2L3SA

Structure of the autoinhibited crk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
163
structure length
163
Chain Sequence
VEYVRALFDFNGNDDEDLPFKKGDILKIRDKPEEQWWNAEDMDGKRGMIPVPYVEKCRPSSASVSTLTGGNQDSSHPQPLGGPEPGPYAQPSINTPLPNLQNGPFYARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Autoinhibited Crk protein
publication title Structural basis for regulation of the Crk signaling protein by a proline switch.
pubmed doi rcsb
source organism Gallus gallus
total genus 13
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3sA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2l3sA02
2DL8A 2W10A 1PKTA 2BZYA 4CC2A 2LCSA 2GTJA 2L3SA 1X27A 3PVLA 4JZ4A 1Y0MA 2O88A 4OMPA 3VRYA 2K3BA 1UHFA 3EHRA 1PHTA 1B07A 1MV0B 2EGEA 2DJQA 4FSSA 1E6GA 1RLQC 2NWMA 3EG2A 1H3HA 2HCKA 4KRTA 4RTWA 1ARKA 1WXUA 2EYYA 2DM1A 2J6OA 2KXCA 4Z8AA 4DEYA 2FRWA 4D8KA 2HBWA 2BZ8A 2DRKA 1WX6A 2YUOA 4CC4B 2K7AA 3VS1A 2KGTA 1TUCA 1PKSA 2OI3A 3UA7A 1GBRA 2F2XA 1VA7A 1M3BA 4JJBA 1GL5A 2EPDA 1HSQA 2J6KA 1SEMA 2CT3A 1NG2A 1ZUYA 1M3CA 1UDLA 2CREA 4LUEA 4ESRA 3IQLA 4LE9A 2FEIA 2YUNA 1HD3A 3QWXX 2PZ1A 1FMKA 2DRMA 2RQWA 2KE9A 1W70A 2HSPA 2JTEA 4R0KA 1KFZA 4RTYA 2I0NA 3I35A 4AFQC 2DL3A 1K9AA 1G2BA 1ZUUA 3REAB 3M0QA 2KRSA 1UJ0A 2V1QA 2PTKA 1I07A 1QCFA 1SHFA 4RTTA 1NEBA 4JZ3A 2EGCA 2FPEA 1TUDA 3EGUA 2DYBA 2ENMA 2FG0A 4RTUA 1M8MA 1SRLA 4CC3A 1V1CA 1BK2A 2CUDA 2K9GA 2D8HA 2EGAA 4J9DA 5EC7A 5IXBA 1FYNA 1ZBJA 1Z9QA 3UA6A 1NLOC 1UG1A 3SHWA 2GTOA 4OMNA 2B86A 1AWWA 3H0HA 4K11A 2VVKA 3TVTA 2DA9A 1PNJA 2KT1A 2CDTA 4OMOA 1UTIA 2RQUA 2LMJA 2RN8A 1K0SA 1RUWA 1NEGA 2AKKA 1UECA 2A37A 2EYXA 4AG1C 3A98A 2JMAA 3ULRB 1NM7A 2D0NA 1AZEA 3VRZA 1VYVA 1U06A 1K4US 2BTTA 3I5RA 3NMZC 2AZVA 2DILA 3FJ5A 4RTZA 2PNIA 1UUEA 1EFNA 2A08A 1WA7A 2YT6A 4Z88A 4ORZA 2EYZA 3VS2A 2GBQA 3EHQA 2J06A 2F2WA 1GFCA 4X1VA 2FO0A 3KFVA 1JO8A 2W0ZA 1SPKA 1QKWA 2RQTA 4J9CA 5IH2A 4DEXA 1RLPC 1M30A 2K79A 4HVWA 1VYTA 2F2VA 4J9BA 2JM9A 1CKAA 5GJWB 4HVVA 4J9HA 2X3WD 1LCKA 1S1NA 2GQIA 2LJ3A 1UGVA 1SRMA 2AKLA 2O9SA 1GFDA 1J3TA 1BB9A 2KRNA 2GGRA 2DX1A 2RQRA 2O2OA 1AOJA 2CSIA 2ROTA 2YSQA 1SHGA 1TG0A 2DVJA 2EQIA 1CKBA 2LZ6B 1AWJA 2EW3A 3R6NA 1XOVA 3VS7A 2SRCA 3NHNA 1JU5C 2ECZA 1HJDA 4HXJA 2BZXA 2X3XD 2DF6A 4HVUA 4J9IA 2J7IA 2IIMA 2DBMA 3M0TA 1Z9ZA 1ABQA 4AG2C 5IHIA 2O31A 1T3SA 2LQWA 2NUZA 4OMQA 2J6FA 1OPKA 3C0CA 4Y92A 4J9GA 4WCIA 1GCPA 2KXDA 1AWXA 2QDLA 2CT4A 3U23A 2JW4A 1ZUKA 2L0AA 1MUZA 2EVRA 2K2MA 2KYBA 2KROA 1AVZC 2FPFA 2AK5A 2RQVA 2J05A 2KT8A 4Z89A 4GLMA 2JMCA 3THKA 2EBPA 1ZSGA 2AZSA 2A36A 1H8KA 3QWYA 1W1FA 3EG0A 1T0JA 2JS0A 2K6DA 1H92A 1JEGA 2KRMA 2MIOA 1SSHA 2CH4A 1QLYA 2KNBB 3O5ZA 1QWEA 5I22A 2JT4A 4JJDA 1GRIA 2KYMA 2DMOA 1BBZA 2HEQA 1BU1A 2OAWA 2LJ0A 5FWBA 1JXMA 2KEAA 1GCQA 2P4RA 1B3QA 1WXTA 1N5ZA 2ED1A 3GBQA 1T0HA 5L23A 3VS0A 3I9QA 1QKXA 1YNZA 2DE0X 1X43A 4LN2A 1AD5A 5IXFA 1ZLMA 5IHNA 2JM8A 1IO6A 1YWPA 1AWOA 2CH4W 1WIEA 1M3AA 3H0IA 4GBQA 1WLPB 1A0NB 4F14A 1ABOA 5GJVB 2V1RA 2E5KA 2RPNA 1KJWA 1WFWA 2M0YA 4J9EA 2DL5A 1JXOA 4ZNXA 4AFUC 2SEMA 1UE9A 1X6GA 3RBBB 3VS3A 3M0RA 4IIOA 3UF4A 2JS2A 2LX7A 3TSWA 2CSQA 2EKHA 1YCSB 2C0OA 4AFZC 1T3LA 2VKNA 2DBKA 3TSZA 4CC7A 4JPBW 2O9VA 4LUDA 2G6FX 4F16A 1PRMC 3H0FA 2ROLA 4OMMA 2MOXA 4AFSC 3PVQA 2XMFA 1M27C 1PRLC 4A63B 3H41A 1GBQA 4HCKA 1KIKA 2LJ1A 3NGPA 2ED0A 3M0PA 3VS5A 2HDAA 5HCKA 1K1ZA 1PWTA 1OOTA 2LQNA 1CSKA 1UJYA 4RTXA 3EG3A 1UFFA 2OJ2A 2D1XA 1I0CA 4JJCA 1U5SA 3ZL7C 3JV3A 1GCQC 1G83A 1Y57A 2CUBA 2FPDA 2DNUA 1YWOA 3LH5A 1YP5A 1ZX6A 4EIKA 2M51A 2RF0A 1OPLA 2ABLA 4QT7A 3REBB 2C0IA 3SEMA 2VWFA 3M0UA 1YN8A 1X2KA 1JQQA 4OMLA 1UHCA 1K76A 5FW9A 4J9FA 1KSWA 1X6BA 2GNCA 4LNPA 3UATA 2H8HA 4RTVA 1NYFA 3NPFA 4F17A 2YDLA 5FWCA 1OEBA 1WXBA 4M4ZA 4IIMA 1W6XA 2DL7A 2JXBA 4E6RA 1E7OA 1AZGB 2MCNA 3VS4A 1RI9A 2DL4A 1AEYA 2ESWA 2A28A 3RNJA 2KR3A 2YUPA 4RUGA 1NLPC 2DLPA 1X2QA 1U3OA 2KBTA 2L3QA 2YUQA 2RNAA 2RMOA 3M0SA 3EG1A 2C0TA 5ECAA 1X69A 4D8DA 3PE0A 3VS6A 2LNHB 5IHKA 2EYWA 2L3PA 1OV3A 3I5SA 5I11A 1WDXA 3CQTA 1MV3A 2L2PA 1I1JA 1VYUA 1QWFA 1WYXA 1NYGA 1K0XA 1WI7A 2FRYA 1E6HA 2D8JA 2LP5A
chains in the Genus database with same CATH superfamily
3X28B 5GMKe 4CC2A 1PKTA 2BZYA 4XU1A 2GTJA 3CC7Q 3GLXA 2O88A 2K3BA 2EGEA 4QVDA 4IUPA 4XU2A 3EGDB 1N6AA 4IKFA 1H3HA 4KT0E 1C1AA 2PVDB 3LH0A 4PKCC 1F1BB 2DM1A 2KXCA 1JJ2S 2QDYB 4BI4A 2HBWA 2NUTA 4CC4B 1VQ6T 2F5TX 1TWBA 2QI2A 1WHMA 4JJBA 2QEXQ 3CEYA 3CCRA 1SEMA 3META 2A3LA 2CT3A 2DXUA 4KBMB 3HFOA 5GMKh 2EYQA 4LUEA 1WQWA 3NTKA 4X34A 2FEIA 2R5AA 1Y96B 2JTEA 1D0ZA 4RTYA 1Q7YR 1YCYA 5GAN6 4LDWA 1WHLA 2FZGB 4FW1A 1FX7A 1ZUUA 3KUFA 1VQPQ 4OB1B 5CKBA 3M0QA 1IHWA 4M77A 2MPXC 5GAN7 3FC3A 3CCQA 1QCFA 4RTTA 4JZ3A 2FYKA 1M1KR 1OX9A 2RHUA 2XDDA 4R55A 4RTUA 1VQLA 4E7KA 2XG8D 1SRLA 4C5EA 4QQ6A 4M7AF 2RH2A 4DOVA 2CUDA 5KYYA 2EGAA 2DKGA 4F7UB 2JUFA 1UGSB 4C0DB 3CBMA 1NJIC 3MP8A 2JN0A 1UGPB 3TQ7P 2KT1A 4LD6A 4ZN3A 2CDTA 4FYVB 2DVEA 1D3BA 1VQOA 3CCJQ 5HK3A 3BDLA 4EPCA 1OQKA 2RN8A 1NEGA 3FLGA 5KYUA 2A37A 4JRIA 1SF9A 4AG1C 3A98A 2JJ9A 2JMAA 4JS4A 1U06A 2BTTA 1SKUB 2RM4A 2VASA 3JAME 3NMZC 2CGHA 5KH6A 4HT8A 2DILA 1NPRA 3CCUA 1JB0E 3RKYA 2DEQA 2VGNA 3VS2A 2GBQA 3EHQA 2XDBA 2QXFA 3TEEA 4X1VA 4PJOD 4JRKA 1JO8A 4QVZA 2VYTA 1Q86U 1VQMQ 3JCMP 1I4K1 3QYGB 2E41A 2K4YA 4HCZA 3OS5A 4BDZA 3J80E 3GNFB 3OYNA 1IGQA 2X3WD 3CXCA 1SRMA 1R77A 1G3WA 1GFDA 3L2RA 3CCVQ 1BB9A 2GGRA 4LDUA 2VGMA 1VQ5A 1SSFA 2O2OA 1AOJA 2RJFA 4HKEA 3UPUA 3CCSA 1CKBA 2LZ6B 5C6SA 1M90U 2E4HA 1D09B 2IVWA 5A0DA 4E7SA 3P8BB 2EW3A 3R6NA 1U8RA 4HT9A 2PUOB 1Q95G 1K8AU 1W4SA 4QKUA 3NHNA 1JU5C 5FU6C 1HJDA 2LT4A 4PJOE 4GLKA 1YJ9Q 2RA2A 4OP0A 2J7IA 2IIMA 3HKSA 5FU7B 1EX4A 5I21A 1T3SA 1YIJQ 2NUZA 4M7DE 2L5QA 5J39A 1OPKA 2JNGA 3HHTB 2KXDA 1BYMA 2QDLA 1XNIA 3R6OA 1OI1A 5LJ5j 1ZUKA 4KGXB 2L0AA 2XD0A 3UT1A 3JCMg 3OY9A 1D1CA 2RJDA 2K2VA 1XTDA 2KT8A 2BUDA 2KMTA 4E7JA 1JJ2A 4BE2A 3OSSC 2ZPIB 3H6ZA 1WNLA 1X6OA 3OMCA 3EG0A 4F7UG 1M5Q1 4XU0A 2KK4A 3CC2Q 1WJQA 2MMPA 4X9DA 5GAMd 1ZA2B 2DMOA 1BBZA 3E1SA 1BU1A 3CCRT 4KGZB 3X26B 1JXMA 1WJSA 1I81A 2P4RA 3FDRA 4XTXA 2HKNA 2ED1A 1NE8A 3GBQA 1T0HA 3I9QA 1YJWA 5A0GA 1WJRA 1D0XA 2QQRA 2DE0X 4LN2A 1AD5A 1ZLMA 5CVIA 5IHNA 3EFSA 1YWPA 3CCLA 2DETA 2CH4W 2COWA 2ATCB 3L2VA 3H0IA 4GBQA 3CCQT 3LGFA 1SG5A 2RPNA 2M0YA 1RADB 2O4XB 2QQ9A 1M4ZA 2EQUA 1YJNT 1X6GA 1I5OB 4C8QC 5KE3A 4IIOA 3UF4A 2JS2A 1Q86C 3SWNA 2DXCA 1YITT 2CSQA 5LL6S 2D6FA 1W2BS 2C0OA 2XICA 4PJOA 2R57A 1VQOT 1Y7XA 3CMEQ 4M78C 4JPBW 4C0GA 3G1JA 3H0FA 2OAUA 2KSSA 2A7YA 3V7RA 1N8RU 4JLGA 3GF5A 3F70A 3UWNA 4PFZA 4FW2A 4P5NA 4UC4A 2RHZA 4M7DA 1PRLC 1M90C 2EJ9A 2MWOA 3M0PA 4MMLA 3CCUT 3OYKA 2X4XA 1K1ZA 4A4HA 4LDVA 2LQNA 5CK9A 1KHIA 1K8AC 1KD1R 2E3IA 5AT1B 3G6EQ 1UFFA 1I0CA 3MPUB 1ZSZA 4PJOF 1MMGA 1G83A 3MO8A 3LWIA 2CZ1B 3EH2A 3M5AA 3LH5A 2FL7A 1YP5A 3M9QA 1ZX6A 5FRNA 5GMKi 1OPLA 4ZGJB 3OYMA 2B8AA 2QQSA 5DLOA 2RHXA 2VWFA 3RUXA 4RG8A 1K9MU 3OYDA 2OTLQ 4E7LA 2EFIA 4ZTJA 3HRTA 4B9XA 4BY6C 1VQ5T 1X6BA 2GNCA 3MJXA 2H8HA 4IUVA 5FWCA 3CCST 3CBOA 4M4ZA 1VQ6A 5GANg 2E64A 2FHDA 2E10A 1V29B 2MCNA 3VS4A 2ESWA 3RNJA 1U3OA 1RI0A 1VQKT 2DXBA 3S3MA 3OYIA 1X69A 3PE0A 2E5QA 2M9UA 4KH0B 4J6WA 3O8VA 1MGQA 4XTUA 2E1HA 1IGUA 3G71A 3CQTA 4A4GA 3LYIA 2LCLA 3L2UA 4FYYB 1WYXA 1WI7A 1NBEB 2OX7A 1RAEB 3LW5E 1QVGS 1TS9A 4A4KA 1C6VX 2ZPFB 2E6ZA 1MMAA 4HCCA 3EFOA 1X27A 3PVLA 3RESA 3SDZA 2ZGWA 3JB9H 5LJ5h 1N9SA 2DXTA 1MV0B 2IG0A 1QP2A 4EMHA 3GNGA 1E6GA 2NWMA 4OMFB 3CCEA 1FMVA 3L42A 2X4YA 2HCKA 1YI2A 4KRTA 9ATCB 3OYAA 4RTWA 3OBWA 1WXUA 4JDSA 2WSCE 4MDXA 2FRWA 1WX6A 2K7AA 3VS1A 2KGTA 1GBRA 4PFOA 3CMAT 4KGVB 2JTMA 2J6KA 2GF7A 2QA4A 4ESRA 2NUPA 5LJ3f 3HFNA 1EZZB 1N9RA 1R0BG 4M7AE 1W2BP 2DRMA 2EQKA 4FT2A 3OYJA 4R0KA 2M02A 3MEUA 3I35A 4VUBA 1N8RC 1BIAA 2DL3A 2XHCA 3CCLT 4EMKB 6AT1B 2COZA 1UJ0A 2V1QA 2PTKA 4OVAA 5GAMe 4B6MA 2CP3A 2DYBA 1M8MA 3JB9I 1V1CA 2X35A 3ZEHA 5CKFA 2K9GA 2D8HA 3X20B 3SD4A 5IXBA 2V26A 3UA6A 1W2BA 4BACA 1UG1A 2GTOA 4BD3A 2FZCB 3E19A 3CCRQ 3H0HA 1UGQB 2VVKA 2RK1A 4RMOA 3T9NA 3CCMA 1PNJA 1N27A 1UEBA 1K9MC 2HMAA 2RQUA 4LDXA 4Z02A 1Y71A 2AKKA 2YRDA 3PIOA 1UECA 3ME9A 1VQ8Q 4PJNA 4MZPA 1TUGB 3I56A 3I5RA 5GAOp 3HRUA 2PNIA 3CCQQ 2P4TA 1D1AA 1EFNA 2RHYA 3I55A 1WA7A 4JLIA 4Z88A 1VQLQ 2F2WA 1M2VB 4OGEA 1G3TA 2FO0A 5GAOm 3KFVA 1TSFA 2JTFA 2W0ZA 3OMGA 5FROA 1QKWA 2RQTA 4J9CA 1RLPC 1M30A 1QVFS 4J9BA 2JM9A 5GJWB 3EG9A 3BDUA 1LCKA 1S1NA 2R58A 4NS5A 1VQOQ 2LJ3A 4ZGEB 1UGVA 4F7UE 4DBRA 3HRSA 1M8VA 4M77C 2VV5A 2RQRA 1BI1A 4IUQA 2CSIA 4J83A 2YSQA 1QVGP 2DD5A 2DVJA 2EQIA 1AWJA 1B34B 2F1LA 2VXFA 5GAOq 3CCUQ 5GAMf 2LX9A 2K5IA 4M7AA 2DEUA 1XOVA 3VS7A 2SRCA 3A5ZB 4NL3A 2ECZA 1PSEA 1VQNA 2DF6A 3C94A 4KUIA 2EIFA 3G71T 4XTYA 3CC4A 3M0TA 1ABQA 1QVGA 2DAQA 2RO0A 2O31A 2RI3A 2J6FA 3C0CA 3G4SQ 1TXQA 2RB6A 3BE3A 3JCMX 1AWXA 1AHJB 3JCMW 2FB7A 3A8HB 4PL6A 3VUZA 3EGDA 1MUZA 4MZMA 2YRCA 1YJNA 1TOVA 2KYBA 2KROA 2OTJA 2J05A 5IT9E 3PNWC 3S6WA 1LNXA 2EJFA 1U1SA 4AT1B 4BB7A 5D7UA 1YITA 2JMCA 3CCET 3THKA 3JB9G 1YI2T 2AZSA 4KH1B 3M4YA 2A36A 1H8KA 3QWYA 2K6DA 1H92A 1JEGA 3VKIA 2P0KA 2KRMA 4Y91A 5IN1A 4PJJA 1RAHB 1Y96A 3EGXB 1GRIA 2KYMA 3QIIA 1BI2A 2LJ0A 4DBFA 3CXCP 2KEAA 1JRIA 5LJ3d 1GCQA 2QA4T 2CP7A 3JSCA 2WACA 1YHQA 4FIBA 1WXTA 1LPLA 3QO3A 2AT1B 3PTAA 4L5GA 2EQJA 1QKXA 1YNZA 5HK0A 2M0OA 1LJOA 3ZBDA 2JM8A 5GMKm 2X4JA 1IO6A 2XK0A 4RCCA 3MHXA 5D6XA 2CZ6B 4F7UA 3OSVA 4BI3A 4C5HA 1EIFA 1ABOA 5GJVB 2K3XA 2E5KA 2HD0A 4CI0C 5GAN2 5DY9A 1KC8U 4J9EA 2DL5A 1JXOA 1IB8A 2SEMA 3LWHA 3WVDB 1UE9A 2Y90A 3LX7A 5CQYA 3VS3A 2QGGA 2DD4A 5GAOn 2DTIA 1VQPA 2LX7A 4BUGA 3TSWA 4EDUA 2FVUA 3CCMT 2EKHA 1YCSB 1IXDA 1QVFP 1TH7A 4M77G 2LC4A 2O9VA 4F7UF 1YJWQ 5GAN5 5KYXB 1VQKA 2ROLA 5FU6B 4A54A 2MOXA 2DIQA 4JJNK 3TU4K 1IRXA 2GFAA 1MNDA 2JVVA 1JJ2P 3I56T 1K73U 3UDCA 1KIKA 4HCKA 2LJ1A 4QQGA 2HDAA 5HCKA 2P84A 1NJIR 8ATCB 3URGA 4M78D 1BCMA 3I55T 4QVCA 2ZCFB 1YBYA 3CCJA 2OJ2A 3MP1A 4Y28E 3JV3A 3TCJA 1QVFA 1Y57A 2MI6A 1IZ6A 1YWOA 3DKMA 2YHTA 4EIKA 2ABLA 4PLLA 1VIEA 3QJ6A 2C0IA 5CQXA 3M0UA 4OMLA 4XQ3A 5CR2A 2QTXA 1QP3A 4L59A 4J9FA 4OF1A 4RTVA 2YDLA 1RAIB 7AT1B 4J7IA 1Q82U 1O75A 2RI5A 3CMAA 2Z0WA 1VQ4T 2A28A 1D0YA 2KR3A 2YUPA 4RUGA 3SWNC 2HQEA 2YUQA 3CCVA 4MDWA 2YXYA 3EG1A 3VJPA 1VQ9A 2C0TA 3MEVA 1VQNT 4PJOC 3SB2A 2EYWA 5GAMj 3I5SA 3CC4T 1HYOA 3LGLA 1MHNA 2VXEA 2L2PA 3VUBA 3JCMf 2H3EB 2BIVA 1H3ZA 4M7DC 1E6HA 3JCMV 4PJMA 2DK3A 5KYWB 3RMQA 2LCSA 1YJ9A 4LDYA 2L3SA 4JZ4A 3E2UA 2OTJT 3N5BB 1WPYA 1RACB 2BE9B 4OMPA 3VRYA 4C8QB 1VQ6Q 3EHRA 1B07A 1ZSZC 2JOYA 5EG2A 4FL6A 3P8DA 2DJQA 1Q81U 1MMNA 1WHKA 3H8ZA 1G8XA 3HTRA 1KC8C 2GQVA 2E12A 2YLBA 4Z8AA 4M78B 1R0CB 4D8KA 2DRKA 1XQHA 2MAMA 3AHUA 3QXEB 4PJLA 4X9CA 1TUCA 2OI3A 2C06A 3OYFA 1GL5A 3L2ZA 1HSQA 4L6V5 4XK8E 2K3YA 1NG2A 1ZUYA 5CKDA 1M3CA 1UDLA 1YHQT 2CREA 3OW2S 3IQLA 2YUNA 1HD3A 2HNIA 3QWXX 1FMKA 2RQWA 2KE9A 4RG2A 4FT4A 4OGCA 3V8KA 3RKXA 3GP8A 1K73C 2O4XA 2KDSA 3JRZA 2CZ7B 1ZQ1A 4ELZC 4C92C 3REAB 4QW2A 3DB4A 3QUIA 4C92B 1SHFA 1YI2Q 1NEBA 2WSEE 4DBHA 2EGCA 2FPEA 2Y4YA 4FCYA 2ENMA 1Q7YU 4BDYA 2HL3A 3A8MB 4M75C 5LJ3e 1BK2A 2E70A 3OS1A 4M75B 4LXCA 2F69A 4PNOA 4BY6B 1FYNA 1ZBJA 4MMKA 1OU9A 3SHWA 1VQPT 3GPLA 4OMNA 2B86A 1AWWA 1M1KU 1OZ2A 3BFMA 3JB9D 5D6YA 4N4HA 1UTIA 3M56A 1RUWA 4E7HA 2LNVA 3AT1B 3L1AA 3ULRB 1NM7A 2D0NA 1Q82C 3X24B 1AZEA 4FYXB 1Q86R 2L8DA 3FJ5A 1BI3A 1UUEA 2A08A 3CMEA 2YT6A 4ORZA 2EYZA 3CCJT 2D9TA 1PM3A 4ZN1A 1KC8R 2HAXA 1OYXA 1SPKA 1Y07A 3VU3C 1KG1A 4XAXB 2E6NA 3C95A 2COYA 2KI7A 5A0LA 2F2VA 3M55A 4HVVA 4M7DG 1M90R 1QQJA 2R5MA 2KRNA 5GANf 3OYLA 4C8QG 4N4IA 1K8AR 3Q1JA 5CAIA 4F04B 2RI2A 2ROTA 4C5GA 1VQMT 2Y4XA 3QPHA 1Q81C 4JS5A 3X25B 4M78G 2OTLA 5FLXE 3CCVT 4TVRA 4M77D 3D7SB 1VQ9T 4HXJA 1LVKA 2AHJB 3NFCA 3BY7A 2DBMA 3QG1A 5IAYA 3JCMd 3MCAB 5IHIA 2LQWA 5GAMh 4OMQA 1KQSS 1V76A 2X9HA 4Y92A 4J9GA 5LJ5g 3PGGA 4PLIA 3U23A 5HKCA 2JW4A 4JUVA 3OYYA 3OW2P 1YJ9T 2EVRA 2PVOB 2K2MA 3G7ZA 4WTOB 1AVZC 2EAYA 2FPFA 2AK5A 1B7TA 4C92G 2RQVA 1PC0A 2DPPB 1U1TA 3VV0A 3KBGA 5FRMA 1ZSGA 1M2OA 3RDVA 1W1FA 4M75G 1Q7YC 3CD6A 1WQ7A 2ZPGB 1QLYA 3OW2A 3CC4Q 1QWEA 5I22A 4JJDA 2L89A 2OAWA 1M1KC 4OB2B 2NUTB 2CP6A 1RAGB 1N5ZA 2DERA 4XU3A 4EMKA 3QHSA 4N0AA 4MZTA 3C4SA 1S72A 4M7AC 2V8KA 2DIGA 1YJNQ 2ZPBB 3QDRB 4OB0B 4O5VA 2CP5A 1WIEA 1YITQ 1WLPB 1A0NB 4NL2A 4F14A 4BE0A 2HQXA 1Q81R 3PMIA 4II1A 2LT1A 2GCXA 4GY5A 2QYZA 3WVEB 4M77B 2YWWA 1N8RR 5CCAA 1KK7A 3M53A 2KY9A 1VQ4A 4R56A 5KYYB 1YHQQ 2D8JA 3JB9F 2MK5A 2XDPA 2HKQB 1FMWA 2VKNA 4CC7A 4J6YA 3MEWA 1ACMB 4LUDA 4B9WA 1PRMC 2QASA 3RKWA 5CKEA 4J7FA 1XJWB 4AFSC 3PVQA 3INZA 3E9FA 4ATOA 1D3BB 2ZAEA 1M2VA 4EMGA 4JRPA 5I2MA 4E7IA 2LTOA 1VQ7A 3P8HA 2L3RA 2ED0A 3QDFA 3A8LB 3EFRA 3CMET 5KYUB 1UJYA 1RAAB 3EG3A 2V8JA 4HA8A 4D6WA 1PD1A 4JJCA 1K9MR 3ZL7C 1GCQC 3HP9A 1VQ5Q 4E47A 1VQ8A 2CUBA 2DNUA 3CCSQ 5KYNA 2RF0A 3S3OA 4QT7A 1ZHIA 3REBB 1QMCA 2EKOA 2LQ8A 1KD1U 2HZYA 3JCMQ 1JQQA 5GANd 2D0QB 3G6ET 3OA6A 1B34A 2AIRB 1K76A 1KQSP 1VQKQ 3FJPA 1KSWA 1NYFA 4C0DC 3NPFA 4F17A 1OULA 3DLLA 3CC7A 4N4GA 3MP6A 2CP0A 1HK9A 2XU8A 2YLCA 2H3JA 4IIMA 4BE1A 1W6XA 2DL7A 3OYGA 2JXBA 2RK2A 5L8RE 4E6RA 1E7OA 1PD0A 2DL4A 3OYBA 1AEYA 3ZFJA 5GANj 1RABB 2OTLT 1NLPC 2KBTA 2L3QA 2RNAA 3PT9A 4M77F 2LCCA 4J5YA 2V8IA 1QVPA 2BKDN 4D8DA 1LOJA 3VS6A 3GOXA 1KQSA 5IHKA 2L3PA 1OV3A 1BCOA 4J6XA 4YTLA 4IUUA 3OS2A 4BI8B 4FU6A 2CYZB 5AYFA 2QEXA 1MV3A 5LJ3j 1VYUA 3M54A 3V7CA 4KULA 4KUDK 4M7AG 3KXTA 1WGSA 2DL8A 2W10A 2BE7D 2LRQA 4A4FA 2PVGB 1WZOA 1Y0MA 2LQKA 1UHFA 1UB4A 4XTWA 1PHTA 3CMAQ 2NYSA 1BIBA 4FSSA 3PIPA 1RLQC 3EG2A 4M7DD 3JCMh 3G4SA 3EGXA 3CD6T 3JCMe 1VIFA 1ARKA 4NOYA 2EYYA 1NPPA 2J6OA 3JCMc 5DM7R 4DEYA 1VQ9Q 1RL2A 4FYWB 4C8QD 4ANJA 2BZ8A 5CIUA 2YUOA 1YFNA 3J81E 1PKSA 3UA7A 2F2XA 1VA7A 1M3BA 5M9OA 2EPDA 2VUBA 3CCLQ 2ZPHB 2P0QA 3OQ5A 3RERA 3M59A 4RCBA 4LE9A 5J3BA 3QJYA 2XI9A 2PZ1A 5LJ5d 1W70A 2DZ9A 2HSPA 1S72T 1KFZA 2I0NA 2E3HA 2HL5C 4AFQC 3JCMb 5FU7C 1K9AA 1G2BA 3EH1A 1G5VA 2VB6A 2CZ0B 5KE2A 3VYGA 2MYSA 2HQHA 4O6JA 2KRSA 1AT1B 3PFSA 1BKBA 1I07A 4ELYC 1TUDA 1P92A 3EGUA 2FG0A 3QSUA 2CS7A 1KHCA 5CKHA 4CC3A 4C8QE 1MMDA 4J9DA 5EC7A 1Z9QA 1C0MA 1NLOC 1NZ9A 2ZZDA 2CKKA 1VQMA 1TU0B 4C92D 5KYXA 4LD9K 3NTIA 2RJEA 4K11A 3TVTA 1GXIE 1KD1C 2DA9A 4M78E 3LLRA 4OMOA 4M75D 3SWNB 4WF2A 2LMJA 3C12A 1K0SA 8AT1B 1IHVA 2I2LA 3OB9A 2EYXA 2QAZA 3V8LA 1QCNA 1OZ3A 4PJOB 3OYCA 3VRZA 1VYVA 3SFMA 1K4US 3QYHB 1VQ7T 4HCBA 2AZVA 2MWPA 4RTZA 4JRQA 3CPWS 5I2SA 2J06A 3EAEA 3V8JA 4M7DB 1GFCA 1VQ8T 3FEOA 4XTZA 3PMTA 4C92E 5IH2A 4DEXA 2K79A 2KQWA 3ER0A 1VYTA 1G3YA 4HVWA 5KCOA 1TTHB 1X01A 1CKAA 1ZSZB 1VUBA 4J9HA 1YIJA 2GQIA 4M75E 5D6WA 2O01E 2AKLA 2O9SA 1JBMA 1VQLT 5GAOl 1J3TA 1HXDA 3RIRA 2DFUA 2EWNA 3JB9J 2DX1A 1X75C 3CC7T 2M16A 1R8OB 4DBQA 4AMCA 5GAN3 4QQDA 1SHGA 1TG0A 3G71Q 3RR6A 3VYHB 1WHGA 3V7SA 3OYHA 4Q5WA 4A53A 1G3SA 2JZ2A 1D1BA 2M1HA 2BZXA 2DO3A 3E9GA 5GANh 1KQ2A 2X3XD 5GANe 4HVUA 4J9IA 3CC2A 4V2SA 2QEXT 5GMKj 1Z9ZA 4XTVA 3QZ5B 5KYWA 2GFUA 4AG2C 5C0MA 3CCEQ 4C8QA 4WCIA 4A4EA 1GCPA 3OYEA 2CT4A 5LJ3h 4C0FA 3A8OB 3M4GA 2K5LA 1MNEA 3HL8A 4ZTFA 4ZGDB 5HY6A 3M58A 2K57A 4M78A 4DA4A 2DTOA 3A1PA 2HBPA 1H641 5J26A 4Z89A 5KCHA 4GLMA 3EFOB 3G4ST 4M7DF 2EBPA 2QA4Q 1UGRB 2RD1A 2IPOB 4E2FB 1T0JA 3L2WA 3FB9A 3TREA 2JS0A 2XKOC 3CPFA 4C8QF 2MIOA 2CP2A 2PU9B 1ZBXA 2X4WA 1SSHA 2CH4A 2P0PA 5GAN4 2YRVA 1RAFB 2KNBB 3O5ZA 2JT4A 2EJGA 1OU8A 2HEQA 2QQAA 5FWBA 3NTHA 3FIFA 1PSFA 4M78F 3WXMB 1B3QA 2LVMA 5L23A 3VS0A 4PJOG 4IUTA 4C92A 1BI0A 2DYIA 1X43A 2QTVA 5IXFA 5LJ3g 1FWZA 2NUPB 4C5IA 1AWOA 2PQWA 2DZCA 3ASKA 4M75A 1M3AA 1I8FA 3CCMQ 4CRIA 3GIBA 3QBYA 1QW1A 3MEAA 1PG5B 1VOMA 2V1RA 3CD6Q 3H9NA 4DOWA 1KJWA 1WFWA 3G6EA 4M7AD 3OBYA 4ZNXA 4AFUC 5GMKl 2F5KA 4IURA 3CPWP 3RBBB 3M0RA 2QQBA 2XIDA 3FRNA 4C92F 5LJ5e 1FXXA 3I56Q 1I5LA 2MF2A 1M9SA 1K73R 1IREB 2HSEB 2QG9B 4AFZC 4PK4A 3I55Q 1T3LA 2DBKA 3TSZA 4M75F 2G6FX 4F16A 2KAFA 2RJCA 2ZPEB 2A0FB 1S72Q 4E7ZA 4OMMA 5DLQE 1M1FA 2VC8A 3HPWA 4J8OA 2XMFA 3DB3A 3DLMA 3CPWA 1M27C 2QK0A 3M57A 4A63B 3H41A 1GBQA 1QCOA 3NGPA 3VS5A 1PWTA 4C0ZA 1OOTA 4DQ2A 1CSKA 4RTXA 1YJWT 3QZ9B 2D1XA 1U5SA 3RMSA 2G3RA 3QKJA 2X51A 2DJZA 2FPDA 2EQMA 3JCMJ 4EMKC 1NJIU 5GAOr 2DTHA 2M51A 3S3NA 4N0AC 5CO7A 3OS0A 1Q82R 4FSXA 1VQ4Q 3SEMA 1YIJT 1YN8A 1X2KA 3J7AF 1UHCA 2WSFE 4M77E 1KQ1A 2QGFB 2LDMA 5FW9A 4RKUE 4LNPA 3UATA 4ME7A 1DJ7B 1VQNQ 3A8GB 3EG9B 3CXCS 1OEBA 1WXBA 4FM4B 2NLUA 2PUKB 2E65A 1WHJA 1VQ7Q 1AZGB 1RI9A 2DLPA 1X2QA 2RMOA 1PCXA 1ZA1B 3CBPA 4PFPA 3M0SA 1O9SA 5ECAA 5GAMg 5A2QE 2K5FA 3CC2T 1OX8A 2LNHB 4OB3B 4M7AB 5LJ5f 2OTJQ 5I11A 1WDXA 2FZKB 3HSBA 1WHHA 1I1JA 3BW1A 1QWFA 5GAN8 1NYGA 1K0XA 3L2QA 2RHIA 2KVQG 3MKDA 2FRYA 1M1GA 2LP5A
chains in the Genus database with same CATH topology
2DL8A 2W10A 1PKTA 2BZYA 4CC2A 2LCSA 2GTJA 2L3SA 1X27A 3PVLA 4JZ4A 1Y0MA 2O88A 4OMPA 3VRYA 2K3BA 1UHFA 3EHRA 1PHTA 1B07A 1MV0B 2EGEA 2DJQA 4FSSA 1E6GA 1RLQC 2NWMA 3EG2A 1H3HA 2HCKA 4KRTA 4RTWA 1ARKA 1WXUA 2EYYA 2DM1A 2J6OA 2KXCA 4Z8AA 4DEYA 2FRWA 4D8KA 2HBWA 2BZ8A 2DRKA 1WX6A 2YUOA 4CC4B 2K7AA 3VS1A 2KGTA 1TUCA 1PKSA 2OI3A 3UA7A 1GBRA 2F2XA 1VA7A 1M3BA 4JJBA 1GL5A 2EPDA 1HSQA 2J6KA 1SEMA 2CT3A 1NG2A 1ZUYA 1M3CA 1UDLA 2CREA 4LUEA 4ESRA 3IQLA 4LE9A 2FEIA 2YUNA 1HD3A 3QWXX 2PZ1A 1FMKA 2DRMA 2RQWA 2KE9A 1W70A 2HSPA 2JTEA 4R0KA 1KFZA 4RTYA 2I0NA 3I35A 4AFQC 2DL3A 1K9AA 1G2BA 1ZUUA 3REAB 3M0QA 2KRSA 1UJ0A 2V1QA 2PTKA 1I07A 1QCFA 1SHFA 4RTTA 1NEBA 4JZ3A 2EGCA 2FPEA 1TUDA 3EGUA 2DYBA 2ENMA 2FG0A 4RTUA 1M8MA 1SRLA 4CC3A 1V1CA 1BK2A 2CUDA 2K9GA 2D8HA 2EGAA 4J9DA 5EC7A 5IXBA 1FYNA 1ZBJA 1Z9QA 3UA6A 1NLOC 1UG1A 3SHWA 2GTOA 4OMNA 2B86A 1AWWA 3H0HA 4K11A 2VVKA 3TVTA 2DA9A 1PNJA 2KT1A 2CDTA 4OMOA 1UTIA 2RQUA 2LMJA 2RN8A 1K0SA 1RUWA 1NEGA 2AKKA 1UECA 2A37A 2EYXA 4AG1C 3A98A 2JMAA 3ULRB 1NM7A 2D0NA 1AZEA 3VRZA 1VYVA 1U06A 1K4US 2BTTA 3I5RA 3NMZC 2AZVA 2DILA 3FJ5A 4RTZA 2PNIA 1UUEA 1EFNA 2A08A 1WA7A 2YT6A 4Z88A 4ORZA 2EYZA 3VS2A 2GBQA 3EHQA 2J06A 2F2WA 1GFCA 4X1VA 2FO0A 3KFVA 1JO8A 2W0ZA 1SPKA 1QKWA 2RQTA 4J9CA 5IH2A 4DEXA 1RLPC 1M30A 2K79A 4HVWA 1VYTA 2F2VA 4J9BA 2JM9A 1CKAA 5GJWB 4HVVA 4J9HA 2X3WD 1LCKA 1S1NA 2GQIA 2LJ3A 1UGVA 1SRMA 2AKLA 2O9SA 1GFDA 1J3TA 1BB9A 2KRNA 2GGRA 2DX1A 2RQRA 2O2OA 1AOJA 2CSIA 2ROTA 2YSQA 1SHGA 1TG0A 2DVJA 2EQIA 1CKBA 2LZ6B 1AWJA 2EW3A 3R6NA 1XOVA 3VS7A 2SRCA 3NHNA 1JU5C 2ECZA 1HJDA 4HXJA 2BZXA 2X3XD 2DF6A 4HVUA 4J9IA 2J7IA 2IIMA 2DBMA 3M0TA 1Z9ZA 1ABQA 4AG2C 5IHIA 2O31A 1T3SA 2LQWA 2NUZA 4OMQA 2J6FA 1OPKA 3C0CA 4Y92A 4J9GA 4WCIA 1GCPA 2KXDA 1AWXA 2QDLA 2CT4A 3U23A 2JW4A 1ZUKA 2L0AA 1MUZA 2EVRA 2K2MA 2KYBA 2KROA 1AVZC 2FPFA 2AK5A 2RQVA 2J05A 2KT8A 4Z89A 4GLMA 2JMCA 3THKA 2EBPA 1ZSGA 2AZSA 2A36A 1H8KA 3QWYA 1W1FA 3EG0A 1T0JA 2JS0A 2K6DA 1H92A 1JEGA 2KRMA 2MIOA 1SSHA 2CH4A 1QLYA 2KNBB 3O5ZA 1QWEA 5I22A 2JT4A 4JJDA 1GRIA 2KYMA 2DMOA 1BBZA 2HEQA 1BU1A 2OAWA 2LJ0A 5FWBA 1JXMA 2KEAA 1GCQA 2P4RA 1B3QA 1WXTA 1N5ZA 2ED1A 3GBQA 1T0HA 5L23A 3VS0A 3I9QA 1QKXA 1YNZA 2DE0X 1X43A 4LN2A 1AD5A 5IXFA 1ZLMA 5IHNA 2JM8A 1IO6A 1YWPA 1AWOA 2CH4W 1WIEA 1M3AA 3H0IA 4GBQA 1WLPB 1A0NB 4F14A 1ABOA 5GJVB 2V1RA 2E5KA 2RPNA 1KJWA 1WFWA 2M0YA 4J9EA 2DL5A 1JXOA 4ZNXA 4AFUC 2SEMA 1UE9A 1X6GA 3RBBB 3VS3A 3M0RA 4IIOA 3UF4A 2JS2A 2LX7A 3TSWA 2CSQA 2EKHA 1YCSB 2C0OA 4AFZC 1T3LA 2VKNA 2DBKA 3TSZA 4CC7A 4JPBW 2O9VA 4LUDA 2G6FX 4F16A 1PRMC 3H0FA 2ROLA 4OMMA 2MOXA 4AFSC 3PVQA 2XMFA 1M27C 1PRLC 4A63B 3H41A 1GBQA 4HCKA 1KIKA 2LJ1A 3NGPA 2ED0A 3M0PA 3VS5A 2HDAA 5HCKA 1K1ZA 1PWTA 1OOTA 2LQNA 1CSKA 1UJYA 4RTXA 3EG3A 1UFFA 2OJ2A 2D1XA 1I0CA 4JJCA 1U5SA 3ZL7C 3JV3A 1GCQC 1G83A 1Y57A 2CUBA 2FPDA 2DNUA 1YWOA 3LH5A 1YP5A 1ZX6A 4EIKA 2M51A 2RF0A 1OPLA 2ABLA 4QT7A 3REBB 2C0IA 3SEMA 2VWFA 3M0UA 1YN8A 1X2KA 1JQQA 4OMLA 1UHCA 1K76A 5FW9A 4J9FA 1KSWA 1X6BA 2GNCA 4LNPA 3UATA 2H8HA 4RTVA 1NYFA 3NPFA 4F17A 2YDLA 5FWCA 1OEBA 1WXBA 4M4ZA 4IIMA 1W6XA 2DL7A 2JXBA 4E6RA 1E7OA 1AZGB 2MCNA 3VS4A 1RI9A 2DL4A 1AEYA 2ESWA 2A28A 3RNJA 2KR3A 2YUPA 4RUGA 1NLPC 2DLPA 1X2QA 1U3OA 2KBTA 2L3QA 2YUQA 2RNAA 2RMOA 3M0SA 3EG1A 2C0TA 5ECAA 1X69A 4D8DA 3PE0A 3VS6A 2LNHB 5IHKA 2EYWA 2L3PA 1OV3A 3I5SA 5I11A 1WDXA 3CQTA 1MV3A 2L2PA 1I1JA 1VYUA 1QWFA 1WYXA 1NYGA 1K0XA 1WI7A 2FRYA 1E6HA 2D8JA 2LP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL8 A;  2W10 A;  1PKT A;  2BZY A;  4CC2 A;  2LCS A;  2GTJ A;  2L3S A;  1X27 A;  3PVL A;  4JZ4 A;  1Y0M A;  2O88 A;  4OMP A;  3VRY A;  2K3B A;  1UHF A;  3EHR A;  1PHT A;  1B07 A;  1MV0 B;  2EGE A;  2DJQ A;  4FSS A;  1E6G A;  1RLQ C;  2NWM A;  3EG2 A;  1H3H A;  2HCK A;  4KRT A;  4RTW A;  1ARK A;  1WXU A;  2EYY A;  2DM1 A;  2J6O A;  2KXC A;  4Z8A A;  4DEY A;  2FRW A;  4D8K A;  2HBW A;  2BZ8 A;  2DRK A;  1WX6 A;  2YUO A;  4CC4 B;  2K7A A;  3VS1 A;  2KGT A;  1TUC A;  1PKS A;  2OI3 A;  3UA7 A;  1GBR A;  2F2X A;  1VA7 A;  1M3B A;  4JJB A;  1GL5 A;  2EPD A;  1HSQ A;  2J6K A;  1SEM A;  2CT3 A;  1NG2 A;  1ZUY A;  1M3C A;  1UDL A;  2CRE A;  4LUE A;  4ESR A;  3IQL A;  4LE9 A;  2FEI A;  2YUN A;  1HD3 A;  3QWX X;  2PZ1 A;  1FMK A;  2DRM A;  2RQW A;  2KE9 A;  1W70 A;  2HSP A;  2JTE A;  4R0K A;  1KFZ A;  4RTY A;  2I0N A;  3I35 A;  4AFQ C;  2DL3 A;  1K9A A;  1G2B A;  1ZUU A;  3REA B;  3M0Q A;  2KRS A;  1UJ0 A;  2V1Q A;  2PTK A;  1I07 A;  1QCF A;  1SHF A;  4RTT A;  1NEB A;  4JZ3 A;  2EGC A;  2FPE A;  1TUD A;  3EGU A;  2DYB A;  2ENM A;  2FG0 A;  4RTU A;  1M8M A;  1SRL A;  4CC3 A;  1V1C A;  1BK2 A;  2CUD A;  2K9G A;  2D8H A;  2EGA A;  4J9D A;  5EC7 A;  5IXB A;  1FYN A;  1ZBJ A;  1Z9Q A;  3UA6 A;  1NLO C;  1UG1 A;  3SHW A;  2GTO A;  4OMN A;  2B86 A;  1AWW A;  3H0H A;  4K11 A;  2VVK A;  3TVT A;  2DA9 A;  1PNJ A;  2KT1 A;  2CDT A;  4OMO A;  1UTI A;  2RQU A;  2LMJ A;  2RN8 A;  1K0S A;  1RUW A;  1NEG A;  2AKK A;  1UEC A;  2A37 A;  2EYX A;  4AG1 C;  3A98 A;  2JMA A;  3ULR B;  1NM7 A;  2D0N A;  1AZE A;  3VRZ A;  1VYV A;  1U06 A;  1K4U S;  2BTT A;  3I5R A;  3NMZ C;  2AZV A;  2DIL A;  3FJ5 A;  4RTZ A;  2PNI A;  1UUE A;  1EFN A;  2A08 A;  1WA7 A;  2YT6 A;  4Z88 A;  4ORZ A;  2EYZ A;  3VS2 A;  2GBQ A;  3EHQ A;  2J06 A;  2F2W A;  1GFC A;  4X1V A;  2FO0 A;  3KFV A;  1JO8 A;  2W0Z A;  1SPK A;  1QKW A;  2RQT A;  4J9C A;  5IH2 A;  4DEX A;  1RLP C;  1M30 A;  2K79 A;  4HVW A;  1VYT A;  2F2V A;  4J9B A;  2JM9 A;  1CKA A;  5GJW B;  4HVV A;  4J9H A;  2X3W D;  1LCK A;  1S1N A;  2GQI A;  2LJ3 A;  1UGV A;  1SRM A;  2AKL A;  2O9S A;  1GFD A;  1J3T A;  1BB9 A;  2KRN A;  2GGR A;  2DX1 A;  2RQR A;  2O2O A;  1AOJ A;  2CSI A;  2ROT A;  2YSQ A;  1SHG A;  1TG0 A;  2DVJ A;  2EQI A;  1CKB A;  2LZ6 B;  1AWJ A;  2EW3 A;  3R6N A;  1XOV A;  3VS7 A;  2SRC A;  3NHN A;  1JU5 C;  2ECZ A;  1HJD A;  4HXJ A;  2BZX A;  2X3X D;  2DF6 A;  4HVU A;  4J9I A;  2J7I A;  2IIM A;  2DBM A;  3M0T A;  1Z9Z A;  1ABQ A;  4AG2 C;  5IHI A;  2O31 A;  1T3S A;  2LQW A;  2NUZ A;  4OMQ A;  2J6F A;  1OPK A;  3C0C A;  4Y92 A;  4J9G A;  4WCI A;  1GCP A;  2KXD A;  1AWX A;  2QDL A;  2CT4 A;  3U23 A;  2JW4 A;  1ZUK A;  2L0A A;  1MUZ A;  2EVR A;  2K2M A;  2KYB A;  2KRO A;  1AVZ C;  2FPF A;  2AK5 A;  2RQV A;  2J05 A;  2KT8 A;  4Z89 A;  4GLM A;  2JMC A;  3THK A;  2EBP A;  1ZSG A;  2AZS A;  2A36 A;  1H8K A;  3QWY A;  1W1F A;  3EG0 A;  1T0J A;  2JS0 A;  2K6D A;  1H92 A;  1JEG A;  2KRM A;  2MIO A;  1SSH A;  2CH4 A;  1QLY A;  2KNB B;  3O5Z A;  1QWE A;  5I22 A;  2JT4 A;  4JJD A;  1GRI A;  2KYM A;  2DMO A;  1BBZ A;  2HEQ A;  1BU1 A;  2OAW A;  2LJ0 A;  5FWB A;  1JXM A;  2KEA A;  1GCQ A;  2P4R A;  1B3Q A;  1WXT A;  1N5Z A;  2ED1 A;  3GBQ A;  1T0H A;  5L23 A;  3VS0 A;  3I9Q A;  1QKX A;  1YNZ A;  2DE0 X;  1X43 A;  4LN2 A;  1AD5 A;  5IXF A;  1ZLM A;  5IHN A;  2JM8 A;  1IO6 A;  1YWP A;  1AWO A;  2CH4 W;  1WIE A;  1M3A A;  3H0I A;  4GBQ A;  1WLP B;  1A0N B;  4F14 A;  1ABO A;  5GJV B;  2V1R A;  2E5K A;  2RPN A;  1KJW A;  1WFW A;  2M0Y A;  4J9E A;  2DL5 A;  1JXO A;  4ZNX A;  4AFU C;  2SEM A;  1UE9 A;  1X6G A;  3RBB B;  3VS3 A;  3M0R A;  4IIO A;  3UF4 A;  2JS2 A;  2LX7 A;  3TSW A;  2CSQ A;  2EKH A;  1YCS B;  2C0O A;  4AFZ C;  1T3L A;  2VKN A;  2DBK A;  3TSZ A;  4CC7 A;  4JPB W;  2O9V A;  4LUD A;  2G6F X;  4F16 A;  1PRM C;  3H0F A;  2ROL A;  4OMM A;  2MOX A;  4AFS C;  3PVQ A;  2XMF A;  1M27 C;  1PRL C;  4A63 B;  3H41 A;  1GBQ A;  4HCK A;  1KIK A;  2LJ1 A;  3NGP A;  2ED0 A;  3M0P A;  3VS5 A;  2HDA A;  5HCK A;  1K1Z A;  1PWT A;  1OOT A;  2LQN A;  1CSK A;  1UJY A;  4RTX A;  3EG3 A;  1UFF A;  2OJ2 A;  2D1X A;  1I0C A;  4JJC A;  1U5S A;  3ZL7 C;  3JV3 A;  1GCQ C;  1G83 A;  1Y57 A;  2CUB A;  2FPD A;  2DNU A;  1YWO A;  3LH5 A;  1YP5 A;  1ZX6 A;  4EIK A;  2M51 A;  2RF0 A;  1OPL A;  2ABL A;  4QT7 A;  3REB B;  2C0I A;  3SEM A;  2VWF A;  3M0U A;  1YN8 A;  1X2K A;  1JQQ A;  4OML A;  1UHC A;  1K76 A;  5FW9 A;  4J9F A;  1KSW A;  1X6B A;  2GNC A;  4LNP A;  3UAT A;  2H8H A;  4RTV A;  1NYF A;  3NPF A;  4F17 A;  2YDL A;  5FWC A;  1OEB A;  1WXB A;  4M4Z A;  4IIM A;  1W6X A;  2DL7 A;  2JXB A;  4E6R A;  1E7O A;  1AZG B;  2MCN A;  3VS4 A;  1RI9 A;  2DL4 A;  1AEY A;  2ESW A;  2A28 A;  3RNJ A;  2KR3 A;  2YUP A;  4RUG A;  1NLP C;  2DLP A;  1X2Q A;  1U3O A;  2KBT A;  2L3Q A;  2YUQ A;  2RNA A;  2RMO A;  3M0S A;  3EG1 A;  2C0T A;  5ECA A;  1X69 A;  4D8D A;  3PE0 A;  3VS6 A;  2LNH B;  5IHK A;  2EYW A;  2L3P A;  1OV3 A;  3I5S A;  5I11 A;  1WDX A;  3CQT A;  1MV3 A;  2L2P A;  1I1J A;  1VYU A;  1QWF A;  1WYX A;  1NYG A;  1K0X A;  1WI7 A;  2FRY A;  1E6H A;  2D8J A;  2LP5 A; 
#chains in the Genus database with same CATH topology
 3X28 B;  5GMK e;  4CC2 A;  1PKT A;  2BZY A;  4XU1 A;  2GTJ A;  3CC7 Q;  3GLX A;  2O88 A;  2K3B A;  2EGE A;  4QVD A;  4IUP A;  4XU2 A;  3EGD B;  1N6A A;  4IKF A;  1H3H A;  4KT0 E;  1C1A A;  2PVD B;  3LH0 A;  4PKC C;  1F1B B;  2DM1 A;  2KXC A;  1JJ2 S;  2QDY B;  4BI4 A;  2HBW A;  2NUT A;  4CC4 B;  1VQ6 T;  2F5T X;  1TWB A;  2QI2 A;  1WHM A;  4JJB A;  2QEX Q;  3CEY A;  3CCR A;  1SEM A;  3MET A;  2A3L A;  2CT3 A;  2DXU A;  4KBM B;  3HFO A;  5GMK h;  2EYQ A;  4LUE A;  1WQW A;  3NTK A;  4X34 A;  2FEI A;  2R5A A;  1Y96 B;  2JTE A;  1D0Z A;  4RTY A;  1Q7Y R;  1YCY A;  5GAN 6;  4LDW A;  1WHL A;  2FZG B;  4FW1 A;  1FX7 A;  1ZUU A;  3KUF A;  1VQP Q;  4OB1 B;  5CKB A;  3M0Q A;  1IHW A;  4M77 A;  2MPX C;  5GAN 7;  3FC3 A;  3CCQ A;  1QCF A;  4RTT A;  4JZ3 A;  2FYK A;  1M1K R;  1OX9 A;  2RHU A;  2XDD A;  4R55 A;  4RTU A;  1VQL A;  4E7K A;  2XG8 D;  1SRL A;  4C5E A;  4QQ6 A;  4M7A F;  2RH2 A;  4DOV A;  2CUD A;  5KYY A;  2EGA A;  2DKG A;  4F7U B;  2JUF A;  1UGS B;  4C0D B;  3CBM A;  1NJI C;  3MP8 A;  2JN0 A;  1UGP B;  3TQ7 P;  2KT1 A;  4LD6 A;  4ZN3 A;  2CDT A;  4FYV B;  2DVE A;  1D3B A;  1VQO A;  3CCJ Q;  5HK3 A;  3BDL A;  4EPC A;  1OQK A;  2RN8 A;  1NEG A;  3FLG A;  5KYU A;  2A37 A;  4JRI A;  1SF9 A;  4AG1 C;  3A98 A;  2JJ9 A;  2JMA A;  4JS4 A;  1U06 A;  2BTT A;  1SKU B;  2RM4 A;  2VAS A;  3JAM E;  3NMZ C;  2CGH A;  5KH6 A;  4HT8 A;  2DIL A;  1NPR A;  3CCU A;  1JB0 E;  3RKY A;  2DEQ A;  2VGN A;  3VS2 A;  2GBQ A;  3EHQ A;  2XDB A;  2QXF A;  3TEE A;  4X1V A;  4PJO D;  4JRK A;  1JO8 A;  4QVZ A;  2VYT A;  1Q86 U;  1VQM Q;  3JCM P;  1I4K 1;  3QYG B;  2E41 A;  2K4Y A;  4HCZ A;  3OS5 A;  4BDZ A;  3J80 E;  3GNF B;  3OYN A;  1IGQ A;  2X3W D;  3CXC A;  1SRM A;  1R77 A;  1G3W A;  1GFD A;  3L2R A;  3CCV Q;  1BB9 A;  2GGR A;  4LDU A;  2VGM A;  1VQ5 A;  1SSF A;  2O2O A;  1AOJ A;  2RJF A;  4HKE A;  3UPU A;  3CCS A;  1CKB A;  2LZ6 B;  5C6S A;  1M90 U;  2E4H A;  1D09 B;  2IVW A;  5A0D A;  4E7S A;  3P8B B;  2EW3 A;  3R6N A;  1U8R A;  4HT9 A;  2PUO B;  1Q95 G;  1K8A U;  1W4S A;  4QKU A;  3NHN A;  1JU5 C;  5FU6 C;  1HJD A;  2LT4 A;  4PJO E;  4GLK A;  1YJ9 Q;  2RA2 A;  4OP0 A;  2J7I A;  2IIM A;  3HKS A;  5FU7 B;  1EX4 A;  5I21 A;  1T3S A;  1YIJ Q;  2NUZ A;  4M7D E;  2L5Q A;  5J39 A;  1OPK A;  2JNG A;  3HHT B;  2KXD A;  1BYM A;  2QDL A;  1XNI A;  3R6O A;  1OI1 A;  5LJ5 j;  1ZUK A;  4KGX B;  2L0A A;  2XD0 A;  3UT1 A;  3JCM g;  3OY9 A;  1D1C A;  2RJD A;  2K2V A;  1XTD A;  2KT8 A;  2BUD A;  2KMT A;  4E7J A;  1JJ2 A;  4BE2 A;  3OSS C;  2ZPI B;  3H6Z A;  1WNL A;  1X6O A;  3OMC A;  3EG0 A;  4F7U G;  1M5Q 1;  4XU0 A;  2KK4 A;  3CC2 Q;  1WJQ A;  2MMP A;  4X9D A;  5GAM d;  1ZA2 B;  2DMO A;  1BBZ A;  3E1S A;  1BU1 A;  3CCR T;  4KGZ B;  3X26 B;  1JXM A;  1WJS A;  1I81 A;  2P4R A;  3FDR A;  4XTX A;  2HKN A;  2ED1 A;  1NE8 A;  3GBQ A;  1T0H A;  3I9Q A;  1YJW A;  5A0G A;  1WJR A;  1D0X A;  2QQR A;  2DE0 X;  4LN2 A;  1AD5 A;  1ZLM A;  5CVI A;  5IHN A;  3EFS A;  1YWP A;  3CCL A;  2DET A;  2CH4 W;  2COW A;  2ATC B;  3L2V A;  3H0I A;  4GBQ A;  3CCQ T;  3LGF A;  1SG5 A;  2RPN A;  2M0Y A;  1RAD B;  2O4X B;  2QQ9 A;  1M4Z A;  2EQU A;  1YJN T;  1X6G A;  1I5O B;  4C8Q C;  5KE3 A;  4IIO A;  3UF4 A;  2JS2 A;  1Q86 C;  3SWN A;  2DXC A;  1YIT T;  2CSQ A;  5LL6 S;  2D6F A;  1W2B S;  2C0O A;  2XIC A;  4PJO A;  2R57 A;  1VQO T;  1Y7X A;  3CME Q;  4M78 C;  4JPB W;  4C0G A;  3G1J A;  3H0F A;  2OAU A;  2KSS A;  2A7Y A;  3V7R A;  1N8R U;  4JLG A;  3GF5 A;  3F70 A;  3UWN A;  4PFZ A;  4FW2 A;  4P5N A;  4UC4 A;  2RHZ A;  4M7D A;  1PRL C;  1M90 C;  2EJ9 A;  2MWO A;  3M0P A;  4MML A;  3CCU T;  3OYK A;  2X4X A;  1K1Z A;  4A4H A;  4LDV A;  2LQN A;  5CK9 A;  1KHI A;  1K8A C;  1KD1 R;  2E3I A;  5AT1 B;  3G6E Q;  1UFF A;  1I0C A;  3MPU B;  1ZSZ A;  4PJO F;  1MMG A;  1G83 A;  3MO8 A;  3LWI A;  2CZ1 B;  3EH2 A;  3M5A A;  3LH5 A;  2FL7 A;  1YP5 A;  3M9Q A;  1ZX6 A;  5FRN A;  5GMK i;  1OPL A;  4ZGJ B;  3OYM A;  2B8A A;  2QQS A;  5DLO A;  2RHX A;  2VWF A;  3RUX A;  4RG8 A;  1K9M U;  3OYD A;  2OTL Q;  4E7L A;  2EFI A;  4ZTJ A;  3HRT A;  4B9X A;  4BY6 C;  1VQ5 T;  1X6B A;  2GNC A;  3MJX A;  2H8H A;  4IUV A;  5FWC A;  3CCS T;  3CBO A;  4M4Z A;  1VQ6 A;  5GAN g;  2E64 A;  2FHD A;  2E10 A;  1V29 B;  2MCN A;  3VS4 A;  2ESW A;  3RNJ A;  1U3O A;  1RI0 A;  1VQK T;  2DXB A;  3S3M A;  3OYI A;  1X69 A;  3PE0 A;  2E5Q A;  2M9U A;  4KH0 B;  4J6W A;  3O8V A;  1MGQ A;  4XTU A;  2E1H A;  1IGU A;  3G71 A;  3CQT A;  4A4G A;  3LYI A;  2LCL A;  3L2U A;  4FYY B;  1WYX A;  1WI7 A;  1NBE B;  2OX7 A;  1RAE B;  3LW5 E;  1QVG S;  1TS9 A;  4A4K A;  1C6V X;  2ZPF B;  2E6Z A;  1MMA A;  4HCC A;  3EFO A;  1X27 A;  3PVL A;  3RES A;  3SDZ A;  2ZGW A;  3JB9 H;  5LJ5 h;  1N9S A;  2DXT A;  1MV0 B;  2IG0 A;  1QP2 A;  4EMH A;  3GNG A;  1E6G A;  2NWM A;  4OMF B;  3CCE A;  1FMV A;  3L42 A;  2X4Y A;  2HCK A;  1YI2 A;  4KRT A;  9ATC B;  3OYA A;  4RTW A;  3OBW A;  1WXU A;  4JDS A;  2WSC E;  4MDX A;  2FRW A;  1WX6 A;  2K7A A;  3VS1 A;  2KGT A;  1GBR A;  4PFO A;  3CMA T;  4KGV B;  2JTM A;  2J6K A;  2GF7 A;  2QA4 A;  4ESR A;  2NUP A;  5LJ3 f;  3HFN A;  1EZZ B;  1N9R A;  1R0B G;  4M7A E;  1W2B P;  2DRM A;  2EQK A;  4FT2 A;  3OYJ A;  4R0K A;  2M02 A;  3MEU A;  3I35 A;  4VUB A;  1N8R C;  1BIA A;  2DL3 A;  2XHC A;  3CCL T;  4EMK B;  6AT1 B;  2COZ A;  1UJ0 A;  2V1Q A;  2PTK A;  4OVA A;  5GAM e;  4B6M A;  2CP3 A;  2DYB A;  1M8M A;  3JB9 I;  1V1C A;  2X35 A;  3ZEH A;  5CKF A;  2K9G A;  2D8H A;  3X20 B;  3SD4 A;  5IXB A;  2V26 A;  3UA6 A;  1W2B A;  4BAC A;  1UG1 A;  2GTO A;  4BD3 A;  2FZC B;  3E19 A;  3CCR Q;  3H0H A;  1UGQ B;  2VVK A;  2RK1 A;  4RMO A;  3T9N A;  3CCM A;  1PNJ A;  1N27 A;  1UEB A;  1K9M C;  2HMA A;  2RQU A;  4LDX A;  4Z02 A;  1Y71 A;  2AKK A;  2YRD A;  3PIO A;  1UEC A;  3ME9 A;  1VQ8 Q;  4PJN A;  4MZP A;  1TUG B;  3I56 A;  3I5R A;  5GAO p;  3HRU A;  2PNI A;  3CCQ Q;  2P4T A;  1D1A A;  1EFN A;  2RHY A;  3I55 A;  1WA7 A;  4JLI A;  4Z88 A;  1VQL Q;  2F2W A;  1M2V B;  4OGE A;  1G3T A;  2FO0 A;  5GAO m;  3KFV A;  1TSF A;  2JTF A;  2W0Z A;  3OMG A;  5FRO A;  1QKW A;  2RQT A;  4J9C A;  1RLP C;  1M30 A;  1QVF S;  4J9B A;  2JM9 A;  5GJW B;  3EG9 A;  3BDU A;  1LCK A;  1S1N A;  2R58 A;  4NS5 A;  1VQO Q;  2LJ3 A;  4ZGE B;  1UGV A;  4F7U E;  4DBR A;  3HRS A;  1M8V A;  4M77 C;  2VV5 A;  2RQR A;  1BI1 A;  4IUQ A;  2CSI A;  4J83 A;  2YSQ A;  1QVG P;  2DD5 A;  2DVJ A;  2EQI A;  1AWJ A;  1B34 B;  2F1L A;  2VXF A;  5GAO q;  3CCU Q;  5GAM f;  2LX9 A;  2K5I A;  4M7A A;  2DEU A;  1XOV A;  3VS7 A;  2SRC A;  3A5Z B;  4NL3 A;  2ECZ A;  1PSE A;  1VQN A;  2DF6 A;  3C94 A;  4KUI A;  2EIF A;  3G71 T;  4XTY A;  3CC4 A;  3M0T A;  1ABQ A;  1QVG A;  2DAQ A;  2RO0 A;  2O31 A;  2RI3 A;  2J6F A;  3C0C A;  3G4S Q;  1TXQ A;  2RB6 A;  3BE3 A;  3JCM X;  1AWX A;  1AHJ B;  3JCM W;  2FB7 A;  3A8H B;  4PL6 A;  3VUZ A;  3EGD A;  1MUZ A;  4MZM A;  2YRC A;  1YJN A;  1TOV A;  2KYB A;  2KRO A;  2OTJ A;  2J05 A;  5IT9 E;  3PNW C;  3S6W A;  1LNX A;  2EJF A;  1U1S A;  4AT1 B;  4BB7 A;  5D7U A;  1YIT A;  2JMC A;  3CCE T;  3THK A;  3JB9 G;  1YI2 T;  2AZS A;  4KH1 B;  3M4Y A;  2A36 A;  1H8K A;  3QWY A;  2K6D A;  1H92 A;  1JEG A;  3VKI A;  2P0K A;  2KRM A;  4Y91 A;  5IN1 A;  4PJJ A;  1RAH B;  1Y96 A;  3EGX B;  1GRI A;  2KYM A;  3QII A;  1BI2 A;  2LJ0 A;  4DBF A;  3CXC P;  2KEA A;  1JRI A;  5LJ3 d;  1GCQ A;  2QA4 T;  2CP7 A;  3JSC A;  2WAC A;  1YHQ A;  4FIB A;  1WXT A;  1LPL A;  3QO3 A;  2AT1 B;  3PTA A;  4L5G A;  2EQJ A;  1QKX A;  1YNZ A;  5HK0 A;  2M0O A;  1LJO A;  3ZBD A;  2JM8 A;  5GMK m;  2X4J A;  1IO6 A;  2XK0 A;  4RCC A;  3MHX A;  5D6X A;  2CZ6 B;  4F7U A;  3OSV A;  4BI3 A;  4C5H A;  1EIF A;  1ABO A;  5GJV B;  2K3X A;  2E5K A;  2HD0 A;  4CI0 C;  5GAN 2;  5DY9 A;  1KC8 U;  4J9E A;  2DL5 A;  1JXO A;  1IB8 A;  2SEM A;  3LWH A;  3WVD B;  1UE9 A;  2Y90 A;  3LX7 A;  5CQY A;  3VS3 A;  2QGG A;  2DD4 A;  5GAO n;  2DTI A;  1VQP A;  2LX7 A;  4BUG A;  3TSW A;  4EDU A;  2FVU A;  3CCM T;  2EKH A;  1YCS B;  1IXD A;  1QVF P;  1TH7 A;  4M77 G;  2LC4 A;  2O9V A;  4F7U F;  1YJW Q;  5GAN 5;  5KYX B;  1VQK A;  2ROL A;  5FU6 B;  4A54 A;  2MOX A;  2DIQ A;  4JJN K;  3TU4 K;  1IRX A;  2GFA A;  1MND A;  2JVV A;  1JJ2 P;  3I56 T;  1K73 U;  3UDC A;  1KIK A;  4HCK A;  2LJ1 A;  4QQG A;  2HDA A;  5HCK A;  2P84 A;  1NJI R;  8ATC B;  3URG A;  4M78 D;  1BCM A;  3I55 T;  4QVC A;  2ZCF B;  1YBY A;  3CCJ A;  2OJ2 A;  3MP1 A;  4Y28 E;  3JV3 A;  3TCJ A;  1QVF A;  1Y57 A;  2MI6 A;  1IZ6 A;  1YWO A;  3DKM A;  2YHT A;  4EIK A;  2ABL A;  4PLL A;  1VIE A;  3QJ6 A;  2C0I A;  5CQX A;  3M0U A;  4OML A;  4XQ3 A;  5CR2 A;  2QTX A;  1QP3 A;  4L59 A;  4J9F A;  4OF1 A;  4RTV A;  2YDL A;  1RAI B;  7AT1 B;  4J7I A;  1Q82 U;  1O75 A;  2RI5 A;  3CMA A;  2Z0W A;  1VQ4 T;  2A28 A;  1D0Y A;  2KR3 A;  2YUP A;  4RUG A;  3SWN C;  2HQE A;  2YUQ A;  3CCV A;  4MDW A;  2YXY A;  3EG1 A;  3VJP A;  1VQ9 A;  2C0T A;  3MEV A;  1VQN T;  4PJO C;  3SB2 A;  2EYW A;  5GAM j;  3I5S A;  3CC4 T;  1HYO A;  3LGL A;  1MHN A;  2VXE A;  2L2P A;  3VUB A;  3JCM f;  2H3E B;  2BIV A;  1H3Z A;  4M7D C;  1E6H A;  3JCM V;  4PJM A;  2DK3 A;  5KYW B;  3RMQ A;  2LCS A;  1YJ9 A;  4LDY A;  2L3S A;  4JZ4 A;  3E2U A;  2OTJ T;  3N5B B;  1WPY A;  1RAC B;  2BE9 B;  4OMP A;  3VRY A;  4C8Q B;  1VQ6 Q;  3EHR A;  1B07 A;  1ZSZ C;  2JOY A;  5EG2 A;  4FL6 A;  3P8D A;  2DJQ A;  1Q81 U;  1MMN A;  1WHK A;  3H8Z A;  1G8X A;  3HTR A;  1KC8 C;  2GQV A;  2E12 A;  2YLB A;  4Z8A A;  4M78 B;  1R0C B;  4D8K A;  2DRK A;  1XQH A;  2MAM A;  3AHU A;  3QXE B;  4PJL A;  4X9C A;  1TUC A;  2OI3 A;  2C06 A;  3OYF A;  1GL5 A;  3L2Z A;  1HSQ A;  4L6V 5;  4XK8 E;  2K3Y A;  1NG2 A;  1ZUY A;  5CKD A;  1M3C A;  1UDL A;  1YHQ T;  2CRE A;  3OW2 S;  3IQL A;  2YUN A;  1HD3 A;  2HNI A;  3QWX X;  1FMK A;  2RQW A;  2KE9 A;  4RG2 A;  4FT4 A;  4OGC A;  3V8K A;  3RKX A;  3GP8 A;  1K73 C;  2O4X A;  2KDS A;  3JRZ A;  2CZ7 B;  1ZQ1 A;  4ELZ C;  4C92 C;  3REA B;  4QW2 A;  3DB4 A;  3QUI A;  4C92 B;  1SHF A;  1YI2 Q;  1NEB A;  2WSE E;  4DBH A;  2EGC A;  2FPE A;  2Y4Y A;  4FCY A;  2ENM A;  1Q7Y U;  4BDY A;  2HL3 A;  3A8M B;  4M75 C;  5LJ3 e;  1BK2 A;  2E70 A;  3OS1 A;  4M75 B;  4LXC A;  2F69 A;  4PNO A;  4BY6 B;  1FYN A;  1ZBJ A;  4MMK A;  1OU9 A;  3SHW A;  1VQP T;  3GPL A;  4OMN A;  2B86 A;  1AWW A;  1M1K U;  1OZ2 A;  3BFM A;  3JB9 D;  5D6Y A;  4N4H A;  1UTI A;  3M56 A;  1RUW A;  4E7H A;  2LNV A;  3AT1 B;  3L1A A;  3ULR B;  1NM7 A;  2D0N A;  1Q82 C;  3X24 B;  1AZE A;  4FYX B;  1Q86 R;  2L8D A;  3FJ5 A;  1BI3 A;  1UUE A;  2A08 A;  3CME A;  2YT6 A;  4ORZ A;  2EYZ A;  3CCJ T;  2D9T A;  1PM3 A;  4ZN1 A;  1KC8 R;  2HAX A;  1OYX A;  1SPK A;  1Y07 A;  3VU3 C;  1KG1 A;  4XAX B;  2E6N A;  3C95 A;  2COY A;  2KI7 A;  5A0L A;  2F2V A;  3M55 A;  4HVV A;  4M7D G;  1M90 R;  1QQJ A;  2R5M A;  2KRN A;  5GAN f;  3OYL A;  4C8Q G;  4N4I A;  1K8A R;  3Q1J A;  5CAI A;  4F04 B;  2RI2 A;  2ROT A;  4C5G A;  1VQM T;  2Y4X A;  3QPH A;  1Q81 C;  4JS5 A;  3X25 B;  4M78 G;  2OTL A;  5FLX E;  3CCV T;  4TVR A;  4M77 D;  3D7S B;  1VQ9 T;  4HXJ A;  1LVK A;  2AHJ B;  3NFC A;  3BY7 A;  2DBM A;  3QG1 A;  5IAY A;  3JCM d;  3MCA B;  5IHI A;  2LQW A;  5GAM h;  4OMQ A;  1KQS S;  1V76 A;  2X9H A;  4Y92 A;  4J9G A;  5LJ5 g;  3PGG A;  4PLI A;  3U23 A;  5HKC A;  2JW4 A;  4JUV A;  3OYY A;  3OW2 P;  1YJ9 T;  2EVR A;  2PVO B;  2K2M A;  3G7Z A;  4WTO B;  1AVZ C;  2EAY A;  2FPF A;  2AK5 A;  1B7T A;  4C92 G;  2RQV A;  1PC0 A;  2DPP B;  1U1T A;  3VV0 A;  3KBG A;  5FRM A;  1ZSG A;  1M2O A;  3RDV A;  1W1F A;  4M75 G;  1Q7Y C;  3CD6 A;  1WQ7 A;  2ZPG B;  1QLY A;  3OW2 A;  3CC4 Q;  1QWE A;  5I22 A;  4JJD A;  2L89 A;  2OAW A;  1M1K C;  4OB2 B;  2NUT B;  2CP6 A;  1RAG B;  1N5Z A;  2DER A;  4XU3 A;  4EMK A;  3QHS A;  4N0A A;  4MZT A;  3C4S A;  1S72 A;  4M7A C;  2V8K A;  2DIG A;  1YJN Q;  2ZPB B;  3QDR B;  4OB0 B;  4O5V A;  2CP5 A;  1WIE A;  1YIT Q;  1WLP B;  1A0N B;  4NL2 A;  4F14 A;  4BE0 A;  2HQX A;  1Q81 R;  3PMI A;  4II1 A;  2LT1 A;  2GCX A;  4GY5 A;  2QYZ A;  3WVE B;  4M77 B;  2YWW A;  1N8R R;  5CCA A;  1KK7 A;  3M53 A;  2KY9 A;  1VQ4 A;  4R56 A;  5KYY B;  1YHQ Q;  2D8J A;  3JB9 F;  2MK5 A;  2XDP A;  2HKQ B;  1FMW A;  2VKN A;  4CC7 A;  4J6Y A;  3MEW A;  1ACM B;  4LUD A;  4B9W A;  1PRM C;  2QAS A;  3RKW A;  5CKE A;  4J7F A;  1XJW B;  4AFS C;  3PVQ A;  3INZ A;  3E9F A;  4ATO A;  1D3B B;  2ZAE A;  1M2V A;  4EMG A;  4JRP A;  5I2M A;  4E7I A;  2LTO A;  1VQ7 A;  3P8H A;  2L3R A;  2ED0 A;  3QDF A;  3A8L B;  3EFR A;  3CME T;  5KYU B;  1UJY A;  1RAA B;  3EG3 A;  2V8J A;  4HA8 A;  4D6W A;  1PD1 A;  4JJC A;  1K9M R;  3ZL7 C;  1GCQ C;  3HP9 A;  1VQ5 Q;  4E47 A;  1VQ8 A;  2CUB A;  2DNU A;  3CCS Q;  5KYN A;  2RF0 A;  3S3O A;  4QT7 A;  1ZHI A;  3REB B;  1QMC A;  2EKO A;  2LQ8 A;  1KD1 U;  2HZY A;  3JCM Q;  1JQQ A;  5GAN d;  2D0Q B;  3G6E T;  3OA6 A;  1B34 A;  2AIR B;  1K76 A;  1KQS P;  1VQK Q;  3FJP A;  1KSW A;  1NYF A;  4C0D C;  3NPF A;  4F17 A;  1OUL A;  3DLL A;  3CC7 A;  4N4G A;  3MP6 A;  2CP0 A;  1HK9 A;  2XU8 A;  2YLC A;  2H3J A;  4IIM A;  4BE1 A;  1W6X A;  2DL7 A;  3OYG A;  2JXB A;  2RK2 A;  5L8R E;  4E6R A;  1E7O A;  1PD0 A;  2DL4 A;  3OYB A;  1AEY A;  3ZFJ A;  5GAN j;  1RAB B;  2OTL T;  1NLP C;  2KBT A;  2L3Q A;  2RNA A;  3PT9 A;  4M77 F;  2LCC A;  4J5Y A;  2V8I A;  1QVP A;  2BKD N;  4D8D A;  1LOJ A;  3VS6 A;  3GOX A;  1KQS A;  5IHK A;  2L3P A;  1OV3 A;  1BCO A;  4J6X A;  4YTL A;  4IUU A;  3OS2 A;  4BI8 B;  4FU6 A;  2CYZ B;  5AYF A;  2QEX A;  1MV3 A;  5LJ3 j;  1VYU A;  3M54 A;  3V7C A;  4KUL A;  4KUD K;  4M7A G;  3KXT A;  1WGS A;  2DL8 A;  2W10 A;  2BE7 D;  2LRQ A;  4A4F A;  2PVG B;  1WZO A;  1Y0M A;  2LQK A;  1UHF A;  1UB4 A;  4XTW A;  1PHT A;  3CMA Q;  2NYS A;  1BIB A;  4FSS A;  3PIP A;  1RLQ C;  3EG2 A;  4M7D D;  3JCM h;  3G4S A;  3EGX A;  3CD6 T;  3JCM e;  1VIF A;  1ARK A;  4NOY A;  2EYY A;  1NPP A;  2J6O A;  3JCM c;  5DM7 R;  4DEY A;  1VQ9 Q;  1RL2 A;  4FYW B;  4C8Q D;  4ANJ A;  2BZ8 A;  5CIU A;  2YUO A;  1YFN A;  3J81 E;  1PKS A;  3UA7 A;  2F2X A;  1VA7 A;  1M3B A;  5M9O A;  2EPD A;  2VUB A;  3CCL Q;  2ZPH B;  2P0Q A;  3OQ5 A;  3RER A;  3M59 A;  4RCB A;  4LE9 A;  5J3B A;  3QJY A;  2XI9 A;  2PZ1 A;  5LJ5 d;  1W70 A;  2DZ9 A;  2HSP A;  1S72 T;  1KFZ A;  2I0N A;  2E3H A;  2HL5 C;  4AFQ C;  3JCM b;  5FU7 C;  1K9A A;  1G2B A;  3EH1 A;  1G5V A;  2VB6 A;  2CZ0 B;  5KE2 A;  3VYG A;  2MYS A;  2HQH A;  4O6J A;  2KRS A;  1AT1 B;  3PFS A;  1BKB A;  1I07 A;  4ELY C;  1TUD A;  1P92 A;  3EGU A;  2FG0 A;  3QSU A;  2CS7 A;  1KHC A;  5CKH A;  4CC3 A;  4C8Q E;  1MMD A;  4J9D A;  5EC7 A;  1Z9Q A;  1C0M A;  1NLO C;  1NZ9 A;  2ZZD A;  2CKK A;  1VQM A;  1TU0 B;  4C92 D;  5KYX A;  4LD9 K;  3NTI A;  2RJE A;  4K11 A;  3TVT A;  1GXI E;  1KD1 C;  2DA9 A;  4M78 E;  3LLR A;  4OMO A;  4M75 D;  3SWN B;  4WF2 A;  2LMJ A;  3C12 A;  1K0S A;  8AT1 B;  1IHV A;  2I2L A;  3OB9 A;  2EYX A;  2QAZ A;  3V8L A;  1QCN A;  1OZ3 A;  4PJO B;  3OYC A;  3VRZ A;  1VYV A;  3SFM A;  1K4U S;  3QYH B;  1VQ7 T;  4HCB A;  2AZV A;  2MWP A;  4RTZ A;  4JRQ A;  3CPW S;  5I2S A;  2J06 A;  3EAE A;  3V8J A;  4M7D B;  1GFC A;  1VQ8 T;  3FEO A;  4XTZ A;  3PMT A;  4C92 E;  5IH2 A;  4DEX A;  2K79 A;  2KQW A;  3ER0 A;  1VYT A;  1G3Y A;  4HVW A;  5KCO A;  1TTH B;  1X01 A;  1CKA A;  1ZSZ B;  1VUB A;  4J9H A;  1YIJ A;  2GQI A;  4M75 E;  5D6W A;  2O01 E;  2AKL A;  2O9S A;  1JBM A;  1VQL T;  5GAO l;  1J3T A;  1HXD A;  3RIR A;  2DFU A;  2EWN A;  3JB9 J;  2DX1 A;  1X75 C;  3CC7 T;  2M16 A;  1R8O B;  4DBQ A;  4AMC A;  5GAN 3;  4QQD A;  1SHG A;  1TG0 A;  3G71 Q;  3RR6 A;  3VYH B;  1WHG A;  3V7S A;  3OYH A;  4Q5W A;  4A53 A;  1G3S A;  2JZ2 A;  1D1B A;  2M1H A;  2BZX A;  2DO3 A;  3E9G A;  5GAN h;  1KQ2 A;  2X3X D;  5GAN e;  4HVU A;  4J9I A;  3CC2 A;  4V2S A;  2QEX T;  5GMK j;  1Z9Z A;  4XTV A;  3QZ5 B;  5KYW A;  2GFU A;  4AG2 C;  5C0M A;  3CCE Q;  4C8Q A;  4WCI A;  4A4E A;  1GCP A;  3OYE A;  2CT4 A;  5LJ3 h;  4C0F A;  3A8O B;  3M4G A;  2K5L A;  1MNE A;  3HL8 A;  4ZTF A;  4ZGD B;  5HY6 A;  3M58 A;  2K57 A;  4M78 A;  4DA4 A;  2DTO A;  3A1P A;  2HBP A;  1H64 1;  5J26 A;  4Z89 A;  5KCH A;  4GLM A;  3EFO B;  3G4S T;  4M7D F;  2EBP A;  2QA4 Q;  1UGR B;  2RD1 A;  2IPO B;  4E2F B;  1T0J A;  3L2W A;  3FB9 A;  3TRE A;  2JS0 A;  2XKO C;  3CPF A;  4C8Q F;  2MIO A;  2CP2 A;  2PU9 B;  1ZBX A;  2X4W A;  1SSH A;  2CH4 A;  2P0P A;  5GAN 4;  2YRV A;  1RAF B;  2KNB B;  3O5Z A;  2JT4 A;  2EJG A;  1OU8 A;  2HEQ A;  2QQA A;  5FWB A;  3NTH A;  3FIF A;  1PSF A;  4M78 F;  3WXM B;  1B3Q A;  2LVM A;  5L23 A;  3VS0 A;  4PJO G;  4IUT A;  4C92 A;  1BI0 A;  2DYI A;  1X43 A;  2QTV A;  5IXF A;  5LJ3 g;  1FWZ A;  2NUP B;  4C5I A;  1AWO A;  2PQW A;  2DZC A;  3ASK A;  4M75 A;  1M3A A;  1I8F A;  3CCM Q;  4CRI A;  3GIB A;  3QBY A;  1QW1 A;  3MEA A;  1PG5 B;  1VOM A;  2V1R A;  3CD6 Q;  3H9N A;  4DOW A;  1KJW A;  1WFW A;  3G6E A;  4M7A D;  3OBY A;  4ZNX A;  4AFU C;  5GMK l;  2F5K A;  4IUR A;  3CPW P;  3RBB B;  3M0R A;  2QQB A;  2XID A;  3FRN A;  4C92 F;  5LJ5 e;  1FXX A;  3I56 Q;  1I5L A;  2MF2 A;  1M9S A;  1K73 R;  1IRE B;  2HSE B;  2QG9 B;  4AFZ C;  4PK4 A;  3I55 Q;  1T3L A;  2DBK A;  3TSZ A;  4M75 F;  2G6F X;  4F16 A;  2KAF A;  2RJC A;  2ZPE B;  2A0F B;  1S72 Q;  4E7Z A;  4OMM A;  5DLQ E;  1M1F A;  2VC8 A;  3HPW A;  4J8O A;  2XMF A;  3DB3 A;  3DLM A;  3CPW A;  1M27 C;  2QK0 A;  3M57 A;  4A63 B;  3H41 A;  1GBQ A;  1QCO A;  3NGP A;  3VS5 A;  1PWT A;  4C0Z A;  1OOT A;  4DQ2 A;  1CSK A;  4RTX A;  1YJW T;  3QZ9 B;  2D1X A;  1U5S A;  3RMS A;  2G3R A;  3QKJ A;  2X51 A;  2DJZ A;  2FPD A;  2EQM A;  3JCM J;  4EMK C;  1NJI U;  5GAO r;  2DTH A;  2M51 A;  3S3N A;  4N0A C;  5CO7 A;  3OS0 A;  1Q82 R;  4FSX A;  1VQ4 Q;  3SEM A;  1YIJ T;  1YN8 A;  1X2K A;  3J7A F;  1UHC A;  2WSF E;  4M77 E;  1KQ1 A;  2QGF B;  2LDM A;  5FW9 A;  4RKU E;  4LNP A;  3UAT A;  4ME7 A;  1DJ7 B;  1VQN Q;  3A8G B;  3EG9 B;  3CXC S;  1OEB A;  1WXB A;  4FM4 B;  2NLU A;  2PUK B;  2E65 A;  1WHJ A;  1VQ7 Q;  1AZG B;  1RI9 A;  2DLP A;  1X2Q A;  2RMO A;  1PCX A;  1ZA1 B;  3CBP A;  4PFP A;  3M0S A;  1O9S A;  5ECA A;  5GAM g;  5A2Q E;  2K5F A;  3CC2 T;  1OX8 A;  2LNH B;  4OB3 B;  4M7A B;  5LJ5 f;  2OTJ Q;  5I11 A;  1WDX A;  2FZK B;  3HSB A;  1WHH A;  1I1J A;  3BW1 A;  1QWF A;  5GAN 8;  1NYG A;  1K0X A;  3L2Q A;  2RHI A;  2KVQ G;  3MKD A;  2FRY A;  1M1G A;  2LP5 A; 
#chains in the Genus database with same CATH homology
 2DL8 A;  2W10 A;  1PKT A;  2BZY A;  4CC2 A;  2LCS A;  2GTJ A;  2L3S A;  1X27 A;  3PVL A;  4JZ4 A;  1Y0M A;  2O88 A;  4OMP A;  3VRY A;  2K3B A;  1UHF A;  3EHR A;  1PHT A;  1B07 A;  1MV0 B;  2EGE A;  2DJQ A;  4FSS A;  1E6G A;  1RLQ C;  2NWM A;  3EG2 A;  1H3H A;  2HCK A;  4KRT A;  4RTW A;  1ARK A;  1WXU A;  2EYY A;  2DM1 A;  2J6O A;  2KXC A;  4Z8A A;  4DEY A;  2FRW A;  4D8K A;  2HBW A;  2BZ8 A;  2DRK A;  1WX6 A;  2YUO A;  4CC4 B;  2K7A A;  3VS1 A;  2KGT A;  1TUC A;  1PKS A;  2OI3 A;  3UA7 A;  1GBR A;  2F2X A;  1VA7 A;  1M3B A;  4JJB A;  1GL5 A;  2EPD A;  1HSQ A;  2J6K A;  1SEM A;  2CT3 A;  1NG2 A;  1ZUY A;  1M3C A;  1UDL A;  2CRE A;  4LUE A;  4ESR A;  3IQL A;  4LE9 A;  2FEI A;  2YUN A;  1HD3 A;  3QWX X;  2PZ1 A;  1FMK A;  2DRM A;  2RQW A;  2KE9 A;  1W70 A;  2HSP A;  2JTE A;  4R0K A;  1KFZ A;  4RTY A;  2I0N A;  3I35 A;  4AFQ C;  2DL3 A;  1K9A A;  1G2B A;  1ZUU A;  3REA B;  3M0Q A;  2KRS A;  1UJ0 A;  2V1Q A;  2PTK A;  1I07 A;  1QCF A;  1SHF A;  4RTT A;  1NEB A;  4JZ3 A;  2EGC A;  2FPE A;  1TUD A;  3EGU A;  2DYB A;  2ENM A;  2FG0 A;  4RTU A;  1M8M A;  1SRL A;  4CC3 A;  1V1C A;  1BK2 A;  2CUD A;  2K9G A;  2D8H A;  2EGA A;  4J9D A;  5EC7 A;  5IXB A;  1FYN A;  1ZBJ A;  1Z9Q A;  3UA6 A;  1NLO C;  1UG1 A;  3SHW A;  2GTO A;  4OMN A;  2B86 A;  1AWW A;  3H0H A;  4K11 A;  2VVK A;  3TVT A;  2DA9 A;  1PNJ A;  2KT1 A;  2CDT A;  4OMO A;  1UTI A;  2RQU A;  2LMJ A;  2RN8 A;  1K0S A;  1RUW A;  1NEG A;  2AKK A;  1UEC A;  2A37 A;  2EYX A;  4AG1 C;  3A98 A;  2JMA A;  3ULR B;  1NM7 A;  2D0N A;  1AZE A;  3VRZ A;  1VYV A;  1U06 A;  1K4U S;  2BTT A;  3I5R A;  3NMZ C;  2AZV A;  2DIL A;  3FJ5 A;  4RTZ A;  2PNI A;  1UUE A;  1EFN A;  2A08 A;  1WA7 A;  2YT6 A;  4Z88 A;  4ORZ A;  2EYZ A;  3VS2 A;  2GBQ A;  3EHQ A;  2J06 A;  2F2W A;  1GFC A;  4X1V A;  2FO0 A;  3KFV A;  1JO8 A;  2W0Z A;  1SPK A;  1QKW A;  2RQT A;  4J9C A;  5IH2 A;  4DEX A;  1RLP C;  1M30 A;  2K79 A;  4HVW A;  1VYT A;  2F2V A;  4J9B A;  2JM9 A;  1CKA A;  5GJW B;  4HVV A;  4J9H A;  2X3W D;  1LCK A;  1S1N A;  2GQI A;  2LJ3 A;  1UGV A;  1SRM A;  2AKL A;  2O9S A;  1GFD A;  1J3T A;  1BB9 A;  2KRN A;  2GGR A;  2DX1 A;  2RQR A;  2O2O A;  1AOJ A;  2CSI A;  2ROT A;  2YSQ A;  1SHG A;  1TG0 A;  2DVJ A;  2EQI A;  1CKB A;  2LZ6 B;  1AWJ A;  2EW3 A;  3R6N A;  1XOV A;  3VS7 A;  2SRC A;  3NHN A;  1JU5 C;  2ECZ A;  1HJD A;  4HXJ A;  2BZX A;  2X3X D;  2DF6 A;  4HVU A;  4J9I A;  2J7I A;  2IIM A;  2DBM A;  3M0T A;  1Z9Z A;  1ABQ A;  4AG2 C;  5IHI A;  2O31 A;  1T3S A;  2LQW A;  2NUZ A;  4OMQ A;  2J6F A;  1OPK A;  3C0C A;  4Y92 A;  4J9G A;  4WCI A;  1GCP A;  2KXD A;  1AWX A;  2QDL A;  2CT4 A;  3U23 A;  2JW4 A;  1ZUK A;  2L0A A;  1MUZ A;  2EVR A;  2K2M A;  2KYB A;  2KRO A;  1AVZ C;  2FPF A;  2AK5 A;  2RQV A;  2J05 A;  2KT8 A;  4Z89 A;  4GLM A;  2JMC A;  3THK A;  2EBP A;  1ZSG A;  2AZS A;  2A36 A;  1H8K A;  3QWY A;  1W1F A;  3EG0 A;  1T0J A;  2JS0 A;  2K6D A;  1H92 A;  1JEG A;  2KRM A;  2MIO A;  1SSH A;  2CH4 A;  1QLY A;  2KNB B;  3O5Z A;  1QWE A;  5I22 A;  2JT4 A;  4JJD A;  1GRI A;  2KYM A;  2DMO A;  1BBZ A;  2HEQ A;  1BU1 A;  2OAW A;  2LJ0 A;  5FWB A;  1JXM A;  2KEA A;  1GCQ A;  2P4R A;  1B3Q A;  1WXT A;  1N5Z A;  2ED1 A;  3GBQ A;  1T0H A;  5L23 A;  3VS0 A;  3I9Q A;  1QKX A;  1YNZ A;  2DE0 X;  1X43 A;  4LN2 A;  1AD5 A;  5IXF A;  1ZLM A;  5IHN A;  2JM8 A;  1IO6 A;  1YWP A;  1AWO A;  2CH4 W;  1WIE A;  1M3A A;  3H0I A;  4GBQ A;  1WLP B;  1A0N B;  4F14 A;  1ABO A;  5GJV B;  2V1R A;  2E5K A;  2RPN A;  1KJW A;  1WFW A;  2M0Y A;  4J9E A;  2DL5 A;  1JXO A;  4ZNX A;  4AFU C;  2SEM A;  1UE9 A;  1X6G A;  3RBB B;  3VS3 A;  3M0R A;  4IIO A;  3UF4 A;  2JS2 A;  2LX7 A;  3TSW A;  2CSQ A;  2EKH A;  1YCS B;  2C0O A;  4AFZ C;  1T3L A;  2VKN A;  2DBK A;  3TSZ A;  4CC7 A;  4JPB W;  2O9V A;  4LUD A;  2G6F X;  4F16 A;  1PRM C;  3H0F A;  2ROL A;  4OMM A;  2MOX A;  4AFS C;  3PVQ A;  2XMF A;  1M27 C;  1PRL C;  4A63 B;  3H41 A;  1GBQ A;  4HCK A;  1KIK A;  2LJ1 A;  3NGP A;  2ED0 A;  3M0P A;  3VS5 A;  2HDA A;  5HCK A;  1K1Z A;  1PWT A;  1OOT A;  2LQN A;  1CSK A;  1UJY A;  4RTX A;  3EG3 A;  1UFF A;  2OJ2 A;  2D1X A;  1I0C A;  4JJC A;  1U5S A;  3ZL7 C;  3JV3 A;  1GCQ C;  1G83 A;  1Y57 A;  2CUB A;  2FPD A;  2DNU A;  1YWO A;  3LH5 A;  1YP5 A;  1ZX6 A;  4EIK A;  2M51 A;  2RF0 A;  1OPL A;  2ABL A;  4QT7 A;  3REB B;  2C0I A;  3SEM A;  2VWF A;  3M0U A;  1YN8 A;  1X2K A;  1JQQ A;  4OML A;  1UHC A;  1K76 A;  5FW9 A;  4J9F A;  1KSW A;  1X6B A;  2GNC A;  4LNP A;  3UAT A;  2H8H A;  4RTV A;  1NYF A;  3NPF A;  4F17 A;  2YDL A;  5FWC A;  1OEB A;  1WXB A;  4M4Z A;  4IIM A;  1W6X A;  2DL7 A;  2JXB A;  4E6R A;  1E7O A;  1AZG B;  2MCN A;  3VS4 A;  1RI9 A;  2DL4 A;  1AEY A;  2ESW A;  2A28 A;  3RNJ A;  2KR3 A;  2YUP A;  4RUG A;  1NLP C;  2DLP A;  1X2Q A;  1U3O A;  2KBT A;  2L3Q A;  2YUQ A;  2RNA A;  2RMO A;  3M0S A;  3EG1 A;  2C0T A;  5ECA A;  1X69 A;  4D8D A;  3PE0 A;  3VS6 A;  2LNH B;  5IHK A;  2EYW A;  2L3P A;  1OV3 A;  3I5S A;  5I11 A;  1WDX A;  3CQT A;  1MV3 A;  2L2P A;  1I1J A;  1VYU A;  1QWF A;  1WYX A;  1NYG A;  1K0X A;  1WI7 A;  2FRY A;  1E6H A;  2D8J A;  2LP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...