2EQJA

Solution structure of the tudor domain of metal-response element-binding transcription factor 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
b'GSSGSSGKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal-response element-binding transcription factor 2
publication title Solution structure of the TUDOR domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqjA00
2XK0A 3NTHA 4A4GA 4E7IA 2YRVA 2GF7A 2B8AA 2BKDN 2DAQA 4IUUA 2GFAA 1OZ2A 2QQRA 5J39A 3MP6A 5D6XA 3OY9A 2HQXA 4PLLA 2E5QA 3FDRA 4QQ6A 2EKOA 3MO8A 5D6YA 3E9GA 2XDPA 2L8DA 2RJDA 3H6ZA 4Q5WA 3C4SA 1H3ZA 1WJRA 3OB9A 4L59A 4RG2A 4Z02A 2RJFA 1WJQA 3PNWC 3PMIA 2GFUA 3OYDA 3FEOA 3S3MA 4BACA 4IUPA 3CEYA 3OYAA 3L42A 2EQUA 4A4EA 4IURA 3L2RA 3DLMA 2HQEA 3OYGA 2M16A 5M9OA 2LRQA 2RJEA 5CIUA 3BDLA 2D9TA 3FLGA 2BUDA 2K3YA 5KE3A 4BD3A 4BE2A 5C0MA 2R58A 3MP1A 2R5MA 4E7LA 4IKFA 2K3XA 2X4WA 3L2UA 3META 5IN1A 4QW2A 3S3NA 2NLUA 4EDUA 4N4IA 3OYCA 4N4GA 3LGLA 3MEVA 2DIQA 4E7JA 4ZTFA 3OYMA 2RHIA 1WGSA 2LCCA 3FC3A 2G3RA 4A4HA 4C5EA 2RJCA 3QJ6A 3OYBA 4NS5A 5KCOA 3LH0A 3H8ZA 1OI1A 2QQSA 4N4HA 3OS2A 3MEWA 3OYFA 4BE1A 3EAEA 4GY5A 3QBYA 2P0KA 2LDMA 3LYIA 5FRNA 2EQJA 4HCZA 2CKKA 5KE2A 2BIVA 4OVAA 5KCHA 3L2QA 3M9QA 3OYHA 2F5KA 3DB3A 4A4FA 3P8HA 1XNIA 1G5VA 3PFSA 3NTIA 3L2WA 2LVMA 4FL6A 3DB4A 3NTKA 3O8VA 4C5HA 3S3OA 4C5IA 2DIGA 3OYLA 4IUTA 5FRMA 1MHNA 3OA6A 2X35A 3UWNA 5C6SA 3LLRA 2MWPA 2EFIA 3ASKA 2RO0A 5IAYA 2MWOA 4B9WA 1N27A 3OMCA 2FHDA 2RHYA 3MP8A 1WJSA 4QQDA 2L3RA 2O4XB 3MEAA 3LX7A 4QQGA 3UT1A 3L2VA 2IG0A 3E9FA 3KUFA 2M0OA 3OYKA 4FU6A 2EQKA 4IUQA 2RHXA 3OQ5A 1KHCA 3ME9A 4E7HA 3GOXA 3QKJA 3ZEHA 2RI5A 2M1HA 4CRIA 4QVZA 4C5GA 3OS0A 4BE0A 3MEUA 2O4XA 4II1A 3S6WA 4PL6A 3QIIA 3P8DA 4B9XA 3F70A 2WACA 2E6NA 4ZTJA 2LTOA 2R57A 3OMGA 2PQWA 3OYIA 3OYJA 2RHZA 3OS1A 3Q1JA 2JTFA 3OYEA 4LD6A 3OYNA 4E7KA 2X4YA 3LGFA 2RHUA 4IUVA 5D6WA 2EQMA 2JZ2A 1OZ3A 2RI3A 4X34A 4BDZA 2VYTA 1RI0A 3PMTA 2L89A 4PLIA 5KH6A 1SSFA 2R5AA 5J26A 4UC4A 4BDYA 2X4XA 1OYXA 2RI2A 3SD4A 5FROA
chains in the Genus database with same CATH superfamily
2RQUA 3CBPA 3P8BB 2AKKA 2HZYA 2Y4XA 2O01E 1QVFA 1OZ2A 4JRPA 4Z88A 3SEMA 3CBOA 2EKOA 1YJNQ 2GNCA 1OU8A 3G71A 1MMDA 4P5NA 1H3ZA 1DJ7B 1TUGB 3EG0A 3CD6Q 4MZPA 4ATOA 2ATCB 2DX1A 3CBMA 1K9MC 2CT3A 4FM4B 2OTLQ 1AZGB 1FMKA 4C0DB 4JS4A 2YUOA 3GPLA 6AT1B 4BY6C 1VQNQ 4KH1B 3BDLA 2K2VA 4KUIA 5GANe 1XJWB 4JRKA 1V1CA 1M3CA 3CCMA 5GAOp 4M77A 3CCJA 1VQOQ 1MGQA 1LJOA 4A4HA 3FJ5A 2DA9A 3UA6A 4OP0A 3O5ZA 1G3WA 1O9SA 2BIVA 5FW9A 3VS3A 4A4FA 1FX7A 5FWCA 2DFUA 2ABLA 1KSWA 5LJ5d 1WIEA 4PJOE 1TTHB 4M7AF 2EPDA 2QAZA 4M77C 1K8AR 4JJDA 3LLRA 2XDBA 1BKBA 4J6WA 1FXXA 2ZPGB 2KAFA 2ZPEB 1M90C 3OYKA 1KQSP 3CCMT 3CCJT 5GMKm 2W0ZA 3OS0A 2OJ2A 2FYKA 2DTIA 1HD3A 2FPEA 3HFNA 2A36A 3PT9A 4LD6A 3LWHA 4PJOD 3G7ZA 3SDZA 5IT9E 2EQMA 1WHMA 3H0IA 5GANg 3G71Q 1W2BP 2ENMA 3TCJA 1M8MA 2A0FB 1UFFA 3EGUA 2OX7A 2XK0A 4A4GA 4E7IA 3JCMW 2XKOC 1Q82C 2DAQA 4O5VA 4IUUA 1PNJA 3TREA 4MMLA 4ZN1A 3I5RA 2RJDA 2Z0WA 2F69A 3C4SA 1NZ9A 1IGUA 1ABQA 3CCMQ 1KQ1A 4F7UA 2ECZA 3CCJQ 4HCCA 1D1CA 2LZ6B 3CCLA 1GBQA 2K3YA 2QI2A 2GCXA 1M1GA 2RQWA 4QW2A 1LNXA 4N4IA 1Y07A 1JB0E 2ED1A 3J81E 2G6FX 2O31A 4ZN3A 2VUBA 4NS5A 2E4HA 3CC4A 5A0GA 4BE1A 2L5QA 1WDXA 2EQJA 2EYZA 1PD0A 1RACB 1YWPA 3OYHA 3TSWA 3P8HA 3CCUA 3RERA 2A08A 1XNIA 1WHGA 2XG8D 2DBKA 1IO6A 1RLPC 2W10A 3QZ9B 3THKA 1BI1A 4XAXB 1VQPA 1M1FA 2HEQA 1NYGA 1YI2A 3RMSA 5GAN4 2A37A 1KIKA 3CC2A 5GAOr 1S1NA 1PG5B 4E6RA 4J9GA 4FU6A 4KGXB 1KHCA 3OSVA 4PFPA 4C5GA 1SKUB 4DA4A 2O4XA 4PL6A 3CC4T 1WQ7A 4C8QG 5KYUA 1K4US 5KYWB 1TSFA 5IH2A 3CCRT 3OYEA 2X4YA 3RIRA 2ZCFB 4A53A 2COYA 3PMTA 3JB9D 4M7DD 4PLIA 1N9RA 2X4JA 4RCCA 2DXUA 1YI2T 2KRSA 4DOWA 2CP6A 1SRMA 3IQLA 3QWXX 3CCLQ 2JM9A 1BYMA 4R0KA 2HKNA 5A2QE 2XI9A 3V8KA 2DD4A 4BY6B 1TG0A 3RMQA 1SHGA 3URGA 3N5BB 1TWBA 3ZL7C 2JN0A 4IURA 3DLMA 3CC4Q 2VVKA 3SFMA 2VWFA 2YUPA 4WTOB 3CCUQ 2BE7D 3PTAA 4OB1B 4RTTA 4KGZB 2V26A 1VQPQ 1Q81R 2L2PA 3X20B 2KGTA 3ZBDA 1YI2Q 1K9MU 4X1VA 2DD5A 3L2QA 1VQ4A 1IZ6A 4M4ZA 2QQBA 3CC2Q 2SRCA 1O75A 2EKHA 4M75D 2LQKA 4R56A 3EHQA 1WJSA 4C92B 1OX9A 3HP9A 3BW1A 3OBYA 1LCKA 3I35A 3EGDA 3JCMg 1NPRA 5LJ3j 2C0TA 1I8FA 3EFSA 1MUZA 4C8QB 4OMOA 4QVZA 4PJOA 2WSFE 2JOYA 2GQVA 3LW5E 3OBWA 1AEYA 5LJ5e 1QWEA 2CSQA 2ZPIB 3OYJA 4XTZA 1VQ4T 4X34A 4QVCA 1M90U 4J83A 2L89A 2JTEA 4DBRA 2R5AA 3HKSA 4UC4A 3D7SB 5CKFA 1XQHA 2K9GA 4IUTA 2C0IA 4PJOC 3NFCA 2FPFA 2CP0A 4DOVA 1ZA1B 2EYXA 5FWBA 2A3LA 2QEXA 2QA4A 2H8HA 1TS9A 1WJRA 3OB9A 3GNFB 4ZGJB 4Z02A 5DLOA 3I55A 3I9QA 2GFUA 4AT1B 2FZCB 2M02A 3L1AA 4ZGEB 1Q86C 1MNEA 3E19A 4C8QF 4A4EA 4J7IA 4J9HA 1U06A 3OW2S 2DKGA 4D6WA 1OQKA 1Q82U 4FT2A 2QDLA 2KK4A 5CKHA 5GAMj 1VQ4Q 2CUDA 3QZ5B 1HSQA 3C94A 5GAOm 4OGCA 2LQ8A 1QCFA 3UA7A 5AYFA 4YTLA 2XMFA 3X25B 1OPKA 2QEXT 2QA4T 5FRNA 1JO8A 3EGXB 2FRWA 1ZBJA 2LT1A 5IHIA 3M9QA 5LJ5g 3I55T 4C92E 5GAOn 1WNLA 4XU2A 3M5AA 2DRKA 3VUZA 1WHKA 1QCOA 3M0PA 4C8QE 1KHIA 3ASKA 5I2SA 2KI7A 1GBRA 4Z89A 2D8JA 4R55A 3L2VA 2OTJA 1EX4A 2EQKA 1YJWA 2ZPFB 5A0DA 3EH2A 4J9DA 5LJ3e 2L3PA 3AHUA 3HSBA 1SSHA 2ESWA 2ROLA 3RKYA 1XOVA 3Q1JA 2KVQG 2FRYA 2KE9A 5GAN8 3J7AF 3GF5A 4L6V5 2JTMA 1OPLA 2DERA 2QEXQ 2QA4Q 1KC8C 2VYTA 1CKBA 5KH6A 1Y57A 5J26A 3I55Q 2FG0A 3V7RA 2YRVA 4JLGA 2CH4A 1R0CB 2LX7A 1VQKA 3OY9A 2OTJT 1YJWT 3I5SA 3VRZA 3CMEA 1UJYA 2RJFA 1N8RR 1BI0A 3CCET 5GJWB 1A0NB 1S72A 2RM4A 1H92A 2AKLA 4JRQA 1VQ8A 1N5ZA 2M16A 4QT7A 1M1KR 3OW2P 4OGEA 2FL7A 4ME7A 1PSFA 3META 1JXMA 1VOMA 2DL4A 2BZXA 2HNIA 2KQWA 3NHNA 3EG2A 5GAN3 4M78B 3HTRA 2LP5A 2RD1A 3H8ZA 1HK9A 3QDRB 2I2LA 1QVGS 1VQKT 4GY5A 1NM7A 1D0ZA 3CCVT 2K4YA 5KE2A 2DZ9A 2EYQA 5KCHA 2JT4A 2F5KA 1ZLMA 3CMET 5GANj 1G3SA 3M57A 3ZFJA 3TU4K 2OTJQ 2HQHA 3S3OA 3DB4A 3NTKA 2V8IA 2DL5A 1YJWQ 1S72T 3M56A 2L0AA 4RTXA 4X9CA 2VKNA 3CCST 1VQ8T 3CCEQ 2F2XA 3JCMP 2EFIA 4XTUA 1U8RA 1YCSB 2MWOA 4QQDA 3PIOA 3TVTA 4J8OA 2DF6A 1K76A 3MHXA 1RUWA 1T3SA 5LL6S 2LJ3A 4QKUA 4XU1A 3HRUA 4E7SA 2R57A 3EH1A 4LD9K 1GFDA 4OMLA 2DXCA 3JAME 1N6AA 4RKUE 1VQKQ 2ZPHB 3OSSC 5KYWA 4Z8AA 1I4K1 3CMEQ 3V7SA 2O9SA 2PUOB 2CYZB 3SD4A 1S72Q 2QQAA 1U1TA 2NYSA 1YNZA 2KYBA 1VQ8Q 2LT4A 2YLCA 3QYHB 2F1LA 4DBHA 1EFNA 2QDYB 3M0TA 2B86A 1HYOA 3PNWC 2PZ1A 3QSUA 1W6XA 4IUPA 2E5KA 5IXBA 1BI3A 5CIUA 4M78E 3JCMJ 2DL8A 3QPHA 5IXFA 2D0QB 2QK0A 1YP5A 1C0MA 2K3XA 5GMKi 2NLUA 4ZGDB 1RADB 2PU9B 4M7AB 4BI3A 4JZ3A 3M4GA 1NBEB 2RJCA 3CPWA 4X9DA 1QW1A 1Q86U 3QBYA 4HA8A 2LDMA 1D1AA 2C0OA 3JB9I 1QVGP 2HD0A 5KYYB 3DB3A 4JRIA 2HAXA 3O8VA 1JJ2A 5GMKh 4M78D 2E64A 2MCNA 2CP3A 1MMNA 2LQWA 5GAMf 3UT1A 1WHJA 4Y28E 4FYVB 1PCXA 2E12A 4EIKA 2MK5A 5CKBA 3QKJA 4AFUC 2JW4A 4C92A 3S6WA 2QTVA 1RAHB 3E1SA 1UDLA 4ELYC 1X6BA 4RTVA 4C8QA 1U3OA 1UUEA 3LH5A 1MV3A 4J9BA 3H41A 1WZOA 1UHFA 2HBWA 4M75G 2DRMA 1ZA2B 2YSQA 2XICA 3PVQA 4C92C 4KBMB 3REAB 2DEUA 3GIBA 2KT1A 1XTDA 4PLLA 3UPUA 1UGSB 4C8QC 1I0CA 4MMKA 2FEIA 1U5SA 2E3HA 1KC8U 1D1BA 1B3QA 1G2BA 8ATCB 2E41A 2RMOA 3GP8A 3L42A 4FSSA 1KK7A 4M7AE 1GFCA 1M1KC 3TQ7P 3OYGA 2AK5A 3JB9H 4IIMA 5DY9A 3T9NA 3HPWA 4IIOA 4FYXB 1OU9A 4IKFA 2EVRA 2CZ0B 3BE3A 4N4GA 3MPUB 1ZBXA 1RAAB 3SB2A 2DXTA 3OYMA 2CP5A 3VUBA 3FIFA 4XTVA 4DEXA 2MMPA 4V2SA 3JRZA 2KR3A 1G8XA 2DVEA 2EWNA 5CKEA 3EGXA 2RPNA 1MHNA 2EBPA 1JRIA 2HKQB 4E2FB 2H3EB 2PVDB 2YUNA 1WFWA 1KG1A 1RABB 2XDDA 2WSCE 2ROTA 1HXDA 3CCRA 4ZNXA 2RI5A 2QYZA 4CRIA 5CQYA 1WHHA 3PVLA 3OYYA 4JDSA 5GANf 4JJCA 3VV0A 1G3YA 4EMHA 2RHUA 5D6WA 1CSKA 2RI3A 3PIPA 1RI0A 2CSIA 4LXCA 2PUKB 1ZSZB 1VQ9A 1QP3A 2GF7A 2JS2A 5LJ5j 2GFAA 4M77G 3QO3A 1OV3A 2XDPA 4PFZA 5EC7A 1IRXA 3KFVA 2CZ1B 1GCPA 5KYNA 2FZKB 2AHJB 2RK1A 2EQUA 1VQ7A 2FVUA 2D9TA 2EQIA 3JCMe 4E7LA 2XIDA 4KH0B 3L2UA 2IVWA 4M75F 3QHSA 4FIBA 2DETA 1W4SA 1M8VA 1Y96B 4FCYA 1ABOA 3FC3A 1VQ9T 5FLXE 1IHWA 5GAMh 1B07A 4EMKB 3EAEA 4E47A 1KQSA 4HT9A 3CC7A 2YDLA 2CP2A 2EJ9A 1YBYA 5GAN2 4M78A 2EJFA 1YHQT 1BI2A 4FL6A 3M0RA 3I56A 2MOXA 3CCRQ 2EIFA 4OMQA 2LC4A 7AT1B 3OA6A 5L8RE 3V8JA 2DYBA 2X35A 1Q7YR 3CXCS 1VQ7T 2MWPA 4F04B 1I5LA 1KD1R 2EGCA 4FSXA 1T0HA 1WYXA 3OMCA 2YUQA 3C0CA 4JZ4A 2K79A 3LX7A 1W2BA 1NLOC 1PRMC 3OQ5A 3QWYA 3ME9A 4J6XA 4MDWA 4M78C 4BE0A 4II1A 4PNOA 2P0PA 3P8DA 2WACA 2E6NA 2JM8A 3CC7T 2LX9A 1M9SA 1K8AC 1VQ9Q 3MCAB 3QG1A 3EG9A 1LVKA 4PK4A 4F7UG 1AD5A 2JZ2A 2JNGA 5GAN5 3I56T 2DLPA 1YHQQ 3QYGB 1ZUKA 3UDCA 4HCBA 2DTOA 1VQ6A 3NTHA 2DVJA 2KRMA 1WI7A 3U23A 2BKDN 3MJXA 2FPDA 3X24B 5J39A 3G1JA 3FDRA 1VQ7Q 3MO8A 3HL8A 2KBTA 2A28A 2BZYA 5I2MA 2RB6A 4BI8B 4BACA 2CZ6B 3AT1B 2K5FA 2QGGA 4MZMA 3M55A 3CC7Q 2PTKA 1QVFS 1OX8A 1K0XA 2SEMA 4K11A 1K73R 3MEVA 4ZTFA 3CPWS 2G3RA 1VQ6T 3I56Q 4CC4B 3QJ6A 4RG8A 3OYBA 5CO7A 1X27A 1BB9A 4LNPA 2P0KA 4M7AA 4M77F 1M1KU 1IGQA 2MPXC 1QLYA 2BTTA 3JB9J 4FW1A 1BCMA 1KJWA 2J05A 1K1ZA 1G5VA 3RNJA 2PVOB 1JJ2S 1QCNA 2NUPB 2CS7A 5KYYA 4PFOA 5GANh 3CPFA 3VKIA 3CXCP 2FHDA 2COWA 3TSZA 3R6NA 4PKCC 1VYVA 1YN8A 4M7AC 1WA7A 3ZEHA 2F5TX 2J7IA 2VB6A 1D0YA 1M5Q1 1PKSA 2KT8A 2LNHB 2EYWA 1VQ6Q 4DBQA 2JTFA 2PVGB 3RUXA 3E2UA 5EG2A 2K5IA 2CGHA 3EFOB 1K0SA 2VGNA 4BDYA 2X4XA 3JCMc 1K9MR 2DL7A 2JMAA 2JVVA 3CCEA 3JSCA 4LDYA 4QQ6A 3G4SA 1ACMB 3E9GA 4A4KA 4C92D 1BU1A 1BK2A 1QQJA 3FEOA 4C8QD 3FRNA 1UG1A 2RJEA 5KE3A 3VS5A 2R58A 4F7UF 5GAOq 1QVFP 4J5YA 2XHCA 3CCVA 2HDAA 5LJ5f 1YJ9A 1WHLA 4PJMA 3LH0A 2QQSA 2JS0A 1PRLC 3VRYA 3G4ST 2QASA 4PJOG 1M90R 3TEEA 3CCSA 2J6KA 1VYTA 2EAYA 2GTOA 3NTIA 2E10A 5KYXB 4DBFA 2CP7A 1T0JA 2BE9B 1Q7YC 1VA7A 3INZA 1KD1C 2EJGA 1FMWA 1Q81C 2DJQA 3RBBB 3MP8A 5CAIA 2ZPBB 3MEAA 4QQGA 2C06A 1X2KA 3KUFA 4NOYA 3QJYA 2CH4W 2RHXA 4E7HA 1YJ9T 3GLXA 1WXTA 3RDVA 2EGAA 3F70A 4TVRA 3EFRA 4ZTJA 1Q82R 4FW2A 2RHZA 3OYNA 1C6VX 2LQNA 1QMCA 3G4SQ 5HY6A 4XTYA 1GL5A 2VGMA 1TH7A 1QKWA 4LDWA 1UGVA 2DXBA 3EG9B 1RAFB 3H0HA 2B8AA 1ZSZA 3A8LB 2MIOA 5D6XA 1K8AU 1RL2A 2L8DA 4LE9A 1YITA 4C0FA 4JLIA 4L59A 1WJQA 3CQTA 4DQ2A 3REBB 4KT0E 3WVDB 5HKCA 3CCVQ 2KY9A 1ZX6A 2A7YA 2CZ7B 3CEYA 2K5LA 2D6FA 1YJ9Q 1E7OA 3VYHB 5D7UA 5LJ3f 2AT1B 4J6YA 2R5MA 1X6OA 4LDVA 1ZSZC 1K73C 1NJIR 3CCSQ 2NUZA 1B34B 2DJZA 3NGPA 1YJNT 4WCIA 1HJDA 1WGSA 2K7AA 2EGEA 1SF9A 1KQSS 3DKMA 2DO3A 3JCMV 1OI1A 4C0ZA 1IXDA 3OS2A 2ED0A 3VS0A 1Y96A 1WXBA 1YITT 1Y0MA 4OVAA 3A8MB 4EMKA 1AWJA 3M0UA 4RUGA 3JB9G 2DIGA 4M7DG 4OB2B 5CCAA 1VQOT 5L23A 1OOTA 2IG0A 4CC7A 4WF2A 2M0OA 1R8OB 2DNUA 3GOXA 3CCQA 1Y71A 5FU6B 2M1HA 4E7ZA 3MEUA 2EYYA 2DTHA 4EMKC 4J9IA 4J9FA 2LCLA 3A5ZB 1EIFA 4GLKA 4LUDA 3OMGA 2E3IA 1IREB 2J6FA 1M4ZA 2HMAA 4PJOF 4HT8A 1OZ3A 1PM3A 2LNVA 4JUVA 1YITQ 2VXFA 1JBMA 4B6MA 1UECA 2XD0A 4BUGA 1FYNA 3OW2A 4PJJA 2YLBA 3JV3A 4PJLA 5HK3A 5CR2A 1PC0A 3MP6A 2NWMA 2E5QA 2JMCA 3VU3C 3M58A 4LDUA 3M59A 3CCQT 5CVIA 3H9NA 5GAOl 2O9VA 5LJ5h 5IHKA 2E1HA 2YWWA 2QXFA 1X2QA 3RESA 1R0BG 4F14A 1WXUA 2YT6A 2IIMA 1WLPB 3G71T 2QTXA 2BUDA 3FJPA 5FU7B 4BE2A 1W1FA 2RK2A 5C0MA 4MDXA 4OMPA 1P92A 4RCBA 4F16A 4HVWA 2DIQA 2RN8A 1N8RC 1F1BB 2JJ9A 1E6HA 1BIAA 2RF0A 2KDSA 5I11A 1SRLA 1BBZA 2HCKA 2CKKA 4M7DB 2MAMA 1X75C 1NEGA 2LVMA 1W70A 3L2ZA 5AT1B 3CCQQ 1AOJA 1U1SA 4JS5A 1BCOA 1X43A 3HRTA 2NUPA 3RR6A 3NPFA 3E9FA 3WVEB 3V8LA 4HVVA 1PWTA 2X9HA 2NUTB 1B7TA 4GBQA 2YRCA 1NEBA 1SHFA 1QVPA 1TUCA 1TOVA 2YRDA 1H8KA 1Q7YU 4M7AD 1KD1U 4KULA 1R77A 4ANJA 2Y4YA 1Y7XA 3A8GB 1Q81U 4IUVA 1AHJB 2L3SA 1AWWA 4LUEA 4XQ3A 4FYYB 2J6OA 1VQMA 4VUBA 1Q86R 3JB9F 2J06A 4M7DF 2CUBA 1PKTA 1QKXA 1FMVA 4HCKA 1ZHIA 1VYUA 5LJ3h 2K6DA 3EFOA 2JXBA 5CKDA 1FWZA 3ER0A 4EPCA 1MNDA 2YHTA 3R6OA 1GCQA 4M75B 1T3LA 4XK8E 1AZEA 2HL3A 2MYSA 4QVDA 5LJ3d 1X01A 4O6JA 1VIFA 3JCMQ 1QVGA 1GXIE 1X6GA 2HL5C 2RQTA 5GMKj 2HSEB 4KRTA 4FYWB 4AFSC 2D1XA 1NJIC 1J3TA 3MP1A 4PJNA 1UGQB 1YIJA 3HRSA 2Y90A 3OYCA 1VQMT 3LGLA 4A54A 3CCLT 4M7DE 4E7JA 3G6EA 1GCQC 5DM7R 1D3BB 1OULA 3H0FA 1YHQA 2MF2A 4D8DA 3OYFA 4N4HA 2BZ8A 2ZGWA 4C92G 3C12A 2P4TA 4OMFB 3J80E 1E6GA 3PFSA 1JXOA 4C5HA 1K73U 4RTWA 1EZZB 4C5IA 3A1PA 1LPLA 1UJ0A 2KROA 5ECAA 1AWOA 3CCUT 3M54A 2RO0A 5KYXA 4LDXA 3SWNB 2KSSA 4ESRA 4XU0A 1M2VB 1VQPT 1YIJT 1KC8R 4IUQA 1QWFA 2M51A 3G6ET 3RKXA 3A8OB 1ZUYA 4RTUA 4XU3A 1G3TA 4AFQC 3CC2T 1UE9A 1VQMQ 8AT1B 2RA2A 4B9XA 5GAMd 2LTOA 3M53A 2HSPA 1PSEA 4J9CA 4D8KA 1CKAA 3A98A 2PNIA 2OAWA 1N9SA 2WSEE 3RKWA 1I1JA 2DM1A 4EMGA 1VIEA 4AG2C 1UB4A 4M75E 3KXTA 2V1QA 4JPBW 3CMAA 3JCMb 1JEGA 5GAN6 2QQRA 2VC8A 5D6YA 2XU8A 3H6ZA 1K9AA 4CI0C 1YIJQ 2COZA 3EHRA 1TXQA 5HCKA 1H3HA 2CREA 3QXEB 3OYDA 3G6EQ 1RAIB 3OYAA 2P4RA 2AIRB 4M77B 2LRQA 5DLQE 3FLGA 5GMKe 1RAGB 1KQ2A 1I5OB 4OB0B 3S3NA 4ORZA 4A63B 1ZQ1A 1X69A 2LCCA 1GRIA 3UF4A 5KCOA 3CMAT 5IHNA 1B34A 3VS7A 2ZZDA 1JU5C 2VXEA 1G83A 3C95A 4LN2A 3OYLA 2GQIA 2K3BA 1N8RU 5C6SA 4RMOA 4DEYA 2DMOA 4B9WA 1N27A 2F2WA 2L3RA 1M3BA 4AMCA 2OAUA 1UEBA 2QG9B 4J7FA 2EW3A 1UHCA 3HFOA 4AG1C 4CC3A 3PGGA 1KFZA 3GBQA 5GMKl 2QQ9A 2PQWA 1M3AA 2ZAEA 1V76A 3JCMf 1YFNA 1BIBA 3LGFA 4C92F 1YWOA 2F2VA 3CMAQ 1VUBA 3V7CA 4BDZA 2DILA 4NL3A 2CDTA 1SSFA 5GANd 1NG2A 2DE0X 2IPOB 5FROA 3EG1A 3X26B 3FB9A 2LMJA 2E6ZA 5A0LA 2O88A 4F7UB 5FU6C 2DBMA 4M77E 5HK0A 4RG2A 2HBPA 1PHTA 3S3MA 2YXYA 2P0QA 4M78G 1WX6A 3L2RA 3VYGA 1D09B 2JUFA 4RTZA 2HQEA 1AVZC 2DK3A 2K57A 5CK9A 1M2OA 3DLLA 5I21A 2KEAA 2M0YA 5IN1A 4C0DC 4N0AA 4EDUA 1SG5A 2RHIA 1JQQA 4BI4A 1Z9ZA 4C5EA 1RI9A 4AFZC 4MZTA 3MKDA 3GNGA 3MEWA 1OEBA 4M77D 3LYIA 2I0NA 4GLMA 1NJIU 4RTYA 1LOJA 2GGRA 2V8JA 1NE8A 1I07A 4CC2A 1H641 2KXCA 1M30A 4M7DA 3KBGA 4N0AC 3EG3A 3SHWA 3A8HB 5FU7C 2O2OA 2V8KA 2RHYA 4Y92A 3CPWP 2O4XB 1ZUUA 4JJNK 2D0NA 1MV0B 5KYUB 1YCYA 4OF1A 3HHTB 3QUIA 2GTJA 2D8HA 4BB7A 2AZVA 2M9UA 4OMNA 1VQ5A 1VQLA 1AWXA 9ATCB 1JJ2P 4HVUA 2NUTA 4M7DC 1Z9QA 2X3WD 1IB8A 3VS2A 2FB7A 2FO0A 1AT1B 3OS5A 4F7UE 1OYXA 2DEQA 2RI2A 2DPPB 3ULRB 1M27C 1WPYA 2HQXA 1MMAA 2GBQA 2L3QA 2V1RA 3NMZC 3VS4A 5GAMe 1ARKA 2P84A 4Q5WA 5LJ3g 4J9EA 3VJPA 1TU0B 4Y91A 1QP2A 3PMIA 4M7AG 1VQ5T 4HKEA 2E70A 1VQLT 3UATA 3PE0A 4XTXA 4M75A 5CQXA 1YJNA 5M9OA 1NYFA 3JCMX 4OB3B 1RLQC 2RQVA 4BD3A 5GAN7 3LWIA 1ZSGA 3WXMB 2X4WA 3CD6A 2K2MA 3QDFA 3CXCA 1UTIA 1I81A 2OTLA 4L5GA 2RH2A 2DL3A 2KNBB 1VQNA 1SEMA 4HXJA 1UGPB 4KUDK 4HCZA 1WQWA 4M75C 1D3BA 2X51A 4F17A 1NPPA 3L2WA 1VQOA 4NL2A 1C1AA 4JJBA 4FT4A 4C0GA 5FRMA 1MMGA 1Q95G 1D0XA 3EGDB 3JCMh 4M78F 5J3BA 2E65A 3UWNA 2KMTA 5IAYA 1NLPC 4XTWA 1VQ5Q 1VQLQ 3M4YA 4OMMA 2VV5A 3BDUA 4PJOB 1IHVA 4KGVB 3VS1A 3CD6T 2RNAA 3JCMd 1UGRB 3SWNA 2AZSA 2LJ1A 1M2VA 3BY7A 3M0QA 2KYMA 5GAMg 2LJ0A 3VS6A 2OTLT 3QIIA 1VQNT 2QGFB 3OYIA 1SPKA 3OS1A 1V29B 4E7KA 2LCSA 3X28B 3M0SA 2KRNA 2MI6A 2CT4A 2KXDA 4ELZC 1W2BS 1TUDA 2DYIA 2OI3A 2X3XD 3BFMA 2DZCA 2FZGB 2RQRA 1PD1A 2H3JA 5I22A 5GJVB 3SWNC 2VASA 1RAEB
chains in the Genus database with same CATH topology
3P8BB 3CBPA 3NTHA 2Y4XA 2YRVA 2BKDN 4JLGA 1ZHIA 2O01E 5LJ3h 1QVFA 1OZ2A 4JRPA 1VQKA 3X24B 5J39A 3OY9A 2OTJT 3CBOA 3FDRA 5CKDA 2EKOA 3MO8A 1YJWT 1FWZA 3HL8A 3ER0A 4EPCA 2YHTA 3R6OA 3G71A 4P5NA 1H3ZA 3CMEA 4M75B 1DJ7B 4XK8E 2RJFA 5I2MA 1BI0A 2RB6A 4MZPA 3CCET 4QVDA 4ATOA 5LJ3d 1X01A 4O6JA 1S72A 1VIFA 2RM4A 4BI8B 3JCMQ 4BACA 1QVGA 2CZ6B 1GXIE 2K5FA 3CBMA 4JRQA 4FM4B 1K9MC 4JS4A 1VQ8A 4C0DB 5GMKj 4MZMA 3GPLA 2M16A 4BY6C 3M55A 1NJIC 3BDLA 2K2VA 4KUIA 5GANe 4JRKA 1QVFS 3MP1A 4OGEA 2FL7A 4ME7A 1UGQB 1PSFA 3HRSA 1YIJA 3META 3CCMA 5GAOp 2Y90A 3OYCA 1VQMT 3LGLA 4A54A 3MEVA 4M77A 3CCJA 3CCLT 4M7DE 2HNIA 1MGQA 3G6EA 1LJOA 2KQWA 3CPWS 4E7JA 5DM7R 4ZTFA 2G3RA 1VQ6T 4A4HA 1D3BB 5GAN3 1YHQA 3QJ6A 4M78B 4RG8A 3OYBA 2RD1A 2MF2A 3H8ZA 5CO7A 3OYFA 4N4HA 1HK9A 3QDRB 4OP0A 2I2LA 1QVGS 1VQKT 4GY5A 2P0KA 4M7AA 3CCVT 2ZGWA 4M77F 1G3WA 1O9SA 4C92G 2K4YA 3C12A 5KE2A 2BIVA 2DZ9A 2EYQA 5KCHA 1M1KU 2F5KA 4A4FA 3CMET 5GANj 1G3SA 2P4TA 3M57A 1FX7A 4OMFB 3ZFJA 3J80E 3TU4K 1G5VA 5LJ5d 3PFSA 2PVOB 1JJ2S 4PJOE 3S3OA 3DB4A 3NTKA 4C5HA 2V8IA 1K73U 1S72T 4C5IA 3M56A 2CS7A 4M7AF 5GANh 4X9CA 3CPFA 4M77C 3CCST 3CCUT 1VQ8T 3LLRA 3M54A 2EFIA 3VKIA 1BKBA 2RO0A 4XTUA 3JCMP 1U8RA 2MWOA 3SWNB 4LDXA 2KSSA 2FHDA 4J6WA 1FXXA 2ZPGB 4QQDA 4XU0A 4PKCC 3PIOA 1VQPT 2KAFA 1YIJT 4J8OA 2ZPEB 1M90C 3OYKA 3MHXA 3CCMT 4IUQA 4M7AC 3CCJT 5LL6S 3G6ET 3ZEHA 5GMKm 2F5TX 3RKXA 3A8OB 3OS0A 2FYKA 4XU3A 1G3TA 4XU1A 3CC2T 1M5Q1 3HRUA 5GAMd 2RA2A 4B9XA 2DTIA 2LTOA 2R57A 3M53A 1PSEA 3HFNA 4LD9K 2JTFA 2DXCA 2PVGB 3PT9A 4LD6A 3RUXA 3LWHA 4PJOD 3G7ZA 3SDZA 3JAME 5IT9E 1N6AA 2EQMA 4RKUE 5EG2A 2ZPHB 3OSSC 2K5IA 1N9SA 2WSEE 3RKWA 2CGHA 1I4K1 5GANg 4EMGA 1VIEA 3V7SA 3TCJA 2VGNA 1UB4A 2X4XA 2PUOB 4M75E 3JCMc 4BDYA 2CYZB 3SD4A 2XK0A 4A4GA 2QQAA 3KXTA 4E7IA 1U1TA 3JCMW 2XKOC 3CMAA 2JVVA 2DAQA 4O5VA 4IUUA 3JCMb 3JSCA 3CCEA 5GAN6 1Q82C 2QQRA 2VC8A 4LDYA 3TREA 4QQ6A 2LT4A 2YLCA 3QYHB 3G4SA 5D6YA 4MMLA 3E9GA 2XU8A 4ZN1A 2RJDA 3H6ZA 4A4KA 2F69A 4C92D 3C4SA 4CI0C 1NZ9A 2QDYB 3PNWC 1KQ1A 4F7UA 3OYDA 3QXEB 4HCCA 3FEOA 3QSUA 4IUPA 4C8QD 3FRNA 3OYAA 3CCLA 1BI3A 4M77B 2LRQA 2RJEA 4M78E 5CIUA 5DLQE 3FLGA 5KE3A 2K3YA 2QI2A 5GMKe 3JCMJ 3QPHA 2R58A 2D0QB 4F7UF 2GCXA 1KQ2A 2K3XA 4OB0B 1M1GA 5GAOq 5GMKi 4QW2A 3S3NA 2NLUA 1LNXA 4J5YA 4N4IA 1Y07A 2XHCA 4ZGDB 3CCVA 1JB0E 2PU9B 3J81E 1ZQ1A 4M7AB 4BI3A 2LCCA 5LJ5f 1YJ9A 3M4GA 4ZN3A 2RJCA 2VUBA 3CPWA 4NS5A 5KCOA 3LH0A 3CC4A 3CMAT 2QQSA 4X9DA 5A0GA 4BE1A 1QW1A 2L5QA 1Q86U 3QBYA 1B34A 4HA8A 3G4ST 2LDMA 2ZZDA 3JB9I 2EQJA 2HD0A 4PJOG 3TEEA 3OYHA 3DB3A 3CCSA 3P8HA 3CCUA 4JRIA 3RERA 2VXEA 1XNIA 2EAYA 2XG8D 3NTIA 2HAXA 2E10A 3C95A 3O8VA 3QZ9B 1BI1A 1JJ2A 4XAXB 3OYLA 1VQPA 1Q7YC 1M1FA 5GMKh 4M78D 3INZA 1KD1C 2EJGA 2E64A 1YI2A 1N8RU 5C6SA 4RMOA 1Q81C 4B9WA 1N27A 5GAMf 3MP8A 3RMSA 5CAIA 2L3RA 5GAN4 2ZPBB 3MEAA 4QQGA 3UT1A 2C06A 3CC2A 5GAOr 2OAUA 3KUFA 4Y28E 1UEBA 4NOYA 3QJYA 4FU6A 3JB9J 2E12A 4J7FA 2RHXA 1KHCA 4E7HA 3OSVA 5CKBA 3QKJA 3I55A 3HFOA 4C92A 3PGGA 4C5GA 4DA4A 1YJ9T 2O4XA 3GLXA 3S6WA 4PL6A 5GMKl 3CC4T 1WQ7A 3F70A 4TVRA 2QQ9A 3E1SA 4C8QG 3EFRA 4ZTJA 2PQWA 4ELYC 4C8QA 2RHZA 3JCMf 3CCRT 3OYEA 3OYNA 1BIBA 2X4YA 3LGFA 3RIRA 4C92F 2ZCFB 4A53A 1VUBA 3V7CA 5HY6A 4BDZA 4M75G 4XTYA 4NL3A 3PMTA 3JB9D 4M7DD 4PLIA 1N9RA 2VGMA 2X4JA 1SSFA 1TH7A 4LDWA 5GANd 4RCCA 2DXUA 2DXBA 1YI2T 2XICA 5FROA 4C92C 4KBMB 4DOWA 2B8AA 3A8LB 3X26B 3FB9A 3GIBA 2E6ZA 5D6XA 5A0LA 1XTDA 4PLLA 3UPUA 1K8AU 4F7UB 1RL2A 1UGSB 5FU6C 2L8DA 4C8QC 1YITA 1BYMA 4C0FA 4MMKA 4M77E 4JLIA 4L59A 5HK0A 4RG2A 5A2QE 1WJQA 2HBPA 2XI9A 4DQ2A 3V8KA 2DD4A 1KC8U 4BY6B 3RMQA 4KT0E 3URGA 3WVDB 5HKCA 2KY9A 3S3MA 3N5BB 2A7YA 2CZ7B 2E41A 2K5LA 2P0QA 3CEYA 4M78G 3GP8A 2D6FA 3L42A 2JN0A 4M7AE 4IURA 3L2RA 3DLMA 3VYGA 2JUFA 1M1KC 3VYHB 2HQEA 3OYGA 2DK3A 3JB9H 2K57A 5DY9A 3T9NA 3HPWA 5CK9A 5LJ3f 4J6YA 2R5MA 1X6OA 4LDVA 3SFMA 1K73C 4IKFA 3DLLA 5I21A 5IN1A 4C0DC 2CZ0B 4N0AA 4EDUA 4N4GA 1ZBXA 1B34B 2DJZA 3PTAA 3SB2A 1YJNT 2DXTA 4OB1B 2RHIA 1WGSA 3OYMA 4BI4A 4C5EA 3VUBA 1KQSS 3FIFA 3DKMA 2DO3A 4MZTA 1OI1A 3GNGA 3JCMV 3X20B 3MEWA 4XTVA 4C0ZA 3OS2A 1Y96A 2MMPA 3ZBDA 4M77D 3LYIA 1K9MU 1YITT 2DD5A 4OVAA 3L2QA 4V2SA 1VQ4A 3JRZA 1IZ6A 1NJIU 2QQBA 1LOJA 2V8JA 3A8MB 2DVEA 4EMKA 1NE8A 1O75A 1H641 2EWNA 5CKEA 3JB9G 2DIGA 4M7DG 4M75D 4M7DA 1MHNA 3KBGA 4N0AC 2LQKA 4OB2B 5CCAA 1JRIA 3A8HB 5FU7C 4R56A 1VQOT 2V8KA 2RHYA 1WJSA 4C92B 3HP9A 2O4XB 4JJNK 2PVDB 3BW1A 3OBYA 1KG1A 2IG0A 4WF2A 3JCMg 1NPRA 2M0OA 5LJ3j 2XDDA 1R8OB 1I8FA 2WSCE 3EFSA 1YCYA 1HXDA 4OF1A 3CCRA 3GOXA 3CCQA 1Y71A 3HHTB 3QUIA 2M1HA 2RI5A 5FU6B 4QVZA 5CQYA 4BB7A 4C8QB 4CRIA 3MEUA 4PJOA 2DTHA 2M9UA 4EMKC 2WSFE 2LCLA 2JOYA 3A5ZB 1VQ5A 1EIFA 1VQLA 2GQVA 3LW5E 3OBWA 4GLKA 3OMGA 3OYYA 4JDSA 5LJ5e 1IREB 5GANf 2ZPIB 3OYJA 3VV0A 4XTZA 1G3YA 4EMHA 4M7DC 1M4ZA 1VQ4T 2RHUA 4PJOF 5D6WA 2FB7A 4HT8A 1OZ3A 2RI3A 3PIPA 2LNVA 4JUVA 4X34A 1RI0A 4QVCA 2PUKB 1JBMA 2VXFA 3OS5A 1M90U 4J83A 2L89A 4F7UE 2XD0A 2R5AA 4BUGA 3HKSA 4UC4A 1OYXA 5CKFA 1XQHA 2DEQA 2RI2A 4IUTA 1VQ9A 2DPPB 4PJOC 3OW2A 1QP3A 2YLBA 3NFCA 2GF7A 5LJ5j 5HK3A 4DOVA 2GFAA 1WPYA 4M77G 5CR2A 3MP6A 2A3LA 2HQXA 2E5QA 3QO3A 2QEXA 2QA4A 3VU3C 3M58A 2XDPA 5GAMe 4LDUA 3M59A 3CCQT 4Q5WA 5CVIA 1WJRA 3OB9A 5GAOl 3GNFB 4ZGJB 4Z02A 2CZ1B 3VJPA 4Y91A 1QP2A 2E1HA 5DLOA 5LJ3g 5LJ5h 3PMIA 4M7AG 1VQ5T 2QXFA 2E70A 2GFUA 4HKEA 1VQLT 3RESA 2AHJB 3L1AA 4ZGEB 1Q86C 2RK1A 3E19A 4M75A 4XTXA 2EQUA 4A4EA 4C8QF 3G71T 4J7IA 1VQ7A 5CQXA 1YJNA 5M9OA 3JCMX 2FVUA 2QTXA 4OB3B 3OW2S 2D9TA 2BUDA 2DKGA 3FJPA 5FU7B 4BD3A 4D6WA 2RK2A 5C0MA 3JCMe 5GAN7 3LWIA 4BE2A 4FT2A 4E7LA 1Q82U 3WXMB 4MDXA 2XIDA 2KK4A 2X4WA 5CKHA 3L2UA 3CD6A 2IVWA 1P92A 5GAMj 4M75F 3QHSA 4FIBA 3QZ5B 4RCBA 1W4SA 1M8VA 1Y96B 3C94A 5GAOm 2DIQA 4OGCA 2LQ8A 1N8RC 3FC3A 3CXCA 1VQ9T 1I81A 2OTLA 5AYFA 5FLXE 4L5GA 4YTLA 5GAMh 2RH2A 1VQNA 4EMKB 3EAEA 3X25B 4E47A 1KQSA 3CC7A 1BIAA 4HT9A 1UGPB 2KDSA 2QEXT 2QA4T 5FRNA 4KUDK 4HCZA 1WQWA 2CKKA 2EJ9A 1D3BA 1YBYA 2LT1A 4M75C 5GAN2 3M9QA 4M78A 5LJ5g 4M7DB 2MAMA 2EJFA 1NPPA 1YHQT 1X75C 1BI2A 3I55T 4C92E 3L2WA 5GAOn 1WNLA 4NL2A 2LVMA 1VQOA 4FL6A 4XU2A 3M5AA 3I56A 4FT4A 3VUZA 3L2ZA 4C0GA 5FRMA 2EIFA 2LC4A 3OA6A 2XDBA 5L8RE 3V8JA 3JCMh 2X35A 4M78F 5J3BA 4C8QE 2E65A 3UWNA 2KMTA 5IAYA 3CXCS 1KHIA 2MWPA 3ASKA 4XTWA 1U1SA 5I2SA 4JS5A 1I5LA 1VQ7T 4FSXA 3HRTA 3M4YA 3OMCA 3BDUA 2VV5A 4R55A 4PJOB 3LX7A 3L2VA 1W2BA 2OTJA 3E9FA 3CD6T 3WVEB 3V8LA 2EQKA 1YJWA 2ZPFB 3OQ5A 5A0DA 3JCMd 3ME9A 1UGRB 3SWNA 5LJ3e 4J6XA 3AHUA 4MDWA 3HSBA 4M78C 4BE0A 4II1A 4PNOA 3BY7A 5GAMg 2OTLT 3RKYA 3QIIA 1QVPA 2P0PA 1XOVA 3P8DA 1VQNT 2WACA 2E6NA 1Q7YU 3CC7T 4M7AD 3OYIA 2LX9A 1M9SA 3OS1A 1K8AC 1KD1U 3Q1JA 3MCAB 1V29B 3QG1A 4KULA 4E7KA 2KVQG 2Y4YA 3X28B 5GAN8 1Y7XA 3J7AF 3A8GB 1Q81U 4IUVA 3GF5A 1AHJB 4F7UG 4L6V5 2JTMA 2MI6A 2JZ2A 2JNGA 4ELZC 4XQ3A 1W2BS 5GAN5 2VYTA 3I56T 1KC8C 3BFMA 2DZCA 5KH6A 1VQMA 4VUBA 3JB9F 5J26A 3QYGB 3UDCA 4M7DF 2H3JA 4HCBA 3SWNC 2DTOA 3V7RA 1VQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XK0 A;  3NTH A;  4A4G A;  4E7I A;  2YRV A;  2GF7 A;  2B8A A;  2BKD N;  2DAQ A;  4IUU A;  2GFA A;  1OZ2 A;  2QQR A;  5J39 A;  3MP6 A;  5D6X A;  3OY9 A;  2HQX A;  4PLL A;  2E5Q A;  3FDR A;  4QQ6 A;  2EKO A;  3MO8 A;  5D6Y A;  3E9G A;  2XDP A;  2L8D A;  2RJD A;  3H6Z A;  4Q5W A;  3C4S A;  1H3Z A;  1WJR A;  3OB9 A;  4L59 A;  4RG2 A;  4Z02 A;  2RJF A;  1WJQ A;  3PNW C;  3PMI A;  2GFU A;  3OYD A;  3FEO A;  3S3M A;  4BAC A;  4IUP A;  3CEY A;  3OYA A;  3L42 A;  2EQU A;  4A4E A;  4IUR A;  3L2R A;  3DLM A;  2HQE A;  3OYG A;  2M16 A;  5M9O A;  2LRQ A;  2RJE A;  5CIU A;  3BDL A;  2D9T A;  3FLG A;  2BUD A;  2K3Y A;  5KE3 A;  4BD3 A;  4BE2 A;  5C0M A;  2R58 A;  3MP1 A;  2R5M A;  4E7L A;  4IKF A;  2K3X A;  2X4W A;  3L2U A;  3MET A;  5IN1 A;  4QW2 A;  3S3N A;  2NLU A;  4EDU A;  4N4I A;  3OYC A;  4N4G A;  3LGL A;  3MEV A;  2DIQ A;  4E7J A;  4ZTF A;  3OYM A;  2RHI A;  1WGS A;  2LCC A;  3FC3 A;  2G3R A;  4A4H A;  4C5E A;  2RJC A;  3QJ6 A;  3OYB A;  4NS5 A;  5KCO A;  3LH0 A;  3H8Z A;  1OI1 A;  2QQS A;  4N4H A;  3OS2 A;  3MEW A;  3OYF A;  4BE1 A;  3EAE A;  4GY5 A;  3QBY A;  2P0K A;  2LDM A;  3LYI A;  5FRN A;  2EQJ A;  4HCZ A;  2CKK A;  5KE2 A;  2BIV A;  4OVA A;  5KCH A;  3L2Q A;  3M9Q A;  3OYH A;  2F5K A;  3DB3 A;  4A4F A;  3P8H A;  1XNI A;  1G5V A;  3PFS A;  3NTI A;  3L2W A;  2LVM A;  4FL6 A;  3DB4 A;  3NTK A;  3O8V A;  4C5H A;  3S3O A;  4C5I A;  2DIG A;  3OYL A;  4IUT A;  5FRM A;  1MHN A;  3OA6 A;  2X35 A;  3UWN A;  5C6S A;  3LLR A;  2MWP A;  2EFI A;  3ASK A;  2RO0 A;  5IAY A;  2MWO A;  4B9W A;  1N27 A;  3OMC A;  2FHD A;  2RHY A;  3MP8 A;  1WJS A;  4QQD A;  2L3R A;  2O4X B;  3MEA A;  3LX7 A;  4QQG A;  3UT1 A;  3L2V A;  2IG0 A;  3E9F A;  3KUF A;  2M0O A;  3OYK A;  4FU6 A;  2EQK A;  4IUQ A;  2RHX A;  3OQ5 A;  1KHC A;  3ME9 A;  4E7H A;  3GOX A;  3QKJ A;  3ZEH A;  2RI5 A;  2M1H A;  4CRI A;  4QVZ A;  4C5G A;  3OS0 A;  4BE0 A;  3MEU A;  2O4X A;  4II1 A;  3S6W A;  4PL6 A;  3QII A;  3P8D A;  4B9X A;  3F70 A;  2WAC A;  2E6N A;  4ZTJ A;  2LTO A;  2R57 A;  3OMG A;  2PQW A;  3OYI A;  3OYJ A;  2RHZ A;  3OS1 A;  3Q1J A;  2JTF A;  3OYE A;  4LD6 A;  3OYN A;  4E7K A;  2X4Y A;  3LGF A;  2RHU A;  4IUV A;  5D6W A;  2EQM A;  2JZ2 A;  1OZ3 A;  2RI3 A;  4X34 A;  4BDZ A;  2VYT A;  1RI0 A;  3PMT A;  2L89 A;  4PLI A;  5KH6 A;  1SSF A;  2R5A A;  5J26 A;  4UC4 A;  4BDY A;  2X4X A;  1OYX A;  2RI2 A;  3SD4 A;  5FRO A; 
#chains in the Genus database with same CATH topology
 2RQU A;  3CBP A;  3P8B B;  2AKK A;  2HZY A;  2Y4X A;  2O01 E;  1QVF A;  1OZ2 A;  4JRP A;  4Z88 A;  3SEM A;  3CBO A;  2EKO A;  1YJN Q;  2GNC A;  1OU8 A;  3G71 A;  1MMD A;  4P5N A;  1H3Z A;  1DJ7 B;  1TUG B;  3EG0 A;  3CD6 Q;  4MZP A;  4ATO A;  2ATC B;  2DX1 A;  3CBM A;  1K9M C;  2CT3 A;  4FM4 B;  2OTL Q;  1AZG B;  1FMK A;  4C0D B;  4JS4 A;  2YUO A;  3GPL A;  6AT1 B;  4BY6 C;  1VQN Q;  4KH1 B;  3BDL A;  2K2V A;  4KUI A;  5GAN e;  1XJW B;  4JRK A;  1V1C A;  1M3C A;  3CCM A;  5GAO p;  4M77 A;  3CCJ A;  1VQO Q;  1MGQ A;  1LJO A;  4A4H A;  3FJ5 A;  2DA9 A;  3UA6 A;  4OP0 A;  3O5Z A;  1G3W A;  1O9S A;  2BIV A;  5FW9 A;  3VS3 A;  4A4F A;  1FX7 A;  5FWC A;  2DFU A;  2ABL A;  1KSW A;  5LJ5 d;  1WIE A;  4PJO E;  1TTH B;  4M7A F;  2EPD A;  2QAZ A;  4M77 C;  1K8A R;  4JJD A;  3LLR A;  2XDB A;  1BKB A;  4J6W A;  1FXX A;  2ZPG B;  2KAF A;  2ZPE B;  1M90 C;  3OYK A;  1KQS P;  3CCM T;  3CCJ T;  5GMK m;  2W0Z A;  3OS0 A;  2OJ2 A;  2FYK A;  2DTI A;  1HD3 A;  2FPE A;  3HFN A;  2A36 A;  3PT9 A;  4LD6 A;  3LWH A;  4PJO D;  3G7Z A;  3SDZ A;  5IT9 E;  2EQM A;  1WHM A;  3H0I A;  5GAN g;  3G71 Q;  1W2B P;  2ENM A;  3TCJ A;  1M8M A;  2A0F B;  1UFF A;  3EGU A;  2OX7 A;  2XK0 A;  4A4G A;  4E7I A;  3JCM W;  2XKO C;  1Q82 C;  2DAQ A;  4O5V A;  4IUU A;  1PNJ A;  3TRE A;  4MML A;  4ZN1 A;  3I5R A;  2RJD A;  2Z0W A;  2F69 A;  3C4S A;  1NZ9 A;  1IGU A;  1ABQ A;  3CCM Q;  1KQ1 A;  4F7U A;  2ECZ A;  3CCJ Q;  4HCC A;  1D1C A;  2LZ6 B;  3CCL A;  1GBQ A;  2K3Y A;  2QI2 A;  2GCX A;  1M1G A;  2RQW A;  4QW2 A;  1LNX A;  4N4I A;  1Y07 A;  1JB0 E;  2ED1 A;  3J81 E;  2G6F X;  2O31 A;  4ZN3 A;  2VUB A;  4NS5 A;  2E4H A;  3CC4 A;  5A0G A;  4BE1 A;  2L5Q A;  1WDX A;  2EQJ A;  2EYZ A;  1PD0 A;  1RAC B;  1YWP A;  3OYH A;  3TSW A;  3P8H A;  3CCU A;  3RER A;  2A08 A;  1XNI A;  1WHG A;  2XG8 D;  2DBK A;  1IO6 A;  1RLP C;  2W10 A;  3QZ9 B;  3THK A;  1BI1 A;  4XAX B;  1VQP A;  1M1F A;  2HEQ A;  1NYG A;  1YI2 A;  3RMS A;  5GAN 4;  2A37 A;  1KIK A;  3CC2 A;  5GAO r;  1S1N A;  1PG5 B;  4E6R A;  4J9G A;  4FU6 A;  4KGX B;  1KHC A;  3OSV A;  4PFP A;  4C5G A;  1SKU B;  4DA4 A;  2O4X A;  4PL6 A;  3CC4 T;  1WQ7 A;  4C8Q G;  5KYU A;  1K4U S;  5KYW B;  1TSF A;  5IH2 A;  3CCR T;  3OYE A;  2X4Y A;  3RIR A;  2ZCF B;  4A53 A;  2COY A;  3PMT A;  3JB9 D;  4M7D D;  4PLI A;  1N9R A;  2X4J A;  4RCC A;  2DXU A;  1YI2 T;  2KRS A;  4DOW A;  2CP6 A;  1SRM A;  3IQL A;  3QWX X;  3CCL Q;  2JM9 A;  1BYM A;  4R0K A;  2HKN A;  5A2Q E;  2XI9 A;  3V8K A;  2DD4 A;  4BY6 B;  1TG0 A;  3RMQ A;  1SHG A;  3URG A;  3N5B B;  1TWB A;  3ZL7 C;  2JN0 A;  4IUR A;  3DLM A;  3CC4 Q;  2VVK A;  3SFM A;  2VWF A;  2YUP A;  4WTO B;  3CCU Q;  2BE7 D;  3PTA A;  4OB1 B;  4RTT A;  4KGZ B;  2V26 A;  1VQP Q;  1Q81 R;  2L2P A;  3X20 B;  2KGT A;  3ZBD A;  1YI2 Q;  1K9M U;  4X1V A;  2DD5 A;  3L2Q A;  1VQ4 A;  1IZ6 A;  4M4Z A;  2QQB A;  3CC2 Q;  2SRC A;  1O75 A;  2EKH A;  4M75 D;  2LQK A;  4R56 A;  3EHQ A;  1WJS A;  4C92 B;  1OX9 A;  3HP9 A;  3BW1 A;  3OBY A;  1LCK A;  3I35 A;  3EGD A;  3JCM g;  1NPR A;  5LJ3 j;  2C0T A;  1I8F A;  3EFS A;  1MUZ A;  4C8Q B;  4OMO A;  4QVZ A;  4PJO A;  2WSF E;  2JOY A;  2GQV A;  3LW5 E;  3OBW A;  1AEY A;  5LJ5 e;  1QWE A;  2CSQ A;  2ZPI B;  3OYJ A;  4XTZ A;  1VQ4 T;  4X34 A;  4QVC A;  1M90 U;  4J83 A;  2L89 A;  2JTE A;  4DBR A;  2R5A A;  3HKS A;  4UC4 A;  3D7S B;  5CKF A;  1XQH A;  2K9G A;  4IUT A;  2C0I A;  4PJO C;  3NFC A;  2FPF A;  2CP0 A;  4DOV A;  1ZA1 B;  2EYX A;  5FWB A;  2A3L A;  2QEX A;  2QA4 A;  2H8H A;  1TS9 A;  1WJR A;  3OB9 A;  3GNF B;  4ZGJ B;  4Z02 A;  5DLO A;  3I55 A;  3I9Q A;  2GFU A;  4AT1 B;  2FZC B;  2M02 A;  3L1A A;  4ZGE B;  1Q86 C;  1MNE A;  3E19 A;  4C8Q F;  4A4E A;  4J7I A;  4J9H A;  1U06 A;  3OW2 S;  2DKG A;  4D6W A;  1OQK A;  1Q82 U;  4FT2 A;  2QDL A;  2KK4 A;  5CKH A;  5GAM j;  1VQ4 Q;  2CUD A;  3QZ5 B;  1HSQ A;  3C94 A;  5GAO m;  4OGC A;  2LQ8 A;  1QCF A;  3UA7 A;  5AYF A;  4YTL A;  2XMF A;  3X25 B;  1OPK A;  2QEX T;  2QA4 T;  5FRN A;  1JO8 A;  3EGX B;  2FRW A;  1ZBJ A;  2LT1 A;  5IHI A;  3M9Q A;  5LJ5 g;  3I55 T;  4C92 E;  5GAO n;  1WNL A;  4XU2 A;  3M5A A;  2DRK A;  3VUZ A;  1WHK A;  1QCO A;  3M0P A;  4C8Q E;  1KHI A;  3ASK A;  5I2S A;  2KI7 A;  1GBR A;  4Z89 A;  2D8J A;  4R55 A;  3L2V A;  2OTJ A;  1EX4 A;  2EQK A;  1YJW A;  2ZPF B;  5A0D A;  3EH2 A;  4J9D A;  5LJ3 e;  2L3P A;  3AHU A;  3HSB A;  1SSH A;  2ESW A;  2ROL A;  3RKY A;  1XOV A;  3Q1J A;  2KVQ G;  2FRY A;  2KE9 A;  5GAN 8;  3J7A F;  3GF5 A;  4L6V 5;  2JTM A;  1OPL A;  2DER A;  2QEX Q;  2QA4 Q;  1KC8 C;  2VYT A;  1CKB A;  5KH6 A;  1Y57 A;  5J26 A;  3I55 Q;  2FG0 A;  3V7R A;  2YRV A;  4JLG A;  2CH4 A;  1R0C B;  2LX7 A;  1VQK A;  3OY9 A;  2OTJ T;  1YJW T;  3I5S A;  3VRZ A;  3CME A;  1UJY A;  2RJF A;  1N8R R;  1BI0 A;  3CCE T;  5GJW B;  1A0N B;  1S72 A;  2RM4 A;  1H92 A;  2AKL A;  4JRQ A;  1VQ8 A;  1N5Z A;  2M16 A;  4QT7 A;  1M1K R;  3OW2 P;  4OGE A;  2FL7 A;  4ME7 A;  1PSF A;  3MET A;  1JXM A;  1VOM A;  2DL4 A;  2BZX A;  2HNI A;  2KQW A;  3NHN A;  3EG2 A;  5GAN 3;  4M78 B;  3HTR A;  2LP5 A;  2RD1 A;  3H8Z A;  1HK9 A;  3QDR B;  2I2L A;  1QVG S;  1VQK T;  4GY5 A;  1NM7 A;  1D0Z A;  3CCV T;  2K4Y A;  5KE2 A;  2DZ9 A;  2EYQ A;  5KCH A;  2JT4 A;  2F5K A;  1ZLM A;  3CME T;  5GAN j;  1G3S A;  3M57 A;  3ZFJ A;  3TU4 K;  2OTJ Q;  2HQH A;  3S3O A;  3DB4 A;  3NTK A;  2V8I A;  2DL5 A;  1YJW Q;  1S72 T;  3M56 A;  2L0A A;  4RTX A;  4X9C A;  2VKN A;  3CCS T;  1VQ8 T;  3CCE Q;  2F2X A;  3JCM P;  2EFI A;  4XTU A;  1U8R A;  1YCS B;  2MWO A;  4QQD A;  3PIO A;  3TVT A;  4J8O A;  2DF6 A;  1K76 A;  3MHX A;  1RUW A;  1T3S A;  5LL6 S;  2LJ3 A;  4QKU A;  4XU1 A;  3HRU A;  4E7S A;  2R57 A;  3EH1 A;  4LD9 K;  1GFD A;  4OML A;  2DXC A;  3JAM E;  1N6A A;  4RKU E;  1VQK Q;  2ZPH B;  3OSS C;  5KYW A;  4Z8A A;  1I4K 1;  3CME Q;  3V7S A;  2O9S A;  2PUO B;  2CYZ B;  3SD4 A;  1S72 Q;  2QQA A;  1U1T A;  2NYS A;  1YNZ A;  2KYB A;  1VQ8 Q;  2LT4 A;  2YLC A;  3QYH B;  2F1L A;  4DBH A;  1EFN A;  2QDY B;  3M0T A;  2B86 A;  1HYO A;  3PNW C;  2PZ1 A;  3QSU A;  1W6X A;  4IUP A;  2E5K A;  5IXB A;  1BI3 A;  5CIU A;  4M78 E;  3JCM J;  2DL8 A;  3QPH A;  5IXF A;  2D0Q B;  2QK0 A;  1YP5 A;  1C0M A;  2K3X A;  5GMK i;  2NLU A;  4ZGD B;  1RAD B;  2PU9 B;  4M7A B;  4BI3 A;  4JZ3 A;  3M4G A;  1NBE B;  2RJC A;  3CPW A;  4X9D A;  1QW1 A;  1Q86 U;  3QBY A;  4HA8 A;  2LDM A;  1D1A A;  2C0O A;  3JB9 I;  1QVG P;  2HD0 A;  5KYY B;  3DB3 A;  4JRI A;  2HAX A;  3O8V A;  1JJ2 A;  5GMK h;  4M78 D;  2E64 A;  2MCN A;  2CP3 A;  1MMN A;  2LQW A;  5GAM f;  3UT1 A;  1WHJ A;  4Y28 E;  4FYV B;  1PCX A;  2E12 A;  4EIK A;  2MK5 A;  5CKB A;  3QKJ A;  4AFU C;  2JW4 A;  4C92 A;  3S6W A;  2QTV A;  1RAH B;  3E1S A;  1UDL A;  4ELY C;  1X6B A;  4RTV A;  4C8Q A;  1U3O A;  1UUE A;  3LH5 A;  1MV3 A;  4J9B A;  3H41 A;  1WZO A;  1UHF A;  2HBW A;  4M75 G;  2DRM A;  1ZA2 B;  2YSQ A;  2XIC A;  3PVQ A;  4C92 C;  4KBM B;  3REA B;  2DEU A;  3GIB A;  2KT1 A;  1XTD A;  4PLL A;  3UPU A;  1UGS B;  4C8Q C;  1I0C A;  4MMK A;  2FEI A;  1U5S A;  2E3H A;  1KC8 U;  1D1B A;  1B3Q A;  1G2B A;  8ATC B;  2E41 A;  2RMO A;  3GP8 A;  3L42 A;  4FSS A;  1KK7 A;  4M7A E;  1GFC A;  1M1K C;  3TQ7 P;  3OYG A;  2AK5 A;  3JB9 H;  4IIM A;  5DY9 A;  3T9N A;  3HPW A;  4IIO A;  4FYX B;  1OU9 A;  4IKF A;  2EVR A;  2CZ0 B;  3BE3 A;  4N4G A;  3MPU B;  1ZBX A;  1RAA B;  3SB2 A;  2DXT A;  3OYM A;  2CP5 A;  3VUB A;  3FIF A;  4XTV A;  4DEX A;  2MMP A;  4V2S A;  3JRZ A;  2KR3 A;  1G8X A;  2DVE A;  2EWN A;  5CKE A;  3EGX A;  2RPN A;  1MHN A;  2EBP A;  1JRI A;  2HKQ B;  4E2F B;  2H3E B;  2PVD B;  2YUN A;  1WFW A;  1KG1 A;  1RAB B;  2XDD A;  2WSC E;  2ROT A;  1HXD A;  3CCR A;  4ZNX A;  2RI5 A;  2QYZ A;  4CRI A;  5CQY A;  1WHH A;  3PVL A;  3OYY A;  4JDS A;  5GAN f;  4JJC A;  3VV0 A;  1G3Y A;  4EMH A;  2RHU A;  5D6W A;  1CSK A;  2RI3 A;  3PIP A;  1RI0 A;  2CSI A;  4LXC A;  2PUK B;  1ZSZ B;  1VQ9 A;  1QP3 A;  2GF7 A;  2JS2 A;  5LJ5 j;  2GFA A;  4M77 G;  3QO3 A;  1OV3 A;  2XDP A;  4PFZ A;  5EC7 A;  1IRX A;  3KFV A;  2CZ1 B;  1GCP A;  5KYN A;  2FZK B;  2AHJ B;  2RK1 A;  2EQU A;  1VQ7 A;  2FVU A;  2D9T A;  2EQI A;  3JCM e;  4E7L A;  2XID A;  4KH0 B;  3L2U A;  2IVW A;  4M75 F;  3QHS A;  4FIB A;  2DET A;  1W4S A;  1M8V A;  1Y96 B;  4FCY A;  1ABO A;  3FC3 A;  1VQ9 T;  5FLX E;  1IHW A;  5GAM h;  1B07 A;  4EMK B;  3EAE A;  4E47 A;  1KQS A;  4HT9 A;  3CC7 A;  2YDL A;  2CP2 A;  2EJ9 A;  1YBY A;  5GAN 2;  4M78 A;  2EJF A;  1YHQ T;  1BI2 A;  4FL6 A;  3M0R A;  3I56 A;  2MOX A;  3CCR Q;  2EIF A;  4OMQ A;  2LC4 A;  7AT1 B;  3OA6 A;  5L8R E;  3V8J A;  2DYB A;  2X35 A;  1Q7Y R;  3CXC S;  1VQ7 T;  2MWP A;  4F04 B;  1I5L A;  1KD1 R;  2EGC A;  4FSX A;  1T0H A;  1WYX A;  3OMC A;  2YUQ A;  3C0C A;  4JZ4 A;  2K79 A;  3LX7 A;  1W2B A;  1NLO C;  1PRM C;  3OQ5 A;  3QWY A;  3ME9 A;  4J6X A;  4MDW A;  4M78 C;  4BE0 A;  4II1 A;  4PNO A;  2P0P A;  3P8D A;  2WAC A;  2E6N A;  2JM8 A;  3CC7 T;  2LX9 A;  1M9S A;  1K8A C;  1VQ9 Q;  3MCA B;  3QG1 A;  3EG9 A;  1LVK A;  4PK4 A;  4F7U G;  1AD5 A;  2JZ2 A;  2JNG A;  5GAN 5;  3I56 T;  2DLP A;  1YHQ Q;  3QYG B;  1ZUK A;  3UDC A;  4HCB A;  2DTO A;  1VQ6 A;  3NTH A;  2DVJ A;  2KRM A;  1WI7 A;  3U23 A;  2BKD N;  3MJX A;  2FPD A;  3X24 B;  5J39 A;  3G1J A;  3FDR A;  1VQ7 Q;  3MO8 A;  3HL8 A;  2KBT A;  2A28 A;  2BZY A;  5I2M A;  2RB6 A;  4BI8 B;  4BAC A;  2CZ6 B;  3AT1 B;  2K5F A;  2QGG A;  4MZM A;  3M55 A;  3CC7 Q;  2PTK A;  1QVF S;  1OX8 A;  1K0X A;  2SEM A;  4K11 A;  1K73 R;  3MEV A;  4ZTF A;  3CPW S;  2G3R A;  1VQ6 T;  3I56 Q;  4CC4 B;  3QJ6 A;  4RG8 A;  3OYB A;  5CO7 A;  1X27 A;  1BB9 A;  4LNP A;  2P0K A;  4M7A A;  4M77 F;  1M1K U;  1IGQ A;  2MPX C;  1QLY A;  2BTT A;  3JB9 J;  4FW1 A;  1BCM A;  1KJW A;  2J05 A;  1K1Z A;  1G5V A;  3RNJ A;  2PVO B;  1JJ2 S;  1QCN A;  2NUP B;  2CS7 A;  5KYY A;  4PFO A;  5GAN h;  3CPF A;  3VKI A;  3CXC P;  2FHD A;  2COW A;  3TSZ A;  3R6N A;  4PKC C;  1VYV A;  1YN8 A;  4M7A C;  1WA7 A;  3ZEH A;  2F5T X;  2J7I A;  2VB6 A;  1D0Y A;  1M5Q 1;  1PKS A;  2KT8 A;  2LNH B;  2EYW A;  1VQ6 Q;  4DBQ A;  2JTF A;  2PVG B;  3RUX A;  3E2U A;  5EG2 A;  2K5I A;  2CGH A;  3EFO B;  1K0S A;  2VGN A;  4BDY A;  2X4X A;  3JCM c;  1K9M R;  2DL7 A;  2JMA A;  2JVV A;  3CCE A;  3JSC A;  4LDY A;  4QQ6 A;  3G4S A;  1ACM B;  3E9G A;  4A4K A;  4C92 D;  1BU1 A;  1BK2 A;  1QQJ A;  3FEO A;  4C8Q D;  3FRN A;  1UG1 A;  2RJE A;  5KE3 A;  3VS5 A;  2R58 A;  4F7U F;  5GAO q;  1QVF P;  4J5Y A;  2XHC A;  3CCV A;  2HDA A;  5LJ5 f;  1YJ9 A;  1WHL A;  4PJM A;  3LH0 A;  2QQS A;  2JS0 A;  1PRL C;  3VRY A;  3G4S T;  2QAS A;  4PJO G;  1M90 R;  3TEE A;  3CCS A;  2J6K A;  1VYT A;  2EAY A;  2GTO A;  3NTI A;  2E10 A;  5KYX B;  4DBF A;  2CP7 A;  1T0J A;  2BE9 B;  1Q7Y C;  1VA7 A;  3INZ A;  1KD1 C;  2EJG A;  1FMW A;  1Q81 C;  2DJQ A;  3RBB B;  3MP8 A;  5CAI A;  2ZPB B;  3MEA A;  4QQG A;  2C06 A;  1X2K A;  3KUF A;  4NOY A;  3QJY A;  2CH4 W;  2RHX A;  4E7H A;  1YJ9 T;  3GLX A;  1WXT A;  3RDV A;  2EGA A;  3F70 A;  4TVR A;  3EFR A;  4ZTJ A;  1Q82 R;  4FW2 A;  2RHZ A;  3OYN A;  1C6V X;  2LQN A;  1QMC A;  3G4S Q;  5HY6 A;  4XTY A;  1GL5 A;  2VGM A;  1TH7 A;  1QKW A;  4LDW A;  1UGV A;  2DXB A;  3EG9 B;  1RAF B;  3H0H A;  2B8A A;  1ZSZ A;  3A8L B;  2MIO A;  5D6X A;  1K8A U;  1RL2 A;  2L8D A;  4LE9 A;  1YIT A;  4C0F A;  4JLI A;  4L59 A;  1WJQ A;  3CQT A;  4DQ2 A;  3REB B;  4KT0 E;  3WVD B;  5HKC A;  3CCV Q;  2KY9 A;  1ZX6 A;  2A7Y A;  2CZ7 B;  3CEY A;  2K5L A;  2D6F A;  1YJ9 Q;  1E7O A;  3VYH B;  5D7U A;  5LJ3 f;  2AT1 B;  4J6Y A;  2R5M A;  1X6O A;  4LDV A;  1ZSZ C;  1K73 C;  1NJI R;  3CCS Q;  2NUZ A;  1B34 B;  2DJZ A;  3NGP A;  1YJN T;  4WCI A;  1HJD A;  1WGS A;  2K7A A;  2EGE A;  1SF9 A;  1KQS S;  3DKM A;  2DO3 A;  3JCM V;  1OI1 A;  4C0Z A;  1IXD A;  3OS2 A;  2ED0 A;  3VS0 A;  1Y96 A;  1WXB A;  1YIT T;  1Y0M A;  4OVA A;  3A8M B;  4EMK A;  1AWJ A;  3M0U A;  4RUG A;  3JB9 G;  2DIG A;  4M7D G;  4OB2 B;  5CCA A;  1VQO T;  5L23 A;  1OOT A;  2IG0 A;  4CC7 A;  4WF2 A;  2M0O A;  1R8O B;  2DNU A;  3GOX A;  3CCQ A;  1Y71 A;  5FU6 B;  2M1H A;  4E7Z A;  3MEU A;  2EYY A;  2DTH A;  4EMK C;  4J9I A;  4J9F A;  2LCL A;  3A5Z B;  1EIF A;  4GLK A;  4LUD A;  3OMG A;  2E3I A;  1IRE B;  2J6F A;  1M4Z A;  2HMA A;  4PJO F;  4HT8 A;  1OZ3 A;  1PM3 A;  2LNV A;  4JUV A;  1YIT Q;  2VXF A;  1JBM A;  4B6M A;  1UEC A;  2XD0 A;  4BUG A;  1FYN A;  3OW2 A;  4PJJ A;  2YLB A;  3JV3 A;  4PJL A;  5HK3 A;  5CR2 A;  1PC0 A;  3MP6 A;  2NWM A;  2E5Q A;  2JMC A;  3VU3 C;  3M58 A;  4LDU A;  3M59 A;  3CCQ T;  5CVI A;  3H9N A;  5GAO l;  2O9V A;  5LJ5 h;  5IHK A;  2E1H A;  2YWW A;  2QXF A;  1X2Q A;  3RES A;  1R0B G;  4F14 A;  1WXU A;  2YT6 A;  2IIM A;  1WLP B;  3G71 T;  2QTX A;  2BUD A;  3FJP A;  5FU7 B;  4BE2 A;  1W1F A;  2RK2 A;  5C0M A;  4MDX A;  4OMP A;  1P92 A;  4RCB A;  4F16 A;  4HVW A;  2DIQ A;  2RN8 A;  1N8R C;  1F1B B;  2JJ9 A;  1E6H A;  1BIA A;  2RF0 A;  2KDS A;  5I11 A;  1SRL A;  1BBZ A;  2HCK A;  2CKK A;  4M7D B;  2MAM A;  1X75 C;  1NEG A;  2LVM A;  1W70 A;  3L2Z A;  5AT1 B;  3CCQ Q;  1AOJ A;  1U1S A;  4JS5 A;  1BCO A;  1X43 A;  3HRT A;  2NUP A;  3RR6 A;  3NPF A;  3E9F A;  3WVE B;  3V8L A;  4HVV A;  1PWT A;  2X9H A;  2NUT B;  1B7T A;  4GBQ A;  2YRC A;  1NEB A;  1SHF A;  1QVP A;  1TUC A;  1TOV A;  2YRD A;  1H8K A;  1Q7Y U;  4M7A D;  1KD1 U;  4KUL A;  1R77 A;  4ANJ A;  2Y4Y A;  1Y7X A;  3A8G B;  1Q81 U;  4IUV A;  1AHJ B;  2L3S A;  1AWW A;  4LUE A;  4XQ3 A;  4FYY B;  2J6O A;  1VQM A;  4VUB A;  1Q86 R;  3JB9 F;  2J06 A;  4M7D F;  2CUB A;  1PKT A;  1QKX A;  1FMV A;  4HCK A;  1ZHI A;  1VYU A;  5LJ3 h;  2K6D A;  3EFO A;  2JXB A;  5CKD A;  1FWZ A;  3ER0 A;  4EPC A;  1MND A;  2YHT A;  3R6O A;  1GCQ A;  4M75 B;  1T3L A;  4XK8 E;  1AZE A;  2HL3 A;  2MYS A;  4QVD A;  5LJ3 d;  1X01 A;  4O6J A;  1VIF A;  3JCM Q;  1QVG A;  1GXI E;  1X6G A;  2HL5 C;  2RQT A;  5GMK j;  2HSE B;  4KRT A;  4FYW B;  4AFS C;  2D1X A;  1NJI C;  1J3T A;  3MP1 A;  4PJN A;  1UGQ B;  1YIJ A;  3HRS A;  2Y90 A;  3OYC A;  1VQM T;  3LGL A;  4A54 A;  3CCL T;  4M7D E;  4E7J A;  3G6E A;  1GCQ C;  5DM7 R;  1D3B B;  1OUL A;  3H0F A;  1YHQ A;  2MF2 A;  4D8D A;  3OYF A;  4N4H A;  2BZ8 A;  2ZGW A;  4C92 G;  3C12 A;  2P4T A;  4OMF B;  3J80 E;  1E6G A;  3PFS A;  1JXO A;  4C5H A;  1K73 U;  4RTW A;  1EZZ B;  4C5I A;  3A1P A;  1LPL A;  1UJ0 A;  2KRO A;  5ECA A;  1AWO A;  3CCU T;  3M54 A;  2RO0 A;  5KYX A;  4LDX A;  3SWN B;  2KSS A;  4ESR A;  4XU0 A;  1M2V B;  1VQP T;  1YIJ T;  1KC8 R;  4IUQ A;  1QWF A;  2M51 A;  3G6E T;  3RKX A;  3A8O B;  1ZUY A;  4RTU A;  4XU3 A;  1G3T A;  4AFQ C;  3CC2 T;  1UE9 A;  1VQM Q;  8AT1 B;  2RA2 A;  4B9X A;  5GAM d;  2LTO A;  3M53 A;  2HSP A;  1PSE A;  4J9C A;  4D8K A;  1CKA A;  3A98 A;  2PNI A;  2OAW A;  1N9S A;  2WSE E;  3RKW A;  1I1J A;  2DM1 A;  4EMG A;  1VIE A;  4AG2 C;  1UB4 A;  4M75 E;  3KXT A;  2V1Q A;  4JPB W;  3CMA A;  3JCM b;  1JEG A;  5GAN 6;  2QQR A;  2VC8 A;  5D6Y A;  2XU8 A;  3H6Z A;  1K9A A;  4CI0 C;  1YIJ Q;  2COZ A;  3EHR A;  1TXQ A;  5HCK A;  1H3H A;  2CRE A;  3QXE B;  3OYD A;  3G6E Q;  1RAI B;  3OYA A;  2P4R A;  2AIR B;  4M77 B;  2LRQ A;  5DLQ E;  3FLG A;  5GMK e;  1RAG B;  1KQ2 A;  1I5O B;  4OB0 B;  3S3N A;  4ORZ A;  4A63 B;  1ZQ1 A;  1X69 A;  2LCC A;  1GRI A;  3UF4 A;  5KCO A;  3CMA T;  5IHN A;  1B34 A;  3VS7 A;  2ZZD A;  1JU5 C;  2VXE A;  1G83 A;  3C95 A;  4LN2 A;  3OYL A;  2GQI A;  2K3B A;  1N8R U;  5C6S A;  4RMO A;  4DEY A;  2DMO A;  4B9W A;  1N27 A;  2F2W A;  2L3R A;  1M3B A;  4AMC A;  2OAU A;  1UEB A;  2QG9 B;  4J7F A;  2EW3 A;  1UHC A;  3HFO A;  4AG1 C;  4CC3 A;  3PGG A;  1KFZ A;  3GBQ A;  5GMK l;  2QQ9 A;  2PQW A;  1M3A A;  2ZAE A;  1V76 A;  3JCM f;  1YFN A;  1BIB A;  3LGF A;  4C92 F;  1YWO A;  2F2V A;  3CMA Q;  1VUB A;  3V7C A;  4BDZ A;  2DIL A;  4NL3 A;  2CDT A;  1SSF A;  5GAN d;  1NG2 A;  2DE0 X;  2IPO B;  5FRO A;  3EG1 A;  3X26 B;  3FB9 A;  2LMJ A;  2E6Z A;  5A0L A;  2O88 A;  4F7U B;  5FU6 C;  2DBM A;  4M77 E;  5HK0 A;  4RG2 A;  2HBP A;  1PHT A;  3S3M A;  2YXY A;  2P0Q A;  4M78 G;  1WX6 A;  3L2R A;  3VYG A;  1D09 B;  2JUF A;  4RTZ A;  2HQE A;  1AVZ C;  2DK3 A;  2K57 A;  5CK9 A;  1M2O A;  3DLL A;  5I21 A;  2KEA A;  2M0Y A;  5IN1 A;  4C0D C;  4N0A A;  4EDU A;  1SG5 A;  2RHI A;  1JQQ A;  4BI4 A;  1Z9Z A;  4C5E A;  1RI9 A;  4AFZ C;  4MZT A;  3MKD A;  3GNG A;  3MEW A;  1OEB A;  4M77 D;  3LYI A;  2I0N A;  4GLM A;  1NJI U;  4RTY A;  1LOJ A;  2GGR A;  2V8J A;  1NE8 A;  1I07 A;  4CC2 A;  1H64 1;  2KXC A;  1M30 A;  4M7D A;  3KBG A;  4N0A C;  3EG3 A;  3SHW A;  3A8H B;  5FU7 C;  2O2O A;  2V8K A;  2RHY A;  4Y92 A;  3CPW P;  2O4X B;  1ZUU A;  4JJN K;  2D0N A;  1MV0 B;  5KYU B;  1YCY A;  4OF1 A;  3HHT B;  3QUI A;  2GTJ A;  2D8H A;  4BB7 A;  2AZV A;  2M9U A;  4OMN A;  1VQ5 A;  1VQL A;  1AWX A;  9ATC B;  1JJ2 P;  4HVU A;  2NUT A;  4M7D C;  1Z9Q A;  2X3W D;  1IB8 A;  3VS2 A;  2FB7 A;  2FO0 A;  1AT1 B;  3OS5 A;  4F7U E;  1OYX A;  2DEQ A;  2RI2 A;  2DPP B;  3ULR B;  1M27 C;  1WPY A;  2HQX A;  1MMA A;  2GBQ A;  2L3Q A;  2V1R A;  3NMZ C;  3VS4 A;  5GAM e;  1ARK A;  2P84 A;  4Q5W A;  5LJ3 g;  4J9E A;  3VJP A;  1TU0 B;  4Y91 A;  1QP2 A;  3PMI A;  4M7A G;  1VQ5 T;  4HKE A;  2E70 A;  1VQL T;  3UAT A;  3PE0 A;  4XTX A;  4M75 A;  5CQX A;  1YJN A;  5M9O A;  1NYF A;  3JCM X;  4OB3 B;  1RLQ C;  2RQV A;  4BD3 A;  5GAN 7;  3LWI A;  1ZSG A;  3WXM B;  2X4W A;  3CD6 A;  2K2M A;  3QDF A;  3CXC A;  1UTI A;  1I81 A;  2OTL A;  4L5G A;  2RH2 A;  2DL3 A;  2KNB B;  1VQN A;  1SEM A;  4HXJ A;  1UGP B;  4KUD K;  4HCZ A;  1WQW A;  4M75 C;  1D3B A;  2X51 A;  4F17 A;  1NPP A;  3L2W A;  1VQO A;  4NL2 A;  1C1A A;  4JJB A;  4FT4 A;  4C0G A;  5FRM A;  1MMG A;  1Q95 G;  1D0X A;  3EGD B;  3JCM h;  4M78 F;  5J3B A;  2E65 A;  3UWN A;  2KMT A;  5IAY A;  1NLP C;  4XTW A;  1VQ5 Q;  1VQL Q;  3M4Y A;  4OMM A;  2VV5 A;  3BDU A;  4PJO B;  1IHV A;  4KGV B;  3VS1 A;  3CD6 T;  2RNA A;  3JCM d;  1UGR B;  3SWN A;  2AZS A;  2LJ1 A;  1M2V A;  3BY7 A;  3M0Q A;  2KYM A;  5GAM g;  2LJ0 A;  3VS6 A;  2OTL T;  3QII A;  1VQN T;  2QGF B;  3OYI A;  1SPK A;  3OS1 A;  1V29 B;  4E7K A;  2LCS A;  3X28 B;  3M0S A;  2KRN A;  2MI6 A;  2CT4 A;  2KXD A;  4ELZ C;  1W2B S;  1TUD A;  2DYI A;  2OI3 A;  2X3X D;  3BFM A;  2DZC A;  2FZG B;  2RQR A;  1PD1 A;  2H3J A;  5I22 A;  5GJV B;  3SWN C;  2VAS A;  1RAE B; 
#chains in the Genus database with same CATH homology
 3P8B B;  3CBP A;  3NTH A;  2Y4X A;  2YRV A;  2BKD N;  4JLG A;  1ZHI A;  2O01 E;  5LJ3 h;  1QVF A;  1OZ2 A;  4JRP A;  1VQK A;  3X24 B;  5J39 A;  3OY9 A;  2OTJ T;  3CBO A;  3FDR A;  5CKD A;  2EKO A;  3MO8 A;  1YJW T;  1FWZ A;  3HL8 A;  3ER0 A;  4EPC A;  2YHT A;  3R6O A;  3G71 A;  4P5N A;  1H3Z A;  3CME A;  4M75 B;  1DJ7 B;  4XK8 E;  2RJF A;  5I2M A;  1BI0 A;  2RB6 A;  4MZP A;  3CCE T;  4QVD A;  4ATO A;  5LJ3 d;  1X01 A;  4O6J A;  1S72 A;  1VIF A;  2RM4 A;  4BI8 B;  3JCM Q;  4BAC A;  1QVG A;  2CZ6 B;  1GXI E;  2K5F A;  3CBM A;  4JRQ A;  4FM4 B;  1K9M C;  4JS4 A;  1VQ8 A;  4C0D B;  5GMK j;  4MZM A;  3GPL A;  2M16 A;  4BY6 C;  3M55 A;  1NJI C;  3BDL A;  2K2V A;  4KUI A;  5GAN e;  4JRK A;  1QVF S;  3MP1 A;  4OGE A;  2FL7 A;  4ME7 A;  1UGQ B;  1PSF A;  3HRS A;  1YIJ A;  3MET A;  3CCM A;  5GAO p;  2Y90 A;  3OYC A;  1VQM T;  3LGL A;  4A54 A;  3MEV A;  4M77 A;  3CCJ A;  3CCL T;  4M7D E;  2HNI A;  1MGQ A;  3G6E A;  1LJO A;  2KQW A;  3CPW S;  4E7J A;  5DM7 R;  4ZTF A;  2G3R A;  1VQ6 T;  4A4H A;  1D3B B;  5GAN 3;  1YHQ A;  3QJ6 A;  4M78 B;  4RG8 A;  3OYB A;  2RD1 A;  2MF2 A;  3H8Z A;  5CO7 A;  3OYF A;  4N4H A;  1HK9 A;  3QDR B;  4OP0 A;  2I2L A;  1QVG S;  1VQK T;  4GY5 A;  2P0K A;  4M7A A;  3CCV T;  2ZGW A;  4M77 F;  1G3W A;  1O9S A;  4C92 G;  2K4Y A;  3C12 A;  5KE2 A;  2BIV A;  2DZ9 A;  2EYQ A;  5KCH A;  1M1K U;  2F5K A;  4A4F A;  3CME T;  5GAN j;  1G3S A;  2P4T A;  3M57 A;  1FX7 A;  4OMF B;  3ZFJ A;  3J80 E;  3TU4 K;  1G5V A;  5LJ5 d;  3PFS A;  2PVO B;  1JJ2 S;  4PJO E;  3S3O A;  3DB4 A;  3NTK A;  4C5H A;  2V8I A;  1K73 U;  1S72 T;  4C5I A;  3M56 A;  2CS7 A;  4M7A F;  5GAN h;  4X9C A;  3CPF A;  4M77 C;  3CCS T;  3CCU T;  1VQ8 T;  3LLR A;  3M54 A;  2EFI A;  3VKI A;  1BKB A;  2RO0 A;  4XTU A;  3JCM P;  1U8R A;  2MWO A;  3SWN B;  4LDX A;  2KSS A;  2FHD A;  4J6W A;  1FXX A;  2ZPG B;  4QQD A;  4XU0 A;  4PKC C;  3PIO A;  1VQP T;  2KAF A;  1YIJ T;  4J8O A;  2ZPE B;  1M90 C;  3OYK A;  3MHX A;  3CCM T;  4IUQ A;  4M7A C;  3CCJ T;  5LL6 S;  3G6E T;  3ZEH A;  5GMK m;  2F5T X;  3RKX A;  3A8O B;  3OS0 A;  2FYK A;  4XU3 A;  1G3T A;  4XU1 A;  3CC2 T;  1M5Q 1;  3HRU A;  5GAM d;  2RA2 A;  4B9X A;  2DTI A;  2LTO A;  2R57 A;  3M53 A;  1PSE A;  3HFN A;  4LD9 K;  2JTF A;  2DXC A;  2PVG B;  3PT9 A;  4LD6 A;  3RUX A;  3LWH A;  4PJO D;  3G7Z A;  3SDZ A;  3JAM E;  5IT9 E;  1N6A A;  2EQM A;  4RKU E;  5EG2 A;  2ZPH B;  3OSS C;  2K5I A;  1N9S A;  2WSE E;  3RKW A;  2CGH A;  1I4K 1;  5GAN g;  4EMG A;  1VIE A;  3V7S A;  3TCJ A;  2VGN A;  1UB4 A;  2X4X A;  2PUO B;  4M75 E;  3JCM c;  4BDY A;  2CYZ B;  3SD4 A;  2XK0 A;  4A4G A;  2QQA A;  3KXT A;  4E7I A;  1U1T A;  3JCM W;  2XKO C;  3CMA A;  2JVV A;  2DAQ A;  4O5V A;  4IUU A;  3JCM b;  3JSC A;  3CCE A;  5GAN 6;  1Q82 C;  2QQR A;  2VC8 A;  4LDY A;  3TRE A;  4QQ6 A;  2LT4 A;  2YLC A;  3QYH B;  3G4S A;  5D6Y A;  4MML A;  3E9G A;  2XU8 A;  4ZN1 A;  2RJD A;  3H6Z A;  4A4K A;  2F69 A;  4C92 D;  3C4S A;  4CI0 C;  1NZ9 A;  2QDY B;  3PNW C;  1KQ1 A;  4F7U A;  3OYD A;  3QXE B;  4HCC A;  3FEO A;  3QSU A;  4IUP A;  4C8Q D;  3FRN A;  3OYA A;  3CCL A;  1BI3 A;  4M77 B;  2LRQ A;  2RJE A;  4M78 E;  5CIU A;  5DLQ E;  3FLG A;  5KE3 A;  2K3Y A;  2QI2 A;  5GMK e;  3JCM J;  3QPH A;  2R58 A;  2D0Q B;  4F7U F;  2GCX A;  1KQ2 A;  2K3X A;  4OB0 B;  1M1G A;  5GAO q;  5GMK i;  4QW2 A;  3S3N A;  2NLU A;  1LNX A;  4J5Y A;  4N4I A;  1Y07 A;  2XHC A;  4ZGD B;  3CCV A;  1JB0 E;  2PU9 B;  3J81 E;  1ZQ1 A;  4M7A B;  4BI3 A;  2LCC A;  5LJ5 f;  1YJ9 A;  3M4G A;  4ZN3 A;  2RJC A;  2VUB A;  3CPW A;  4NS5 A;  5KCO A;  3LH0 A;  3CC4 A;  3CMA T;  2QQS A;  4X9D A;  5A0G A;  4BE1 A;  1QW1 A;  2L5Q A;  1Q86 U;  3QBY A;  1B34 A;  4HA8 A;  3G4S T;  2LDM A;  2ZZD A;  3JB9 I;  2EQJ A;  2HD0 A;  4PJO G;  3TEE A;  3OYH A;  3DB3 A;  3CCS A;  3P8H A;  3CCU A;  4JRI A;  3RER A;  2VXE A;  1XNI A;  2EAY A;  2XG8 D;  3NTI A;  2HAX A;  2E10 A;  3C95 A;  3O8V A;  3QZ9 B;  1BI1 A;  1JJ2 A;  4XAX B;  3OYL A;  1VQP A;  1Q7Y C;  1M1F A;  5GMK h;  4M78 D;  3INZ A;  1KD1 C;  2EJG A;  2E64 A;  1YI2 A;  1N8R U;  5C6S A;  4RMO A;  1Q81 C;  4B9W A;  1N27 A;  5GAM f;  3MP8 A;  3RMS A;  5CAI A;  2L3R A;  5GAN 4;  2ZPB B;  3MEA A;  4QQG A;  3UT1 A;  2C06 A;  3CC2 A;  5GAO r;  2OAU A;  3KUF A;  4Y28 E;  1UEB A;  4NOY A;  3QJY A;  4FU6 A;  3JB9 J;  2E12 A;  4J7F A;  2RHX A;  1KHC A;  4E7H A;  3OSV A;  5CKB A;  3QKJ A;  3I55 A;  3HFO A;  4C92 A;  3PGG A;  4C5G A;  4DA4 A;  1YJ9 T;  2O4X A;  3GLX A;  3S6W A;  4PL6 A;  5GMK l;  3CC4 T;  1WQ7 A;  3F70 A;  4TVR A;  2QQ9 A;  3E1S A;  4C8Q G;  3EFR A;  4ZTJ A;  2PQW A;  4ELY C;  4C8Q A;  2RHZ A;  3JCM f;  3CCR T;  3OYE A;  3OYN A;  1BIB A;  2X4Y A;  3LGF A;  3RIR A;  4C92 F;  2ZCF B;  4A53 A;  1VUB A;  3V7C A;  5HY6 A;  4BDZ A;  4M75 G;  4XTY A;  4NL3 A;  3PMT A;  3JB9 D;  4M7D D;  4PLI A;  1N9R A;  2VGM A;  2X4J A;  1SSF A;  1TH7 A;  4LDW A;  5GAN d;  4RCC A;  2DXU A;  2DXB A;  1YI2 T;  2XIC A;  5FRO A;  4C92 C;  4KBM B;  4DOW A;  2B8A A;  3A8L B;  3X26 B;  3FB9 A;  3GIB A;  2E6Z A;  5D6X A;  5A0L A;  1XTD A;  4PLL A;  3UPU A;  1K8A U;  4F7U B;  1RL2 A;  1UGS B;  5FU6 C;  2L8D A;  4C8Q C;  1YIT A;  1BYM A;  4C0F A;  4MMK A;  4M77 E;  4JLI A;  4L59 A;  5HK0 A;  4RG2 A;  5A2Q E;  1WJQ A;  2HBP A;  2XI9 A;  4DQ2 A;  3V8K A;  2DD4 A;  1KC8 U;  4BY6 B;  3RMQ A;  4KT0 E;  3URG A;  3WVD B;  5HKC A;  2KY9 A;  3S3M A;  3N5B B;  2A7Y A;  2CZ7 B;  2E41 A;  2K5L A;  2P0Q A;  3CEY A;  4M78 G;  3GP8 A;  2D6F A;  3L42 A;  2JN0 A;  4M7A E;  4IUR A;  3L2R A;  3DLM A;  3VYG A;  2JUF A;  1M1K C;  3VYH B;  2HQE A;  3OYG A;  2DK3 A;  3JB9 H;  2K57 A;  5DY9 A;  3T9N A;  3HPW A;  5CK9 A;  5LJ3 f;  4J6Y A;  2R5M A;  1X6O A;  4LDV A;  3SFM A;  1K73 C;  4IKF A;  3DLL A;  5I21 A;  5IN1 A;  4C0D C;  2CZ0 B;  4N0A A;  4EDU A;  4N4G A;  1ZBX A;  1B34 B;  2DJZ A;  3PTA A;  3SB2 A;  1YJN T;  2DXT A;  4OB1 B;  2RHI A;  1WGS A;  3OYM A;  4BI4 A;  4C5E A;  3VUB A;  1KQS S;  3FIF A;  3DKM A;  2DO3 A;  4MZT A;  1OI1 A;  3GNG A;  3JCM V;  3X20 B;  3MEW A;  4XTV A;  4C0Z A;  3OS2 A;  1Y96 A;  2MMP A;  3ZBD A;  4M77 D;  3LYI A;  1K9M U;  1YIT T;  2DD5 A;  4OVA A;  3L2Q A;  4V2S A;  1VQ4 A;  3JRZ A;  1IZ6 A;  1NJI U;  2QQB A;  1LOJ A;  2V8J A;  3A8M B;  2DVE A;  4EMK A;  1NE8 A;  1O75 A;  1H64 1;  2EWN A;  5CKE A;  3JB9 G;  2DIG A;  4M7D G;  4M75 D;  4M7D A;  1MHN A;  3KBG A;  4N0A C;  2LQK A;  4OB2 B;  5CCA A;  1JRI A;  3A8H B;  5FU7 C;  4R56 A;  1VQO T;  2V8K A;  2RHY A;  1WJS A;  4C92 B;  3HP9 A;  2O4X B;  4JJN K;  2PVD B;  3BW1 A;  3OBY A;  1KG1 A;  2IG0 A;  4WF2 A;  3JCM g;  1NPR A;  2M0O A;  5LJ3 j;  2XDD A;  1R8O B;  1I8F A;  2WSC E;  3EFS A;  1YCY A;  1HXD A;  4OF1 A;  3CCR A;  3GOX A;  3CCQ A;  1Y71 A;  3HHT B;  3QUI A;  2M1H A;  2RI5 A;  5FU6 B;  4QVZ A;  5CQY A;  4BB7 A;  4C8Q B;  4CRI A;  3MEU A;  4PJO A;  2DTH A;  2M9U A;  4EMK C;  2WSF E;  2LCL A;  2JOY A;  3A5Z B;  1VQ5 A;  1EIF A;  1VQL A;  2GQV A;  3LW5 E;  3OBW A;  4GLK A;  3OMG A;  3OYY A;  4JDS A;  5LJ5 e;  1IRE B;  5GAN f;  2ZPI B;  3OYJ A;  3VV0 A;  4XTZ A;  1G3Y A;  4EMH A;  4M7D C;  1M4Z A;  1VQ4 T;  2RHU A;  4PJO F;  5D6W A;  2FB7 A;  4HT8 A;  1OZ3 A;  2RI3 A;  3PIP A;  2LNV A;  4JUV A;  4X34 A;  1RI0 A;  4QVC A;  2PUK B;  1JBM A;  2VXF A;  3OS5 A;  1M90 U;  4J83 A;  2L89 A;  4F7U E;  2XD0 A;  2R5A A;  4BUG A;  3HKS A;  4UC4 A;  1OYX A;  5CKF A;  1XQH A;  2DEQ A;  2RI2 A;  4IUT A;  1VQ9 A;  2DPP B;  4PJO C;  3OW2 A;  1QP3 A;  2YLB A;  3NFC A;  2GF7 A;  5LJ5 j;  5HK3 A;  4DOV A;  2GFA A;  1WPY A;  4M77 G;  5CR2 A;  3MP6 A;  2A3L A;  2HQX A;  2E5Q A;  3QO3 A;  2QEX A;  2QA4 A;  3VU3 C;  3M58 A;  2XDP A;  5GAM e;  4LDU A;  3M59 A;  3CCQ T;  4Q5W A;  5CVI A;  1WJR A;  3OB9 A;  5GAO l;  3GNF B;  4ZGJ B;  4Z02 A;  2CZ1 B;  3VJP A;  4Y91 A;  1QP2 A;  2E1H A;  5DLO A;  5LJ3 g;  5LJ5 h;  3PMI A;  4M7A G;  1VQ5 T;  2QXF A;  2E70 A;  2GFU A;  4HKE A;  1VQL T;  3RES A;  2AHJ B;  3L1A A;  4ZGE B;  1Q86 C;  2RK1 A;  3E19 A;  4M75 A;  4XTX A;  2EQU A;  4A4E A;  4C8Q F;  3G71 T;  4J7I A;  1VQ7 A;  5CQX A;  1YJN A;  5M9O A;  3JCM X;  2FVU A;  2QTX A;  4OB3 B;  3OW2 S;  2D9T A;  2BUD A;  2DKG A;  3FJP A;  5FU7 B;  4BD3 A;  4D6W A;  2RK2 A;  5C0M A;  3JCM e;  5GAN 7;  3LWI A;  4BE2 A;  4FT2 A;  4E7L A;  1Q82 U;  3WXM B;  4MDX A;  2XID A;  2KK4 A;  2X4W A;  5CKH A;  3L2U A;  3CD6 A;  2IVW A;  1P92 A;  5GAM j;  4M75 F;  3QHS A;  4FIB A;  3QZ5 B;  4RCB A;  1W4S A;  1M8V A;  1Y96 B;  3C94 A;  5GAO m;  2DIQ A;  4OGC A;  2LQ8 A;  1N8R C;  3FC3 A;  3CXC A;  1VQ9 T;  1I81 A;  2OTL A;  5AYF A;  5FLX E;  4L5G A;  4YTL A;  5GAM h;  2RH2 A;  1VQN A;  4EMK B;  3EAE A;  3X25 B;  4E47 A;  1KQS A;  3CC7 A;  1BIA A;  4HT9 A;  1UGP B;  2KDS A;  2QEX T;  2QA4 T;  5FRN A;  4KUD K;  4HCZ A;  1WQW A;  2CKK A;  2EJ9 A;  1D3B A;  1YBY A;  2LT1 A;  4M75 C;  5GAN 2;  3M9Q A;  4M78 A;  5LJ5 g;  4M7D B;  2MAM A;  2EJF A;  1NPP A;  1YHQ T;  1X75 C;  1BI2 A;  3I55 T;  4C92 E;  3L2W A;  5GAO n;  1WNL A;  4NL2 A;  2LVM A;  1VQO A;  4FL6 A;  4XU2 A;  3M5A A;  3I56 A;  4FT4 A;  3VUZ A;  3L2Z A;  4C0G A;  5FRM A;  2EIF A;  2LC4 A;  3OA6 A;  2XDB A;  5L8R E;  3V8J A;  3JCM h;  2X35 A;  4M78 F;  5J3B A;  4C8Q E;  2E65 A;  3UWN A;  2KMT A;  5IAY A;  3CXC S;  1KHI A;  2MWP A;  3ASK A;  4XTW A;  1U1S A;  5I2S A;  4JS5 A;  1I5L A;  1VQ7 T;  4FSX A;  3HRT A;  3M4Y A;  3OMC A;  3BDU A;  2VV5 A;  4R55 A;  4PJO B;  3LX7 A;  3L2V A;  1W2B A;  2OTJ A;  3E9F A;  3CD6 T;  3WVE B;  3V8L A;  2EQK A;  1YJW A;  2ZPF B;  3OQ5 A;  5A0D A;  3JCM d;  3ME9 A;  1UGR B;  3SWN A;  5LJ3 e;  4J6X A;  3AHU A;  4MDW A;  3HSB A;  4M78 C;  4BE0 A;  4II1 A;  4PNO A;  3BY7 A;  5GAM g;  2OTL T;  3RKY A;  3QII A;  1QVP A;  2P0P A;  1XOV A;  3P8D A;  1VQN T;  2WAC A;  2E6N A;  1Q7Y U;  3CC7 T;  4M7A D;  3OYI A;  2LX9 A;  1M9S A;  3OS1 A;  1K8A C;  1KD1 U;  3Q1J A;  3MCA B;  1V29 B;  3QG1 A;  4KUL A;  4E7K A;  2KVQ G;  2Y4Y A;  3X28 B;  5GAN 8;  1Y7X A;  3J7A F;  3A8G B;  1Q81 U;  4IUV A;  3GF5 A;  1AHJ B;  4F7U G;  4L6V 5;  2JTM A;  2MI6 A;  2JZ2 A;  2JNG A;  4ELZ C;  4XQ3 A;  1W2B S;  5GAN 5;  2VYT A;  3I56 T;  1KC8 C;  3BFM A;  2DZC A;  5KH6 A;  1VQM A;  4VUB A;  3JB9 F;  5J26 A;  3QYG B;  3UDC A;  4M7D F;  2H3J A;  4HCB A;  3SWN C;  2DTO A;  3V7R A;  1VQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...