2MWOA

Solution structure of 53bp1 tandem tudor domains in complex with a p53k370me2 peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Plasticity of Methyllysine Recognition by the Tandem Tudor Domain of 53BP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/antitumor protein
molecule keywords Tumor suppressor p53-binding protein 1
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA01
3C4SA 3ZEHA 4YTLA 1M1GA 1KC8C 3OS2A 3DLLA 3CC2A 3L42A 3I55T 4QVZA 3CCUA 4N4GA 3L2UA 2RHIA 3CCJT 4IUQA 3CCMA 5FRMA 3H6ZA 1VQ8A 4BDZA 3OW2S 3OYNA 3CMAT 3OQ5A 1YJWT 2DAQA 1KHCA 3MEVA 3H8ZA 3CCVT 4IKFA 2EFIA 4C5HA 2CKKA 4Z02A 2FHDA 2DIGA 3G6ET 3GOXA 2E70A 2IG0A 4QQ6A 3OB9A 3CCST 1IZ6A 2GFUA 1RI0A 1VQMA 3OYAA 1QVGA 3S6WA 4UC4A 1VQ5T 2M1HA 1N8RU 1MHNA 2EQKA 1VQPA 3J81E 2OTLT 1X6OA 3P8HA 4E7JA 3CPWA 3LGLA 5J39A 3S3MA 4QQGA 3CCEA 2LCCA 2L8DA 4BE2A 1VQ6A 3CC4A 3CEYA 4C5EA 1YIJT 2L89A 2E6NA 2X35A 2JVVA 1H3ZA 3CC4T 1JJ2A 3L2RA 1VQKA 2QA4A 1K9MC 1SSFA 3S3OA 3P8BB 2WACA 3CMET 2L3RA 1EIFA 3L2WA 4X34A 4Q5WA 5HY6A 1S72A 2R5AA 2LCLA 3J7AF 4BACA 1Q82C 1KHIA 3LH0A 4B9WA 3HKSA 1OYXA 2OTLA 3S3NA 4RG2A 1VQOT 1N27A 1G5VA 2M16A 2LQ8A 2RI2A 1KQSS 1NJIC 2XDPA 5FROA 3OYYA 2KVQG 5FLXE 3QIIA 2MI6A 1NJIU 1Q86U 1NZ9A 1VQKT 4A4EA 3ASKA 1YJ9T 2XK0A 3OYFA 3CCQA 4FU6A 4PLIA 3FC3A 2BUDA 3E9FA 2EKOA 2RI5A 2R57A 3G71T 2JOYA 3Q1JA 2EQJA 2MWOA 2XHCA 3OYKA 3NTHA 2G3RA 1RL2A 4IUUA 1VQ9A 3NTIA 3DB3A 3OYMA 4II1A 2QEXA 3OYIA 3KBGA 1YI2T 1VQLA 2EQMA 4E7IA 2X4XA 3I56A 3OYJA 3CC2T 1VQMT 4IURA 3JAME 2DIQA 4GY5A 4A4GA 2HQEA 1JJ2S 2R58A 1VQ7T 1K8AC 1YJ9A 3LYIA 4ZTFA 2RJDA 2RJEA 2D9TA 2RHZA 1M90C 2E5QA 3G4SA 5J3BA 3I56T 1VQ4A 3OS0A 1YI2A 4HCZA 1VQNA 2HQXA 3MP6A 3QKJA 1W2BA 1OZ2A 4NS5A 3LGFA 4IUVA 3CCLT 3F70A 5KH6A 3CCJA 3E9GA 1WJRA 3ME9A 2P0KA 3CPFA 5KE2A 3MO8A 5C6SA 1YHQT 3CCRA 4LD6A 4E7HA 2RI3A 4TVRA 4C5GA 2JZ2A 2OTJT 1Q7YU 3EAEA 3TREA 1KQSA 4IUTA 3M9QA 1OI1A 1YJWA 2QQSA 4PL6A 4OVAA 5C0MA 5A2QE 1NPRA 3BDLA 3KUFA 4ZN3A 1OZ3A 3PFSA 1Q81C 3CCRT 2DO3A 3G71A 3OYEA 1VQ4T 3FEOA 3I55A 2M0OA 2YRVA 3OYHA 1QVFA 5CIUA 1YBYA 3MP8A 2K3YA 5KCOA 2KDSA 4BD3A 3MEWA 3L2QA 3DB4A 1W2BS 3O8VA 5LL6S 1WJSA 5KCHA 3CD6T 4EDUA 4A4HA 2RHUA 2MWPA 2RJCA 4N4HA 1VQPT 1VQ7A 5D6WA 3SD4A 2EIFA 5IN1A 5IT9E 4A4FA 4E7LA 3OMCA 4PLLA 1VQ9T 3CCSA 2F5KA 4B9XA 1BKBA 5DLQE 3A5ZB 3MP1A 3CXCA 3OY9A 1XNIA 1UEBA 2JNGA 1Q81U 1N8RC 1M90U 1XTDA 2K3XA 3OYLA 2RHYA 3OS1A 3ER0A 3PMIA 1VQ5A 4ZN1A 1YIJA 1QVFS 3QBYA 3LX7A 1VQOA 2LTOA 2LDMA 3OYGA 2LRQA 2GFAA 4C5IA 4CRIA 3MEUA 1YJNA 1Q7YC 3PIOA 3OW2A 1YITA 2RO0A 1QVGS 1M1KC 1S72T 3CXCS 3FDRA 2LVMA 2BKDN 1WJQA 1K73U 3OYCA 5D6XA 3QJ6A 2R5MA 3CCMT 3MEAA 2QA4T 3PMTA 2X4YA 4IUPA 3UWNA 1KC8U 1WGSA 2QEXT 1K8AU 5FRNA 4L59A 3L2VA 2X4WA 2GF7A 2EQUA 3OMGA 3LLRA 2PQWA 1NPPA 1VQ6T 1KD1U 3CCQT 5D6YA 2JUFA 3J80E 3CC7A 3CCUT 1KD1C 3CMEA 1YJNT 3CPWS 3OYDA 4FL6A 1VQ8T 3P8DA 2QQRA 2O4XB 4BE1A 4QQDA 2O4XA 3META 1K9MU 3CC7T 2RHXA 3CCVA 3CCET 4BDYA 1YHQA 2NLUA 2VYTA 4N4IA 3OYBA 1Q82U 3FLGA 5M9OA 4E7KA 1VQLT 1VQNT 2JTFA 3OA6A 4QW2A 4BE0A 5IAYA 2RJFA 4ZTJA 1K73C 3CCLA 2E6ZA 3DLMA 3G6EA 5DM7R 1M1KU 3UT1A 3PIPA 2B8AA 3G4ST 3NTKA 5KE3A 2OTJA 1Q86C 3PNWC 3CD6A 2BIVA 5J26A 3CMAA 1YITT
chains in the Genus database with same CATH superfamily
2XIDA 3OS2A 3CCUA 1I8FA 3BW1A 1KJWA 1JJ2P 2LC4A 5FRMA 4JS4A 4HT9A 1OU8A 1YJWT 3RKYA 1R0CB 1B34B 3A8HB 2JM8A 3PTAA 2HSPA 4J9HA 5FWBA 2P84A 2FEIA 4MZPA 1PKSA 2DXUA 2XD0A 4GLKA 4XU3A 2E70A 4QQ6A 3CCST 3ULRB 4BUGA 4M7AC 5GMKm 3T9NA 2FRYA 4M77D 2CZ1B 1VQ5T 4C8QC 1WNLA 2DBKA 3BDUA 2OTLT 2QEXQ 1X6BA 1Y7XA 2LQKA 3LGLA 3M0QA 3S3MA 4M78E 4QQGA 2FPEA 2EJGA 2QDLA 5IXBA 5LJ3h 2DETA 4J7IA 1VQ6A 4KGVB 1YIJT 4RMOA 3M56A 2QI2A 4RUGA 1PRLC 1EX4A 2YHTA 2QA4A 4AG2C 5KYNA 3S3OA 3GBQA 1GFCA 2L3RA 1UECA 1OQKA 3HSBA 1EIFA 3L2WA 4X34A 4ELZC 3RR6A 3JCMX 2R5AA 1KFZA 2AZSA 4BACA 4M7DA 3C95A 1BU1A 1X6GA 2PZ1A 1YCSB 5GANd 1XQHA 2XDDA 1M2OA 2OTLA 1N6AA 2EYXA 2PVGB 1G5VA 3RMQA 4PJOF 2FO0A 2XDPA 4HCBA 5ECAA 8AT1B 1M3CA 3RMSA 1R0BG 2KBTA 3AT1B 2HBWA 3A1PA 2BZXA 2MI6A 1NJIU 4M75G 3QZ9B 1PWTA 2AIRB 3M5AA 2EJFA 2DVJA 1BI2A 2EYWA 1YJ9T 5GAN3 2FYKA 1OX9A 2IVWA 3CPWP 2XK0A 2L2PA 2KROA 5LJ5d 3OYFA 2C0TA 4PLIA 2ESWA 1YJNQ 2EKOA 3GLXA 1UHCA 1JQQA 3G71T 2CSIA 1CKAA 2EQJA 1Q86R 1VQ6Q 3OYKA 3NTHA 1M1FA 1QCNA 1T3LA 7AT1B 2A37A 4OB3B 3EGXA 3RKXA 1AVZC 2X3XD 3DB3A 4J5YA 5GAOr 1BYMA 1H92A 2QEXA 3OYIA 2AKKA 2MIOA 1ACMB 4NL3A 1VQLA 1ZBXA 2COYA 2CH4A 3OYJA 4A63B 3CC2T 1VQMT 2MAMA 3BY7A 4IURA 2L0AA 4GY5A 2H8HA 4A4GA 4LDVA 2HQEA 4JLGA 3LYIA 2RJDA 2D9TA 2RQVA 2JMCA 5KYYB 2RHZA 1M90C 1M5Q1 1I5OB 2I2LA 3M58A 1SRMA 1VIEA 4XU0A 3M57A 5KYXA 1YI2A 1GL5A 4HCZA 5CQXA 1NM7A 1VYTA 2M51A 2LJ0A 3VS6A 5KH6A 4QT7A 3E9GA 5HKCA 4L6V5 2P0KA 5C6SA 4AG1C 2DEUA 1Q7YR 4C0FA 4N0AC 1IGQA 2DZ9A 2RI3A 3TU4K 2JZ2A 1M1KR 4M7DB 4IUTA 4HVVA 5C0MA 5GAOq 3V8JA 1NE8A 4KUIA 1VQNQ 3BDLA 4ZGEB 2F2WA 1NG2A 4F04B 5AT1B 4PJNA 1AZEA 4XU1A 1VQ4T 6AT1B 3OYHA 2P4RA 2PNIA 1AWJA 4C92A 3RESA 4DA4A 2K3YA 4XQ3A 2KDSA 4ATOA 2CREA 3O8VA 1U1SA 1WJSA 5GMKe 2AHJB 4J9GA 4M7DC 4JPBW 3QYGB 4A4HA 2RHUA 2E65A 2GTOA 1WHHA 4N4HA 4NL2A 1IREB 2HSEB 2VB6A 4FT4A 3SD4A 5KYUA 3VUZA 2SRCA 2YUNA 4RTTA 4FM4B 1GXIE 4PLLA 3OMCA 3CCSA 1M90R 3TEEA 5GAN5 1HK9A 4PJOB 2AKLA 4OGEA 3AHUA 4R56A 5DLQE 4KUDK 4HVUA 5AYFA 3MP1A 3CXCA 3OY9A 1XNIA 2DTOA 4OB2B 1KQ1A 1YCYA 1RACB 2K7AA 1Q81U 3OBYA 1M90U 2YUPA 1W2BP 2K3XA 3OYLA 4J8OA 2DK3A 1K8AR 1D1AA 1TWBA 1QVFS 4AFQC 1QVFP 4PJOG 2CZ0B 4RCBA 1WHGA 2OAWA 5I11A 4E2FB 3MEUA 1K73R 1YJNA 5GAOl 1XJWB 1KQ2A 2CYZB 4AMCA 2DZCA 3R6OA 3CXCP 2BTTA 2ED0A 2LCSA 2RD1A 4C0GA 3CXCS 1IXDA 2BKDN 2C0IA 4P5NA 1C1AA 1K73U 2CP6A 4ZGJB 2F69A 1Q81R 3CCMT 4EMKB 3UWNA 3V8LA 1N8RR 4C8QE 3M0RA 1PSFA 1K8AU 5LJ5f 5FRNA 3VRYA 4CC4B 2MYSA 4L59A 2KK4A 2CZ6B 3C0CA 2GF7A 1FMVA 3OMGA 1K4US 4F7UE 1YI2Q 1Y07A 3O5ZA 2RK1A 4LDUA 2F2XA 1B7TA 1D0XA 2J7IA 3CCQT 1M4ZA 3JB9H 1K9AA 5D6YA 2JUFA 3VS3A 3J80E 1BK2A 3CCUT 1KD1C 1OEBA 3I9QA 2YUQA 4FIBA 3OYDA 4PJOA 4OP0A 1VQ5Q 2VXFA 2B86A 2ZAEA 4AFUC 3MCAB 4JDSA 4C8QF 4QQDA 2O4XA 2HNIA 3UDCA 5GAN2 4R55A 4RTYA 3VS7A 3SB2A 2RK2A 2E12A 2EYQA 4M78A 2VVKA 3G1JA 1PRMC 1AOJA 3RIRA 3RUXA 3THKA 1Q82U 5M9OA 1HYOA 2RMOA 4ME7A 4OF1A 5CVIA 4J9DA 5IAYA 1AWOA 2RJFA 2LQWA 4F17A 1QMCA 2D1XA 3G6EA 5CO7A 5DM7R 1M1KU 2MK5A 1WX6A 1X69A 5KE3A 3QDFA 3RNJA 5CKFA 4KGZB 4CC7A 4C0ZA 1YITQ 2JJ9A 3CC4Q 2BIVA 5J26A 1VYVA 3CMAA 4ANJA 2PTKA 4RTUA 3VS1A 1KC8C 4M7DG 3DLLA 3CC2A 2KT1A 3I55T 3TSZA 4N4GA 1TTHB 3ZFJA 4JZ4A 1V29B 2K57A 2RHIA 3H6ZA 2M9UA 4X1VA 3GIBA 4PJOE 3SFMA 4GBQA 2KXDA 1NLPC 4C8QA 4QVDA 3RDVA 2HAXA 2ENMA 1M3BA 2DAQA 1KHCA 3MEVA 2LT4A 4J9BA 3VKIA 3GF5A 3JV3A 4WTOB 2ZPGB 2RNAA 1MMDA 4Z02A 2DIGA 1M9SA 1WFWA 1BCOA 3G6ET 3FIFA 4MDXA 2ZPEB 4IIOA 2XU8A 2JMAA 4MZMA 3CC7Q 1PC0A 1O9SA 1IZ6A 1VQMA 1BB9A 3JCMJ 1YNZA 1RAIB 2W0ZA 3S6WA 4K11A 4Y92A 3SDZA 1N8RU 2VC8A 1MHNA 3X24B 4J6WA 2LNHB 3P8HA 4DBHA 1PCXA 5J39A 3VS4A 2DKGA 3CQTA 2LCCA 4PJLA 2L8DA 3JB9F 3CC4A 3CCLQ 5GMKl 2FZKB 2DL5A 2E6NA 1UGVA 3M55A 3CC4T 3L2RA 1VQKA 3SHWA 1NLOC 4JS5A 3NHNA 2E10A 4KULA 3P8BB 1NBEB 3V7CA 3VYGA 5DY9A 1NEBA 2DYBA 4OMNA 2HL3A 1S72A 2LCLA 3EGDA 3H0HA 1VQMQ 1QW1A 1SPKA 2DRMA 2IPOB 3BE3A 2ZGWA 2OTJQ 1YIJQ 1G3SA 1QKXA 1G2BA 2EBPA 3QHSA 4PJOD 1MMNA 2EGEA 1MGQA 2M16A 4BI3A 2QXFA 1QVGP 3C94A 2DFUA 1RLQC 1NJIC 2ZPHB 1GCQC 4MMKA 2XKOC 3LW5E 2P0QA 4C92E 3UATA 5FLXE 1D1CA 4C8QB 4M78G 4JJBA 1Q86U 1NZ9A 3ASKA 1SKUB 4DQ2A 3OSVA 3A8GB 1WYXA 2YLCA 3CCQA 4BI8B 3E9FA 1WPYA 2WSFE 4XAXB 1MNEA 3L2ZA 3EHRA 2RB6A 1HXDA 2R57A 3LWIA 2JOYA 1SSHA 2XHCA 3EG9B 4OGCA 4IUUA 1T0JA 1VQ9A 1WXUA 1WHLA 4FYYB 1X01A 5KYWA 5GJWB 4DBFA 4ZGDB 4II1A 2CT4A 1M3AA 2COZA 4RTWA 3KBGA 2QK0A 2EQMA 4E7IA 2X4XA 3I56A 1SHFA 3JAME 5GAMh 4J6YA 3V7RA 5HK0A 4PJOC 4J83A 3G71Q 1RADB 2R58A 5GANf 1YJ9A 3JCMc 3M4YA 2RJEA 2RQWA 5KYXB 2E5QA 1M8MA 5GAMf 1W70A 5GAMe 1D3BA 3OS0A 3MP6A 3ZBDA 1FX7A 2YWWA 1OZ2A 4NS5A 4HA8A 3F70A 4C92C 1QCOA 5A0DA 3UA6A 1TU0B 2GNCA 3EAEA 2A7YA 4QKUA 1OI1A 3M0SA 4OVAA 5A2QE 2L3SA 1NPRA 1D09B 2K5IA 3JCMQ 3PFSA 2NUPB 1BIBA 1M2VA 2RPNA 1UDLA 1H3HA 1QQJA 1V76A 2E41A 2O9VA 2K79A 2LX9A 4BB7A 5CIUA 2EPDA 1U06A 3QPHA 2FG0A 3MEWA 1Y96A 1W2BS 1I1JA 1WDXA 3I56Q 4WCIA 1WXBA 2JT4A 2E3IA 2RJCA 3EFRA 5CCAA 4XTWA 2EIFA 1N5ZA 2E4HA 1NYGA 5IN1A 4E7LA 1JB0E 4JJCA 2DEQA 1W1FA 2HQHA 2V1RA 1IHWA 1G83A 1WI7A 1WLPB 2DL4A 4J9EA 1AZGB 1HJDA 9ATCB 4PJJA 3A5ZB 3CCSQ 1WHMA 2LT1A 1G3TA 1UEBA 2QQ9A 1KQSP 4ELYC 3HFOA 4LE9A 2K4YA 4A4KA 2RHYA 3OS1A 1D3BB 1GCPA 2LJ1A 3ER0A 4EMHA 1OX8A 4LN2A 1ZA2B 2JXBA 2L3PA 3QBYA 1LJOA 1UUEA 3VUBA 1VQOA 1LVKA 4ORZA 3QDRB 2DILA 3D7SB 1W4SA 3EH2A 3PIOA 3OW2A 1YITA 2FZCB 2AZVA 4M78F 1M1KC 1C6VX 1PD1A 1S72T 1YFNA 1UGPB 3MKDA 4MMLA 1MUZA 2DMOA 2DBMA 2QGGA 4LDXA 1K0SA 3VRZA 2MF2A 5LJ3g 1FXXA 1ZSGA 2V8KA 4EMKA 4PK4A 1GBQA 3PMTA 2X4YA 2J05A 2ZPBB 1GRIA 3VU3C 1VQ8Q 4FCYA 1W6XA 2OI3A 2YRDA 1JBMA 1AEYA 5L23A 3JCMP 2EGCA 3WXMB 2OTLQ 4A53A 4RTVA 4AFSC 2FRWA 2CP5A 3GPLA 2FPFA 1QWEA 5GAMg 1J3TA 2EQUA 2YSQA 4R0KA 3JCMg 2DXCA 1KD1U 3CC7A 4JRPA 3CPWS 2P4TA 4FL6A 1VQ8T 4MZTA 2QQRA 3OS5A 2DF6A 5DLOA 2PVDB 3M0UA 2O4XB 1K76A 4LDYA 1IRXA 5KYWB 3VS5A 2X4JA 2FB7A 2KRSA 3INZA 2V1QA 2CS7A 4M7AB 2Z0WA 4BDYA 1YHQA 1E6GA 5GAMj 3FLGA 4KT0E 1R8OB 1KD1R 4ZTJA 1K73C 3CCLA 4M77F 2V8JA 3X20B 3CMEQ 3QUIA 1TUGB 3G7ZA 2B8AA 2W10A 1YWOA 4DBRA 1KG1A 2L3QA 4LXCA 4ZNXA 1I07A 2XDBA 3CD6A 2CT3A 2NWMA 1RAAB 2OX7A 2ZCFB 2LNVA 3ZEHA 2D0QB 1M1GA 1IHVA 3V8KA 4M77B 3NGPA 2ZPFB 4XTVA 2DL7A 1UHFA 1X2KA 1Q82R 3L2UA 1ZSZC 4IUQA 1WIEA 3MPUB 3H9NA 3OW2S 3EH1A 3JRZA 3CMAT 3VS0A 4M7DE 3RKWA 3SWNA 1Y96B 1T3SA 4J9CA 2ED1A 4PFPA 2RN8A 2CKKA 5EG2A 3WVDB 1I0CA 4RG8A 3OB9A 1B3QA 1RI0A 3OYAA 1EFNA 3VYHB 4EIKA 3A98A 3UF4A 4UC4A 3JB9J 2M1HA 2V26A 2EQKA 5FW9A 1ZLMA 5GMKj 2K2MA 3J81E 4VUBA 1BCMA 1X6OA 3H0IA 4RCCA 3CCUQ 4LNPA 1SEMA 4N0AA 3CPWA 4X9CA 5KYYA 3VJPA 1LCKA 4D6WA 3QZ5B 2O88A 2QQBA 4M75B 2DL8A 4OMFB 4RKUE 1I81A 2CGHA 4C5EA 2BZ8A 2X35A 1TXQA 5CK9A 5GANh 5IH2A 2DERA 1JJ2A 4C92F 4KRTA 1SSFA 1AWXA 1WQ7A 3UA7A 2C06A 2M0YA 3HRUA 3JCMf 4LDWA 1PKTA 5GANg 4Q5WA 5HY6A 5A0LA 1AHJB 1Q82C 1KHIA 3LH0A 3JCMb 5CAIA 5D7UA 1OYXA 2GQIA 1VQLQ 4Z88A 3S3NA 1QP2A 4RG2A 1YHQQ 4J7FA 4M7AE 3HPWA 2J6OA 1H641 2G6FX 5FU7B 3CCEQ 1KK7A 2F1LA 1BI1A 1KQSS 4C92B 5FROA 2D0NA 5EC7A 1AD5A 1ZBJA 5I21A 1GFDA 1VQKT 4A4EA 1MMGA 2DLPA 2KYMA 2JTMA 3HFNA 3U23A 3FC3A 2KR3A 4LUDA 2DJQA 2YT6A 4JRKA 3Q1JA 5CKBA 5L8RE 2MWOA 3HL8A 5LJ5g 5GAOm 3VV0A 2K9GA 4PFZA 1UGQB 2HBPA 3NTIA 2DX1A 3PGGA 3CD6Q 4M78D 3M59A 2ZZDA 4DEXA 3SWNC 2GGRA 1MV0B 1VOMA 3TVTA 5LJ5h 1OPLA 2MMPA 2VGMA 4LUEA 1ZUKA 1U8RA 1IB8A 2DIQA 3JSCA 1WZOA 5CKHA 1ABOA 1PD0A 1C0MA 2KSSA 3GP8A 1SF9A 1K8AC 2KYBA 2QQAA 5J3BA 3JCMW 1UE9A 2HQXA 1VQNA 2CDTA 2K5LA 3QKJA 1W2BA 2EAYA 2J6FA 4C8QG 3CCLT 3CCJA 1WJRA 3ME9A 2KQWA 1CKBA 3M53A 2QAZA 5GMKi 3RERA 3CPFA 3R6NA 3CCRA 4E7HA 1VQOQ 2LZ6B 2PUKB 2O2OA 1FMWA 2XICA 2BE7D 4C5GA 2OTJT 2KY9A 1OOTA 3M9QA 4PNOA 1G3YA 1YJWA 2DL3A 4FSSA 2QQSA 3REBB 1R77A 1BI3A 4PL6A 2DM1A 1YP5A 1M2VB 3EFOB 2KAFA 2FL7A 2MCNA 3QSUA 1B07A 4F14A 1OZ3A 1PSEA 1Y0MA 1NYFA 5GAN7 8ATCB 2DO3A 3L1AA 3G71A 3FEOA 1QLYA 1QVFA 3G6EQ 1M8VA 2DJZA 4RTZA 3MP8A 5GAN8 5KCOA 1RLPC 2GTJA 4BD3A 2F2VA 1S1NA 2DNUA 3DB4A 5LL6S 2JS0A 3TSWA 1ZA1B 4KBMB 1Y57A 3CCJQ 2X51A 2DXBA 5D6WA 1VQ7A 4M7DF 4Y91A 4EMGA 3LWHA 5IT9E 5LJ3d 1WHKA 2YDLA 1QP3A 4PJMA 1LNXA 1VQ9T 2LQNA 5GANj 2EJ9A 5IHKA 2KT8A 2MOXA 3KXTA 4B9XA 3HTRA 1BKBA 2KRMA 2VUBA 4OB1B 2WSCE 5IXFA 3HRTA 4FYXB 2OJ2A 2QGFB 3EGUA 5CR2A 4F7UA 2EKHA 5GANe 1N8RC 2BZYA 3DKMA 1XTDA 2ROTA 2WSEE 3C12A 3ZL7C 4ZN1A 3CBOA 3V7SA 2F5TX 4BI4A 1JU5C 2LTOA 1UFFA 3M0TA 2LDMA 2VASA 3OYGA 2ATCB 4C5IA 2FPDA 2ECZA 4J9FA 4CRIA 1WQWA 1Q7YC 1TUDA 1WXTA 1QKWA 2RO0A 4OMQA 4M75F 1QVGS 2J06A 1AWWA 2LVMA 2A36A 4HT8A 3EFOA 3REAB 5D6XA 3QJ6A 2BE9B 1TSFA 4Z8AA 3MEAA 2XI9A 2QA4T 4IUPA 3E2UA 2KI7A 2D6FA 1D0YA 2DTHA 1WGSA 2CUDA 2KGTA 2QTVA 3X26B 5I22A 1TOVA 3CC2Q 1SG5A 5LJ3f 1M27C 4OMMA 5FU6B 3CCQQ 3FB9A 1CSKA 2PUOB 2PQWA 4OMLA 1TH7A 1NPPA 3QJYA 2KRNA 1VQ6T 1ZHIA 1GBRA 1BBZA 4M78C 2JM9A 1YJNT 4FSXA 5KYUB 4KH1B 4F7UG 1QVPA 4XTYA 2H3JA 1VYUA 5IHNA 3I35A 3META 2CSQA 4F7UB 1ZSZA 2CUBA 1P92A 4C0DC 1ZX6A 5CKEA 3CCET 3PT9A 2VYTA 3QO3A 2Y90A 2QG9B 5CQYA 3GNFB 3GNGA 4M7DD 4E7KA 1VQNT 3OA6A 2YUOA 1D0ZA 1PHTA 2KNBB 1YWPA 2HCKA 1E6HA 2GBQA 1IO6A 3UT1A 3M4GA 2K3BA 2LJ3A 3G4ST 3NTKA 2OTJA 2HMAA 1K1ZA 2NYSA 4M7AF 4D8KA 2DXTA 2LP5A 5A0GA 4OMPA 3C4SA 1MNDA 2HKNA 4XU2A 4YTLA 2NUTA 1ZUUA 1X2QA 3L42A 1RAHB 1X27A 4QVZA 4CC3A 2JW4A 1ZUYA 1RAEB 3CCJT 1OULA 3CBMA 1ARKA 3CCMA 1MV3A 3SWNB 3LH5A 2CP3A 4BDZA 1VQ8A 4ESRA 3SEMA 4EMKC 4JRIA 3OYNA 2X3WD 3OQ5A 2OAUA 3HRSA 3H8ZA 2LX7A 3CCVT 4CI0C 4IKFA 1ABQA 2EFIA 4QVCA 5GAMd 4C5HA 2KXCA 1G3WA 1BIAA 2FHDA 4C92D 4Y28E 1FMKA 3EG9A 2QASA 1JRIA 4M7AD 5IHIA 3GOXA 2IG0A 1Z9ZA 4XK8E 2GFUA 1QVGA 1U3OA 3E19A 3CMAQ 3CCVQ 3JCMV 3JB9I 1ZSZB 4GLMA 1FWZA 1YJ9Q 1VQPA 4XTXA 4JZ3A 2V8IA 1VA7A 4E6RA 3EG3A 4E7JA 1U1TA 4JJNK 4M75E 5I2SA 2E64A 3CCEA 3A8OB 2K6DA 4M78B 4BE2A 1Z9QA 2NUZA 3CEYA 3E1SA 3JCMd 1A0NB 4J9IA 1BI0A 2L89A 1YN8A 4AFZC 4BY6B 1OU9A 2JVVA 1H3ZA 1K9MC 1X43A 4FW1A 5FWCA 3EG1A 1VQ4Q 2DTIA 2WACA 3CMET 1OPKA 5FU6C 1MMAA 1PM3A 3FRNA 2E3HA 2RQRA 1UG1A 4KGXB 3A8LB 4DBQA 4WF2A 1LPLA 5GAOn 3MJXA 1D1BA 3J7AF 3JCMh 5HCKA 2NUTB 4B9WA 4LD9K 4F16A 2A0FB 3HKSA 3HP9A 3N5BB 2XMFA 4OB0B 1VQOT 1N27A 2P0PA 2LQ8A 2RI2A 4FT2A 2DD4A 2YLBA 2K5FA 3OYYA 3HHTB 2RQUA 4F7UF 2KVQG 3NPFA 3QIIA 4V2SA 3QG1A 2EYZA 4M77E 2X9HA 2GCXA 1U5SA 4BY6C 1TS9A 1JEGA 2C0OA 4FU6A 1QCFA 2BUDA 2ZPIB 3I5RA 1UTIA 2RI5A 4Z89A 2CP2A 4A54A 2KEAA 1VUBA 4AT1B 2G3RA 1EZZB 1TG0A 1RL2A 1HD3A 3I55Q 1XOVA 3OBWA 4JLIA 4M75D 1KIKA 4HCCA 3OYMA 1PG5B 1JXOA 2DA9A 2VV5A 1JXMA 3MHXA 1YI2T 1DJ7B 3QXEB 4NOYA 1K9MR 1RAFB 2PU9B 4D8DA 2RQTA 1E7OA 1VIFA 3G4SQ 2KE9A 2HZYA 4O5VA 1JJ2S 1VQPQ 1VQ7T 3H41A 4ZTFA 2O01E 4M7AG 3TQ7P 2DRKA 3M54A 3G4SA 1IGUA 2QA4Q 3I56T 3CCMQ 1VQ4A 4PFOA 1UGSB 2RM4A 3LGFA 4IUVA 4FYWB 2YRCA 4IIMA 4DEYA 2EGAA 2QYZA 2H3EB 4B6MA 1KSWA 1Y71A 5KE2A 3MO8A 4LD6A 1YHQT 1UGRB 2IIMA 4TVRA 1Q7YU 1H8KA 3TREA 1KQSA 1G8XA 1M30A 3M0PA 5I2MA 2RA2A 4O6JA 3EGDB 2FVUA 3KUFA 5GJVB 4ZN3A 1RI9A 2SEMA 4FW2A 2A3LA 2HKQB 2DYIA 1RAGB 1LOJA 1Q81C 4JUVA 2VWFA 4PKCC 1SRLA 1K0XA 3CCRT 2QTXA 3RBBB 3OYEA 1TUCA 2M0OA 2EYYA 2YRVA 3I55A 4M77G 2E1HA 5LJ5e 1YBYA 4HVWA 3EG0A 1I4K1 1B34A 3L2QA 2AT1B 5KCHA 4RTXA 3CD6T 1Q95G 1F1BB 4EDUA 2CP0A 2K2VA 1O75A 4DOVA 2MWPA 1HSQA 3FJPA 3OSSC 1UJYA 1VQPT 2EW3A 2M02A 1OV3A 3JCMe 1VQ9Q 2HEQA 2CP7A 4JRQA 2A08A 2CZ7B 2VXEA 3JB9G 2DD5A 2JS2A 4A4FA 2VKNA 2HL5C 2O31A 3X25B 4XTUA 2F5KA 4L5GA 5GAOp 2JTEA 2L5QA 4E7SA 1VQKQ 2XG8D 4M7AA 2Y4YA 2LMJA 4C8QD 3CCRQ 2JNGA 5LJ5j 5LJ3e 4HXJA 3PMIA 2EWNA 4JJDA 1VQ5A 3EHQA 1YIJA 3CBPA 1ZQ1A 3LX7A 1WHJA 2LRQA 2GFAA 3I5SA 4HKEA 4HCKA 1S72Q 3H0FA 2ROLA 2MPXC 1JO8A 3FDRA 1RABB 1N9RA 1WJQA 2DVEA 3OYCA 3URGA 4E7ZA 2R5MA 4M77A 3EFSA 4X9DA 2Y4XA 1VQ7Q 2E5KA 2PVOB 4C92G 1KC8U 1QWFA 2NUPA 2QEXT 1WA7A 5CKDA 1N9SA 3PVQA 1SHGA 2DPPB 3EG2A 3L2VA 4MDWA 2JN0A 2X4WA 1FYNA 2J6KA 1NJIR 3WVEB 2D8JA 4KH0B 2RF0A 3LLRA 3BFMA 1V1CA 2EQIA 1I5LA 4DOWA 3PE0A 2CH4W 2COWA 3A8MB 2I0NA 4M75C 3EGXB 3CMEA 5GAN6 1NEGA 5FU7C 3P8DA 1YJWQ 4XTZA 4J6XA 2HD0A 5GAN4 3NMZC 2O9SA 3VS2A 4BE1A 1X75C 1RUWA 3OW2P 2VGNA 3IQLA 3KFVA 1K9MU 3CC7T 2RHXA 3QYHB 3CCVA 3FJ5A 3TCJA 1T0HA 3QWYA 1GCQA 4CC2A 2NLUA 3PVLA 2HDAA 4M75A 4N4IA 5GMKh 4E47A 2AK5A 2GQVA 2RH2A 3JB9D 3OYBA 1UJ0A 2DE0X 1AT1B 2FZGB 1UB4A 2QDYB 5HK3A 1VQLT 2JTFA 4QW2A 4BE0A 3NFCA 5LJ3j 2KMTA 1KC8R 2D8HA 2A28A 2EVRA 2E6ZA 3DLMA 2YXYA 4C0DB 3PIPA 3UPUA 1PNJA 4M4ZA 1Q86C 3PNWC 4M77C 3QWXX 4FYVB 4EPCA 3X28B 2ABLA 4OMOA 1YITT
chains in the Genus database with same CATH topology
3C4SA 3ZEHA 2D0QB 4XU2A 4YTLA 1M1GA 2XIDA 3OS2A 1KC8C 3V8KA 4M7DG 3DLLA 3CC2A 3L42A 4M77B 3I55T 4QVZA 3CCUA 2ZPFB 4N4GA 1I8FA 4XTVA 3ZFJA 3BW1A 1V29B 3L2UA 2K57A 2LC4A 2RHIA 4IUQA 3CCJT 3CBMA 3CCMA 5FRMA 3SWNB 3H6ZA 2M9UA 4JS4A 4BDZA 1VQ8A 3GIBA 3OW2S 3JRZA 4HT9A 4EMKC 4JRIA 4PJOE 3SFMA 3OYNA 3CMAT 4C8QA 4M7DE 3RKWA 3SWNA 4QVDA 3OQ5A 2HAXA 1YJWT 3RKYA 2DAQA 1KHCA 1B34B 1Y96B 2OAUA 2LT4A 3A8HB 3MEVA 3HRSA 3H8ZA 3VKIA 3PTAA 3GF5A 3CCVT 4CI0C 4IKFA 2ZPGB 2EFIA 4QVCA 5GAMd 4MZPA 4C5HA 2CKKA 1G3WA 1BIAA 2FHDA 4Z02A 4C92D 2DIGA 4Y28E 5EG2A 2DXUA 1JRIA 1M9SA 3G6ET 3FIFA 4MDXA 2XD0A 2ZPEB 3GOXA 3WVDB 4M7AD 4GLKA 4XU3A 2E70A 2IG0A 4QQ6A 2XU8A 4RG8A 3OB9A 4MZMA 4XK8E 1O9SA 3CCST 1IZ6A 2GFUA 1RI0A 4BUGA 1VQMA 4M7AC 3OYAA 5I21A 5GMKm 3JCMJ 1QVGA 3E19A 3T9NA 3VYHB 3S6WA 3JCMV 3JB9I 4M77D 4UC4A 3JB9J 2CZ1B 2M1HA 4C8QC 1WNLA 3SDZA 1VQ5T 1N8RU 2VC8A 1MHNA 1FWZA 2EQKA 1VQPA 4XTXA 3X24B 4J6WA 5GMKj 3BDUA 3J81E 2OTLT 4VUBA 2V8IA 1X6OA 4RCCA 3P8HA 4E7JA 1Y7XA 1U1TA 2LQKA 3LGLA 4N0AA 5J39A 3CPWA 4JJNK 3S3MA 4M78E 4M75E 4QQGA 4X9CA 5I2SA 3VJPA 2E64A 3CCEA 2DKGA 2EJGA 4D6WA 3A8OB 3QZ5B 2LCCA 5LJ3h 2QQBA 2L8DA 4M75B 4J7IA 4M78B 4BE2A 1VQ6A 4OMFB 3JB9F 4RKUE 1I81A 3CC4A 2CGHA 3CEYA 3E1SA 3JCMd 4C5EA 1YIJT 5GMKl 4RMOA 1BI0A 2L89A 3M56A 2E6NA 2X35A 2QI2A 4BY6B 5CK9A 5GANh 2JVVA 3M55A 1H3ZA 3CC4T 1JJ2A 2YHTA 4C92F 3L2RA 2QA4A 1K9MC 1VQKA 1SSFA 4JS5A 2E10A 3S3OA 4KULA 3P8BB 2DTIA 2WACA 3CMET 1WQ7A 2L3RA 3V7CA 3VYGA 2C06A 5FU6C 3HRUA 3JCMf 5DY9A 3HSBA 4LDWA 3FRNA 1EIFA 3L2WA 4X34A 5GANg 3A8LB 4Q5WA 4ELZC 5HY6A 4WF2A 3JCMX 1S72A 5GAOn 2R5AA 2LCLA 5A0LA 3J7AF 1AHJB 3JCMh 1QW1A 4BACA 4M7DA 3C95A 1KHIA 3LH0A 3JCMb 4B9WA 1Q82C 5CAIA 4LD9K 3HKSA 3HP9A 5GANd 1XQHA 2ZGWA 1OYXA 2XDDA 1G3SA 3N5BB 3QHSA 4PJOD 4OB0B 3S3NA 2OTLA 1N6AA 1QP2A 4RG2A 1VQOT 2PVGB 1N27A 2P0PA 1MGQA 4J7FA 4M7AE 3HPWA 1G5VA 1H641 2M16A 5FU7B 3RMQA 2LQ8A 2RI2A 4FT2A 4PJOF 2QXFA 4BI3A 1BI1A 2DD4A 3C94A 2YLBA 4C92B 1KQSS 2XDPA 1NJIC 4HCBA 2K5FA 2ZPHB 3OYYA 3HHTB 5FROA 4F7UF 2KVQG 2XKOC 4MMKA 3RMSA 3LW5E 2P0QA 3QIIA 4C92E 5FLXE 3QG1A 4V2SA 2MI6A 4C8QB 1NJIU 4M75G 3QZ9B 4M78G 1Q86U 1NZ9A 4A4EA 4M77E 3M5AA 1VQKT 3ASKA 2EJFA 2GCXA 1BI2A 1YJ9T 5GAN3 2FYKA 2IVWA 4DQ2A 2JTMA 3HFNA 3A8GB 2XK0A 3OSVA 4BY6C 3OYFA 5LJ5d 2YLCA 4FU6A 4PLIA 3FC3A 2ZPIB 2BUDA 3CCQA 4BI8B 3E9FA 1WPYA 2EKOA 2WSFE 4XAXB 3L2ZA 2RI5A 3GLXA 2RB6A 4JRKA 1HXDA 2R57A 4A54A 3LWIA 2JOYA 3Q1JA 3G71T 5CKBA 5L8RE 2EQJA 2MWOA 2XHCA 3HL8A 1VUBA 5LJ5g 3OYKA 4OGCA 3NTHA 2G3RA 1M1FA 1RL2A 5GAOm 4IUUA 3VV0A 4OB3B 1UGQB 2HBPA 1VQ9A 1XOVA 3NTIA 3PGGA 3RKXA 3OBWA 4JLIA 4M75D 4M78D 4HCCA 1X01A 3DB3A 4J5YA 3OYMA 5GAOr 4ZGDB 3M59A 2ZZDA 1BYMA 2VV5A 4II1A 2QEXA 3OYIA 3MHXA 3KBGA 1YI2T 1DJ7B 3QXEB 3SWNC 4NL3A 1VQLA 1ZBXA 2EQMA 4E7IA 2X4XA 5LJ5h 3OYJA 3I56A 4NOYA 3CC2T 1VQMT 2MMPA 2MAMA 2VGMA 3BY7A 4IURA 3JAME 5GAMh 4J6YA 3V7RA 1U8RA 3JSCA 2DIQA 2PU9B 4GY5A 5HK0A 4PJOC 1VIFA 5CKHA 4A4GA 4J83A 4LDVA 2HQEA 4JLGA 4O5VA 2KSSA 1JJ2S 3GP8A 2R58A 3LYIA 5GANf 1YJ9A 3JCMc 1K8AC 1VQ7T 3M4YA 4ZTFA 2RJDA 2RJEA 2D9TA 2O01E 4M7AG 3M54A 2RHZA 1M90C 2E5QA 2QQAA 5GAMf 1M5Q1 3M58A 2I2LA 3G4SA 5J3BA 3JCMW 3I56T 5GAMe 1VIEA 1D3BA 1VQ4A 4XU0A 3M57A 3OS0A 1YI2A 2HQXA 1UGSB 3MP6A 4HCZA 1VQNA 2K5LA 3ZBDA 3QKJA 2RM4A 1FX7A 5CQXA 1OZ2A 4NS5A 1W2BA 3LGFA 2EAYA 4IUVA 4HA8A 4C8QG 3F70A 4C92C 3CCLT 5KH6A 3CCJA 3E9GA 1WJRA 3ME9A 2KQWA 5HKCA 4L6V5 3M53A 5A0DA 2P0KA 5GMKi 3RERA 3CPFA 1Y71A 5KE2A 3MO8A 5C6SA 4LD6A 3CCRA 4E7HA 1YHQT 4C0FA 4N0AC 1UGRB 2PUKB 2DZ9A 2RI3A 3TU4K 2XICA 4TVRA 4C5GA 2JZ2A 2OTJT 1Q7YU 2KY9A 3EAEA 3TREA 2A7YA 4M7DB 1KQSA 4IUTA 3M9QA 4PNOA 1G3YA 1OI1A 5I2MA 1YJWA 2RA2A 2QQSA 4PL6A 1BI3A 4OVAA 5C0MA 4O6JA 5GAOq 3V8JA 5A2QE 2FVUA 1NE8A 1NPRA 4KUIA 3BDLA 2KAFA 2K5IA 3KUFA 4ZGEB 2FL7A 4ZN3A 3QSUA 3JCMQ 1OZ3A 1PSEA 3PFSA 1BIBA 5GAN7 2A3LA 1Q81C 1LOJA 4JUVA 4PKCC 3CCRT 2QTXA 2DO3A 3L1AA 3G71A 2E41A 3OYEA 4XU1A 1VQ4T 2LX9A 3FEOA 2M0OA 2YRVA 4BB7A 3OYHA 3I55A 1QVFA 1M8VA 4M77G 5CIUA 2E1HA 5LJ5e 4C92A 2DJZA 1YBYA 3RESA 3MP8A 5GAN8 2K3YA 3QPHA 5KCOA 4DA4A 1I4K1 4XQ3A 2KDSA 4ATOA 4BD3A 3MEWA 1B34A 1Y96A 3L2QA 3DB4A 3O8VA 1U1SA 1W2BS 5LL6S 1WJSA 5KCHA 5GMKe 2AHJB 3CD6T 4M7DC 4EDUA 3QYGB 4A4HA 2K2VA 1O75A 2RHUA 2E65A 4DOVA 2MWPA 4KBMB 3FJPA 3OSSC 2RJCA 4N4HA 4NL2A 1IREB 3EFRA 1VQPT 5CCAA 3JCMe 2DXBA 4JRQA 5D6WA 2CZ7B 4FT4A 1VQ7A 2VXEA 3SD4A 4XTWA 4M7DF 3JB9G 4Y91A 2EIFA 3VUZA 2DD5A 4EMGA 3LWHA 5IN1A 4A4FA 5IT9E 5LJ3d 1JB0E 4FM4B 1QP3A 4E7LA 2DEQA 3OMCA 1LNXA 4PLLA 1VQ9T 1GXIE 3CCSA 5GANj 2EJ9A 3X25B 3TEEA 5GAN5 1HK9A 4XTUA 3KXTA 2F5KA 4PJOB 4L5GA 4B9XA 4OGEA 5GAOp 1BKBA 2L5QA 3AHUA 2VUBA 4R56A 5DLQE 4OB1B 2WSCE 4KUDK 2XG8D 3A5ZB 3HRTA 5AYFA 3MP1A 3CXCA 3OY9A 4M7AA 1XNIA 2LT1A 5CR2A 1G3TA 2DTOA 2Y4YA 4OB2B 1KQ1A 4F7UA 1UEBA 2QQ9A 1YCYA 4C8QD 2JNGA 4ELYC 1Q81U 3OBYA 5GANe 1N8RC 1M90U 3DKMA 1XTDA 3HFOA 5LJ5j 2K3XA 2K4YA 4A4KA 5LJ3e 3OYLA 2RHYA 3OS1A 1D3BB 4J8OA 2DK3A 3ER0A 3PMIA 4EMHA 2WSEE 3C12A 2EWNA 1VQ5A 4ZN1A 1YIJA 3CBOA 3CBPA 1ZQ1A 3V7SA 3QBYA 2F5TX 1QVFS 3LX7A 4BI4A 1LJOA 3VUBA 2LTOA 1VQOA 4PJOG 2LDMA 2CZ0B 4RCBA 3OYGA 2LRQA 2GFAA 4HKEA 4C5IA 3QDRB 4CRIA 1WQWA 3MEUA 1YJNA 1Q7YC 1W4SA 3PIOA 5GAOl 3OW2A 1KQ2A 1YITA 2CYZB 2RO0A 2DZCA 4M75F 4M78F 3R6OA 1QVGS 1M1KC 1S72T 4C0GA 2RD1A 1UGPB 3CXCS 4MMLA 3FDRA 2LVMA 2BKDN 4LDXA 1N9RA 4P5NA 1WJQA 2MF2A 4HT8A 5LJ3g 1K73U 1FXXA 2DVEA 3OYCA 5D6XA 3QJ6A 4ZGJB 3URGA 2R5MA 2V8KA 4EMKA 4M77A 2F69A 3MEAA 3CCMT 2XI9A 3EFSA 2QA4T 4X9DA 2Y4XA 3PMTA 2X4YA 4IUPA 4EMKB 2ZPBB 3UWNA 3VU3C 2PVOB 4C92G 3V8LA 1KC8U 2DTHA 4C8QE 2D6FA 1JBMA 1WGSA 2QEXT 5CKDA 3JCMP 1N9SA 3WXMB 1PSFA 1K8AU 5LJ5f 3X26B 5FRNA 4A53A 2DPPB 5LJ3f 5FU6B 4L59A 3L2VA 4MDWA 2JN0A 2KK4A 2X4WA 3FB9A 3GPLA 2CZ6B 3WVEB 5GAMg 2GF7A 2EQUA 3OMGA 4F7UE 1Y07A 3LLRA 3BFMA 2RK1A 2PUOB 2PQWA 1TH7A 4LDUA 3JCMg 1NPPA 3QJYA 1I5LA 4DOWA 2DXCA 1KD1U 1VQ6T 3CCQT 1ZHIA 1M4ZA 3JB9H 5D6YA 2JUFA 3J80E 3CC7A 4JRPA 3A8MB 4M78C 4M75C 3CCUT 1KD1C 3CMEA 5GAN6 1YJNT 3CPWS 2P4TA 4FIBA 3OYDA 4FL6A 4FSXA 4PJOA 1VQ8T 5FU7C 3P8DA 4MZTA 2QQRA 3OS5A 4OP0A 5DLOA 2PVDB 2VXFA 4XTZA 4J6XA 2HD0A 4F7UG 1QVPA 5GAN4 2O4XB 4BE1A 1X75C 3MCAB 2H3JA 4XTYA 4JDSA 4C8QF 4LDYA 4QQDA 2O4XA 2VGNA 3META 1K9MU 3CC7T 2X4JA 4F7UB 2FB7A 2HNIA 3UDCA 3INZA 5GAN2 2RHXA 4R55A 1P92A 2RK2A 3QYHB 3SB2A 4C0DC 3CCVA 3TCJA 2CS7A 5CKEA 2E12A 4M7AB 3CCET 3PT9A 4BDYA 1YHQA 2NLUA 2EYQA 2VYTA 3QO3A 4M75A 4M78A 4N4IA 2Y90A 5GMKh 4E47A 5CQYA 2GQVA 2RH2A 3JB9D 3OYBA 3GNFB 3RIRA 3RUXA 1Q82U 5GAMj 2QDYB 3GNGA 1UB4A 3FLGA 5M9OA 4M7DD 4E7KA 4ME7A 5CVIA 5HK3A 4KT0E 4OF1A 1VQLT 1R8OB 2JTFA 3OA6A 1VQNT 4QW2A 4BE0A 5IAYA 3NFCA 5LJ3j 2RJFA 2KMTA 4ZTJA 1K73C 3CCLA 2E6ZA 3DLMA 4M77F 2V8JA 3X20B 3G6EA 5CO7A 5DM7R 1M1KU 4C0DB 3UT1A 3M4GA 3QUIA 3PIPA 3G7ZA 2B8AA 5KE3A 3NTKA 3G4ST 3UPUA 2OTJA 5CKFA 1KG1A 4C0ZA 1Q86C 3PNWC 4M77C 4M7AF 4EPCA 3X28B 2XDBA 3CD6A 2BIVA 5J26A 3CMAA 1YITT 2ZCFB 2DXTA 2LNVA 5A0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4S A;  3ZEH A;  4YTL A;  1M1G A;  1KC8 C;  3OS2 A;  3DLL A;  3CC2 A;  3L42 A;  3I55 T;  4QVZ A;  3CCU A;  4N4G A;  3L2U A;  2RHI A;  3CCJ T;  4IUQ A;  3CCM A;  5FRM A;  3H6Z A;  1VQ8 A;  4BDZ A;  3OW2 S;  3OYN A;  3CMA T;  3OQ5 A;  1YJW T;  2DAQ A;  1KHC A;  3MEV A;  3H8Z A;  3CCV T;  4IKF A;  2EFI A;  4C5H A;  2CKK A;  4Z02 A;  2FHD A;  2DIG A;  3G6E T;  3GOX A;  2E70 A;  2IG0 A;  4QQ6 A;  3OB9 A;  3CCS T;  1IZ6 A;  2GFU A;  1RI0 A;  1VQM A;  3OYA A;  1QVG A;  3S6W A;  4UC4 A;  1VQ5 T;  2M1H A;  1N8R U;  1MHN A;  2EQK A;  1VQP A;  3J81 E;  2OTL T;  1X6O A;  3P8H A;  4E7J A;  3CPW A;  3LGL A;  5J39 A;  3S3M A;  4QQG A;  3CCE A;  2LCC A;  2L8D A;  4BE2 A;  1VQ6 A;  3CC4 A;  3CEY A;  4C5E A;  1YIJ T;  2L89 A;  2E6N A;  2X35 A;  2JVV A;  1H3Z A;  3CC4 T;  1JJ2 A;  3L2R A;  1VQK A;  2QA4 A;  1K9M C;  1SSF A;  3S3O A;  3P8B B;  2WAC A;  3CME T;  2L3R A;  1EIF A;  3L2W A;  4X34 A;  4Q5W A;  5HY6 A;  1S72 A;  2R5A A;  2LCL A;  3J7A F;  4BAC A;  1Q82 C;  1KHI A;  3LH0 A;  4B9W A;  3HKS A;  1OYX A;  2OTL A;  3S3N A;  4RG2 A;  1VQO T;  1N27 A;  1G5V A;  2M16 A;  2LQ8 A;  2RI2 A;  1KQS S;  1NJI C;  2XDP A;  5FRO A;  3OYY A;  2KVQ G;  5FLX E;  3QII A;  2MI6 A;  1NJI U;  1Q86 U;  1NZ9 A;  1VQK T;  4A4E A;  3ASK A;  1YJ9 T;  2XK0 A;  3OYF A;  3CCQ A;  4FU6 A;  4PLI A;  3FC3 A;  2BUD A;  3E9F A;  2EKO A;  2RI5 A;  2R57 A;  3G71 T;  2JOY A;  3Q1J A;  2EQJ A;  2MWO A;  2XHC A;  3OYK A;  3NTH A;  2G3R A;  1RL2 A;  4IUU A;  1VQ9 A;  3NTI A;  3DB3 A;  3OYM A;  4II1 A;  2QEX A;  3OYI A;  3KBG A;  1YI2 T;  1VQL A;  2EQM A;  4E7I A;  2X4X A;  3I56 A;  3OYJ A;  3CC2 T;  1VQM T;  4IUR A;  3JAM E;  2DIQ A;  4GY5 A;  4A4G A;  2HQE A;  1JJ2 S;  2R58 A;  1VQ7 T;  1K8A C;  1YJ9 A;  3LYI A;  4ZTF A;  2RJD A;  2RJE A;  2D9T A;  2RHZ A;  1M90 C;  2E5Q A;  3G4S A;  5J3B A;  3I56 T;  1VQ4 A;  3OS0 A;  1YI2 A;  4HCZ A;  1VQN A;  2HQX A;  3MP6 A;  3QKJ A;  1W2B A;  1OZ2 A;  4NS5 A;  3LGF A;  4IUV A;  3CCL T;  3F70 A;  5KH6 A;  3CCJ A;  3E9G A;  1WJR A;  3ME9 A;  2P0K A;  3CPF A;  5KE2 A;  3MO8 A;  5C6S A;  1YHQ T;  3CCR A;  4LD6 A;  4E7H A;  2RI3 A;  4TVR A;  4C5G A;  2JZ2 A;  2OTJ T;  1Q7Y U;  3EAE A;  3TRE A;  1KQS A;  4IUT A;  3M9Q A;  1OI1 A;  1YJW A;  2QQS A;  4PL6 A;  4OVA A;  5C0M A;  5A2Q E;  1NPR A;  3BDL A;  3KUF A;  4ZN3 A;  1OZ3 A;  3PFS A;  1Q81 C;  3CCR T;  2DO3 A;  3G71 A;  3OYE A;  1VQ4 T;  3FEO A;  3I55 A;  2M0O A;  2YRV A;  3OYH A;  1QVF A;  5CIU A;  1YBY A;  3MP8 A;  2K3Y A;  5KCO A;  2KDS A;  4BD3 A;  3MEW A;  3L2Q A;  3DB4 A;  1W2B S;  3O8V A;  5LL6 S;  1WJS A;  5KCH A;  3CD6 T;  4EDU A;  4A4H A;  2RHU A;  2MWP A;  2RJC A;  4N4H A;  1VQP T;  1VQ7 A;  5D6W A;  3SD4 A;  2EIF A;  5IN1 A;  5IT9 E;  4A4F A;  4E7L A;  3OMC A;  4PLL A;  1VQ9 T;  3CCS A;  2F5K A;  4B9X A;  1BKB A;  5DLQ E;  3A5Z B;  3MP1 A;  3CXC A;  3OY9 A;  1XNI A;  1UEB A;  2JNG A;  1Q81 U;  1N8R C;  1M90 U;  1XTD A;  2K3X A;  3OYL A;  2RHY A;  3OS1 A;  3ER0 A;  3PMI A;  1VQ5 A;  4ZN1 A;  1YIJ A;  1QVF S;  3QBY A;  3LX7 A;  1VQO A;  2LTO A;  2LDM A;  3OYG A;  2LRQ A;  2GFA A;  4C5I A;  4CRI A;  3MEU A;  1YJN A;  1Q7Y C;  3PIO A;  3OW2 A;  1YIT A;  2RO0 A;  1QVG S;  1M1K C;  1S72 T;  3CXC S;  3FDR A;  2LVM A;  2BKD N;  1WJQ A;  1K73 U;  3OYC A;  5D6X A;  3QJ6 A;  2R5M A;  3CCM T;  3MEA A;  2QA4 T;  3PMT A;  2X4Y A;  4IUP A;  3UWN A;  1KC8 U;  1WGS A;  2QEX T;  1K8A U;  5FRN A;  4L59 A;  3L2V A;  2X4W A;  2GF7 A;  2EQU A;  3OMG A;  3LLR A;  2PQW A;  1NPP A;  1VQ6 T;  1KD1 U;  3CCQ T;  5D6Y A;  2JUF A;  3J80 E;  3CC7 A;  3CCU T;  1KD1 C;  3CME A;  1YJN T;  3CPW S;  3OYD A;  4FL6 A;  1VQ8 T;  3P8D A;  2QQR A;  2O4X B;  4BE1 A;  4QQD A;  2O4X A;  3MET A;  1K9M U;  3CC7 T;  2RHX A;  3CCV A;  3CCE T;  4BDY A;  1YHQ A;  2NLU A;  2VYT A;  4N4I A;  3OYB A;  1Q82 U;  3FLG A;  5M9O A;  4E7K A;  1VQL T;  1VQN T;  2JTF A;  3OA6 A;  4QW2 A;  4BE0 A;  5IAY A;  2RJF A;  4ZTJ A;  1K73 C;  3CCL A;  2E6Z A;  3DLM A;  3G6E A;  5DM7 R;  1M1K U;  3UT1 A;  3PIP A;  2B8A A;  3G4S T;  3NTK A;  5KE3 A;  2OTJ A;  1Q86 C;  3PNW C;  3CD6 A;  2BIV A;  5J26 A;  3CMA A;  1YIT T; 
#chains in the Genus database with same CATH topology
 2XID A;  3OS2 A;  3CCU A;  1I8F A;  3BW1 A;  1KJW A;  1JJ2 P;  2LC4 A;  5FRM A;  4JS4 A;  4HT9 A;  1OU8 A;  1YJW T;  3RKY A;  1R0C B;  1B34 B;  3A8H B;  2JM8 A;  3PTA A;  2HSP A;  4J9H A;  5FWB A;  2P84 A;  2FEI A;  4MZP A;  1PKS A;  2DXU A;  2XD0 A;  4GLK A;  4XU3 A;  2E70 A;  4QQ6 A;  3CCS T;  3ULR B;  4BUG A;  4M7A C;  5GMK m;  3T9N A;  2FRY A;  4M77 D;  2CZ1 B;  1VQ5 T;  4C8Q C;  1WNL A;  2DBK A;  3BDU A;  2OTL T;  2QEX Q;  1X6B A;  1Y7X A;  2LQK A;  3LGL A;  3M0Q A;  3S3M A;  4M78 E;  4QQG A;  2FPE A;  2EJG A;  2QDL A;  5IXB A;  5LJ3 h;  2DET A;  4J7I A;  1VQ6 A;  4KGV B;  1YIJ T;  4RMO A;  3M56 A;  2QI2 A;  4RUG A;  1PRL C;  1EX4 A;  2YHT A;  2QA4 A;  4AG2 C;  5KYN A;  3S3O A;  3GBQ A;  1GFC A;  2L3R A;  1UEC A;  1OQK A;  3HSB A;  1EIF A;  3L2W A;  4X34 A;  4ELZ C;  3RR6 A;  3JCM X;  2R5A A;  1KFZ A;  2AZS A;  4BAC A;  4M7D A;  3C95 A;  1BU1 A;  1X6G A;  2PZ1 A;  1YCS B;  5GAN d;  1XQH A;  2XDD A;  1M2O A;  2OTL A;  1N6A A;  2EYX A;  2PVG B;  1G5V A;  3RMQ A;  4PJO F;  2FO0 A;  2XDP A;  4HCB A;  5ECA A;  8AT1 B;  1M3C A;  3RMS A;  1R0B G;  2KBT A;  3AT1 B;  2HBW A;  3A1P A;  2BZX A;  2MI6 A;  1NJI U;  4M75 G;  3QZ9 B;  1PWT A;  2AIR B;  3M5A A;  2EJF A;  2DVJ A;  1BI2 A;  2EYW A;  1YJ9 T;  5GAN 3;  2FYK A;  1OX9 A;  2IVW A;  3CPW P;  2XK0 A;  2L2P A;  2KRO A;  5LJ5 d;  3OYF A;  2C0T A;  4PLI A;  2ESW A;  1YJN Q;  2EKO A;  3GLX A;  1UHC A;  1JQQ A;  3G71 T;  2CSI A;  1CKA A;  2EQJ A;  1Q86 R;  1VQ6 Q;  3OYK A;  3NTH A;  1M1F A;  1QCN A;  1T3L A;  7AT1 B;  2A37 A;  4OB3 B;  3EGX A;  3RKX A;  1AVZ C;  2X3X D;  3DB3 A;  4J5Y A;  5GAO r;  1BYM A;  1H92 A;  2QEX A;  3OYI A;  2AKK A;  2MIO A;  1ACM B;  4NL3 A;  1VQL A;  1ZBX A;  2COY A;  2CH4 A;  3OYJ A;  4A63 B;  3CC2 T;  1VQM T;  2MAM A;  3BY7 A;  4IUR A;  2L0A A;  4GY5 A;  2H8H A;  4A4G A;  4LDV A;  2HQE A;  4JLG A;  3LYI A;  2RJD A;  2D9T A;  2RQV A;  2JMC A;  5KYY B;  2RHZ A;  1M90 C;  1M5Q 1;  1I5O B;  2I2L A;  3M58 A;  1SRM A;  1VIE A;  4XU0 A;  3M57 A;  5KYX A;  1YI2 A;  1GL5 A;  4HCZ A;  5CQX A;  1NM7 A;  1VYT A;  2M51 A;  2LJ0 A;  3VS6 A;  5KH6 A;  4QT7 A;  3E9G A;  5HKC A;  4L6V 5;  2P0K A;  5C6S A;  4AG1 C;  2DEU A;  1Q7Y R;  4C0F A;  4N0A C;  1IGQ A;  2DZ9 A;  2RI3 A;  3TU4 K;  2JZ2 A;  1M1K R;  4M7D B;  4IUT A;  4HVV A;  5C0M A;  5GAO q;  3V8J A;  1NE8 A;  4KUI A;  1VQN Q;  3BDL A;  4ZGE B;  2F2W A;  1NG2 A;  4F04 B;  5AT1 B;  4PJN A;  1AZE A;  4XU1 A;  1VQ4 T;  6AT1 B;  3OYH A;  2P4R A;  2PNI A;  1AWJ A;  4C92 A;  3RES A;  4DA4 A;  2K3Y A;  4XQ3 A;  2KDS A;  4ATO A;  2CRE A;  3O8V A;  1U1S A;  1WJS A;  5GMK e;  2AHJ B;  4J9G A;  4M7D C;  4JPB W;  3QYG B;  4A4H A;  2RHU A;  2E65 A;  2GTO A;  1WHH A;  4N4H A;  4NL2 A;  1IRE B;  2HSE B;  2VB6 A;  4FT4 A;  3SD4 A;  5KYU A;  3VUZ A;  2SRC A;  2YUN A;  4RTT A;  4FM4 B;  1GXI E;  4PLL A;  3OMC A;  3CCS A;  1M90 R;  3TEE A;  5GAN 5;  1HK9 A;  4PJO B;  2AKL A;  4OGE A;  3AHU A;  4R56 A;  5DLQ E;  4KUD K;  4HVU A;  5AYF A;  3MP1 A;  3CXC A;  3OY9 A;  1XNI A;  2DTO A;  4OB2 B;  1KQ1 A;  1YCY A;  1RAC B;  2K7A A;  1Q81 U;  3OBY A;  1M90 U;  2YUP A;  1W2B P;  2K3X A;  3OYL A;  4J8O A;  2DK3 A;  1K8A R;  1D1A A;  1TWB A;  1QVF S;  4AFQ C;  1QVF P;  4PJO G;  2CZ0 B;  4RCB A;  1WHG A;  2OAW A;  5I11 A;  4E2F B;  3MEU A;  1K73 R;  1YJN A;  5GAO l;  1XJW B;  1KQ2 A;  2CYZ B;  4AMC A;  2DZC A;  3R6O A;  3CXC P;  2BTT A;  2ED0 A;  2LCS A;  2RD1 A;  4C0G A;  3CXC S;  1IXD A;  2BKD N;  2C0I A;  4P5N A;  1C1A A;  1K73 U;  2CP6 A;  4ZGJ B;  2F69 A;  1Q81 R;  3CCM T;  4EMK B;  3UWN A;  3V8L A;  1N8R R;  4C8Q E;  3M0R A;  1PSF A;  1K8A U;  5LJ5 f;  5FRN A;  3VRY A;  4CC4 B;  2MYS A;  4L59 A;  2KK4 A;  2CZ6 B;  3C0C A;  2GF7 A;  1FMV A;  3OMG A;  1K4U S;  4F7U E;  1YI2 Q;  1Y07 A;  3O5Z A;  2RK1 A;  4LDU A;  2F2X A;  1B7T A;  1D0X A;  2J7I A;  3CCQ T;  1M4Z A;  3JB9 H;  1K9A A;  5D6Y A;  2JUF A;  3VS3 A;  3J80 E;  1BK2 A;  3CCU T;  1KD1 C;  1OEB A;  3I9Q A;  2YUQ A;  4FIB A;  3OYD A;  4PJO A;  4OP0 A;  1VQ5 Q;  2VXF A;  2B86 A;  2ZAE A;  4AFU C;  3MCA B;  4JDS A;  4C8Q F;  4QQD A;  2O4X A;  2HNI A;  3UDC A;  5GAN 2;  4R55 A;  4RTY A;  3VS7 A;  3SB2 A;  2RK2 A;  2E12 A;  2EYQ A;  4M78 A;  2VVK A;  3G1J A;  1PRM C;  1AOJ A;  3RIR A;  3RUX A;  3THK A;  1Q82 U;  5M9O A;  1HYO A;  2RMO A;  4ME7 A;  4OF1 A;  5CVI A;  4J9D A;  5IAY A;  1AWO A;  2RJF A;  2LQW A;  4F17 A;  1QMC A;  2D1X A;  3G6E A;  5CO7 A;  5DM7 R;  1M1K U;  2MK5 A;  1WX6 A;  1X69 A;  5KE3 A;  3QDF A;  3RNJ A;  5CKF A;  4KGZ B;  4CC7 A;  4C0Z A;  1YIT Q;  2JJ9 A;  3CC4 Q;  2BIV A;  5J26 A;  1VYV A;  3CMA A;  4ANJ A;  2PTK A;  4RTU A;  3VS1 A;  1KC8 C;  4M7D G;  3DLL A;  3CC2 A;  2KT1 A;  3I55 T;  3TSZ A;  4N4G A;  1TTH B;  3ZFJ A;  4JZ4 A;  1V29 B;  2K57 A;  2RHI A;  3H6Z A;  2M9U A;  4X1V A;  3GIB A;  4PJO E;  3SFM A;  4GBQ A;  2KXD A;  1NLP C;  4C8Q A;  4QVD A;  3RDV A;  2HAX A;  2ENM A;  1M3B A;  2DAQ A;  1KHC A;  3MEV A;  2LT4 A;  4J9B A;  3VKI A;  3GF5 A;  3JV3 A;  4WTO B;  2ZPG B;  2RNA A;  1MMD A;  4Z02 A;  2DIG A;  1M9S A;  1WFW A;  1BCO A;  3G6E T;  3FIF A;  4MDX A;  2ZPE B;  4IIO A;  2XU8 A;  2JMA A;  4MZM A;  3CC7 Q;  1PC0 A;  1O9S A;  1IZ6 A;  1VQM A;  1BB9 A;  3JCM J;  1YNZ A;  1RAI B;  2W0Z A;  3S6W A;  4K11 A;  4Y92 A;  3SDZ A;  1N8R U;  2VC8 A;  1MHN A;  3X24 B;  4J6W A;  2LNH B;  3P8H A;  4DBH A;  1PCX A;  5J39 A;  3VS4 A;  2DKG A;  3CQT A;  2LCC A;  4PJL A;  2L8D A;  3JB9 F;  3CC4 A;  3CCL Q;  5GMK l;  2FZK B;  2DL5 A;  2E6N A;  1UGV A;  3M55 A;  3CC4 T;  3L2R A;  1VQK A;  3SHW A;  1NLO C;  4JS5 A;  3NHN A;  2E10 A;  4KUL A;  3P8B B;  1NBE B;  3V7C A;  3VYG A;  5DY9 A;  1NEB A;  2DYB A;  4OMN A;  2HL3 A;  1S72 A;  2LCL A;  3EGD A;  3H0H A;  1VQM Q;  1QW1 A;  1SPK A;  2DRM A;  2IPO B;  3BE3 A;  2ZGW A;  2OTJ Q;  1YIJ Q;  1G3S A;  1QKX A;  1G2B A;  2EBP A;  3QHS A;  4PJO D;  1MMN A;  2EGE A;  1MGQ A;  2M16 A;  4BI3 A;  2QXF A;  1QVG P;  3C94 A;  2DFU A;  1RLQ C;  1NJI C;  2ZPH B;  1GCQ C;  4MMK A;  2XKO C;  3LW5 E;  2P0Q A;  4C92 E;  3UAT A;  5FLX E;  1D1C A;  4C8Q B;  4M78 G;  4JJB A;  1Q86 U;  1NZ9 A;  3ASK A;  1SKU B;  4DQ2 A;  3OSV A;  3A8G B;  1WYX A;  2YLC A;  3CCQ A;  4BI8 B;  3E9F A;  1WPY A;  2WSF E;  4XAX B;  1MNE A;  3L2Z A;  3EHR A;  2RB6 A;  1HXD A;  2R57 A;  3LWI A;  2JOY A;  1SSH A;  2XHC A;  3EG9 B;  4OGC A;  4IUU A;  1T0J A;  1VQ9 A;  1WXU A;  1WHL A;  4FYY B;  1X01 A;  5KYW A;  5GJW B;  4DBF A;  4ZGD B;  4II1 A;  2CT4 A;  1M3A A;  2COZ A;  4RTW A;  3KBG A;  2QK0 A;  2EQM A;  4E7I A;  2X4X A;  3I56 A;  1SHF A;  3JAM E;  5GAM h;  4J6Y A;  3V7R A;  5HK0 A;  4PJO C;  4J83 A;  3G71 Q;  1RAD B;  2R58 A;  5GAN f;  1YJ9 A;  3JCM c;  3M4Y A;  2RJE A;  2RQW A;  5KYX B;  2E5Q A;  1M8M A;  5GAM f;  1W70 A;  5GAM e;  1D3B A;  3OS0 A;  3MP6 A;  3ZBD A;  1FX7 A;  2YWW A;  1OZ2 A;  4NS5 A;  4HA8 A;  3F70 A;  4C92 C;  1QCO A;  5A0D A;  3UA6 A;  1TU0 B;  2GNC A;  3EAE A;  2A7Y A;  4QKU A;  1OI1 A;  3M0S A;  4OVA A;  5A2Q E;  2L3S A;  1NPR A;  1D09 B;  2K5I A;  3JCM Q;  3PFS A;  2NUP B;  1BIB A;  1M2V A;  2RPN A;  1UDL A;  1H3H A;  1QQJ A;  1V76 A;  2E41 A;  2O9V A;  2K79 A;  2LX9 A;  4BB7 A;  5CIU A;  2EPD A;  1U06 A;  3QPH A;  2FG0 A;  3MEW A;  1Y96 A;  1W2B S;  1I1J A;  1WDX A;  3I56 Q;  4WCI A;  1WXB A;  2JT4 A;  2E3I A;  2RJC A;  3EFR A;  5CCA A;  4XTW A;  2EIF A;  1N5Z A;  2E4H A;  1NYG A;  5IN1 A;  4E7L A;  1JB0 E;  4JJC A;  2DEQ A;  1W1F A;  2HQH A;  2V1R A;  1IHW A;  1G83 A;  1WI7 A;  1WLP B;  2DL4 A;  4J9E A;  1AZG B;  1HJD A;  9ATC B;  4PJJ A;  3A5Z B;  3CCS Q;  1WHM A;  2LT1 A;  1G3T A;  1UEB A;  2QQ9 A;  1KQS P;  4ELY C;  3HFO A;  4LE9 A;  2K4Y A;  4A4K A;  2RHY A;  3OS1 A;  1D3B B;  1GCP A;  2LJ1 A;  3ER0 A;  4EMH A;  1OX8 A;  4LN2 A;  1ZA2 B;  2JXB A;  2L3P A;  3QBY A;  1LJO A;  1UUE A;  3VUB A;  1VQO A;  1LVK A;  4ORZ A;  3QDR B;  2DIL A;  3D7S B;  1W4S A;  3EH2 A;  3PIO A;  3OW2 A;  1YIT A;  2FZC B;  2AZV A;  4M78 F;  1M1K C;  1C6V X;  1PD1 A;  1S72 T;  1YFN A;  1UGP B;  3MKD A;  4MML A;  1MUZ A;  2DMO A;  2DBM A;  2QGG A;  4LDX A;  1K0S A;  3VRZ A;  2MF2 A;  5LJ3 g;  1FXX A;  1ZSG A;  2V8K A;  4EMK A;  4PK4 A;  1GBQ A;  3PMT A;  2X4Y A;  2J05 A;  2ZPB B;  1GRI A;  3VU3 C;  1VQ8 Q;  4FCY A;  1W6X A;  2OI3 A;  2YRD A;  1JBM A;  1AEY A;  5L23 A;  3JCM P;  2EGC A;  3WXM B;  2OTL Q;  4A53 A;  4RTV A;  4AFS C;  2FRW A;  2CP5 A;  3GPL A;  2FPF A;  1QWE A;  5GAM g;  1J3T A;  2EQU A;  2YSQ A;  4R0K A;  3JCM g;  2DXC A;  1KD1 U;  3CC7 A;  4JRP A;  3CPW S;  2P4T A;  4FL6 A;  1VQ8 T;  4MZT A;  2QQR A;  3OS5 A;  2DF6 A;  5DLO A;  2PVD B;  3M0U A;  2O4X B;  1K76 A;  4LDY A;  1IRX A;  5KYW B;  3VS5 A;  2X4J A;  2FB7 A;  2KRS A;  3INZ A;  2V1Q A;  2CS7 A;  4M7A B;  2Z0W A;  4BDY A;  1YHQ A;  1E6G A;  5GAM j;  3FLG A;  4KT0 E;  1R8O B;  1KD1 R;  4ZTJ A;  1K73 C;  3CCL A;  4M77 F;  2V8J A;  3X20 B;  3CME Q;  3QUI A;  1TUG B;  3G7Z A;  2B8A A;  2W10 A;  1YWO A;  4DBR A;  1KG1 A;  2L3Q A;  4LXC A;  4ZNX A;  1I07 A;  2XDB A;  3CD6 A;  2CT3 A;  2NWM A;  1RAA B;  2OX7 A;  2ZCF B;  2LNV A;  3ZEH A;  2D0Q B;  1M1G A;  1IHV A;  3V8K A;  4M77 B;  3NGP A;  2ZPF B;  4XTV A;  2DL7 A;  1UHF A;  1X2K A;  1Q82 R;  3L2U A;  1ZSZ C;  4IUQ A;  1WIE A;  3MPU B;  3H9N A;  3OW2 S;  3EH1 A;  3JRZ A;  3CMA T;  3VS0 A;  4M7D E;  3RKW A;  3SWN A;  1Y96 B;  1T3S A;  4J9C A;  2ED1 A;  4PFP A;  2RN8 A;  2CKK A;  5EG2 A;  3WVD B;  1I0C A;  4RG8 A;  3OB9 A;  1B3Q A;  1RI0 A;  3OYA A;  1EFN A;  3VYH B;  4EIK A;  3A98 A;  3UF4 A;  4UC4 A;  3JB9 J;  2M1H A;  2V26 A;  2EQK A;  5FW9 A;  1ZLM A;  5GMK j;  2K2M A;  3J81 E;  4VUB A;  1BCM A;  1X6O A;  3H0I A;  4RCC A;  3CCU Q;  4LNP A;  1SEM A;  4N0A A;  3CPW A;  4X9C A;  5KYY A;  3VJP A;  1LCK A;  4D6W A;  3QZ5 B;  2O88 A;  2QQB A;  4M75 B;  2DL8 A;  4OMF B;  4RKU E;  1I81 A;  2CGH A;  4C5E A;  2BZ8 A;  2X35 A;  1TXQ A;  5CK9 A;  5GAN h;  5IH2 A;  2DER A;  1JJ2 A;  4C92 F;  4KRT A;  1SSF A;  1AWX A;  1WQ7 A;  3UA7 A;  2C06 A;  2M0Y A;  3HRU A;  3JCM f;  4LDW A;  1PKT A;  5GAN g;  4Q5W A;  5HY6 A;  5A0L A;  1AHJ B;  1Q82 C;  1KHI A;  3LH0 A;  3JCM b;  5CAI A;  5D7U A;  1OYX A;  2GQI A;  1VQL Q;  4Z88 A;  3S3N A;  1QP2 A;  4RG2 A;  1YHQ Q;  4J7F A;  4M7A E;  3HPW A;  2J6O A;  1H64 1;  2G6F X;  5FU7 B;  3CCE Q;  1KK7 A;  2F1L A;  1BI1 A;  1KQS S;  4C92 B;  5FRO A;  2D0N A;  5EC7 A;  1AD5 A;  1ZBJ A;  5I21 A;  1GFD A;  1VQK T;  4A4E A;  1MMG A;  2DLP A;  2KYM A;  2JTM A;  3HFN A;  3U23 A;  3FC3 A;  2KR3 A;  4LUD A;  2DJQ A;  2YT6 A;  4JRK A;  3Q1J A;  5CKB A;  5L8R E;  2MWO A;  3HL8 A;  5LJ5 g;  5GAO m;  3VV0 A;  2K9G A;  4PFZ A;  1UGQ B;  2HBP A;  3NTI A;  2DX1 A;  3PGG A;  3CD6 Q;  4M78 D;  3M59 A;  2ZZD A;  4DEX A;  3SWN C;  2GGR A;  1MV0 B;  1VOM A;  3TVT A;  5LJ5 h;  1OPL A;  2MMP A;  2VGM A;  4LUE A;  1ZUK A;  1U8R A;  1IB8 A;  2DIQ A;  3JSC A;  1WZO A;  5CKH A;  1ABO A;  1PD0 A;  1C0M A;  2KSS A;  3GP8 A;  1SF9 A;  1K8A C;  2KYB A;  2QQA A;  5J3B A;  3JCM W;  1UE9 A;  2HQX A;  1VQN A;  2CDT A;  2K5L A;  3QKJ A;  1W2B A;  2EAY A;  2J6F A;  4C8Q G;  3CCL T;  3CCJ A;  1WJR A;  3ME9 A;  2KQW A;  1CKB A;  3M53 A;  2QAZ A;  5GMK i;  3RER A;  3CPF A;  3R6N A;  3CCR A;  4E7H A;  1VQO Q;  2LZ6 B;  2PUK B;  2O2O A;  1FMW A;  2XIC A;  2BE7 D;  4C5G A;  2OTJ T;  2KY9 A;  1OOT A;  3M9Q A;  4PNO A;  1G3Y A;  1YJW A;  2DL3 A;  4FSS A;  2QQS A;  3REB B;  1R77 A;  1BI3 A;  4PL6 A;  2DM1 A;  1YP5 A;  1M2V B;  3EFO B;  2KAF A;  2FL7 A;  2MCN A;  3QSU A;  1B07 A;  4F14 A;  1OZ3 A;  1PSE A;  1Y0M A;  1NYF A;  5GAN 7;  8ATC B;  2DO3 A;  3L1A A;  3G71 A;  3FEO A;  1QLY A;  1QVF A;  3G6E Q;  1M8V A;  2DJZ A;  4RTZ A;  3MP8 A;  5GAN 8;  5KCO A;  1RLP C;  2GTJ A;  4BD3 A;  2F2V A;  1S1N A;  2DNU A;  3DB4 A;  5LL6 S;  2JS0 A;  3TSW A;  1ZA1 B;  4KBM B;  1Y57 A;  3CCJ Q;  2X51 A;  2DXB A;  5D6W A;  1VQ7 A;  4M7D F;  4Y91 A;  4EMG A;  3LWH A;  5IT9 E;  5LJ3 d;  1WHK A;  2YDL A;  1QP3 A;  4PJM A;  1LNX A;  1VQ9 T;  2LQN A;  5GAN j;  2EJ9 A;  5IHK A;  2KT8 A;  2MOX A;  3KXT A;  4B9X A;  3HTR A;  1BKB A;  2KRM A;  2VUB A;  4OB1 B;  2WSC E;  5IXF A;  3HRT A;  4FYX B;  2OJ2 A;  2QGF B;  3EGU A;  5CR2 A;  4F7U A;  2EKH A;  5GAN e;  1N8R C;  2BZY A;  3DKM A;  1XTD A;  2ROT A;  2WSE E;  3C12 A;  3ZL7 C;  4ZN1 A;  3CBO A;  3V7S A;  2F5T X;  4BI4 A;  1JU5 C;  2LTO A;  1UFF A;  3M0T A;  2LDM A;  2VAS A;  3OYG A;  2ATC B;  4C5I A;  2FPD A;  2ECZ A;  4J9F A;  4CRI A;  1WQW A;  1Q7Y C;  1TUD A;  1WXT A;  1QKW A;  2RO0 A;  4OMQ A;  4M75 F;  1QVG S;  2J06 A;  1AWW A;  2LVM A;  2A36 A;  4HT8 A;  3EFO A;  3REA B;  5D6X A;  3QJ6 A;  2BE9 B;  1TSF A;  4Z8A A;  3MEA A;  2XI9 A;  2QA4 T;  4IUP A;  3E2U A;  2KI7 A;  2D6F A;  1D0Y A;  2DTH A;  1WGS A;  2CUD A;  2KGT A;  2QTV A;  3X26 B;  5I22 A;  1TOV A;  3CC2 Q;  1SG5 A;  5LJ3 f;  1M27 C;  4OMM A;  5FU6 B;  3CCQ Q;  3FB9 A;  1CSK A;  2PUO B;  2PQW A;  4OML A;  1TH7 A;  1NPP A;  3QJY A;  2KRN A;  1VQ6 T;  1ZHI A;  1GBR A;  1BBZ A;  4M78 C;  2JM9 A;  1YJN T;  4FSX A;  5KYU B;  4KH1 B;  4F7U G;  1QVP A;  4XTY A;  2H3J A;  1VYU A;  5IHN A;  3I35 A;  3MET A;  2CSQ A;  4F7U B;  1ZSZ A;  2CUB A;  1P92 A;  4C0D C;  1ZX6 A;  5CKE A;  3CCE T;  3PT9 A;  2VYT A;  3QO3 A;  2Y90 A;  2QG9 B;  5CQY A;  3GNF B;  3GNG A;  4M7D D;  4E7K A;  1VQN T;  3OA6 A;  2YUO A;  1D0Z A;  1PHT A;  2KNB B;  1YWP A;  2HCK A;  1E6H A;  2GBQ A;  1IO6 A;  3UT1 A;  3M4G A;  2K3B A;  2LJ3 A;  3G4S T;  3NTK A;  2OTJ A;  2HMA A;  1K1Z A;  2NYS A;  4M7A F;  4D8K A;  2DXT A;  2LP5 A;  5A0G A;  4OMP A;  3C4S A;  1MND A;  2HKN A;  4XU2 A;  4YTL A;  2NUT A;  1ZUU A;  1X2Q A;  3L42 A;  1RAH B;  1X27 A;  4QVZ A;  4CC3 A;  2JW4 A;  1ZUY A;  1RAE B;  3CCJ T;  1OUL A;  3CBM A;  1ARK A;  3CCM A;  1MV3 A;  3SWN B;  3LH5 A;  2CP3 A;  4BDZ A;  1VQ8 A;  4ESR A;  3SEM A;  4EMK C;  4JRI A;  3OYN A;  2X3W D;  3OQ5 A;  2OAU A;  3HRS A;  3H8Z A;  2LX7 A;  3CCV T;  4CI0 C;  4IKF A;  1ABQ A;  2EFI A;  4QVC A;  5GAM d;  4C5H A;  2KXC A;  1G3W A;  1BIA A;  2FHD A;  4C92 D;  4Y28 E;  1FMK A;  3EG9 A;  2QAS A;  1JRI A;  4M7A D;  5IHI A;  3GOX A;  2IG0 A;  1Z9Z A;  4XK8 E;  2GFU A;  1QVG A;  1U3O A;  3E19 A;  3CMA Q;  3CCV Q;  3JCM V;  3JB9 I;  1ZSZ B;  4GLM A;  1FWZ A;  1YJ9 Q;  1VQP A;  4XTX A;  4JZ3 A;  2V8I A;  1VA7 A;  4E6R A;  3EG3 A;  4E7J A;  1U1T A;  4JJN K;  4M75 E;  5I2S A;  2E64 A;  3CCE A;  3A8O B;  2K6D A;  4M78 B;  4BE2 A;  1Z9Q A;  2NUZ A;  3CEY A;  3E1S A;  3JCM d;  1A0N B;  4J9I A;  1BI0 A;  2L89 A;  1YN8 A;  4AFZ C;  4BY6 B;  1OU9 A;  2JVV A;  1H3Z A;  1K9M C;  1X43 A;  4FW1 A;  5FWC A;  3EG1 A;  1VQ4 Q;  2DTI A;  2WAC A;  3CME T;  1OPK A;  5FU6 C;  1MMA A;  1PM3 A;  3FRN A;  2E3H A;  2RQR A;  1UG1 A;  4KGX B;  3A8L B;  4DBQ A;  4WF2 A;  1LPL A;  5GAO n;  3MJX A;  1D1B A;  3J7A F;  3JCM h;  5HCK A;  2NUT B;  4B9W A;  4LD9 K;  4F16 A;  2A0F B;  3HKS A;  3HP9 A;  3N5B B;  2XMF A;  4OB0 B;  1VQO T;  1N27 A;  2P0P A;  2LQ8 A;  2RI2 A;  4FT2 A;  2DD4 A;  2YLB A;  2K5F A;  3OYY A;  3HHT B;  2RQU A;  4F7U F;  2KVQ G;  3NPF A;  3QII A;  4V2S A;  3QG1 A;  2EYZ A;  4M77 E;  2X9H A;  2GCX A;  1U5S A;  4BY6 C;  1TS9 A;  1JEG A;  2C0O A;  4FU6 A;  1QCF A;  2BUD A;  2ZPI B;  3I5R A;  1UTI A;  2RI5 A;  4Z89 A;  2CP2 A;  4A54 A;  2KEA A;  1VUB A;  4AT1 B;  2G3R A;  1EZZ B;  1TG0 A;  1RL2 A;  1HD3 A;  3I55 Q;  1XOV A;  3OBW A;  4JLI A;  4M75 D;  1KIK A;  4HCC A;  3OYM A;  1PG5 B;  1JXO A;  2DA9 A;  2VV5 A;  1JXM A;  3MHX A;  1YI2 T;  1DJ7 B;  3QXE B;  4NOY A;  1K9M R;  1RAF B;  2PU9 B;  4D8D A;  2RQT A;  1E7O A;  1VIF A;  3G4S Q;  2KE9 A;  2HZY A;  4O5V A;  1JJ2 S;  1VQP Q;  1VQ7 T;  3H41 A;  4ZTF A;  2O01 E;  4M7A G;  3TQ7 P;  2DRK A;  3M54 A;  3G4S A;  1IGU A;  2QA4 Q;  3I56 T;  3CCM Q;  1VQ4 A;  4PFO A;  1UGS B;  2RM4 A;  3LGF A;  4IUV A;  4FYW B;  2YRC A;  4IIM A;  4DEY A;  2EGA A;  2QYZ A;  2H3E B;  4B6M A;  1KSW A;  1Y71 A;  5KE2 A;  3MO8 A;  4LD6 A;  1YHQ T;  1UGR B;  2IIM A;  4TVR A;  1Q7Y U;  1H8K A;  3TRE A;  1KQS A;  1G8X A;  1M30 A;  3M0P A;  5I2M A;  2RA2 A;  4O6J A;  3EGD B;  2FVU A;  3KUF A;  5GJV B;  4ZN3 A;  1RI9 A;  2SEM A;  4FW2 A;  2A3L A;  2HKQ B;  2DYI A;  1RAG B;  1LOJ A;  1Q81 C;  4JUV A;  2VWF A;  4PKC C;  1SRL A;  1K0X A;  3CCR T;  2QTX A;  3RBB B;  3OYE A;  1TUC A;  2M0O A;  2EYY A;  2YRV A;  3I55 A;  4M77 G;  2E1H A;  5LJ5 e;  1YBY A;  4HVW A;  3EG0 A;  1I4K 1;  1B34 A;  3L2Q A;  2AT1 B;  5KCH A;  4RTX A;  3CD6 T;  1Q95 G;  1F1B B;  4EDU A;  2CP0 A;  2K2V A;  1O75 A;  4DOV A;  2MWP A;  1HSQ A;  3FJP A;  3OSS C;  1UJY A;  1VQP T;  2EW3 A;  2M02 A;  1OV3 A;  3JCM e;  1VQ9 Q;  2HEQ A;  2CP7 A;  4JRQ A;  2A08 A;  2CZ7 B;  2VXE A;  3JB9 G;  2DD5 A;  2JS2 A;  4A4F A;  2VKN A;  2HL5 C;  2O31 A;  3X25 B;  4XTU A;  2F5K A;  4L5G A;  5GAO p;  2JTE A;  2L5Q A;  4E7S A;  1VQK Q;  2XG8 D;  4M7A A;  2Y4Y A;  2LMJ A;  4C8Q D;  3CCR Q;  2JNG A;  5LJ5 j;  5LJ3 e;  4HXJ A;  3PMI A;  2EWN A;  4JJD A;  1VQ5 A;  3EHQ A;  1YIJ A;  3CBP A;  1ZQ1 A;  3LX7 A;  1WHJ A;  2LRQ A;  2GFA A;  3I5S A;  4HKE A;  4HCK A;  1S72 Q;  3H0F A;  2ROL A;  2MPX C;  1JO8 A;  3FDR A;  1RAB B;  1N9R A;  1WJQ A;  2DVE A;  3OYC A;  3URG A;  4E7Z A;  2R5M A;  4M77 A;  3EFS A;  4X9D A;  2Y4X A;  1VQ7 Q;  2E5K A;  2PVO B;  4C92 G;  1KC8 U;  1QWF A;  2NUP A;  2QEX T;  1WA7 A;  5CKD A;  1N9S A;  3PVQ A;  1SHG A;  2DPP B;  3EG2 A;  3L2V A;  4MDW A;  2JN0 A;  2X4W A;  1FYN A;  2J6K A;  1NJI R;  3WVE B;  2D8J A;  4KH0 B;  2RF0 A;  3LLR A;  3BFM A;  1V1C A;  2EQI A;  1I5L A;  4DOW A;  3PE0 A;  2CH4 W;  2COW A;  3A8M B;  2I0N A;  4M75 C;  3EGX B;  3CME A;  5GAN 6;  1NEG A;  5FU7 C;  3P8D A;  1YJW Q;  4XTZ A;  4J6X A;  2HD0 A;  5GAN 4;  3NMZ C;  2O9S A;  3VS2 A;  4BE1 A;  1X75 C;  1RUW A;  3OW2 P;  2VGN A;  3IQL A;  3KFV A;  1K9M U;  3CC7 T;  2RHX A;  3QYH B;  3CCV A;  3FJ5 A;  3TCJ A;  1T0H A;  3QWY A;  1GCQ A;  4CC2 A;  2NLU A;  3PVL A;  2HDA A;  4M75 A;  4N4I A;  5GMK h;  4E47 A;  2AK5 A;  2GQV A;  2RH2 A;  3JB9 D;  3OYB A;  1UJ0 A;  2DE0 X;  1AT1 B;  2FZG B;  1UB4 A;  2QDY B;  5HK3 A;  1VQL T;  2JTF A;  4QW2 A;  4BE0 A;  3NFC A;  5LJ3 j;  2KMT A;  1KC8 R;  2D8H A;  2A28 A;  2EVR A;  2E6Z A;  3DLM A;  2YXY A;  4C0D B;  3PIP A;  3UPU A;  1PNJ A;  4M4Z A;  1Q86 C;  3PNW C;  4M77 C;  3QWX X;  4FYV B;  4EPC A;  3X28 B;  2ABL A;  4OMO A;  1YIT T; 
#chains in the Genus database with same CATH homology
 3C4S A;  3ZEH A;  2D0Q B;  4XU2 A;  4YTL A;  1M1G A;  2XID A;  3OS2 A;  1KC8 C;  3V8K A;  4M7D G;  3DLL A;  3CC2 A;  3L42 A;  4M77 B;  3I55 T;  4QVZ A;  3CCU A;  2ZPF B;  4N4G A;  1I8F A;  4XTV A;  3ZFJ A;  3BW1 A;  1V29 B;  3L2U A;  2K57 A;  2LC4 A;  2RHI A;  4IUQ A;  3CCJ T;  3CBM A;  3CCM A;  5FRM A;  3SWN B;  3H6Z A;  2M9U A;  4JS4 A;  4BDZ A;  1VQ8 A;  3GIB A;  3OW2 S;  3JRZ A;  4HT9 A;  4EMK C;  4JRI A;  4PJO E;  3SFM A;  3OYN A;  3CMA T;  4C8Q A;  4M7D E;  3RKW A;  3SWN A;  4QVD A;  3OQ5 A;  2HAX A;  1YJW T;  3RKY A;  2DAQ A;  1KHC A;  1B34 B;  1Y96 B;  2OAU A;  2LT4 A;  3A8H B;  3MEV A;  3HRS A;  3H8Z A;  3VKI A;  3PTA A;  3GF5 A;  3CCV T;  4CI0 C;  4IKF A;  2ZPG B;  2EFI A;  4QVC A;  5GAM d;  4MZP A;  4C5H A;  2CKK A;  1G3W A;  1BIA A;  2FHD A;  4Z02 A;  4C92 D;  2DIG A;  4Y28 E;  5EG2 A;  2DXU A;  1JRI A;  1M9S A;  3G6E T;  3FIF A;  4MDX A;  2XD0 A;  2ZPE B;  3GOX A;  3WVD B;  4M7A D;  4GLK A;  4XU3 A;  2E70 A;  2IG0 A;  4QQ6 A;  2XU8 A;  4RG8 A;  3OB9 A;  4MZM A;  4XK8 E;  1O9S A;  3CCS T;  1IZ6 A;  2GFU A;  1RI0 A;  4BUG A;  1VQM A;  4M7A C;  3OYA A;  5I21 A;  5GMK m;  3JCM J;  1QVG A;  3E19 A;  3T9N A;  3VYH B;  3S6W A;  3JCM V;  3JB9 I;  4M77 D;  4UC4 A;  3JB9 J;  2CZ1 B;  2M1H A;  4C8Q C;  1WNL A;  3SDZ A;  1VQ5 T;  1N8R U;  2VC8 A;  1MHN A;  1FWZ A;  2EQK A;  1VQP A;  4XTX A;  3X24 B;  4J6W A;  5GMK j;  3BDU A;  3J81 E;  2OTL T;  4VUB A;  2V8I A;  1X6O A;  4RCC A;  3P8H A;  4E7J A;  1Y7X A;  1U1T A;  2LQK A;  3LGL A;  4N0A A;  5J39 A;  3CPW A;  4JJN K;  3S3M A;  4M78 E;  4M75 E;  4QQG A;  4X9C A;  5I2S A;  3VJP A;  2E64 A;  3CCE A;  2DKG A;  2EJG A;  4D6W A;  3A8O B;  3QZ5 B;  2LCC A;  5LJ3 h;  2QQB A;  2L8D A;  4M75 B;  4J7I A;  4M78 B;  4BE2 A;  1VQ6 A;  4OMF B;  3JB9 F;  4RKU E;  1I81 A;  3CC4 A;  2CGH A;  3CEY A;  3E1S A;  3JCM d;  4C5E A;  1YIJ T;  5GMK l;  4RMO A;  1BI0 A;  2L89 A;  3M56 A;  2E6N A;  2X35 A;  2QI2 A;  4BY6 B;  5CK9 A;  5GAN h;  2JVV A;  3M55 A;  1H3Z A;  3CC4 T;  1JJ2 A;  2YHT A;  4C92 F;  3L2R A;  2QA4 A;  1K9M C;  1VQK A;  1SSF A;  4JS5 A;  2E10 A;  3S3O A;  4KUL A;  3P8B B;  2DTI A;  2WAC A;  3CME T;  1WQ7 A;  2L3R A;  3V7C A;  3VYG A;  2C06 A;  5FU6 C;  3HRU A;  3JCM f;  5DY9 A;  3HSB A;  4LDW A;  3FRN A;  1EIF A;  3L2W A;  4X34 A;  5GAN g;  3A8L B;  4Q5W A;  4ELZ C;  5HY6 A;  4WF2 A;  3JCM X;  1S72 A;  5GAO n;  2R5A A;  2LCL A;  5A0L A;  3J7A F;  1AHJ B;  3JCM h;  1QW1 A;  4BAC A;  4M7D A;  3C95 A;  1KHI A;  3LH0 A;  3JCM b;  4B9W A;  1Q82 C;  5CAI A;  4LD9 K;  3HKS A;  3HP9 A;  5GAN d;  1XQH A;  2ZGW A;  1OYX A;  2XDD A;  1G3S A;  3N5B B;  3QHS A;  4PJO D;  4OB0 B;  3S3N A;  2OTL A;  1N6A A;  1QP2 A;  4RG2 A;  1VQO T;  2PVG B;  1N27 A;  2P0P A;  1MGQ A;  4J7F A;  4M7A E;  3HPW A;  1G5V A;  1H64 1;  2M16 A;  5FU7 B;  3RMQ A;  2LQ8 A;  2RI2 A;  4FT2 A;  4PJO F;  2QXF A;  4BI3 A;  1BI1 A;  2DD4 A;  3C94 A;  2YLB A;  4C92 B;  1KQS S;  2XDP A;  1NJI C;  4HCB A;  2K5F A;  2ZPH B;  3OYY A;  3HHT B;  5FRO A;  4F7U F;  2KVQ G;  2XKO C;  4MMK A;  3RMS A;  3LW5 E;  2P0Q A;  3QII A;  4C92 E;  5FLX E;  3QG1 A;  4V2S A;  2MI6 A;  4C8Q B;  1NJI U;  4M75 G;  3QZ9 B;  4M78 G;  1Q86 U;  1NZ9 A;  4A4E A;  4M77 E;  3M5A A;  1VQK T;  3ASK A;  2EJF A;  2GCX A;  1BI2 A;  1YJ9 T;  5GAN 3;  2FYK A;  2IVW A;  4DQ2 A;  2JTM A;  3HFN A;  3A8G B;  2XK0 A;  3OSV A;  4BY6 C;  3OYF A;  5LJ5 d;  2YLC A;  4FU6 A;  4PLI A;  3FC3 A;  2ZPI B;  2BUD A;  3CCQ A;  4BI8 B;  3E9F A;  1WPY A;  2EKO A;  2WSF E;  4XAX B;  3L2Z A;  2RI5 A;  3GLX A;  2RB6 A;  4JRK A;  1HXD A;  2R57 A;  4A54 A;  3LWI A;  2JOY A;  3Q1J A;  3G71 T;  5CKB A;  5L8R E;  2EQJ A;  2MWO A;  2XHC A;  3HL8 A;  1VUB A;  5LJ5 g;  3OYK A;  4OGC A;  3NTH A;  2G3R A;  1M1F A;  1RL2 A;  5GAO m;  4IUU A;  3VV0 A;  4OB3 B;  1UGQ B;  2HBP A;  1VQ9 A;  1XOV A;  3NTI A;  3PGG A;  3RKX A;  3OBW A;  4JLI A;  4M75 D;  4M78 D;  4HCC A;  1X01 A;  3DB3 A;  4J5Y A;  3OYM A;  5GAO r;  4ZGD B;  3M59 A;  2ZZD A;  1BYM A;  2VV5 A;  4II1 A;  2QEX A;  3OYI A;  3MHX A;  3KBG A;  1YI2 T;  1DJ7 B;  3QXE B;  3SWN C;  4NL3 A;  1VQL A;  1ZBX A;  2EQM A;  4E7I A;  2X4X A;  5LJ5 h;  3OYJ A;  3I56 A;  4NOY A;  3CC2 T;  1VQM T;  2MMP A;  2MAM A;  2VGM A;  3BY7 A;  4IUR A;  3JAM E;  5GAM h;  4J6Y A;  3V7R A;  1U8R A;  3JSC A;  2DIQ A;  2PU9 B;  4GY5 A;  5HK0 A;  4PJO C;  1VIF A;  5CKH A;  4A4G A;  4J83 A;  4LDV A;  2HQE A;  4JLG A;  4O5V A;  2KSS A;  1JJ2 S;  3GP8 A;  2R58 A;  3LYI A;  5GAN f;  1YJ9 A;  3JCM c;  1K8A C;  1VQ7 T;  3M4Y A;  4ZTF A;  2RJD A;  2RJE A;  2D9T A;  2O01 E;  4M7A G;  3M54 A;  2RHZ A;  1M90 C;  2E5Q A;  2QQA A;  5GAM f;  1M5Q 1;  3M58 A;  2I2L A;  3G4S A;  5J3B A;  3JCM W;  3I56 T;  5GAM e;  1VIE A;  1D3B A;  1VQ4 A;  4XU0 A;  3M57 A;  3OS0 A;  1YI2 A;  2HQX A;  1UGS B;  3MP6 A;  4HCZ A;  1VQN A;  2K5L A;  3ZBD A;  3QKJ A;  2RM4 A;  1FX7 A;  5CQX A;  1OZ2 A;  4NS5 A;  1W2B A;  3LGF A;  2EAY A;  4IUV A;  4HA8 A;  4C8Q G;  3F70 A;  4C92 C;  3CCL T;  5KH6 A;  3CCJ A;  3E9G A;  1WJR A;  3ME9 A;  2KQW A;  5HKC A;  4L6V 5;  3M53 A;  5A0D A;  2P0K A;  5GMK i;  3RER A;  3CPF A;  1Y71 A;  5KE2 A;  3MO8 A;  5C6S A;  4LD6 A;  3CCR A;  4E7H A;  1YHQ T;  4C0F A;  4N0A C;  1UGR B;  2PUK B;  2DZ9 A;  2RI3 A;  3TU4 K;  2XIC A;  4TVR A;  4C5G A;  2JZ2 A;  2OTJ T;  1Q7Y U;  2KY9 A;  3EAE A;  3TRE A;  2A7Y A;  4M7D B;  1KQS A;  4IUT A;  3M9Q A;  4PNO A;  1G3Y A;  1OI1 A;  5I2M A;  1YJW A;  2RA2 A;  2QQS A;  4PL6 A;  1BI3 A;  4OVA A;  5C0M A;  4O6J A;  5GAO q;  3V8J A;  5A2Q E;  2FVU A;  1NE8 A;  1NPR A;  4KUI A;  3BDL A;  2KAF A;  2K5I A;  3KUF A;  4ZGE B;  2FL7 A;  4ZN3 A;  3QSU A;  3JCM Q;  1OZ3 A;  1PSE A;  3PFS A;  1BIB A;  5GAN 7;  2A3L A;  1Q81 C;  1LOJ A;  4JUV A;  4PKC C;  3CCR T;  2QTX A;  2DO3 A;  3L1A A;  3G71 A;  2E41 A;  3OYE A;  4XU1 A;  1VQ4 T;  2LX9 A;  3FEO A;  2M0O A;  2YRV A;  4BB7 A;  3OYH A;  3I55 A;  1QVF A;  1M8V A;  4M77 G;  5CIU A;  2E1H A;  5LJ5 e;  4C92 A;  2DJZ A;  1YBY A;  3RES A;  3MP8 A;  5GAN 8;  2K3Y A;  3QPH A;  5KCO A;  4DA4 A;  1I4K 1;  4XQ3 A;  2KDS A;  4ATO A;  4BD3 A;  3MEW A;  1B34 A;  1Y96 A;  3L2Q A;  3DB4 A;  3O8V A;  1U1S A;  1W2B S;  5LL6 S;  1WJS A;  5KCH A;  5GMK e;  2AHJ B;  3CD6 T;  4M7D C;  4EDU A;  3QYG B;  4A4H A;  2K2V A;  1O75 A;  2RHU A;  2E65 A;  4DOV A;  2MWP A;  4KBM B;  3FJP A;  3OSS C;  2RJC A;  4N4H A;  4NL2 A;  1IRE B;  3EFR A;  1VQP T;  5CCA A;  3JCM e;  2DXB A;  4JRQ A;  5D6W A;  2CZ7 B;  4FT4 A;  1VQ7 A;  2VXE A;  3SD4 A;  4XTW A;  4M7D F;  3JB9 G;  4Y91 A;  2EIF A;  3VUZ A;  2DD5 A;  4EMG A;  3LWH A;  5IN1 A;  4A4F A;  5IT9 E;  5LJ3 d;  1JB0 E;  4FM4 B;  1QP3 A;  4E7L A;  2DEQ A;  3OMC A;  1LNX A;  4PLL A;  1VQ9 T;  1GXI E;  3CCS A;  5GAN j;  2EJ9 A;  3X25 B;  3TEE A;  5GAN 5;  1HK9 A;  4XTU A;  3KXT A;  2F5K A;  4PJO B;  4L5G A;  4B9X A;  4OGE A;  5GAO p;  1BKB A;  2L5Q A;  3AHU A;  2VUB A;  4R56 A;  5DLQ E;  4OB1 B;  2WSC E;  4KUD K;  2XG8 D;  3A5Z B;  3HRT A;  5AYF A;  3MP1 A;  3CXC A;  3OY9 A;  4M7A A;  1XNI A;  2LT1 A;  5CR2 A;  1G3T A;  2DTO A;  2Y4Y A;  4OB2 B;  1KQ1 A;  4F7U A;  1UEB A;  2QQ9 A;  1YCY A;  4C8Q D;  2JNG A;  4ELY C;  1Q81 U;  3OBY A;  5GAN e;  1N8R C;  1M90 U;  3DKM A;  1XTD A;  3HFO A;  5LJ5 j;  2K3X A;  2K4Y A;  4A4K A;  5LJ3 e;  3OYL A;  2RHY A;  3OS1 A;  1D3B B;  4J8O A;  2DK3 A;  3ER0 A;  3PMI A;  4EMH A;  2WSE E;  3C12 A;  2EWN A;  1VQ5 A;  4ZN1 A;  1YIJ A;  3CBO A;  3CBP A;  1ZQ1 A;  3V7S A;  3QBY A;  2F5T X;  1QVF S;  3LX7 A;  4BI4 A;  1LJO A;  3VUB A;  2LTO A;  1VQO A;  4PJO G;  2LDM A;  2CZ0 B;  4RCB A;  3OYG A;  2LRQ A;  2GFA A;  4HKE A;  4C5I A;  3QDR B;  4CRI A;  1WQW A;  3MEU A;  1YJN A;  1Q7Y C;  1W4S A;  3PIO A;  5GAO l;  3OW2 A;  1KQ2 A;  1YIT A;  2CYZ B;  2RO0 A;  2DZC A;  4M75 F;  4M78 F;  3R6O A;  1QVG S;  1M1K C;  1S72 T;  4C0G A;  2RD1 A;  1UGP B;  3CXC S;  4MML A;  3FDR A;  2LVM A;  2BKD N;  4LDX A;  1N9R A;  4P5N A;  1WJQ A;  2MF2 A;  4HT8 A;  5LJ3 g;  1K73 U;  1FXX A;  2DVE A;  3OYC A;  5D6X A;  3QJ6 A;  4ZGJ B;  3URG A;  2R5M A;  2V8K A;  4EMK A;  4M77 A;  2F69 A;  3MEA A;  3CCM T;  2XI9 A;  3EFS A;  2QA4 T;  4X9D A;  2Y4X A;  3PMT A;  2X4Y A;  4IUP A;  4EMK B;  2ZPB B;  3UWN A;  3VU3 C;  2PVO B;  4C92 G;  3V8L A;  1KC8 U;  2DTH A;  4C8Q E;  2D6F A;  1JBM A;  1WGS A;  2QEX T;  5CKD A;  3JCM P;  1N9S A;  3WXM B;  1PSF A;  1K8A U;  5LJ5 f;  3X26 B;  5FRN A;  4A53 A;  2DPP B;  5LJ3 f;  5FU6 B;  4L59 A;  3L2V A;  4MDW A;  2JN0 A;  2KK4 A;  2X4W A;  3FB9 A;  3GPL A;  2CZ6 B;  3WVE B;  5GAM g;  2GF7 A;  2EQU A;  3OMG A;  4F7U E;  1Y07 A;  3LLR A;  3BFM A;  2RK1 A;  2PUO B;  2PQW A;  1TH7 A;  4LDU A;  3JCM g;  1NPP A;  3QJY A;  1I5L A;  4DOW A;  2DXC A;  1KD1 U;  1VQ6 T;  3CCQ T;  1ZHI A;  1M4Z A;  3JB9 H;  5D6Y A;  2JUF A;  3J80 E;  3CC7 A;  4JRP A;  3A8M B;  4M78 C;  4M75 C;  3CCU T;  1KD1 C;  3CME A;  5GAN 6;  1YJN T;  3CPW S;  2P4T A;  4FIB A;  3OYD A;  4FL6 A;  4FSX A;  4PJO A;  1VQ8 T;  5FU7 C;  3P8D A;  4MZT A;  2QQR A;  3OS5 A;  4OP0 A;  5DLO A;  2PVD B;  2VXF A;  4XTZ A;  4J6X A;  2HD0 A;  4F7U G;  1QVP A;  5GAN 4;  2O4X B;  4BE1 A;  1X75 C;  3MCA B;  2H3J A;  4XTY A;  4JDS A;  4C8Q F;  4LDY A;  4QQD A;  2O4X A;  2VGN A;  3MET A;  1K9M U;  3CC7 T;  2X4J A;  4F7U B;  2FB7 A;  2HNI A;  3UDC A;  3INZ A;  5GAN 2;  2RHX A;  4R55 A;  1P92 A;  2RK2 A;  3QYH B;  3SB2 A;  4C0D C;  3CCV A;  3TCJ A;  2CS7 A;  5CKE A;  2E12 A;  4M7A B;  3CCE T;  3PT9 A;  4BDY A;  1YHQ A;  2NLU A;  2EYQ A;  2VYT A;  3QO3 A;  4M75 A;  4M78 A;  4N4I A;  2Y90 A;  5GMK h;  4E47 A;  5CQY A;  2GQV A;  2RH2 A;  3JB9 D;  3OYB A;  3GNF B;  3RIR A;  3RUX A;  1Q82 U;  5GAM j;  2QDY B;  3GNG A;  1UB4 A;  3FLG A;  5M9O A;  4M7D D;  4E7K A;  4ME7 A;  5CVI A;  5HK3 A;  4KT0 E;  4OF1 A;  1VQL T;  1R8O B;  2JTF A;  3OA6 A;  1VQN T;  4QW2 A;  4BE0 A;  5IAY A;  3NFC A;  5LJ3 j;  2RJF A;  2KMT A;  4ZTJ A;  1K73 C;  3CCL A;  2E6Z A;  3DLM A;  4M77 F;  2V8J A;  3X20 B;  3G6E A;  5CO7 A;  5DM7 R;  1M1K U;  4C0D B;  3UT1 A;  3M4G A;  3QUI A;  3PIP A;  3G7Z A;  2B8A A;  5KE3 A;  3NTK A;  3G4S T;  3UPU A;  2OTJ A;  5CKF A;  1KG1 A;  4C0Z A;  1Q86 C;  3PNW C;  4M77 C;  4M7A F;  4EPC A;  3X28 B;  2XDB A;  3CD6 A;  2BIV A;  5J26 A;  3CMA A;  1YIT T;  2ZCF B;  2DXT A;  2LNV A;  5A0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...