2L3SA

Structure of the autoinhibited crk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
163
structure length
163
Chain Sequence
VEYVRALFDFNGNDDEDLPFKKGDILKIRDKPEEQWWNAEDMDGKRGMIPVPYVEKCRPSSASVSTLTGGNQDSSHPQPLGGPEPGPYAQPSINTPLPNLQNGPFYARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinhibited Crk protein
publication title Structural basis for regulation of the Crk signaling protein by a proline switch.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 13
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3sA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3sA02
2DF6A 2H8HA 1AWWA 3VS7A 2ESWA 2AKKA 1PKTA 4RUGA 2EYWA 2P4RA 2F2WA 4AG2C 2QDLA 4OMNA 1K4US 1UGVA 1W6XA 1PRLC 2FEIA 2J6KA 4ESRA 1WIEA 5HCKA 1SPKA 4JPBW 5IXBA 2RPNA 1B3QA 2K2MA 3R6NA 4HVVA 1W70A 1X2QA 2OAWA 2EYYA 1GBQA 1HSQA 1M8MA 1B07A 2KEAA 1GCQA 2PNIA 1X2KA 4Z88A 2K79A 2YDLA 1T3LA 4QT7A 4D8KA 1JXOA 1U3OA 2GTOA 1YNZA 1IO6A 3UATA 1QLYA 1K0SA 2JS2A 2MIOA 2X3XD 2KXCA 2RF0A 1NEGA 2KE9A 1PHTA 2YUNA 5ECAA 1UTIA 3EG0A 4OMLA 3PVQA 1H3HA 2EBPA 3C0CA 1SEMA 2CSIA 2PZ1A 2J05A 2LJ3A 2JMAA 2MCNA 3KFVA 4J9HA 1CSKA 2DM1A 1GFCA 5GJVB 5EC7A 2LP5A 3SHWA 3EG1A 3I35A 2NUZA 2A08A 2K6DA 1LCKA 1K76A 1VYUA 4GBQA 3VS4A 1VYVA 2O9SA 2LJ1A 2XMFA 3VS6A 2JMCA 2RMOA 4LUDA 1H92A 4F17A 3I9QA 2I0NA 2CDTA 4JZ4A 3VRYA 2IIMA 2KYBA 3RNJA 3UA6A 1QKXA 2GNCA 2DILA 3TSWA 2ENMA 2JT4A 2AZVA 2YT6A 3O5ZA 3TVTA 2EKHA 2KT1A 4OMPA 2J6OA 2LCSA 1ZUKA 1SRMA 2CSQA 2O31A 1TG0A 3EHRA 1UJ0A 4CC2A 1U06A 2ROTA 1NLOC 2V1QA 2DVJA 3NGPA 4A63B 1JQQA 1MV0B 4RTVA 1AWOA 1JU5C 2MOXA 3I5RA 4RTYA 3VS1A 3EHQA 4LNPA 3QWXX 1ZUYA 4J9BA 1KIKA 4OMMA 1NYFA 2M0YA 4WCIA 2CREA 2EYXA 2D1XA 2JM9A 3VS0A 3REAB 2FRWA 1PWTA 2RQVA 1BBZA 4LN2A 4Y92A 2J6FA 2K9GA 1XOVA 1ZUUA 2PTKA 1JXMA 2DRMA 1BU1A 4RTZA 1UE9A 4HVWA 2LMJA 4OMOA 2LX7A 1OPLA 2DL5A 5L23A 4CC4B 1S1NA 1WX6A 3ZL7C 3VRZA 3M0SA 4GLMA 2NWMA 1X69A 3NMZC 2KT8A 4AFUC 1YP5A 5FWBA 4LE9A 4J9GA 2OJ2A 1SRLA 3PVLA 2A36A 4JJCA 1UJYA 3LH5A 1W1FA 2RN8A 4FSSA 4X1VA 2EYZA 2L3SA 1J3TA 2RNAA 4CC3A 2YSQA 3UF4A 1NM7A 1PKSA 1AZEA 2JM8A 2EVRA 4Z8AA 1HJDA 2KYMA 2OI3A 1N5ZA 2F2VA 1Z9ZA 1VA7A 1YWOA 4RTWA 2DBMA 1AZGB 1UHCA 1UDLA 4RTTA 1U5SA 1WXBA 2DBKA 2DE0X 3PE0A 1QKWA 1TUDA 1FMKA 1MV3A 1GFDA 2LNHB 3VS3A 2O9VA 2L0AA 2D8JA 1AWXA 1GRIA 1VYTA 2LZ6B 1I0CA 3EGUA 1M3BA 2CUBA 1QCFA 2FPFA 2W10A 1NG2A 1X27A 3M0RA 3VS2A 3U23A 3CQTA 1RI9A 1QWEA 1K0XA 4AFSC 2KR3A 1KFZA 2RQTA 1T0JA 4J9IA 3GBQA 2RQWA 2VVKA 2DRKA 1E6HA 3THKA 1GCQC 1T3SA 2LJ0A 2CUDA 2DL4A 1T0HA 4M4ZA 1SHFA 1OV3A 2A37A 1Y0MA 1M30A 1MUZA 2BZ8A 4JJDA 2HDAA 2KBTA 3FJ5A 4AG1C 1H8KA 3EG2A 2YUQA 1M27C 4AFZC 4J9FA 5FWCA 2LQNA 1HD3A 3TSZA 3QWYA 2O88A 5IHIA 4F14A 1AWJA 1BB9A 2HCKA 1Z9QA 2X3WD 4R0KA 1JO8A 2EGCA 2V1RA 2DL8A 2G6FX 2J7IA 2ECZA 3H0HA 3ULRB 2CT4A 1I1JA 2VWFA 1PNJA 2ABLA 1KSWA 5I22A 2JS0A 3M0QA 2KRNA 2SRCA 1X43A 1OPKA 4OMQA 2JW4A 1YWPA 4DEYA 1WA7A 2CH4W 1RLQC 1G2BA 2A28A 2RQRA 1WDXA 4EIKA 2DNUA 5IH2A 1UFFA 4HVUA 2EGAA 2EGEA 1GBRA 4CC7A 2FRYA 2HEQA 1PRMC 3REBB 2SEMA 3M0PA 1X6GA 2ROLA 2GTJA 2LQWA 2F2XA 2HSPA 3IQLA 1ARKA 3UA7A 1NYGA 2BZYA 5GJWB 1A0NB 1V1CA 3I5SA 2JTEA 4LUEA 4J9CA 2L3QA 1WFWA 2EPDA 2M51A 1AD5A 1QWFA 4HXJA 2VKNA 1YN8A 1AVZC 1M3CA 1SHGA 1TUCA 1RUWA 4AFQC 2GQIA 2CH4A 2RQUA 3RBBB 1BK2A 2KROA 2GBQA 3H0IA 1M3AA 2YUOA 2KXDA 2DYBA 2W0ZA 1AEYA 1NLPC 4JJBA 3NPFA 2C0TA 3H41A 3A98A 2J06A 1ZLMA 1ABOA 1EFNA 2EQIA 1NEBA 2HBWA 2KNBB 1GCPA 2D8HA 1ZX6A 3VS5A 2JXBA 2DMOA 5I11A 1UECA 2FPDA 1RLPC 2GGRA 5FW9A 2B86A 1WI7A 4J9EA 2FG0A 1E6GA 2ED1A 4F16A 1AOJA 1KJWA 3JV3A 2KGTA 2FPEA 3EG3A 1JEGA 1I07A 2DA9A 4IIOA 2AZSA 1UHFA 1WXTA 4RTXA 5IXFA 2BTTA 1OOTA 2KRMA 2ED0A 1ZSGA 2FO0A 4JZ3A 1K9AA 2AK5A 2K7AA 2CT3A 2DL3A 4IIMA 2L3PA 2D0NA 1ZBJA 1YCSB 2YUPA 3M0UA 1GL5A 1E7OA 4HCKA 3M0TA 2DLPA 4DEXA 1WYXA 3NHNA 1K1ZA 1X6BA 4E6RA 4ZNXA 2DX1A 4KRTA 2E5KA 1G83A 1UUEA 2K3BA 1FYNA 2C0OA 2DJQA 4ORZA 1OEBA 2C0IA 4D8DA 2KRSA 1ABQA 4K11A 3H0FA 4RTUA 2EW3A 5IHKA 1Y57A 2DL7A 1SSHA 1WXUA 5IHNA 2O2OA 2L2PA 2AKLA 1CKAA 1UG1A 1CKBA 4J9DA 3SEMA 1WLPB 2BZXA 4Z89A
chains in the Genus database with same CATH superfamily
2DF6A 3TREA 1C6VX 3DKMA 2ESWA 2AKKA 2RK2A 4RUGA 2K57A 1RAGB 2F2WA 2D0QB 2QDLA 4J6YA 1K4US 3G7ZA 1W6XA 2L89A 1D0ZA 1PRLC 2J6KA 5I2SA 2HL3A 5GAMj 1KD1C 2E41A 5HCKA 4M75C 1VIFA 4JPBW 2RPNA 5LL6S 2K2MA 4HVVA 5GAN6 1X2QA 2B8AA 4OB1B 1M90R 3CBOA 2JVVA 3CCSQ 3JCMc 1GCQA 2E4HA 3PMIA 4Z88A 3OYIA 1T3LA 2MAMA 4QT7A 3G1JA 3JSCA 2HQXA 1YNZA 1IO6A 3UATA 4OB3B 4C0DB 1QLYA 1K73U 2E10A 1K0SA 2MIOA 3EG9B 2RF0A 3CPFA 3HHTB 1C0MA 5ECAA 1UTIA 2CZ7B 2KAFA 1OX8A 4M78E 5D6YA 3M5AA 1K9MC 4KUDK 3KFVA 4C92B 4DBHA 3JCMg 2DM1A 2LP5A 2EYQA 1VYUA 2R58A 2OTJA 3OYEA 3NFCA 3AHUA 2LJ1A 1YHQT 3VS6A 2DZ9A 2COYA 3A5ZB 4M78B 2EJ9A 2VYTA 2CDTA 1G3YA 3RMSA 2IIMA 2KYBA 2L8DA 4OF1A 1N8RU 1BI3A 4A4KA 3CPWP 2ENMA 2QEXQ 3OB9A 2EKHA 3E1SA 4M77E 2Z0WA 3UWNA 3GOXA 5GMKm 2J6OA 1S72A 1LNXA 1KC8R 2RHXA 5GANh 4AMCA 1MMAA 2V1QA 1BI2A 3NGPA 3EH1A 1LVKA 4RTVA 5J3BA 1AWOA 1KQ2A 3OSSC 3EHQA 4MZTA 2O4XB 1KIKA 4M75A 1N27A 5L8RE 3OYKA 4M77B 4C8QC 2CREA 3CCEQ 4KH0B 2NUTA 5D7UA 3VS0A 1WHKA 2RQVA 1BBZA 1NJIU 1V76A 4Y92A 1D0XA 3MP6A 2JJ9A 3NTIA 2K9GA 1XOVA 3DB4A 2MYSA 5AT1B 1JXMA 5LJ5e 5J39A 2LMJA 2LX7A 1TXQA 1K8AC 8ATCB 5FRMA 5L23A 4R55A 4CC4B 1S1NA 5CAIA 5FU7C 4PJOG 1Q7YR 2Y4XA 1KQSS 1BIBA 3UDCA 2HNIA 4GLMA 2YRVA 1X69A 1KQSA 2KMTA 1QP2A 4ZTJA 4LE9A 4J9GA 4ATOA 1D3BA 1SRLA 2A36A 4JJCA 3OSVA 2R5MA 1UJYA 3V8JA 1WHJA 4X1VA 2L3SA 2YWWA 3RESA 1PKSA 4CRIA 2EVRA 3QIIA 2E3IA 2F2VA 1FMWA 1Z9ZA 2BKDN 3V7SA 2JNGA 3JCMW 1KD1U 1AZGB 4M78D 1UDLA 4N0AC 4PL6A 1U5SA 4C8QF 4DBQA 4A4FA 1VIEA 1Y07A 1FMKA 1F1BB 1BCOA 2QQRA 4RCCA 1M1FA 1JBMA 2D8JA 5LJ3g 1YHQA 2QG9B 1WZOA 2LZ6B 5I2MA 3OY9A 2ZPHB 3EGUA 1YIJQ 2CUBA 1M5Q1 4M7AE 2EQKA 4QQDA 3VJPA 3A8GB 3U23A 1QWEA 4KULA 3H9NA 3EH2A 5LJ3f 2RQWA 3QYGB 3FB9A 3THKA 1T3SA 2LJ0A 4M77D 1RAFB 2LCLA 2RJEA 3LGLA 3EFOA 2BZ8A 2NLUA 4C5EA 2HDAA 3DLLA 2PQWA 4B9WA 4M7AB 1UGSB 3EG2A 3MEUA 1Q81C 4JRQA 3V7CA 3FEOA 4M77G 4PJOA 3TSZA 4Q5WA 4LDXA 1TWBA 4DA4A 1IHVA 1BB9A 4E7HA 1Z9QA 4R0KA 4XTYA 2V1RA 4CI0C 2ECZA 3A8LB 1MGQA 3OYYA 4NL2A 2GFUA 5CKDA 1I1JA 2E6ZA 1PNJA 1VQNQ 1KSWA 2A0FB 1I5OB 2RA2A 4RMOA 4IURA 2BUDA 2WSEE 2JW4A 2XD0A 4ZTFA 1D0YA 4QVDA 1VUBA 3CCLQ 1WDXA 2EGAA 4CC7A 2FRYA 3REBB 4N0AA 1X6GA 3WXMB 4C5IA 4MZPA 4IUUA 4R56A 2HSPA 3CC2T 1ARKA 1M1KC 1NYGA 5GAMg 2DXCA 3I5SA 4J9CA 1VQ5Q 1JJ2S 4FIBA 4HXJA 2VKNA 4BY6B 2OTLT 3LGFA 2CP3A 3P8DA 5CK9A 1JJ2A 1R0BG 3CC4T 3CCJQ 5LJ5h 3LW5E 2QA4Q 2CH4A 3RR6A 3RBBB 3PNWC 3H0IA 1R8OB 1ZQ1A 2LVMA 2QQ9A 3I55T 1H641 2YUOA 2P0KA 4XU1A 4MMKA 2F5TX 2W0ZA 3QSUA 3CCVQ 1NLPC 2GQVA 4O6JA 3A98A 4PFOA 1TUGB 1VOMA 4FT4A 4M7AD 3C95A 4KUIA 1ZLMA 1ABOA 1EFNA 2HBWA 1ACMB 3QDRB 1RLPC 4XU2A 2GGRA 4MDWA 2G3RA 1JB0E 4M7AG 1KJWA 3JV3A 4LDVA 2F5KA 2FPEA 1G3WA 3OMCA 1GXIE 4RTXA 1Q82C 4BDYA 3HRTA 1ZSGA 3A8OB 2CYZB 1FX7A 1M90U 1TTHB 2K7AA 1OQKA 2DL3A 2KI7A 2D0NA 3M0UA 3I56Q 4LDUA 3M0TA 1VQKQ 1I4K1 1Y71A 4E6RA 1QVPA 2DX1A 1WQ7A 3CCUQ 3L2ZA 1ZBXA 1N6AA 2C0IA 2KRSA 1VQLQ 3VKIA 5GMKj 2CP7A 2HD0A 2DXUA 2EIFA 1U1TA 1AHJB 2L2PA 2AKLA 3CC2A 2CS7A 3CMET 1RADB 1UG1A 1ZHIA 1WLPB 4RG8A 5GAOm 2Y4YA 3BW1A 2RHIA 5CQXA 1AWWA 2CP6A 2OTLA 3VS7A 4M75E 1QW1A 1YITT 3CC4A 1PKTA 2P4RA 5KYYB 2DD5A 4AG2C 3EAEA 2VXFA 1UGVA 1K73C 2EKOA 4WF2A 3CD6Q 4EMGA 2FEIA 4DBFA 4M7DC 1WIEA 1SPKA 3FDRA 3I55A 1D1BA 4YTLA 3R6NA 3C4SA 3QPHA 1W70A 2OAWA 4EDUA 1GBQA 1K9MR 5M9OA 3OYFA 3KUFA 1B07A 3N5BB 4M75B 2PNIA 1X2KA 4JUVA 1VQ7Q 4D8KA 1JXOA 2OX7A 4XTZA 2NUTB 5GAOr 5GANd 3JCMJ 2JS2A 4VUBA 1RL2A 1QVGP 2DERA 1NEGA 2CZ0B 1YI2Q 3PVQA 1H3HA 2EBPA 1YJNQ 2QQBA 1ZSZC 3NTKA 3OYLA 1N8RC 2J05A 1WGSA 2MCNA 2XK0A 4J9HA 3JCMP 4HKEA 1IGQA 5EC7A 2QGFB 3I35A 3JCMQ 2NUZA 1K76A 4RG2A 1IGUA 2LNVA 1D3BB 4M7DF 3CXCS 2RMOA 4LUDA 1H92A 4F17A 2K5IA 3CXCA 4F7UA 2WACA 2HSEB 3VRYA 3RNJA 3TCJA 3UA6A 2GNCA 1XTDA 2HBPA 3TSWA 2X4JA 3JCMe 3J81E 4FYXB 1ZUKA 3JB9F 1SRMA 2O31A 3EHRA 4FW2A 1UJ0A 4CC2A 1Y7XA 3QJYA 2XHCA 1PSFA 2DYIA 4IUTA 4A63B 4BI4A 1MV0B 4C8QE 1YJ9Q 1JU5C 2MOXA 3I5RA 2DZCA 2CZ1B 1WJSA 5A0LA 2A7YA 4XTUA 4BUGA 3CCMQ 3QDFA 2DTOA 2XIDA 3LLRA 1NPRA 2PVOB 4OMMA 3UT1A 1NYFA 3PFSA 2EYXA 2YLBA 2D1XA 3H6ZA 1YITA 1PWTA 2LCCA 3LWIA 4LN2A 4M75D 1P92A 3X28B 1ZUUA 2RJDA 2DD4A 2PTKA 1BU1A 4RTZA 4LDYA 1IZ6A 4OMOA 4A53A 2COZA 3EFOB 3OYMA 3ZL7C 2QQSA 1VQOT 4M75G 3NMZC 1TSFA 1YP5A 2JN0A 2EAYA 5FWBA 1NE8A 2CP2A 3GPLA 4PJOB 4OVAA 3PVLA 4EMKC 4JRIA 3TEEA 5FLXE 1I81A 1W1FA 2RN8A 1OU9A 1RAAB 3TU4K 3M54A 1V29B 2RI3A 4Z8AA 4FYYB 1VA7A 2X4XA 2DJZA 4RTWA 3E2UA 5GAOq 2DBMA 4MDXA 3BFMA 2DE0X 3SFMA 3UPUA 1AT1B 1IREB 1TUDA 2CP0A 2GF7A 5DM7R 2DEUA 1Y96A 3M55A 1RAEB 2LNHB 4EMHA 1LPLA 5FU6C 2O9VA 2RHZA 3S3MA 1W2BS 4BDZA 1I0CA 1M3BA 2M1HA 3WVEB 2H3EB 2FPFA 2PVDB 1W2BA 2LX9A 3GIBA 2OTJQ 1C1AA 7AT1B 1VQPT 1KFZA 1BIAA 2VVKA 4BI8B 1E6HA 1FMVA 1X6OA 2CUDA 2DL4A 1YJWT 5C6SA 1G8XA 4A4EA 1MUZA 3FJ5A 2KBTA 2HL5C 2JOYA 4X34A 3OYGA 1S72Q 1G3SA 2EQMA 3HKSA 2ZAEA 2LQNA 4PFPA 3RKXA 3QWYA 2O88A 2YXYA 1EIFA 3OMGA 5IHIA 5LJ5d 2Y90A 3X26B 2X3WD 1JO8A 2EGCA 3EGXA 2DL8A 2RJCA 2D9TA 3H0HA 3FC3A 4C8QG 1BI0A 4PJOD 2CT4A 3CCQT 1OULA 3JCMh 2JS0A 3VV0A 2ZPEB 2SRCA 1X43A 3HFOA 3JCMX 4OMQA 1YWPA 2EWNA 1VQOA 5GAOn 1WA7A 2D6FA 2X35A 1G2BA 2RQRA 5C0MA 5IH2A 4HVUA 4PK4A 2EGEA 1GBRA 4ELYC 1PRMC 4XAXB 5A2QE 3ZEHA 2JTMA 1IHWA 2GTJA 2LQWA 2F2XA 2CZ6B 3IQLA 4X9CA 2BZYA 4JDSA 3G6ET 1KQSP 1V1CA 1A0NB 2QTVA 1H3ZA 1MNDA 1VQ4T 4IUPA 2FZCB 1AD5A 4KH1B 4ZGDB 4OP0A 1YCYA 4DOWA 1M2OA 3G4ST 2RQUA 2ZPGB 4C0DC 3M9QA 5GAMe 1PG5B 2VGMA 2GCXA 5GAN8 2KXDA 2DYBA 4E7IA 2RI2A 4JJBA 2KY9A 4O5VA 3H41A 3V7RA 2J06A 5CKFA 5GAOp 3JRZA 4C92C 1YHQQ 1VQPA 5I21A 2XICA 4ZGEB 1M90C 2E64A 5FW9A 1YJWA 1DJ7B 3F70A 4GY5A 1UEBA 2DO3A 3PGGA 3CMAT 4F16A 5HK0A 1AOJA 4C8QA 3FJPA 2KGTA 1VQMT 2VGNA 5KCHA 1JEGA 2DA9A 4IIOA 2AZSA 1WXTA 3OS1A 3MO8A 1Q86R 2ED0A 3G71T 2RD1A 2FO0A 1EZZB 2CP5A 3ZFJA 5CO7A 5GAN4 3L42A 2E6NA 2OAUA 1YCSB 2EQJA 2YUPA 3JB9I 1W4SA 3PMTA 3CCQA 2DLPA 4DEXA 4HCBA 3L2WA 3NHNA 4FL6A 3A8MB 3URGA 1VQ6T 4PNOA 1EX4A 2FHDA 2E5KA 2R5AA 1G83A 4F7UE 1UUEA 2QK0A 4PLLA 4FYWB 1PSEA 4D8DA 2LDMA 5LJ3h 1ABQA 4K11A 2EW3A 3RIRA 4C92F 2DTIA 1BI1A 2QAZA 5KCOA 3OQ5A 3INZA 1WXUA 4OB0B 3CCRT 2M9UA 1CKAA 3EGDA 3V8LA 2HQHA 3G6EA 3OYBA 5LJ5f 2JUFA 4J9DA 3C94A 5IT9E 1KC8C 4M78F 4Z89A 1VQ4A 2MF2A 5CVIA 4F7UB 2H8HA 5KYXA 3DB3A 4M7DE 2EFIA 2WSFE 2DEQA 2HKNA 3MEWA 1VQ9T 3QO3A 4BD3A 3G4SA 4HCCA 2K5LA 3TQ7P 2X4YA 1JJ2P 3HP9A 2DVEA 5IXBA 4JRPA 3M57A 1B3QA 3MHXA 3GLXA 2EYYA 1M8MA 1HSQA 4B9XA 5KE2A 4C0GA 1WHLA 2VUBA 2KEAA 1SF9A 2K79A 1XQHA 2X9HA 1D1CA 1ZA1B 1U3OA 1WPYA 4M77F 1MMNA 2DXBA 2DKGA 2E12A 4HT9A 1OU8A 2KXCA 3LYIA 2HKQB 4V2SA 1KQ1A 2KE9A 4KBMB 1IRXA 4TVRA 3OW2S 3BDUA 5GANj 4OMLA 2ZZDA 1SEMA 2RM4A 3CMAA 3QG1A 1PC0A 3OW2A 3VUZA 1FWZA 1VQMA 3X24B 2LJ3A 1CSKA 9ATCB 3J7AF 2XDDA 1GFCA 5GJVB 5GAMh 2FL7A 3SHWA 3EG1A 1UGRB 3G71A 2A08A 2K6DA 1NJIR 4GBQA 3VS4A 1VYVA 2O9SA 2QDYB 4P5NA 4II1A 1MNEA 1M2VA 3SWNC 5FROA 2A3LA 4N4HA 1MMGA 4L5GA 5KH6A 4JZ4A 1SG5A 1WHHA 3LX7A 2AT1B 2DILA 3H8ZA 2JT4A 2YT6A 3MCAB 3TVTA 1VQ6A 4E7KA 1M4ZA 2KT1A 1LOJA 3M4YA 1QP3A 2K3XA 3MP1A 2BIVA 2NUPA 1I5LA 1U1SA 1U06A 3VU3C 1RAIB 2BE7D 4QVCA 1Y96B 5GMKi 1JQQA 3CBPA 5KYWA 3CCRA 2DAQA 3CC7T 1OI1A 3VS1A 2KQWA 4LNPA 3QWXX 3RUXA 2LT1A 2ATCB 4DBRA 2RJFA 4F7UG 2FZGB 2M0YA 1KD1R 4PJNA 4LDWA 1XJWB 1QMCA 4ELZC 2JM9A 2O01E 3REAB 3CC2Q 4M7DD 1BKBA 3HRUA 1VQ9A 2J6FA 2DTHA 2DPPB 3QJ6A 2EQUA 2DRMA 2VC8A 1UE9A 2YLCA 3CCMT 1OPLA 2K4YA 2OTLQ 1WX6A 3CC4Q 3M0SA 3JB9H 4M7DG 4X9DA 4M7AF 2NWMA 3JB9D 1VQ8T 1O75A 1PD1A 4AFUC 1WHMA 3QHSA 2IPOB 1X75C 1KC8U 3SDZA 3I55Q 4FW1A 3LH5A 4FSSA 3EGXB 2EYZA 1J3TA 1D09B 2RNAA 4NS5A 4E7LA 2YSQA 3JB9G 1HJDA 2OI3A 3SWNA 4MMLA 3OYAA 1YWOA 2V8IA 2X4WA 3HPWA 4RTTA 2HMAA 3PT9A 4J6XA 2PU9B 3CCST 1MV3A 2JTFA 2P0PA 3QZ5B 3VS3A 4J8OA 4KGXB 2L0AA 1AWXA 1X01A 3JCMd 1Q7YU 2PUKB 1B34A 2RHUA 4J5YA 1NG2A 1X27A 3M0RA 5KYUA 3VS2A 3CQTA 1LJOA 4BACA 4AFSC 3QZ9B 4BE2A 2KR3A 2RQTA 3GBQA 3CXCP 1HYOA 2DFUA 2DRKA 3BY7A 3OYNA 1GCQC 2LQ8A 4A54A 1KHIA 1SHFA 1OV3A 5GAN3 1TOVA 1M30A 2K5FA 3RKWA 4JJDA 1BCMA 3CC7A 1H8KA 2YUQA 4QW2A 4PJLA 1N9RA 2FZKB 2COWA 4LXCA 5FWCA 3LH0A 1HD3A 4BE1A 1K8AR 3CMEA 3FIFA 4F14A 1AWJA 4M7DA 1M8VA 3E9FA 2XG8D 5CQYA 2QEXT 2G6FX 2LTOA 2J7IA 2JZ2A 3CMEQ 1WHGA 4FYVB 5GMKl 5LJ5j 2ABLA 2GFAA 2XU8A 5I22A 4XTVA 3A8HB 1G5VA 3O8VA 1OPKA 1YITQ 4N4GA 2RO0A 4C8QB 2CH4W 1WQWA 2DNUA 1QVFS 1VQ8A 1UFFA 1RABB 4J6WA 2XI9A 1KHCA 5KYNA 2HEQA 5GAN7 1QVFA 2SEMA 3CCET 3UA7A 3MP8A 5GJWB 1ZSZA 3HFNA 1Q86U 5FU7B 3P8BB 3RKYA 1WFWA 2EPDA 2M51A 2K3YA 4FCYA 1U8RA 3RERA 3OS2A 2NYSA 2AIRB 1NZ9A 1AVZC 2QASA 4C5HA 1HK9A 3MEAA 5HY6A 1RUWA 4AFQC 2GQIA 3ASKA 5A0DA 3CCSA 2KROA 2GBQA 3GF5A 5DY9A 2VV5A 4IUVA 5HK3A 3OBYA 4C92E 1OZ2A 3EGDB 5GANg 1AEYA 2C0TA 3T9NA 4L59A 2CGHA 5KYXB 1MHNA 5LJ3d 1GCPA 2D8HA 1ZX6A 3VS5A 5GANf 1Q81R 2JXBA 2DMOA 1W2BP 1UECA 3HTRA 1UGQB 1KG1A 3M59A 4UC4A 3OYDA 2HZYA 5LJ3e 1I07A 1YIJT 1QCOA 5IXFA 2BTTA 1OOTA 3QKJA 4M75F 4JZ3A 3JCMf 1G3TA 4C8QD 3CPWS 2QEXA 2CT3A 1BYMA 4IIMA 3CPWA 1ZBJA 1GL5A 1E7OA 1QQJA 5KYYA 4DQ2A 1WYXA 3OS0A 1K1ZA 1X6BA 1M1KR 3META 4EMKA 2K3BA 1FYNA 4ORZA 1OEBA 3OA6A 3JAME 3X25B 1FXXA 4ME7A 1Y57A 2DL7A 2ZGWA 3CCEA 5IHNA 4JS5A 2LRQA 1SKUB 1VQOQ 1M2VB 5GAN5 3M58A 1TS9A 3S6WA 1CKBA 2LT4A 3L2RA 1VQNT 1IB8A 3BE3A 5GAMd 4IUQA 2FVUA 1SSFA 2EYWA 3C12A 3RMQA 3CCLT 4OMNA 4PJOC 1PD0A 2V8JA 2NUPB 4OGEA 4Y28E 1IXDA 4ESRA 2P0QA 2VXEA 4OGCA 5KYWB 1Q95G 3L2VA 5FRNA 5CIUA 6AT1B 5GMKh 3OS5A 1OYXA 4C92D 2KDSA 5CR2A 1VQ5T 2YDLA 3QUIA 4LD9K 4ANJA 5CKHA 4B6MA 3JCMb 2GTOA 2DK3A 3DLMA 4Z02A 2X3XD 3CCJT 3KXTA 3V8KA 2PUOB 2QA4T 1Q82R 1PHTA 2C06A 2YUNA 4C92G 2X51A 4KT0E 5D6WA 3EG0A 3C0CA 4C0FA 2CSIA 2BE9B 1VQPQ 1MMDA 4A4GA 2PZ1A 4E7SA 2JMAA 3CCVT 2QYZA 2L3RA 1YIJA 1YJWQ 3S3OA 4M78C 4M78G 1OZ3A 2KVQG 1LCKA 4XU0A 1M9SA 4F04B 2E70A 3E9GA 4PJOF 2HAXA 4NL3A 2XMFA 4XTWA 2JMCA 3KBGA 3VYHB 2WSCE 3I9QA 2I0NA 1K9MU 2MK5A 3SWNB 1QKXA 4JRKA 5KE3A 3O5ZA 1I8FA 2AZVA 1YFNA 2YRDA 3MJXA 3GNGA 4OMPA 1ZA2B 3CEYA 2I2LA 2LCSA 2F1LA 2M0OA 4WTOB 2CSQA 2XDPA 1TG0A 3CCQQ 2ROTA 2DIGA 3QYHB 1UGPB 1NLOC 5HKCA 2DVJA 4GLKA 4DOVA 2M02A 2PVGB 4J7FA 5LJ5g 4J83A 4M77C 2QTXA 2EJFA 4RTYA 1N9SA 1M1GA 2K2VA 2V8KA 1ZUYA 4J9BA 3I56T 1R0CB 1K73R 5IN1A 1B34B 1VQNA 1VQKT 5KYUB 4WCIA 3ZBDA 1RACB 3CCUT 3L2UA 2FRWA 3EG9A 3G6EQ 4AT1B 4E47A 2P4TA 2QQAA 3CCLA 4QQGA 1VQLT 1VQ4Q 4HVWA 2LQKA 2MWOA 3M4GA 4ZGJB 2RHYA 2DL5A 3RDVA 1OX9A 3VRZA 2DIQA 3MPUB 2MWPA 4C92A 2IG0A 3G4SQ 2KT8A 4ZN1A 4BE0A 5GAOl 1VQ5A 2HQEA 2OJ2A 4M7DB 1RI0A 2QI2A 4D6WA 4QQ6A 1N8RR 4KGVB 4M78A 4XK8E 4CC3A 3CCJA 3UF4A 4BI3A 1NM7A 1AZEA 4OB2B 2JM8A 1K8AU 4JLGA 2QA4A 3HL8A 2KYMA 5GAMf 2VB6A 3CD6T 1N5ZA 1Q7YC 4E2FB 1UHCA 1TH7A 3FLGA 5CKEA 1WXBA 2E3HA 2DBKA 3PE0A 4XU3A 3CCVA 1QKWA 2QXFA 1GFDA 1VQ7T 4PJJA 3OW2P 3R6OA 2R57A 3J80E 3CMAQ 4XQ3A 2DETA 1VQMQ 1GRIA 1VYTA 4C0ZA 2O4XA 1ZSZB 2KK4A 1QCFA 2VASA 2W10A 3HSBA 4M77A 3G71Q 1RI9A 1YI2T 1K0XA 1JRIA 3PIOA 3L2QA 1YJNT 3FRNA 1PCXA 1T0JA 4J9IA 4PLIA 4FSXA 3EFRA 4M7AC 1T0HA 5GAN2 4M4ZA 1B7TA 2P84A 1KK7A 2A37A 1Y0MA 2YHTA 1VQ6Q 4AG1C 4E7ZA 1M27C 4AFZC 4JS4A 4J9FA 3I56A 5D6XA 3NTHA 2XDBA 4FU6A 1VQKA 3S3NA 3M56A 3CCRQ 2HCKA 3CCUA 4PKCC 3OYHA 2DXTA 4OMFB 3ULRB 4LD6A 4ZN3A 3GP8A 2VWFA 1VQLA 2E1HA 2ZCFB 2KSSA 2IVWA 1Q86C 3M0QA 4FM4B 2KRNA 1UB4A 1Q81U 1YJ9T 4PFZA 4DEYA 4Y91A 3Q1JA 1VQ9Q 4XTXA 1RLQC 2A28A 4EIKA 1WJRA 2RK1A 2ZPFB 4RKUE 3M0PA 3L1AA 2ROLA 2MMPA 3LWHA 1R77A 1RAHB 4BY6C 4EPCA 2XKOC 2LC4A 3SB2A 2M16A 2JTEA 4LUEA 1WJQA 2L3QA 3CD6A 3AT1B 1QWFA 3JCMV 4J7IA 4FT2A 1YN8A 1M3CA 1SHGA 3CBMA 4EMKB 3E19A 1TUCA 2RH2A 1PM3A 2YRCA 4C5GA 1O9SA 1BK2A 3P8HA 1VQ7A 1M3AA 5DLQE 1M1KU 3PTAA 5A0GA 4M7AA 5J26A 2MI6A 4HT8A 1QVGS 4HA8A 2MPXC 5AYFA 3NPFA 3ER0A 1QVGA 2ZPIB 3VUBA 1HXDA 3D7SB 1YI2A 2H3JA 3X20B 4F7UF 3QXEB 2L5QA 2EQIA 1NEBA 1YJNA 2KNBB 3EFSA 3M53A 5I11A 2FPDA 5FU6B 3WVDB 5LJ3j 2B86A 4E7JA 1WI7A 5IAYA 4J9EA 4N4IA 2FG0A 1E6GA 3SD4A 5GANe 1NPPA 2ED1A 4QVZA 2RI5A 3OYJA 4JJNK 2E5QA 1WNLA 3EG3A 3MEVA 4KGZB 3VYGA 3OBWA 1UHFA 5CKBA 2FB7A 2KRMA 1TU0B 4BB7A 3BDLA 1XNIA 4HCZA 2OTJT 3QBYA 1K9AA 3CC7Q 2AK5A 2ZPBB 4PJMA 1D1AA 2L3PA 5CCAA 5EG2A 4A4HA 4HCKA 4L6V5 3JB9J 1NJIC 4ZNXA 4RCBA 4KRTA 1YJ9A 2EJGA 2CKKA 3A1PA 4MZMA 2C0OA 3GNFB 2DJQA 1Q82U 1S72T 3CCMA 2F69A 1QCNA 3H0FA 4RTUA 1YBYA 2RB6A 5IHKA 3MKDA 3PIPA 1SSHA 2E65A 2AHJB 3ME9A 3HRSA 4IKFA 2O2OA 1NBEB 2QGGA 5DLOA 2V26A 5GMKe 2FYKA 4JLIA 1VQ8Q 3OYCA 3SEMA 4NOYA 8AT1B 4QKUA 2BZXA 1QVFP 4PJOE
chains in the Genus database with same CATH topology
2DF6A 2H8HA 1AWWA 3VS7A 2ESWA 2AKKA 1PKTA 4RUGA 2EYWA 2P4RA 2F2WA 4AG2C 2QDLA 4OMNA 1K4US 1UGVA 1W6XA 1PRLC 2FEIA 2J6KA 4ESRA 1WIEA 5HCKA 1SPKA 4JPBW 5IXBA 2RPNA 1B3QA 2K2MA 3R6NA 4HVVA 1W70A 1X2QA 2OAWA 2EYYA 1GBQA 1HSQA 1M8MA 1B07A 2KEAA 1GCQA 2PNIA 1X2KA 4Z88A 2K79A 2YDLA 1T3LA 4QT7A 4D8KA 1JXOA 1U3OA 2GTOA 1YNZA 1IO6A 3UATA 1QLYA 1K0SA 2JS2A 2MIOA 2X3XD 2KXCA 2RF0A 1NEGA 2KE9A 1PHTA 2YUNA 5ECAA 1UTIA 3EG0A 4OMLA 3PVQA 1H3HA 2EBPA 3C0CA 1SEMA 2CSIA 2PZ1A 2J05A 2LJ3A 2JMAA 2MCNA 3KFVA 4J9HA 1CSKA 2DM1A 1GFCA 5GJVB 5EC7A 2LP5A 3SHWA 3EG1A 3I35A 2NUZA 2A08A 2K6DA 1LCKA 1K76A 1VYUA 4GBQA 3VS4A 1VYVA 2O9SA 2LJ1A 2XMFA 3VS6A 2JMCA 2RMOA 4LUDA 1H92A 4F17A 3I9QA 2I0NA 2CDTA 4JZ4A 3VRYA 2IIMA 2KYBA 3RNJA 3UA6A 1QKXA 2GNCA 2DILA 3TSWA 2ENMA 2JT4A 2AZVA 2YT6A 3O5ZA 3TVTA 2EKHA 2KT1A 4OMPA 2J6OA 2LCSA 1ZUKA 1SRMA 2CSQA 2O31A 1TG0A 3EHRA 1UJ0A 4CC2A 1U06A 2ROTA 1NLOC 2V1QA 2DVJA 3NGPA 4A63B 1JQQA 1MV0B 4RTVA 1AWOA 1JU5C 2MOXA 3I5RA 4RTYA 3VS1A 3EHQA 4LNPA 3QWXX 1ZUYA 4J9BA 1KIKA 4OMMA 1NYFA 2M0YA 4WCIA 2CREA 2EYXA 2D1XA 2JM9A 3VS0A 3REAB 2FRWA 1PWTA 2RQVA 1BBZA 4LN2A 4Y92A 2J6FA 2K9GA 1XOVA 1ZUUA 2PTKA 1JXMA 2DRMA 1BU1A 4RTZA 1UE9A 4HVWA 2LMJA 4OMOA 2LX7A 1OPLA 2DL5A 5L23A 4CC4B 1S1NA 1WX6A 3ZL7C 3VRZA 3M0SA 4GLMA 2NWMA 1X69A 3NMZC 2KT8A 4AFUC 1YP5A 5FWBA 4LE9A 4J9GA 2OJ2A 1SRLA 3PVLA 2A36A 4JJCA 1UJYA 3LH5A 1W1FA 2RN8A 4FSSA 4X1VA 2EYZA 2L3SA 1J3TA 2RNAA 4CC3A 2YSQA 3UF4A 1NM7A 1PKSA 1AZEA 2JM8A 2EVRA 4Z8AA 1HJDA 2KYMA 2OI3A 1N5ZA 2F2VA 1Z9ZA 1VA7A 1YWOA 4RTWA 2DBMA 1AZGB 1UHCA 1UDLA 4RTTA 1U5SA 1WXBA 2DBKA 2DE0X 3PE0A 1QKWA 1TUDA 1FMKA 1MV3A 1GFDA 2LNHB 3VS3A 2O9VA 2L0AA 2D8JA 1AWXA 1GRIA 1VYTA 2LZ6B 1I0CA 3EGUA 1M3BA 2CUBA 1QCFA 2FPFA 2W10A 1NG2A 1X27A 3M0RA 3VS2A 3U23A 3CQTA 1RI9A 1QWEA 1K0XA 4AFSC 2KR3A 1KFZA 2RQTA 1T0JA 4J9IA 3GBQA 2RQWA 2VVKA 2DRKA 1E6HA 3THKA 1GCQC 1T3SA 2LJ0A 2CUDA 2DL4A 1T0HA 4M4ZA 1SHFA 1OV3A 2A37A 1Y0MA 1M30A 1MUZA 2BZ8A 4JJDA 2HDAA 2KBTA 3FJ5A 4AG1C 1H8KA 3EG2A 2YUQA 1M27C 4AFZC 4J9FA 5FWCA 2LQNA 1HD3A 3TSZA 3QWYA 2O88A 5IHIA 4F14A 1AWJA 1BB9A 2HCKA 1Z9QA 2X3WD 4R0KA 1JO8A 2EGCA 2V1RA 2DL8A 2G6FX 2J7IA 2ECZA 3H0HA 3ULRB 2CT4A 1I1JA 2VWFA 1PNJA 2ABLA 1KSWA 5I22A 2JS0A 3M0QA 2KRNA 2SRCA 1X43A 1OPKA 4OMQA 2JW4A 1YWPA 4DEYA 1WA7A 2CH4W 1RLQC 1G2BA 2A28A 2RQRA 1WDXA 4EIKA 2DNUA 5IH2A 1UFFA 4HVUA 2EGAA 2EGEA 1GBRA 4CC7A 2FRYA 2HEQA 1PRMC 3REBB 2SEMA 3M0PA 1X6GA 2ROLA 2GTJA 2LQWA 2F2XA 2HSPA 3IQLA 1ARKA 3UA7A 1NYGA 2BZYA 5GJWB 1A0NB 1V1CA 3I5SA 2JTEA 4LUEA 4J9CA 2L3QA 1WFWA 2EPDA 2M51A 1AD5A 1QWFA 4HXJA 2VKNA 1YN8A 1AVZC 1M3CA 1SHGA 1TUCA 1RUWA 4AFQC 2GQIA 2CH4A 2RQUA 3RBBB 1BK2A 2KROA 2GBQA 3H0IA 1M3AA 2YUOA 2KXDA 2DYBA 2W0ZA 1AEYA 1NLPC 4JJBA 3NPFA 2C0TA 3H41A 3A98A 2J06A 1ZLMA 1ABOA 1EFNA 2EQIA 1NEBA 2HBWA 2KNBB 1GCPA 2D8HA 1ZX6A 3VS5A 2JXBA 2DMOA 5I11A 1UECA 2FPDA 1RLPC 2GGRA 5FW9A 2B86A 1WI7A 4J9EA 2FG0A 1E6GA 2ED1A 4F16A 1AOJA 1KJWA 3JV3A 2KGTA 2FPEA 3EG3A 1JEGA 1I07A 2DA9A 4IIOA 2AZSA 1UHFA 1WXTA 4RTXA 5IXFA 2BTTA 1OOTA 2KRMA 2ED0A 1ZSGA 2FO0A 4JZ3A 1K9AA 2AK5A 2K7AA 2CT3A 2DL3A 4IIMA 2L3PA 2D0NA 1ZBJA 1YCSB 2YUPA 3M0UA 1GL5A 1E7OA 4HCKA 3M0TA 2DLPA 4DEXA 1WYXA 3NHNA 1K1ZA 1X6BA 4E6RA 4ZNXA 2DX1A 4KRTA 2E5KA 1G83A 1UUEA 2K3BA 1FYNA 2C0OA 2DJQA 4ORZA 1OEBA 2C0IA 4D8DA 2KRSA 1ABQA 4K11A 3H0FA 4RTUA 2EW3A 5IHKA 1Y57A 2DL7A 1SSHA 1WXUA 5IHNA 2O2OA 2L2PA 2AKLA 1CKAA 1UG1A 1CKBA 4J9DA 3SEMA 1WLPB 2BZXA 4Z89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF6 A;  2H8H A;  1AWW A;  3VS7 A;  2ESW A;  2AKK A;  1PKT A;  4RUG A;  2EYW A;  2P4R A;  2F2W A;  4AG2 C;  2QDL A;  4OMN A;  1K4U S;  1UGV A;  1W6X A;  1PRL C;  2FEI A;  2J6K A;  4ESR A;  1WIE A;  5HCK A;  1SPK A;  4JPB W;  5IXB A;  2RPN A;  1B3Q A;  2K2M A;  3R6N A;  4HVV A;  1W70 A;  1X2Q A;  2OAW A;  2EYY A;  1GBQ A;  1HSQ A;  1M8M A;  1B07 A;  2KEA A;  1GCQ A;  2PNI A;  1X2K A;  4Z88 A;  2K79 A;  2YDL A;  1T3L A;  4QT7 A;  4D8K A;  1JXO A;  1U3O A;  2GTO A;  1YNZ A;  1IO6 A;  3UAT A;  1QLY A;  1K0S A;  2JS2 A;  2MIO A;  2X3X D;  2KXC A;  2RF0 A;  1NEG A;  2KE9 A;  1PHT A;  2YUN A;  5ECA A;  1UTI A;  3EG0 A;  4OML A;  3PVQ A;  1H3H A;  2EBP A;  3C0C A;  1SEM A;  2CSI A;  2PZ1 A;  2J05 A;  2LJ3 A;  2JMA A;  2MCN A;  3KFV A;  4J9H A;  1CSK A;  2DM1 A;  1GFC A;  5GJV B;  5EC7 A;  2LP5 A;  3SHW A;  3EG1 A;  3I35 A;  2NUZ A;  2A08 A;  2K6D A;  1LCK A;  1K76 A;  1VYU A;  4GBQ A;  3VS4 A;  1VYV A;  2O9S A;  2LJ1 A;  2XMF A;  3VS6 A;  2JMC A;  2RMO A;  4LUD A;  1H92 A;  4F17 A;  3I9Q A;  2I0N A;  2CDT A;  4JZ4 A;  3VRY A;  2IIM A;  2KYB A;  3RNJ A;  3UA6 A;  1QKX A;  2GNC A;  2DIL A;  3TSW A;  2ENM A;  2JT4 A;  2AZV A;  2YT6 A;  3O5Z A;  3TVT A;  2EKH A;  2KT1 A;  4OMP A;  2J6O A;  2LCS A;  1ZUK A;  1SRM A;  2CSQ A;  2O31 A;  1TG0 A;  3EHR A;  1UJ0 A;  4CC2 A;  1U06 A;  2ROT A;  1NLO C;  2V1Q A;  2DVJ A;  3NGP A;  4A63 B;  1JQQ A;  1MV0 B;  4RTV A;  1AWO A;  1JU5 C;  2MOX A;  3I5R A;  4RTY A;  3VS1 A;  3EHQ A;  4LNP A;  3QWX X;  1ZUY A;  4J9B A;  1KIK A;  4OMM A;  1NYF A;  2M0Y A;  4WCI A;  2CRE A;  2EYX A;  2D1X A;  2JM9 A;  3VS0 A;  3REA B;  2FRW A;  1PWT A;  2RQV A;  1BBZ A;  4LN2 A;  4Y92 A;  2J6F A;  2K9G A;  1XOV A;  1ZUU A;  2PTK A;  1JXM A;  2DRM A;  1BU1 A;  4RTZ A;  1UE9 A;  4HVW A;  2LMJ A;  4OMO A;  2LX7 A;  1OPL A;  2DL5 A;  5L23 A;  4CC4 B;  1S1N A;  1WX6 A;  3ZL7 C;  3VRZ A;  3M0S A;  4GLM A;  2NWM A;  1X69 A;  3NMZ C;  2KT8 A;  4AFU C;  1YP5 A;  5FWB A;  4LE9 A;  4J9G A;  2OJ2 A;  1SRL A;  3PVL A;  2A36 A;  4JJC A;  1UJY A;  3LH5 A;  1W1F A;  2RN8 A;  4FSS A;  4X1V A;  2EYZ A;  2L3S A;  1J3T A;  2RNA A;  4CC3 A;  2YSQ A;  3UF4 A;  1NM7 A;  1PKS A;  1AZE A;  2JM8 A;  2EVR A;  4Z8A A;  1HJD A;  2KYM A;  2OI3 A;  1N5Z A;  2F2V A;  1Z9Z A;  1VA7 A;  1YWO A;  4RTW A;  2DBM A;  1AZG B;  1UHC A;  1UDL A;  4RTT A;  1U5S A;  1WXB A;  2DBK A;  2DE0 X;  3PE0 A;  1QKW A;  1TUD A;  1FMK A;  1MV3 A;  1GFD A;  2LNH B;  3VS3 A;  2O9V A;  2L0A A;  2D8J A;  1AWX A;  1GRI A;  1VYT A;  2LZ6 B;  1I0C A;  3EGU A;  1M3B A;  2CUB A;  1QCF A;  2FPF A;  2W10 A;  1NG2 A;  1X27 A;  3M0R A;  3VS2 A;  3U23 A;  3CQT A;  1RI9 A;  1QWE A;  1K0X A;  4AFS C;  2KR3 A;  1KFZ A;  2RQT A;  1T0J A;  4J9I A;  3GBQ A;  2RQW A;  2VVK A;  2DRK A;  1E6H A;  3THK A;  1GCQ C;  1T3S A;  2LJ0 A;  2CUD A;  2DL4 A;  1T0H A;  4M4Z A;  1SHF A;  1OV3 A;  2A37 A;  1Y0M A;  1M30 A;  1MUZ A;  2BZ8 A;  4JJD A;  2HDA A;  2KBT A;  3FJ5 A;  4AG1 C;  1H8K A;  3EG2 A;  2YUQ A;  1M27 C;  4AFZ C;  4J9F A;  5FWC A;  2LQN A;  1HD3 A;  3TSZ A;  3QWY A;  2O88 A;  5IHI A;  4F14 A;  1AWJ A;  1BB9 A;  2HCK A;  1Z9Q A;  2X3W D;  4R0K A;  1JO8 A;  2EGC A;  2V1R A;  2DL8 A;  2G6F X;  2J7I A;  2ECZ A;  3H0H A;  3ULR B;  2CT4 A;  1I1J A;  2VWF A;  1PNJ A;  2ABL A;  1KSW A;  5I22 A;  2JS0 A;  3M0Q A;  2KRN A;  2SRC A;  1X43 A;  1OPK A;  4OMQ A;  2JW4 A;  1YWP A;  4DEY A;  1WA7 A;  2CH4 W;  1RLQ C;  1G2B A;  2A28 A;  2RQR A;  1WDX A;  4EIK A;  2DNU A;  5IH2 A;  1UFF A;  4HVU A;  2EGA A;  2EGE A;  1GBR A;  4CC7 A;  2FRY A;  2HEQ A;  1PRM C;  3REB B;  2SEM A;  3M0P A;  1X6G A;  2ROL A;  2GTJ A;  2LQW A;  2F2X A;  2HSP A;  3IQL A;  1ARK A;  3UA7 A;  1NYG A;  2BZY A;  5GJW B;  1A0N B;  1V1C A;  3I5S A;  2JTE A;  4LUE A;  4J9C A;  2L3Q A;  1WFW A;  2EPD A;  2M51 A;  1AD5 A;  1QWF A;  4HXJ A;  2VKN A;  1YN8 A;  1AVZ C;  1M3C A;  1SHG A;  1TUC A;  1RUW A;  4AFQ C;  2GQI A;  2CH4 A;  2RQU A;  3RBB B;  1BK2 A;  2KRO A;  2GBQ A;  3H0I A;  1M3A A;  2YUO A;  2KXD A;  2DYB A;  2W0Z A;  1AEY A;  1NLP C;  4JJB A;  3NPF A;  2C0T A;  3H41 A;  3A98 A;  2J06 A;  1ZLM A;  1ABO A;  1EFN A;  2EQI A;  1NEB A;  2HBW A;  2KNB B;  1GCP A;  2D8H A;  1ZX6 A;  3VS5 A;  2JXB A;  2DMO A;  5I11 A;  1UEC A;  2FPD A;  1RLP C;  2GGR A;  5FW9 A;  2B86 A;  1WI7 A;  4J9E A;  2FG0 A;  1E6G A;  2ED1 A;  4F16 A;  1AOJ A;  1KJW A;  3JV3 A;  2KGT A;  2FPE A;  3EG3 A;  1JEG A;  1I07 A;  2DA9 A;  4IIO A;  2AZS A;  1UHF A;  1WXT A;  4RTX A;  5IXF A;  2BTT A;  1OOT A;  2KRM A;  2ED0 A;  1ZSG A;  2FO0 A;  4JZ3 A;  1K9A A;  2AK5 A;  2K7A A;  2CT3 A;  2DL3 A;  4IIM A;  2L3P A;  2D0N A;  1ZBJ A;  1YCS B;  2YUP A;  3M0U A;  1GL5 A;  1E7O A;  4HCK A;  3M0T A;  2DLP A;  4DEX A;  1WYX A;  3NHN A;  1K1Z A;  1X6B A;  4E6R A;  4ZNX A;  2DX1 A;  4KRT A;  2E5K A;  1G83 A;  1UUE A;  2K3B A;  1FYN A;  2C0O A;  2DJQ A;  4ORZ A;  1OEB A;  2C0I A;  4D8D A;  2KRS A;  1ABQ A;  4K11 A;  3H0F A;  4RTU A;  2EW3 A;  5IHK A;  1Y57 A;  2DL7 A;  1SSH A;  1WXU A;  5IHN A;  2O2O A;  2L2P A;  2AKL A;  1CKA A;  1UG1 A;  1CKB A;  4J9D A;  3SEM A;  1WLP B;  2BZX A;  4Z89 A; 
#chains in the Genus database with same CATH topology
 2DF6 A;  3TRE A;  1C6V X;  3DKM A;  2ESW A;  2AKK A;  2RK2 A;  4RUG A;  2K57 A;  1RAG B;  2F2W A;  2D0Q B;  2QDL A;  4J6Y A;  1K4U S;  3G7Z A;  1W6X A;  2L89 A;  1D0Z A;  1PRL C;  2J6K A;  5I2S A;  2HL3 A;  5GAM j;  1KD1 C;  2E41 A;  5HCK A;  4M75 C;  1VIF A;  4JPB W;  2RPN A;  5LL6 S;  2K2M A;  4HVV A;  5GAN 6;  1X2Q A;  2B8A A;  4OB1 B;  1M90 R;  3CBO A;  2JVV A;  3CCS Q;  3JCM c;  1GCQ A;  2E4H A;  3PMI A;  4Z88 A;  3OYI A;  1T3L A;  2MAM A;  4QT7 A;  3G1J A;  3JSC A;  2HQX A;  1YNZ A;  1IO6 A;  3UAT A;  4OB3 B;  4C0D B;  1QLY A;  1K73 U;  2E10 A;  1K0S A;  2MIO A;  3EG9 B;  2RF0 A;  3CPF A;  3HHT B;  1C0M A;  5ECA A;  1UTI A;  2CZ7 B;  2KAF A;  1OX8 A;  4M78 E;  5D6Y A;  3M5A A;  1K9M C;  4KUD K;  3KFV A;  4C92 B;  4DBH A;  3JCM g;  2DM1 A;  2LP5 A;  2EYQ A;  1VYU A;  2R58 A;  2OTJ A;  3OYE A;  3NFC A;  3AHU A;  2LJ1 A;  1YHQ T;  3VS6 A;  2DZ9 A;  2COY A;  3A5Z B;  4M78 B;  2EJ9 A;  2VYT A;  2CDT A;  1G3Y A;  3RMS A;  2IIM A;  2KYB A;  2L8D A;  4OF1 A;  1N8R U;  1BI3 A;  4A4K A;  3CPW P;  2ENM A;  2QEX Q;  3OB9 A;  2EKH A;  3E1S A;  4M77 E;  2Z0W A;  3UWN A;  3GOX A;  5GMK m;  2J6O A;  1S72 A;  1LNX A;  1KC8 R;  2RHX A;  5GAN h;  4AMC A;  1MMA A;  2V1Q A;  1BI2 A;  3NGP A;  3EH1 A;  1LVK A;  4RTV A;  5J3B A;  1AWO A;  1KQ2 A;  3OSS C;  3EHQ A;  4MZT A;  2O4X B;  1KIK A;  4M75 A;  1N27 A;  5L8R E;  3OYK A;  4M77 B;  4C8Q C;  2CRE A;  3CCE Q;  4KH0 B;  2NUT A;  5D7U A;  3VS0 A;  1WHK A;  2RQV A;  1BBZ A;  1NJI U;  1V76 A;  4Y92 A;  1D0X A;  3MP6 A;  2JJ9 A;  3NTI A;  2K9G A;  1XOV A;  3DB4 A;  2MYS A;  5AT1 B;  1JXM A;  5LJ5 e;  5J39 A;  2LMJ A;  2LX7 A;  1TXQ A;  1K8A C;  8ATC B;  5FRM A;  5L23 A;  4R55 A;  4CC4 B;  1S1N A;  5CAI A;  5FU7 C;  4PJO G;  1Q7Y R;  2Y4X A;  1KQS S;  1BIB A;  3UDC A;  2HNI A;  4GLM A;  2YRV A;  1X69 A;  1KQS A;  2KMT A;  1QP2 A;  4ZTJ A;  4LE9 A;  4J9G A;  4ATO A;  1D3B A;  1SRL A;  2A36 A;  4JJC A;  3OSV A;  2R5M A;  1UJY A;  3V8J A;  1WHJ A;  4X1V A;  2L3S A;  2YWW A;  3RES A;  1PKS A;  4CRI A;  2EVR A;  3QII A;  2E3I A;  2F2V A;  1FMW A;  1Z9Z A;  2BKD N;  3V7S A;  2JNG A;  3JCM W;  1KD1 U;  1AZG B;  4M78 D;  1UDL A;  4N0A C;  4PL6 A;  1U5S A;  4C8Q F;  4DBQ A;  4A4F A;  1VIE A;  1Y07 A;  1FMK A;  1F1B B;  1BCO A;  2QQR A;  4RCC A;  1M1F A;  1JBM A;  2D8J A;  5LJ3 g;  1YHQ A;  2QG9 B;  1WZO A;  2LZ6 B;  5I2M A;  3OY9 A;  2ZPH B;  3EGU A;  1YIJ Q;  2CUB A;  1M5Q 1;  4M7A E;  2EQK A;  4QQD A;  3VJP A;  3A8G B;  3U23 A;  1QWE A;  4KUL A;  3H9N A;  3EH2 A;  5LJ3 f;  2RQW A;  3QYG B;  3FB9 A;  3THK A;  1T3S A;  2LJ0 A;  4M77 D;  1RAF B;  2LCL A;  2RJE A;  3LGL A;  3EFO A;  2BZ8 A;  2NLU A;  4C5E A;  2HDA A;  3DLL A;  2PQW A;  4B9W A;  4M7A B;  1UGS B;  3EG2 A;  3MEU A;  1Q81 C;  4JRQ A;  3V7C A;  3FEO A;  4M77 G;  4PJO A;  3TSZ A;  4Q5W A;  4LDX A;  1TWB A;  4DA4 A;  1IHV A;  1BB9 A;  4E7H A;  1Z9Q A;  4R0K A;  4XTY A;  2V1R A;  4CI0 C;  2ECZ A;  3A8L B;  1MGQ A;  3OYY A;  4NL2 A;  2GFU A;  5CKD A;  1I1J A;  2E6Z A;  1PNJ A;  1VQN Q;  1KSW A;  2A0F B;  1I5O B;  2RA2 A;  4RMO A;  4IUR A;  2BUD A;  2WSE E;  2JW4 A;  2XD0 A;  4ZTF A;  1D0Y A;  4QVD A;  1VUB A;  3CCL Q;  1WDX A;  2EGA A;  4CC7 A;  2FRY A;  3REB B;  4N0A A;  1X6G A;  3WXM B;  4C5I A;  4MZP A;  4IUU A;  4R56 A;  2HSP A;  3CC2 T;  1ARK A;  1M1K C;  1NYG A;  5GAM g;  2DXC A;  3I5S A;  4J9C A;  1VQ5 Q;  1JJ2 S;  4FIB A;  4HXJ A;  2VKN A;  4BY6 B;  2OTL T;  3LGF A;  2CP3 A;  3P8D A;  5CK9 A;  1JJ2 A;  1R0B G;  3CC4 T;  3CCJ Q;  5LJ5 h;  3LW5 E;  2QA4 Q;  2CH4 A;  3RR6 A;  3RBB B;  3PNW C;  3H0I A;  1R8O B;  1ZQ1 A;  2LVM A;  2QQ9 A;  3I55 T;  1H64 1;  2YUO A;  2P0K A;  4XU1 A;  4MMK A;  2F5T X;  2W0Z A;  3QSU A;  3CCV Q;  1NLP C;  2GQV A;  4O6J A;  3A98 A;  4PFO A;  1TUG B;  1VOM A;  4FT4 A;  4M7A D;  3C95 A;  4KUI A;  1ZLM A;  1ABO A;  1EFN A;  2HBW A;  1ACM B;  3QDR B;  1RLP C;  4XU2 A;  2GGR A;  4MDW A;  2G3R A;  1JB0 E;  4M7A G;  1KJW A;  3JV3 A;  4LDV A;  2F5K A;  2FPE A;  1G3W A;  3OMC A;  1GXI E;  4RTX A;  1Q82 C;  4BDY A;  3HRT A;  1ZSG A;  3A8O B;  2CYZ B;  1FX7 A;  1M90 U;  1TTH B;  2K7A A;  1OQK A;  2DL3 A;  2KI7 A;  2D0N A;  3M0U A;  3I56 Q;  4LDU A;  3M0T A;  1VQK Q;  1I4K 1;  1Y71 A;  4E6R A;  1QVP A;  2DX1 A;  1WQ7 A;  3CCU Q;  3L2Z A;  1ZBX A;  1N6A A;  2C0I A;  2KRS A;  1VQL Q;  3VKI A;  5GMK j;  2CP7 A;  2HD0 A;  2DXU A;  2EIF A;  1U1T A;  1AHJ B;  2L2P A;  2AKL A;  3CC2 A;  2CS7 A;  3CME T;  1RAD B;  1UG1 A;  1ZHI A;  1WLP B;  4RG8 A;  5GAO m;  2Y4Y A;  3BW1 A;  2RHI A;  5CQX A;  1AWW A;  2CP6 A;  2OTL A;  3VS7 A;  4M75 E;  1QW1 A;  1YIT T;  3CC4 A;  1PKT A;  2P4R A;  5KYY B;  2DD5 A;  4AG2 C;  3EAE A;  2VXF A;  1UGV A;  1K73 C;  2EKO A;  4WF2 A;  3CD6 Q;  4EMG A;  2FEI A;  4DBF A;  4M7D C;  1WIE A;  1SPK A;  3FDR A;  3I55 A;  1D1B A;  4YTL A;  3R6N A;  3C4S A;  3QPH A;  1W70 A;  2OAW A;  4EDU A;  1GBQ A;  1K9M R;  5M9O A;  3OYF A;  3KUF A;  1B07 A;  3N5B B;  4M75 B;  2PNI A;  1X2K A;  4JUV A;  1VQ7 Q;  4D8K A;  1JXO A;  2OX7 A;  4XTZ A;  2NUT B;  5GAO r;  5GAN d;  3JCM J;  2JS2 A;  4VUB A;  1RL2 A;  1QVG P;  2DER A;  1NEG A;  2CZ0 B;  1YI2 Q;  3PVQ A;  1H3H A;  2EBP A;  1YJN Q;  2QQB A;  1ZSZ C;  3NTK A;  3OYL A;  1N8R C;  2J05 A;  1WGS A;  2MCN A;  2XK0 A;  4J9H A;  3JCM P;  4HKE A;  1IGQ A;  5EC7 A;  2QGF B;  3I35 A;  3JCM Q;  2NUZ A;  1K76 A;  4RG2 A;  1IGU A;  2LNV A;  1D3B B;  4M7D F;  3CXC S;  2RMO A;  4LUD A;  1H92 A;  4F17 A;  2K5I A;  3CXC A;  4F7U A;  2WAC A;  2HSE B;  3VRY A;  3RNJ A;  3TCJ A;  3UA6 A;  2GNC A;  1XTD A;  2HBP A;  3TSW A;  2X4J A;  3JCM e;  3J81 E;  4FYX B;  1ZUK A;  3JB9 F;  1SRM A;  2O31 A;  3EHR A;  4FW2 A;  1UJ0 A;  4CC2 A;  1Y7X A;  3QJY A;  2XHC A;  1PSF A;  2DYI A;  4IUT A;  4A63 B;  4BI4 A;  1MV0 B;  4C8Q E;  1YJ9 Q;  1JU5 C;  2MOX A;  3I5R A;  2DZC A;  2CZ1 B;  1WJS A;  5A0L A;  2A7Y A;  4XTU A;  4BUG A;  3CCM Q;  3QDF A;  2DTO A;  2XID A;  3LLR A;  1NPR A;  2PVO B;  4OMM A;  3UT1 A;  1NYF A;  3PFS A;  2EYX A;  2YLB A;  2D1X A;  3H6Z A;  1YIT A;  1PWT A;  2LCC A;  3LWI A;  4LN2 A;  4M75 D;  1P92 A;  3X28 B;  1ZUU A;  2RJD A;  2DD4 A;  2PTK A;  1BU1 A;  4RTZ A;  4LDY A;  1IZ6 A;  4OMO A;  4A53 A;  2COZ A;  3EFO B;  3OYM A;  3ZL7 C;  2QQS A;  1VQO T;  4M75 G;  3NMZ C;  1TSF A;  1YP5 A;  2JN0 A;  2EAY A;  5FWB A;  1NE8 A;  2CP2 A;  3GPL A;  4PJO B;  4OVA A;  3PVL A;  4EMK C;  4JRI A;  3TEE A;  5FLX E;  1I81 A;  1W1F A;  2RN8 A;  1OU9 A;  1RAA B;  3TU4 K;  3M54 A;  1V29 B;  2RI3 A;  4Z8A A;  4FYY B;  1VA7 A;  2X4X A;  2DJZ A;  4RTW A;  3E2U A;  5GAO q;  2DBM A;  4MDX A;  3BFM A;  2DE0 X;  3SFM A;  3UPU A;  1AT1 B;  1IRE B;  1TUD A;  2CP0 A;  2GF7 A;  5DM7 R;  2DEU A;  1Y96 A;  3M55 A;  1RAE B;  2LNH B;  4EMH A;  1LPL A;  5FU6 C;  2O9V A;  2RHZ A;  3S3M A;  1W2B S;  4BDZ A;  1I0C A;  1M3B A;  2M1H A;  3WVE B;  2H3E B;  2FPF A;  2PVD B;  1W2B A;  2LX9 A;  3GIB A;  2OTJ Q;  1C1A A;  7AT1 B;  1VQP T;  1KFZ A;  1BIA A;  2VVK A;  4BI8 B;  1E6H A;  1FMV A;  1X6O A;  2CUD A;  2DL4 A;  1YJW T;  5C6S A;  1G8X A;  4A4E A;  1MUZ A;  3FJ5 A;  2KBT A;  2HL5 C;  2JOY A;  4X34 A;  3OYG A;  1S72 Q;  1G3S A;  2EQM A;  3HKS A;  2ZAE A;  2LQN A;  4PFP A;  3RKX A;  3QWY A;  2O88 A;  2YXY A;  1EIF A;  3OMG A;  5IHI A;  5LJ5 d;  2Y90 A;  3X26 B;  2X3W D;  1JO8 A;  2EGC A;  3EGX A;  2DL8 A;  2RJC A;  2D9T A;  3H0H A;  3FC3 A;  4C8Q G;  1BI0 A;  4PJO D;  2CT4 A;  3CCQ T;  1OUL A;  3JCM h;  2JS0 A;  3VV0 A;  2ZPE B;  2SRC A;  1X43 A;  3HFO A;  3JCM X;  4OMQ A;  1YWP A;  2EWN A;  1VQO A;  5GAO n;  1WA7 A;  2D6F A;  2X35 A;  1G2B A;  2RQR A;  5C0M A;  5IH2 A;  4HVU A;  4PK4 A;  2EGE A;  1GBR A;  4ELY C;  1PRM C;  4XAX B;  5A2Q E;  3ZEH A;  2JTM A;  1IHW A;  2GTJ A;  2LQW A;  2F2X A;  2CZ6 B;  3IQL A;  4X9C A;  2BZY A;  4JDS A;  3G6E T;  1KQS P;  1V1C A;  1A0N B;  2QTV A;  1H3Z A;  1MND A;  1VQ4 T;  4IUP A;  2FZC B;  1AD5 A;  4KH1 B;  4ZGD B;  4OP0 A;  1YCY A;  4DOW A;  1M2O A;  3G4S T;  2RQU A;  2ZPG B;  4C0D C;  3M9Q A;  5GAM e;  1PG5 B;  2VGM A;  2GCX A;  5GAN 8;  2KXD A;  2DYB A;  4E7I A;  2RI2 A;  4JJB A;  2KY9 A;  4O5V A;  3H41 A;  3V7R A;  2J06 A;  5CKF A;  5GAO p;  3JRZ A;  4C92 C;  1YHQ Q;  1VQP A;  5I21 A;  2XIC A;  4ZGE B;  1M90 C;  2E64 A;  5FW9 A;  1YJW A;  1DJ7 B;  3F70 A;  4GY5 A;  1UEB A;  2DO3 A;  3PGG A;  3CMA T;  4F16 A;  5HK0 A;  1AOJ A;  4C8Q A;  3FJP A;  2KGT A;  1VQM T;  2VGN A;  5KCH A;  1JEG A;  2DA9 A;  4IIO A;  2AZS A;  1WXT A;  3OS1 A;  3MO8 A;  1Q86 R;  2ED0 A;  3G71 T;  2RD1 A;  2FO0 A;  1EZZ B;  2CP5 A;  3ZFJ A;  5CO7 A;  5GAN 4;  3L42 A;  2E6N A;  2OAU A;  1YCS B;  2EQJ A;  2YUP A;  3JB9 I;  1W4S A;  3PMT A;  3CCQ A;  2DLP A;  4DEX A;  4HCB A;  3L2W A;  3NHN A;  4FL6 A;  3A8M B;  3URG A;  1VQ6 T;  4PNO A;  1EX4 A;  2FHD A;  2E5K A;  2R5A A;  1G83 A;  4F7U E;  1UUE A;  2QK0 A;  4PLL A;  4FYW B;  1PSE A;  4D8D A;  2LDM A;  5LJ3 h;  1ABQ A;  4K11 A;  2EW3 A;  3RIR A;  4C92 F;  2DTI A;  1BI1 A;  2QAZ A;  5KCO A;  3OQ5 A;  3INZ A;  1WXU A;  4OB0 B;  3CCR T;  2M9U A;  1CKA A;  3EGD A;  3V8L A;  2HQH A;  3G6E A;  3OYB A;  5LJ5 f;  2JUF A;  4J9D A;  3C94 A;  5IT9 E;  1KC8 C;  4M78 F;  4Z89 A;  1VQ4 A;  2MF2 A;  5CVI A;  4F7U B;  2H8H A;  5KYX A;  3DB3 A;  4M7D E;  2EFI A;  2WSF E;  2DEQ A;  2HKN A;  3MEW A;  1VQ9 T;  3QO3 A;  4BD3 A;  3G4S A;  4HCC A;  2K5L A;  3TQ7 P;  2X4Y A;  1JJ2 P;  3HP9 A;  2DVE A;  5IXB A;  4JRP A;  3M57 A;  1B3Q A;  3MHX A;  3GLX A;  2EYY A;  1M8M A;  1HSQ A;  4B9X A;  5KE2 A;  4C0G A;  1WHL A;  2VUB A;  2KEA A;  1SF9 A;  2K79 A;  1XQH A;  2X9H A;  1D1C A;  1ZA1 B;  1U3O A;  1WPY A;  4M77 F;  1MMN A;  2DXB A;  2DKG A;  2E12 A;  4HT9 A;  1OU8 A;  2KXC A;  3LYI A;  2HKQ B;  4V2S A;  1KQ1 A;  2KE9 A;  4KBM B;  1IRX A;  4TVR A;  3OW2 S;  3BDU A;  5GAN j;  4OML A;  2ZZD A;  1SEM A;  2RM4 A;  3CMA A;  3QG1 A;  1PC0 A;  3OW2 A;  3VUZ A;  1FWZ A;  1VQM A;  3X24 B;  2LJ3 A;  1CSK A;  9ATC B;  3J7A F;  2XDD A;  1GFC A;  5GJV B;  5GAM h;  2FL7 A;  3SHW A;  3EG1 A;  1UGR B;  3G71 A;  2A08 A;  2K6D A;  1NJI R;  4GBQ A;  3VS4 A;  1VYV A;  2O9S A;  2QDY B;  4P5N A;  4II1 A;  1MNE A;  1M2V A;  3SWN C;  5FRO A;  2A3L A;  4N4H A;  1MMG A;  4L5G A;  5KH6 A;  4JZ4 A;  1SG5 A;  1WHH A;  3LX7 A;  2AT1 B;  2DIL A;  3H8Z A;  2JT4 A;  2YT6 A;  3MCA B;  3TVT A;  1VQ6 A;  4E7K A;  1M4Z A;  2KT1 A;  1LOJ A;  3M4Y A;  1QP3 A;  2K3X A;  3MP1 A;  2BIV A;  2NUP A;  1I5L A;  1U1S A;  1U06 A;  3VU3 C;  1RAI B;  2BE7 D;  4QVC A;  1Y96 B;  5GMK i;  1JQQ A;  3CBP A;  5KYW A;  3CCR A;  2DAQ A;  3CC7 T;  1OI1 A;  3VS1 A;  2KQW A;  4LNP A;  3QWX X;  3RUX A;  2LT1 A;  2ATC B;  4DBR A;  2RJF A;  4F7U G;  2FZG B;  2M0Y A;  1KD1 R;  4PJN A;  4LDW A;  1XJW B;  1QMC A;  4ELZ C;  2JM9 A;  2O01 E;  3REA B;  3CC2 Q;  4M7D D;  1BKB A;  3HRU A;  1VQ9 A;  2J6F A;  2DTH A;  2DPP B;  3QJ6 A;  2EQU A;  2DRM A;  2VC8 A;  1UE9 A;  2YLC A;  3CCM T;  1OPL A;  2K4Y A;  2OTL Q;  1WX6 A;  3CC4 Q;  3M0S A;  3JB9 H;  4M7D G;  4X9D A;  4M7A F;  2NWM A;  3JB9 D;  1VQ8 T;  1O75 A;  1PD1 A;  4AFU C;  1WHM A;  3QHS A;  2IPO B;  1X75 C;  1KC8 U;  3SDZ A;  3I55 Q;  4FW1 A;  3LH5 A;  4FSS A;  3EGX B;  2EYZ A;  1J3T A;  1D09 B;  2RNA A;  4NS5 A;  4E7L A;  2YSQ A;  3JB9 G;  1HJD A;  2OI3 A;  3SWN A;  4MML A;  3OYA A;  1YWO A;  2V8I A;  2X4W A;  3HPW A;  4RTT A;  2HMA A;  3PT9 A;  4J6X A;  2PU9 B;  3CCS T;  1MV3 A;  2JTF A;  2P0P A;  3QZ5 B;  3VS3 A;  4J8O A;  4KGX B;  2L0A A;  1AWX A;  1X01 A;  3JCM d;  1Q7Y U;  2PUK B;  1B34 A;  2RHU A;  4J5Y A;  1NG2 A;  1X27 A;  3M0R A;  5KYU A;  3VS2 A;  3CQT A;  1LJO A;  4BAC A;  4AFS C;  3QZ9 B;  4BE2 A;  2KR3 A;  2RQT A;  3GBQ A;  3CXC P;  1HYO A;  2DFU A;  2DRK A;  3BY7 A;  3OYN A;  1GCQ C;  2LQ8 A;  4A54 A;  1KHI A;  1SHF A;  1OV3 A;  5GAN 3;  1TOV A;  1M30 A;  2K5F A;  3RKW A;  4JJD A;  1BCM A;  3CC7 A;  1H8K A;  2YUQ A;  4QW2 A;  4PJL A;  1N9R A;  2FZK B;  2COW A;  4LXC A;  5FWC A;  3LH0 A;  1HD3 A;  4BE1 A;  1K8A R;  3CME A;  3FIF A;  4F14 A;  1AWJ A;  4M7D A;  1M8V A;  3E9F A;  2XG8 D;  5CQY A;  2QEX T;  2G6F X;  2LTO A;  2J7I A;  2JZ2 A;  3CME Q;  1WHG A;  4FYV B;  5GMK l;  5LJ5 j;  2ABL A;  2GFA A;  2XU8 A;  5I22 A;  4XTV A;  3A8H B;  1G5V A;  3O8V A;  1OPK A;  1YIT Q;  4N4G A;  2RO0 A;  4C8Q B;  2CH4 W;  1WQW A;  2DNU A;  1QVF S;  1VQ8 A;  1UFF A;  1RAB B;  4J6W A;  2XI9 A;  1KHC A;  5KYN A;  2HEQ A;  5GAN 7;  1QVF A;  2SEM A;  3CCE T;  3UA7 A;  3MP8 A;  5GJW B;  1ZSZ A;  3HFN A;  1Q86 U;  5FU7 B;  3P8B B;  3RKY A;  1WFW A;  2EPD A;  2M51 A;  2K3Y A;  4FCY A;  1U8R A;  3RER A;  3OS2 A;  2NYS A;  2AIR B;  1NZ9 A;  1AVZ C;  2QAS A;  4C5H A;  1HK9 A;  3MEA A;  5HY6 A;  1RUW A;  4AFQ C;  2GQI A;  3ASK A;  5A0D A;  3CCS A;  2KRO A;  2GBQ A;  3GF5 A;  5DY9 A;  2VV5 A;  4IUV A;  5HK3 A;  3OBY A;  4C92 E;  1OZ2 A;  3EGD B;  5GAN g;  1AEY A;  2C0T A;  3T9N A;  4L59 A;  2CGH A;  5KYX B;  1MHN A;  5LJ3 d;  1GCP A;  2D8H A;  1ZX6 A;  3VS5 A;  5GAN f;  1Q81 R;  2JXB A;  2DMO A;  1W2B P;  1UEC A;  3HTR A;  1UGQ B;  1KG1 A;  3M59 A;  4UC4 A;  3OYD A;  2HZY A;  5LJ3 e;  1I07 A;  1YIJ T;  1QCO A;  5IXF A;  2BTT A;  1OOT A;  3QKJ A;  4M75 F;  4JZ3 A;  3JCM f;  1G3T A;  4C8Q D;  3CPW S;  2QEX A;  2CT3 A;  1BYM A;  4IIM A;  3CPW A;  1ZBJ A;  1GL5 A;  1E7O A;  1QQJ A;  5KYY A;  4DQ2 A;  1WYX A;  3OS0 A;  1K1Z A;  1X6B A;  1M1K R;  3MET A;  4EMK A;  2K3B A;  1FYN A;  4ORZ A;  1OEB A;  3OA6 A;  3JAM E;  3X25 B;  1FXX A;  4ME7 A;  1Y57 A;  2DL7 A;  2ZGW A;  3CCE A;  5IHN A;  4JS5 A;  2LRQ A;  1SKU B;  1VQO Q;  1M2V B;  5GAN 5;  3M58 A;  1TS9 A;  3S6W A;  1CKB A;  2LT4 A;  3L2R A;  1VQN T;  1IB8 A;  3BE3 A;  5GAM d;  4IUQ A;  2FVU A;  1SSF A;  2EYW A;  3C12 A;  3RMQ A;  3CCL T;  4OMN A;  4PJO C;  1PD0 A;  2V8J A;  2NUP B;  4OGE A;  4Y28 E;  1IXD A;  4ESR A;  2P0Q A;  2VXE A;  4OGC A;  5KYW B;  1Q95 G;  3L2V A;  5FRN A;  5CIU A;  6AT1 B;  5GMK h;  3OS5 A;  1OYX A;  4C92 D;  2KDS A;  5CR2 A;  1VQ5 T;  2YDL A;  3QUI A;  4LD9 K;  4ANJ A;  5CKH A;  4B6M A;  3JCM b;  2GTO A;  2DK3 A;  3DLM A;  4Z02 A;  2X3X D;  3CCJ T;  3KXT A;  3V8K A;  2PUO B;  2QA4 T;  1Q82 R;  1PHT A;  2C06 A;  2YUN A;  4C92 G;  2X51 A;  4KT0 E;  5D6W A;  3EG0 A;  3C0C A;  4C0F A;  2CSI A;  2BE9 B;  1VQP Q;  1MMD A;  4A4G A;  2PZ1 A;  4E7S A;  2JMA A;  3CCV T;  2QYZ A;  2L3R A;  1YIJ A;  1YJW Q;  3S3O A;  4M78 C;  4M78 G;  1OZ3 A;  2KVQ G;  1LCK A;  4XU0 A;  1M9S A;  4F04 B;  2E70 A;  3E9G A;  4PJO F;  2HAX A;  4NL3 A;  2XMF A;  4XTW A;  2JMC A;  3KBG A;  3VYH B;  2WSC E;  3I9Q A;  2I0N A;  1K9M U;  2MK5 A;  3SWN B;  1QKX A;  4JRK A;  5KE3 A;  3O5Z A;  1I8F A;  2AZV A;  1YFN A;  2YRD A;  3MJX A;  3GNG A;  4OMP A;  1ZA2 B;  3CEY A;  2I2L A;  2LCS A;  2F1L A;  2M0O A;  4WTO B;  2CSQ A;  2XDP A;  1TG0 A;  3CCQ Q;  2ROT A;  2DIG A;  3QYH B;  1UGP B;  1NLO C;  5HKC A;  2DVJ A;  4GLK A;  4DOV A;  2M02 A;  2PVG B;  4J7F A;  5LJ5 g;  4J83 A;  4M77 C;  2QTX A;  2EJF A;  4RTY A;  1N9S A;  1M1G A;  2K2V A;  2V8K A;  1ZUY A;  4J9B A;  3I56 T;  1R0C B;  1K73 R;  5IN1 A;  1B34 B;  1VQN A;  1VQK T;  5KYU B;  4WCI A;  3ZBD A;  1RAC B;  3CCU T;  3L2U A;  2FRW A;  3EG9 A;  3G6E Q;  4AT1 B;  4E47 A;  2P4T A;  2QQA A;  3CCL A;  4QQG A;  1VQL T;  1VQ4 Q;  4HVW A;  2LQK A;  2MWO A;  3M4G A;  4ZGJ B;  2RHY A;  2DL5 A;  3RDV A;  1OX9 A;  3VRZ A;  2DIQ A;  3MPU B;  2MWP A;  4C92 A;  2IG0 A;  3G4S Q;  2KT8 A;  4ZN1 A;  4BE0 A;  5GAO l;  1VQ5 A;  2HQE A;  2OJ2 A;  4M7D B;  1RI0 A;  2QI2 A;  4D6W A;  4QQ6 A;  1N8R R;  4KGV B;  4M78 A;  4XK8 E;  4CC3 A;  3CCJ A;  3UF4 A;  4BI3 A;  1NM7 A;  1AZE A;  4OB2 B;  2JM8 A;  1K8A U;  4JLG A;  2QA4 A;  3HL8 A;  2KYM A;  5GAM f;  2VB6 A;  3CD6 T;  1N5Z A;  1Q7Y C;  4E2F B;  1UHC A;  1TH7 A;  3FLG A;  5CKE A;  1WXB A;  2E3H A;  2DBK A;  3PE0 A;  4XU3 A;  3CCV A;  1QKW A;  2QXF A;  1GFD A;  1VQ7 T;  4PJJ A;  3OW2 P;  3R6O A;  2R57 A;  3J80 E;  3CMA Q;  4XQ3 A;  2DET A;  1VQM Q;  1GRI A;  1VYT A;  4C0Z A;  2O4X A;  1ZSZ B;  2KK4 A;  1QCF A;  2VAS A;  2W10 A;  3HSB A;  4M77 A;  3G71 Q;  1RI9 A;  1YI2 T;  1K0X A;  1JRI A;  3PIO A;  3L2Q A;  1YJN T;  3FRN A;  1PCX A;  1T0J A;  4J9I A;  4PLI A;  4FSX A;  3EFR A;  4M7A C;  1T0H A;  5GAN 2;  4M4Z A;  1B7T A;  2P84 A;  1KK7 A;  2A37 A;  1Y0M A;  2YHT A;  1VQ6 Q;  4AG1 C;  4E7Z A;  1M27 C;  4AFZ C;  4JS4 A;  4J9F A;  3I56 A;  5D6X A;  3NTH A;  2XDB A;  4FU6 A;  1VQK A;  3S3N A;  3M56 A;  3CCR Q;  2HCK A;  3CCU A;  4PKC C;  3OYH A;  2DXT A;  4OMF B;  3ULR B;  4LD6 A;  4ZN3 A;  3GP8 A;  2VWF A;  1VQL A;  2E1H A;  2ZCF B;  2KSS A;  2IVW A;  1Q86 C;  3M0Q A;  4FM4 B;  2KRN A;  1UB4 A;  1Q81 U;  1YJ9 T;  4PFZ A;  4DEY A;  4Y91 A;  3Q1J A;  1VQ9 Q;  4XTX A;  1RLQ C;  2A28 A;  4EIK A;  1WJR A;  2RK1 A;  2ZPF B;  4RKU E;  3M0P A;  3L1A A;  2ROL A;  2MMP A;  3LWH A;  1R77 A;  1RAH B;  4BY6 C;  4EPC A;  2XKO C;  2LC4 A;  3SB2 A;  2M16 A;  2JTE A;  4LUE A;  1WJQ A;  2L3Q A;  3CD6 A;  3AT1 B;  1QWF A;  3JCM V;  4J7I A;  4FT2 A;  1YN8 A;  1M3C A;  1SHG A;  3CBM A;  4EMK B;  3E19 A;  1TUC A;  2RH2 A;  1PM3 A;  2YRC A;  4C5G A;  1O9S A;  1BK2 A;  3P8H A;  1VQ7 A;  1M3A A;  5DLQ E;  1M1K U;  3PTA A;  5A0G A;  4M7A A;  5J26 A;  2MI6 A;  4HT8 A;  1QVG S;  4HA8 A;  2MPX C;  5AYF A;  3NPF A;  3ER0 A;  1QVG A;  2ZPI B;  3VUB A;  1HXD A;  3D7S B;  1YI2 A;  2H3J A;  3X20 B;  4F7U F;  3QXE B;  2L5Q A;  2EQI A;  1NEB A;  1YJN A;  2KNB B;  3EFS A;  3M53 A;  5I11 A;  2FPD A;  5FU6 B;  3WVD B;  5LJ3 j;  2B86 A;  4E7J A;  1WI7 A;  5IAY A;  4J9E A;  4N4I A;  2FG0 A;  1E6G A;  3SD4 A;  5GAN e;  1NPP A;  2ED1 A;  4QVZ A;  2RI5 A;  3OYJ A;  4JJN K;  2E5Q A;  1WNL A;  3EG3 A;  3MEV A;  4KGZ B;  3VYG A;  3OBW A;  1UHF A;  5CKB A;  2FB7 A;  2KRM A;  1TU0 B;  4BB7 A;  3BDL A;  1XNI A;  4HCZ A;  2OTJ T;  3QBY A;  1K9A A;  3CC7 Q;  2AK5 A;  2ZPB B;  4PJM A;  1D1A A;  2L3P A;  5CCA A;  5EG2 A;  4A4H A;  4HCK A;  4L6V 5;  3JB9 J;  1NJI C;  4ZNX A;  4RCB A;  4KRT A;  1YJ9 A;  2EJG A;  2CKK A;  3A1P A;  4MZM A;  2C0O A;  3GNF B;  2DJQ A;  1Q82 U;  1S72 T;  3CCM A;  2F69 A;  1QCN A;  3H0F A;  4RTU A;  1YBY A;  2RB6 A;  5IHK A;  3MKD A;  3PIP A;  1SSH A;  2E65 A;  2AHJ B;  3ME9 A;  3HRS A;  4IKF A;  2O2O A;  1NBE B;  2QGG A;  5DLO A;  2V26 A;  5GMK e;  2FYK A;  4JLI A;  1VQ8 Q;  3OYC A;  3SEM A;  4NOY A;  8AT1 B;  4QKU A;  2BZX A;  1QVF P;  4PJO E; 
#chains in the Genus database with same CATH homology
 2DF6 A;  2H8H A;  1AWW A;  3VS7 A;  2ESW A;  2AKK A;  1PKT A;  4RUG A;  2EYW A;  2P4R A;  2F2W A;  4AG2 C;  2QDL A;  4OMN A;  1K4U S;  1UGV A;  1W6X A;  1PRL C;  2FEI A;  2J6K A;  4ESR A;  1WIE A;  5HCK A;  1SPK A;  4JPB W;  5IXB A;  2RPN A;  1B3Q A;  2K2M A;  3R6N A;  4HVV A;  1W70 A;  1X2Q A;  2OAW A;  2EYY A;  1GBQ A;  1HSQ A;  1M8M A;  1B07 A;  2KEA A;  1GCQ A;  2PNI A;  1X2K A;  4Z88 A;  2K79 A;  2YDL A;  1T3L A;  4QT7 A;  4D8K A;  1JXO A;  1U3O A;  2GTO A;  1YNZ A;  1IO6 A;  3UAT A;  1QLY A;  1K0S A;  2JS2 A;  2MIO A;  2X3X D;  2KXC A;  2RF0 A;  1NEG A;  2KE9 A;  1PHT A;  2YUN A;  5ECA A;  1UTI A;  3EG0 A;  4OML A;  3PVQ A;  1H3H A;  2EBP A;  3C0C A;  1SEM A;  2CSI A;  2PZ1 A;  2J05 A;  2LJ3 A;  2JMA A;  2MCN A;  3KFV A;  4J9H A;  1CSK A;  2DM1 A;  1GFC A;  5GJV B;  5EC7 A;  2LP5 A;  3SHW A;  3EG1 A;  3I35 A;  2NUZ A;  2A08 A;  2K6D A;  1LCK A;  1K76 A;  1VYU A;  4GBQ A;  3VS4 A;  1VYV A;  2O9S A;  2LJ1 A;  2XMF A;  3VS6 A;  2JMC A;  2RMO A;  4LUD A;  1H92 A;  4F17 A;  3I9Q A;  2I0N A;  2CDT A;  4JZ4 A;  3VRY A;  2IIM A;  2KYB A;  3RNJ A;  3UA6 A;  1QKX A;  2GNC A;  2DIL A;  3TSW A;  2ENM A;  2JT4 A;  2AZV A;  2YT6 A;  3O5Z A;  3TVT A;  2EKH A;  2KT1 A;  4OMP A;  2J6O A;  2LCS A;  1ZUK A;  1SRM A;  2CSQ A;  2O31 A;  1TG0 A;  3EHR A;  1UJ0 A;  4CC2 A;  1U06 A;  2ROT A;  1NLO C;  2V1Q A;  2DVJ A;  3NGP A;  4A63 B;  1JQQ A;  1MV0 B;  4RTV A;  1AWO A;  1JU5 C;  2MOX A;  3I5R A;  4RTY A;  3VS1 A;  3EHQ A;  4LNP A;  3QWX X;  1ZUY A;  4J9B A;  1KIK A;  4OMM A;  1NYF A;  2M0Y A;  4WCI A;  2CRE A;  2EYX A;  2D1X A;  2JM9 A;  3VS0 A;  3REA B;  2FRW A;  1PWT A;  2RQV A;  1BBZ A;  4LN2 A;  4Y92 A;  2J6F A;  2K9G A;  1XOV A;  1ZUU A;  2PTK A;  1JXM A;  2DRM A;  1BU1 A;  4RTZ A;  1UE9 A;  4HVW A;  2LMJ A;  4OMO A;  2LX7 A;  1OPL A;  2DL5 A;  5L23 A;  4CC4 B;  1S1N A;  1WX6 A;  3ZL7 C;  3VRZ A;  3M0S A;  4GLM A;  2NWM A;  1X69 A;  3NMZ C;  2KT8 A;  4AFU C;  1YP5 A;  5FWB A;  4LE9 A;  4J9G A;  2OJ2 A;  1SRL A;  3PVL A;  2A36 A;  4JJC A;  1UJY A;  3LH5 A;  1W1F A;  2RN8 A;  4FSS A;  4X1V A;  2EYZ A;  2L3S A;  1J3T A;  2RNA A;  4CC3 A;  2YSQ A;  3UF4 A;  1NM7 A;  1PKS A;  1AZE A;  2JM8 A;  2EVR A;  4Z8A A;  1HJD A;  2KYM A;  2OI3 A;  1N5Z A;  2F2V A;  1Z9Z A;  1VA7 A;  1YWO A;  4RTW A;  2DBM A;  1AZG B;  1UHC A;  1UDL A;  4RTT A;  1U5S A;  1WXB A;  2DBK A;  2DE0 X;  3PE0 A;  1QKW A;  1TUD A;  1FMK A;  1MV3 A;  1GFD A;  2LNH B;  3VS3 A;  2O9V A;  2L0A A;  2D8J A;  1AWX A;  1GRI A;  1VYT A;  2LZ6 B;  1I0C A;  3EGU A;  1M3B A;  2CUB A;  1QCF A;  2FPF A;  2W10 A;  1NG2 A;  1X27 A;  3M0R A;  3VS2 A;  3U23 A;  3CQT A;  1RI9 A;  1QWE A;  1K0X A;  4AFS C;  2KR3 A;  1KFZ A;  2RQT A;  1T0J A;  4J9I A;  3GBQ A;  2RQW A;  2VVK A;  2DRK A;  1E6H A;  3THK A;  1GCQ C;  1T3S A;  2LJ0 A;  2CUD A;  2DL4 A;  1T0H A;  4M4Z A;  1SHF A;  1OV3 A;  2A37 A;  1Y0M A;  1M30 A;  1MUZ A;  2BZ8 A;  4JJD A;  2HDA A;  2KBT A;  3FJ5 A;  4AG1 C;  1H8K A;  3EG2 A;  2YUQ A;  1M27 C;  4AFZ C;  4J9F A;  5FWC A;  2LQN A;  1HD3 A;  3TSZ A;  3QWY A;  2O88 A;  5IHI A;  4F14 A;  1AWJ A;  1BB9 A;  2HCK A;  1Z9Q A;  2X3W D;  4R0K A;  1JO8 A;  2EGC A;  2V1R A;  2DL8 A;  2G6F X;  2J7I A;  2ECZ A;  3H0H A;  3ULR B;  2CT4 A;  1I1J A;  2VWF A;  1PNJ A;  2ABL A;  1KSW A;  5I22 A;  2JS0 A;  3M0Q A;  2KRN A;  2SRC A;  1X43 A;  1OPK A;  4OMQ A;  2JW4 A;  1YWP A;  4DEY A;  1WA7 A;  2CH4 W;  1RLQ C;  1G2B A;  2A28 A;  2RQR A;  1WDX A;  4EIK A;  2DNU A;  5IH2 A;  1UFF A;  4HVU A;  2EGA A;  2EGE A;  1GBR A;  4CC7 A;  2FRY A;  2HEQ A;  1PRM C;  3REB B;  2SEM A;  3M0P A;  1X6G A;  2ROL A;  2GTJ A;  2LQW A;  2F2X A;  2HSP A;  3IQL A;  1ARK A;  3UA7 A;  1NYG A;  2BZY A;  5GJW B;  1A0N B;  1V1C A;  3I5S A;  2JTE A;  4LUE A;  4J9C A;  2L3Q A;  1WFW A;  2EPD A;  2M51 A;  1AD5 A;  1QWF A;  4HXJ A;  2VKN A;  1YN8 A;  1AVZ C;  1M3C A;  1SHG A;  1TUC A;  1RUW A;  4AFQ C;  2GQI A;  2CH4 A;  2RQU A;  3RBB B;  1BK2 A;  2KRO A;  2GBQ A;  3H0I A;  1M3A A;  2YUO A;  2KXD A;  2DYB A;  2W0Z A;  1AEY A;  1NLP C;  4JJB A;  3NPF A;  2C0T A;  3H41 A;  3A98 A;  2J06 A;  1ZLM A;  1ABO A;  1EFN A;  2EQI A;  1NEB A;  2HBW A;  2KNB B;  1GCP A;  2D8H A;  1ZX6 A;  3VS5 A;  2JXB A;  2DMO A;  5I11 A;  1UEC A;  2FPD A;  1RLP C;  2GGR A;  5FW9 A;  2B86 A;  1WI7 A;  4J9E A;  2FG0 A;  1E6G A;  2ED1 A;  4F16 A;  1AOJ A;  1KJW A;  3JV3 A;  2KGT A;  2FPE A;  3EG3 A;  1JEG A;  1I07 A;  2DA9 A;  4IIO A;  2AZS A;  1UHF A;  1WXT A;  4RTX A;  5IXF A;  2BTT A;  1OOT A;  2KRM A;  2ED0 A;  1ZSG A;  2FO0 A;  4JZ3 A;  1K9A A;  2AK5 A;  2K7A A;  2CT3 A;  2DL3 A;  4IIM A;  2L3P A;  2D0N A;  1ZBJ A;  1YCS B;  2YUP A;  3M0U A;  1GL5 A;  1E7O A;  4HCK A;  3M0T A;  2DLP A;  4DEX A;  1WYX A;  3NHN A;  1K1Z A;  1X6B A;  4E6R A;  4ZNX A;  2DX1 A;  4KRT A;  2E5K A;  1G83 A;  1UUE A;  2K3B A;  1FYN A;  2C0O A;  2DJQ A;  4ORZ A;  1OEB A;  2C0I A;  4D8D A;  2KRS A;  1ABQ A;  4K11 A;  3H0F A;  4RTU A;  2EW3 A;  5IHK A;  1Y57 A;  2DL7 A;  1SSH A;  1WXU A;  5IHN A;  2O2O A;  2L2P A;  2AKL A;  1CKA A;  1UG1 A;  1CKB A;  4J9D A;  3SEM A;  1WLP B;  2BZX A;  4Z89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...