2EQJA

Solution structure of the tudor domain of metal-response element-binding transcription factor 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GSSGSSGKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TUDOR domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Metal-response element-binding transcription factor 2
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqjA00
4C5HA 2O4XA 4CRIA 3OYMA 4BE1A 2IG0A 3MEWA 5J39A 4E7HA 3DB3A 4FU6A 5CIUA 2M16A 1RI0A 3M9QA 4PLIA 4N4HA 2PQWA 2X4WA 3E9GA 5C6SA 3DB4A 4BE2A 3P8DA 4BD3A 5KCHA 3DLMA 3OYFA 4E7LA 1H3ZA 4X34A 5KE2A 2L8DA 3FDRA 2E5QA 2EQKA 3H6ZA 3S6WA 2L3RA 4RG2A 4GY5A 1WJRA 4IUUA 1OI1A 4NS5A 3FLGA 4A4HA 2O4XB 2M1HA 2MWOA 3O8VA 1OZ2A 1SSFA 3GOXA 3KUFA 2CKKA 3ME9A 2M0OA 3S3MA 3NTIA 3OMGA 5D6YA 2FHDA 2YRVA 3S3OA 5IAYA 1WJQA 2RI5A 3EAEA 3OYNA 3OYDA 3MP1A 3OYCA 2DAQA 4OVAA 4EDUA 3L2WA 2VYTA 3L2VA 4QVZA 2NLUA 3OYKA 4QW2A 2RHYA 2R5AA 2LTOA 3LLRA 3MO8A 4C5EA 4C5IA 2R57A 3H8ZA 5C0MA 3E9FA 3L2QA 5KE3A 2GFUA 2EQJA 3NTKA 2D9TA 2BKDN 3QJ6A 4ZTFA 4BE0A 4Z02A 4A4FA 3SD4A 1OZ3A 3NTHA 2BUDA 3MEVA 2EQMA 3LGLA 3FC3A 3P8HA 2RI3A 1OYXA 5FRMA 3BDLA 3LYIA 4L59A 3L42A 4E7KA 2RHZA 2RO0A 3OQ5A 3OYAA 2XK0A 3OY9A 4FL6A 2X35A 4UC4A 4QQGA 2QQRA 3PFSA 3ASKA 3MEUA 3Q1JA 3OYHA 4BDZA 2G3RA 3PNWC 2RHUA 2B8AA 5FRNA 3PMIA 2QQSA 2LRQA 3OMCA 4IUQA 3L2RA 3FEOA 3LX7A 4HCZA 4B9XA 3OYJA 4PLLA 2R58A 2RHXA 4IUVA 5IN1A 4E7IA 1G5VA 4B9WA 2LDMA 3MP6A 5D6WA 3UT1A 2GFAA 1N27A 2LVMA 3C4SA 3OYEA 2K3YA 2R5MA 4IKFA 3OYBA 4IUTA 2EQUA 3META 4A4GA 2L89A 1KHCA 3MP8A 3QKJA 2P0KA 5KCOA 4II1A 1WGSA 3L2UA 3CEYA 2F5KA 2X4YA 2X4XA 3LH0A 5J26A 4LD6A 2XDPA 2DIQA 4BDYA 4IURA 4QQ6A 2HQEA 5KH6A 2JZ2A 2LCCA 3F70A 5D6XA 3OS2A 2RI2A 3QIIA 2GF7A 3OB9A 4A4EA 3OYGA 2RHIA 2HQXA 2RJCA 2RJEA 3PMTA 2K3XA 4IUPA 3ZEHA 4N4GA 3QBYA 3OYLA 4Q5WA 5FROA 2BIVA 2E6NA 2RJFA 3OS1A 2WACA 2EFIA 3LGFA 4PL6A 3S3NA 1MHNA 2MWPA 3OS0A 4C5GA 3OA6A 2JTFA 1WJSA 4N4IA 3MEAA 4QQDA 4BACA 5M9OA 3OYIA 4E7JA 4ZTJA 2DIGA 3UWNA 1XNIA 2EKOA 2RJDA
chains in the Genus database with same CATH superfamily
1Y96A 5GANe 4CI0C 3CCJT 3MEWA 3H0FA 3M0QA 3M9QA 4XTWA 1EX4A 2AKKA 2A08A 1BI2A 2PUOB 3EHQA 4BD3A 1HSQA 1G8XA 1UHFA 4LDYA 2JOYA 3CBOA 3SHWA 4M77B 2KT8A 1WJRA 1WYXA 1OI1A 4RG8A 2YUNA 2K6DA 2O4XB 1FYNA 4BUGA 3CMEA 3GOXA 1K76A 1UHCA 1WQ7A 2BE7D 3I56A 3WXMB 1M3CA 2J7IA 2GCXA 5GAOl 3CCLQ 1NPRA 3CCRA 4F7UB 2BZYA 4AMCA 4CC2A 2CUDA 3H8ZA 1NYFA 2FYKA 4C92F 1GCQC 3QDFA 1VQMQ 4BI8B 1WXTA 1E6GA 4BE0A 3NFCA 3C95A 1ZSZA 5FU6C 3CQTA 2EYQA 1MMAA 1OYXA 2CP0A 1UGVA 2Y90A 3G4ST 2RQWA 5GAN4 2EW3A 2QQSA 5LJ3d 2ZPFB 3X28B 5IHIA 3TEEA 1VQ6Q 3QDRB 1PWTA 3HFOA 1OPLA 1BCMA 4O5VA 1GCQA 3META 1M1FA 1VUBA 4F14A 1YI2T 4JJCA 1SG5A 2F5KA 3EFOA 4Y91A 2FZGB 1X6BA 1RAIB 4PJOD 4DEXA 3TSWA 4M78A 3RKYA 2E6NA 2IPOB 4XTZA 3CC4Q 1IB8A 1UECA 1YP5A 2MWPA 4LUDA 3QZ9B 9ATCB 1ZSZB 2H3JA 1QVFA 4JS4A 1IXDA 2AT1B 2V8IA 3OYMA 1CKBA 4HKEA 2KDSA 3DB3A 3PIPA 5CIUA 4LD9K 2L3SA 2CYZB 3HL8A 2YT6A 4M77A 3CXCA 2CT4A 3EG2A 2L8DA 3RESA 1TU0B 1QKWA 2OTJT 1KG1A 1VQ8Q 3G7ZA 3QSUA 4MZPA 5CK9A 2M0OA 2QI2A 3VRZA 4J9IA 1KSWA 3OYNA 2QEXT 2E65A 2X51A 5I11A 5IT9E 4OMPA 3RKWA 4M7DF 3CCJQ 1NEBA 1RAEB 3JCMe 1R8OB 1PRMC 4M7AB 1RLQC 3P8HA 5EG2A 1GXIE 1GL5A 3OQ5A 3RR6A 4UC4A 1ZSZC 2HDAA 2LP5A 1YCSB 3CPWP 4WF2A 5DLOA 5LJ5f 3QUIA 2KNBB 3FEOA 1XQHA 5CR2A 2JMAA 2RH2A 4PJOG 1M4ZA 4OB3B 2K2MA 2DK3A 1YIJT 5GANh 1B7TA 4DOVA 2K3YA 2QQBA 2QAZA 2X4YA 3LH0A 4XU1A 3IQLA 3CCUT 1YITT 1N5ZA 5EC7A 4MDWA 3X24B 1VQMA 5L8RE 4R55A 1W2BA 2HQEA 1YJ9T 3ZFJA 2LCCA 1KJWA 1MNEA 2EQIA 1C6VX 3TCJA 1JBMA 2QG9B 1W2BP 1SSHA 3VS3A 3JCMb 1M3AA 4FYXB 4JJNK 3TU4K 5GMKl 3VYGA 4FT2A 4C5GA 1VQ5T 4L6V5 1KD1U 4FM4B 2KYBA 3L1AA 2DL8A 3JB9J 1X2KA 3I55A 2CDTA 3JV3A 1Q95G 4N4HA 3CMAT 4RTWA 2OAWA 3ER0A 3CPWA 2FG0A 2XG8D 2AHJB 2CREA 2KXDA 1B34A 2I0NA 3LW5E 1SSFA 2CP5A 2EYXA 2HSPA 1JJ2P 4M7AG 2RA2A 3CBMA 2DFUA 3VUBA 4C0GA 5GAOq 2OTLQ 3EAEA 3CC7Q 2PNIA 3CC4A 5GMKm 4GLKA 4KH1B 2RHYA 1PKTA 5KE3A 4Z88A 2FRWA 2V1QA 1MV0B 3GLXA 1U06A 3MPUB 2DF6A 4XTUA 4D6WA 1Q81U 2NUZA 4C92B 2KXCA 1X27A 3CC4T 3ASKA 2RHUA 3TSZA 2C0TA 3CXCS 3A8MB 4B9XA 4FCYA 5IN1A 1K9MC 4OMOA 4KUIA 1BCOA 1K73U 2R5MA 3UA6A 3QKJA 8AT1B 3CCJA 1TUGB 4LDUA 1M5Q1 2JVVA 1QVGA 2H3EB 3QPHA 3V7SA 1D0ZA 1OU9A 2DZ9A 4PJOF 4EMKA 3A5ZB 1ZLMA 3QWXX 1YI2A 1I4K1 3SB2A 2YSQA 4MZMA 3UWNA 4QVCA 2LQKA 2QDYB 4E7HA 1Q86U 2D8JA 5C6SA 1M8MA 1B34B 2NWMA 3DKMA 2E5QA 3H6ZA 1VQLQ 2K57A 2NUTB 4KT0E 4R0KA 3RKXA 1K8AR 3OYYA 3VS5A 2VV5A 4XU2A 1M3BA 1AT1B 5HKCA 1UB4A 2HL3A 2P84A 5GAMh 3RUXA 4JS5A 5GANg 2XDBA 3CCVT 2LQWA 1Y71A 2ENMA 5KYXB 3RMSA 1K9MU 2JT4A 1UJYA 2DYBA 3JB9G 3RDVA 3JCMP 1VA7A 4JUVA 1KC8R 4A54A 1PD1A 4DBHA 1ZBJA 3L42A 3PVLA 3DLLA 1K4US 2EPDA 2CS7A 4FL6A 4AG1C 1PC0A 3MEUA 3NMZC 1RAAB 5LJ5h 3OMCA 4D8KA 1R77A 1BI1A 2KT1A 1ZUUA 1AVZC 1ABQA 3JRZA 2JM8A 1N27A 3C4SA 3CC7A 4IKFA 2SRCA 4QT7A 1AWWA 5KCOA 5FU6B 3L2UA 4KBMB 1KC8C 2CSIA 5GANj 1PSEA 5D7UA 2JZ2A 3F70A 4XTVA 2CH4A 3TREA 1VQ7Q 2RJEA 2RQUA 3VS1A 1V29B 1VIEA 1NPPA 3BDUA 1A0NB 4JRKA 2OJ2A 2LJ1A 2XMFA 4M75E 3QWYA 4RCCA 1NG2A 2PZ1A 5FLXE 2DM1A 3EG3A 2LCLA 3E9GA 2CP3A 4YTLA 1QMCA 2QGFB 2DEQA 1TWBA 1P92A 2VXFA 1AWXA 2M02A 2L3RA 2FRYA 4IIMA 2D0NA 2DXTA 1HYOA 1D09B 4J7FA 3CCVQ 1HK9A 2CKKA 2QA4A 3OMGA 2K2VA 3G6EQ 4J6WA 5IAYA 1Q7YR 1PHTA 2AIRB 1TOVA 3VJPA 1QLYA 3JB9F 2E41A 1F1BB 1I1JA 2LCSA 3L2QA 1K9AA 4Y28E 4ESRA 4F7UE 1SRLA 3SEMA 4R56A 5I2SA 2FVUA 1EIFA 3FC3A 1ZHIA 2PUKB 2LNHB 4L59A 1OX8A 4JDSA 3OY9A 1O9SA 4QQGA 4VUBA 4C0DB 1KQ1A 3V8KA 4OGEA 2QYZA 4OMMA 2LVMA 1J3TA 2E12A 5GAOp 1E7OA 4RTYA 5J3BA 2L0AA 3GF5A 1WHHA 2YLCA 1KFZA 2EYWA 1LOJA 4F04B 4A4KA 2A3LA 3QIIA 4OP0A 4PJOA 1VQ4Q 4HT9A 1GBRA 5LJ3h 1PG5B 2EYZA 2VXEA 2ZAEA 3BFMA 2QQ9A 3A98A 1D1BA 2K3XA 4E47A 3CC2A 2GBQA 2O9VA 2RJFA 2H8HA 3C0CA 1IHWA 2XU8A 4XAXB 2VGNA 4OF1A 4J6YA 2QK0A 2V8JA 4M78G 1SF9A 1IGQA 2RD1A 2QDLA 1ABOA 3VRYA 5KCHA 2X3XD 2DX1A 4RG2A 1G2BA 1NLPC 2D1XA 1JO8A 3M0UA 3ME9A 1WXBA 1NEGA 3JSCA 1RACB 2KMTA 2YRVA 5FWBA 3BW1A 3MP1A 1ZQ1A 1O75A 5CVIA 4ZNXA 3M58A 2DERA 2R5AA 2GTJA 2DTHA 2KGTA 2LTOA 1VQNA 1H8KA 2DXCA 2ZPGB 1B07A 2D8HA 3QJ6A 1KQSA 2C0OA 2KQWA 3SDZA 1IREB 4JRPA 2A0FB 4A63B 5GMKj 3JCMW 2RK1A 1OEBA 2VKNA 1VQNQ 2KBTA 2RHZA 5HY6A 3CCUA 1YITA 1BB9A 1BYMA 4BDZA 1BI0A 1I07A 4CC7A 1KD1R 2JJ9A 3EFRA 3PNWC 2J6FA 3PMIA 3M54A 1WHGA 3V8LA 4HCZA 1RAGB 2BZ8A 2DD4A 3LX7A 3CXCP 4Z89A 1ZA1B 3CCVA 5A0DA 5FU7B 1VQ5Q 3G6EA 1KIKA 3HFNA 4K11A 1R0BG 2FEIA 5FU7C 5LJ5d 5GANd 4C8QA 5GAN5 4M78D 2P0KA 2K9GA 5A0LA 1ZBXA 5IH2A 1VQ5A 4IURA 2AK5A 3THKA 1Z9QA 3OS2A 1MMNA 3HRSA 2YRDA 4A4EA 4C0ZA 1X2QA 1R0CB 1W6XA 3JCMg 4N4GA 4HA8A 3EFOB 2XD0A 3M57A 5FROA 3A8OB 1I8FA 3OS1A 1YJWA 3EG0A 1NYGA 1JXMA 4PNOA 3JCMJ 5A2QE 3OA6A 1PKSA 2HBPA 4N4IA 3TQ7P 2QEXA 5CO7A 1JB0E 1WX6A 4M7DD 2O2OA 1XJWB 4CC4B 2O4XA 1G83A 5IXBA 2IG0A 2HAXA 3D7SB 2M16A 2RQVA 8ATCB 4LN2A 3VS6A 1YJNA 3P8DA 3G71Q 4X34A 1LCKA 3O5ZA 4EMKC 1G3SA 1W2BS 3REBB 4GY5A 1AEYA 3V7RA 2GTOA 2XHCA 2YRCA 2E10A 3KUFA 1SRMA 3NTIA 3CC2Q 3JCMX 1EZZB 2LX7A 3OYCA 2COWA 1TUCA 1ZUYA 2JS2A 2JMCA 3MO8A 2D6FA 2OTLT 1X75C 3T9NA 4AFUC 2EQJA 1VYVA 1FXXA 2ZPHB 4C8QD 1G3YA 5GAMj 3JB9I 1PRLC 2K5FA 5CQYA 1QWEA 1YCYA 2BE9B 3X26B 2GGRA 4M7DC 4LDWA 4C92C 3RBBB 1ZA2B 4IUQA 4AFSC 3OYJA 2W0ZA 4E7IA 3QXEB 2O88A 2GFAA 2LJ3A 2MK5A 2KRSA 3G71T 1VQNT 3A8GB 3I55T 4M78B 3NHNA 2CP7A 2MAMA 3KBGA 3SWNB 1RUWA 5I2MA 3JCMd 1MGQA 4FIBA 4RTUA 5GMKi 3JB9H 5KYYB 4LUEA 5GMKh 4J9FA 4PJJA 2L3QA 2RPNA 3OYLA 4ANJA 4Q5WA 3OS5A 3OSSC 5CAIA 2WACA 4ME7A 4F7UG 3G6ET 4C8QC 3OS0A 3A8HB 3HHTB 2Z0WA 3RNJA 4C8QE 3JCMV 4JZ4A 3EGXA 2VASA 1WLPB 4PFPA 1FWZA 4AG2C 4LXCA 1KC8U 3RERA 3C12A 2HBWA 1U1TA 4ELZC 3FIFA 1M27C 4HVUA 3CCEQ 1RI9A 2LZ6B 3S6WA 2EQKA 3G1JA 1G3WA 1ZUKA 4M75F 2KRMA 4ZN3A 2M1HA 2V26A 4HVVA 3WVDB 3PVQA 3QYHB 5D6YA 1YJWQ 1WNLA 3GNFB 4QVDA 1T0HA 1D0YA 2VYTA 4J83A 1M90R 3EG1A 7AT1B 2QEXQ 2DNUA 1PSFA 2CSQA 1B3QA 1N6AA 2YUPA 3L2ZA 3HKSA 3SD4A 3QHSA 3LGLA 3BDLA 1JJ2A 2CZ1B 2J6OA 2RO0A 4KULA 3U23A 4PJOC 3OYHA 4J9CA 1KK7A 3CMAQ 1K9MR 2K79A 5GMKe 2EJ9A 5KYUA 4M4ZA 2RHXA 4IUVA 1UGSB 4C8QF 3CPWS 3CCRT 2OI3A 4N0AC 1AOJA 3OYEA 1RLPC 5GAN7 3LWHA 2HL5C 3J7AF 5IHKA 3CCET 1ZX6A 4RCBA 2VC8A 2F69A 1Z9ZA 3CCQA 5L23A 4AFQC 4EMHA 5IXFA 1GBQA 4XTXA 5D6XA 2IIMA 2HEQA 3OB9A 3EG9A 1VQ8A 5HK0A 3VS2A 4B6MA 1YJ9Q 4LDXA 2QASA 3C94A 4M77D 2L3PA 5GAMg 2MYSA 3VKIA 4KGVB 5CKHA 1QVPA 1D3BA 3S3NA 2XICA 4FYWB 4GLMA 4DBRA 5M9OA 1YJ9A 2CZ6B 2RJDA 2HZYA 1UDLA 4CRIA 2ZPIB 1VQOT 2CH4W 3H0IA 1M1KC 2PQWA 1NJIC 3FB9A 1KQSS 1G3TA 1KHIA 4FSXA 1I5OB 2DXUA 1Q81C 4FW1A 4M78C 4IUUA 3CCRQ 4PJNA 2LMJA 3O8VA 4C92G 4XU0A 1OZ2A 4MMKA 3BY7A 4F17A 1Y7XA 2EGCA 3S3MA 3V8JA 2RK2A 5GJWB 3S3OA 4IIOA 2LQNA 4DQ2A 2MF2A 4OB2B 2EBPA 2DAQA 4ATOA 4QVZA 2IVWA 3EG9B 1UTIA 3I35A 4M77C 3I56Q 1JJ2S 4X1VA 2DILA 1WFWA 4M77E 1Q81R 2CP2A 1V1CA 4C0DC 2XK0A 3MJXA 1NLOC 3E19A 1K0SA 1WHJA 1BIAA 1UGRB 2CP6A 5FRNA 1OV3A 2CT3A 2VGMA 4JLGA 1KD1C 2YXYA 2VUBA 2HKQB 3FRNA 2DTOA 1LVKA 4EMKB 4EMGA 1JU5C 1TTHB 3R6NA 2HMAA 2VVKA 1WZOA 2DETA 1S1NA 1M30A 1KQSP 1BI3A 2ZPEB 2E3HA 3CCSQ 2ESWA 3UDCA 2D0QB 4M78F 2W10A 2DL7A 1U1SA 2RJCA 4FSSA 2DA9A 2HKNA 1FMWA 2BIVA 2QA4T 5KYXA 4KGXB 5GAMe 2B86A 4NL3A 2RQTA 2XKOC 1MMDA 2QTVA 1I0CA 2AZVA 2KROA 4C92D 1M2VB 2A36A 4BE1A 5CKEA 4M77F 4M77G 4Y92A 3CCQQ 2WSEE 3HPWA 2FL7A 2ABLA 2GNCA 1FMKA 3CCST 1TUDA 2PVGB 1K8AU 1RABB 4HCCA 2DRMA 4ZN1A 4HCBA 1BKBA 2RI5A 2KR3A 1GCPA 4A53A 3L2WA 4EDUA 4LE9A 2YUQA 2KRNA 2RMOA 2GFUA 3REAB 2KYMA 4E2FB 3CPFA 2K7AA 4Z02A 5CKBA 4A4FA 1WHKA 3VS4A 3ZBDA 2ZZDA 2RI3A 5DLQE 3MCAB 2LC4A 4KH0B 2K5IA 4RKUE 1YI2Q 2NYSA 3CC2T 3KFVA 3V7CA 2AKLA 3PGGA 3JCMQ 4PLLA 1CSKA 3VYHB 3MP6A 1HJDA 5D6WA 3UT1A 2YHTA 2DEUA 4BI4A 5ECAA 2EQUA 3MKDA 2QTXA 5CKFA 3GNGA 4JRQA 3OW2P 4RMOA 5GAMd 1VQPA 1TH7A 4ZGJB 4FYYB 4C92A 2VWFA 1X43A 1S72T 2MPXC 1JXOA 3X25B 3LWIA 1YJNT 2M51A 4MZTA 6AT1B 1MHNA 4PKCC 1X6GA 1VQ6A 2A28A 4E7JA 1VQ4T 2DBKA 4BI3A 2X4JA 4OMFB 4ZGEB 2BZXA 1OX9A 3KXTA 3AHUA 1AZEA 2EKHA 1RAHB 2RN8A 1SHFA 4OMNA 1ARKA 4E7LA 3J81E 2PVOB 2OTLA 4BY6C 1SEMA 2JXBA 3I55Q 1AZGB 1YIJQ 4C92E 1UFFA 2DE0X 4J9GA 1QCOA 1VQOA 2SEMA 5CCAA 2E1HA 4M75D 3I5RA 4AT1B 1QQJA 1YIJA 1N8RC 1VQKT 3EH1A 4N0AA 1I5LA 1CKAA 2XIDA 1M9SA 1UGPB 2BKDN 4KGZB 5GAOr 1VQOQ 1YHQQ 1IO6A 3NTHA 2EQMA 3P8BB 5GAN8 2NUPA 2QGGA 3LYIA 2NUTA 1GFDA 4Z8AA 4C8QG 1D0XA 2G3RA 1YHQA 1V76A 1M1KU 2P0QA 2P4RA 5LJ3e 1ZSGA 4QKUA 4B9WA 2O9SA 5HK3A 1OOTA 1M8VA 1AD5A 2F2VA 2HD0A 1VOMA 2JUFA 5I21A 3OYBA 3M0SA 4II1A 3OBYA 2X4XA 5J26A 1S72Q 2E6ZA 1K1ZA 5KYYA 2QQAA 2WSCE 2GF7A 1WHMA 4XQ3A 3I9QA 2JTMA 4M75C 3OYGA 1M1GA 3QZ5B 4NL2A 3H41A 1Q86R 2RQRA 3CCMT 3JCMc 3UA7A 2EFIA 3EH2A 4PL6A 2FPEA 3CC7T 1VQ7T 1OQKA 4BACA 3JB9D 1XNIA 2ATCB 5J39A 1K0XA 2FZCB 5DY9A 4C0FA 3N5BB 4AFZC 2JNGA 4NOYA 2E3IA 3DB4A 5LJ5j 1RL2A 1VQPQ 3DLMA 1IHVA 3GIBA 2MCNA 4BB7A 5KE2A 1Y07A 1Q7YU 4NS5A 3FLGA 1I81A 3URGA 3PE0A 4DBFA 1U3OA 3VS7A 1K73R 2EGEA 1WJQA 2AZSA 1N8RU 1QWFA 3LH5A 2FPDA 3H0HA 3OYKA 3PIOA 5FWCA 3EGDA 2MIOA 1XTDA 2COYA 3MEVA 4E7ZA 1UG1A 5LJ3j 1NE8A 3J80E 5FRMA 2E64A 2EVRA 4E7KA 4J5YA 3OYAA 2X35A 3PFSA 3Q1JA 1YWPA 2F2XA 2B8AA 3L2RA 2Y4YA 2FZKB 3E1SA 1VQ8T 2V1RA 2LDMA 1RADB 5LJ3g 1OU8A 3QG1A 1JQQA 4M7AC 2DO3A 1D1AA 4IUTA 1KHCA 3MP8A 3G4SQ 4F16A 3FJ5A 5FW9A 1GFCA 2FPFA 2YDLA 3CCMQ 1BIBA 2LNVA 1YN8A 4J6XA 2HCKA 1BU1A 1C1AA 2ED1A 1M2OA 2DTIA 3HRUA 3M53A 3G4SA 1NBEB 3UF4A 3PMTA 1OPKA 1UUEA 1BBZA 4HXJA 3ZEHA 4ELYC 3QBYA 4PK4A 5KYWA 1QVGP 5LJ5g 2KAFA 1D3BB 2O01E 4LDVA 2HQHA 2K5LA 3EGDB 2JTEA 2JS0A 4JRIA 3HSBA 2EIFA 1RI0A 4PLIA 3HRTA 2J6KA 1S72A 1GRIA 2QA4Q 2PVDB 4X9CA 1PD0A 4BE2A 3A8LB 4EPCA 4HT8A 3CCUQ 1YITQ 1YJWT 2KE9A 4KUDK 2LQ8A 1DJ7B 1VQ6T 1WHLA 3E2UA 3JAME 5KYNA 2CGHA 4F7UA 5AYFA 1VIFA 4M75B 1TG0A 1VQLT 1KQ2A 3SWNA 2LJ0A 4TVRA 4PFOA 1FMVA 1QP2A 4XU3A 2DRKA 1H92A 2EAYA 1Y96B 1Q86C 1MV3A 1W1FA 3NGPA 1X6OA 1JEGA 1LPLA 5CKDA 1VQPT 2DYIA 1VQ9T 2BUDA 2RM4A 2DXBA 1VQLA 2QQRA 2YUOA 2XI9A 2JM9A 3M4GA 2X3WD 1VYTA 2ROTA 2KI7A 4DOWA 3GP8A 1T3SA 4GBQA 2PU9B 1UJ0A 1VQ9A 2MI6A 2L5QA 1VQ4A 4JLIA 2EJGA 3CEYA 3WVEB 4V2SA 4RTZA 4C8QB 2K4YA 4LD6A 4D8DA 4OB0B 1VQKQ 2XDPA 1YJNQ 4J9DA 4ZGDB 2F5TX 2OAUA 5KH6A 1W70A 2RI2A 1VQ9Q 2HQXA 3EGXB 3TVTA 1Q82C 3PTAA 4DA4A 2E5KA 4J9BA 1EFNA 1YBYA 2KEAA 2ROLA 2DJQA 3LGFA 4RTTA 3EFSA 2DL4A 3SFMA 1D1CA 1WJSA 4QQDA 1M1KR 4J8OA 2MMPA 3OYIA 3OW2A 4ZTJA 2DIGA 2HNIA 1X01A 2KSSA 4O6JA 2X4WA 1TXQA 2C06A 4OMLA 2WSFE 3M55A 2DVEA 2M0YA 3QYGB 3CCMA 3OYFA 1H3ZA 3VV0A 2COZA 2PTKA 2Y4XA 4M7DG 1QVFP 1QVGS 1PM3A 4RTXA 4WTOB 2E4HA 2MWOA 3RMQA 1VQ7A 3M59A 4WCIA 1SKUB 2CUBA 2FHDA 5IHNA 1WIEA 4OVAA 2RF0A 3M0TA 4QW2A 4M7AA 3LLRA 1M2VA 2YWWA 2R57A 1N9SA 2VB6A 3VUZA 2I2LA 3H9NA 2DKGA 3ZL7C 4JPBW 4OMQA 2DPPB 1H641 5GAMf 4LNPA 4ORZA 3HP9A 5GAN3 4JZ3A 1NZ9A 2LRQA 1WI7A 2C0IA 3NPFA 3QJYA 3I56T 2G6FX 2M9UA 3OSVA 2DZCA 4E6RA 2DD5A 1E6HA 2ZCFB 4KRTA 4MMLA 5LJ3f 4OGCA 2DLPA 1PNJA 1N8RR 3CD6Q 1QVFS 1WQWA 4PJOB 4QQ6A 1Q82U 1IZ6A 2A7YA 2GQIA 3UATA 1YNZA 5HCKA 4EIKA 2XDDA 1MMGA 4DEYA 2RHIA 4OB1B 1ACMB 1TSFA 3CD6A 1QW1A 1LNXA 5GJVB 1MNDA 3A1PA 1NJIU 5GANf 2A37A 2LT1A 2JTFA 2RB6A 2ECZA 5GAN6 3ULRB 3G71A 4P5NA 1AWJA 2EKOA 2FO0A 1YWOA 3M0PA 3SWNC 4C5HA 3RIRA 4FU6A 4E7SA 3AT1B 1QCNA 3CD6T 1VQKA 4M7AD 4XTYA 2P4TA 3FDRA 1AWOA 2JW4A 4FYVB 4M7DE 3JCMh 4A4HA 1IGUA 4F7UF 5DM7R 4MDXA 2EWNA 1T0JA 1FX7A 3X20B 2GQVA 1HXDA 1SHGA 2V8KA 4C5EA 1K73C 4C5IA 5C0MA 3I5SA 5CQXA 2DJZA 3E9FA 3GPLA 3NTKA 3VU3C 3OBWA 3EGUA 1OZ3A 3QO3A 1QP3A 4M7DB 3M5AA 2YLBA 2BTTA 1Y0MA 2OTJA 4CC3A 2MOXA 5I22A 1WA7A 1IRXA 1U5SA 1NJIR 3INZA 2NUPB 4HCKA 2R58A 1G5VA 1K8AC 4X9DA 2P0PA 2OTJQ 5LL6S 1H3HA 2DVJA 3VS0A 1Q82R 3GBQA 4FW2A 2LT4A 2FB7A 2L89A 2L2PA 4J9HA 1WGSA 1M90U 1BK2A 2DIQA 2DBMA 5GAOn 2KK4A 1PCXA 1T3LA 3MHXA 2OX7A 1RAFB 3CMEQ 2EGAA 4IUPA 1VYUA 1WPYA 4BY6B 1U8RA 5GAN2 4JJDA 3JCMf 1WXUA 2E70A 3CCLA 2JN0A 1UEBA 5AT1B 4PFZA 2HSEB 4HVWA 4M78E 3CCEA 5KYUB 1JRIA 1N9RA 1AHJB 2EYYA 1VQMT 1QCFA 3CCQT 1C0MA 2ZGWA 4M75A 4J7IA 4RTVA 3CCLT 1UE9A 2O31A 5A0GA 2X9HA 1YHQT 3M4YA 3FJPA 2RNAA 3HTRA 3OYDA 4M7AF 4DBQA 1M90C 3L2VA 4M7AE 2NLUA 1MUZA 3EHRA 2J06A 4XK8E 2D9TA 4ZTFA 4RUGA 3CMAA 4M7DA 2ZPBB 3CBPA 2DMOA 3CCSA 2DL3A 3BE3A 4FT4A 1HD3A 4JJBA 5LJ5e 1QKXA 2ED0A 2LX9A 1NM7A 2KVQG 4J9EA 1LJOA 2K3BA 1Y57A 5KYWB 3M0RA 1OULA 1Q7YC 4A4GA 1WDXA 2F2WA 4PJLA 1TS9A 1W4SA 2KY9A 4BDYA 3UPUA 1XOVA 4PJMA 2CZ0B 2CZ7B 4L5GA 4PJOE 2QXFA 1X69A 1YFNA 2DL5A 1SPKA 4M75G 3R6OA 3OW2S 5GAOm 2F1LA 3MEAA 3CMET 3PT9A 1UGQB 3M56A 2J05A 2EJFA
chains in the Genus database with same CATH topology
1Y96A 5GANe 4CI0C 2K5LA 4CRIA 2ZPIB 3CCJT 5FLXE 1VQOT 3MEWA 4JRIA 3HSBA 2EIFA 1RI0A 3M9QA 4PLIA 1M1KC 3HRTA 2PQWA 4XTWA 1S72A 2LCLA 3E9GA 4YTLA 2PVDB 4X9CA 3FB9A 1BI2A 2PUOB 1NJIC 4BE2A 1KQSS 1G3TA 1KHIA 2DEQA 4BD3A 4FSXA 3A8LB 4EPCA 4HT8A 1P92A 2DXUA 2VXFA 4LDYA 1YJWT 2JOYA 1Q81C 2L3RA 3CBOA 4M78C 4M77B 4IUUA 1WJRA 4RG8A 1OI1A 2LQ8A 4KUDK 2DXTA 1DJ7B 2O4XB 3O8VA 4BUGA 4C92G 4J7FA 4XU0A 1OZ2A 4MMKA 3BY7A 3GOXA 3CMEA 3JAME 1HK9A 1Y7XA 2CKKA 2QA4A 3S3MA 1WQ7A 3OMGA 2K2VA 2CGHA 3V8JA 2RK2A 4F7UA 5AYFA 1VIFA 4J6WA 5IAYA 3I56A 3S3OA 4M75B 3WXMB 4DQ2A 2GCXA 2MF2A 5GAOl 1NPRA 4OB2B 1VQLT 1KQ2A 2DAQA 3SWNA 4ATOA 3CCRA 3VJPA 4F7UB 4QVZA 4TVRA 3JB9F 1QP2A 2E41A 4XU3A 2EAYA 1Y96B 3H8ZA 2FYKA 4C92F 3L2QA 2IVWA 4Y28E 1Q86C 4BI8B 4M77C 4F7UE 3NFCA 4BE0A 1X6OA 3C95A 5FU6C 5CKDA 1JJ2S 1VQPT 1VQ9T 2BUDA 2RM4A 2FVUA 2EYQA 1EIFA 4M77E 5I2SA 1ZHIA 4R56A 3FC3A 1OYXA 2PUKB 4L59A 2Y90A 4C0DC 3G4ST 2DXBA 4JDSA 2XK0A 3OY9A 1VQLA 1O9SA 4QQGA 2QQRA 4VUBA 4C0DB 1KQ1A 3E19A 2XI9A 5GAN4 2QQSA 3M4GA 4OGEA 1BIAA 2ZPFB 1UGRB 5LJ3d 3V8KA 4DOWA 3GP8A 3X28B 5FRNA 3TEEA 2LVMA 2E12A 3QDRB 5GAOp 2VGMA 4JLGA 1KD1C 2PU9B 3HFOA 4O5VA 2VUBA 3META 1VQ9A 1M1FA 1VUBA 2MI6A 2L5QA 3FRNA 4JLIA 5J3BA 1VQ4A 1YI2T 2EJGA 3CEYA 2F5KA 3WVEB 2DTOA 4V2SA 4EMKB 3GF5A 4EMGA 4C8QB 2YLCA 2K4YA 4LD6A 4OB0B 2XDPA 4Y91A 4ZGDB 2F5TX 1LOJA 2OAUA 5KH6A 4A4KA 2A3LA 1BI3A 2ZPEB 4PJOD 2RI2A 3QIIA 3UDCA 4OP0A 4PJOA 4HT9A 2D0QB 4M78F 5LJ3h 2HQXA 1U1SA 2VXEA 2RJCA 1Q82C 3BFMA 2QQ9A 3PTAA 2K3XA 4DA4A 4M78A 4E47A 3CC2A 2BIVA 3RKYA 2E6NA 1YBYA 2RJFA 2QA4T 3LGFA 4XTZA 3EFSA 3SFMA 2MWPA 2XU8A 5GAMe 4NL3A 3QZ9B 1WJSA 4QQDA 4XAXB 2VGNA 4OF1A 4J6YA 4J8OA 2MMPA 2XKOC 2V8JA 4M78G 3OYIA 2H3JA 3OW2A 4ZTJA 2DIGA 2HNIA 1QVFA 4JS4A 4C92D 2V8IA 3OYMA 1X01A 2RD1A 2KSSA 4HKEA 2KDSA 5CKEA 4BE1A 3DB3A 3PIPA 4M77F 5CIUA 4LD9K 4M77G 4O6JA 2X4WA 2C06A 2CYZB 3HL8A 2WSFE 3M55A 2DVEA 3CCMA 3QYGB 4M77A 5KCHA 3OYFA 3CXCA 1H3ZA 2L8DA 2WSEE 3VV0A 2Y4XA 3RESA 3HPWA 4RG2A 4M7DG 2FL7A 1QVGS 2OTJT 1KG1A 2MWOA 3G7ZA 3RMQA 3CCST 2PVGB 1K8AU 1VQ7A 4HCCA 3M59A 3QSUA 4MZPA 5CK9A 3ME9A 2M0OA 2QI2A 3JSCA 4ZN1A 4HCBA 2FHDA 2KMTA 1BKBA 2YRVA 2RI5A 3BW1A 3OYNA 2QEXT 2E65A 3MP1A 1ZQ1A 4A53A 4OVAA 3L2WA 4EDUA 1O75A 5IT9E 5CVIA 3RKWA 3M58A 4QW2A 4M7DF 2R5AA 2LTOA 2DTHA 3LLRA 4M7AA 2R57A 1N9SA 3VUZA 3JCMe 1VQNA 2DXCA 2ZPGB 2I2LA 2GFUA 1R8OB 3QJ6A 1KQSA 2DKGA 4M7AB 3CPFA 2KQWA 4Z02A 1IREB 5CKBA 3SDZA 4A4FA 2DPPB 4JRPA 1H641 3ZBDA 2ZZDA 3P8HA 2RI3A 5EG2A 5DLQE 5GAMf 5GMKj 3JCMW 3MCAB 2RK1A 1GXIE 2LC4A 5HY6A 2RHZA 3OQ5A 3CCUA 1YITA 1BYMA 3HP9A 2K5IA 1BI0A 4UC4A 4BDZA 4RKUE 4WF2A 3EFRA 5DLOA 5LJ5f 3QUIA 3PNWC 5GAN3 3PMIA 1NZ9A 3M54A 2LRQA 3CC2T 3V8LA 3V7CA 3FEOA 3LX7A 3PGGA 1XQHA 2DD4A 3QJYA 4HCZA 4PLLA 5CR2A 3JCMQ 3I56T 5A0DA 2RH2A 5FU7B 4PJOG 3VYHB 1M4ZA 4OB3B 2M9UA 3MP6A 5D6WA 3HFNA 3UT1A 2YHTA 3OSVA 3G6EA 2DZCA 2DK3A 1YIJT 5GANh 2DD5A 5FU7C 4DOVA 5LJ5d 4BI4A 2K3YA 5GANd 2ZCFB 4MMLA 4C8QA 2EQUA 5GAN5 4M78D 2QTXA 2P0KA 5CKFA 5LJ3f 4OGCA 2QQBA 5A0LA 2X4YA 1ZBXA 3LH0A 3GNGA 4XU1A 4JRQA 4RMOA 3CCUT 5GAMd 1YITT 1WQWA 1QVFS 1VQ5A 1VQMA 4MDWA 3X24B 4IURA 4PJOB 5L8RE 4R55A 4QQ6A 2HQEA 1VQPA 1YJ9T 1W2BA 1Q82U 1IZ6A 1TH7A 3ZFJA 2LCCA 2A7YA 4ZGJB 3OS2A 3HRSA 4A4EA 4C92A 2XDDA 3TCJA 2RHIA 4OB1B 1JBMA 4C0ZA 1S72T 3JCMg 4N4GA 3CD6A 4HA8A 2XD0A 1QW1A 1LNXA 3M57A 3X25B 3LWIA 5FROA 1YJNT 3A8OB 1I8FA 2D6FA 3OS1A 3JCMb 4MZTA 5GANf 1NJIU 4JJNK 1YJWA 3TU4K 5GMKl 3VYGA 1MHNA 2LT1A 4PKCC 4FT2A 4PNOA 2JTFA 4C5GA 5A2QE 2HBPA 2RB6A 4N4IA 3OA6A 1VQ5T 2QEXA 5GAN6 5CO7A 1JB0E 4L6V5 3CCVA 4FM4B 1KD1U 1VQ6A 4M7DD 3L1AA 3G71A 4E7JA 1VQ4T 4P5NA 4ZGEB 4BI3A 2X4JA 4OMFB 2EKOA 3SWNC 4C5HA 3JB9J 3I55A 2O4XA 3KXTA 3AHUA 3RIRA 2IG0A 2HAXA 4FU6A 2M16A 4N4HA 3CMAT 3CD6T 1VQKA 3ER0A 1YJNA 3CPWA 3P8DA 4M7AD 4E7LA 3J81E 2PVOB 2XG8D 4X34A 4XTYA 2P4TA 3FDRA 4BY6C 2OTLA 2AHJB 1G3SA 4EMKC 1W2BS 4M7DE 4GY5A 3JCMh 3V7RA 1B34A 4A4HA 2XHCA 4F7UF 4C92E 3LW5E 1SSFA 2E10A 5DM7R 3KUFA 4M7AG 2RA2A 3NTIA 3CBMA 4MDXA 3VUBA 4C0GA 3JCMX 2EWNA 5GAOq 1VQOA 3EAEA 3CC4A 1FX7A 5CCAA 5GMKm 3X20B 3OYCA 2E1HA 2GQVA 4M75D 1YIJA 1N8RC 1VQKT 4GLKA 1HXDA 2RHYA 2V8KA 3MO8A 4N0AA 4C5EA 1K73C 4C5IA 2XIDA 5C0MA 1I5LA 1M9SA 5CQXA 1X75C 1UGPB 2DJZA 3E9FA 3T9NA 5KE3A 3GPLA 2EQJA 3NTKA 3VU3C 2BKDN 3OBWA 5GAOr 1FXXA 3GLXA 2ZPHB 1OZ3A 3NTHA 3QO3A 4C8QD 1G3YA 1QP3A 5GAMj 4XTUA 2EQMA 3M5AA 4D6WA 1Q81U 3P8BB 2YLBA 5GAN8 3JB9I 4M7DB 2K5FA 5CQYA 1YCYA 3LYIA 4C92B 3X26B 4M7DC 2OTJA 3CC4T 4LDWA 3ASKA 4C8QG 4C92C 2G3RA 3INZA 1YHQA 1M1KU 2RHUA 2P0QA 3CXCS 5LJ3e 4IUQA 3OYJA 4E7IA 3A8MB 4B9XA 3QXEB 2R58A 5IN1A 1G5VA 4B9WA 1K8AC 5HK3A 4X9DA 4RCCA 2P0PA 1M8VA 2GFAA 1K9MC 2HD0A 5LL6S 2JUFA 4KUIA 1K73U 2R5MA 5I21A 3OYBA 2LT4A 2FB7A 2L89A 3G71T 3QKJA 1VQNT 4II1A 3OBYA 1WGSA 3A8GB 1M90U 2X4XA 4M78B 3I55T 5J26A 3CCJA 2MAMA 2E6ZA 3KBGA 2DIQA 4LDUA 1M5Q1 3SWNB 2JVVA 1QVGA 5GAOn 3QPHA 2KK4A 3V7SA 5I2MA 3JCMd 1MGQA 2QQAA 3MHXA 2WSCE 2GF7A 4FIBA 4XQ3A 5GMKi 3JB9H 2JTMA 4M75C 3OYGA 5GMKh 1M1GA 2DZ9A 3QZ5B 4IUPA 4NL2A 3JCMJ 3OYLA 4PJOF 1WPYA 4Q5WA 4BY6B 4EMKA 3OS5A 3OSSC 5GAN2 3A5ZB 3JCMc 3CCMT 1U8RA 5CAIA 2WACA 2EFIA 3JCMf 1YI2A 2E70A 3CCLA 1I4K1 2JN0A 4ME7A 4F7UG 4PL6A 1UEBA 3G6ET 3SB2A 4MZMA 4C8QC 3OS0A 3A8HB 3UWNA 3CC7T 1VQ7T 3HHTB 4M78E 4BACA 4QVCA 3JB9D 4C8QE 3CCEA 3JCMV 1XNIA 2LQKA 1FWZA 1JRIA 1N9RA 1AHJB 2QDYB 5J39A 4E7HA 1Q86U 5DY9A 1VQMT 4C0FA 3CCQT 3N5BB 1KC8U 3RERA 2JNGA 4NOYA 3C12A 2ZGWA 5C6SA 3DB4A 1U1TA 4M75A 1RL2A 4ELZC 5LJ5j 3FIFA 3DLMA 4J7IA 1B34B 3GIBA 4BB7A 5KE2A 1Y07A 1Q7YU 3DKMA 2E5QA 2EQKA 3H6ZA 3S6WA 3CCLT 1G3WA 2K57A 4KT0E 4M75F 4ZN3A 4NS5A 3FLGA 5A0GA 1I81A 2M1HA 3RKXA 3URGA 3OYYA 1YHQT 3M4YA 3WVDB 3FJPA 3QYHB 5D6YA 2VV5A 4XU2A 1WJQA 5HKCA 1UB4A 1VQ6T 1WNLA 3GNFB 4QVDA 3OYDA 1N8RU 4M7AF 1M90C 4J83A 2VYTA 3L2VA 5GAMh 4M7AE 2NLUA 3OYKA 3PIOA 3RUXA 4JS5A 5GANg 2XDBA 1PSFA 3CCVT 1Y71A 3RMSA 1K9MU 4XK8E 2D9TA 4ZTFA 4M7DA 3CMAA 1N6AA 3JB9G 2ZPBB 3JCMP 3L2ZA 3CBPA 3HKSA 4JUVA 1XTDA 3SD4A 3QHSA 3CCSA 3MEVA 3LGLA 4FT4A 5LJ3j 1NE8A 3J80E 4A54A 5FRMA 3BDLA 2E64A 5LJ5e 3L42A 2CZ1B 3DLLA 4E7KA 1JJ2A 2RO0A 4J5YA 2CS7A 2LX9A 3OYAA 4KULA 4FL6A 2X35A 3PFSA 3MEUA 3Q1JA 3OYHA 4PJOC 2KVQG 2B8AA 5LJ5h 3OMCA 2EJ9A 5GMKe 1LJOA 1BI1A 3L2RA 2Y4YA 2RHXA 4IUVA 1UGSB 3E1SA 4C8QF 3JRZA 1VQ8T 2LDMA 5LJ3g 1N27A 3QG1A 3CPWS 3C4SA 3CCRT 4M7AC 4N0AC 3CC7A 3OYEA 4IKFA 2DO3A 4IUTA 5GAN7 3LWHA 1Q7YC 4A4GA 3J7AF 1KHCA 3MP8A 5KCOA 4RCBA 3CCET 5FU6B 3L2UA 4KBMB 2VC8A 2F69A 1W4SA 2KY9A 1KC8C 4BDYA 3UPUA 5GANj 1BIBA 2LNVA 1PSEA 1XOVA 3CCQA 4J6XA 4EMHA 4XTXA 2JZ2A 2CZ0B 3F70A 5D6XA 4XTVA 2CZ7B 4L5GA 2DTIA 3HRUA 3M53A 3OB9A 3G4SA 3TREA 1VQ8A 5HK0A 3PMTA 2RJEA 4PJOE 2QXFA 4ELYC 3ZEHA 4LDXA 3QBYA 3C94A 4M77D 5GAMg 4M75G 2OTLT 3R6OA 3VKIA 1V29B 5CKHA 1QVPA 5GAOm 1D3BA 3OW2S 1VIEA 3S3NA 1NPPA 3BDUA 4JRKA 3MEAA 2XICA 3CMET 3PT9A 5LJ5g 2KAFA 5M9OA 1D3BB 1YJ9A 1UGQB 2O01E 4M75E 3M56A 4LDVA 2CZ6B 2EJFA 2RJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5H A;  2O4X A;  4CRI A;  3OYM A;  4BE1 A;  2IG0 A;  3MEW A;  5J39 A;  4E7H A;  3DB3 A;  4FU6 A;  5CIU A;  2M16 A;  1RI0 A;  3M9Q A;  4PLI A;  4N4H A;  2PQW A;  2X4W A;  3E9G A;  5C6S A;  3DB4 A;  4BE2 A;  3P8D A;  4BD3 A;  5KCH A;  3DLM A;  3OYF A;  4E7L A;  1H3Z A;  4X34 A;  5KE2 A;  2L8D A;  3FDR A;  2E5Q A;  2EQK A;  3H6Z A;  3S6W A;  2L3R A;  4RG2 A;  4GY5 A;  1WJR A;  4IUU A;  1OI1 A;  4NS5 A;  3FLG A;  4A4H A;  2O4X B;  2M1H A;  2MWO A;  3O8V A;  1OZ2 A;  1SSF A;  3GOX A;  3KUF A;  2CKK A;  3ME9 A;  2M0O A;  3S3M A;  3NTI A;  3OMG A;  5D6Y A;  2FHD A;  2YRV A;  3S3O A;  5IAY A;  1WJQ A;  2RI5 A;  3EAE A;  3OYN A;  3OYD A;  3MP1 A;  3OYC A;  2DAQ A;  4OVA A;  4EDU A;  3L2W A;  2VYT A;  3L2V A;  4QVZ A;  2NLU A;  3OYK A;  4QW2 A;  2RHY A;  2R5A A;  2LTO A;  3LLR A;  3MO8 A;  4C5E A;  4C5I A;  2R57 A;  3H8Z A;  5C0M A;  3E9F A;  3L2Q A;  5KE3 A;  2GFU A;  2EQJ A;  3NTK A;  2D9T A;  2BKD N;  3QJ6 A;  4ZTF A;  4BE0 A;  4Z02 A;  4A4F A;  3SD4 A;  1OZ3 A;  3NTH A;  2BUD A;  3MEV A;  2EQM A;  3LGL A;  3FC3 A;  3P8H A;  2RI3 A;  1OYX A;  5FRM A;  3BDL A;  3LYI A;  4L59 A;  3L42 A;  4E7K A;  2RHZ A;  2RO0 A;  3OQ5 A;  3OYA A;  2XK0 A;  3OY9 A;  4FL6 A;  2X35 A;  4UC4 A;  4QQG A;  2QQR A;  3PFS A;  3ASK A;  3MEU A;  3Q1J A;  3OYH A;  4BDZ A;  2G3R A;  3PNW C;  2RHU A;  2B8A A;  5FRN A;  3PMI A;  2QQS A;  2LRQ A;  3OMC A;  4IUQ A;  3L2R A;  3FEO A;  3LX7 A;  4HCZ A;  4B9X A;  3OYJ A;  4PLL A;  2R58 A;  2RHX A;  4IUV A;  5IN1 A;  4E7I A;  1G5V A;  4B9W A;  2LDM A;  3MP6 A;  5D6W A;  3UT1 A;  2GFA A;  1N27 A;  2LVM A;  3C4S A;  3OYE A;  2K3Y A;  2R5M A;  4IKF A;  3OYB A;  4IUT A;  2EQU A;  3MET A;  4A4G A;  2L89 A;  1KHC A;  3MP8 A;  3QKJ A;  2P0K A;  5KCO A;  4II1 A;  1WGS A;  3L2U A;  3CEY A;  2F5K A;  2X4Y A;  2X4X A;  3LH0 A;  5J26 A;  4LD6 A;  2XDP A;  2DIQ A;  4BDY A;  4IUR A;  4QQ6 A;  2HQE A;  5KH6 A;  2JZ2 A;  2LCC A;  3F70 A;  5D6X A;  3OS2 A;  2RI2 A;  3QII A;  2GF7 A;  3OB9 A;  4A4E A;  3OYG A;  2RHI A;  2HQX A;  2RJC A;  2RJE A;  3PMT A;  2K3X A;  4IUP A;  3ZEH A;  4N4G A;  3QBY A;  3OYL A;  4Q5W A;  5FRO A;  2BIV A;  2E6N A;  2RJF A;  3OS1 A;  2WAC A;  2EFI A;  3LGF A;  4PL6 A;  3S3N A;  1MHN A;  2MWP A;  3OS0 A;  4C5G A;  3OA6 A;  2JTF A;  1WJS A;  4N4I A;  3MEA A;  4QQD A;  4BAC A;  5M9O A;  3OYI A;  4E7J A;  4ZTJ A;  2DIG A;  3UWN A;  1XNI A;  2EKO A;  2RJD A; 
#chains in the Genus database with same CATH topology
 1Y96 A;  5GAN e;  4CI0 C;  3CCJ T;  3MEW A;  3H0F A;  3M0Q A;  3M9Q A;  4XTW A;  1EX4 A;  2AKK A;  2A08 A;  1BI2 A;  2PUO B;  3EHQ A;  4BD3 A;  1HSQ A;  1G8X A;  1UHF A;  4LDY A;  2JOY A;  3CBO A;  3SHW A;  4M77 B;  2KT8 A;  1WJR A;  1WYX A;  1OI1 A;  4RG8 A;  2YUN A;  2K6D A;  2O4X B;  1FYN A;  4BUG A;  3CME A;  3GOX A;  1K76 A;  1UHC A;  1WQ7 A;  2BE7 D;  3I56 A;  3WXM B;  1M3C A;  2J7I A;  2GCX A;  5GAO l;  3CCL Q;  1NPR A;  3CCR A;  4F7U B;  2BZY A;  4AMC A;  4CC2 A;  2CUD A;  3H8Z A;  1NYF A;  2FYK A;  4C92 F;  1GCQ C;  3QDF A;  1VQM Q;  4BI8 B;  1WXT A;  1E6G A;  4BE0 A;  3NFC A;  3C95 A;  1ZSZ A;  5FU6 C;  3CQT A;  2EYQ A;  1MMA A;  1OYX A;  2CP0 A;  1UGV A;  2Y90 A;  3G4S T;  2RQW A;  5GAN 4;  2EW3 A;  2QQS A;  5LJ3 d;  2ZPF B;  3X28 B;  5IHI A;  3TEE A;  1VQ6 Q;  3QDR B;  1PWT A;  3HFO A;  1OPL A;  1BCM A;  4O5V A;  1GCQ A;  3MET A;  1M1F A;  1VUB A;  4F14 A;  1YI2 T;  4JJC A;  1SG5 A;  2F5K A;  3EFO A;  4Y91 A;  2FZG B;  1X6B A;  1RAI B;  4PJO D;  4DEX A;  3TSW A;  4M78 A;  3RKY A;  2E6N A;  2IPO B;  4XTZ A;  3CC4 Q;  1IB8 A;  1UEC A;  1YP5 A;  2MWP A;  4LUD A;  3QZ9 B;  9ATC B;  1ZSZ B;  2H3J A;  1QVF A;  4JS4 A;  1IXD A;  2AT1 B;  2V8I A;  3OYM A;  1CKB A;  4HKE A;  2KDS A;  3DB3 A;  3PIP A;  5CIU A;  4LD9 K;  2L3S A;  2CYZ B;  3HL8 A;  2YT6 A;  4M77 A;  3CXC A;  2CT4 A;  3EG2 A;  2L8D A;  3RES A;  1TU0 B;  1QKW A;  2OTJ T;  1KG1 A;  1VQ8 Q;  3G7Z A;  3QSU A;  4MZP A;  5CK9 A;  2M0O A;  2QI2 A;  3VRZ A;  4J9I A;  1KSW A;  3OYN A;  2QEX T;  2E65 A;  2X51 A;  5I11 A;  5IT9 E;  4OMP A;  3RKW A;  4M7D F;  3CCJ Q;  1NEB A;  1RAE B;  3JCM e;  1R8O B;  1PRM C;  4M7A B;  1RLQ C;  3P8H A;  5EG2 A;  1GXI E;  1GL5 A;  3OQ5 A;  3RR6 A;  4UC4 A;  1ZSZ C;  2HDA A;  2LP5 A;  1YCS B;  3CPW P;  4WF2 A;  5DLO A;  5LJ5 f;  3QUI A;  2KNB B;  3FEO A;  1XQH A;  5CR2 A;  2JMA A;  2RH2 A;  4PJO G;  1M4Z A;  4OB3 B;  2K2M A;  2DK3 A;  1YIJ T;  5GAN h;  1B7T A;  4DOV A;  2K3Y A;  2QQB A;  2QAZ A;  2X4Y A;  3LH0 A;  4XU1 A;  3IQL A;  3CCU T;  1YIT T;  1N5Z A;  5EC7 A;  4MDW A;  3X24 B;  1VQM A;  5L8R E;  4R55 A;  1W2B A;  2HQE A;  1YJ9 T;  3ZFJ A;  2LCC A;  1KJW A;  1MNE A;  2EQI A;  1C6V X;  3TCJ A;  1JBM A;  2QG9 B;  1W2B P;  1SSH A;  3VS3 A;  3JCM b;  1M3A A;  4FYX B;  4JJN K;  3TU4 K;  5GMK l;  3VYG A;  4FT2 A;  4C5G A;  1VQ5 T;  4L6V 5;  1KD1 U;  4FM4 B;  2KYB A;  3L1A A;  2DL8 A;  3JB9 J;  1X2K A;  3I55 A;  2CDT A;  3JV3 A;  1Q95 G;  4N4H A;  3CMA T;  4RTW A;  2OAW A;  3ER0 A;  3CPW A;  2FG0 A;  2XG8 D;  2AHJ B;  2CRE A;  2KXD A;  1B34 A;  2I0N A;  3LW5 E;  1SSF A;  2CP5 A;  2EYX A;  2HSP A;  1JJ2 P;  4M7A G;  2RA2 A;  3CBM A;  2DFU A;  3VUB A;  4C0G A;  5GAO q;  2OTL Q;  3EAE A;  3CC7 Q;  2PNI A;  3CC4 A;  5GMK m;  4GLK A;  4KH1 B;  2RHY A;  1PKT A;  5KE3 A;  4Z88 A;  2FRW A;  2V1Q A;  1MV0 B;  3GLX A;  1U06 A;  3MPU B;  2DF6 A;  4XTU A;  4D6W A;  1Q81 U;  2NUZ A;  4C92 B;  2KXC A;  1X27 A;  3CC4 T;  3ASK A;  2RHU A;  3TSZ A;  2C0T A;  3CXC S;  3A8M B;  4B9X A;  4FCY A;  5IN1 A;  1K9M C;  4OMO A;  4KUI A;  1BCO A;  1K73 U;  2R5M A;  3UA6 A;  3QKJ A;  8AT1 B;  3CCJ A;  1TUG B;  4LDU A;  1M5Q 1;  2JVV A;  1QVG A;  2H3E B;  3QPH A;  3V7S A;  1D0Z A;  1OU9 A;  2DZ9 A;  4PJO F;  4EMK A;  3A5Z B;  1ZLM A;  3QWX X;  1YI2 A;  1I4K 1;  3SB2 A;  2YSQ A;  4MZM A;  3UWN A;  4QVC A;  2LQK A;  2QDY B;  4E7H A;  1Q86 U;  2D8J A;  5C6S A;  1M8M A;  1B34 B;  2NWM A;  3DKM A;  2E5Q A;  3H6Z A;  1VQL Q;  2K57 A;  2NUT B;  4KT0 E;  4R0K A;  3RKX A;  1K8A R;  3OYY A;  3VS5 A;  2VV5 A;  4XU2 A;  1M3B A;  1AT1 B;  5HKC A;  1UB4 A;  2HL3 A;  2P84 A;  5GAM h;  3RUX A;  4JS5 A;  5GAN g;  2XDB A;  3CCV T;  2LQW A;  1Y71 A;  2ENM A;  5KYX B;  3RMS A;  1K9M U;  2JT4 A;  1UJY A;  2DYB A;  3JB9 G;  3RDV A;  3JCM P;  1VA7 A;  4JUV A;  1KC8 R;  4A54 A;  1PD1 A;  4DBH A;  1ZBJ A;  3L42 A;  3PVL A;  3DLL A;  1K4U S;  2EPD A;  2CS7 A;  4FL6 A;  4AG1 C;  1PC0 A;  3MEU A;  3NMZ C;  1RAA B;  5LJ5 h;  3OMC A;  4D8K A;  1R77 A;  1BI1 A;  2KT1 A;  1ZUU A;  1AVZ C;  1ABQ A;  3JRZ A;  2JM8 A;  1N27 A;  3C4S A;  3CC7 A;  4IKF A;  2SRC A;  4QT7 A;  1AWW A;  5KCO A;  5FU6 B;  3L2U A;  4KBM B;  1KC8 C;  2CSI A;  5GAN j;  1PSE A;  5D7U A;  2JZ2 A;  3F70 A;  4XTV A;  2CH4 A;  3TRE A;  1VQ7 Q;  2RJE A;  2RQU A;  3VS1 A;  1V29 B;  1VIE A;  1NPP A;  3BDU A;  1A0N B;  4JRK A;  2OJ2 A;  2LJ1 A;  2XMF A;  4M75 E;  3QWY A;  4RCC A;  1NG2 A;  2PZ1 A;  5FLX E;  2DM1 A;  3EG3 A;  2LCL A;  3E9G A;  2CP3 A;  4YTL A;  1QMC A;  2QGF B;  2DEQ A;  1TWB A;  1P92 A;  2VXF A;  1AWX A;  2M02 A;  2L3R A;  2FRY A;  4IIM A;  2D0N A;  2DXT A;  1HYO A;  1D09 B;  4J7F A;  3CCV Q;  1HK9 A;  2CKK A;  2QA4 A;  3OMG A;  2K2V A;  3G6E Q;  4J6W A;  5IAY A;  1Q7Y R;  1PHT A;  2AIR B;  1TOV A;  3VJP A;  1QLY A;  3JB9 F;  2E41 A;  1F1B B;  1I1J A;  2LCS A;  3L2Q A;  1K9A A;  4Y28 E;  4ESR A;  4F7U E;  1SRL A;  3SEM A;  4R56 A;  5I2S A;  2FVU A;  1EIF A;  3FC3 A;  1ZHI A;  2PUK B;  2LNH B;  4L59 A;  1OX8 A;  4JDS A;  3OY9 A;  1O9S A;  4QQG A;  4VUB A;  4C0D B;  1KQ1 A;  3V8K A;  4OGE A;  2QYZ A;  4OMM A;  2LVM A;  1J3T A;  2E12 A;  5GAO p;  1E7O A;  4RTY A;  5J3B A;  2L0A A;  3GF5 A;  1WHH A;  2YLC A;  1KFZ A;  2EYW A;  1LOJ A;  4F04 B;  4A4K A;  2A3L A;  3QII A;  4OP0 A;  4PJO A;  1VQ4 Q;  4HT9 A;  1GBR A;  5LJ3 h;  1PG5 B;  2EYZ A;  2VXE A;  2ZAE A;  3BFM A;  2QQ9 A;  3A98 A;  1D1B A;  2K3X A;  4E47 A;  3CC2 A;  2GBQ A;  2O9V A;  2RJF A;  2H8H A;  3C0C A;  1IHW A;  2XU8 A;  4XAX B;  2VGN A;  4OF1 A;  4J6Y A;  2QK0 A;  2V8J A;  4M78 G;  1SF9 A;  1IGQ A;  2RD1 A;  2QDL A;  1ABO A;  3VRY A;  5KCH A;  2X3X D;  2DX1 A;  4RG2 A;  1G2B A;  1NLP C;  2D1X A;  1JO8 A;  3M0U A;  3ME9 A;  1WXB A;  1NEG A;  3JSC A;  1RAC B;  2KMT A;  2YRV A;  5FWB A;  3BW1 A;  3MP1 A;  1ZQ1 A;  1O75 A;  5CVI A;  4ZNX A;  3M58 A;  2DER A;  2R5A A;  2GTJ A;  2DTH A;  2KGT A;  2LTO A;  1VQN A;  1H8K A;  2DXC A;  2ZPG B;  1B07 A;  2D8H A;  3QJ6 A;  1KQS A;  2C0O A;  2KQW A;  3SDZ A;  1IRE B;  4JRP A;  2A0F B;  4A63 B;  5GMK j;  3JCM W;  2RK1 A;  1OEB A;  2VKN A;  1VQN Q;  2KBT A;  2RHZ A;  5HY6 A;  3CCU A;  1YIT A;  1BB9 A;  1BYM A;  4BDZ A;  1BI0 A;  1I07 A;  4CC7 A;  1KD1 R;  2JJ9 A;  3EFR A;  3PNW C;  2J6F A;  3PMI A;  3M54 A;  1WHG A;  3V8L A;  4HCZ A;  1RAG B;  2BZ8 A;  2DD4 A;  3LX7 A;  3CXC P;  4Z89 A;  1ZA1 B;  3CCV A;  5A0D A;  5FU7 B;  1VQ5 Q;  3G6E A;  1KIK A;  3HFN A;  4K11 A;  1R0B G;  2FEI A;  5FU7 C;  5LJ5 d;  5GAN d;  4C8Q A;  5GAN 5;  4M78 D;  2P0K A;  2K9G A;  5A0L A;  1ZBX A;  5IH2 A;  1VQ5 A;  4IUR A;  2AK5 A;  3THK A;  1Z9Q A;  3OS2 A;  1MMN A;  3HRS A;  2YRD A;  4A4E A;  4C0Z A;  1X2Q A;  1R0C B;  1W6X A;  3JCM g;  4N4G A;  4HA8 A;  3EFO B;  2XD0 A;  3M57 A;  5FRO A;  3A8O B;  1I8F A;  3OS1 A;  1YJW A;  3EG0 A;  1NYG A;  1JXM A;  4PNO A;  3JCM J;  5A2Q E;  3OA6 A;  1PKS A;  2HBP A;  4N4I A;  3TQ7 P;  2QEX A;  5CO7 A;  1JB0 E;  1WX6 A;  4M7D D;  2O2O A;  1XJW B;  4CC4 B;  2O4X A;  1G83 A;  5IXB A;  2IG0 A;  2HAX A;  3D7S B;  2M16 A;  2RQV A;  8ATC B;  4LN2 A;  3VS6 A;  1YJN A;  3P8D A;  3G71 Q;  4X34 A;  1LCK A;  3O5Z A;  4EMK C;  1G3S A;  1W2B S;  3REB B;  4GY5 A;  1AEY A;  3V7R A;  2GTO A;  2XHC A;  2YRC A;  2E10 A;  3KUF A;  1SRM A;  3NTI A;  3CC2 Q;  3JCM X;  1EZZ B;  2LX7 A;  3OYC A;  2COW A;  1TUC A;  1ZUY A;  2JS2 A;  2JMC A;  3MO8 A;  2D6F A;  2OTL T;  1X75 C;  3T9N A;  4AFU C;  2EQJ A;  1VYV A;  1FXX A;  2ZPH B;  4C8Q D;  1G3Y A;  5GAM j;  3JB9 I;  1PRL C;  2K5F A;  5CQY A;  1QWE A;  1YCY A;  2BE9 B;  3X26 B;  2GGR A;  4M7D C;  4LDW A;  4C92 C;  3RBB B;  1ZA2 B;  4IUQ A;  4AFS C;  3OYJ A;  2W0Z A;  4E7I A;  3QXE B;  2O88 A;  2GFA A;  2LJ3 A;  2MK5 A;  2KRS A;  3G71 T;  1VQN T;  3A8G B;  3I55 T;  4M78 B;  3NHN A;  2CP7 A;  2MAM A;  3KBG A;  3SWN B;  1RUW A;  5I2M A;  3JCM d;  1MGQ A;  4FIB A;  4RTU A;  5GMK i;  3JB9 H;  5KYY B;  4LUE A;  5GMK h;  4J9F A;  4PJJ A;  2L3Q A;  2RPN A;  3OYL A;  4ANJ A;  4Q5W A;  3OS5 A;  3OSS C;  5CAI A;  2WAC A;  4ME7 A;  4F7U G;  3G6E T;  4C8Q C;  3OS0 A;  3A8H B;  3HHT B;  2Z0W A;  3RNJ A;  4C8Q E;  3JCM V;  4JZ4 A;  3EGX A;  2VAS A;  1WLP B;  4PFP A;  1FWZ A;  4AG2 C;  4LXC A;  1KC8 U;  3RER A;  3C12 A;  2HBW A;  1U1T A;  4ELZ C;  3FIF A;  1M27 C;  4HVU A;  3CCE Q;  1RI9 A;  2LZ6 B;  3S6W A;  2EQK A;  3G1J A;  1G3W A;  1ZUK A;  4M75 F;  2KRM A;  4ZN3 A;  2M1H A;  2V26 A;  4HVV A;  3WVD B;  3PVQ A;  3QYH B;  5D6Y A;  1YJW Q;  1WNL A;  3GNF B;  4QVD A;  1T0H A;  1D0Y A;  2VYT A;  4J83 A;  1M90 R;  3EG1 A;  7AT1 B;  2QEX Q;  2DNU A;  1PSF A;  2CSQ A;  1B3Q A;  1N6A A;  2YUP A;  3L2Z A;  3HKS A;  3SD4 A;  3QHS A;  3LGL A;  3BDL A;  1JJ2 A;  2CZ1 B;  2J6O A;  2RO0 A;  4KUL A;  3U23 A;  4PJO C;  3OYH A;  4J9C A;  1KK7 A;  3CMA Q;  1K9M R;  2K79 A;  5GMK e;  2EJ9 A;  5KYU A;  4M4Z A;  2RHX A;  4IUV A;  1UGS B;  4C8Q F;  3CPW S;  3CCR T;  2OI3 A;  4N0A C;  1AOJ A;  3OYE A;  1RLP C;  5GAN 7;  3LWH A;  2HL5 C;  3J7A F;  5IHK A;  3CCE T;  1ZX6 A;  4RCB A;  2VC8 A;  2F69 A;  1Z9Z A;  3CCQ A;  5L23 A;  4AFQ C;  4EMH A;  5IXF A;  1GBQ A;  4XTX A;  5D6X A;  2IIM A;  2HEQ A;  3OB9 A;  3EG9 A;  1VQ8 A;  5HK0 A;  3VS2 A;  4B6M A;  1YJ9 Q;  4LDX A;  2QAS A;  3C94 A;  4M77 D;  2L3P A;  5GAM g;  2MYS A;  3VKI A;  4KGV B;  5CKH A;  1QVP A;  1D3B A;  3S3N A;  2XIC A;  4FYW B;  4GLM A;  4DBR A;  5M9O A;  1YJ9 A;  2CZ6 B;  2RJD A;  2HZY A;  1UDL A;  4CRI A;  2ZPI B;  1VQO T;  2CH4 W;  3H0I A;  1M1K C;  2PQW A;  1NJI C;  3FB9 A;  1KQS S;  1G3T A;  1KHI A;  4FSX A;  1I5O B;  2DXU A;  1Q81 C;  4FW1 A;  4M78 C;  4IUU A;  3CCR Q;  4PJN A;  2LMJ A;  3O8V A;  4C92 G;  4XU0 A;  1OZ2 A;  4MMK A;  3BY7 A;  4F17 A;  1Y7X A;  2EGC A;  3S3M A;  3V8J A;  2RK2 A;  5GJW B;  3S3O A;  4IIO A;  2LQN A;  4DQ2 A;  2MF2 A;  4OB2 B;  2EBP A;  2DAQ A;  4ATO A;  4QVZ A;  2IVW A;  3EG9 B;  1UTI A;  3I35 A;  4M77 C;  3I56 Q;  1JJ2 S;  4X1V A;  2DIL A;  1WFW A;  4M77 E;  1Q81 R;  2CP2 A;  1V1C A;  4C0D C;  2XK0 A;  3MJX A;  1NLO C;  3E19 A;  1K0S A;  1WHJ A;  1BIA A;  1UGR B;  2CP6 A;  5FRN A;  1OV3 A;  2CT3 A;  2VGM A;  4JLG A;  1KD1 C;  2YXY A;  2VUB A;  2HKQ B;  3FRN A;  2DTO A;  1LVK A;  4EMK B;  4EMG A;  1JU5 C;  1TTH B;  3R6N A;  2HMA A;  2VVK A;  1WZO A;  2DET A;  1S1N A;  1M30 A;  1KQS P;  1BI3 A;  2ZPE B;  2E3H A;  3CCS Q;  2ESW A;  3UDC A;  2D0Q B;  4M78 F;  2W10 A;  2DL7 A;  1U1S A;  2RJC A;  4FSS A;  2DA9 A;  2HKN A;  1FMW A;  2BIV A;  2QA4 T;  5KYX A;  4KGX B;  5GAM e;  2B86 A;  4NL3 A;  2RQT A;  2XKO C;  1MMD A;  2QTV A;  1I0C A;  2AZV A;  2KRO A;  4C92 D;  1M2V B;  2A36 A;  4BE1 A;  5CKE A;  4M77 F;  4M77 G;  4Y92 A;  3CCQ Q;  2WSE E;  3HPW A;  2FL7 A;  2ABL A;  2GNC A;  1FMK A;  3CCS T;  1TUD A;  2PVG B;  1K8A U;  1RAB B;  4HCC A;  2DRM A;  4ZN1 A;  4HCB A;  1BKB A;  2RI5 A;  2KR3 A;  1GCP A;  4A53 A;  3L2W A;  4EDU A;  4LE9 A;  2YUQ A;  2KRN A;  2RMO A;  2GFU A;  3REA B;  2KYM A;  4E2F B;  3CPF A;  2K7A A;  4Z02 A;  5CKB A;  4A4F A;  1WHK A;  3VS4 A;  3ZBD A;  2ZZD A;  2RI3 A;  5DLQ E;  3MCA B;  2LC4 A;  4KH0 B;  2K5I A;  4RKU E;  1YI2 Q;  2NYS A;  3CC2 T;  3KFV A;  3V7C A;  2AKL A;  3PGG A;  3JCM Q;  4PLL A;  1CSK A;  3VYH B;  3MP6 A;  1HJD A;  5D6W A;  3UT1 A;  2YHT A;  2DEU A;  4BI4 A;  5ECA A;  2EQU A;  3MKD A;  2QTX A;  5CKF A;  3GNG A;  4JRQ A;  3OW2 P;  4RMO A;  5GAM d;  1VQP A;  1TH7 A;  4ZGJ B;  4FYY B;  4C92 A;  2VWF A;  1X43 A;  1S72 T;  2MPX C;  1JXO A;  3X25 B;  3LWI A;  1YJN T;  2M51 A;  4MZT A;  6AT1 B;  1MHN A;  4PKC C;  1X6G A;  1VQ6 A;  2A28 A;  4E7J A;  1VQ4 T;  2DBK A;  4BI3 A;  2X4J A;  4OMF B;  4ZGE B;  2BZX A;  1OX9 A;  3KXT A;  3AHU A;  1AZE A;  2EKH A;  1RAH B;  2RN8 A;  1SHF A;  4OMN A;  1ARK A;  4E7L A;  3J81 E;  2PVO B;  2OTL A;  4BY6 C;  1SEM A;  2JXB A;  3I55 Q;  1AZG B;  1YIJ Q;  4C92 E;  1UFF A;  2DE0 X;  4J9G A;  1QCO A;  1VQO A;  2SEM A;  5CCA A;  2E1H A;  4M75 D;  3I5R A;  4AT1 B;  1QQJ A;  1YIJ A;  1N8R C;  1VQK T;  3EH1 A;  4N0A A;  1I5L A;  1CKA A;  2XID A;  1M9S A;  1UGP B;  2BKD N;  4KGZ B;  5GAO r;  1VQO Q;  1YHQ Q;  1IO6 A;  3NTH A;  2EQM A;  3P8B B;  5GAN 8;  2NUP A;  2QGG A;  3LYI A;  2NUT A;  1GFD A;  4Z8A A;  4C8Q G;  1D0X A;  2G3R A;  1YHQ A;  1V76 A;  1M1K U;  2P0Q A;  2P4R A;  5LJ3 e;  1ZSG A;  4QKU A;  4B9W A;  2O9S A;  5HK3 A;  1OOT A;  1M8V A;  1AD5 A;  2F2V A;  2HD0 A;  1VOM A;  2JUF A;  5I21 A;  3OYB A;  3M0S A;  4II1 A;  3OBY A;  2X4X A;  5J26 A;  1S72 Q;  2E6Z A;  1K1Z A;  5KYY A;  2QQA A;  2WSC E;  2GF7 A;  1WHM A;  4XQ3 A;  3I9Q A;  2JTM A;  4M75 C;  3OYG A;  1M1G A;  3QZ5 B;  4NL2 A;  3H41 A;  1Q86 R;  2RQR A;  3CCM T;  3JCM c;  3UA7 A;  2EFI A;  3EH2 A;  4PL6 A;  2FPE A;  3CC7 T;  1VQ7 T;  1OQK A;  4BAC A;  3JB9 D;  1XNI A;  2ATC B;  5J39 A;  1K0X A;  2FZC B;  5DY9 A;  4C0F A;  3N5B B;  4AFZ C;  2JNG A;  4NOY A;  2E3I A;  3DB4 A;  5LJ5 j;  1RL2 A;  1VQP Q;  3DLM A;  1IHV A;  3GIB A;  2MCN A;  4BB7 A;  5KE2 A;  1Y07 A;  1Q7Y U;  4NS5 A;  3FLG A;  1I81 A;  3URG A;  3PE0 A;  4DBF A;  1U3O A;  3VS7 A;  1K73 R;  2EGE A;  1WJQ A;  2AZS A;  1N8R U;  1QWF A;  3LH5 A;  2FPD A;  3H0H A;  3OYK A;  3PIO A;  5FWC A;  3EGD A;  2MIO A;  1XTD A;  2COY A;  3MEV A;  4E7Z A;  1UG1 A;  5LJ3 j;  1NE8 A;  3J80 E;  5FRM A;  2E64 A;  2EVR A;  4E7K A;  4J5Y A;  3OYA A;  2X35 A;  3PFS A;  3Q1J A;  1YWP A;  2F2X A;  2B8A A;  3L2R A;  2Y4Y A;  2FZK B;  3E1S A;  1VQ8 T;  2V1R A;  2LDM A;  1RAD B;  5LJ3 g;  1OU8 A;  3QG1 A;  1JQQ A;  4M7A C;  2DO3 A;  1D1A A;  4IUT A;  1KHC A;  3MP8 A;  3G4S Q;  4F16 A;  3FJ5 A;  5FW9 A;  1GFC A;  2FPF A;  2YDL A;  3CCM Q;  1BIB A;  2LNV A;  1YN8 A;  4J6X A;  2HCK A;  1BU1 A;  1C1A A;  2ED1 A;  1M2O A;  2DTI A;  3HRU A;  3M53 A;  3G4S A;  1NBE B;  3UF4 A;  3PMT A;  1OPK A;  1UUE A;  1BBZ A;  4HXJ A;  3ZEH A;  4ELY C;  3QBY A;  4PK4 A;  5KYW A;  1QVG P;  5LJ5 g;  2KAF A;  1D3B B;  2O01 E;  4LDV A;  2HQH A;  2K5L A;  3EGD B;  2JTE A;  2JS0 A;  4JRI A;  3HSB A;  2EIF A;  1RI0 A;  4PLI A;  3HRT A;  2J6K A;  1S72 A;  1GRI A;  2QA4 Q;  2PVD B;  4X9C A;  1PD0 A;  4BE2 A;  3A8L B;  4EPC A;  4HT8 A;  3CCU Q;  1YIT Q;  1YJW T;  2KE9 A;  4KUD K;  2LQ8 A;  1DJ7 B;  1VQ6 T;  1WHL A;  3E2U A;  3JAM E;  5KYN A;  2CGH A;  4F7U A;  5AYF A;  1VIF A;  4M75 B;  1TG0 A;  1VQL T;  1KQ2 A;  3SWN A;  2LJ0 A;  4TVR A;  4PFO A;  1FMV A;  1QP2 A;  4XU3 A;  2DRK A;  1H92 A;  2EAY A;  1Y96 B;  1Q86 C;  1MV3 A;  1W1F A;  3NGP A;  1X6O A;  1JEG A;  1LPL A;  5CKD A;  1VQP T;  2DYI A;  1VQ9 T;  2BUD A;  2RM4 A;  2DXB A;  1VQL A;  2QQR A;  2YUO A;  2XI9 A;  2JM9 A;  3M4G A;  2X3W D;  1VYT A;  2ROT A;  2KI7 A;  4DOW A;  3GP8 A;  1T3S A;  4GBQ A;  2PU9 B;  1UJ0 A;  1VQ9 A;  2MI6 A;  2L5Q A;  1VQ4 A;  4JLI A;  2EJG A;  3CEY A;  3WVE B;  4V2S A;  4RTZ A;  4C8Q B;  2K4Y A;  4LD6 A;  4D8D A;  4OB0 B;  1VQK Q;  2XDP A;  1YJN Q;  4J9D A;  4ZGD B;  2F5T X;  2OAU A;  5KH6 A;  1W70 A;  2RI2 A;  1VQ9 Q;  2HQX A;  3EGX B;  3TVT A;  1Q82 C;  3PTA A;  4DA4 A;  2E5K A;  4J9B A;  1EFN A;  1YBY A;  2KEA A;  2ROL A;  2DJQ A;  3LGF A;  4RTT A;  3EFS A;  2DL4 A;  3SFM A;  1D1C A;  1WJS A;  4QQD A;  1M1K R;  4J8O A;  2MMP A;  3OYI A;  3OW2 A;  4ZTJ A;  2DIG A;  2HNI A;  1X01 A;  2KSS A;  4O6J A;  2X4W A;  1TXQ A;  2C06 A;  4OML A;  2WSF E;  3M55 A;  2DVE A;  2M0Y A;  3QYG B;  3CCM A;  3OYF A;  1H3Z A;  3VV0 A;  2COZ A;  2PTK A;  2Y4X A;  4M7D G;  1QVF P;  1QVG S;  1PM3 A;  4RTX A;  4WTO B;  2E4H A;  2MWO A;  3RMQ A;  1VQ7 A;  3M59 A;  4WCI A;  1SKU B;  2CUB A;  2FHD A;  5IHN A;  1WIE A;  4OVA A;  2RF0 A;  3M0T A;  4QW2 A;  4M7A A;  3LLR A;  1M2V A;  2YWW A;  2R57 A;  1N9S A;  2VB6 A;  3VUZ A;  2I2L A;  3H9N A;  2DKG A;  3ZL7 C;  4JPB W;  4OMQ A;  2DPP B;  1H64 1;  5GAM f;  4LNP A;  4ORZ A;  3HP9 A;  5GAN 3;  4JZ3 A;  1NZ9 A;  2LRQ A;  1WI7 A;  2C0I A;  3NPF A;  3QJY A;  3I56 T;  2G6F X;  2M9U A;  3OSV A;  2DZC A;  4E6R A;  2DD5 A;  1E6H A;  2ZCF B;  4KRT A;  4MML A;  5LJ3 f;  4OGC A;  2DLP A;  1PNJ A;  1N8R R;  3CD6 Q;  1QVF S;  1WQW A;  4PJO B;  4QQ6 A;  1Q82 U;  1IZ6 A;  2A7Y A;  2GQI A;  3UAT A;  1YNZ A;  5HCK A;  4EIK A;  2XDD A;  1MMG A;  4DEY A;  2RHI A;  4OB1 B;  1ACM B;  1TSF A;  3CD6 A;  1QW1 A;  1LNX A;  5GJV B;  1MND A;  3A1P A;  1NJI U;  5GAN f;  2A37 A;  2LT1 A;  2JTF A;  2RB6 A;  2ECZ A;  5GAN 6;  3ULR B;  3G71 A;  4P5N A;  1AWJ A;  2EKO A;  2FO0 A;  1YWO A;  3M0P A;  3SWN C;  4C5H A;  3RIR A;  4FU6 A;  4E7S A;  3AT1 B;  1QCN A;  3CD6 T;  1VQK A;  4M7A D;  4XTY A;  2P4T A;  3FDR A;  1AWO A;  2JW4 A;  4FYV B;  4M7D E;  3JCM h;  4A4H A;  1IGU A;  4F7U F;  5DM7 R;  4MDX A;  2EWN A;  1T0J A;  1FX7 A;  3X20 B;  2GQV A;  1HXD A;  1SHG A;  2V8K A;  4C5E A;  1K73 C;  4C5I A;  5C0M A;  3I5S A;  5CQX A;  2DJZ A;  3E9F A;  3GPL A;  3NTK A;  3VU3 C;  3OBW A;  3EGU A;  1OZ3 A;  3QO3 A;  1QP3 A;  4M7D B;  3M5A A;  2YLB A;  2BTT A;  1Y0M A;  2OTJ A;  4CC3 A;  2MOX A;  5I22 A;  1WA7 A;  1IRX A;  1U5S A;  1NJI R;  3INZ A;  2NUP B;  4HCK A;  2R58 A;  1G5V A;  1K8A C;  4X9D A;  2P0P A;  2OTJ Q;  5LL6 S;  1H3H A;  2DVJ A;  3VS0 A;  1Q82 R;  3GBQ A;  4FW2 A;  2LT4 A;  2FB7 A;  2L89 A;  2L2P A;  4J9H A;  1WGS A;  1M90 U;  1BK2 A;  2DIQ A;  2DBM A;  5GAO n;  2KK4 A;  1PCX A;  1T3L A;  3MHX A;  2OX7 A;  1RAF B;  3CME Q;  2EGA A;  4IUP A;  1VYU A;  1WPY A;  4BY6 B;  1U8R A;  5GAN 2;  4JJD A;  3JCM f;  1WXU A;  2E70 A;  3CCL A;  2JN0 A;  1UEB A;  5AT1 B;  4PFZ A;  2HSE B;  4HVW A;  4M78 E;  3CCE A;  5KYU B;  1JRI A;  1N9R A;  1AHJ B;  2EYY A;  1VQM T;  1QCF A;  3CCQ T;  1C0M A;  2ZGW A;  4M75 A;  4J7I A;  4RTV A;  3CCL T;  1UE9 A;  2O31 A;  5A0G A;  2X9H A;  1YHQ T;  3M4Y A;  3FJP A;  2RNA A;  3HTR A;  3OYD A;  4M7A F;  4DBQ A;  1M90 C;  3L2V A;  4M7A E;  2NLU A;  1MUZ A;  3EHR A;  2J06 A;  4XK8 E;  2D9T A;  4ZTF A;  4RUG A;  3CMA A;  4M7D A;  2ZPB B;  3CBP A;  2DMO A;  3CCS A;  2DL3 A;  3BE3 A;  4FT4 A;  1HD3 A;  4JJB A;  5LJ5 e;  1QKX A;  2ED0 A;  2LX9 A;  1NM7 A;  2KVQ G;  4J9E A;  1LJO A;  2K3B A;  1Y57 A;  5KYW B;  3M0R A;  1OUL A;  1Q7Y C;  4A4G A;  1WDX A;  2F2W A;  4PJL A;  1TS9 A;  1W4S A;  2KY9 A;  4BDY A;  3UPU A;  1XOV A;  4PJM A;  2CZ0 B;  2CZ7 B;  4L5G A;  4PJO E;  2QXF A;  1X69 A;  1YFN A;  2DL5 A;  1SPK A;  4M75 G;  3R6O A;  3OW2 S;  5GAO m;  2F1L A;  3MEA A;  3CME T;  3PT9 A;  1UGQ B;  3M56 A;  2J05 A;  2EJF A; 
#chains in the Genus database with same CATH homology
 1Y96 A;  5GAN e;  4CI0 C;  2K5L A;  4CRI A;  2ZPI B;  3CCJ T;  5FLX E;  1VQO T;  3MEW A;  4JRI A;  3HSB A;  2EIF A;  1RI0 A;  3M9Q A;  4PLI A;  1M1K C;  3HRT A;  2PQW A;  4XTW A;  1S72 A;  2LCL A;  3E9G A;  4YTL A;  2PVD B;  4X9C A;  3FB9 A;  1BI2 A;  2PUO B;  1NJI C;  4BE2 A;  1KQS S;  1G3T A;  1KHI A;  2DEQ A;  4BD3 A;  4FSX A;  3A8L B;  4EPC A;  4HT8 A;  1P92 A;  2DXU A;  2VXF A;  4LDY A;  1YJW T;  2JOY A;  1Q81 C;  2L3R A;  3CBO A;  4M78 C;  4M77 B;  4IUU A;  1WJR A;  4RG8 A;  1OI1 A;  2LQ8 A;  4KUD K;  2DXT A;  1DJ7 B;  2O4X B;  3O8V A;  4BUG A;  4C92 G;  4J7F A;  4XU0 A;  1OZ2 A;  4MMK A;  3BY7 A;  3GOX A;  3CME A;  3JAM E;  1HK9 A;  1Y7X A;  2CKK A;  2QA4 A;  3S3M A;  1WQ7 A;  3OMG A;  2K2V A;  2CGH A;  3V8J A;  2RK2 A;  4F7U A;  5AYF A;  1VIF A;  4J6W A;  5IAY A;  3I56 A;  3S3O A;  4M75 B;  3WXM B;  4DQ2 A;  2GCX A;  2MF2 A;  5GAO l;  1NPR A;  4OB2 B;  1VQL T;  1KQ2 A;  2DAQ A;  3SWN A;  4ATO A;  3CCR A;  3VJP A;  4F7U B;  4QVZ A;  4TVR A;  3JB9 F;  1QP2 A;  2E41 A;  4XU3 A;  2EAY A;  1Y96 B;  3H8Z A;  2FYK A;  4C92 F;  3L2Q A;  2IVW A;  4Y28 E;  1Q86 C;  4BI8 B;  4M77 C;  4F7U E;  3NFC A;  4BE0 A;  1X6O A;  3C95 A;  5FU6 C;  5CKD A;  1JJ2 S;  1VQP T;  1VQ9 T;  2BUD A;  2RM4 A;  2FVU A;  2EYQ A;  1EIF A;  4M77 E;  5I2S A;  1ZHI A;  4R56 A;  3FC3 A;  1OYX A;  2PUK B;  4L59 A;  2Y90 A;  4C0D C;  3G4S T;  2DXB A;  4JDS A;  2XK0 A;  3OY9 A;  1VQL A;  1O9S A;  4QQG A;  2QQR A;  4VUB A;  4C0D B;  1KQ1 A;  3E19 A;  2XI9 A;  5GAN 4;  2QQS A;  3M4G A;  4OGE A;  1BIA A;  2ZPF B;  1UGR B;  5LJ3 d;  3V8K A;  4DOW A;  3GP8 A;  3X28 B;  5FRN A;  3TEE A;  2LVM A;  2E12 A;  3QDR B;  5GAO p;  2VGM A;  4JLG A;  1KD1 C;  2PU9 B;  3HFO A;  4O5V A;  2VUB A;  3MET A;  1VQ9 A;  1M1F A;  1VUB A;  2MI6 A;  2L5Q A;  3FRN A;  4JLI A;  5J3B A;  1VQ4 A;  1YI2 T;  2EJG A;  3CEY A;  2F5K A;  3WVE B;  2DTO A;  4V2S A;  4EMK B;  3GF5 A;  4EMG A;  4C8Q B;  2YLC A;  2K4Y A;  4LD6 A;  4OB0 B;  2XDP A;  4Y91 A;  4ZGD B;  2F5T X;  1LOJ A;  2OAU A;  5KH6 A;  4A4K A;  2A3L A;  1BI3 A;  2ZPE B;  4PJO D;  2RI2 A;  3QII A;  3UDC A;  4OP0 A;  4PJO A;  4HT9 A;  2D0Q B;  4M78 F;  5LJ3 h;  2HQX A;  1U1S A;  2VXE A;  2RJC A;  1Q82 C;  3BFM A;  2QQ9 A;  3PTA A;  2K3X A;  4DA4 A;  4M78 A;  4E47 A;  3CC2 A;  2BIV A;  3RKY A;  2E6N A;  1YBY A;  2RJF A;  2QA4 T;  3LGF A;  4XTZ A;  3EFS A;  3SFM A;  2MWP A;  2XU8 A;  5GAM e;  4NL3 A;  3QZ9 B;  1WJS A;  4QQD A;  4XAX B;  2VGN A;  4OF1 A;  4J6Y A;  4J8O A;  2MMP A;  2XKO C;  2V8J A;  4M78 G;  3OYI A;  2H3J A;  3OW2 A;  4ZTJ A;  2DIG A;  2HNI A;  1QVF A;  4JS4 A;  4C92 D;  2V8I A;  3OYM A;  1X01 A;  2RD1 A;  2KSS A;  4HKE A;  2KDS A;  5CKE A;  4BE1 A;  3DB3 A;  3PIP A;  4M77 F;  5CIU A;  4LD9 K;  4M77 G;  4O6J A;  2X4W A;  2C06 A;  2CYZ B;  3HL8 A;  2WSF E;  3M55 A;  2DVE A;  3CCM A;  3QYG B;  4M77 A;  5KCH A;  3OYF A;  3CXC A;  1H3Z A;  2L8D A;  2WSE E;  3VV0 A;  2Y4X A;  3RES A;  3HPW A;  4RG2 A;  4M7D G;  2FL7 A;  1QVG S;  2OTJ T;  1KG1 A;  2MWO A;  3G7Z A;  3RMQ A;  3CCS T;  2PVG B;  1K8A U;  1VQ7 A;  4HCC A;  3M59 A;  3QSU A;  4MZP A;  5CK9 A;  3ME9 A;  2M0O A;  2QI2 A;  3JSC A;  4ZN1 A;  4HCB A;  2FHD A;  2KMT A;  1BKB A;  2YRV A;  2RI5 A;  3BW1 A;  3OYN A;  2QEX T;  2E65 A;  3MP1 A;  1ZQ1 A;  4A53 A;  4OVA A;  3L2W A;  4EDU A;  1O75 A;  5IT9 E;  5CVI A;  3RKW A;  3M58 A;  4QW2 A;  4M7D F;  2R5A A;  2LTO A;  2DTH A;  3LLR A;  4M7A A;  2R57 A;  1N9S A;  3VUZ A;  3JCM e;  1VQN A;  2DXC A;  2ZPG B;  2I2L A;  2GFU A;  1R8O B;  3QJ6 A;  1KQS A;  2DKG A;  4M7A B;  3CPF A;  2KQW A;  4Z02 A;  1IRE B;  5CKB A;  3SDZ A;  4A4F A;  2DPP B;  4JRP A;  1H64 1;  3ZBD A;  2ZZD A;  3P8H A;  2RI3 A;  5EG2 A;  5DLQ E;  5GAM f;  5GMK j;  3JCM W;  3MCA B;  2RK1 A;  1GXI E;  2LC4 A;  5HY6 A;  2RHZ A;  3OQ5 A;  3CCU A;  1YIT A;  1BYM A;  3HP9 A;  2K5I A;  1BI0 A;  4UC4 A;  4BDZ A;  4RKU E;  4WF2 A;  3EFR A;  5DLO A;  5LJ5 f;  3QUI A;  3PNW C;  5GAN 3;  3PMI A;  1NZ9 A;  3M54 A;  2LRQ A;  3CC2 T;  3V8L A;  3V7C A;  3FEO A;  3LX7 A;  3PGG A;  1XQH A;  2DD4 A;  3QJY A;  4HCZ A;  4PLL A;  5CR2 A;  3JCM Q;  3I56 T;  5A0D A;  2RH2 A;  5FU7 B;  4PJO G;  3VYH B;  1M4Z A;  4OB3 B;  2M9U A;  3MP6 A;  5D6W A;  3HFN A;  3UT1 A;  2YHT A;  3OSV A;  3G6E A;  2DZC A;  2DK3 A;  1YIJ T;  5GAN h;  2DD5 A;  5FU7 C;  4DOV A;  5LJ5 d;  4BI4 A;  2K3Y A;  5GAN d;  2ZCF B;  4MML A;  4C8Q A;  2EQU A;  5GAN 5;  4M78 D;  2QTX A;  2P0K A;  5CKF A;  5LJ3 f;  4OGC A;  2QQB A;  5A0L A;  2X4Y A;  1ZBX A;  3LH0 A;  3GNG A;  4XU1 A;  4JRQ A;  4RMO A;  3CCU T;  5GAM d;  1YIT T;  1WQW A;  1QVF S;  1VQ5 A;  1VQM A;  4MDW A;  3X24 B;  4IUR A;  4PJO B;  5L8R E;  4R55 A;  4QQ6 A;  2HQE A;  1VQP A;  1YJ9 T;  1W2B A;  1Q82 U;  1IZ6 A;  1TH7 A;  3ZFJ A;  2LCC A;  2A7Y A;  4ZGJ B;  3OS2 A;  3HRS A;  4A4E A;  4C92 A;  2XDD A;  3TCJ A;  2RHI A;  4OB1 B;  1JBM A;  4C0Z A;  1S72 T;  3JCM g;  4N4G A;  3CD6 A;  4HA8 A;  2XD0 A;  1QW1 A;  1LNX A;  3M57 A;  3X25 B;  3LWI A;  5FRO A;  1YJN T;  3A8O B;  1I8F A;  2D6F A;  3OS1 A;  3JCM b;  4MZT A;  5GAN f;  1NJI U;  4JJN K;  1YJW A;  3TU4 K;  5GMK l;  3VYG A;  1MHN A;  2LT1 A;  4PKC C;  4FT2 A;  4PNO A;  2JTF A;  4C5G A;  5A2Q E;  2HBP A;  2RB6 A;  4N4I A;  3OA6 A;  1VQ5 T;  2QEX A;  5GAN 6;  5CO7 A;  1JB0 E;  4L6V 5;  3CCV A;  4FM4 B;  1KD1 U;  1VQ6 A;  4M7D D;  3L1A A;  3G71 A;  4E7J A;  1VQ4 T;  4P5N A;  4ZGE B;  4BI3 A;  2X4J A;  4OMF B;  2EKO A;  3SWN C;  4C5H A;  3JB9 J;  3I55 A;  2O4X A;  3KXT A;  3AHU A;  3RIR A;  2IG0 A;  2HAX A;  4FU6 A;  2M16 A;  4N4H A;  3CMA T;  3CD6 T;  1VQK A;  3ER0 A;  1YJN A;  3CPW A;  3P8D A;  4M7A D;  4E7L A;  3J81 E;  2PVO B;  2XG8 D;  4X34 A;  4XTY A;  2P4T A;  3FDR A;  4BY6 C;  2OTL A;  2AHJ B;  1G3S A;  4EMK C;  1W2B S;  4M7D E;  4GY5 A;  3JCM h;  3V7R A;  1B34 A;  4A4H A;  2XHC A;  4F7U F;  4C92 E;  3LW5 E;  1SSF A;  2E10 A;  5DM7 R;  3KUF A;  4M7A G;  2RA2 A;  3NTI A;  3CBM A;  4MDX A;  3VUB A;  4C0G A;  3JCM X;  2EWN A;  5GAO q;  1VQO A;  3EAE A;  3CC4 A;  1FX7 A;  5CCA A;  5GMK m;  3X20 B;  3OYC A;  2E1H A;  2GQV A;  4M75 D;  1YIJ A;  1N8R C;  1VQK T;  4GLK A;  1HXD A;  2RHY A;  2V8K A;  3MO8 A;  4N0A A;  4C5E A;  1K73 C;  4C5I A;  2XID A;  5C0M A;  1I5L A;  1M9S A;  5CQX A;  1X75 C;  1UGP B;  2DJZ A;  3E9F A;  3T9N A;  5KE3 A;  3GPL A;  2EQJ A;  3NTK A;  3VU3 C;  2BKD N;  3OBW A;  5GAO r;  1FXX A;  3GLX A;  2ZPH B;  1OZ3 A;  3NTH A;  3QO3 A;  4C8Q D;  1G3Y A;  1QP3 A;  5GAM j;  4XTU A;  2EQM A;  3M5A A;  4D6W A;  1Q81 U;  3P8B B;  2YLB A;  5GAN 8;  3JB9 I;  4M7D B;  2K5F A;  5CQY A;  1YCY A;  3LYI A;  4C92 B;  3X26 B;  4M7D C;  2OTJ A;  3CC4 T;  4LDW A;  3ASK A;  4C8Q G;  4C92 C;  2G3R A;  3INZ A;  1YHQ A;  1M1K U;  2RHU A;  2P0Q A;  3CXC S;  5LJ3 e;  4IUQ A;  3OYJ A;  4E7I A;  3A8M B;  4B9X A;  3QXE B;  2R58 A;  5IN1 A;  1G5V A;  4B9W A;  1K8A C;  5HK3 A;  4X9D A;  4RCC A;  2P0P A;  1M8V A;  2GFA A;  1K9M C;  2HD0 A;  5LL6 S;  2JUF A;  4KUI A;  1K73 U;  2R5M A;  5I21 A;  3OYB A;  2LT4 A;  2FB7 A;  2L89 A;  3G71 T;  3QKJ A;  1VQN T;  4II1 A;  3OBY A;  1WGS A;  3A8G B;  1M90 U;  2X4X A;  4M78 B;  3I55 T;  5J26 A;  3CCJ A;  2MAM A;  2E6Z A;  3KBG A;  2DIQ A;  4LDU A;  1M5Q 1;  3SWN B;  2JVV A;  1QVG A;  5GAO n;  3QPH A;  2KK4 A;  3V7S A;  5I2M A;  3JCM d;  1MGQ A;  2QQA A;  3MHX A;  2WSC E;  2GF7 A;  4FIB A;  4XQ3 A;  5GMK i;  3JB9 H;  2JTM A;  4M75 C;  3OYG A;  5GMK h;  1M1G A;  2DZ9 A;  3QZ5 B;  4IUP A;  4NL2 A;  3JCM J;  3OYL A;  4PJO F;  1WPY A;  4Q5W A;  4BY6 B;  4EMK A;  3OS5 A;  3OSS C;  5GAN 2;  3A5Z B;  3JCM c;  3CCM T;  1U8R A;  5CAI A;  2WAC A;  2EFI A;  3JCM f;  1YI2 A;  2E70 A;  3CCL A;  1I4K 1;  2JN0 A;  4ME7 A;  4F7U G;  4PL6 A;  1UEB A;  3G6E T;  3SB2 A;  4MZM A;  4C8Q C;  3OS0 A;  3A8H B;  3UWN A;  3CC7 T;  1VQ7 T;  3HHT B;  4M78 E;  4BAC A;  4QVC A;  3JB9 D;  4C8Q E;  3CCE A;  3JCM V;  1XNI A;  2LQK A;  1FWZ A;  1JRI A;  1N9R A;  1AHJ B;  2QDY B;  5J39 A;  4E7H A;  1Q86 U;  5DY9 A;  1VQM T;  4C0F A;  3CCQ T;  3N5B B;  1KC8 U;  3RER A;  2JNG A;  4NOY A;  3C12 A;  2ZGW A;  5C6S A;  3DB4 A;  1U1T A;  4M75 A;  1RL2 A;  4ELZ C;  5LJ5 j;  3FIF A;  3DLM A;  4J7I A;  1B34 B;  3GIB A;  4BB7 A;  5KE2 A;  1Y07 A;  1Q7Y U;  3DKM A;  2E5Q A;  2EQK A;  3H6Z A;  3S6W A;  3CCL T;  1G3W A;  2K57 A;  4KT0 E;  4M75 F;  4ZN3 A;  4NS5 A;  3FLG A;  5A0G A;  1I81 A;  2M1H A;  3RKX A;  3URG A;  3OYY A;  1YHQ T;  3M4Y A;  3WVD B;  3FJP A;  3QYH B;  5D6Y A;  2VV5 A;  4XU2 A;  1WJQ A;  5HKC A;  1UB4 A;  1VQ6 T;  1WNL A;  3GNF B;  4QVD A;  3OYD A;  1N8R U;  4M7A F;  1M90 C;  4J83 A;  2VYT A;  3L2V A;  5GAM h;  4M7A E;  2NLU A;  3OYK A;  3PIO A;  3RUX A;  4JS5 A;  5GAN g;  2XDB A;  1PSF A;  3CCV T;  1Y71 A;  3RMS A;  1K9M U;  4XK8 E;  2D9T A;  4ZTF A;  4M7D A;  3CMA A;  1N6A A;  3JB9 G;  2ZPB B;  3JCM P;  3L2Z A;  3CBP A;  3HKS A;  4JUV A;  1XTD A;  3SD4 A;  3QHS A;  3CCS A;  3MEV A;  3LGL A;  4FT4 A;  5LJ3 j;  1NE8 A;  3J80 E;  4A54 A;  5FRM A;  3BDL A;  2E64 A;  5LJ5 e;  3L42 A;  2CZ1 B;  3DLL A;  4E7K A;  1JJ2 A;  2RO0 A;  4J5Y A;  2CS7 A;  2LX9 A;  3OYA A;  4KUL A;  4FL6 A;  2X35 A;  3PFS A;  3MEU A;  3Q1J A;  3OYH A;  4PJO C;  2KVQ G;  2B8A A;  5LJ5 h;  3OMC A;  2EJ9 A;  5GMK e;  1LJO A;  1BI1 A;  3L2R A;  2Y4Y A;  2RHX A;  4IUV A;  1UGS B;  3E1S A;  4C8Q F;  3JRZ A;  1VQ8 T;  2LDM A;  5LJ3 g;  1N27 A;  3QG1 A;  3CPW S;  3C4S A;  3CCR T;  4M7A C;  4N0A C;  3CC7 A;  3OYE A;  4IKF A;  2DO3 A;  4IUT A;  5GAN 7;  3LWH A;  1Q7Y C;  4A4G A;  3J7A F;  1KHC A;  3MP8 A;  5KCO A;  4RCB A;  3CCE T;  5FU6 B;  3L2U A;  4KBM B;  2VC8 A;  2F69 A;  1W4S A;  2KY9 A;  1KC8 C;  4BDY A;  3UPU A;  5GAN j;  1BIB A;  2LNV A;  1PSE A;  1XOV A;  3CCQ A;  4J6X A;  4EMH A;  4XTX A;  2JZ2 A;  2CZ0 B;  3F70 A;  5D6X A;  4XTV A;  2CZ7 B;  4L5G A;  2DTI A;  3HRU A;  3M53 A;  3OB9 A;  3G4S A;  3TRE A;  1VQ8 A;  5HK0 A;  3PMT A;  2RJE A;  4PJO E;  2QXF A;  4ELY C;  3ZEH A;  4LDX A;  3QBY A;  3C94 A;  4M77 D;  5GAM g;  4M75 G;  2OTL T;  3R6O A;  3VKI A;  1V29 B;  5CKH A;  1QVP A;  5GAO m;  1D3B A;  3OW2 S;  1VIE A;  3S3N A;  1NPP A;  3BDU A;  4JRK A;  3MEA A;  2XIC A;  3CME T;  3PT9 A;  5LJ5 g;  2KAF A;  5M9O A;  1D3B B;  1YJ9 A;  1UGQ B;  2O01 E;  4M75 E;  3M56 A;  4LDV A;  2CZ6 B;  2EJF A;  2RJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...