2EQJA

Solution structure of the tudor domain of metal-response element-binding transcription factor 2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
GSSGSSGKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal-response element-binding transcription factor 2
publication title Solution structure of the TUDOR domain of Metal-response element-binding transcription factor 2
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eqjA00
2GF7A 4Q5WA 3O8VA 3OS1A 3MEWA 2XK0A 3KUFA 2PQWA 3OS2A 4C5IA 4BD3A 5D6YA 4L59A 2D9TA 4Z02A 2RI5A 1RI0A 3MEAA 3M9QA 4II1A 1OYXA 3H6ZA 3OMCA 3DB4A 2G3RA 2X4WA 1WJRA 1WJSA 5C0MA 1SSFA 4FL6A 2RI2A 2M1HA 2EFIA 3OYEA 2MWOA 5D6XA 2E6NA 3OYAA 3OQ5A 4A4EA 3L2WA 2P0KA 4BDYA 2BUDA 5D6WA 3MO8A 4E7LA 1H3ZA 4UC4A 2B8AA 4IUUA 2RI3A 3UWNA 4E7IA 2BIVA 3LYIA 5IAYA 3P8HA 5FRMA 2GFUA 2R5AA 3GOXA 4QQ6A 2O4XA 4HCZA 3SD4A 5KE3A 4BE0A 2R57A 2F5KA 2X4YA 5IN1A 3OYLA 3MEUA 3NTIA 3ASKA 2YRVA 3FDRA 3QBYA 4N4IA 5J26A 3OYMA 2K3YA 3CEYA 3NTKA 2QQSA 4A4FA 3QKJA 3OYKA 5KH6A 3L42A 3OA6A 3QJ6A 3L2RA 3LH0A 2RO0A 1OZ3A 5KCOA 3OYGA 2RHUA 3OYCA 2L3RA 2JZ2A 2RHIA 1WJQA 4EDUA 5M9OA 2HQXA 2EKOA 3MP1A 3L2VA 4LD6A 1N27A 3FC3A 3S3OA 2R58A 3PNWC 3OMGA 1OI1A 4E7KA 2R5MA 4A4GA 2CKKA 1WGSA 3MP6A 3PMTA 3OYBA 3OY9A 2EQKA 2WACA 3OYNA 2HQEA 2LVMA 2K3XA 2L8DA 3OYHA 3FLGA 2RHZA 2FHDA 3DLMA 5CIUA 1MHNA 3S6WA 4B9WA 2VYTA 4IUPA 4PLLA 4N4HA 4B9XA 4X34A 5KE2A 3ZEHA 4N4GA 3F70A 3LLRA 3MEVA 4IURA 3UT1A 2DIQA 3LX7A 3PFSA 5FROA 2E5QA 3P8DA 4C5GA 3H8ZA 3MP8A 5C6SA 3OYJA 4IUQA 2EQJA 4A4HA 3L2QA 4BACA 3OYIA 2L89A 4IUTA 2RJDA 2X4XA 3PMIA 2RHXA 2IG0A 3L2UA 2GFAA 3C4SA 2BKDN 1G5VA 3DB3A 4BE1A 2LDMA 4QW2A 4E7HA 4IKFA 3Q1JA 4GY5A 2RHYA 4NS5A 2RJCA 2M16A 3META 3ME9A 2LTOA 4IUVA 4PL6A 3EAEA 2DIGA 2RJEA 1OZ2A 3OYDA 1KHCA 3LGLA 2JTFA 3E9GA 2LRQA 2RJFA 4QQDA 2X35A 4C5EA 3NTHA 2EQMA 3OB9A 3E9FA 4OVAA 2NLUA 1XNIA 4C5HA 3S3NA 5FRNA 5KCHA 4ZTFA 2QQRA 2EQUA 4QVZA 3OS0A 3OYFA 3S3MA 3LGFA 4CRIA 2MWPA 2XDPA 2LCCA 2DAQA 4BE2A 4RG2A 3BDLA 5J39A 2O4XB 3FEOA 4PLIA 4BDZA 4E7JA 4ZTJA 3QIIA 2M0OA 4FU6A 4QQGA
chains in the Genus database with same CATH superfamily
4M75E 1YIJQ 2LQ8A 2L3PA 4BD3A 2O9VA 1Y57A 1Y96A 1CSKA 1AWWA 4HA8A 3OSVA 3H6ZA 4LN2A 2GBQA 1W2BS 4RTZA 2PUKB 4GBQA 4M78D 1RLPC 3CCSA 2M51A 2KDSA 1AHJB 3OYAA 2L3SA 1X2KA 4OMLA 2KROA 1FMVA 2KT1A 2DYIA 4UC4A 5GJWB 3X20B 2OAUA 3QUIA 4JRQA 5L8RE 2CZ7B 1RUWA 1UDLA 3EH1A 5FU7B 2ED0A 2QG9B 5FU6C 5GAOp 2QAZA 2KT8A 4M77E 2VXFA 3X28B 2C0TA 1VQ6T 1M2VA 3J81E 1KD1U 4OMOA 5KH6A 1KSWA 3JCMQ 4J7FA 3D7SB 3LH0A 3LWHA 3OYCA 1PNJA 4C0GA 1YITT 1WA7A 2V1RA 5EC7A 1QMCA 3EGXB 4LDVA 3RUXA 1W2BP 1FX7A 1KQSS 2QDLA 1K76A 2DILA 4P5NA 3OS5A 4MDXA 2LVMA 1UUEA 2JM9A 1AWJA 2JS2A 2VYTA 4C92D 3MEVA 1UB4A 3QZ5B 2QEXA 4JUVA 3P8DA 3CD6Q 2AT1B 5KYYB 4M75F 2O88A 2GFAA 1X43A 4IKFA 1EFNA 2DZCA 2JW4A 2K4YA 2RJCA 3JCMX 3CMEA 5GMKl 1VA7A 4CC2A 3A8LB 2EQMA 4OVAA 1C1AA 3G6ET 3OS0A 1JJ2S 2KVQG 4RKUE 2DVJA 2V8JA 1W4SA 4DBQA 4M7AC 1YJNQ 4M77F 2ZPIB 1ZUKA 2Z0WA 4ORZA 2V8IA 2EYXA 3MEWA 1B07A 4N0AC 1MMAA 3MEAA 1D1CA 4KH0B 3G4ST 5FW9A 2PZ1A 2A0FB 2RK2A 5J3BA 3CCQQ 2YT6A 4KGXB 1HYOA 5LL6S 3CCEQ 3THKA 1M1KR 3L2WA 2E65A 4NL2A 2NUZA 2GFUA 3CC2Q 4JZ4A 1MMNA 1YJWQ 2CGHA 2LP5A 3CCJQ 4HXJA 5KYNA 1JJ2P 5GAN3 3L2RA 1BI3A 5KCOA 4QT7A 2O9SA 5GMKm 2O31A 5CK9A 4XTWA 4C0DC 5GANj 4RMOA 1ZA2B 3CCUA 2KXDA 3GBQA 2DERA 3MP6A 1YN8A 2PVOB 1OOTA 4JRIA 4KBMB 5CQYA 2HBPA 2EGAA 3VS7A 1MHNA 3DLLA 3RKWA 1VQKQ 2OTLA 3H8ZA 2ZPGB 1JB0E 2KY9A 1MGQA 3RDVA 1M90R 3L2UA 1X75C 1ZQ1A 4KULA 4QW2A 5GAMg 1MMDA 4IIOA 3UDCA 2EGEA 2BZYA 2DFUA 2HQHA 2J05A 2DTIA 2NWMA 4JJNK 4C5EA 4HCKA 5LJ5g 3TEEA 1OU9A 5CKFA 1JXMA 4F16A 2DL3A 3V7SA 3ZFJA 1S72T 4HCBA 2RK1A 1B34B 3J7AF 2FEIA 2QI2A 2J6OA 3NPFA 1Y07A 1K9MR 3UA6A 3UATA 4AFQC 2E10A 3RERA 1ZUYA 2MF2A 3OW2S 2KAFA 3CXCS 5ECAA 2E64A 3CC7Q 4M7DB 2K5LA 5DY9A 1M3AA 4PK4A 2K2MA 5AT1B 2OJ2A 1ZSZA 4E7LA 2MCNA 3EG1A 1QKXA 2DD4A 3FIFA 3G71A 3ZL7C 4OB2B 2R57A 4J5YA 2YLBA 2K57A 2QTXA 4LUDA 4BI4A 3TREA 1RAHB 3QJ6A 4M78B 1YCSB 1W6XA 1AWOA 2ZPFB 2X51A 3R6OA 2ZPEB 4A54A 1Y0MA 3PMTA 2C0OA 5CCAA 3OYBA 2GQVA 2KYMA 4J6WA 3VV0A 3OYNA 1G3TA 1TSFA 2DE0X 3A5ZB 2COYA 4PJNA 4BY6C 1VQNA 4ATOA 3L2QA 2PTKA 3CC4A 2LX7A 3VS0A 3REBB 4JJDA 2BKDN 1BB9A 2XKOC 1VQ9T 4QVCA 3EGXA 3SB2A 1N8RR 4IUVA 1Q86C 2CP6A 2QGFB 3CCRA 1KC8U 2X35A 2LCSA 3JCMb 1VQMT 2LJ0A 4C92B 5KCHA 2RN8A 3X24B 4FM4B 4RTTA 1GBQA 2GTOA 2YSQA 2PUOB 2OX7A 4FU6A 4LDUA 4MMLA 2HZYA 5KYYA 4C5IA 1X01A 2M0YA 2I0NA 3VS1A 4WCIA 2A28A 2QA4A 4A4KA 2KRNA 1QVGS 1SRMA 1VQLA 3A8MB 1ARKA 3CCVT 5LJ3g 3NGPA 5CO7A 2K3BA 5D6WA 4BB7A 4HKEA 3P8HA 1M8VA 1IHWA 2FYKA 5FWBA 3JCMW 4QQ6A 4Z89A 4R55A 2OTJQ 3I55Q 2D0QB 8AT1B 4JLIA 1KC8C 2GNCA 5FWCA 4M7DG 2OTLT 1KG1A 1K8AU 1OZ3A 1VQOA 2VASA 2DL4A 2F1LA 4XAXB 4EDUA 2HSEB 4A63B 1G2BA 2RQUA 2LJ3A 3HRSA 3EFRA 2KE9A 4HVUA 2HQEA 2L8DA 3JB9G 1WHMA 1ZUUA 4M78G 1KJWA 4J9EA 5KE2A 4N4GA 3VKIA 2COWA 1M2OA 4ELZC 5FROA 1KQSA 2YLCA 3CBMA 2LJ1A 1PSFA 2RHXA 4J83A 1BCMA 2DEUA 2CP5A 1TUDA 3Q1JA 2JVVA 2RQTA 1KHCA 1UGSB 2RPNA 4XQ3A 1E7OA 1VQ6A 3GNGA 3TCJA 1ZSGA 3QHSA 3CPFA 1XNIA 3M59A 5CR2A 1Z9QA 5FRNA 3V7RA 4ZTFA 5HKCA 4F17A 1YP5A 1PC0A 1GCQA 1YITA 1IRXA 4ZTJA 4WF2A 1K0XA 4EMHA 3RMSA 3CPWS 2EYYA 4C92G 3HKSA 4E2FB 5C0MA 4FL6A 1JBMA 2RI2A 2M1HA 3I56T 1AVZC 1WYXA 1I1JA 2MWOA 3WXMB 4AMCA 3I9QA 1D3BB 1WIEA 1VQ5A 1WFWA 1B34A 1VQ4Q 5FRMA 4X9DA 2O2OA 2L5QA 4JJCA 1PRLC 2JTMA 3CEYA 2YHTA 2L3QA 1WHGA 2CZ1B 4FSSA 3SDZA 3RKYA 2YXYA 1MNEA 1T3SA 1SSHA 2RHUA 4FCYA 1M8MA 2LZ6B 2DTOA 5GMKe 4ZGDB 4M7DA 3BFMA 1N27A 3M5AA 3CPWP 1FWZA 4JPBW 1AZEA 2LX9A 2JNGA 4DBHA 2X4JA 2D8JA 2DJZA 2DEQA 3TSWA 2EQIA 2LMJA 1QCFA 3X25B 1Z9ZA 4X34A 3F70A 3G4SA 4LE9A 4XTUA 3R6NA 2EIFA 2SRCA 1LNXA 4M78A 2HDAA 1SG5A 4C8QC 3PVQA 5GMKh 4JLGA 4AG2C 1QVFP 2CH4W 3PGGA 4GY5A 1MMGA 1NJIC 2XI9A 2LTOA 3OYDA 2FZCB 1IREB 1KQ1A 3RESA 1OULA 3OB9A 4FYWB 3S3MA 2XICA 5I2MA 2FL7A 2K5IA 2E41A 5I11A 3GF5A 3QO3A 4JZ3A 3CD6T 2O4XB 5GAN5 2VGNA 1X6GA 3JCMg 2DMOA 5GAMf 1O9SA 1D0XA 1ZX6A 4F14A 2ENMA 1AWXA 4J9GA 1HK9A 2VGMA 1FYNA 1OU8A 4LXCA 2JUFA 5LJ5f 3J80E 3CQTA 8ATCB 2AIRB 2HKQB 3OQ5A 4C92A 4FYYB 3OW2A 1Q82U 1M1GA 2EKHA 1LPLA 3CXCA 1HJDA 1YJNT 1NYGA 4XTZA 3FRNA 1AZGB 2X4YA 5GAMd 1NLPC 4MZPA 4XU0A 3NTKA 3JB9D 3TQ7P 3OA6A 1RAEB 3M53A 4EMGA 3CCLQ 4PJOB 4PJOC 5LJ5d 3CCQT 2HQXA 1NBEB 3CCET 1S72A 4E47A 4LD6A 5AYFA 3S3OA 2QXFA 3JCMP 1SHFA 1PWTA 1UJYA 1D1BA 1DJ7B 1XTDA 2WACA 5HY6A 5FU6B 2KGTA 3HRUA 3CC2T 4LNPA 2PVGB 1YJWT 1NYFA 2LQNA 1LVKA 5CIUA 3CCJT 2LC4A 1QKWA 5GAOn 2RA2A 2LT4A 2C06A 3OYJA 1M4ZA 2ATCB 4A4HA 1U8RA 2RJDA 1Q82C 3A8HB 1VQ8Q 1A0NB 4HVVA 1Q86R 1G5VA 1NG2A 3M0RA 5GAMe 3SEMA 2RHYA 2D8HA 3META 3ME9A 3V8LA 1VOMA 4ELYC 2HSPA 2F5TX 3TSZA 4E7ZA 5LJ5e 1G8XA 4RTVA 3HFNA 4AT1B 1VQ7Q 1TUGB 3SWNB 3SWNC 4C8QG 1K73U 4FT4A 2LCCA 1VQ5T 1UGVA 1OPKA 3HSBA 1NEGA 2BZXA 1S1NA 1AOJA 4D8DA 2PQWA 1KHIA 5D6YA 2D9TA 5GAMh 4B6MA 2H3JA 4OMNA 1KD1C 3DB4A 3CCMQ 2X4WA 2QTVA 4GLKA 4X9CA 3M57A 1UGQB 1UHCA 1XJWB 5D6XA 2E6NA 2W10A 5LJ5h 3EFSA 4A4EA 1G3SA 1Q7YR 5DM7R 1UGRB 1QVPA 4M7AB 1KC8R 2XDDA 2QYZA 1QVGA 3OSSC 1VQ9A 2JMCA 2GTJA 2DYBA 4PJLA 1NEBA 2JJ9A 3JB9J 1VUBA 1UHFA 3M0TA 1K73C 3AHUA 4IIMA 4M75C 1VQMA 1M5Q1 1U1TA 1WHHA 5LJ3f 4JDSA 3HRTA 5EG2A 3OMGA 4M7DE 1IB8A 2K7AA 1D3BA 2OAWA 2RB6A 3QWYA 4AFSC 1WI7A 3OYHA 4IUPA 2F2WA 4DEXA 1RAAB 2KK4A 4PJOG 2DIQA 2LNHB 2XDBA 2ROTA 2QGGA 2VC8A 4M77C 1HSQA 3EG3A 1VYVA 1BIAA 2XG8D 4M78E 2P0PA 3C4SA 4C0DB 5A0DA 3CCVA 2E3HA 1NE8A 2FPFA 3EG9B 4B9XA 1N5ZA 1OZ2A 2NUPB 2ECZA 4NL3A 3NTHA 4C5HA 3UA7A 5GAN6 2DTHA 4DA4A 2AKLA 2DZ9A 2YWWA 3BDLA 1RI9A 1B3QA 2KBTA 3H9NA 2GF7A 3O8VA 1EX4A 1T0HA 4JS5A 3OS2A 3H0IA 4FYXB 4J9CA 5KYXB 1GL5A 1WQWA 1UJ0A 2P0QA 2I2LA 4XU1A 3MPUB 4RG8A 5D7UA 4M7DF 5LJ3e 2BUDA 2LCLA 2VVKA 2DXCA 4C92E 1AEYA 1RAIB 2G6FX 3KFVA 2O4XA 1YI2Q 3FB9A 1QWFA 3G6EQ 3FDRA 3QBYA 1PRMC 2DXUA 2X3XD 3L42A 1BI1A 2VUBA 2CREA 2RO0A 1ZBXA 3JB9F 3I5SA 4M78F 2DETA 4M7AG 5FLXE 2DL5A 1YHQQ 3HL8A 3CBPA 5LJ3h 2FRYA 2MIOA 2HCKA 4PFPA 3G4SQ 2XMFA 1WZOA 1BU1A 2OTJT 3M56A 3I55T 5GANg 3BY7A 1T3LA 1UE9A 3CMAT 1RAFB 3M0SA 1WX6A 4IUQA 2FZKB 2EQJA 1TUCA 3I56A 4C8QD 5GMKi 1NJIR 2E70A 4PJOA 3DB3A 2WSCE 3G1JA 2ZCFB 2KEAA 4X1VA 4EMKC 1H641 3HHTB 1VIFA 2LRQA 3I5RA 3VYGA 5IXBA 3C95A 3URGA 5IXFA 3HPWA 1WDXA 2CP3A 4BY6B 2QQ9A 4C92F 3LW5E 2BZ8A 2JS0A 2ROLA 4J9HA 1TH7A 2JN0A 3M55A 2KI7A 3VU3C 1QCNA 4M4ZA 4XU2A 2J06A 4R56A 1ABOA 4XTYA 4ME7A 4FW1A 4RTWA 3SWNA 2EJFA 4FT2A 1X2QA 1VQPT 1YWPA 3VRYA 3CCSQ 1UGPB 1KQ2A 1WHKA 1MUZA 1ABQA 3NTIA 2YRVA 3OYMA 4JS4A 2KSSA 3C94A 2K79A 4PJOD 2L3RA 2IIMA 3WVEB 1WXUA 5M9OA 3QSUA 3L2VA 4F7UB 4C0ZA 4FYVB 1W2BA 9ATCB 3PT9A 3CD6A 1BIBA 1VQ4T 4M7AA 2KYBA 3HFOA 2KQWA 1PD1A 2HKNA 1Q95G 4N0AA 1D0YA 3JSCA 3LX7A 3PFSA 1Y71A 2EGCA 3H0HA 2DO3A 2KRSA 5CKHA 2ZPHB 4Z88A 1M9SA 1WHJA 2MI6A 2FPEA 1GFCA 3U23A 2LDMA 4E7HA 3QXEB 2LT1A 1PHTA 4BUGA 1TU0B 3V8KA 2QEXQ 3HP9A 1U5SA 1YJNA 2DNUA 4JRKA 3A98A 1TOVA 3EFOB 1IXDA 3P8BB 3EHRA 4RTUA 3PIOA 4XTVA 5IHIA 2V26A 3CCQA 3CMEQ 3RNJA 3UWNA 3CCEA 1TWBA 5L23A 1KD1R 1M90U 2L0AA 3M9QA 2RH2A 4L5GA 3ER0A 1ZLMA 3EG9A 4RCBA 1YJ9T 3CC2A 1K8AC 3NHNA 1CKBA 5HK3A 1YJWA 2NUPA 2X3WD 4PJMA 3CCJA 1PG5B 1QWEA 3QDRB 4V2SA 2EBPA 2A7YA 2EJ9A 3EGUA 5IHKA 2DXBA 3JCMV 2B8AA 4M7AD 2V1QA 3LYIA 1TG0A 1YCYA 4OP0A 3QPHA 2CZ6B 5GAOq 1NZ9A 2FB7A 3GNFB 3JCMh 3BE3A 1JJ2A 1G3WA 1IGUA 4F04B 1VQMQ 3A1PA 4N4IA 2HNIA 2K3YA 1K73R 1K9MU 5KYXA 3H41A 5DLOA 3KXTA 4CC3A 1I5OB 4M75D 4PKCC 3M0QA 3RBBB 4HVWA 2EJGA 2R58A 3PNWC 3LWIA 1IO6A 1K1ZA 1M90C 3EGDB 3OY9A 2WSEE 2SEMA 5HCKA 2ZZDA 3FLGA 3DLMA 3G7ZA 1YIJT 2ABLA 4B9WA 2XD0A 1QVFS 3UT1A 3M4YA 4KGZB 2OI3A 4CI0C 3CCUQ 1RABB 2CUBA 2XIDA 4M77D 4F7UG 4BACA 2L89A 2CH4A 4CC7A 4KGVB 1I5LA 2D6FA 4DOVA 4C8QF 1K0SA 3OBWA 3E19A 1RAGB 2OTLQ 2DIGA 4KT0E 5IT9E 2HEQA 3E9GA 2AZSA 2DBKA 1K9MC 4MDWA 1U3OA 3VUBA 1D09B 3VS6A 3C12A 1QQJA 3JCMJ 1I8FA 1JU5C 2QQRA 2DLPA 3OYFA 4Z8AA 2MAMA 4XTXA 3RR6A 1NPRA 3CC7A 3I35A 4C8QB 3QZ9B 3FJPA 1VQ8T 5KYWB 4Q5WA 2HL5C 1J3TA 4KRTA 4II1A 2YUQA 2EFIA 4OB1B 1X69A 4XU3A 2CP2A 2BE9B 2RI3A 5CQXA 2R5AA 1H3HA 3A8OB 4A53A 3SFMA 2WSFE 3SD4A 5CAIA 1SRLA 5GMKj 3M0UA 2F5KA 2PU9B 5IN1A 4BE0A 4PFZA 4LDXA 3ASKA 2YUPA 2BTTA 1OQKA 4PFOA 1BI2A 1N9SA 4ZN3A 1OV3A 1OPLA 3CCMT 2JZ2A 3G71Q 1GRIA 7AT1B 4QKUA 2YRCA 2EPDA 4J8OA 4PJOF 1OI1A 2E5KA 4JJBA 4LD9K 2HD0A 2Y4XA 5CKEA 3X26B 3V7CA 1SPKA 2EAYA 3VS3A 2FHDA 2M9UA 4M7AE 1WXTA 4Y28E 4PLLA 1YBYA 2H3EB 4KH1B 3LLRA 1WLPB 1ZSZC 3MP8A 4OGCA 4FSXA 4IUTA 4R0KA 2X4XA 4KUIA 4OB3B 4FIBA 2K9GA 2A37A 1WHLA 4F7UA 2H8HA 3M0PA 1KK7A 2RJEA 3EAEA 3M4GA 4LDWA 4DOWA 3BDUA 5DLQE 1VQNQ 3PTAA 3CC4Q 2MPXC 5GANf 1JRIA 1GFDA 3E9FA 1W1FA 4JRPA 2DX1A 2YUNA 2A36A 1QCOA 2FVUA 4E7JA 4Y92A 4K11A 3CCRQ 4QQGA 5FU7C 4DBFA 3O5ZA 4L59A 5I2SA 2RI5A 1Q81U 4D8KA 2MK5A 2P4RA 2E3IA 2ZPBB 1BK2A 1WJRA 4J6YA 2OTJA 3I55A 4ANJA 1VQKT 5GANd 4L6V5 3EFOA 2DRKA 3CMAA 1RACB 1BCOA 1I07A 3H0FA 3MO8A 2AK5A 1Y7XA 1ZBJA 3SHWA 4M7AF 3DKMA 2QA4Q 1T0JA 2AZVA 3A8GB 3PE0A 4A4FA 1VQLQ 4J6XA 2K2VA 4ZNXA 1JQQA 3UPUA 3M58A 1XOVA 2ZAEA 3E1SA 2EYWA 1RL2A 2GQIA 4J9BA 3FC3A 1G3YA 1RLQC 3JV3A 5CKBA 1WGSA 1C0MA 1PM3A 1VIEA 1Q81C 2K3XA 1VQOQ 3EH2A 3QG1A 1CKAA 1YI2T 2QDYB 5KYUB 1V76A 5GANe 1AT1B 5GAMj 1TXQA 2QQAA 2EVRA 4O5VA 5GAN4 1KQSP 2P84A 1ZA1B 1QLYA 3CC7T 4M75B 1VYUA 4DBRA 5LJ5j 2DKGA 4O6JA 1YHQT 2JT4A 2MYSA 2V8KA 3BW1A 1VQPA 4C0FA 3VS2A 3EGDA 1QP3A 1HXDA 2MOXA 2JOYA 5GANh 2LQWA 4QVZA 3LGFA 2XDPA 4OB0B 1C6VX 4M77B 1D1AA 3GPLA 1M30A 2FG0A 1TS9A 2ZGWA 4BDZA 3QIIA 1O75A 2NYSA 2M0OA 2EYZA 3VJPA 5LJ3d 1VQ6Q 1ACMB 5IHNA 3KUFA 3NFCA 1K8AR 4OGEA 1VQ4A 2HL3A 1YITQ 4RTXA 3RIRA 1SSFA 5I21A 1YFNA 3EHQA 3OYEA 5GAN8 1N9RA 4Y91A 2P0KA 3GIBA 4AG1C 2CSIA 2X9HA 5IAYA 2GCXA 1MNDA 3GOXA 1JO8A 4C8QA 5KE3A 5KYWA 2HMAA 1GXIE 1GCQC 2ED1A 1IGQA 2PNIA 2XU8A 3L2ZA 2J7IA 2ESWA 1VQ5Q 2VXEA 4J7IA 2RHIA 1GBRA 2RF0A 1ZHIA 2FO0A 2P4TA 3MP1A 1BI0A 3CPWA 3TU4K 2YUOA 4ESRA 3ZBDA 2VWFA 3LH5A 2KRMA 3CCST 2PVDB 1NLOC 2RHZA 1OX8A 4PNOA 2E12A 1YJ9A 3V8JA 5C6SA 4E7SA 2AKKA 3PMIA 3VUZA 5CVIA 1QVFA 4J9IA 4BE1A 1WPYA 4F7UE 2J6KA 1H8KA 2RJFA 3RMQA 2QK0A 1X6BA 1AD5A 4M7DC 2VB6A 4M75G 2QQBA 2JXBA 3MKDA 5IH2A 4BE2A 1OEBA 1SHGA 1YWOA 1P92A 2EYQA 4PLIA 3KBGA 2JTEA 1SEMA 1WQ7A 2IPOB 3MCAB 3JAME 1PKTA 2DL7A 1IZ6A 2XK0A 4EMKB 1Q86U 1E6GA 5LJ3j 4BI3A 2QEXT 2G3RA 4MMKA 4M78C 1YIJA 2CS7A 1M3CA 4M77G 3REAB 4HT8A 2NUTB 2MMPA 2K5FA 1B7TA 1PD0A 3OW2P 3M54A 3CCLA 2DJQA 3CXCP 3CMET 2EWNA 2AHJB 4HCZA 2M02A 1BKBA 3OYLA 2HBWA 5I22A 1FMKA 3OBYA 3RKXA 1EZZB 4OMPA 2RQWA 4EIKA 1I81A 2CT4A 3OYGA 1NM7A 1EIFA 2KR3A 3VYHB 1LCKA 4E7KA 2R5MA 1BBZA 4A4GA 2F69A 4F7UF 3JCMf 2O01E 2VV5A 4OMMA 1Q7YU 2EQKA 1VQ8A 4NOYA 3JRZA 1FXXA 4J9DA 1TTHB 3FJ5A 3GLXA 4N4HA 1M27C 2RMOA 1M3BA 4C92C 1S72Q 4E6RA 4DEYA 2C0IA 4D6WA 3OYIA 1X6OA 1UTIA 1GCPA 2D1XA 1WNLA 1VQ7A 2DL8A 1RADB 2KNBB 4XK8E 1Y96B 3OYYA 1PKSA 1M1KU 4CC4B 1SF9A 3WVDB 2IVWA 4ZGJB 2JTFA 3JCMd 5HK0A 4QQDA 5A0GA 1H92A 1KIKA 1BYMA 3C0CA 3S3NA 1Q82R 5KYUA 3EG0A 3CCUT 5GAOr 2DPPB 4BI8B 3CCMA 4OMFB 3JCMc 1IHVA 2DF6A 5J39A 3FEOA 4GLMA 3ULRB 4MZMA 4M75A 1M2VB 1Q7YC 3NMZC 4RTYA 2DBMA 2DK3A 2RQVA 1R0BG 4Z02A 1RI0A 1WXBA 4PJJA 5GJVB 3CMAQ 3OMCA 2J6FA 2DXTA 3QWXX 2YDLA 3INZA 1XQHA 4BDYA 2KMTA 1G83A 1PCXA 1UECA 2BIVA 5A0LA 2Y4YA 1M1KC 4M77A 1LOJA 3JCMe 4AFUC 1UG1A 4KUDK 2A08A 1QVGP 1HD3A 3EG2A 4FW2A 4C8QE 5J26A 3MHXA 4WTOB 4LDYA 5GAN2 5A2QE 1I0CA 2RQRA 3QKJA 3OYKA 1NPPA 4VUBA 3AT1B 1N6AA 2D0NA 5CKDA 1Q81R 1VQ9Q 5GAOl 3N5BB 2CKKA 2DVEA 2XHCA 4YTLA 2QASA 1JEGA 3QDFA 4RCCA 3HTRA 2CP0A 3QJYA 3ZEHA 3MJXA 2CT3A 2E5QA 4C5GA 4AFZC 1VQPQ 3G71T 1R0CB 1VQKA 2CYZB 3CBOA 2VKNA 3E2UA 4NS5A 2M16A 2CP7A 1QW1A 4ZGEB 2DRMA 3QYGB 2LNVA 4RUGA 2NLUA 2HAXA 1E6HA 1R8OB 2EQUA 3CCVQ 4CRIA 2MWPA 2B86A 3CCLT 1UFFA 1MV3A 3OS1A 4PJOE 1NJIU 1LJOA 2E1HA 3VS4A 1M1FA 1OYXA 2F2XA 3L1AA 1U06A 5GAOm 1VQNT 1WJSA 2CSQA 3CC4T 1YI2A 3G6EA 3TVTA 1YNZA 2F2VA 1H3ZA 1K9AA 4IUUA 4E7IA 1U1SA 6AT1B 3JB9H 1PSEA 2W0ZA 3CCRT 1YHQA 3IQLA 3MEUA 2A3LA 1K4US 2QQSA 4OF1A 2FZGB 4EMKA 2COZA 1OX9A 1N8RU 4HCCA 4J9FA 3PIPA 1WJQA 3VRZA 1VQ7T 2GGRA 2EKOA 1D0ZA 4HT9A 1FMWA 2DA9A 1SKUB 4MZTA 2DM1A 2FPDA 2BE7D 1I4K1 2E6ZA 2NUTA 1JXOA 2CDTA 1YJ9Q 1VYTA 3S6WA 2EW3A 2LQKA 2RNAA 1X27A 2YRDA 2QA4T 4EPCA 4IURA 3GP8A 1VQLT 1MV0B 4QVDA 3T9NA 1R77A 2DD5A 5GAN7 1UEBA 1V1CA 2IG0A 2RD1A 3UF4A 2Y90A 1V29B 1F1BB 4DQ2A 3VS5A 4PL6A 2CUDA 3LGLA 2JMAA 2CZ0B 1W70A 2L2PA 3QYHB 4ZN1A 1VQOT 1N8RC 3I56Q 4M7DD 1ZSZB 4LUEA 2E4HA 4OMQA 2K6DA 3JB9I 2FRWA 1QP2A 2KXCA 3PVLA 2DAQA 4RG2A 1KFZA 2RM4A 2JM8A 4TVRA
chains in the Genus database with same CATH topology
3VJPA 5LJ3d 2JN0A 4M75E 4EMHA 3KUFA 3NFCA 2LQ8A 4BD3A 3M55A 3RMSA 3CPWS 4OGEA 3VU3C 1Y96A 4HA8A 3OSVA 3H6ZA 4XU2A 4C92G 1VQ4A 1W2BS 3HKSA 2PUKB 4M78D 3CCSA 3RIRA 5C0MA 1SSFA 1JBMA 2RI2A 4FL6A 2KDSA 1AHJB 2M1HA 5I21A 4R56A 3I56T 3OYEA 4XTYA 2MWOA 4ME7A 3WXMB 5GAN8 3OYAA 1N9RA 4Y91A 1D3BB 2P0KA 3GIBA 3SWNA 4UC4A 3X20B 2OAUA 3QUIA 1VQ5A 4JRQA 2EJFA 2CZ7B 4FT2A 1B34A 2GCXA 5L8RE 5IAYA 1VQPT 5FRMA 4X9DA 3GOXA 5FU7B 1KQ2A 1UGPB 5FU6C 5GAOp 2L5QA 4M77E 4C8QA 2VXFA 3X28B 5KE3A 1VQ6T 2JTMA 3NTIA 3J81E 2YRVA 3OYMA 3CEYA 4JS4A 2YHTA 1KD1U 1GXIE 5KH6A 3JCMQ 2KSSA 2CZ1B 2XU8A 3C94A 3L2ZA 4J7FA 3LH0A 3RKYA 3SDZA 3LWHA 2RHUA 3OYCA 4C0GA 2VXEA 2L3RA 1YITT 4J7IA 4PJOD 3WVEB 2RHIA 2DTOA 5M9OA 5GMKe 4ZGDB 1ZHIA 3QSUA 4M7DA 2P4TA 3BFMA 1BI0A 3MP1A 1N27A 3M5AA 4LDVA 1FWZA 4F7UB 3L2VA 4C0ZA 3RUXA 3TU4K 1W2BA 3PT9A 2LX9A 1FX7A 2JNGA 2X4JA 1KQSS 3ZBDA 3CD6A 1BIBA 1VQ4T 2DJZA 2DEQA 4P5NA 3OS5A 4M7AA 4MDXA 2LVMA 3CCST 2PVDB 2RHZA 3HFOA 2KQWA 2VYTA 3X25B 4X34A 4C92D 3F70A 3MEVA 4PNOA 1UB4A 3QZ5B 4N0AA 3JSCA 3LX7A 3PFSA 3G4SA 2QEXA 2E12A 4JUVA 3P8DA 1YJ9A 3V8JA 5C6SA 1Y71A 4XTUA 2EIFA 2DO3A 1LNXA 3PMIA 4M78A 5CKHA 2ZPHB 3VUZA 1M9SA 5CVIA 4M75F 4C8QC 2GFAA 2MI6A 5GMKh 1QVFA 4BE1A 2LDMA 4JLGA 3QXEB 4E7HA 4IKFA 3PGGA 2LT1A 1WPYA 4GY5A 1NJIC 2DZCA 4BUGA 2K4YA 2RJCA 2XI9A 3JCMX 3V8KA 2LTOA 3OYDA 4F7UE 3HP9A 3CMEA 1YJNA 5GMKl 1IREB 1KQ1A 2RJFA 3RESA 3RMQA 4JRKA 3A8LB 2EQMA 3OB9A 3P8BB 4OVAA 4M7DC 3G6ET 4M75G 3OS0A 3PIOA 2QQBA 2XICA 5I2MA 3S3MA 1JJ2S 2KVQG 2FL7A 2K5IA 2E41A 4RKUE 4XTVA 4BE2A 2V8JA 1W4SA 3GF5A 3QO3A 3CD6T 3CCQA 4M7AC 1P92A 2EYQA 2O4XB 2VGNA 3KBGA 4M77F 4PLIA 5GAN5 3UWNA 3JCMg 3CCEA 1WQ7A 3MCAB 5GAMf 1O9SA 2ZPIB 3JAME 2V8IA 3MEWA 1IZ6A 2XK0A 1M90U 4N0AC 4EMKB 1Q86U 3MEAA 5LJ3j 1HK9A 3M9QA 2RH2A 2VGMA 4L5GA 3ER0A 3G4ST 4BI3A 2QEXT 4RCBA 1YJ9T 3CC2A 2G3RA 2JUFA 5HK3A 2RK2A 4MMKA 4M78C 5LJ5f 1YJWA 1K8AC 1YIJA 3CCJA 3J80E 2CS7A 5J3BA 3QDRB 4M77G 4V2SA 5LL6S 2A7YA 4HT8A 3OQ5A 2EJ9A 2MMPA 3L2WA 2E65A 4NL2A 4C92A 2K5FA 2DXBA 3JCMV 3OW2A 1Q82U 1M1GA 2B8AA 4M7AD 3M54A 3LYIA 3CCLA 3CXCA 2GFUA 1YCYA 3CMET 1YJNT 4XTZA 4OP0A 2EWNA 2CZ6B 2AHJB 2CGHA 3QPHA 5GAOq 1NZ9A 2FB7A 3FRNA 3GNFB 4HCZA 3JCMh 1BKBA 1G3WA 3OYLA 2X4YA 5GAMd 1JJ2A 4MZPA 4N4IA 4XU0A 2HNIA 3OBYA 3RKXA 2K3YA 3NTKA 5GAN3 3JB9D 1K9MU 3OA6A 5DLOA 3L2RA 1I81A 3KXTA 1BI3A 5KCOA 3OYGA 3M53A 4M75D 4PKCC 4EMGA 4PJOB 4PJOC 4KUDK 5LJ5d 5GMKm 3CCQT 1EIFA 2HQXA 3VYHB 3CCET 2EJGA 5CK9A 4E47A 4LD6A 1S72A 4XTWA 5AYFA 4C0DC 3S3OA 5GANj 2QXFA 2R58A 3PNWC 4RMOA 3JCMP 4E7KA 3CCUA 2R5MA 3LWIA 4A4GA 2F69A 4F7UF 3MP6A 1M90C 3JCMf 2O01E 2VV5A 1DJ7B 2PVOB 1XTDA 2WSEE 4JRIA 4KBMB 5CQYA 2EQKA 2WACA 1Q7YU 5HY6A 5FU6B 1VQ8A 4NOYA 2HBPA 2ZZDA 3HRUA 3JRZA 3CC2T 1FXXA 2PVGB 3FLGA 3DLMA 3G7ZA 5CIUA 1YJWT 1MHNA 3GLXA 2LC4A 4B9WA 3CCJT 1YIJT 2XD0A 4N4HA 3DLLA 5GAOn 2RA2A 3RKWA 2LT4A 1QVFS 2C06A 3UT1A 4C92C 3M4YA 2OTLA 4CI0C 3OYJA 3H8ZA 1M4ZA 2XIDA 2ZPGB 4A4HA 4D6WA 4M77D 1JB0E 4F7UG 4BACA 3OYIA 1U8RA 2L89A 1X6OA 2RJDA 2KY9A 1Q82C 1MGQA 3A8HB 1I5LA 1WNLA 3L2UA 1X75C 1VQ7A 2D6FA 1ZQ1A 4KULA 4DOVA 1G5VA 4XK8E 4QW2A 5GAMg 4C8QF 1Y96B 3OYYA 3UDCA 3OBWA 5GAMe 1M1KU 2RHYA 3E19A 3WVDB 3META 2IVWA 3ME9A 3V8LA 4ELYC 2DIGA 4ZGJB 4KT0E 5IT9E 2JTFA 3E9GA 2DTIA 3JCMd 2F5TX 5HK0A 4QQDA 1K9MC 4JJNK 4MDWA 4C5EA 5A0GA 3VUBA 3C12A 5LJ5g 1BYMA 3TEEA 5LJ5e 3JCMJ 3S3NA 3HFNA 1I8FA 5CKFA 3V7SA 3ZFJA 2QQRA 3SWNC 3SWNB 1S72T 3OYFA 4C8QG 1K73U 4HCBA 2MAMA 2RK1A 1B34B 3CCUT 4FT4A 4XTXA 2LCCA 5GAOr 2DPPB 4BI8B 3CCMA 1VQ5T 3J7AF 4OMFB 3JCMc 1NPRA 3CC7A 5J39A 3FEOA 3HSBA 4C8QB 3QZ9B 4MZMA 3FJPA 4M75A 1VQ8T 2QI2A 4Q5WA 1Q7YC 1Y07A 2DK3A 2PQWA 1KHIA 5D6YA 2E10A 2D9TA 4Z02A 5GAMh 1RI0A 3RERA 4II1A 2H3JA 2MF2A 3OW2S 3OMCA 1KD1C 2KAFA 3DB4A 2X4WA 3CXCS 2DXTA 4GLKA 2E64A 4X9CA 4M7DB 2EFIA 2K5LA 3INZA 3M57A 5DY9A 1UGQB 4OB1B 5D6XA 2E6NA 5LJ5h 1XQHA 3EFSA 4A4EA 4BDYA 2KMTA 4XU3A 1G3SA 4E7LA 5DM7R 2RI3A 1UGRB 1QVPA 2BIVA 4M7AB 5A0LA 2DD4A 2Y4YA 3FIFA 5CQXA 3G71A 1M1KC 2R5AA 4M77A 3A8OB 2XDDA 1LOJA 4A53A 3JCMe 3SFMA 4OB2B 2WSFE 1QVGA 3SD4A 5CAIA 3OSSC 5GMKj 2R57A 2F5KA 2PU9B 2YLBA 4J5YA 5IN1A 4BE0A 3ASKA 4C8QE 2K57A 2QTXA 5J26A 3MHXA 4LDXA 4LDYA 5GAN2 4BI4A 5A2QE 3JB9J 3QKJA 3OYKA 3TREA 1VUBA 1NPPA 3QJ6A 1BI2A 1N9SA 4M78B 4ZN3A 4VUBA 3CCMT 1K73C 2JZ2A 3AHUA 4M75C 1VQMA 1N6AA 2ZPFB 1M5Q1 4J8OA 1U1TA 5LJ3f 3R6OA 5CKDA 4PJOF 4JDSA 3HRTA 2ZPEB 5EG2A 3OMGA 1OI1A 4A54A 4M7DE 5GAOl 3N5BB 1D3BA 2CKKA 2DVEA 3PMTA 5CCAA 2XHCA 3OYBA 4LD9K 2GQVA 2HD0A 2Y4XA 2RB6A 4J6WA 5CKEA 4YTLA 3VV0A 3V7CA 3X26B 3OYNA 3OYHA 2EAYA 1G3TA 2FHDA 2M9UA 4M7AE 4RCCA 4Y28E 4IUPA 4PLLA 3QJYA 1YBYA 3ZEHA 3A5ZB 3LLRA 2KK4A 4PJOG 3CPWA 2DIQA 2E5QA 2XDBA 4BY6C 4C5GA 3MP8A 4OGCA 1VQNA 2VC8A 4ATOA 3L2QA 4FSXA 3CC4A 4IUTA 4M77C 2X4XA 3G71T 4KUIA 1BIAA 2CYZB 1VQKA 2XG8D 4M78E 2P0PA 3C4SA 4OB3B 4C0DB 4FIBA 5A0DA 2BKDN 3CCVA 2XKOC 1NE8A 3CBOA 1VQ9T 4QVCA 3SB2A 4NS5A 4F7UA 4B9XA 2M16A 4IUVA 1Q86C 1QW1A 2RJEA 3EAEA 1OZ2A 3M4GA 4LDWA 4DOWA 4ZGEB 3BDUA 5DLQE 4NL3A 3CCRA 1KC8U 3PTAA 2X35A 3QYGB 5GANf 2LNVA 3NTHA 1JRIA 3JCMb 3E9FA 2NLUA 1VQMT 4C5HA 4C92B 5KCHA 2HAXA 2EQUA 1R8OB 4JRPA 5GAN6 3X24B 4FM4B 2DTHA 4CRIA 4DA4A 2MWPA 2DZ9A 3CCLT 3BDLA 2FVUA 4E7JA 2PUOB 4FU6A 4LDUA 4MMLA 2GF7A 4QQGA 5FU7C 3O8VA 3OS1A 4PJOE 1NJIU 4JS5A 1LJOA 3OS2A 4C5IA 1X01A 4L59A 5I2SA 2RI5A 1Q81U 2E1HA 1M1FA 1OYXA 3L1AA 5GAOm 1VQNT 2ZPBB 1WQWA 1WJRA 1WJSA 2P0QA 2I2LA 4J6YA 3CC4T 4XU1A 1YI2A 2OTJA 3I55A 4RG8A 2QA4A 4A4KA 1VQKT 5GANd 3G6EA 1QVGS 4L6V5 4M7DF 1VQLA 3A8MB 3CMAA 3CCVT 5LJ3g 5CO7A 5LJ3e 2BUDA 5D6WA 4BB7A 3MO8A 1H3ZA 2LCLA 1Y7XA 4IUUA 2DXCA 4HKEA 4C92E 4E7IA 1VQ9A 1U1SA 3JB9H 1PSEA 3P8HA 1M8VA 2FYKA 4M7AF 3JCMW 3DKMA 4QQ6A 3CCRT 2O4XA 4R55A 1YHQA 3FB9A 2D0QB 4JLIA 3A8GB 1KC8C 3MEUA 2A3LA 3FDRA 3QBYA 4M7DG 2OTLT 4A4FA 2DXUA 2QQSA 4OF1A 1KG1A 4EMKA 4J6XA 1N8RU 3OY9A 3L42A 1K8AU 1BI1A 2K2VA 2VUBA 2RO0A 4HCCA 1OZ3A 1VQOA 1ZBXA 3JB9F 3PIPA 4M78F 1WJQA 3UPUA 4XAXB 4EDUA 3M58A 1VQ7T 4M7AG 5FLXE 1XOVA 2EKOA 3E1SA 4HT9A 1RL2A 3HL8A 4MZTA 3FC3A 1G3YA 3CBPA 2E6ZA 1I4K1 5CKBA 3HRSA 5LJ3h 1WGSA 3EFRA 1VIEA 1Q81C 2HQEA 2K3XA 2L8DA 3JB9G 3QG1A 1YI2T 2QDYB 4M78G 3S6WA 2LQKA 3M56A 3I55T 2QA4T 2OTJT 5GANg 4EPCA 3BY7A 5GANe 5KE2A 4N4GA 3VKIA 4IURA 3GP8A 5GAMj 4ELZC 5FROA 1VQLT 3CMAT 4QVDA 3T9NA 1KQSA 2QQAA 4O5VA 5GAN4 2YLCA 4IUQA 2DD5A 2EQJA 5GAN7 3CC7T 4M75B 3CBMA 3I56A 4C8QD 1UEBA 5GMKi 1PSFA 2RHXA 2IG0A 2RD1A 2E70A 4J83A 5LJ5j 4PJOA 2DKGA 3DB3A 4O6JA 2Y90A 1YHQT 2WSCE 1V29B 2ZCFB 3Q1JA 4DQ2A 4EMKC 2V8KA 3BW1A 1VQPA 4PL6A 2JVVA 4C0FA 1KHCA 3LGLA 1H641 1UGSB 1VIFA 2CZ0B 2LRQA 3HHTB 3VYGA 3QYHB 4XQ3A 4ZN1A 1VQOT 1QP3A 3C95A 1N8RC 1HXDA 4M7DD 1VQ6A 3GNGA 3TCJA 3URGA 3QHSA 3CPFA 1XNIA 3M59A 5CR2A 3HPWA 5FRNA 2JOYA 3V7RA 4BY6B 2QQ9A 4QVZA 5HKCA 5GANh 4ZTFA 3LGFA 4C92F 3JB9I 1QP2A 2XDPA 4OB0B 3LW5E 4M77B 1YITA 2DAQA 4RG2A 3GPLA 2RM4A 2ZGWA 4BDZA 4ZTJA 3QIIA 1O75A 1TH7A 2M0OA 4WF2A 4TVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF7 A;  4Q5W A;  3O8V A;  3OS1 A;  3MEW A;  2XK0 A;  3KUF A;  2PQW A;  3OS2 A;  4C5I A;  4BD3 A;  5D6Y A;  4L59 A;  2D9T A;  4Z02 A;  2RI5 A;  1RI0 A;  3MEA A;  3M9Q A;  4II1 A;  1OYX A;  3H6Z A;  3OMC A;  3DB4 A;  2G3R A;  2X4W A;  1WJR A;  1WJS A;  5C0M A;  1SSF A;  4FL6 A;  2RI2 A;  2M1H A;  2EFI A;  3OYE A;  2MWO A;  5D6X A;  2E6N A;  3OYA A;  3OQ5 A;  4A4E A;  3L2W A;  2P0K A;  4BDY A;  2BUD A;  5D6W A;  3MO8 A;  4E7L A;  1H3Z A;  4UC4 A;  2B8A A;  4IUU A;  2RI3 A;  3UWN A;  4E7I A;  2BIV A;  3LYI A;  5IAY A;  3P8H A;  5FRM A;  2GFU A;  2R5A A;  3GOX A;  4QQ6 A;  2O4X A;  4HCZ A;  3SD4 A;  5KE3 A;  4BE0 A;  2R57 A;  2F5K A;  2X4Y A;  5IN1 A;  3OYL A;  3MEU A;  3NTI A;  3ASK A;  2YRV A;  3FDR A;  3QBY A;  4N4I A;  5J26 A;  3OYM A;  2K3Y A;  3CEY A;  3NTK A;  2QQS A;  4A4F A;  3QKJ A;  3OYK A;  5KH6 A;  3L42 A;  3OA6 A;  3QJ6 A;  3L2R A;  3LH0 A;  2RO0 A;  1OZ3 A;  5KCO A;  3OYG A;  2RHU A;  3OYC A;  2L3R A;  2JZ2 A;  2RHI A;  1WJQ A;  4EDU A;  5M9O A;  2HQX A;  2EKO A;  3MP1 A;  3L2V A;  4LD6 A;  1N27 A;  3FC3 A;  3S3O A;  2R58 A;  3PNW C;  3OMG A;  1OI1 A;  4E7K A;  2R5M A;  4A4G A;  2CKK A;  1WGS A;  3MP6 A;  3PMT A;  3OYB A;  3OY9 A;  2EQK A;  2WAC A;  3OYN A;  2HQE A;  2LVM A;  2K3X A;  2L8D A;  3OYH A;  3FLG A;  2RHZ A;  2FHD A;  3DLM A;  5CIU A;  1MHN A;  3S6W A;  4B9W A;  2VYT A;  4IUP A;  4PLL A;  4N4H A;  4B9X A;  4X34 A;  5KE2 A;  3ZEH A;  4N4G A;  3F70 A;  3LLR A;  3MEV A;  4IUR A;  3UT1 A;  2DIQ A;  3LX7 A;  3PFS A;  5FRO A;  2E5Q A;  3P8D A;  4C5G A;  3H8Z A;  3MP8 A;  5C6S A;  3OYJ A;  4IUQ A;  2EQJ A;  4A4H A;  3L2Q A;  4BAC A;  3OYI A;  2L89 A;  4IUT A;  2RJD A;  2X4X A;  3PMI A;  2RHX A;  2IG0 A;  3L2U A;  2GFA A;  3C4S A;  2BKD N;  1G5V A;  3DB3 A;  4BE1 A;  2LDM A;  4QW2 A;  4E7H A;  4IKF A;  3Q1J A;  4GY5 A;  2RHY A;  4NS5 A;  2RJC A;  2M16 A;  3MET A;  3ME9 A;  2LTO A;  4IUV A;  4PL6 A;  3EAE A;  2DIG A;  2RJE A;  1OZ2 A;  3OYD A;  1KHC A;  3LGL A;  2JTF A;  3E9G A;  2LRQ A;  2RJF A;  4QQD A;  2X35 A;  4C5E A;  3NTH A;  2EQM A;  3OB9 A;  3E9F A;  4OVA A;  2NLU A;  1XNI A;  4C5H A;  3S3N A;  5FRN A;  5KCH A;  4ZTF A;  2QQR A;  2EQU A;  4QVZ A;  3OS0 A;  3OYF A;  3S3M A;  3LGF A;  4CRI A;  2MWP A;  2XDP A;  2LCC A;  2DAQ A;  4BE2 A;  4RG2 A;  3BDL A;  5J39 A;  2O4X B;  3FEO A;  4PLI A;  4BDZ A;  4E7J A;  4ZTJ A;  3QII A;  2M0O A;  4FU6 A;  4QQG A; 
#chains in the Genus database with same CATH topology
 4M75 E;  1YIJ Q;  2LQ8 A;  2L3P A;  4BD3 A;  2O9V A;  1Y57 A;  1Y96 A;  1CSK A;  1AWW A;  4HA8 A;  3OSV A;  3H6Z A;  4LN2 A;  2GBQ A;  1W2B S;  4RTZ A;  2PUK B;  4GBQ A;  4M78 D;  1RLP C;  3CCS A;  2M51 A;  2KDS A;  1AHJ B;  3OYA A;  2L3S A;  1X2K A;  4OML A;  2KRO A;  1FMV A;  2KT1 A;  2DYI A;  4UC4 A;  5GJW B;  3X20 B;  2OAU A;  3QUI A;  4JRQ A;  5L8R E;  2CZ7 B;  1RUW A;  1UDL A;  3EH1 A;  5FU7 B;  2ED0 A;  2QG9 B;  5FU6 C;  5GAO p;  2QAZ A;  2KT8 A;  4M77 E;  2VXF A;  3X28 B;  2C0T A;  1VQ6 T;  1M2V A;  3J81 E;  1KD1 U;  4OMO A;  5KH6 A;  1KSW A;  3JCM Q;  4J7F A;  3D7S B;  3LH0 A;  3LWH A;  3OYC A;  1PNJ A;  4C0G A;  1YIT T;  1WA7 A;  2V1R A;  5EC7 A;  1QMC A;  3EGX B;  4LDV A;  3RUX A;  1W2B P;  1FX7 A;  1KQS S;  2QDL A;  1K76 A;  2DIL A;  4P5N A;  3OS5 A;  4MDX A;  2LVM A;  1UUE A;  2JM9 A;  1AWJ A;  2JS2 A;  2VYT A;  4C92 D;  3MEV A;  1UB4 A;  3QZ5 B;  2QEX A;  4JUV A;  3P8D A;  3CD6 Q;  2AT1 B;  5KYY B;  4M75 F;  2O88 A;  2GFA A;  1X43 A;  4IKF A;  1EFN A;  2DZC A;  2JW4 A;  2K4Y A;  2RJC A;  3JCM X;  3CME A;  5GMK l;  1VA7 A;  4CC2 A;  3A8L B;  2EQM A;  4OVA A;  1C1A A;  3G6E T;  3OS0 A;  1JJ2 S;  2KVQ G;  4RKU E;  2DVJ A;  2V8J A;  1W4S A;  4DBQ A;  4M7A C;  1YJN Q;  4M77 F;  2ZPI B;  1ZUK A;  2Z0W A;  4ORZ A;  2V8I A;  2EYX A;  3MEW A;  1B07 A;  4N0A C;  1MMA A;  3MEA A;  1D1C A;  4KH0 B;  3G4S T;  5FW9 A;  2PZ1 A;  2A0F B;  2RK2 A;  5J3B A;  3CCQ Q;  2YT6 A;  4KGX B;  1HYO A;  5LL6 S;  3CCE Q;  3THK A;  1M1K R;  3L2W A;  2E65 A;  4NL2 A;  2NUZ A;  2GFU A;  3CC2 Q;  4JZ4 A;  1MMN A;  1YJW Q;  2CGH A;  2LP5 A;  3CCJ Q;  4HXJ A;  5KYN A;  1JJ2 P;  5GAN 3;  3L2R A;  1BI3 A;  5KCO A;  4QT7 A;  2O9S A;  5GMK m;  2O31 A;  5CK9 A;  4XTW A;  4C0D C;  5GAN j;  4RMO A;  1ZA2 B;  3CCU A;  2KXD A;  3GBQ A;  2DER A;  3MP6 A;  1YN8 A;  2PVO B;  1OOT A;  4JRI A;  4KBM B;  5CQY A;  2HBP A;  2EGA A;  3VS7 A;  1MHN A;  3DLL A;  3RKW A;  1VQK Q;  2OTL A;  3H8Z A;  2ZPG B;  1JB0 E;  2KY9 A;  1MGQ A;  3RDV A;  1M90 R;  3L2U A;  1X75 C;  1ZQ1 A;  4KUL A;  4QW2 A;  5GAM g;  1MMD A;  4IIO A;  3UDC A;  2EGE A;  2BZY A;  2DFU A;  2HQH A;  2J05 A;  2DTI A;  2NWM A;  4JJN K;  4C5E A;  4HCK A;  5LJ5 g;  3TEE A;  1OU9 A;  5CKF A;  1JXM A;  4F16 A;  2DL3 A;  3V7S A;  3ZFJ A;  1S72 T;  4HCB A;  2RK1 A;  1B34 B;  3J7A F;  2FEI A;  2QI2 A;  2J6O A;  3NPF A;  1Y07 A;  1K9M R;  3UA6 A;  3UAT A;  4AFQ C;  2E10 A;  3RER A;  1ZUY A;  2MF2 A;  3OW2 S;  2KAF A;  3CXC S;  5ECA A;  2E64 A;  3CC7 Q;  4M7D B;  2K5L A;  5DY9 A;  1M3A A;  4PK4 A;  2K2M A;  5AT1 B;  2OJ2 A;  1ZSZ A;  4E7L A;  2MCN A;  3EG1 A;  1QKX A;  2DD4 A;  3FIF A;  3G71 A;  3ZL7 C;  4OB2 B;  2R57 A;  4J5Y A;  2YLB A;  2K57 A;  2QTX A;  4LUD A;  4BI4 A;  3TRE A;  1RAH B;  3QJ6 A;  4M78 B;  1YCS B;  1W6X A;  1AWO A;  2ZPF B;  2X51 A;  3R6O A;  2ZPE B;  4A54 A;  1Y0M A;  3PMT A;  2C0O A;  5CCA A;  3OYB A;  2GQV A;  2KYM A;  4J6W A;  3VV0 A;  3OYN A;  1G3T A;  1TSF A;  2DE0 X;  3A5Z B;  2COY A;  4PJN A;  4BY6 C;  1VQN A;  4ATO A;  3L2Q A;  2PTK A;  3CC4 A;  2LX7 A;  3VS0 A;  3REB B;  4JJD A;  2BKD N;  1BB9 A;  2XKO C;  1VQ9 T;  4QVC A;  3EGX A;  3SB2 A;  1N8R R;  4IUV A;  1Q86 C;  2CP6 A;  2QGF B;  3CCR A;  1KC8 U;  2X35 A;  2LCS A;  3JCM b;  1VQM T;  2LJ0 A;  4C92 B;  5KCH A;  2RN8 A;  3X24 B;  4FM4 B;  4RTT A;  1GBQ A;  2GTO A;  2YSQ A;  2PUO B;  2OX7 A;  4FU6 A;  4LDU A;  4MML A;  2HZY A;  5KYY A;  4C5I A;  1X01 A;  2M0Y A;  2I0N A;  3VS1 A;  4WCI A;  2A28 A;  2QA4 A;  4A4K A;  2KRN A;  1QVG S;  1SRM A;  1VQL A;  3A8M B;  1ARK A;  3CCV T;  5LJ3 g;  3NGP A;  5CO7 A;  2K3B A;  5D6W A;  4BB7 A;  4HKE A;  3P8H A;  1M8V A;  1IHW A;  2FYK A;  5FWB A;  3JCM W;  4QQ6 A;  4Z89 A;  4R55 A;  2OTJ Q;  3I55 Q;  2D0Q B;  8AT1 B;  4JLI A;  1KC8 C;  2GNC A;  5FWC A;  4M7D G;  2OTL T;  1KG1 A;  1K8A U;  1OZ3 A;  1VQO A;  2VAS A;  2DL4 A;  2F1L A;  4XAX B;  4EDU A;  2HSE B;  4A63 B;  1G2B A;  2RQU A;  2LJ3 A;  3HRS A;  3EFR A;  2KE9 A;  4HVU A;  2HQE A;  2L8D A;  3JB9 G;  1WHM A;  1ZUU A;  4M78 G;  1KJW A;  4J9E A;  5KE2 A;  4N4G A;  3VKI A;  2COW A;  1M2O A;  4ELZ C;  5FRO A;  1KQS A;  2YLC A;  3CBM A;  2LJ1 A;  1PSF A;  2RHX A;  4J83 A;  1BCM A;  2DEU A;  2CP5 A;  1TUD A;  3Q1J A;  2JVV A;  2RQT A;  1KHC A;  1UGS B;  2RPN A;  4XQ3 A;  1E7O A;  1VQ6 A;  3GNG A;  3TCJ A;  1ZSG A;  3QHS A;  3CPF A;  1XNI A;  3M59 A;  5CR2 A;  1Z9Q A;  5FRN A;  3V7R A;  4ZTF A;  5HKC A;  4F17 A;  1YP5 A;  1PC0 A;  1GCQ A;  1YIT A;  1IRX A;  4ZTJ A;  4WF2 A;  1K0X A;  4EMH A;  3RMS A;  3CPW S;  2EYY A;  4C92 G;  3HKS A;  4E2F B;  5C0M A;  4FL6 A;  1JBM A;  2RI2 A;  2M1H A;  3I56 T;  1AVZ C;  1WYX A;  1I1J A;  2MWO A;  3WXM B;  4AMC A;  3I9Q A;  1D3B B;  1WIE A;  1VQ5 A;  1WFW A;  1B34 A;  1VQ4 Q;  5FRM A;  4X9D A;  2O2O A;  2L5Q A;  4JJC A;  1PRL C;  2JTM A;  3CEY A;  2YHT A;  2L3Q A;  1WHG A;  2CZ1 B;  4FSS A;  3SDZ A;  3RKY A;  2YXY A;  1MNE A;  1T3S A;  1SSH A;  2RHU A;  4FCY A;  1M8M A;  2LZ6 B;  2DTO A;  5GMK e;  4ZGD B;  4M7D A;  3BFM A;  1N27 A;  3M5A A;  3CPW P;  1FWZ A;  4JPB W;  1AZE A;  2LX9 A;  2JNG A;  4DBH A;  2X4J A;  2D8J A;  2DJZ A;  2DEQ A;  3TSW A;  2EQI A;  2LMJ A;  1QCF A;  3X25 B;  1Z9Z A;  4X34 A;  3F70 A;  3G4S A;  4LE9 A;  4XTU A;  3R6N A;  2EIF A;  2SRC A;  1LNX A;  4M78 A;  2HDA A;  1SG5 A;  4C8Q C;  3PVQ A;  5GMK h;  4JLG A;  4AG2 C;  1QVF P;  2CH4 W;  3PGG A;  4GY5 A;  1MMG A;  1NJI C;  2XI9 A;  2LTO A;  3OYD A;  2FZC B;  1IRE B;  1KQ1 A;  3RES A;  1OUL A;  3OB9 A;  4FYW B;  3S3M A;  2XIC A;  5I2M A;  2FL7 A;  2K5I A;  2E41 A;  5I11 A;  3GF5 A;  3QO3 A;  4JZ3 A;  3CD6 T;  2O4X B;  5GAN 5;  2VGN A;  1X6G A;  3JCM g;  2DMO A;  5GAM f;  1O9S A;  1D0X A;  1ZX6 A;  4F14 A;  2ENM A;  1AWX A;  4J9G A;  1HK9 A;  2VGM A;  1FYN A;  1OU8 A;  4LXC A;  2JUF A;  5LJ5 f;  3J80 E;  3CQT A;  8ATC B;  2AIR B;  2HKQ B;  3OQ5 A;  4C92 A;  4FYY B;  3OW2 A;  1Q82 U;  1M1G A;  2EKH A;  1LPL A;  3CXC A;  1HJD A;  1YJN T;  1NYG A;  4XTZ A;  3FRN A;  1AZG B;  2X4Y A;  5GAM d;  1NLP C;  4MZP A;  4XU0 A;  3NTK A;  3JB9 D;  3TQ7 P;  3OA6 A;  1RAE B;  3M53 A;  4EMG A;  3CCL Q;  4PJO B;  4PJO C;  5LJ5 d;  3CCQ T;  2HQX A;  1NBE B;  3CCE T;  1S72 A;  4E47 A;  4LD6 A;  5AYF A;  3S3O A;  2QXF A;  3JCM P;  1SHF A;  1PWT A;  1UJY A;  1D1B A;  1DJ7 B;  1XTD A;  2WAC A;  5HY6 A;  5FU6 B;  2KGT A;  3HRU A;  3CC2 T;  4LNP A;  2PVG B;  1YJW T;  1NYF A;  2LQN A;  1LVK A;  5CIU A;  3CCJ T;  2LC4 A;  1QKW A;  5GAO n;  2RA2 A;  2LT4 A;  2C06 A;  3OYJ A;  1M4Z A;  2ATC B;  4A4H A;  1U8R A;  2RJD A;  1Q82 C;  3A8H B;  1VQ8 Q;  1A0N B;  4HVV A;  1Q86 R;  1G5V A;  1NG2 A;  3M0R A;  5GAM e;  3SEM A;  2RHY A;  2D8H A;  3MET A;  3ME9 A;  3V8L A;  1VOM A;  4ELY C;  2HSP A;  2F5T X;  3TSZ A;  4E7Z A;  5LJ5 e;  1G8X A;  4RTV A;  3HFN A;  4AT1 B;  1VQ7 Q;  1TUG B;  3SWN B;  3SWN C;  4C8Q G;  1K73 U;  4FT4 A;  2LCC A;  1VQ5 T;  1UGV A;  1OPK A;  3HSB A;  1NEG A;  2BZX A;  1S1N A;  1AOJ A;  4D8D A;  2PQW A;  1KHI A;  5D6Y A;  2D9T A;  5GAM h;  4B6M A;  2H3J A;  4OMN A;  1KD1 C;  3DB4 A;  3CCM Q;  2X4W A;  2QTV A;  4GLK A;  4X9C A;  3M57 A;  1UGQ B;  1UHC A;  1XJW B;  5D6X A;  2E6N A;  2W10 A;  5LJ5 h;  3EFS A;  4A4E A;  1G3S A;  1Q7Y R;  5DM7 R;  1UGR B;  1QVP A;  4M7A B;  1KC8 R;  2XDD A;  2QYZ A;  1QVG A;  3OSS C;  1VQ9 A;  2JMC A;  2GTJ A;  2DYB A;  4PJL A;  1NEB A;  2JJ9 A;  3JB9 J;  1VUB A;  1UHF A;  3M0T A;  1K73 C;  3AHU A;  4IIM A;  4M75 C;  1VQM A;  1M5Q 1;  1U1T A;  1WHH A;  5LJ3 f;  4JDS A;  3HRT A;  5EG2 A;  3OMG A;  4M7D E;  1IB8 A;  2K7A A;  1D3B A;  2OAW A;  2RB6 A;  3QWY A;  4AFS C;  1WI7 A;  3OYH A;  4IUP A;  2F2W A;  4DEX A;  1RAA B;  2KK4 A;  4PJO G;  2DIQ A;  2LNH B;  2XDB A;  2ROT A;  2QGG A;  2VC8 A;  4M77 C;  1HSQ A;  3EG3 A;  1VYV A;  1BIA A;  2XG8 D;  4M78 E;  2P0P A;  3C4S A;  4C0D B;  5A0D A;  3CCV A;  2E3H A;  1NE8 A;  2FPF A;  3EG9 B;  4B9X A;  1N5Z A;  1OZ2 A;  2NUP B;  2ECZ A;  4NL3 A;  3NTH A;  4C5H A;  3UA7 A;  5GAN 6;  2DTH A;  4DA4 A;  2AKL A;  2DZ9 A;  2YWW A;  3BDL A;  1RI9 A;  1B3Q A;  2KBT A;  3H9N A;  2GF7 A;  3O8V A;  1EX4 A;  1T0H A;  4JS5 A;  3OS2 A;  3H0I A;  4FYX B;  4J9C A;  5KYX B;  1GL5 A;  1WQW A;  1UJ0 A;  2P0Q A;  2I2L A;  4XU1 A;  3MPU B;  4RG8 A;  5D7U A;  4M7D F;  5LJ3 e;  2BUD A;  2LCL A;  2VVK A;  2DXC A;  4C92 E;  1AEY A;  1RAI B;  2G6F X;  3KFV A;  2O4X A;  1YI2 Q;  3FB9 A;  1QWF A;  3G6E Q;  3FDR A;  3QBY A;  1PRM C;  2DXU A;  2X3X D;  3L42 A;  1BI1 A;  2VUB A;  2CRE A;  2RO0 A;  1ZBX A;  3JB9 F;  3I5S A;  4M78 F;  2DET A;  4M7A G;  5FLX E;  2DL5 A;  1YHQ Q;  3HL8 A;  3CBP A;  5LJ3 h;  2FRY A;  2MIO A;  2HCK A;  4PFP A;  3G4S Q;  2XMF A;  1WZO A;  1BU1 A;  2OTJ T;  3M56 A;  3I55 T;  5GAN g;  3BY7 A;  1T3L A;  1UE9 A;  3CMA T;  1RAF B;  3M0S A;  1WX6 A;  4IUQ A;  2FZK B;  2EQJ A;  1TUC A;  3I56 A;  4C8Q D;  5GMK i;  1NJI R;  2E70 A;  4PJO A;  3DB3 A;  2WSC E;  3G1J A;  2ZCF B;  2KEA A;  4X1V A;  4EMK C;  1H64 1;  3HHT B;  1VIF A;  2LRQ A;  3I5R A;  3VYG A;  5IXB A;  3C95 A;  3URG A;  5IXF A;  3HPW A;  1WDX A;  2CP3 A;  4BY6 B;  2QQ9 A;  4C92 F;  3LW5 E;  2BZ8 A;  2JS0 A;  2ROL A;  4J9H A;  1TH7 A;  2JN0 A;  3M55 A;  2KI7 A;  3VU3 C;  1QCN A;  4M4Z A;  4XU2 A;  2J06 A;  4R56 A;  1ABO A;  4XTY A;  4ME7 A;  4FW1 A;  4RTW A;  3SWN A;  2EJF A;  4FT2 A;  1X2Q A;  1VQP T;  1YWP A;  3VRY A;  3CCS Q;  1UGP B;  1KQ2 A;  1WHK A;  1MUZ A;  1ABQ A;  3NTI A;  2YRV A;  3OYM A;  4JS4 A;  2KSS A;  3C94 A;  2K79 A;  4PJO D;  2L3R A;  2IIM A;  3WVE B;  1WXU A;  5M9O A;  3QSU A;  3L2V A;  4F7U B;  4C0Z A;  4FYV B;  1W2B A;  9ATC B;  3PT9 A;  3CD6 A;  1BIB A;  1VQ4 T;  4M7A A;  2KYB A;  3HFO A;  2KQW A;  1PD1 A;  2HKN A;  1Q95 G;  4N0A A;  1D0Y A;  3JSC A;  3LX7 A;  3PFS A;  1Y71 A;  2EGC A;  3H0H A;  2DO3 A;  2KRS A;  5CKH A;  2ZPH B;  4Z88 A;  1M9S A;  1WHJ A;  2MI6 A;  2FPE A;  1GFC A;  3U23 A;  2LDM A;  4E7H A;  3QXE B;  2LT1 A;  1PHT A;  4BUG A;  1TU0 B;  3V8K A;  2QEX Q;  3HP9 A;  1U5S A;  1YJN A;  2DNU A;  4JRK A;  3A98 A;  1TOV A;  3EFO B;  1IXD A;  3P8B B;  3EHR A;  4RTU A;  3PIO A;  4XTV A;  5IHI A;  2V26 A;  3CCQ A;  3CME Q;  3RNJ A;  3UWN A;  3CCE A;  1TWB A;  5L23 A;  1KD1 R;  1M90 U;  2L0A A;  3M9Q A;  2RH2 A;  4L5G A;  3ER0 A;  1ZLM A;  3EG9 A;  4RCB A;  1YJ9 T;  3CC2 A;  1K8A C;  3NHN A;  1CKB A;  5HK3 A;  1YJW A;  2NUP A;  2X3W D;  4PJM A;  3CCJ A;  1PG5 B;  1QWE A;  3QDR B;  4V2S A;  2EBP A;  2A7Y A;  2EJ9 A;  3EGU A;  5IHK A;  2DXB A;  3JCM V;  2B8A A;  4M7A D;  2V1Q A;  3LYI A;  1TG0 A;  1YCY A;  4OP0 A;  3QPH A;  2CZ6 B;  5GAO q;  1NZ9 A;  2FB7 A;  3GNF B;  3JCM h;  3BE3 A;  1JJ2 A;  1G3W A;  1IGU A;  4F04 B;  1VQM Q;  3A1P A;  4N4I A;  2HNI A;  2K3Y A;  1K73 R;  1K9M U;  5KYX A;  3H41 A;  5DLO A;  3KXT A;  4CC3 A;  1I5O B;  4M75 D;  4PKC C;  3M0Q A;  3RBB B;  4HVW A;  2EJG A;  2R58 A;  3PNW C;  3LWI A;  1IO6 A;  1K1Z A;  1M90 C;  3EGD B;  3OY9 A;  2WSE E;  2SEM A;  5HCK A;  2ZZD A;  3FLG A;  3DLM A;  3G7Z A;  1YIJ T;  2ABL A;  4B9W A;  2XD0 A;  1QVF S;  3UT1 A;  3M4Y A;  4KGZ B;  2OI3 A;  4CI0 C;  3CCU Q;  1RAB B;  2CUB A;  2XID A;  4M77 D;  4F7U G;  4BAC A;  2L89 A;  2CH4 A;  4CC7 A;  4KGV B;  1I5L A;  2D6F A;  4DOV A;  4C8Q F;  1K0S A;  3OBW A;  3E19 A;  1RAG B;  2OTL Q;  2DIG A;  4KT0 E;  5IT9 E;  2HEQ A;  3E9G A;  2AZS A;  2DBK A;  1K9M C;  4MDW A;  1U3O A;  3VUB A;  1D09 B;  3VS6 A;  3C12 A;  1QQJ A;  3JCM J;  1I8F A;  1JU5 C;  2QQR A;  2DLP A;  3OYF A;  4Z8A A;  2MAM A;  4XTX A;  3RR6 A;  1NPR A;  3CC7 A;  3I35 A;  4C8Q B;  3QZ9 B;  3FJP A;  1VQ8 T;  5KYW B;  4Q5W A;  2HL5 C;  1J3T A;  4KRT A;  4II1 A;  2YUQ A;  2EFI A;  4OB1 B;  1X69 A;  4XU3 A;  2CP2 A;  2BE9 B;  2RI3 A;  5CQX A;  2R5A A;  1H3H A;  3A8O B;  4A53 A;  3SFM A;  2WSF E;  3SD4 A;  5CAI A;  1SRL A;  5GMK j;  3M0U A;  2F5K A;  2PU9 B;  5IN1 A;  4BE0 A;  4PFZ A;  4LDX A;  3ASK A;  2YUP A;  2BTT A;  1OQK A;  4PFO A;  1BI2 A;  1N9S A;  4ZN3 A;  1OV3 A;  1OPL A;  3CCM T;  2JZ2 A;  3G71 Q;  1GRI A;  7AT1 B;  4QKU A;  2YRC A;  2EPD A;  4J8O A;  4PJO F;  1OI1 A;  2E5K A;  4JJB A;  4LD9 K;  2HD0 A;  2Y4X A;  5CKE A;  3X26 B;  3V7C A;  1SPK A;  2EAY A;  3VS3 A;  2FHD A;  2M9U A;  4M7A E;  1WXT A;  4Y28 E;  4PLL A;  1YBY A;  2H3E B;  4KH1 B;  3LLR A;  1WLP B;  1ZSZ C;  3MP8 A;  4OGC A;  4FSX A;  4IUT A;  4R0K A;  2X4X A;  4KUI A;  4OB3 B;  4FIB A;  2K9G A;  2A37 A;  1WHL A;  4F7U A;  2H8H A;  3M0P A;  1KK7 A;  2RJE A;  3EAE A;  3M4G A;  4LDW A;  4DOW A;  3BDU A;  5DLQ E;  1VQN Q;  3PTA A;  3CC4 Q;  2MPX C;  5GAN f;  1JRI A;  1GFD A;  3E9F A;  1W1F A;  4JRP A;  2DX1 A;  2YUN A;  2A36 A;  1QCO A;  2FVU A;  4E7J A;  4Y92 A;  4K11 A;  3CCR Q;  4QQG A;  5FU7 C;  4DBF A;  3O5Z A;  4L59 A;  5I2S A;  2RI5 A;  1Q81 U;  4D8K A;  2MK5 A;  2P4R A;  2E3I A;  2ZPB B;  1BK2 A;  1WJR A;  4J6Y A;  2OTJ A;  3I55 A;  4ANJ A;  1VQK T;  5GAN d;  4L6V 5;  3EFO A;  2DRK A;  3CMA A;  1RAC B;  1BCO A;  1I07 A;  3H0F A;  3MO8 A;  2AK5 A;  1Y7X A;  1ZBJ A;  3SHW A;  4M7A F;  3DKM A;  2QA4 Q;  1T0J A;  2AZV A;  3A8G B;  3PE0 A;  4A4F A;  1VQL Q;  4J6X A;  2K2V A;  4ZNX A;  1JQQ A;  3UPU A;  3M58 A;  1XOV A;  2ZAE A;  3E1S A;  2EYW A;  1RL2 A;  2GQI A;  4J9B A;  3FC3 A;  1G3Y A;  1RLQ C;  3JV3 A;  5CKB A;  1WGS A;  1C0M A;  1PM3 A;  1VIE A;  1Q81 C;  2K3X A;  1VQO Q;  3EH2 A;  3QG1 A;  1CKA A;  1YI2 T;  2QDY B;  5KYU B;  1V76 A;  5GAN e;  1AT1 B;  5GAM j;  1TXQ A;  2QQA A;  2EVR A;  4O5V A;  5GAN 4;  1KQS P;  2P84 A;  1ZA1 B;  1QLY A;  3CC7 T;  4M75 B;  1VYU A;  4DBR A;  5LJ5 j;  2DKG A;  4O6J A;  1YHQ T;  2JT4 A;  2MYS A;  2V8K A;  3BW1 A;  1VQP A;  4C0F A;  3VS2 A;  3EGD A;  1QP3 A;  1HXD A;  2MOX A;  2JOY A;  5GAN h;  2LQW A;  4QVZ A;  3LGF A;  2XDP A;  4OB0 B;  1C6V X;  4M77 B;  1D1A A;  3GPL A;  1M30 A;  2FG0 A;  1TS9 A;  2ZGW A;  4BDZ A;  3QII A;  1O75 A;  2NYS A;  2M0O A;  2EYZ A;  3VJP A;  5LJ3 d;  1VQ6 Q;  1ACM B;  5IHN A;  3KUF A;  3NFC A;  1K8A R;  4OGE A;  1VQ4 A;  2HL3 A;  1YIT Q;  4RTX A;  3RIR A;  1SSF A;  5I21 A;  1YFN A;  3EHQ A;  3OYE A;  5GAN 8;  1N9R A;  4Y91 A;  2P0K A;  3GIB A;  4AG1 C;  2CSI A;  2X9H A;  5IAY A;  2GCX A;  1MND A;  3GOX A;  1JO8 A;  4C8Q A;  5KE3 A;  5KYW A;  2HMA A;  1GXI E;  1GCQ C;  2ED1 A;  1IGQ A;  2PNI A;  2XU8 A;  3L2Z A;  2J7I A;  2ESW A;  1VQ5 Q;  2VXE A;  4J7I A;  2RHI A;  1GBR A;  2RF0 A;  1ZHI A;  2FO0 A;  2P4T A;  3MP1 A;  1BI0 A;  3CPW A;  3TU4 K;  2YUO A;  4ESR A;  3ZBD A;  2VWF A;  3LH5 A;  2KRM A;  3CCS T;  2PVD B;  1NLO C;  2RHZ A;  1OX8 A;  4PNO A;  2E12 A;  1YJ9 A;  3V8J A;  5C6S A;  4E7S A;  2AKK A;  3PMI A;  3VUZ A;  5CVI A;  1QVF A;  4J9I A;  4BE1 A;  1WPY A;  4F7U E;  2J6K A;  1H8K A;  2RJF A;  3RMQ A;  2QK0 A;  1X6B A;  1AD5 A;  4M7D C;  2VB6 A;  4M75 G;  2QQB A;  2JXB A;  3MKD A;  5IH2 A;  4BE2 A;  1OEB A;  1SHG A;  1YWO A;  1P92 A;  2EYQ A;  4PLI A;  3KBG A;  2JTE A;  1SEM A;  1WQ7 A;  2IPO B;  3MCA B;  3JAM E;  1PKT A;  2DL7 A;  1IZ6 A;  2XK0 A;  4EMK B;  1Q86 U;  1E6G A;  5LJ3 j;  4BI3 A;  2QEX T;  2G3R A;  4MMK A;  4M78 C;  1YIJ A;  2CS7 A;  1M3C A;  4M77 G;  3REA B;  4HT8 A;  2NUT B;  2MMP A;  2K5F A;  1B7T A;  1PD0 A;  3OW2 P;  3M54 A;  3CCL A;  2DJQ A;  3CXC P;  3CME T;  2EWN A;  2AHJ B;  4HCZ A;  2M02 A;  1BKB A;  3OYL A;  2HBW A;  5I22 A;  1FMK A;  3OBY A;  3RKX A;  1EZZ B;  4OMP A;  2RQW A;  4EIK A;  1I81 A;  2CT4 A;  3OYG A;  1NM7 A;  1EIF A;  2KR3 A;  3VYH B;  1LCK A;  4E7K A;  2R5M A;  1BBZ A;  4A4G A;  2F69 A;  4F7U F;  3JCM f;  2O01 E;  2VV5 A;  4OMM A;  1Q7Y U;  2EQK A;  1VQ8 A;  4NOY A;  3JRZ A;  1FXX A;  4J9D A;  1TTH B;  3FJ5 A;  3GLX A;  4N4H A;  1M27 C;  2RMO A;  1M3B A;  4C92 C;  1S72 Q;  4E6R A;  4DEY A;  2C0I A;  4D6W A;  3OYI A;  1X6O A;  1UTI A;  1GCP A;  2D1X A;  1WNL A;  1VQ7 A;  2DL8 A;  1RAD B;  2KNB B;  4XK8 E;  1Y96 B;  3OYY A;  1PKS A;  1M1K U;  4CC4 B;  1SF9 A;  3WVD B;  2IVW A;  4ZGJ B;  2JTF A;  3JCM d;  5HK0 A;  4QQD A;  5A0G A;  1H92 A;  1KIK A;  1BYM A;  3C0C A;  3S3N A;  1Q82 R;  5KYU A;  3EG0 A;  3CCU T;  5GAO r;  2DPP B;  4BI8 B;  3CCM A;  4OMF B;  3JCM c;  1IHV A;  2DF6 A;  5J39 A;  3FEO A;  4GLM A;  3ULR B;  4MZM A;  4M75 A;  1M2V B;  1Q7Y C;  3NMZ C;  4RTY A;  2DBM A;  2DK3 A;  2RQV A;  1R0B G;  4Z02 A;  1RI0 A;  1WXB A;  4PJJ A;  5GJV B;  3CMA Q;  3OMC A;  2J6F A;  2DXT A;  3QWX X;  2YDL A;  3INZ A;  1XQH A;  4BDY A;  2KMT A;  1G83 A;  1PCX A;  1UEC A;  2BIV A;  5A0L A;  2Y4Y A;  1M1K C;  4M77 A;  1LOJ A;  3JCM e;  4AFU C;  1UG1 A;  4KUD K;  2A08 A;  1QVG P;  1HD3 A;  3EG2 A;  4FW2 A;  4C8Q E;  5J26 A;  3MHX A;  4WTO B;  4LDY A;  5GAN 2;  5A2Q E;  1I0C A;  2RQR A;  3QKJ A;  3OYK A;  1NPP A;  4VUB A;  3AT1 B;  1N6A A;  2D0N A;  5CKD A;  1Q81 R;  1VQ9 Q;  5GAO l;  3N5B B;  2CKK A;  2DVE A;  2XHC A;  4YTL A;  2QAS A;  1JEG A;  3QDF A;  4RCC A;  3HTR A;  2CP0 A;  3QJY A;  3ZEH A;  3MJX A;  2CT3 A;  2E5Q A;  4C5G A;  4AFZ C;  1VQP Q;  3G71 T;  1R0C B;  1VQK A;  2CYZ B;  3CBO A;  2VKN A;  3E2U A;  4NS5 A;  2M16 A;  2CP7 A;  1QW1 A;  4ZGE B;  2DRM A;  3QYG B;  2LNV A;  4RUG A;  2NLU A;  2HAX A;  1E6H A;  1R8O B;  2EQU A;  3CCV Q;  4CRI A;  2MWP A;  2B86 A;  3CCL T;  1UFF A;  1MV3 A;  3OS1 A;  4PJO E;  1NJI U;  1LJO A;  2E1H A;  3VS4 A;  1M1F A;  1OYX A;  2F2X A;  3L1A A;  1U06 A;  5GAO m;  1VQN T;  1WJS A;  2CSQ A;  3CC4 T;  1YI2 A;  3G6E A;  3TVT A;  1YNZ A;  2F2V A;  1H3Z A;  1K9A A;  4IUU A;  4E7I A;  1U1S A;  6AT1 B;  3JB9 H;  1PSE A;  2W0Z A;  3CCR T;  1YHQ A;  3IQL A;  3MEU A;  2A3L A;  1K4U S;  2QQS A;  4OF1 A;  2FZG B;  4EMK A;  2COZ A;  1OX9 A;  1N8R U;  4HCC A;  4J9F A;  3PIP A;  1WJQ A;  3VRZ A;  1VQ7 T;  2GGR A;  2EKO A;  1D0Z A;  4HT9 A;  1FMW A;  2DA9 A;  1SKU B;  4MZT A;  2DM1 A;  2FPD A;  2BE7 D;  1I4K 1;  2E6Z A;  2NUT A;  1JXO A;  2CDT A;  1YJ9 Q;  1VYT A;  3S6W A;  2EW3 A;  2LQK A;  2RNA A;  1X27 A;  2YRD A;  2QA4 T;  4EPC A;  4IUR A;  3GP8 A;  1VQL T;  1MV0 B;  4QVD A;  3T9N A;  1R77 A;  2DD5 A;  5GAN 7;  1UEB A;  1V1C A;  2IG0 A;  2RD1 A;  3UF4 A;  2Y90 A;  1V29 B;  1F1B B;  4DQ2 A;  3VS5 A;  4PL6 A;  2CUD A;  3LGL A;  2JMA A;  2CZ0 B;  1W70 A;  2L2P A;  3QYH B;  4ZN1 A;  1VQO T;  1N8R C;  3I56 Q;  4M7D D;  1ZSZ B;  4LUE A;  2E4H A;  4OMQ A;  2K6D A;  3JB9 I;  2FRW A;  1QP2 A;  2KXC A;  3PVL A;  2DAQ A;  4RG2 A;  1KFZ A;  2RM4 A;  2JM8 A;  4TVR A; 
#chains in the Genus database with same CATH homology
 3VJP A;  5LJ3 d;  2JN0 A;  4M75 E;  4EMH A;  3KUF A;  3NFC A;  2LQ8 A;  4BD3 A;  3M55 A;  3RMS A;  3CPW S;  4OGE A;  3VU3 C;  1Y96 A;  4HA8 A;  3OSV A;  3H6Z A;  4XU2 A;  4C92 G;  1VQ4 A;  1W2B S;  3HKS A;  2PUK B;  4M78 D;  3CCS A;  3RIR A;  5C0M A;  1SSF A;  1JBM A;  2RI2 A;  4FL6 A;  2KDS A;  1AHJ B;  2M1H A;  5I21 A;  4R56 A;  3I56 T;  3OYE A;  4XTY A;  2MWO A;  4ME7 A;  3WXM B;  5GAN 8;  3OYA A;  1N9R A;  4Y91 A;  1D3B B;  2P0K A;  3GIB A;  3SWN A;  4UC4 A;  3X20 B;  2OAU A;  3QUI A;  1VQ5 A;  4JRQ A;  2EJF A;  2CZ7 B;  4FT2 A;  1B34 A;  2GCX A;  5L8R E;  5IAY A;  1VQP T;  5FRM A;  4X9D A;  3GOX A;  5FU7 B;  1KQ2 A;  1UGP B;  5FU6 C;  5GAO p;  2L5Q A;  4M77 E;  4C8Q A;  2VXF A;  3X28 B;  5KE3 A;  1VQ6 T;  2JTM A;  3NTI A;  3J81 E;  2YRV A;  3OYM A;  3CEY A;  4JS4 A;  2YHT A;  1KD1 U;  1GXI E;  5KH6 A;  3JCM Q;  2KSS A;  2CZ1 B;  2XU8 A;  3C94 A;  3L2Z A;  4J7F A;  3LH0 A;  3RKY A;  3SDZ A;  3LWH A;  2RHU A;  3OYC A;  4C0G A;  2VXE A;  2L3R A;  1YIT T;  4J7I A;  4PJO D;  3WVE B;  2RHI A;  2DTO A;  5M9O A;  5GMK e;  4ZGD B;  1ZHI A;  3QSU A;  4M7D A;  2P4T A;  3BFM A;  1BI0 A;  3MP1 A;  1N27 A;  3M5A A;  4LDV A;  1FWZ A;  4F7U B;  3L2V A;  4C0Z A;  3RUX A;  3TU4 K;  1W2B A;  3PT9 A;  2LX9 A;  1FX7 A;  2JNG A;  2X4J A;  1KQS S;  3ZBD A;  3CD6 A;  1BIB A;  1VQ4 T;  2DJZ A;  2DEQ A;  4P5N A;  3OS5 A;  4M7A A;  4MDX A;  2LVM A;  3CCS T;  2PVD B;  2RHZ A;  3HFO A;  2KQW A;  2VYT A;  3X25 B;  4X34 A;  4C92 D;  3F70 A;  3MEV A;  4PNO A;  1UB4 A;  3QZ5 B;  4N0A A;  3JSC A;  3LX7 A;  3PFS A;  3G4S A;  2QEX A;  2E12 A;  4JUV A;  3P8D A;  1YJ9 A;  3V8J A;  5C6S A;  1Y71 A;  4XTU A;  2EIF A;  2DO3 A;  1LNX A;  3PMI A;  4M78 A;  5CKH A;  2ZPH B;  3VUZ A;  1M9S A;  5CVI A;  4M75 F;  4C8Q C;  2GFA A;  2MI6 A;  5GMK h;  1QVF A;  4BE1 A;  2LDM A;  4JLG A;  3QXE B;  4E7H A;  4IKF A;  3PGG A;  2LT1 A;  1WPY A;  4GY5 A;  1NJI C;  2DZC A;  4BUG A;  2K4Y A;  2RJC A;  2XI9 A;  3JCM X;  3V8K A;  2LTO A;  3OYD A;  4F7U E;  3HP9 A;  3CME A;  1YJN A;  5GMK l;  1IRE B;  1KQ1 A;  2RJF A;  3RES A;  3RMQ A;  4JRK A;  3A8L B;  2EQM A;  3OB9 A;  3P8B B;  4OVA A;  4M7D C;  3G6E T;  4M75 G;  3OS0 A;  3PIO A;  2QQB A;  2XIC A;  5I2M A;  3S3M A;  1JJ2 S;  2KVQ G;  2FL7 A;  2K5I A;  2E41 A;  4RKU E;  4XTV A;  4BE2 A;  2V8J A;  1W4S A;  3GF5 A;  3QO3 A;  3CD6 T;  3CCQ A;  4M7A C;  1P92 A;  2EYQ A;  2O4X B;  2VGN A;  3KBG A;  4M77 F;  4PLI A;  5GAN 5;  3UWN A;  3JCM g;  3CCE A;  1WQ7 A;  3MCA B;  5GAM f;  1O9S A;  2ZPI B;  3JAM E;  2V8I A;  3MEW A;  1IZ6 A;  2XK0 A;  1M90 U;  4N0A C;  4EMK B;  1Q86 U;  3MEA A;  5LJ3 j;  1HK9 A;  3M9Q A;  2RH2 A;  2VGM A;  4L5G A;  3ER0 A;  3G4S T;  4BI3 A;  2QEX T;  4RCB A;  1YJ9 T;  3CC2 A;  2G3R A;  2JUF A;  5HK3 A;  2RK2 A;  4MMK A;  4M78 C;  5LJ5 f;  1YJW A;  1K8A C;  1YIJ A;  3CCJ A;  3J80 E;  2CS7 A;  5J3B A;  3QDR B;  4M77 G;  4V2S A;  5LL6 S;  2A7Y A;  4HT8 A;  3OQ5 A;  2EJ9 A;  2MMP A;  3L2W A;  2E65 A;  4NL2 A;  4C92 A;  2K5F A;  2DXB A;  3JCM V;  3OW2 A;  1Q82 U;  1M1G A;  2B8A A;  4M7A D;  3M54 A;  3LYI A;  3CCL A;  3CXC A;  2GFU A;  1YCY A;  3CME T;  1YJN T;  4XTZ A;  4OP0 A;  2EWN A;  2CZ6 B;  2AHJ B;  2CGH A;  3QPH A;  5GAO q;  1NZ9 A;  2FB7 A;  3FRN A;  3GNF B;  4HCZ A;  3JCM h;  1BKB A;  1G3W A;  3OYL A;  2X4Y A;  5GAM d;  1JJ2 A;  4MZP A;  4N4I A;  4XU0 A;  2HNI A;  3OBY A;  3RKX A;  2K3Y A;  3NTK A;  5GAN 3;  3JB9 D;  1K9M U;  3OA6 A;  5DLO A;  3L2R A;  1I81 A;  3KXT A;  1BI3 A;  5KCO A;  3OYG A;  3M53 A;  4M75 D;  4PKC C;  4EMG A;  4PJO B;  4PJO C;  4KUD K;  5LJ5 d;  5GMK m;  3CCQ T;  1EIF A;  2HQX A;  3VYH B;  3CCE T;  2EJG A;  5CK9 A;  4E47 A;  4LD6 A;  1S72 A;  4XTW A;  5AYF A;  4C0D C;  3S3O A;  5GAN j;  2QXF A;  2R58 A;  3PNW C;  4RMO A;  3JCM P;  4E7K A;  3CCU A;  2R5M A;  3LWI A;  4A4G A;  2F69 A;  4F7U F;  3MP6 A;  1M90 C;  3JCM f;  2O01 E;  2VV5 A;  1DJ7 B;  2PVO B;  1XTD A;  2WSE E;  4JRI A;  4KBM B;  5CQY A;  2EQK A;  2WAC A;  1Q7Y U;  5HY6 A;  5FU6 B;  1VQ8 A;  4NOY A;  2HBP A;  2ZZD A;  3HRU A;  3JRZ A;  3CC2 T;  1FXX A;  2PVG B;  3FLG A;  3DLM A;  3G7Z A;  5CIU A;  1YJW T;  1MHN A;  3GLX A;  2LC4 A;  4B9W A;  3CCJ T;  1YIJ T;  2XD0 A;  4N4H A;  3DLL A;  5GAO n;  2RA2 A;  3RKW A;  2LT4 A;  1QVF S;  2C06 A;  3UT1 A;  4C92 C;  3M4Y A;  2OTL A;  4CI0 C;  3OYJ A;  3H8Z A;  1M4Z A;  2XID A;  2ZPG B;  4A4H A;  4D6W A;  4M77 D;  1JB0 E;  4F7U G;  4BAC A;  3OYI A;  1U8R A;  2L89 A;  1X6O A;  2RJD A;  2KY9 A;  1Q82 C;  1MGQ A;  3A8H B;  1I5L A;  1WNL A;  3L2U A;  1X75 C;  1VQ7 A;  2D6F A;  1ZQ1 A;  4KUL A;  4DOV A;  1G5V A;  4XK8 E;  4QW2 A;  5GAM g;  4C8Q F;  1Y96 B;  3OYY A;  3UDC A;  3OBW A;  5GAM e;  1M1K U;  2RHY A;  3E19 A;  3WVD B;  3MET A;  2IVW A;  3ME9 A;  3V8L A;  4ELY C;  2DIG A;  4ZGJ B;  4KT0 E;  5IT9 E;  2JTF A;  3E9G A;  2DTI A;  3JCM d;  2F5T X;  5HK0 A;  4QQD A;  1K9M C;  4JJN K;  4MDW A;  4C5E A;  5A0G A;  3VUB A;  3C12 A;  5LJ5 g;  1BYM A;  3TEE A;  5LJ5 e;  3JCM J;  3S3N A;  3HFN A;  1I8F A;  5CKF A;  3V7S A;  3ZFJ A;  2QQR A;  3SWN C;  3SWN B;  1S72 T;  3OYF A;  4C8Q G;  1K73 U;  4HCB A;  2MAM A;  2RK1 A;  1B34 B;  3CCU T;  4FT4 A;  4XTX A;  2LCC A;  5GAO r;  2DPP B;  4BI8 B;  3CCM A;  1VQ5 T;  3J7A F;  4OMF B;  3JCM c;  1NPR A;  3CC7 A;  5J39 A;  3FEO A;  3HSB A;  4C8Q B;  3QZ9 B;  4MZM A;  3FJP A;  4M75 A;  1VQ8 T;  2QI2 A;  4Q5W A;  1Q7Y C;  1Y07 A;  2DK3 A;  2PQW A;  1KHI A;  5D6Y A;  2E10 A;  2D9T A;  4Z02 A;  5GAM h;  1RI0 A;  3RER A;  4II1 A;  2H3J A;  2MF2 A;  3OW2 S;  3OMC A;  1KD1 C;  2KAF A;  3DB4 A;  2X4W A;  3CXC S;  2DXT A;  4GLK A;  2E64 A;  4X9C A;  4M7D B;  2EFI A;  2K5L A;  3INZ A;  3M57 A;  5DY9 A;  1UGQ B;  4OB1 B;  5D6X A;  2E6N A;  5LJ5 h;  1XQH A;  3EFS A;  4A4E A;  4BDY A;  2KMT A;  4XU3 A;  1G3S A;  4E7L A;  5DM7 R;  2RI3 A;  1UGR B;  1QVP A;  2BIV A;  4M7A B;  5A0L A;  2DD4 A;  2Y4Y A;  3FIF A;  5CQX A;  3G71 A;  1M1K C;  2R5A A;  4M77 A;  3A8O B;  2XDD A;  1LOJ A;  4A53 A;  3JCM e;  3SFM A;  4OB2 B;  2WSF E;  1QVG A;  3SD4 A;  5CAI A;  3OSS C;  5GMK j;  2R57 A;  2F5K A;  2PU9 B;  2YLB A;  4J5Y A;  5IN1 A;  4BE0 A;  3ASK A;  4C8Q E;  2K57 A;  2QTX A;  5J26 A;  3MHX A;  4LDX A;  4LDY A;  5GAN 2;  4BI4 A;  5A2Q E;  3JB9 J;  3QKJ A;  3OYK A;  3TRE A;  1VUB A;  1NPP A;  3QJ6 A;  1BI2 A;  1N9S A;  4M78 B;  4ZN3 A;  4VUB A;  3CCM T;  1K73 C;  2JZ2 A;  3AHU A;  4M75 C;  1VQM A;  1N6A A;  2ZPF B;  1M5Q 1;  4J8O A;  1U1T A;  5LJ3 f;  3R6O A;  5CKD A;  4PJO F;  4JDS A;  3HRT A;  2ZPE B;  5EG2 A;  3OMG A;  1OI1 A;  4A54 A;  4M7D E;  5GAO l;  3N5B B;  1D3B A;  2CKK A;  2DVE A;  3PMT A;  5CCA A;  2XHC A;  3OYB A;  4LD9 K;  2GQV A;  2HD0 A;  2Y4X A;  2RB6 A;  4J6W A;  5CKE A;  4YTL A;  3VV0 A;  3V7C A;  3X26 B;  3OYN A;  3OYH A;  2EAY A;  1G3T A;  2FHD A;  2M9U A;  4M7A E;  4RCC A;  4Y28 E;  4IUP A;  4PLL A;  3QJY A;  1YBY A;  3ZEH A;  3A5Z B;  3LLR A;  2KK4 A;  4PJO G;  3CPW A;  2DIQ A;  2E5Q A;  2XDB A;  4BY6 C;  4C5G A;  3MP8 A;  4OGC A;  1VQN A;  2VC8 A;  4ATO A;  3L2Q A;  4FSX A;  3CC4 A;  4IUT A;  4M77 C;  2X4X A;  3G71 T;  4KUI A;  1BIA A;  2CYZ B;  1VQK A;  2XG8 D;  4M78 E;  2P0P A;  3C4S A;  4OB3 B;  4C0D B;  4FIB A;  5A0D A;  2BKD N;  3CCV A;  2XKO C;  1NE8 A;  3CBO A;  1VQ9 T;  4QVC A;  3SB2 A;  4NS5 A;  4F7U A;  4B9X A;  2M16 A;  4IUV A;  1Q86 C;  1QW1 A;  2RJE A;  3EAE A;  1OZ2 A;  3M4G A;  4LDW A;  4DOW A;  4ZGE B;  3BDU A;  5DLQ E;  4NL3 A;  3CCR A;  1KC8 U;  3PTA A;  2X35 A;  3QYG B;  5GAN f;  2LNV A;  3NTH A;  1JRI A;  3JCM b;  3E9F A;  2NLU A;  1VQM T;  4C5H A;  4C92 B;  5KCH A;  2HAX A;  2EQU A;  1R8O B;  4JRP A;  5GAN 6;  3X24 B;  4FM4 B;  2DTH A;  4CRI A;  4DA4 A;  2MWP A;  2DZ9 A;  3CCL T;  3BDL A;  2FVU A;  4E7J A;  2PUO B;  4FU6 A;  4LDU A;  4MML A;  2GF7 A;  4QQG A;  5FU7 C;  3O8V A;  3OS1 A;  4PJO E;  1NJI U;  4JS5 A;  1LJO A;  3OS2 A;  4C5I A;  1X01 A;  4L59 A;  5I2S A;  2RI5 A;  1Q81 U;  2E1H A;  1M1F A;  1OYX A;  3L1A A;  5GAO m;  1VQN T;  2ZPB B;  1WQW A;  1WJR A;  1WJS A;  2P0Q A;  2I2L A;  4J6Y A;  3CC4 T;  4XU1 A;  1YI2 A;  2OTJ A;  3I55 A;  4RG8 A;  2QA4 A;  4A4K A;  1VQK T;  5GAN d;  3G6E A;  1QVG S;  4L6V 5;  4M7D F;  1VQL A;  3A8M B;  3CMA A;  3CCV T;  5LJ3 g;  5CO7 A;  5LJ3 e;  2BUD A;  5D6W A;  4BB7 A;  3MO8 A;  1H3Z A;  2LCL A;  1Y7X A;  4IUU A;  2DXC A;  4HKE A;  4C92 E;  4E7I A;  1VQ9 A;  1U1S A;  3JB9 H;  1PSE A;  3P8H A;  1M8V A;  2FYK A;  4M7A F;  3JCM W;  3DKM A;  4QQ6 A;  3CCR T;  2O4X A;  4R55 A;  1YHQ A;  3FB9 A;  2D0Q B;  4JLI A;  3A8G B;  1KC8 C;  3MEU A;  2A3L A;  3FDR A;  3QBY A;  4M7D G;  2OTL T;  4A4F A;  2DXU A;  2QQS A;  4OF1 A;  1KG1 A;  4EMK A;  4J6X A;  1N8R U;  3OY9 A;  3L42 A;  1K8A U;  1BI1 A;  2K2V A;  2VUB A;  2RO0 A;  4HCC A;  1OZ3 A;  1VQO A;  1ZBX A;  3JB9 F;  3PIP A;  4M78 F;  1WJQ A;  3UPU A;  4XAX B;  4EDU A;  3M58 A;  1VQ7 T;  4M7A G;  5FLX E;  1XOV A;  2EKO A;  3E1S A;  4HT9 A;  1RL2 A;  3HL8 A;  4MZT A;  3FC3 A;  1G3Y A;  3CBP A;  2E6Z A;  1I4K 1;  5CKB A;  3HRS A;  5LJ3 h;  1WGS A;  3EFR A;  1VIE A;  1Q81 C;  2HQE A;  2K3X A;  2L8D A;  3JB9 G;  3QG1 A;  1YI2 T;  2QDY B;  4M78 G;  3S6W A;  2LQK A;  3M56 A;  3I55 T;  2QA4 T;  2OTJ T;  5GAN g;  4EPC A;  3BY7 A;  5GAN e;  5KE2 A;  4N4G A;  3VKI A;  4IUR A;  3GP8 A;  5GAM j;  4ELZ C;  5FRO A;  1VQL T;  3CMA T;  4QVD A;  3T9N A;  1KQS A;  2QQA A;  4O5V A;  5GAN 4;  2YLC A;  4IUQ A;  2DD5 A;  2EQJ A;  5GAN 7;  3CC7 T;  4M75 B;  3CBM A;  3I56 A;  4C8Q D;  1UEB A;  5GMK i;  1PSF A;  2RHX A;  2IG0 A;  2RD1 A;  2E70 A;  4J83 A;  5LJ5 j;  4PJO A;  2DKG A;  3DB3 A;  4O6J A;  2Y90 A;  1YHQ T;  2WSC E;  1V29 B;  2ZCF B;  3Q1J A;  4DQ2 A;  4EMK C;  2V8K A;  3BW1 A;  1VQP A;  4PL6 A;  2JVV A;  4C0F A;  1KHC A;  3LGL A;  1H64 1;  1UGS B;  1VIF A;  2CZ0 B;  2LRQ A;  3HHT B;  3VYG A;  3QYH B;  4XQ3 A;  4ZN1 A;  1VQO T;  1QP3 A;  3C95 A;  1N8R C;  1HXD A;  4M7D D;  1VQ6 A;  3GNG A;  3TCJ A;  3URG A;  3QHS A;  3CPF A;  1XNI A;  3M59 A;  5CR2 A;  3HPW A;  5FRN A;  2JOY A;  3V7R A;  4BY6 B;  2QQ9 A;  4QVZ A;  5HKC A;  5GAN h;  4ZTF A;  3LGF A;  4C92 F;  3JB9 I;  1QP2 A;  2XDP A;  4OB0 B;  3LW5 E;  4M77 B;  1YIT A;  2DAQ A;  4RG2 A;  3GPL A;  2RM4 A;  2ZGW A;  4BDZ A;  4ZTJ A;  3QII A;  1O75 A;  1TH7 A;  2M0O A;  4WF2 A;  4TVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...