KC8 R;  1S72 T;  2RJC A;  1DJ7 B;  1YCS B;  3S3M A;  1GBQ A;  2VXF A;  2Y90 A;  1G8X A;  2LVM A;  3M55 A;  2DKG A;  4PJO D;  5GAM g;  3A98 A;  2YLB A;  2PTK A;  1CKA A;  3FJ5 A;  3UT1 A;  5C6S A;  2IIM A;  5GAN d;  1YWP A;  1N8R R;  2YRC A;  4LD6 A;  4RTV A;  5GAO n;  2HEQ A;  4ELZ C;  3L2W A;  2KDS A;  3M4G A;  1MMD A;  5A2Q E;  1ZUU A;  3MP1 A;  4OVA A;  3UA6 A;  1MHN A;  2CUB A;  4XU0 A;  5GAM d;  2KE9 A;  1SRL A;  2YT6 A;  4F16 A;  1TS9 A;  1Q81 C;  3F70 A;  2LQ8 A;  2FZC B;  1D0Z A;  1OX9 A;  1PC0 A;  1M8V A;  1UGR B;  2DVJ A;  1HSQ A;  4RTZ A;  3RER A;  2JOY A;  2KMT A;  1WA7 A;  2VGM A;  2C0O A;  3H9N A;  4KRT A;  2LP5 A;  3MHX A;  4M78 A;  5M9O A;  3I55 A;  4KH0 B;  5GAO r;  2F5K A;  2LTO A;  2QQA A;  4IUR A;  3ZEH A;  2HBW A;  1Q95 G;  1WHK A;  3PMI A;  4V2S A;  4D6W A;  2LQK A;  2LCL A;  1NJI R;  3CC7 Q;  1BU1 A;  2QDL A;  4JS5 A;  2JM9 A;  1YWO A;  5KYU B;  1KQS P;  2O01 E;  1GRI A;  1LOJ A;  2E12 A;  5EG2 A;  2CUD A;  2OJ2 A;  4M4Z A;  2X51 A;  5FWB A;  4C8Q C;  1RUW A;  1QVG S;  1JJ2 P;  1D1B A;  5D6X A;  4AFU C;  1K8A R;  5AYF A;  2GFU A;  1CKB A;  3CCJ T;  3UA7 A;  2CT4 A;  5EC7 A;  4B9X A;  2FPF A;  4CC2 A;  1B34 A;  4LNP A;  4A63 B;  2PU9 B;  3KFV A;  1Y7X A;  4BI8 B;  2JTF A;  3M0Q A;  2HD0 A;  1NM7 A;  4ZNX A;  2WAC A;  4KH1 B;  4X9D A;  3OYF A;  1YIT Q;  1ZLM A;  4DQ2 A;  1UDL A;  4QVZ A;  1T3S A;  1QW1 A;  3KUF A;  3I55 Q;  4X1V A;  3CC2 T;  1IXD A;  2E6Z A;  1RAH B;  3CCJ Q;  1VQN A;  4J9B A;  5J39 A;  4M75 F;  4EMK C;  4OB3 B;  5GMK e;  3V8K A;  1H3H A;  1M3B A;  1IHW A;  1YIT A;  2XU8 A;  3C94 A;  1QKW A;  1TU0 B;  4L5G A;  1WZO A;  1UJY A;  1X6G A;  3CPW A;  3I56 Q;  4CRI A;  2NUT B;  4GBQ A;  3DB3 A;  3EFO A;  2L89 A;  2YLC A;  4DA4 A;  2P0Q A;  3CCQ T;  3EFR A;  1V29 B;  2HDA A;  1QVF S;  4FL6 A;  1YN8 A;  2CP5 A;  1YJW A;  4DBR A;  2RF0 A;  1X75 C;  3EG9 B;  4J7F A;  2O2O A;  4M7D E;  3EGD A;  4J9D A;  2QQB A;  3CD6 Q;  4J9F A;  1C0M A;  4OMF B;  1Q82 U;  3JV3 A;  1Y96 B;  4DBQ A;  4QQ6 A;  2M9U A;  4M7D B;  1W4S A;  1BKB A;  2ATC B;  2X35 A;  3G6E A;  4Z02 A;  3OYC A;  1BI1 A;  4OF1 A;  4F7U B;  2JS0 A;  3ASK A;  3M53 A;  4QT7 A;  3OY9 A;  1QVP A;  1X6O A;  1YIJ Q;  1UEC A;  2F69 A;  4KUD K;  7AT1 B;  3OYL A;  1VQ9 T;  5DM7 R;  2EJ9 A;  2RMO A;  3LGL A;  3UAT A;  1M90 R;  1K9M U;  4XU2 A;  4LDY A;  5FRO A;  2EGC A;  2CKK A;  1G5V A;  2D9T A;  1PCX A;  2D0Q B;  2ABL A;  1WJR A;  1LCK A;  1D0Y A;  2EGA A;  4KGV B;  4PLI A;  2JT4 A;  2ZPE B;  4LDX A;  3QBY A;  3TEE A;  1SKU B;  4C5I A;  1VIE A;  5CKH A;  2W10 A;  1K73 C;  2E6N A;  2PUO B;  4J83 A;  3RNJ A;  2HQH A;  1SG5 A;  1WXU A;  5IHI A;  2DXU A;  1KQS S;  3MP6 A;  2JW4 A;  4M75 B;  2FB7 A;  2M1H A;  4J7I A;  2QTV A;  4JJB A;  2P0K A;  2KRN A;  1PKT A;  1K8A U;  1TXQ A;  5LJ3 j;  3BFM A;  1OU9 A;  1FX7 A;  3OYE A;  1AWO A;  2RK2 A;  3ER0 A;  3CCR Q;  1XJW B;  5I11 A;  1K0S A;  2RQT A;  3ZFJ A;  3LH5 A;  2H8H A;  2DL3 A;  3REB B;  3M0P A;  4ANJ A;  2MCN A;  1G2B A;  1TUD A;  3JB9 D;  2MAM A;  3TQ7 P;  1E6H A;  5IT9 E;  2M16 A;  2YDL A;  1M3A A;  2AIR B;  1S72 A;  2OTJ T;  3P8D A;  4IUQ A;  2HCK A;  5GAO m;  1OEB A;  4OMM A;  3CD6 T;  1WHL A;  4CC7 A;  3CME Q;  1N8R U;  1WHG A;  1NLO C;  4XTY A;  2JUF A;  2DAQ A;  3VS4 A;  1KD1 R;  4WCI A;  1VQM Q;  2D6F A;  3JCM e;  1VYT A;  4E7I A;  2ED1 A;  2VVK A;  1NEB A;  3I9Q A;  5KYW A;  2KAF A;  2JXB A;  4ZN1 A;  5LJ3 d;  2DM1 A;  1AD5 A;  1IB8 A;  3OYY A;  2RQW A;  1BBZ A;  2XDD A;  2QXF A;  1WQ7 A;  2LJ0 A;  2KSS A;  1UJ0 A;  1VQ4 A;  1X27 A;  1VQN T;  4RUG A;  4PFZ A;  2RD1 A;  4DOW A;  3CC7 T;  3RKX A;  1MV0 B;  2F5T X;  1Z9Z A;  2KRS A;  4QKU A;  4BE2 A;  2ZAE A;  5GAN e;  3CCR T;  1R8O B;  5IHN A;  2RNA A;  3CME A;  1X6B A;  3A5Z B;  1KJW A;  4MML A;  2QEX A;  2D8J A;  3THK A;  1I0C A;  4C8Q B;  1YIJ A;  2PVO B;  5GMK h;  1BYM A;  4C92 D;  3VS7 A;  1X01 A;  2QG9 B;  1RAI B;  2FG0 A;  3BDU A;  4C8Q F;  5KYY A;  2KYB A;  5GMK j;  2K3Y A;  1WHH A;  1PKS A;  4BI4 A;  2RI2 A;  3MPU B;  1VQP T;  1YJ9 Q;  3JB9 J;  3I55 T;  3HSB A;  2MK5 A;  2LQN A;  3M0T A;  2QEX T;  4MZM A;  4BI3 A;  4CI0 C;  3PIO A;  2OTJ A;  2EPD A;  1JB0 E;  3UDC A;  2VXE A;  3VYH B;  1JO8 A;  3CCV T;  3EGU A;  3CCU A;  3CC7 A;  1ZUY A;  1I81 A;  3CQT A;  3G71 T;  4AT1 B;  4F7U E;  2L3R A;  4MDX A;  5HCK A;  4AG2 C;  1N9R A;  4EMG A;  1M3C A;  1VQ4 T;  2FVU A;  2QTX A;  1TSF A;  3PNW C;  2RHZ A;  1RL2 A;  3BW1 A;  2RI5 A;  4OB0 B;  2EYW A;  1NYG A;  3FC3 A;  2E5Q A;  1VQ9 Q;  2EQU A;  3CC4 A;  4JZ4 A;  5LJ5 e;  1VQL T;  3FB9 A;  1ZHI A;  2DYB A;  5GAN 6;  2IVW A;  4N0A A;  4PJO A;  3WXM B;  4FYW B;  2KRM A;  2G3R A;  1TUC A;  3JCM c;  3M54 A;  4M7D G;  2ZPF B;  3QYG B;  2DD4 A;  1OPL A;  2LRQ A;  1ZQ1 A;  2EVR A;  4M7D C;  2ENM A;  1WDX A;  2RJF A;  3FEO A;  3JCM W;  1H8K A;  3LYI A;  4MZP A;  2E5K A;  3MJX A;  4PJM A;  2E64 A;  3QWY A;  2DIG A;  3X26 B;  4N4H A;  2O4X B;  3NTK A;  1OX8 A;  2GBQ A;  2KXD A;  4B9W A;  2NUP A;  4JUV A;  3OBY A;  1JU5 C;  1YIJ T;  4KGX B;  2CH4 W;  2K5L A;  4OP0 A;  5I2S A;  1K9M C;  4M77 F;  4M7D F;  2BTT A;  3MEA A;  2DK3 A;  1SRM A;  2KR3 A;  3TRE A;  2O88 A;  2K57 A;  4PJN A;  1T0J A;  3G6E T;  4AFS C;  3H6Z A;  1M1K U;  3VS1 A;  3JCM d;  3AHU A;  1SSH A;  4DOV A;  3E19 A;  3D7S B;  3GIB A;  4FYY B;  3OW2 A;  5CO7 A;  1VQ8 A;  2DTI A;  1VQP Q;  1HK9 A;  4M7A D;  3OW2 S;  1T0H A;  2K9G A;  5GJW B;  5LJ3 h;  3DLM A;  1OYX A;  3EG3 A;  4C5H A;  2BUD A;  3CCS T;  4CC4 B;  1CSK A;  4A4F A;  3TU4 K;  2R58 A;  2M0Y A;  1KC8 U;  1JXM A;  3BE3 A;  4LDW A;  2XMF A;  3LH0 A;  3MCA B;  3CCS Q;  1FMK A;  3L2U A;  2FYK A;  2KNB B;  5CQY A;  2ZCF B;  1BI3 A;  2JS2 A;  3JCM h;  1BI0 A;  2GGR A;  4M7D A;  4XK8 E;  4DBH A;  2XHC A;  2RI3 A;  2DD5 A;  2V8I A;  1YJN A;  3MEV A;  4J9H A;  3GNG A;  3JCM V;  2FPD A;  5IH2 A;  5KCO A;  4N0A C;  2FL7 A;  4M7A E;  3CC2 Q;  1X43 A;  2B8A A;  4HCK A;  1TG0 A;  1VQ7 Q;  2DMO A;  3NTH A;  4MMK A;  2RK1 A;  1UB4 A;  3A8G B;  3PMT A;  2EJG A;  8ATC B;  2K3B A;  2MYS A;  3OYA A;  1N8R C;  3OYI A;  1UEB A;  4OGE A;  1Q86 C;  3VS0 A;  2LNV A;  5GAM h;  3RMS A;  2LDM A;  3OA6 A;  1VQ6 T;  3MEW A;  3R6O A;  3J81 E;  4N4I A;  4NL3 A;  2XI9 A;  4XTZ A;  5GAN 8;  4MDW A;  4A4K A;  1RLP C;  2JTE A;  1Q81 R;  4RKU E;  4RTY A;  1IHV A;  8AT1 B;  4IIO A;  1QKX A;  3JB9 H;  2BZY A;  1BIA A;  2DYI A;  2YSQ A;  4NS5 A;  2VAS A;  1D1C A;  3O5Z A;  5GMK i;  2AK5 A;  2CRE A;  2QI2 A;  1G3S A;  3AT1 B;  1UGP B;  1YHQ Q;  1YCY A;  4NOY A;  2RHU A;  1OZ3 A;  3GPL A;  3A8O B;  2X9H A;  2DIL A;  1YI2 Q;  1KD1 U;  3SDZ A;  5FU7 B;  4QVC A;  1YI2 A;  4IUV A;  1YJN T;  3JCM b;  2CYZ B;  4F7U F;  4HKE A;  1ZSZ A;  5IHK A;  5CIU A;  1WHM A;  1X2K A;  1QCF A;  2CP0 A;  4E6R A;  1U8R A;  2DX1 A;  2QEX Q;  2JZ2 A;  2R57 A;  2PVD B;  3FRN A;  3JB9 G;  1OZ2 A;  4O6J A;  3OBW A;  2V1Q A;  4JS4 A;  4IUU A;  2J06 A;  4KT0 E;  4AMC A;  4C92 E;  2VB6 A;  3CCL T;  2YXY A;  4Z88 A;  1M30 A;  2GTJ A;  2YUP A;  2KRO A;  1OV3 A;  4C92 B;  4FCY A;  2CZ6 B;  1W2B S;  5GAO q;  2JTM A;  4R0K A;  2QQR A;  5LJ5 h;  4C8Q D;  1FMW A;  4BE0 A;  1VQ8 T;  1KIK A;  4LDU A;  4M7A G;  1X2Q A;  1RAE B;  4C92 F;  3VS3 A;  4HA8 A;  4LUE A;  3GOX A;  1WNL A;  2KYM A;  3I35 A;  1Z9Q A;  2DRK A;  2OI3 A;  1R77 A;  2ROL A;  2D0N A;  1G3W A;  1SEM A;  3HHT B;  4E2F B;  1SF9 A;  2M02 A;  3H8Z A;  1ABQ A;  2F2X A;  3OYJ A;  5GAM j;  4FM4 B;  2BKD N;  3X20 B;  5HK0 A;  2EQK A;  2DBM A;  3TCJ A;  1D09 B;  1VUB A;  1IO6 A;  5FRM A;  2ZPG B;  3OYD A;  4M77 E;  1M4Z A;  3LWI A;  1GL5 A;  3QXE B;  3INZ A;  2V1R A;  1AOJ A;  3OYB A;  3O8V A;  1UHF A;  1VQL A;  5KH6 A;  2LX7 A;  3R6N A;  2XDB A;  1FMV A;  4HXJ A;  4A4H A;  3CBM A;  3I5S A;  1VIF A;  2CT3 A;  5KE2 A;  2DL5 A;  1MGQ A;  3REA B;  2ED0 A;  3SFM A;  4BB7 A;  2COW A;  1QVF A;  1ACM B;  1AVZ C;  1M27 C;  2L0A A;  1AHJ B;  1MUZ A;  3UPU A;  3EGD B;  1AWJ A;  4C5E A;  2H3J A;  3DB4 A;  3NTI A;  3GLX A;  4FSX A;  3VV0 A;  2RQV A;  4R55 A;  5FU6 B;  2Y4X A;  3V7C A;  2J6O A;  2DO3 A;  1RAG B;  4XTW A;  2EYZ A;  3SWN A;  2V26 A;  2LCC A;  4E47 A;  2LQW A;  2OAU A;  2XKO C;  3M9Q A;  4LXC A;  1JBM A;  3JCM X;  3P8B B;  2KQW A;  1KQS A;  4PJJ A;  2MOX A;  3HKS A;  1ZSZ C;  2QAZ A;  5CK9 A;  3G6E Q;  1QLY A;  3URG A;  1HJD A;  3E2U A;  4KBM B;  5LJ5 d;  1PRM C;  3G1J A;  4HVV A;  2DZ9 A;  5IN1 A;  5HK3 A;  3G4S A;  1KK7 A;  2P0P A;  2RA2 A;  3MKD A;  4ZGE B;  2EKO A;  4D8D A;  4ATO A;  2KI7 A;  4AFQ C;  1G3T A;  1RI9 A;  1KHI A;  1GXI E;  3QDF A;  4EMK B;  4WTO B;  2EQI A;  1WYX A;  1R0C B;  1M2V B;  2VC8 A;  4M75 D;  1JEG A;  4J5Y A;  2GTO A;  3RMQ A;  4FYX B;  1D3B B;  2LJ3 A;  3GP8 A;  2K2M A;  2BE7 D;  2F2V A;  3QHS A;  2EAY A;  2EQM A;  3RES A;  4RCB A;  3HRU A;  2QA4 T;  3UF4 A;  4K11 A;  1JJ2 S;  2HL5 C;  1JRI A;  4BY6 C;  2NUT A;  2FO0 A;  1KD1 C;  4PLL A;  5LL6 S;  5CVI A;  5HY6 A;  1D0X A;  1IRE B;  2YRV A;  4JRQ A;  3VS6 A;  1KQ2 A;  4GLM A;  1RAB B;  5C0M A;  3CCJ A;  4ME7 A;  4AFZ C;  3A8L B;  2O9V A;  1QP2 A;  5D6Y A;  3EAE A;  1VQ7 T;  3VYG A;  2XD0 A;  5FU7 C;  1NPP A;  3RUX A;  2BZX A;  1Q82 R;  2KT1 A;  1G83 A;  1YJ9 A;  1WI7 A;  1ZSZ B;  4KGZ B;  2MWO A;  2XG8 D;  3HPW A;  1QWE A;  1U3O A;  2DRM A;  2QA4 Q;  3CPW S;  1RAC B;  2DL4 A;  3KBG A;  1V76 A;  5L23 A;  3HP9 A;  1M2V A;  4M7D D;  1VQN Q;  3QZ5 B;  1O75 A;  2RHI A;  4M78 B;  3JCM g;  3CCM A;  2L3Q A;  4EMK A;  2J05 A;  5IXF A;  3GBQ A;  3H0H A; 
#chains in the Genus database with same CATH homology
 2ENM A;  4KRT A;  2LP5 A;  1WDX A;  1WLP B;  2DL8 A;  1H8K A;  2E5K A;  1AWW A;  3QWY A;  4F17 A;  1OOT A;  4LE9 A;  2HBW A;  2GBQ A;  2KXD A;  4LUD A;  1JQQ A;  4OMO A;  5FWC A;  1JU5 C;  4JJC A;  2CH4 W;  1BB9 A;  5IXB A;  3ZL7 C;  1GCQ C;  2BTT A;  1SRM A;  2DJQ A;  2KR3 A;  2O88 A;  1BU1 A;  2LMJ A;  2QDL A;  4J9G A;  2JM9 A;  1U06 A;  1SPK A;  4ESR A;  1YWO A;  2A37 A;  1T0J A;  3PVQ A;  1N5Z A;  4AFS C;  2EYY A;  1GRI A;  2KGT A;  3VS1 A;  1SSH A;  2J6K A;  2L3P A;  2CUD A;  2OJ2 A;  4HVU A;  2HSP A;  4M4Z A;  2C0T A;  3RBB B;  2B86 A;  1I07 A;  5FWB A;  1RUW A;  2L3S A;  2EKH A;  2NUZ A;  2KXC A;  3NMZ C;  1T0H A;  5ECA A;  4AFU C;  5I22 A;  2K9G A;  5GJW B;  1ARK A;  1CKB A;  3UA7 A;  2CT4 A;  5EC7 A;  2FPF A;  3EG3 A;  4LNP A;  4CC2 A;  4A63 B;  3IQL A;  2SEM A;  1WIE A;  2DA9 A;  4CC4 B;  1AZG B;  2M51 A;  2JMA A;  1CSK A;  3KFV A;  3H0F A;  2CSI A;  1X69 A;  3M0Q A;  2M0Y A;  1MV3 A;  1NM7 A;  4ZNX A;  1JXM A;  1ZLM A;  2CSQ A;  1UDL A;  2XMF A;  2JMC A;  1H92 A;  4HVW A;  1UG1 A;  1FMK A;  4AG1 C;  1T3S A;  2KNB B;  4X1V A;  4J9C A;  2JS2 A;  1Y57 A;  2EGE A;  3NHN A;  2GGR A;  4ORZ A;  1YP5 A;  4J9B A;  1UE9 A;  2DF6 A;  3M0S A;  4IIM A;  1WFW A;  4Y92 A;  1JXO A;  1PHT A;  1UHC A;  4J9H A;  2OAW A;  1GBR A;  1GFD A;  2FPD A;  3I5R A;  1H3H A;  1M3B A;  5IH2 A;  3EG1 A;  1QKW A;  1NG2 A;  1X43 A;  1W1F A;  4HCK A;  1TG0 A;  2KBT A;  1WX6 A;  2DMO A;  1KSW A;  1UJY A;  2YUO A;  1X6G A;  2K3B A;  4GBQ A;  1EFN A;  3VS0 A;  3TVT A;  1T3L A;  3EG0 A;  1I1J A;  2HDA A;  1YN8 A;  3H0I A;  4CC3 A;  3VRZ A;  1RLP C;  2RF0 A;  2LZ6 B;  2JTE A;  2O2O A;  2PZ1 A;  4RTY A;  4J9D A;  4J9F A;  1WXT A;  2CH4 A;  1GFC A;  1Y0M A;  4IIO A;  3SEM A;  1QKX A;  2BZY A;  2LNH B;  3JV3 A;  2YSQ A;  1KFZ A;  3H41 A;  3O5Z A;  2AK5 A;  2CRE A;  1ZBJ A;  3NPF A;  1UGV A;  1W6X A;  1BK2 A;  2K6D A;  3EHQ A;  4F14 A;  2JS0 A;  4QT7 A;  2D1X A;  1VYU A;  2DLP A;  2J7I A;  1UEC A;  4OMQ A;  2DIL A;  2P4R A;  1E6G A;  2AZV A;  1RLQ C;  4D8K A;  2DE0 X;  2RQR A;  2RMO A;  1NEG A;  2KT8 A;  3C0C A;  1K0X A;  3UAT A;  5IHK A;  3EHR A;  2ECZ A;  2CDT A;  4JZ3 A;  2EGC A;  1X2K A;  1QCF A;  4E6R A;  3PE0 A;  2EYX A;  2F2W A;  2ABL A;  2DX1 A;  1LCK A;  4Z8A A;  2YUN A;  2EGA A;  2FEI A;  2JT4 A;  3M0U A;  3EG2 A;  2FPE A;  2V1Q A;  3VS5 A;  2W10 A;  2J06 A;  2VKN A;  1K1Z A;  3RNJ A;  1WXU A;  4OMN A;  1NYF A;  4Z88 A;  1M30 A;  2GTJ A;  1NLP C;  5IHI A;  2YUP A;  2X3W D;  3PVL A;  2KRO A;  1PNJ A;  1OV3 A;  2JW4 A;  2RQU A;  4JJB A;  2KRN A;  1K76 A;  3VS2 A;  4R0K A;  1PKT A;  2A08 A;  2EBP A;  1J3T A;  1B3Q A;  1KIK A;  2PNI A;  1QWF A;  1U5S A;  1AWO A;  1X2Q A;  2K7A A;  1A0N B;  1ZUK A;  4DEX A;  1K4U S;  1ABO A;  3M0R A;  3VS3 A;  4LUE A;  5GJV B;  5I11 A;  2J6F A;  1K0S A;  2RQT A;  2KYM A;  1VYV A;  3I35 A;  1Z9Q A;  2DRK A;  2OI3 A;  2H8H A;  3LH5 A;  2DL3 A;  3NGP A;  3REB B;  2ROL A;  2D0N A;  3M0P A;  4RTU A;  2MCN A;  1G2B A;  1TUD A;  1SEM A;  1K9A A;  1YNZ A;  1V1C A;  1E6H A;  2BZ8 A;  1B07 A;  1W70 A;  1AZE A;  1ABQ A;  2F2X A;  2YDL A;  1M3A A;  1AWX A;  4RTX A;  1GCQ A;  2D8H A;  2W0Z A;  2HCK A;  1OEB A;  4OMP A;  2DBM A;  4OMM A;  1IO6 A;  1WXB A;  2K79 A;  4CC7 A;  1ZSG A;  2L2P A;  4Z89 A;  1NLO C;  2KEA A;  1GL5 A;  1PWT A;  2V1R A;  1AOJ A;  3VS4 A;  4WCI A;  2I0N A;  1UHF A;  1VYT A;  2ED1 A;  2LX7 A;  2VVK A;  3R6N A;  1NEB A;  3I9Q A;  4HXJ A;  2JXB A;  2YUQ A;  2ROT A;  3I5S A;  4LN2 A;  2CT3 A;  1M8M A;  4OML A;  2DM1 A;  1AD5 A;  2DL5 A;  2G6F X;  5FW9 A;  3REA B;  2ED0 A;  3ULR B;  2RQW A;  1BBZ A;  1AVZ C;  4RTT A;  1M27 C;  2L0A A;  1MUZ A;  2LJ0 A;  1AWJ A;  1UJ0 A;  1X27 A;  2FRW A;  1VA7 A;  4RUG A;  2A36 A;  2RN8 A;  2RQV A;  2DNU A;  2X3X D;  1XOV A;  4J9E A;  3U23 A;  2J6O A;  2EYZ A;  1MV0 B;  3SHW A;  4DEY A;  4JJD A;  2LQW A;  1UUE A;  1Z9Z A;  2KRS A;  2LJ1 A;  1E7O A;  1UTI A;  3TSZ A;  2NWM A;  4JPB W;  5IHN A;  2MOX A;  2RNA A;  1X6B A;  1KJW A;  1AEY A;  1QLY A;  3QWX X;  2D8J A;  3THK A;  1I0C A;  4J9I A;  1HJD A;  2ESW A;  2GQI A;  1PRM C;  4HVV A;  2SRC A;  2RPN A;  3VS7 A;  1HD3 A;  2A28 A;  4D8D A;  2FG0 A;  4RTW A;  4AFQ C;  1RI9 A;  2KYB A;  1PKS A;  2LCS A;  4EIK A;  2MIO A;  2EQI A;  1WYX A;  2O9S A;  1JEG A;  2GTO A;  2LQN A;  3M0T A;  2AKK A;  2AZS A;  2LJ3 A;  2K2M A;  3VRY A;  2F2V A;  3TSW A;  1OPK A;  2EPD A;  1YCS B;  3UF4 A;  1GBQ A;  4K11 A;  1JO8 A;  3EGU A;  2FO0 A;  1FYN A;  2C0I A;  1ZUY A;  3CQT A;  1PRL C;  2EW3 A;  2AKL A;  3A98 A;  2PTK A;  2VWF A;  1CKA A;  3FJ5 A;  3VS6 A;  2IIM A;  1GCP A;  4GLM A;  5HCK A;  4AG2 C;  1YWP A;  1M3C A;  4RTV A;  4AFZ C;  2HEQ A;  2O9V A;  1ZUU A;  2EYW A;  2JM8 A;  1NYG A;  2BZX A;  2FRY A;  3UA6 A;  2CUB A;  2KT1 A;  1G83 A;  2KE9 A;  4JZ4 A;  1WI7 A;  1SRL A;  4FSS A;  1QWE A;  2YT6 A;  4F16 A;  1U3O A;  2DRM A;  2DYB A;  1SHF A;  1ZX6 A;  2DL4 A;  1UFF A;  2DBK A;  2GNC A;  5L23 A;  2KRM A;  2DVJ A;  1TUC A;  1HSQ A;  1SHG A;  4RTZ A;  2L3Q A;  2DL7 A;  2J05 A;  5IXF A;  3GBQ A;  1WA7 A;  1OPL A;  3H0H A;  2C0O A;  2O31 A;  2EVR A;  1S1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...