2EQJA

Solution structure of the tudor domain of metal-response element-binding transcription factor 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GSSGSSGKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Metal-response element-binding transcription factor 2
publication title Solution structure of the TUDOR domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqjA00
3PMIA 3UT1A 4B9WA 3P8HA 2HQXA 3QKJA 1SSFA 3LLRA 3LX7A 3MEUA 1OYXA 2QQRA 2LCCA 3L2WA 2QQSA 3P8DA 4Q5WA 3ASKA 2LDMA 4IUPA 3OYEA 2M0OA 4RG2A 3S3NA 3SD4A 4IUQA 4IUUA 3META 4N4IA 5D6XA 4C5IA 2RJDA 1OZ3A 3LYIA 2O4XB 2P0KA 2GF7A 3H6ZA 2NLUA 4B9XA 4C5EA 3L2RA 4ZTJA 3LGFA 3OYNA 5J26A 2EQUA 2RI2A 4C5HA 2R5MA 3OYFA 2LTOA 4E7IA 3OYAA 1WJSA 4L59A 2BKDN 2LVMA 4FU6A 2M1HA 2GFUA 2MWPA 2RHIA 4QW2A 3MP8A 2L89A 2EQMA 4IURA 1OZ2A 3MEAA 1RI0A 4QQGA 2JZ2A 2JTFA 3NTIA 4IUVA 3NTKA 2EQKA 4IUTA 5FRMA 2XDPA 3DLMA 3O8VA 4PLLA 2R57A 4CRIA 5KE2A 4BDYA 4BE0A 3PMTA 2BUDA 3L2QA 4BD3A 1OI1A 2RHUA 1WJQA 2R5AA 4A4HA 5KH6A 2DAQA 2RI3A 3OS0A 3C4SA 3KUFA 4GY5A 2RJFA 3CEYA 3OYHA 1WJRA 3PNWC 2E5QA 3EAEA 3H8ZA 4OVAA 3LGLA 4NS5A 5KCOA 3OYGA 2X4XA 5KCHA 2RHZA 3NTHA 2EKOA 4E7KA 2O4XA 2RJCA 2E6NA 4LD6A 3LH0A 4C5GA 3FC3A 1MHNA 2K3XA 5C6SA 5FRNA 4FL6A 1KHCA 2PQWA 2RHYA 2X35A 5C0MA 3QJ6A 4N4GA 3S3MA 3OYCA 4Z02A 2LRQA 4A4FA 2RHXA 3OMCA 2R58A 2F5KA 3GOXA 3OYBA 2G3RA 5CIUA 3DB3A 4N4HA 2MWOA 2HQEA 2IG0A 2YRVA 3FDRA 4HCZA 2L3RA 5IAYA 3M9QA 4EDUA 2WACA 3OYLA 3L2UA 4UC4A 4BE1A 3OA6A 1N27A 3Q1JA 4QVZA 3L2VA 3MO8A 1XNIA 3OYMA 2L8DA 2DIGA 2D9TA 2CKKA 4II1A 4PLIA 5J39A 5IN1A 3OYIA 4ZTFA 5FROA 4BE2A 3MP6A 4E7JA 4E7LA 3OB9A 3ME9A 3DB4A 4E7HA 4A4EA 3L42A 2K3YA 2FHDA 3OMGA 3OS1A 3QIIA 3OS2A 3OY9A 2EFIA 2GFAA 4QQ6A 3MEVA 3OYJA 3MP1A 2M16A 3E9FA 5D6WA 4QQDA 3S6WA 5KE3A 4BDZA 2EQJA 2RJEA 2XK0A 3FEOA 3PFSA 1G5VA 3OQ5A 3UWNA 2BIVA 3E9GA 3ZEHA 3OYKA 3OYDA 4BACA 2RO0A 3MEWA 3QBYA 4PL6A 1WGSA 3FLGA 4X34A 5D6YA 2B8AA 2X4YA 3BDLA 4A4GA 4IKFA 3S3OA 1H3ZA 5M9OA 2VYTA 2RI5A 2DIQA 3F70A 2X4WA
chains in the Genus database with same CATH superfamily
3I55A 3SDZA 1VQPT 4LUEA 4PJMA 3DKMA 2ZGWA 1NLOC 1D0ZA 1XTDA 1AWJA 2CT4A 4M7AB 1B7TA 1M90C 2KBTA 1JRIA 1YITQ 2ESWA 3CC7A 2QGFB 1VQKQ 1RAGB 4J9DA 3OYFA 1WDXA 4FU6A 4CC3A 4DEXA 2YUQA 4M7DG 1OULA 2JZ2A 1U1SA 5FRMA 3CCLA 4LDYA 4EMGA 3J81E 4HA8A 1K73C 3CCRA 1Y96B 3BW1A 4BDYA 1G83A 3VS5A 1VIEA 1PG5B 1OI1A 3H41A 1WJQA 4XTZA 2DAQA 2JMCA 5KYNA 2C0TA 4BI3A 1X2QA 4FT4A 5L23A 2F2VA 2DILA 2P4RA 1NJIU 4M77A 2EGAA 4JZ4A 2ZPEB 4LD6A 4C5GA 2QQAA 1QCOA 2YDLA 2PVGB 2DL8A 1VUBA 2DTIA 4ATOA 2DMOA 2HBWA 3DB3A 3G7ZA 4DOVA 4RMOA 3OYLA 2HNIA 1NPPA 1W4SA 4M7AA 3HFOA 3CMAA 2CSQA 2D9TA 3CMEQ 2V8KA 3MP6A 3OB9A 1D0YA 1M1KC 1W6XA 4HCBA 4PFOA 2CT3A 4QQDA 5KE3A 1BIAA 1WA7A 1X43A 3OYKA 3CCVT 5GAOl 3L2UA 3HL8A 4C0ZA 1KC8U 5GANh 1Z9ZA 1T0JA 2DIQA 2ZZDA 5KYXB 2X4WA 4J6WA 3JRZA 1UGQB 2HQXA 2RM4A 1YWOA 2QQSA 3JCMf 4Y92A 1YWPA 3ASKA 4DBRA 4E7SA 2QA4Q 1M2OA 2OX7A 3VRYA 2XDBA 2GNCA 1EFNA 4C5EA 3BY7A 2O01E 3EH1A 3CC2A 3HKSA 2XD0A 2O2OA 2LVMA 1V76A 2QEXA 1ZX6A 2DE0X 3HRTA 1NYGA 2EQKA 1LOJA 5GANg 2D8HA 2LP5A 4D8KA 2FZGB 3M0RA 2BE7D 2DETA 3G6ET 4MZPA 3X20B 1RL2A 3C4SA 1X2KA 4E2FB 1VQMT 2VASA 2QASA 3O5ZA 1IB8A 1X01A 2COYA 2RJCA 4BUGA 1AWOA 1MHNA 1RUWA 3HTRA 4BB7A 4C92B 2QQBA 4O6JA 3X24B 3EGUA 3G4ST 4KULA 2XDDA 4N4HA 3FDRA 2L3RA 4BE1A 2DERA 4LDUA 3EG2A 2E1HA 2E5KA 1IXDA 5J39A 4MMLA 3X25B 2ROLA 3TU4K 2EW3A 2HCKA 2JJ9A 1BYMA 3CCSQ 3OMGA 3I56Q 2W0ZA 3A8LB 1G3YA 3FJ5A 4MDWA 1TUGB 2FYKA 2RJEA 1XOVA 4CC4B 2K5IA 4ANJA 4F16A 5LJ3j 3FRNA 3JB9H 2XI9A 5GANd 2FRWA 2OTJT 2KROA 1NJIC 3LWHA 3GPLA 4B9WA 3P8HA 3LLRA 3LX7A 2EGEA 3VUBA 3EGDA 1GL5A 1ZBJA 1M8MA 3S3NA 1NZ9A 2D0NA 3META 1N9SA 1V1CA 1HD3A 1YCYA 2CUBA 3CC4A 2J6FA 3DLLA 4C92A 4C5HA 2D8JA 5LJ3e 4L59A 2BKDN 3A5ZB 4C8QA 1WIEA 2DEUA 1YJWQ 3CD6A 4F04B 1M2VB 2JUFA 2COWA 3SWNC 4C0DC 1VQ5A 3OSVA 2GTOA 2JTEA 1VQ5Q 2O9VA 2BUDA 1HYOA 1IHVA 3KUFA 2CUDA 2KT1A 2LJ0A 1KC8C 3EAEA 4J9FA 2RNAA 3LGLA 4IIOA 5KCOA 3CCEA 2EQIA 3NTHA 4E7KA 2K5FA 4PNOA 3CCEQ 2KGTA 2OTLT 2HD0A 5CKBA 4PFPA 4OMOA 3RKWA 1BI2A 4A4FA 1QW1A 1YI2A 1R0BG 1JU5C 2D0QB 2HQEA 2YRVA 3OYYA 4OMNA 3M0PA 3OYMA 2J06A 3C95A 1GRIA 3HRSA 2DEQA 4PJNA 4M75B 2EYXA 4J9HA 2FHDA 3QIIA 5FWBA 4E47A 3GIBA 1YIJQ 4P5NA 5ECAA 3EGXB 1MMDA 2KNBB 2JMAA 3FLGA 3BDLA 3UT1A 3F70A 2JW4A 2LC4A 3PMIA 5I11A 2HKQB 4M77D 4OMLA 1Q86U 2NUPB 2DZ9A 4RG2A 1TTHB 3I35A 4XTXA 1VQ8A 4IUUA 4HVUA 4PK4A 1VQ4A 2FG0A 2PZ1A 3I5RA 4Y28E 1YJ9A 4EPCA 3PVQA 4AG1C 4IURA 4M7AD 3EFSA 2XMFA 3HFNA 1ZUYA 1D1BA 1QVFA 1K8AU 4ORZA 2QG9B 2O88A 1Y0MA 1PC0A 4M78B 1WQWA 4QKUA 2J6KA 4BD3A 3G6EA 1UGPB 2QTVA 5GAN4 1GCQC 1VOMA 4FM4B 1W2BP 4XU2A 3EGXA 1VQMA 3X28B 2YLCA 2CP2A 2DZCA 1YITT 1W70A 1EZZB 1H3HA 2DA9A 4FL6A 2EAYA 1VQKT 2JM9A 1ZSZC 1EIFA 3J80E 4AT1B 2QDYB 3P8BB 3REAB 1IHWA 2ZAEA 2K7AA 2MWOA 3VS1A 4HCZA 2NUPA 3SB2A 1PKTA 3Q1JA 4QVZA 4FT2A 2ED0A 2AIRB 2DD4A 3M53A 3CCUQ 4XTVA 4JS5A 1Q82U 1JEGA 1TOVA 2CKKA 4II1A 3OBWA 3OYIA 4KUDK 4OP0A 3DB4A 5GMKl 5A0DA 2ZPHB 1Q81R 3EG9B 2KMTA 1TS9A 2K3BA 4JJNK 5EG2A 1K9MU 2VGMA 1OOTA 1D3BB 3FEOA 5IXBA 5CQXA 3UWNA 4FYWB 3E9GA 2LCLA 4HVWA 2RH2A 4J9EA 2L3PA 4M78A 1YBYA 4NL3A 5FU7B 2FZKB 4RTWA 5GAN7 1WHMA 3CCMQ 2FB7A 1PD1A 1KD1U 2A08A 4RTUA 3CMET 2YRCA 2C0IA 2X3WD 4F7UB 2R5MA 2RD1A 3KXTA 4E7IA 4E6RA 1WXTA 3CCQT 2PUKB 2DLPA 4JS4A 2BZYA 3OS5A 4KGVB 5HK3A 3O8VA 4OGCA 4FW1A 4M7DC 3ZFJA 2DD5A 4IIMA 5LJ3f 1ZLMA 1UTIA 2AZSA 3PIOA 2VVKA 1YFNA 3EG9A 4Y91A 3OYGA 2DBMA 2O4XA 2QA4T 2ROTA 4J7FA 1M3AA 1D3BA 1VQNT 1H8KA 2JM8A 2JNGA 1OV3A 3I5SA 1Q86C 2H3EB 2RB6A 2JS2A 2X35A 5C0MA 2OTLA 1VQ6A 1YHQA 2AKLA 4FIBA 2J7IA 1PM3A 2E64A 3H0FA 1QVPA 3CCJT 4ZN1A 4FSXA 1WHKA 4C0FA 1D1AA 4KH1B 4BY6C 2X4JA 3L2VA 4C92D 2GCXA 2EWNA 2CP7A 4C8QD 6AT1B 4E7LA 5GAMh 4C0GA 1R0CB 2DL7A 4KBMB 1G8XA 2F2XA 1K8AC 3OYJA 1Q95G 3REBB 2F69A 1S72Q 3QXEB 2QTXA 1UJ0A 5IT9E 3EH2A 3UDCA 4A4GA 1H3ZA 2RI5A 1OU8A 3SD4A 1WHJA 4J9IA 1RLPC 4PJOB 3MCAB 5CKFA 1BB9A 1QP2A 1EX4A 1I4K1 3V7RA 2E3HA 2A37A 4M77B 4DBQA 1MMNA 3G71Q 5GAMg 1IRXA 1IGUA 1VQLQ 2V8JA 1B34A 3M0UA 4LN2A 5GANj 1Q82C 4JRPA 2RHIA 5IH2A 2OI3A 1IZ6A 1KHIA 2EJGA 3I56T 5FWCA 3I55Q 2HQHA 2KRMA 2QI2A 1JXOA 4J6XA 1U06A 2EYZA 1K9MC 3HHTB 2DXBA 2DL4A 1SF9A 1BKBA 1VYUA 3OYHA 3CC7Q 3CBPA 1TH7A 4XQ3A 2X4XA 2EKOA 2L3QA 5GANe 2WSFE 2LT4A 3PTAA 2K2MA 1NBEB 3M0QA 1BU1A 4K11A 5IHKA 5GMKh 2RHYA 3S3MA 5GMKi 3CCLQ 1X6OA 2F5KA 4J9BA 4PJOA 1KD1C 3LWIA 2G3RA 3CCRQ 1YJWT 2PVOB 4L5GA 3UPUA 3V8JA 1BCOA 3QDFA 4UC4A 1WHLA 2HZYA 1M27C 4M77E 1XNIA 3CBMA 2DIGA 1TSFA 2CREA 1YJNA 5GAMd 4RTYA 3OY9A 2KY9A 3VS7A 2EQJA 3PGGA 4M7AF 4M75G 1X75C 5CR2A 1PCXA 1X6BA 4A4KA 2KQWA 1UEBA 4RKUE 1AHJB 2Z0WA 4M7AE 2LNVA 4M75D 1NEGA 1LPLA 4AFQC 2EJFA 3CMAQ 3VYGA 4RTXA 1H641 3HP9A 3JCMQ 3L2WA 1VQ7A 1KQSP 4A63B 4OB0B 2MYSA 3QYGB 3FIFA 4JLGA 3M56A 2GF7A 2KR3A 3NGPA 2CP0A 4YTLA 1R77A 2DFUA 5HKCA 2MWPA 3MKDA 1YIJT 1N8RR 4CC2A 2JTFA 4IUVA 1OPLA 3NTKA 4KGZB 4DQ2A 1E7OA 1LJOA 2EGCA 2E4HA 2VXFA 4ZN3A 4PLLA 5DY9A 3J7AF 2HL5C 1UDLA 2FO0A 1NJIR 3JB9I 5KH6A 1OQKA 2MAMA 3M4YA 1PKSA 1JJ2A 4J5YA 2JS0A 3BDUA 3SFMA 2RK2A 1WJRA 1BCMA 3CC2Q 2HSPA 3SWNA 4X9DA 4M78D 3CPWS 2QEXQ 5DLQE 1C0MA 5LJ5h 2CS7A 3HSBA 4JUVA 5A2QE 4XK8E 4HT8A 4PKCC 4J9GA 4HT9A 3QJ6A 2SRCA 2M9UA 1FXXA 1SPKA 2RPNA 2FVUA 3M9QA 3FJPA 3OA6A 5CVIA 3JCMc 3EGDB 2L8DA 4Z89A 1I81A 5IN1A 1HJDA 1N5ZA 1WQ7A 4OF1A 2GFAA 4RTVA 4C8QB 3MJXA 1KC8R 5LJ5g 5IHNA 1WPYA 4D8DA 2IIMA 3QBYA 4PL6A 2KE9A 2B8AA 3EFOA 1VQ9A 4A54A 4N0AC 5CK9A 4R55A 3MHXA 1Z9QA 3NFCA 4XTYA 3RMQA 1Y07A 1PD0A 2AZVA 2GQIA 3TSZA 1M3CA 2BTTA 3OYEA 2M0OA 1WNLA 3QYHB 4LNPA 5EC7A 1CKBA 3M54A 2E3IA 3CCUT 3HPWA 1E6GA 2MF2A 2JT4A 2XKOC 3H6ZA 8ATCB 2NLUA 2YUOA 3AHUA 2EBPA 2V8IA 1YCSB 2A36A 4NOYA 2CH4A 1O9SA 2EYWA 1YP5A 4MDXA 4F7UG 4QQGA 2ENMA 2NWMA 3SEMA 5DM7R 3VS3A 2GQVA 1VQPA 3CPWP 2DRMA 4C92F 4CRIA 1XJWB 4BE0A 3EHQA 3TCJA 2G6FX 2RHUA 1Y71A 3CCMT 2DK3A 3CC4Q 4C92E 4CI0C 4ELZC 4C8QE 1Y57A 2KYMA 5KCHA 2DNUA 1U8RA 1WXUA 1B07A 5LJ5d 2K3XA 3CD6Q 5C6SA 1GCPA 3OBYA 3OYCA 5GAOp 2LRQA 2XICA 1IGQA 1JXMA 2A3LA 4DOWA 2KYBA 1GCQA 1SRMA 2KRNA 2K9GA 5GANf 2X3XD 4EDUA 9ATCB 3JB9D 3R6OA 5D7UA 4DBFA 1GBQA 4PLIA 1BI1A 2KK4A 2LMJA 2VC8A 4AG2C 1BI0A 3OS1A 2HMAA 3V7CA 1YI2Q 5KYWB 4GBQA 4M7DB 2CYZB 2LQWA 2X51A 1W2BS 1H92A 1MNDA 5FU6B 1WFWA 2E10A 4FSSA 2B86A 3OW2P 4JJDA 3C12A 2LZ6B 4PJLA 4MZMA 2YRDA 1SSFA 2LCCA 3N5BB 1PRMC 3HRUA 1K76A 3JV3A 2DM1A 3I9QA 2V1QA 4J83A 2DRKA 3GF5A 2P0KA 2WSCE 4PJOD 5IXFA 3L2RA 2VV5A 4M77G 3JCMX 3CCVA 2O9SA 3TQ7P 2WSEE 4BI8B 1TG0A 4ZNXA 3RBBB 1S72T 3JSCA 4DEYA 1QVFP 3U23A 2EVRA 3KBGA 2VKNA 3H9NA 2K2VA 3A8GB 1OEBA 2HKNA 2P0PA 3M5AA 2DF6A 1VQOT 1VQ8Q 3JCMb 1UB4A 2DXUA 4M7AG 5GAN5 4BI4A 3PVLA 2RQTA 1VQ4Q 3EG3A 2YT6A 2E6NA 1MNEA 5GAOr 1YJ9Q 5KYWA 3TSWA 4M7DA 3G71T 4A53A 2MI6A 2PQWA 1QVGP 2K6DA 4M75F 3RDVA 1G3TA 5IHIA 1Q81U 2HBPA 1E6HA 4VUBA 2KAFA 4M75E 4MMKA 2DXCA 2RA2A 2JN0A 3I55T 1WX6A 4RTZA 3G6EQ 2DJQA 1ZSGA 2VWFA 1JBMA 4OMQA 4C92C 3WVEB 4EIKA 2K79A 4GLKA 4AMCA 4E7JA 3JB9J 1OX9A 1VQMQ 2DTHA 3H0IA 1O75A 3OS2A 3MEVA 4JRKA 4PFZA 3CC7T 1UGVA 3V8LA 3BE3A 5GAN6 4RCCA 1TWBA 3OQ5A 3G4SA 1GBRA 2ECZA 2HSEB 2RK1A 1WGSA 4IKFA 4OMPA 2QXFA 3VS6A 2QAZA 3CCLT 3M0SA 2ABLA 1I1JA 2LDMA 4JPBW 1JB0E 5GAMj 2YSQA 4O5VA 2FRYA 4HKEA 2K57A 3D7SB 4CC7A 2RJDA 4M78F 3L1AA 2O4XB 1ACMB 3BFMA 4ZTJA 3IQLA 3OYAA 4OB2B 4M78E 1MMAA 1WXBA 3RR6A 4RG8A 2EQMA 1K8AR 1W2BA 4F14A 1AEYA 1GFCA 2OTJA 3NTIA 1PSEA 2FPDA 1X6GA 1RI9A 2I2LA 4FYXB 5GAMe 2PNIA 1K9AA 1T3LA 1AOJA 4J8OA 4RCBA 3VJPA 5HK0A 1M9SA 1I0CA 3CXCP 2C06A 3QDRB 3JCMW 1PRLC 2CZ7B 3CMAT 1A0NB 2XIDA 5LL6S 4EMKC 2A7YA 2SEMA 1HK9A 2L3SA 1KG1A 1X69A 4LE9A 2AHJB 2R58A 3OMCA 2K4YA 1VYVA 2O31A 4LUDA 2XU8A 3JCMJ 2D6FA 3A8HB 1ABQA 1N27A 1KQ2A 1QKXA 1U3OA 5CAIA 5I22A 1KK7A 1GXIE 1RAIB 2PVDB 2DTOA 1TUDA 4ELYC 2CDTA 3VS0A 4ZTFA 1M90R 1Q7YU 3FB9A 3G1JA 3L42A 3C94A 5GMKj 1B34B 5CKEA 5DLOA 2D1XA 1CKAA 2OTLQ 3CC2T 1VQ6Q 3ZBDA 1YHQQ 4C92G 2I0NA 2VUBA 3OYDA 2QEXT 4C8QG 4X34A 1VA7A 3VKIA 1D09B 1ZBXA 4F7UF 4X9CA 4M75C 1SSHA 2DXTA 3WVDB 1K73R 1KD1R 3GNFB 1BI3A 4F7UE 1J3TA 2LQ8A 3EHRA 5KYUB 2KRSA 5GMKe 2DVJA 1OZ3A 3LYIA 1ZA1B 1FMWA 2EQUA 1WHHA 1G3WA 4M4ZA 1T0HA 3QHSA 4QW2A 2L89A 1NE8A 1RI0A 1B3QA 2KI7A 2KVQG 3LH5A 4IUTA 2EPDA 3RUXA 3E2UA 3JB9F 3JCMh 2E12A 3A1PA 2MIOA 1RAHB 2CZ6B 1VQOA 3M59A 2EYQA 3URGA 4OB1B 5GAOm 1ARKA 3H8ZA 1M1KR 3QUIA 3CCST 5GJWB 4JRIA 1KQSS 4ZGJB 2VXEA 3FC3A 1PNJA 2CH4W 1BIBA 1F1BB 4OB3B 3MPUB 3JCMg 2MPXC 5KYUA 1C1AA 3VU3C 1QMCA 1RABB 3ER0A 1K1ZA 4PJOF 1WI7A 3ME9A 4FYVB 5LJ5j 1NPRA 3CC4T 2RQUA 4V2SA 2LJ3A 2LNHB 1YITA 3MP1A 3VRZA 1UFFA 3THKA 4PJOE 3E9FA 1VQKA 4E7ZA 1UGSB 1ZA2B 4M77F 4Z8AA 4BACA 1WZOA 4XU0A 4D6WA 3CD6T 2X4YA 2E65A 5M9OA 1UG1A 3JCMP 1G2BA 2P84A 1VQ5T 2RN8A 1DJ7B 2HEQA 2QQRA 4XU1A 3AT1B 1N6AA 1YJNQ 5LJ5e 1HXDA 1N8RU 4M7DD 2J05A 2BZ8A 4C5IA 2DL5A 1ZUKA 2RQWA 4PJJA 3SWNB 4C0DB 5FU7C 3CCET 4N0AA 3GP8A 3ULRB 2AT1B 2M02A 1PWTA 4XU3A 1WJSA 3QWXX 2HL3A 1RAEB 1UE9A 2LX9A 4AFSC 2QK0A 2COZA 1PSFA 5AYFA 1Q7YC 1YI2T 3NMZC 4R0KA 3KFVA 2XG8D 4OMFB 3JCMd 2NYSA 1VQ7Q 3PMTA 2QQ9A 1SKUB 3X26B 5GAN8 1JJ2P 3CQTA 3RERA 2ED1A 3CMEA 3PNWC 4OVAA 1T3SA 1K4US 5I21A 4DA4A 1NG2A 1SHGA 5GAMf 5I2SA 4Z88A 3CCQA 3TVTA 3L2ZA 2YHTA 3CCQQ 3EFOB 2RHXA 1U1TA 3C0CA 5GAOn 3R6NA 3V8KA 3A8MB 2LQNA 4M78G 2DPPB 5L8RE 2FEIA 1Y96A 3GNGA 1X27A 1QCNA 2P4TA 1YN8A 2V26A 1QP3A 1VQ8T 2KXDA 5A0LA 3RNJA 2QA4A 1VQNA 1KQSA 4JJBA 1IREB 4QQ6A 5CKDA 1VQNQ 2C0OA 1VQ4T 2DX1A 3CPFA 2BIVA 2V1RA 1AD5A 1BBZA 1YJ9T 4JLIA 4XTWA 5D6YA 2FZCB 3CCJA 3V7SA 1LVKA 1RAAB 3CCJQ 1ZHIA 3MEUA 1KFZA 2CP6A 3NHNA 2FPFA 4LXCA 4KH0B 2OJ2A 2W10A 1K0SA 4N4IA 5CO7A 1D0XA 4PJOC 1D1CA 3LGFA 5J26A 2KEAA 2GGRA 8AT1B 3PIPA 3MP8A 2DBKA 2RQRA 1VQ9Q 5J3BA 3INZA 3QWYA 3EFRA 4M77C 2XDPA 2DVEA 5KYXA 2R57A 1SG5A 4TVRA 1BK2A 4JJCA 3GLXA 1V29B 4HXJA 4A4HA 2R5AA 3RESA 1ZSZB 1FYNA 3OW2S 2CGHA 3UATA 2H8HA 3E19A 2E5QA 4NS5A 1M3BA 2L0AA 2E41A 2CZ0B 4LDVA 1W1FA 2ZPFB 3LH0A 3CCSA 3M57A 4M7AC 2RQVA 3CBOA 3I56A 2NUTB 1N8RC 2QYZA 4Z02A 1VQPQ 1XQHA 2KDSA 1TU0B 4C8QF 3A8OB 1KIKA 2ATCB 5GAOq 2EKHA 4JZ3A 1QVFS 1I07A 4J7IA 2M51A 2MOXA 2XHCA 3QZ9B 4QVCA 2M16A 1VYTA 1JO8A 3JB9G 3QPHA 2XK0A 4RUGA 1Y7XA 2RO0A 3MEWA 2P0QA 4HCKA 1YJWA 5CKHA 1M8VA 2JVVA 1QVGS 1WHGA 1ZSZA 4OGEA 1OYXA 4EMKB 2QGGA 4KGXB 3M58A 3P8DA 5GJVB 2LQKA 1FX7A 4IUQA 3CPWA 4DBHA 2OAUA 4J9CA 4LDWA 2K5LA 4FYYB 3M55A 1JQQA 2DKGA 2ZPBB 2NUTA 2Y90A 4B6MA 5A0GA 1OU9A 4MZTA 1AWXA 5CCAA 5LJ5f 1AT1B 3LW5E 1OZ2A 1U5SA 1I5OB 1VQ6T 2ZCFB 1YHQT 2PTKA 2BE9B 2YXYA 5GMKm 4PJOG 2F1LA 4RTTA 5CQYA 5KE2A 2EJ9A 2FL7A 1SRLA 4GY5A 2HAXA 2RHZA 2DL3A 5AT1B 1P92A 4LD9K 1RACB 3CCVQ 2KXCA 1MV0B 4BY6B 1YIJA 3RKYA 4N4GA 1UJYA 1M2VA 1UHFA 2IG0A 3UA6A 4EMKA 3TREA 5LJ3h 1ZQ1A 2JXBA 5FLXE 1OX8A 2LT1A 3EG1A 5FW9A 4M7DF 1MGQA 2EIFA 4QVDA 4R56A 3OW2A 1NLPC 7AT1B 1KJWA 4M7DE 1UGRB 3ZL7C 4E7HA 2K3YA 2L2PA 3CXCS 1VQLT 4OMMA 2KT8A 3VS4A 5D6WA 4HVVA 5HCKA 3S6WA 2ZPGB 4BDZA 3PFSA 1G5VA 1GFDA 3QZ5B 2CP3A 3ZEHA 1UHCA 1CSKA 2DYIA 4FCYA 4WTOB 2A0FB 3S3OA 2CZ1B 3H0HA 3JCMV 1MUZA 1PHTA 5LJ3g 4C8QC 4IUPA 5I2MA 3VS2A 1AVZC 4HCCA 4ESRA 4LDXA 1TXQA 3JAME 3A98A 1QCFA 4GLMA 4M75A 3OYNA 2LTOA 2BZXA 3G4SQ 2X9HA 2GFUA 1Q86R 5GAN3 2IPOB 3MEAA 2YWWA 3CCRT 1QVGA 2MMPA 3TEEA 2AKKA 1M30A 1UUEA 3UA7A 2DJZA 4KT0E 3L2QA 1WLPB 2MK5A 4XTUA 2EYYA 2CP5A 2RI3A 5HY6A 3CCUA 2Y4YA 3RKXA 1C6VX 1YJNT 4KRTA 3GBQA 2FPEA 2GBQA 1M4ZA 2H3JA 1N9RA 5FRNA 1R8OB 1IO6A 2OTJQ 3GOXA 1M90U 5IAYA 5LJ3d 4XAXB 3CCMA 5GAN2 3T9NA 1M1GA 2QDLA 2YUNA 4X1VA 1ZUUA 1VQ7T 2J6OA 1SEMA 4J6YA 2E70A 2F2WA 4A4EA 1I5LA 3PE0A 2PUOB 4QT7A 1K73U 1NYFA 2EFIA 1HSQA 2NUZA 3JCMe 1AZEA 1QWEA 1Q82R 3VYHB 2LJ1A 2L5QA 3M4GA 2VYTA 1MV3A 1QLYA 2DYBA 2E6ZA 3QKJA 1MMGA 4Q5WA 3PT9A 1K9MR 2RMOA 2LCSA 3SHWA 1RADB 5D6XA 5FU6C 1SHFA 3CXCA 1QWFA 1FMVA 4B9XA 4F17A 4AFUC 2RI2A 2AK5A 3VV0A 3E1SA 4ZGEB 2M0YA 2KSSA 2M1HA 4NL2A 3EG0A 1QQJA 4EMHA 1ABOA 2HDAA 2YUPA 1M1KU 5KYYB 1FWZA 3DLMA 4JRQA 1M5Q1 4AFZC 4ZGDB 4WCIA 3QG1A 2RF0A 4FW2A 1WYXA 2LX7A 2A28A 1FMKA 3OS0A 1Q81C 1I8FA 1OPKA 2RJFA 3CEYA 3OSSC 1G3SA 1LNXA 2PU9B 1K0XA 1NEBA 1AZGB 2JOYA 4F7UA 1M1FA 2DO3A 1KHCA 2YLBA 1S72A 1VIFA 1UECA 3RIRA 1QKWA 1S1NA 3WXMB 1YNZA 3OYBA 3VUZA 5CIUA 4ME7A 2ZPIB 3QSUA 2VB6A 2WACA 1VQ9T 3RMSA 1VQOQ 1TUCA 1Q7YR 4KUIA 2JTMA 4WF2A 2MCNA 1KQ1A 3MO8A 2IVWA 1KSWA 5FROA 3QO3A 4M78C 4BE2A 1AWWA 3UF4A 4JDSA 2CSIA 2F5TX 1NM7A 3G71A 2GTJA 1JJ2S 1VQLA 2OAWA 4L6V5 2VGNA 3NPFA 5KYYA 2Y4XA 1RLQC 3QJYA 1LCKA 3M0TA 1RAFB
chains in the Genus database with same CATH topology
3I55A 1ZHIA 3SDZA 4MZMA 1VQPT 1SSFA 3MEUA 2FB7A 2LCCA 3N5BB 3DKMA 2ZGWA 1XTDA 3HRUA 4M7AB 1KD1U 4N4IA 1M90C 4J83A 5CO7A 3GF5A 1JRIA 2P0KA 2WSCE 3CMET 3CC7A 4PJOD 3L2RA 2VV5A 3LGFA 4PJOC 5J26A 4F7UB 2R5MA 2RD1A 3OYFA 3KXTA 4E7IA 4M77G 3JCMX 4FU6A 3CCVA 3PIPA 2WSEE 3MP8A 4BI8B 3CCQT 2PUKB 4JS4A 4M7DG 2JZ2A 1S72T 1U1SA 3JSCA 5J3BA 5FRMA 3INZA 3EFRA 3KBGA 4M77C 3CCLA 3OS5A 2XDPA 4LDYA 2K2VA 4EMGA 3A8GB 4HA8A 5HK3A 3O8VA 4OGCA 3J81E 2P0PA 1K73C 2DVEA 3M5AA 3CCRA 2R57A 1Y96B 4M7DC 3ZFJA 4TVRA 2DD5A 3BW1A 4BDYA 1VQOT 5LJ3f 3GLXA 3JCMb 1VIEA 1V29B 1OI1A 1UB4A 1WJQA 2R5AA 3RESA 4XTZA 4A4HA 2DAQA 2DXUA 4BI3A 3PIOA 3OW2S 2CGHA 4FT4A 5GAN5 4M7AG 3E19A 4Y91A 4BI4A 2E5QA 3OYGA 1NJIU 4NS5A 4M77A 2E41A 2CZ0B 2O4XA 4LDVA 2QA4T 2ZPEB 2E6NA 5GAOr 4J7FA 4LD6A 1D3BA 1VQNT 2ZPFB 3LH0A 4C5GA 3CCSA 2JNGA 2QQAA 3M57A 4M7DA 3G71T 2PVGB 4M7AC 4A53A 3CBOA 3I56A 1Q86C 2MI6A 2PQWA 2RB6A 2X35A 5C0MA 1VUBA 2DTIA 2OTLA 1N8RC 1VQ6A 4Z02A 1YHQA 4ATOA 4M75F 4FIBA 1G3TA 1XQHA 2KDSA 3DB3A 4C8QF 3G7ZA 1Q81U 3A8OB 4DOVA 4RMOA 2HBPA 2E64A 1QVPA 4VUBA 3CCJT 2KAFA 4M75E 4MMKA 2HNIA 4ZN1A 2DXCA 5GAOq 2RA2A 2JN0A 4FSXA 4C0FA 3I55T 1NPPA 1W4SA 4BY6C 2X4JA 3L2VA 4M7AA 3HFOA 4C92D 3CMAA 2GCXA 4C92C 1JBMA 2EWNA 2D9TA 1QVFS 3WVEB 4C8QD 4J7IA 4GLKA 2V8KA 3MP6A 4E7JA 4E7LA 3OB9A 3JB9J 5GAMh 1M1KC 4HCBA 2DTHA 2XHCA 4C0GA 3QZ9B 1O75A 4KBMB 1K8AC 3V7SA 4QVCA 3OS2A 3OYJA 3MEVA 4JRKA 2M16A 3CC7T 3V8LA 3JB9G 5GAN6 2F69A 4RCCA 4QQDA 3QPHA 5KE3A 3QXEB 2QTXA 2XK0A 1BIAA 1Y7XA 3OQ5A 3G4SA 3CCVT 3OYKA 5IT9E 2RK1A 3UDCA 2RO0A 3MEWA 3HL8A 5GAOl 1WGSA 2P0QA 4C0ZA 3L2UA 1KC8U 1YJWA 4A4GA 5GANh 5CKHA 4IKFA 1H3ZA 2QXFA 1M8VA 2RI5A 2DIQA 3SD4A 2ZZDA 4PJOB 3CCLT 2X4WA 3MCAB 4J6WA 3JRZA 1UGQB 2JVVA 1QVGS 5CKFA 2HQXA 2RM4A 4OGEA 4EMKB 1OYXA 1QP2A 1I4K1 2QQSA 3M58A 3P8DA 3ASKA 2LDMA 3JCMf 3V7RA 2LQKA 1JB0E 5GAMj 4O5VA 1FX7A 4IUQA 3CPWA 4HKEA 2K57A 2OAUA 4M77B 2XDBA 2RJDA 4LDWA 2K5LA 3L1AA 4M78F 3M55A 2O4XB 5GAMg 3BFMA 2DKGA 3BY7A 4C5EA 4ZTJA 2O01E 2V8JA 2ZPBB 3CC2A 3HKSA 2Y90A 1Q82U 3OYAA 1B34A 4M78E 4OB2B 5A0GA 2LVMA 2XD0A 5GANj 4MZTA 1Q82C 4RG8A 2RHIA 5CCAA 2QEXA 4JRPA 2EQMA 1IZ6A 1KHIA 2EJGA 3HRTA 3LW5E 1OZ2A 5LJ5f 3I56T 1W2BA 2OTJA 3NTIA 1VQ6T 2EQKA 2ZCFB 1YHQT 1LOJA 5GANg 1PSEA 2QI2A 2I2LA 5GMKm 4PJOG 5GAMe 4J8OA 4RCBA 5CQYA 5KE2A 2EJ9A 3VJPA 5HK0A 1M9SA 3G6ET 4J6XA 2C06A 3QDRB 4MZPA 1K9MC 2FL7A 3HHTB 3JCMW 2CZ7B 2DXBA 3X20B 3CMAT 1RL2A 1BKBA 3C4SA 4GY5A 2HAXA 2XIDA 3OYHA 3CBPA 5LL6S 1TH7A 4EMKC 1VQMT 4XQ3A 2A7YA 2X4XA 2RHZA 2EKOA 1P92A 5GANe 1X01A 2RJCA 4LD9K 2WSFE 1HK9A 2LT4A 4BUGA 3PTAA 1KG1A 1MHNA 4BY6B 4BB7A 1YIJA 3RKYA 4C92B 5GMKh 2RHYA 2QQBA 4N4GA 3S3MA 5GMKi 4O6JA 3X24B 2AHJB 2R58A 1X6OA 2F5KA 3OMCA 4KULA 3G4ST 1KD1C 4M7AF 2XDDA 3LWIA 4PJOA 2G3RA 2K4YA 4N4HA 1YJWT 2IG0A 2PVOB 2XU8A 3FDRA 2L3RA 4L5GA 3TREA 3V8JA 5LJ3h 1ZQ1A 5FLXE 4EMKA 3UPUA 2LT1A 2D6FA 3A8HB 4UC4A 4BE1A 1N27A 1KQ2A 4LDUA 4M7DF 5CAIA 1MGQA 2EIFA 4QVDA 1GXIE 4M77E 2E1HA 1XNIA 3CBMA 4R56A 3OW2A 2DIGA 2PVDB 2DTOA 5J39A 4ELYC 4ZTFA 4MMLA 3X25B 1YJNA 4M7DE 1UGRB 3TU4K 1Q7YU 3FB9A 5GAMd 4E7HA 1BYMA 3L42A 2K3YA 3C94A 3OMGA 3CXCS 3OY9A 5GMKj 1VQLT 1B34B 2KY9A 5CKEA 5DLOA 3A8LB 1G3YA 5D6WA 4MDWA 3S6WA 4BDZA 2ZPGB 2EQJA 3CC2T 2FYKA 2RJEA 1XOVA 3PGGA 1X75C 2K5IA 4M75G 3ZBDA 3PFSA 5CR2A 4C92G 1G5VA 3QZ5B 2VUBA 3ZEHA 3OYDA 4A4KA 2QEXT 2KQWA 4C8QG 5LJ3j 4X34A 1UEBA 3FRNA 3JB9H 2XI9A 3VKIA 5GANd 4RKUE 1AHJB 3S3OA 1ZBXA 4F7UF 4M7AE 4X9CA 2OTJT 2LNVA 2CZ1B 4M75D 1NJIC 4M75C 3LWHA 3GPLA 3JCMV 2DXTA 5LJ3g 2EJFA 3WVDB 3P8HA 4B9WA 3VYGA 4C8QC 3LLRA 3GNFB 1H641 3HP9A 1BI3A 3LX7A 3VUBA 3JCMQ 4F7UE 3L2WA 4IUPA 2LQ8A 1VQ7A 5I2MA 3S3NA 4OB0B 1NZ9A 3QYGB 4HCCA 3META 3FIFA 1N9SA 5GMKe 4LDXA 1YCYA 3JAME 1OZ3A 3CC4A 3LYIA 4JLGA 3M56A 2GF7A 4M75A 3OYNA 3DLLA 2EQUA 4C92A 4C5HA 2LTOA 1G3WA 4YTLA 5LJ3e 4L59A 2BKDN 3A5ZB 4C8QA 5HKCA 2GFUA 2MWPA 3QHSA 4QW2A 2L89A 5GAN3 3CD6A 1YIJT 1NE8A 1RI0A 3MEAA 2KVQG 2JUFA 2JTFA 4IUVA 3NTKA 4IUTA 4DQ2A 1LJOA 3RUXA 3JB9F 3SWNC 3CCRT 4C0DC 1QVGA 2MMPA 3OSVA 3TEEA 1VQ5A 3JCMh 2VXFA 2E12A 4ZN3A 4PLLA 2DJZA 5DY9A 3J7AF 4KT0E 2BUDA 3L2QA 2CZ6B 1VQOA 3M59A 4XTUA 3JB9I 5KH6A 2MAMA 2EYQA 2RI3A 3M4YA 5HY6A 3URGA 4J5YA 3CCUA 3KUFA 2Y4YA 3BDUA 4OB1B 3SFMA 1JJ2A 2RK2A 5GAOm 3RKXA 1KC8C 1WJRA 3EAEA 3H8ZA 3CCEA 3LGLA 5KCOA 1YJNT 3QUIA 3NTHA 3SWNA 3CCST 2K5FA 4M78D 4PNOA 4X9DA 4E7KA 4JRIA 1KQSS 4ZGJB 2VXEA 3FC3A 3CPWS 1M4ZA 2H3JA 5DLQE 5LJ5h 2CS7A 3HSBA 4JUVA 1N9RA 2OTLT 5A2QE 4XK8E 3JCMJ 4HT8A 2HD0A 4PKCC 5FRNA 1R8OB 5CKBA 4HT9A 3QJ6A 3RKWA 1BI2A 4A4FA 1QW1A 2M9UA 3GOXA 1M90U 1YI2A 1FXXA 1BIBA 2D0QB 2FVUA 2HQEA 2YRVA 5IAYA 3M9QA 3OYYA 4OB3B 5LJ3d 3JCMg 3FJPA 4XAXB 5CVIA 3JCMc 3OA6A 3VU3C 3CCMA 5GAN2 3T9NA 1M1GA 3OYMA 2L8DA 3ER0A 1I81A 5IN1A 3C95A 1VQ7T 4PJOF 1WQ7A 3HRSA 4J6YA 2E70A 2DEQA 3ME9A 1NPRA 5LJ5j 4A4EA 4M75B 1I5LA 2PUOB 4OF1A 3CC4T 2FHDA 1K73U 4V2SA 3QIIA 2EFIA 2GFAA 4E47A 1YITA 3GIBA 3MP1A 4C8QB 4P5NA 4PJOE 3E9FA 3JCMe 1VQKA 5LJ5g 1UGSB 4M77F 1WPYA 3VYHB 4BACA 3QBYA 4XU0A 4PL6A 4D6WA 3FLGA 3CD6T 2B8AA 2X4YA 2E65A 2L5QA 3BDLA 3M4GA 5M9OA 2VYTA 3UT1A 3F70A 3JCMP 4A54A 4N0AC 5CK9A 4R55A 1VQ9A 3MHXA 2LC4A 3PMIA 2E6ZA 3QKJA 4M77D 1VQ5T 3NFCA 4XTYA 3RMQA 1DJ7B 1Y07A 2QQRA 1Q86U 4Q5WA 4XU1A 3PT9A 1N6AA 2DZ9A 2M0OA 3OYEA 5LJ5e 1HXDA 4RG2A 4XTXA 1N8RU 1VQ8A 4IUUA 4M7DD 1WNLA 3QYHB 3M54A 5D6XA 4C5IA 3CCUT 5FU6C 3HPWA 2MF2A 3SWNB 3CXCA 4C0DB 2XKOC 3H6ZA 3AHUA 2NLUA 4B9XA 5FU7C 3CCET 4N0AA 3GP8A 2RI2A 3VV0A 1VQ4A 4XU3A 2V8IA 3E1SA 1WJSA 4Y28E 4ZGEB 2KSSA 2M1HA 4NOYA 4NL2A 1YJ9A 1O9SA 4EMHA 4EPCA 2LX9A 4IURA 4MDXA 4F7UG 4M7AD 4QQGA 3EFSA 3HFNA 1M1KU 1PSFA 5AYFA 1FWZA 5DM7R 1Q7YC 1YI2T 1QVFA 2GQVA 3DLMA 1VQPA 4JRQA 2XG8D 1K8AU 4OMFB 3JCMd 4M78B 1WQWA 1M5Q1 4C92F 4ZGDB 4CRIA 4BE0A 3PMTA 2QQ9A 3QG1A 3X26B 3TCJA 5GAN8 4BD3A 2RHUA 1Y71A 3OYLA 3CCMT 2DK3A 3OS0A 3G6EA 1Q81C 1I8FA 4C92E 3RERA 4CI0C 1UGPB 2RJFA 3CEYA 5GAN4 3OSSC 4C8QE 4ELZC 3CMEA 3PNWC 1G3SA 4OVAA 5I21A 5KCHA 4FM4B 4DA4A 1LNXA 2PU9B 4XU2A 5GAMf 3X28B 1VQMA 2YLCA 5I2SA 2JOYA 1U8RA 4F7UA 5LJ5d 2K3XA 2DZCA 1YITT 5C6SA 1M1FA 3CCQA 2DO3A 4FL6A 1KHCA 2EAYA 3OBYA 2YLBA 1VQKT 1S72A 3L2ZA 1VIFA 2YHTA 3OYCA 3RIRA 5GAOp 1EIFA 2LRQA 2XICA 2RHXA 3J80E 1U1TA 3WXMB 5GAOn 2QDYB 3P8BB 3OYBA 2A3LA 4DOWA 3VUZA 5CIUA 4ME7A 2MWOA 2ZPIB 4HCZA 3V8KA 5GANf 3QSUA 3A8MB 4EDUA 2WACA 4M78G 3JB9D 3R6OA 3SB2A 1VQ9T 3RMSA 2DPPB 5L8RE 3Q1JA 4QVZA 1Y96A 2DD4A 2JTMA 3GNGA 3M53A 1KQ1A 4FT2A 4KUIA 3MO8A 4WF2A 4XTVA 4JS5A 2P4TA 2CKKA 2IVWA 4II1A 1BI1A 4PLIA 2KK4A 3OBWA 3OYIA 5FROA 1QP3A 2VC8A 3QO3A 4M78C 4BE2A 1VQ8T 4KUDK 4OP0A 4JDSA 5A0LA 2F5TX 1BI0A 3DB4A 2QA4A 5GMKl 1VQNA 1KQSA 5A0DA 2ZPHB 1IREB 3OS1A 4QQ6A 5CKDA 3G71A 2KMTA 1JJ2S 1VQLA 4JJNK 5EG2A 1VQ4T 3V7CA 1K9MU 2VGMA 3CPFA 1D3BB 2VGNA 3FEOA 4L6V5 5CQXA 3UWNA 2BIVA 3E9GA 4M7DB 2CYZB 2LCLA 2Y4XA 1YJ9T 3QJYA 4JLIA 4XTWA 5D6YA 1W2BS 2RH2A 5FU6B 4M78A 2E10A 1YBYA 4NL3A 3CCJA 5FU7B 5GAN7 3C12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMI A;  3UT1 A;  4B9W A;  3P8H A;  2HQX A;  3QKJ A;  1SSF A;  3LLR A;  3LX7 A;  3MEU A;  1OYX A;  2QQR A;  2LCC A;  3L2W A;  2QQS A;  3P8D A;  4Q5W A;  3ASK A;  2LDM A;  4IUP A;  3OYE A;  2M0O A;  4RG2 A;  3S3N A;  3SD4 A;  4IUQ A;  4IUU A;  3MET A;  4N4I A;  5D6X A;  4C5I A;  2RJD A;  1OZ3 A;  3LYI A;  2O4X B;  2P0K A;  2GF7 A;  3H6Z A;  2NLU A;  4B9X A;  4C5E A;  3L2R A;  4ZTJ A;  3LGF A;  3OYN A;  5J26 A;  2EQU A;  2RI2 A;  4C5H A;  2R5M A;  3OYF A;  2LTO A;  4E7I A;  3OYA A;  1WJS A;  4L59 A;  2BKD N;  2LVM A;  4FU6 A;  2M1H A;  2GFU A;  2MWP A;  2RHI A;  4QW2 A;  3MP8 A;  2L89 A;  2EQM A;  4IUR A;  1OZ2 A;  3MEA A;  1RI0 A;  4QQG A;  2JZ2 A;  2JTF A;  3NTI A;  4IUV A;  3NTK A;  2EQK A;  4IUT A;  5FRM A;  2XDP A;  3DLM A;  3O8V A;  4PLL A;  2R57 A;  4CRI A;  5KE2 A;  4BDY A;  4BE0 A;  3PMT A;  2BUD A;  3L2Q A;  4BD3 A;  1OI1 A;  2RHU A;  1WJQ A;  2R5A A;  4A4H A;  5KH6 A;  2DAQ A;  2RI3 A;  3OS0 A;  3C4S A;  3KUF A;  4GY5 A;  2RJF A;  3CEY A;  3OYH A;  1WJR A;  3PNW C;  2E5Q A;  3EAE A;  3H8Z A;  4OVA A;  3LGL A;  4NS5 A;  5KCO A;  3OYG A;  2X4X A;  5KCH A;  2RHZ A;  3NTH A;  2EKO A;  4E7K A;  2O4X A;  2RJC A;  2E6N A;  4LD6 A;  3LH0 A;  4C5G A;  3FC3 A;  1MHN A;  2K3X A;  5C6S A;  5FRN A;  4FL6 A;  1KHC A;  2PQW A;  2RHY A;  2X35 A;  5C0M A;  3QJ6 A;  4N4G A;  3S3M A;  3OYC A;  4Z02 A;  2LRQ A;  4A4F A;  2RHX A;  3OMC A;  2R58 A;  2F5K A;  3GOX A;  3OYB A;  2G3R A;  5CIU A;  3DB3 A;  4N4H A;  2MWO A;  2HQE A;  2IG0 A;  2YRV A;  3FDR A;  4HCZ A;  2L3R A;  5IAY A;  3M9Q A;  4EDU A;  2WAC A;  3OYL A;  3L2U A;  4UC4 A;  4BE1 A;  3OA6 A;  1N27 A;  3Q1J A;  4QVZ A;  3L2V A;  3MO8 A;  1XNI A;  3OYM A;  2L8D A;  2DIG A;  2D9T A;  2CKK A;  4II1 A;  4PLI A;  5J39 A;  5IN1 A;  3OYI A;  4ZTF A;  5FRO A;  4BE2 A;  3MP6 A;  4E7J A;  4E7L A;  3OB9 A;  3ME9 A;  3DB4 A;  4E7H A;  4A4E A;  3L42 A;  2K3Y A;  2FHD A;  3OMG A;  3OS1 A;  3QII A;  3OS2 A;  3OY9 A;  2EFI A;  2GFA A;  4QQ6 A;  3MEV A;  3OYJ A;  3MP1 A;  2M16 A;  3E9F A;  5D6W A;  4QQD A;  3S6W A;  5KE3 A;  4BDZ A;  2EQJ A;  2RJE A;  2XK0 A;  3FEO A;  3PFS A;  1G5V A;  3OQ5 A;  3UWN A;  2BIV A;  3E9G A;  3ZEH A;  3OYK A;  3OYD A;  4BAC A;  2RO0 A;  3MEW A;  3QBY A;  4PL6 A;  1WGS A;  3FLG A;  4X34 A;  5D6Y A;  2B8A A;  2X4Y A;  3BDL A;  4A4G A;  4IKF A;  3S3O A;  1H3Z A;  5M9O A;  2VYT A;  2RI5 A;  2DIQ A;  3F70 A;  2X4W A; 
#chains in the Genus database with same CATH topology
 3I55 A;  3SDZ A;  1VQP T;  4LUE A;  4PJM A;  3DKM A;  2ZGW A;  1NLO C;  1D0Z A;  1XTD A;  1AWJ A;  2CT4 A;  4M7A B;  1B7T A;  1M90 C;  2KBT A;  1JRI A;  1YIT Q;  2ESW A;  3CC7 A;  2QGF B;  1VQK Q;  1RAG B;  4J9D A;  3OYF A;  1WDX A;  4FU6 A;  4CC3 A;  4DEX A;  2YUQ A;  4M7D G;  1OUL A;  2JZ2 A;  1U1S A;  5FRM A;  3CCL A;  4LDY A;  4EMG A;  3J81 E;  4HA8 A;  1K73 C;  3CCR A;  1Y96 B;  3BW1 A;  4BDY A;  1G83 A;  3VS5 A;  1VIE A;  1PG5 B;  1OI1 A;  3H41 A;  1WJQ A;  4XTZ A;  2DAQ A;  2JMC A;  5KYN A;  2C0T A;  4BI3 A;  1X2Q A;  4FT4 A;  5L23 A;  2F2V A;  2DIL A;  2P4R A;  1NJI U;  4M77 A;  2EGA A;  4JZ4 A;  2ZPE B;  4LD6 A;  4C5G A;  2QQA A;  1QCO A;  2YDL A;  2PVG B;  2DL8 A;  1VUB A;  2DTI A;  4ATO A;  2DMO A;  2HBW A;  3DB3 A;  3G7Z A;  4DOV A;  4RMO A;  3OYL A;  2HNI A;  1NPP A;  1W4S A;  4M7A A;  3HFO A;  3CMA A;  2CSQ A;  2D9T A;  3CME Q;  2V8K A;  3MP6 A;  3OB9 A;  1D0Y A;  1M1K C;  1W6X A;  4HCB A;  4PFO A;  2CT3 A;  4QQD A;  5KE3 A;  1BIA A;  1WA7 A;  1X43 A;  3OYK A;  3CCV T;  5GAO l;  3L2U A;  3HL8 A;  4C0Z A;  1KC8 U;  5GAN h;  1Z9Z A;  1T0J A;  2DIQ A;  2ZZD A;  5KYX B;  2X4W A;  4J6W A;  3JRZ A;  1UGQ B;  2HQX A;  2RM4 A;  1YWO A;  2QQS A;  3JCM f;  4Y92 A;  1YWP A;  3ASK A;  4DBR A;  4E7S A;  2QA4 Q;  1M2O A;  2OX7 A;  3VRY A;  2XDB A;  2GNC A;  1EFN A;  4C5E A;  3BY7 A;  2O01 E;  3EH1 A;  3CC2 A;  3HKS A;  2XD0 A;  2O2O A;  2LVM A;  1V76 A;  2QEX A;  1ZX6 A;  2DE0 X;  3HRT A;  1NYG A;  2EQK A;  1LOJ A;  5GAN g;  2D8H A;  2LP5 A;  4D8K A;  2FZG B;  3M0R A;  2BE7 D;  2DET A;  3G6E T;  4MZP A;  3X20 B;  1RL2 A;  3C4S A;  1X2K A;  4E2F B;  1VQM T;  2VAS A;  2QAS A;  3O5Z A;  1IB8 A;  1X01 A;  2COY A;  2RJC A;  4BUG A;  1AWO A;  1MHN A;  1RUW A;  3HTR A;  4BB7 A;  4C92 B;  2QQB A;  4O6J A;  3X24 B;  3EGU A;  3G4S T;  4KUL A;  2XDD A;  4N4H A;  3FDR A;  2L3R A;  4BE1 A;  2DER A;  4LDU A;  3EG2 A;  2E1H A;  2E5K A;  1IXD A;  5J39 A;  4MML A;  3X25 B;  2ROL A;  3TU4 K;  2EW3 A;  2HCK A;  2JJ9 A;  1BYM A;  3CCS Q;  3OMG A;  3I56 Q;  2W0Z A;  3A8L B;  1G3Y A;  3FJ5 A;  4MDW A;  1TUG B;  2FYK A;  2RJE A;  1XOV A;  4CC4 B;  2K5I A;  4ANJ A;  4F16 A;  5LJ3 j;  3FRN A;  3JB9 H;  2XI9 A;  5GAN d;  2FRW A;  2OTJ T;  2KRO A;  1NJI C;  3LWH A;  3GPL A;  4B9W A;  3P8H A;  3LLR A;  3LX7 A;  2EGE A;  3VUB A;  3EGD A;  1GL5 A;  1ZBJ A;  1M8M A;  3S3N A;  1NZ9 A;  2D0N A;  3MET A;  1N9S A;  1V1C A;  1HD3 A;  1YCY A;  2CUB A;  3CC4 A;  2J6F A;  3DLL A;  4C92 A;  4C5H A;  2D8J A;  5LJ3 e;  4L59 A;  2BKD N;  3A5Z B;  4C8Q A;  1WIE A;  2DEU A;  1YJW Q;  3CD6 A;  4F04 B;  1M2V B;  2JUF A;  2COW A;  3SWN C;  4C0D C;  1VQ5 A;  3OSV A;  2GTO A;  2JTE A;  1VQ5 Q;  2O9V A;  2BUD A;  1HYO A;  1IHV A;  3KUF A;  2CUD A;  2KT1 A;  2LJ0 A;  1KC8 C;  3EAE A;  4J9F A;  2RNA A;  3LGL A;  4IIO A;  5KCO A;  3CCE A;  2EQI A;  3NTH A;  4E7K A;  2K5F A;  4PNO A;  3CCE Q;  2KGT A;  2OTL T;  2HD0 A;  5CKB A;  4PFP A;  4OMO A;  3RKW A;  1BI2 A;  4A4F A;  1QW1 A;  1YI2 A;  1R0B G;  1JU5 C;  2D0Q B;  2HQE A;  2YRV A;  3OYY A;  4OMN A;  3M0P A;  3OYM A;  2J06 A;  3C95 A;  1GRI A;  3HRS A;  2DEQ A;  4PJN A;  4M75 B;  2EYX A;  4J9H A;  2FHD A;  3QII A;  5FWB A;  4E47 A;  3GIB A;  1YIJ Q;  4P5N A;  5ECA A;  3EGX B;  1MMD A;  2KNB B;  2JMA A;  3FLG A;  3BDL A;  3UT1 A;  3F70 A;  2JW4 A;  2LC4 A;  3PMI A;  5I11 A;  2HKQ B;  4M77 D;  4OML A;  1Q86 U;  2NUP B;  2DZ9 A;  4RG2 A;  1TTH B;  3I35 A;  4XTX A;  1VQ8 A;  4IUU A;  4HVU A;  4PK4 A;  1VQ4 A;  2FG0 A;  2PZ1 A;  3I5R A;  4Y28 E;  1YJ9 A;  4EPC A;  3PVQ A;  4AG1 C;  4IUR A;  4M7A D;  3EFS A;  2XMF A;  3HFN A;  1ZUY A;  1D1B A;  1QVF A;  1K8A U;  4ORZ A;  2QG9 B;  2O88 A;  1Y0M A;  1PC0 A;  4M78 B;  1WQW A;  4QKU A;  2J6K A;  4BD3 A;  3G6E A;  1UGP B;  2QTV A;  5GAN 4;  1GCQ C;  1VOM A;  4FM4 B;  1W2B P;  4XU2 A;  3EGX A;  1VQM A;  3X28 B;  2YLC A;  2CP2 A;  2DZC A;  1YIT T;  1W70 A;  1EZZ B;  1H3H A;  2DA9 A;  4FL6 A;  2EAY A;  1VQK T;  2JM9 A;  1ZSZ C;  1EIF A;  3J80 E;  4AT1 B;  2QDY B;  3P8B B;  3REA B;  1IHW A;  2ZAE A;  2K7A A;  2MWO A;  3VS1 A;  4HCZ A;  2NUP A;  3SB2 A;  1PKT A;  3Q1J A;  4QVZ A;  4FT2 A;  2ED0 A;  2AIR B;  2DD4 A;  3M53 A;  3CCU Q;  4XTV A;  4JS5 A;  1Q82 U;  1JEG A;  1TOV A;  2CKK A;  4II1 A;  3OBW A;  3OYI A;  4KUD K;  4OP0 A;  3DB4 A;  5GMK l;  5A0D A;  2ZPH B;  1Q81 R;  3EG9 B;  2KMT A;  1TS9 A;  2K3B A;  4JJN K;  5EG2 A;  1K9M U;  2VGM A;  1OOT A;  1D3B B;  3FEO A;  5IXB A;  5CQX A;  3UWN A;  4FYW B;  3E9G A;  2LCL A;  4HVW A;  2RH2 A;  4J9E A;  2L3P A;  4M78 A;  1YBY A;  4NL3 A;  5FU7 B;  2FZK B;  4RTW A;  5GAN 7;  1WHM A;  3CCM Q;  2FB7 A;  1PD1 A;  1KD1 U;  2A08 A;  4RTU A;  3CME T;  2YRC A;  2C0I A;  2X3W D;  4F7U B;  2R5M A;  2RD1 A;  3KXT A;  4E7I A;  4E6R A;  1WXT A;  3CCQ T;  2PUK B;  2DLP A;  4JS4 A;  2BZY A;  3OS5 A;  4KGV B;  5HK3 A;  3O8V A;  4OGC A;  4FW1 A;  4M7D C;  3ZFJ A;  2DD5 A;  4IIM A;  5LJ3 f;  1ZLM A;  1UTI A;  2AZS A;  3PIO A;  2VVK A;  1YFN A;  3EG9 A;  4Y91 A;  3OYG A;  2DBM A;  2O4X A;  2QA4 T;  2ROT A;  4J7F A;  1M3A A;  1D3B A;  1VQN T;  1H8K A;  2JM8 A;  2JNG A;  1OV3 A;  3I5S A;  1Q86 C;  2H3E B;  2RB6 A;  2JS2 A;  2X35 A;  5C0M A;  2OTL A;  1VQ6 A;  1YHQ A;  2AKL A;  4FIB A;  2J7I A;  1PM3 A;  2E64 A;  3H0F A;  1QVP A;  3CCJ T;  4ZN1 A;  4FSX A;  1WHK A;  4C0F A;  1D1A A;  4KH1 B;  4BY6 C;  2X4J A;  3L2V A;  4C92 D;  2GCX A;  2EWN A;  2CP7 A;  4C8Q D;  6AT1 B;  4E7L A;  5GAM h;  4C0G A;  1R0C B;  2DL7 A;  4KBM B;  1G8X A;  2F2X A;  1K8A C;  3OYJ A;  1Q95 G;  3REB B;  2F69 A;  1S72 Q;  3QXE B;  2QTX A;  1UJ0 A;  5IT9 E;  3EH2 A;  3UDC A;  4A4G A;  1H3Z A;  2RI5 A;  1OU8 A;  3SD4 A;  1WHJ A;  4J9I A;  1RLP C;  4PJO B;  3MCA B;  5CKF A;  1BB9 A;  1QP2 A;  1EX4 A;  1I4K 1;  3V7R A;  2E3H A;  2A37 A;  4M77 B;  4DBQ A;  1MMN A;  3G71 Q;  5GAM g;  1IRX A;  1IGU A;  1VQL Q;  2V8J A;  1B34 A;  3M0U A;  4LN2 A;  5GAN j;  1Q82 C;  4JRP A;  2RHI A;  5IH2 A;  2OI3 A;  1IZ6 A;  1KHI A;  2EJG A;  3I56 T;  5FWC A;  3I55 Q;  2HQH A;  2KRM A;  2QI2 A;  1JXO A;  4J6X A;  1U06 A;  2EYZ A;  1K9M C;  3HHT B;  2DXB A;  2DL4 A;  1SF9 A;  1BKB A;  1VYU A;  3OYH A;  3CC7 Q;  3CBP A;  1TH7 A;  4XQ3 A;  2X4X A;  2EKO A;  2L3Q A;  5GAN e;  2WSF E;  2LT4 A;  3PTA A;  2K2M A;  1NBE B;  3M0Q A;  1BU1 A;  4K11 A;  5IHK A;  5GMK h;  2RHY A;  3S3M A;  5GMK i;  3CCL Q;  1X6O A;  2F5K A;  4J9B A;  4PJO A;  1KD1 C;  3LWI A;  2G3R A;  3CCR Q;  1YJW T;  2PVO B;  4L5G A;  3UPU A;  3V8J A;  1BCO A;  3QDF A;  4UC4 A;  1WHL A;  2HZY A;  1M27 C;  4M77 E;  1XNI A;  3CBM A;  2DIG A;  1TSF A;  2CRE A;  1YJN A;  5GAM d;  4RTY A;  3OY9 A;  2KY9 A;  3VS7 A;  2EQJ A;  3PGG A;  4M7A F;  4M75 G;  1X75 C;  5CR2 A;  1PCX A;  1X6B A;  4A4K A;  2KQW A;  1UEB A;  4RKU E;  1AHJ B;  2Z0W A;  4M7A E;  2LNV A;  4M75 D;  1NEG A;  1LPL A;  4AFQ C;  2EJF A;  3CMA Q;  3VYG A;  4RTX A;  1H64 1;  3HP9 A;  3JCM Q;  3L2W A;  1VQ7 A;  1KQS P;  4A63 B;  4OB0 B;  2MYS A;  3QYG B;  3FIF A;  4JLG A;  3M56 A;  2GF7 A;  2KR3 A;  3NGP A;  2CP0 A;  4YTL A;  1R77 A;  2DFU A;  5HKC A;  2MWP A;  3MKD A;  1YIJ T;  1N8R R;  4CC2 A;  2JTF A;  4IUV A;  1OPL A;  3NTK A;  4KGZ B;  4DQ2 A;  1E7O A;  1LJO A;  2EGC A;  2E4H A;  2VXF A;  4ZN3 A;  4PLL A;  5DY9 A;  3J7A F;  2HL5 C;  1UDL A;  2FO0 A;  1NJI R;  3JB9 I;  5KH6 A;  1OQK A;  2MAM A;  3M4Y A;  1PKS A;  1JJ2 A;  4J5Y A;  2JS0 A;  3BDU A;  3SFM A;  2RK2 A;  1WJR A;  1BCM A;  3CC2 Q;  2HSP A;  3SWN A;  4X9D A;  4M78 D;  3CPW S;  2QEX Q;  5DLQ E;  1C0M A;  5LJ5 h;  2CS7 A;  3HSB A;  4JUV A;  5A2Q E;  4XK8 E;  4HT8 A;  4PKC C;  4J9G A;  4HT9 A;  3QJ6 A;  2SRC A;  2M9U A;  1FXX A;  1SPK A;  2RPN A;  2FVU A;  3M9Q A;  3FJP A;  3OA6 A;  5CVI A;  3JCM c;  3EGD B;  2L8D A;  4Z89 A;  1I81 A;  5IN1 A;  1HJD A;  1N5Z A;  1WQ7 A;  4OF1 A;  2GFA A;  4RTV A;  4C8Q B;  3MJX A;  1KC8 R;  5LJ5 g;  5IHN A;  1WPY A;  4D8D A;  2IIM A;  3QBY A;  4PL6 A;  2KE9 A;  2B8A A;  3EFO A;  1VQ9 A;  4A54 A;  4N0A C;  5CK9 A;  4R55 A;  3MHX A;  1Z9Q A;  3NFC A;  4XTY A;  3RMQ A;  1Y07 A;  1PD0 A;  2AZV A;  2GQI A;  3TSZ A;  1M3C A;  2BTT A;  3OYE A;  2M0O A;  1WNL A;  3QYH B;  4LNP A;  5EC7 A;  1CKB A;  3M54 A;  2E3I A;  3CCU T;  3HPW A;  1E6G A;  2MF2 A;  2JT4 A;  2XKO C;  3H6Z A;  8ATC B;  2NLU A;  2YUO A;  3AHU A;  2EBP A;  2V8I A;  1YCS B;  2A36 A;  4NOY A;  2CH4 A;  1O9S A;  2EYW A;  1YP5 A;  4MDX A;  4F7U G;  4QQG A;  2ENM A;  2NWM A;  3SEM A;  5DM7 R;  3VS3 A;  2GQV A;  1VQP A;  3CPW P;  2DRM A;  4C92 F;  4CRI A;  1XJW B;  4BE0 A;  3EHQ A;  3TCJ A;  2G6F X;  2RHU A;  1Y71 A;  3CCM T;  2DK3 A;  3CC4 Q;  4C92 E;  4CI0 C;  4ELZ C;  4C8Q E;  1Y57 A;  2KYM A;  5KCH A;  2DNU A;  1U8R A;  1WXU A;  1B07 A;  5LJ5 d;  2K3X A;  3CD6 Q;  5C6S A;  1GCP A;  3OBY A;  3OYC A;  5GAO p;  2LRQ A;  2XIC A;  1IGQ A;  1JXM A;  2A3L A;  4DOW A;  2KYB A;  1GCQ A;  1SRM A;  2KRN A;  2K9G A;  5GAN f;  2X3X D;  4EDU A;  9ATC B;  3JB9 D;  3R6O A;  5D7U A;  4DBF A;  1GBQ A;  4PLI A;  1BI1 A;  2KK4 A;  2LMJ A;  2VC8 A;  4AG2 C;  1BI0 A;  3OS1 A;  2HMA A;  3V7C A;  1YI2 Q;  5KYW B;  4GBQ A;  4M7D B;  2CYZ B;  2LQW A;  2X51 A;  1W2B S;  1H92 A;  1MND A;  5FU6 B;  1WFW A;  2E10 A;  4FSS A;  2B86 A;  3OW2 P;  4JJD A;  3C12 A;  2LZ6 B;  4PJL A;  4MZM A;  2YRD A;  1SSF A;  2LCC A;  3N5B B;  1PRM C;  3HRU A;  1K76 A;  3JV3 A;  2DM1 A;  3I9Q A;  2V1Q A;  4J83 A;  2DRK A;  3GF5 A;  2P0K A;  2WSC E;  4PJO D;  5IXF A;  3L2R A;  2VV5 A;  4M77 G;  3JCM X;  3CCV A;  2O9S A;  3TQ7 P;  2WSE E;  4BI8 B;  1TG0 A;  4ZNX A;  3RBB B;  1S72 T;  3JSC A;  4DEY A;  1QVF P;  3U23 A;  2EVR A;  3KBG A;  2VKN A;  3H9N A;  2K2V A;  3A8G B;  1OEB A;  2HKN A;  2P0P A;  3M5A A;  2DF6 A;  1VQO T;  1VQ8 Q;  3JCM b;  1UB4 A;  2DXU A;  4M7A G;  5GAN 5;  4BI4 A;  3PVL A;  2RQT A;  1VQ4 Q;  3EG3 A;  2YT6 A;  2E6N A;  1MNE A;  5GAO r;  1YJ9 Q;  5KYW A;  3TSW A;  4M7D A;  3G71 T;  4A53 A;  2MI6 A;  2PQW A;  1QVG P;  2K6D A;  4M75 F;  3RDV A;  1G3T A;  5IHI A;  1Q81 U;  2HBP A;  1E6H A;  4VUB A;  2KAF A;  4M75 E;  4MMK A;  2DXC A;  2RA2 A;  2JN0 A;  3I55 T;  1WX6 A;  4RTZ A;  3G6E Q;  2DJQ A;  1ZSG A;  2VWF A;  1JBM A;  4OMQ A;  4C92 C;  3WVE B;  4EIK A;  2K79 A;  4GLK A;  4AMC A;  4E7J A;  3JB9 J;  1OX9 A;  1VQM Q;  2DTH A;  3H0I A;  1O75 A;  3OS2 A;  3MEV A;  4JRK A;  4PFZ A;  3CC7 T;  1UGV A;  3V8L A;  3BE3 A;  5GAN 6;  4RCC A;  1TWB A;  3OQ5 A;  3G4S A;  1GBR A;  2ECZ A;  2HSE B;  2RK1 A;  1WGS A;  4IKF A;  4OMP A;  2QXF A;  3VS6 A;  2QAZ A;  3CCL T;  3M0S A;  2ABL A;  1I1J A;  2LDM A;  4JPB W;  1JB0 E;  5GAM j;  2YSQ A;  4O5V A;  2FRY A;  4HKE A;  2K57 A;  3D7S B;  4CC7 A;  2RJD A;  4M78 F;  3L1A A;  2O4X B;  1ACM B;  3BFM A;  4ZTJ A;  3IQL A;  3OYA A;  4OB2 B;  4M78 E;  1MMA A;  1WXB A;  3RR6 A;  4RG8 A;  2EQM A;  1K8A R;  1W2B A;  4F14 A;  1AEY A;  1GFC A;  2OTJ A;  3NTI A;  1PSE A;  2FPD A;  1X6G A;  1RI9 A;  2I2L A;  4FYX B;  5GAM e;  2PNI A;  1K9A A;  1T3L A;  1AOJ A;  4J8O A;  4RCB A;  3VJP A;  5HK0 A;  1M9S A;  1I0C A;  3CXC P;  2C06 A;  3QDR B;  3JCM W;  1PRL C;  2CZ7 B;  3CMA T;  1A0N B;  2XID A;  5LL6 S;  4EMK C;  2A7Y A;  2SEM A;  1HK9 A;  2L3S A;  1KG1 A;  1X69 A;  4LE9 A;  2AHJ B;  2R58 A;  3OMC A;  2K4Y A;  1VYV A;  2O31 A;  4LUD A;  2XU8 A;  3JCM J;  2D6F A;  3A8H B;  1ABQ A;  1N27 A;  1KQ2 A;  1QKX A;  1U3O A;  5CAI A;  5I22 A;  1KK7 A;  1GXI E;  1RAI B;  2PVD B;  2DTO A;  1TUD A;  4ELY C;  2CDT A;  3VS0 A;  4ZTF A;  1M90 R;  1Q7Y U;  3FB9 A;  3G1J A;  3L42 A;  3C94 A;  5GMK j;  1B34 B;  5CKE A;  5DLO A;  2D1X A;  1CKA A;  2OTL Q;  3CC2 T;  1VQ6 Q;  3ZBD A;  1YHQ Q;  4C92 G;  2I0N A;  2VUB A;  3OYD A;  2QEX T;  4C8Q G;  4X34 A;  1VA7 A;  3VKI A;  1D09 B;  1ZBX A;  4F7U F;  4X9C A;  4M75 C;  1SSH A;  2DXT A;  3WVD B;  1K73 R;  1KD1 R;  3GNF B;  1BI3 A;  4F7U E;  1J3T A;  2LQ8 A;  3EHR A;  5KYU B;  2KRS A;  5GMK e;  2DVJ A;  1OZ3 A;  3LYI A;  1ZA1 B;  1FMW A;  2EQU A;  1WHH A;  1G3W A;  4M4Z A;  1T0H A;  3QHS A;  4QW2 A;  2L89 A;  1NE8 A;  1RI0 A;  1B3Q A;  2KI7 A;  2KVQ G;  3LH5 A;  4IUT A;  2EPD A;  3RUX A;  3E2U A;  3JB9 F;  3JCM h;  2E12 A;  3A1P A;  2MIO A;  1RAH B;  2CZ6 B;  1VQO A;  3M59 A;  2EYQ A;  3URG A;  4OB1 B;  5GAO m;  1ARK A;  3H8Z A;  1M1K R;  3QUI A;  3CCS T;  5GJW B;  4JRI A;  1KQS S;  4ZGJ B;  2VXE A;  3FC3 A;  1PNJ A;  2CH4 W;  1BIB A;  1F1B B;  4OB3 B;  3MPU B;  3JCM g;  2MPX C;  5KYU A;  1C1A A;  3VU3 C;  1QMC A;  1RAB B;  3ER0 A;  1K1Z A;  4PJO F;  1WI7 A;  3ME9 A;  4FYV B;  5LJ5 j;  1NPR A;  3CC4 T;  2RQU A;  4V2S A;  2LJ3 A;  2LNH B;  1YIT A;  3MP1 A;  3VRZ A;  1UFF A;  3THK A;  4PJO E;  3E9F A;  1VQK A;  4E7Z A;  1UGS B;  1ZA2 B;  4M77 F;  4Z8A A;  4BAC A;  1WZO A;  4XU0 A;  4D6W A;  3CD6 T;  2X4Y A;  2E65 A;  5M9O A;  1UG1 A;  3JCM P;  1G2B A;  2P84 A;  1VQ5 T;  2RN8 A;  1DJ7 B;  2HEQ A;  2QQR A;  4XU1 A;  3AT1 B;  1N6A A;  1YJN Q;  5LJ5 e;  1HXD A;  1N8R U;  4M7D D;  2J05 A;  2BZ8 A;  4C5I A;  2DL5 A;  1ZUK A;  2RQW A;  4PJJ A;  3SWN B;  4C0D B;  5FU7 C;  3CCE T;  4N0A A;  3GP8 A;  3ULR B;  2AT1 B;  2M02 A;  1PWT A;  4XU3 A;  1WJS A;  3QWX X;  2HL3 A;  1RAE B;  1UE9 A;  2LX9 A;  4AFS C;  2QK0 A;  2COZ A;  1PSF A;  5AYF A;  1Q7Y C;  1YI2 T;  3NMZ C;  4R0K A;  3KFV A;  2XG8 D;  4OMF B;  3JCM d;  2NYS A;  1VQ7 Q;  3PMT A;  2QQ9 A;  1SKU B;  3X26 B;  5GAN 8;  1JJ2 P;  3CQT A;  3RER A;  2ED1 A;  3CME A;  3PNW C;  4OVA A;  1T3S A;  1K4U S;  5I21 A;  4DA4 A;  1NG2 A;  1SHG A;  5GAM f;  5I2S A;  4Z88 A;  3CCQ A;  3TVT A;  3L2Z A;  2YHT A;  3CCQ Q;  3EFO B;  2RHX A;  1U1T A;  3C0C A;  5GAO n;  3R6N A;  3V8K A;  3A8M B;  2LQN A;  4M78 G;  2DPP B;  5L8R E;  2FEI A;  1Y96 A;  3GNG A;  1X27 A;  1QCN A;  2P4T A;  1YN8 A;  2V26 A;  1QP3 A;  1VQ8 T;  2KXD A;  5A0L A;  3RNJ A;  2QA4 A;  1VQN A;  1KQS A;  4JJB A;  1IRE B;  4QQ6 A;  5CKD A;  1VQN Q;  2C0O A;  1VQ4 T;  2DX1 A;  3CPF A;  2BIV A;  2V1R A;  1AD5 A;  1BBZ A;  1YJ9 T;  4JLI A;  4XTW A;  5D6Y A;  2FZC B;  3CCJ A;  3V7S A;  1LVK A;  1RAA B;  3CCJ Q;  1ZHI A;  3MEU A;  1KFZ A;  2CP6 A;  3NHN A;  2FPF A;  4LXC A;  4KH0 B;  2OJ2 A;  2W10 A;  1K0S A;  4N4I A;  5CO7 A;  1D0X A;  4PJO C;  1D1C A;  3LGF A;  5J26 A;  2KEA A;  2GGR A;  8AT1 B;  3PIP A;  3MP8 A;  2DBK A;  2RQR A;  1VQ9 Q;  5J3B A;  3INZ A;  3QWY A;  3EFR A;  4M77 C;  2XDP A;  2DVE A;  5KYX A;  2R57 A;  1SG5 A;  4TVR A;  1BK2 A;  4JJC A;  3GLX A;  1V29 B;  4HXJ A;  4A4H A;  2R5A A;  3RES A;  1ZSZ B;  1FYN A;  3OW2 S;  2CGH A;  3UAT A;  2H8H A;  3E19 A;  2E5Q A;  4NS5 A;  1M3B A;  2L0A A;  2E41 A;  2CZ0 B;  4LDV A;  1W1F A;  2ZPF B;  3LH0 A;  3CCS A;  3M57 A;  4M7A C;  2RQV A;  3CBO A;  3I56 A;  2NUT B;  1N8R C;  2QYZ A;  4Z02 A;  1VQP Q;  1XQH A;  2KDS A;  1TU0 B;  4C8Q F;  3A8O B;  1KIK A;  2ATC B;  5GAO q;  2EKH A;  4JZ3 A;  1QVF S;  1I07 A;  4J7I A;  2M51 A;  2MOX A;  2XHC A;  3QZ9 B;  4QVC A;  2M16 A;  1VYT A;  1JO8 A;  3JB9 G;  3QPH A;  2XK0 A;  4RUG A;  1Y7X A;  2RO0 A;  3MEW A;  2P0Q A;  4HCK A;  1YJW A;  5CKH A;  1M8V A;  2JVV A;  1QVG S;  1WHG A;  1ZSZ A;  4OGE A;  1OYX A;  4EMK B;  2QGG A;  4KGX B;  3M58 A;  3P8D A;  5GJV B;  2LQK A;  1FX7 A;  4IUQ A;  3CPW A;  4DBH A;  2OAU A;  4J9C A;  4LDW A;  2K5L A;  4FYY B;  3M55 A;  1JQQ A;  2DKG A;  2ZPB B;  2NUT A;  2Y90 A;  4B6M A;  5A0G A;  1OU9 A;  4MZT A;  1AWX A;  5CCA A;  5LJ5 f;  1AT1 B;  3LW5 E;  1OZ2 A;  1U5S A;  1I5O B;  1VQ6 T;  2ZCF B;  1YHQ T;  2PTK A;  2BE9 B;  2YXY A;  5GMK m;  4PJO G;  2F1L A;  4RTT A;  5CQY A;  5KE2 A;  2EJ9 A;  2FL7 A;  1SRL A;  4GY5 A;  2HAX A;  2RHZ A;  2DL3 A;  5AT1 B;  1P92 A;  4LD9 K;  1RAC B;  3CCV Q;  2KXC A;  1MV0 B;  4BY6 B;  1YIJ A;  3RKY A;  4N4G A;  1UJY A;  1M2V A;  1UHF A;  2IG0 A;  3UA6 A;  4EMK A;  3TRE A;  5LJ3 h;  1ZQ1 A;  2JXB A;  5FLX E;  1OX8 A;  2LT1 A;  3EG1 A;  5FW9 A;  4M7D F;  1MGQ A;  2EIF A;  4QVD A;  4R56 A;  3OW2 A;  1NLP C;  7AT1 B;  1KJW A;  4M7D E;  1UGR B;  3ZL7 C;  4E7H A;  2K3Y A;  2L2P A;  3CXC S;  1VQL T;  4OMM A;  2KT8 A;  3VS4 A;  5D6W A;  4HVV A;  5HCK A;  3S6W A;  2ZPG B;  4BDZ A;  3PFS A;  1G5V A;  1GFD A;  3QZ5 B;  2CP3 A;  3ZEH A;  1UHC A;  1CSK A;  2DYI A;  4FCY A;  4WTO B;  2A0F B;  3S3O A;  2CZ1 B;  3H0H A;  3JCM V;  1MUZ A;  1PHT A;  5LJ3 g;  4C8Q C;  4IUP A;  5I2M A;  3VS2 A;  1AVZ C;  4HCC A;  4ESR A;  4LDX A;  1TXQ A;  3JAM E;  3A98 A;  1QCF A;  4GLM A;  4M75 A;  3OYN A;  2LTO A;  2BZX A;  3G4S Q;  2X9H A;  2GFU A;  1Q86 R;  5GAN 3;  2IPO B;  3MEA A;  2YWW A;  3CCR T;  1QVG A;  2MMP A;  3TEE A;  2AKK A;  1M30 A;  1UUE A;  3UA7 A;  2DJZ A;  4KT0 E;  3L2Q A;  1WLP B;  2MK5 A;  4XTU A;  2EYY A;  2CP5 A;  2RI3 A;  5HY6 A;  3CCU A;  2Y4Y A;  3RKX A;  1C6V X;  1YJN T;  4KRT A;  3GBQ A;  2FPE A;  2GBQ A;  1M4Z A;  2H3J A;  1N9R A;  5FRN A;  1R8O B;  1IO6 A;  2OTJ Q;  3GOX A;  1M90 U;  5IAY A;  5LJ3 d;  4XAX B;  3CCM A;  5GAN 2;  3T9N A;  1M1G A;  2QDL A;  2YUN A;  4X1V A;  1ZUU A;  1VQ7 T;  2J6O A;  1SEM A;  4J6Y A;  2E70 A;  2F2W A;  4A4E A;  1I5L A;  3PE0 A;  2PUO B;  4QT7 A;  1K73 U;  1NYF A;  2EFI A;  1HSQ A;  2NUZ A;  3JCM e;  1AZE A;  1QWE A;  1Q82 R;  3VYH B;  2LJ1 A;  2L5Q A;  3M4G A;  2VYT A;  1MV3 A;  1QLY A;  2DYB A;  2E6Z A;  3QKJ A;  1MMG A;  4Q5W A;  3PT9 A;  1K9M R;  2RMO A;  2LCS A;  3SHW A;  1RAD B;  5D6X A;  5FU6 C;  1SHF A;  3CXC A;  1QWF A;  1FMV A;  4B9X A;  4F17 A;  4AFU C;  2RI2 A;  2AK5 A;  3VV0 A;  3E1S A;  4ZGE B;  2M0Y A;  2KSS A;  2M1H A;  4NL2 A;  3EG0 A;  1QQJ A;  4EMH A;  1ABO A;  2HDA A;  2YUP A;  1M1K U;  5KYY B;  1FWZ A;  3DLM A;  4JRQ A;  1M5Q 1;  4AFZ C;  4ZGD B;  4WCI A;  3QG1 A;  2RF0 A;  4FW2 A;  1WYX A;  2LX7 A;  2A28 A;  1FMK A;  3OS0 A;  1Q81 C;  1I8F A;  1OPK A;  2RJF A;  3CEY A;  3OSS C;  1G3S A;  1LNX A;  2PU9 B;  1K0X A;  1NEB A;  1AZG B;  2JOY A;  4F7U A;  1M1F A;  2DO3 A;  1KHC A;  2YLB A;  1S72 A;  1VIF A;  1UEC A;  3RIR A;  1QKW A;  1S1N A;  3WXM B;  1YNZ A;  3OYB A;  3VUZ A;  5CIU A;  4ME7 A;  2ZPI B;  3QSU A;  2VB6 A;  2WAC A;  1VQ9 T;  3RMS A;  1VQO Q;  1TUC A;  1Q7Y R;  4KUI A;  2JTM A;  4WF2 A;  2MCN A;  1KQ1 A;  3MO8 A;  2IVW A;  1KSW A;  5FRO A;  3QO3 A;  4M78 C;  4BE2 A;  1AWW A;  3UF4 A;  4JDS A;  2CSI A;  2F5T X;  1NM7 A;  3G71 A;  2GTJ A;  1JJ2 S;  1VQL A;  2OAW A;  4L6V 5;  2VGN A;  3NPF A;  5KYY A;  2Y4X A;  1RLQ C;  3QJY A;  1LCK A;  3M0T A;  1RAF B; 
#chains in the Genus database with same CATH homology
 3I55 A;  1ZHI A;  3SDZ A;  4MZM A;  1VQP T;  1SSF A;  3MEU A;  2FB7 A;  2LCC A;  3N5B B;  3DKM A;  2ZGW A;  1XTD A;  3HRU A;  4M7A B;  1KD1 U;  4N4I A;  1M90 C;  4J83 A;  5CO7 A;  3GF5 A;  1JRI A;  2P0K A;  2WSC E;  3CME T;  3CC7 A;  4PJO D;  3L2R A;  2VV5 A;  3LGF A;  4PJO C;  5J26 A;  4F7U B;  2R5M A;  2RD1 A;  3OYF A;  3KXT A;  4E7I A;  4M77 G;  3JCM X;  4FU6 A;  3CCV A;  3PIP A;  2WSE E;  3MP8 A;  4BI8 B;  3CCQ T;  2PUK B;  4JS4 A;  4M7D G;  2JZ2 A;  1S72 T;  1U1S A;  3JSC A;  5J3B A;  5FRM A;  3INZ A;  3EFR A;  3KBG A;  4M77 C;  3CCL A;  3OS5 A;  2XDP A;  4LDY A;  2K2V A;  4EMG A;  3A8G B;  4HA8 A;  5HK3 A;  3O8V A;  4OGC A;  3J81 E;  2P0P A;  1K73 C;  2DVE A;  3M5A A;  3CCR A;  2R57 A;  1Y96 B;  4M7D C;  3ZFJ A;  4TVR A;  2DD5 A;  3BW1 A;  4BDY A;  1VQO T;  5LJ3 f;  3GLX A;  3JCM b;  1VIE A;  1V29 B;  1OI1 A;  1UB4 A;  1WJQ A;  2R5A A;  3RES A;  4XTZ A;  4A4H A;  2DAQ A;  2DXU A;  4BI3 A;  3PIO A;  3OW2 S;  2CGH A;  4FT4 A;  5GAN 5;  4M7A G;  3E19 A;  4Y91 A;  4BI4 A;  2E5Q A;  3OYG A;  1NJI U;  4NS5 A;  4M77 A;  2E41 A;  2CZ0 B;  2O4X A;  4LDV A;  2QA4 T;  2ZPE B;  2E6N A;  5GAO r;  4J7F A;  4LD6 A;  1D3B A;  1VQN T;  2ZPF B;  3LH0 A;  4C5G A;  3CCS A;  2JNG A;  2QQA A;  3M57 A;  4M7D A;  3G71 T;  2PVG B;  4M7A C;  4A53 A;  3CBO A;  3I56 A;  1Q86 C;  2MI6 A;  2PQW A;  2RB6 A;  2X35 A;  5C0M A;  1VUB A;  2DTI A;  2OTL A;  1N8R C;  1VQ6 A;  4Z02 A;  1YHQ A;  4ATO A;  4M75 F;  4FIB A;  1G3T A;  1XQH A;  2KDS A;  3DB3 A;  4C8Q F;  3G7Z A;  1Q81 U;  3A8O B;  4DOV A;  4RMO A;  2HBP A;  2E64 A;  1QVP A;  4VUB A;  3CCJ T;  2KAF A;  4M75 E;  4MMK A;  2HNI A;  4ZN1 A;  2DXC A;  5GAO q;  2RA2 A;  2JN0 A;  4FSX A;  4C0F A;  3I55 T;  1NPP A;  1W4S A;  4BY6 C;  2X4J A;  3L2V A;  4M7A A;  3HFO A;  4C92 D;  3CMA A;  2GCX A;  4C92 C;  1JBM A;  2EWN A;  2D9T A;  1QVF S;  3WVE B;  4C8Q D;  4J7I A;  4GLK A;  2V8K A;  3MP6 A;  4E7J A;  4E7L A;  3OB9 A;  3JB9 J;  5GAM h;  1M1K C;  4HCB A;  2DTH A;  2XHC A;  4C0G A;  3QZ9 B;  1O75 A;  4KBM B;  1K8A C;  3V7S A;  4QVC A;  3OS2 A;  3OYJ A;  3MEV A;  4JRK A;  2M16 A;  3CC7 T;  3V8L A;  3JB9 G;  5GAN 6;  2F69 A;  4RCC A;  4QQD A;  3QPH A;  5KE3 A;  3QXE B;  2QTX A;  2XK0 A;  1BIA A;  1Y7X A;  3OQ5 A;  3G4S A;  3CCV T;  3OYK A;  5IT9 E;  2RK1 A;  3UDC A;  2RO0 A;  3MEW A;  3HL8 A;  5GAO l;  1WGS A;  2P0Q A;  4C0Z A;  3L2U A;  1KC8 U;  1YJW A;  4A4G A;  5GAN h;  5CKH A;  4IKF A;  1H3Z A;  2QXF A;  1M8V A;  2RI5 A;  2DIQ A;  3SD4 A;  2ZZD A;  4PJO B;  3CCL T;  2X4W A;  3MCA B;  4J6W A;  3JRZ A;  1UGQ B;  2JVV A;  1QVG S;  5CKF A;  2HQX A;  2RM4 A;  4OGE A;  4EMK B;  1OYX A;  1QP2 A;  1I4K 1;  2QQS A;  3M58 A;  3P8D A;  3ASK A;  2LDM A;  3JCM f;  3V7R A;  2LQK A;  1JB0 E;  5GAM j;  4O5V A;  1FX7 A;  4IUQ A;  3CPW A;  4HKE A;  2K57 A;  2OAU A;  4M77 B;  2XDB A;  2RJD A;  4LDW A;  2K5L A;  3L1A A;  4M78 F;  3M55 A;  2O4X B;  5GAM g;  3BFM A;  2DKG A;  3BY7 A;  4C5E A;  4ZTJ A;  2O01 E;  2V8J A;  2ZPB B;  3CC2 A;  3HKS A;  2Y90 A;  1Q82 U;  3OYA A;  1B34 A;  4M78 E;  4OB2 B;  5A0G A;  2LVM A;  2XD0 A;  5GAN j;  4MZT A;  1Q82 C;  4RG8 A;  2RHI A;  5CCA A;  2QEX A;  4JRP A;  2EQM A;  1IZ6 A;  1KHI A;  2EJG A;  3HRT A;  3LW5 E;  1OZ2 A;  5LJ5 f;  3I56 T;  1W2B A;  2OTJ A;  3NTI A;  1VQ6 T;  2EQK A;  2ZCF B;  1YHQ T;  1LOJ A;  5GAN g;  1PSE A;  2QI2 A;  2I2L A;  5GMK m;  4PJO G;  5GAM e;  4J8O A;  4RCB A;  5CQY A;  5KE2 A;  2EJ9 A;  3VJP A;  5HK0 A;  1M9S A;  3G6E T;  4J6X A;  2C06 A;  3QDR B;  4MZP A;  1K9M C;  2FL7 A;  3HHT B;  3JCM W;  2CZ7 B;  2DXB A;  3X20 B;  3CMA T;  1RL2 A;  1BKB A;  3C4S A;  4GY5 A;  2HAX A;  2XID A;  3OYH A;  3CBP A;  5LL6 S;  1TH7 A;  4EMK C;  1VQM T;  4XQ3 A;  2A7Y A;  2X4X A;  2RHZ A;  2EKO A;  1P92 A;  5GAN e;  1X01 A;  2RJC A;  4LD9 K;  2WSF E;  1HK9 A;  2LT4 A;  4BUG A;  3PTA A;  1KG1 A;  1MHN A;  4BY6 B;  4BB7 A;  1YIJ A;  3RKY A;  4C92 B;  5GMK h;  2RHY A;  2QQB A;  4N4G A;  3S3M A;  5GMK i;  4O6J A;  3X24 B;  2AHJ B;  2R58 A;  1X6O A;  2F5K A;  3OMC A;  4KUL A;  3G4S T;  1KD1 C;  4M7A F;  2XDD A;  3LWI A;  4PJO A;  2G3R A;  2K4Y A;  4N4H A;  1YJW T;  2IG0 A;  2PVO B;  2XU8 A;  3FDR A;  2L3R A;  4L5G A;  3TRE A;  3V8J A;  5LJ3 h;  1ZQ1 A;  5FLX E;  4EMK A;  3UPU A;  2LT1 A;  2D6F A;  3A8H B;  4UC4 A;  4BE1 A;  1N27 A;  1KQ2 A;  4LDU A;  4M7D F;  5CAI A;  1MGQ A;  2EIF A;  4QVD A;  1GXI E;  4M77 E;  2E1H A;  1XNI A;  3CBM A;  4R56 A;  3OW2 A;  2DIG A;  2PVD B;  2DTO A;  5J39 A;  4ELY C;  4ZTF A;  4MML A;  3X25 B;  1YJN A;  4M7D E;  1UGR B;  3TU4 K;  1Q7Y U;  3FB9 A;  5GAM d;  4E7H A;  1BYM A;  3L42 A;  2K3Y A;  3C94 A;  3OMG A;  3CXC S;  3OY9 A;  5GMK j;  1VQL T;  1B34 B;  2KY9 A;  5CKE A;  5DLO A;  3A8L B;  1G3Y A;  5D6W A;  4MDW A;  3S6W A;  4BDZ A;  2ZPG B;  2EQJ A;  3CC2 T;  2FYK A;  2RJE A;  1XOV A;  3PGG A;  1X75 C;  2K5I A;  4M75 G;  3ZBD A;  3PFS A;  5CR2 A;  4C92 G;  1G5V A;  3QZ5 B;  2VUB A;  3ZEH A;  3OYD A;  4A4K A;  2QEX T;  2KQW A;  4C8Q G;  5LJ3 j;  4X34 A;  1UEB A;  3FRN A;  3JB9 H;  2XI9 A;  3VKI A;  5GAN d;  4RKU E;  1AHJ B;  3S3O A;  1ZBX A;  4F7U F;  4M7A E;  4X9C A;  2OTJ T;  2LNV A;  2CZ1 B;  4M75 D;  1NJI C;  4M75 C;  3LWH A;  3GPL A;  3JCM V;  2DXT A;  5LJ3 g;  2EJF A;  3WVD B;  3P8H A;  4B9W A;  3VYG A;  4C8Q C;  3LLR A;  3GNF B;  1H64 1;  3HP9 A;  1BI3 A;  3LX7 A;  3VUB A;  3JCM Q;  4F7U E;  3L2W A;  4IUP A;  2LQ8 A;  1VQ7 A;  5I2M A;  3S3N A;  4OB0 B;  1NZ9 A;  3QYG B;  4HCC A;  3MET A;  3FIF A;  1N9S A;  5GMK e;  4LDX A;  1YCY A;  3JAM E;  1OZ3 A;  3CC4 A;  3LYI A;  4JLG A;  3M56 A;  2GF7 A;  4M75 A;  3OYN A;  3DLL A;  2EQU A;  4C92 A;  4C5H A;  2LTO A;  1G3W A;  4YTL A;  5LJ3 e;  4L59 A;  2BKD N;  3A5Z B;  4C8Q A;  5HKC A;  2GFU A;  2MWP A;  3QHS A;  4QW2 A;  2L89 A;  5GAN 3;  3CD6 A;  1YIJ T;  1NE8 A;  1RI0 A;  3MEA A;  2KVQ G;  2JUF A;  2JTF A;  4IUV A;  3NTK A;  4IUT A;  4DQ2 A;  1LJO A;  3RUX A;  3JB9 F;  3SWN C;  3CCR T;  4C0D C;  1QVG A;  2MMP A;  3OSV A;  3TEE A;  1VQ5 A;  3JCM h;  2VXF A;  2E12 A;  4ZN3 A;  4PLL A;  2DJZ A;  5DY9 A;  3J7A F;  4KT0 E;  2BUD A;  3L2Q A;  2CZ6 B;  1VQO A;  3M59 A;  4XTU A;  3JB9 I;  5KH6 A;  2MAM A;  2EYQ A;  2RI3 A;  3M4Y A;  5HY6 A;  3URG A;  4J5Y A;  3CCU A;  3KUF A;  2Y4Y A;  3BDU A;  4OB1 B;  3SFM A;  1JJ2 A;  2RK2 A;  5GAO m;  3RKX A;  1KC8 C;  1WJR A;  3EAE A;  3H8Z A;  3CCE A;  3LGL A;  5KCO A;  1YJN T;  3QUI A;  3NTH A;  3SWN A;  3CCS T;  2K5F A;  4M78 D;  4PNO A;  4X9D A;  4E7K A;  4JRI A;  1KQS S;  4ZGJ B;  2VXE A;  3FC3 A;  3CPW S;  1M4Z A;  2H3J A;  5DLQ E;  5LJ5 h;  2CS7 A;  3HSB A;  4JUV A;  1N9R A;  2OTL T;  5A2Q E;  4XK8 E;  3JCM J;  4HT8 A;  2HD0 A;  4PKC C;  5FRN A;  1R8O B;  5CKB A;  4HT9 A;  3QJ6 A;  3RKW A;  1BI2 A;  4A4F A;  1QW1 A;  2M9U A;  3GOX A;  1M90 U;  1YI2 A;  1FXX A;  1BIB A;  2D0Q B;  2FVU A;  2HQE A;  2YRV A;  5IAY A;  3M9Q A;  3OYY A;  4OB3 B;  5LJ3 d;  3JCM g;  3FJP A;  4XAX B;  5CVI A;  3JCM c;  3OA6 A;  3VU3 C;  3CCM A;  5GAN 2;  3T9N A;  1M1G A;  3OYM A;  2L8D A;  3ER0 A;  1I81 A;  5IN1 A;  3C95 A;  1VQ7 T;  4PJO F;  1WQ7 A;  3HRS A;  4J6Y A;  2E70 A;  2DEQ A;  3ME9 A;  1NPR A;  5LJ5 j;  4A4E A;  4M75 B;  1I5L A;  2PUO B;  4OF1 A;  3CC4 T;  2FHD A;  1K73 U;  4V2S A;  3QII A;  2EFI A;  2GFA A;  4E47 A;  1YIT A;  3GIB A;  3MP1 A;  4C8Q B;  4P5N A;  4PJO E;  3E9F A;  3JCM e;  1VQK A;  5LJ5 g;  1UGS B;  4M77 F;  1WPY A;  3VYH B;  4BAC A;  3QBY A;  4XU0 A;  4PL6 A;  4D6W A;  3FLG A;  3CD6 T;  2B8A A;  2X4Y A;  2E65 A;  2L5Q A;  3BDL A;  3M4G A;  5M9O A;  2VYT A;  3UT1 A;  3F70 A;  3JCM P;  4A54 A;  4N0A C;  5CK9 A;  4R55 A;  1VQ9 A;  3MHX A;  2LC4 A;  3PMI A;  2E6Z A;  3QKJ A;  4M77 D;  1VQ5 T;  3NFC A;  4XTY A;  3RMQ A;  1DJ7 B;  1Y07 A;  2QQR A;  1Q86 U;  4Q5W A;  4XU1 A;  3PT9 A;  1N6A A;  2DZ9 A;  2M0O A;  3OYE A;  5LJ5 e;  1HXD A;  4RG2 A;  4XTX A;  1N8R U;  1VQ8 A;  4IUU A;  4M7D D;  1WNL A;  3QYH B;  3M54 A;  5D6X A;  4C5I A;  3CCU T;  5FU6 C;  3HPW A;  2MF2 A;  3SWN B;  3CXC A;  4C0D B;  2XKO C;  3H6Z A;  3AHU A;  2NLU A;  4B9X A;  5FU7 C;  3CCE T;  4N0A A;  3GP8 A;  2RI2 A;  3VV0 A;  1VQ4 A;  4XU3 A;  2V8I A;  3E1S A;  1WJS A;  4Y28 E;  4ZGE B;  2KSS A;  2M1H A;  4NOY A;  4NL2 A;  1YJ9 A;  1O9S A;  4EMH A;  4EPC A;  2LX9 A;  4IUR A;  4MDX A;  4F7U G;  4M7A D;  4QQG A;  3EFS A;  3HFN A;  1M1K U;  1PSF A;  5AYF A;  1FWZ A;  5DM7 R;  1Q7Y C;  1YI2 T;  1QVF A;  2GQV A;  3DLM A;  1VQP A;  4JRQ A;  2XG8 D;  1K8A U;  4OMF B;  3JCM d;  4M78 B;  1WQW A;  1M5Q 1;  4C92 F;  4ZGD B;  4CRI A;  4BE0 A;  3PMT A;  2QQ9 A;  3QG1 A;  3X26 B;  3TCJ A;  5GAN 8;  4BD3 A;  2RHU A;  1Y71 A;  3OYL A;  3CCM T;  2DK3 A;  3OS0 A;  3G6E A;  1Q81 C;  1I8F A;  4C92 E;  3RER A;  4CI0 C;  1UGP B;  2RJF A;  3CEY A;  5GAN 4;  3OSS C;  4C8Q E;  4ELZ C;  3CME A;  3PNW C;  1G3S A;  4OVA A;  5I21 A;  5KCH A;  4FM4 B;  4DA4 A;  1LNX A;  2PU9 B;  4XU2 A;  5GAM f;  3X28 B;  1VQM A;  2YLC A;  5I2S A;  2JOY A;  1U8R A;  4F7U A;  5LJ5 d;  2K3X A;  2DZC A;  1YIT T;  5C6S A;  1M1F A;  3CCQ A;  2DO3 A;  4FL6 A;  1KHC A;  2EAY A;  3OBY A;  2YLB A;  1VQK T;  1S72 A;  3L2Z A;  1VIF A;  2YHT A;  3OYC A;  3RIR A;  5GAO p;  1EIF A;  2LRQ A;  2XIC A;  2RHX A;  3J80 E;  1U1T A;  3WXM B;  5GAO n;  2QDY B;  3P8B B;  3OYB A;  2A3L A;  4DOW A;  3VUZ A;  5CIU A;  4ME7 A;  2MWO A;  2ZPI B;  4HCZ A;  3V8K A;  5GAN f;  3QSU A;  3A8M B;  4EDU A;  2WAC A;  4M78 G;  3JB9 D;  3R6O A;  3SB2 A;  1VQ9 T;  3RMS A;  2DPP B;  5L8R E;  3Q1J A;  4QVZ A;  1Y96 A;  2DD4 A;  2JTM A;  3GNG A;  3M53 A;  1KQ1 A;  4FT2 A;  4KUI A;  3MO8 A;  4WF2 A;  4XTV A;  4JS5 A;  2P4T A;  2CKK A;  2IVW A;  4II1 A;  1BI1 A;  4PLI A;  2KK4 A;  3OBW A;  3OYI A;  5FRO A;  1QP3 A;  2VC8 A;  3QO3 A;  4M78 C;  4BE2 A;  1VQ8 T;  4KUD K;  4OP0 A;  4JDS A;  5A0L A;  2F5T X;  1BI0 A;  3DB4 A;  2QA4 A;  5GMK l;  1VQN A;  1KQS A;  5A0D A;  2ZPH B;  1IRE B;  3OS1 A;  4QQ6 A;  5CKD A;  3G71 A;  2KMT A;  1JJ2 S;  1VQL A;  4JJN K;  5EG2 A;  1VQ4 T;  3V7C A;  1K9M U;  2VGM A;  3CPF A;  1D3B B;  2VGN A;  3FEO A;  4L6V 5;  5CQX A;  3UWN A;  2BIV A;  3E9G A;  4M7D B;  2CYZ B;  2LCL A;  2Y4X A;  1YJ9 T;  3QJY A;  4JLI A;  4XTW A;  5D6Y A;  1W2B S;  2RH2 A;  5FU6 B;  4M78 A;  2E10 A;  1YBY A;  4NL3 A;  3CCJ A;  5FU7 B;  5GAN 7;  3C12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...