4M7AD

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 14
structure length 74
sequence length 74
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aD00
4C8QA 1WNLA 5I21A 5GMKe 4M78B 4NL2A 1Y96B 3JB9D 3RKXA 1JBMA 4RCCA 2DXTA 1D3BB 4X9CA 3JCMQ 4RCBA 3JB9F 4M7DA 4XTZA 4V2SA 4C92G 4XTVA 5GAMg 3JCMJ 4XQ3A 3JB9I 2VXEA 5GANg 4M77D 2FB7A 4M78E 4HT8A 4M78C 5LJ5h 5LJ3h 4M7AD 2RD1A 4EMKA 5GAMf 3GIBA 3V8KA 3HSBA 4F7UA 4PJOA 4M77F 1LOJA 4MMKA 4MMLA 1KQ1A 4XTXA 1WQWA 4M75A 5GAN6 5GMKj 3JB9J 3BDUA 3PGGA 5GMKm 3SWNB 5GMKi 2E41A 3V8LA 1X01A 4M7AB 4X9DA 3JCMf 3RERA 1N9RA 3VU3C 2EJFA 4M75F 3EFSA 1TH7A 4C8QD 3JCMW 3BFMA 2YHTA 4QVDA 3QSUA 1WPYA 4C92A 1JRIA 3QHSA 1M5Q1 2E65A 2DKGA 4M78A 3SWNC 5LJ3e 4C8QF 4N0AA 5LJ5e 1M8VA 4M7AE 4NOYA 4M78G 4M7AC 4M7DD 1D3BA 1B34A 1H641 2DTHA 4J5YA 2HNIA 2QTXA 4C8QB 4C92F 3BY7A 5GAN2 2EAYA 5GMKl 5GAN7 4M7DF 2YLBA 5LJ5d 2DXUA 2VXFA 5LJ3d 5GAOq 4EMHA 2Y90A 4M7AG 4JRIA 4PJOD 3JCMg 4XTUA 1LJOA 4M77B 1KQ2A 4M7DB 3EFRA 3QUIA 4M75D 5GANe 4PNOA 4F7UF 3JCMc 4PJOF 4C8QC 2FYKA 4HA8A 5LJ5j 1LNXA 3QO3A 5LJ3j 3SWNA 5GAMh 2JN0A 4XU3A 5GANh 3RESA 3AHUA 4QVCA 2DEQA 4A54A 2EJ9A 4F7UB 3FJPA 3FIFA 4PJOB 4EMGA 1N9SA 4Y91A 4M77E 5GANd 4M75B 2DJZA 2DVEA 4M77C 1Y96A 3L2ZA 2CGHA 3SB2A 4XU2A 4XU0A 4C92D 4A53A 4M78D 3RKYA 4J6WA 3RUXA 3JCMh 1YCYA 2YLCA 3HFOA 3RIRA 5GAOp 5GAOn 4XTYA 3V7SA 2VC8A 5LJ5g 4M7DC 4M78F 4XTWA 5GAN8 2E1HA 4NL3A 2RB6A 1I5LA 5GANj 4HT9A 4PJOC 3HFNA 2RM4A 2DTOA 3INZA 4M75E 2I2LA 4JRKA 4M75C 4C92B 5LJ5f 5LJ3f 3L1AA 2RA2A 5GAN5 1BIAA 5GAMe 2EWNA 3JB9G 4C8QG 3JCMb 3RKWA 3JCMV 1U1TA 2DZCA 1I8FA 4C8QE 2E10A 5GMKh 1B34B 2K57A 5GAN3 4WF2A 3JB9H 4EMKB 4M77A 2E64A 2ZGWA 3M4GA 3JCMX 4M7AA 1I4K1 5GAMd 4M77G 3V7RA 4C92E 4M7DG 2EJGA 4C92C 1WQ7A 4J6XA 4DQ2A 3JCMe 1U1SA 3V8JA 4M7DE 4JLIA 4JUVA 1I81A 4N0AC 1BIBA 2DZ9A 4J6YA 5CAIA 5GANf 2DTIA 5GAOl 1HK9A 5GAN4 3BW1A 4F7UG 5DY9A 1HXDA 3FB9A 4PJOG 4XU1A 4EMKC 3JCMP 4M7AF 4F7UE 5GAMj 5LJ3g 5GAOr 4PJOE 3JCMd 5GAOm 4M75G 4OP0A 1MGQA 3V7CA
chains in the Genus database with same CATH superfamily
3CD6T 1ZSGA 2QA4Q 3TCJA 2K79A 3CCLQ 4Y92A 1PCXA 1HYOA 1DJ7B 2K9GA 1R0BG 3GIBA 2E6NA 2LX7A 3V8KA 5CR2A 3HSBA 4R56A 2ZAEA 1UTIA 3M57A 2E41A 1JU5C 2DLPA 3CXCP 5EC7A 2CP0A 2CKKA 2O9SA 1N6AA 2YHTA 4E6RA 1JJ2S 1VQKA 2VVKA 1M8VA 3MPUB 5I22A 3HTRA 4M78G 1SSHA 1UJYA 2J6KA 1Q7YC 2EVRA 5FLXE 3OW2P 3CC4A 2DNUA 4MDXA 4RG8A 2HKNA 1YNZA 4N4IA 1FX7A 4QQGA 2DXBA 2EQKA 2NUZA 2F2WA 3QO3A 3VS4A 2OJ2A 3CC2Q 3NGPA 3MP1A 5L23A 1IRXA 1LCKA 2DVEA 2CYZB 3OSVA 2EYYA 3A8HB 4Z8AA 4ZTJA 3VUBA 2G3RA 1Z9ZA 1ACMB 1QLYA 5IHNA 1VQ6A 1OX8A 1LPLA 2QA4T 2I2LA 4RTYA 5GAN5 2W0ZA 2GTJA 2ED1A 1Y0MA 1WJQA 2K7AA 3EFOB 3VS0A 1T0JA 3CCQA 1R77A 1B3QA 1I5OB 1IHVA 2B8AA 4DOVA 3P8HA 2FZKB 1VQ4Q 1YIJQ 3KUFA 2DZ9A 1IB8A 3HRUA 1WXUA 3UA6A 4NS5A 4EIKA 4M75G 3PTAA 2KGTA 2QQRA 4CI0C 1JBMA 1OEBA 1N8RR 4RCBA 1FWZA 2OTJA 5KH6A 2L3SA 4RTUA 2QTVA 5DM7R 4OB1B 3OS1A 2O4XB 2QG9B 4EMKA 1PSEA 3EGDB 3OYFA 3CD6A 4PJOA 2BTTA 3RR6A 3CC2T 3EH1A 3CPWP 2RH2A 2QAZA 5I2MA 2EQIA 2EJFA 4PFOA 1QMCA 1S1NA 4CC7A 3BFMA 2DO3A 1VQPQ 1U5SA 1KK7A 1M90R 1MMDA 1RACB 2LP5A 4M7AC 3OW2A 4A4KA 3CCUQ 2CZ6B 2EAYA 3TSZA 5GAN7 1UE9A 4F04B 5I2SA 4PJOD 3QXEB 1QP3A 4FL6A 4PJJA 3L2WA 2GQIA 5D6XA 4PJOF 4ZGDB 4HA8A 1VQ4T 2WSEE 1RAIB 4ANJA 5LJ3j 3RESA 2HQXA 3FJPA 2P0QA 2VKNA 2YXYA 2QGFB 2LQ8A 2C0TA 1QVGA 1HJDA 1OPKA 3VRYA 1QKXA 1TUGB 4FYXB 4IUVA 4XTWA 1FMWA 4FSXA 5A2QE 3I9QA 4F17A 3GNGA 2MIOA 1NM7A 3INZA 2EWNA 2VYTA 2K3BA 3ZFJA 3HL8A 3JB9H 2MMPA 1WIEA 3JRZA 3PIOA 2PVGB 1W6XA 2M1HA 2QA4A 3OMGA 1WI7A 5GANf 2QK0A 3M54A 4QW2A 3UDCA 4F7UE 5GAMj 1AT1B 2XU8A 1JXOA 3UF4A 4C8QA 3UWNA 5GMKe 3SDZA 4JJDA 2DILA 4X9CA 3CCUT 2MAMA 3TQ7P 2GBQA 3MEUA 1GCQA 1K0XA 3L2RA 5CIUA 3CPWA 3MP8A 3LGLA 3NPFA 1WX6A 1BI3A 4RTXA 2K2MA 3GLXA 1NZ9A 3QZ5B 3G71T 1SHFA 3MEWA 3EFSA 2PUOB 4C8QD 3CCJT 2LT4A 1R0CB 1WPYA 2FZGB 4M78A 1QCFA 4C8QF 5FROA 4RUGA 1VQ5Q 3QDFA 3OYDA 5LJ5d 2F5KA 4JRIA 1W4SA 2J05A 4M77B 4QQ6A 1W70A 1SF9A 2FYKA 3CCSQ 4HVWA 1T0HA 2LJ0A 2QQBA 2JM9A 1KSWA 2MOXA 1UHCA 4PJOB 1Y07A 3CBMA 4M77E 4FCYA 3UATA 2JM8A 3L2ZA 2QXFA 3OYMA 4M78D 2H8HA 2IPOB 3RKYA 3OSSC 2DE0X 1PD1A 4M78F 1VQ4A 5GJWB 2CH4A 2LMJA 4C5IA 1QVFS 3G4ST 2HDAA 2LNVA 2EYWA 2YDLA 1KG1A 2YUPA 1TTHB 2LCCA 4JLIA 2C0OA 3QWYA 2KR3A 2DM1A 4WTOB 1W2BP 2JTEA 2KNBB 1S72A 3EAEA 1MGQA 5J3BA 2DF6A 1MMNA 3DLLA 1RL2A 1RABB 4QKUA 4R0KA 3JCMQ 1VQ5T 5FU6C 4XTZA 3SEMA 4C92G 4OMMA 3EG2A 2D9TA 2ATCB 2F2XA 2FRWA 1OOTA 3A98A 1K1ZA 1LOJA 3IQLA 1AWWA 2KT1A 1BCMA 4KGZB 4ZGJB 3CCUA 2DBMA 2AK5A 2KXDA 2J7IA 2EGCA 2KYBA 4C0DC 4M75F 4OF1A 3QSUA 3M0QA 1M5Q1 2JMAA 3VKIA 1E6HA 2CP6A 3OYCA 1QVPA 2ABLA 1ZBXA 1BI2A 4C8QB 1GXIE 3REBB 3M0TA 3FEOA 5GMKl 2RHZA 3G71A 4BUGA 2ZPGB 4BDZA 4LD9K 1VYUA 3CCJA 4F16A 1WLPB 4JZ4A 2A28A 4IUQA 1BKBA 1K73U 1RLQC 3SWNA 3LH5A 4XU3A 3PNWC 4A54A 3M5AA 2BIVA 2YRVA 2DJZA 4M7DC 1YFNA 2KI7A 3M58A 2C06A 3LLRA 4LE9A 5CQXA 2E1HA 2RB6A 1WFWA 3THKA 3R6NA 5LJ3f 4JRQA 2DRKA 1BIAA 3NHNA 1OV3A 2K57A 4LXCA 4M7AA 3O5ZA 1YJ9Q 1NJIU 3VJPA 2EJGA 1W2BA 1KD1U 1UHFA 1ABQA 2HSPA 4ZTFA 1KFZA 4RTTA 1Y7XA 2RI3A 3G1JA 1W1FA 2PQWA 4LD6A 4C5HA 2O01E 5GAN4 4F7UG 3JCMP 4EMKC 3G4SA 1CSKA 2PVOB 4J9CA 4OGEA 3DB4A 1K73C 2E3IA 1AVZC 2DXTA 2CUBA 4PJMA 4A4FA 3EG0A 4M7AD 5GAMf 1M4ZA 1RAFB 3PMIA 4FYYB 1KQ1A 3OS0A 1WQWA 2LJ3A 4AFSC 5GMKi 1VQ5A 1JB0E 4X9DA 4DBQA 4D6WA 3TREA 4ELZC 2CZ0B 2CSIA 4GY5A 1IGQA 2LQNA 4PFZA 4Q5WA 3EGUA 3H0HA 1YJ9T 2OTJQ 4E7LA 4MDWA 3QZ9B 2DIGA 1V1CA 2K6DA 3BDLA 4Y91A 3GP8A 1M1GA 1Y96A 4BE2A 2K5LA 4N4GA 3HFOA 1C1AA 1D0ZA 1Q81U 2LCLA 4HXJA 3JCMV 1YJWA 2DZCA 2HD0A 2BE7D 1NLOC 1K9MC 2COZA 2M0YA 1QW1A 5KYUA 1RAAB 4ZN1A 4J7FA 1BIBA 4DBRA 1NYGA 1Q95G 2NYSA 5HY6A 4DEXA 4XU1A 3MHXA 4OB3B 3H0FA 4XAXB 1H92A 1PM3A 4OP0A 1M2VA 2GF7A 2WSFE 1GCPA 2D8JA 3V7CA 5I21A 1ZUKA 1TOVA 3QIIA 2XD0A 3OYYA 1UG1A 2MYSA 3A1PA 4HT8A 4M78C 5LJ3h 2DYIA 4QVZA 2VWFA 4E2FB 3CC7Q 2JS0A 1Q7YU 2WSCE 1YJNA 3J7AF 2OTJT 3CCRQ 1Q81C 2KROA 1GBQA 2RF0A 4M7AB 3VS3A 2EQJA 3TVTA 2GFUA 4ME7A 2Z0WA 3QHSA 2DKGA 1RAEB 2V8JA 2ZPFB 4M7AE 2EKOA 4ORZA 1M30A 4J5YA 4C92F 4MZPA 2EW3A 4Z88A 2DXUA 1RI0A 2Y90A 1GL5A 4CC4B 3QUIA 4BE1A 4Y28E 1XJWB 4EDUA 5C6SA 2I0NA 5LJ5j 5GAMh 2KDSA 1UEBA 1YBYA 2X4YA 2JN0A 3OYKA 1K73R 2EQMA 3MEAA 2M9UA 3KXTA 8AT1B 4JJCA 2GGRA 2DERA 3C94A 4XK8E 1YJ9A 2VC8A 2XDPA 1I07A 1X2KA 3MEVA 1CKBA 1MUZA 2RM4A 3EGXA 3HRSA 4M75C 4KBMB 1BB9A 1NBEB 2F5TX 4KH1B 3CC7T 3E19A 5CVIA 4AT1B 4KH0B 3CCRT 2CP2A 3JCMe 4E7IA 2HQEA 4JUVA 1I81A 2HZYA 1GRIA 1NJIR 2ECZA 4AG1C 1KD1R 1QVGP 2DETA 5DY9A 1ZX6A 1G5VA 2CP3A 4J9EA 3FC3A 3M53A 2X3WD 3NMZC 1KHIA 3H9NA 2V1QA 4RTWA 1I0CA 1Y96B 4WCIA 2AKLA 2DMOA 2E12A 1UGSB 2BZXA 4RTVA 4M7DA 2MK5A 4XTVA 3QPHA 2HL5C 4O6JA 3I56T 3OY9A 1M3BA 2LDMA 2RQUA 4XTXA 8ATCB 3SHWA 5KYUB 4P5NA 2ROTA 2NUTA 2YWWA 4A63B 5FRMA 2D8HA 4E7JA 3L2VA 4J8OA 3I55Q 3O8VA 1K9MR 3SWNC 4NOYA 1S72Q 4M7DD 1JJ2P 1GFCA 1NEBA 2FPDA 3OA6A 4RKUE 3BY7A 4M7DF 1EZZB 3C95A 3EG1A 3ULRB 3ZEHA 5FW9A 4CC2A 4PNOA 2DXCA 2AZVA 4C5GA 5FWBA 2A37A 1MHNA 1D1AA 1AHJB 1YCSB 4ZGEB 4IUUA 4XU2A 3M0SA 2CT4A 2RJFA 3DB3A 2F2VA 1XQHA 2DVJA 1YCYA 5GAOn 4ELYC 1M8MA 2L3QA 1IZ6A 1LVKA 5GAN8 1KJWA 4NL3A 2QI2A 1K76A 1Q81R 2JTMA 1WHHA 1PD0A 3VYGA 3VS1A 2E10A 4L5GA 2JNGA 4B6MA 2VGMA 2CT3A 1KQSS 3OBYA 3G71Q 1U1SA 3UT1A 3V8JA 4IKFA 3HRTA 2SEMA 3CCJQ 2NLUA 1OI1A 1SKUB 1HK9A 2GFAA 2PZ1A 4K11A 1UUEA 2A0FB 5FU6B 4A4EA 1VQ7A 3S6WA 2HQHA 3CC7A 1OU8A 1G3YA 1B7TA 3OS5A 3P8BB 3I55T 4AG2C 3CCRA 4BD3A 1S72T 2ZCFB 1WZOA 1ZQ1A 1V76A 4JRPA 1AWXA 2P4RA 1EIFA 4UC4A 3VUZA 3EGXB 3REAB 2SRCA 2KVQG 2NWMA 4C0DB 1JEGA 3RBBB 1AWJA 1Q7YR 5KYWA 2EIFA 3PGGA 2DL8A 1N5ZA 1AZGB 4IURA 2M51A 2XI9A 3X28B 4AFQC 1VQ8T 2YUOA 2RMOA 1OULA 3I56A 1JJ2A 1VYTA 2CSQA 3FDRA 2K5IA 3PMTA 2COYA 3G4SQ 2JXBA 2HEQA 1PRMC 2IG0A 1TU0B 1QP2A 2WACA 4M7DB 4J83A 2KXCA 1VQMQ 1TS9A 1UDLA 3CBPA 2W10A 1LNXA 3P8DA 1WHMA 1VQOA 5D6YA 1WHLA 2XMFA 3T9NA 4PLLA 1M3CA 2GCXA 4VUBA 3D7SB 2ED0A 1YN8A 4XU0A 4DBFA 1X2QA 3CCMQ 1MMGA 2KT8A 2IVWA 1KQSP 4DBHA 3A8MB 1Q86U 1VOMA 4Z02A 5LJ5f 1ZBJA 3LW5E 1H8KA 3BE3A 4OMNA 5J39A 2OTLA 1IO6A 3JV3A 4EMKB 3F70A 1M3AA 2CH4W 4C92C 2CREA 4J6XA 4PKCC 2DAQA 4N0AC 1K4US 2DTIA 3RNJA 1C6VX 1TG0A 1QCOA 4PJOE 1UB4A 3UPUA 3QJYA 2EBPA 1YP5A 3FJ5A 3E9FA 1X6GA 3KBGA 4DOWA 3AT1B 2M16A 1BCOA 2HAXA 1M9SA 2F1LA 1QQJA 1NEGA 3G6EA 2KMTA 3I55A 1VQMT 1Q86C 3HHTB 4M75A 5GMKj 1YJWQ 3BDUA 2AIRB 1X01A 3I5SA 4ATOA 6AT1B 2G6FX 2O2OA 3CCMT 3S3OA 4IUPA 1HD3A 3H6ZA 1VQNQ 2O9VA 3OS2A 4J9BA 2EGEA 2YUNA 2CP5A 1D3BA 2JT4A 2YRCA 1PC0A 4BY6C 1VQ8A 1X27A 4RG2A 4C0GA 1M2OA 4XTUA 1PRLC 3MO8A 5KCHA 4M75D 2FG0A 2MCNA 1HSQA 4N4HA 2DK3A 2GQVA 1TSFA 5GANh 1XOVA 2EJ9A 2K3XA 1YJNQ 1N9SA 4C5EA 5KYWB 3LH0A 4L6V5 1KQSA 2E70A 1BYMA 1WA7A 2RJEA 4KRTA 3RIRA 3V7SA 4HT9A 1PNJA 4JRKA 3PVLA 4IIOA 2X4XA 3LX7A 4OMQA 2RQVA 1V29B 4OMFB 3X25B 1I8FA 4C8QE 5J26A 3RDVA 5GAN3 2DA9A 2E64A 2ZGWA 3A8OB 1QVFP 2DBKA 3H0IA 4FT4A 3VS6A 1YJWT 2XDBA 2KSSA 1RLPC 1PSFA 4J9FA 1WXBA 3FLGA 2FPFA 4JJBA 1ZSZC 1VQLA 3JCMd 1IXDA 1VQNT 3JCMb 4KGVB 4M78B 1RADB 3M0RA 1ZA2B 1PKSA 1J3TA 4LDWA 3EG9A 2P4TA 5KCOA 4KULA 4XQ3A 2MPXC 4M78E 4AFZC 5LJ5h 2JMCA 2HBWA 4J9IA 5IT9E 2PNIA 5FU7C 4J7IA 5CCAA 1WYXA 1YJNT 1NLPC 3QYHB 3TU4K 2LTOA 1VQ9Q 2CZ1B 3WXMB 1D0YA 2DRMA 4C0FA 2QYZA 3RMQA 5IHKA 3OYIA 2F69A 1ZUUA 2RK2A 1AEYA 2D0NA 1FMKA 1VQMA 1AZEA 2BUDA 2X9HA 1SPKA 4HVUA 4OMLA 5GAOq 4EMHA 4HCZA 3CCMA 3VV0A 2RO0A 1U8RA 2VB6A 2OAUA 5GANe 1D1BA 1QWEA 2VASA 1VIFA 2RHXA 3AHUA 1K9MU 2FHDA 3MJXA 2E5QA 4M75B 2V1RA 4LDUA 3CCVA 4BACA 2M0OA 3DKMA 1NPPA 1R8OB 3OYLA 4XTYA 2A3LA 2FEIA 1Q82C 3PFSA 1I5LA 4IUTA 4BI3A 1K8AC 4M75E 2A36A 1Q86R 3VS7A 4FYVB 4FIBA 5I11A 4HCBA 1QVFA 1ABOA 2GTOA 2LQKA 1H3ZA 3RMSA 4M77G 2JVVA 4DQ2A 3OYHA 4E7ZA 2JS2A 2A08A 1SHGA 1HXDA 2KEAA 3EHQA 4PJOG 5IH2A 5KYNA 1VQ9T 1XNIA 2FL7A 3JCMW 1WNLA 4NL2A 4AFUC 4PJLA 4RCCA 5CK9A 3OBWA 4BDYA 2LT1A 2X3XD 1WDXA 4V2SA 3C12A 3EG3A 1PKTA 3M55A 2IIMA 2LRQA 3CEYA 3LWIA 1G2BA 1VQNA 1Y57A 3ASKA 3EHRA 3CXCS 3JB9J 5FRNA 1UGQB 1UJ0A 3SWNB 3C0CA 2K2VA 2DL7A 2QGGA 4LUDA 2JJ9A 4C92A 2FVUA 4N0AA 3OW2S 1G83A 2QDYB 1VQ7Q 1YWPA 1B07A 4J9DA 1VIEA 4GLMA 3U23A 3LWHA 3CMAQ 1C0MA 4JPBW 2O4XA 1WHJA 4ZNXA 3EG9B 3JCMg 1UGVA 3GBQA 2J6FA 3QDRB 3QKJA 2HBPA 4DA4A 2LC4A 1N27A 1SRMA 1M90C 1AWOA 2H3EB 1ZHIA 2LZ6B 3MKDA 4B9WA 3FIFA 4EMGA 2H3JA 2DFUA 2LX9A 1QKWA 4C92D 2ZPBB 2XG8D 5GAOp 4ZN3A 3CMEQ 4DEYA 1SEMA 1WHKA 2PVDB 1BK2A 3I56Q 4C8QG 2RHIA 4AMCA 5ECAA 2CP7A 4KT0E 1MNEA 2DYBA 4PFPA 5KE2A 2ZZDA 3JCMX 1I4K1 1ZUYA 2KE9A 4JLGA 2KAFA 2DL4A 4FT2A 1FMVA 2P0KA 3CPFA 2RK1A 5GAOr 5GAOm 2FO0A 5CQYA 1VQOQ 4PLIA 3META 1PWTA 3CBOA 1VQ7T 2KBTA 2R5AA 2PUKB 1M27C 2YUQA 1X69A 4CC3A 1M1KU 5GAMg 1XTDA 3JCMJ 3CMAT 1VQ9A 2KYMA 3CPWS 1NG2A 1SRLA 1O9SA 4F7UA 5KYXA 1OX9A 4Z89A 2NUPA 1G3TA 2ENMA 5IXBA 1G3WA 2CZ7B 3V8LA 1Q82R 2OTLQ 2CUDA 3RERA 2RI2A 1K8AR 1ZA1B 2KY9A 1TH7A 5IN1A 1MV3A 2DL3A 4C0ZA 2FZCB 4EPCA 3N5BB 1JRIA 5LJ3e 5A0LA 2VUBA 3CMET 2RHUA 4JZ3A 2A7YA 1ZSZA 5CKHA 2L2PA 4OB2B 2HKQB 2B86A 2MF2A 5DLOA 3CCLT 1KQ2A 4F7UF 4LNPA 1M1KC 3G6EQ 2EQUA 1GFDA 2CGHA 2X4JA 2QDLA 1M2VB 2AHJB 3A8LB 1VQOT 1OZ3A 4KUIA 4R55A 3HFNA 4FSSA 4C92B 3CCEQ 1UGRB 2XK0A 5GAMe 4D8DA 1TXQA 1JQQA 1ARKA 2J6OA 5GMKh 4LN2A 3ER0A 4WF2A 4QQDA 2LVMA 4M77A 4JS5A 1BI1A 4C92E 1WQ7A 2RJDA 1VQ8Q 4IIMA 1G8XA 3S3MA 3JSCA 2OTLT 2JUFA 5GAOl 3BW1A 3FB9A 4HKEA 2DEUA 3CXCA 2RJCA 2HCKA 4A4GA 1YI2Q 2HSEB 3OYBA 5D6WA 1VA7A 2JZ2A 3E1SA 1X6BA 2BZYA 3MCAB 2M02A 2VXEA 3QJ6A 4M77D 3LGFA 1OYXA 1WXTA 1AD5A 4M77F 4FW1A 5GAN6 5KYYA 2E6ZA 1KC8U 1KIKA 1OZ2A 3TSWA 3X26B 3G6ET 1YIJT 2ZPHB 3CMAA 2EKHA 2AZSA 4BY6B 2O88A 1JO8A 2E65A 4BI8B 2D1XA 2XHCA 1D0XA 2L89A 3VS5A 1VQLQ 3ZBDA 3CCET 2LQWA 2HNIA 2QTXA 2QEXQ 1PG5B 1RAHB 2VXFA 2BE9B 2XKOC 1FYNA 1BU1A 2R58A 2L0AA 4LUEA 1F1BB 1EFNA 3TEEA 2L5QA 3CMEA 2MWPA 3OYNA 4OVAA 4F7UB 2OX7A 2BZ8A 5IXFA 4F14A 5KYXB 2NUPB 5GANd 1T3LA 4M7AG 1BI0A 4A53A 3URGA 1YI2T 1T3SA 4J6WA 3RUXA 3CCLA 1E7OA 4E7SA 2DIQA 1NPRA 2RQTA 2L8DA 1VQPT 3NTKA 1KC8C 2E4HA 2RA2A 1CKAA 3JB9G 1EX4A 1U1TA 2OI3A 3KFVA 5L8RE 3DLMA 2YT6A 1W2BS 1ZSZB 3ME9A 3CQTA 2XDDA 2K4YA 4M7DE 2QASA 4O5VA 2EGAA 4J6YA 1IGUA 4RMOA 1A0NB 2NUTB 4L59A 2VV5A 1FXXA 1JXMA 3OYJA 3LYIA 1VQLT 1WHGA 3CCVQ 1X43A 1WGSA 2QEXT 5FU7B 3SD4A 3JB9I 3CC2A 1M1KR 3GOXA 1WJSA 4E7KA 3FRNA 2RN8A 5GMKm 1RI9A 1YITQ 4II1A 4CRIA 5KE3A 1I1JA 1N9RA 3VU3C 1D09B 3X24B 3VRZA 4KGXB 3OYGA 2JTFA 4ESRA 4A4HA 1H3HA 1K9AA 2K5FA 2Y4XA 1OQKA 5CKEA 1B34A 2EYZA 2QQSA 1X6OA 3UA7A 3QYGB 1RAGB 3VYHB 3G7ZA 1YIJA 4JDSA 4BB7A 1YHQQ 5EG2A 4LDXA 1WJRA 2O31A 3EFRA 2KQWA 5HK3A 2R5MA 1IREB 5IAYA 3S3NA 3H8ZA 2HMAA 1G3SA 3OQ5A 4J9HA 2L3RA 3CCEA 4HVVA 2P84A 5AYFA 2X51A 2GNCA 4FW2A 5KYYB 3I5RA 3L2UA 4OGCA 3OYEA 2D0QB 1QCNA 3OMCA 1TUCA 5A0GA 3CCVT 4HCKA 1U3OA 2EFIA 1NYFA 3PT9A 3RKWA 4JS4A 4PJNA 1YI2A 1K0SA 3M4GA 4GBQA 2KRSA 4LDYA 2L3PA 3V7RA 3NTIA 1VQPA 2RHYA 2ZPIB 1YITT 2RPNA 3GPLA 4OMOA 3HKSA 3CCST 1OPLA 9ATCB 3PVQA 3JAME 2COWA 2V26A 3M0UA 2RQWA 1U06A 3RKXA 2RNAA 2KK4A 2KRNA 3QG1A 5HCKA 5GANg 3WVEB 1Z9QA 1YHQT 2FB7A 1BBZA 3HP9A 1YWOA 1RUWA 3GNFB 5C0MA 4KUDK 2XIDA 1X75C 2QEXA 2LNHB 1KC8R 3JCMf 1NE8A 3E2UA 2ZPEB 4X1VA 5CKFA 4QVDA 7AT1B 1AOJA 3ZL7C 3Q1JA 4M4ZA 1VYVA 4FU6A 2BKDN 2DTHA 2JOYA 5GAN2 2YRDA 3PIPA 5LJ3d 1Q82U 5D7UA 4E47A 2PU9B 1LJOA 2DD4A 2E5KA 1K8AU 1VQKQ 4PK4A 2E3HA 2R57A 4TVRA 2ESWA 4QVCA 2DEQA 2DD5A 2DX1A 3SFMA 2FPEA 4M77C 3SB2A 3CC4Q 4B9XA 4FM4B 3J81E 4HCCA 2EYQA 2YLCA 5LJ5g 2ROLA 4MZTA 4OB0B 4PJOC 2MWOA 1IHWA 2AT1B 3L1AA 2KRMA 2Y4YA 2CS7A 1B34B 1PHTA 1UECA 5LL6S 2LJ1A 1QWFA 4RTZA 3WVDB 1VQ6Q 1E6GA 3M56A 5GAMd 4M7DG 1GBRA 3M0PA 5IHIA 2VGNA 1VUBA 3MP6A 4YTLA 2OAWA 3A8GB 4JJNK 2EPDA 2D6FA 4M7AF 1M1FA 4E7HA 1D1CA 4X34A 2P0PA 5CO7A 3CCQQ 3OB9A 2K3YA 2C0IA 1N8RU 3JB9D 5CKDA 2QQAA 2XICA 1D3BB 3OYAA 1YITA 1KHCA 1P92A 1NJIC 3JB9F 1KD1C 3NTHA 3CCSA 2DPPB 3GF5A 2RD1A 3QBYA 1UGPB 1VQKT 5DLQE 4MMKA 4MMLA 3M9QA 2MI6A 1MNDA 3J80E 2V8IA 2JW4A 3CC4T 1TWBA 1YHQA 1SG5A 3L2QA 5A0DA 3L42A 3NFCA 1M90U 2X4WA 3E9GA 5LJ5e 2RQRA 3CD6Q 1ZLMA 2V8KA 1SSFA 3X20B 2FRYA 5CKBA 3PE0A 1Y71A 3EFOA 1H641 1MMAA 2HL3A 2LCSA 4LDVA 2AKKA 2DL5A 4MZMA 2YLBA 1TUDA 5HK0A 3M4YA 1VQ6T 1N8RC 3EH2A 3JCMc 4C8QC 2X35A 1O75A 2YSQA 2QQ9A 4QT7A 3HPWA 3H41A 3C4SA 4BE0A 2DJQA 1OU9A 1GCQC 3CCQT 3QWXX 3JCMh 3I35A 2CDTA 3A5ZB 5GANj 2DTOA 5FWCA 3EGDA 2PTKA 5AT1B 1MV0B 2RI5A 1QVGS 4GLKA 3R6OA 5HKCA 4J9GA 4FYWB 3VS2A 4D8KA 4BI4A 5CAIA 2EYXA 5GJVB 2J06A 4PL6A 5M9OA 1UFFA 5LJ3g 3M59A 4OMPA
chains in the Genus database with same CATH topology
3QJYA 3CD6T 3OYBA 5D6WA 4OGEA 3DB4A 1K73C 2JZ2A 3E1SA 2DXTA 3TCJA 3E9FA 3KBGA 3MCAB 4DOWA 2VXEA 2M16A 3QJ6A 4M77D 1DJ7B 1M9SA 3LGFA 1OYXA 4A4FA 2HAXA 4M7AD 5GAMf 3GIBA 2E6NA 3V8KA 3G6EA 1M4ZA 5CR2A 3HSBA 2KMTA 3I55A 4M77F 4R56A 1VQMT 3PMIA 1KQ1A 3OS0A 1Q86C 1WQWA 3HHTB 4M75A 5GAN6 3M57A 3BDUA 5GMKj 1KC8U 2E6ZA 5GMKi 1VQ5A 2E41A 1X01A 1OZ2A 1JB0E 3X26B 3G6ET 4X9DA 4ATOA 1YIJT 2ZPHB 3CMAA 4D6WA 2CKKA 3CCMT 3S3OA 1N6AA 2YHTA 4IUPA 3TREA 4BY6B 1JJ2S 3H6ZA 1VQKA 4ELZC 2E65A 4BI8B 3OS2A 1M8VA 2XHCA 2CZ0B 2OTLT 4M78G 4GY5A 2L89A 1D3BA 1Q7YC 3ZBDA 3CCET 2HNIA 2QTXA 5FLXE 4BY6C 2VXFA 2XKOC 1VQ8A 3CC4A 2R58A 4RG2A 4C0GA 4MDXA 4RG8A 4Q5WA 4XTUA 3MO8A 5KCHA 4M75D 3TEEA 4N4IA 1FX7A 4QQGA 1YJ9T 2DXBA 2L5QA 4MDWA 2EQKA 4E7LA 3QZ9B 3CMEA 2DIGA 2MWPA 3OYNA 4N4HA 3QO3A 2DK3A 2GQVA 5GANh 1XOVA 3MP1A 4OVAA 2EJ9A 4F7UB 3BDLA 2K3XA 1N9SA 4Y91A 4C5EA 5GANd 3GP8A 2DVEA 4M7AG 1M1GA 1Y96A 2CYZB 1BI0A 3A8HB 3LH0A 3OSVA 4L6V5 3VUBA 2G3RA 3URGA 4A53A 4BE2A 4ZTJA 1KQSA 2E70A 1YI2T 3RUXA 2K5LA 2RJEA 4J6WA 4N4GA 3CCLA 1BYMA 3RIRA 3HFOA 1VQ6A 3V7SA 2DIQA 1NPRA 1Q81U 4HT9A 2L8DA 2QA4T 1VQPT 3NTKA 1KC8C 2I2LA 4JRKA 5GAN5 2RA2A 2X4XA 3LX7A 2LCLA 3JB9G 1V29B 4OMFB 1YJWA 3JCMV 3X25B 1U1TA 2DZCA 2HD0A 1I8FA 4C8QE 5J26A 1WJQA 1K9MC 5L8RE 5GAN3 3DLMA 2E64A 2ZGWA 3CCQA 1W2BS 3A8OB 3ME9A 1QW1A 2XDDA 2K4YA 4FT4A 2B8AA 4DOVA 1YJWT 3P8HA 2XDBA 4ZN1A 4M7DE 2KSSA 4O5VA 4J7FA 1BIBA 2DZ9A 3KUFA 1PSFA 4J6YA 3HRUA 4RMOA 4NS5A 5HY6A 3FLGA 4XU1A 3MHXA 1VQLA 4OB3B 4XAXB 3JCMd 4M75G 4OP0A 3PTAA 2GF7A 2QQRA 2WSFE 4L59A 4CI0C 1VQNT 3V7CA 3JCMb 5I21A 4M78B 3QIIA 2VV5A 1FXXA 1JBMA 3OYJA 2XD0A 3LYIA 1VQLT 4LDWA 3OYYA 1WGSA 1FWZA 2P4TA 4RCBA 5FU7B 2QEXT 2OTJA 5KH6A 5KCOA 3SD4A 4KULA 4XQ3A 3JB9I 4M78E 5DM7R 3CC2A 4OB1B 4M78C 5LJ5h 5LJ3h 2O4XB 4QVZA 3OS1A 4HT8A 4EMKA 1PSEA 1Q7YU 2WSCE 1YJNA 3GOXA 1WJSA 3OYFA 4E7KA 3CD6A 3J7AF 3FRNA 5IT9E 4PJOA 2OTJT 1Q81C 5FU7C 4J7IA 5GMKm 3CC2T 5CCAA 2RH2A 5I2MA 4II1A 4M7AB 4CRIA 5KE3A 1YJNT 1N9RA 3QYHB 3VU3C 2EQJA 2LTOA 3X24B 3TU4K 2EJFA 2GFUA 2CZ1B 4ME7A 3WXMB 3BFMA 2DO3A 3OYGA 2JTFA 4C0FA 3OYIA 3RMQA 4A4HA 2F69A 2RK2A 3QHSA 1VQMA 2DKGA 2V8JA 2ZPFB 4M7AE 4M7AC 2BUDA 2K5FA 2EKOA 2Y4XA 5CKEA 1B34A 3OW2A 5GAMh 4J5YA 2QQSA 4A4KA 1X6OA 4C92F 3QYGB 2CZ6B 2EAYA 4MZPA 5GAN7 5GAOq 2DXUA 3G7ZA 1RI0A 3VYHB 1YIJA 4JDSA 2Y90A 4HCZA 4BB7A 4EMHA 5I2SA 3CCMA 3VV0A 4PJOD 5EG2A 4LDXA 1WJRA 3QXEB 1QP3A 2RO0A 1U8RA 4FL6A 3EFRA 2OAUA 3QUIA 4Y28E 5GANe 3L2WA 2KQWA 5HK3A 2R5MA 1IREB 5D6XA 4PJOF 4ZGDB 5IAYA 3S3NA 4EDUA 5C6SA 4HA8A 1VQ4T 2WSEE 5LJ5j 3H8ZA 2KDSA 1UEBA 1YBYA 2X4YA 1G3SA 1VIFA 2RHXA 2JN0A 3RESA 3OYKA 2HQXA 1K9MU 3AHUA 2FHDA 3OQ5A 2L3RA 3FJPA 3CCEA 2P0QA 2EQMA 3MEAA 2E5QA 5AYFA 2LQ8A 2M9UA 4M75B 1QVGA 4LDUA 3KXTA 3CCVA 4BACA 3L2UA 2M0OA 3DKMA 4IUVA 1NPPA 1R8OB 4OGCA 3OYEA 2D0QB 3OYLA 3C94A 4XK8E 4XTYA 2A3LA 2VC8A 1YJ9A 3OMCA 4XTWA 2XDPA 3PFSA 1Q82C 1I5LA 4IUTA 4FSXA 4BI3A 5A0GA 5A2QE 3MEVA 3GNGA 3CCVT 2RM4A 3HRSA 3INZA 4M75E 1K8AC 4M75C 4KBMB 2EFIA 2EWNA 3PT9A 4FIBA 2VYTA 3RKWA 4JS4A 3ZFJA 4HCBA 3HL8A 2F5TX 3CC7T 1QVFA 3E19A 2MMPA 5CVIA 1YI2A 3JB9H 2LQKA 1H3ZA 3M4GA 3JRZA 3PIOA 3RMSA 4LDYA 3CCRT 2PVGB 4M77G 2M1HA 3V7RA 2JVVA 3JCMe 3NTIA 2HQEA 4DQ2A 3OYHA 2QA4A 4E7IA 1VQPA 3OMGA 1I81A 4JUVA 2RHYA 2ZPIB 1YITT 5GANf 3GPLA 3HKSA 3M54A 3CCST 5DY9A 1HXDA 4PJOG 4QW2A 3UDCA 4F7UE 5GAMj 1VQ9T 1G5VA 2XU8A 3FC3A 1XNIA 2FL7A 3JAME 3M53A 3JCMW 4C8QA 1KHIA 1WNLA 3UWNA 5GMKe 3SDZA 4NL2A 1Y96B 3RKXA 4RCCA 2KK4A 2E12A 5CK9A 1UGSB 3OBWA 4BDYA 4X9CA 2LT1A 3QG1A 3CCUT 4M7DA 2MAMA 4V2SA 3MEUA 4XTVA 3QPHA 3C12A 3WVEB 5GANg 1YHQT 3M55A 2FB7A 3L2RA 2LRQA 3CEYA 3HP9A 4O6JA 5CIUA 3LWIA 3GNFB 5C0MA 3I56T 1VQNA 3ASKA 3OY9A 3CPWA 4KUDK 2XIDA 3CXCS 2LDMA 3MP8A 4XTXA 3JB9J 5FRNA 3LGLA 1UGQB 3SWNB 1X75C 2K2VA 1BI3A 2QEXA 3GLXA 4P5NA 1NZ9A 3QZ5B 3JCMf 1NE8A 3G71T 3MEWA 5FRMA 2ZPEB 3EFSA 2PUOB 4C8QD 3CCJT 5CKFA 2LT4A 4E7JA 4QVDA 1WPYA 4C92A 3L2VA 4J8OA 4M78A 3O8VA 3SWNC 2FVUA 4C8QF 4N0AA 3OW2S 5FROA 4NOYA 2QDYB 4M7DD 3Q1JA 4FU6A 3OA6A 2BKDN 2DTHA 2JOYA 4RKUE 3BY7A 5GAN2 3OYDA 1VIEA 5LJ5d 3PIPA 5LJ3d 3LWHA 4M7DF 3C95A 2F5KA 1Q82U 2O4XA 4JRIA 1W4SA 4E47A 3JCMg 2PU9B 1LJOA 2DD4A 4M77B 4QQ6A 3QDRB 3ZEHA 1K8AU 3QKJA 2HBPA 4PNOA 2DXCA 4DA4A 2FYKA 2LC4A 1N27A 2R57A 4TVRA 4C5GA 1M90C 2QQBA 1ZHIA 4QVCA 2DEQA 4B9WA 2DD5A 3FIFA 1MHNA 4PJOB 1AHJB 2H3JA 2LX9A 4EMGA 4ZGEB 1Y07A 3CBMA 3SFMA 4M77E 4M77C 3SB2A 3L2ZA 2QXFA 4IUUA 3OYMA 4XU2A 4B9XA 4FM4B 2RJFA 2ZPBB 4M78D 3DB3A 4C92D 3J81E 1XQHA 3RKYA 4HCCA 2EYQA 1YCYA 2YLCA 3OSSC 2XG8D 4ELYC 5GAOp 4ZN3A 5GAOn 5LJ5g 4M78F 1IZ6A 5GAN8 4NL3A 4MZTA 4OB0B 4PJOC 1VQ4A 2QI2A 2PVDB 2MWOA 3L1AA 2JTMA 4C5IA 2Y4YA 4C8QG 5LJ3j 2RHIA 3VYGA 1QVFS 2CS7A 3G4ST 4KT0E 2E10A 4L5GA 1B34B 2JNGA 2LNVA 5LL6S 2VGMA 1KG1A 5KE2A 2ZZDA 3WVDB 3JCMX 1I4K1 3M56A 5GAMd 4M7DG 1KQSS 3OBYA 4JLGA 1U1SA 2LCCA 3UT1A 2KAFA 4JLIA 3V8JA 4IKFA 2VGNA 3HRTA 1VUBA 3MP6A 4YTLA 3A8GB 4FT2A 2NLUA 1OI1A 2GFAA 1HK9A 4JJNK 2P0KA 3CPFA 2D6FA 4M7AF 1S72A 1M1FA 2RK1A 5FU6B 4E7HA 4A4EA 5GAOr 3S6WA 1VQ7A 5GAOm 4X34A 2P0PA 3EAEA 5CO7A 3CC7A 1G3YA 1MGQA 5CQYA 5J3BA 3OS5A 3OB9A 3P8BB 3I55T 2K3YA 4PLIA 3META 3DLLA 3CCRA 1N8RU 3JB9D 3CBOA 4BD3A 5CKDA 1S72T 1RL2A 2ZCFB 1ZQ1A 2QQAA 1VQ7T 2XICA 4JRPA 1D3BB 2R5AA 3JCMQ 1VQ5T 2PUKB 3OYAA 1KHCA 1EIFA 5FU6C 1P92A 1YITA 1NJIC 3JB9F 4XTZA 1M1KU 1KD1C 3NTHA 4C92G 5GAMg 3CCSA 1XTDA 2DPPB 3JCMJ 3CMAT 2D9TA 1VQ9A 4UC4A 3VUZA 3GF5A 2RD1A 3QBYA 3CPWS 2KVQG 1O9SA 1UGPB 4C0DB 4F7UA 1VQKT 5DLQE 1LOJA 4MMKA 4MMLA 4BE1A 1G3TA 3M9QA 2MI6A 1G3WA 2EIFA 3PGGA 3J80E 2CZ7B 3V8LA 4IURA 4ZGJB 3CCUA 2V8IA 2XI9A 3X28B 3RERA 2RI2A 3CC4T 1VQ8T 4C0DC 1YHQA 3L2QA 4M75F 5A0DA 2KY9A 1TH7A 3L42A 5IN1A 3NFCA 1M90U 2X4WA 4OF1A 4C0ZA 4EPCA 3I56A 3E9GA 3N5BB 1JRIA 3QSUA 1M5Q1 5LJ5e 5LJ3e 1JJ2A 3VKIA 5A0LA 2V8KA 2VUBA 1SSFA 3FDRA 3CMET 3X20B 2K5IA 2RHUA 3PMTA 5CKBA 3OYCA 1QVPA 2A7YA 1Y71A 1ZBXA 1BI2A 1H641 4C8QB 1GXIE 4LDVA 5GMKl 3FEOA 5CKHA 4MZMA 2RHZA 2YLBA 4OB2B 4BUGA 2ZPGB 3G71A 4BDZA 4LD9K 2MF2A 5DLOA 2IG0A 3CCJA 5HK0A 1QP2A 3CCLT 2WACA 3M4YA 1KQ2A 4M7DB 4J83A 1VQ6T 4IUQA 4F7UF 3CBPA 3JCMc 1N8RC 1BKBA 4C8QC 2X35A 1K73U 1LNXA 3SWNA 3P8DA 1O75A 4XU3A 2QQ9A 3PNWC 1VQOA 4A54A 3M5AA 3HPWA 5D6YA 1M1KC 2BIVA 3T9NA 2EQUA 2YRVA 4PLLA 4VUBA 2GCXA 2DJZA 3C4SA 4BE0A 4M7DC 2CGHA 4XU0A 3M58A 2C06A 3LLRA 2X4JA 2AHJB 3CCQT 3A8LB 3JCMh 1VQOT 1OZ3A 2IVWA 5CQXA 4KUIA 3A8MB 2E1HA 2RB6A 3A5ZB 4R55A 5GANj 1Q86U 3HFNA 2DTOA 4Z02A 4C92B 5LJ5f 5LJ3f 4JRQA 1UGRB 1BIAA 2XK0A 5GAMe 3LW5E 5J39A 5GMKh 2K57A 3ER0A 4WF2A 2OTLA 4QQDA 2LVMA 4EMKB 4M77A 4JS5A 3F70A 2RI5A 1QVGS 1BI1A 1NJIU 4GLKA 4M7AA 4C92E 3VJPA 2EJGA 4C92C 1W2BA 1WQ7A 4J6XA 1KD1U 3R6OA 5HKCA 2RJDA 4PKCC 4ZTFA 2DAQA 4N0AC 4BI4A 1Y7XA 3JSCA 5CAIA 3S3MA 2DTIA 2JUFA 2PQWA 2RI3A 4LD6A 4C5HA 2O01E 5GAN4 5GAOl 3BW1A 4PL6A 5M9OA 4F7UG 3JCMP 3FB9A 4HKEA 4EMKC 5LJ3g 3G4SA 4PJOE 1UB4A 2RJCA 3CXCA 2PVOB 3UPUA 3M59A 4A4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q A;  1WNL A;  5I21 A;  5GMK e;  4M78 B;  4NL2 A;  1Y96 B;  3JB9 D;  3RKX A;  1JBM A;  4RCC A;  2DXT A;  1D3B B;  4X9C A;  3JCM Q;  4RCB A;  3JB9 F;  4M7D A;  4XTZ A;  4V2S A;  4C92 G;  4XTV A;  5GAM g;  3JCM J;  4XQ3 A;  3JB9 I;  2VXE A;  5GAN g;  4M77 D;  2FB7 A;  4M78 E;  4HT8 A;  4M78 C;  5LJ5 h;  5LJ3 h;  4M7A D;  2RD1 A;  4EMK A;  5GAM f;  3GIB A;  3V8K A;  3HSB A;  4F7U A;  4PJO A;  4M77 F;  1LOJ A;  4MMK A;  4MML A;  1KQ1 A;  4XTX A;  1WQW A;  4M75 A;  5GAN 6;  5GMK j;  3JB9 J;  3BDU A;  3PGG A;  5GMK m;  3SWN B;  5GMK i;  2E41 A;  3V8L A;  1X01 A;  4M7A B;  4X9D A;  3JCM f;  3RER A;  1N9R A;  3VU3 C;  2EJF A;  4M75 F;  3EFS A;  1TH7 A;  4C8Q D;  3JCM W;  3BFM A;  2YHT A;  4QVD A;  3QSU A;  1WPY A;  4C92 A;  1JRI A;  3QHS A;  1M5Q 1;  2E65 A;  2DKG A;  4M78 A;  3SWN C;  5LJ3 e;  4C8Q F;  4N0A A;  5LJ5 e;  1M8V A;  4M7A E;  4NOY A;  4M78 G;  4M7A C;  4M7D D;  1D3B A;  1B34 A;  1H64 1;  2DTH A;  4J5Y A;  2HNI A;  2QTX A;  4C8Q B;  4C92 F;  3BY7 A;  5GAN 2;  2EAY A;  5GMK l;  5GAN 7;  4M7D F;  2YLB A;  5LJ5 d;  2DXU A;  2VXF A;  5LJ3 d;  5GAO q;  4EMH A;  2Y90 A;  4M7A G;  4JRI A;  4PJO D;  3JCM g;  4XTU A;  1LJO A;  4M77 B;  1KQ2 A;  4M7D B;  3EFR A;  3QUI A;  4M75 D;  5GAN e;  4PNO A;  4F7U F;  3JCM c;  4PJO F;  4C8Q C;  2FYK A;  4HA8 A;  5LJ5 j;  1LNX A;  3QO3 A;  5LJ3 j;  3SWN A;  5GAM h;  2JN0 A;  4XU3 A;  5GAN h;  3RES A;  3AHU A;  4QVC A;  2DEQ A;  4A54 A;  2EJ9 A;  4F7U B;  3FJP A;  3FIF A;  4PJO B;  4EMG A;  1N9S A;  4Y91 A;  4M77 E;  5GAN d;  4M75 B;  2DJZ A;  2DVE A;  4M77 C;  1Y96 A;  3L2Z A;  2CGH A;  3SB2 A;  4XU2 A;  4XU0 A;  4C92 D;  4A53 A;  4M78 D;  3RKY A;  4J6W A;  3RUX A;  3JCM h;  1YCY A;  2YLC A;  3HFO A;  3RIR A;  5GAO p;  5GAO n;  4XTY A;  3V7S A;  2VC8 A;  5LJ5 g;  4M7D C;  4M78 F;  4XTW A;  5GAN 8;  2E1H A;  4NL3 A;  2RB6 A;  1I5L A;  5GAN j;  4HT9 A;  4PJO C;  3HFN A;  2RM4 A;  2DTO A;  3INZ A;  4M75 E;  2I2L A;  4JRK A;  4M75 C;  4C92 B;  5LJ5 f;  5LJ3 f;  3L1A A;  2RA2 A;  5GAN 5;  1BIA A;  5GAM e;  2EWN A;  3JB9 G;  4C8Q G;  3JCM b;  3RKW A;  3JCM V;  1U1T A;  2DZC A;  1I8F A;  4C8Q E;  2E10 A;  5GMK h;  1B34 B;  2K57 A;  5GAN 3;  4WF2 A;  3JB9 H;  4EMK B;  4M77 A;  2E64 A;  2ZGW A;  3M4G A;  3JCM X;  4M7A A;  1I4K 1;  5GAM d;  4M77 G;  3V7R A;  4C92 E;  4M7D G;  2EJG A;  4C92 C;  1WQ7 A;  4J6X A;  4DQ2 A;  3JCM e;  1U1S A;  3V8J A;  4M7D E;  4JLI A;  4JUV A;  1I81 A;  4N0A C;  1BIB A;  2DZ9 A;  4J6Y A;  5CAI A;  5GAN f;  2DTI A;  5GAO l;  1HK9 A;  5GAN 4;  3BW1 A;  4F7U G;  5DY9 A;  1HXD A;  3FB9 A;  4PJO G;  4XU1 A;  4EMK C;  3JCM P;  4M7A F;  4F7U E;  5GAM j;  5LJ3 g;  5GAO r;  4PJO E;  3JCM d;  5GAO m;  4M75 G;  4OP0 A;  1MGQ A;  3V7C A; 
#chains in the Genus database with same CATH topology
 3CD6 T;  1ZSG A;  2QA4 Q;  3TCJ A;  2K79 A;  3CCL Q;  4Y92 A;  1PCX A;  1HYO A;  1DJ7 B;  2K9G A;  1R0B G;  3GIB A;  2E6N A;  2LX7 A;  3V8K A;  5CR2 A;  3HSB A;  4R56 A;  2ZAE A;  1UTI A;  3M57 A;  2E41 A;  1JU5 C;  2DLP A;  3CXC P;  5EC7 A;  2CP0 A;  2CKK A;  2O9S A;  1N6A A;  2YHT A;  4E6R A;  1JJ2 S;  1VQK A;  2VVK A;  1M8V A;  3MPU B;  5I22 A;  3HTR A;  4M78 G;  1SSH A;  1UJY A;  2J6K A;  1Q7Y C;  2EVR A;  5FLX E;  3OW2 P;  3CC4 A;  2DNU A;  4MDX A;  4RG8 A;  2HKN A;  1YNZ A;  4N4I A;  1FX7 A;  4QQG A;  2DXB A;  2EQK A;  2NUZ A;  2F2W A;  3QO3 A;  3VS4 A;  2OJ2 A;  3CC2 Q;  3NGP A;  3MP1 A;  5L23 A;  1IRX A;  1LCK A;  2DVE A;  2CYZ B;  3OSV A;  2EYY A;  3A8H B;  4Z8A A;  4ZTJ A;  3VUB A;  2G3R A;  1Z9Z A;  1ACM B;  1QLY A;  5IHN A;  1VQ6 A;  1OX8 A;  1LPL A;  2QA4 T;  2I2L A;  4RTY A;  5GAN 5;  2W0Z A;  2GTJ A;  2ED1 A;  1Y0M A;  1WJQ A;  2K7A A;  3EFO B;  3VS0 A;  1T0J A;  3CCQ A;  1R77 A;  1B3Q A;  1I5O B;  1IHV A;  2B8A A;  4DOV A;  3P8H A;  2FZK B;  1VQ4 Q;  1YIJ Q;  3KUF A;  2DZ9 A;  1IB8 A;  3HRU A;  1WXU A;  3UA6 A;  4NS5 A;  4EIK A;  4M75 G;  3PTA A;  2KGT A;  2QQR A;  4CI0 C;  1JBM A;  1OEB A;  1N8R R;  4RCB A;  1FWZ A;  2OTJ A;  5KH6 A;  2L3S A;  4RTU A;  2QTV A;  5DM7 R;  4OB1 B;  3OS1 A;  2O4X B;  2QG9 B;  4EMK A;  1PSE A;  3EGD B;  3OYF A;  3CD6 A;  4PJO A;  2BTT A;  3RR6 A;  3CC2 T;  3EH1 A;  3CPW P;  2RH2 A;  2QAZ A;  5I2M A;  2EQI A;  2EJF A;  4PFO A;  1QMC A;  1S1N A;  4CC7 A;  3BFM A;  2DO3 A;  1VQP Q;  1U5S A;  1KK7 A;  1M90 R;  1MMD A;  1RAC B;  2LP5 A;  4M7A C;  3OW2 A;  4A4K A;  3CCU Q;  2CZ6 B;  2EAY A;  3TSZ A;  5GAN 7;  1UE9 A;  4F04 B;  5I2S A;  4PJO D;  3QXE B;  1QP3 A;  4FL6 A;  4PJJ A;  3L2W A;  2GQI A;  5D6X A;  4PJO F;  4ZGD B;  4HA8 A;  1VQ4 T;  2WSE E;  1RAI B;  4ANJ A;  5LJ3 j;  3RES A;  2HQX A;  3FJP A;  2P0Q A;  2VKN A;  2YXY A;  2QGF B;  2LQ8 A;  2C0T A;  1QVG A;  1HJD A;  1OPK A;  3VRY A;  1QKX A;  1TUG B;  4FYX B;  4IUV A;  4XTW A;  1FMW A;  4FSX A;  5A2Q E;  3I9Q A;  4F17 A;  3GNG A;  2MIO A;  1NM7 A;  3INZ A;  2EWN A;  2VYT A;  2K3B A;  3ZFJ A;  3HL8 A;  3JB9 H;  2MMP A;  1WIE A;  3JRZ A;  3PIO A;  2PVG B;  1W6X A;  2M1H A;  2QA4 A;  3OMG A;  1WI7 A;  5GAN f;  2QK0 A;  3M54 A;  4QW2 A;  3UDC A;  4F7U E;  5GAM j;  1AT1 B;  2XU8 A;  1JXO A;  3UF4 A;  4C8Q A;  3UWN A;  5GMK e;  3SDZ A;  4JJD A;  2DIL A;  4X9C A;  3CCU T;  2MAM A;  3TQ7 P;  2GBQ A;  3MEU A;  1GCQ A;  1K0X A;  3L2R A;  5CIU A;  3CPW A;  3MP8 A;  3LGL A;  3NPF A;  1WX6 A;  1BI3 A;  4RTX A;  2K2M A;  3GLX A;  1NZ9 A;  3QZ5 B;  3G71 T;  1SHF A;  3MEW A;  3EFS A;  2PUO B;  4C8Q D;  3CCJ T;  2LT4 A;  1R0C B;  1WPY A;  2FZG B;  4M78 A;  1QCF A;  4C8Q F;  5FRO A;  4RUG A;  1VQ5 Q;  3QDF A;  3OYD A;  5LJ5 d;  2F5K A;  4JRI A;  1W4S A;  2J05 A;  4M77 B;  4QQ6 A;  1W70 A;  1SF9 A;  2FYK A;  3CCS Q;  4HVW A;  1T0H A;  2LJ0 A;  2QQB A;  2JM9 A;  1KSW A;  2MOX A;  1UHC A;  4PJO B;  1Y07 A;  3CBM A;  4M77 E;  4FCY A;  3UAT A;  2JM8 A;  3L2Z A;  2QXF A;  3OYM A;  4M78 D;  2H8H A;  2IPO B;  3RKY A;  3OSS C;  2DE0 X;  1PD1 A;  4M78 F;  1VQ4 A;  5GJW B;  2CH4 A;  2LMJ A;  4C5I A;  1QVF S;  3G4S T;  2HDA A;  2LNV A;  2EYW A;  2YDL A;  1KG1 A;  2YUP A;  1TTH B;  2LCC A;  4JLI A;  2C0O A;  3QWY A;  2KR3 A;  2DM1 A;  4WTO B;  1W2B P;  2JTE A;  2KNB B;  1S72 A;  3EAE A;  1MGQ A;  5J3B A;  2DF6 A;  1MMN A;  3DLL A;  1RL2 A;  1RAB B;  4QKU A;  4R0K A;  3JCM Q;  1VQ5 T;  5FU6 C;  4XTZ A;  3SEM A;  4C92 G;  4OMM A;  3EG2 A;  2D9T A;  2ATC B;  2F2X A;  2FRW A;  1OOT A;  3A98 A;  1K1Z A;  1LOJ A;  3IQL A;  1AWW A;  2KT1 A;  1BCM A;  4KGZ B;  4ZGJ B;  3CCU A;  2DBM A;  2AK5 A;  2KXD A;  2J7I A;  2EGC A;  2KYB A;  4C0D C;  4M75 F;  4OF1 A;  3QSU A;  3M0Q A;  1M5Q 1;  2JMA A;  3VKI A;  1E6H A;  2CP6 A;  3OYC A;  1QVP A;  2ABL A;  1ZBX A;  1BI2 A;  4C8Q B;  1GXI E;  3REB B;  3M0T A;  3FEO A;  5GMK l;  2RHZ A;  3G71 A;  4BUG A;  2ZPG B;  4BDZ A;  4LD9 K;  1VYU A;  3CCJ A;  4F16 A;  1WLP B;  4JZ4 A;  2A28 A;  4IUQ A;  1BKB A;  1K73 U;  1RLQ C;  3SWN A;  3LH5 A;  4XU3 A;  3PNW C;  4A54 A;  3M5A A;  2BIV A;  2YRV A;  2DJZ A;  4M7D C;  1YFN A;  2KI7 A;  3M58 A;  2C06 A;  3LLR A;  4LE9 A;  5CQX A;  2E1H A;  2RB6 A;  1WFW A;  3THK A;  3R6N A;  5LJ3 f;  4JRQ A;  2DRK A;  1BIA A;  3NHN A;  1OV3 A;  2K57 A;  4LXC A;  4M7A A;  3O5Z A;  1YJ9 Q;  1NJI U;  3VJP A;  2EJG A;  1W2B A;  1KD1 U;  1UHF A;  1ABQ A;  2HSP A;  4ZTF A;  1KFZ A;  4RTT A;  1Y7X A;  2RI3 A;  3G1J A;  1W1F A;  2PQW A;  4LD6 A;  4C5H A;  2O01 E;  5GAN 4;  4F7U G;  3JCM P;  4EMK C;  3G4S A;  1CSK A;  2PVO B;  4J9C A;  4OGE A;  3DB4 A;  1K73 C;  2E3I A;  1AVZ C;  2DXT A;  2CUB A;  4PJM A;  4A4F A;  3EG0 A;  4M7A D;  5GAM f;  1M4Z A;  1RAF B;  3PMI A;  4FYY B;  1KQ1 A;  3OS0 A;  1WQW A;  2LJ3 A;  4AFS C;  5GMK i;  1VQ5 A;  1JB0 E;  4X9D A;  4DBQ A;  4D6W A;  3TRE A;  4ELZ C;  2CZ0 B;  2CSI A;  4GY5 A;  1IGQ A;  2LQN A;  4PFZ A;  4Q5W A;  3EGU A;  3H0H A;  1YJ9 T;  2OTJ Q;  4E7L A;  4MDW A;  3QZ9 B;  2DIG A;  1V1C A;  2K6D A;  3BDL A;  4Y91 A;  3GP8 A;  1M1G A;  1Y96 A;  4BE2 A;  2K5L A;  4N4G A;  3HFO A;  1C1A A;  1D0Z A;  1Q81 U;  2LCL A;  4HXJ A;  3JCM V;  1YJW A;  2DZC A;  2HD0 A;  2BE7 D;  1NLO C;  1K9M C;  2COZ A;  2M0Y A;  1QW1 A;  5KYU A;  1RAA B;  4ZN1 A;  4J7F A;  1BIB A;  4DBR A;  1NYG A;  1Q95 G;  2NYS A;  5HY6 A;  4DEX A;  4XU1 A;  3MHX A;  4OB3 B;  3H0F A;  4XAX B;  1H92 A;  1PM3 A;  4OP0 A;  1M2V A;  2GF7 A;  2WSF E;  1GCP A;  2D8J A;  3V7C A;  5I21 A;  1ZUK A;  1TOV A;  3QII A;  2XD0 A;  3OYY A;  1UG1 A;  2MYS A;  3A1P A;  4HT8 A;  4M78 C;  5LJ3 h;  2DYI A;  4QVZ A;  2VWF A;  4E2F B;  3CC7 Q;  2JS0 A;  1Q7Y U;  2WSC E;  1YJN A;  3J7A F;  2OTJ T;  3CCR Q;  1Q81 C;  2KRO A;  1GBQ A;  2RF0 A;  4M7A B;  3VS3 A;  2EQJ A;  3TVT A;  2GFU A;  4ME7 A;  2Z0W A;  3QHS A;  2DKG A;  1RAE B;  2V8J A;  2ZPF B;  4M7A E;  2EKO A;  4ORZ A;  1M30 A;  4J5Y A;  4C92 F;  4MZP A;  2EW3 A;  4Z88 A;  2DXU A;  1RI0 A;  2Y90 A;  1GL5 A;  4CC4 B;  3QUI A;  4BE1 A;  4Y28 E;  1XJW B;  4EDU A;  5C6S A;  2I0N A;  5LJ5 j;  5GAM h;  2KDS A;  1UEB A;  1YBY A;  2X4Y A;  2JN0 A;  3OYK A;  1K73 R;  2EQM A;  3MEA A;  2M9U A;  3KXT A;  8AT1 B;  4JJC A;  2GGR A;  2DER A;  3C94 A;  4XK8 E;  1YJ9 A;  2VC8 A;  2XDP A;  1I07 A;  1X2K A;  3MEV A;  1CKB A;  1MUZ A;  2RM4 A;  3EGX A;  3HRS A;  4M75 C;  4KBM B;  1BB9 A;  1NBE B;  2F5T X;  4KH1 B;  3CC7 T;  3E19 A;  5CVI A;  4AT1 B;  4KH0 B;  3CCR T;  2CP2 A;  3JCM e;  4E7I A;  2HQE A;  4JUV A;  1I81 A;  2HZY A;  1GRI A;  1NJI R;  2ECZ A;  4AG1 C;  1KD1 R;  1QVG P;  2DET A;  5DY9 A;  1ZX6 A;  1G5V A;  2CP3 A;  4J9E A;  3FC3 A;  3M53 A;  2X3W D;  3NMZ C;  1KHI A;  3H9N A;  2V1Q A;  4RTW A;  1I0C A;  1Y96 B;  4WCI A;  2AKL A;  2DMO A;  2E12 A;  1UGS B;  2BZX A;  4RTV A;  4M7D A;  2MK5 A;  4XTV A;  3QPH A;  2HL5 C;  4O6J A;  3I56 T;  3OY9 A;  1M3B A;  2LDM A;  2RQU A;  4XTX A;  8ATC B;  3SHW A;  5KYU B;  4P5N A;  2ROT A;  2NUT A;  2YWW A;  4A63 B;  5FRM A;  2D8H A;  4E7J A;  3L2V A;  4J8O A;  3I55 Q;  3O8V A;  1K9M R;  3SWN C;  4NOY A;  1S72 Q;  4M7D D;  1JJ2 P;  1GFC A;  1NEB A;  2FPD A;  3OA6 A;  4RKU E;  3BY7 A;  4M7D F;  1EZZ B;  3C95 A;  3EG1 A;  3ULR B;  3ZEH A;  5FW9 A;  4CC2 A;  4PNO A;  2DXC A;  2AZV A;  4C5G A;  5FWB A;  2A37 A;  1MHN A;  1D1A A;  1AHJ B;  1YCS B;  4ZGE B;  4IUU A;  4XU2 A;  3M0S A;  2CT4 A;  2RJF A;  3DB3 A;  2F2V A;  1XQH A;  2DVJ A;  1YCY A;  5GAO n;  4ELY C;  1M8M A;  2L3Q A;  1IZ6 A;  1LVK A;  5GAN 8;  1KJW A;  4NL3 A;  2QI2 A;  1K76 A;  1Q81 R;  2JTM A;  1WHH A;  1PD0 A;  3VYG A;  3VS1 A;  2E10 A;  4L5G A;  2JNG A;  4B6M A;  2VGM A;  2CT3 A;  1KQS S;  3OBY A;  3G71 Q;  1U1S A;  3UT1 A;  3V8J A;  4IKF A;  3HRT A;  2SEM A;  3CCJ Q;  2NLU A;  1OI1 A;  1SKU B;  1HK9 A;  2GFA A;  2PZ1 A;  4K11 A;  1UUE A;  2A0F B;  5FU6 B;  4A4E A;  1VQ7 A;  3S6W A;  2HQH A;  3CC7 A;  1OU8 A;  1G3Y A;  1B7T A;  3OS5 A;  3P8B B;  3I55 T;  4AG2 C;  3CCR A;  4BD3 A;  1S72 T;  2ZCF B;  1WZO A;  1ZQ1 A;  1V76 A;  4JRP A;  1AWX A;  2P4R A;  1EIF A;  4UC4 A;  3VUZ A;  3EGX B;  3REA B;  2SRC A;  2KVQ G;  2NWM A;  4C0D B;  1JEG A;  3RBB B;  1AWJ A;  1Q7Y R;  5KYW A;  2EIF A;  3PGG A;  2DL8 A;  1N5Z A;  1AZG B;  4IUR A;  2M51 A;  2XI9 A;  3X28 B;  4AFQ C;  1VQ8 T;  2YUO A;  2RMO A;  1OUL A;  3I56 A;  1JJ2 A;  1VYT A;  2CSQ A;  3FDR A;  2K5I A;  3PMT A;  2COY A;  3G4S Q;  2JXB A;  2HEQ A;  1PRM C;  2IG0 A;  1TU0 B;  1QP2 A;  2WAC A;  4M7D B;  4J83 A;  2KXC A;  1VQM Q;  1TS9 A;  1UDL A;  3CBP A;  2W10 A;  1LNX A;  3P8D A;  1WHM A;  1VQO A;  5D6Y A;  1WHL A;  2XMF A;  3T9N A;  4PLL A;  1M3C A;  2GCX A;  4VUB A;  3D7S B;  2ED0 A;  1YN8 A;  4XU0 A;  4DBF A;  1X2Q A;  3CCM Q;  1MMG A;  2KT8 A;  2IVW A;  1KQS P;  4DBH A;  3A8M B;  1Q86 U;  1VOM A;  4Z02 A;  5LJ5 f;  1ZBJ A;  3LW5 E;  1H8K A;  3BE3 A;  4OMN A;  5J39 A;  2OTL A;  1IO6 A;  3JV3 A;  4EMK B;  3F70 A;  1M3A A;  2CH4 W;  4C92 C;  2CRE A;  4J6X A;  4PKC C;  2DAQ A;  4N0A C;  1K4U S;  2DTI A;  3RNJ A;  1C6V X;  1TG0 A;  1QCO A;  4PJO E;  1UB4 A;  3UPU A;  3QJY A;  2EBP A;  1YP5 A;  3FJ5 A;  3E9F A;  1X6G A;  3KBG A;  4DOW A;  3AT1 B;  2M16 A;  1BCO A;  2HAX A;  1M9S A;  2F1L A;  1QQJ A;  1NEG A;  3G6E A;  2KMT A;  3I55 A;  1VQM T;  1Q86 C;  3HHT B;  4M75 A;  5GMK j;  1YJW Q;  3BDU A;  2AIR B;  1X01 A;  3I5S A;  4ATO A;  6AT1 B;  2G6F X;  2O2O A;  3CCM T;  3S3O A;  4IUP A;  1HD3 A;  3H6Z A;  1VQN Q;  2O9V A;  3OS2 A;  4J9B A;  2EGE A;  2YUN A;  2CP5 A;  1D3B A;  2JT4 A;  2YRC A;  1PC0 A;  4BY6 C;  1VQ8 A;  1X27 A;  4RG2 A;  4C0G A;  1M2O A;  4XTU A;  1PRL C;  3MO8 A;  5KCH A;  4M75 D;  2FG0 A;  2MCN A;  1HSQ A;  4N4H A;  2DK3 A;  2GQV A;  1TSF A;  5GAN h;  1XOV A;  2EJ9 A;  2K3X A;  1YJN Q;  1N9S A;  4C5E A;  5KYW B;  3LH0 A;  4L6V 5;  1KQS A;  2E70 A;  1BYM A;  1WA7 A;  2RJE A;  4KRT A;  3RIR A;  3V7S A;  4HT9 A;  1PNJ A;  4JRK A;  3PVL A;  4IIO A;  2X4X A;  3LX7 A;  4OMQ A;  2RQV A;  1V29 B;  4OMF B;  3X25 B;  1I8F A;  4C8Q E;  5J26 A;  3RDV A;  5GAN 3;  2DA9 A;  2E64 A;  2ZGW A;  3A8O B;  1QVF P;  2DBK A;  3H0I A;  4FT4 A;  3VS6 A;  1YJW T;  2XDB A;  2KSS A;  1RLP C;  1PSF A;  4J9F A;  1WXB A;  3FLG A;  2FPF A;  4JJB A;  1ZSZ C;  1VQL A;  3JCM d;  1IXD A;  1VQN T;  3JCM b;  4KGV B;  4M78 B;  1RAD B;  3M0R A;  1ZA2 B;  1PKS A;  1J3T A;  4LDW A;  3EG9 A;  2P4T A;  5KCO A;  4KUL A;  4XQ3 A;  2MPX C;  4M78 E;  4AFZ C;  5LJ5 h;  2JMC A;  2HBW A;  4J9I A;  5IT9 E;  2PNI A;  5FU7 C;  4J7I A;  5CCA A;  1WYX A;  1YJN T;  1NLP C;  3QYH B;  3TU4 K;  2LTO A;  1VQ9 Q;  2CZ1 B;  3WXM B;  1D0Y A;  2DRM A;  4C0F A;  2QYZ A;  3RMQ A;  5IHK A;  3OYI A;  2F69 A;  1ZUU A;  2RK2 A;  1AEY A;  2D0N A;  1FMK A;  1VQM A;  1AZE A;  2BUD A;  2X9H A;  1SPK A;  4HVU A;  4OML A;  5GAO q;  4EMH A;  4HCZ A;  3CCM A;  3VV0 A;  2RO0 A;  1U8R A;  2VB6 A;  2OAU A;  5GAN e;  1D1B A;  1QWE A;  2VAS A;  1VIF A;  2RHX A;  3AHU A;  1K9M U;  2FHD A;  3MJX A;  2E5Q A;  4M75 B;  2V1R A;  4LDU A;  3CCV A;  4BAC A;  2M0O A;  3DKM A;  1NPP A;  1R8O B;  3OYL A;  4XTY A;  2A3L A;  2FEI A;  1Q82 C;  3PFS A;  1I5L A;  4IUT A;  4BI3 A;  1K8A C;  4M75 E;  2A36 A;  1Q86 R;  3VS7 A;  4FYV B;  4FIB A;  5I11 A;  4HCB A;  1QVF A;  1ABO A;  2GTO A;  2LQK A;  1H3Z A;  3RMS A;  4M77 G;  2JVV A;  4DQ2 A;  3OYH A;  4E7Z A;  2JS2 A;  2A08 A;  1SHG A;  1HXD A;  2KEA A;  3EHQ A;  4PJO G;  5IH2 A;  5KYN A;  1VQ9 T;  1XNI A;  2FL7 A;  3JCM W;  1WNL A;  4NL2 A;  4AFU C;  4PJL A;  4RCC A;  5CK9 A;  3OBW A;  4BDY A;  2LT1 A;  2X3X D;  1WDX A;  4V2S A;  3C12 A;  3EG3 A;  1PKT A;  3M55 A;  2IIM A;  2LRQ A;  3CEY A;  3LWI A;  1G2B A;  1VQN A;  1Y57 A;  3ASK A;  3EHR A;  3CXC S;  3JB9 J;  5FRN A;  1UGQ B;  1UJ0 A;  3SWN B;  3C0C A;  2K2V A;  2DL7 A;  2QGG A;  4LUD A;  2JJ9 A;  4C92 A;  2FVU A;  4N0A A;  3OW2 S;  1G83 A;  2QDY B;  1VQ7 Q;  1YWP A;  1B07 A;  4J9D A;  1VIE A;  4GLM A;  3U23 A;  3LWH A;  3CMA Q;  1C0M A;  4JPB W;  2O4X A;  1WHJ A;  4ZNX A;  3EG9 B;  3JCM g;  1UGV A;  3GBQ A;  2J6F A;  3QDR B;  3QKJ A;  2HBP A;  4DA4 A;  2LC4 A;  1N27 A;  1SRM A;  1M90 C;  1AWO A;  2H3E B;  1ZHI A;  2LZ6 B;  3MKD A;  4B9W A;  3FIF A;  4EMG A;  2H3J A;  2DFU A;  2LX9 A;  1QKW A;  4C92 D;  2ZPB B;  2XG8 D;  5GAO p;  4ZN3 A;  3CME Q;  4DEY A;  1SEM A;  1WHK A;  2PVD B;  1BK2 A;  3I56 Q;  4C8Q G;  2RHI A;  4AMC A;  5ECA A;  2CP7 A;  4KT0 E;  1MNE A;  2DYB A;  4PFP A;  5KE2 A;  2ZZD A;  3JCM X;  1I4K 1;  1ZUY A;  2KE9 A;  4JLG A;  2KAF A;  2DL4 A;  4FT2 A;  1FMV A;  2P0K A;  3CPF A;  2RK1 A;  5GAO r;  5GAO m;  2FO0 A;  5CQY A;  1VQO Q;  4PLI A;  3MET A;  1PWT A;  3CBO A;  1VQ7 T;  2KBT A;  2R5A A;  2PUK B;  1M27 C;  2YUQ A;  1X69 A;  4CC3 A;  1M1K U;  5GAM g;  1XTD A;  3JCM J;  3CMA T;  1VQ9 A;  2KYM A;  3CPW S;  1NG2 A;  1SRL A;  1O9S A;  4F7U A;  5KYX A;  1OX9 A;  4Z89 A;  2NUP A;  1G3T A;  2ENM A;  5IXB A;  1G3W A;  2CZ7 B;  3V8L A;  1Q82 R;  2OTL Q;  2CUD A;  3RER A;  2RI2 A;  1K8A R;  1ZA1 B;  2KY9 A;  1TH7 A;  5IN1 A;  1MV3 A;  2DL3 A;  4C0Z A;  2FZC B;  4EPC A;  3N5B B;  1JRI A;  5LJ3 e;  5A0L A;  2VUB A;  3CME T;  2RHU A;  4JZ3 A;  2A7Y A;  1ZSZ A;  5CKH A;  2L2P A;  4OB2 B;  2HKQ B;  2B86 A;  2MF2 A;  5DLO A;  3CCL T;  1KQ2 A;  4F7U F;  4LNP A;  1M1K C;  3G6E Q;  2EQU A;  1GFD A;  2CGH A;  2X4J A;  2QDL A;  1M2V B;  2AHJ B;  3A8L B;  1VQO T;  1OZ3 A;  4KUI A;  4R55 A;  3HFN A;  4FSS A;  4C92 B;  3CCE Q;  1UGR B;  2XK0 A;  5GAM e;  4D8D A;  1TXQ A;  1JQQ A;  1ARK A;  2J6O A;  5GMK h;  4LN2 A;  3ER0 A;  4WF2 A;  4QQD A;  2LVM A;  4M77 A;  4JS5 A;  1BI1 A;  4C92 E;  1WQ7 A;  2RJD A;  1VQ8 Q;  4IIM A;  1G8X A;  3S3M A;  3JSC A;  2OTL T;  2JUF A;  5GAO l;  3BW1 A;  3FB9 A;  4HKE A;  2DEU A;  3CXC A;  2RJC A;  2HCK A;  4A4G A;  1YI2 Q;  2HSE B;  3OYB A;  5D6W A;  1VA7 A;  2JZ2 A;  3E1S A;  1X6B A;  2BZY A;  3MCA B;  2M02 A;  2VXE A;  3QJ6 A;  4M77 D;  3LGF A;  1OYX A;  1WXT A;  1AD5 A;  4M77 F;  4FW1 A;  5GAN 6;  5KYY A;  2E6Z A;  1KC8 U;  1KIK A;  1OZ2 A;  3TSW A;  3X26 B;  3G6E T;  1YIJ T;  2ZPH B;  3CMA A;  2EKH A;  2AZS A;  4BY6 B;  2O88 A;  1JO8 A;  2E65 A;  4BI8 B;  2D1X A;  2XHC A;  1D0X A;  2L89 A;  3VS5 A;  1VQL Q;  3ZBD A;  3CCE T;  2LQW A;  2HNI A;  2QTX A;  2QEX Q;  1PG5 B;  1RAH B;  2VXF A;  2BE9 B;  2XKO C;  1FYN A;  1BU1 A;  2R58 A;  2L0A A;  4LUE A;  1F1B B;  1EFN A;  3TEE A;  2L5Q A;  3CME A;  2MWP A;  3OYN A;  4OVA A;  4F7U B;  2OX7 A;  2BZ8 A;  5IXF A;  4F14 A;  5KYX B;  2NUP B;  5GAN d;  1T3L A;  4M7A G;  1BI0 A;  4A53 A;  3URG A;  1YI2 T;  1T3S A;  4J6W A;  3RUX A;  3CCL A;  1E7O A;  4E7S A;  2DIQ A;  1NPR A;  2RQT A;  2L8D A;  1VQP T;  3NTK A;  1KC8 C;  2E4H A;  2RA2 A;  1CKA A;  3JB9 G;  1EX4 A;  1U1T A;  2OI3 A;  3KFV A;  5L8R E;  3DLM A;  2YT6 A;  1W2B S;  1ZSZ B;  3ME9 A;  3CQT A;  2XDD A;  2K4Y A;  4M7D E;  2QAS A;  4O5V A;  2EGA A;  4J6Y A;  1IGU A;  4RMO A;  1A0N B;  2NUT B;  4L59 A;  2VV5 A;  1FXX A;  1JXM A;  3OYJ A;  3LYI A;  1VQL T;  1WHG A;  3CCV Q;  1X43 A;  1WGS A;  2QEX T;  5FU7 B;  3SD4 A;  3JB9 I;  3CC2 A;  1M1K R;  3GOX A;  1WJS A;  4E7K A;  3FRN A;  2RN8 A;  5GMK m;  1RI9 A;  1YIT Q;  4II1 A;  4CRI A;  5KE3 A;  1I1J A;  1N9R A;  3VU3 C;  1D09 B;  3X24 B;  3VRZ A;  4KGX B;  3OYG A;  2JTF A;  4ESR A;  4A4H A;  1H3H A;  1K9A A;  2K5F A;  2Y4X A;  1OQK A;  5CKE A;  1B34 A;  2EYZ A;  2QQS A;  1X6O A;  3UA7 A;  3QYG B;  1RAG B;  3VYH B;  3G7Z A;  1YIJ A;  4JDS A;  4BB7 A;  1YHQ Q;  5EG2 A;  4LDX A;  1WJR A;  2O31 A;  3EFR A;  2KQW A;  5HK3 A;  2R5M A;  1IRE B;  5IAY A;  3S3N A;  3H8Z A;  2HMA A;  1G3S A;  3OQ5 A;  4J9H A;  2L3R A;  3CCE A;  4HVV A;  2P84 A;  5AYF A;  2X51 A;  2GNC A;  4FW2 A;  5KYY B;  3I5R A;  3L2U A;  4OGC A;  3OYE A;  2D0Q B;  1QCN A;  3OMC A;  1TUC A;  5A0G A;  3CCV T;  4HCK A;  1U3O A;  2EFI A;  1NYF A;  3PT9 A;  3RKW A;  4JS4 A;  4PJN A;  1YI2 A;  1K0S A;  3M4G A;  4GBQ A;  2KRS A;  4LDY A;  2L3P A;  3V7R A;  3NTI A;  1VQP A;  2RHY A;  2ZPI B;  1YIT T;  2RPN A;  3GPL A;  4OMO A;  3HKS A;  3CCS T;  1OPL A;  9ATC B;  3PVQ A;  3JAM E;  2COW A;  2V26 A;  3M0U A;  2RQW A;  1U06 A;  3RKX A;  2RNA A;  2KK4 A;  2KRN A;  3QG1 A;  5HCK A;  5GAN g;  3WVE B;  1Z9Q A;  1YHQ T;  2FB7 A;  1BBZ A;  3HP9 A;  1YWO A;  1RUW A;  3GNF B;  5C0M A;  4KUD K;  2XID A;  1X75 C;  2QEX A;  2LNH B;  1KC8 R;  3JCM f;  1NE8 A;  3E2U A;  2ZPE B;  4X1V A;  5CKF A;  4QVD A;  7AT1 B;  1AOJ A;  3ZL7 C;  3Q1J A;  4M4Z A;  1VYV A;  4FU6 A;  2BKD N;  2DTH A;  2JOY A;  5GAN 2;  2YRD A;  3PIP A;  5LJ3 d;  1Q82 U;  5D7U A;  4E47 A;  2PU9 B;  1LJO A;  2DD4 A;  2E5K A;  1K8A U;  1VQK Q;  4PK4 A;  2E3H A;  2R57 A;  4TVR A;  2ESW A;  4QVC A;  2DEQ A;  2DD5 A;  2DX1 A;  3SFM A;  2FPE A;  4M77 C;  3SB2 A;  3CC4 Q;  4B9X A;  4FM4 B;  3J81 E;  4HCC A;  2EYQ A;  2YLC A;  5LJ5 g;  2ROL A;  4MZT A;  4OB0 B;  4PJO C;  2MWO A;  1IHW A;  2AT1 B;  3L1A A;  2KRM A;  2Y4Y A;  2CS7 A;  1B34 B;  1PHT A;  1UEC A;  5LL6 S;  2LJ1 A;  1QWF A;  4RTZ A;  3WVD B;  1VQ6 Q;  1E6G A;  3M56 A;  5GAM d;  4M7D G;  1GBR A;  3M0P A;  5IHI A;  2VGN A;  1VUB A;  3MP6 A;  4YTL A;  2OAW A;  3A8G B;  4JJN K;  2EPD A;  2D6F A;  4M7A F;  1M1F A;  4E7H A;  1D1C A;  4X34 A;  2P0P A;  5CO7 A;  3CCQ Q;  3OB9 A;  2K3Y A;  2C0I A;  1N8R U;  3JB9 D;  5CKD A;  2QQA A;  2XIC A;  1D3B B;  3OYA A;  1YIT A;  1KHC A;  1P92 A;  1NJI C;  3JB9 F;  1KD1 C;  3NTH A;  3CCS A;  2DPP B;  3GF5 A;  2RD1 A;  3QBY A;  1UGP B;  1VQK T;  5DLQ E;  4MMK A;  4MML A;  3M9Q A;  2MI6 A;  1MND A;  3J80 E;  2V8I A;  2JW4 A;  3CC4 T;  1TWB A;  1YHQ A;  1SG5 A;  3L2Q A;  5A0D A;  3L42 A;  3NFC A;  1M90 U;  2X4W A;  3E9G A;  5LJ5 e;  2RQR A;  3CD6 Q;  1ZLM A;  2V8K A;  1SSF A;  3X20 B;  2FRY A;  5CKB A;  3PE0 A;  1Y71 A;  3EFO A;  1H64 1;  1MMA A;  2HL3 A;  2LCS A;  4LDV A;  2AKK A;  2DL5 A;  4MZM A;  2YLB A;  1TUD A;  5HK0 A;  3M4Y A;  1VQ6 T;  1N8R C;  3EH2 A;  3JCM c;  4C8Q C;  2X35 A;  1O75 A;  2YSQ A;  2QQ9 A;  4QT7 A;  3HPW A;  3H41 A;  3C4S A;  4BE0 A;  2DJQ A;  1OU9 A;  1GCQ C;  3CCQ T;  3QWX X;  3JCM h;  3I35 A;  2CDT A;  3A5Z B;  5GAN j;  2DTO A;  5FWC A;  3EGD A;  2PTK A;  5AT1 B;  1MV0 B;  2RI5 A;  1QVG S;  4GLK A;  3R6O A;  5HKC A;  4J9G A;  4FYW B;  3VS2 A;  4D8K A;  4BI4 A;  5CAI A;  2EYX A;  5GJV B;  2J06 A;  4PL6 A;  5M9O A;  1UFF A;  5LJ3 g;  3M59 A;  4OMP A; 
#chains in the Genus database with same CATH homology
 3QJY A;  3CD6 T;  3OYB A;  5D6W A;  4OGE A;  3DB4 A;  1K73 C;  2JZ2 A;  3E1S A;  2DXT A;  3TCJ A;  3E9F A;  3KBG A;  3MCA B;  4DOW A;  2VXE A;  2M16 A;  3QJ6 A;  4M77 D;  1DJ7 B;  1M9S A;  3LGF A;  1OYX A;  4A4F A;  2HAX A;  4M7A D;  5GAM f;  3GIB A;  2E6N A;  3V8K A;  3G6E A;  1M4Z A;  5CR2 A;  3HSB A;  2KMT A;  3I55 A;  4M77 F;  4R56 A;  1VQM T;  3PMI A;  1KQ1 A;  3OS0 A;  1Q86 C;  1WQW A;  3HHT B;  4M75 A;  5GAN 6;  3M57 A;  3BDU A;  5GMK j;  1KC8 U;  2E6Z A;  5GMK i;  1VQ5 A;  2E41 A;  1X01 A;  1OZ2 A;  1JB0 E;  3X26 B;  3G6E T;  4X9D A;  4ATO A;  1YIJ T;  2ZPH B;  3CMA A;  4D6W A;  2CKK A;  3CCM T;  3S3O A;  1N6A A;  2YHT A;  4IUP A;  3TRE A;  4BY6 B;  1JJ2 S;  3H6Z A;  1VQK A;  4ELZ C;  2E65 A;  4BI8 B;  3OS2 A;  1M8V A;  2XHC A;  2CZ0 B;  2OTL T;  4M78 G;  4GY5 A;  2L89 A;  1D3B A;  1Q7Y C;  3ZBD A;  3CCE T;  2HNI A;  2QTX A;  5FLX E;  4BY6 C;  2VXF A;  2XKO C;  1VQ8 A;  3CC4 A;  2R58 A;  4RG2 A;  4C0G A;  4MDX A;  4RG8 A;  4Q5W A;  4XTU A;  3MO8 A;  5KCH A;  4M75 D;  3TEE A;  4N4I A;  1FX7 A;  4QQG A;  1YJ9 T;  2DXB A;  2L5Q A;  4MDW A;  2EQK A;  4E7L A;  3QZ9 B;  3CME A;  2DIG A;  2MWP A;  3OYN A;  4N4H A;  3QO3 A;  2DK3 A;  2GQV A;  5GAN h;  1XOV A;  3MP1 A;  4OVA A;  2EJ9 A;  4F7U B;  3BDL A;  2K3X A;  1N9S A;  4Y91 A;  4C5E A;  5GAN d;  3GP8 A;  2DVE A;  4M7A G;  1M1G A;  1Y96 A;  2CYZ B;  1BI0 A;  3A8H B;  3LH0 A;  3OSV A;  4L6V 5;  3VUB A;  2G3R A;  3URG A;  4A53 A;  4BE2 A;  4ZTJ A;  1KQS A;  2E70 A;  1YI2 T;  3RUX A;  2K5L A;  2RJE A;  4J6W A;  4N4G A;  3CCL A;  1BYM A;  3RIR A;  3HFO A;  1VQ6 A;  3V7S A;  2DIQ A;  1NPR A;  1Q81 U;  4HT9 A;  2L8D A;  2QA4 T;  1VQP T;  3NTK A;  1KC8 C;  2I2L A;  4JRK A;  5GAN 5;  2RA2 A;  2X4X A;  3LX7 A;  2LCL A;  3JB9 G;  1V29 B;  4OMF B;  1YJW A;  3JCM V;  3X25 B;  1U1T A;  2DZC A;  2HD0 A;  1I8F A;  4C8Q E;  5J26 A;  1WJQ A;  1K9M C;  5L8R E;  5GAN 3;  3DLM A;  2E64 A;  2ZGW A;  3CCQ A;  1W2B S;  3A8O B;  3ME9 A;  1QW1 A;  2XDD A;  2K4Y A;  4FT4 A;  2B8A A;  4DOV A;  1YJW T;  3P8H A;  2XDB A;  4ZN1 A;  4M7D E;  2KSS A;  4O5V A;  4J7F A;  1BIB A;  2DZ9 A;  3KUF A;  1PSF A;  4J6Y A;  3HRU A;  4RMO A;  4NS5 A;  5HY6 A;  3FLG A;  4XU1 A;  3MHX A;  1VQL A;  4OB3 B;  4XAX B;  3JCM d;  4M75 G;  4OP0 A;  3PTA A;  2GF7 A;  2QQR A;  2WSF E;  4L59 A;  4CI0 C;  1VQN T;  3V7C A;  3JCM b;  5I21 A;  4M78 B;  3QII A;  2VV5 A;  1FXX A;  1JBM A;  3OYJ A;  2XD0 A;  3LYI A;  1VQL T;  4LDW A;  3OYY A;  1WGS A;  1FWZ A;  2P4T A;  4RCB A;  5FU7 B;  2QEX T;  2OTJ A;  5KH6 A;  5KCO A;  3SD4 A;  4KUL A;  4XQ3 A;  3JB9 I;  4M78 E;  5DM7 R;  3CC2 A;  4OB1 B;  4M78 C;  5LJ5 h;  5LJ3 h;  2O4X B;  4QVZ A;  3OS1 A;  4HT8 A;  4EMK A;  1PSE A;  1Q7Y U;  2WSC E;  1YJN A;  3GOX A;  1WJS A;  3OYF A;  4E7K A;  3CD6 A;  3J7A F;  3FRN A;  5IT9 E;  4PJO A;  2OTJ T;  1Q81 C;  5FU7 C;  4J7I A;  5GMK m;  3CC2 T;  5CCA A;  2RH2 A;  5I2M A;  4II1 A;  4M7A B;  4CRI A;  5KE3 A;  1YJN T;  1N9R A;  3QYH B;  3VU3 C;  2EQJ A;  2LTO A;  3X24 B;  3TU4 K;  2EJF A;  2GFU A;  2CZ1 B;  4ME7 A;  3WXM B;  3BFM A;  2DO3 A;  3OYG A;  2JTF A;  4C0F A;  3OYI A;  3RMQ A;  4A4H A;  2F69 A;  2RK2 A;  3QHS A;  1VQM A;  2DKG A;  2V8J A;  2ZPF B;  4M7A E;  4M7A C;  2BUD A;  2K5F A;  2EKO A;  2Y4X A;  5CKE A;  1B34 A;  3OW2 A;  5GAM h;  4J5Y A;  2QQS A;  4A4K A;  1X6O A;  4C92 F;  3QYG B;  2CZ6 B;  2EAY A;  4MZP A;  5GAN 7;  5GAO q;  2DXU A;  3G7Z A;  1RI0 A;  3VYH B;  1YIJ A;  4JDS A;  2Y90 A;  4HCZ A;  4BB7 A;  4EMH A;  5I2S A;  3CCM A;  3VV0 A;  4PJO D;  5EG2 A;  4LDX A;  1WJR A;  3QXE B;  1QP3 A;  2RO0 A;  1U8R A;  4FL6 A;  3EFR A;  2OAU A;  3QUI A;  4Y28 E;  5GAN e;  3L2W A;  2KQW A;  5HK3 A;  2R5M A;  1IRE B;  5D6X A;  4PJO F;  4ZGD B;  5IAY A;  3S3N A;  4EDU A;  5C6S A;  4HA8 A;  1VQ4 T;  2WSE E;  5LJ5 j;  3H8Z A;  2KDS A;  1UEB A;  1YBY A;  2X4Y A;  1G3S A;  1VIF A;  2RHX A;  2JN0 A;  3RES A;  3OYK A;  2HQX A;  1K9M U;  3AHU A;  2FHD A;  3OQ5 A;  2L3R A;  3FJP A;  3CCE A;  2P0Q A;  2EQM A;  3MEA A;  2E5Q A;  5AYF A;  2LQ8 A;  2M9U A;  4M75 B;  1QVG A;  4LDU A;  3KXT A;  3CCV A;  4BAC A;  3L2U A;  2M0O A;  3DKM A;  4IUV A;  1NPP A;  1R8O B;  4OGC A;  3OYE A;  2D0Q B;  3OYL A;  3C94 A;  4XK8 E;  4XTY A;  2A3L A;  2VC8 A;  1YJ9 A;  3OMC A;  4XTW A;  2XDP A;  3PFS A;  1Q82 C;  1I5L A;  4IUT A;  4FSX A;  4BI3 A;  5A0G A;  5A2Q E;  3MEV A;  3GNG A;  3CCV T;  2RM4 A;  3HRS A;  3INZ A;  4M75 E;  1K8A C;  4M75 C;  4KBM B;  2EFI A;  2EWN A;  3PT9 A;  4FIB A;  2VYT A;  3RKW A;  4JS4 A;  3ZFJ A;  4HCB A;  3HL8 A;  2F5T X;  3CC7 T;  1QVF A;  3E19 A;  2MMP A;  5CVI A;  1YI2 A;  3JB9 H;  2LQK A;  1H3Z A;  3M4G A;  3JRZ A;  3PIO A;  3RMS A;  4LDY A;  3CCR T;  2PVG B;  4M77 G;  2M1H A;  3V7R A;  2JVV A;  3JCM e;  3NTI A;  2HQE A;  4DQ2 A;  3OYH A;  2QA4 A;  4E7I A;  1VQP A;  3OMG A;  1I81 A;  4JUV A;  2RHY A;  2ZPI B;  1YIT T;  5GAN f;  3GPL A;  3HKS A;  3M54 A;  3CCS T;  5DY9 A;  1HXD A;  4PJO G;  4QW2 A;  3UDC A;  4F7U E;  5GAM j;  1VQ9 T;  1G5V A;  2XU8 A;  3FC3 A;  1XNI A;  2FL7 A;  3JAM E;  3M53 A;  3JCM W;  4C8Q A;  1KHI A;  1WNL A;  3UWN A;  5GMK e;  3SDZ A;  4NL2 A;  1Y96 B;  3RKX A;  4RCC A;  2KK4 A;  2E12 A;  5CK9 A;  1UGS B;  3OBW A;  4BDY A;  4X9C A;  2LT1 A;  3QG1 A;  3CCU T;  4M7D A;  2MAM A;  4V2S A;  3MEU A;  4XTV A;  3QPH A;  3C12 A;  3WVE B;  5GAN g;  1YHQ T;  3M55 A;  2FB7 A;  3L2R A;  2LRQ A;  3CEY A;  3HP9 A;  4O6J A;  5CIU A;  3LWI A;  3GNF B;  5C0M A;  3I56 T;  1VQN A;  3ASK A;  3OY9 A;  3CPW A;  4KUD K;  2XID A;  3CXC S;  2LDM A;  3MP8 A;  4XTX A;  3JB9 J;  5FRN A;  3LGL A;  1UGQ B;  3SWN B;  1X75 C;  2K2V A;  1BI3 A;  2QEX A;  3GLX A;  4P5N A;  1NZ9 A;  3QZ5 B;  3JCM f;  1NE8 A;  3G71 T;  3MEW A;  5FRM A;  2ZPE B;  3EFS A;  2PUO B;  4C8Q D;  3CCJ T;  5CKF A;  2LT4 A;  4E7J A;  4QVD A;  1WPY A;  4C92 A;  3L2V A;  4J8O A;  4M78 A;  3O8V A;  3SWN C;  2FVU A;  4C8Q F;  4N0A A;  3OW2 S;  5FRO A;  4NOY A;  2QDY B;  4M7D D;  3Q1J A;  4FU6 A;  3OA6 A;  2BKD N;  2DTH A;  2JOY A;  4RKU E;  3BY7 A;  5GAN 2;  3OYD A;  1VIE A;  5LJ5 d;  3PIP A;  5LJ3 d;  3LWH A;  4M7D F;  3C95 A;  2F5K A;  1Q82 U;  2O4X A;  4JRI A;  1W4S A;  4E47 A;  3JCM g;  2PU9 B;  1LJO A;  2DD4 A;  4M77 B;  4QQ6 A;  3QDR B;  3ZEH A;  1K8A U;  3QKJ A;  2HBP A;  4PNO A;  2DXC A;  4DA4 A;  2FYK A;  2LC4 A;  1N27 A;  2R57 A;  4TVR A;  4C5G A;  1M90 C;  2QQB A;  1ZHI A;  4QVC A;  2DEQ A;  4B9W A;  2DD5 A;  3FIF A;  1MHN A;  4PJO B;  1AHJ B;  2H3J A;  2LX9 A;  4EMG A;  4ZGE B;  1Y07 A;  3CBM A;  3SFM A;  4M77 E;  4M77 C;  3SB2 A;  3L2Z A;  2QXF A;  4IUU A;  3OYM A;  4XU2 A;  4B9X A;  4FM4 B;  2RJF A;  2ZPB B;  4M78 D;  3DB3 A;  4C92 D;  3J81 E;  1XQH A;  3RKY A;  4HCC A;  2EYQ A;  1YCY A;  2YLC A;  3OSS C;  2XG8 D;  4ELY C;  5GAO p;  4ZN3 A;  5GAO n;  5LJ5 g;  4M78 F;  1IZ6 A;  5GAN 8;  4NL3 A;  4MZT A;  4OB0 B;  4PJO C;  1VQ4 A;  2QI2 A;  2PVD B;  2MWO A;  3L1A A;  2JTM A;  4C5I A;  2Y4Y A;  4C8Q G;  5LJ3 j;  2RHI A;  3VYG A;  1QVF S;  2CS7 A;  3G4S T;  4KT0 E;  2E10 A;  4L5G A;  1B34 B;  2JNG A;  2LNV A;  5LL6 S;  2VGM A;  1KG1 A;  5KE2 A;  2ZZD A;  3WVD B;  3JCM X;  1I4K 1;  3M56 A;  5GAM d;  4M7D G;  1KQS S;  3OBY A;  4JLG A;  1U1S A;  2LCC A;  3UT1 A;  2KAF A;  4JLI A;  3V8J A;  4IKF A;  2VGN A;  3HRT A;  1VUB A;  3MP6 A;  4YTL A;  3A8G B;  4FT2 A;  2NLU A;  1OI1 A;  2GFA A;  1HK9 A;  4JJN K;  2P0K A;  3CPF A;  2D6F A;  4M7A F;  1S72 A;  1M1F A;  2RK1 A;  5FU6 B;  4E7H A;  4A4E A;  5GAO r;  3S6W A;  1VQ7 A;  5GAO m;  4X34 A;  2P0P A;  3EAE A;  5CO7 A;  3CC7 A;  1G3Y A;  1MGQ A;  5CQY A;  5J3B A;  3OS5 A;  3OB9 A;  3P8B B;  3I55 T;  2K3Y A;  4PLI A;  3MET A;  3DLL A;  3CCR A;  1N8R U;  3JB9 D;  3CBO A;  4BD3 A;  5CKD A;  1S72 T;  1RL2 A;  2ZCF B;  1ZQ1 A;  2QQA A;  1VQ7 T;  2XIC A;  4JRP A;  1D3B B;  2R5A A;  3JCM Q;  1VQ5 T;  2PUK B;  3OYA A;  1KHC A;  1EIF A;  5FU6 C;  1P92 A;  1YIT A;  1NJI C;  3JB9 F;  4XTZ A;  1M1K U;  1KD1 C;  3NTH A;  4C92 G;  5GAM g;  3CCS A;  1XTD A;  2DPP B;  3JCM J;  3CMA T;  2D9T A;  1VQ9 A;  4UC4 A;  3VUZ A;  3GF5 A;  2RD1 A;  3QBY A;  3CPW S;  2KVQ G;  1O9S A;  1UGP B;  4C0D B;  4F7U A;  1VQK T;  5DLQ E;  1LOJ A;  4MMK A;  4MML A;  4BE1 A;  1G3T A;  3M9Q A;  2MI6 A;  1G3W A;  2EIF A;  3PGG A;  3J80 E;  2CZ7 B;  3V8L A;  4IUR A;  4ZGJ B;  3CCU A;  2V8I A;  2XI9 A;  3X28 B;  3RER A;  2RI2 A;  3CC4 T;  1VQ8 T;  4C0D C;  1YHQ A;  3L2Q A;  4M75 F;  5A0D A;  2KY9 A;  1TH7 A;  3L42 A;  5IN1 A;  3NFC A;  1M90 U;  2X4W A;  4OF1 A;  4C0Z A;  4EPC A;  3I56 A;  3E9G A;  3N5B B;  1JRI A;  3QSU A;  1M5Q 1;  5LJ5 e;  5LJ3 e;  1JJ2 A;  3VKI A;  5A0L A;  2V8K A;  2VUB A;  1SSF A;  3FDR A;  3CME T;  3X20 B;  2K5I A;  2RHU A;  3PMT A;  5CKB A;  3OYC A;  1QVP A;  2A7Y A;  1Y71 A;  1ZBX A;  1BI2 A;  1H64 1;  4C8Q B;  1GXI E;  4LDV A;  5GMK l;  3FEO A;  5CKH A;  4MZM A;  2RHZ A;  2YLB A;  4OB2 B;  4BUG A;  2ZPG B;  3G71 A;  4BDZ A;  4LD9 K;  2MF2 A;  5DLO A;  2IG0 A;  3CCJ A;  5HK0 A;  1QP2 A;  3CCL T;  2WAC A;  3M4Y A;  1KQ2 A;  4M7D B;  4J83 A;  1VQ6 T;  4IUQ A;  4F7U F;  3CBP A;  3JCM c;  1N8R C;  1BKB A;  4C8Q C;  2X35 A;  1K73 U;  1LNX A;  3SWN A;  3P8D A;  1O75 A;  4XU3 A;  2QQ9 A;  3PNW C;  1VQO A;  4A54 A;  3M5A A;  3HPW A;  5D6Y A;  1M1K C;  2BIV A;  3T9N A;  2EQU A;  2YRV A;  4PLL A;  4VUB A;  2GCX A;  2DJZ A;  3C4S A;  4BE0 A;  4M7D C;  2CGH A;  4XU0 A;  3M58 A;  2C06 A;  3LLR A;  2X4J A;  2AHJ B;  3CCQ T;  3A8L B;  3JCM h;  1VQO T;  1OZ3 A;  2IVW A;  5CQX A;  4KUI A;  3A8M B;  2E1H A;  2RB6 A;  3A5Z B;  4R55 A;  5GAN j;  1Q86 U;  3HFN A;  2DTO A;  4Z02 A;  4C92 B;  5LJ5 f;  5LJ3 f;  4JRQ A;  1UGR B;  1BIA A;  2XK0 A;  5GAM e;  3LW5 E;  5J39 A;  5GMK h;  2K57 A;  3ER0 A;  4WF2 A;  2OTL A;  4QQD A;  2LVM A;  4EMK B;  4M77 A;  4JS5 A;  3F70 A;  2RI5 A;  1QVG S;  1BI1 A;  1NJI U;  4GLK A;  4M7A A;  4C92 E;  3VJP A;  2EJG A;  4C92 C;  1W2B A;  1WQ7 A;  4J6X A;  1KD1 U;  3R6O A;  5HKC A;  2RJD A;  4PKC C;  4ZTF A;  2DAQ A;  4N0A C;  4BI4 A;  1Y7X A;  3JSC A;  5CAI A;  3S3M A;  2DTI A;  2JUF A;  2PQW A;  2RI3 A;  4LD6 A;  4C5H A;  2O01 E;  5GAN 4;  5GAO l;  3BW1 A;  4PL6 A;  5M9O A;  4F7U G;  3JCM P;  3FB9 A;  4HKE A;  4EMK C;  5LJ3 g;  3G4S A;  4PJO E;  1UB4 A;  2RJC A;  3CXC A;  2PVO B;  3UPU A;  3M59 A;  4A4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...