4M7AD

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
VTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 74
sequence length 74
chains with identical sequence K
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aD00
2EJGA 3RKYA 2DZCA 2E65A 5GAN4 3QSUA 5GAOn 4M78D 4EMHA 3SWNB 3V7RA 5GAMf 4X9DA 2DVEA 3SWNC 3JCMQ 4XQ3A 4OP0A 4HT8A 4XTVA 2VC8A 5LJ3j 3JCMd 4M7AG 1HXDA 3JCMe 3JB9F 2E41A 4C92F 5GANj 1X01A 3JCMh 4QVCA 4M77D 1WQ7A 4EMGA 1WQWA 2I2LA 3PGGA 4EMKA 5GAMj 3EFRA 2EJFA 1JBMA 1N9SA 5GAN3 4F7UG 4M7AA 4XTUA 1H641 2VXFA 5GANe 3M4GA 3V8KA 4EMKB 5GAN8 3JCMJ 4M7DG 4M7AE 3QUIA 4M77F 4EMKC 5GMKh 3BW1A 1LJOA 4M7AB 5LJ3g 3HFNA 5GAMe 4J5YA 4M78A 4PJOG 4M7AC 5GANg 2HNIA 2RD1A 4JRIA 1BIAA 4M78E 4RCBA 4F7UA 5CAIA 3JB9D 4C92D 5GAN2 3V7SA 5LJ5f 4M78B 4PNOA 3HSBA 4M7DA 4M75A 4F7UE 5GAMg 4WF2A 4M78C 1JRIA 3GIBA 4XTZA 5LJ3d 4F7UB 3HFOA 3JCMW 4M75E 4M7DE 4C8QA 5GAOm 3L1AA 4M7DB 4PJOA 3BFMA 4M75B 5GANd 4M7DC 2RA2A 1LNXA 4M75C 4C8QE 4N0AA 4HT9A 4PJOE 5GANh 4C8QB 4PJOB 2EAYA 5GAMd 4C8QC 1U1SA 3JCMc 4JUVA 4M78G 5LJ5j 4PJOC 3JCMX 1I81A 4N0AC 3AHUA 5GAN7 3JCMf 4A54A 4RCCA 4M75G 2RB6A 4JLIA 4J6WA 5GMKe 5LJ5e 4C8QG 5GAOp 2DTHA 1U1TA 3RKWA 3JCMV 4QVDA 4M7AF 2DJZA 2CGHA 2VXEA 2Y90A 4C92E 3V8JA 2E1HA 1M5Q1 5LJ5g 2YLBA 3JB9J 2FB7A 4X9CA 2FYKA 5GMKi 3V8LA 4J6YA 1Y96A 4F7UF 1BIBA 5GAOr 4M77A 3EFSA 4M7DF 5LJ3h 1M8VA 3JCMb 4M77E 1Y96B 4A53A 3BDUA 2DXUA 2EWNA 5LJ5d 3FJPA 4MMKA 3VU3C 3BY7A 4M77B 3RKXA 5GMKj 4PJOF 4C92G 3JB9G 4J6XA 4M77C 4XTWA 1N9RA 3RESA 1I4K1 4M7AD 5LJ3f 5GAMh 2YHTA 5I21A 2DZ9A 5GANf 3JCMP 2E10A 2DTOA 4XTXA 2DTIA 3V7CA 4HA8A 2YLCA 2JN0A 3RIRA 4JRKA 4C92A 1KQ1A 3INZA 5GMKm 5GAOl 4M77G 1YCYA 1TH7A 1D3BA 3QHSA 4M7DD 1LOJA 1WPYA 4M75D 4XU2A 4C92B 4NL3A 1WNLA 3FIFA 4V2SA 4MMLA 2K57A 3FB9A 3QO3A 4M78F 4C92C 2QTXA 2ZGWA 1D3BB 4XU0A 4C8QD 4Y91A 5GAOq 3JB9I 4PJOD 4XTYA 4XU1A 5DY9A 1I5LA 3L2ZA 2RM4A 2DXTA 4M75F 3RUXA 1HK9A 1MGQA 2DEQA 5LJ3e 3JB9H 4NL2A 1B34A 2DKGA 4DQ2A 4C8QF 4NOYA 5GAN6 4XU3A 1I8FA 3SB2A 3RERA 5GMKl 5LJ5h 2E64A 1B34B 1KQ2A 3SWNA 2EJ9A 3JCMg 5GAN5
chains in the Genus database with same CATH superfamily
2PUOB 1TUDA 2V1QA 2DEUA 4JJBA 2K79A 3OBYA 3H0IA 2YSQA 4OMPA 5HK0A 1KG1A 3CPWP 1WQ7A 1WQWA 4FYVB 2RF0A 4F7UG 1M1KR 3OYCA 3M4GA 4PLLA 2D6FA 4N4GA 2RH2A 4J8OA 1IRXA 3M54A 3OYLA 2DBMA 3T9NA 1QWEA 4FT4A 1X43A 4PNOA 2CT3A 2P84A 2VVKA 4M75E 2JTFA 2M0OA 4OMNA 2HKNA 3CCSQ 3UT1A 3GF5A 2DF6A 3U23A 3EHRA 3EH2A 4C8QC 3MEAA 2MWPA 3VRYA 3PIOA 3CCSA 3CCUQ 5GMKe 1U1TA 2ROLA 1K4US 1YWPA 3CCUA 2YLBA 4X9CA 4ELZC 1K73C 2ZZDA 2LVMA 3V8LA 1MNEA 4CC7A 1JEGA 4JRQA 2CT4A 4MMKA 1RAAB 5KYUB 4M77C 3RESA 2EQJA 1Q7YU 2JTEA 2C0IA 2W0ZA 1OX9A 2K7AA 1K0XA 3I35A 4GLKA 5AT1B 1KQ1A 2XIDA 3INZA 4ORZA 2QASA 3ZL7C 4F16A 1X6GA 4M75D 2CSQA 3SHWA 3H41A 2GTOA 4KH1B 2GGRA 2XU8A 1I5LA 3JB9H 4OB1B 3RBBB 1RADB 3SB2A 3CD6Q 2NWMA 3MP1A 3JCMg 4Z88A 1NE8A 2BTTA 2E65A 2ZPIB 3KBGA 5C0MA 8ATCB 1YJWQ 3CD6A 3SWNB 1AEYA 2KVQG 1Y7XA 2M16A 1PG5B 3LYIA 3ME9A 4M7AG 2EQMA 1YJWA 2BZ8A 2F2VA 2KT1A 2F69A 1QVPA 2PU9B 1VA7A 1JXOA 1QLYA 3QKJA 5GAN8 1NYFA 4PL6A 2QEXQ 1YJWT 3MEVA 4M7AC 1C1AA 2RD1A 2JM8A 2PVDB 2QEXA 2QQBA 1QVFS 4BI4A 5GAMg 2LJ0A 4E7HA 4M7DE 4CC4B 2RA2A 1LNXA 2NUPA 1XTDA 2QEXT 4PJOB 2RHYA 5I2MA 2LJ3A 3JCMX 3EG2A 4OF1A 3OYAA 2ZPEB 4BY6B 4BDYA 1PHTA 2RHUA 3LWHA 1IO6A 4IUPA 4QVDA 3FRNA 5HK3A 3L2UA 1NM7A 4BACA 1MV3A 4A53A 1Y96B 2DO3A 2EGCA 3JCMW 2CREA 4PJOF 1WHJA 3WVDB 2E10A 2L3RA 1WX6A 4DBFA 1TSFA 4C92A 5GAOl 3CXCA 3DLLA 4HVWA 3S3MA 4M7DD 5GAOq 2LMJA 2EBPA 2XHCA 3OS0A 1XOVA 2M02A 4E2FB 1YJ9Q 2CSIA 4B9WA 1WXBA 5LJ3e 1ZHIA 3VUBA 4AMCA 1K8AC 1Q81R 5GMKl 2RNAA 1YJ9A 1AVZC 2VASA 2QQSA 5GAMf 1NLPC 2D0QB 2C0OA 3VYHB 3JRZA 1YJ9T 3GBQA 2RHZA 1AD5A 2CZ0B 3QZ9B 5IHNA 3J80E 1KQSP 3VUZA 1KD1R 1X2KA 4LE9A 3OYDA 1Q82U 4EMGA 1SSHA 3PGGA 4J9CA 5DLOA 1FWZA 4MDXA 2KMTA 2LDMA 1QVFP 2M1HA 3QUIA 3A8HB 1WJSA 2LCLA 3RMSA 3HFNA 2F5TX 2RI2A 3TVTA 4F7UE 2V8KA 1U3OA 4E7KA 1Z9ZA 1RAHB 3MP8A 3L1AA 4BD3A 1RLQC 4C8QE 4JJDA 4KT0E 4K11A 4N0AC 3EG9A 1U5SA 1FYNA 2ZPBB 3ZBDA 3CPWA 3OA6A 3OW2A 1M9SA 2E1HA 2RK1A 3TU4K 2ZPFB 1VQ4Q 1N27A 4PLIA 4M77E 1TOVA 5GANh 2DETA 1KHIA 2MMPA 3X26B 3OYJA 3RKXA 4FCYA 1M30A 1VQ4A 1RI0A 1H3HA 1X69A 1R77A 5GANf 2P4RA 1NZ9A 2JZ2A 2FPDA 2X51A 2HMAA 1S1NA 2O4XA 1ABQA 1TH7A 1VQ4T 4FW1A 4DOVA 4MZPA 3H8ZA 4C8QD 1BBZA 3H0FA 3QJYA 2RJFA 1H3ZA 1T0HA 3I5SA 2L3PA 2PQWA 1ZSZA 1GXIE 3OYFA 1F1BB 2YUPA 3CCEQ 4E7ZA 4R0KA 2DZCA 3CCEA 2BKDN 1NBEB 2XICA 5CKEA 2RQUA 1PKTA 3DB4A 3JB9F 4HVUA 2EPDA 3R6OA 1EIFA 2PVOB 1ZLMA 1BI0A 3PIPA 3CCET 4M77D 1WHLA 1UGVA 4OB3B 3MEWA 2KSSA 1Q95G 2EQUA 2X4WA 4M7AE 1OU8A 2DL4A 2CYZB 1Y57A 1SF9A 2X4XA 1K0SA 1LVKA 3V7SA 2KXDA 2HAXA 1UHCA 4WF2A 4M78C 3G6EQ 3LW5E 3NHNA 3BFMA 5CCAA 3H0HA 3M56A 3FJ5A 4DA4A 3G6EA 2EAYA 3A1PA 2DL7A 3HPWA 1X6OA 4ZGDB 5GAN7 3MJXA 1VQOQ 2OX7A 4FIBA 2JS0A 3FEOA 4M75G 3E19A 2CH4A 4JLIA 3J81E 2D8HA 3G6ET 1K73U 2HQHA 3CCJQ 1UG1A 1VQOA 4C92E 1WDXA 2K2MA 3O5ZA 3EGXA 2NUZA 2O01E 5GMKi 3CCJA 4PK4A 2E3IA 1YN8A 3TCJA 1VQOT 3BDUA 4O5VA 3EAEA 4XTWA 4M7AD 3CCJT 2MAMA 3EG3A 1UGRB 2YLCA 5KE2A 1RLPC 2YWWA 2AIRB 4R55A 3TSZA 3UA6A 2LQNA 2GF7A 4M4ZA 2DXTA 1RAFB 3HRSA 4OB2B 3WVEB 4QVZA 4FYWB 1SKUB 4EMHA 3L2VA 1K9MU 3ULRB 1GL5A 3KUFA 4KRTA 2KR3A 4AG1C 5GANe 4EMKB 5IN1A 5KH6A 4XK8E 4C5HA 5GMKh 3EH1A 1BI1A 4AT1B 1QKWA 1N8RU 1KFZA 3OSVA 3SFMA 4JS5A 3PVLA 3J7AF 5FU6C 1D1AA 1IZ6A 3L2WA 1PKSA 5FROA 1UTIA 3BDLA 3CC2Q 2RPNA 2FEIA 2DFUA 2J7IA 3THKA 2E6ZA 2RHXA 1CSKA 1KQSA 5GAOp 3CC2A 4OB0B 3TQ7P 1KK7A 1NPRA 4FYXB 4DBHA 4HCBA 3M57A 3GOXA 4QT7A 2FB7A 2LC4A 4J6YA 2MWOA 1R0BG 3CC2T 2E6NA 3KFVA 5KYUA 3JCMb 1M90U 2AT1B 4DEYA 2QK0A 4J6XA 2QYZA 2YHTA 3VS1A 1YBYA 2DTOA 1NJIC 2OTJQ 2A36A 3G1JA 5AYFA 1PD0A 2MYSA 2SRCA 1UGPB 2CP5A 1OEBA 4NL3A 2OTJA 3FB9A 4MZTA 4ANJA 1K8AU 1I5OB 1RAGB 2QDLA 1ZSGA 1I1JA 2HKQB 2SEMA 4J9FA 3SWNA 1UHFA 1RACB 5A0GA 2HZYA 3MKDA 3CC4Q 2DM1A 4OP0A 1ZA1B 2QQAA 1EZZB 2DERA 3JCMd 2DD5A 3FC3A 2ATCB 2DIGA 5GANj 3CC4A 3FLGA 1WZOA 4AFZC 3GPLA 3E9FA 5A0LA 1H641 1Z9QA 5IT9E 4D8KA 2VUBA 2EKHA 4RTYA 3CC4T 5IH2A 3SD4A 2HDAA 1WI7A 4C0DC 2XDPA 4M78E 4J7IA 4J9HA 1IB8A 2KRSA 3JV3A 2YRDA 3CC7Q 3MP6A 4PJOA 4M75B 5FU7B 3R6NA 3CC7A 2H8HA 2CP7A 5GAMd 2KI7A 3JSCA 1PSEA 1WLPB 3OB9A 4LDWA 2A0FB 1G2BA 1AZEA 4J83A 4C8QG 3CC7T 4ME7A 4RTVA 2FRYA 1SHGA 5EG2A 3VS6A 4RTTA 2A7YA 2COZA 1M27C 4VUBA 3NTIA 3QYHB 3QYGB 1Y96A 5GAOr 3DKMA 5LJ3h 2LP5A 3C95A 3H6ZA 5FRNA 2DXUA 1KIKA 2DLPA 2CP6A 5LJ3f 2WSFE 4KBMB 2DIQA 5D6YA 5KYWB 1G3SA 1CKAA 4IKFA 4HA8A 3RIRA 4M77G 1V29B 4ZNXA 2IPOB 3FIFA 4PJLA 3VJPA 3CCLQ 3OS5A 3RUXA 4A4FA 2QGGA 3ZEHA 2KRNA 3X24B 5GAN6 4IIMA 4RG8A 3CCLA 1Q7YR 5LJ5h 5HCKA 4FL6A 2GQIA 1UJYA 4WCIA 5EC7A 3CCLT 3L2RA 1H8KA 1KSWA 3QZ5B 2I2LA 2MI6A 5GAN3 3A98A 1D0XA 1M2OA 2FZKB 2KE9A 4RCBA 3OYNA 2FPFA 3GIBA 4XTZA 2Y4YA 4M7DB 1G83A 1TS9A 3MPUB 5DM7R 1K9MC 2BE9B 2RQWA 1U1SA 1QWFA 1I81A 2L0AA 2MF2A 4CRIA 2KXCA 1SPKA 2DJZA 1RAEB 5I11A 4FM4B 1M3BA 1JJ2S 1MMAA 5D7UA 3OS1A 4OVAA 1PCXA 5J26A 3EFSA 1YNZA 4M7DF 1BKBA 1N8RC 1KHCA 2BZXA 5GMKj 4C92G 3EGDB 2KEAA 1G3WA 1NLOC 4FYYB 3JCMP 4E7LA 3VKIA 2CH4W 4CC3A 4XAXB 1YFNA 1QP2A 2LT4A 3QHSA 1G3YA 3H9NA 5M9OA 3F70A 4C92C 4ZTFA 4ESRA 2FVUA 1JXMA 4NL2A 1V76A 3OSSC 1B07A 1UJ0A 3LGFA 1PD1A 1QW1A 1M90C 3GP8A 2KQWA 1KC8C 1BCMA 2V1RA 3C4SA 4C5EA 1BYMA 2L3QA 1W70A 2O88A 4AG2C 2LQ8A 3HP9A 3N5BB 2E41A 2KK4A 2ED0A 1X01A 3JCMh 3QXEB 1WFWA 4QVCA 4JPBW 3EFRA 1ARKA 1TWBA 2O31A 2VKNA 3ZFJA 5IHKA 2RK2A 1WHGA 3BW1A 1D0ZA 3EFOB 4J5YA 3JAME 5GANg 4LUDA 1TG0A 1IXDA 3P8DA 3HSBA 1K76A 2DA9A 5I22A 1SHFA 2LQKA 2KAFA 4F7UB 2B8AA 3L2QA 1VQMQ 1ZBJA 4C8QB 4BE1A 1Q82R 2LT1A 1WXTA 1VQMA 4MDWA 5CQXA 3CMAT 3AHUA 4EIKA 4J9BA 2YRVA 4J9DA 2C0TA 5LJ5e 3RKWA 2J06A 3OBWA 3A8LB 1VQMT 5J3BA 2Y90A 2K2VA 3V8JA 4X34A 2F1LA 1QP3A 3JB9J 3IQLA 2BIVA 3VS0A 4F7UF 1QKXA 2EYZA 2G6FX 1M8VA 3S3NA 3M0PA 5GAN4 1NJIU 4M77B 2HSPA 2DRMA 3EG1A 3MHXA 5D6WA 4AFSC 1N9RA 4HCCA 2BUDA 1BB9A 2J6OA 2IIMA 2FZCB 1R0CB 9ATCB 5FRMA 1OPKA 1X2QA 2ZGWA 1WA7A 3JB9I 3M53A 2A37A 2OAWA 1U06A 2DNUA 4LN2A 2KYMA 2VB6A 4TVRA 1ZSZC 2EJ9A 1M1KC 4Y28E 2O2OA 4HXJA 1MMDA 4LDVA 5LJ3j 1D1BA 2JW4A 4RTWA 3C94A 1D1CA 1Q86C 3RDVA 4FSSA 4JDSA 4EMKA 2KBTA 4B9XA 4E7JA 3CBOA 2FG0A 2DVJA 3NMZC 1RL2A 1UFFA 1ZX6A 3VV0A 3G71Q 2HSEB 3DLMA 2NLUA 4M7AB 3G71A 1SRMA 1X75C 3RMQA 2GTJA 1ZUKA 3PVQA 4RKUE 1H92A 2R5AA 2O9SA 1E6HA 1UGSB 2CP2A 1UECA 3G71T 5LJ5j 4JUVA 4M78G 2HEQA 1BCOA 4JJCA 3O8VA 3TEEA 4GBQA 4Y92A 3M9QA 3JCMV 4M7AF 5D6XA 2DRKA 2CGHA 2VXEA 5KYYB 1HD3A 1M5Q1 2LTOA 3HRUA 4X1VA 2M51A 1MMGA 1WHHA 3CCQQ 3META 1Y71A 2YDLA 2R5MA 2EWNA 3JCMe 2H3JA 1VUBA 2HBWA 3OYYA 1I4K1 3CCQA 1DJ7B 2XI9A 4C5IA 2JVVA 2PZ1A 2KT8A 3M0QA 1NYGA 1K73R 1FX7A 2B86A 3CCQT 1LOJA 4LDXA 4XU2A 2XD0A 1WNLA 3OYIA 2MCNA 2COWA 3VRZA 2DEQA 2DX1A 2VV5A 5DLQE 4DQ2A 4NOYA 2DYIA 1PSFA 2AZSA 2JNGA 1AWOA 2GFUA 2O9VA 2CDTA 5I21A 2QDYB 2JMCA 4C0GA 3LGLA 3JCMQ 4O6JA 3OS2A 1PWTA 3CCVQ 3MO8A 2EQKA 1FMVA 5HKCA 3M55A 1JBMA 4E6RA 1VQPQ 1A0NB 1FMWA 2D0NA 2KDSA 3CCVA 4JRPA 1MUZA 2WSEE 3CXCS 1VQPA 1EX4A 3REAB 1XNIA 4C92D 5GAN2 2HL5C 1K1ZA 2EYQA 4M75A 3VS2A 1K9MR 1M1FA 1GCQA 3CCVT 4OMOA 5GAOm 2DJQA 2YUNA 1VQPT 5ECAA 4EPCA 1YITQ 3A5ZB 1ZA2B 3M0TA 2L5QA 2L2PA 2CUDA 2P0PA 1G5VA 1VOMA 4CC2A 1YITA 1UE9A 4RCCA 3NTKA 2AK5A 7AT1B 3LWIA 1OU9A 2F2XA 3I5RA 2HQXA 3SDZA 4ZN3A 1YITT 1N8RR 4A4KA 2ZAEA 2LZ6B 3OYEA 2ZPGB 1BIBA 3UA7A 2DILA 1IGUA 2EGEA 1JB0E 1RABB 8AT1B 3HKSA 1WYXA 5IHIA 5KYWA 1OYXA 3M0UA 3UF4A 2A3LA 1M4ZA 2DTIA 4N4HA 4JRKA 2KYBA 2K5FA 1YCYA 2KY9A 3G4ST 2OI3A 4Y91A 2RJCA 4KGZB 1QVFA 4XTYA 5FWBA 1KJWA 2XKOC 1HK9A 4E7SA 1PC0A 1C6VX 1M90R 1KC8U 3CPWS 1T0JA 3OW2S 2HD0A 4F04B 5CVIA 3RKYA 2LQWA 3UWNA 3CMEQ 1HSQA 3SWNC 2DVEA 4XQ3A 3CBMA 3OYBA 4XTVA 3CMEA 4YTLA 1K8AR 4QQGA 4A4EA 5C6SA 1TXQA 1CKBA 4LDUA 2V8IA 3CMET 1OX8A 1OZ2A 1K9AA 4JZ3A 5LJ3g 3S3OA 1Y0MA 4PJOG 2GQVA 4M78B 2DYBA 4M7DA 2OAUA 3G7ZA 1GFCA 3CBPA 2QQ9A 3TSWA 1I0CA 1XJWB 4OMMA 3HHTB 2L89A 3CCMQ 3HRTA 1C0MA 3JCMc 4PJOC 2D8JA 3QPHA 2X4YA 5GJWB 3OQ5A 2MPXC 3C12A 4ZN1A 3CCMA 4BY6C 4FT2A 1WXUA 4DOWA 2EYYA 4IURA 1MV0B 1WJQA 2EGAA 1VQNT 5LJ5g 3CCMT 1ZUYA 1GRIA 4RMOA 2FYKA 3CCRQ 1IGQA 1EFNA 2V26A 4HCKA 3EGDA 2A28A 3CCRA 5J39A 1XQHA 4L6V5 1VYTA 5I2SA 5KYXA 3QG1A 1M8MA 2OTLQ 1ACMB 1W2BS 4DBQA 4J9GA 3E2UA 3CCRT 1PRLC 2OTLA 1WPYA 2H3EB 2FHDA 4V2SA 2K57A 2OJ2A 2DAQA 2DL8A 3PT9A 1MNDA 3OW2P 2GBQA 3NGPA 2WACA 4M75F 2RQRA 1M1KU 2OTLT 3REBB 2EYWA 1M2VB 1MHNA 2ZPHB 1IREB 3I56Q 1VIEA 4OGEA 4LNPA 4J9EA 2QA4Q 3NTHA 1M3AA 4DBRA 3A8MB 2M9UA 4M78D 1ZUUA 3I56A 3V7RA 2ECZA 4X9DA 2QA4A 1Q86U 1Q86R 3PNWC 4J7FA 5CK9A 2JT4A 1UDLA 2DL5A 2X3WD 2AHJB 2DBKA 5KYNA 3I56T 2VGNA 2QTVA 1AHJB 2QA4T 3EFOA 2J6FA 4IUTA 1WHMA 3LH5A 3V8KA 3X28B 2FPEA 4BE2A 1OOTA 3VYGA 2LRQA 2HNIA 4BI8B 4JZ4A 4JRIA 4F7UA 1SRLA 5LJ5f 3CCST 3A8GB 2RQTA 1W1FA 1VQKQ 1N5ZA 4C8QA 1O9SA 5FU6B 4E7IA 5GANd 1U8RA 2GCXA 4PFZA 1VQKA 3CCUT 1T3LA 1BU1A 2HQEA 3LLRA 1YIJQ 2LJ1A 1OI1A 3EHQA 2ROTA 2RQVA 1VQKT 1WHKA 2DTHA 2FZGB 4L59A 2C06A 1YIJA 4F17A 1E7OA 4LD6A 4OMFB 3D7SB 1PM3A 1P92A 1BK2A 4M77A 2ED1A 2NUTB 4BI3A 1W2BP 1YIJT 1OULA 1UUEA 3PFSA 3JB9G 2X3XD 4Z89A 1D0YA 3C0CA 2EVRA 2K4YA 1S72Q 1YP5A 1QVGS 1LCKA 4LDYA 4ZGEB 1WJRA 3QDFA 1S72A 5CKDA 1G3TA 2CKKA 1D3BB 2LX7A 5DY9A 3CD6T 1B7TA 4QW2A 4NS5A 1VQ6Q 2DKGA 1KQSS 2LNVA 3M0RA 1M3CA 1S72T 4XU3A 1QCFA 3VS3A 1B34B 2K3BA 3PE0A 1TTHB 2QI2A 1VQ6A 2P4TA 2EJGA 4L5GA 2E5QA 2XDDA 5GAOn 5KYXB 3OYMA 1IHWA 2CZ7B 2VC8A 5IXBA 4C0FA 1OQKA 1VQ6T 2JMAA 1BI3A 1O75A 2DPPB 3VS5A 3QDRB 3P8HA 4RG2A 1N9SA 3KXTA 4M7AA 1IHVA 1BI2A 3GNFB 4ZTJA 2F2WA 5IAYA 2L8DA 2QXFA 3OYHA 4UC4A 4C0DB 3A8OB 3PMTA 3PMIA 4KH0B 3Q1JA 3HFOA 1YCSB 3P8BB 2DK3A 4HT9A 4PJOE 2VYTA 6AT1B 2FL7A 1ABOA 1W4SA 2GNCA 2K5LA 4N4IA 1LPLA 4GY5A 3JCMf 4A54A 1TUCA 5KYYA 3VS7A 1GCPA 3CMAQ 4LD9K 2DXCA 5CQYA 5IXFA 5CIUA 2JM9A 1YHQQ 1RI9A 3NPFA 3QWXX 5CR2A 3CMAA 2AZVA 1AT1B 4FU6A 1AZGB 4RTXA 4C0ZA 1YHQA 2L3SA 2NYSA 3VU3C 1QVGP 3BY7A 1QCOA 1Q81U 5GAMh 2E3HA 2ABLA 2CS7A 1JJ2P 2YRCA 1AWJA 3VS4A 4IUQA 1JQQA 3V7CA 1VQ9Q 1YHQT 2JN0A 1HJDA 1G8XA 1RAIB 2CP3A 2JOYA 2CUBA 2J05A 1VQ9A 2DMOA 2QTXA 4J9IA 1KD1U 2KNBB 1N6AA 4KUDK 4PJOD 1V1CA 2DL3A 4XU1A 1UEBA 2DXBA 2BZYA 2QAZA 5GJVB 1MGQA 4PFPA 2X4JA 1NJIR 4C8QF 1I8FA 1VQ9T 4PFOA 5CO7A 2P0KA 2D9TA 1I07A 4ZGJB 5GAN5 4Z8AA 4QQ6A 3MCAB 4KGXB 2XG8D 2X9HA 3M59A 2Y4XA 1HXDA 3EG0A 3OMCA 1NG2A 4BE0A 5KCHA 2I0NA 4HKEA 1OPLA 2MOXA 1VQ5Q 2YT6A 2F5KA 1TUGB 4XTUA 2JTMA 4JLGA 4M77F 4EMKC 2K3XA 1SEMA 1VQ5A 1FXXA 3X25B 2RMOA 2VWFA 2W10A 2QQRA 1MMNA 3M5AA 3L42A 1VQ5T 3AT1B 4N0AA 2LCCA 3GNGA 2NUPB 4DEXA 4OMQA 4Z02A 2DE0X 3S6WA 2RI5A 4CI0C 4A63B 1D09B 4JS4A 3GLXA 4GLMA 4ATOA 2E70A 2XK0A 2RHIA 3FJPA 2A08A 2R57A 2DD4A 1GFDA 3I55Q 4BDZA 1Q7YC 4OMLA 5L23A 4PJMA 3I55A 3UPUA 4A4HA 3URGA 3I9QA 4C92B 1HYOA 3WXMB 2JUFA 3QO3A 5A2QE 3QWYA 1R8OB 1VQ7Q 3L2ZA 2RI3A 2K9GA 1NEGA 4LUEA 3I55T 4P5NA 2EW3A 1VQ7A 4ELYC 2MIOA 2EFIA 4KGVB 5FWCA 4KUIA 2RJDA 1QQJA 3QIIA 4QKUA 1W2BA 4R56A 4BB7A 1E6GA 4PJNA 4HT8A 1VQ7T 2XDBA 5KE3A 1TU0B 3RR6A 4C92F 4Q5WA 1AWWA 3E1SA 2EJFA 1YJNQ 5A0DA 2ESWA 3EGUA 3NFCA 3HL8A 1B3QA 1VYUA 3CQTA 1YJNA 2FO0A 5GAMe 4M78A 3JB9D 1YWOA 2JJ9A 2CZ6B 2LX9A 2X35A 1J3TA 4D8DA 2QG9B 1VQ8Q 1JRIA 5LJ3d 3PTAA 2QGFB 3CPFA 1YJNT 4C5GA 1T3SA 4M75C 3OY9A 1VQ8A 5LL6S 1GCQC 1ZQ1A 5FU7C 3ER0A 3UDCA 2HBPA 2RJEA 3ASKA 2CZ1B 2D1XA 4KULA 3MEUA 2RB6A 3UATA 2LNHB 1YI2Q 4J6WA 1VQ8T 3EG9B 2YUQA 3OYGA 2E12A 4RTUA 1YI2A 2V8JA 3OYKA 4JJNK 2IVWA 2P0QA 2BE7D 4II1A 3RNJA 4PJJA 5LJ5d 1YI2T 1W6XA 4WTOB 3SEMA 1M1GA 2JXBA 5GMKm 1NPPA 1SG5A 4IUUA 2YUOA 1AOJA 1X6BA 1RUWA 2O4XB 3FDRA 4XU0A 4QQDA 1PNJA 1GBQA 2ENMA 4IIOA 1M2VA 2IG0A 2RM4A 5CKFA 3G4SQ 2PNIA 1QCNA 2FRWA 5CKHA 1ZSZB 2E64A 1KQ2A 2KRMA 2XMFA 5L8RE 3BE3A 3G4SA 3QSUA 1Q81C 1UB4A 4OGCA 1JU5C 2PVGB 2EIFA 1QVGA 2GFAA 3M4YA 1WIEA 5FLXE 1JJ2A 1ZBXA 5HY6A 1AWXA 5GAMj 4HCZA 1FMKA 3M0SA 2VXFA 1KD1C 3JCMJ 4M7DG 2E5KA 3M58A 1Q82C 4AFUC 1NEBA 1KC8R 2RN8A 1LJOA 3OMGA 4B6MA 1VIFA 3QBYA 2J6KA 1BIAA 3TREA 5CAIA 3HTRA 1VQLQ 2PUKB 4MZMA 4IUVA 2AKKA 1VQLA 4LXCA 5KCOA 2MK5A 4M7DC 2YXYA 3CXCP 3QJ6A 1Y07A 4FW2A 2CP0A 2K3YA 4BUGA 4A4GA 1VQLT 1OZ3A 2RO0A 2VGMA 2PTKA 3E9GA 4RUGA 1OV3A 2NUTA 4PKCC 4E47A 1X27A 4AFQC 4EDUA 2JS2A 1VQNQ 4D6WA 3EGXB 3CEYA 3DB3A 2LCSA 2COYA 2OTJT 2EQIA 2HL3A 1VQNA 4RTZA 3LX7A 2DZ9A 1UGQB 4XTXA 2WSCE 4HVVA 2G3RA 2Z0WA 2K6DA 2EYXA 5CKBA 2R58A 2M0YA 2K5IA 1D3BA 2AKLA 1SSFA 4MMLA 4M78F 1QMCA 2KROA 2HCKA 5FW9A 2KGTA 2ZCFB 2E4HA 4FSXA 1WGSA 4F14A 1JO8A 1GBRA 1VYVA 1PRMC 1B34A 3RERA 2EKOA 3LH0A 3X20B
chains in the Genus database with same CATH topology
2EJGA 4L5GA 4Y28E 2PUOB 2E5QA 2XDDA 5GAOn 4EMHA 3OYMA 3L2VA 1K9MU 3OBYA 2CZ7B 2VC8A 4LDVA 4C0FA 5LJ3j 1VQ6T 3C94A 1BI3A 5HK0A 1KG1A 1O75A 1Q86C 2DPPB 4JDSA 1WQ7A 3QDRB 3P8HA 3KUFA 1WQWA 4RG2A 4EMKA 1N9SA 3KXTA 4B9XA 4F7UG 4E7JA 3CBOA 4M7AA 1BI2A 2EJ9A 3OYCA 3GNFB 5GANe 3M4GA 4EMKB 5IN1A 5KH6A 1RL2A 4PLLA 3VV0A 4N4GA 2RH2A 4J8OA 3DLMA 4XK8E 2L8DA 4C5HA 3M54A 2NLUA 4M7AB 5IAYA 2QXFA 5GMKh 3OYLA 3OYHA 3T9NA 1BI1A 4UC4A 4C0DB 3A8OB 3PMTA 4FT4A 3G71A 3PMIA 1X75C 4PNOA 1N8RU 3RMQA 3Q1JA 3OSVA 3SFMA 3HFOA 4RKUE 4M75E 4JS5A 2R5AA 3J7AF 2JTFA 2M0OA 3P8BB 5FU6C 2DK3A 1UGSB 1IZ6A 3L2WA 4HT9A 4PJOE 3UT1A 3GF5A 2VYTA 3G71T 4C8QC 5LJ5j 5FROA 3MEAA 4JUVA 2MWPA 4M78G 2FL7A 3BDLA 1W4SA 2K5LA 4N4IA 4GY5A 3PIOA 3O8VA 3CCSA 3JCMf 4A54A 3TEEA 2E6ZA 2RHXA 1KQSA 5GMKe 5GAOp 3M9QA 1U1TA 4OB0B 3JCMV 3CC2A 4M7AF 1NPRA 5D6XA 2CGHA 2VXEA 4LD9K 2DXCA 5CQYA 4HCBA 3M57A 3GOXA 1M5Q1 5CIUA 2D6FA 3CCUA 2LTOA 2YLBA 3HRUA 2FB7A 4X9CA 5CR2A 4ELZC 3CMAA 1K73C 2LC4A 2LVMA 2ZZDA 4J6YA 3V8LA 2MWOA 3CC2T 2E6NA 3META 4JRQA 4FU6A 1Y71A 4C0ZA 3JCMb 1YHQA 2R5MA 2EWNA 3JCMe 4MMKA 3VU3C 1M90U 3BY7A 1Q81U 2H3JA 4J6XA 1VUBA 2EQJA 3OYYA 1I4K1 4M77C 3RESA 1DJ7B 3CCQA 2XI9A 5GAMh 1Q7YU 2YHTA 2CS7A 1YBYA 4C5IA 2JVVA 2DTOA 1NJIC 4IUQA 3V7CA 1YHQT 2JN0A 4GLKA 1KQ1A 2XIDA 3INZA 5AYFA 2JOYA 1FX7A 1UGPB 3CCQT 1LOJA 4M75D 4LDXA 4XU2A 4NL3A 2XD0A 1WNLA 1VQ9A 2OTJA 3FB9A 4MZTA 2QTXA 1KD1U 1K8AU 1N6AA 3OYIA 4KUDK 4PJOD 4XU1A 2XU8A 1I5LA 1UEBA 2DXBA 3JB9H 1MGQA 4OB1B 2DEQA 2X4JA 2VV5A 4DQ2A 5DLQE 4C8QF 4NOYA 1I8FA 3SB2A 1VQ9T 5CO7A 1PSFA 2JNGA 2P0KA 2D9TA 2GFUA 3SWNA 3MP1A 4ZGJB 5I21A 3JCMg 2QDYB 5GAN5 1NE8A 2E65A 2ZPIB 3KBGA 4C0GA 5C0MA 3CD6A 3SWNB 3LGLA 5A0GA 4QQ6A 3MCAB 2XG8D 2KVQG 3JCMQ 4OP0A 2QQAA 4O6JA 3OS2A 1Y7XA 2M16A 3LYIA 3M59A 3ME9A 2DD5A 2Y4XA 1HXDA 3JCMd 2EQMA 3FC3A 1YJWA 4M7AG 2DIGA 3OMCA 5GANj 3CC4A 3FLGA 4BE0A 2F69A 5KCHA 1QVPA 2PU9B 3MO8A 2EQKA 5HKCA 3M55A 4HKEA 1JBMA 3GPLA 3E9FA 2F5KA 4XTUA 1H641 5A0LA 5IT9E 5GAN8 2KDSA 3QKJA 4PL6A 1YJWT 2JTMA 2VUBA 4JLGA 4M77F 4EMKC 3CCVA 4JRPA 3CC4T 2K3XA 3MEVA 2WSEE 3CXCS 1VQPA 4M7AC 3SD4A 1VQ5A 1FXXA 2RD1A 4C0DC 2XDPA 1XNIA 4J7IA 2PVDB 4M78E 2QEXA 4C92D 2QQBA 5GAN2 1QVFS 2EYQA 4BI4A 4M75A 3X25B 5GAMg 1M1FA 4E7HA 3CCVT 4M7DE 2QQRA 5GAOm 3MP6A 4PJOA 4M75B 1VQPT 3M5AA 3L42A 2RA2A 1LNXA 4EPCA 1VQ5T 4N0AA 3A5ZB 4ZTJA 1XTDA 2L5QA 5FU7B 3CC7A 2LCCA 2QEXT 5GAMd 4PJOB 2RHYA 3GNGA 3JSCA 5I2MA 3JCMX 1PSEA 4OF1A 2P0PA 3OYAA 4Z02A 1G5VA 2ZPEB 3OB9A 1YITA 4LDWA 4BY6B 4RCCA 3NTKA 4BDYA 2RHUA 4J83A 3LWHA 4IUPA 4C8QG 4QVDA 3CC7T 4ME7A 3FRNA 5EG2A 3LWIA 2HQXA 2A7YA 3SDZA 4ZN3A 1YITT 4A4KA 4VUBA 5HK3A 3NTIA 3L2UA 3QYHB 3S6WA 3OYEA 3QYGB 2ZPGB 1Y96A 1BIBA 2RI5A 4CI0C 5GAOr 4BACA 3DKMA 4JS4A 3GLXA 5LJ3h 3C95A 4ATOA 1JB0E 2E70A 3H6ZA 5FRNA 4A53A 1Y96B 2DO3A 2DXUA 2XK0A 3JCMW 2RHIA 3FJPA 3HKSA 4PJOF 2R57A 1OYXA 1M1KC 2DD4A 5LJ3f 2WSFE 4KBMB 2DIQA 5D6YA 2A3LA 2E10A 3WVDB 2L3RA 1M4ZA 2DTIA 1G3SA 4IKFA 4BDZA 4HA8A 1Q7YC 4N4HA 3RIRA 4JRKA 4C92A 5GAOl 4M77G 2K5FA 1V29B 1YCYA 3CXCA 3DLLA 2KY9A 3I55A 3UPUA 3S3MA 4M7DD 4A4HA 3URGA 4C92B 3FIFA 3WXMB 2JUFA 3QO3A 5GAOq 5A2QE 3G4ST 2XHCA 4Y91A 2RJCA 1R8OB 1XOVA 4XTYA 3VJPA 3OS0A 1QVFA 3L2ZA 4B9WA 2RI3A 2XKOC 3OS5A 3RUXA 1HK9A 5LJ3e 4A4FA 1ZHIA 3VUBA 3I55T 4P5NA 3ZEHA 1K8AC 3X24B 5GAN6 4ELYC 1VQ7A 3CCLA 2EFIA 4RG8A 5GMKl 1YJ9A 5LJ5h 1KC8U 3CPWS 4KUIA 3OW2S 2HD0A 2RJDA 4FL6A 5CVIA 3QIIA 3RKYA 3UWNA 1W2BA 2QQSA 5GAMf 4R56A 4BB7A 3SWNC 2DVEA 1VQ7T 4HT8A 2D0QB 3CBMA 4XQ3A 4XTVA 3OYBA 3CCLT 3VYHB 3JRZA 3L2RA 1YJ9T 5KE3A 2RHZA 2CZ0B 3QZ9B 3J80E 3CMEA 3VUZA 4C92F 4YTLA 4Q5WA 3QZ5B 4QQGA 4A4EA 5C6SA 3OYDA 1Q82U 4EMGA 2I2LA 3PGGA 2MI6A 3E1SA 5DLOA 2EJFA 5GAN3 1FWZA 5A0DA 4MDXA 2KMTA 4LDUA 2LDMA 3NFCA 3HL8A 2V8IA 2M1HA 3CMET 1OZ2A 3QUIA 3A8HB 1WJSA 2LCLA 5LJ3g 3RMSA 3S3OA 1YJNA 3HFNA 5GAMe 4M78A 4PJOG 2F5TX 2RI2A 3JB9D 4RCBA 2GQVA 2CZ6B 2LX9A 2X35A 2OAUA 4M78B 4F7UE 3G7ZA 4M7DA 3OYNA 1JRIA 2V8KA 3GIBA 4XTZA 2Y4YA 2QQ9A 3CBPA 3MP8A 5LJ3d 3PTAA 4E7KA 3L1AA 3CPFA 4M7DB 1YJNT 3HHTB 4BD3A 2L89A 4C5GA 4C8QE 5DM7R 4M75C 3OY9A 1K9MC 1VQ8A 5LL6S 1ZQ1A 3HRTA 4KT0E 5FU7C 3ER0A 1U1SA 3JCMc 4PJOC 3QPHA 1I81A 2X4YA 4N0AC 2HBPA 2RJEA 3ASKA 3C12A 3OQ5A 2MF2A 3UDCA 4ZN1A 3CCMA 2CZ1B 4BY6C 4KULA 4CRIA 3MEUA 4FT2A 2RB6A 4J6WA 1VQ8T 2ZPBB 4DOWA 3ZBDA 2DJZA 4IURA 3CPWA 3OA6A 4FM4B 1WJQA 3OW2A 1M9SA 3OYGA 2E1HA 1VQNT 2E12A 1JJ2S 5LJ5g 1YI2A 2RK1A 3CCMT 3QSUA 2V8JA 3OS1A 3TU4K 4RMOA 2FYKA 3OYKA 4OVAA 4JJNK 2ZPFB 2IVWA 5J26A 2P0QA 3EFSA 1N27A 4M7DF 4II1A 4PLIA 1BKBA 1N8RC 1KHCA 4M77E 5LJ5d 5GANh 3CCRA 1KHIA 2MMPA 3X26B 5J39A 5GMKj 3RKXA 3OYJA 1XQHA 4L6V5 4C92G 1YI2T 1VQ4A 1RI0A 5I2SA 1G3WA 3QG1A 5GANf 3JCMP 1W2BS 1NZ9A 1M1GA 3VKIA 4E7LA 2JZ2A 4XAXB 3CCRT 5GMKm 1NPPA 1QP2A 2LT4A 4IUUA 2O4XA 2OTLA 1TH7A 3QHSA 1VQ4T 1G3YA 1WPYA 4MZPA 4DOVA 2FHDA 3F70A 5M9OA 4V2SA 2K57A 4C92C 3H8ZA 2O4XB 3FDRA 4XU0A 2DAQA 4QQDA 4C8QD 4ZTFA 3PT9A 2FVUA 2RJFA 3QJYA 2WACA 2IG0A 2RM4A 1H3ZA 5CKFA 4M75F 1M1KU 2OTLT 2PQWA 4NL2A 3OSSC 1GXIE 3OYFA 1MHNA 2ZPHB 1IREB 1VIEA 5CKHA 4OGEA 3LGFA 2E64A 1KQ2A 1QW1A 5L8RE 3G4SA 3NTHA 2DZCA 1M90C 3GP8A 3CCEA 3A8MB 2M9UA 1Q81C 4M78D 2KQWA 3I56A 1UB4A 4OGCA 3V7RA 3C4SA 2BKDN 2PVGB 2EIFA 4C5EA 1KC8C 4X9DA 2QA4A 1Q86U 1BYMA 2XICA 5CKEA 3PNWC 4J7FA 5CK9A 1QVGA 2GFAA 3M4YA 2LQ8A 3DB4A 3HP9A 3JB9F 2AHJB 3N5BB 2E41A 2KK4A 2PVOB 1EIFA 3R6OA 1X01A 5FLXE 3JCMh 1BI0A 3QXEB 4QVCA 1ZBXA 4M77D 3PIPA 1JJ2A 3I56T 3CCET 2VGNA 5HY6A 4OB3B 3MEWA 5GAMj 3EFRA 2QA4T 1AHJB 4HCZA 2KSSA 2EQUA 2X4WA 4IUTA 1KD1C 2VXFA 3V8KA 3ZFJA 3X28B 3JCMJ 4M7DG 2RK2A 3M58A 1Q82C 4BE2A 4M7AE 2XDBA 3BW1A 1LJOA 3VYGA 2LRQA 3OMGA 4J5YA 2CYZB 3JAME 5GANg 1VIFA 2HNIA 3QBYA 2X4XA 4BI8B 4JRIA 1BIAA 3TREA 4F7UA 5CAIA 2PUKB 3P8DA 4MZMA 3V7SA 5LJ5f 3HSBA 3CCST 3A8GB 2HAXA 4WF2A 4M78C 2LQKA 2KAFA 4F7UB 2B8AA 3LW5E 4IUVA 1O9SA 4C8QA 5FU6B 3L2QA 4E7IA 3BFMA 5GANd 1VQLA 5CCAA 5KCOA 1U8RA 4M7DC 2GCXA 3M56A 1VQKA 4C8QB 4BE1A 4DA4A 3G6EA 2EAYA 2LT1A 3QJ6A 3CCUT 1Y07A 1VQMA 4MDWA 2HQEA 3HPWA 5CQXA 1X6OA 3CMAT 3AHUA 4ZGDB 2K3YA 3LLRA 5GAN7 4BUGA 4A4GA 2YRVA 1VQLT 1OZ3A 4M75G 4FIBA 2RO0A 3FEOA 1OI1A 3E19A 2VGMA 4JLIA 1VQKT 5LJ5e 3E9GA 2DTHA 4L59A 3RKWA 3J81E 3G6ET 1K73U 3OBWA 3A8LB 1YIJA 2C06A 1VQMT 5J3BA 1VQOA 4C92E 2Y90A 2K2VA 4LD6A 3V8JA 4X34A 4OMFB 1QP3A 3JB9J 2BIVA 2O01E 5GMKi 4PKCC 3CCJA 1P92A 4E47A 4EDUA 4F7UF 4M77A 4BI3A 1M8VA 4D6WA 3S3NA 3TCJA 1YIJT 3CEYA 3DB3A 5GAN4 1VQOT 3BDUA 4O5VA 1NJIU 3PFSA 3JB9G 3EAEA 4M77B 3MHXA 5D6WA 2OTJT 4XTWA 1N9RA 4M7AD 1VQNA 3CCJT 2MAMA 2K4YA 2DZ9A 3LX7A 4HCCA 1UGRB 1UGQB 2BUDA 4XTXA 2WSCE 2G3RA 2YLCA 1QVGS 5CKBA 5KE2A 2R58A 4LDYA 2K5IA 1D3BA 4ZGEB 1WJRA 1SSFA 1S72A 5FRMA 4R55A 4MMLA 5CKDA 4M78F 1G3TA 2CKKA 2ZGWA 1D3BB 3JB9I 3M53A 4FSXA 2GF7A 2ZCFB 5DY9A 1WGSA 3CD6T 2DXTA 4QW2A 4NS5A 1B34A 2DKGA 1KQSS 2LNVA 4TVRA 3HRSA 1S72T 4XU3A 3RERA 2EKOA 4OB2B 3WVEB 1B34B 4QVZA 3LH0A 1VQ6A 2QI2A 2P4TA 3X20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJG A;  3RKY A;  2DZC A;  2E65 A;  5GAN 4;  3QSU A;  5GAO n;  4M78 D;  4EMH A;  3SWN B;  3V7R A;  5GAM f;  4X9D A;  2DVE A;  3SWN C;  3JCM Q;  4XQ3 A;  4OP0 A;  4HT8 A;  4XTV A;  2VC8 A;  5LJ3 j;  3JCM d;  4M7A G;  1HXD A;  3JCM e;  3JB9 F;  2E41 A;  4C92 F;  5GAN j;  1X01 A;  3JCM h;  4QVC A;  4M77 D;  1WQ7 A;  4EMG A;  1WQW A;  2I2L A;  3PGG A;  4EMK A;  5GAM j;  3EFR A;  2EJF A;  1JBM A;  1N9S A;  5GAN 3;  4F7U G;  4M7A A;  4XTU A;  1H64 1;  2VXF A;  5GAN e;  3M4G A;  3V8K A;  4EMK B;  5GAN 8;  3JCM J;  4M7D G;  4M7A E;  3QUI A;  4M77 F;  4EMK C;  5GMK h;  3BW1 A;  1LJO A;  4M7A B;  5LJ3 g;  3HFN A;  5GAM e;  4J5Y A;  4M78 A;  4PJO G;  4M7A C;  5GAN g;  2HNI A;  2RD1 A;  4JRI A;  1BIA A;  4M78 E;  4RCB A;  4F7U A;  5CAI A;  3JB9 D;  4C92 D;  5GAN 2;  3V7S A;  5LJ5 f;  4M78 B;  4PNO A;  3HSB A;  4M7D A;  4M75 A;  4F7U E;  5GAM g;  4WF2 A;  4M78 C;  1JRI A;  3GIB A;  4XTZ A;  5LJ3 d;  4F7U B;  3HFO A;  3JCM W;  4M75 E;  4M7D E;  4C8Q A;  5GAO m;  3L1A A;  4M7D B;  4PJO A;  3BFM A;  4M75 B;  5GAN d;  4M7D C;  2RA2 A;  1LNX A;  4M75 C;  4C8Q E;  4N0A A;  4HT9 A;  4PJO E;  5GAN h;  4C8Q B;  4PJO B;  2EAY A;  5GAM d;  4C8Q C;  1U1S A;  3JCM c;  4JUV A;  4M78 G;  5LJ5 j;  4PJO C;  3JCM X;  1I81 A;  4N0A C;  3AHU A;  5GAN 7;  3JCM f;  4A54 A;  4RCC A;  4M75 G;  2RB6 A;  4JLI A;  4J6W A;  5GMK e;  5LJ5 e;  4C8Q G;  5GAO p;  2DTH A;  1U1T A;  3RKW A;  3JCM V;  4QVD A;  4M7A F;  2DJZ A;  2CGH A;  2VXE A;  2Y90 A;  4C92 E;  3V8J A;  2E1H A;  1M5Q 1;  5LJ5 g;  2YLB A;  3JB9 J;  2FB7 A;  4X9C A;  2FYK A;  5GMK i;  3V8L A;  4J6Y A;  1Y96 A;  4F7U F;  1BIB A;  5GAO r;  4M77 A;  3EFS A;  4M7D F;  5LJ3 h;  1M8V A;  3JCM b;  4M77 E;  1Y96 B;  4A53 A;  3BDU A;  2DXU A;  2EWN A;  5LJ5 d;  3FJP A;  4MMK A;  3VU3 C;  3BY7 A;  4M77 B;  3RKX A;  5GMK j;  4PJO F;  4C92 G;  3JB9 G;  4J6X A;  4M77 C;  4XTW A;  1N9R A;  3RES A;  1I4K 1;  4M7A D;  5LJ3 f;  5GAM h;  2YHT A;  5I21 A;  2DZ9 A;  5GAN f;  3JCM P;  2E10 A;  2DTO A;  4XTX A;  2DTI A;  3V7C A;  4HA8 A;  2YLC A;  2JN0 A;  3RIR A;  4JRK A;  4C92 A;  1KQ1 A;  3INZ A;  5GMK m;  5GAO l;  4M77 G;  1YCY A;  1TH7 A;  1D3B A;  3QHS A;  4M7D D;  1LOJ A;  1WPY A;  4M75 D;  4XU2 A;  4C92 B;  4NL3 A;  1WNL A;  3FIF A;  4V2S A;  4MML A;  2K57 A;  3FB9 A;  3QO3 A;  4M78 F;  4C92 C;  2QTX A;  2ZGW A;  1D3B B;  4XU0 A;  4C8Q D;  4Y91 A;  5GAO q;  3JB9 I;  4PJO D;  4XTY A;  4XU1 A;  5DY9 A;  1I5L A;  3L2Z A;  2RM4 A;  2DXT A;  4M75 F;  3RUX A;  1HK9 A;  1MGQ A;  2DEQ A;  5LJ3 e;  3JB9 H;  4NL2 A;  1B34 A;  2DKG A;  4DQ2 A;  4C8Q F;  4NOY A;  5GAN 6;  4XU3 A;  1I8F A;  3SB2 A;  3RER A;  5GMK l;  5LJ5 h;  2E64 A;  1B34 B;  1KQ2 A;  3SWN A;  2EJ9 A;  3JCM g;  5GAN 5; 
#chains in the Genus database with same CATH topology
 2PUO B;  1TUD A;  2V1Q A;  2DEU A;  4JJB A;  2K79 A;  3OBY A;  3H0I A;  2YSQ A;  4OMP A;  5HK0 A;  1KG1 A;  3CPW P;  1WQ7 A;  1WQW A;  4FYV B;  2RF0 A;  4F7U G;  1M1K R;  3OYC A;  3M4G A;  4PLL A;  2D6F A;  4N4G A;  2RH2 A;  4J8O A;  1IRX A;  3M54 A;  3OYL A;  2DBM A;  3T9N A;  1QWE A;  4FT4 A;  1X43 A;  4PNO A;  2CT3 A;  2P84 A;  2VVK A;  4M75 E;  2JTF A;  2M0O A;  4OMN A;  2HKN A;  3CCS Q;  3UT1 A;  3GF5 A;  2DF6 A;  3U23 A;  3EHR A;  3EH2 A;  4C8Q C;  3MEA A;  2MWP A;  3VRY A;  3PIO A;  3CCS A;  3CCU Q;  5GMK e;  1U1T A;  2ROL A;  1K4U S;  1YWP A;  3CCU A;  2YLB A;  4X9C A;  4ELZ C;  1K73 C;  2ZZD A;  2LVM A;  3V8L A;  1MNE A;  4CC7 A;  1JEG A;  4JRQ A;  2CT4 A;  4MMK A;  1RAA B;  5KYU B;  4M77 C;  3RES A;  2EQJ A;  1Q7Y U;  2JTE A;  2C0I A;  2W0Z A;  1OX9 A;  2K7A A;  1K0X A;  3I35 A;  4GLK A;  5AT1 B;  1KQ1 A;  2XID A;  3INZ A;  4ORZ A;  2QAS A;  3ZL7 C;  4F16 A;  1X6G A;  4M75 D;  2CSQ A;  3SHW A;  3H41 A;  2GTO A;  4KH1 B;  2GGR A;  2XU8 A;  1I5L A;  3JB9 H;  4OB1 B;  3RBB B;  1RAD B;  3SB2 A;  3CD6 Q;  2NWM A;  3MP1 A;  3JCM g;  4Z88 A;  1NE8 A;  2BTT A;  2E65 A;  2ZPI B;  3KBG A;  5C0M A;  8ATC B;  1YJW Q;  3CD6 A;  3SWN B;  1AEY A;  2KVQ G;  1Y7X A;  2M16 A;  1PG5 B;  3LYI A;  3ME9 A;  4M7A G;  2EQM A;  1YJW A;  2BZ8 A;  2F2V A;  2KT1 A;  2F69 A;  1QVP A;  2PU9 B;  1VA7 A;  1JXO A;  1QLY A;  3QKJ A;  5GAN 8;  1NYF A;  4PL6 A;  2QEX Q;  1YJW T;  3MEV A;  4M7A C;  1C1A A;  2RD1 A;  2JM8 A;  2PVD B;  2QEX A;  2QQB A;  1QVF S;  4BI4 A;  5GAM g;  2LJ0 A;  4E7H A;  4M7D E;  4CC4 B;  2RA2 A;  1LNX A;  2NUP A;  1XTD A;  2QEX T;  4PJO B;  2RHY A;  5I2M A;  2LJ3 A;  3JCM X;  3EG2 A;  4OF1 A;  3OYA A;  2ZPE B;  4BY6 B;  4BDY A;  1PHT A;  2RHU A;  3LWH A;  1IO6 A;  4IUP A;  4QVD A;  3FRN A;  5HK3 A;  3L2U A;  1NM7 A;  4BAC A;  1MV3 A;  4A53 A;  1Y96 B;  2DO3 A;  2EGC A;  3JCM W;  2CRE A;  4PJO F;  1WHJ A;  3WVD B;  2E10 A;  2L3R A;  1WX6 A;  4DBF A;  1TSF A;  4C92 A;  5GAO l;  3CXC A;  3DLL A;  4HVW A;  3S3M A;  4M7D D;  5GAO q;  2LMJ A;  2EBP A;  2XHC A;  3OS0 A;  1XOV A;  2M02 A;  4E2F B;  1YJ9 Q;  2CSI A;  4B9W A;  1WXB A;  5LJ3 e;  1ZHI A;  3VUB A;  4AMC A;  1K8A C;  1Q81 R;  5GMK l;  2RNA A;  1YJ9 A;  1AVZ C;  2VAS A;  2QQS A;  5GAM f;  1NLP C;  2D0Q B;  2C0O A;  3VYH B;  3JRZ A;  1YJ9 T;  3GBQ A;  2RHZ A;  1AD5 A;  2CZ0 B;  3QZ9 B;  5IHN A;  3J80 E;  1KQS P;  3VUZ A;  1KD1 R;  1X2K A;  4LE9 A;  3OYD A;  1Q82 U;  4EMG A;  1SSH A;  3PGG A;  4J9C A;  5DLO A;  1FWZ A;  4MDX A;  2KMT A;  2LDM A;  1QVF P;  2M1H A;  3QUI A;  3A8H B;  1WJS A;  2LCL A;  3RMS A;  3HFN A;  2F5T X;  2RI2 A;  3TVT A;  4F7U E;  2V8K A;  1U3O A;  4E7K A;  1Z9Z A;  1RAH B;  3MP8 A;  3L1A A;  4BD3 A;  1RLQ C;  4C8Q E;  4JJD A;  4KT0 E;  4K11 A;  4N0A C;  3EG9 A;  1U5S A;  1FYN A;  2ZPB B;  3ZBD A;  3CPW A;  3OA6 A;  3OW2 A;  1M9S A;  2E1H A;  2RK1 A;  3TU4 K;  2ZPF B;  1VQ4 Q;  1N27 A;  4PLI A;  4M77 E;  1TOV A;  5GAN h;  2DET A;  1KHI A;  2MMP A;  3X26 B;  3OYJ A;  3RKX A;  4FCY A;  1M30 A;  1VQ4 A;  1RI0 A;  1H3H A;  1X69 A;  1R77 A;  5GAN f;  2P4R A;  1NZ9 A;  2JZ2 A;  2FPD A;  2X51 A;  2HMA A;  1S1N A;  2O4X A;  1ABQ A;  1TH7 A;  1VQ4 T;  4FW1 A;  4DOV A;  4MZP A;  3H8Z A;  4C8Q D;  1BBZ A;  3H0F A;  3QJY A;  2RJF A;  1H3Z A;  1T0H A;  3I5S A;  2L3P A;  2PQW A;  1ZSZ A;  1GXI E;  3OYF A;  1F1B B;  2YUP A;  3CCE Q;  4E7Z A;  4R0K A;  2DZC A;  3CCE A;  2BKD N;  1NBE B;  2XIC A;  5CKE A;  2RQU A;  1PKT A;  3DB4 A;  3JB9 F;  4HVU A;  2EPD A;  3R6O A;  1EIF A;  2PVO B;  1ZLM A;  1BI0 A;  3PIP A;  3CCE T;  4M77 D;  1WHL A;  1UGV A;  4OB3 B;  3MEW A;  2KSS A;  1Q95 G;  2EQU A;  2X4W A;  4M7A E;  1OU8 A;  2DL4 A;  2CYZ B;  1Y57 A;  1SF9 A;  2X4X A;  1K0S A;  1LVK A;  3V7S A;  2KXD A;  2HAX A;  1UHC A;  4WF2 A;  4M78 C;  3G6E Q;  3LW5 E;  3NHN A;  3BFM A;  5CCA A;  3H0H A;  3M56 A;  3FJ5 A;  4DA4 A;  3G6E A;  2EAY A;  3A1P A;  2DL7 A;  3HPW A;  1X6O A;  4ZGD B;  5GAN 7;  3MJX A;  1VQO Q;  2OX7 A;  4FIB A;  2JS0 A;  3FEO A;  4M75 G;  3E19 A;  2CH4 A;  4JLI A;  3J81 E;  2D8H A;  3G6E T;  1K73 U;  2HQH A;  3CCJ Q;  1UG1 A;  1VQO A;  4C92 E;  1WDX A;  2K2M A;  3O5Z A;  3EGX A;  2NUZ A;  2O01 E;  5GMK i;  3CCJ A;  4PK4 A;  2E3I A;  1YN8 A;  3TCJ A;  1VQO T;  3BDU A;  4O5V A;  3EAE A;  4XTW A;  4M7A D;  3CCJ T;  2MAM A;  3EG3 A;  1UGR B;  2YLC A;  5KE2 A;  1RLP C;  2YWW A;  2AIR B;  4R55 A;  3TSZ A;  3UA6 A;  2LQN A;  2GF7 A;  4M4Z A;  2DXT A;  1RAF B;  3HRS A;  4OB2 B;  3WVE B;  4QVZ A;  4FYW B;  1SKU B;  4EMH A;  3L2V A;  1K9M U;  3ULR B;  1GL5 A;  3KUF A;  4KRT A;  2KR3 A;  4AG1 C;  5GAN e;  4EMK B;  5IN1 A;  5KH6 A;  4XK8 E;  4C5H A;  5GMK h;  3EH1 A;  1BI1 A;  4AT1 B;  1QKW A;  1N8R U;  1KFZ A;  3OSV A;  3SFM A;  4JS5 A;  3PVL A;  3J7A F;  5FU6 C;  1D1A A;  1IZ6 A;  3L2W A;  1PKS A;  5FRO A;  1UTI A;  3BDL A;  3CC2 Q;  2RPN A;  2FEI A;  2DFU A;  2J7I A;  3THK A;  2E6Z A;  2RHX A;  1CSK A;  1KQS A;  5GAO p;  3CC2 A;  4OB0 B;  3TQ7 P;  1KK7 A;  1NPR A;  4FYX B;  4DBH A;  4HCB A;  3M57 A;  3GOX A;  4QT7 A;  2FB7 A;  2LC4 A;  4J6Y A;  2MWO A;  1R0B G;  3CC2 T;  2E6N A;  3KFV A;  5KYU A;  3JCM b;  1M90 U;  2AT1 B;  4DEY A;  2QK0 A;  4J6X A;  2QYZ A;  2YHT A;  3VS1 A;  1YBY A;  2DTO A;  1NJI C;  2OTJ Q;  2A36 A;  3G1J A;  5AYF A;  1PD0 A;  2MYS A;  2SRC A;  1UGP B;  2CP5 A;  1OEB A;  4NL3 A;  2OTJ A;  3FB9 A;  4MZT A;  4ANJ A;  1K8A U;  1I5O B;  1RAG B;  2QDL A;  1ZSG A;  1I1J A;  2HKQ B;  2SEM A;  4J9F A;  3SWN A;  1UHF A;  1RAC B;  5A0G A;  2HZY A;  3MKD A;  3CC4 Q;  2DM1 A;  4OP0 A;  1ZA1 B;  2QQA A;  1EZZ B;  2DER A;  3JCM d;  2DD5 A;  3FC3 A;  2ATC B;  2DIG A;  5GAN j;  3CC4 A;  3FLG A;  1WZO A;  4AFZ C;  3GPL A;  3E9F A;  5A0L A;  1H64 1;  1Z9Q A;  5IT9 E;  4D8K A;  2VUB A;  2EKH A;  4RTY A;  3CC4 T;  5IH2 A;  3SD4 A;  2HDA A;  1WI7 A;  4C0D C;  2XDP A;  4M78 E;  4J7I A;  4J9H A;  1IB8 A;  2KRS A;  3JV3 A;  2YRD A;  3CC7 Q;  3MP6 A;  4PJO A;  4M75 B;  5FU7 B;  3R6N A;  3CC7 A;  2H8H A;  2CP7 A;  5GAM d;  2KI7 A;  3JSC A;  1PSE A;  1WLP B;  3OB9 A;  4LDW A;  2A0F B;  1G2B A;  1AZE A;  4J83 A;  4C8Q G;  3CC7 T;  4ME7 A;  4RTV A;  2FRY A;  1SHG A;  5EG2 A;  3VS6 A;  4RTT A;  2A7Y A;  2COZ A;  1M27 C;  4VUB A;  3NTI A;  3QYH B;  3QYG B;  1Y96 A;  5GAO r;  3DKM A;  5LJ3 h;  2LP5 A;  3C95 A;  3H6Z A;  5FRN A;  2DXU A;  1KIK A;  2DLP A;  2CP6 A;  5LJ3 f;  2WSF E;  4KBM B;  2DIQ A;  5D6Y A;  5KYW B;  1G3S A;  1CKA A;  4IKF A;  4HA8 A;  3RIR A;  4M77 G;  1V29 B;  4ZNX A;  2IPO B;  3FIF A;  4PJL A;  3VJP A;  3CCL Q;  3OS5 A;  3RUX A;  4A4F A;  2QGG A;  3ZEH A;  2KRN A;  3X24 B;  5GAN 6;  4IIM A;  4RG8 A;  3CCL A;  1Q7Y R;  5LJ5 h;  5HCK A;  4FL6 A;  2GQI A;  1UJY A;  4WCI A;  5EC7 A;  3CCL T;  3L2R A;  1H8K A;  1KSW A;  3QZ5 B;  2I2L A;  2MI6 A;  5GAN 3;  3A98 A;  1D0X A;  1M2O A;  2FZK B;  2KE9 A;  4RCB A;  3OYN A;  2FPF A;  3GIB A;  4XTZ A;  2Y4Y A;  4M7D B;  1G83 A;  1TS9 A;  3MPU B;  5DM7 R;  1K9M C;  2BE9 B;  2RQW A;  1U1S A;  1QWF A;  1I81 A;  2L0A A;  2MF2 A;  4CRI A;  2KXC A;  1SPK A;  2DJZ A;  1RAE B;  5I11 A;  4FM4 B;  1M3B A;  1JJ2 S;  1MMA A;  5D7U A;  3OS1 A;  4OVA A;  1PCX A;  5J26 A;  3EFS A;  1YNZ A;  4M7D F;  1BKB A;  1N8R C;  1KHC A;  2BZX A;  5GMK j;  4C92 G;  3EGD B;  2KEA A;  1G3W A;  1NLO C;  4FYY B;  3JCM P;  4E7L A;  3VKI A;  2CH4 W;  4CC3 A;  4XAX B;  1YFN A;  1QP2 A;  2LT4 A;  3QHS A;  1G3Y A;  3H9N A;  5M9O A;  3F70 A;  4C92 C;  4ZTF A;  4ESR A;  2FVU A;  1JXM A;  4NL2 A;  1V76 A;  3OSS C;  1B07 A;  1UJ0 A;  3LGF A;  1PD1 A;  1QW1 A;  1M90 C;  3GP8 A;  2KQW A;  1KC8 C;  1BCM A;  2V1R A;  3C4S A;  4C5E A;  1BYM A;  2L3Q A;  1W70 A;  2O88 A;  4AG2 C;  2LQ8 A;  3HP9 A;  3N5B B;  2E41 A;  2KK4 A;  2ED0 A;  1X01 A;  3JCM h;  3QXE B;  1WFW A;  4QVC A;  4JPB W;  3EFR A;  1ARK A;  1TWB A;  2O31 A;  2VKN A;  3ZFJ A;  5IHK A;  2RK2 A;  1WHG A;  3BW1 A;  1D0Z A;  3EFO B;  4J5Y A;  3JAM E;  5GAN g;  4LUD A;  1TG0 A;  1IXD A;  3P8D A;  3HSB A;  1K76 A;  2DA9 A;  5I22 A;  1SHF A;  2LQK A;  2KAF A;  4F7U B;  2B8A A;  3L2Q A;  1VQM Q;  1ZBJ A;  4C8Q B;  4BE1 A;  1Q82 R;  2LT1 A;  1WXT A;  1VQM A;  4MDW A;  5CQX A;  3CMA T;  3AHU A;  4EIK A;  4J9B A;  2YRV A;  4J9D A;  2C0T A;  5LJ5 e;  3RKW A;  2J06 A;  3OBW A;  3A8L B;  1VQM T;  5J3B A;  2Y90 A;  2K2V A;  3V8J A;  4X34 A;  2F1L A;  1QP3 A;  3JB9 J;  3IQL A;  2BIV A;  3VS0 A;  4F7U F;  1QKX A;  2EYZ A;  2G6F X;  1M8V A;  3S3N A;  3M0P A;  5GAN 4;  1NJI U;  4M77 B;  2HSP A;  2DRM A;  3EG1 A;  3MHX A;  5D6W A;  4AFS C;  1N9R A;  4HCC A;  2BUD A;  1BB9 A;  2J6O A;  2IIM A;  2FZC B;  1R0C B;  9ATC B;  5FRM A;  1OPK A;  1X2Q A;  2ZGW A;  1WA7 A;  3JB9 I;  3M53 A;  2A37 A;  2OAW A;  1U06 A;  2DNU A;  4LN2 A;  2KYM A;  2VB6 A;  4TVR A;  1ZSZ C;  2EJ9 A;  1M1K C;  4Y28 E;  2O2O A;  4HXJ A;  1MMD A;  4LDV A;  5LJ3 j;  1D1B A;  2JW4 A;  4RTW A;  3C94 A;  1D1C A;  1Q86 C;  3RDV A;  4FSS A;  4JDS A;  4EMK A;  2KBT A;  4B9X A;  4E7J A;  3CBO A;  2FG0 A;  2DVJ A;  3NMZ C;  1RL2 A;  1UFF A;  1ZX6 A;  3VV0 A;  3G71 Q;  2HSE B;  3DLM A;  2NLU A;  4M7A B;  3G71 A;  1SRM A;  1X75 C;  3RMQ A;  2GTJ A;  1ZUK A;  3PVQ A;  4RKU E;  1H92 A;  2R5A A;  2O9S A;  1E6H A;  1UGS B;  2CP2 A;  1UEC A;  3G71 T;  5LJ5 j;  4JUV A;  4M78 G;  2HEQ A;  1BCO A;  4JJC A;  3O8V A;  3TEE A;  4GBQ A;  4Y92 A;  3M9Q A;  3JCM V;  4M7A F;  5D6X A;  2DRK A;  2CGH A;  2VXE A;  5KYY B;  1HD3 A;  1M5Q 1;  2LTO A;  3HRU A;  4X1V A;  2M51 A;  1MMG A;  1WHH A;  3CCQ Q;  3MET A;  1Y71 A;  2YDL A;  2R5M A;  2EWN A;  3JCM e;  2H3J A;  1VUB A;  2HBW A;  3OYY A;  1I4K 1;  3CCQ A;  1DJ7 B;  2XI9 A;  4C5I A;  2JVV A;  2PZ1 A;  2KT8 A;  3M0Q A;  1NYG A;  1K73 R;  1FX7 A;  2B86 A;  3CCQ T;  1LOJ A;  4LDX A;  4XU2 A;  2XD0 A;  1WNL A;  3OYI A;  2MCN A;  2COW A;  3VRZ A;  2DEQ A;  2DX1 A;  2VV5 A;  5DLQ E;  4DQ2 A;  4NOY A;  2DYI A;  1PSF A;  2AZS A;  2JNG A;  1AWO A;  2GFU A;  2O9V A;  2CDT A;  5I21 A;  2QDY B;  2JMC A;  4C0G A;  3LGL A;  3JCM Q;  4O6J A;  3OS2 A;  1PWT A;  3CCV Q;  3MO8 A;  2EQK A;  1FMV A;  5HKC A;  3M55 A;  1JBM A;  4E6R A;  1VQP Q;  1A0N B;  1FMW A;  2D0N A;  2KDS A;  3CCV A;  4JRP A;  1MUZ A;  2WSE E;  3CXC S;  1VQP A;  1EX4 A;  3REA B;  1XNI A;  4C92 D;  5GAN 2;  2HL5 C;  1K1Z A;  2EYQ A;  4M75 A;  3VS2 A;  1K9M R;  1M1F A;  1GCQ A;  3CCV T;  4OMO A;  5GAO m;  2DJQ A;  2YUN A;  1VQP T;  5ECA A;  4EPC A;  1YIT Q;  3A5Z B;  1ZA2 B;  3M0T A;  2L5Q A;  2L2P A;  2CUD A;  2P0P A;  1G5V A;  1VOM A;  4CC2 A;  1YIT A;  1UE9 A;  4RCC A;  3NTK A;  2AK5 A;  7AT1 B;  3LWI A;  1OU9 A;  2F2X A;  3I5R A;  2HQX A;  3SDZ A;  4ZN3 A;  1YIT T;  1N8R R;  4A4K A;  2ZAE A;  2LZ6 B;  3OYE A;  2ZPG B;  1BIB A;  3UA7 A;  2DIL A;  1IGU A;  2EGE A;  1JB0 E;  1RAB B;  8AT1 B;  3HKS A;  1WYX A;  5IHI A;  5KYW A;  1OYX A;  3M0U A;  3UF4 A;  2A3L A;  1M4Z A;  2DTI A;  4N4H A;  4JRK A;  2KYB A;  2K5F A;  1YCY A;  2KY9 A;  3G4S T;  2OI3 A;  4Y91 A;  2RJC A;  4KGZ B;  1QVF A;  4XTY A;  5FWB A;  1KJW A;  2XKO C;  1HK9 A;  4E7S A;  1PC0 A;  1C6V X;  1M90 R;  1KC8 U;  3CPW S;  1T0J A;  3OW2 S;  2HD0 A;  4F04 B;  5CVI A;  3RKY A;  2LQW A;  3UWN A;  3CME Q;  1HSQ A;  3SWN C;  2DVE A;  4XQ3 A;  3CBM A;  3OYB A;  4XTV A;  3CME A;  4YTL A;  1K8A R;  4QQG A;  4A4E A;  5C6S A;  1TXQ A;  1CKB A;  4LDU A;  2V8I A;  3CME T;  1OX8 A;  1OZ2 A;  1K9A A;  4JZ3 A;  5LJ3 g;  3S3O A;  1Y0M A;  4PJO G;  2GQV A;  4M78 B;  2DYB A;  4M7D A;  2OAU A;  3G7Z A;  1GFC A;  3CBP A;  2QQ9 A;  3TSW A;  1I0C A;  1XJW B;  4OMM A;  3HHT B;  2L89 A;  3CCM Q;  3HRT A;  1C0M A;  3JCM c;  4PJO C;  2D8J A;  3QPH A;  2X4Y A;  5GJW B;  3OQ5 A;  2MPX C;  3C12 A;  4ZN1 A;  3CCM A;  4BY6 C;  4FT2 A;  1WXU A;  4DOW A;  2EYY A;  4IUR A;  1MV0 B;  1WJQ A;  2EGA A;  1VQN T;  5LJ5 g;  3CCM T;  1ZUY A;  1GRI A;  4RMO A;  2FYK A;  3CCR Q;  1IGQ A;  1EFN A;  2V26 A;  4HCK A;  3EGD A;  2A28 A;  3CCR A;  5J39 A;  1XQH A;  4L6V 5;  1VYT A;  5I2S A;  5KYX A;  3QG1 A;  1M8M A;  2OTL Q;  1ACM B;  1W2B S;  4DBQ A;  4J9G A;  3E2U A;  3CCR T;  1PRL C;  2OTL A;  1WPY A;  2H3E B;  2FHD A;  4V2S A;  2K57 A;  2OJ2 A;  2DAQ A;  2DL8 A;  3PT9 A;  1MND A;  3OW2 P;  2GBQ A;  3NGP A;  2WAC A;  4M75 F;  2RQR A;  1M1K U;  2OTL T;  3REB B;  2EYW A;  1M2V B;  1MHN A;  2ZPH B;  1IRE B;  3I56 Q;  1VIE A;  4OGE A;  4LNP A;  4J9E A;  2QA4 Q;  3NTH A;  1M3A A;  4DBR A;  3A8M B;  2M9U A;  4M78 D;  1ZUU A;  3I56 A;  3V7R A;  2ECZ A;  4X9D A;  2QA4 A;  1Q86 U;  1Q86 R;  3PNW C;  4J7F A;  5CK9 A;  2JT4 A;  1UDL A;  2DL5 A;  2X3W D;  2AHJ B;  2DBK A;  5KYN A;  3I56 T;  2VGN A;  2QTV A;  1AHJ B;  2QA4 T;  3EFO A;  2J6F A;  4IUT A;  1WHM A;  3LH5 A;  3V8K A;  3X28 B;  2FPE A;  4BE2 A;  1OOT A;  3VYG A;  2LRQ A;  2HNI A;  4BI8 B;  4JZ4 A;  4JRI A;  4F7U A;  1SRL A;  5LJ5 f;  3CCS T;  3A8G B;  2RQT A;  1W1F A;  1VQK Q;  1N5Z A;  4C8Q A;  1O9S A;  5FU6 B;  4E7I A;  5GAN d;  1U8R A;  2GCX A;  4PFZ A;  1VQK A;  3CCU T;  1T3L A;  1BU1 A;  2HQE A;  3LLR A;  1YIJ Q;  2LJ1 A;  1OI1 A;  3EHQ A;  2ROT A;  2RQV A;  1VQK T;  1WHK A;  2DTH A;  2FZG B;  4L59 A;  2C06 A;  1YIJ A;  4F17 A;  1E7O A;  4LD6 A;  4OMF B;  3D7S B;  1PM3 A;  1P92 A;  1BK2 A;  4M77 A;  2ED1 A;  2NUT B;  4BI3 A;  1W2B P;  1YIJ T;  1OUL A;  1UUE A;  3PFS A;  3JB9 G;  2X3X D;  4Z89 A;  1D0Y A;  3C0C A;  2EVR A;  2K4Y A;  1S72 Q;  1YP5 A;  1QVG S;  1LCK A;  4LDY A;  4ZGE B;  1WJR A;  3QDF A;  1S72 A;  5CKD A;  1G3T A;  2CKK A;  1D3B B;  2LX7 A;  5DY9 A;  3CD6 T;  1B7T A;  4QW2 A;  4NS5 A;  1VQ6 Q;  2DKG A;  1KQS S;  2LNV A;  3M0R A;  1M3C A;  1S72 T;  4XU3 A;  1QCF A;  3VS3 A;  1B34 B;  2K3B A;  3PE0 A;  1TTH B;  2QI2 A;  1VQ6 A;  2P4T A;  2EJG A;  4L5G A;  2E5Q A;  2XDD A;  5GAO n;  5KYX B;  3OYM A;  1IHW A;  2CZ7 B;  2VC8 A;  5IXB A;  4C0F A;  1OQK A;  1VQ6 T;  2JMA A;  1BI3 A;  1O75 A;  2DPP B;  3VS5 A;  3QDR B;  3P8H A;  4RG2 A;  1N9S A;  3KXT A;  4M7A A;  1IHV A;  1BI2 A;  3GNF B;  4ZTJ A;  2F2W A;  5IAY A;  2L8D A;  2QXF A;  3OYH A;  4UC4 A;  4C0D B;  3A8O B;  3PMT A;  3PMI A;  4KH0 B;  3Q1J A;  3HFO A;  1YCS B;  3P8B B;  2DK3 A;  4HT9 A;  4PJO E;  2VYT A;  6AT1 B;  2FL7 A;  1ABO A;  1W4S A;  2GNC A;  2K5L A;  4N4I A;  1LPL A;  4GY5 A;  3JCM f;  4A54 A;  1TUC A;  5KYY A;  3VS7 A;  1GCP A;  3CMA Q;  4LD9 K;  2DXC A;  5CQY A;  5IXF A;  5CIU A;  2JM9 A;  1YHQ Q;  1RI9 A;  3NPF A;  3QWX X;  5CR2 A;  3CMA A;  2AZV A;  1AT1 B;  4FU6 A;  1AZG B;  4RTX A;  4C0Z A;  1YHQ A;  2L3S A;  2NYS A;  3VU3 C;  1QVG P;  3BY7 A;  1QCO A;  1Q81 U;  5GAM h;  2E3H A;  2ABL A;  2CS7 A;  1JJ2 P;  2YRC A;  1AWJ A;  3VS4 A;  4IUQ A;  1JQQ A;  3V7C A;  1VQ9 Q;  1YHQ T;  2JN0 A;  1HJD A;  1G8X A;  1RAI B;  2CP3 A;  2JOY A;  2CUB A;  2J05 A;  1VQ9 A;  2DMO A;  2QTX A;  4J9I A;  1KD1 U;  2KNB B;  1N6A A;  4KUD K;  4PJO D;  1V1C A;  2DL3 A;  4XU1 A;  1UEB A;  2DXB A;  2BZY A;  2QAZ A;  5GJV B;  1MGQ A;  4PFP A;  2X4J A;  1NJI R;  4C8Q F;  1I8F A;  1VQ9 T;  4PFO A;  5CO7 A;  2P0K A;  2D9T A;  1I07 A;  4ZGJ B;  5GAN 5;  4Z8A A;  4QQ6 A;  3MCA B;  4KGX B;  2XG8 D;  2X9H A;  3M59 A;  2Y4X A;  1HXD A;  3EG0 A;  3OMC A;  1NG2 A;  4BE0 A;  5KCH A;  2I0N A;  4HKE A;  1OPL A;  2MOX A;  1VQ5 Q;  2YT6 A;  2F5K A;  1TUG B;  4XTU A;  2JTM A;  4JLG A;  4M77 F;  4EMK C;  2K3X A;  1SEM A;  1VQ5 A;  1FXX A;  3X25 B;  2RMO A;  2VWF A;  2W10 A;  2QQR A;  1MMN A;  3M5A A;  3L42 A;  1VQ5 T;  3AT1 B;  4N0A A;  2LCC A;  3GNG A;  2NUP B;  4DEX A;  4OMQ A;  4Z02 A;  2DE0 X;  3S6W A;  2RI5 A;  4CI0 C;  4A63 B;  1D09 B;  4JS4 A;  3GLX A;  4GLM A;  4ATO A;  2E70 A;  2XK0 A;  2RHI A;  3FJP A;  2A08 A;  2R57 A;  2DD4 A;  1GFD A;  3I55 Q;  4BDZ A;  1Q7Y C;  4OML A;  5L23 A;  4PJM A;  3I55 A;  3UPU A;  4A4H A;  3URG A;  3I9Q A;  4C92 B;  1HYO A;  3WXM B;  2JUF A;  3QO3 A;  5A2Q E;  3QWY A;  1R8O B;  1VQ7 Q;  3L2Z A;  2RI3 A;  2K9G A;  1NEG A;  4LUE A;  3I55 T;  4P5N A;  2EW3 A;  1VQ7 A;  4ELY C;  2MIO A;  2EFI A;  4KGV B;  5FWC A;  4KUI A;  2RJD A;  1QQJ A;  3QII A;  4QKU A;  1W2B A;  4R56 A;  4BB7 A;  1E6G A;  4PJN A;  4HT8 A;  1VQ7 T;  2XDB A;  5KE3 A;  1TU0 B;  3RR6 A;  4C92 F;  4Q5W A;  1AWW A;  3E1S A;  2EJF A;  1YJN Q;  5A0D A;  2ESW A;  3EGU A;  3NFC A;  3HL8 A;  1B3Q A;  1VYU A;  3CQT A;  1YJN A;  2FO0 A;  5GAM e;  4M78 A;  3JB9 D;  1YWO A;  2JJ9 A;  2CZ6 B;  2LX9 A;  2X35 A;  1J3T A;  4D8D A;  2QG9 B;  1VQ8 Q;  1JRI A;  5LJ3 d;  3PTA A;  2QGF B;  3CPF A;  1YJN T;  4C5G A;  1T3S A;  4M75 C;  3OY9 A;  1VQ8 A;  5LL6 S;  1GCQ C;  1ZQ1 A;  5FU7 C;  3ER0 A;  3UDC A;  2HBP A;  2RJE A;  3ASK A;  2CZ1 B;  2D1X A;  4KUL A;  3MEU A;  2RB6 A;  3UAT A;  2LNH B;  1YI2 Q;  4J6W A;  1VQ8 T;  3EG9 B;  2YUQ A;  3OYG A;  2E12 A;  4RTU A;  1YI2 A;  2V8J A;  3OYK A;  4JJN K;  2IVW A;  2P0Q A;  2BE7 D;  4II1 A;  3RNJ A;  4PJJ A;  5LJ5 d;  1YI2 T;  1W6X A;  4WTO B;  3SEM A;  1M1G A;  2JXB A;  5GMK m;  1NPP A;  1SG5 A;  4IUU A;  2YUO A;  1AOJ A;  1X6B A;  1RUW A;  2O4X B;  3FDR A;  4XU0 A;  4QQD A;  1PNJ A;  1GBQ A;  2ENM A;  4IIO A;  1M2V A;  2IG0 A;  2RM4 A;  5CKF A;  3G4S Q;  2PNI A;  1QCN A;  2FRW A;  5CKH A;  1ZSZ B;  2E64 A;  1KQ2 A;  2KRM A;  2XMF A;  5L8R E;  3BE3 A;  3G4S A;  3QSU A;  1Q81 C;  1UB4 A;  4OGC A;  1JU5 C;  2PVG B;  2EIF A;  1QVG A;  2GFA A;  3M4Y A;  1WIE A;  5FLX E;  1JJ2 A;  1ZBX A;  5HY6 A;  1AWX A;  5GAM j;  4HCZ A;  1FMK A;  3M0S A;  2VXF A;  1KD1 C;  3JCM J;  4M7D G;  2E5K A;  3M58 A;  1Q82 C;  4AFU C;  1NEB A;  1KC8 R;  2RN8 A;  1LJO A;  3OMG A;  4B6M A;  1VIF A;  3QBY A;  2J6K A;  1BIA A;  3TRE A;  5CAI A;  3HTR A;  1VQL Q;  2PUK B;  4MZM A;  4IUV A;  2AKK A;  1VQL A;  4LXC A;  5KCO A;  2MK5 A;  4M7D C;  2YXY A;  3CXC P;  3QJ6 A;  1Y07 A;  4FW2 A;  2CP0 A;  2K3Y A;  4BUG A;  4A4G A;  1VQL T;  1OZ3 A;  2RO0 A;  2VGM A;  2PTK A;  3E9G A;  4RUG A;  1OV3 A;  2NUT A;  4PKC C;  4E47 A;  1X27 A;  4AFQ C;  4EDU A;  2JS2 A;  1VQN Q;  4D6W A;  3EGX B;  3CEY A;  3DB3 A;  2LCS A;  2COY A;  2OTJ T;  2EQI A;  2HL3 A;  1VQN A;  4RTZ A;  3LX7 A;  2DZ9 A;  1UGQ B;  4XTX A;  2WSC E;  4HVV A;  2G3R A;  2Z0W A;  2K6D A;  2EYX A;  5CKB A;  2R58 A;  2M0Y A;  2K5I A;  1D3B A;  2AKL A;  1SSF A;  4MML A;  4M78 F;  1QMC A;  2KRO A;  2HCK A;  5FW9 A;  2KGT A;  2ZCF B;  2E4H A;  4FSX A;  1WGS A;  4F14 A;  1JO8 A;  1GBR A;  1VYV A;  1PRM C;  1B34 A;  3RER A;  2EKO A;  3LH0 A;  3X20 B; 
#chains in the Genus database with same CATH homology
 2EJG A;  4L5G A;  4Y28 E;  2PUO B;  2E5Q A;  2XDD A;  5GAO n;  4EMH A;  3OYM A;  3L2V A;  1K9M U;  3OBY A;  2CZ7 B;  2VC8 A;  4LDV A;  4C0F A;  5LJ3 j;  1VQ6 T;  3C94 A;  1BI3 A;  5HK0 A;  1KG1 A;  1O75 A;  1Q86 C;  2DPP B;  4JDS A;  1WQ7 A;  3QDR B;  3P8H A;  3KUF A;  1WQW A;  4RG2 A;  4EMK A;  1N9S A;  3KXT A;  4B9X A;  4F7U G;  4E7J A;  3CBO A;  4M7A A;  1BI2 A;  2EJ9 A;  3OYC A;  3GNF B;  5GAN e;  3M4G A;  4EMK B;  5IN1 A;  5KH6 A;  1RL2 A;  4PLL A;  3VV0 A;  4N4G A;  2RH2 A;  4J8O A;  3DLM A;  4XK8 E;  2L8D A;  4C5H A;  3M54 A;  2NLU A;  4M7A B;  5IAY A;  2QXF A;  5GMK h;  3OYL A;  3OYH A;  3T9N A;  1BI1 A;  4UC4 A;  4C0D B;  3A8O B;  3PMT A;  4FT4 A;  3G71 A;  3PMI A;  1X75 C;  4PNO A;  1N8R U;  3RMQ A;  3Q1J A;  3OSV A;  3SFM A;  3HFO A;  4RKU E;  4M75 E;  4JS5 A;  2R5A A;  3J7A F;  2JTF A;  2M0O A;  3P8B B;  5FU6 C;  2DK3 A;  1UGS B;  1IZ6 A;  3L2W A;  4HT9 A;  4PJO E;  3UT1 A;  3GF5 A;  2VYT A;  3G71 T;  4C8Q C;  5LJ5 j;  5FRO A;  3MEA A;  4JUV A;  2MWP A;  4M78 G;  2FL7 A;  3BDL A;  1W4S A;  2K5L A;  4N4I A;  4GY5 A;  3PIO A;  3O8V A;  3CCS A;  3JCM f;  4A54 A;  3TEE A;  2E6Z A;  2RHX A;  1KQS A;  5GMK e;  5GAO p;  3M9Q A;  1U1T A;  4OB0 B;  3JCM V;  3CC2 A;  4M7A F;  1NPR A;  5D6X A;  2CGH A;  2VXE A;  4LD9 K;  2DXC A;  5CQY A;  4HCB A;  3M57 A;  3GOX A;  1M5Q 1;  5CIU A;  2D6F A;  3CCU A;  2LTO A;  2YLB A;  3HRU A;  2FB7 A;  4X9C A;  5CR2 A;  4ELZ C;  3CMA A;  1K73 C;  2LC4 A;  2LVM A;  2ZZD A;  4J6Y A;  3V8L A;  2MWO A;  3CC2 T;  2E6N A;  3MET A;  4JRQ A;  4FU6 A;  1Y71 A;  4C0Z A;  3JCM b;  1YHQ A;  2R5M A;  2EWN A;  3JCM e;  4MMK A;  3VU3 C;  1M90 U;  3BY7 A;  1Q81 U;  2H3J A;  4J6X A;  1VUB A;  2EQJ A;  3OYY A;  1I4K 1;  4M77 C;  3RES A;  1DJ7 B;  3CCQ A;  2XI9 A;  5GAM h;  1Q7Y U;  2YHT A;  2CS7 A;  1YBY A;  4C5I A;  2JVV A;  2DTO A;  1NJI C;  4IUQ A;  3V7C A;  1YHQ T;  2JN0 A;  4GLK A;  1KQ1 A;  2XID A;  3INZ A;  5AYF A;  2JOY A;  1FX7 A;  1UGP B;  3CCQ T;  1LOJ A;  4M75 D;  4LDX A;  4XU2 A;  4NL3 A;  2XD0 A;  1WNL A;  1VQ9 A;  2OTJ A;  3FB9 A;  4MZT A;  2QTX A;  1KD1 U;  1K8A U;  1N6A A;  3OYI A;  4KUD K;  4PJO D;  4XU1 A;  2XU8 A;  1I5L A;  1UEB A;  2DXB A;  3JB9 H;  1MGQ A;  4OB1 B;  2DEQ A;  2X4J A;  2VV5 A;  4DQ2 A;  5DLQ E;  4C8Q F;  4NOY A;  1I8F A;  3SB2 A;  1VQ9 T;  5CO7 A;  1PSF A;  2JNG A;  2P0K A;  2D9T A;  2GFU A;  3SWN A;  3MP1 A;  4ZGJ B;  5I21 A;  3JCM g;  2QDY B;  5GAN 5;  1NE8 A;  2E65 A;  2ZPI B;  3KBG A;  4C0G A;  5C0M A;  3CD6 A;  3SWN B;  3LGL A;  5A0G A;  4QQ6 A;  3MCA B;  2XG8 D;  2KVQ G;  3JCM Q;  4OP0 A;  2QQA A;  4O6J A;  3OS2 A;  1Y7X A;  2M16 A;  3LYI A;  3M59 A;  3ME9 A;  2DD5 A;  2Y4X A;  1HXD A;  3JCM d;  2EQM A;  3FC3 A;  1YJW A;  4M7A G;  2DIG A;  3OMC A;  5GAN j;  3CC4 A;  3FLG A;  4BE0 A;  2F69 A;  5KCH A;  1QVP A;  2PU9 B;  3MO8 A;  2EQK A;  5HKC A;  3M55 A;  4HKE A;  1JBM A;  3GPL A;  3E9F A;  2F5K A;  4XTU A;  1H64 1;  5A0L A;  5IT9 E;  5GAN 8;  2KDS A;  3QKJ A;  4PL6 A;  1YJW T;  2JTM A;  2VUB A;  4JLG A;  4M77 F;  4EMK C;  3CCV A;  4JRP A;  3CC4 T;  2K3X A;  3MEV A;  2WSE E;  3CXC S;  1VQP A;  4M7A C;  3SD4 A;  1VQ5 A;  1FXX A;  2RD1 A;  4C0D C;  2XDP A;  1XNI A;  4J7I A;  2PVD B;  4M78 E;  2QEX A;  4C92 D;  2QQB A;  5GAN 2;  1QVF S;  2EYQ A;  4BI4 A;  4M75 A;  3X25 B;  5GAM g;  1M1F A;  4E7H A;  3CCV T;  4M7D E;  2QQR A;  5GAO m;  3MP6 A;  4PJO A;  4M75 B;  1VQP T;  3M5A A;  3L42 A;  2RA2 A;  1LNX A;  4EPC A;  1VQ5 T;  4N0A A;  3A5Z B;  4ZTJ A;  1XTD A;  2L5Q A;  5FU7 B;  3CC7 A;  2LCC A;  2QEX T;  5GAM d;  4PJO B;  2RHY A;  3GNG A;  3JSC A;  5I2M A;  3JCM X;  1PSE A;  4OF1 A;  2P0P A;  3OYA A;  4Z02 A;  1G5V A;  2ZPE B;  3OB9 A;  1YIT A;  4LDW A;  4BY6 B;  4RCC A;  3NTK A;  4BDY A;  2RHU A;  4J83 A;  3LWH A;  4IUP A;  4C8Q G;  4QVD A;  3CC7 T;  4ME7 A;  3FRN A;  5EG2 A;  3LWI A;  2HQX A;  2A7Y A;  3SDZ A;  4ZN3 A;  1YIT T;  4A4K A;  4VUB A;  5HK3 A;  3NTI A;  3L2U A;  3QYH B;  3S6W A;  3OYE A;  3QYG B;  2ZPG B;  1Y96 A;  1BIB A;  2RI5 A;  4CI0 C;  5GAO r;  4BAC A;  3DKM A;  4JS4 A;  3GLX A;  5LJ3 h;  3C95 A;  4ATO A;  1JB0 E;  2E70 A;  3H6Z A;  5FRN A;  4A53 A;  1Y96 B;  2DO3 A;  2DXU A;  2XK0 A;  3JCM W;  2RHI A;  3FJP A;  3HKS A;  4PJO F;  2R57 A;  1OYX A;  1M1K C;  2DD4 A;  5LJ3 f;  2WSF E;  4KBM B;  2DIQ A;  5D6Y A;  2A3L A;  2E10 A;  3WVD B;  2L3R A;  1M4Z A;  2DTI A;  1G3S A;  4IKF A;  4BDZ A;  4HA8 A;  1Q7Y C;  4N4H A;  3RIR A;  4JRK A;  4C92 A;  5GAO l;  4M77 G;  2K5F A;  1V29 B;  1YCY A;  3CXC A;  3DLL A;  2KY9 A;  3I55 A;  3UPU A;  3S3M A;  4M7D D;  4A4H A;  3URG A;  4C92 B;  3FIF A;  3WXM B;  2JUF A;  3QO3 A;  5GAO q;  5A2Q E;  3G4S T;  2XHC A;  4Y91 A;  2RJC A;  1R8O B;  1XOV A;  4XTY A;  3VJP A;  3OS0 A;  1QVF A;  3L2Z A;  4B9W A;  2RI3 A;  2XKO C;  3OS5 A;  3RUX A;  1HK9 A;  5LJ3 e;  4A4F A;  1ZHI A;  3VUB A;  3I55 T;  4P5N A;  3ZEH A;  1K8A C;  3X24 B;  5GAN 6;  4ELY C;  1VQ7 A;  3CCL A;  2EFI A;  4RG8 A;  5GMK l;  1YJ9 A;  5LJ5 h;  1KC8 U;  3CPW S;  4KUI A;  3OW2 S;  2HD0 A;  2RJD A;  4FL6 A;  5CVI A;  3QII A;  3RKY A;  3UWN A;  1W2B A;  2QQS A;  5GAM f;  4R56 A;  4BB7 A;  3SWN C;  2DVE A;  1VQ7 T;  4HT8 A;  2D0Q B;  3CBM A;  4XQ3 A;  4XTV A;  3OYB A;  3CCL T;  3VYH B;  3JRZ A;  3L2R A;  1YJ9 T;  5KE3 A;  2RHZ A;  2CZ0 B;  3QZ9 B;  3J80 E;  3CME A;  3VUZ A;  4C92 F;  4YTL A;  4Q5W A;  3QZ5 B;  4QQG A;  4A4E A;  5C6S A;  3OYD A;  1Q82 U;  4EMG A;  2I2L A;  3PGG A;  2MI6 A;  3E1S A;  5DLO A;  2EJF A;  5GAN 3;  1FWZ A;  5A0D A;  4MDX A;  2KMT A;  4LDU A;  2LDM A;  3NFC A;  3HL8 A;  2V8I A;  2M1H A;  3CME T;  1OZ2 A;  3QUI A;  3A8H B;  1WJS A;  2LCL A;  5LJ3 g;  3RMS A;  3S3O A;  1YJN A;  3HFN A;  5GAM e;  4M78 A;  4PJO G;  2F5T X;  2RI2 A;  3JB9 D;  4RCB A;  2GQV A;  2CZ6 B;  2LX9 A;  2X35 A;  2OAU A;  4M78 B;  4F7U E;  3G7Z A;  4M7D A;  3OYN A;  1JRI A;  2V8K A;  3GIB A;  4XTZ A;  2Y4Y A;  2QQ9 A;  3CBP A;  3MP8 A;  5LJ3 d;  3PTA A;  4E7K A;  3L1A A;  3CPF A;  4M7D B;  1YJN T;  3HHT B;  4BD3 A;  2L89 A;  4C5G A;  4C8Q E;  5DM7 R;  4M75 C;  3OY9 A;  1K9M C;  1VQ8 A;  5LL6 S;  1ZQ1 A;  3HRT A;  4KT0 E;  5FU7 C;  3ER0 A;  1U1S A;  3JCM c;  4PJO C;  3QPH A;  1I81 A;  2X4Y A;  4N0A C;  2HBP A;  2RJE A;  3ASK A;  3C12 A;  3OQ5 A;  2MF2 A;  3UDC A;  4ZN1 A;  3CCM A;  2CZ1 B;  4BY6 C;  4KUL A;  4CRI A;  3MEU A;  4FT2 A;  2RB6 A;  4J6W A;  1VQ8 T;  2ZPB B;  4DOW A;  3ZBD A;  2DJZ A;  4IUR A;  3CPW A;  3OA6 A;  4FM4 B;  1WJQ A;  3OW2 A;  1M9S A;  3OYG A;  2E1H A;  1VQN T;  2E12 A;  1JJ2 S;  5LJ5 g;  1YI2 A;  2RK1 A;  3CCM T;  3QSU A;  2V8J A;  3OS1 A;  3TU4 K;  4RMO A;  2FYK A;  3OYK A;  4OVA A;  4JJN K;  2ZPF B;  2IVW A;  5J26 A;  2P0Q A;  3EFS A;  1N27 A;  4M7D F;  4II1 A;  4PLI A;  1BKB A;  1N8R C;  1KHC A;  4M77 E;  5LJ5 d;  5GAN h;  3CCR A;  1KHI A;  2MMP A;  3X26 B;  5J39 A;  5GMK j;  3RKX A;  3OYJ A;  1XQH A;  4L6V 5;  4C92 G;  1YI2 T;  1VQ4 A;  1RI0 A;  5I2S A;  1G3W A;  3QG1 A;  5GAN f;  3JCM P;  1W2B S;  1NZ9 A;  1M1G A;  3VKI A;  4E7L A;  2JZ2 A;  4XAX B;  3CCR T;  5GMK m;  1NPP A;  1QP2 A;  2LT4 A;  4IUU A;  2O4X A;  2OTL A;  1TH7 A;  3QHS A;  1VQ4 T;  1G3Y A;  1WPY A;  4MZP A;  4DOV A;  2FHD A;  3F70 A;  5M9O A;  4V2S A;  2K57 A;  4C92 C;  3H8Z A;  2O4X B;  3FDR A;  4XU0 A;  2DAQ A;  4QQD A;  4C8Q D;  4ZTF A;  3PT9 A;  2FVU A;  2RJF A;  3QJY A;  2WAC A;  2IG0 A;  2RM4 A;  1H3Z A;  5CKF A;  4M75 F;  1M1K U;  2OTL T;  2PQW A;  4NL2 A;  3OSS C;  1GXI E;  3OYF A;  1MHN A;  2ZPH B;  1IRE B;  1VIE A;  5CKH A;  4OGE A;  3LGF A;  2E64 A;  1KQ2 A;  1QW1 A;  5L8R E;  3G4S A;  3NTH A;  2DZC A;  1M90 C;  3GP8 A;  3CCE A;  3A8M B;  2M9U A;  1Q81 C;  4M78 D;  2KQW A;  3I56 A;  1UB4 A;  4OGC A;  3V7R A;  3C4S A;  2BKD N;  2PVG B;  2EIF A;  4C5E A;  1KC8 C;  4X9D A;  2QA4 A;  1Q86 U;  1BYM A;  2XIC A;  5CKE A;  3PNW C;  4J7F A;  5CK9 A;  1QVG A;  2GFA A;  3M4Y A;  2LQ8 A;  3DB4 A;  3HP9 A;  3JB9 F;  2AHJ B;  3N5B B;  2E41 A;  2KK4 A;  2PVO B;  1EIF A;  3R6O A;  1X01 A;  5FLX E;  3JCM h;  1BI0 A;  3QXE B;  4QVC A;  1ZBX A;  4M77 D;  3PIP A;  1JJ2 A;  3I56 T;  3CCE T;  2VGN A;  5HY6 A;  4OB3 B;  3MEW A;  5GAM j;  3EFR A;  2QA4 T;  1AHJ B;  4HCZ A;  2KSS A;  2EQU A;  2X4W A;  4IUT A;  1KD1 C;  2VXF A;  3V8K A;  3ZFJ A;  3X28 B;  3JCM J;  4M7D G;  2RK2 A;  3M58 A;  1Q82 C;  4BE2 A;  4M7A E;  2XDB A;  3BW1 A;  1LJO A;  3VYG A;  2LRQ A;  3OMG A;  4J5Y A;  2CYZ B;  3JAM E;  5GAN g;  1VIF A;  2HNI A;  3QBY A;  2X4X A;  4BI8 B;  4JRI A;  1BIA A;  3TRE A;  4F7U A;  5CAI A;  2PUK B;  3P8D A;  4MZM A;  3V7S A;  5LJ5 f;  3HSB A;  3CCS T;  3A8G B;  2HAX A;  4WF2 A;  4M78 C;  2LQK A;  2KAF A;  4F7U B;  2B8A A;  3LW5 E;  4IUV A;  1O9S A;  4C8Q A;  5FU6 B;  3L2Q A;  4E7I A;  3BFM A;  5GAN d;  1VQL A;  5CCA A;  5KCO A;  1U8R A;  4M7D C;  2GCX A;  3M56 A;  1VQK A;  4C8Q B;  4BE1 A;  4DA4 A;  3G6E A;  2EAY A;  2LT1 A;  3QJ6 A;  3CCU T;  1Y07 A;  1VQM A;  4MDW A;  2HQE A;  3HPW A;  5CQX A;  1X6O A;  3CMA T;  3AHU A;  4ZGD B;  2K3Y A;  3LLR A;  5GAN 7;  4BUG A;  4A4G A;  2YRV A;  1VQL T;  1OZ3 A;  4M75 G;  4FIB A;  2RO0 A;  3FEO A;  1OI1 A;  3E19 A;  2VGM A;  4JLI A;  1VQK T;  5LJ5 e;  3E9G A;  2DTH A;  4L59 A;  3RKW A;  3J81 E;  3G6E T;  1K73 U;  3OBW A;  3A8L B;  1YIJ A;  2C06 A;  1VQM T;  5J3B A;  1VQO A;  4C92 E;  2Y90 A;  2K2V A;  4LD6 A;  3V8J A;  4X34 A;  4OMF B;  1QP3 A;  3JB9 J;  2BIV A;  2O01 E;  5GMK i;  4PKC C;  3CCJ A;  1P92 A;  4E47 A;  4EDU A;  4F7U F;  4M77 A;  4BI3 A;  1M8V A;  4D6W A;  3S3N A;  3TCJ A;  1YIJ T;  3CEY A;  3DB3 A;  5GAN 4;  1VQO T;  3BDU A;  4O5V A;  1NJI U;  3PFS A;  3JB9 G;  3EAE A;  4M77 B;  3MHX A;  5D6W A;  2OTJ T;  4XTW A;  1N9R A;  4M7A D;  1VQN A;  3CCJ T;  2MAM A;  2K4Y A;  2DZ9 A;  3LX7 A;  4HCC A;  1UGR B;  1UGQ B;  2BUD A;  4XTX A;  2WSC E;  2G3R A;  2YLC A;  1QVG S;  5CKB A;  5KE2 A;  2R58 A;  4LDY A;  2K5I A;  1D3B A;  4ZGE B;  1WJR A;  1SSF A;  1S72 A;  5FRM A;  4R55 A;  4MML A;  5CKD A;  4M78 F;  1G3T A;  2CKK A;  2ZGW A;  1D3B B;  3JB9 I;  3M53 A;  4FSX A;  2GF7 A;  2ZCF B;  5DY9 A;  1WGS A;  3CD6 T;  2DXT A;  4QW2 A;  4NS5 A;  1B34 A;  2DKG A;  1KQS S;  2LNV A;  4TVR A;  3HRS A;  1S72 T;  4XU3 A;  3RER A;  2EKO A;  4OB2 B;  3WVE B;  1B34 B;  4QVZ A;  3LH0 A;  1VQ6 A;  2QI2 A;  2P4T A;  3X20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...