2EQJA

Solution structure of the tudor domain of metal-response element-binding transcription factor 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GSSGSSGKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the TUDOR domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Metal-response element-binding transcription factor 2
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqjA00
5FRNA 3GOXA 1OZ3A 3OMCA 3MEUA 5KH6A 4CRIA 3H6ZA 4X34A 2RI3A 2RHZA 4C5GA 3OYGA 2JZ2A 4IUVA 3NTHA 2M16A 3ME9A 3PFSA 4LD6A 2XDPA 4QW2A 2X4WA 3FC3A 2YRVA 1WJQA 2P0KA 4ZTFA 2BUDA 3OYHA 4PL6A 2HQXA 2L8DA 4RG2A 3OYFA 4ZTJA 2EKOA 2XK0A 4BD3A 2MWPA 3DLMA 4QVZA 5D6WA 3OA6A 3CEYA 5FROA 1WGSA 1WJSA 2DIGA 2RO0A 4N4IA 2G3RA 4L59A 2RHYA 2EQUA 3OMGA 2DAQA 3H8ZA 5D6XA 3UT1A 4FU6A 5J26A 2DIQA 2QQSA 2O4XA 2R57A 3OYNA 2PQWA 1OYXA 3S3OA 4A4GA 4UC4A 3S6WA 4A4FA 3E9FA 3PMIA 2HQEA 5J39A 4Z02A 2E6NA 5D6YA 2CKKA 2E5QA 3P8HA 3LGFA 5KE3A 2VYTA 3LX7A 3OYCA 2M1HA 3OB9A 4GY5A 4A4EA 5C6SA 3OQ5A 2L3RA 4BE0A 3LYIA 2R5MA 3QBYA 2R58A 2GFUA 2F5KA 2LVMA 2RJDA 3DB3A 3LH0A 4QQDA 2NLUA 3MO8A 4C5HA 4BDZA 3OYMA 3OYJA 3META 3NTKA 4BE2A 2LTOA 3UWNA 3OS0A 4HCZA 1SSFA 2RI5A 3F70A 4C5EA 4E7IA 5KCHA 2EFIA 2D9TA 3O8VA 5IAYA 4A4HA 4N4GA 2LRQA 3L42A 3MEWA 3L2UA 2RJFA 3Q1JA 2GF7A 3MEVA 2GFAA 3OYIA 3C4SA 2BKDN 4IUUA 3S3NA 3L2WA 4OVAA 5C0MA 4FL6A 3OYLA 2L89A 4PLIA 2LDMA 3ZEHA 2X4YA 1RI0A 2EQKA 4IURA 3KUFA 1H3ZA 5IN1A 4BDYA 3MP1A 4E7JA 3FDRA 4BE1A 1OZ2A 3M9QA 2RJEA 4II1A 4E7LA 3MP6A 4E7HA 4B9WA 2X35A 3FLGA 3LGLA 4IUQA 2RHUA 3NTIA 3L2RA 2MWOA 4IUTA 3PNWC 4C5IA 3OY9A 4Q5WA 4E7KA 3SD4A 3OS1A 4B9XA 4N4HA 2RI2A 2B8AA 3S3MA 4NS5A 5M9OA 2FHDA 2WACA 3DB4A 3QJ6A 3OS2A 2K3YA 2R5AA 3L2VA 1G5VA 1XNIA 2QQRA 2M0OA 4QQGA 3MP8A 3QKJA 3OYAA 5FRMA 3PMTA 1WJRA 1N27A 2EQMA 1MHNA 2RHXA 3FEOA 4IKFA 2RJCA 2EQJA 2X4XA 2IG0A 5CIUA 3P8DA 5KE2A 5KCOA 3OYDA 2RHIA 1KHCA 2O4XB 4PLLA 2JTFA 2K3XA 3ASKA 4QQ6A 3BDLA 4EDUA 3EAEA 3OYEA 4BACA 3MEAA 4IUPA 3E9GA 2LCCA 3OYKA 3OYBA 3L2QA 1OI1A 2BIVA 3QIIA 3LLRA
chains in the Genus database with same CATH superfamily
1JQQA 2NYSA 5FRNA 2FZGB 2PVDB 2JXBA 3OYGA 1AOJA 1RUWA 1TSFA 4BUGA 1H3HA 2O31A 2EAYA 2P0KA 4FSXA 4C8QA 5HK0A 2E1HA 4RG2A 1FXXA 2WSCE 2ED1A 1VQMT 3DLMA 1D1BA 1I1JA 1E6GA 3SWNA 2JUFA 4VUBA 4L59A 4ZN1A 4FCYA 1HK9A 4XTXA 1RAGB 1UECA 1VA7A 3UDCA 1Z9ZA 1NBEB 1Q86U 2RN8A 3H0HA 1YJNA 2CH4A 2D0QB 4MZPA 4A4GA 1QVFA 1PSFA 2EYXA 3VS1A 4EMGA 1VQMQ 4RUGA 3SB2A 4PJOF 1VQLT 4M78E 4XTWA 1N9RA 4RCBA 3JCMQ 1Q7YR 4MDXA 1ARKA 1VQ8T 2J06A 3JB9I 1Y7XA 4M7AE 2XKOC 3TQ7P 4M7DB 2JMAA 1U1TA 1K76A 1UDLA 2JVVA 3I55Q 1M8MA 1VQ8Q 3RERA 4RTYA 1LCKA 1MNDA 2E10A 3TSWA 1XTDA 2QGFB 3CQTA 2DBKA 3CCMQ 5LJ3f 4KRTA 1W2BS 4IUTA 1I8FA 3EGUA 1I07A 3I5SA 2DXCA 4JUVA 3URGA 3OS2A 2QQRA 1SF9A 3X26B 5A2QE 1GBQA 5GAMd 5IXFA 3FEOA 3OYDA 5AT1B 1QLYA 4C92A 2VV5A 5GAN4 2ZPFB 3OYEA 4QT7A 3MEAA 2CP2A 2IIMA 2QASA 1EIFA 3JCMW 1KQSS 2HBWA 2LQKA 4E6RA 2OI3A 4F7UF 2LX7A 1BU1A 1VYTA 3CCVQ 4JS4A 1MMDA 2DEQA 1NZ9A 3ME9A 3PFSA 1NJIU 4Z8AA 4FYVB 1VQ5A 2PZ1A 2X3XD 2BUDA 3PE0A 3JCMX 3JB9J 5IHKA 3EGXA 4BD3A 1UGQB 2RA2A 1M27C 2DX1A 4N4IA 3CCJA 4RTUA 2SEMA 2KVQG 4JLGA 4JDSA 1KQSA 2R57A 4HA8A 3HRSA 3MCAB 2W10A 2HQEA 2VXEA 3G7ZA 2VB6A 2CKKA 1M3CA 2YUPA 4OMOA 1YI2Q 2R5MA 2E70A 5GMKi 2EJFA 4PJOD 5IH2A 3G1JA 2O9SA 2JMCA 1SSFA 5A0LA 3EG9A 4JRQA 3WXMB 2QAZA 1VQ9T 1K1ZA 1YJ9Q 2DNUA 2VXFA 2CREA 3S3NA 3G71T 4OVAA 3CMAA 1Q86C 3M4GA 3GNFB 2M02A 2HKNA 5GANf 2VKNA 1ZX6A 4K11A 1I5OB 3M9QA 2COYA 4II1A 4OF1A 3MP6A 1CKBA 2QA4A 1E7OA 2I2LA 2X35A 5GANh 3NPFA 2F2XA 1BKBA 3KXTA 5KYXB 1VQOQ 2RI2A 5LJ5h 2X4JA 3INZA 2K79A 4DEXA 2P0PA 1VQOT 4QQGA 4X9DA 3R6NA 5LJ5f 4M75F 4F7UG 1SSHA 1WXBA 3OS5A 4IKFA 5KCOA 3R6OA 2HQHA 5GAOr 4BY6B 3I35A 1AHJB 3M59A 4PJLA 1RLPC 2ED0A 4FYXB 1M4ZA 1OZ3A 5IHNA 4ESRA 4F7UE 4X34A 3QDFA 4JZ4A 3HHTB 1RAIB 3OSVA 2VVKA 4J7IA 4QW2A 3ZL7C 1AWWA 2DTOA 4LN2A 4C92G 4ZTJA 4QVZA 3RR6A 5LJ3e 2LX9A 4D8DA 5KYYA 3WVDB 2DJQA 5CVIA 1FYNA 4J6XA 4AFQC 2K5FA 1KQ1A 2EGEA 1G3SA 1I0CA 2KQWA 4XTUA 1M8VA 1D09B 1VQ7A 5KE3A 2M1HA 4C8QC 1RL2A 1YFNA 2GFUA 4X9CA 3L1AA 3CCUQ 2JJ9A 2LQNA 2Y4XA 2LT1A 4E7IA 4J7FA 5KCHA 1PG5B 4XU0A 4HVWA 4OP0A 5CKBA 4AT1B 1D0YA 2K5IA 2NUTA 1PC0A 3QSUA 5L23A 2C0TA 2QQAA 1H3ZA 3G6ET 4DEYA 3QHSA 2RNAA 4FW1A 2DD5A 2DRMA 4J5YA 3ULRB 2HEQA 4J6YA 3O5ZA 2V8KA 1D0ZA 4FT4A 2KK4A 1BIBA 2YDLA 2DYIA 1MNEA 2AKLA 1S72A 2H3EB 2EJGA 2YT6A 4ZGJB 4PJOC 4FIBA 4M78C 2D6FA 2QGGA 2PUOB 3CC7T 2F69A 3GOXA 3JB9F 2EBPA 4E7SA 1PWTA 2EQIA 5L8RE 3H41A 4C5GA 1IXDA 3NTHA 4RG8A 3JRZA 2LQ8A 4OGEA 9ATCB 1QVGA 1RI9A 5GAMg 2XK0A 5CKHA 1QWEA 1K9MR 2E3IA 3PIOA 1YJWA 2JM9A 1YJWT 1S72Q 2OX7A 3FJ5A 5D6XA 2PU9B 3U23A 5ECAA 3I56Q 2JN0A 4BI3A 3SWNB 4OMPA 3QWYA 2VYTA 1M2VA 1NLPC 5J3BA 4M78D 2IPOB 3LH0A 2H3JA 3JB9H 4DBQA 1RAEB 2LC4A 3G4SA 3JCMb 4BE2A 1KQSP 2RI5A 2PVOB 2D9TA 4ELZC 3O8VA 1KHIA 4C8QB 1ACMB 2V8JA 4OMQA 1IO6A 2X4YA 2QXFA 2JM8A 1YJ9A 4KGVB 4E7HA 2CZ1B 3M0PA 3CMET 1YHQT 1WLPB 2D0NA 4CC7A 4LDVA 4C92D 2K6DA 2HL3A 2E4HA 3SD4A 2C0IA 4N4HA 5FU6C 2F2WA 5IXBA 2FPDA 1PM3A 5GAN5 1W2BP 1KD1C 2K3YA 3MP8A 2AKKA 5GANg 3JB9G 1AEYA 4Y91A 2MI6A 3HFOA 1AVZC 1QCOA 2MK5A 3LW5E 4OMNA 4C8QD 2Y4YA 3VYHB 3JCMc 5GAMj 2LCCA 2VASA 5LJ5g 2DZCA 3GP8A 1OX8A 4DOVA 8ATCB 3QDRB 5GAOn 2FEIA 3HRUA 4JRKA 4XU3A 1XOVA 3H0FA 1SPKA 5D6WA 4J8OA 5GAMe 3VS6A 2DKGA 4XU1A 2EQUA 2DPPB 3CC2A 2EYWA 1YI2A 4N0AA 4OMFB 1R0BG 1IGQA 3JCMh 2PNIA 4CC3A 4ELYC 3QBYA 2R58A 2NLUA 1YIJA 2K4YA 1OU9A 1KFZA 1Q81U 1P92A 3CMAQ 2EFIA 3RBBB 3EFRA 2KEAA 2RK1A 1AWJA 2GF7A 2VGNA 3MEVA 3CCJQ 4LUEA 5LJ5e 4FL6A 3REBB 3OYLA 2GCXA 1VIFA 4J9CA 1TWBA 1QCNA 4LDUA 1ZHIA 4MZTA 2FG0A 3TU4K 3QWXX 1AZGB 2K9GA 1YCYA 5GMKm 3PNWC 3CXCP 1B34B 4E7KA 2D8HA 3EH1A 1Q95G 1U8RA 2OAUA 5IHIA 2DE0X 2R5AA 3CCMA 1NPPA 1N8RC 2FZCB 2DMOA 2HCKA 1KC8C 1VQ6A 2J6FA 1UHCA 4M75D 4R0KA 2RJCA 3BFMA 2K2VA 4QQ6A 3BDLA 1T3SA 4C0GA 3MJXA 5FU6B 1OEBA 2V26A 1VQNQ 2DFUA 1K8AR 2DVEA 3J80E 3OMCA 4M77G 1YWOA 5DLQE 2JW4A 2XG8D 5GAOq 3M54A 1M1FA 4F16A 2DM1A 1WJQA 1ZQ1A 2KT8A 4XTZA 3CMEA 2ZGWA 1KD1R 2XIDA 2MWPA 1XJWB 3M57A 4R55A 2J7IA 2RO0A 2J05A 1VQ8A 3VU3C 4LDXA 3H8ZA 2O4XA 1VQ4Q 2KYBA 4A4FA 2PVGB 1VQPQ 4J9IA 1M1KR 3P8HA 2EJ9A 2LCLA 2MMPA 3OQ5A 4J9HA 4E7LA 2LP5A 2RJDA 3MO8A 1UGVA 4ZN3A 4HT9A 2ABLA 4XQ3A 2P4TA 3V8JA 1JXOA 2GQIA 3RDVA 3HTRA 3CCET 2RF0A 4F04B 3RESA 3MEWA 2CP5A 1D3BB 3CBOA 2GFAA 4L6V5 2KRNA 3OW2S 5GAN6 4BE1A 3HFNA 5EG2A 4O6JA 1EFNA 2A28A 4JRIA 1VQKA 4IUQA 4E7ZA 4Q5WA 1M3AA 1GL5A 2GQVA 1PKTA 1BCOA 2RK2A 1VQ5T 1CSKA 1X43A 3OYAA 4KH1B 5CAIA 3ZBDA 3NGPA 4RTTA 2EQMA 2RHXA 4PNOA 3GLXA 5CIUA 2L0AA 1YNZA 4C0DB 2QDYB 3RUXA 5GAOl 1TOVA 1UHFA 1EX4A 2V1RA 5AYFA 3RKYA 3MEUA 1RADB 1VQNT 1JEGA 2XICA 2E12A 2BTTA 2CP0A 2XDDA 2X9HA 2FRWA 1TUGB 5HCKA 1A0NB 2EW3A 4JJDA 2OTJA 1NLOC 2YUNA 2QK0A 5GAN3 3OMGA 2JOYA 3LH5A 1QW1A 1RLQC 2Z0WA 3EFOA 3QXEB 2MYSA 1R77A 3S6WA 5J39A 2FPFA 5KYUA 3LWHA 2RB6A 2DZ9A 1TG0A 2L3RA 1IB8A 2A0FB 2F5KA 3GF5A 2K3BA 1FMWA 3HKSA 4BDZA 3EG0A 1M9SA 1QVFP 1TUCA 4M77B 1QCFA 5A0GA 3TREA 3CMAT 4EMKC 1M1KC 1YJWQ 4A54A 2K2MA 2CGHA 4M75A 3V7SA 5CQYA 3CXCA 5C0MA 2K5LA 1YHQQ 1WYXA 1B07A 4XAXB 1YJNT 1H641 5CK9A 2A3LA 1ZSGA 4M4ZA 3LGLA 1QP2A 4X1VA 4KUIA 4BY6C 1VQKT 4J9FA 1ZBJA 2DK3A 4PJNA 4OGCA 1M2OA 3DB4A 3CCQT 1MGQA 1T0JA 3L2VA 3SHWA 3UATA 4F17A 1PRMC 5I21A 2CP6A 3QUIA 2CUDA 1K73U 2YLBA 1RAFB 3CBMA 1HJDA 4BI8B 4KBMB 3VS4A 4WCIA 4HCBA 1UJYA 2V8IA 1KK7A 1UG1A 1KG1A 2HZYA 4R56A 3RKXA 1FWZA 3EFSA 2OTJQ 2KE9A 3G6EQ 1WIEA 2O88A 4LXCA 5GAN2 3OYHA 2DERA 4PL6A 4MDWA 2YUOA 3CEYA 2VGMA 4RTXA 3CXCS 1X6OA 3V8LA 4DBFA 4Y92A 3X20B 1WHMA 2LJ3A 2K57A 4DOWA 3M0TA 4XTVA 4KT0E 1M90U 3TVTA 5GAOp 4A4EA 1YITT 1Q81R 4C5HA 3UF4A 3NFCA 3E1SA 3JCMg 1AD5A 2Y90A 3PVLA 2RMOA 3KBGA 2KAFA 3TEEA 1HXDA 2LRQA 3L42A 3CCRA 5KYYB 1K9MC 5DY9A 5GAN8 1OPKA 1JJ2P 4HT8A 4M78F 3CD6T 1AZEA 2CDTA 3VKIA 4IURA 3KUFA 2OTLT 2XU8A 5GAN7 1OPLA 3I9QA 3J81E 4M77C 3GBQA 3I5RA 3CCLA 4B9WA 4HCCA 2ATCB 3FLGA 4FYWB 5I2SA 4CI0C 3I56T 1NYGA 2FL7A 1S72T 4C0FA 1ZLMA 2EKHA 5KYXA 3QKJA 1WJRA 3THKA 1VQLA 2HAXA 2EQJA 5KE2A 5CCAA 2KY9A 3P8DA 4Z89A 2RHIA 1BI2A 1B34A 4PLLA 3HL8A 1PHTA 5GJVB 1T3LA 1QVGS 3CC7Q 4PJMA 3C94A 2LT4A 3V7CA 2ZPEB 2GTOA 4AFZC 2DETA 3CCEQ 2D8JA 3C0CA 4M77A 2C06A 3CCUT 2DTHA 2M16A 2EIFA 3PVQA 4M7DC 1UGSB 4J9BA 2EWNA 1WI7A 1SKUB 4E2FB 4RCCA 5HKCA 3JV3A 5GAOm 4OB0B 4QVDA 4GLKA 4NL3A 1JO8A 3CC4A 2M51A 2XDBA 4M77D 1VQ4T 2YXYA 2LNVA 4C0ZA 3VS0A 4AFSC 3QYHB 4M78A 2E6NA 1XQHA 1G2BA 1IHWA 1GCQA 1PKSA 1V1CA 1K0SA 3VS5A 3REAB 1DJ7B 3OBWA 4QQDA 4C8QG 3UPUA 3JCMf 1AWXA 2F2VA 1YBYA 3NTKA 3EG3A 4EMKA 1PSEA 3F70A 3HSBA 1K4US 2SRCA 4A53A 4ATOA 4M75C 2QYZA 2AIRB 4C8QE 4XK8E 1VIEA 3L2WA 1WFWA 3E2UA 1PD0A 5DM7R 1RI0A 4JZ3A 2KI7A 4QVCA 3RMSA 1K9MU 1VQMA 2L2PA 5LL6S 2VC8A 3BY7A 2E65A 2WACA 3CCUA 1MV0B 2COZA 1B3QA 1W2BA 3VRZA 1KIKA 1M5Q1 2FZKB 2ZPGB 1VQOA 3A8OB 3EGXB 2DILA 1X75C 4IIOA 1YI2T 1YCSB 3A8GB 3NHNA 1QMCA 1Q82R 2YRCA 3RMQA 2KXDA 1Q7YC 2CP3A 4M7AG 2E5KA 3G71A 3JAME 2XD0A 4PJOA 2FRYA 4LD6A 1C0MA 1KSWA 2X4WA 4PK4A 2ZPIB 3FC3A 1F1BB 4Z88A 1ZSZC 3M55A 1TUDA 1GFCA 2FYKA 4PJJA 5FROA 2COWA 3CCRQ 2KROA 2LCSA 1KC8R 4C8QF 5FWCA 1Y71A 2YSQA 2DEUA 5J26A 3OYNA 1Y96B 1QVPA 3QZ5B 2JNGA 3GPLA 2DVJA 3SDZA 2X51A 1X69A 5KYWA 4GY5A 3M0SA 3LYIA 2EGAA 3G71Q 3META 1YJ9T 3UWNA 3H9NA 4M77E 1KC8U 4RTVA 3EHQA 1W70A 1YHQA 5GJWB 2DXTA 3HRTA 2FB7A 4A4HA 2RJFA 4ORZA 5GMKh 1G3YA 2LDMA 3WVEB 4PJOE 3GIBA 2HL5C 2JT4A 4BB7A 2HDAA 2CZ7B 1Q7YU 1K8AU 2A37A 1Q82U 5CKDA 1ABOA 4CC2A 4M75B 2MWOA 3BW1A 2O2OA 1C6VX 3SEMA 4B9XA 1U1SA 1Z9QA 4TVRA 3A8MB 2L3PA 4JJBA 1I5LA 2YRDA 5CO7A 4FM4B 1NG2A 3JCMe 8AT1B 2BE9B 1X6BA 2OTLQ 4FYYB 1W1FA 1QP3A 1VUBA 3VS3A 3OYBA 3L2QA 1OOTA 3T9NA 1UE9A 2DL3A 1N8RU 1OQKA 5CR2A 1YWPA 2JZ2A 4IUVA 3CC7A 3CCMT 1GXIE 4JS5A 3CD6Q 5KYNA 3OA6A 3CCQQ 3I55A 3G4ST 2DA9A 3DKMA 3I55T 2PUKB 1NM7A 2CZ6B 2BZXA 2IVWA 4QKUA 2AT1B 2QQSA 1Y96A 1BB9A 1WPYA 3A5ZB 2DL7A 4OMLA 1ZSZB 2LZ6B 1N5ZA 3MHXA 2ZPHB 1R8OB 1TTHB 3PIPA 4AMCA 3CC4T 2DYBA 3JSCA 2HBPA 5I2MA 1H92A 5LJ3j 1SRLA 4C5EA 1X2KA 2A08A 2EYZA 3DLLA 3JCMJ 3M0UA 3HP9A 2LMJA 1YITA 1FMKA 2RQTA 3BE3A 2BKDN 2L3SA 3VUZA 2EYYA 3EH2A 3EG2A 4BDYA 1M1GA 2RQVA 1D1AA 2GGRA 4C5IA 4M7DA 4EMHA 4P5NA 1QVFS 3SFMA 5M9OA 1G3WA 2VWFA 1IREB 1XNIA 1VQKQ 5FRMA 1VQ6T 1MMAA 1D0XA 1WA7A 2LJ0A 4C92B 4LD9K 2RH2A 4CC4B 2BZYA 4J9GA 3EAEA 4IUPA 4MZMA 2RPNA 4M77F 1OI1A 3QIIA 5EC7A 1WX6A 3QG1A 1PCXA 4NOYA 3IQLA 2JTEA 5KH6A 3CD6A 2RI3A 2RHZA 2KYMA 2JS2A 3CBPA 5DLOA 2C0OA 4ZNXA 3CPWS 4ZTFA 1D3BA 1TU0B 3CCRT 5GMKe 2L8DA 3PT9A 3OYFA 2ZZDA 2QEXA 1U3OA 1GBRA 3CCSQ 3A1PA 3N5BB 1WJSA 2X3WD 2CSIA 3G6EA 2RHYA 1WHJA 1G8XA 4FU6A 3EFOB 3S3OA 3E9FA 2HMAA 2QTVA 1WHLA 4M78B 1TXQA 3LX7A 1X27A 3CC2Q 5C6SA 1HYOA 2LQWA 3M5AA 7AT1B 1NE8A 1UFFA 2AK5A 4HCKA 2WSEE 2LTOA 2DXBA 4M7AB 1WZOA 4DQ2A 4M7DE 5CQXA 4OB3B 3RKWA 1AWOA 4N0AC 3Q1JA 2GNCA 6AT1B 1UB4A 3C4SA 3M0QA 4IUUA 1UJ0A 3EHRA 1GCQC 3VYGA 5GAMh 1VQPA 1SRMA 1RABB 4M7DG 1WXTA 1SHFA 2MOXA 1NJIR 1N9SA 2DL5A 1UUEA 5IT9E 1ZUUA 3S3MA 3E19A 1VQ5Q 3SWNC 2DL8A 2HKQB 3QJ6A 4YTLA 2M0YA 4DBRA 4FSSA 3JCMV 5FLXE 2ECZA 2M9UA 4GBQA 2YWWA 3CCQA 1X6GA 1JJ2S 2QQBA 1G3TA 4O5VA 5KYWB 2KGTA 4J9DA 5KYUB 3MPUB 1OULA 2P84A 4AG2C 4F14A 3JCMP 3VRYA 2BIVA 3LLRA 1MUZA 4CRIA 1VQ7T 2LJ1A 2J6KA 1RAAB 1M1KU 1SHGA 1WQ7A 2KRSA 3EG1A 3EG9B 4IIMA 2GTJA 4GLMA 5A0DA 4C92F 4RTWA 3M56A 4JJNK 4J83A 4KH0B 1Q86R 4OMMA 2DIQA 2PQWA 1OYXA 2FVUA 1Y57A 4PKCC 5LJ3d 2QQ9A 3M53A 2O9VA 5D6YA 2P0QA 3LGFA 3CPWP 4PFPA 2E64A 2LVMA 1ZA2B 3DB3A 1I4K1 3CCJT 4KUDK 2KMTA 1VQPT 3OS0A 2L5QA 2L3QA 1NEGA 2OAWA 2OTJT 3VUBA 4A4KA 3CCVT 2XHCA 1KQ2A 2KR3A 3AT1B 1B7TA 4ZGDB 2DRKA 3M4YA 4JJCA 3J7AF 1ZA1B 3FB9A 1WHGA 3ZEHA 3MKDA 1QKWA 2EQKA 5IN1A 3MP1A 1WDXA 4Y28E 3OW2A 1N8RR 4M7AC 2F5TX 4J6WA 1OZ2A 4ME7A 1SG5A 2RHUA 3L2RA 1HSQA 1BI1A 3A8LB 1JXMA 5GANd 1MMGA 2AHJB 2B8AA 1YIJQ 4NS5A 3CCLT 4WTOB 2YUQA 3CMEQ 1D1CA 2DXUA 5D7UA 2MPXC 2QEXQ 2OTLA 2KT1A 4L5GA 1IZ6A 2X4XA 1X2QA 2E6ZA 2O4XB 2JTFA 2A36A 4J9EA 2I0NA 1VQ4A 2EYQA 1C1AA 2ESWA 2KXCA 4BI4A 2ZPBB 4DA4A 2HSEB 2AZVA 1G83A 5CKFA 2XDPA 4HVVA 2YRVA 1YN8A 2KNBB 1HD3A 3ZFJA 2CT4A 2O01E 1VQLQ 3OSSC 4EPCA 3M58A 2G3RA 2RQRA 2VUBA 1TH7A 3FJPA 4PFZA 3TSZA 1PRLC 1EZZB 3H0IA 4M7DD 4UC4A 4AG1C 3RIRA 2E5QA 1K8AC 1BCMA 3BDUA 2W0ZA 4BE0A 1BBZA 4B6MA 3FRNA 5GANj 3TCJA 1YITQ 2DLPA 5FU7C 2WSFE 4C0DC 1M90R 5FWBA 4M7AF 1JB0E 1QVGP 4KULA 1KD1U 2EGCA 3G4SQ 2QTXA 4M78G 1BK2A 3OYIA 1LVKA 1N6AA 4PLIA 1Q82C 1BYMA 4A63B 4V2SA 1U06A 2DD4A 2H8HA 4XTYA 1JRIA 1FX7A 4RMOA 5I11A 3OS1A 2DO3A 1TS9A 1NPRA 2FHDA 1K9AA 1UTIA 1WHHA 3VV0A 3PTAA 1IHVA 1W6XA 1O9SA 1H8KA 5GMKj 2YLCA 3I56A 1ZSZA 4JLIA 4FW2A 4BACA 2B86A 1LOJA 2FPEA 2G6FX 3OYKA 1NEBA 1JU5C 4M7DF 4DBHA 3H6ZA 4PJOG 4KGXB 3HPWA 3JB9D 5LJ5j 1W4SA 1WNLA 4EMKB 4HKEA 4PJOB 1RAHB 1OV3A 2D1XA 4LNPA 2MAMA 2PTKA 3CC2T 3EGDA 4F7UA 1YJNQ 2AZSA 2EKOA 2F1LA 3KFVA 5LJ3h 3CCVA 1M2VB 2HD0A 5HY6A 1WGSA 3A8HB 2KDSA 1OX9A 3X25B 1Q81C 2JTMA 1YIJT 3ER0A 1VYVA 3PGGA 3UT1A 1J3TA 2CP7A 4D6WA 5FW9A 3D7SB 4E47A 1T0HA 2DBMA 1YP5A 3PMIA 5I22A 2MCNA 1BI0A 3A98A 3OYCA 2MF2A 2FO0A 2BZ8A 1PD1A 1JBMA 2RQUA 1GFDA 3L2ZA 3QYGB 1QWFA 1VQ7Q 1S1NA 1R0CB 2E3HA 2ENMA 1U5SA 5IAYA 2YHTA 3EGDB 4MMKA 4N4GA 4F7UB 3JCMd 2QA4T 1BI3A 3L2UA 4OB2B 1UGPB 4LDWA 3X24B 4M7AA 2CYZB 1K73R 3QJYA 1ABQA 2L89A 1V76A 3FIFA 3OBYA 4MMLA 2CSQA 4E7JA 1X01A 2XMFA 2K7AA 4JRPA 2DTIA 3QZ9B 4JPBW 1LNXA 2DF6A 3NTIA 2CH4W 5LJ5d 4LDYA 3OY9A 3NMZC 2NUZA 1KJWA 2QEXT 1ZBXA 1QQJA 2ZAEA 2ZCFB 1K73C 2RD1A 1G5VA 3CCLQ 1JJ2A 4LE9A 3UA7A 3M0RA 4XU2A 1N27A 2HSPA 1MHNA 2NUPA 3OW2P 4RTZA 5GANe 2K3XA 2CUBA 5HK3A 4EDUA 4HXJA 2QG9B 1WHKA 1FMVA 4KGZB 5GMKl 1VQ9Q 3C95A 3AHUA 2QA4Q 1NYFA 1OU8A 1RACB 2E41A 1M90C 2RQWA 2DJZA 2HQXA 3X28B 2EVRA 5LJ3g 2V1QA 1SEMA 3V8KA 1M3BA 1UEBA 1ZUYA 2NUTB 1K0XA 2KSSA 3LWIA 2DIGA 1CKAA 2LNHB 2P4RA 1ZUKA 2KRMA 3GNGA 4FT2A 2DAQA 2CS7A 2BE7D 4PFOA 3OYYA 3QO3A 4M7AD 1IGUA 1IRXA 3CCSA 1UGRB 4RKUE 2QDLA 4Z02A 4C92E 1GRIA 1VQ9A 2A7YA 3QPHA 4NL2A 2CT3A 3OB9A 1NJIC 3CPFA 2MIOA 2JS0A 4LUDA 1LPLA 1I81A 2CZ0B 3OYMA 3OYJA 3UA6A 2J6OA 2RM4A 4D8KA 1M30A 2EPDA 4WF2A 4OB1B 1VQ6Q 4M75G 3CPWA 4EIKA 4ZGEB 2XI9A 1WQWA 1LJOA 4AFUC 4ANJA 1PNJA 1MV3A 3CCST 1VQNA 3V7RA 3P8BB 3FDRA 3RNJA 2ROLA 2KBTA 1VYUA 4C92C 2RJEA 1O75A 4M75E 3CCEA 1Y0MA 5GAMf 1V29B 1E6HA 1WXUA 2HNIA 1MMNA 5CKEA 1VOMA 2QI2A 3VS7A 3VS2A 2ROTA 2DL4A 2GBQA 3VJPA 2M0OA 2OJ2A 2NUPB 3PMTA 1Y07A 4HVUA 2IG0A 5FU7B 3CC4Q 1QKXA 1KHCA 3ASKA 1GCPA 3C12A 3E9GA 1AT1B 1BIAA 4HCZA 2NWMA
chains in the Genus database with same CATH topology
3C94A 2LT4A 3V7CA 5FRNA 5LJ5g 2DZCA 2ZPEB 3GP8A 4CRIA 2PVDB 4DOVA 1VQ7T 3OYGA 4M77A 2C06A 3CCUT 2DTHA 2M16A 2EIFA 3QDRB 5GAOn 4M7DC 1UGSB 1M1KU 2EWNA 4BUGA 3HRUA 4JRKA 1WQ7A 2P0KA 2EAYA 4FSXA 4C8QA 4RCCA 2E1HA 4RG2A 4XU3A 1FXXA 2WSCE 5HK0A 5HKCA 1XOVA 1VQMT 3DLMA 5D6WA 5A0DA 4J8OA 4C92F 5GAMe 5GAOm 4OB0B 4QVDA 3SWNA 2JUFA 3M56A 4VUBA 4L59A 4ZN1A 4GLKA 1HK9A 2DKGA 4J83A 4XTXA 3UDCA 4NL3A 4XU1A 2EQUA 2DPPB 3CC4A 1Q86U 3CC2A 2XDBA 4M77D 1YJNA 1VQ4T 2DIQA 1YI2A 2D0QB 2LNVA 1OYXA 2PQWA 2FVUA 4MZPA 4N0AA 4OMFB 4A4GA 4C0ZA 4PKCC 1QVFA 5LJ3d 2QQ9A 3M53A 3QYHB 1PSFA 4M78A 2E6NA 5D6YA 1XQHA 2P0QA 3JCMh 3LGFA 4EMGA 3SB2A 4PJOF 1VQLT 4M78E 4XTWA 4ELYC 1N9RA 3QBYA 1DJ7B 2E64A 2LVMA 2R58A 3DB3A 3OBWA 4QQDA 4RCBA 2NLUA 3JCMf 3JCMQ 4MDXA 1YIJA 1I4K1 3CCJT 1VQ8T 1YBYA 4KUDK 3NTKA 2K4YA 2KMTA 1VQPT 3OS0A 2L5QA 4HCZA 4EMKA 3JB9I 1PSEA 1Y7XA 1P92A 3F70A 1Q81U 3VUBA 4A4KA 2EFIA 3HSBA 3CCVT 4M7AE 2XHCA 1KQ2A 4A53A 4ATOA 4M75C 2XKOC 3EFRA 4ZGDB 2RK1A 4M7DB 1U1TA 2JVVA 3M4YA 2GF7A 2VGNA 3MEVA 3J7AF 3FB9A 4C8QE 4XK8E 1VIEA 3RERA 3I55T 5LJ5e 3L2WA 4FL6A 2E10A 3OYLA 2GCXA 3ZEHA 5DM7R 1VIFA 1RI0A 2EQKA 1XTDA 5IN1A 3MP1A 4M7AC 4Y28E 3OW2A 2F5TX 4LDUA 4J6WA 1ZHIA 1OZ2A 4QVCA 4MZTA 3RMSA 4ME7A 1K9MU 5LJ3f 1VQMA 3TU4K 1W2BS 2RHUA 3L2RA 1YCYA 1BI1A 4IUTA 1I8FA 3PNWC 2VC8A 5LL6S 3A8LB 5GMKm 3BY7A 1B34B 4E7KA 5GANd 2AHJB 2DXCA 4JUVA 2B8AA 2E65A 3URGA 4NS5A 3UPUA 1U8RA 2WACA 3OS2A 2OAUA 3CCLT 3CCUA 2R5AA 2QQRA 3CCMA 2DXUA 1W2BA 1NPPA 1N8RC 3X26B 5A2QE 2OTLA 5GAMd 4L5GA 1KC8C 3FEOA 1VQ6A 1M5Q1 2ZPGB 4M75D 1VQOA 1IZ6A 2RJCA 3OYDA 2X4XA 3A8OB 2E6ZA 3BFMA 2K2VA 2O4XB 2JTFA 4QQ6A 4C92A 2VV5A 3BDLA 4C0GA 1X75C 5GAN4 2ZPFB 5FU6B 3OYEA 3MEAA 1VQ4A 1YI2T 3A8GB 1EIFA 3JCMW 1KQSS 2EYQA 2DVEA 3J80E 2LQKA 3OMCA 4BI4A 4M77G 3RMQA 2ZPBB 4F7UF 4DA4A 1Q7YC 4M7AG 3G71A 5DLQE 4JS4A 3JAME 2DEQA 2XG8D 2XD0A 1NZ9A 5GAOq 3ME9A 3M54A 1M1FA 3PFSA 4LD6A 4PJOA 5CKFA 2XDPA 1NJIU 2X4WA 2ZPIB 3FC3A 2YRVA 1WJQA 1ZQ1A 1VQ5A 2BUDA 4XTZA 3ZFJA 3JCMX 3JB9J 3M55A 3CMEA 2O01E 2ZGWA 2XIDA 4BD3A 2MWPA 1UGQB 2FYKA 2RA2A 3M57A 4R55A 5FROA 3OSSC 4EPCA 2RO0A 4N4IA 3M58A 2G3RA 4C8QF 2VUBA 3CCJA 1VQ8A 1Y71A 3VU3C 1TH7A 2KVQG 3FJPA 3H8ZA 4JLGA 4LDXA 4JDSA 5J26A 1KQSA 2R57A 2O4XA 4HA8A 3OYNA 1Y96B 1QVPA 3HRSA 3QZ5B 3MCAB 4M7DD 4UC4A 4A4FA 2PVGB 2JNGA 2HQEA 3GPLA 3SDZA 2VXEA 3G7ZA 3RIRA 2CKKA 2E5QA 3P8HA 1K8AC 2EJ9A 4GY5A 2LCLA 2MMPA 3OQ5A 3BDUA 4BE0A 3LYIA 2R5MA 4E7LA 2E70A 2RJDA 2EJFA 3FRNA 5GMKi 3MO8A 5GANj 4PJOD 4ZN3A 4HT9A 3TCJA 3META 4XQ3A 1YJ9T 3UWNA 4M77E 5FU7C 1KC8U 2P4TA 1SSFA 3V8JA 2WSFE 5A0LA 4C0DC 4JRQA 1JB0E 1YHQA 4KULA 3CCET 4M7AF 3WXMB 2DXTA 3HRTA 2FB7A 4A4HA 1VQ9T 3RESA 1KD1U 3MEWA 1D3BB 2QTXA 3CBOA 2RJFA 4M78G 2GFAA 4L6V5 3OYIA 2VXFA 5GMKh 1G3YA 3S3NA 3G71T 4OVAA 1N6AA 3CMAA 3OW2S 4PLIA 2LDMA 3WVEB 1Q86C 3M4GA 3GNFB 1Q82C 3GIBA 4PJOE 5GAN6 4BB7A 1BYMA 5GANf 4BE1A 2CZ7B 1Q7YU 1K8AU 4V2SA 2DD4A 3HFNA 3M9QA 5EG2A 4II1A 4OF1A 4XTYA 1JRIA 3MP6A 4O6JA 4JRIA 1Q82U 1FX7A 5CKDA 2QA4A 2I2LA 1VQKA 2X35A 4IUQA 4M75B 2MWOA 3BW1A 5GANh 4RMOA 1BKBA 4Q5WA 3KXTA 3OS1A 2DO3A 1U1SA 4B9XA 2GQVA 2RI2A 5LJ5h 1NPRA 2X4JA 4TVRA 2FHDA 3INZA 3A8MB 2RK2A 2P0PA 1VQOT 1VQ5T 4QQGA 4X9DA 3OYAA 5CAIA 3ZBDA 5LJ5f 3VV0A 2EQMA 4M75F 3PTAA 1I5LA 2RHXA 4PNOA 4F7UG 5CO7A 1O9SA 4FM4B 3GLXA 3OS5A 4IKFA 5KCOA 3R6OA 5CIUA 3JCMe 5GMKj 2YLCA 4C0DB 2QDYB 3I56A 5GAOr 3RUXA 4BY6B 5GAOl 4JLIA 4BACA 1AHJB 1LOJA 1QP3A 3M59A 1VUBA 3OYKA 3OYBA 3L2QA 5AYFA 3T9NA 3RKYA 5FU7B 1M4ZA 4M7DF 1OZ3A 3MEUA 1N8RU 1VQNT 3CCRT 3H6ZA 4F7UE 4X34A 2XICA 4PJOG 5CR2A 3HPWA 3JB9D 2E12A 5LJ5j 3HHTB 2JZ2A 4IUVA 1W4SA 1WNLA 4EMKB 4HKEA 4PJOB 4J7IA 3OSVA 4QW2A 3CC7A 2XDDA 2MAMA 3CCMT 1GXIE 4JS5A 3CC2T 4F7UA 2DTOA 4C92G 4ZTJA 2EKOA 4QVZA 5LJ3h 3CCVA 5LJ3e 3OA6A 2HD0A 5HY6A 1WGSA 2OTJA 3A8HB 2LX9A 2KDSA 3X25B 5GAN3 1Q81C 3I55A 2JTMA 3WVDB 3G4ST 1YIJT 3ER0A 3DKMA 3OMGA 5CVIA 2JOYA 2PUKB 3PGGA 4J6XA 1QW1A 2CZ6B 3UT1A 2IVWA 2QQSA 4C8QG 3QXEB 1Y96A 4D6WA 2K5FA 1KQ1A 1WPYA 3A5ZB 1G3SA 4E47A 3S6WA 3PMIA 5J39A 2KQWA 4XTUA 1M8VA 3LWHA 1BI0A 2RB6A 3MHXA 5KE3A 1VQ7A 2ZPHB 3OYCA 2DZ9A 2M1HA 4C8QC 1K73C 1R8OB 2L3RA 2MF2A 3PIPA 1RL2A 2GFUA 2F5KA 3GF5A 4X9CA 3L1AA 3HKSA 1JBMA 4BDZA 3CC4T 3L2ZA 3QYGB 1M9SA 3JSCA 2Y4XA 2HBPA 2LT1A 5I2MA 5LJ3j 4M77B 4J7FA 4C5EA 4E7IA 5A0GA 3TREA 5KCHA 3JCMJ 3DLLA 3CMAT 1M90U 5IAYA 2YHTA 4MMKA 4EMKC 4N4GA 4F7UB 3JCMd 4A54A 2QA4T 1M1KC 1BI3A 2CGHA 3L2UA 3HP9A 4XU0A 1YITA 4OB2B 4M75A 3V7SA 1UGPB 4LDWA 4OP0A 5CQYA 5CKBA 3CXCA 3X24B 2BKDN 4M7AA 2CYZB 2K5IA 3QJYA 5C0MA 2L89A 3QSUA 2K5LA 3FIFA 3OBYA 3VUZA 4MMLA 2QQAA 1H3ZA 4BDYA 4E7JA 3G6ET 1M1GA 4XAXB 1X01A 1YJNT 1H641 3QHSA 5CK9A 2A3LA 1QVFS 2DD5A 4JRPA 2DTIA 3QZ9B 4J5YA 1LNXA 3LGLA 1QP2A 3NTIA 4KUIA 4J6YA 4C5IA 5LJ5d 4LDYA 3OY9A 4M7DA 4EMHA 4BY6C 2QEXT 1ZBXA 4P5NA 1VQKT 2ZCFB 2V8KA 2DK3A 4FT4A 4OGCA 3SFMA 3DB4A 5M9OA 2RD1A 1MGQA 1G3WA 3CCQT 2KK4A 3L2VA 1G5VA 1BIBA 1IREB 1XNIA 1JJ2A 5FRMA 4XU2A 5I21A 1VQ6T 1N27A 1MHNA 3QUIA 4LD9K 4C92B 2YLBA 1K73U 2RH2A 1S72A 2EJGA 3CBMA 5GANe 4ZGJB 4PJOC 4BI8B 4FIBA 4M78C 2K3XA 4KBMB 2D6FA 5HK3A 4EDUA 3EAEA 4HCBA 4IUPA 2V8IA 4MZMA 4JJNK 4M77F 2PUOB 1OI1A 3QIIA 5GMKl 3QG1A 1KG1A 3C95A 4NOYA 3CC7T 3AHUA 2F69A 3GOXA 4R56A 3JB9F 3RKXA 5KH6A 3CD6A 2RI3A 5L8RE 2RHZA 1FWZA 4C5GA 3EFSA 3NTHA 4RG8A 3JRZA 2LQ8A 3CBPA 4OGEA 5DLOA 1QVGA 2E41A 3CPWS 1M90C 4ZTFA 5GAMg 5GAN2 1D3BA 3OYHA 4PL6A 5GMKe 2DJZA 2HQXA 2L8DA 3PT9A 4MDWA 3X28B 5LJ3g 2XK0A 5CKHA 3OYFA 2ZZDA 2QEXA 3V8KA 1UEBA 2KSSA 3CEYA 1YJWA 3PIOA 3N5BB 1WJSA 2VGMA 2DIGA 3LWIA 3G6EA 3CXCS 1YJWT 2RHYA 3GNGA 1X6OA 4FT2A 2DAQA 5D6XA 2CS7A 4FU6A 3V8LA 2PU9B 3OYYA 3QO3A 4M7AD 3X20B 3S3OA 3CCSA 2JN0A 1UGRB 4RKUE 3E9FA 4BI3A 2K57A 4Z02A 4C92E 1VQ9A 2A7YA 4DOWA 3SWNB 3QPHA 4NL2A 4KT0E 4M78B 2VYTA 3LX7A 4XTVA 5GAOp 3OB9A 5C6SA 1NJIC 4A4EA 1YITT 3M5AA 3CPFA 5J3BA 4M78D 4C5HA 3LH0A 2H3JA 3JB9H 1NE8A 2LC4A 3NFCA 1I81A 2CZ0B 3JCMb 3E1SA 3OYMA 3OYJA 3G4SA 3JCMg 2RM4A 2WSEE 2LTOA 4BE2A 2DXBA 2Y90A 4M7AB 2RI5A 3KBGA 2KAFA 2PVOB 3TEEA 4WF2A 4OB1B 4DQ2A 2D9TA 4ELZC 1HXDA 3O8VA 4M75G 5CQXA 4OB3B 3RKWA 3CPWA 4M7DE 2LRQA 3L42A 4ZGEB 3CCRA 1KHIA 4N0AC 2XI9A 1WQWA 4C8QB 1LJOA 3Q1JA 5DY9A 1K9MC 2V8JA 1UB4A 3C4SA 5GAN8 4IUUA 4HT8A 4M78F 3CD6T 2X4YA 3CCST 3VKIA 3VYGA 2QXFA 4IURA 3V7RA 3KUFA 2OTLT 2XU8A 3P8BB 1VQNA 5GAN7 3FDRA 5GAMh 1VQPA 1YJ9A 4C92C 3J81E 4M77C 2RJEA 1O75A 4E7HA 2CZ1B 1QVGS 3CCLA 4B9WA 4M75E 4HCCA 4M7DG 3FLGA 3CMET 3CCEA 1YHQT 5GAMf 1V29B 5I2SA 4CI0C 4LDVA 4C92D 3I56T 2HNIA 1N9SA 5CKEA 3SD4A 5FU6C 4N4HA 5IT9E 2QI2A 3S3MA 3E19A 5GAN5 2FL7A 3SWNC 3QJ6A 1S72T 1KD1C 4YTLA 2K3YA 4C0FA 3VJPA 2M0OA 3MP8A 3QKJA 2OTJT 3PMTA 5GANg 1WJRA 3JCMV 5FLXE 3JB9G 1VQLA 2M9UA 1Y07A 2HAXA 4Y91A 3CCQA 2EQJA 5KE2A 2IG0A 5CCAA 2KY9A 2MI6A 3P8DA 1JJ2S 2RHIA 3HFOA 2QQBA 1BI2A 1B34A 1G3TA 1KHCA 3HL8A 4O5VA 3ASKA 3LW5E 4PLLA 3C12A 4C8QD 2Y4YA 3VYHB 3JCMc 5GAMj 3E9GA 2LCCA 3JCMP 1BIAA 2BIVA 3LLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRN A;  3GOX A;  1OZ3 A;  3OMC A;  3MEU A;  5KH6 A;  4CRI A;  3H6Z A;  4X34 A;  2RI3 A;  2RHZ A;  4C5G A;  3OYG A;  2JZ2 A;  4IUV A;  3NTH A;  2M16 A;  3ME9 A;  3PFS A;  4LD6 A;  2XDP A;  4QW2 A;  2X4W A;  3FC3 A;  2YRV A;  1WJQ A;  2P0K A;  4ZTF A;  2BUD A;  3OYH A;  4PL6 A;  2HQX A;  2L8D A;  4RG2 A;  3OYF A;  4ZTJ A;  2EKO A;  2XK0 A;  4BD3 A;  2MWP A;  3DLM A;  4QVZ A;  5D6W A;  3OA6 A;  3CEY A;  5FRO A;  1WGS A;  1WJS A;  2DIG A;  2RO0 A;  4N4I A;  2G3R A;  4L59 A;  2RHY A;  2EQU A;  3OMG A;  2DAQ A;  3H8Z A;  5D6X A;  3UT1 A;  4FU6 A;  5J26 A;  2DIQ A;  2QQS A;  2O4X A;  2R57 A;  3OYN A;  2PQW A;  1OYX A;  3S3O A;  4A4G A;  4UC4 A;  3S6W A;  4A4F A;  3E9F A;  3PMI A;  2HQE A;  5J39 A;  4Z02 A;  2E6N A;  5D6Y A;  2CKK A;  2E5Q A;  3P8H A;  3LGF A;  5KE3 A;  2VYT A;  3LX7 A;  3OYC A;  2M1H A;  3OB9 A;  4GY5 A;  4A4E A;  5C6S A;  3OQ5 A;  2L3R A;  4BE0 A;  3LYI A;  2R5M A;  3QBY A;  2R58 A;  2GFU A;  2F5K A;  2LVM A;  2RJD A;  3DB3 A;  3LH0 A;  4QQD A;  2NLU A;  3MO8 A;  4C5H A;  4BDZ A;  3OYM A;  3OYJ A;  3MET A;  3NTK A;  4BE2 A;  2LTO A;  3UWN A;  3OS0 A;  4HCZ A;  1SSF A;  2RI5 A;  3F70 A;  4C5E A;  4E7I A;  5KCH A;  2EFI A;  2D9T A;  3O8V A;  5IAY A;  4A4H A;  4N4G A;  2LRQ A;  3L42 A;  3MEW A;  3L2U A;  2RJF A;  3Q1J A;  2GF7 A;  3MEV A;  2GFA A;  3OYI A;  3C4S A;  2BKD N;  4IUU A;  3S3N A;  3L2W A;  4OVA A;  5C0M A;  4FL6 A;  3OYL A;  2L89 A;  4PLI A;  2LDM A;  3ZEH A;  2X4Y A;  1RI0 A;  2EQK A;  4IUR A;  3KUF A;  1H3Z A;  5IN1 A;  4BDY A;  3MP1 A;  4E7J A;  3FDR A;  4BE1 A;  1OZ2 A;  3M9Q A;  2RJE A;  4II1 A;  4E7L A;  3MP6 A;  4E7H A;  4B9W A;  2X35 A;  3FLG A;  3LGL A;  4IUQ A;  2RHU A;  3NTI A;  3L2R A;  2MWO A;  4IUT A;  3PNW C;  4C5I A;  3OY9 A;  4Q5W A;  4E7K A;  3SD4 A;  3OS1 A;  4B9X A;  4N4H A;  2RI2 A;  2B8A A;  3S3M A;  4NS5 A;  5M9O A;  2FHD A;  2WAC A;  3DB4 A;  3QJ6 A;  3OS2 A;  2K3Y A;  2R5A A;  3L2V A;  1G5V A;  1XNI A;  2QQR A;  2M0O A;  4QQG A;  3MP8 A;  3QKJ A;  3OYA A;  5FRM A;  3PMT A;  1WJR A;  1N27 A;  2EQM A;  1MHN A;  2RHX A;  3FEO A;  4IKF A;  2RJC A;  2EQJ A;  2X4X A;  2IG0 A;  5CIU A;  3P8D A;  5KE2 A;  5KCO A;  3OYD A;  2RHI A;  1KHC A;  2O4X B;  4PLL A;  2JTF A;  2K3X A;  3ASK A;  4QQ6 A;  3BDL A;  4EDU A;  3EAE A;  3OYE A;  4BAC A;  3MEA A;  4IUP A;  3E9G A;  2LCC A;  3OYK A;  3OYB A;  3L2Q A;  1OI1 A;  2BIV A;  3QII A;  3LLR A; 
#chains in the Genus database with same CATH topology
 1JQQ A;  2NYS A;  5FRN A;  2FZG B;  2PVD B;  2JXB A;  3OYG A;  1AOJ A;  1RUW A;  1TSF A;  4BUG A;  1H3H A;  2O31 A;  2EAY A;  2P0K A;  4FSX A;  4C8Q A;  5HK0 A;  2E1H A;  4RG2 A;  1FXX A;  2WSC E;  2ED1 A;  1VQM T;  3DLM A;  1D1B A;  1I1J A;  1E6G A;  3SWN A;  2JUF A;  4VUB A;  4L59 A;  4ZN1 A;  4FCY A;  1HK9 A;  4XTX A;  1RAG B;  1UEC A;  1VA7 A;  3UDC A;  1Z9Z A;  1NBE B;  1Q86 U;  2RN8 A;  3H0H A;  1YJN A;  2CH4 A;  2D0Q B;  4MZP A;  4A4G A;  1QVF A;  1PSF A;  2EYX A;  3VS1 A;  4EMG A;  1VQM Q;  4RUG A;  3SB2 A;  4PJO F;  1VQL T;  4M78 E;  4XTW A;  1N9R A;  4RCB A;  3JCM Q;  1Q7Y R;  4MDX A;  1ARK A;  1VQ8 T;  2J06 A;  3JB9 I;  1Y7X A;  4M7A E;  2XKO C;  3TQ7 P;  4M7D B;  2JMA A;  1U1T A;  1K76 A;  1UDL A;  2JVV A;  3I55 Q;  1M8M A;  1VQ8 Q;  3RER A;  4RTY A;  1LCK A;  1MND A;  2E10 A;  3TSW A;  1XTD A;  2QGF B;  3CQT A;  2DBK A;  3CCM Q;  5LJ3 f;  4KRT A;  1W2B S;  4IUT A;  1I8F A;  3EGU A;  1I07 A;  3I5S A;  2DXC A;  4JUV A;  3URG A;  3OS2 A;  2QQR A;  1SF9 A;  3X26 B;  5A2Q E;  1GBQ A;  5GAM d;  5IXF A;  3FEO A;  3OYD A;  5AT1 B;  1QLY A;  4C92 A;  2VV5 A;  5GAN 4;  2ZPF B;  3OYE A;  4QT7 A;  3MEA A;  2CP2 A;  2IIM A;  2QAS A;  1EIF A;  3JCM W;  1KQS S;  2HBW A;  2LQK A;  4E6R A;  2OI3 A;  4F7U F;  2LX7 A;  1BU1 A;  1VYT A;  3CCV Q;  4JS4 A;  1MMD A;  2DEQ A;  1NZ9 A;  3ME9 A;  3PFS A;  1NJI U;  4Z8A A;  4FYV B;  1VQ5 A;  2PZ1 A;  2X3X D;  2BUD A;  3PE0 A;  3JCM X;  3JB9 J;  5IHK A;  3EGX A;  4BD3 A;  1UGQ B;  2RA2 A;  1M27 C;  2DX1 A;  4N4I A;  3CCJ A;  4RTU A;  2SEM A;  2KVQ G;  4JLG A;  4JDS A;  1KQS A;  2R57 A;  4HA8 A;  3HRS A;  3MCA B;  2W10 A;  2HQE A;  2VXE A;  3G7Z A;  2VB6 A;  2CKK A;  1M3C A;  2YUP A;  4OMO A;  1YI2 Q;  2R5M A;  2E70 A;  5GMK i;  2EJF A;  4PJO D;  5IH2 A;  3G1J A;  2O9S A;  2JMC A;  1SSF A;  5A0L A;  3EG9 A;  4JRQ A;  3WXM B;  2QAZ A;  1VQ9 T;  1K1Z A;  1YJ9 Q;  2DNU A;  2VXF A;  2CRE A;  3S3N A;  3G71 T;  4OVA A;  3CMA A;  1Q86 C;  3M4G A;  3GNF B;  2M02 A;  2HKN A;  5GAN f;  2VKN A;  1ZX6 A;  4K11 A;  1I5O B;  3M9Q A;  2COY A;  4II1 A;  4OF1 A;  3MP6 A;  1CKB A;  2QA4 A;  1E7O A;  2I2L A;  2X35 A;  5GAN h;  3NPF A;  2F2X A;  1BKB A;  3KXT A;  5KYX B;  1VQO Q;  2RI2 A;  5LJ5 h;  2X4J A;  3INZ A;  2K79 A;  4DEX A;  2P0P A;  1VQO T;  4QQG A;  4X9D A;  3R6N A;  5LJ5 f;  4M75 F;  4F7U G;  1SSH A;  1WXB A;  3OS5 A;  4IKF A;  5KCO A;  3R6O A;  2HQH A;  5GAO r;  4BY6 B;  3I35 A;  1AHJ B;  3M59 A;  4PJL A;  1RLP C;  2ED0 A;  4FYX B;  1M4Z A;  1OZ3 A;  5IHN A;  4ESR A;  4F7U E;  4X34 A;  3QDF A;  4JZ4 A;  3HHT B;  1RAI B;  3OSV A;  2VVK A;  4J7I A;  4QW2 A;  3ZL7 C;  1AWW A;  2DTO A;  4LN2 A;  4C92 G;  4ZTJ A;  4QVZ A;  3RR6 A;  5LJ3 e;  2LX9 A;  4D8D A;  5KYY A;  3WVD B;  2DJQ A;  5CVI A;  1FYN A;  4J6X A;  4AFQ C;  2K5F A;  1KQ1 A;  2EGE A;  1G3S A;  1I0C A;  2KQW A;  4XTU A;  1M8V A;  1D09 B;  1VQ7 A;  5KE3 A;  2M1H A;  4C8Q C;  1RL2 A;  1YFN A;  2GFU A;  4X9C A;  3L1A A;  3CCU Q;  2JJ9 A;  2LQN A;  2Y4X A;  2LT1 A;  4E7I A;  4J7F A;  5KCH A;  1PG5 B;  4XU0 A;  4HVW A;  4OP0 A;  5CKB A;  4AT1 B;  1D0Y A;  2K5I A;  2NUT A;  1PC0 A;  3QSU A;  5L23 A;  2C0T A;  2QQA A;  1H3Z A;  3G6E T;  4DEY A;  3QHS A;  2RNA A;  4FW1 A;  2DD5 A;  2DRM A;  4J5Y A;  3ULR B;  2HEQ A;  4J6Y A;  3O5Z A;  2V8K A;  1D0Z A;  4FT4 A;  2KK4 A;  1BIB A;  2YDL A;  2DYI A;  1MNE A;  2AKL A;  1S72 A;  2H3E B;  2EJG A;  2YT6 A;  4ZGJ B;  4PJO C;  4FIB A;  4M78 C;  2D6F A;  2QGG A;  2PUO B;  3CC7 T;  2F69 A;  3GOX A;  3JB9 F;  2EBP A;  4E7S A;  1PWT A;  2EQI A;  5L8R E;  3H41 A;  4C5G A;  1IXD A;  3NTH A;  4RG8 A;  3JRZ A;  2LQ8 A;  4OGE A;  9ATC B;  1QVG A;  1RI9 A;  5GAM g;  2XK0 A;  5CKH A;  1QWE A;  1K9M R;  2E3I A;  3PIO A;  1YJW A;  2JM9 A;  1YJW T;  1S72 Q;  2OX7 A;  3FJ5 A;  5D6X A;  2PU9 B;  3U23 A;  5ECA A;  3I56 Q;  2JN0 A;  4BI3 A;  3SWN B;  4OMP A;  3QWY A;  2VYT A;  1M2V A;  1NLP C;  5J3B A;  4M78 D;  2IPO B;  3LH0 A;  2H3J A;  3JB9 H;  4DBQ A;  1RAE B;  2LC4 A;  3G4S A;  3JCM b;  4BE2 A;  1KQS P;  2RI5 A;  2PVO B;  2D9T A;  4ELZ C;  3O8V A;  1KHI A;  4C8Q B;  1ACM B;  2V8J A;  4OMQ A;  1IO6 A;  2X4Y A;  2QXF A;  2JM8 A;  1YJ9 A;  4KGV B;  4E7H A;  2CZ1 B;  3M0P A;  3CME T;  1YHQ T;  1WLP B;  2D0N A;  4CC7 A;  4LDV A;  4C92 D;  2K6D A;  2HL3 A;  2E4H A;  3SD4 A;  2C0I A;  4N4H A;  5FU6 C;  2F2W A;  5IXB A;  2FPD A;  1PM3 A;  5GAN 5;  1W2B P;  1KD1 C;  2K3Y A;  3MP8 A;  2AKK A;  5GAN g;  3JB9 G;  1AEY A;  4Y91 A;  2MI6 A;  3HFO A;  1AVZ C;  1QCO A;  2MK5 A;  3LW5 E;  4OMN A;  4C8Q D;  2Y4Y A;  3VYH B;  3JCM c;  5GAM j;  2LCC A;  2VAS A;  5LJ5 g;  2DZC A;  3GP8 A;  1OX8 A;  4DOV A;  8ATC B;  3QDR B;  5GAO n;  2FEI A;  3HRU A;  4JRK A;  4XU3 A;  1XOV A;  3H0F A;  1SPK A;  5D6W A;  4J8O A;  5GAM e;  3VS6 A;  2DKG A;  4XU1 A;  2EQU A;  2DPP B;  3CC2 A;  2EYW A;  1YI2 A;  4N0A A;  4OMF B;  1R0B G;  1IGQ A;  3JCM h;  2PNI A;  4CC3 A;  4ELY C;  3QBY A;  2R58 A;  2NLU A;  1YIJ A;  2K4Y A;  1OU9 A;  1KFZ A;  1Q81 U;  1P92 A;  3CMA Q;  2EFI A;  3RBB B;  3EFR A;  2KEA A;  2RK1 A;  1AWJ A;  2GF7 A;  2VGN A;  3MEV A;  3CCJ Q;  4LUE A;  5LJ5 e;  4FL6 A;  3REB B;  3OYL A;  2GCX A;  1VIF A;  4J9C A;  1TWB A;  1QCN A;  4LDU A;  1ZHI A;  4MZT A;  2FG0 A;  3TU4 K;  3QWX X;  1AZG B;  2K9G A;  1YCY A;  5GMK m;  3PNW C;  3CXC P;  1B34 B;  4E7K A;  2D8H A;  3EH1 A;  1Q95 G;  1U8R A;  2OAU A;  5IHI A;  2DE0 X;  2R5A A;  3CCM A;  1NPP A;  1N8R C;  2FZC B;  2DMO A;  2HCK A;  1KC8 C;  1VQ6 A;  2J6F A;  1UHC A;  4M75 D;  4R0K A;  2RJC A;  3BFM A;  2K2V A;  4QQ6 A;  3BDL A;  1T3S A;  4C0G A;  3MJX A;  5FU6 B;  1OEB A;  2V26 A;  1VQN Q;  2DFU A;  1K8A R;  2DVE A;  3J80 E;  3OMC A;  4M77 G;  1YWO A;  5DLQ E;  2JW4 A;  2XG8 D;  5GAO q;  3M54 A;  1M1F A;  4F16 A;  2DM1 A;  1WJQ A;  1ZQ1 A;  2KT8 A;  4XTZ A;  3CME A;  2ZGW A;  1KD1 R;  2XID A;  2MWP A;  1XJW B;  3M57 A;  4R55 A;  2J7I A;  2RO0 A;  2J05 A;  1VQ8 A;  3VU3 C;  4LDX A;  3H8Z A;  2O4X A;  1VQ4 Q;  2KYB A;  4A4F A;  2PVG B;  1VQP Q;  4J9I A;  1M1K R;  3P8H A;  2EJ9 A;  2LCL A;  2MMP A;  3OQ5 A;  4J9H A;  4E7L A;  2LP5 A;  2RJD A;  3MO8 A;  1UGV A;  4ZN3 A;  4HT9 A;  2ABL A;  4XQ3 A;  2P4T A;  3V8J A;  1JXO A;  2GQI A;  3RDV A;  3HTR A;  3CCE T;  2RF0 A;  4F04 B;  3RES A;  3MEW A;  2CP5 A;  1D3B B;  3CBO A;  2GFA A;  4L6V 5;  2KRN A;  3OW2 S;  5GAN 6;  4BE1 A;  3HFN A;  5EG2 A;  4O6J A;  1EFN A;  2A28 A;  4JRI A;  1VQK A;  4IUQ A;  4E7Z A;  4Q5W A;  1M3A A;  1GL5 A;  2GQV A;  1PKT A;  1BCO A;  2RK2 A;  1VQ5 T;  1CSK A;  1X43 A;  3OYA A;  4KH1 B;  5CAI A;  3ZBD A;  3NGP A;  4RTT A;  2EQM A;  2RHX A;  4PNO A;  3GLX A;  5CIU A;  2L0A A;  1YNZ A;  4C0D B;  2QDY B;  3RUX A;  5GAO l;  1TOV A;  1UHF A;  1EX4 A;  2V1R A;  5AYF A;  3RKY A;  3MEU A;  1RAD B;  1VQN T;  1JEG A;  2XIC A;  2E12 A;  2BTT A;  2CP0 A;  2XDD A;  2X9H A;  2FRW A;  1TUG B;  5HCK A;  1A0N B;  2EW3 A;  4JJD A;  2OTJ A;  1NLO C;  2YUN A;  2QK0 A;  5GAN 3;  3OMG A;  2JOY A;  3LH5 A;  1QW1 A;  1RLQ C;  2Z0W A;  3EFO A;  3QXE B;  2MYS A;  1R77 A;  3S6W A;  5J39 A;  2FPF A;  5KYU A;  3LWH A;  2RB6 A;  2DZ9 A;  1TG0 A;  2L3R A;  1IB8 A;  2A0F B;  2F5K A;  3GF5 A;  2K3B A;  1FMW A;  3HKS A;  4BDZ A;  3EG0 A;  1M9S A;  1QVF P;  1TUC A;  4M77 B;  1QCF A;  5A0G A;  3TRE A;  3CMA T;  4EMK C;  1M1K C;  1YJW Q;  4A54 A;  2K2M A;  2CGH A;  4M75 A;  3V7S A;  5CQY A;  3CXC A;  5C0M A;  2K5L A;  1YHQ Q;  1WYX A;  1B07 A;  4XAX B;  1YJN T;  1H64 1;  5CK9 A;  2A3L A;  1ZSG A;  4M4Z A;  3LGL A;  1QP2 A;  4X1V A;  4KUI A;  4BY6 C;  1VQK T;  4J9F A;  1ZBJ A;  2DK3 A;  4PJN A;  4OGC A;  1M2O A;  3DB4 A;  3CCQ T;  1MGQ A;  1T0J A;  3L2V A;  3SHW A;  3UAT A;  4F17 A;  1PRM C;  5I21 A;  2CP6 A;  3QUI A;  2CUD A;  1K73 U;  2YLB A;  1RAF B;  3CBM A;  1HJD A;  4BI8 B;  4KBM B;  3VS4 A;  4WCI A;  4HCB A;  1UJY A;  2V8I A;  1KK7 A;  1UG1 A;  1KG1 A;  2HZY A;  4R56 A;  3RKX A;  1FWZ A;  3EFS A;  2OTJ Q;  2KE9 A;  3G6E Q;  1WIE A;  2O88 A;  4LXC A;  5GAN 2;  3OYH A;  2DER A;  4PL6 A;  4MDW A;  2YUO A;  3CEY A;  2VGM A;  4RTX A;  3CXC S;  1X6O A;  3V8L A;  4DBF A;  4Y92 A;  3X20 B;  1WHM A;  2LJ3 A;  2K57 A;  4DOW A;  3M0T A;  4XTV A;  4KT0 E;  1M90 U;  3TVT A;  5GAO p;  4A4E A;  1YIT T;  1Q81 R;  4C5H A;  3UF4 A;  3NFC A;  3E1S A;  3JCM g;  1AD5 A;  2Y90 A;  3PVL A;  2RMO A;  3KBG A;  2KAF A;  3TEE A;  1HXD A;  2LRQ A;  3L42 A;  3CCR A;  5KYY B;  1K9M C;  5DY9 A;  5GAN 8;  1OPK A;  1JJ2 P;  4HT8 A;  4M78 F;  3CD6 T;  1AZE A;  2CDT A;  3VKI A;  4IUR A;  3KUF A;  2OTL T;  2XU8 A;  5GAN 7;  1OPL A;  3I9Q A;  3J81 E;  4M77 C;  3GBQ A;  3I5R A;  3CCL A;  4B9W A;  4HCC A;  2ATC B;  3FLG A;  4FYW B;  5I2S A;  4CI0 C;  3I56 T;  1NYG A;  2FL7 A;  1S72 T;  4C0F A;  1ZLM A;  2EKH A;  5KYX A;  3QKJ A;  1WJR A;  3THK A;  1VQL A;  2HAX A;  2EQJ A;  5KE2 A;  5CCA A;  2KY9 A;  3P8D A;  4Z89 A;  2RHI A;  1BI2 A;  1B34 A;  4PLL A;  3HL8 A;  1PHT A;  5GJV B;  1T3L A;  1QVG S;  3CC7 Q;  4PJM A;  3C94 A;  2LT4 A;  3V7C A;  2ZPE B;  2GTO A;  4AFZ C;  2DET A;  3CCE Q;  2D8J A;  3C0C A;  4M77 A;  2C06 A;  3CCU T;  2DTH A;  2M16 A;  2EIF A;  3PVQ A;  4M7D C;  1UGS B;  4J9B A;  2EWN A;  1WI7 A;  1SKU B;  4E2F B;  4RCC A;  5HKC A;  3JV3 A;  5GAO m;  4OB0 B;  4QVD A;  4GLK A;  4NL3 A;  1JO8 A;  3CC4 A;  2M51 A;  2XDB A;  4M77 D;  1VQ4 T;  2YXY A;  2LNV A;  4C0Z A;  3VS0 A;  4AFS C;  3QYH B;  4M78 A;  2E6N A;  1XQH A;  1G2B A;  1IHW A;  1GCQ A;  1PKS A;  1V1C A;  1K0S A;  3VS5 A;  3REA B;  1DJ7 B;  3OBW A;  4QQD A;  4C8Q G;  3UPU A;  3JCM f;  1AWX A;  2F2V A;  1YBY A;  3NTK A;  3EG3 A;  4EMK A;  1PSE A;  3F70 A;  3HSB A;  1K4U S;  2SRC A;  4A53 A;  4ATO A;  4M75 C;  2QYZ A;  2AIR B;  4C8Q E;  4XK8 E;  1VIE A;  3L2W A;  1WFW A;  3E2U A;  1PD0 A;  5DM7 R;  1RI0 A;  4JZ3 A;  2KI7 A;  4QVC A;  3RMS A;  1K9M U;  1VQM A;  2L2P A;  5LL6 S;  2VC8 A;  3BY7 A;  2E65 A;  2WAC A;  3CCU A;  1MV0 B;  2COZ A;  1B3Q A;  1W2B A;  3VRZ A;  1KIK A;  1M5Q 1;  2FZK B;  2ZPG B;  1VQO A;  3A8O B;  3EGX B;  2DIL A;  1X75 C;  4IIO A;  1YI2 T;  1YCS B;  3A8G B;  3NHN A;  1QMC A;  1Q82 R;  2YRC A;  3RMQ A;  2KXD A;  1Q7Y C;  2CP3 A;  4M7A G;  2E5K A;  3G71 A;  3JAM E;  2XD0 A;  4PJO A;  2FRY A;  4LD6 A;  1C0M A;  1KSW A;  2X4W A;  4PK4 A;  2ZPI B;  3FC3 A;  1F1B B;  4Z88 A;  1ZSZ C;  3M55 A;  1TUD A;  1GFC A;  2FYK A;  4PJJ A;  5FRO A;  2COW A;  3CCR Q;  2KRO A;  2LCS A;  1KC8 R;  4C8Q F;  5FWC A;  1Y71 A;  2YSQ A;  2DEU A;  5J26 A;  3OYN A;  1Y96 B;  1QVP A;  3QZ5 B;  2JNG A;  3GPL A;  2DVJ A;  3SDZ A;  2X51 A;  1X69 A;  5KYW A;  4GY5 A;  3M0S A;  3LYI A;  2EGA A;  3G71 Q;  3MET A;  1YJ9 T;  3UWN A;  3H9N A;  4M77 E;  1KC8 U;  4RTV A;  3EHQ A;  1W70 A;  1YHQ A;  5GJW B;  2DXT A;  3HRT A;  2FB7 A;  4A4H A;  2RJF A;  4ORZ A;  5GMK h;  1G3Y A;  2LDM A;  3WVE B;  4PJO E;  3GIB A;  2HL5 C;  2JT4 A;  4BB7 A;  2HDA A;  2CZ7 B;  1Q7Y U;  1K8A U;  2A37 A;  1Q82 U;  5CKD A;  1ABO A;  4CC2 A;  4M75 B;  2MWO A;  3BW1 A;  2O2O A;  1C6V X;  3SEM A;  4B9X A;  1U1S A;  1Z9Q A;  4TVR A;  3A8M B;  2L3P A;  4JJB A;  1I5L A;  2YRD A;  5CO7 A;  4FM4 B;  1NG2 A;  3JCM e;  8AT1 B;  2BE9 B;  1X6B A;  2OTL Q;  4FYY B;  1W1F A;  1QP3 A;  1VUB A;  3VS3 A;  3OYB A;  3L2Q A;  1OOT A;  3T9N A;  1UE9 A;  2DL3 A;  1N8R U;  1OQK A;  5CR2 A;  1YWP A;  2JZ2 A;  4IUV A;  3CC7 A;  3CCM T;  1GXI E;  4JS5 A;  3CD6 Q;  5KYN A;  3OA6 A;  3CCQ Q;  3I55 A;  3G4S T;  2DA9 A;  3DKM A;  3I55 T;  2PUK B;  1NM7 A;  2CZ6 B;  2BZX A;  2IVW A;  4QKU A;  2AT1 B;  2QQS A;  1Y96 A;  1BB9 A;  1WPY A;  3A5Z B;  2DL7 A;  4OML A;  1ZSZ B;  2LZ6 B;  1N5Z A;  3MHX A;  2ZPH B;  1R8O B;  1TTH B;  3PIP A;  4AMC A;  3CC4 T;  2DYB A;  3JSC A;  2HBP A;  5I2M A;  1H92 A;  5LJ3 j;  1SRL A;  4C5E A;  1X2K A;  2A08 A;  2EYZ A;  3DLL A;  3JCM J;  3M0U A;  3HP9 A;  2LMJ A;  1YIT A;  1FMK A;  2RQT A;  3BE3 A;  2BKD N;  2L3S A;  3VUZ A;  2EYY A;  3EH2 A;  3EG2 A;  4BDY A;  1M1G A;  2RQV A;  1D1A A;  2GGR A;  4C5I A;  4M7D A;  4EMH A;  4P5N A;  1QVF S;  3SFM A;  5M9O A;  1G3W A;  2VWF A;  1IRE B;  1XNI A;  1VQK Q;  5FRM A;  1VQ6 T;  1MMA A;  1D0X A;  1WA7 A;  2LJ0 A;  4C92 B;  4LD9 K;  2RH2 A;  4CC4 B;  2BZY A;  4J9G A;  3EAE A;  4IUP A;  4MZM A;  2RPN A;  4M77 F;  1OI1 A;  3QII A;  5EC7 A;  1WX6 A;  3QG1 A;  1PCX A;  4NOY A;  3IQL A;  2JTE A;  5KH6 A;  3CD6 A;  2RI3 A;  2RHZ A;  2KYM A;  2JS2 A;  3CBP A;  5DLO A;  2C0O A;  4ZNX A;  3CPW S;  4ZTF A;  1D3B A;  1TU0 B;  3CCR T;  5GMK e;  2L8D A;  3PT9 A;  3OYF A;  2ZZD A;  2QEX A;  1U3O A;  1GBR A;  3CCS Q;  3A1P A;  3N5B B;  1WJS A;  2X3W D;  2CSI A;  3G6E A;  2RHY A;  1WHJ A;  1G8X A;  4FU6 A;  3EFO B;  3S3O A;  3E9F A;  2HMA A;  2QTV A;  1WHL A;  4M78 B;  1TXQ A;  3LX7 A;  1X27 A;  3CC2 Q;  5C6S A;  1HYO A;  2LQW A;  3M5A A;  7AT1 B;  1NE8 A;  1UFF A;  2AK5 A;  4HCK A;  2WSE E;  2LTO A;  2DXB A;  4M7A B;  1WZO A;  4DQ2 A;  4M7D E;  5CQX A;  4OB3 B;  3RKW A;  1AWO A;  4N0A C;  3Q1J A;  2GNC A;  6AT1 B;  1UB4 A;  3C4S A;  3M0Q A;  4IUU A;  1UJ0 A;  3EHR A;  1GCQ C;  3VYG A;  5GAM h;  1VQP A;  1SRM A;  1RAB B;  4M7D G;  1WXT A;  1SHF A;  2MOX A;  1NJI R;  1N9S A;  2DL5 A;  1UUE A;  5IT9 E;  1ZUU A;  3S3M A;  3E19 A;  1VQ5 Q;  3SWN C;  2DL8 A;  2HKQ B;  3QJ6 A;  4YTL A;  2M0Y A;  4DBR A;  4FSS A;  3JCM V;  5FLX E;  2ECZ A;  2M9U A;  4GBQ A;  2YWW A;  3CCQ A;  1X6G A;  1JJ2 S;  2QQB A;  1G3T A;  4O5V A;  5KYW B;  2KGT A;  4J9D A;  5KYU B;  3MPU B;  1OUL A;  2P84 A;  4AG2 C;  4F14 A;  3JCM P;  3VRY A;  2BIV A;  3LLR A;  1MUZ A;  4CRI A;  1VQ7 T;  2LJ1 A;  2J6K A;  1RAA B;  1M1K U;  1SHG A;  1WQ7 A;  2KRS A;  3EG1 A;  3EG9 B;  4IIM A;  2GTJ A;  4GLM A;  5A0D A;  4C92 F;  4RTW A;  3M56 A;  4JJN K;  4J83 A;  4KH0 B;  1Q86 R;  4OMM A;  2DIQ A;  2PQW A;  1OYX A;  2FVU A;  1Y57 A;  4PKC C;  5LJ3 d;  2QQ9 A;  3M53 A;  2O9V A;  5D6Y A;  2P0Q A;  3LGF A;  3CPW P;  4PFP A;  2E64 A;  2LVM A;  1ZA2 B;  3DB3 A;  1I4K 1;  3CCJ T;  4KUD K;  2KMT A;  1VQP T;  3OS0 A;  2L5Q A;  2L3Q A;  1NEG A;  2OAW A;  2OTJ T;  3VUB A;  4A4K A;  3CCV T;  2XHC A;  1KQ2 A;  2KR3 A;  3AT1 B;  1B7T A;  4ZGD B;  2DRK A;  3M4Y A;  4JJC A;  3J7A F;  1ZA1 B;  3FB9 A;  1WHG A;  3ZEH A;  3MKD A;  1QKW A;  2EQK A;  5IN1 A;  3MP1 A;  1WDX A;  4Y28 E;  3OW2 A;  1N8R R;  4M7A C;  2F5T X;  4J6W A;  1OZ2 A;  4ME7 A;  1SG5 A;  2RHU A;  3L2R A;  1HSQ A;  1BI1 A;  3A8L B;  1JXM A;  5GAN d;  1MMG A;  2AHJ B;  2B8A A;  1YIJ Q;  4NS5 A;  3CCL T;  4WTO B;  2YUQ A;  3CME Q;  1D1C A;  2DXU A;  5D7U A;  2MPX C;  2QEX Q;  2OTL A;  2KT1 A;  4L5G A;  1IZ6 A;  2X4X A;  1X2Q A;  2E6Z A;  2O4X B;  2JTF A;  2A36 A;  4J9E A;  2I0N A;  1VQ4 A;  2EYQ A;  1C1A A;  2ESW A;  2KXC A;  4BI4 A;  2ZPB B;  4DA4 A;  2HSE B;  2AZV A;  1G83 A;  5CKF A;  2XDP A;  4HVV A;  2YRV A;  1YN8 A;  2KNB B;  1HD3 A;  3ZFJ A;  2CT4 A;  2O01 E;  1VQL Q;  3OSS C;  4EPC A;  3M58 A;  2G3R A;  2RQR A;  2VUB A;  1TH7 A;  3FJP A;  4PFZ A;  3TSZ A;  1PRL C;  1EZZ B;  3H0I A;  4M7D D;  4UC4 A;  4AG1 C;  3RIR A;  2E5Q A;  1K8A C;  1BCM A;  3BDU A;  2W0Z A;  4BE0 A;  1BBZ A;  4B6M A;  3FRN A;  5GAN j;  3TCJ A;  1YIT Q;  2DLP A;  5FU7 C;  2WSF E;  4C0D C;  1M90 R;  5FWB A;  4M7A F;  1JB0 E;  1QVG P;  4KUL A;  1KD1 U;  2EGC A;  3G4S Q;  2QTX A;  4M78 G;  1BK2 A;  3OYI A;  1LVK A;  1N6A A;  4PLI A;  1Q82 C;  1BYM A;  4A63 B;  4V2S A;  1U06 A;  2DD4 A;  2H8H A;  4XTY A;  1JRI A;  1FX7 A;  4RMO A;  5I11 A;  3OS1 A;  2DO3 A;  1TS9 A;  1NPR A;  2FHD A;  1K9A A;  1UTI A;  1WHH A;  3VV0 A;  3PTA A;  1IHV A;  1W6X A;  1O9S A;  1H8K A;  5GMK j;  2YLC A;  3I56 A;  1ZSZ A;  4JLI A;  4FW2 A;  4BAC A;  2B86 A;  1LOJ A;  2FPE A;  2G6F X;  3OYK A;  1NEB A;  1JU5 C;  4M7D F;  4DBH A;  3H6Z A;  4PJO G;  4KGX B;  3HPW A;  3JB9 D;  5LJ5 j;  1W4S A;  1WNL A;  4EMK B;  4HKE A;  4PJO B;  1RAH B;  1OV3 A;  2D1X A;  4LNP A;  2MAM A;  2PTK A;  3CC2 T;  3EGD A;  4F7U A;  1YJN Q;  2AZS A;  2EKO A;  2F1L A;  3KFV A;  5LJ3 h;  3CCV A;  1M2V B;  2HD0 A;  5HY6 A;  1WGS A;  3A8H B;  2KDS A;  1OX9 A;  3X25 B;  1Q81 C;  2JTM A;  1YIJ T;  3ER0 A;  1VYV A;  3PGG A;  3UT1 A;  1J3T A;  2CP7 A;  4D6W A;  5FW9 A;  3D7S B;  4E47 A;  1T0H A;  2DBM A;  1YP5 A;  3PMI A;  5I22 A;  2MCN A;  1BI0 A;  3A98 A;  3OYC A;  2MF2 A;  2FO0 A;  2BZ8 A;  1PD1 A;  1JBM A;  2RQU A;  1GFD A;  3L2Z A;  3QYG B;  1QWF A;  1VQ7 Q;  1S1N A;  1R0C B;  2E3H A;  2ENM A;  1U5S A;  5IAY A;  2YHT A;  3EGD B;  4MMK A;  4N4G A;  4F7U B;  3JCM d;  2QA4 T;  1BI3 A;  3L2U A;  4OB2 B;  1UGP B;  4LDW A;  3X24 B;  4M7A A;  2CYZ B;  1K73 R;  3QJY A;  1ABQ A;  2L89 A;  1V76 A;  3FIF A;  3OBY A;  4MML A;  2CSQ A;  4E7J A;  1X01 A;  2XMF A;  2K7A A;  4JRP A;  2DTI A;  3QZ9 B;  4JPB W;  1LNX A;  2DF6 A;  3NTI A;  2CH4 W;  5LJ5 d;  4LDY A;  3OY9 A;  3NMZ C;  2NUZ A;  1KJW A;  2QEX T;  1ZBX A;  1QQJ A;  2ZAE A;  2ZCF B;  1K73 C;  2RD1 A;  1G5V A;  3CCL Q;  1JJ2 A;  4LE9 A;  3UA7 A;  3M0R A;  4XU2 A;  1N27 A;  2HSP A;  1MHN A;  2NUP A;  3OW2 P;  4RTZ A;  5GAN e;  2K3X A;  2CUB A;  5HK3 A;  4EDU A;  4HXJ A;  2QG9 B;  1WHK A;  1FMV A;  4KGZ B;  5GMK l;  1VQ9 Q;  3C95 A;  3AHU A;  2QA4 Q;  1NYF A;  1OU8 A;  1RAC B;  2E41 A;  1M90 C;  2RQW A;  2DJZ A;  2HQX A;  3X28 B;  2EVR A;  5LJ3 g;  2V1Q A;  1SEM A;  3V8K A;  1M3B A;  1UEB A;  1ZUY A;  2NUT B;  1K0X A;  2KSS A;  3LWI A;  2DIG A;  1CKA A;  2LNH B;  2P4R A;  1ZUK A;  2KRM A;  3GNG A;  4FT2 A;  2DAQ A;  2CS7 A;  2BE7 D;  4PFO A;  3OYY A;  3QO3 A;  4M7A D;  1IGU A;  1IRX A;  3CCS A;  1UGR B;  4RKU E;  2QDL A;  4Z02 A;  4C92 E;  1GRI A;  1VQ9 A;  2A7Y A;  3QPH A;  4NL2 A;  2CT3 A;  3OB9 A;  1NJI C;  3CPF A;  2MIO A;  2JS0 A;  4LUD A;  1LPL A;  1I81 A;  2CZ0 B;  3OYM A;  3OYJ A;  3UA6 A;  2J6O A;  2RM4 A;  4D8K A;  1M30 A;  2EPD A;  4WF2 A;  4OB1 B;  1VQ6 Q;  4M75 G;  3CPW A;  4EIK A;  4ZGE B;  2XI9 A;  1WQW A;  1LJO A;  4AFU C;  4ANJ A;  1PNJ A;  1MV3 A;  3CCS T;  1VQN A;  3V7R A;  3P8B B;  3FDR A;  3RNJ A;  2ROL A;  2KBT A;  1VYU A;  4C92 C;  2RJE A;  1O75 A;  4M75 E;  3CCE A;  1Y0M A;  5GAM f;  1V29 B;  1E6H A;  1WXU A;  2HNI A;  1MMN A;  5CKE A;  1VOM A;  2QI2 A;  3VS7 A;  3VS2 A;  2ROT A;  2DL4 A;  2GBQ A;  3VJP A;  2M0O A;  2OJ2 A;  2NUP B;  3PMT A;  1Y07 A;  4HVU A;  2IG0 A;  5FU7 B;  3CC4 Q;  1QKX A;  1KHC A;  3ASK A;  1GCP A;  3C12 A;  3E9G A;  1AT1 B;  1BIA A;  4HCZ A;  2NWM A; 
#chains in the Genus database with same CATH homology
 3C94 A;  2LT4 A;  3V7C A;  5FRN A;  5LJ5 g;  2DZC A;  2ZPE B;  3GP8 A;  4CRI A;  2PVD B;  4DOV A;  1VQ7 T;  3OYG A;  4M77 A;  2C06 A;  3CCU T;  2DTH A;  2M16 A;  2EIF A;  3QDR B;  5GAO n;  4M7D C;  1UGS B;  1M1K U;  2EWN A;  4BUG A;  3HRU A;  4JRK A;  1WQ7 A;  2P0K A;  2EAY A;  4FSX A;  4C8Q A;  4RCC A;  2E1H A;  4RG2 A;  4XU3 A;  1FXX A;  2WSC E;  5HK0 A;  5HKC A;  1XOV A;  1VQM T;  3DLM A;  5D6W A;  5A0D A;  4J8O A;  4C92 F;  5GAM e;  5GAO m;  4OB0 B;  4QVD A;  3SWN A;  2JUF A;  3M56 A;  4VUB A;  4L59 A;  4ZN1 A;  4GLK A;  1HK9 A;  2DKG A;  4J83 A;  4XTX A;  3UDC A;  4NL3 A;  4XU1 A;  2EQU A;  2DPP B;  3CC4 A;  1Q86 U;  3CC2 A;  2XDB A;  4M77 D;  1YJN A;  1VQ4 T;  2DIQ A;  1YI2 A;  2D0Q B;  2LNV A;  1OYX A;  2PQW A;  2FVU A;  4MZP A;  4N0A A;  4OMF B;  4A4G A;  4C0Z A;  4PKC C;  1QVF A;  5LJ3 d;  2QQ9 A;  3M53 A;  3QYH B;  1PSF A;  4M78 A;  2E6N A;  5D6Y A;  1XQH A;  2P0Q A;  3JCM h;  3LGF A;  4EMG A;  3SB2 A;  4PJO F;  1VQL T;  4M78 E;  4XTW A;  4ELY C;  1N9R A;  3QBY A;  1DJ7 B;  2E64 A;  2LVM A;  2R58 A;  3DB3 A;  3OBW A;  4QQD A;  4RCB A;  2NLU A;  3JCM f;  3JCM Q;  4MDX A;  1YIJ A;  1I4K 1;  3CCJ T;  1VQ8 T;  1YBY A;  4KUD K;  3NTK A;  2K4Y A;  2KMT A;  1VQP T;  3OS0 A;  2L5Q A;  4HCZ A;  4EMK A;  3JB9 I;  1PSE A;  1Y7X A;  1P92 A;  3F70 A;  1Q81 U;  3VUB A;  4A4K A;  2EFI A;  3HSB A;  3CCV T;  4M7A E;  2XHC A;  1KQ2 A;  4A53 A;  4ATO A;  4M75 C;  2XKO C;  3EFR A;  4ZGD B;  2RK1 A;  4M7D B;  1U1T A;  2JVV A;  3M4Y A;  2GF7 A;  2VGN A;  3MEV A;  3J7A F;  3FB9 A;  4C8Q E;  4XK8 E;  1VIE A;  3RER A;  3I55 T;  5LJ5 e;  3L2W A;  4FL6 A;  2E10 A;  3OYL A;  2GCX A;  3ZEH A;  5DM7 R;  1VIF A;  1RI0 A;  2EQK A;  1XTD A;  5IN1 A;  3MP1 A;  4M7A C;  4Y28 E;  3OW2 A;  2F5T X;  4LDU A;  4J6W A;  1ZHI A;  1OZ2 A;  4QVC A;  4MZT A;  3RMS A;  4ME7 A;  1K9M U;  5LJ3 f;  1VQM A;  3TU4 K;  1W2B S;  2RHU A;  3L2R A;  1YCY A;  1BI1 A;  4IUT A;  1I8F A;  3PNW C;  2VC8 A;  5LL6 S;  3A8L B;  5GMK m;  3BY7 A;  1B34 B;  4E7K A;  5GAN d;  2AHJ B;  2DXC A;  4JUV A;  2B8A A;  2E65 A;  3URG A;  4NS5 A;  3UPU A;  1U8R A;  2WAC A;  3OS2 A;  2OAU A;  3CCL T;  3CCU A;  2R5A A;  2QQR A;  3CCM A;  2DXU A;  1W2B A;  1NPP A;  1N8R C;  3X26 B;  5A2Q E;  2OTL A;  5GAM d;  4L5G A;  1KC8 C;  3FEO A;  1VQ6 A;  1M5Q 1;  2ZPG B;  4M75 D;  1VQO A;  1IZ6 A;  2RJC A;  3OYD A;  2X4X A;  3A8O B;  2E6Z A;  3BFM A;  2K2V A;  2O4X B;  2JTF A;  4QQ6 A;  4C92 A;  2VV5 A;  3BDL A;  4C0G A;  1X75 C;  5GAN 4;  2ZPF B;  5FU6 B;  3OYE A;  3MEA A;  1VQ4 A;  1YI2 T;  3A8G B;  1EIF A;  3JCM W;  1KQS S;  2EYQ A;  2DVE A;  3J80 E;  2LQK A;  3OMC A;  4BI4 A;  4M77 G;  3RMQ A;  2ZPB B;  4F7U F;  4DA4 A;  1Q7Y C;  4M7A G;  3G71 A;  5DLQ E;  4JS4 A;  3JAM E;  2DEQ A;  2XG8 D;  2XD0 A;  1NZ9 A;  5GAO q;  3ME9 A;  3M54 A;  1M1F A;  3PFS A;  4LD6 A;  4PJO A;  5CKF A;  2XDP A;  1NJI U;  2X4W A;  2ZPI B;  3FC3 A;  2YRV A;  1WJQ A;  1ZQ1 A;  1VQ5 A;  2BUD A;  4XTZ A;  3ZFJ A;  3JCM X;  3JB9 J;  3M55 A;  3CME A;  2O01 E;  2ZGW A;  2XID A;  4BD3 A;  2MWP A;  1UGQ B;  2FYK A;  2RA2 A;  3M57 A;  4R55 A;  5FRO A;  3OSS C;  4EPC A;  2RO0 A;  4N4I A;  3M58 A;  2G3R A;  4C8Q F;  2VUB A;  3CCJ A;  1VQ8 A;  1Y71 A;  3VU3 C;  1TH7 A;  2KVQ G;  3FJP A;  3H8Z A;  4JLG A;  4LDX A;  4JDS A;  5J26 A;  1KQS A;  2R57 A;  2O4X A;  4HA8 A;  3OYN A;  1Y96 B;  1QVP A;  3HRS A;  3QZ5 B;  3MCA B;  4M7D D;  4UC4 A;  4A4F A;  2PVG B;  2JNG A;  2HQE A;  3GPL A;  3SDZ A;  2VXE A;  3G7Z A;  3RIR A;  2CKK A;  2E5Q A;  3P8H A;  1K8A C;  2EJ9 A;  4GY5 A;  2LCL A;  2MMP A;  3OQ5 A;  3BDU A;  4BE0 A;  3LYI A;  2R5M A;  4E7L A;  2E70 A;  2RJD A;  2EJF A;  3FRN A;  5GMK i;  3MO8 A;  5GAN j;  4PJO D;  4ZN3 A;  4HT9 A;  3TCJ A;  3MET A;  4XQ3 A;  1YJ9 T;  3UWN A;  4M77 E;  5FU7 C;  1KC8 U;  2P4T A;  1SSF A;  3V8J A;  2WSF E;  5A0L A;  4C0D C;  4JRQ A;  1JB0 E;  1YHQ A;  4KUL A;  3CCE T;  4M7A F;  3WXM B;  2DXT A;  3HRT A;  2FB7 A;  4A4H A;  1VQ9 T;  3RES A;  1KD1 U;  3MEW A;  1D3B B;  2QTX A;  3CBO A;  2RJF A;  4M78 G;  2GFA A;  4L6V 5;  3OYI A;  2VXF A;  5GMK h;  1G3Y A;  3S3N A;  3G71 T;  4OVA A;  1N6A A;  3CMA A;  3OW2 S;  4PLI A;  2LDM A;  3WVE B;  1Q86 C;  3M4G A;  3GNF B;  1Q82 C;  3GIB A;  4PJO E;  5GAN 6;  4BB7 A;  1BYM A;  5GAN f;  4BE1 A;  2CZ7 B;  1Q7Y U;  1K8A U;  4V2S A;  2DD4 A;  3HFN A;  3M9Q A;  5EG2 A;  4II1 A;  4OF1 A;  4XTY A;  1JRI A;  3MP6 A;  4O6J A;  4JRI A;  1Q82 U;  1FX7 A;  5CKD A;  2QA4 A;  2I2L A;  1VQK A;  2X35 A;  4IUQ A;  4M75 B;  2MWO A;  3BW1 A;  5GAN h;  4RMO A;  1BKB A;  4Q5W A;  3KXT A;  3OS1 A;  2DO3 A;  1U1S A;  4B9X A;  2GQV A;  2RI2 A;  5LJ5 h;  1NPR A;  2X4J A;  4TVR A;  2FHD A;  3INZ A;  3A8M B;  2RK2 A;  2P0P A;  1VQO T;  1VQ5 T;  4QQG A;  4X9D A;  3OYA A;  5CAI A;  3ZBD A;  5LJ5 f;  3VV0 A;  2EQM A;  4M75 F;  3PTA A;  1I5L A;  2RHX A;  4PNO A;  4F7U G;  5CO7 A;  1O9S A;  4FM4 B;  3GLX A;  3OS5 A;  4IKF A;  5KCO A;  3R6O A;  5CIU A;  3JCM e;  5GMK j;  2YLC A;  4C0D B;  2QDY B;  3I56 A;  5GAO r;  3RUX A;  4BY6 B;  5GAO l;  4JLI A;  4BAC A;  1AHJ B;  1LOJ A;  1QP3 A;  3M59 A;  1VUB A;  3OYK A;  3OYB A;  3L2Q A;  5AYF A;  3T9N A;  3RKY A;  5FU7 B;  1M4Z A;  4M7D F;  1OZ3 A;  3MEU A;  1N8R U;  1VQN T;  3CCR T;  3H6Z A;  4F7U E;  4X34 A;  2XIC A;  4PJO G;  5CR2 A;  3HPW A;  3JB9 D;  2E12 A;  5LJ5 j;  3HHT B;  2JZ2 A;  4IUV A;  1W4S A;  1WNL A;  4EMK B;  4HKE A;  4PJO B;  4J7I A;  3OSV A;  4QW2 A;  3CC7 A;  2XDD A;  2MAM A;  3CCM T;  1GXI E;  4JS5 A;  3CC2 T;  4F7U A;  2DTO A;  4C92 G;  4ZTJ A;  2EKO A;  4QVZ A;  5LJ3 h;  3CCV A;  5LJ3 e;  3OA6 A;  2HD0 A;  5HY6 A;  1WGS A;  2OTJ A;  3A8H B;  2LX9 A;  2KDS A;  3X25 B;  5GAN 3;  1Q81 C;  3I55 A;  2JTM A;  3WVD B;  3G4S T;  1YIJ T;  3ER0 A;  3DKM A;  3OMG A;  5CVI A;  2JOY A;  2PUK B;  3PGG A;  4J6X A;  1QW1 A;  2CZ6 B;  3UT1 A;  2IVW A;  2QQS A;  4C8Q G;  3QXE B;  1Y96 A;  4D6W A;  2K5F A;  1KQ1 A;  1WPY A;  3A5Z B;  1G3S A;  4E47 A;  3S6W A;  3PMI A;  5J39 A;  2KQW A;  4XTU A;  1M8V A;  3LWH A;  1BI0 A;  2RB6 A;  3MHX A;  5KE3 A;  1VQ7 A;  2ZPH B;  3OYC A;  2DZ9 A;  2M1H A;  4C8Q C;  1K73 C;  1R8O B;  2L3R A;  2MF2 A;  3PIP A;  1RL2 A;  2GFU A;  2F5K A;  3GF5 A;  4X9C A;  3L1A A;  3HKS A;  1JBM A;  4BDZ A;  3CC4 T;  3L2Z A;  3QYG B;  1M9S A;  3JSC A;  2Y4X A;  2HBP A;  2LT1 A;  5I2M A;  5LJ3 j;  4M77 B;  4J7F A;  4C5E A;  4E7I A;  5A0G A;  3TRE A;  5KCH A;  3JCM J;  3DLL A;  3CMA T;  1M90 U;  5IAY A;  2YHT A;  4MMK A;  4EMK C;  4N4G A;  4F7U B;  3JCM d;  4A54 A;  2QA4 T;  1M1K C;  1BI3 A;  2CGH A;  3L2U A;  3HP9 A;  4XU0 A;  1YIT A;  4OB2 B;  4M75 A;  3V7S A;  1UGP B;  4LDW A;  4OP0 A;  5CQY A;  5CKB A;  3CXC A;  3X24 B;  2BKD N;  4M7A A;  2CYZ B;  2K5I A;  3QJY A;  5C0M A;  2L89 A;  3QSU A;  2K5L A;  3FIF A;  3OBY A;  3VUZ A;  4MML A;  2QQA A;  1H3Z A;  4BDY A;  4E7J A;  3G6E T;  1M1G A;  4XAX B;  1X01 A;  1YJN T;  1H64 1;  3QHS A;  5CK9 A;  2A3L A;  1QVF S;  2DD5 A;  4JRP A;  2DTI A;  3QZ9 B;  4J5Y A;  1LNX A;  3LGL A;  1QP2 A;  3NTI A;  4KUI A;  4J6Y A;  4C5I A;  5LJ5 d;  4LDY A;  3OY9 A;  4M7D A;  4EMH A;  4BY6 C;  2QEX T;  1ZBX A;  4P5N A;  1VQK T;  2ZCF B;  2V8K A;  2DK3 A;  4FT4 A;  4OGC A;  3SFM A;  3DB4 A;  5M9O A;  2RD1 A;  1MGQ A;  1G3W A;  3CCQ T;  2KK4 A;  3L2V A;  1G5V A;  1BIB A;  1IRE B;  1XNI A;  1JJ2 A;  5FRM A;  4XU2 A;  5I21 A;  1VQ6 T;  1N27 A;  1MHN A;  3QUI A;  4LD9 K;  4C92 B;  2YLB A;  1K73 U;  2RH2 A;  1S72 A;  2EJG A;  3CBM A;  5GAN e;  4ZGJ B;  4PJO C;  4BI8 B;  4FIB A;  4M78 C;  2K3X A;  4KBM B;  2D6F A;  5HK3 A;  4EDU A;  3EAE A;  4HCB A;  4IUP A;  2V8I A;  4MZM A;  4JJN K;  4M77 F;  2PUO B;  1OI1 A;  3QII A;  5GMK l;  3QG1 A;  1KG1 A;  3C95 A;  4NOY A;  3CC7 T;  3AHU A;  2F69 A;  3GOX A;  4R56 A;  3JB9 F;  3RKX A;  5KH6 A;  3CD6 A;  2RI3 A;  5L8R E;  2RHZ A;  1FWZ A;  4C5G A;  3EFS A;  3NTH A;  4RG8 A;  3JRZ A;  2LQ8 A;  3CBP A;  4OGE A;  5DLO A;  1QVG A;  2E41 A;  3CPW S;  1M90 C;  4ZTF A;  5GAM g;  5GAN 2;  1D3B A;  3OYH A;  4PL6 A;  5GMK e;  2DJZ A;  2HQX A;  2L8D A;  3PT9 A;  4MDW A;  3X28 B;  5LJ3 g;  2XK0 A;  5CKH A;  3OYF A;  2ZZD A;  2QEX A;  3V8K A;  1UEB A;  2KSS A;  3CEY A;  1YJW A;  3PIO A;  3N5B B;  1WJS A;  2VGM A;  2DIG A;  3LWI A;  3G6E A;  3CXC S;  1YJW T;  2RHY A;  3GNG A;  1X6O A;  4FT2 A;  2DAQ A;  5D6X A;  2CS7 A;  4FU6 A;  3V8L A;  2PU9 B;  3OYY A;  3QO3 A;  4M7A D;  3X20 B;  3S3O A;  3CCS A;  2JN0 A;  1UGR B;  4RKU E;  3E9F A;  4BI3 A;  2K57 A;  4Z02 A;  4C92 E;  1VQ9 A;  2A7Y A;  4DOW A;  3SWN B;  3QPH A;  4NL2 A;  4KT0 E;  4M78 B;  2VYT A;  3LX7 A;  4XTV A;  5GAO p;  3OB9 A;  5C6S A;  1NJI C;  4A4E A;  1YIT T;  3M5A A;  3CPF A;  5J3B A;  4M78 D;  4C5H A;  3LH0 A;  2H3J A;  3JB9 H;  1NE8 A;  2LC4 A;  3NFC A;  1I81 A;  2CZ0 B;  3JCM b;  3E1S A;  3OYM A;  3OYJ A;  3G4S A;  3JCM g;  2RM4 A;  2WSE E;  2LTO A;  4BE2 A;  2DXB A;  2Y90 A;  4M7A B;  2RI5 A;  3KBG A;  2KAF A;  2PVO B;  3TEE A;  4WF2 A;  4OB1 B;  4DQ2 A;  2D9T A;  4ELZ C;  1HXD A;  3O8V A;  4M75 G;  5CQX A;  4OB3 B;  3RKW A;  3CPW A;  4M7D E;  2LRQ A;  3L42 A;  4ZGE B;  3CCR A;  1KHI A;  4N0A C;  2XI9 A;  1WQW A;  4C8Q B;  1LJO A;  3Q1J A;  5DY9 A;  1K9M C;  2V8J A;  1UB4 A;  3C4S A;  5GAN 8;  4IUU A;  4HT8 A;  4M78 F;  3CD6 T;  2X4Y A;  3CCS T;  3VKI A;  3VYG A;  2QXF A;  4IUR A;  3V7R A;  3KUF A;  2OTL T;  2XU8 A;  3P8B B;  1VQN A;  5GAN 7;  3FDR A;  5GAM h;  1VQP A;  1YJ9 A;  4C92 C;  3J81 E;  4M77 C;  2RJE A;  1O75 A;  4E7H A;  2CZ1 B;  1QVG S;  3CCL A;  4B9W A;  4M75 E;  4HCC A;  4M7D G;  3FLG A;  3CME T;  3CCE A;  1YHQ T;  5GAM f;  1V29 B;  5I2S A;  4CI0 C;  4LDV A;  4C92 D;  3I56 T;  2HNI A;  1N9S A;  5CKE A;  3SD4 A;  5FU6 C;  4N4H A;  5IT9 E;  2QI2 A;  3S3M A;  3E19 A;  5GAN 5;  2FL7 A;  3SWN C;  3QJ6 A;  1S72 T;  1KD1 C;  4YTL A;  2K3Y A;  4C0F A;  3VJP A;  2M0O A;  3MP8 A;  3QKJ A;  2OTJ T;  3PMT A;  5GAN g;  1WJR A;  3JCM V;  5FLX E;  3JB9 G;  1VQL A;  2M9U A;  1Y07 A;  2HAX A;  4Y91 A;  3CCQ A;  2EQJ A;  5KE2 A;  2IG0 A;  5CCA A;  2KY9 A;  2MI6 A;  3P8D A;  1JJ2 S;  2RHI A;  3HFO A;  2QQB A;  1BI2 A;  1B34 A;  1G3T A;  1KHC A;  3HL8 A;  4O5V A;  3ASK A;  3LW5 E;  4PLL A;  3C12 A;  4C8Q D;  2Y4Y A;  3VYH B;  3JCM c;  5GAM j;  3E9G A;  2LCC A;  3JCM P;  1BIA A;  2BIV A;  3LLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...