2MWOA

Solution structure of 53bp1 tandem tudor domains in complex with a p53k370me2 peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Plasticity of Methyllysine Recognition by the Tandem Tudor Domain of 53BP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/antitumor protein
molecule keywords Tumor suppressor p53-binding protein 1
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA01
1QVGS 2EQJA 4QVZA 3S3NA 3G71A 3CCMT 5KCHA 3CCQA 3CD6A 5KE3A 1RL2A 1WJSA 1YJWA 3OYEA 1M90U 3HKSA 4Q5WA 4BACA 4E7JA 1W2BA 3Q1JA 2JVVA 3OYAA 3OYKA 1KC8U 1BKBA 2EFIA 1UEBA 2VYTA 1VQ8A 3CCET 2JOYA 1Q7YU 2LCCA 1NPPA 3JAME 1VQKA 2LRQA 1VQ6A 1K8AC 3E9FA 1VQ4T 1VQOT 2LCLA 2QA4A 5DLQE 4PLIA 1XTDA 3PFSA 2GF7A 3G6ET 2RHIA 2WACA 5C6SA 3CD6T 5KE2A 3FLGA 1VQ7T 4IUPA 4FU6A 3ME9A 5KH6A 2RHUA 2XK0A 4CRIA 3CCQT 2B8AA 3P8HA 3DB3A 2OTJA 2L8DA 1M90C 3CCSA 2R58A 3FEOA 3NTHA 1S72T 5DM7R 1NJIC 5D6YA 4BD3A 2JTFA 3QKJA 3MEVA 4C5GA 1YJ9A 2RHXA 4UC4A 1IZ6A 3CCVT 1MHNA 3CCUA 3ZEHA 2QQSA 2RJCA 4N4GA 2LQ8A 3LGLA 4QQGA 3FC3A 5J3BA 2P0KA 4BDZA 4E7KA 3QBYA 4IUTA 2EQMA 1YJNA 5LL6S 1EIFA 4IURA 3LH0A 3CC4A 3CC2A 1NPRA 1VQ5A 1N27A 3OMCA 2O4XA 3CMAA 2RJFA 2M0OA 3OYGA 2E70A 3OYJA 3LX7A 1WJQA 2BKDN 4EDUA 1S72A 3L2VA 3H8ZA 1K73C 3PMIA 2K3YA 5IN1A 2R5AA 4Z02A 4BE2A 5A2QE 5FLXE 4YTLA 2GFUA 5J26A 2BUDA 2EKOA 3KBGA 3MEWA 2XHCA 1VQNT 3CPFA 3CCRA 4BE0A 1OYXA 4IUQA 1K73U 4A4FA 2DAQA 2GFAA 2RJEA 2G3RA 1VQLT 3CCLA 3EAEA 1Q82U 3MEAA 3LLRA 3G6EA 2CKKA 1NZ9A 3L42A 2OTLT 1KC8C 3OYFA 3DB4A 4C5EA 3OS2A 3CMAT 4GY5A 1YIJA 4X34A 1YITT 2E6ZA 1N8RC 3TREA 1KD1C 1KHCA 3KUFA 1Q86U 2QEXT 3ASKA 2E6NA 3NTKA 4HCZA 3CC7T 2EQUA 3H6ZA 3MP1A 4L59A 3SD4A 4B9XA 3CC7A 3C4SA 2JZ2A 1K8AU 3UT1A 3MP6A 1VQOA 2LDMA 3L2WA 2LVMA 3CXCA 4ZN1A 1K9MU 2O4XB 1SSFA 2RJDA 3A5ZB 1YI2A 5KCOA 3META 4QQ6A 3CCST 3FDRA 4IKFA 3S3OA 1VQLA 4OVAA 4RG2A 2DO3A 3O8VA 3LYIA 3J81E 2LTOA 2EQKA 1OZ2A 3PMTA 1WGSA 4PL6A 2MWOA 5D6WA 4C5IA 2QQRA 2KVQG 1VQ4A 1VQMT 5FRNA 4BDYA 1YIJT 2BIVA 3S6WA 2IG0A 1YHQT 3L2UA 1YJ9T 5D6XA 2RHYA 1Q81U 4NS5A 2L3RA 4N4HA 2OTLA 1OI1A 3OQ5A 2JNGA 1YHQA 4PLLA 2K3XA 3P8DA 3I55A 3CC4T 2D9TA 2YRVA 4LD6A 3CCJT 3PIPA 3CXCS 3DLLA 2RO0A 2OTJT 5IAYA 1M1KU 1VQNA 2F5KA 1KD1U 2KDSA 5C0MA 1Q86C 3E9GA 3L2RA 3MEUA 3OYYA 2RI3A 5HY6A 3PIOA 2DIQA 1VQ9A 3OYBA 3CC2T 2HQXA 4A4HA 5FRMA 2MI6A 3CPWA 3BDLA 3G4SA 4FL6A 3CCEA 1M1KC 5FROA 4ZN3A 3CCVA 1YJWT 1RI0A 1YITA 3P8BB 3UWNA 1KQSS 1VQ8T 3CMEA 1VQPT 2JUFA 3OW2A 2QEXA 1Q81C 3LGFA 2E5QA 3OA6A 2DIGA 1K9MC 3QIIA 2NLUA 3OMGA 3OW2S 1XNIA 3OS0A 3OYDA 2QA4T 4E7IA 1YI2T 1W2BS 4BE1A 4ZTJA 3I56A 3PNWC 2EIFA 1YBYA 3G71T 3CCMA 4IUUA 3ER0A 3CCJA 1N8RU 2X4XA 5J39A 1VQ5T 2RI5A 1QVGA 3OYMA 2HQEA 2MWPA 3I56T 3QJ6A 2XDPA 3MO8A 2L89A 3L2QA 3NTIA 1VQMA 1KQSA 3OB9A 1JJ2A 3J80E 3OYHA 1VQ6T 3CCLT 3CCRT 2R5MA 4QW2A 4N4IA 4B9WA 3OYCA 1VQ9T 3CCUT 1VQ7A 4E7LA 4A4GA 2X4YA 3CMET 1VQPA 1H3ZA 3G4ST 3M9QA 3DLMA 3CEYA 4A4EA 3I55T 4IUVA 5CIUA 3S3MA 1X6OA 2M1HA 3OYLA 1Q7YC 1KHIA 2R57A 2RHZA 2PQWA 1OZ3A 4E7HA 1Q82C 4C5HA 2RI2A 1QVFS 1G5VA 2X4WA 2X35A 3OS1A 3J7AF 3F70A 5IT9E 1JJ2S 1NJIU 3CPWS 5M9OA 3GOXA 3MP8A 1VQKT 2FHDA 1M1GA 2M16A 3OYIA 1WJRA 4II1A 4TVRA 1QVFA 3OYNA 4QQDA 4ZTFA 3OY9A 1YJNT
chains in the Genus database with same CATH superfamily
3JB9J 1K0XA 5LJ3g 3CCMT 3G7ZA 2WSCE 2YT6A 3ZL7C 3HKSA 5IXBA 1YIJQ 3SEMA 2DBKA 1G3SA 1RADB 1U8RA 4MZMA 3I5SA 1ARKA 2EFIA 4V2SA 3M53A 2HSEB 1M9SA 2WSEE 1X43A 1ABQA 1MV3A 3VRYA 2E3IA 2ATCB 3PTAA 1VQKA 1TH7A 5IXFA 3E9FA 1VQ4T 4ELYC 5HK0A 4PLIA 6AT1B 2A0FB 4J8OA 1XTDA 4PJMA 4B6MA 3GNFB 3PFSA 4D8DA 3G6ET 1M4ZA 2RHIA 3QSUA 2DILA 1C6VX 5L23A 1CKBA 2FRWA 2YSQA 2YUOA 1K76A 3FLGA 1ZUYA 1YJWQ 2RHUA 1M27C 2VV5A 2RNAA 1VQPQ 2EGAA 3CCQT 2H3EB 2OTJA 2HL3A 1M90C 4M77C 2R58A 4J6XA 2JTMA 3LH5A 4C0GA 1H92A 1Y57A 1S72T 5DM7R 2VGMA 1SF9A 1AWWA 4UC4A 2RHXA 4NL3A 1NEBA 3CCUA 1V1CA 3RDVA 4PFOA 2QQSA 2BZYA 2GTJA 3M0TA 2QAZA 1U1SA 1NM7A 2EAYA 2LQ8A 3VYHB 1YJ9Q 4BDZA 5LJ3h 3QBYA 2QDYB 2D8JA 2V8KA 4RCBA 1EIFA 4IURA 3T9NA 3MCAB 1NPRA 4M78A 2DEQA 2RD1A 3TVTA 1N27A 2O4XA 5FW9A 2M0OA 1RAFB 4XU2A 2ENMA 4M78D 3RMSA 2AZVA 2E41A 4ORZA 2KROA 1B7TA 1MNDA 3PMIA 2K3YA 2K6DA 1K9MR 1A0NB 2R5AA 4C8QA 3G1JA 1HXDA 3N5BB 3PGGA 4DOVA 2J6KA 2BUDA 3TEEA 4KH1B 2XG8D 2O9SA 1OYXA 4M75G 1K73U 2M51A 4A4FA 2GFAA 1NYFA 4E6RA 1EZZB 1JU5C 4DBQA 1QW1A 1YCYA 3UDCA 3CD6Q 2A7YA 3G6EA 3HRTA 2BE9B 1BK2A 2RK2A 5GAN6 4C5EA 5GMKj 3BFMA 1AHJB 1UFFA 2ESWA 4GY5A 1YIJA 2ZPEB 2NUTA 4J9FA 1GL5A 2QEXT 1NBEB 5CO7A 4C92C 4WCIA 4HCZA 4EMKA 2QASA 1JO8A 3IQLA 3E19A 4XTWA 3BE3A 3H6ZA 4L59A 1UGPB 1VQOQ 1QKWA 1OV3A 1IGQA 1OU9A 2DNUA 2WSFE 4MZTA 4BI4A 3A8HB 1VQ6Q 4PJOF 3L2ZA 2Y4XA 2LDMA 5GANg 2KXDA 2EJGA 1WHJA 4ZN1A 2ZAEA 2OTLQ 3QDFA 2LJ1A 1SHGA 3META 1R0CB 2KBTA 3EG9A 3NMZC 3CCST 2VC8A 1X6BA 4BI8B 3QXEB 1Q7YR 1TXQA 1YWOA 1S1NA 3VRZA 2KT8A 2DVEA 1UE9A 3WVEB 1HSQA 3O8VA 3LYIA 5AT1B 2EQKA 4XK8E 4M7AC 4PL6A 1ABOA 3VS4A 1SKUB 2O31A 2QQRA 1X27A 2GGRA 2KNBB 2KVQG 1Z9ZA 3RERA 1T3SA 1VQMT 3LWHA 2FO0A 1RABB 4BDYA 1M1FA 3REBB 2HCKA 4GLMA 8ATCB 1M3AA 2ZCFB 1YJ9T 2RHYA 4MMKA 2L3RA 4N4HA 4M7DD 1D3BA 1OI1A 1YHQA 2FVUA 1MMNA 2IVWA 3I55A 4C0DC 2AIRB 3CC2Q 1SG5A 3CXCS 3UATA 2QDLA 1VQNA 4EMGA 5LJ5h 3JCMf 3E9GA 4FYWB 4MDWA 3QWXX 3CCLQ 1X6GA 1ZSGA 2E12A 2MMPA 4OMNA 2DIQA 2O01E 4JZ3A 4FT4A 4PJOC 2JJ9A 3CC2T 2HQXA 3M0QA 2MI6A 3VJPA 3G4SA 4OP0A 4PK4A 3CCEA 3E2UA 2DE0X 4CC3A 1RAGB 3CCVA 2YWWA 5I2MA 3WXMB 4A53A 2XU8A 1I4K1 1RI0A 3P8BB 2FB7A 2K5FA 1VQ8T 1VQPT 2VXEA 2PTKA 3OSVA 2HKQB 4AFUC 2QEXA 4LUEA 4GBQA 4L6V5 3QIIA 3M0UA 1BI2A 4J9BA 1ZLMA 3OMGA 4LD9K 5GAMd 3OW2S 4XTYA 1VOMA 4FIBA 2E65A 1W2BS 2K3BA 4ZTJA 1QWEA 2HL5C 3HPWA 4C92A 5GAMg 2KK4A 3CCJA 1B34A 4JS5A 3V8JA 4CI0C 4IIOA 1Y96A 5GAOm 2CH4W 3CCMQ 1NE8A 1WDXA 2DFUA 4PFZA 3OYMA 2QTXA 4KGXB 2XDPA 3OSSC 2L89A 1I5LA 4M78F 4M78B 5GAN7 1KQSA 4AG1C 1V29B 5CVIA 1MNEA 1PCXA 5CK9A 1AD5A 3J80E 2EBPA 1WXBA 1EX4A 2RF0A 3EHRA 4QW2A 1WHGA 5LJ5e 1VQ9T 1M1KR 1R0BG 1VQ7A 3CC4Q 4A4GA 2GQVA 1OX9A 4LDXA 1LCKA 2DL7A 3GNGA 2XICA 1G3TA 1W2BP 3CBOA 4F14A 2J6OA 2KGTA 1K9AA 3OYLA 1Q7YC 2XKOC 5IH2A 4C5HA 2LC4A 2M0YA 1FXXA 3J7AF 2AT1B 2E4HA 2H3JA 3VUBA 4C92B 4F04B 3JB9D 1YHQQ 4C92E 1WHKA 2QQBA 1J3TA 3I55Q 1NJIU 5M9OA 1BU1A 2RA2A 1BB9A 3MP8A 4M4ZA 1UGQB 3CCRQ 1AEYA 1UJYA 1Q81R 2VUBA 2QA4Q 1QVFA 1I8FA 2ECZA 4ZTFA 4LDWA 5FU6C 2VKNA 4QVZA 3CCQA 3CBPA 1TUCA 1RL2A 1WYXA 2X3XD 4HCCA 1WJSA 4RCCA 2DK3A 1M90U 1M2VB 4BACA 4E7JA 2KAFA 1D0ZA 2VWFA 4M78E 4M75E 3CCSQ 1W2BA 2JVVA 2K2MA 1QVPA 3OYKA 2CUDA 1KC8U 2DRMA 3X25B 3TU4K 1UEBA 2D8HA 2VYTA 1VQ8A 3CCET 1YFNA 2QGFB 2JOYA 2LCCA 1Q7YU 2EKHA 4ZGJB 1E6GA 2W10A 2FPDA 5GAN5 2J06A 4F7UE 2LCLA 1VQOT 2XMFA 3UF4A 1PWTA 5GMKm 2DX1A 2OI3A 5C6SA 1HK9A 5KE2A 3A1PA 2JXBA 2ROLA 5GAN2 3EG0A 3JB9F 3C12A 5I11A 2B8AA 1WHMA 2L8DA 4F7UB 4P5NA 1U3OA 4M77E 2GQIA 5IHIA 4KUDK 1QQJA 3RKYA 1PC0A 4CC7A 3R6NA 2RN8A 2KEAA 1Y0MA 2YHTA 3PE0A 1QP2A 1VQ4Q 1YJ9A 2NUTB 1WIEA 1MHNA 1HYOA 1AT1B 1UHFA 2EGCA 3JCMP 3ZBDA 4QQGA 3LGLA 3QZ9B 2P0KA 4E7KA 4J9CA 2J05A 5HCKA 1KD1R 1ZX6A 2EYXA 2EQMA 4Z88A 1SHFA 1BBZA 4OB1B 3CC4A 5FWBA 1TG0A 3OMCA 3U23A 1E7OA 2RJFA 9ATCB 3CMAA 1UECA 4M75D 1TUDA 2CZ6B 1KQ2A 2GTOA 4FT2A 5GJVB 1E6HA 4J9IA 5CCAA 5CR2A 1VQ5Q 1IRXA 1X75C 3LX7A 2FZGB 1WJQA 4LXCA 4WTOB 1S72A 5KYYA 4C92D 2L2PA 3JCMX 2V8JA 1OPKA 3VYGA 4D6WA 2DJZA 3PVLA 3EG3A 4M77D 4O6JA 2DLPA 4BI3A 4PJJA 2AZSA 3CCRA 2CP7A 1JRIA 2LJ0A 3CQTA 4J7FA 4Z8AA 1VIEA 3SHWA 2GNCA 3FJ5A 2F2WA 3EAEA 1RLPC 5LJ3j 4KBMB 2VASA 5KYWB 1TUGB 2OTLT 2NUZA 3RNJA 4E7ZA 2X4JA 3X20B 1WHLA 3JB9I 3CMAT 5LJ3f 3SDZA 3UPUA 1YITT 1ZSZB 3OS5A 3TREA 1KD1C 2K57A 3SWNB 2CP6A 2ZGWA 3RESA 1Q86U 2E6NA 1ZA2B 1YITQ 2OTJQ 1UB4A 4M75C 4M78C 2EQUA 5ECAA 2FYKA 4B9XA 4J9GA 2PVOB 4A63B 3CC7A 1BYMA 2A08A 1KQ1A 3UT1A 5LJ5d 2CP2A 4IIMA 5DY9A 1VQMQ 2FZCB 2LVMA 2QGGA 2RK1A 2FL7A 2L3PA 3MHXA 3CXCP 2RJDA 4F17A 1BI1A 1O75A 1ZQ1A 5KCOA 1GXIE 3QZ5B 4FSXA 4QQ6A 1WHHA 3G6EQ 2CSIA 4DBRA 3FDRA 4IKFA 2EPDA 2AHJB 3JV3A 3H0FA 3S3OA 2KXCA 1VQLA 1OU8A 4KRTA 4OVAA 2DKGA 5CKHA 2DEUA 4RTVA 3HRUA 1KFZA 1KK7A 2CT4A 2Y4YA 4HT8A 1YP5A 2KYMA 3JCMg 2RQWA 3NGPA 1OZ2A 3PMTA 2X9HA 2DXTA 1OEBA 5KYUA 4R0KA 3VS2A 4QKUA 3M0PA 4AFZC 2F2VA 2DL4A 1V76A 1M3CA 4M7DA 5D6XA 4RTUA 5KYUB 4OB0B 2OTLA 2I2LA 4PLLA 3RR6A 3CCJT 2CDTA 2OTJT 5IAYA 1BIBA 3JCMQ 1M1KU 2KDSA 4JUVA 4Y91A 2LNHB 3VS1A 2RI3A 5FU7C 1T3LA 3TQ7P 3PIOA 4C92G 3OYBA 5I22A 1LNXA 1U1TA 5GANd 1Y7XA 2YRCA 1IREB 2LCSA 1MMDA 2GCXA 3CPWA 4HXJA 4FL6A 5FROA 4ZN3A 4M7AE 4LDVA 4DBHA 1PG5B 1WZOA 1TOVA 1Y07A 3UWNA 2HNIA 1KQSS 1W70A 2V1RA 1Q81C 2YLBA 4M7DC 4M77A 2VGNA 1VQNQ 3OS0A 3H0HA 1TTHB 1WA7A 1YI2T 1D1BA 2G6FX 1ZUKA 4M77B 3I56A 1UDLA 1R77A 1QP3A 4RTTA 3CCMA 1I0CA 4IUUA 3I5RA 3WVDB 2L3SA 2B86A 2X4XA 2HEQA 5J39A 2RI5A 3QYHB 4FW2A 3I56T 4KGZB 2EQIA 2LP5A 3QJ6A 5L8RE 1KJWA 2HAXA 1ZSZC 5LJ3d 3L2QA 3OBYA 1VQMA 1B34B 2QEXQ 4OB2B 1FYNA 3OB9A 1PKTA 3A98A 2D0NA 2RM4A 4XTXA 1W1FA 1GBQA 4MDXA 4AFSC 3CCLT 2R5MA 2HD0A 3HHTB 2CS7A 4JRKA 4B9WA 3OYCA 3CCUT 5GANh 4E7LA 4JJBA 4RMOA 4C8QG 2XDBA 1W4SA 3JCMW 3M9QA 1X2KA 3HFNA 1MMGA 1VYTA 1F1BB 3V8LA 4IUVA 5CIUA 1UJ0A 2P0PA 3S3MA 4OB3B 1WI7A 2M1HA 1D1AA 1KHIA 5CKFA 2R57A 3QO3A 1IXDA 2PQWA 4M77F 4M75F 2DRKA 4E7HA 1Q82C 4M7DF 3VU3C 3CCUQ 4JRQA 5GAOn 1QVFS 1TWBA 1NEGA 4X1VA 1M2VA 4JJCA 4R55A 2MF2A 5IT9E 2X3WD 1JJ2S 2K5LA 2CZ0B 1VQKT 1M1GA 2ZZDA 3QYGB 2MOXA 5GAN4 3OYIA 3E1SA 2JN0A 3OYNA 2QXFA 1Q82R 1CSKA 1YJNT 4FYYB 2RMOA 2VXFA 1I1JA 2EQJA 2J6FA 2HBPA 1QVGS 3S3NA 3G71A 5KCHA 2LJ3A 5KE3A 4CC4B 3JSCA 2YUPA 4ESRA 2JTEA 2DTOA 3ULRB 3OYEA 5GMKe 4Q5WA 1M8MA 5HK3A 4QVDA 3NFCA 1BKBA 1HD3A 1YCSB 2LZ6B 1NPPA 1P92A 3JAME 2H8HA 3C95A 4Y92A 4E47A 2QA4A 5DLQE 2FPFA 4Y28E 2GF7A 4LNPA 2WACA 4O5VA 5KYXB 3CD6T 4J83A 3JCMb 4E7SA 3TSWA 1VQ7T 2AK5A 4JRIA 3ME9A 1VQ7Q 5KH6A 1QVGP 2XK0A 3THKA 3P8HA 3DB3A 2RH2A 3CCSA 2BE7D 3M59A 3RMQA 4C0FA 1WNLA 2KRMA 2LT1A 1GCPA 3M55A 5D6YA 5GANf 2EJ9A 4BD3A 4DBFA 3QKJA 3R6OA 4C5GA 4XTVA 1IZ6A 3VUZA 2YRDA 2LT4A 4RTWA 3ZEHA 2RJCA 2A3LA 3I9QA 2MAMA 5J3BA 2DMOA 4IUTA 4J5YA 1YJNA 1PD0A 3REAB 3LH0A 5GAMe 3X24B 5KYNA 2QQAA 4NOYA 2XI9A 3EFRA 2DXBA 2RB6A 3BW1A 3HFOA 2E70A 4DQ2A 3OYJA 4PNOA 3VS5A 2LNVA 1WQ7A 5GJWB 2DL3A 4EDUA 5AYFA 2PVDB 2PUKB 3L2VA 4A54A 4EMKB 1UGRB 5FLXE 2OJ2A 4YTLA 2GFUA 2EKOA 5I2SA 1MV0B 2C0IA 4JLIA 1UG1A 2V26A 1VQNT 1ZBJA 1CKAA 3CPFA 1VQ8Q 3H9NA 4BE0A 3EFOA 1M30A 2M02A 4RTZA 1LPLA 4IUQA 4M78G 2DAQA 1IO6A 2G3RA 1UGSB 2MYSA 4PKCC 2RQUA 2ZPGB 1VQLT 3CCLA 2PVGB 1Q82U 3MEAA 1PRLC 2CKKA 2DTIA 3JRZA 1QCOA 3OYFA 1VQ9Q 3OS2A 2AKLA 1N6AA 1QVFP 3G4SQ 1GBRA 4X34A 3CCEQ 2PUOB 3EGXA 3CCVQ 1HJDA 3VS7A 2ZPFB 1KHCA 2LQWA 3KUFA 1NLOC 1M8VA 2DZ9A 1NYGA 1B07A 3CC7Q 1PRMC 1BCMA 3CC7T 3MP1A 3V7SA 1ZUUA 1KG1A 3SD4A 3C4SA 2JZ2A 2CH4A 4M7DG 2CGHA 3MP6A 4C8QB 1GCQC 4C0ZA 1VQOA 1KIKA 1YWPA 5CQYA 1VA7A 1OOTA 1ACMB 2JM9A 3A5ZB 1YI2A 3I35A 4KH0B 4MMLA 5GAMh 4M7DB 1AWJA 2LQNA 2PU9B 4OGEA 2CP3A 1LJOA 2P4TA 2QI2A 2NUPB 4RG2A 2V1QA 3H0IA 2DO3A 5D7UA 1PD1A 1AZGB 3V7CA 4EPCA 4RTXA 2EW3A 2BZ8A 1M90R 3J81E 4JJDA 4F7UA 2OX7A 3UA6A 2MWOA 5D6WA 3RKWA 2K5IA 4KUIA 1D0XA 1G8XA 3QDRB 1VQ4A 2ABLA 2CZ7B 1GFCA 2K7AA 1JJ2P 5FRNA 1YIJT 2KT1A 3S6WA 4ZGEB 2IG0A 1N9SA 5KYXA 3EH1A 1D09B 2I0NA 2MPXC 4NS5A 1Q81U 1MGQA 1WXUA 2C0OA 5GMKl 3GIBA 2JNGA 2K3XA 3P8DA 2CSQA 4RUGA 3PT9A 2YRVA 4LD6A 1D3BB 3PIPA 1NJIR 4RG8A 2RO0A 2DPPB 2F5TX 1JXMA 3L2RA 5GAMf 3EFOB 1GFDA 3MEUA 3OYYA 1FMVA 3SB2A 3SFMA 5LJ5g 3GLXA 1H8KA 1AZEA 5GANj 1VYUA 4D8KA 2W0ZA 1ZA1B 4HT9A 4LDUA 3BDLA 4RKUE 1M1KC 2NUPA 1BI3A 1YJWT 1K0SA 1WLPB 2KR3A 1LOJA 4XQ3A 5GMKh 4JLGA 2A36A 3DKMA 2JUFA 2P0QA 2SRCA 2DYIA 4BY6B 3LGFA 1XJWB 3RUXA 1K9MC 2NLUA 4JZ4A 1Z9QA 4C92F 2CT3A 4ANJA 2E1HA 2JS0A 5FU6B 3CMEQ 1SEMA 2HKNA 1XNIA 3OYDA 2EYZA 2QA4T 1GCQA 2K4YA 1TS9A 2K79A 2CP0A 4BE1A 2RQVA 1Y71A 1WFWA 3H41A 4BB7A 4HVUA 1YBYA 1ZHIA 2M9UA 2F69A 4XU3A 2KE9A 3EGDB 3FRNA 1N8RU 2MCNA 2P84A 1VQ5T 1B3QA 3X28B 2QG9B 2DD4A 2HQEA 4JRPA 1RAEB 3JCMJ 2DXCA 1VQKQ 3CBMA 3NTIA 3JB9G 2FEIA 3M54A 5CKDA 3QUIA 4AT1B 5GAOl 1Q95G 2DBMA 4AMCA 3HSBA 2COZA 2E10A 2EJFA 3MKDA 2ED1A 2D6FA 3BY7A 3CCRT 5EC7A 2LX7A 4ELZC 2P4RA 3KXTA 2X4YA 1VQPA 4PFPA 1H3ZA 3G4ST 3DLMA 3KFVA 1PHTA 4KULA 1SRLA 4A4EA 4M7AA 2JMCA 1SSHA 4J7IA 3VKIA 2KRNA 1QLYA 4R56A 1RAHB 4ATOA 4J9HA 2DM1A 1MUZA 2RHZA 2O88A 3C0CA 1OZ3A 2DTHA 2F1LA 1G2BA 4NL2A 2K2VA 4HVWA 3V8KA 2EWNA 3SWNA 1G5VA 2X4WA 2X35A 3OS1A 1DJ7B 2IIMA 1OQKA 3F70A 1RUWA 2PNIA 5CKEA 4OF1A 3SWNC 2KRSA 2YUQA 1UUEA 2DJQA 4J6YA 3GOXA 4LE9A 2FHDA 4M75B 4A4KA 3M56A 1UHCA 2DXUA 4II1A 4TVRA 2KQWA 2ZPBB 3M4GA 1OULA 3OY9A 4E2FB 3AHUA 1D0YA 5IHKA 4XU1A 3NHNA 1OPLA 5FWCA 2AKKA 3CD6A 2EGEA 2KSSA 5LJ3e 2EYYA 3MPUB 4PJOD 1I07A 2HSPA 1YJWA 1H641 3JCMd 5GAOr 1G3YA 3Q1JA 3OYAA 1X2QA 1T0HA 2V8IA 1AVZC 1PNJA 1Q86R 1U06A 2RPNA 1ZSZA 1NG2A 1ZBXA 3V7RA 3O5ZA 2RQRA 1AWOA 2CREA 3HTRA 5HKCA 3QG1A 2LRQA 1VQ6A 1JXOA 2GBQA 3VV0A 5GAN3 1K8AC 3PVQA 1RAIB 5A0DA 3EG9B 4OGCA 4HKEA 3M4YA 1RI9A 4N0AC 4ZNXA 4L5GA 2KYBA 4IUPA 4FU6A 4WF2A 2PZ1A 3CMAQ 2YLCA 4C8QC 2D0QB 4CRIA 4M75A 1IHWA 4EMHA 2JT4A 1AWXA 3FEOA 1LVKA 3NTHA 2DERA 3M0SA 3MJXA 4LUDA 1NJIC 2A37A 3RKXA 2D1XA 4RTYA 2JTFA 2KI7A 3MEVA 1N9RA 2XD0A 4PJOE 2QTVA 5CAIA 3CCVT 2VB6A 2CP5A 4C8QF 2EYWA 3JCMc 1AOJA 4N4GA 3FC3A 4MZPA 4XTZA 4PJOB 1K8AR 2VVKA 1FWZA 1BCOA 3JCMV 3OW2P 4M7AF 2NYSA 5LL6S 1UGVA 5GAOp 3BDUA 3M0RA 1VQLQ 1PSFA 4M77G 3CC2A 2XIDA 2O2OA 2HMAA 1VQ5A 1JB0E 5KYWA 2COWA 3EFSA 2CZ1B 3ZFJA 2BZXA 3VS0A 4X9DA 4Z89A 3OYGA 3AT1B 1R8OB 1GRIA 4F7UF 1BIAA 4GLKA 3G71Q 2BKDN 1FMWA 3NPFA 4J9DA 1N8RR 1XOVA 2FRYA 4F16A 3A8MB 3H8ZA 1YN8A 2ZPIB 1K73C 3GBQA 5IN1A 1WQWA 4Z02A 3VS3A 4BE2A 1FMKA 4DOWA 1S72Q 5A2QE 2COYA 1KC8R 5FU7B 5J26A 4HVVA 2YDLA 3C94A 4HA8A 4BY6C 3KBGA 3JCMe 1X69A 3MEWA 2XHCA 1WX6A 2ZPHB 5CKBA 1NLPC 4JJNK 2A28A 1QCNA 3GP8A 2RJEA 1M3BA 2DD5A 3LLRA 1QKXA 1NZ9A 1W6XA 3L42A 1KC8C 3A8OB 3DB4A 1QMCA 2C0TA 7AT1B 2LMJA 4XTUA 2J7IA 1EFNA 3QPHA 1K73R 1K1ZA 1FX7A 4M7AD 2FPEA 1Y96B 2E6ZA 1N8RC 5KYYB 2L3QA 8AT1B 3QHSA 3ASKA 3EGDA 3NTKA 3LWIA 4FCYA 5GMKi 2ROTA 1K4US 3JB9H 5LJ5f 4LN2A 4HCBA 1TU0B 1I5OB 3HL8A 1K8AU 2OAWA 1JQQA 4JDSA 4DA4A 2HDAA 1VUBA 2ED0A 2BTTA 3L2WA 5LJ5j 3CXCA 1XQHA 1K9MU 2O4XB 1SSFA 3OBWA 5GANe 5A0LA 2DA9A 3I56Q 2QQ9A 3TSZA 3X26B 3GF5A 2L0AA 1WPYA 1OX8A 1YJNQ 1H3HA 3EHQA 1RAAB 4FYVB 3LW5E 2LTOA 4AFQC 4PJOA 1TSFA 4C5IA 1WGSA 2YUNA 3M57A 2C06A 2DL5A 3QJYA 1T0JA 2OAUA 4XAXB 4X9CA 1YNZA 2Z0WA 1KQSP 3D7SB 2DVJA 1G3WA 2BIVA 4J9EA 1JEGA 1YHQT 2EYQA 3L2UA 3FIFA 1IB8A 1D1CA 1PKSA 3OQ5A 1RLQC 1M5Q1 2HBWA 2X51A 4K11A 3CC4T 4XU0A 2EVRA 2D9TA 5GAN8 3HRSA 4JPBW 4KT0E 2JMAA 2LQKA 3DLLA 1QCFA 2KY9A 2F5KA 1KD1U 5C0MA 1VIFA 3UA7A 4BUGA 2IPOB 1Q86C 2F2XA 2HQHA 4DEXA 2MIOA 1N5ZA 3L1AA 4OMQA 2E64A 5HY6A 2JM8A 2LX9A 5I21A 1JBMA 2QK0A 5GAMj 1VQ9A 4KGVB 3A8LB 3CCJQ 4PJNA 4JS4A 4FM4B 4A4HA 5FRMA 4OMMA 3EGUA 4M7AB 4FW1A 3TCJA 1I81A 2QYZA 5CQXA 2K9GA 1YITA 1M2OA 5A0GA 1IGUA 3CMEA 3OW2A 3QWYA 2E5QA 3OA6A 2DIGA 3CPWP 4HCKA 1O9SA 3M58A 2CYZB 2L5QA 2FZKB 4J6WA 4E7IA 2HZYA 5GAOq 2DF6A 3A8GB 1YI2Q 2O9VA 4M7DE 3PNWC 2EIFA 1MMAA 4DEYA 1KSWA 3RIRA 3G71T 4M7AG 4EMKC 3ER0A 4N0AA 4VUBA 4OMFB 2MK5A 3FB9A 3RBBB 3VS6A 4C8QD 4F7UG 1QVGA 3EG2A 2CUBA 2DL8A 2MWPA 1SPKA 1QWFA 2NWMA 4FYXB 4EIKA 4ME7A 4C0DB 2DYBA 3EGXB 3MO8A 5IHNA 4OMOA 2RQTA 3EG1A 4QVCA 5EG2A 1G83A 2KMTA 1JJ2A 4FSSA 1C1AA 2FG0A 4CC2A 3OYHA 1UTIA 4AG2C 1VYVA 1VQ6T 4N4IA 1WXTA 2YXYA 1RACB 3CMET 4ZGDB 1U5SA 3FJPA 4PJOG 4PJLA 3CEYA 4OMLA 3I55T 3CCQQ 1X6OA 1BI0A 2XDDA 3JCMh 2JS2A 1PSEA 2JW4A 1IHVA 2DETA 2RI2A 4QT7A 3INZA 3HP9A 2Y90A 1C0MA 2DZCA 1PM3A 4C8QE 1X01A 3URGA 3CPWS 4LDYA 2E5KA 5DLOA 3EH2A 2M16A 3GPLA 1WJRA 4QQDA 2E3HA 3M5AA 2SEMA 1SRMA 4OMPA
chains in the Genus database with same CATH topology
2EQJA 1QVGS 2HBPA 4QVZA 3JB9J 3S3NA 4XU1A 5LJ3g 3G71A 3CCMT 5KCHA 3CCQA 3CD6A 5KE3A 3G7ZA 2KSSA 3CBPA 2WSCE 5LJ3e 3JSCA 1RL2A 4HCCA 1WJSA 4RCCA 4PJOD 2DK3A 2DTOA 1YJWA 3OYEA 5GMKe 3HKSA 1M90U 4Q5WA 4BACA 1H641 3JCMd 4E7JA 2KAFA 4M75E 4M78E 1G3YA 5GAOr 1W2BA 3Q1JA 2JVVA 3OYAA 1G3SA 5HK3A 4QVDA 1U8RA 1QVPA 3NFCA 3OYKA 1KC8U 4MZMA 2V8IA 3X25B 1BKBA 3TU4K 2EFIA 1UEBA 2VYTA 4V2SA 1VQ8A 3M53A 3CCET 1M9SA 2WSEE 2JOYA 1ZBXA 2LCCA 1Q7YU 3V7RA 1NPPA 1P92A 4ZGJB 5HKCA 3JAME 3PTAA 3QG1A 1VQKA 2LRQA 1VQ6A 3VV0A 1TH7A 3C95A 5GAN5 5GAN3 3E9FA 1K8AC 1VQ4T 4ELYC 4F7UE 2LCLA 4E47A 2QA4A 1VQOT 5HK0A 5DLQE 4PLIA 4J8OA 5GMKm 4Y28E 1XTDA 5A0DA 3GNFB 2GF7A 3PFSA 4OGCA 1M4ZA 2RHIA 4HKEA 2WACA 5C6SA 3G6ET 3QSUA 3M4YA 4O5VA 4N0AC 1HK9A 3CD6T 5KE2A 3FLGA 4L5GA 4J83A 3JCMb 5GAN2 4IUPA 1VQ7T 4FU6A 4JRIA 4WF2A 3ME9A 5KH6A 2RHUA 3JB9F 2VV5A 2YLCA 2XK0A 4C8QC 2D0QB 4CRIA 3CCQT 3C12A 4M75A 2B8AA 4EMHA 3P8HA 3DB3A 2L8DA 2RH2A 2OTJA 1M90C 3CCSA 4M77C 4F7UB 2R58A 3M59A 4P5NA 3RMQA 4M77E 4KUDK 4C0FA 3FEOA 4J6XA 2JTMA 3NTHA 3RKYA 1WNLA 4C0GA 1S72T 2LT1A 3M55A 5D6YA 5DM7R 5GANf 2EJ9A 3RKXA 1NJIC 4BD3A 2VGMA 2JTFA 2YHTA 1QP2A 3QKJA 3MEVA 3R6OA 1N9RA 4C5GA 2XD0A 4PJOE 4UC4A 2RHXA 1YJ9A 4XTVA 1IZ6A 5CAIA 3VUZA 4NL3A 4C8QF 1MHNA 3CCVT 3CCUA 2LT4A 3JCMc 3ZEHA 2QQSA 2RJCA 3JCMP 2A3LA 1U1SA 3ZBDA 2EAYA 4N4GA 2LQ8A 3LGLA 4QQGA 3VYHB 3QZ9B 2MAMA 3FC3A 5J3BA 2P0KA 4BDZA 4MZPA 5LJ3h 4E7KA 4XTZA 4PJOB 3QBYA 1FWZA 2QDYB 4IUTA 2V8KA 4J5YA 3JCMV 2EQMA 4M7AF 4RCBA 1YJNA 5LL6S 1EIFA 4IURA 5GAOp 3BDUA 3LH0A 4OB1B 3X24B 3T9NA 3MCAB 5GAMe 3CC4A 1PSFA 2QQAA 4M77G 4NOYA 3CC2A 2XI9A 1NPRA 2XIDA 4M78A 1VQ5A 3EFRA 2DEQA 2RD1A 1JB0E 1N27A 2DXBA 2RB6A 2O4XA 3BW1A 3OMCA 3EFSA 3CMAA 2CZ1B 2RJFA 3HFOA 3ZFJA 2M0OA 4X9DA 4XU2A 4M75D 2E70A 4DQ2A 4M78D 2CZ6B 1R8OB 3OYGA 4PNOA 3RMSA 3OYJA 2LNVA 4FT2A 1KQ2A 4F7UF 2E41A 1WQ7A 5CCAA 5CR2A 1BIAA 4GLKA 1X75C 3LX7A 1M1KU 1WJQA 2BKDN 4EDUA 5AYFA 2PVDB 2PUKB 1S72A 1XOVA 3L2VA 3A8MB 4C92D 3H8ZA 2ZPIB 1K73C 3PMIA 2K3YA 5IN1A 4A54A 4EMKB 1WQWA 2R5AA 4Z02A 4C8QA 4DOWA 1HXDA 3JCMX 2V8JA 5A2QE 4BE2A 3N5BB 3PGGA 4DOVA 1UGRB 3VYGA 5FLXE 4YTLA 2GFUA 5FU7B 5J26A 4D6WA 2BUDA 2EKOA 5I2SA 2DJZA 3C94A 4HA8A 4BY6C 3JCMe 3KBGA 4JLIA 3MEWA 2XHCA 1VQNT 2ZPHB 4M77D 3TEEA 3CPFA 4O6JA 5CKBA 4BI3A 2XG8D 3AHUA 3CCRA 4JJNK 1JRIA 4BE0A 1OYXA 4M75G 4IUQA 4M78G 4A4FA 1K73U 2DAQA 2GFAA 4J7FA 3GP8A 2RJEA 2G3RA 1VIEA 1UGSB 4PKCC 2DD5A 2ZPGB 1QW1A 1YCYA 2PVGB 3EAEA 1Q82U 1VQLT 3MEAA 3UDCA 3CCLA 3LLRA 5LJ3j 2A7YA 3G6EA 2CKKA 1NZ9A 4KBMB 2DTIA 2RK2A 3HRTA 3JRZA 3L42A 2OTLT 1KC8C 3A8OB 3OYFA 5GAN6 3DB4A 4C5EA 5GMKj 2X4JA 3BFMA 3OS2A 1AHJB 3X20B 3JB9I 3CMAT 4XTUA 5LJ3f 3QPHA 4GY5A 1YIJA 1N6AA 1FX7A 4X34A 3SDZA 3UPUA 1YITT 2PUOB 4M7AD 3OS5A 1Y96B 2ZPEB 2E6ZA 1N8RC 3TREA 1KD1C 2K57A 3SWNB 2ZPFB 1KHCA 3KUFA 2ZGWA 3RESA 2QEXT 1YJNT 2DZ9A 3QHSA 3ASKA 5CO7A 1Q86U 4C92C 1M8VA 2E6NA 3NTKA 4HCZA 4EMKA 3LWIA 5GMKi 1UB4A 4M75C 3CC7T 3E19A 4M78C 2EQUA 3H6ZA 3MP1A 4L59A 1UGPB 4XTWA 3V7SA 5LJ5f 3JB9H 2FYKA 3SD4A 4B9XA 1KG1A 4HCBA 1BYMA 2PVOB 3C4SA 3CC7A 2JZ2A 2WSFE 1KQ1A 3HL8A 4MZTA 3UT1A 3A8HB 2CGHA 4BI4A 5LJ5d 1K8AU 4M7DG 4DA4A 4JDSA 3MP6A 5DY9A 4PJOF 4C8QB 1VUBA 3L2ZA 2Y4XA 4C0ZA 1VQOA 2LDMA 3L2WA 2LVMA 5LJ5j 3CXCA 5GANg 2RK1A 2EJGA 1XQHA 4ZN1A 1K9MU 5CQYA 2O4XB 2FL7A 3MHXA 1SSFA 2RJDA 1BI1A 3OBWA 5GANe 3A5ZB 1O75A 5A0LA 1YI2A 1ZQ1A 5KCOA 1GXIE 3QZ5B 3META 2QQ9A 4FSXA 4QQ6A 4MMLA 3CCST 2VC8A 1VQNA 3X26B 3FDRA 5GAMh 4IKFA 2AHJB 3GF5A 4BI8B 1WPYA 4M7DB 3QXEB 3S3OA 2PU9B 4OGEA 1VQLA 1LJOA 2P4TA 2QI2A 4OVAA 2DKGA 5CKHA 2DVEA 3HRUA 4RG2A 2DO3A 3WVEB 3V7CA 2Y4YA 3O8VA 4EPCA 4HT8A 3LYIA 3LW5E 3J81E 2LTOA 3JCMg 4PJOA 2EQKA 4F7UA 4XK8E 4M7AC 1OZ2A 3PMTA 1WGSA 3M57A 2MWOA 4PL6A 5D6WA 3QJYA 3RKWA 2K5IA 2DXTA 4KUIA 2C06A 2OAUA 2QQRA 2KVQG 4XAXB 3QDRB 1VQ4A 2CZ7B 4X9CA 3RERA 1VQMT 3LWHA 5FRNA 4BDYA 1M1FA 1YIJT 1G3WA 2BIVA 4C5IA 4M7DA 3S6WA 4ZGEB 2IG0A 1N9SA 2EYQA 3L2UA 1YHQT 2ZCFB 3FIFA 5D6XA 2RHYA 4MMKA 1YJ9T 4NS5A 1Q81U 1MGQA 2L3RA 4N4HA 4M7DD 4OB0B 1D3BA 1OI1A 3OQ5A 5GMKl 2OTLA 3GIBA 2JNGA 1YHQA 2FVUA 2I2LA 4PLLA 1M5Q1 2IVWA 2K3XA 3P8DA 3I55A 3CC4T 4XU0A 2D9TA 3PT9A 3HRSA 5GAN8 2YRVA 4LD6A 4KT0E 4C0DC 1D3BB 3CCJT 3PIPA 2LQKA 3CXCS 3DLLA 4RG8A 2RO0A 2OTJT 2DPPB 2KY9A 5IAYA 1BIBA 2F5KA 3JCMQ 4EMGA 5LJ5h 2KDSA 5C0MA 1VIFA 1KD1U 2F5TX 4JUVA 3JCMf 4Y91A 4BUGA 1Q86C 3E9GA 5GAMf 3L2RA 3MEUA 3OYYA 4MDWA 2RI3A 5FU7C 3L1AA 3SB2A 3SFMA 2E12A 2E64A 5HY6A 2MMPA 5LJ5g 2DIQA 2O01E 2LX9A 3GLXA 3PIOA 5GANj 5I21A 1JBMA 4C92G 5GAMj 1VQ9A 3OYBA 3A8LB 4FT4A 4PJOC 3CC2T 1LNXA 1U1TA 5GANd 1Y7XA 2HQXA 4JS4A 4HT9A 1IREB 4FM4B 4LDUA 4A4HA 5FRMA 2GCXA 2MI6A 3BDLA 3VJPA 3CPWA 4RKUE 4FL6A 3G4SA 4OP0A 5FROA 3CCEA 1M1KC 4ZN3A 4M7AB 3CCVA 1BI3A 5I2MA 3WXMB 3TCJA 4M7AE 1I81A 5CQXA 4LDVA 1YJWT 4A53A 2XU8A 1I4K1 1LOJA 1RI0A 1YITA 4XQ3A 3P8BB 1Y07A 5GMKh 4JLGA 3UWNA 2FB7A 2HNIA 2K5FA 5A0GA 1KQSS 1VQ8T 3CMEA 2VXEA 2JUFA 3DKMA 3OW2A 1VQPT 2P0QA 3OSVA 2QEXA 1Q81C 2YLBA 4BY6B 2E5QA 3LGFA 3OA6A 2DIGA 4L6V5 3RUXA 3QIIA 1K9MC 1BI2A 2NLUA 4M7DC 3OMGA 4M77A 4C92F 2E1HA 2VGNA 4LD9K 5FU6B 5GAMd 3OW2S 1XNIA 4XTYA 1QVFA 1O9SA 3OS0A 3M58A 2CYZB 2L5QA 3OYDA 2QA4T 4J6WA 2K4YA 4E7IA 4FIBA 2E65A 1YI2T 5GAOq 3A8GB 1W2BS 4BE1A 1Y71A 4M77B 4ZTJA 3I56A 3PNWC 4M7DE 4BB7A 2EIFA 1QP3A 1YBYA 1ZHIA 3RIRA 2M9UA 2F69A 3G71T 4XU3A 4IUUA 4EMKC 3HPWA 3CCMA 4M7AG 3WVDB 4C92A 5GAMg 2KK4A 3ER0A 3FRNA 3CCJA 1B34A 4N0AA 2X4XA 3V8JA 5J39A 4JS5A 4CI0C 1N8RU 4VUBA 4OMFB 3FB9A 4C8QD 1Y96A 5GAOm 1VQ5T 2RI5A 1NE8A 3QYHB 4F7UG 3OYMA 3X28B 1QVGA 2DD4A 2HQEA 2MWPA 2QTXA 3I56T 4JRPA 4ME7A 3QJ6A 4C0DB 5L8RE 3JCMJ 2DXCA 2HAXA 5LJ3d 2XDPA 3MO8A 2L89A 3OSSC 3CBMA 3OBYA 3NTIA 3L2QA 1I5LA 3JB9G 3M54A 1VQMA 1B34B 4M78F 4M78B 5EG2A 4QVCA 4OB2B 5CKDA 5GAN7 3QUIA 1KQSA 5GAOl 3OB9A 2KMTA 1JJ2A 1V29B 5CVIA 5CK9A 3HSBA 3J80E 2E10A 2RM4A 4XTXA 2EJFA 3OYHA 4MDXA 1VQ6T 2D6FA 3BY7A 2R5MA 2HD0A 4QW2A 3CCLT 3CCRT 3HHTB 2CS7A 4JRKA 4N4IA 4B9WA 3OYCA 4ELZC 5LJ5e 1VQ9T 3CCUT 1VQ7A 5GANh 4E7LA 4RMOA 3KXTA 4A4GA 4C8QG 2GQVA 2X4YA 3CMET 1VQPA 2XDBA 1W4SA 3JCMW 4LDXA 1H3ZA 4ZGDB 3GNGA 2XICA 3G4ST 3FJPA 3M9QA 4PJOG 1G3TA 3DLMA 4KULA 3CEYA 3HFNA 4A4EA 4M7AA 3I55T 3V8LA 4IUVA 3CBOA 4J7IA 5CIUA 3VKIA 2P0PA 3S3MA 1X6OA 1BI0A 4OB3B 2XDDA 4R56A 2M1HA 3OYLA 4ATOA 1Q7YC 1KHIA 5CKFA 3JCMh 2R57A 2RHZA 2XKOC 1PSEA 3QO3A 2PQWA 4M77F 4M75F 1OZ3A 4E7HA 2DTHA 4NL2A 1Q82C 4M7DF 2K2VA 3VU3C 4C5HA 4JRQA 2RI2A 3INZA 3V8KA 2LC4A 5GAOn 1QVFS 2EWNA 3SWNA 3HP9A 1G5VA 1FXXA 2X4WA 2X35A 3OS1A 3J7AF 2Y90A 1DJ7B 2H3JA 3VUBA 2DZCA 3F70A 4C92B 4R55A 4C8QE 2MF2A 5IT9E 3JB9D 4C92E 5CKEA 1JJ2S 1X01A 4OF1A 2QQBA 3SWNC 2K5LA 3URGA 1NJIU 2CZ0B 3CPWS 4LDYA 5M9OA 2RA2A 5DLOA 4J6YA 3MP8A 3GOXA 1UGQB 1VQKT 2FHDA 1M1GA 2M16A 2ZZDA 3QYGB 3GPLA 4M75B 4A4KA 2VUBA 5GAN4 3M56A 1WJRA 3E1SA 2JN0A 3OYIA 2DXUA 4II1A 4TVRA 3OYNA 2KQWA 1I8FA 2ZPBB 3M4GA 3M5AA 4QQDA 4ZTFA 2QXFA 3OY9A 4LDWA 2VXFA 5FU6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG S;  2EQJ A;  4QVZ A;  3S3N A;  3G71 A;  3CCM T;  5KCH A;  3CCQ A;  3CD6 A;  5KE3 A;  1RL2 A;  1WJS A;  1YJW A;  3OYE A;  1M90 U;  3HKS A;  4Q5W A;  4BAC A;  4E7J A;  1W2B A;  3Q1J A;  2JVV A;  3OYA A;  3OYK A;  1KC8 U;  1BKB A;  2EFI A;  1UEB A;  2VYT A;  1VQ8 A;  3CCE T;  2JOY A;  1Q7Y U;  2LCC A;  1NPP A;  3JAM E;  1VQK A;  2LRQ A;  1VQ6 A;  1K8A C;  3E9F A;  1VQ4 T;  1VQO T;  2LCL A;  2QA4 A;  5DLQ E;  4PLI A;  1XTD A;  3PFS A;  2GF7 A;  3G6E T;  2RHI A;  2WAC A;  5C6S A;  3CD6 T;  5KE2 A;  3FLG A;  1VQ7 T;  4IUP A;  4FU6 A;  3ME9 A;  5KH6 A;  2RHU A;  2XK0 A;  4CRI A;  3CCQ T;  2B8A A;  3P8H A;  3DB3 A;  2OTJ A;  2L8D A;  1M90 C;  3CCS A;  2R58 A;  3FEO A;  3NTH A;  1S72 T;  5DM7 R;  1NJI C;  5D6Y A;  4BD3 A;  2JTF A;  3QKJ A;  3MEV A;  4C5G A;  1YJ9 A;  2RHX A;  4UC4 A;  1IZ6 A;  3CCV T;  1MHN A;  3CCU A;  3ZEH A;  2QQS A;  2RJC A;  4N4G A;  2LQ8 A;  3LGL A;  4QQG A;  3FC3 A;  5J3B A;  2P0K A;  4BDZ A;  4E7K A;  3QBY A;  4IUT A;  2EQM A;  1YJN A;  5LL6 S;  1EIF A;  4IUR A;  3LH0 A;  3CC4 A;  3CC2 A;  1NPR A;  1VQ5 A;  1N27 A;  3OMC A;  2O4X A;  3CMA A;  2RJF A;  2M0O A;  3OYG A;  2E70 A;  3OYJ A;  3LX7 A;  1WJQ A;  2BKD N;  4EDU A;  1S72 A;  3L2V A;  3H8Z A;  1K73 C;  3PMI A;  2K3Y A;  5IN1 A;  2R5A A;  4Z02 A;  4BE2 A;  5A2Q E;  5FLX E;  4YTL A;  2GFU A;  5J26 A;  2BUD A;  2EKO A;  3KBG A;  3MEW A;  2XHC A;  1VQN T;  3CPF A;  3CCR A;  4BE0 A;  1OYX A;  4IUQ A;  1K73 U;  4A4F A;  2DAQ A;  2GFA A;  2RJE A;  2G3R A;  1VQL T;  3CCL A;  3EAE A;  1Q82 U;  3MEA A;  3LLR A;  3G6E A;  2CKK A;  1NZ9 A;  3L42 A;  2OTL T;  1KC8 C;  3OYF A;  3DB4 A;  4C5E A;  3OS2 A;  3CMA T;  4GY5 A;  1YIJ A;  4X34 A;  1YIT T;  2E6Z A;  1N8R C;  3TRE A;  1KD1 C;  1KHC A;  3KUF A;  1Q86 U;  2QEX T;  3ASK A;  2E6N A;  3NTK A;  4HCZ A;  3CC7 T;  2EQU A;  3H6Z A;  3MP1 A;  4L59 A;  3SD4 A;  4B9X A;  3CC7 A;  3C4S A;  2JZ2 A;  1K8A U;  3UT1 A;  3MP6 A;  1VQO A;  2LDM A;  3L2W A;  2LVM A;  3CXC A;  4ZN1 A;  1K9M U;  2O4X B;  1SSF A;  2RJD A;  3A5Z B;  1YI2 A;  5KCO A;  3MET A;  4QQ6 A;  3CCS T;  3FDR A;  4IKF A;  3S3O A;  1VQL A;  4OVA A;  4RG2 A;  2DO3 A;  3O8V A;  3LYI A;  3J81 E;  2LTO A;  2EQK A;  1OZ2 A;  3PMT A;  1WGS A;  4PL6 A;  2MWO A;  5D6W A;  4C5I A;  2QQR A;  2KVQ G;  1VQ4 A;  1VQM T;  5FRN A;  4BDY A;  1YIJ T;  2BIV A;  3S6W A;  2IG0 A;  1YHQ T;  3L2U A;  1YJ9 T;  5D6X A;  2RHY A;  1Q81 U;  4NS5 A;  2L3R A;  4N4H A;  2OTL A;  1OI1 A;  3OQ5 A;  2JNG A;  1YHQ A;  4PLL A;  2K3X A;  3P8D A;  3I55 A;  3CC4 T;  2D9T A;  2YRV A;  4LD6 A;  3CCJ T;  3PIP A;  3CXC S;  3DLL A;  2RO0 A;  2OTJ T;  5IAY A;  1M1K U;  1VQN A;  2F5K A;  1KD1 U;  2KDS A;  5C0M A;  1Q86 C;  3E9G A;  3L2R A;  3MEU A;  3OYY A;  2RI3 A;  5HY6 A;  3PIO A;  2DIQ A;  1VQ9 A;  3OYB A;  3CC2 T;  2HQX A;  4A4H A;  5FRM A;  2MI6 A;  3CPW A;  3BDL A;  3G4S A;  4FL6 A;  3CCE A;  1M1K C;  5FRO A;  4ZN3 A;  3CCV A;  1YJW T;  1RI0 A;  1YIT A;  3P8B B;  3UWN A;  1KQS S;  1VQ8 T;  3CME A;  1VQP T;  2JUF A;  3OW2 A;  2QEX A;  1Q81 C;  3LGF A;  2E5Q A;  3OA6 A;  2DIG A;  1K9M C;  3QII A;  2NLU A;  3OMG A;  3OW2 S;  1XNI A;  3OS0 A;  3OYD A;  2QA4 T;  4E7I A;  1YI2 T;  1W2B S;  4BE1 A;  4ZTJ A;  3I56 A;  3PNW C;  2EIF A;  1YBY A;  3G71 T;  3CCM A;  4IUU A;  3ER0 A;  3CCJ A;  1N8R U;  2X4X A;  5J39 A;  1VQ5 T;  2RI5 A;  1QVG A;  3OYM A;  2HQE A;  2MWP A;  3I56 T;  3QJ6 A;  2XDP A;  3MO8 A;  2L89 A;  3L2Q A;  3NTI A;  1VQM A;  1KQS A;  3OB9 A;  1JJ2 A;  3J80 E;  3OYH A;  1VQ6 T;  3CCL T;  3CCR T;  2R5M A;  4QW2 A;  4N4I A;  4B9W A;  3OYC A;  1VQ9 T;  3CCU T;  1VQ7 A;  4E7L A;  4A4G A;  2X4Y A;  3CME T;  1VQP A;  1H3Z A;  3G4S T;  3M9Q A;  3DLM A;  3CEY A;  4A4E A;  3I55 T;  4IUV A;  5CIU A;  3S3M A;  1X6O A;  2M1H A;  3OYL A;  1Q7Y C;  1KHI A;  2R57 A;  2RHZ A;  2PQW A;  1OZ3 A;  4E7H A;  1Q82 C;  4C5H A;  2RI2 A;  1QVF S;  1G5V A;  2X4W A;  2X35 A;  3OS1 A;  3J7A F;  3F70 A;  5IT9 E;  1JJ2 S;  1NJI U;  3CPW S;  5M9O A;  3GOX A;  3MP8 A;  1VQK T;  2FHD A;  1M1G A;  2M16 A;  3OYI A;  1WJR A;  4II1 A;  4TVR A;  1QVF A;  3OYN A;  4QQD A;  4ZTF A;  3OY9 A;  1YJN T; 
#chains in the Genus database with same CATH topology
 3JB9 J;  1K0X A;  5LJ3 g;  3CCM T;  3G7Z A;  2WSC E;  2YT6 A;  3ZL7 C;  3HKS A;  5IXB A;  1YIJ Q;  3SEM A;  2DBK A;  1G3S A;  1RAD B;  1U8R A;  4MZM A;  3I5S A;  1ARK A;  2EFI A;  4V2S A;  3M53 A;  2HSE B;  1M9S A;  2WSE E;  1X43 A;  1ABQ A;  1MV3 A;  3VRY A;  2E3I A;  2ATC B;  3PTA A;  1VQK A;  1TH7 A;  5IXF A;  3E9F A;  1VQ4 T;  4ELY C;  5HK0 A;  4PLI A;  6AT1 B;  2A0F B;  4J8O A;  1XTD A;  4PJM A;  4B6M A;  3GNF B;  3PFS A;  4D8D A;  3G6E T;  1M4Z A;  2RHI A;  3QSU A;  2DIL A;  1C6V X;  5L23 A;  1CKB A;  2FRW A;  2YSQ A;  2YUO A;  1K76 A;  3FLG A;  1ZUY A;  1YJW Q;  2RHU A;  1M27 C;  2VV5 A;  2RNA A;  1VQP Q;  2EGA A;  3CCQ T;  2H3E B;  2OTJ A;  2HL3 A;  1M90 C;  4M77 C;  2R58 A;  4J6X A;  2JTM A;  3LH5 A;  4C0G A;  1H92 A;  1Y57 A;  1S72 T;  5DM7 R;  2VGM A;  1SF9 A;  1AWW A;  4UC4 A;  2RHX A;  4NL3 A;  1NEB A;  3CCU A;  1V1C A;  3RDV A;  4PFO A;  2QQS A;  2BZY A;  2GTJ A;  3M0T A;  2QAZ A;  1U1S A;  1NM7 A;  2EAY A;  2LQ8 A;  3VYH B;  1YJ9 Q;  4BDZ A;  5LJ3 h;  3QBY A;  2QDY B;  2D8J A;  2V8K A;  4RCB A;  1EIF A;  4IUR A;  3T9N A;  3MCA B;  1NPR A;  4M78 A;  2DEQ A;  2RD1 A;  3TVT A;  1N27 A;  2O4X A;  5FW9 A;  2M0O A;  1RAF B;  4XU2 A;  2ENM A;  4M78 D;  3RMS A;  2AZV A;  2E41 A;  4ORZ A;  2KRO A;  1B7T A;  1MND A;  3PMI A;  2K3Y A;  2K6D A;  1K9M R;  1A0N B;  2R5A A;  4C8Q A;  3G1J A;  1HXD A;  3N5B B;  3PGG A;  4DOV A;  2J6K A;  2BUD A;  3TEE A;  4KH1 B;  2XG8 D;  2O9S A;  1OYX A;  4M75 G;  1K73 U;  2M51 A;  4A4F A;  2GFA A;  1NYF A;  4E6R A;  1EZZ B;  1JU5 C;  4DBQ A;  1QW1 A;  1YCY A;  3UDC A;  3CD6 Q;  2A7Y A;  3G6E A;  3HRT A;  2BE9 B;  1BK2 A;  2RK2 A;  5GAN 6;  4C5E A;  5GMK j;  3BFM A;  1AHJ B;  1UFF A;  2ESW A;  4GY5 A;  1YIJ A;  2ZPE B;  2NUT A;  4J9F A;  1GL5 A;  2QEX T;  1NBE B;  5CO7 A;  4C92 C;  4WCI A;  4HCZ A;  4EMK A;  2QAS A;  1JO8 A;  3IQL A;  3E19 A;  4XTW A;  3BE3 A;  3H6Z A;  4L59 A;  1UGP B;  1VQO Q;  1QKW A;  1OV3 A;  1IGQ A;  1OU9 A;  2DNU A;  2WSF E;  4MZT A;  4BI4 A;  3A8H B;  1VQ6 Q;  4PJO F;  3L2Z A;  2Y4X A;  2LDM A;  5GAN g;  2KXD A;  2EJG A;  1WHJ A;  4ZN1 A;  2ZAE A;  2OTL Q;  3QDF A;  2LJ1 A;  1SHG A;  3MET A;  1R0C B;  2KBT A;  3EG9 A;  3NMZ C;  3CCS T;  2VC8 A;  1X6B A;  4BI8 B;  3QXE B;  1Q7Y R;  1TXQ A;  1YWO A;  1S1N A;  3VRZ A;  2KT8 A;  2DVE A;  1UE9 A;  3WVE B;  1HSQ A;  3O8V A;  3LYI A;  5AT1 B;  2EQK A;  4XK8 E;  4M7A C;  4PL6 A;  1ABO A;  3VS4 A;  1SKU B;  2O31 A;  2QQR A;  1X27 A;  2GGR A;  2KNB B;  2KVQ G;  1Z9Z A;  3RER A;  1T3S A;  1VQM T;  3LWH A;  2FO0 A;  1RAB B;  4BDY A;  1M1F A;  3REB B;  2HCK A;  4GLM A;  8ATC B;  1M3A A;  2ZCF B;  1YJ9 T;  2RHY A;  4MMK A;  2L3R A;  4N4H A;  4M7D D;  1D3B A;  1OI1 A;  1YHQ A;  2FVU A;  1MMN A;  2IVW A;  3I55 A;  4C0D C;  2AIR B;  3CC2 Q;  1SG5 A;  3CXC S;  3UAT A;  2QDL A;  1VQN A;  4EMG A;  5LJ5 h;  3JCM f;  3E9G A;  4FYW B;  4MDW A;  3QWX X;  3CCL Q;  1X6G A;  1ZSG A;  2E12 A;  2MMP A;  4OMN A;  2DIQ A;  2O01 E;  4JZ3 A;  4FT4 A;  4PJO C;  2JJ9 A;  3CC2 T;  2HQX A;  3M0Q A;  2MI6 A;  3VJP A;  3G4S A;  4OP0 A;  4PK4 A;  3CCE A;  3E2U A;  2DE0 X;  4CC3 A;  1RAG B;  3CCV A;  2YWW A;  5I2M A;  3WXM B;  4A53 A;  2XU8 A;  1I4K 1;  1RI0 A;  3P8B B;  2FB7 A;  2K5F A;  1VQ8 T;  1VQP T;  2VXE A;  2PTK A;  3OSV A;  2HKQ B;  4AFU C;  2QEX A;  4LUE A;  4GBQ A;  4L6V 5;  3QII A;  3M0U A;  1BI2 A;  4J9B A;  1ZLM A;  3OMG A;  4LD9 K;  5GAM d;  3OW2 S;  4XTY A;  1VOM A;  4FIB A;  2E65 A;  1W2B S;  2K3B A;  4ZTJ A;  1QWE A;  2HL5 C;  3HPW A;  4C92 A;  5GAM g;  2KK4 A;  3CCJ A;  1B34 A;  4JS5 A;  3V8J A;  4CI0 C;  4IIO A;  1Y96 A;  5GAO m;  2CH4 W;  3CCM Q;  1NE8 A;  1WDX A;  2DFU A;  4PFZ A;  3OYM A;  2QTX A;  4KGX B;  2XDP A;  3OSS C;  2L89 A;  1I5L A;  4M78 F;  4M78 B;  5GAN 7;  1KQS A;  4AG1 C;  1V29 B;  5CVI A;  1MNE A;  1PCX A;  5CK9 A;  1AD5 A;  3J80 E;  2EBP A;  1WXB A;  1EX4 A;  2RF0 A;  3EHR A;  4QW2 A;  1WHG A;  5LJ5 e;  1VQ9 T;  1M1K R;  1R0B G;  1VQ7 A;  3CC4 Q;  4A4G A;  2GQV A;  1OX9 A;  4LDX A;  1LCK A;  2DL7 A;  3GNG A;  2XIC A;  1G3T A;  1W2B P;  3CBO A;  4F14 A;  2J6O A;  2KGT A;  1K9A A;  3OYL A;  1Q7Y C;  2XKO C;  5IH2 A;  4C5H A;  2LC4 A;  2M0Y A;  1FXX A;  3J7A F;  2AT1 B;  2E4H A;  2H3J A;  3VUB A;  4C92 B;  4F04 B;  3JB9 D;  1YHQ Q;  4C92 E;  1WHK A;  2QQB A;  1J3T A;  3I55 Q;  1NJI U;  5M9O A;  1BU1 A;  2RA2 A;  1BB9 A;  3MP8 A;  4M4Z A;  1UGQ B;  3CCR Q;  1AEY A;  1UJY A;  1Q81 R;  2VUB A;  2QA4 Q;  1QVF A;  1I8F A;  2ECZ A;  4ZTF A;  4LDW A;  5FU6 C;  2VKN A;  4QVZ A;  3CCQ A;  3CBP A;  1TUC A;  1RL2 A;  1WYX A;  2X3X D;  4HCC A;  1WJS A;  4RCC A;  2DK3 A;  1M90 U;  1M2V B;  4BAC A;  4E7J A;  2KAF A;  1D0Z A;  2VWF A;  4M78 E;  4M75 E;  3CCS Q;  1W2B A;  2JVV A;  2K2M A;  1QVP A;  3OYK A;  2CUD A;  1KC8 U;  2DRM A;  3X25 B;  3TU4 K;  1UEB A;  2D8H A;  2VYT A;  1VQ8 A;  3CCE T;  1YFN A;  2QGF B;  2JOY A;  2LCC A;  1Q7Y U;  2EKH A;  4ZGJ B;  1E6G A;  2W10 A;  2FPD A;  5GAN 5;  2J06 A;  4F7U E;  2LCL A;  1VQO T;  2XMF A;  3UF4 A;  1PWT A;  5GMK m;  2DX1 A;  2OI3 A;  5C6S A;  1HK9 A;  5KE2 A;  3A1P A;  2JXB A;  2ROL A;  5GAN 2;  3EG0 A;  3JB9 F;  3C12 A;  5I11 A;  2B8A A;  1WHM A;  2L8D A;  4F7U B;  4P5N A;  1U3O A;  4M77 E;  2GQI A;  5IHI A;  4KUD K;  1QQJ A;  3RKY A;  1PC0 A;  4CC7 A;  3R6N A;  2RN8 A;  2KEA A;  1Y0M A;  2YHT A;  3PE0 A;  1QP2 A;  1VQ4 Q;  1YJ9 A;  2NUT B;  1WIE A;  1MHN A;  1HYO A;  1AT1 B;  1UHF A;  2EGC A;  3JCM P;  3ZBD A;  4QQG A;  3LGL A;  3QZ9 B;  2P0K A;  4E7K A;  4J9C A;  2J05 A;  5HCK A;  1KD1 R;  1ZX6 A;  2EYX A;  2EQM A;  4Z88 A;  1SHF A;  1BBZ A;  4OB1 B;  3CC4 A;  5FWB A;  1TG0 A;  3OMC A;  3U23 A;  1E7O A;  2RJF A;  9ATC B;  3CMA A;  1UEC A;  4M75 D;  1TUD A;  2CZ6 B;  1KQ2 A;  2GTO A;  4FT2 A;  5GJV B;  1E6H A;  4J9I A;  5CCA A;  5CR2 A;  1VQ5 Q;  1IRX A;  1X75 C;  3LX7 A;  2FZG B;  1WJQ A;  4LXC A;  4WTO B;  1S72 A;  5KYY A;  4C92 D;  2L2P A;  3JCM X;  2V8J A;  1OPK A;  3VYG A;  4D6W A;  2DJZ A;  3PVL A;  3EG3 A;  4M77 D;  4O6J A;  2DLP A;  4BI3 A;  4PJJ A;  2AZS A;  3CCR A;  2CP7 A;  1JRI A;  2LJ0 A;  3CQT A;  4J7F A;  4Z8A A;  1VIE A;  3SHW A;  2GNC A;  3FJ5 A;  2F2W A;  3EAE A;  1RLP C;  5LJ3 j;  4KBM B;  2VAS A;  5KYW B;  1TUG B;  2OTL T;  2NUZ A;  3RNJ A;  4E7Z A;  2X4J A;  3X20 B;  1WHL A;  3JB9 I;  3CMA T;  5LJ3 f;  3SDZ A;  3UPU A;  1YIT T;  1ZSZ B;  3OS5 A;  3TRE A;  1KD1 C;  2K57 A;  3SWN B;  2CP6 A;  2ZGW A;  3RES A;  1Q86 U;  2E6N A;  1ZA2 B;  1YIT Q;  2OTJ Q;  1UB4 A;  4M75 C;  4M78 C;  2EQU A;  5ECA A;  2FYK A;  4B9X A;  4J9G A;  2PVO B;  4A63 B;  3CC7 A;  1BYM A;  2A08 A;  1KQ1 A;  3UT1 A;  5LJ5 d;  2CP2 A;  4IIM A;  5DY9 A;  1VQM Q;  2FZC B;  2LVM A;  2QGG A;  2RK1 A;  2FL7 A;  2L3P A;  3MHX A;  3CXC P;  2RJD A;  4F17 A;  1BI1 A;  1O75 A;  1ZQ1 A;  5KCO A;  1GXI E;  3QZ5 B;  4FSX A;  4QQ6 A;  1WHH A;  3G6E Q;  2CSI A;  4DBR A;  3FDR A;  4IKF A;  2EPD A;  2AHJ B;  3JV3 A;  3H0F A;  3S3O A;  2KXC A;  1VQL A;  1OU8 A;  4KRT A;  4OVA A;  2DKG A;  5CKH A;  2DEU A;  4RTV A;  3HRU A;  1KFZ A;  1KK7 A;  2CT4 A;  2Y4Y A;  4HT8 A;  1YP5 A;  2KYM A;  3JCM g;  2RQW A;  3NGP A;  1OZ2 A;  3PMT A;  2X9H A;  2DXT A;  1OEB A;  5KYU A;  4R0K A;  3VS2 A;  4QKU A;  3M0P A;  4AFZ C;  2F2V A;  2DL4 A;  1V76 A;  1M3C A;  4M7D A;  5D6X A;  4RTU A;  5KYU B;  4OB0 B;  2OTL A;  2I2L A;  4PLL A;  3RR6 A;  3CCJ T;  2CDT A;  2OTJ T;  5IAY A;  1BIB A;  3JCM Q;  1M1K U;  2KDS A;  4JUV A;  4Y91 A;  2LNH B;  3VS1 A;  2RI3 A;  5FU7 C;  1T3L A;  3TQ7 P;  3PIO A;  4C92 G;  3OYB A;  5I22 A;  1LNX A;  1U1T A;  5GAN d;  1Y7X A;  2YRC A;  1IRE B;  2LCS A;  1MMD A;  2GCX A;  3CPW A;  4HXJ A;  4FL6 A;  5FRO A;  4ZN3 A;  4M7A E;  4LDV A;  4DBH A;  1PG5 B;  1WZO A;  1TOV A;  1Y07 A;  3UWN A;  2HNI A;  1KQS S;  1W70 A;  2V1R A;  1Q81 C;  2YLB A;  4M7D C;  4M77 A;  2VGN A;  1VQN Q;  3OS0 A;  3H0H A;  1TTH B;  1WA7 A;  1YI2 T;  1D1B A;  2G6F X;  1ZUK A;  4M77 B;  3I56 A;  1UDL A;  1R77 A;  1QP3 A;  4RTT A;  3CCM A;  1I0C A;  4IUU A;  3I5R A;  3WVD B;  2L3S A;  2B86 A;  2X4X A;  2HEQ A;  5J39 A;  2RI5 A;  3QYH B;  4FW2 A;  3I56 T;  4KGZ B;  2EQI A;  2LP5 A;  3QJ6 A;  5L8R E;  1KJW A;  2HAX A;  1ZSZ C;  5LJ3 d;  3L2Q A;  3OBY A;  1VQM A;  1B34 B;  2QEX Q;  4OB2 B;  1FYN A;  3OB9 A;  1PKT A;  3A98 A;  2D0N A;  2RM4 A;  4XTX A;  1W1F A;  1GBQ A;  4MDX A;  4AFS C;  3CCL T;  2R5M A;  2HD0 A;  3HHT B;  2CS7 A;  4JRK A;  4B9W A;  3OYC A;  3CCU T;  5GAN h;  4E7L A;  4JJB A;  4RMO A;  4C8Q G;  2XDB A;  1W4S A;  3JCM W;  3M9Q A;  1X2K A;  3HFN A;  1MMG A;  1VYT A;  1F1B B;  3V8L A;  4IUV A;  5CIU A;  1UJ0 A;  2P0P A;  3S3M A;  4OB3 B;  1WI7 A;  2M1H A;  1D1A A;  1KHI A;  5CKF A;  2R57 A;  3QO3 A;  1IXD A;  2PQW A;  4M77 F;  4M75 F;  2DRK A;  4E7H A;  1Q82 C;  4M7D F;  3VU3 C;  3CCU Q;  4JRQ A;  5GAO n;  1QVF S;  1TWB A;  1NEG A;  4X1V A;  1M2V A;  4JJC A;  4R55 A;  2MF2 A;  5IT9 E;  2X3W D;  1JJ2 S;  2K5L A;  2CZ0 B;  1VQK T;  1M1G A;  2ZZD A;  3QYG B;  2MOX A;  5GAN 4;  3OYI A;  3E1S A;  2JN0 A;  3OYN A;  2QXF A;  1Q82 R;  1CSK A;  1YJN T;  4FYY B;  2RMO A;  2VXF A;  1I1J A;  2EQJ A;  2J6F A;  2HBP A;  1QVG S;  3S3N A;  3G71 A;  5KCH A;  2LJ3 A;  5KE3 A;  4CC4 B;  3JSC A;  2YUP A;  4ESR A;  2JTE A;  2DTO A;  3ULR B;  3OYE A;  5GMK e;  4Q5W A;  1M8M A;  5HK3 A;  4QVD A;  3NFC A;  1BKB A;  1HD3 A;  1YCS B;  2LZ6 B;  1NPP A;  1P92 A;  3JAM E;  2H8H A;  3C95 A;  4Y92 A;  4E47 A;  2QA4 A;  5DLQ E;  2FPF A;  4Y28 E;  2GF7 A;  4LNP A;  2WAC A;  4O5V A;  5KYX B;  3CD6 T;  4J83 A;  3JCM b;  4E7S A;  3TSW A;  1VQ7 T;  2AK5 A;  4JRI A;  3ME9 A;  1VQ7 Q;  5KH6 A;  1QVG P;  2XK0 A;  3THK A;  3P8H A;  3DB3 A;  2RH2 A;  3CCS A;  2BE7 D;  3M59 A;  3RMQ A;  4C0F A;  1WNL A;  2KRM A;  2LT1 A;  1GCP A;  3M55 A;  5D6Y A;  5GAN f;  2EJ9 A;  4BD3 A;  4DBF A;  3QKJ A;  3R6O A;  4C5G A;  4XTV A;  1IZ6 A;  3VUZ A;  2YRD A;  2LT4 A;  4RTW A;  3ZEH A;  2RJC A;  2A3L A;  3I9Q A;  2MAM A;  5J3B A;  2DMO A;  4IUT A;  4J5Y A;  1YJN A;  1PD0 A;  3REA B;  3LH0 A;  5GAM e;  3X24 B;  5KYN A;  2QQA A;  4NOY A;  2XI9 A;  3EFR A;  2DXB A;  2RB6 A;  3BW1 A;  3HFO A;  2E70 A;  4DQ2 A;  3OYJ A;  4PNO A;  3VS5 A;  2LNV A;  1WQ7 A;  5GJW B;  2DL3 A;  4EDU A;  5AYF A;  2PVD B;  2PUK B;  3L2V A;  4A54 A;  4EMK B;  1UGR B;  5FLX E;  2OJ2 A;  4YTL A;  2GFU A;  2EKO A;  5I2S A;  1MV0 B;  2C0I A;  4JLI A;  1UG1 A;  2V26 A;  1VQN T;  1ZBJ A;  1CKA A;  3CPF A;  1VQ8 Q;  3H9N A;  4BE0 A;  3EFO A;  1M30 A;  2M02 A;  4RTZ A;  1LPL A;  4IUQ A;  4M78 G;  2DAQ A;  1IO6 A;  2G3R A;  1UGS B;  2MYS A;  4PKC C;  2RQU A;  2ZPG B;  1VQL T;  3CCL A;  2PVG B;  1Q82 U;  3MEA A;  1PRL C;  2CKK A;  2DTI A;  3JRZ A;  1QCO A;  3OYF A;  1VQ9 Q;  3OS2 A;  2AKL A;  1N6A A;  1QVF P;  3G4S Q;  1GBR A;  4X34 A;  3CCE Q;  2PUO B;  3EGX A;  3CCV Q;  1HJD A;  3VS7 A;  2ZPF B;  1KHC A;  2LQW A;  3KUF A;  1NLO C;  1M8V A;  2DZ9 A;  1NYG A;  1B07 A;  3CC7 Q;  1PRM C;  1BCM A;  3CC7 T;  3MP1 A;  3V7S A;  1ZUU A;  1KG1 A;  3SD4 A;  3C4S A;  2JZ2 A;  2CH4 A;  4M7D G;  2CGH A;  3MP6 A;  4C8Q B;  1GCQ C;  4C0Z A;  1VQO A;  1KIK A;  1YWP A;  5CQY A;  1VA7 A;  1OOT A;  1ACM B;  2JM9 A;  3A5Z B;  1YI2 A;  3I35 A;  4KH0 B;  4MML A;  5GAM h;  4M7D B;  1AWJ A;  2LQN A;  2PU9 B;  4OGE A;  2CP3 A;  1LJO A;  2P4T A;  2QI2 A;  2NUP B;  4RG2 A;  2V1Q A;  3H0I A;  2DO3 A;  5D7U A;  1PD1 A;  1AZG B;  3V7C A;  4EPC A;  4RTX A;  2EW3 A;  2BZ8 A;  1M90 R;  3J81 E;  4JJD A;  4F7U A;  2OX7 A;  3UA6 A;  2MWO A;  5D6W A;  3RKW A;  2K5I A;  4KUI A;  1D0X A;  1G8X A;  3QDR B;  1VQ4 A;  2ABL A;  2CZ7 B;  1GFC A;  2K7A A;  1JJ2 P;  5FRN A;  1YIJ T;  2KT1 A;  3S6W A;  4ZGE B;  2IG0 A;  1N9S A;  5KYX A;  3EH1 A;  1D09 B;  2I0N A;  2MPX C;  4NS5 A;  1Q81 U;  1MGQ A;  1WXU A;  2C0O A;  5GMK l;  3GIB A;  2JNG A;  2K3X A;  3P8D A;  2CSQ A;  4RUG A;  3PT9 A;  2YRV A;  4LD6 A;  1D3B B;  3PIP A;  1NJI R;  4RG8 A;  2RO0 A;  2DPP B;  2F5T X;  1JXM A;  3L2R A;  5GAM f;  3EFO B;  1GFD A;  3MEU A;  3OYY A;  1FMV A;  3SB2 A;  3SFM A;  5LJ5 g;  3GLX A;  1H8K A;  1AZE A;  5GAN j;  1VYU A;  4D8K A;  2W0Z A;  1ZA1 B;  4HT9 A;  4LDU A;  3BDL A;  4RKU E;  1M1K C;  2NUP A;  1BI3 A;  1YJW T;  1K0S A;  1WLP B;  2KR3 A;  1LOJ A;  4XQ3 A;  5GMK h;  4JLG A;  2A36 A;  3DKM A;  2JUF A;  2P0Q A;  2SRC A;  2DYI A;  4BY6 B;  3LGF A;  1XJW B;  3RUX A;  1K9M C;  2NLU A;  4JZ4 A;  1Z9Q A;  4C92 F;  2CT3 A;  4ANJ A;  2E1H A;  2JS0 A;  5FU6 B;  3CME Q;  1SEM A;  2HKN A;  1XNI A;  3OYD A;  2EYZ A;  2QA4 T;  1GCQ A;  2K4Y A;  1TS9 A;  2K79 A;  2CP0 A;  4BE1 A;  2RQV A;  1Y71 A;  1WFW A;  3H41 A;  4BB7 A;  4HVU A;  1YBY A;  1ZHI A;  2M9U A;  2F69 A;  4XU3 A;  2KE9 A;  3EGD B;  3FRN A;  1N8R U;  2MCN A;  2P84 A;  1VQ5 T;  1B3Q A;  3X28 B;  2QG9 B;  2DD4 A;  2HQE A;  4JRP A;  1RAE B;  3JCM J;  2DXC A;  1VQK Q;  3CBM A;  3NTI A;  3JB9 G;  2FEI A;  3M54 A;  5CKD A;  3QUI A;  4AT1 B;  5GAO l;  1Q95 G;  2DBM A;  4AMC A;  3HSB A;  2COZ A;  2E10 A;  2EJF A;  3MKD A;  2ED1 A;  2D6F A;  3BY7 A;  3CCR T;  5EC7 A;  2LX7 A;  4ELZ C;  2P4R A;  3KXT A;  2X4Y A;  1VQP A;  4PFP A;  1H3Z A;  3G4S T;  3DLM A;  3KFV A;  1PHT A;  4KUL A;  1SRL A;  4A4E A;  4M7A A;  2JMC A;  1SSH A;  4J7I A;  3VKI A;  2KRN A;  1QLY A;  4R56 A;  1RAH B;  4ATO A;  4J9H A;  2DM1 A;  1MUZ A;  2RHZ A;  2O88 A;  3C0C A;  1OZ3 A;  2DTH A;  2F1L A;  1G2B A;  4NL2 A;  2K2V A;  4HVW A;  3V8K A;  2EWN A;  3SWN A;  1G5V A;  2X4W A;  2X35 A;  3OS1 A;  1DJ7 B;  2IIM A;  1OQK A;  3F70 A;  1RUW A;  2PNI A;  5CKE A;  4OF1 A;  3SWN C;  2KRS A;  2YUQ A;  1UUE A;  2DJQ A;  4J6Y A;  3GOX A;  4LE9 A;  2FHD A;  4M75 B;  4A4K A;  3M56 A;  1UHC A;  2DXU A;  4II1 A;  4TVR A;  2KQW A;  2ZPB B;  3M4G A;  1OUL A;  3OY9 A;  4E2F B;  3AHU A;  1D0Y A;  5IHK A;  4XU1 A;  3NHN A;  1OPL A;  5FWC A;  2AKK A;  3CD6 A;  2EGE A;  2KSS A;  5LJ3 e;  2EYY A;  3MPU B;  4PJO D;  1I07 A;  2HSP A;  1YJW A;  1H64 1;  3JCM d;  5GAO r;  1G3Y A;  3Q1J A;  3OYA A;  1X2Q A;  1T0H A;  2V8I A;  1AVZ C;  1PNJ A;  1Q86 R;  1U06 A;  2RPN A;  1ZSZ A;  1NG2 A;  1ZBX A;  3V7R A;  3O5Z A;  2RQR A;  1AWO A;  2CRE A;  3HTR A;  5HKC A;  3QG1 A;  2LRQ A;  1VQ6 A;  1JXO A;  2GBQ A;  3VV0 A;  5GAN 3;  1K8A C;  3PVQ A;  1RAI B;  5A0D A;  3EG9 B;  4OGC A;  4HKE A;  3M4Y A;  1RI9 A;  4N0A C;  4ZNX A;  4L5G A;  2KYB A;  4IUP A;  4FU6 A;  4WF2 A;  2PZ1 A;  3CMA Q;  2YLC A;  4C8Q C;  2D0Q B;  4CRI A;  4M75 A;  1IHW A;  4EMH A;  2JT4 A;  1AWX A;  3FEO A;  1LVK A;  3NTH A;  2DER A;  3M0S A;  3MJX A;  4LUD A;  1NJI C;  2A37 A;  3RKX A;  2D1X A;  4RTY A;  2JTF A;  2KI7 A;  3MEV A;  1N9R A;  2XD0 A;  4PJO E;  2QTV A;  5CAI A;  3CCV T;  2VB6 A;  2CP5 A;  4C8Q F;  2EYW A;  3JCM c;  1AOJ A;  4N4G A;  3FC3 A;  4MZP A;  4XTZ A;  4PJO B;  1K8A R;  2VVK A;  1FWZ A;  1BCO A;  3JCM V;  3OW2 P;  4M7A F;  2NYS A;  5LL6 S;  1UGV A;  5GAO p;  3BDU A;  3M0R A;  1VQL Q;  1PSF A;  4M77 G;  3CC2 A;  2XID A;  2O2O A;  2HMA A;  1VQ5 A;  1JB0 E;  5KYW A;  2COW A;  3EFS A;  2CZ1 B;  3ZFJ A;  2BZX A;  3VS0 A;  4X9D A;  4Z89 A;  3OYG A;  3AT1 B;  1R8O B;  1GRI A;  4F7U F;  1BIA A;  4GLK A;  3G71 Q;  2BKD N;  1FMW A;  3NPF A;  4J9D A;  1N8R R;  1XOV A;  2FRY A;  4F16 A;  3A8M B;  3H8Z A;  1YN8 A;  2ZPI B;  1K73 C;  3GBQ A;  5IN1 A;  1WQW A;  4Z02 A;  3VS3 A;  4BE2 A;  1FMK A;  4DOW A;  1S72 Q;  5A2Q E;  2COY A;  1KC8 R;  5FU7 B;  5J26 A;  4HVV A;  2YDL A;  3C94 A;  4HA8 A;  4BY6 C;  3KBG A;  3JCM e;  1X69 A;  3MEW A;  2XHC A;  1WX6 A;  2ZPH B;  5CKB A;  1NLP C;  4JJN K;  2A28 A;  1QCN A;  3GP8 A;  2RJE A;  1M3B A;  2DD5 A;  3LLR A;  1QKX A;  1NZ9 A;  1W6X A;  3L42 A;  1KC8 C;  3A8O B;  3DB4 A;  1QMC A;  2C0T A;  7AT1 B;  2LMJ A;  4XTU A;  2J7I A;  1EFN A;  3QPH A;  1K73 R;  1K1Z A;  1FX7 A;  4M7A D;  2FPE A;  1Y96 B;  2E6Z A;  1N8R C;  5KYY B;  2L3Q A;  8AT1 B;  3QHS A;  3ASK A;  3EGD A;  3NTK A;  3LWI A;  4FCY A;  5GMK i;  2ROT A;  1K4U S;  3JB9 H;  5LJ5 f;  4LN2 A;  4HCB A;  1TU0 B;  1I5O B;  3HL8 A;  1K8A U;  2OAW A;  1JQQ A;  4JDS A;  4DA4 A;  2HDA A;  1VUB A;  2ED0 A;  2BTT A;  3L2W A;  5LJ5 j;  3CXC A;  1XQH A;  1K9M U;  2O4X B;  1SSF A;  3OBW A;  5GAN e;  5A0L A;  2DA9 A;  3I56 Q;  2QQ9 A;  3TSZ A;  3X26 B;  3GF5 A;  2L0A A;  1WPY A;  1OX8 A;  1YJN Q;  1H3H A;  3EHQ A;  1RAA B;  4FYV B;  3LW5 E;  2LTO A;  4AFQ C;  4PJO A;  1TSF A;  4C5I A;  1WGS A;  2YUN A;  3M57 A;  2C06 A;  2DL5 A;  3QJY A;  1T0J A;  2OAU A;  4XAX B;  4X9C A;  1YNZ A;  2Z0W A;  1KQS P;  3D7S B;  2DVJ A;  1G3W A;  2BIV A;  4J9E A;  1JEG A;  1YHQ T;  2EYQ A;  3L2U A;  3FIF A;  1IB8 A;  1D1C A;  1PKS A;  3OQ5 A;  1RLQ C;  1M5Q 1;  2HBW A;  2X51 A;  4K11 A;  3CC4 T;  4XU0 A;  2EVR A;  2D9T A;  5GAN 8;  3HRS A;  4JPB W;  4KT0 E;  2JMA A;  2LQK A;  3DLL A;  1QCF A;  2KY9 A;  2F5K A;  1KD1 U;  5C0M A;  1VIF A;  3UA7 A;  4BUG A;  2IPO B;  1Q86 C;  2F2X A;  2HQH A;  4DEX A;  2MIO A;  1N5Z A;  3L1A A;  4OMQ A;  2E64 A;  5HY6 A;  2JM8 A;  2LX9 A;  5I21 A;  1JBM A;  2QK0 A;  5GAM j;  1VQ9 A;  4KGV B;  3A8L B;  3CCJ Q;  4PJN A;  4JS4 A;  4FM4 B;  4A4H A;  5FRM A;  4OMM A;  3EGU A;  4M7A B;  4FW1 A;  3TCJ A;  1I81 A;  2QYZ A;  5CQX A;  2K9G A;  1YIT A;  1M2O A;  5A0G A;  1IGU A;  3CME A;  3OW2 A;  3QWY A;  2E5Q A;  3OA6 A;  2DIG A;  3CPW P;  4HCK A;  1O9S A;  3M58 A;  2CYZ B;  2L5Q A;  2FZK B;  4J6W A;  4E7I A;  2HZY A;  5GAO q;  2DF6 A;  3A8G B;  1YI2 Q;  2O9V A;  4M7D E;  3PNW C;  2EIF A;  1MMA A;  4DEY A;  1KSW A;  3RIR A;  3G71 T;  4M7A G;  4EMK C;  3ER0 A;  4N0A A;  4VUB A;  4OMF B;  2MK5 A;  3FB9 A;  3RBB B;  3VS6 A;  4C8Q D;  4F7U G;  1QVG A;  3EG2 A;  2CUB A;  2DL8 A;  2MWP A;  1SPK A;  1QWF A;  2NWM A;  4FYX B;  4EIK A;  4ME7 A;  4C0D B;  2DYB A;  3EGX B;  3MO8 A;  5IHN A;  4OMO A;  2RQT A;  3EG1 A;  4QVC A;  5EG2 A;  1G83 A;  2KMT A;  1JJ2 A;  4FSS A;  1C1A A;  2FG0 A;  4CC2 A;  3OYH A;  1UTI A;  4AG2 C;  1VYV A;  1VQ6 T;  4N4I A;  1WXT A;  2YXY A;  1RAC B;  3CME T;  4ZGD B;  1U5S A;  3FJP A;  4PJO G;  4PJL A;  3CEY A;  4OML A;  3I55 T;  3CCQ Q;  1X6O A;  1BI0 A;  2XDD A;  3JCM h;  2JS2 A;  1PSE A;  2JW4 A;  1IHV A;  2DET A;  2RI2 A;  4QT7 A;  3INZ A;  3HP9 A;  2Y90 A;  1C0M A;  2DZC A;  1PM3 A;  4C8Q E;  1X01 A;  3URG A;  3CPW S;  4LDY A;  2E5K A;  5DLO A;  3EH2 A;  2M16 A;  3GPL A;  1WJR A;  4QQD A;  2E3H A;  3M5A A;  2SEM A;  1SRM A;  4OMP A; 
#chains in the Genus database with same CATH homology
 2EQJ A;  1QVG S;  2HBP A;  4QVZ A;  3JB9 J;  3S3N A;  4XU1 A;  5LJ3 g;  3G71 A;  3CCM T;  5KCH A;  3CCQ A;  3CD6 A;  5KE3 A;  3G7Z A;  2KSS A;  3CBP A;  2WSC E;  5LJ3 e;  3JSC A;  1RL2 A;  4HCC A;  1WJS A;  4RCC A;  4PJO D;  2DK3 A;  2DTO A;  1YJW A;  3OYE A;  5GMK e;  3HKS A;  1M90 U;  4Q5W A;  4BAC A;  1H64 1;  3JCM d;  4E7J A;  2KAF A;  4M75 E;  4M78 E;  1G3Y A;  5GAO r;  1W2B A;  3Q1J A;  2JVV A;  3OYA A;  1G3S A;  5HK3 A;  4QVD A;  1U8R A;  1QVP A;  3NFC A;  3OYK A;  1KC8 U;  4MZM A;  2V8I A;  3X25 B;  1BKB A;  3TU4 K;  2EFI A;  1UEB A;  2VYT A;  4V2S A;  1VQ8 A;  3M53 A;  3CCE T;  1M9S A;  2WSE E;  2JOY A;  1ZBX A;  2LCC A;  1Q7Y U;  3V7R A;  1NPP A;  1P92 A;  4ZGJ B;  5HKC A;  3JAM E;  3PTA A;  3QG1 A;  1VQK A;  2LRQ A;  1VQ6 A;  3VV0 A;  1TH7 A;  3C95 A;  5GAN 5;  5GAN 3;  3E9F A;  1K8A C;  1VQ4 T;  4ELY C;  4F7U E;  2LCL A;  4E47 A;  2QA4 A;  1VQO T;  5HK0 A;  5DLQ E;  4PLI A;  4J8O A;  5GMK m;  4Y28 E;  1XTD A;  5A0D A;  3GNF B;  2GF7 A;  3PFS A;  4OGC A;  1M4Z A;  2RHI A;  4HKE A;  2WAC A;  5C6S A;  3G6E T;  3QSU A;  3M4Y A;  4O5V A;  4N0A C;  1HK9 A;  3CD6 T;  5KE2 A;  3FLG A;  4L5G A;  4J83 A;  3JCM b;  5GAN 2;  4IUP A;  1VQ7 T;  4FU6 A;  4JRI A;  4WF2 A;  3ME9 A;  5KH6 A;  2RHU A;  3JB9 F;  2VV5 A;  2YLC A;  2XK0 A;  4C8Q C;  2D0Q B;  4CRI A;  3CCQ T;  3C12 A;  4M75 A;  2B8A A;  4EMH A;  3P8H A;  3DB3 A;  2L8D A;  2RH2 A;  2OTJ A;  1M90 C;  3CCS A;  4M77 C;  4F7U B;  2R58 A;  3M59 A;  4P5N A;  3RMQ A;  4M77 E;  4KUD K;  4C0F A;  3FEO A;  4J6X A;  2JTM A;  3NTH A;  3RKY A;  1WNL A;  4C0G A;  1S72 T;  2LT1 A;  3M55 A;  5D6Y A;  5DM7 R;  5GAN f;  2EJ9 A;  3RKX A;  1NJI C;  4BD3 A;  2VGM A;  2JTF A;  2YHT A;  1QP2 A;  3QKJ A;  3MEV A;  3R6O A;  1N9R A;  4C5G A;  2XD0 A;  4PJO E;  4UC4 A;  2RHX A;  1YJ9 A;  4XTV A;  1IZ6 A;  5CAI A;  3VUZ A;  4NL3 A;  4C8Q F;  1MHN A;  3CCV T;  3CCU A;  2LT4 A;  3JCM c;  3ZEH A;  2QQS A;  2RJC A;  3JCM P;  2A3L A;  1U1S A;  3ZBD A;  2EAY A;  4N4G A;  2LQ8 A;  3LGL A;  4QQG A;  3VYH B;  3QZ9 B;  2MAM A;  3FC3 A;  5J3B A;  2P0K A;  4BDZ A;  4MZP A;  5LJ3 h;  4E7K A;  4XTZ A;  4PJO B;  3QBY A;  1FWZ A;  2QDY B;  4IUT A;  2V8K A;  4J5Y A;  3JCM V;  2EQM A;  4M7A F;  4RCB A;  1YJN A;  5LL6 S;  1EIF A;  4IUR A;  5GAO p;  3BDU A;  3LH0 A;  4OB1 B;  3X24 B;  3T9N A;  3MCA B;  5GAM e;  3CC4 A;  1PSF A;  2QQA A;  4M77 G;  4NOY A;  3CC2 A;  2XI9 A;  1NPR A;  2XID A;  4M78 A;  1VQ5 A;  3EFR A;  2DEQ A;  2RD1 A;  1JB0 E;  1N27 A;  2DXB A;  2RB6 A;  2O4X A;  3BW1 A;  3OMC A;  3EFS A;  3CMA A;  2CZ1 B;  2RJF A;  3HFO A;  3ZFJ A;  2M0O A;  4X9D A;  4XU2 A;  4M75 D;  2E70 A;  4DQ2 A;  4M78 D;  2CZ6 B;  1R8O B;  3OYG A;  4PNO A;  3RMS A;  3OYJ A;  2LNV A;  4FT2 A;  1KQ2 A;  4F7U F;  2E41 A;  1WQ7 A;  5CCA A;  5CR2 A;  1BIA A;  4GLK A;  1X75 C;  3LX7 A;  1M1K U;  1WJQ A;  2BKD N;  4EDU A;  5AYF A;  2PVD B;  2PUK B;  1S72 A;  1XOV A;  3L2V A;  3A8M B;  4C92 D;  3H8Z A;  2ZPI B;  1K73 C;  3PMI A;  2K3Y A;  5IN1 A;  4A54 A;  4EMK B;  1WQW A;  2R5A A;  4Z02 A;  4C8Q A;  4DOW A;  1HXD A;  3JCM X;  2V8J A;  5A2Q E;  4BE2 A;  3N5B B;  3PGG A;  4DOV A;  1UGR B;  3VYG A;  5FLX E;  4YTL A;  2GFU A;  5FU7 B;  5J26 A;  4D6W A;  2BUD A;  2EKO A;  5I2S A;  2DJZ A;  3C94 A;  4HA8 A;  4BY6 C;  3JCM e;  3KBG A;  4JLI A;  3MEW A;  2XHC A;  1VQN T;  2ZPH B;  4M77 D;  3TEE A;  3CPF A;  4O6J A;  5CKB A;  4BI3 A;  2XG8 D;  3AHU A;  3CCR A;  4JJN K;  1JRI A;  4BE0 A;  1OYX A;  4M75 G;  4IUQ A;  4M78 G;  4A4F A;  1K73 U;  2DAQ A;  2GFA A;  4J7F A;  3GP8 A;  2RJE A;  2G3R A;  1VIE A;  1UGS B;  4PKC C;  2DD5 A;  2ZPG B;  1QW1 A;  1YCY A;  2PVG B;  3EAE A;  1Q82 U;  1VQL T;  3MEA A;  3UDC A;  3CCL A;  3LLR A;  5LJ3 j;  2A7Y A;  3G6E A;  2CKK A;  1NZ9 A;  4KBM B;  2DTI A;  2RK2 A;  3HRT A;  3JRZ A;  3L42 A;  2OTL T;  1KC8 C;  3A8O B;  3OYF A;  5GAN 6;  3DB4 A;  4C5E A;  5GMK j;  2X4J A;  3BFM A;  3OS2 A;  1AHJ B;  3X20 B;  3JB9 I;  3CMA T;  4XTU A;  5LJ3 f;  3QPH A;  4GY5 A;  1YIJ A;  1N6A A;  1FX7 A;  4X34 A;  3SDZ A;  3UPU A;  1YIT T;  2PUO B;  4M7A D;  3OS5 A;  1Y96 B;  2ZPE B;  2E6Z A;  1N8R C;  3TRE A;  1KD1 C;  2K57 A;  3SWN B;  2ZPF B;  1KHC A;  3KUF A;  2ZGW A;  3RES A;  2QEX T;  1YJN T;  2DZ9 A;  3QHS A;  3ASK A;  5CO7 A;  1Q86 U;  4C92 C;  1M8V A;  2E6N A;  3NTK A;  4HCZ A;  4EMK A;  3LWI A;  5GMK i;  1UB4 A;  4M75 C;  3CC7 T;  3E19 A;  4M78 C;  2EQU A;  3H6Z A;  3MP1 A;  4L59 A;  1UGP B;  4XTW A;  3V7S A;  5LJ5 f;  3JB9 H;  2FYK A;  3SD4 A;  4B9X A;  1KG1 A;  4HCB A;  1BYM A;  2PVO B;  3C4S A;  3CC7 A;  2JZ2 A;  2WSF E;  1KQ1 A;  3HL8 A;  4MZT A;  3UT1 A;  3A8H B;  2CGH A;  4BI4 A;  5LJ5 d;  1K8A U;  4M7D G;  4DA4 A;  4JDS A;  3MP6 A;  5DY9 A;  4PJO F;  4C8Q B;  1VUB A;  3L2Z A;  2Y4X A;  4C0Z A;  1VQO A;  2LDM A;  3L2W A;  2LVM A;  5LJ5 j;  3CXC A;  5GAN g;  2RK1 A;  2EJG A;  1XQH A;  4ZN1 A;  1K9M U;  5CQY A;  2O4X B;  2FL7 A;  3MHX A;  1SSF A;  2RJD A;  1BI1 A;  3OBW A;  5GAN e;  3A5Z B;  1O75 A;  5A0L A;  1YI2 A;  1ZQ1 A;  5KCO A;  1GXI E;  3QZ5 B;  3MET A;  2QQ9 A;  4FSX A;  4QQ6 A;  4MML A;  3CCS T;  2VC8 A;  1VQN A;  3X26 B;  3FDR A;  5GAM h;  4IKF A;  2AHJ B;  3GF5 A;  4BI8 B;  1WPY A;  4M7D B;  3QXE B;  3S3O A;  2PU9 B;  4OGE A;  1VQL A;  1LJO A;  2P4T A;  2QI2 A;  4OVA A;  2DKG A;  5CKH A;  2DVE A;  3HRU A;  4RG2 A;  2DO3 A;  3WVE B;  3V7C A;  2Y4Y A;  3O8V A;  4EPC A;  4HT8 A;  3LYI A;  3LW5 E;  3J81 E;  2LTO A;  3JCM g;  4PJO A;  2EQK A;  4F7U A;  4XK8 E;  4M7A C;  1OZ2 A;  3PMT A;  1WGS A;  3M57 A;  2MWO A;  4PL6 A;  5D6W A;  3QJY A;  3RKW A;  2K5I A;  2DXT A;  4KUI A;  2C06 A;  2OAU A;  2QQR A;  2KVQ G;  4XAX B;  3QDR B;  1VQ4 A;  2CZ7 B;  4X9C A;  3RER A;  1VQM T;  3LWH A;  5FRN A;  4BDY A;  1M1F A;  1YIJ T;  1G3W A;  2BIV A;  4C5I A;  4M7D A;  3S6W A;  4ZGE B;  2IG0 A;  1N9S A;  2EYQ A;  3L2U A;  1YHQ T;  2ZCF B;  3FIF A;  5D6X A;  2RHY A;  4MMK A;  1YJ9 T;  4NS5 A;  1Q81 U;  1MGQ A;  2L3R A;  4N4H A;  4M7D D;  4OB0 B;  1D3B A;  1OI1 A;  3OQ5 A;  5GMK l;  2OTL A;  3GIB A;  2JNG A;  1YHQ A;  2FVU A;  2I2L A;  4PLL A;  1M5Q 1;  2IVW A;  2K3X A;  3P8D A;  3I55 A;  3CC4 T;  4XU0 A;  2D9T A;  3PT9 A;  3HRS A;  5GAN 8;  2YRV A;  4LD6 A;  4KT0 E;  4C0D C;  1D3B B;  3CCJ T;  3PIP A;  2LQK A;  3CXC S;  3DLL A;  4RG8 A;  2RO0 A;  2OTJ T;  2DPP B;  2KY9 A;  5IAY A;  1BIB A;  2F5K A;  3JCM Q;  4EMG A;  5LJ5 h;  2KDS A;  5C0M A;  1VIF A;  1KD1 U;  2F5T X;  4JUV A;  3JCM f;  4Y91 A;  4BUG A;  1Q86 C;  3E9G A;  5GAM f;  3L2R A;  3MEU A;  3OYY A;  4MDW A;  2RI3 A;  5FU7 C;  3L1A A;  3SB2 A;  3SFM A;  2E12 A;  2E64 A;  5HY6 A;  2MMP A;  5LJ5 g;  2DIQ A;  2O01 E;  2LX9 A;  3GLX A;  3PIO A;  5GAN j;  5I21 A;  1JBM A;  4C92 G;  5GAM j;  1VQ9 A;  3OYB A;  3A8L B;  4FT4 A;  4PJO C;  3CC2 T;  1LNX A;  1U1T A;  5GAN d;  1Y7X A;  2HQX A;  4JS4 A;  4HT9 A;  1IRE B;  4FM4 B;  4LDU A;  4A4H A;  5FRM A;  2GCX A;  2MI6 A;  3BDL A;  3VJP A;  3CPW A;  4RKU E;  4FL6 A;  3G4S A;  4OP0 A;  5FRO A;  3CCE A;  1M1K C;  4ZN3 A;  4M7A B;  3CCV A;  1BI3 A;  5I2M A;  3WXM B;  3TCJ A;  4M7A E;  1I81 A;  5CQX A;  4LDV A;  1YJW T;  4A53 A;  2XU8 A;  1I4K 1;  1LOJ A;  1RI0 A;  1YIT A;  4XQ3 A;  3P8B B;  1Y07 A;  5GMK h;  4JLG A;  3UWN A;  2FB7 A;  2HNI A;  2K5F A;  5A0G A;  1KQS S;  1VQ8 T;  3CME A;  2VXE A;  2JUF A;  3DKM A;  3OW2 A;  1VQP T;  2P0Q A;  3OSV A;  2QEX A;  1Q81 C;  2YLB A;  4BY6 B;  2E5Q A;  3LGF A;  3OA6 A;  2DIG A;  4L6V 5;  3RUX A;  3QII A;  1K9M C;  1BI2 A;  2NLU A;  4M7D C;  3OMG A;  4M77 A;  4C92 F;  2E1H A;  2VGN A;  4LD9 K;  5FU6 B;  5GAM d;  3OW2 S;  1XNI A;  4XTY A;  1QVF A;  1O9S A;  3OS0 A;  3M58 A;  2CYZ B;  2L5Q A;  3OYD A;  2QA4 T;  4J6W A;  2K4Y A;  4E7I A;  4FIB A;  2E65 A;  1YI2 T;  5GAO q;  3A8G B;  1W2B S;  4BE1 A;  1Y71 A;  4M77 B;  4ZTJ A;  3I56 A;  3PNW C;  4M7D E;  4BB7 A;  2EIF A;  1QP3 A;  1YBY A;  1ZHI A;  3RIR A;  2M9U A;  2F69 A;  3G71 T;  4XU3 A;  4IUU A;  4EMK C;  3HPW A;  3CCM A;  4M7A G;  3WVD B;  4C92 A;  5GAM g;  2KK4 A;  3ER0 A;  3FRN A;  3CCJ A;  1B34 A;  4N0A A;  2X4X A;  3V8J A;  5J39 A;  4JS5 A;  4CI0 C;  1N8R U;  4VUB A;  4OMF B;  3FB9 A;  4C8Q D;  1Y96 A;  5GAO m;  1VQ5 T;  2RI5 A;  1NE8 A;  3QYH B;  4F7U G;  3OYM A;  3X28 B;  1QVG A;  2DD4 A;  2HQE A;  2MWP A;  2QTX A;  3I56 T;  4JRP A;  4ME7 A;  3QJ6 A;  4C0D B;  5L8R E;  3JCM J;  2DXC A;  2HAX A;  5LJ3 d;  2XDP A;  3MO8 A;  2L89 A;  3OSS C;  3CBM A;  3OBY A;  3NTI A;  3L2Q A;  1I5L A;  3JB9 G;  3M54 A;  1VQM A;  1B34 B;  4M78 F;  4M78 B;  5EG2 A;  4QVC A;  4OB2 B;  5CKD A;  5GAN 7;  3QUI A;  1KQS A;  5GAO l;  3OB9 A;  2KMT A;  1JJ2 A;  1V29 B;  5CVI A;  5CK9 A;  3HSB A;  3J80 E;  2E10 A;  2RM4 A;  4XTX A;  2EJF A;  3OYH A;  4MDX A;  1VQ6 T;  2D6F A;  3BY7 A;  2R5M A;  2HD0 A;  4QW2 A;  3CCL T;  3CCR T;  3HHT B;  2CS7 A;  4JRK A;  4N4I A;  4B9W A;  3OYC A;  4ELZ C;  5LJ5 e;  1VQ9 T;  3CCU T;  1VQ7 A;  5GAN h;  4E7L A;  4RMO A;  3KXT A;  4A4G A;  4C8Q G;  2GQV A;  2X4Y A;  3CME T;  1VQP A;  2XDB A;  1W4S A;  3JCM W;  4LDX A;  1H3Z A;  4ZGD B;  3GNG A;  2XIC A;  3G4S T;  3FJP A;  3M9Q A;  4PJO G;  1G3T A;  3DLM A;  4KUL A;  3CEY A;  3HFN A;  4A4E A;  4M7A A;  3I55 T;  3V8L A;  4IUV A;  3CBO A;  4J7I A;  5CIU A;  3VKI A;  2P0P A;  3S3M A;  1X6O A;  1BI0 A;  4OB3 B;  2XDD A;  4R56 A;  2M1H A;  3OYL A;  4ATO A;  1Q7Y C;  1KHI A;  5CKF A;  3JCM h;  2R57 A;  2RHZ A;  2XKO C;  1PSE A;  3QO3 A;  2PQW A;  4M77 F;  4M75 F;  1OZ3 A;  4E7H A;  2DTH A;  4NL2 A;  1Q82 C;  4M7D F;  2K2V A;  3VU3 C;  4C5H A;  4JRQ A;  2RI2 A;  3INZ A;  3V8K A;  2LC4 A;  5GAO n;  1QVF S;  2EWN A;  3SWN A;  3HP9 A;  1G5V A;  1FXX A;  2X4W A;  2X35 A;  3OS1 A;  3J7A F;  2Y90 A;  1DJ7 B;  2H3J A;  3VUB A;  2DZC A;  3F70 A;  4C92 B;  4R55 A;  4C8Q E;  2MF2 A;  5IT9 E;  3JB9 D;  4C92 E;  5CKE A;  1JJ2 S;  1X01 A;  4OF1 A;  2QQB A;  3SWN C;  2K5L A;  3URG A;  1NJI U;  2CZ0 B;  3CPW S;  4LDY A;  5M9O A;  2RA2 A;  5DLO A;  4J6Y A;  3MP8 A;  3GOX A;  1UGQ B;  1VQK T;  2FHD A;  1M1G A;  2M16 A;  2ZZD A;  3QYG B;  3GPL A;  4M75 B;  4A4K A;  2VUB A;  5GAN 4;  3M56 A;  1WJR A;  3E1S A;  2JN0 A;  3OYI A;  2DXU A;  4II1 A;  4TVR A;  3OYN A;  2KQW A;  1I8F A;  2ZPB B;  3M4G A;  3M5A A;  4QQD A;  4ZTF A;  2QXF A;  3OY9 A;  4LDW A;  2VXF A;  5FU6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...