2CT3A

Solution structure of the sh3 domain of the vinexin protein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
70
structure length
70
Chain Sequence
b'GSSGSSGTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinexin
publication title Solution Structure of the SH3 domain of the Vinexin protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ct3A00
4ORZA 5IHIA 1QKXA 2LQWA 1K1ZA 1GRIA 1PRMC 1Y0MA 2HCKA 3VS6A 3M0RA 1QKWA 1NLOC 1UFFA 1QLYA 2OI3A 2ECZA 1KFZA 1KIKA 2CUDA 4A63B 1JO8A 2LJ3A 4J9EA 4RTYA 1UG1A 2G6FX 1YWPA 1WDXA 2BZXA 2NWMA 1RLQC 2CT3A 5IHNA 1WXTA 2A28A 2A36A 4Z8AA 2JMCA 1RI9A 1GFDA 1RLPC 2BTTA 4QT7A 2BZ8A 4ZNXA 1CKAA 1H92A 4CC2A 1HD3A 1K4US 2NUZA 2L0AA 2W10A 2ROTA 2D1XA 2CDTA 2HSPA 3FJ5A 4K11A 4F16A 1U3OA 1WFWA 2AK5A 2DLPA 2DM1A 2YUNA 2KNBB 3VS0A 2CH4A 1MV3A 1QWEA 1T0HA 3NHNA 1ZLMA 5FWBA 3VRZA 1VYVA 4AFZC 1PKTA 2QDLA 3M0TA 2OJ2A 4M4ZA 4GLMA 2LMJA 2GTOA 2DNUA 1X6BA 1PNJA 4FSSA 2KBTA 2C0TA 2A08A 2DRKA 2D8HA 1NLPC 3I5SA 2YT6A 2VVKA 1T3SA 2EKHA 1M3CA 4OMQA 4LE9A 2LP5A 1VYTA 4Z88A 2YUPA 2FPFA 3H0FA 3LH5A 2PZ1A 1NM7A 2AKKA 2E5KA 2L2PA 2EBPA 1WX6A 3TSZA 2YUQA 2DL7A 1NYFA 1UDLA 1M30A 1MV0B 1GCPA 2DRMA 2DL3A 2LCSA 1GFCA 3M0QA 2K7AA 1Z9ZA 1I1JA 2LJ0A 2F2XA 1ARKA 2RQTA 3R6NA 2V1RA 2EGEA 1ZUUA 1QWFA 2KRMA 3EHRA 1ZBJA 1X69A 3UF4A 4F14A 2EPDA 2M0YA 4J9IA 1GBRA 4CC3A 3CQTA 2KGTA 4D8DA 2YSQA 2I0NA 1CKBA 1K0XA 1UUEA 5L23A 1UHCA 4R0KA 2SEMA 3PVQA 2K6DA 2GBQA 2J05A 2KE9A 4J9GA 2J6OA 1SSHA 2H8HA 5IXBA 1AZGB 2SRCA 1W70A 1G83A 2DL5A 4J9CA 2KXDA 2DL8A 1YP5A 3EHQA 2DBMA 3TSWA 5I11A 1SHFA 2GQIA 2X3XD 4WCIA 2K3BA 2K9GA 4RTWA 1WIEA 2LNHB 1ZUKA 1OPKA 4CC7A 3JV3A 1T0JA 1OOTA 1E7OA 2FRWA 3M0UA 1BB9A 1E6GA 2JM9A 4RTTA 2ROLA 2DVJA 3O5ZA 3H0IA 1X2KA 2C0IA 2LJ1A 1UE9A 4IIOA 2LX7A 4ESRA 3A98A 2VKNA 2KRNA 1I07A 2JMAA 2RF0A 2J06A 1YN8A 4DEXA 1NG2A 1QCFA 4JJCA 3THKA 3UA6A 2CT4A 2JTEA 2JM8A 2ED1A 3EG3A 1U06A 3I9QA 1RUWA 2PTKA 1BK2A 1BU1A 2ABLA 1OEBA 1NEGA 3RBBB 1E6HA 1NEBA 1ZX6A 1GCQC 1AWXA 4DEYA 2KT1A 2J6FA 1ABQA 1TUDA 1K9AA 2O2OA 1OV3A 1EFNA 2CUBA 2KEAA 3VS5A 1SRMA 4RUGA 4AG1C 4JJDA 4GBQA 1X2QA 1LCKA 3VS4A 3PVLA 1AWOA 3REAB 2J7IA 1YCSB 2D0NA 4OMMA 4LNPA 1S1NA 1GL5A 1JXOA 2FG0A 3U23A 1AZEA 1BBZA 2X3WD 4OMLA 2EVRA 2LZ6B 4HVWA 1CSKA 1Z9QA 1VA7A 1WXBA 4J9BA 1YWOA 2GNCA 2L3QA 4RTUA 2FPDA 2P4RA 2GTJA 3VS2A 2O9VA 1SHGA 2CSIA 4HXJA 1FYNA 2OAWA 3VS1A 1KSWA 4D8KA 2KROA 4X1VA 1JEGA 5IH2A 1J3TA 2AZSA 1X27A 2CH4W 4AFSC 3SEMA 2JXBA 2MCNA 2M51A 1SPKA 1K0SA 4IIMA 1H3HA 2KRSA 1XOVA 2K79A 1GBQA 1GCQA 1I0CA 1AVZC 2FO0A 2EGAA 1M3BA 2RPNA 3EG2A 2F2WA 3C0CA 3SHWA 4J9FA 1IO6A 1AOJA 3ZL7C 3IQLA 2RN8A 2KYMA 4Y92A 1M27C 2F2VA 1HSQA 1M8MA 2YDLA 1FMKA 2AKLA 5GJWB 2VWFA 2O31A 3EG0A 3ULRB 2O88A 1K76A 1B07A 1ABOA 5I22A 1N5ZA 1SEMA 2DF6A 5IXFA 4J9DA 1JXMA 2EQIA 3I5RA 2DYBA 3H41A 2DA9A 4E6RA 4EIKA 1UHFA 1UGVA 1TUCA 1JU5C 1V1CA 1G2BA 2YUOA 3M0PA 3M0SA 3VRYA 2DL4A 4RTVA 2KT8A 1AD5A 4JPBW 5FW9A 1X43A 2EYYA 2ENMA 2AZVA 3EGUA 3TVTA 1PHTA 1WA7A 2RQRA 2DJQA 2HBWA 2D8JA 4OMNA 3VS3A 1WXUA 3REBB 4F17A 3UA7A 1B3QA 4HVVA 1PKSA 2FPEA 1UTIA 5FWCA 2RNAA 3UATA 2DE0X 1HJDA 2MIOA 1T3LA 1X6GA 1OPLA 2KXCA 5HCKA 2CSQA 2RQWA 1NYGA 4JJBA 4Z89A 2HEQA 4HCKA 3EG1A 4OMOA 2J6KA 2C0OA 3PE0A 2RQUA 3KFVA 1YNZA 2EW3A 2L3SA 1Y57A 4RTZA 1WYXA 1SRLA 2JW4A 1M3AA 3NGPA 4HVUA 1UECA 5IHKA 2EYZA 2B86A 2BZYA 2RQVA 2O9SA 1AWJA 2RMOA 1AWWA 2XMFA 2FEIA 3NMZC 3QWYA 3VS7A 4AFQC 2JT4A 2PNIA 1VYUA 2L3PA 4AFUC 4LN2A 1ZUYA 2EGCA 2EYXA 2ESWA 2DMOA 1AEYA 4LUEA 2K2MA 2ED0A 1JQQA 1H8KA 2KR3A 2KYBA 2EYWA 3RNJA 2DILA 4OMPA 2A37A 4LUDA 5EC7A 2DBKA 1W1FA 2DX1A 2JS0A 4JZ3A 4KRTA 1PWTA 1W6XA 5GJVB 3NPFA 3GBQA 4J9HA 1TG0A 4AG2C 1UJYA 2W0ZA 4CC4B 1UJ0A 3I35A 3H0HA 4RTXA 1A0NB 2LQNA 5ECAA 1PRLC 4JZ4A 1MUZA 2FRYA 2JS2A 1U5SA 1WLPB 1WI7A 2IIMA 2V1QA 1KJWA 2GGRA 2MOXA 2CREA 3QWXX 1ZSGA 2HDAA
chains in the Genus database with same CATH superfamily
3WVDB 4EMKC 2PUOB 1QKXA 2LQWA 4PFPA 1YIJQ 2QYZA 3M0RA 5A0LA 3META 2NYSA 1D0YA 5A0GA 1NLOC 2CUDA 5KYUA 4A63B 1YITT 1UG1A 5KYYB 3PGGA 3PMIA 2EQUA 3I55T 3DB4A 1K8AR 2RB6A 1BI3A 2VXFA 4ZGJB 4C0ZA 4M77F 4QT7A 2LRQA 4ZNXA 4LDXA 4MMLA 2Y90A 2CZ7B 1Q86C 4JLGA 3SWNC 2NUZA 2L0AA 1WHJA 1VQLQ 4J8OA 2CDTA 4FW1A 3CCMQ 3FJ5A 4X9CA 5GAOn 3L2RA 3CCUT 3PIPA 1G3YA 2DLPA 3CC2Q 2YUNA 1QVFA 2HKNA 1MV3A 4EMKA 3TU4K 4XU0A 4E7ZA 3OYJA 3NHNA 3VRZA 2OX7A 2LDMA 4AFZC 1PKTA 3SFMA 3M0TA 1KHIA 3V7SA 2LMJA 1WHKA 4M75D 1YJ9A 4O5VA 2K5LA 3LX7A 2NUTA 2AIRB 1K9MR 3OBYA 4F7UG 1Y96A 4FSSA 3M56A 2C0TA 2GF7A 2A08A 1QMCA 1Q82C 3OYCA 2PUKB 2FVUA 1KQSP 2YT6A 3ER0A 3DB3A 4ELZC 3C95A 1M3CA 5CKEA 2FPFA 3WVEB 2PZ1A 1NM7A 2E3IA 5GAN4 3BDUA 4M7DE 3M9QA 2EBPA 2DTIA 3TSZA 2X4XA 3SWNA 2YUQA 4IUTA 2ZGWA 1M30A 1EX4A 1MV0B 4O6JA 1GFCA 3V8KA 2LJ0A 3R6NA 2V8JA 1MHNA 4PJOF 1VQPA 4F14A 2MMPA 4J9IA 1RAIB 2QGGA 2RD1A 4C92E 1GBRA 5I2MA 4D8DA 4M78E 2I0NA 2XDBA 1QVPA 4BI4A 2PU9B 3OQ5A 5J26A 2QAZA 3RMSA 4NL2A 4E7KA 3MEAA 3JCMJ 4J9GA 1RAFB 2H8HA 2HL3A 2E1HA 2SRCA 1JBMA 1G83A 4QKUA 3CCQA 3NTIA 2KXDA 3DLLA 3TSWA 2X3XD 3G71A 3CCVQ 1OU8A 1WIEA 1JB0E 4X9DA 3OSSC 5GMKm 2DKGA 1OPKA 4PJLA 4CC7A 3JV3A 1T0JA 1E7OA 2RK2A 1BB9A 4RTTA 1WJSA 2ZPHB 3HPWA 1PCXA 1B34B 1ZSZC 1WHLA 1UE9A 3EFOB 3QYGB 2X35A 1I5LA 1Y07A 2RF0A 3UDCA 1S72A 5LJ5f 4MDWA 4JJCA 3THKA 3PMTA 2CT4A 1YJNQ 1U06A 2OTJA 3I9QA 2PTKA 1BU1A 3HRSA 3V7CA 1G8XA 4M7AE 3LWIA 1AWXA 5GMKh 1TUDA 2O2OA 2ZPGB 1LPLA 4C8QF 2GFUA 4RUGA 4FIBA 4KH1B 3OYHA 3PVLA 4BE0A 1YCSB 2D0NA 1ZA1B 4LNPA 3E2UA 5LJ5h 1M1KC 3OS0A 4PLIA 2Y4XA 3CD6T 1GL5A 1TWBA 1JXOA 1RAEB 3G6ET 1JJ2S 1BBZA 4LDYA 3OW2S 3M55A 4OMLA 3CCJA 2EVRA 5A2QE 3J81E 1CSKA 3GNFB 1WXBA 4BACA 1ZSZA 4OB1B 3JB9D 2JNGA 2OTLQ 5IAYA 2ATCB 1I8FA 5KCHA 2XHCA 2OAWA 1KSWA 4D8KA 4X1VA 1JEGA 4C0GA 1PC0A 3TEEA 2MCNA 1K0SA 1TU0B 2PQWA 2X4YA 2KRSA 2DZCA 2HL5C 1VQOA 1KC8U 2DIGA 4OVAA 2E65A 1I4K1 2QA4Q 1AVZC 2FO0A 1XJWB 2EGAA 3EG2A 2F5KA 4J9FA 2RN8A 1XQHA 1M27C 5LJ5e 2YDLA 2KAFA 5GJWB 5CAIA 2O31A 3CMAT 3CCRT 4HKEA 4C5IA 1ABOA 4M77E 1SEMA 2LCCA 2Z0WA 1Y7XA 1OYXA 1PSFA 4EIKA 1UGVA 2RO0A 4EMGA 2CP7A 4M75F 2CGHA 2LNVA 1JU5C 3VUBA 1XNIA 4HT9A 1G2BA 3TQ7P 5FU7C 1YIJA 4JRQA 5FW9A 1LVKA 1IRXA 2ENMA 2H3JA 1N9RA 3OA6A 1W2BP 4C5GA 2HBWA 2D8JA 4PL6A 4RMOA 4BUGA 3I56Q 6AT1B 3REBB 1VQMQ 4HVVA 1PKSA 1Q95G 5KYUB 2EQMA 1PSEA 1VQ9Q 4JJBA 2QQSA 2WACA 4Z89A 2YRDA 2X51A 4BDZA 2HEQA 1JJ2A 1NJIC 3EG1A 2QG9B 2J6KA 3PE0A 2LT4A 2NUPB 2K5IA 3OBWA 4M78C 1WHGA 1SRLA 2JW4A 1M3AA 5EG2A 1U1TA 4Q5WA 1YJWQ 1VQLA 3FEOA 2XICA 4JUVA 3QDFA 5IHKA 2HKQB 1TOVA 2KSSA 2B86A 3CCMA 4LDUA 1AWJA 2CZ6B 4C8QG 2ZAEA 2ZZDA 2XI9A 4BY6C 2XG8D 2FZGB 1YHQA 2FEIA 5HKCA 3NMZC 3A8HB 4AFQC 3CC2A 3X20B 3QIIA 1KQ1A 2RK1A 1VYUA 2BE7D 1M1GA 4LN2A 4XU3A 1F1BB 2EQKA 2EGCA 4XTVA 5I21A 2ESWA 4BI3A 1RL2A 1LJOA 2DXBA 1M90C 2LQ8A 3OYBA 2KYBA 2EYWA 4PJOE 3OB9A 3V7RA 3HFNA 4LUDA 1VQNT 2DBKA 3CBPA 2RJFA 3NFCA 2A3LA 2JS0A 4JZ3A 4KRTA 2M16A 1PWTA 4R56A 4OP0A 5CKFA 5GAMd 1QP3A 1W6XA 2NUTB 5GJVB 3CC4T 1Y96B 1VQ4Q 4DOWA 5J3BA 3CCQQ 1TG0A 2EIFA 3JCMb 3JB9J 1C1AA 3H0HA 4RTXA 3G71Q 4HCCA 4M78A 1UGSB 4FSXA 2JS2A 1U5SA 2IIMA 1KJWA 2CREA 2MPXC 1PG5B 5GAMg 3FDRA 4ORZA 1K1ZA 3CMEQ 1GRIA 1PRMC 1YFNA 4KBMB 3CPWP 1FMVA 2DFUA 3RKYA 7AT1B 1N27A 3NTKA 1QLYA 2OI3A 4RCCA 1JO8A 2LJ3A 4RTYA 4BDYA 4KT0E 3CCLA 2G6FX 5FRNA 2OTJQ 2BZXA 2NWMA 4M75G 4DBQA 3CCET 2A36A 2JMCA 1RI9A 2CP0A 2QEXQ 1K73C 1GFDA 1RLPC 2BZ8A 1CKAA 2KVQG 3OYDA 1MGQA 3BFMA 1ZQ1A 3MPUB 1Y71A 2LTOA 1H641 2RHXA 4J7FA 4RKUE 2AK5A 1YI2T 2DM1A 3EG9B 2KNBB 1O9SA 1QWEA 3UT1A 1T0HA 4KUIA 3RKXA 3RDVA 3OSVA 2YHTA 4F7UF 4C8QB 4BE1A 4II1A 3QG1A 1VQ7T 1K8AU 2OJ2A 4M4ZA 3L2QA 2CKKA 1KD1C 3J80E 9ATCB 1Q81C 4BI8B 4J6YA 2EQJA 5I2SA 3CEYA 1QVFP 1IGUA 3JCMd 4LD9K 1M4ZA 2DRKA 1M1KR 1NLPC 3G1JA 2VVKA 2DJZA 3CCST 2K4YA 3CCVT 4DQ2A 4BD3A 4LE9A 4J83A 4D6WA 4BB7A 3OYAA 2E5KA 1WX6A 2YXYA 4JS4A 3JCMg 1VQ5Q 2LCSA 1Z9ZA 4PLLA 2F2XA 1FX7A 1EIFA 1VQ6T 2V1RA 1MMNA 2EGEA 1ZUUA 2EAYA 3QHSA 1QWFA 1VIFA 4L5GA 3VUZA 4WF2A 1N8RU 3UF4A 3QSUA 2M0YA 2KGTA 2QGFB 2OTLA 2MK5A 1K9MU 4OF1A 1K0XA 4ZGDB 4N4IA 1ZSZB 4FYVB 1UHCA 1HK9A 3KUFA 4R0KA 4PJMA 2HMAA 2J6OA 1SSHA 3CPFA 4GLKA 4A54A 2DL5A 3URGA 1PM3A 4E7SA 1YP5A 2QA4A 2D6FA 1SHFA 2COYA 2GQIA 4B9WA 2K9GA 1QVGA 4M75B 4A4HA 2E64A 5GAN5 4FT4A 4KH0B 3E1SA 3QJ6A 2FRWA 1R77A 2ROLA 2DVJA 3O5ZA 1RAHB 1VQKA 2P0QA 5CKHA 1WQWA 4TVRA 1YHQQ 4KGVB 3RKWA 1BIBA 2KRNA 4X34A 1OU9A 2J06A 3JB9G 4ZTFA 2JTEA 2JM8A 2DD4A 2ED1A 4XTUA 3JCMP 1RUWA 3RERA 1BIAA 5IT9E 1OEBA 1M2VB 1E6HA 4DBFA 2FYKA 1N8RR 3CC7Q 2KT1A 5FU6B 2J6FA 1BI2A 3I56A 4C5HA 1VQMA 1OV3A 2CUBA 2E6NA 3VS5A 2WSFE 2CZ1B 1SRMA 3OYIA 3A1PA 4AG1C 4JJDA 1KC8C 1X2QA 1VQ9A 2M1HA 2XD0A 3X26B 3OS1A 1D1AA 5GAOr 1SF9A 5HK0A 1S1NA 3U23A 2YWWA 3UWNA 4OGCA 1AZEA 4V2SA 4PJNA 5AT1B 1C6VX 1YJWA 3PIOA 2LZ6B 5GAMf 4OB2B 1YBYA 4XK8E 3A8GB 1YWOA 2GNCA 2RHUA 2FPDA 2P4RA 3M4YA 2EWNA 1SSFA 3EAEA 1KQSS 1D3BB 1VQ8Q 2O9VA 1SHGA 2KROA 5IH2A 1J3TA 2AZSA 4E2FB 5KCOA 3ZFJA 2M51A 4B6MA 2KY9A 1SPKA 1D0ZA 1YJ9T 4IIMA 1Q7YC 1XOVA 3CCLQ 1GBQA 5GAMh 2F2WA 2DVEA 1JRIA 1IO6A 3ZL7C 2M02A 2E5QA 3IQLA 3O8VA 2RHIA 2XKOC 2KYMA 3RESA 1VQ4A 2F2VA 3X25B 2K5FA 2VWFA 5LJ3g 2ZCFB 2GQVA 1K76A 2L8DA 5I22A 2VASA 4JLIA 1U1SA 4MMKA 1BCOA 1JXMA 4F04B 3G4SA 1FXXA 2LT1A 3VV0A 2FB7A 3MP8A 4NOYA 1VQPT 5C6SA 5LL6S 3CMEA 3M0SA 3VRYA 3FLGA 3RUXA 2X4WA 4OGEA 3X28B 2P4TA 2LVMA 3SDZA 4BY6B 1QCOA 2AZVA 5KYXA 3KBGA 3FIFA 2VV5A 5CR2A 4IUVA 4M7DD 3UA7A 4IKFA 1B3QA 2FPEA 3RIRA 5GAMe 2LX9A 4KULA 2VC8A 4F7UE 3UPUA 2KXCA 1OPLA 2CSQA 3CCQT 5IN1A 4L6V5 1NYGA 2QXFA 3AHUA 2ZPFB 2IPOB 1UEBA 3OS2A 2QEXA 3G71T 4RG8A 2C0OA 3CBMA 4J6WA 1WYXA 2QQ9A 3JCMc 4C92D 4F7UB 3QZ5B 4RG2A 3JCMf 4MZTA 4M78D 3QBYA 1BCMA 4LDWA 2BZYA 2RMOA 5FLXE 2XMFA 1IXDA 1BI1A 1JJ2P 4JRPA 1R0CB 1KD1R 1Q81R 2LCLA 3M5AA 2QTVA 4FL6A 4AFUC 3ME9A 2MWOA 2CZ0B 1YITQ 1ZUYA 4C5EA 1S72T 5KYWA 3I55Q 1MMDA 1Q86U 1AEYA 3QPHA 5CO7A 2ED0A 3RR6A 2OTJT 1H8KA 2KR3A 2DILA 2VUBA 3C4SA 5GAOm 2JN0A 1GXIE 4C0DC 5LJ3j 2XDDA 1W1FA 3C12A 2DX1A 2FL7A 3CXCP 3WXMB 3P8BB 2JTMA 4GY5A 4VUBA 4E7LA 1UJ0A 3I35A 3LLRA 2F5TX 2A0FB 4QW2A 2QQBA 3HHTB 1A0NB 1PRLC 1MUZA 2FRYA 3JCMX 1VQ5A 2DETA 1X01A 3CCJT 3EGXB 4FYWB 2MYSA 3JCMV 4LXCA 4JJNK 4CI0C 1VQKQ 2VGNA 3EFSA 3OS5A 3QDRB 4M7AD 3C94A 1OQKA 5GANj 1KFZA 1BKBA 4YTLA 2HQXA 2DAQA 2RHYA 3JCMe 3JRZA 1RLQC 1K8AC 1WXTA 1VQOT 4M7DC 3X24B 4LD6A 2MI6A 2BTTA 1H92A 1M5Q1 1OI1A 1Q86R 4CC2A 1K4US 3OYFA 3HFOA 2V8KA 2D1XA 2HAXA 2HSPA 2BE9B 3OYKA 3OW2A 4K11A 3A5ZB 2CYZB 5CQYA 1QP2A 4C92C 1U3OA 4DBRA 1G3SA 4DOVA 3S3OA 3VS0A 2CH4A 5GAN7 4ZGEB 4FCYA 3MP1A 4XAXB 3MEUA 2NLUA 1ZBXA 5GAN3 1C0MA 4ZTJA 2DK3A 1YIJT 3JSCA 2PVOB 4GLMA 4A53A 5HY6A 2DNUA 1K9MC 1Q82R 2KBTA 4OMFB 4EMKB 2D8HA 1LNXA 2E41A 2CP5A 3AT1B 3I5SA 4AT1B 4M7DA 3CC7A 1T3SA 1I81A 4M77D 2L5QA 3BE3A 1UB4A 2E3HA 2LC4A 4Z88A 3H0FA 2JJ9A 3LH5A 5GMKl 1WHMA 3ZBDA 5CK9A 3OYGA 1UGQB 4AMCA 5LJ3f 2P0PA 1UDLA 4IUQA 3T9NA 1GCPA 1UGRB 3M0QA 1VQLT 1ARKA 2RQTA 1PD1A 4C92A 2IVWA 5GAOp 3CCMT 3VU3C 3EHRA 2L3RA 3TREA 4PJJA 1X69A 2K3XA 3OYLA 1YHQT 3G4SQ 4CC3A 3CC2T 3CQTA 5DM7R 2KDSA 2ZPBB 3SWNB 2F1LA 3E9FA 1Q7YR 1CKBA 3MJXA 3QO3A 4E7IA 3S3NA 4M7AC 5L23A 1YCYA 1VQ8A 2DZ9A 1M1KU 5M9OA 2SEMA 1WQ7A 2E10A 3PVQA 2GBQA 2EJFA 2EJGA 5IXBA 2KI7A 1W70A 3KXTA 8AT1B 4J9CA 1B34A 3QXEB 2DL8A 3MEVA 3EHQA 4M78F 5I11A 3EFOA 4WCIA 2K3BA 4RTWA 3CD6Q 3L2VA 3JB9H 1ZUKA 4Y28E 3M57A 3CPWS 1D1BA 1OOTA 2I2LA 2HBPA 1E6GA 2JM9A 1EZZB 2R58A 5GAOq 3HP9A 2C0IA 3JB9F 4P5NA 1QVGP 4KUDK 3OY9A 3L1AA 4IIOA 2HQEA 4PJOD 4C8QE 4ESRA 2RI2A 3L2ZA 5GAOl 1KG1A 2VKNA 1I07A 3FB9A 1YN8A 1NG2A 5GAN8 2DEQA 1M1FA 4FM4B 2DTHA 4M7AA 1TH7A 1LOJA 2P0KA 2DERA 3RBBB 4FT2A 3GF5A 2JUFA 3M4GA 4OB0B 1ABQA 1ZA2B 5KYXB 3L2UA 2KEAA 2EKOA 2KK4A 3CMAQ 4GBQA 5CVIA 3VS4A 1AWOA 3BY7A 5GAN6 1B7TA 3REAB 1D09B 2J7IA 2VB6A 5GMKi 4M77C 4OMMA 4N4HA 4EMHA 1HXDA 4OB3B 3FJPA 4KGXB 3HSBA 2FG0A 4M7AF 1TSFA 2CS7A 2X3WD 2FHDA 5DLQE 4DA4A 2LQKA 1WHHA 2XDPA 4HVWA 2HNIA 3V8JA 1Z9QA 4EDUA 1QVFS 2GCXA 4RTUA 4IUPA 2C06A 2XIDA 4IURA 3VS2A 1OX8A 4HXJA 1FYNA 3VS1A 1NJIU 1YITA 1WJRA 1X27A 1N9SA 3SEMA 3P8DA 5CIUA 3I55A 1YJNT 1H3ZA 1H3HA 5KYWB 3BW1A 4JS5A 4M7DG 3CPWA 4PKCC 3C0CA 3SHWA 4M75E 3SB2A 1AOJA 4KGZB 3ZEHA 1RAAB 3QUIA 4Y92A 2V26A 1HSQA 1FMKA 2AKLA 4M77A 3EG0A 3ULRB 3MEWA 2K57A 3PT9A 1B07A 2EJ9A 4HCBA 2BKDN 1M90U 4QVZA 3CCUA 2DD5A 2DF6A 2DPPB 2V8IA 4J9DA 4RCBA 4C92G 2DA9A 3HTRA 2E12A 4E6RA 4M78G 4QQGA 4HA8A 5GAN2 1SG5A 3GNGA 1TUCA 3M0PA 2QDYB 1TS9A 2DL4A 1IHWA 1KQ2A 4PJOC 2PVDB 4ME7A 2KT8A 2OTLT 1AD5A 4JPBW 2X4JA 3NTHA 2EYYA 2NUPA 3EGUA 3EGDA 1VQNQ 3TVTA 1TXQA 1WA7A 2RQRA 2DJQA 3PFSA 5GMKj 1WXUA 1NBEB 4FW2A 4J7IA 4F17A 4E7JA 3A8LB 1UTIA 5FWCA 3GPLA 2RNAA 3CC4Q 3UATA 1M9SA 4ANJA 1HJDA 1T3LA 4BE2A 3GIBA 8ATCB 3OMGA 5KH6A 2QA4T 4Z02A 4FYXB 5LJ5j 1NJIR 2B8AA 4OMOA 4C0DB 1BI0A 2A7YA 2EW3A 1QCNA 1VIEA 3N5BB 3LGLA 1DJ7B 3NGPA 2QK0A 2HD0A 2O4XA 4DBHA 2HZYA 1RACB 3GOXA 4HVUA 2EYZA 1WNLA 1QW1A 4Y91A 2X9HA 2RQVA 1SKUB 1VQKT 3QWYA 3VS7A 2JT4A 4PFZA 2PNIA 3LYIA 1RADB 3H8ZA 4EPCA 2L3PA 1K73U 3G7ZA 2EYXA 4PJOA 2DMOA 4XTYA 1ZHIA 1M90R 4M7AG 5CKBA 2KMTA 4LUEA 2K2MA 5FROA 2QASA 1JQQA 2E4HA 3CCEQ 3HRTA 4QQ6A 2A37A 2BIVA 4B9XA 3E9GA 3R6OA 2K2VA 2RJCA 4L59A 3I56T 2CP2A 5LJ3d 2DTOA 1VQMT 3NPFA 3GBQA 1RAGB 5KYNA 5FU7B 1RI0A 4QVCA 1UJYA 4CC4B 1VQ9T 4C8QC 5CQXA 2DXCA 4M7DB 3E19A 1YI2Q 5ECAA 3QYHB 1KD1U 1WLPB 1Q81U 1WI7A 2V1QA 3QWXX 1ZSGA 1YJWT 3BDLA 1FMWA 5IHIA 1Y0MA 1VQ7Q 2HCKA 3VS6A 1QKWA 4C92B 2P84A 2CP6A 4M78B 1IHVA 1W4SA 4XU1A 1UFFA 2E70A 1KIKA 2ECZA 1M8VA 1R0BG 4J9EA 5D6YA 5GANd 3MP6A 1YWPA 4MZPA 1WDXA 3CCSQ 2CT3A 5IHNA 5DLOA 4Z8AA 2A28A 3EG9A 5KE2A 1K73R 3OMCA 3DKMA 1I5OB 4MDXA 2KQWA 1HD3A 3EH2A 2W10A 4M77G 5GANg 1VQ4T 3CD6A 4C8QA 5AYFA 2ROTA 3ASKA 1VQ6Q 3G6EA 5KE3A 4F16A 2PVGB 4C0FA 3A8MB 1WFWA 4N0AC 2QQRA 2R5AA 3G4ST 1G3WA 4HCZA 2R57A 1ZLMA 5FWBA 1KQSA 3QZ9B 1VYVA 3CMET 4LDVA 1V76A 2ZPEB 4M75C 1D0XA 2QDLA 3S3MA 3OW2P 4HT8A 2GTOA 2CP3A 2DXUA 2WSEE 2FZKB 2RI5A 1X6BA 1PNJA 4IUUA 4JRKA 1G3TA 3JCMW 1X6OA 2M9UA 2RJEA 2RA2A 4M7AB 1IGQA 2EKHA 3JCMh 4OMQA 3VJPA 2LP5A 1VYTA 2YUPA 2AKKA 2WSCE 2L2PA 3OYYA 3EFRA 2QEXT 3CMAA 2YLCA 3CCRA 1VUBA 4ELYC 2DL7A 2XU8A 2IG0A 1NYFA 2DRMA 2DL3A 2K7AA 1I1JA 3VYGA 2Y4YA 3P8HA 4N0AA 2KRMA 1ZBJA 3CCUQ 5FU6C 4PK4A 4XU2A 2EPDA 2RHZA 1IREB 3H6ZA 3M54A 5KYYA 2YSQA 1X75C 1QQJA 5D6WA 4PJOG 3CXCS 3LGFA 3MCAB 2EYQA 4M75A 5GMKe 1Q82U 1UUEA 3SD4A 4XQ3A 1OZ2A 2O01E 2K6DA 2J05A 2KE9A 4NS5A 1AZGB 3Q1JA 3CBOA 3GLXA 3J7AF 1G5VA 2HSEB 3FRNA 2DBMA 3M58A 4ATOA 2JZ2A 3LW5E 2LNHB 1U8RA 4A4EA 2HQHA 1PD0A 2JOYA 5HK3A 4ZN1A 2ZPIB 3M0UA 2VYTA 4J6XA 3V8LA 4E7HA 5DY9A 3H0IA 1VQ5T 1M2VA 3INZA 4M77B 1Q7YU 1X2KA 4NL3A 2DYIA 2LJ1A 3HRUA 2LX7A 3A98A 2JVVA 2RM4A 4R55A 2JMAA 1W2BS 4DEXA 1QCFA 3UA6A 5C0MA 1NZ9A 1YJ9Q 3EG3A 3HKSA 1BK2A 2ABLA 1NEGA 1VQNA 1NEBA 4UC4A 1ZX6A 1N8RC 1GCQC 2L89A 4A4KA 4DEYA 1K9AA 3EGDB 4N4GA 1RABB 1EFNA 3OYEA 3CC4A 3VYHB 1KC8R 3RMQA 1MMAA 1LCKA 2D9TA 1UGPB 4XTWA 1XTDA 1D3BA 4FYYB 3L2WA 3F70A 3FC3A 2RJDA 2FZCB 2XK0A 1KHCA 3QKJA 1VQPQ 2YRVA 1VOMA 3CXCA 1V29B 2MF2A 1VA7A 4J9BA 3PTAA 2O4XB 1R8OB 2L3QA 1OZ3A 2GTJA 2CSIA 2QTXA 2BUDA 5A0DA 2CH4W 4AFSC 2JXBA 4M7DF 4QVDA 2GFAA 3TCJA 3CCEA 4PJOB 2K79A 2VGMA 1GCQA 1FWZA 2YRCA 4ZN3A 3JB9I 1I0CA 4FU6A 5LJ3h 1M3BA 2RPNA 3M59A 3CC7T 1IZ6A 1M8MA 3H9NA 2AT1B 4C92F 1NE8A 5GANf 2O88A 2RI3A 1HYOA 3LH0A 2JTFA 3JCMQ 1WJQA 1N5ZA 1YI2A 5IXFA 3HL8A 2EQIA 3I5RA 2H3EB 1W2BA 2DYBA 4J5YA 3G6EQ 3H41A 1WGSA 3QJYA 1UHFA 1NPPA 1WPYA 3OYMA 1V1CA 1S72Q 2YUOA 3DLMA 1VQ7A 4JRIA 4RTVA 1MMGA 1X43A 1AT1B 3JAME 5FRMA 1WZOA 1ACMB 5GANh 2MAMA 1PHTA 1VQ8T 4OMNA 3VS3A 5L8RE 4A4FA 4F7UA 2QQAA 1TTHB 5D6XA 2DE0X 5LJ3e 3EH1A 3CCSA 4XTXA 2MIOA 3CCVA 1X6GA 5HCKA 2RQWA 3CCLT 4HCKA 2MWPA 2DEUA 3S6WA 1QVGS 2R5MA 2RQUA 3KFVA 1YNZA 5J39A 2L3SA 3PNWC 1Y57A 4RTZA 5LJ5d 2K3YA 1N6AA 3CCRQ 1NPRA 3CCJQ 1UECA 1VQ6A 5CKDA 4E47A 2O9SA 4CRIA 2RH2A 1AWWA 4JDSA 1O75A 4A4GA 1TUGB 1MNEA 1BYMA 1P92A 1YJNA 2F69A 2COZA 1OX9A 1OULA 5LJ5g 5CCAA 1IB8A 2D0QB 2EFIA 2DXTA 1AHJB 3VKIA 4PFOA 5GANe 4QQDA 5D7UA 2G3RA 3M53A 3RNJA 2QI2A 1VQOQ 4XTZA 4OMPA 2DO3A 2VXEA 2YLBA 5GAMj 5EC7A 2AHJB 3L42A 1MNDA 4MZMA 4WTOB 3EGXA 3D7SB 2M0OA 2DIQA 3MHXA 4J9HA 3GP8A 4AG2C 2W0ZA 2E6ZA 3MO8A 2LQNA 1D1CA 4JZ4A 4C8QD 3A8OB 4PNOA 2MOXA 2GGRA 2COWA 1KK7A 1M2OA 2OAUA 3MKDA 3LWHA 2HDAA 3OYNA
chains in the Genus database with same CATH topology
4ORZA 5IHIA 1QKXA 2LQWA 1K1ZA 1GRIA 1PRMC 1Y0MA 2HCKA 3VS6A 3M0RA 1QKWA 1NLOC 1UFFA 1QLYA 2OI3A 2ECZA 1KFZA 1KIKA 2CUDA 4A63B 1JO8A 2LJ3A 4J9EA 4RTYA 1UG1A 2G6FX 1YWPA 1WDXA 2BZXA 2NWMA 1RLQC 2CT3A 5IHNA 1WXTA 2A28A 2A36A 4Z8AA 2JMCA 1RI9A 1GFDA 1RLPC 2BTTA 4QT7A 2BZ8A 4ZNXA 1CKAA 1H92A 4CC2A 1HD3A 1K4US 2NUZA 2L0AA 2W10A 2ROTA 2D1XA 2CDTA 2HSPA 3FJ5A 4K11A 4F16A 1U3OA 1WFWA 2AK5A 2DLPA 2DM1A 2YUNA 2KNBB 3VS0A 2CH4A 1MV3A 1QWEA 1T0HA 3NHNA 1ZLMA 5FWBA 3VRZA 1VYVA 4AFZC 1PKTA 2QDLA 3M0TA 2OJ2A 4M4ZA 4GLMA 2LMJA 2GTOA 2DNUA 1X6BA 1PNJA 4FSSA 2KBTA 2C0TA 2A08A 2DRKA 2D8HA 1NLPC 3I5SA 2YT6A 2VVKA 1T3SA 2EKHA 1M3CA 4OMQA 4LE9A 2LP5A 1VYTA 4Z88A 2YUPA 2FPFA 3H0FA 3LH5A 2PZ1A 1NM7A 2AKKA 2E5KA 2L2PA 2EBPA 1WX6A 3TSZA 2YUQA 2DL7A 1NYFA 1UDLA 1M30A 1MV0B 1GCPA 2DRMA 2DL3A 2LCSA 1GFCA 3M0QA 2K7AA 1Z9ZA 1I1JA 2LJ0A 2F2XA 1ARKA 2RQTA 3R6NA 2V1RA 2EGEA 1ZUUA 1QWFA 2KRMA 3EHRA 1ZBJA 1X69A 3UF4A 4F14A 2EPDA 2M0YA 4J9IA 1GBRA 4CC3A 3CQTA 2KGTA 4D8DA 2YSQA 2I0NA 1CKBA 1K0XA 1UUEA 5L23A 1UHCA 4R0KA 2SEMA 3PVQA 2K6DA 2GBQA 2J05A 2KE9A 4J9GA 2J6OA 1SSHA 2H8HA 5IXBA 1AZGB 2SRCA 1W70A 1G83A 2DL5A 4J9CA 2KXDA 2DL8A 1YP5A 3EHQA 2DBMA 3TSWA 5I11A 1SHFA 2GQIA 2X3XD 4WCIA 2K3BA 2K9GA 4RTWA 1WIEA 2LNHB 1ZUKA 1OPKA 4CC7A 3JV3A 1T0JA 1OOTA 1E7OA 2FRWA 3M0UA 1BB9A 1E6GA 2JM9A 4RTTA 2ROLA 2DVJA 3O5ZA 3H0IA 1X2KA 2C0IA 2LJ1A 1UE9A 4IIOA 2LX7A 4ESRA 3A98A 2VKNA 2KRNA 1I07A 2JMAA 2RF0A 2J06A 1YN8A 4DEXA 1NG2A 1QCFA 4JJCA 3THKA 3UA6A 2CT4A 2JTEA 2JM8A 2ED1A 3EG3A 1U06A 3I9QA 1RUWA 2PTKA 1BK2A 1BU1A 2ABLA 1OEBA 1NEGA 3RBBB 1E6HA 1NEBA 1ZX6A 1GCQC 1AWXA 4DEYA 2KT1A 2J6FA 1ABQA 1TUDA 1K9AA 2O2OA 1OV3A 1EFNA 2CUBA 2KEAA 3VS5A 1SRMA 4RUGA 4AG1C 4JJDA 4GBQA 1X2QA 1LCKA 3VS4A 3PVLA 1AWOA 3REAB 2J7IA 1YCSB 2D0NA 4OMMA 4LNPA 1S1NA 1GL5A 1JXOA 2FG0A 3U23A 1AZEA 1BBZA 2X3WD 4OMLA 2EVRA 2LZ6B 4HVWA 1CSKA 1Z9QA 1VA7A 1WXBA 4J9BA 1YWOA 2GNCA 2L3QA 4RTUA 2FPDA 2P4RA 2GTJA 3VS2A 2O9VA 1SHGA 2CSIA 4HXJA 1FYNA 2OAWA 3VS1A 1KSWA 4D8KA 2KROA 4X1VA 1JEGA 5IH2A 1J3TA 2AZSA 1X27A 2CH4W 4AFSC 3SEMA 2JXBA 2MCNA 2M51A 1SPKA 1K0SA 4IIMA 1H3HA 2KRSA 1XOVA 2K79A 1GBQA 1GCQA 1I0CA 1AVZC 2FO0A 2EGAA 1M3BA 2RPNA 3EG2A 2F2WA 3C0CA 3SHWA 4J9FA 1IO6A 1AOJA 3ZL7C 3IQLA 2RN8A 2KYMA 4Y92A 1M27C 2F2VA 1HSQA 1M8MA 2YDLA 1FMKA 2AKLA 5GJWB 2VWFA 2O31A 3EG0A 3ULRB 2O88A 1K76A 1B07A 1ABOA 5I22A 1N5ZA 1SEMA 2DF6A 5IXFA 4J9DA 1JXMA 2EQIA 3I5RA 2DYBA 3H41A 2DA9A 4E6RA 4EIKA 1UHFA 1UGVA 1TUCA 1JU5C 1V1CA 1G2BA 2YUOA 3M0PA 3M0SA 3VRYA 2DL4A 4RTVA 2KT8A 1AD5A 4JPBW 5FW9A 1X43A 2EYYA 2ENMA 2AZVA 3EGUA 3TVTA 1PHTA 1WA7A 2RQRA 2DJQA 2HBWA 2D8JA 4OMNA 3VS3A 1WXUA 3REBB 4F17A 3UA7A 1B3QA 4HVVA 1PKSA 2FPEA 1UTIA 5FWCA 2RNAA 3UATA 2DE0X 1HJDA 2MIOA 1T3LA 1X6GA 1OPLA 2KXCA 5HCKA 2CSQA 2RQWA 1NYGA 4JJBA 4Z89A 2HEQA 4HCKA 3EG1A 4OMOA 2J6KA 2C0OA 3PE0A 2RQUA 3KFVA 1YNZA 2EW3A 2L3SA 1Y57A 4RTZA 1WYXA 1SRLA 2JW4A 1M3AA 3NGPA 4HVUA 1UECA 5IHKA 2EYZA 2B86A 2BZYA 2RQVA 2O9SA 1AWJA 2RMOA 1AWWA 2XMFA 2FEIA 3NMZC 3QWYA 3VS7A 4AFQC 2JT4A 2PNIA 1VYUA 2L3PA 4AFUC 4LN2A 1ZUYA 2EGCA 2EYXA 2ESWA 2DMOA 1AEYA 4LUEA 2K2MA 2ED0A 1JQQA 1H8KA 2KR3A 2KYBA 2EYWA 3RNJA 2DILA 4OMPA 2A37A 4LUDA 5EC7A 2DBKA 1W1FA 2DX1A 2JS0A 4JZ3A 4KRTA 1PWTA 1W6XA 5GJVB 3NPFA 3GBQA 4J9HA 1TG0A 4AG2C 1UJYA 2W0ZA 4CC4B 1UJ0A 3I35A 3H0HA 4RTXA 1A0NB 2LQNA 5ECAA 1PRLC 4JZ4A 1MUZA 2FRYA 2JS2A 1U5SA 1WLPB 1WI7A 2IIMA 2V1QA 1KJWA 2GGRA 2MOXA 2CREA 3QWXX 1ZSGA 2HDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ORZ A;  5IHI A;  1QKX A;  2LQW A;  1K1Z A;  1GRI A;  1PRM C;  1Y0M A;  2HCK A;  3VS6 A;  3M0R A;  1QKW A;  1NLO C;  1UFF A;  1QLY A;  2OI3 A;  2ECZ A;  1KFZ A;  1KIK A;  2CUD A;  4A63 B;  1JO8 A;  2LJ3 A;  4J9E A;  4RTY A;  1UG1 A;  2G6F X;  1YWP A;  1WDX A;  2BZX A;  2NWM A;  1RLQ C;  2CT3 A;  5IHN A;  1WXT A;  2A28 A;  2A36 A;  4Z8A A;  2JMC A;  1RI9 A;  1GFD A;  1RLP C;  2BTT A;  4QT7 A;  2BZ8 A;  4ZNX A;  1CKA A;  1H92 A;  4CC2 A;  1HD3 A;  1K4U S;  2NUZ A;  2L0A A;  2W10 A;  2ROT A;  2D1X A;  2CDT A;  2HSP A;  3FJ5 A;  4K11 A;  4F16 A;  1U3O A;  1WFW A;  2AK5 A;  2DLP A;  2DM1 A;  2YUN A;  2KNB B;  3VS0 A;  2CH4 A;  1MV3 A;  1QWE A;  1T0H A;  3NHN A;  1ZLM A;  5FWB A;  3VRZ A;  1VYV A;  4AFZ C;  1PKT A;  2QDL A;  3M0T A;  2OJ2 A;  4M4Z A;  4GLM A;  2LMJ A;  2GTO A;  2DNU A;  1X6B A;  1PNJ A;  4FSS A;  2KBT A;  2C0T A;  2A08 A;  2DRK A;  2D8H A;  1NLP C;  3I5S A;  2YT6 A;  2VVK A;  1T3S A;  2EKH A;  1M3C A;  4OMQ A;  4LE9 A;  2LP5 A;  1VYT A;  4Z88 A;  2YUP A;  2FPF A;  3H0F A;  3LH5 A;  2PZ1 A;  1NM7 A;  2AKK A;  2E5K A;  2L2P A;  2EBP A;  1WX6 A;  3TSZ A;  2YUQ A;  2DL7 A;  1NYF A;  1UDL A;  1M30 A;  1MV0 B;  1GCP A;  2DRM A;  2DL3 A;  2LCS A;  1GFC A;  3M0Q A;  2K7A A;  1Z9Z A;  1I1J A;  2LJ0 A;  2F2X A;  1ARK A;  2RQT A;  3R6N A;  2V1R A;  2EGE A;  1ZUU A;  1QWF A;  2KRM A;  3EHR A;  1ZBJ A;  1X69 A;  3UF4 A;  4F14 A;  2EPD A;  2M0Y A;  4J9I A;  1GBR A;  4CC3 A;  3CQT A;  2KGT A;  4D8D A;  2YSQ A;  2I0N A;  1CKB A;  1K0X A;  1UUE A;  5L23 A;  1UHC A;  4R0K A;  2SEM A;  3PVQ A;  2K6D A;  2GBQ A;  2J05 A;  2KE9 A;  4J9G A;  2J6O A;  1SSH A;  2H8H A;  5IXB A;  1AZG B;  2SRC A;  1W70 A;  1G83 A;  2DL5 A;  4J9C A;  2KXD A;  2DL8 A;  1YP5 A;  3EHQ A;  2DBM A;  3TSW A;  5I11 A;  1SHF A;  2GQI A;  2X3X D;  4WCI A;  2K3B A;  2K9G A;  4RTW A;  1WIE A;  2LNH B;  1ZUK A;  1OPK A;  4CC7 A;  3JV3 A;  1T0J A;  1OOT A;  1E7O A;  2FRW A;  3M0U A;  1BB9 A;  1E6G A;  2JM9 A;  4RTT A;  2ROL A;  2DVJ A;  3O5Z A;  3H0I A;  1X2K A;  2C0I A;  2LJ1 A;  1UE9 A;  4IIO A;  2LX7 A;  4ESR A;  3A98 A;  2VKN A;  2KRN A;  1I07 A;  2JMA A;  2RF0 A;  2J06 A;  1YN8 A;  4DEX A;  1NG2 A;  1QCF A;  4JJC A;  3THK A;  3UA6 A;  2CT4 A;  2JTE A;  2JM8 A;  2ED1 A;  3EG3 A;  1U06 A;  3I9Q A;  1RUW A;  2PTK A;  1BK2 A;  1BU1 A;  2ABL A;  1OEB A;  1NEG A;  3RBB B;  1E6H A;  1NEB A;  1ZX6 A;  1GCQ C;  1AWX A;  4DEY A;  2KT1 A;  2J6F A;  1ABQ A;  1TUD A;  1K9A A;  2O2O A;  1OV3 A;  1EFN A;  2CUB A;  2KEA A;  3VS5 A;  1SRM A;  4RUG A;  4AG1 C;  4JJD A;  4GBQ A;  1X2Q A;  1LCK A;  3VS4 A;  3PVL A;  1AWO A;  3REA B;  2J7I A;  1YCS B;  2D0N A;  4OMM A;  4LNP A;  1S1N A;  1GL5 A;  1JXO A;  2FG0 A;  3U23 A;  1AZE A;  1BBZ A;  2X3W D;  4OML A;  2EVR A;  2LZ6 B;  4HVW A;  1CSK A;  1Z9Q A;  1VA7 A;  1WXB A;  4J9B A;  1YWO A;  2GNC A;  2L3Q A;  4RTU A;  2FPD A;  2P4R A;  2GTJ A;  3VS2 A;  2O9V A;  1SHG A;  2CSI A;  4HXJ A;  1FYN A;  2OAW A;  3VS1 A;  1KSW A;  4D8K A;  2KRO A;  4X1V A;  1JEG A;  5IH2 A;  1J3T A;  2AZS A;  1X27 A;  2CH4 W;  4AFS C;  3SEM A;  2JXB A;  2MCN A;  2M51 A;  1SPK A;  1K0S A;  4IIM A;  1H3H A;  2KRS A;  1XOV A;  2K79 A;  1GBQ A;  1GCQ A;  1I0C A;  1AVZ C;  2FO0 A;  2EGA A;  1M3B A;  2RPN A;  3EG2 A;  2F2W A;  3C0C A;  3SHW A;  4J9F A;  1IO6 A;  1AOJ A;  3ZL7 C;  3IQL A;  2RN8 A;  2KYM A;  4Y92 A;  1M27 C;  2F2V A;  1HSQ A;  1M8M A;  2YDL A;  1FMK A;  2AKL A;  5GJW B;  2VWF A;  2O31 A;  3EG0 A;  3ULR B;  2O88 A;  1K76 A;  1B07 A;  1ABO A;  5I22 A;  1N5Z A;  1SEM A;  2DF6 A;  5IXF A;  4J9D A;  1JXM A;  2EQI A;  3I5R A;  2DYB A;  3H41 A;  2DA9 A;  4E6R A;  4EIK A;  1UHF A;  1UGV A;  1TUC A;  1JU5 C;  1V1C A;  1G2B A;  2YUO A;  3M0P A;  3M0S A;  3VRY A;  2DL4 A;  4RTV A;  2KT8 A;  1AD5 A;  4JPB W;  5FW9 A;  1X43 A;  2EYY A;  2ENM A;  2AZV A;  3EGU A;  3TVT A;  1PHT A;  1WA7 A;  2RQR A;  2DJQ A;  2HBW A;  2D8J A;  4OMN A;  3VS3 A;  1WXU A;  3REB B;  4F17 A;  3UA7 A;  1B3Q A;  4HVV A;  1PKS A;  2FPE A;  1UTI A;  5FWC A;  2RNA A;  3UAT A;  2DE0 X;  1HJD A;  2MIO A;  1T3L A;  1X6G A;  1OPL A;  2KXC A;  5HCK A;  2CSQ A;  2RQW A;  1NYG A;  4JJB A;  4Z89 A;  2HEQ A;  4HCK A;  3EG1 A;  4OMO A;  2J6K A;  2C0O A;  3PE0 A;  2RQU A;  3KFV A;  1YNZ A;  2EW3 A;  2L3S A;  1Y57 A;  4RTZ A;  1WYX A;  1SRL A;  2JW4 A;  1M3A A;  3NGP A;  4HVU A;  1UEC A;  5IHK A;  2EYZ A;  2B86 A;  2BZY A;  2RQV A;  2O9S A;  1AWJ A;  2RMO A;  1AWW A;  2XMF A;  2FEI A;  3NMZ C;  3QWY A;  3VS7 A;  4AFQ C;  2JT4 A;  2PNI A;  1VYU A;  2L3P A;  4AFU C;  4LN2 A;  1ZUY A;  2EGC A;  2EYX A;  2ESW A;  2DMO A;  1AEY A;  4LUE A;  2K2M A;  2ED0 A;  1JQQ A;  1H8K A;  2KR3 A;  2KYB A;  2EYW A;  3RNJ A;  2DIL A;  4OMP A;  2A37 A;  4LUD A;  5EC7 A;  2DBK A;  1W1F A;  2DX1 A;  2JS0 A;  4JZ3 A;  4KRT A;  1PWT A;  1W6X A;  5GJV B;  3NPF A;  3GBQ A;  4J9H A;  1TG0 A;  4AG2 C;  1UJY A;  2W0Z A;  4CC4 B;  1UJ0 A;  3I35 A;  3H0H A;  4RTX A;  1A0N B;  2LQN A;  5ECA A;  1PRL C;  4JZ4 A;  1MUZ A;  2FRY A;  2JS2 A;  1U5S A;  1WLP B;  1WI7 A;  2IIM A;  2V1Q A;  1KJW A;  2GGR A;  2MOX A;  2CRE A;  3QWX X;  1ZSG A;  2HDA A; 
#chains in the Genus database with same CATH topology
 3WVD B;  4EMK C;  2PUO B;  1QKX A;  2LQW A;  4PFP A;  1YIJ Q;  2QYZ A;  3M0R A;  5A0L A;  3MET A;  2NYS A;  1D0Y A;  5A0G A;  1NLO C;  2CUD A;  5KYU A;  4A63 B;  1YIT T;  1UG1 A;  5KYY B;  3PGG A;  3PMI A;  2EQU A;  3I55 T;  3DB4 A;  1K8A R;  2RB6 A;  1BI3 A;  2VXF A;  4ZGJ B;  4C0Z A;  4M77 F;  4QT7 A;  2LRQ A;  4ZNX A;  4LDX A;  4MML A;  2Y90 A;  2CZ7 B;  1Q86 C;  4JLG A;  3SWN C;  2NUZ A;  2L0A A;  1WHJ A;  1VQL Q;  4J8O A;  2CDT A;  4FW1 A;  3CCM Q;  3FJ5 A;  4X9C A;  5GAO n;  3L2R A;  3CCU T;  3PIP A;  1G3Y A;  2DLP A;  3CC2 Q;  2YUN A;  1QVF A;  2HKN A;  1MV3 A;  4EMK A;  3TU4 K;  4XU0 A;  4E7Z A;  3OYJ A;  3NHN A;  3VRZ A;  2OX7 A;  2LDM A;  4AFZ C;  1PKT A;  3SFM A;  3M0T A;  1KHI A;  3V7S A;  2LMJ A;  1WHK A;  4M75 D;  1YJ9 A;  4O5V A;  2K5L A;  3LX7 A;  2NUT A;  2AIR B;  1K9M R;  3OBY A;  4F7U G;  1Y96 A;  4FSS A;  3M56 A;  2C0T A;  2GF7 A;  2A08 A;  1QMC A;  1Q82 C;  3OYC A;  2PUK B;  2FVU A;  1KQS P;  2YT6 A;  3ER0 A;  3DB3 A;  4ELZ C;  3C95 A;  1M3C A;  5CKE A;  2FPF A;  3WVE B;  2PZ1 A;  1NM7 A;  2E3I A;  5GAN 4;  3BDU A;  4M7D E;  3M9Q A;  2EBP A;  2DTI A;  3TSZ A;  2X4X A;  3SWN A;  2YUQ A;  4IUT A;  2ZGW A;  1M30 A;  1EX4 A;  1MV0 B;  4O6J A;  1GFC A;  3V8K A;  2LJ0 A;  3R6N A;  2V8J A;  1MHN A;  4PJO F;  1VQP A;  4F14 A;  2MMP A;  4J9I A;  1RAI B;  2QGG A;  2RD1 A;  4C92 E;  1GBR A;  5I2M A;  4D8D A;  4M78 E;  2I0N A;  2XDB A;  1QVP A;  4BI4 A;  2PU9 B;  3OQ5 A;  5J26 A;  2QAZ A;  3RMS A;  4NL2 A;  4E7K A;  3MEA A;  3JCM J;  4J9G A;  1RAF B;  2H8H A;  2HL3 A;  2E1H A;  2SRC A;  1JBM A;  1G83 A;  4QKU A;  3CCQ A;  3NTI A;  2KXD A;  3DLL A;  3TSW A;  2X3X D;  3G71 A;  3CCV Q;  1OU8 A;  1WIE A;  1JB0 E;  4X9D A;  3OSS C;  5GMK m;  2DKG A;  1OPK A;  4PJL A;  4CC7 A;  3JV3 A;  1T0J A;  1E7O A;  2RK2 A;  1BB9 A;  4RTT A;  1WJS A;  2ZPH B;  3HPW A;  1PCX A;  1B34 B;  1ZSZ C;  1WHL A;  1UE9 A;  3EFO B;  3QYG B;  2X35 A;  1I5L A;  1Y07 A;  2RF0 A;  3UDC A;  1S72 A;  5LJ5 f;  4MDW A;  4JJC A;  3THK A;  3PMT A;  2CT4 A;  1YJN Q;  1U06 A;  2OTJ A;  3I9Q A;  2PTK A;  1BU1 A;  3HRS A;  3V7C A;  1G8X A;  4M7A E;  3LWI A;  1AWX A;  5GMK h;  1TUD A;  2O2O A;  2ZPG B;  1LPL A;  4C8Q F;  2GFU A;  4RUG A;  4FIB A;  4KH1 B;  3OYH A;  3PVL A;  4BE0 A;  1YCS B;  2D0N A;  1ZA1 B;  4LNP A;  3E2U A;  5LJ5 h;  1M1K C;  3OS0 A;  4PLI A;  2Y4X A;  3CD6 T;  1GL5 A;  1TWB A;  1JXO A;  1RAE B;  3G6E T;  1JJ2 S;  1BBZ A;  4LDY A;  3OW2 S;  3M55 A;  4OML A;  3CCJ A;  2EVR A;  5A2Q E;  3J81 E;  1CSK A;  3GNF B;  1WXB A;  4BAC A;  1ZSZ A;  4OB1 B;  3JB9 D;  2JNG A;  2OTL Q;  5IAY A;  2ATC B;  1I8F A;  5KCH A;  2XHC A;  2OAW A;  1KSW A;  4D8K A;  4X1V A;  1JEG A;  4C0G A;  1PC0 A;  3TEE A;  2MCN A;  1K0S A;  1TU0 B;  2PQW A;  2X4Y A;  2KRS A;  2DZC A;  2HL5 C;  1VQO A;  1KC8 U;  2DIG A;  4OVA A;  2E65 A;  1I4K 1;  2QA4 Q;  1AVZ C;  2FO0 A;  1XJW B;  2EGA A;  3EG2 A;  2F5K A;  4J9F A;  2RN8 A;  1XQH A;  1M27 C;  5LJ5 e;  2YDL A;  2KAF A;  5GJW B;  5CAI A;  2O31 A;  3CMA T;  3CCR T;  4HKE A;  4C5I A;  1ABO A;  4M77 E;  1SEM A;  2LCC A;  2Z0W A;  1Y7X A;  1OYX A;  1PSF A;  4EIK A;  1UGV A;  2RO0 A;  4EMG A;  2CP7 A;  4M75 F;  2CGH A;  2LNV A;  1JU5 C;  3VUB A;  1XNI A;  4HT9 A;  1G2B A;  3TQ7 P;  5FU7 C;  1YIJ A;  4JRQ A;  5FW9 A;  1LVK A;  1IRX A;  2ENM A;  2H3J A;  1N9R A;  3OA6 A;  1W2B P;  4C5G A;  2HBW A;  2D8J A;  4PL6 A;  4RMO A;  4BUG A;  3I56 Q;  6AT1 B;  3REB B;  1VQM Q;  4HVV A;  1PKS A;  1Q95 G;  5KYU B;  2EQM A;  1PSE A;  1VQ9 Q;  4JJB A;  2QQS A;  2WAC A;  4Z89 A;  2YRD A;  2X51 A;  4BDZ A;  2HEQ A;  1JJ2 A;  1NJI C;  3EG1 A;  2QG9 B;  2J6K A;  3PE0 A;  2LT4 A;  2NUP B;  2K5I A;  3OBW A;  4M78 C;  1WHG A;  1SRL A;  2JW4 A;  1M3A A;  5EG2 A;  1U1T A;  4Q5W A;  1YJW Q;  1VQL A;  3FEO A;  2XIC A;  4JUV A;  3QDF A;  5IHK A;  2HKQ B;  1TOV A;  2KSS A;  2B86 A;  3CCM A;  4LDU A;  1AWJ A;  2CZ6 B;  4C8Q G;  2ZAE A;  2ZZD A;  2XI9 A;  4BY6 C;  2XG8 D;  2FZG B;  1YHQ A;  2FEI A;  5HKC A;  3NMZ C;  3A8H B;  4AFQ C;  3CC2 A;  3X20 B;  3QII A;  1KQ1 A;  2RK1 A;  1VYU A;  2BE7 D;  1M1G A;  4LN2 A;  4XU3 A;  1F1B B;  2EQK A;  2EGC A;  4XTV A;  5I21 A;  2ESW A;  4BI3 A;  1RL2 A;  1LJO A;  2DXB A;  1M90 C;  2LQ8 A;  3OYB A;  2KYB A;  2EYW A;  4PJO E;  3OB9 A;  3V7R A;  3HFN A;  4LUD A;  1VQN T;  2DBK A;  3CBP A;  2RJF A;  3NFC A;  2A3L A;  2JS0 A;  4JZ3 A;  4KRT A;  2M16 A;  1PWT A;  4R56 A;  4OP0 A;  5CKF A;  5GAM d;  1QP3 A;  1W6X A;  2NUT B;  5GJV B;  3CC4 T;  1Y96 B;  1VQ4 Q;  4DOW A;  5J3B A;  3CCQ Q;  1TG0 A;  2EIF A;  3JCM b;  3JB9 J;  1C1A A;  3H0H A;  4RTX A;  3G71 Q;  4HCC A;  4M78 A;  1UGS B;  4FSX A;  2JS2 A;  1U5S A;  2IIM A;  1KJW A;  2CRE A;  2MPX C;  1PG5 B;  5GAM g;  3FDR A;  4ORZ A;  1K1Z A;  3CME Q;  1GRI A;  1PRM C;  1YFN A;  4KBM B;  3CPW P;  1FMV A;  2DFU A;  3RKY A;  7AT1 B;  1N27 A;  3NTK A;  1QLY A;  2OI3 A;  4RCC A;  1JO8 A;  2LJ3 A;  4RTY A;  4BDY A;  4KT0 E;  3CCL A;  2G6F X;  5FRN A;  2OTJ Q;  2BZX A;  2NWM A;  4M75 G;  4DBQ A;  3CCE T;  2A36 A;  2JMC A;  1RI9 A;  2CP0 A;  2QEX Q;  1K73 C;  1GFD A;  1RLP C;  2BZ8 A;  1CKA A;  2KVQ G;  3OYD A;  1MGQ A;  3BFM A;  1ZQ1 A;  3MPU B;  1Y71 A;  2LTO A;  1H64 1;  2RHX A;  4J7F A;  4RKU E;  2AK5 A;  1YI2 T;  2DM1 A;  3EG9 B;  2KNB B;  1O9S A;  1QWE A;  3UT1 A;  1T0H A;  4KUI A;  3RKX A;  3RDV A;  3OSV A;  2YHT A;  4F7U F;  4C8Q B;  4BE1 A;  4II1 A;  3QG1 A;  1VQ7 T;  1K8A U;  2OJ2 A;  4M4Z A;  3L2Q A;  2CKK A;  1KD1 C;  3J80 E;  9ATC B;  1Q81 C;  4BI8 B;  4J6Y A;  2EQJ A;  5I2S A;  3CEY A;  1QVF P;  1IGU A;  3JCM d;  4LD9 K;  1M4Z A;  2DRK A;  1M1K R;  1NLP C;  3G1J A;  2VVK A;  2DJZ A;  3CCS T;  2K4Y A;  3CCV T;  4DQ2 A;  4BD3 A;  4LE9 A;  4J83 A;  4D6W A;  4BB7 A;  3OYA A;  2E5K A;  1WX6 A;  2YXY A;  4JS4 A;  3JCM g;  1VQ5 Q;  2LCS A;  1Z9Z A;  4PLL A;  2F2X A;  1FX7 A;  1EIF A;  1VQ6 T;  2V1R A;  1MMN A;  2EGE A;  1ZUU A;  2EAY A;  3QHS A;  1QWF A;  1VIF A;  4L5G A;  3VUZ A;  4WF2 A;  1N8R U;  3UF4 A;  3QSU A;  2M0Y A;  2KGT A;  2QGF B;  2OTL A;  2MK5 A;  1K9M U;  4OF1 A;  1K0X A;  4ZGD B;  4N4I A;  1ZSZ B;  4FYV B;  1UHC A;  1HK9 A;  3KUF A;  4R0K A;  4PJM A;  2HMA A;  2J6O A;  1SSH A;  3CPF A;  4GLK A;  4A54 A;  2DL5 A;  3URG A;  1PM3 A;  4E7S A;  1YP5 A;  2QA4 A;  2D6F A;  1SHF A;  2COY A;  2GQI A;  4B9W A;  2K9G A;  1QVG A;  4M75 B;  4A4H A;  2E64 A;  5GAN 5;  4FT4 A;  4KH0 B;  3E1S A;  3QJ6 A;  2FRW A;  1R77 A;  2ROL A;  2DVJ A;  3O5Z A;  1RAH B;  1VQK A;  2P0Q A;  5CKH A;  1WQW A;  4TVR A;  1YHQ Q;  4KGV B;  3RKW A;  1BIB A;  2KRN A;  4X34 A;  1OU9 A;  2J06 A;  3JB9 G;  4ZTF A;  2JTE A;  2JM8 A;  2DD4 A;  2ED1 A;  4XTU A;  3JCM P;  1RUW A;  3RER A;  1BIA A;  5IT9 E;  1OEB A;  1M2V B;  1E6H A;  4DBF A;  2FYK A;  1N8R R;  3CC7 Q;  2KT1 A;  5FU6 B;  2J6F A;  1BI2 A;  3I56 A;  4C5H A;  1VQM A;  1OV3 A;  2CUB A;  2E6N A;  3VS5 A;  2WSF E;  2CZ1 B;  1SRM A;  3OYI A;  3A1P A;  4AG1 C;  4JJD A;  1KC8 C;  1X2Q A;  1VQ9 A;  2M1H A;  2XD0 A;  3X26 B;  3OS1 A;  1D1A A;  5GAO r;  1SF9 A;  5HK0 A;  1S1N A;  3U23 A;  2YWW A;  3UWN A;  4OGC A;  1AZE A;  4V2S A;  4PJN A;  5AT1 B;  1C6V X;  1YJW A;  3PIO A;  2LZ6 B;  5GAM f;  4OB2 B;  1YBY A;  4XK8 E;  3A8G B;  1YWO A;  2GNC A;  2RHU A;  2FPD A;  2P4R A;  3M4Y A;  2EWN A;  1SSF A;  3EAE A;  1KQS S;  1D3B B;  1VQ8 Q;  2O9V A;  1SHG A;  2KRO A;  5IH2 A;  1J3T A;  2AZS A;  4E2F B;  5KCO A;  3ZFJ A;  2M51 A;  4B6M A;  2KY9 A;  1SPK A;  1D0Z A;  1YJ9 T;  4IIM A;  1Q7Y C;  1XOV A;  3CCL Q;  1GBQ A;  5GAM h;  2F2W A;  2DVE A;  1JRI A;  1IO6 A;  3ZL7 C;  2M02 A;  2E5Q A;  3IQL A;  3O8V A;  2RHI A;  2XKO C;  2KYM A;  3RES A;  1VQ4 A;  2F2V A;  3X25 B;  2K5F A;  2VWF A;  5LJ3 g;  2ZCF B;  2GQV A;  1K76 A;  2L8D A;  5I22 A;  2VAS A;  4JLI A;  1U1S A;  4MMK A;  1BCO A;  1JXM A;  4F04 B;  3G4S A;  1FXX A;  2LT1 A;  3VV0 A;  2FB7 A;  3MP8 A;  4NOY A;  1VQP T;  5C6S A;  5LL6 S;  3CME A;  3M0S A;  3VRY A;  3FLG A;  3RUX A;  2X4W A;  4OGE A;  3X28 B;  2P4T A;  2LVM A;  3SDZ A;  4BY6 B;  1QCO A;  2AZV A;  5KYX A;  3KBG A;  3FIF A;  2VV5 A;  5CR2 A;  4IUV A;  4M7D D;  3UA7 A;  4IKF A;  1B3Q A;  2FPE A;  3RIR A;  5GAM e;  2LX9 A;  4KUL A;  2VC8 A;  4F7U E;  3UPU A;  2KXC A;  1OPL A;  2CSQ A;  3CCQ T;  5IN1 A;  4L6V 5;  1NYG A;  2QXF A;  3AHU A;  2ZPF B;  2IPO B;  1UEB A;  3OS2 A;  2QEX A;  3G71 T;  4RG8 A;  2C0O A;  3CBM A;  4J6W A;  1WYX A;  2QQ9 A;  3JCM c;  4C92 D;  4F7U B;  3QZ5 B;  4RG2 A;  3JCM f;  4MZT A;  4M78 D;  3QBY A;  1BCM A;  4LDW A;  2BZY A;  2RMO A;  5FLX E;  2XMF A;  1IXD A;  1BI1 A;  1JJ2 P;  4JRP A;  1R0C B;  1KD1 R;  1Q81 R;  2LCL A;  3M5A A;  2QTV A;  4FL6 A;  4AFU C;  3ME9 A;  2MWO A;  2CZ0 B;  1YIT Q;  1ZUY A;  4C5E A;  1S72 T;  5KYW A;  3I55 Q;  1MMD A;  1Q86 U;  1AEY A;  3QPH A;  5CO7 A;  2ED0 A;  3RR6 A;  2OTJ T;  1H8K A;  2KR3 A;  2DIL A;  2VUB A;  3C4S A;  5GAO m;  2JN0 A;  1GXI E;  4C0D C;  5LJ3 j;  2XDD A;  1W1F A;  3C12 A;  2DX1 A;  2FL7 A;  3CXC P;  3WXM B;  3P8B B;  2JTM A;  4GY5 A;  4VUB A;  4E7L A;  1UJ0 A;  3I35 A;  3LLR A;  2F5T X;  2A0F B;  4QW2 A;  2QQB A;  3HHT B;  1A0N B;  1PRL C;  1MUZ A;  2FRY A;  3JCM X;  1VQ5 A;  2DET A;  1X01 A;  3CCJ T;  3EGX B;  4FYW B;  2MYS A;  3JCM V;  4LXC A;  4JJN K;  4CI0 C;  1VQK Q;  2VGN A;  3EFS A;  3OS5 A;  3QDR B;  4M7A D;  3C94 A;  1OQK A;  5GAN j;  1KFZ A;  1BKB A;  4YTL A;  2HQX A;  2DAQ A;  2RHY A;  3JCM e;  3JRZ A;  1RLQ C;  1K8A C;  1WXT A;  1VQO T;  4M7D C;  3X24 B;  4LD6 A;  2MI6 A;  2BTT A;  1H92 A;  1M5Q 1;  1OI1 A;  1Q86 R;  4CC2 A;  1K4U S;  3OYF A;  3HFO A;  2V8K A;  2D1X A;  2HAX A;  2HSP A;  2BE9 B;  3OYK A;  3OW2 A;  4K11 A;  3A5Z B;  2CYZ B;  5CQY A;  1QP2 A;  4C92 C;  1U3O A;  4DBR A;  1G3S A;  4DOV A;  3S3O A;  3VS0 A;  2CH4 A;  5GAN 7;  4ZGE B;  4FCY A;  3MP1 A;  4XAX B;  3MEU A;  2NLU A;  1ZBX A;  5GAN 3;  1C0M A;  4ZTJ A;  2DK3 A;  1YIJ T;  3JSC A;  2PVO B;  4GLM A;  4A53 A;  5HY6 A;  2DNU A;  1K9M C;  1Q82 R;  2KBT A;  4OMF B;  4EMK B;  2D8H A;  1LNX A;  2E41 A;  2CP5 A;  3AT1 B;  3I5S A;  4AT1 B;  4M7D A;  3CC7 A;  1T3S A;  1I81 A;  4M77 D;  2L5Q A;  3BE3 A;  1UB4 A;  2E3H A;  2LC4 A;  4Z88 A;  3H0F A;  2JJ9 A;  3LH5 A;  5GMK l;  1WHM A;  3ZBD A;  5CK9 A;  3OYG A;  1UGQ B;  4AMC A;  5LJ3 f;  2P0P A;  1UDL A;  4IUQ A;  3T9N A;  1GCP A;  1UGR B;  3M0Q A;  1VQL T;  1ARK A;  2RQT A;  1PD1 A;  4C92 A;  2IVW A;  5GAO p;  3CCM T;  3VU3 C;  3EHR A;  2L3R A;  3TRE A;  4PJJ A;  1X69 A;  2K3X A;  3OYL A;  1YHQ T;  3G4S Q;  4CC3 A;  3CC2 T;  3CQT A;  5DM7 R;  2KDS A;  2ZPB B;  3SWN B;  2F1L A;  3E9F A;  1Q7Y R;  1CKB A;  3MJX A;  3QO3 A;  4E7I A;  3S3N A;  4M7A C;  5L23 A;  1YCY A;  1VQ8 A;  2DZ9 A;  1M1K U;  5M9O A;  2SEM A;  1WQ7 A;  2E10 A;  3PVQ A;  2GBQ A;  2EJF A;  2EJG A;  5IXB A;  2KI7 A;  1W70 A;  3KXT A;  8AT1 B;  4J9C A;  1B34 A;  3QXE B;  2DL8 A;  3MEV A;  3EHQ A;  4M78 F;  5I11 A;  3EFO A;  4WCI A;  2K3B A;  4RTW A;  3CD6 Q;  3L2V A;  3JB9 H;  1ZUK A;  4Y28 E;  3M57 A;  3CPW S;  1D1B A;  1OOT A;  2I2L A;  2HBP A;  1E6G A;  2JM9 A;  1EZZ B;  2R58 A;  5GAO q;  3HP9 A;  2C0I A;  3JB9 F;  4P5N A;  1QVG P;  4KUD K;  3OY9 A;  3L1A A;  4IIO A;  2HQE A;  4PJO D;  4C8Q E;  4ESR A;  2RI2 A;  3L2Z A;  5GAO l;  1KG1 A;  2VKN A;  1I07 A;  3FB9 A;  1YN8 A;  1NG2 A;  5GAN 8;  2DEQ A;  1M1F A;  4FM4 B;  2DTH A;  4M7A A;  1TH7 A;  1LOJ A;  2P0K A;  2DER A;  3RBB B;  4FT2 A;  3GF5 A;  2JUF A;  3M4G A;  4OB0 B;  1ABQ A;  1ZA2 B;  5KYX B;  3L2U A;  2KEA A;  2EKO A;  2KK4 A;  3CMA Q;  4GBQ A;  5CVI A;  3VS4 A;  1AWO A;  3BY7 A;  5GAN 6;  1B7T A;  3REA B;  1D09 B;  2J7I A;  2VB6 A;  5GMK i;  4M77 C;  4OMM A;  4N4H A;  4EMH A;  1HXD A;  4OB3 B;  3FJP A;  4KGX B;  3HSB A;  2FG0 A;  4M7A F;  1TSF A;  2CS7 A;  2X3W D;  2FHD A;  5DLQ E;  4DA4 A;  2LQK A;  1WHH A;  2XDP A;  4HVW A;  2HNI A;  3V8J A;  1Z9Q A;  4EDU A;  1QVF S;  2GCX A;  4RTU A;  4IUP A;  2C06 A;  2XID A;  4IUR A;  3VS2 A;  1OX8 A;  4HXJ A;  1FYN A;  3VS1 A;  1NJI U;  1YIT A;  1WJR A;  1X27 A;  1N9S A;  3SEM A;  3P8D A;  5CIU A;  3I55 A;  1YJN T;  1H3Z A;  1H3H A;  5KYW B;  3BW1 A;  4JS5 A;  4M7D G;  3CPW A;  4PKC C;  3C0C A;  3SHW A;  4M75 E;  3SB2 A;  1AOJ A;  4KGZ B;  3ZEH A;  1RAA B;  3QUI A;  4Y92 A;  2V26 A;  1HSQ A;  1FMK A;  2AKL A;  4M77 A;  3EG0 A;  3ULR B;  3MEW A;  2K57 A;  3PT9 A;  1B07 A;  2EJ9 A;  4HCB A;  2BKD N;  1M90 U;  4QVZ A;  3CCU A;  2DD5 A;  2DF6 A;  2DPP B;  2V8I A;  4J9D A;  4RCB A;  4C92 G;  2DA9 A;  3HTR A;  2E12 A;  4E6R A;  4M78 G;  4QQG A;  4HA8 A;  5GAN 2;  1SG5 A;  3GNG A;  1TUC A;  3M0P A;  2QDY B;  1TS9 A;  2DL4 A;  1IHW A;  1KQ2 A;  4PJO C;  2PVD B;  4ME7 A;  2KT8 A;  2OTL T;  1AD5 A;  4JPB W;  2X4J A;  3NTH A;  2EYY A;  2NUP A;  3EGU A;  3EGD A;  1VQN Q;  3TVT A;  1TXQ A;  1WA7 A;  2RQR A;  2DJQ A;  3PFS A;  5GMK j;  1WXU A;  1NBE B;  4FW2 A;  4J7I A;  4F17 A;  4E7J A;  3A8L B;  1UTI A;  5FWC A;  3GPL A;  2RNA A;  3CC4 Q;  3UAT A;  1M9S A;  4ANJ A;  1HJD A;  1T3L A;  4BE2 A;  3GIB A;  8ATC B;  3OMG A;  5KH6 A;  2QA4 T;  4Z02 A;  4FYX B;  5LJ5 j;  1NJI R;  2B8A A;  4OMO A;  4C0D B;  1BI0 A;  2A7Y A;  2EW3 A;  1QCN A;  1VIE A;  3N5B B;  3LGL A;  1DJ7 B;  3NGP A;  2QK0 A;  2HD0 A;  2O4X A;  4DBH A;  2HZY A;  1RAC B;  3GOX A;  4HVU A;  2EYZ A;  1WNL A;  1QW1 A;  4Y91 A;  2X9H A;  2RQV A;  1SKU B;  1VQK T;  3QWY A;  3VS7 A;  2JT4 A;  4PFZ A;  2PNI A;  3LYI A;  1RAD B;  3H8Z A;  4EPC A;  2L3P A;  1K73 U;  3G7Z A;  2EYX A;  4PJO A;  2DMO A;  4XTY A;  1ZHI A;  1M90 R;  4M7A G;  5CKB A;  2KMT A;  4LUE A;  2K2M A;  5FRO A;  2QAS A;  1JQQ A;  2E4H A;  3CCE Q;  3HRT A;  4QQ6 A;  2A37 A;  2BIV A;  4B9X A;  3E9G A;  3R6O A;  2K2V A;  2RJC A;  4L59 A;  3I56 T;  2CP2 A;  5LJ3 d;  2DTO A;  1VQM T;  3NPF A;  3GBQ A;  1RAG B;  5KYN A;  5FU7 B;  1RI0 A;  4QVC A;  1UJY A;  4CC4 B;  1VQ9 T;  4C8Q C;  5CQX A;  2DXC A;  4M7D B;  3E19 A;  1YI2 Q;  5ECA A;  3QYH B;  1KD1 U;  1WLP B;  1Q81 U;  1WI7 A;  2V1Q A;  3QWX X;  1ZSG A;  1YJW T;  3BDL A;  1FMW A;  5IHI A;  1Y0M A;  1VQ7 Q;  2HCK A;  3VS6 A;  1QKW A;  4C92 B;  2P84 A;  2CP6 A;  4M78 B;  1IHV A;  1W4S A;  4XU1 A;  1UFF A;  2E70 A;  1KIK A;  2ECZ A;  1M8V A;  1R0B G;  4J9E A;  5D6Y A;  5GAN d;  3MP6 A;  1YWP A;  4MZP A;  1WDX A;  3CCS Q;  2CT3 A;  5IHN A;  5DLO A;  4Z8A A;  2A28 A;  3EG9 A;  5KE2 A;  1K73 R;  3OMC A;  3DKM A;  1I5O B;  4MDX A;  2KQW A;  1HD3 A;  3EH2 A;  2W10 A;  4M77 G;  5GAN g;  1VQ4 T;  3CD6 A;  4C8Q A;  5AYF A;  2ROT A;  3ASK A;  1VQ6 Q;  3G6E A;  5KE3 A;  4F16 A;  2PVG B;  4C0F A;  3A8M B;  1WFW A;  4N0A C;  2QQR A;  2R5A A;  3G4S T;  1G3W A;  4HCZ A;  2R57 A;  1ZLM A;  5FWB A;  1KQS A;  3QZ9 B;  1VYV A;  3CME T;  4LDV A;  1V76 A;  2ZPE B;  4M75 C;  1D0X A;  2QDL A;  3S3M A;  3OW2 P;  4HT8 A;  2GTO A;  2CP3 A;  2DXU A;  2WSE E;  2FZK B;  2RI5 A;  1X6B A;  1PNJ A;  4IUU A;  4JRK A;  1G3T A;  3JCM W;  1X6O A;  2M9U A;  2RJE A;  2RA2 A;  4M7A B;  1IGQ A;  2EKH A;  3JCM h;  4OMQ A;  3VJP A;  2LP5 A;  1VYT A;  2YUP A;  2AKK A;  2WSC E;  2L2P A;  3OYY A;  3EFR A;  2QEX T;  3CMA A;  2YLC A;  3CCR A;  1VUB A;  4ELY C;  2DL7 A;  2XU8 A;  2IG0 A;  1NYF A;  2DRM A;  2DL3 A;  2K7A A;  1I1J A;  3VYG A;  2Y4Y A;  3P8H A;  4N0A A;  2KRM A;  1ZBJ A;  3CCU Q;  5FU6 C;  4PK4 A;  4XU2 A;  2EPD A;  2RHZ A;  1IRE B;  3H6Z A;  3M54 A;  5KYY A;  2YSQ A;  1X75 C;  1QQJ A;  5D6W A;  4PJO G;  3CXC S;  3LGF A;  3MCA B;  2EYQ A;  4M75 A;  5GMK e;  1Q82 U;  1UUE A;  3SD4 A;  4XQ3 A;  1OZ2 A;  2O01 E;  2K6D A;  2J05 A;  2KE9 A;  4NS5 A;  1AZG B;  3Q1J A;  3CBO A;  3GLX A;  3J7A F;  1G5V A;  2HSE B;  3FRN A;  2DBM A;  3M58 A;  4ATO A;  2JZ2 A;  3LW5 E;  2LNH B;  1U8R A;  4A4E A;  2HQH A;  1PD0 A;  2JOY A;  5HK3 A;  4ZN1 A;  2ZPI B;  3M0U A;  2VYT A;  4J6X A;  3V8L A;  4E7H A;  5DY9 A;  3H0I A;  1VQ5 T;  1M2V A;  3INZ A;  4M77 B;  1Q7Y U;  1X2K A;  4NL3 A;  2DYI A;  2LJ1 A;  3HRU A;  2LX7 A;  3A98 A;  2JVV A;  2RM4 A;  4R55 A;  2JMA A;  1W2B S;  4DEX A;  1QCF A;  3UA6 A;  5C0M A;  1NZ9 A;  1YJ9 Q;  3EG3 A;  3HKS A;  1BK2 A;  2ABL A;  1NEG A;  1VQN A;  1NEB A;  4UC4 A;  1ZX6 A;  1N8R C;  1GCQ C;  2L89 A;  4A4K A;  4DEY A;  1K9A A;  3EGD B;  4N4G A;  1RAB B;  1EFN A;  3OYE A;  3CC4 A;  3VYH B;  1KC8 R;  3RMQ A;  1MMA A;  1LCK A;  2D9T A;  1UGP B;  4XTW A;  1XTD A;  1D3B A;  4FYY B;  3L2W A;  3F70 A;  3FC3 A;  2RJD A;  2FZC B;  2XK0 A;  1KHC A;  3QKJ A;  1VQP Q;  2YRV A;  1VOM A;  3CXC A;  1V29 B;  2MF2 A;  1VA7 A;  4J9B A;  3PTA A;  2O4X B;  1R8O B;  2L3Q A;  1OZ3 A;  2GTJ A;  2CSI A;  2QTX A;  2BUD A;  5A0D A;  2CH4 W;  4AFS C;  2JXB A;  4M7D F;  4QVD A;  2GFA A;  3TCJ A;  3CCE A;  4PJO B;  2K79 A;  2VGM A;  1GCQ A;  1FWZ A;  2YRC A;  4ZN3 A;  3JB9 I;  1I0C A;  4FU6 A;  5LJ3 h;  1M3B A;  2RPN A;  3M59 A;  3CC7 T;  1IZ6 A;  1M8M A;  3H9N A;  2AT1 B;  4C92 F;  1NE8 A;  5GAN f;  2O88 A;  2RI3 A;  1HYO A;  3LH0 A;  2JTF A;  3JCM Q;  1WJQ A;  1N5Z A;  1YI2 A;  5IXF A;  3HL8 A;  2EQI A;  3I5R A;  2H3E B;  1W2B A;  2DYB A;  4J5Y A;  3G6E Q;  3H41 A;  1WGS A;  3QJY A;  1UHF A;  1NPP A;  1WPY A;  3OYM A;  1V1C A;  1S72 Q;  2YUO A;  3DLM A;  1VQ7 A;  4JRI A;  4RTV A;  1MMG A;  1X43 A;  1AT1 B;  3JAM E;  5FRM A;  1WZO A;  1ACM B;  5GAN h;  2MAM A;  1PHT A;  1VQ8 T;  4OMN A;  3VS3 A;  5L8R E;  4A4F A;  4F7U A;  2QQA A;  1TTH B;  5D6X A;  2DE0 X;  5LJ3 e;  3EH1 A;  3CCS A;  4XTX A;  2MIO A;  3CCV A;  1X6G A;  5HCK A;  2RQW A;  3CCL T;  4HCK A;  2MWP A;  2DEU A;  3S6W A;  1QVG S;  2R5M A;  2RQU A;  3KFV A;  1YNZ A;  5J39 A;  2L3S A;  3PNW C;  1Y57 A;  4RTZ A;  5LJ5 d;  2K3Y A;  1N6A A;  3CCR Q;  1NPR A;  3CCJ Q;  1UEC A;  1VQ6 A;  5CKD A;  4E47 A;  2O9S A;  4CRI A;  2RH2 A;  1AWW A;  4JDS A;  1O75 A;  4A4G A;  1TUG B;  1MNE A;  1BYM A;  1P92 A;  1YJN A;  2F69 A;  2COZ A;  1OX9 A;  1OUL A;  5LJ5 g;  5CCA A;  1IB8 A;  2D0Q B;  2EFI A;  2DXT A;  1AHJ B;  3VKI A;  4PFO A;  5GAN e;  4QQD A;  5D7U A;  2G3R A;  3M53 A;  3RNJ A;  2QI2 A;  1VQO Q;  4XTZ A;  4OMP A;  2DO3 A;  2VXE A;  2YLB A;  5GAM j;  5EC7 A;  2AHJ B;  3L42 A;  1MND A;  4MZM A;  4WTO B;  3EGX A;  3D7S B;  2M0O A;  2DIQ A;  3MHX A;  4J9H A;  3GP8 A;  4AG2 C;  2W0Z A;  2E6Z A;  3MO8 A;  2LQN A;  1D1C A;  4JZ4 A;  4C8Q D;  3A8O B;  4PNO A;  2MOX A;  2GGR A;  2COW A;  1KK7 A;  1M2O A;  2OAU A;  3MKD A;  3LWH A;  2HDA A;  3OYN A; 
#chains in the Genus database with same CATH homology
 4ORZ A;  5IHI A;  1QKX A;  2LQW A;  1K1Z A;  1GRI A;  1PRM C;  1Y0M A;  2HCK A;  3VS6 A;  3M0R A;  1QKW A;  1NLO C;  1UFF A;  1QLY A;  2OI3 A;  2ECZ A;  1KFZ A;  1KIK A;  2CUD A;  4A63 B;  1JO8 A;  2LJ3 A;  4J9E A;  4RTY A;  1UG1 A;  2G6F X;  1YWP A;  1WDX A;  2BZX A;  2NWM A;  1RLQ C;  2CT3 A;  5IHN A;  1WXT A;  2A28 A;  2A36 A;  4Z8A A;  2JMC A;  1RI9 A;  1GFD A;  1RLP C;  2BTT A;  4QT7 A;  2BZ8 A;  4ZNX A;  1CKA A;  1H92 A;  4CC2 A;  1HD3 A;  1K4U S;  2NUZ A;  2L0A A;  2W10 A;  2ROT A;  2D1X A;  2CDT A;  2HSP A;  3FJ5 A;  4K11 A;  4F16 A;  1U3O A;  1WFW A;  2AK5 A;  2DLP A;  2DM1 A;  2YUN A;  2KNB B;  3VS0 A;  2CH4 A;  1MV3 A;  1QWE A;  1T0H A;  3NHN A;  1ZLM A;  5FWB A;  3VRZ A;  1VYV A;  4AFZ C;  1PKT A;  2QDL A;  3M0T A;  2OJ2 A;  4M4Z A;  4GLM A;  2LMJ A;  2GTO A;  2DNU A;  1X6B A;  1PNJ A;  4FSS A;  2KBT A;  2C0T A;  2A08 A;  2DRK A;  2D8H A;  1NLP C;  3I5S A;  2YT6 A;  2VVK A;  1T3S A;  2EKH A;  1M3C A;  4OMQ A;  4LE9 A;  2LP5 A;  1VYT A;  4Z88 A;  2YUP A;  2FPF A;  3H0F A;  3LH5 A;  2PZ1 A;  1NM7 A;  2AKK A;  2E5K A;  2L2P A;  2EBP A;  1WX6 A;  3TSZ A;  2YUQ A;  2DL7 A;  1NYF A;  1UDL A;  1M30 A;  1MV0 B;  1GCP A;  2DRM A;  2DL3 A;  2LCS A;  1GFC A;  3M0Q A;  2K7A A;  1Z9Z A;  1I1J A;  2LJ0 A;  2F2X A;  1ARK A;  2RQT A;  3R6N A;  2V1R A;  2EGE A;  1ZUU A;  1QWF A;  2KRM A;  3EHR A;  1ZBJ A;  1X69 A;  3UF4 A;  4F14 A;  2EPD A;  2M0Y A;  4J9I A;  1GBR A;  4CC3 A;  3CQT A;  2KGT A;  4D8D A;  2YSQ A;  2I0N A;  1CKB A;  1K0X A;  1UUE A;  5L23 A;  1UHC A;  4R0K A;  2SEM A;  3PVQ A;  2K6D A;  2GBQ A;  2J05 A;  2KE9 A;  4J9G A;  2J6O A;  1SSH A;  2H8H A;  5IXB A;  1AZG B;  2SRC A;  1W70 A;  1G83 A;  2DL5 A;  4J9C A;  2KXD A;  2DL8 A;  1YP5 A;  3EHQ A;  2DBM A;  3TSW A;  5I11 A;  1SHF A;  2GQI A;  2X3X D;  4WCI A;  2K3B A;  2K9G A;  4RTW A;  1WIE A;  2LNH B;  1ZUK A;  1OPK A;  4CC7 A;  3JV3 A;  1T0J A;  1OOT A;  1E7O A;  2FRW A;  3M0U A;  1BB9 A;  1E6G A;  2JM9 A;  4RTT A;  2ROL A;  2DVJ A;  3O5Z A;  3H0I A;  1X2K A;  2C0I A;  2LJ1 A;  1UE9 A;  4IIO A;  2LX7 A;  4ESR A;  3A98 A;  2VKN A;  2KRN A;  1I07 A;  2JMA A;  2RF0 A;  2J06 A;  1YN8 A;  4DEX A;  1NG2 A;  1QCF A;  4JJC A;  3THK A;  3UA6 A;  2CT4 A;  2JTE A;  2JM8 A;  2ED1 A;  3EG3 A;  1U06 A;  3I9Q A;  1RUW A;  2PTK A;  1BK2 A;  1BU1 A;  2ABL A;  1OEB A;  1NEG A;  3RBB B;  1E6H A;  1NEB A;  1ZX6 A;  1GCQ C;  1AWX A;  4DEY A;  2KT1 A;  2J6F A;  1ABQ A;  1TUD A;  1K9A A;  2O2O A;  1OV3 A;  1EFN A;  2CUB A;  2KEA A;  3VS5 A;  1SRM A;  4RUG A;  4AG1 C;  4JJD A;  4GBQ A;  1X2Q A;  1LCK A;  3VS4 A;  3PVL A;  1AWO A;  3REA B;  2J7I A;  1YCS B;  2D0N A;  4OMM A;  4LNP A;  1S1N A;  1GL5 A;  1JXO A;  2FG0 A;  3U23 A;  1AZE A;  1BBZ A;  2X3W D;  4OML A;  2EVR A;  2LZ6 B;  4HVW A;  1CSK A;  1Z9Q A;  1VA7 A;  1WXB A;  4J9B A;  1YWO A;  2GNC A;  2L3Q A;  4RTU A;  2FPD A;  2P4R A;  2GTJ A;  3VS2 A;  2O9V A;  1SHG A;  2CSI A;  4HXJ A;  1FYN A;  2OAW A;  3VS1 A;  1KSW A;  4D8K A;  2KRO A;  4X1V A;  1JEG A;  5IH2 A;  1J3T A;  2AZS A;  1X27 A;  2CH4 W;  4AFS C;  3SEM A;  2JXB A;  2MCN A;  2M51 A;  1SPK A;  1K0S A;  4IIM A;  1H3H A;  2KRS A;  1XOV A;  2K79 A;  1GBQ A;  1GCQ A;  1I0C A;  1AVZ C;  2FO0 A;  2EGA A;  1M3B A;  2RPN A;  3EG2 A;  2F2W A;  3C0C A;  3SHW A;  4J9F A;  1IO6 A;  1AOJ A;  3ZL7 C;  3IQL A;  2RN8 A;  2KYM A;  4Y92 A;  1M27 C;  2F2V A;  1HSQ A;  1M8M A;  2YDL A;  1FMK A;  2AKL A;  5GJW B;  2VWF A;  2O31 A;  3EG0 A;  3ULR B;  2O88 A;  1K76 A;  1B07 A;  1ABO A;  5I22 A;  1N5Z A;  1SEM A;  2DF6 A;  5IXF A;  4J9D A;  1JXM A;  2EQI A;  3I5R A;  2DYB A;  3H41 A;  2DA9 A;  4E6R A;  4EIK A;  1UHF A;  1UGV A;  1TUC A;  1JU5 C;  1V1C A;  1G2B A;  2YUO A;  3M0P A;  3M0S A;  3VRY A;  2DL4 A;  4RTV A;  2KT8 A;  1AD5 A;  4JPB W;  5FW9 A;  1X43 A;  2EYY A;  2ENM A;  2AZV A;  3EGU A;  3TVT A;  1PHT A;  1WA7 A;  2RQR A;  2DJQ A;  2HBW A;  2D8J A;  4OMN A;  3VS3 A;  1WXU A;  3REB B;  4F17 A;  3UA7 A;  1B3Q A;  4HVV A;  1PKS A;  2FPE A;  1UTI A;  5FWC A;  2RNA A;  3UAT A;  2DE0 X;  1HJD A;  2MIO A;  1T3L A;  1X6G A;  1OPL A;  2KXC A;  5HCK A;  2CSQ A;  2RQW A;  1NYG A;  4JJB A;  4Z89 A;  2HEQ A;  4HCK A;  3EG1 A;  4OMO A;  2J6K A;  2C0O A;  3PE0 A;  2RQU A;  3KFV A;  1YNZ A;  2EW3 A;  2L3S A;  1Y57 A;  4RTZ A;  1WYX A;  1SRL A;  2JW4 A;  1M3A A;  3NGP A;  4HVU A;  1UEC A;  5IHK A;  2EYZ A;  2B86 A;  2BZY A;  2RQV A;  2O9S A;  1AWJ A;  2RMO A;  1AWW A;  2XMF A;  2FEI A;  3NMZ C;  3QWY A;  3VS7 A;  4AFQ C;  2JT4 A;  2PNI A;  1VYU A;  2L3P A;  4AFU C;  4LN2 A;  1ZUY A;  2EGC A;  2EYX A;  2ESW A;  2DMO A;  1AEY A;  4LUE A;  2K2M A;  2ED0 A;  1JQQ A;  1H8K A;  2KR3 A;  2KYB A;  2EYW A;  3RNJ A;  2DIL A;  4OMP A;  2A37 A;  4LUD A;  5EC7 A;  2DBK A;  1W1F A;  2DX1 A;  2JS0 A;  4JZ3 A;  4KRT A;  1PWT A;  1W6X A;  5GJV B;  3NPF A;  3GBQ A;  4J9H A;  1TG0 A;  4AG2 C;  1UJY A;  2W0Z A;  4CC4 B;  1UJ0 A;  3I35 A;  3H0H A;  4RTX A;  1A0N B;  2LQN A;  5ECA A;  1PRL C;  4JZ4 A;  1MUZ A;  2FRY A;  2JS2 A;  1U5S A;  1WLP B;  1WI7 A;  2IIM A;  2V1Q A;  1KJW A;  2GGR A;  2MOX A;  2CRE A;  3QWX X;  1ZSG A;  2HDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...