2MWOA

Solution structure of 53bp1 tandem tudor domains in complex with a p53k370me2 peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural Plasticity of Methyllysine Recognition by the Tandem Tudor Domain of 53BP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/antitumor protein
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA01
4BE1A 1JJ2S 2E5QA 3CCJA 4RG2A 1Q82C 3MEUA 2EQUA 3CPWS 2RI5A 3DB4A 2O4XA 2RJCA 5IAYA 1VQOA 2QQRA 1VQ7T 1YJ9T 2K3XA 4ZTFA 1VQ4A 3ZEHA 3CC2T 3G6EA 1VQ5T 3L2VA 2OTLA 1QVGS 2XDPA 1Q82U 3NTHA 2L8DA 3S3NA 4N4HA 2DIQA 2E6NA 3PIPA 3OS0A 3OYNA 3CMEA 1M1KC 4C5GA 3CPWA 3QKJA 5KCHA 5A2QE 2G3RA 5J26A 2QA4T 3CCRT 1KD1C 4TVRA 2RHUA 2X4YA 2RI2A 4IUQA 1YJWA 1RL2A 1YJNT 1QVGA 5KE2A 3L2UA 1M1KU 4ZN3A 3OY9A 3DLMA 3G71T 1VQKA 1KC8C 5C0MA 1VQPT 3CC7A 1KD1U 4E7IA 3QIIA 3CD6T 2F5KA 3O8VA 1Q7YC 3CCET 1VQLA 1YHQA 1BKBA 4IUUA 1KC8U 5IT9E 4GY5A 3CCVA 3J81E 1MHNA 3CCMA 2LVMA 2OTJA 1N27A 2D9TA 1VQMA 1Q7YU 3CCLA 3PNWC 3QBYA 4IUVA 1YBYA 1YITA 5CIUA 3OYAA 1YIJA 4X34A 4BDYA 1VQ8T 2BKDN 2DO3A 4IKFA 3OYIA 4IUTA 3CXCS 3OYGA 4HCZA 1M1GA 4UC4A 3OA6A 3LX7A 3G4SA 3CCSA 1NPRA 1M90C 2HQXA 4E7LA 1YJ9A 3MEWA 3CC2A 2EKOA 3P8BB 2XK0A 4N4IA 3I56T 3UT1A 1N8RC 3CC4A 5M9OA 2RJEA 4B9WA 5FROA 3CXCA 3OS2A 2LCCA 1M90U 2X4WA 2M16A 2KVQG 5KE3A 3FC3A 3CMAT 1VQ9A 2RHXA 4L59A 3CCRA 4Q5WA 1KHIA 3JAME 3OYLA 1N8RU 5J39A 1S72A 3PMIA 1K8AC 1QVFS 3NTKA 2R5AA 4LD6A 3CCUT 4C5EA 2QEXT 3FEOA 1Q81C 1VQNT 2NLUA 2R57A 3OW2A 2P0KA 2PQWA 2L3RA 3I55A 2IG0A 1K8AU 5FLXE 1SSFA 3OYBA 3PIOA 4ZTJA 3KBGA 1YI2T 1IZ6A 1QVFA 2YRVA 1Q81U 4E7KA 3L2WA 4IURA 1K73C 2XHCA 1VQ6A 3P8DA 3DLLA 4A4EA 1X6OA 1W2BS 2GF7A 3CCJT 3MO8A 3OS1A 2JOYA 4NS5A 3L42A 3CCQA 3MP6A 1K73U 1OI1A 2QQSA 3C4SA 2HQEA 1VQOT 2WACA 1VQ4T 3DB3A 3G6ET 4CRIA 4QQDA 2OTLT 4FU6A 2DIGA 4A4FA 2M0OA 1G5VA 2RHIA 1W2BA 3CMET 1WJSA 4PLIA 4IUPA 4QVZA 3OYMA 3L2QA 3BDLA 3NTIA 5IN1A 1YJWT 5KH6A 4PLLA 2B8AA 4A4GA 5FRMA 3H8ZA 1K9MC 1VQ7A 3S6WA 2EIFA 4BE2A 2E70A 4BE0A 2JNGA 1XTDA 3OYKA 1VQKT 1VQ5A 3CC7T 4QQGA 2R58A 2KDSA 2RHZA 3LLRA 5HY6A 4C5HA 3ER0A 4EDUA 1VQLT 1YHQT 3OYCA 2EQJA 3H6ZA 1K9MU 1OYXA 3KUFA 3OW2S 1KQSA 1NJIC 1WGSA 3E9GA 5DM7R 2DAQA 3ASKA 2VYTA 3OMCA 3S3MA 2QA4A 3MP1A 3CCMT 2OTJT 2BIVA 1OZ3A 3CCLT 1VQMT 4A4HA 1YITT 1YJNA 1NPPA 1NJIU 3G71A 2EQMA 4E7JA 2GFUA 2RJFA 1VQPA 3J7AF 3G4ST 3HKSA 3CCST 3OB9A 3CD6A 1RI0A 4BDZA 3CCEA 4B9XA 3MEVA 2EFIA 4C5IA 2LCLA 3P8HA 5C6SA 4QW2A 3J80E 3CC4T 2X4XA 1JJ2A 3FDRA 2JZ2A 3Q1JA 2MWPA 2GFAA 4BD3A 2JTFA 1WJQA 5D6XA 3LGLA 2EQKA 3OYJA 1H3ZA 3FLGA 1VQ8A 3LGFA 1VQ9T 3UWNA 5DLQE 2LTOA 3F70A 1S72T 3PMTA 2MI6A 5D6WA 3SD4A 3TREA 2M1HA 5KCOA 3S3OA 2JVVA 1UEBA 2JUFA 1Q86C 3META 3I56A 2L89A 2O4XB 2LDMA 3I55T 3MP8A 2R5MA 2RO0A 2FHDA 3E9FA 3MEAA 3OMGA 3OYFA 4PL6A 2K3YA 3CMAA 1Q86U 3OQ5A 1KQSS 1VQ6T 2X35A 3GOXA 5LL6S 2LRQA 2LQ8A 2BUDA 4E7HA 5FRNA 5D6YA 3PFSA 3CCUA 2QEXA 4OVAA 1VQNA 4FL6A 1WJRA 1OZ2A 4N4GA 3M9QA 3OYYA 3CCQT 3CEYA 4YTLA 3L2RA 1XNIA 3EAEA 2MWOA 2RJDA 3LYIA 1NZ9A 2CKKA 4Z02A 3A5ZB 3LH0A 2RHYA 1YI2A 1KHCA 3ME9A 3CCVT 3OYEA 3CPFA 4II1A 5J3BA 2RI3A 3OYDA 3OYHA 3QJ6A 2E6ZA 4QQ6A 4ZN1A 1EIFA 1YIJT 4BACA
chains in the Genus database with same CATH superfamily
2KMTA 1TSFA 1U06A 1XOVA 2RJCA 2DD4A 2B86A 1X43A 5LJ5d 1VQOA 2FZGB 4A53A 1VQ7T 2ZPIB 1M27C 2CT4A 4XTUA 2K3XA 4ZTFA 2NUZA 4MDWA 1G83A 1PKTA 3OBYA 4FYXB 3E1SA 4HCCA 2BZ8A 4KH0B 3FJPA 2HSPA 3S3NA 2EGEA 2L5QA 2VGMA 2VXEA 3OS0A 1M1FA 4M78B 1YN8A 5A2QE 2O9VA 1I5OB 5KYWB 3CC2Q 1NLPC 1VQ5Q 2EGAA 4RUGA 2DTOA 2QDLA 1K76A 1VOMA 2KT8A 2RHUA 2X4YA 3I9QA 5FU7B 2CH4A 1RL2A 2RQUA 1QVGA 2D8HA 4KBMB 4E2FB 1QKXA 1U1TA 3KFVA 4QT7A 3EG9B 3JB9F 5C0MA 2EPDA 1B34A 1M9SA 5GMKj 3H41A 1VQ9Q 4E7IA 1R0BG 3HPWA 3H0HA 2HQHA 3CD6T 2A7YA 1H641 2CP0A 1YHQA 1YJNQ 3FIFA 5FWCA 4Y28E 1BKBA 2FZKB 2J7IA 5GAN6 3G71Q 4GY5A 5IT9E 5GAN8 4PJOA 2KNBB 4CC4B 3CCVA 2LNVA 2JS0A 4ZNXA 3CCMA 2PTKA 4XTVA 2OTJA 1TUCA 3VS5A 3I55Q 1Z9ZA 2D9TA 1VQMA 4ESRA 1YITA 2DXBA 4J7IA 1UE9A 1UHFA 3V8KA 4RTWA 2KYMA 3JCMP 2DETA 2DXUA 2HEQA 3PT9A 4PJOF 4JRKA 2DRKA 5L8RE 3CXCS 5LJ5g 4EMKA 1EX4A 3HFNA 4OMLA 4PJOE 2EJFA 4E7LA 1SF9A 3MEWA 1HK9A 1K9MR 2M9UA 2EYQA 2XK0A 2SRCA 4RTTA 4F16A 2EBPA 2LZ6B 4HVVA 4LUDA 3CCQQ 1N8RC 2RJEA 3JCMg 5FROA 1WX6A 5KYUB 2DBKA 4LDXA 3OS2A 2BE9B 2CZ1B 2X4WA 2LT1A 4R0KA 2E4HA 3AT1B 5KE3A 1ZA1B 5GANg 3FC3A 1ZUYA 3EG9A 3V7CA 4L59A 2GQIA 1ZUUA 5GMKh 5J39A 4OMQA 1O75A 1RADB 3QPHA 2DJQA 4LD6A 4F7UA 2QEXT 1Q81C 1VQNT 2KBTA 1QCNA 2P0QA 2P0KA 5FLXE 4F7UF 3SDZA 1IZ6A 1QVFA 5KYXA 4JJBA 2O88A 2XI9A 1J3TA 1K73C 2E12A 4F7UE 1FYNA 1WXBA 1Y57A 2DFUA 4X9DA 2PVOB 5L23A 1JRIA 1N9RA 1X2QA 1Q95G 2HBPA 1UGQB 4A63B 1M1KR 5GAMj 4NL3A 3EGUA 4C0ZA 1T3SA 1TG0A 4D6WA 3C4SA 1LPLA 3UATA 1ZSZB 1VQ4T 1JBMA 2GGRA 2OTLT 1OX8A 2DIGA 2M0OA 2YXYA 3CCJQ 4OMPA 4XU3A 2OAWA 1M3AA 4HVWA 4BI4A 2SEMA 4E47A 3EFOB 4A4KA 3OYMA 4QVZA 3RIRA 3BDLA 1YJWT 5KH6A 2RQRA 2BE7D 1K4US 4C8QD 1KJWA 3FB9A 1VQ7A 3V7SA 2EIFA 3OYKA 3ULRB 2D1XA 1IXDA 2LNHB 3CXCP 2BZXA 4KGXB 2YUOA 4F14A 3EG2A 1ZLMA 3ER0A 1ABOA 3QXEB 1PD1A 1VQLT 3VV0A 1K9MU 4J83A 2DEQA 3RR6A 3E9GA 1QLYA 2DBMA 2CP3A 2DE0X 2VB6A 4PJMA 1QVPA 5GAMh 3JB9G 1UHCA 4OMFB 2BIVA 2QXFA 4X1VA 2DM1A 2QAZA 2IPOB 3CCLT 4J6XA 4MDXA 4M75D 3SFMA 2YWWA 1NPPA 2H3EB 2EQMA 2MOXA 2ROTA 2PZ1A 2RJFA 3LW5E 1JXOA 3J7AF 1G8XA 3GNGA 1WA7A 1Q82R 1UDLA 5GANj 3CD6A 1D3BB 1MNEA 2Y90A 3JB9I 4VUBA 4HA8A 4C5IA 3EFOA 3P8HA 4C8QC 4DBRA 4QW2A 4PJOG 4AT1B 5IHIA 1W6XA 4M78D 2K9GA 2JZ2A 1I1JA 2J6FA 3X25B 3JCMQ 4J6WA 3JB9J 2GFAA 3QJYA 2ZCFB 1WJQA 2QK0A 4JJCA 1YFNA 1VQ9T 5DLQE 1SHGA 1DJ7B 3PMTA 1IHWA 1MMDA 2MI6A 2VVKA 2JT4A 2FVUA 4J9FA 2P0PA 1P92A 1M8VA 1M4ZA 3WXMB 3VU3C 4BB7A 5KYNA 1U1SA 2OX7A 1AOJA 2VKNA 4M75C 1Q86C 4KUIA 2L89A 2O4XB 2QDYB 3I55T 2XDBA 4Z89A 3EFSA 5CK9A 1PKSA 2RO0A 4OB1B 4FW1A 3G7ZA 2JTMA 2KAFA 3X28B 1Q7YR 5CO7A 1AHJB 3HRSA 5I11A 2ZZDA 3JCMh 4KGVB 3HTRA 1KQSS 1CKBA 1BYMA 4OP0A 3WVEB 5LJ3e 3VS0A 1D3BA 5LL6S 5GANh 3CMEQ 2CGHA 4E7HA 3PFSA 4F7UG 2DTHA 3HP9A 2QEXA 1VQNA 4LDYA 1OZ2A 1HYOA 3M9QA 3OYYA 2O2OA 3A8HB 3CCQT 2DVEA 4YTLA 2QQ9A 2YUNA 2K5FA 2ZPEB 4XTWA 4DA4A 7AT1B 1IB8A 3MJXA 3RDVA 4MZPA 2MWOA 2D0QB 2KEAA 2CKKA 4DEXA 2YUPA 4Z02A 3A5ZB 2RHYA 2F5TX 3ME9A 3CCVT 3BDUA 4ANJA 5GAMf 1M90R 3CPFA 2E3HA 3JCMb 2K57A 5J3BA 2KQWA 3RNJA 3LH5A 2E6ZA 4ZN1A 2DA9A 1JJ2S 2M0YA 4LXCA 4RG2A 2MK5A 4Z8AA 3CPWS 2RI5A 2K79A 2ROLA 2HZYA 2ATCB 4EIKA 2O4XA 1K0XA 1WXUA 1LCKA 5HK0A 4CI0C 2C0OA 2AK5A 4CC7A 1VQ4A 4FYVB 1MNDA 2CSQA 3UA6A 1K8AR 4JS5A 2OTLA 1PM3A 3M54A 2IVWA 1JB0E 1Q82U 2L8DA 2DL4A 2DIQA 1BBZA 4QVDA 3OYNA 3QKJA 5KCHA 2X51A 3HRTA 2RQTA 3QDFA 1YJ9Q 5HKCA 5J26A 2RF0A 1Y07A 1WHJA 3EG1A 2LJ1A 3NHNA 4J8OA 1BI0A 1VYUA 4IUQA 1YJWA 1R0CB 3HL8A 5IHKA 5KE2A 3L2UA 2MMPA 1GRIA 3NPFA 1BI3A 3GLXA 5LJ5f 1PCXA 1RAEB 2HKNA 2XU8A 3CCRQ 3QIIA 1S72Q 1AEYA 3O8VA 1VQLA 5CKFA 4DQ2A 4FT4A 2RB6A 4IUUA 4ME7A 1JXMA 3JCMf 2XDDA 5I22A 2LVMA 1PWTA 1N27A 2DD5A 2C0TA 3BE3A 5GANf 3PNWC 2MCNA 1Q7YU 3QBYA 3CCLA 4LDUA 1TOVA 2CP5A 4OB0B 3I5RA 4C8QB 4X34A 3THKA 1VIEA 2BKDN 2KT1A 4HT8A 3SB2A 1KQSP 1U8RA 1M3CA 1M1GA 4UC4A 1VQ6Q 3LX7A 2VV5A 2QASA 4JS4A 2HQXA 2DZCA 2L3PA 2JJ9A 3EHQA 5DLOA 3CC2A 2VUBA 5GAOq 4N4IA 4A54A 1NEGA 1RACB 3I35A 5CR2A 4HCKA 2DXCA 2ECZA 1TUGB 2HDAA 3NMZC 2VC8A 2GTJA 4LDVA 3RMQA 1RAFB 2K2MA 3N5BB 1ZSZC 1M90U 2M16A 1SHFA 4M75B 5LJ3d 4MZMA 2QTVA 1UB4A 3VRYA 4FYWB 1VQ9A 1D1AA 5CCAA 1KHIA 3JAME 1AWOA 1QCOA 3PMIA 4JLGA 2MPXC 2R5AA 1TH7A 1JJ2P 4F04B 1I5LA 4M7AD 2RPNA 1LVKA 1IGQA 4M77C 4BI3A 3CBMA 3CPWP 2E1HA 2R57A 2KXDA 3VUZA 3I55A 5CKBA 1YCYA 2IG0A 3V8LA 1K8AU 1NM7A 1SSFA 3OYBA 4J9HA 1UECA 4ZTJA 4WTOB 1UJ0A 2DKGA 4BUGA 3KBGA 4C8QA 2YRVA 1GFDA 3VS2A 2CREA 3QDRB 2KSSA 3MKDA 2DL5A 3P8DA 4A4EA 1PC0A 1X6BA 4RMOA 1W2BS 1ZA2B 4PKCC 3T9NA 4NS5A 2DK3A 1I4K1 5CKHA 5GAN2 5GAOp 3CCQA 3M53A 1OI1A 1X75C 2QQSA 4AFQC 4KUDK 3UA7A 1SG5A 2CP6A 1RAGB 3DB3A 4CRIA 4QQDA 1AZEA 2C0IA 4A4FA 4J9EA 4M75A 1YNZA 2RHIA 4RCCA 4M7AC 4R56A 3SWNC 2ZGWA 3CMET 1WJSA 3TSWA 4PK4A 5IXBA 1TXQA 1ZQ1A 2EYYA 2KROA 2CZ7B 4M75F 1PSEA 2QTXA 2YSQA 3GF5A 4C92B 3JV3A 4JJDA 2E65A 3L2QA 1HXDA 4PLLA 2B8AA 4M75E 3H8ZA 5GAOr 1K9MC 3KXTA 3VS4A 1M30A 3S6WA 4BE2A 4M78A 1BU1A 2I0NA 1KK7A 1FMKA 5KYWA 1VQ8Q 2D8JA 2KDSA 3LLRA 4C5HA 2P4TA 1UFFA 2ZPHB 1ZBJA 4E7SA 1WQ7A 3EG3A 3PTAA 3OYCA 4N0AC 3URGA 1OYXA 4M78F 3KUFA 3OW2S 1KQSA 3VYGA 4WCIA 5DM7R 1HSQA 1R77A 2Y4YA 4XU2A 3MP1A 4M78E 2IIMA 2CDTA 4L6V5 5HK3A 2BTTA 3G1JA 2DJZA 5GMKi 4E7JA 2YHTA 1PHTA 1NLOC 1TS9A 3CCMQ 3OB9A 4HT9A 2DL3A 4J9IA 1WIEA 3MEVA 3EGXB 1BI2A 3VUBA 2EFIA 2RNAA 3CCUQ 5GAN4 2O9SA 1HJDA 2EYXA 1RLPC 2EQIA 2X4XA 1Q81R 2CT3A 1JJ2A 3Q1JA 1WI7A 1D0ZA 4BD3A 4XTZA 5D6XA 3PVQA 3GNFB 1FXXA 1ZX6A 2YRDA 2AZVA 3FLGA 2X9HA 1SSHA 1S72T 2OJ2A 3EHRA 1TUDA 1XQHA 3QWYA 3M59A 5GMKe 1KD1R 1YP5A 5KYUA 5D6WA 3TREA 2M1HA 3TCJA 2JXBA 3M57A 2JUFA 3RKYA 2L3QA 4J9BA 1KSWA 3EFRA 2QYZA 4PNOA 2JMCA 3HFOA 5GAOm 3M0RA 2LX7A 1KC8R 2Z0WA 4HVUA 1MV0B 2RK2A 3RKXA 2CZ0B 1AWJA 1C6VX 3E9FA 4M77B 4OGEA 2X3XD 2YUQA 1SEMA 3G6EQ 4AG1C 4PL6A 1M3BA 1MGQA 2YDLA 1VQ6T 3GIBA 4GLKA 3EH1A 4K11A 1UGVA 2WSCE 1GBQA 4CC2A 1B7TA 2DYIA 4J5YA 2BUDA 2PVDB 5FRNA 5D6YA 1ARKA 5GAOl 1CKAA 4OVAA 4IIMA 4N4GA 3C95A 1RI9A 1X6GA 3L2RA 3NGPA 1XNIA 1X27A 2COZA 1BI1A 2CH4W 5I2MA 1IHVA 3EAEA 1D09B 4ZGEB 3LYIA 1NZ9A 1U5SA 5LJ5j 1OX9A 5CQYA 4C8QG 4E7ZA 1AZGB 2AKKA 3LH0A 4QVCA 1KHCA 4EMHA 3OYEA 1VQKQ 3EGDB 4V2SA 4II1A 3CC7Q 1N6AA 1VUBA 2RI3A 3OSSC 1ZSZA 1EIFA 3OW2P 2FYKA 5FWBA 4BACA 4BE1A 2O01E 2E5QA 4XQ3A 1WFWA 3C12A 1OU9A 1TTHB 2XG8D 4XU1A 1Q82C 3MEUA 4M7AB 1LOJA 2EQUA 2A08A 3SWNB 4RTUA 3DB4A 2LQKA 1GCQC 1NYGA 1R8OB 4LE9A 4OMOA 2A28A 2QQRA 4JLIA 1N9SA 3RMSA 4M7DD 3CC2T 1G3SA 4M77A 1VQ5T 1KG1A 3V8JA 1YIJQ 2QI2A 4M75G 2CSIA 4MMKA 2PU9B 1BCMA 1QVGS 4Y91A 3NTHA 2A36A 2EVRA 5GAN7 2K7AA 3G4SQ 4HXJA 3CMEA 4OF1A 4C5GA 3CCSQ 4GBQA 1VQ7Q 1RAIB 2G3RA 1A0NB 2DERA 5EC7A 4FYYB 2AKLA 3VS7A 4TVRA 1PSFA 4C0FA 1QW1A 2RI2A 3LWIA 5GAMe 3CC4Q 1YJNT 5CVIA 1M1KU 3OY9A 4M78G 3DLMA 2ED0A 4ELYC 8AT1B 5LJ5h 3G71T 2DILA 1M8MA 3MPUB 4XAXB 1PG5B 1WLPB 2KR3A 1V1CA 1KD1U 1SRMA 1ABQA 1W4SA 2QG9B 2PUKB 2RQWA 1Q7YC 2NYSA 1FMVA 5GAOn 1O9SA 3INZA 2WSFE 1E6HA 4F17A 2A0FB 4AFSC 1KC8U 4M7DC 2DTIA 2EWNA 4M7AA 3J81E 3SWNA 4PJOC 3RUXA 3QYHB 4FSXA 4ATOA 1AT1B 8ATCB 2VGNA 1W1FA 1YBYA 4C92D 2ZAEA 1D1CA 5CIUA 2FPDA 1WPYA 1VQ8T 2V8JA 1ZUKA 1X69A 2JM8A 4AFZC 4M7AF 2KGTA 3FRNA 4IKFA 4RTXA 2E5KA 3BY7A 3OYGA 2DF6A 2ZPGB 3OA6A 1D1BA 4EMKC 4FSSA 4M7AE 1NPRA 1M90C 1VA7A 1YJ9A 3MCAB 1YWOA 4M4ZA 1GFCA 2KXCA 3O5ZA 2FG0A 3UT1A 3EH2A 5M9OA 1Y7XA 4B9WA 2KYBA 4N0AA 3CXCA 1M2OA 2LCCA 4FM4B 2KVQG 5A0LA 2XMFA 4JJNK 2RHXA 2X3WD 1V29B 4X9CA 1YCSB 3CCRA 2PUOB 1NJIR 2LT4A 5FW9A 3OYLA 1S72A 1K8AC 1QVFS 3FJ5A 2LX9A 2P4RA 4C5EA 3CCUT 1Y96B 2H8HA 1N5ZA 2DXTA 1YWPA 4C92C 1V76A 3OW2A 4MZTA 2PQWA 2L3RA 1OOTA 2HCKA 2RA2A 1SKUB 3QUIA 1K1ZA 3PIOA 2CUBA 2DL8A 5GMKm 3D7SB 3M5AA 2E10A 3M0TA 2LC4A 4E7KA 2XHCA 2JM9A 4RTYA 1VQ6A 1QWFA 2I2LA 2VASA 2LQWA 3PVLA 1X6OA 3MHXA 3CCJT 3MO8A 1G3TA 1JU5C 2ABLA 4FW2A 2QA4Q 1LJOA 1UG1A 2HQEA 2E41A 1XJWB 1OPKA 2Y4XA 1E7OA 3G6ET 4FU6A 1D0YA 3E19A 3RERA 1VQPQ 2LJ3A 1ZSGA 1M5Q1 4M77D 4C0GA 2WSEE 1D0XA 2HKQB 4AG2C 4XK8E 4NL2A 4OMMA 3UPUA 3CCEQ 5GAMd 1AWWA 4GLMA 2F2VA 3DKMA 4PLIA 2ZPBB 2EW3A 2MIOA 5IN1A 3I5SA 1KIKA 2VWFA 3OBWA 1HD3A 2KRSA 3PE0A 4J9GA 3JCMJ 2E70A 1XTDA 2A37A 1VQKT 1VQ5A 2LP5A 3CC7T 4R55A 2R58A 2KRMA 2CP2A 1AVZC 1B3QA 3JRZA 3VYHB 2JTEA 2EQJA 3QZ5B 3A8LB 1W70A 4LN2A 2DAQA 3ASKA 1ZBXA 2VYTA 4BI8B 3OMCA 1C0MA 1C1AA 2DRMA 3I56Q 1X2KA 2K4YA 1T0HA 2J05A 4EPCA 1YJNA 5AT1B 2G6FX 1NJIU 2CP7A 3M56A 3G71A 4M7DB 3GP8A 4PJOB 3BW1A 1B07A 3CMAQ 1GCQA 2COWA 1QVFP 1OEBA 3G4ST 2L2PA 4JRIA 3CCST 3M4GA 2DYBA 2X4JA 2RK1A 3CCLQ 2DZ9A 5IHNA 2ED1A 2FO0A 4M7AG 3CC4T 2JW4A 2RQVA 4EMKB 2K5LA 3C0CA 2V8IA 4BY6C 1RLQC 5GAMg 3JSCA 1WYXA 4C8QF 3LGLA 1WDXA 3JCMd 1GXIE 2CS7A 4KRTA 4PJNA 3RESA 1VQ8A 1YI2Q 1UGPB 3QZ9B 3UWNA 5A0DA 1H3HA 5GANd 4C8QE 1AD5A 1WHMA 4FCYA 4L5GA 3SD4A 5DY9A 2FPFA 5KCOA 3S3OA 2JVVA 2LQNA 2DX1A 1QP3A 4AFUC 1M2VB 2OAUA 2LDMA 1OU8A 2QGFB 3ZL7C 2HD0A 3MP8A 2EAYA 2R5MA 1VQOQ 5LJ3g 3ZBDA 2XICA 1WQWA 4F7UB 3IQLA 4ZGDB 1KFZA 1ZHIA 3UDCA 1EFNA 3OYFA 4O5VA 4M7DA 1H8KA 4HCBA 3OQ5A 3A8GB 4LNPA 2K3BA 4RCBA 2O31A 4AMCA 3A98A 2J6KA 4XU0A 1PRLC 2CUDA 1I0CA 3PGGA 3CCUA 4M7DF 5KYXB 4FL6A 4DEYA 3CEYA 2DMOA 1NEBA 4M7DE 1QKWA 4JPBW 1MMAA 2RJDA 4Z88A 1G2BA 4WF2A 3M0PA 2JN0A 2LCSA 3A8MB 4E6RA 3RBBB 4DBQA 3OYDA 1OPLA 4QQ6A 3M0QA 1N8RR 3HRUA 1YHQQ 2J06A 3CCJA 2F2XA 3LWHA 1RAAB 3QYGB 1G3WA 1M2VA 3CCVQ 2F1LA 1UUEA 5IAYA 4OB2B 1X01A 2EJ9A 1IREB 2OTJQ 1VQMQ 1YJ9T 1YITQ 3ZEHA 2JMAA 3G6EA 3L2VA 1IRXA 2KY9A 4OB3B 4MMLA 2M51A 4C92A 2ESWA 2XDPA 3M0UA 3X20B 2D0NA 4N4HA 2DEUA 2E6NA 2K5IA 2XKOC 3PIPA 4KGZB 1IO6A 2OI3A 3X26B 2V1QA 1M1KC 1PRMC 3CPWA 4O6JA 4ORZA 1MUZA 1QP2A 1E6GA 4J9CA 5IXFA 4C92F 2QA4T 3CCRT 1QCFA 2E64A 1KD1C 1QWEA 3TEEA 4C92E 3OSVA 1K73R 1W2BP 5IH2A 4ZN3A 1JO8A 1VQKA 1KC8C 3U23A 1VQPT 3CC7A 2JS2A 4B6MA 5A0GA 3C94A 2FL7A 2F5KA 3CCET 2V1RA 2KI7A 2YLBA 1SRLA 2RN8A 1RABB 1MHNA 5D7UA 4RG8A 1VYVA 4JRPA 4IUVA 1UTIA 3EGXA 2HBWA 3OYAA 1YIJA 4BDYA 2DLPA 2HSEB 2DO3A 3OYIA 4IUTA 3L2ZA 5LJ3j 4HKEA 2FPEA 4HCZA 1Y0MA 4BY6B 5GAN5 4DOVA 2HMAA 3H0FA 2RMOA 3G4SA 1NE8A 2DPPB 3A8OB 3CCSA 4J9DA 3CQTA 1I8FA 3JB9D 4QKUA 2EKOA 3P8BB 1K9AA 1OULA 2FEIA 3I56T 3QSUA 4KT0E 4JDSA 2COYA 2EYWA 3CC4A 9ATCB 4ELZC 4XTXA 1OQKA 2NUPB 1KQ2A 1WXTA 3CMAT 3ZFJA 3HHTB 5I21A 2A3LA 4Q5WA 2HL3A 3REBB 2CYZB 1N8RU 1UGSB 4RTVA 3NTKA 1MMNA 1GL5A 4PJOD 3FEOA 3VRZA 1RAHB 2NLUA 1WHHA 1WHKA 4KH1B 4PFZA 2YT6A 4EMGA 1VIFA 3CBPA 1F1BB 3AHUA 2FRYA 2YLCA 4XTYA 1MV3A 6AT1B 4M77F 3GPLA 1GCPA 5CKDA 1YI2T 3M4YA 1UJYA 1Q81U 2E3IA 4M7DG 2KE9A 3NFCA 2HAXA 4JZ3A 3L2WA 4IURA 4M77E 5LJ3h 4PJLA 3DLLA 3JCMX 2AIRB 1FX7A 2C06A 3BFMA 1PNJA 2K6DA 5CKEA 2GF7A 2V8KA 3OS1A 1TWBA 2M02A 3JCMc 2JOYA 3L42A 4JZ4A 3EGDA 3MP6A 5HCKA 1K73U 1WHGA 3VJPA 4C0DC 1VQOT 4CC3A 2QQBA 1CSKA 5GAN3 2WACA 4RKUE 1FWZA 2EGCA 2NUPA 3A1PA 5FU6C 1G5VA 4DBFA 4FIBA 1W2BA 3QO3A 1TU0B 2DNUA 3TSZA 2AHJB 4LUEA 3EG0A 2D6FA 1Q86R 2XD0A 2DVJA 1I07A 3CD6Q 2XIDA 4D8DA 3M58A 4IUPA 2F2WA 4OGCA 2GTOA 3NTIA 2L0AA 2AT1B 4A4GA 5FRMA 2RH2A 3E2UA 1WHLA 2H3JA 1PD0A 2EJGA 2FRWA 3RKWA 2F69A 1EZZB 4BE0A 3M55A 3HSBA 2JNGA 1BIBA 2GQVA 4M78C 5EG2A 2P84A 4C92G 2CZ6B 3V7RA 5LJ5e 4QQGA 3H9NA 2RHZA 4LD9K 1SPKA 1KQ1A 5HY6A 3H0IA 2GNCA 5FU7C 1GBRA 1K0SA 4EDUA 5CAIA 5GJWB 1YHQT 4P5NA 2AZSA 3H6ZA 3R6NA 2HNIA 1NJIC 1WGSA 1AWXA 3JB9H 3TQ7P 3VKIA 3S3MA 2QA4A 3CCMT 3QWXX 1H92A 2YRCA 3JCMe 2OTJT 1OZ3A 1VQMT 2ZPFB 2PNIA 4A4HA 1ACMB 4J6YA 1YITT 2FZCB 1NBEB 3R6OA 4NOYA 5GANe 3VS6A 1T3LA 4RTZA 1FMWA 2GFUA 4LDWA 1VQPA 1BB9A 4PFOA 2LMJA 1QMCA 2L3SA 3HKSA 1RI0A 4BDZA 3X24B 3CCEA 4B9XA 1Z9QA 4FT2A 1QVGP 2LCLA 2V26A 5C6SA 1RUWA 2QEXQ 1IGUA 1VQNQ 2NUTB 3VS3A 3J80E 5LJ3f 2EYZA 3SHWA 3FDRA 4DBHA 3JCMW 3TU4K 1I81A 2KK4A 1T0JA 2KRNA 2MWPA 1BK2A 2JTFA 4DOWA 2QGGA 4ZGJB 1OV3A 2EQKA 5GJVB 3OYJA 1H3ZA 3LGFA 2GBQA 3M0SA 1JQQA 5KYYB 2LTOA 3F70A 5GMKl 2PVGB 4JRQA 1MMGA 3REAB 1Y71A 5ECAA 1UEBA 2LJ0A 4OMNA 1BIAA 2J6OA 3VS1A 3META 2QQAA 1QQJA 3I56A 1U3OA 3CBOA 1VYTA 2FB7A 4PFPA 1G3YA 2FHDA 3OS5A 1Y96A 1VQ4Q 3L1AA 4D8KA 3MEAA 3SEMA 2OTLQ 3OMGA 2K3YA 3CMAA 1Q86U 1JEGA 3WVDB 2X35A 4PJJA 3GOXA 1S1NA 2EKHA 1UGRB 2W0ZA 2LRQA 2LQ8A 5CQXA 2MAMA 4M77G 2MYSA 4JUVA 2NWMA 1WJRA 1NG2A 2K2VA 3JCMV 2NUTA 3QG1A 1NYFA 2RM4A 5I2SA 2RD1A 3UF4A 1YJWQ 4IIOA 2MF2A 1WNLA 1BCOA 2DL7A 4J7FA 3TVTA 3GBQA 1YI2A 2GCXA 1B34B 1LNXA 2HL5C 4KULA 3QHSA 5KYYA 2BZYA 4C0DB 3OYHA 3QJ6A 4Y92A 2VXFA 1WZOA 5FU6B 1VQLQ 5AYFA 1YIJT 2ENMA 2W10A
chains in the Genus database with same CATH topology
4BE1A 2O01E 2KMTA 1JJ2S 2E5QA 4XQ3A 3C12A 3CCJA 2XG8D 3LWHA 4XU1A 4RG2A 3MEUA 1Q82C 4M7AB 1LOJA 3QYGB 1XOVA 2EQUA 1G3WA 3SWNB 3CPWS 2RI5A 3DB4A 2LQKA 2O4XA 2RJCA 1R8OB 2DD4A 5IAYA 4OB2B 1X01A 2EJ9A 1IREB 5LJ5d 1VQOA 2QQRA 4JLIA 4A53A 1VQ7T 2ZPIB 1N9SA 4CI0C 3RMSA 5HK0A 4M7DD 4XTUA 1YJ9T 2K3XA 4ZTFA 1VQ4A 3ZEHA 3CC2T 1G3SA 3G6EA 4M77A 1VQ5T 3L2VA 4JS5A 2OTLA 2KY9A 3V8JA 4MDWA 3M54A 2QI2A 4M75G 2IVWA 4MMKA 2PU9B 4MMLA 4OB3B 4C92A 3OBYA 1QVGS 2XDPA 3E1SA 1JB0E 4Y91A 1Q82U 3X20B 4HCCA 3NTHA 3FJPA 2L8DA 3S3NA 4N4HA 2DIQA 2E6NA 5GAN7 2K5IA 2XKOC 2L5QA 2VGMA 2VXEA 4QVDA 3PIPA 3OS0A 3OYNA 3CMEA 1M1FA 4OF1A 3X26B 4C5GA 1M1KC 3CPWA 4O6JA 3QKJA 5KCHA 4M78B 5A2QE 1QP2A 3HRTA 4C92F 2G3RA 5HKCA 5J26A 2QA4T 1Y07A 3CCRT 2E64A 1KD1C 2DTOA 2RHUA 4J8OA 2X4YA 1BI0A 1PSFA 4TVRA 5FU7B 4C0FA 1QW1A 2RI2A 4IUQA 3TEEA 5GAMe 3HL8A 3LWIA 1YJWA 1RL2A 3CCLA 1YJNT 1QVGA 4C92E 5CVIA 5KE2A 3L2UA 3OSVA 2MMPA 1M1KU 4KBMB 4ZN3A 1BI3A 4M78G 3OY9A 3GLXA 3DLMA 4ELYC 5LJ5f 5LJ5h 3G71T 1U1TA 4XAXB 1VQKA 1KC8C 3JB9F 5C0MA 1VQPT 1B34A 1M9SA 3CC7A 2XU8A 5GMKj 1KD1U 4E7IA 3HPWA 1W4SA 5A0GA 3C94A 2PUKB 3QIIA 2FL7A 3CD6T 2A7YA 2F5KA 3O8VA 1H641 1Q7YC 3CCET 1VQLA 5GAOn 1YHQA 5CKFA 1O9SA 3INZA 4DQ2A 4FT4A 3FIFA 2WSFE 4Y28E 2YLBA 1BKBA 2RB6A 5GAN6 4IUUA 4ME7A 3JCMf 1KC8U 4GY5A 2DTIA 5GAN8 5IT9E 2EWNA 3CCVA 3J81E 4M7AA 4M7DC 4PJOA 2LNVA 1MHNA 3CCMA 2XDDA 3SWNA 4PJOC 3RUXA 4RG8A 2LVMA 4XTVA 3QYHB 2OTJA 4FSXA 1N27A 2DD5A 4JRPA 4ATOA 2D9TA 5GANf 3PNWC 1VQMA 2VGNA 3QBYA 4IUVA 1Q7YU 1YBYA 4C92D 1YITA 2DXBA 4J7IA 4LDUA 4OB0B 3V8KA 5CIUA 3OYAA 1YIJA 4C8QB 4X34A 4BDYA 3JCMP 1WPYA 2DXUA 1VQ8T 3PT9A 2V8JA 4PJOF 4M7AF 1VIEA 2BKDN 2DO3A 4JRKA 4HT8A 3FRNA 3SB2A 3OYIA 4IUTA 3L2ZA 5LJ3j 5L8RE 3CXCS 4IKFA 1U8RA 3BY7A 4HKEA 4HCZA 5LJ5g 3OYGA 4BY6B 2ZPGB 4EMKA 5GAN5 1M1GA 4UC4A 4DOVA 3OA6A 3LX7A 4EMKC 3G4SA 2VV5A 1NE8A 2DPPB 3A8OB 3CCSA 3HFNA 4JS4A 4PJOE 4M7AE 2EJFA 1NPRA 2HQXA 1M90C 4E7LA 2DZCA 1I8FA 3JB9D 1YJ9A 5DLOA 3MEWA 1HK9A 3MCAB 3CC2A 2VUBA 2M9UA 2EKOA 5GAOq 2EYQA 2XK0A 3P8BB 4N4IA 4A54A 3I56T 3QSUA 5CR2A 4KT0E 3UT1A 2DXCA 4JDSA 1N8RC 3CC4A 4ELZC 5M9OA 1Y7XA 2RJEA 2VC8A 4XTXA 4B9WA 4LDVA 3RMQA 3JCMg 4N0AA 5FROA 3N5BB 3CXCA 3OS2A 4LDXA 2CZ1B 2LCCA 1M90U 2X4WA 2LT1A 2M16A 4FM4B 2KVQG 5A0LA 4M75B 5LJ3d 4MZMA 5KE3A 5GANg 1KQ2A 3FC3A 3CMAT 4JJNK 3ZFJA 1UB4A 3HHTB 1VQ9A 5I21A 3V7CA 2RHXA 2A3LA 1V29B 4L59A 4X9CA 4Q5WA 1KHIA 2PUOB 5CCAA 3JAME 3CCRA 2LT4A 2CYZB 5J39A 5GMKh 1UGSB 3OYLA 3PMIA 1S72A 1N8RU 1K8AC 1O75A 1QVFS 3NTKA 4JLGA 3QPHA 2LX9A 2R5AA 1TH7A 4PJOD 4LD6A 4C5EA 1Y96B 3CCUT 1I5LA 4F7UA 2QEXT 4M7AD 3FEOA 1Q81C 1VQNT 4M77C 2NLUA 2DXTA 4BI3A 3CBMA 4C92C 2P0QA 2E1HA 4EMGA 1VIFA 2R57A 3CBPA 3OW2A 3VUZA 4MZTA 2P0KA 3AHUA 2PQWA 2L3RA 2YLCA 3I55A 5CKBA 1YCYA 2IG0A 3V8LA 1K8AU 5FLXE 1SSFA 4XTYA 2RA2A 3QUIA 3OYBA 3PIOA 4M77F 4F7UF 4ZTJA 3SDZA 3GPLA 2DKGA 4BUGA 1K9MU 3KBGA 5CKDA 5GMKm 1IZ6A 2YRVA 3M5AA 3M4YA 4C8QA 1YI2T 2E10A 1Q81U 1QVFA 4M7DG 2LC4A 3NFCA 4E7KA 2HAXA 2XI9A 3L2WA 4IURA 3QDRB 1K73C 1KG1A 2XHCA 2KSSA 2E12A 4M77E 5LJ3h 4F7UE 3P8DA 1VQ6A 4A4EA 3DLLA 3JCMX 2I2LA 4X9DA 2PVOB 1FX7A 1JRIA 1N9RA 2C06A 4RMOA 3BFMA 2HBPA 1X6OA 5CKEA 1W2BS 3MHXA 2GF7A 2V8KA 3CCJT 3MO8A 1UGQB 4PKCC 3T9NA 3OS1A 1G3TA 3JCMc 2JOYA 4NS5A 5GAMj 2DK3A 3L42A 4NL3A 1I4K1 5CKHA 4C0ZA 5GAN2 5GAOp 3MP6A 3M53A 3CCQA 1K73U 1LJOA 1OI1A 1X75C 4D6WA 2QQSA 3VJPA 3C4SA 2HQEA 4KUDK 4C0DC 1VQOT 2E41A 2QQBA 5GAN3 2WACA 4RKUE 1FWZA 2Y4XA 1VQ4T 1JBMA 3DB3A 3G6ET 5FU6C 4CRIA 4QQDA 4FU6A 2OTLT 2DIGA 4A4FA 2M0OA 4M75A 1G5VA 4XU3A 2RHIA 3E19A 4FIBA 4RCCA 1W2BA 3RERA 4R56A 4M7AC 3QO3A 3SWNC 1M5Q1 4M77D 4C0GA 2AHJB 2WSEE 2ZGWA 2D6FA 3CMET 1WJSA 2XD0A 4XK8E 2XIDA 4NL2A 4BI4A 3UPUA 4E47A 1ZQ1A 5GAMd 3M58A 2CZ7B 4A4KA 4M75F 1PSEA 2QTXA 3DKMA 4PLIA 3GF5A 4IUPA 4OGCA 4QVZA 4C92B 3OYMA 3RIRA 2ZPBB 2E65A 3BDLA 3L2QA 3NTIA 5IN1A 1YJWT 5KH6A 1HXDA 4PLLA 2B8AA 4A4GA 5FRMA 2RH2A 3OBWA 4M75E 2H3JA 3H8ZA 4C8QD 5GAOr 1K9MC 2EJGA 3FB9A 3KXTA 3RKWA 1VQ7A 3V7SA 2F69A 3S6WA 2EIFA 4BE2A 2E70A 3M55A 4M78A 4BE0A 3JCMJ 2JNGA 3HSBA 1XTDA 1BIBA 2GQVA 3OYKA 4M78C 5EG2A 1VQ5A 1VQKT 4C92G 2CZ6B 3V7RA 5LJ5e 3CC7T 4QQGA 4R55A 2R58A 2KDSA 2RHZA 3LLRA 4LD9K 1KQ1A 5HY6A 4C5HA 2P4TA 2ZPHB 3ER0A 5FU7C 3JRZA 3QXEB 4EDUA 5CAIA 1WQ7A 3VYHB 1VQLT 1YHQT 3VV0A 4P5NA 4N0AC 2EQJA 3H6ZA 1OYXA 3URGA 3OYCA 4M78F 3PTAA 3QZ5B 2DEQA 3A8LB 2HNIA 4J83A 3KUFA 3OW2S 1KQSA 3VYGA 1NJIC 1WGSA 3E9GA 5DM7R 3JB9H 2DAQA 2Y4YA 1ZBXA 2VYTA 3ASKA 4XU2A 4BI8B 3OMCA 3VKIA 3S3MA 3MP1A 2QA4A 1QVPA 5GAMh 3JB9G 3CCMT 4M78E 4OMFB 3JCMe 2BIVA 2OTJT 2K4YA 2QXFA 4EPCA 1OZ3A 4L6V5 3CCLT 2ZPFB 1VQMT 4A4HA 4J6XA 4J6YA 5HK3A 1YITT 1YJNA 4MDXA 4M75D 3R6OA 3SFMA 4NOYA 4E7HA 5GANe 2DJZA 1NPPA 1NJIU 5GMKi 3M56A 3G71A 4M7DB 2EQMA 2YHTA 4E7JA 3GP8A 2GFUA 4PJOB 2RJFA 3BW1A 3LW5E 4LDWA 1VQPA 3J7AF 3GNGA 3G4ST 3HKSA 4JRIA 3CCST 3OB9A 5GANj 3CD6A 4HT9A 1RI0A 3M4GA 1D3BB 4BDZA 2X4JA 3X24B 3CCEA 4B9XA 3MEVA 2RK1A 2Y90A 3JB9I 1BI2A 3VUBA 2EFIA 4VUBA 4FT2A 4HA8A 4C5IA 2LCLA 2DZ9A 3P8HA 5C6SA 4C8QC 5GAN4 4QW2A 4PJOG 4M7AG 3J80E 3CC4T 5LJ3f 2X4XA 4EMKB 1JJ2A 3FDRA 4M78D 3JCMW 2K5LA 2JZ2A 3TU4K 2V8IA 3Q1JA 4BY6C 1I81A 2KK4A 3X25B 3JCMQ 4J6WA 2MWPA 5GAMg 2GFAA 3JB9J 3JSCA 3QJYA 4BD3A 2JTFA 2ZCFB 1WJQA 4DOWA 4XTZA 4ZGJB 5D6XA 3LGLA 4C8QF 3JCMd 2EQKA 1GXIE 2CS7A 3GNFB 3OYJA 1FXXA 1H3ZA 3FLGA 3RESA 1VQ8A 3LGFA 1VQ9T 1UGPB 3QZ9B 3UWNA 5DLQE 5A0DA 2LTOA 3F70A 1DJ7B 5GANd 1S72T 5GMKl 4C8QE 2PVGB 3PMTA 1XQHA 4JRQA 2MI6A 3M59A 5GMKe 2FVUA 5D6WA 4L5GA 3SD4A 2P0PA 5DY9A 3TREA 1Y71A 2M1HA 1P92A 3TCJA 5KCOA 3M57A 3S3OA 1M8VA 1M4ZA 1UEBA 2JVVA 3WXMB 1BIAA 2JUFA 1QP3A 3RKYA 3VU3C 4BB7A 1U1SA 3EFRA 4M75C 1Q86C 3META 2QQAA 2OAUA 4KUIA 4PNOA 3I56A 2L89A 3HFOA 2O4XB 2QDYB 2LDMA 3CBOA 3I55T 2XDBA 5GAOm 2RK2A 2HD0A 3EFSA 3MP8A 2FB7A 5CK9A 2EAYA 2R5MA 3RKXA 2RO0A 2CZ0B 4OB1B 3ZBDA 1G3YA 5LJ3g 3G7ZA 2FHDA 2JTMA 2XICA 3E9FA 3OS5A 1WQWA 1Y96A 4M77B 4OGEA 2KAFA 3X28B 4F7UB 3L1AA 4ZGDB 1ZHIA 3UDCA 3MEAA 5CO7A 1AHJB 3HRSA 3OMGA 3OYFA 4O5VA 4M7DA 4PL6A 4HCBA 2K3YA 2ZZDA 3CMAA 3JCMh 1Q86U 1MGQA 3A8GB 3OQ5A 4RCBA 1KQSS 1VQ6T 3GIBA 3WVDB 2X35A 1BYMA 4GLKA 3GOXA 4OP0A 3WVEB 4XU0A 5LJ3e 2WSCE 1UGRB 1D3BA 5LL6S 5GANh 2LRQA 2LQ8A 2BUDA 2CGHA 2PVDB 2MAMA 4J5YA 4M77G 3PFSA 5CQXA 4JUVA 5D6YA 3PGGA 4F7UG 5FRNA 2DTHA 3CCUA 5GAOl 3HP9A 2QEXA 4M7DF 4OVAA 1VQNA 4FL6A 1WJRA 1OZ2A 3C95A 4LDYA 4N4GA 2K2VA 3M9QA 3OYYA 3A8HB 3CCQT 3JCMV 2DVEA 3CEYA 4YTLA 3QG1A 3L2RA 2QQ9A 1XNIA 2K5FA 2RM4A 2ZPEB 1BI1A 2RD1A 5I2MA 4XTWA 5I2SA 4DA4A 3EAEA 2MF2A 4M7DE 4ZGEB 4MZPA 1WNLA 2MWOA 2RJDA 2D0QB 3LYIA 1NZ9A 2CKKA 5LJ5j 4Z02A 4J7FA 5CQYA 3A5ZB 4WF2A 4C8QG 2JN0A 3LH0A 2RHYA 1YI2A 4QVCA 2F5TX 1KHCA 3A8MB 2GCXA 3ME9A 4EMHA 3BDUA 1B34B 1LNXA 5GAMf 3OYEA 3CPFA 3CCVT 4KULA 4V2SA 3QHSA 4II1A 1N6AA 3JCMb 2K57A 5J3BA 1VUBA 4C0DB 2KQWA 2RI3A 3OYDA 3OYHA 3QJ6A 2E6ZA 4QQ6A 3OSSC 2VXFA 4ZN1A 1EIFA 5FU6B 3HRUA 2FYKA 5AYFA 1YIJT 4BACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BE1 A;  1JJ2 S;  2E5Q A;  3CCJ A;  4RG2 A;  1Q82 C;  3MEU A;  2EQU A;  3CPW S;  2RI5 A;  3DB4 A;  2O4X A;  2RJC A;  5IAY A;  1VQO A;  2QQR A;  1VQ7 T;  1YJ9 T;  2K3X A;  4ZTF A;  1VQ4 A;  3ZEH A;  3CC2 T;  3G6E A;  1VQ5 T;  3L2V A;  2OTL A;  1QVG S;  2XDP A;  1Q82 U;  3NTH A;  2L8D A;  3S3N A;  4N4H A;  2DIQ A;  2E6N A;  3PIP A;  3OS0 A;  3OYN A;  3CME A;  1M1K C;  4C5G A;  3CPW A;  3QKJ A;  5KCH A;  5A2Q E;  2G3R A;  5J26 A;  2QA4 T;  3CCR T;  1KD1 C;  4TVR A;  2RHU A;  2X4Y A;  2RI2 A;  4IUQ A;  1YJW A;  1RL2 A;  1YJN T;  1QVG A;  5KE2 A;  3L2U A;  1M1K U;  4ZN3 A;  3OY9 A;  3DLM A;  3G71 T;  1VQK A;  1KC8 C;  5C0M A;  1VQP T;  3CC7 A;  1KD1 U;  4E7I A;  3QII A;  3CD6 T;  2F5K A;  3O8V A;  1Q7Y C;  3CCE T;  1VQL A;  1YHQ A;  1BKB A;  4IUU A;  1KC8 U;  5IT9 E;  4GY5 A;  3CCV A;  3J81 E;  1MHN A;  3CCM A;  2LVM A;  2OTJ A;  1N27 A;  2D9T A;  1VQM A;  1Q7Y U;  3CCL A;  3PNW C;  3QBY A;  4IUV A;  1YBY A;  1YIT A;  5CIU A;  3OYA A;  1YIJ A;  4X34 A;  4BDY A;  1VQ8 T;  2BKD N;  2DO3 A;  4IKF A;  3OYI A;  4IUT A;  3CXC S;  3OYG A;  4HCZ A;  1M1G A;  4UC4 A;  3OA6 A;  3LX7 A;  3G4S A;  3CCS A;  1NPR A;  1M90 C;  2HQX A;  4E7L A;  1YJ9 A;  3MEW A;  3CC2 A;  2EKO A;  3P8B B;  2XK0 A;  4N4I A;  3I56 T;  3UT1 A;  1N8R C;  3CC4 A;  5M9O A;  2RJE A;  4B9W A;  5FRO A;  3CXC A;  3OS2 A;  2LCC A;  1M90 U;  2X4W A;  2M16 A;  2KVQ G;  5KE3 A;  3FC3 A;  3CMA T;  1VQ9 A;  2RHX A;  4L59 A;  3CCR A;  4Q5W A;  1KHI A;  3JAM E;  3OYL A;  1N8R U;  5J39 A;  1S72 A;  3PMI A;  1K8A C;  1QVF S;  3NTK A;  2R5A A;  4LD6 A;  3CCU T;  4C5E A;  2QEX T;  3FEO A;  1Q81 C;  1VQN T;  2NLU A;  2R57 A;  3OW2 A;  2P0K A;  2PQW A;  2L3R A;  3I55 A;  2IG0 A;  1K8A U;  5FLX E;  1SSF A;  3OYB A;  3PIO A;  4ZTJ A;  3KBG A;  1YI2 T;  1IZ6 A;  1QVF A;  2YRV A;  1Q81 U;  4E7K A;  3L2W A;  4IUR A;  1K73 C;  2XHC A;  1VQ6 A;  3P8D A;  3DLL A;  4A4E A;  1X6O A;  1W2B S;  2GF7 A;  3CCJ T;  3MO8 A;  3OS1 A;  2JOY A;  4NS5 A;  3L42 A;  3CCQ A;  3MP6 A;  1K73 U;  1OI1 A;  2QQS A;  3C4S A;  2HQE A;  1VQO T;  2WAC A;  1VQ4 T;  3DB3 A;  3G6E T;  4CRI A;  4QQD A;  2OTL T;  4FU6 A;  2DIG A;  4A4F A;  2M0O A;  1G5V A;  2RHI A;  1W2B A;  3CME T;  1WJS A;  4PLI A;  4IUP A;  4QVZ A;  3OYM A;  3L2Q A;  3BDL A;  3NTI A;  5IN1 A;  1YJW T;  5KH6 A;  4PLL A;  2B8A A;  4A4G A;  5FRM A;  3H8Z A;  1K9M C;  1VQ7 A;  3S6W A;  2EIF A;  4BE2 A;  2E70 A;  4BE0 A;  2JNG A;  1XTD A;  3OYK A;  1VQK T;  1VQ5 A;  3CC7 T;  4QQG A;  2R58 A;  2KDS A;  2RHZ A;  3LLR A;  5HY6 A;  4C5H A;  3ER0 A;  4EDU A;  1VQL T;  1YHQ T;  3OYC A;  2EQJ A;  3H6Z A;  1K9M U;  1OYX A;  3KUF A;  3OW2 S;  1KQS A;  1NJI C;  1WGS A;  3E9G A;  5DM7 R;  2DAQ A;  3ASK A;  2VYT A;  3OMC A;  3S3M A;  2QA4 A;  3MP1 A;  3CCM T;  2OTJ T;  2BIV A;  1OZ3 A;  3CCL T;  1VQM T;  4A4H A;  1YIT T;  1YJN A;  1NPP A;  1NJI U;  3G71 A;  2EQM A;  4E7J A;  2GFU A;  2RJF A;  1VQP A;  3J7A F;  3G4S T;  3HKS A;  3CCS T;  3OB9 A;  3CD6 A;  1RI0 A;  4BDZ A;  3CCE A;  4B9X A;  3MEV A;  2EFI A;  4C5I A;  2LCL A;  3P8H A;  5C6S A;  4QW2 A;  3J80 E;  3CC4 T;  2X4X A;  1JJ2 A;  3FDR A;  2JZ2 A;  3Q1J A;  2MWP A;  2GFA A;  4BD3 A;  2JTF A;  1WJQ A;  5D6X A;  3LGL A;  2EQK A;  3OYJ A;  1H3Z A;  3FLG A;  1VQ8 A;  3LGF A;  1VQ9 T;  3UWN A;  5DLQ E;  2LTO A;  3F70 A;  1S72 T;  3PMT A;  2MI6 A;  5D6W A;  3SD4 A;  3TRE A;  2M1H A;  5KCO A;  3S3O A;  2JVV A;  1UEB A;  2JUF A;  1Q86 C;  3MET A;  3I56 A;  2L89 A;  2O4X B;  2LDM A;  3I55 T;  3MP8 A;  2R5M A;  2RO0 A;  2FHD A;  3E9F A;  3MEA A;  3OMG A;  3OYF A;  4PL6 A;  2K3Y A;  3CMA A;  1Q86 U;  3OQ5 A;  1KQS S;  1VQ6 T;  2X35 A;  3GOX A;  5LL6 S;  2LRQ A;  2LQ8 A;  2BUD A;  4E7H A;  5FRN A;  5D6Y A;  3PFS A;  3CCU A;  2QEX A;  4OVA A;  1VQN A;  4FL6 A;  1WJR A;  1OZ2 A;  4N4G A;  3M9Q A;  3OYY A;  3CCQ T;  3CEY A;  4YTL A;  3L2R A;  1XNI A;  3EAE A;  2MWO A;  2RJD A;  3LYI A;  1NZ9 A;  2CKK A;  4Z02 A;  3A5Z B;  3LH0 A;  2RHY A;  1YI2 A;  1KHC A;  3ME9 A;  3CCV T;  3OYE A;  3CPF A;  4II1 A;  5J3B A;  2RI3 A;  3OYD A;  3OYH A;  3QJ6 A;  2E6Z A;  4QQ6 A;  4ZN1 A;  1EIF A;  1YIJ T;  4BAC A; 
#chains in the Genus database with same CATH topology
 2KMT A;  1TSF A;  1U06 A;  1XOV A;  2RJC A;  2DD4 A;  2B86 A;  1X43 A;  5LJ5 d;  1VQO A;  2FZG B;  4A53 A;  1VQ7 T;  2ZPI B;  1M27 C;  2CT4 A;  4XTU A;  2K3X A;  4ZTF A;  2NUZ A;  4MDW A;  1G83 A;  1PKT A;  3OBY A;  4FYX B;  3E1S A;  4HCC A;  2BZ8 A;  4KH0 B;  3FJP A;  2HSP A;  3S3N A;  2EGE A;  2L5Q A;  2VGM A;  2VXE A;  3OS0 A;  1M1F A;  4M78 B;  1YN8 A;  5A2Q E;  2O9V A;  1I5O B;  5KYW B;  3CC2 Q;  1NLP C;  1VQ5 Q;  2EGA A;  4RUG A;  2DTO A;  2QDL A;  1K76 A;  1VOM A;  2KT8 A;  2RHU A;  2X4Y A;  3I9Q A;  5FU7 B;  2CH4 A;  1RL2 A;  2RQU A;  1QVG A;  2D8H A;  4KBM B;  4E2F B;  1QKX A;  1U1T A;  3KFV A;  4QT7 A;  3EG9 B;  3JB9 F;  5C0M A;  2EPD A;  1B34 A;  1M9S A;  5GMK j;  3H41 A;  1VQ9 Q;  4E7I A;  1R0B G;  3HPW A;  3H0H A;  2HQH A;  3CD6 T;  2A7Y A;  1H64 1;  2CP0 A;  1YHQ A;  1YJN Q;  3FIF A;  5FWC A;  4Y28 E;  1BKB A;  2FZK B;  2J7I A;  5GAN 6;  3G71 Q;  4GY5 A;  5IT9 E;  5GAN 8;  4PJO A;  2KNB B;  4CC4 B;  3CCV A;  2LNV A;  2JS0 A;  4ZNX A;  3CCM A;  2PTK A;  4XTV A;  2OTJ A;  1TUC A;  3VS5 A;  3I55 Q;  1Z9Z A;  2D9T A;  1VQM A;  4ESR A;  1YIT A;  2DXB A;  4J7I A;  1UE9 A;  1UHF A;  3V8K A;  4RTW A;  2KYM A;  3JCM P;  2DET A;  2DXU A;  2HEQ A;  3PT9 A;  4PJO F;  4JRK A;  2DRK A;  5L8R E;  3CXC S;  5LJ5 g;  4EMK A;  1EX4 A;  3HFN A;  4OML A;  4PJO E;  2EJF A;  4E7L A;  1SF9 A;  3MEW A;  1HK9 A;  1K9M R;  2M9U A;  2EYQ A;  2XK0 A;  2SRC A;  4RTT A;  4F16 A;  2EBP A;  2LZ6 B;  4HVV A;  4LUD A;  3CCQ Q;  1N8R C;  2RJE A;  3JCM g;  5FRO A;  1WX6 A;  5KYU B;  2DBK A;  4LDX A;  3OS2 A;  2BE9 B;  2CZ1 B;  2X4W A;  2LT1 A;  4R0K A;  2E4H A;  3AT1 B;  5KE3 A;  1ZA1 B;  5GAN g;  3FC3 A;  1ZUY A;  3EG9 A;  3V7C A;  4L59 A;  2GQI A;  1ZUU A;  5GMK h;  5J39 A;  4OMQ A;  1O75 A;  1RAD B;  3QPH A;  2DJQ A;  4LD6 A;  4F7U A;  2QEX T;  1Q81 C;  1VQN T;  2KBT A;  1QCN A;  2P0Q A;  2P0K A;  5FLX E;  4F7U F;  3SDZ A;  1IZ6 A;  1QVF A;  5KYX A;  4JJB A;  2O88 A;  2XI9 A;  1J3T A;  1K73 C;  2E12 A;  4F7U E;  1FYN A;  1WXB A;  1Y57 A;  2DFU A;  4X9D A;  2PVO B;  5L23 A;  1JRI A;  1N9R A;  1X2Q A;  1Q95 G;  2HBP A;  1UGQ B;  4A63 B;  1M1K R;  5GAM j;  4NL3 A;  3EGU A;  4C0Z A;  1T3S A;  1TG0 A;  4D6W A;  3C4S A;  1LPL A;  3UAT A;  1ZSZ B;  1VQ4 T;  1JBM A;  2GGR A;  2OTL T;  1OX8 A;  2DIG A;  2M0O A;  2YXY A;  3CCJ Q;  4OMP A;  4XU3 A;  2OAW A;  1M3A A;  4HVW A;  4BI4 A;  2SEM A;  4E47 A;  3EFO B;  4A4K A;  3OYM A;  4QVZ A;  3RIR A;  3BDL A;  1YJW T;  5KH6 A;  2RQR A;  2BE7 D;  1K4U S;  4C8Q D;  1KJW A;  3FB9 A;  1VQ7 A;  3V7S A;  2EIF A;  3OYK A;  3ULR B;  2D1X A;  1IXD A;  2LNH B;  3CXC P;  2BZX A;  4KGX B;  2YUO A;  4F14 A;  3EG2 A;  1ZLM A;  3ER0 A;  1ABO A;  3QXE B;  1PD1 A;  1VQL T;  3VV0 A;  1K9M U;  4J83 A;  2DEQ A;  3RR6 A;  3E9G A;  1QLY A;  2DBM A;  2CP3 A;  2DE0 X;  2VB6 A;  4PJM A;  1QVP A;  5GAM h;  3JB9 G;  1UHC A;  4OMF B;  2BIV A;  2QXF A;  4X1V A;  2DM1 A;  2QAZ A;  2IPO B;  3CCL T;  4J6X A;  4MDX A;  4M75 D;  3SFM A;  2YWW A;  1NPP A;  2H3E B;  2EQM A;  2MOX A;  2ROT A;  2PZ1 A;  2RJF A;  3LW5 E;  1JXO A;  3J7A F;  1G8X A;  3GNG A;  1WA7 A;  1Q82 R;  1UDL A;  5GAN j;  3CD6 A;  1D3B B;  1MNE A;  2Y90 A;  3JB9 I;  4VUB A;  4HA8 A;  4C5I A;  3EFO A;  3P8H A;  4C8Q C;  4DBR A;  4QW2 A;  4PJO G;  4AT1 B;  5IHI A;  1W6X A;  4M78 D;  2K9G A;  2JZ2 A;  1I1J A;  2J6F A;  3X25 B;  3JCM Q;  4J6W A;  3JB9 J;  2GFA A;  3QJY A;  2ZCF B;  1WJQ A;  2QK0 A;  4JJC A;  1YFN A;  1VQ9 T;  5DLQ E;  1SHG A;  1DJ7 B;  3PMT A;  1IHW A;  1MMD A;  2MI6 A;  2VVK A;  2JT4 A;  2FVU A;  4J9F A;  2P0P A;  1P92 A;  1M8V A;  1M4Z A;  3WXM B;  3VU3 C;  4BB7 A;  5KYN A;  1U1S A;  2OX7 A;  1AOJ A;  2VKN A;  4M75 C;  1Q86 C;  4KUI A;  2L89 A;  2O4X B;  2QDY B;  3I55 T;  2XDB A;  4Z89 A;  3EFS A;  5CK9 A;  1PKS A;  2RO0 A;  4OB1 B;  4FW1 A;  3G7Z A;  2JTM A;  2KAF A;  3X28 B;  1Q7Y R;  5CO7 A;  1AHJ B;  3HRS A;  5I11 A;  2ZZD A;  3JCM h;  4KGV B;  3HTR A;  1KQS S;  1CKB A;  1BYM A;  4OP0 A;  3WVE B;  5LJ3 e;  3VS0 A;  1D3B A;  5LL6 S;  5GAN h;  3CME Q;  2CGH A;  4E7H A;  3PFS A;  4F7U G;  2DTH A;  3HP9 A;  2QEX A;  1VQN A;  4LDY A;  1OZ2 A;  1HYO A;  3M9Q A;  3OYY A;  2O2O A;  3A8H B;  3CCQ T;  2DVE A;  4YTL A;  2QQ9 A;  2YUN A;  2K5F A;  2ZPE B;  4XTW A;  4DA4 A;  7AT1 B;  1IB8 A;  3MJX A;  3RDV A;  4MZP A;  2MWO A;  2D0Q B;  2KEA A;  2CKK A;  4DEX A;  2YUP A;  4Z02 A;  3A5Z B;  2RHY A;  2F5T X;  3ME9 A;  3CCV T;  3BDU A;  4ANJ A;  5GAM f;  1M90 R;  3CPF A;  2E3H A;  3JCM b;  2K57 A;  5J3B A;  2KQW A;  3RNJ A;  3LH5 A;  2E6Z A;  4ZN1 A;  2DA9 A;  1JJ2 S;  2M0Y A;  4LXC A;  4RG2 A;  2MK5 A;  4Z8A A;  3CPW S;  2RI5 A;  2K79 A;  2ROL A;  2HZY A;  2ATC B;  4EIK A;  2O4X A;  1K0X A;  1WXU A;  1LCK A;  5HK0 A;  4CI0 C;  2C0O A;  2AK5 A;  4CC7 A;  1VQ4 A;  4FYV B;  1MND A;  2CSQ A;  3UA6 A;  1K8A R;  4JS5 A;  2OTL A;  1PM3 A;  3M54 A;  2IVW A;  1JB0 E;  1Q82 U;  2L8D A;  2DL4 A;  2DIQ A;  1BBZ A;  4QVD A;  3OYN A;  3QKJ A;  5KCH A;  2X51 A;  3HRT A;  2RQT A;  3QDF A;  1YJ9 Q;  5HKC A;  5J26 A;  2RF0 A;  1Y07 A;  1WHJ A;  3EG1 A;  2LJ1 A;  3NHN A;  4J8O A;  1BI0 A;  1VYU A;  4IUQ A;  1YJW A;  1R0C B;  3HL8 A;  5IHK A;  5KE2 A;  3L2U A;  2MMP A;  1GRI A;  3NPF A;  1BI3 A;  3GLX A;  5LJ5 f;  1PCX A;  1RAE B;  2HKN A;  2XU8 A;  3CCR Q;  3QII A;  1S72 Q;  1AEY A;  3O8V A;  1VQL A;  5CKF A;  4DQ2 A;  4FT4 A;  2RB6 A;  4IUU A;  4ME7 A;  1JXM A;  3JCM f;  2XDD A;  5I22 A;  2LVM A;  1PWT A;  1N27 A;  2DD5 A;  2C0T A;  3BE3 A;  5GAN f;  3PNW C;  2MCN A;  1Q7Y U;  3QBY A;  3CCL A;  4LDU A;  1TOV A;  2CP5 A;  4OB0 B;  3I5R A;  4C8Q B;  4X34 A;  3THK A;  1VIE A;  2BKD N;  2KT1 A;  4HT8 A;  3SB2 A;  1KQS P;  1U8R A;  1M3C A;  1M1G A;  4UC4 A;  1VQ6 Q;  3LX7 A;  2VV5 A;  2QAS A;  4JS4 A;  2HQX A;  2DZC A;  2L3P A;  2JJ9 A;  3EHQ A;  5DLO A;  3CC2 A;  2VUB A;  5GAO q;  4N4I A;  4A54 A;  1NEG A;  1RAC B;  3I35 A;  5CR2 A;  4HCK A;  2DXC A;  2ECZ A;  1TUG B;  2HDA A;  3NMZ C;  2VC8 A;  2GTJ A;  4LDV A;  3RMQ A;  1RAF B;  2K2M A;  3N5B B;  1ZSZ C;  1M90 U;  2M16 A;  1SHF A;  4M75 B;  5LJ3 d;  4MZM A;  2QTV A;  1UB4 A;  3VRY A;  4FYW B;  1VQ9 A;  1D1A A;  5CCA A;  1KHI A;  3JAM E;  1AWO A;  1QCO A;  3PMI A;  4JLG A;  2MPX C;  2R5A A;  1TH7 A;  1JJ2 P;  4F04 B;  1I5L A;  4M7A D;  2RPN A;  1LVK A;  1IGQ A;  4M77 C;  4BI3 A;  3CBM A;  3CPW P;  2E1H A;  2R57 A;  2KXD A;  3VUZ A;  3I55 A;  5CKB A;  1YCY A;  2IG0 A;  3V8L A;  1K8A U;  1NM7 A;  1SSF A;  3OYB A;  4J9H A;  1UEC A;  4ZTJ A;  4WTO B;  1UJ0 A;  2DKG A;  4BUG A;  3KBG A;  4C8Q A;  2YRV A;  1GFD A;  3VS2 A;  2CRE A;  3QDR B;  2KSS A;  3MKD A;  2DL5 A;  3P8D A;  4A4E A;  1PC0 A;  1X6B A;  4RMO A;  1W2B S;  1ZA2 B;  4PKC C;  3T9N A;  4NS5 A;  2DK3 A;  1I4K 1;  5CKH A;  5GAN 2;  5GAO p;  3CCQ A;  3M53 A;  1OI1 A;  1X75 C;  2QQS A;  4AFQ C;  4KUD K;  3UA7 A;  1SG5 A;  2CP6 A;  1RAG B;  3DB3 A;  4CRI A;  4QQD A;  1AZE A;  2C0I A;  4A4F A;  4J9E A;  4M75 A;  1YNZ A;  2RHI A;  4RCC A;  4M7A C;  4R56 A;  3SWN C;  2ZGW A;  3CME T;  1WJS A;  3TSW A;  4PK4 A;  5IXB A;  1TXQ A;  1ZQ1 A;  2EYY A;  2KRO A;  2CZ7 B;  4M75 F;  1PSE A;  2QTX A;  2YSQ A;  3GF5 A;  4C92 B;  3JV3 A;  4JJD A;  2E65 A;  3L2Q A;  1HXD A;  4PLL A;  2B8A A;  4M75 E;  3H8Z A;  5GAO r;  1K9M C;  3KXT A;  3VS4 A;  1M30 A;  3S6W A;  4BE2 A;  4M78 A;  1BU1 A;  2I0N A;  1KK7 A;  1FMK A;  5KYW A;  1VQ8 Q;  2D8J A;  2KDS A;  3LLR A;  4C5H A;  2P4T A;  1UFF A;  2ZPH B;  1ZBJ A;  4E7S A;  1WQ7 A;  3EG3 A;  3PTA A;  3OYC A;  4N0A C;  3URG A;  1OYX A;  4M78 F;  3KUF A;  3OW2 S;  1KQS A;  3VYG A;  4WCI A;  5DM7 R;  1HSQ A;  1R77 A;  2Y4Y A;  4XU2 A;  3MP1 A;  4M78 E;  2IIM A;  2CDT A;  4L6V 5;  5HK3 A;  2BTT A;  3G1J A;  2DJZ A;  5GMK i;  4E7J A;  2YHT A;  1PHT A;  1NLO C;  1TS9 A;  3CCM Q;  3OB9 A;  4HT9 A;  2DL3 A;  4J9I A;  1WIE A;  3MEV A;  3EGX B;  1BI2 A;  3VUB A;  2EFI A;  2RNA A;  3CCU Q;  5GAN 4;  2O9S A;  1HJD A;  2EYX A;  1RLP C;  2EQI A;  2X4X A;  1Q81 R;  2CT3 A;  1JJ2 A;  3Q1J A;  1WI7 A;  1D0Z A;  4BD3 A;  4XTZ A;  5D6X A;  3PVQ A;  3GNF B;  1FXX A;  1ZX6 A;  2YRD A;  2AZV A;  3FLG A;  2X9H A;  1SSH A;  1S72 T;  2OJ2 A;  3EHR A;  1TUD A;  1XQH A;  3QWY A;  3M59 A;  5GMK e;  1KD1 R;  1YP5 A;  5KYU A;  5D6W A;  3TRE A;  2M1H A;  3TCJ A;  2JXB A;  3M57 A;  2JUF A;  3RKY A;  2L3Q A;  4J9B A;  1KSW A;  3EFR A;  2QYZ A;  4PNO A;  2JMC A;  3HFO A;  5GAO m;  3M0R A;  2LX7 A;  1KC8 R;  2Z0W A;  4HVU A;  1MV0 B;  2RK2 A;  3RKX A;  2CZ0 B;  1AWJ A;  1C6V X;  3E9F A;  4M77 B;  4OGE A;  2X3X D;  2YUQ A;  1SEM A;  3G6E Q;  4AG1 C;  4PL6 A;  1M3B A;  1MGQ A;  2YDL A;  1VQ6 T;  3GIB A;  4GLK A;  3EH1 A;  4K11 A;  1UGV A;  2WSC E;  1GBQ A;  4CC2 A;  1B7T A;  2DYI A;  4J5Y A;  2BUD A;  2PVD B;  5FRN A;  5D6Y A;  1ARK A;  5GAO l;  1CKA A;  4OVA A;  4IIM A;  4N4G A;  3C95 A;  1RI9 A;  1X6G A;  3L2R A;  3NGP A;  1XNI A;  1X27 A;  2COZ A;  1BI1 A;  2CH4 W;  5I2M A;  1IHV A;  3EAE A;  1D09 B;  4ZGE B;  3LYI A;  1NZ9 A;  1U5S A;  5LJ5 j;  1OX9 A;  5CQY A;  4C8Q G;  4E7Z A;  1AZG B;  2AKK A;  3LH0 A;  4QVC A;  1KHC A;  4EMH A;  3OYE A;  1VQK Q;  3EGD B;  4V2S A;  4II1 A;  3CC7 Q;  1N6A A;  1VUB A;  2RI3 A;  3OSS C;  1ZSZ A;  1EIF A;  3OW2 P;  2FYK A;  5FWB A;  4BAC A;  4BE1 A;  2O01 E;  2E5Q A;  4XQ3 A;  1WFW A;  3C12 A;  1OU9 A;  1TTH B;  2XG8 D;  4XU1 A;  1Q82 C;  3MEU A;  4M7A B;  1LOJ A;  2EQU A;  2A08 A;  3SWN B;  4RTU A;  3DB4 A;  2LQK A;  1GCQ C;  1NYG A;  1R8O B;  4LE9 A;  4OMO A;  2A28 A;  2QQR A;  4JLI A;  1N9S A;  3RMS A;  4M7D D;  3CC2 T;  1G3S A;  4M77 A;  1VQ5 T;  1KG1 A;  3V8J A;  1YIJ Q;  2QI2 A;  4M75 G;  2CSI A;  4MMK A;  2PU9 B;  1BCM A;  1QVG S;  4Y91 A;  3NTH A;  2A36 A;  2EVR A;  5GAN 7;  2K7A A;  3G4S Q;  4HXJ A;  3CME A;  4OF1 A;  4C5G A;  3CCS Q;  4GBQ A;  1VQ7 Q;  1RAI B;  2G3R A;  1A0N B;  2DER A;  5EC7 A;  4FYY B;  2AKL A;  3VS7 A;  4TVR A;  1PSF A;  4C0F A;  1QW1 A;  2RI2 A;  3LWI A;  5GAM e;  3CC4 Q;  1YJN T;  5CVI A;  1M1K U;  3OY9 A;  4M78 G;  3DLM A;  2ED0 A;  4ELY C;  8AT1 B;  5LJ5 h;  3G71 T;  2DIL A;  1M8M A;  3MPU B;  4XAX B;  1PG5 B;  1WLP B;  2KR3 A;  1V1C A;  1KD1 U;  1SRM A;  1ABQ A;  1W4S A;  2QG9 B;  2PUK B;  2RQW A;  1Q7Y C;  2NYS A;  1FMV A;  5GAO n;  1O9S A;  3INZ A;  2WSF E;  1E6H A;  4F17 A;  2A0F B;  4AFS C;  1KC8 U;  4M7D C;  2DTI A;  2EWN A;  4M7A A;  3J81 E;  3SWN A;  4PJO C;  3RUX A;  3QYH B;  4FSX A;  4ATO A;  1AT1 B;  8ATC B;  2VGN A;  1W1F A;  1YBY A;  4C92 D;  2ZAE A;  1D1C A;  5CIU A;  2FPD A;  1WPY A;  1VQ8 T;  2V8J A;  1ZUK A;  1X69 A;  2JM8 A;  4AFZ C;  4M7A F;  2KGT A;  3FRN A;  4IKF A;  4RTX A;  2E5K A;  3BY7 A;  3OYG A;  2DF6 A;  2ZPG B;  3OA6 A;  1D1B A;  4EMK C;  4FSS A;  4M7A E;  1NPR A;  1M90 C;  1VA7 A;  1YJ9 A;  3MCA B;  1YWO A;  4M4Z A;  1GFC A;  2KXC A;  3O5Z A;  2FG0 A;  3UT1 A;  3EH2 A;  5M9O A;  1Y7X A;  4B9W A;  2KYB A;  4N0A A;  3CXC A;  1M2O A;  2LCC A;  4FM4 B;  2KVQ G;  5A0L A;  2XMF A;  4JJN K;  2RHX A;  2X3W D;  1V29 B;  4X9C A;  1YCS B;  3CCR A;  2PUO B;  1NJI R;  2LT4 A;  5FW9 A;  3OYL A;  1S72 A;  1K8A C;  1QVF S;  3FJ5 A;  2LX9 A;  2P4R A;  4C5E A;  3CCU T;  1Y96 B;  2H8H A;  1N5Z A;  2DXT A;  1YWP A;  4C92 C;  1V76 A;  3OW2 A;  4MZT A;  2PQW A;  2L3R A;  1OOT A;  2HCK A;  2RA2 A;  1SKU B;  3QUI A;  1K1Z A;  3PIO A;  2CUB A;  2DL8 A;  5GMK m;  3D7S B;  3M5A A;  2E10 A;  3M0T A;  2LC4 A;  4E7K A;  2XHC A;  2JM9 A;  4RTY A;  1VQ6 A;  1QWF A;  2I2L A;  2VAS A;  2LQW A;  3PVL A;  1X6O A;  3MHX A;  3CCJ T;  3MO8 A;  1G3T A;  1JU5 C;  2ABL A;  4FW2 A;  2QA4 Q;  1LJO A;  1UG1 A;  2HQE A;  2E41 A;  1XJW B;  1OPK A;  2Y4X A;  1E7O A;  3G6E T;  4FU6 A;  1D0Y A;  3E19 A;  3RER A;  1VQP Q;  2LJ3 A;  1ZSG A;  1M5Q 1;  4M77 D;  4C0G A;  2WSE E;  1D0X A;  2HKQ B;  4AG2 C;  4XK8 E;  4NL2 A;  4OMM A;  3UPU A;  3CCE Q;  5GAM d;  1AWW A;  4GLM A;  2F2V A;  3DKM A;  4PLI A;  2ZPB B;  2EW3 A;  2MIO A;  5IN1 A;  3I5S A;  1KIK A;  2VWF A;  3OBW A;  1HD3 A;  2KRS A;  3PE0 A;  4J9G A;  3JCM J;  2E70 A;  1XTD A;  2A37 A;  1VQK T;  1VQ5 A;  2LP5 A;  3CC7 T;  4R55 A;  2R58 A;  2KRM A;  2CP2 A;  1AVZ C;  1B3Q A;  3JRZ A;  3VYH B;  2JTE A;  2EQJ A;  3QZ5 B;  3A8L B;  1W70 A;  4LN2 A;  2DAQ A;  3ASK A;  1ZBX A;  2VYT A;  4BI8 B;  3OMC A;  1C0M A;  1C1A A;  2DRM A;  3I56 Q;  1X2K A;  2K4Y A;  1T0H A;  2J05 A;  4EPC A;  1YJN A;  5AT1 B;  2G6F X;  1NJI U;  2CP7 A;  3M56 A;  3G71 A;  4M7D B;  3GP8 A;  4PJO B;  3BW1 A;  1B07 A;  3CMA Q;  1GCQ A;  2COW A;  1QVF P;  1OEB A;  3G4S T;  2L2P A;  4JRI A;  3CCS T;  3M4G A;  2DYB A;  2X4J A;  2RK1 A;  3CCL Q;  2DZ9 A;  5IHN A;  2ED1 A;  2FO0 A;  4M7A G;  3CC4 T;  2JW4 A;  2RQV A;  4EMK B;  2K5L A;  3C0C A;  2V8I A;  4BY6 C;  1RLQ C;  5GAM g;  3JSC A;  1WYX A;  4C8Q F;  3LGL A;  1WDX A;  3JCM d;  1GXI E;  2CS7 A;  4KRT A;  4PJN A;  3RES A;  1VQ8 A;  1YI2 Q;  1UGP B;  3QZ9 B;  3UWN A;  5A0D A;  1H3H A;  5GAN d;  4C8Q E;  1AD5 A;  1WHM A;  4FCY A;  4L5G A;  3SD4 A;  5DY9 A;  2FPF A;  5KCO A;  3S3O A;  2JVV A;  2LQN A;  2DX1 A;  1QP3 A;  4AFU C;  1M2V B;  2OAU A;  2LDM A;  1OU8 A;  2QGF B;  3ZL7 C;  2HD0 A;  3MP8 A;  2EAY A;  2R5M A;  1VQO Q;  5LJ3 g;  3ZBD A;  2XIC A;  1WQW A;  4F7U B;  3IQL A;  4ZGD B;  1KFZ A;  1ZHI A;  3UDC A;  1EFN A;  3OYF A;  4O5V A;  4M7D A;  1H8K A;  4HCB A;  3OQ5 A;  3A8G B;  4LNP A;  2K3B A;  4RCB A;  2O31 A;  4AMC A;  3A98 A;  2J6K A;  4XU0 A;  1PRL C;  2CUD A;  1I0C A;  3PGG A;  3CCU A;  4M7D F;  5KYX B;  4FL6 A;  4DEY A;  3CEY A;  2DMO A;  1NEB A;  4M7D E;  1QKW A;  4JPB W;  1MMA A;  2RJD A;  4Z88 A;  1G2B A;  4WF2 A;  3M0P A;  2JN0 A;  2LCS A;  3A8M B;  4E6R A;  3RBB B;  4DBQ A;  3OYD A;  1OPL A;  4QQ6 A;  3M0Q A;  1N8R R;  3HRU A;  1YHQ Q;  2J06 A;  3CCJ A;  2F2X A;  3LWH A;  1RAA B;  3QYG B;  1G3W A;  1M2V A;  3CCV Q;  2F1L A;  1UUE A;  5IAY A;  4OB2 B;  1X01 A;  2EJ9 A;  1IRE B;  2OTJ Q;  1VQM Q;  1YJ9 T;  1YIT Q;  3ZEH A;  2JMA A;  3G6E A;  3L2V A;  1IRX A;  2KY9 A;  4OB3 B;  4MML A;  2M51 A;  4C92 A;  2ESW A;  2XDP A;  3M0U A;  3X20 B;  2D0N A;  4N4H A;  2DEU A;  2E6N A;  2K5I A;  2XKO C;  3PIP A;  4KGZ B;  1IO6 A;  2OI3 A;  3X26 B;  2V1Q A;  1M1K C;  1PRM C;  3CPW A;  4O6J A;  4ORZ A;  1MUZ A;  1QP2 A;  1E6G A;  4J9C A;  5IXF A;  4C92 F;  2QA4 T;  3CCR T;  1QCF A;  2E64 A;  1KD1 C;  1QWE A;  3TEE A;  4C92 E;  3OSV A;  1K73 R;  1W2B P;  5IH2 A;  4ZN3 A;  1JO8 A;  1VQK A;  1KC8 C;  3U23 A;  1VQP T;  3CC7 A;  2JS2 A;  4B6M A;  5A0G A;  3C94 A;  2FL7 A;  2F5K A;  3CCE T;  2V1R A;  2KI7 A;  2YLB A;  1SRL A;  2RN8 A;  1RAB B;  1MHN A;  5D7U A;  4RG8 A;  1VYV A;  4JRP A;  4IUV A;  1UTI A;  3EGX A;  2HBW A;  3OYA A;  1YIJ A;  4BDY A;  2DLP A;  2HSE B;  2DO3 A;  3OYI A;  4IUT A;  3L2Z A;  5LJ3 j;  4HKE A;  2FPE A;  4HCZ A;  1Y0M A;  4BY6 B;  5GAN 5;  4DOV A;  2HMA A;  3H0F A;  2RMO A;  3G4S A;  1NE8 A;  2DPP B;  3A8O B;  3CCS A;  4J9D A;  3CQT A;  1I8F A;  3JB9 D;  4QKU A;  2EKO A;  3P8B B;  1K9A A;  1OUL A;  2FEI A;  3I56 T;  3QSU A;  4KT0 E;  4JDS A;  2COY A;  2EYW A;  3CC4 A;  9ATC B;  4ELZ C;  4XTX A;  1OQK A;  2NUP B;  1KQ2 A;  1WXT A;  3CMA T;  3ZFJ A;  3HHT B;  5I21 A;  2A3L A;  4Q5W A;  2HL3 A;  3REB B;  2CYZ B;  1N8R U;  1UGS B;  4RTV A;  3NTK A;  1MMN A;  1GL5 A;  4PJO D;  3FEO A;  3VRZ A;  1RAH B;  2NLU A;  1WHH A;  1WHK A;  4KH1 B;  4PFZ A;  2YT6 A;  4EMG A;  1VIF A;  3CBP A;  1F1B B;  3AHU A;  2FRY A;  2YLC A;  4XTY A;  1MV3 A;  6AT1 B;  4M77 F;  3GPL A;  1GCP A;  5CKD A;  1YI2 T;  3M4Y A;  1UJY A;  1Q81 U;  2E3I A;  4M7D G;  2KE9 A;  3NFC A;  2HAX A;  4JZ3 A;  3L2W A;  4IUR A;  4M77 E;  5LJ3 h;  4PJL A;  3DLL A;  3JCM X;  2AIR B;  1FX7 A;  2C06 A;  3BFM A;  1PNJ A;  2K6D A;  5CKE A;  2GF7 A;  2V8K A;  3OS1 A;  1TWB A;  2M02 A;  3JCM c;  2JOY A;  3L42 A;  4JZ4 A;  3EGD A;  3MP6 A;  5HCK A;  1K73 U;  1WHG A;  3VJP A;  4C0D C;  1VQO T;  4CC3 A;  2QQB A;  1CSK A;  5GAN 3;  2WAC A;  4RKU E;  1FWZ A;  2EGC A;  2NUP A;  3A1P A;  5FU6 C;  1G5V A;  4DBF A;  4FIB A;  1W2B A;  3QO3 A;  1TU0 B;  2DNU A;  3TSZ A;  2AHJ B;  4LUE A;  3EG0 A;  2D6F A;  1Q86 R;  2XD0 A;  2DVJ A;  1I07 A;  3CD6 Q;  2XID A;  4D8D A;  3M58 A;  4IUP A;  2F2W A;  4OGC A;  2GTO A;  3NTI A;  2L0A A;  2AT1 B;  4A4G A;  5FRM A;  2RH2 A;  3E2U A;  1WHL A;  2H3J A;  1PD0 A;  2EJG A;  2FRW A;  3RKW A;  2F69 A;  1EZZ B;  4BE0 A;  3M55 A;  3HSB A;  2JNG A;  1BIB A;  2GQV A;  4M78 C;  5EG2 A;  2P84 A;  4C92 G;  2CZ6 B;  3V7R A;  5LJ5 e;  4QQG A;  3H9N A;  2RHZ A;  4LD9 K;  1SPK A;  1KQ1 A;  5HY6 A;  3H0I A;  2GNC A;  5FU7 C;  1GBR A;  1K0S A;  4EDU A;  5CAI A;  5GJW B;  1YHQ T;  4P5N A;  2AZS A;  3H6Z A;  3R6N A;  2HNI A;  1NJI C;  1WGS A;  1AWX A;  3JB9 H;  3TQ7 P;  3VKI A;  3S3M A;  2QA4 A;  3CCM T;  3QWX X;  1H92 A;  2YRC A;  3JCM e;  2OTJ T;  1OZ3 A;  1VQM T;  2ZPF B;  2PNI A;  4A4H A;  1ACM B;  4J6Y A;  1YIT T;  2FZC B;  1NBE B;  3R6O A;  4NOY A;  5GAN e;  3VS6 A;  1T3L A;  4RTZ A;  1FMW A;  2GFU A;  4LDW A;  1VQP A;  1BB9 A;  4PFO A;  2LMJ A;  1QMC A;  2L3S A;  3HKS A;  1RI0 A;  4BDZ A;  3X24 B;  3CCE A;  4B9X A;  1Z9Q A;  4FT2 A;  1QVG P;  2LCL A;  2V26 A;  5C6S A;  1RUW A;  2QEX Q;  1IGU A;  1VQN Q;  2NUT B;  3VS3 A;  3J80 E;  5LJ3 f;  2EYZ A;  3SHW A;  3FDR A;  4DBH A;  3JCM W;  3TU4 K;  1I81 A;  2KK4 A;  1T0J A;  2KRN A;  2MWP A;  1BK2 A;  2JTF A;  4DOW A;  2QGG A;  4ZGJ B;  1OV3 A;  2EQK A;  5GJV B;  3OYJ A;  1H3Z A;  3LGF A;  2GBQ A;  3M0S A;  1JQQ A;  5KYY B;  2LTO A;  3F70 A;  5GMK l;  2PVG B;  4JRQ A;  1MMG A;  3REA B;  1Y71 A;  5ECA A;  1UEB A;  2LJ0 A;  4OMN A;  1BIA A;  2J6O A;  3VS1 A;  3MET A;  2QQA A;  1QQJ A;  3I56 A;  1U3O A;  3CBO A;  1VYT A;  2FB7 A;  4PFP A;  1G3Y A;  2FHD A;  3OS5 A;  1Y96 A;  1VQ4 Q;  3L1A A;  4D8K A;  3MEA A;  3SEM A;  2OTL Q;  3OMG A;  2K3Y A;  3CMA A;  1Q86 U;  1JEG A;  3WVD B;  2X35 A;  4PJJ A;  3GOX A;  1S1N A;  2EKH A;  1UGR B;  2W0Z A;  2LRQ A;  2LQ8 A;  5CQX A;  2MAM A;  4M77 G;  2MYS A;  4JUV A;  2NWM A;  1WJR A;  1NG2 A;  2K2V A;  3JCM V;  2NUT A;  3QG1 A;  1NYF A;  2RM4 A;  5I2S A;  2RD1 A;  3UF4 A;  1YJW Q;  4IIO A;  2MF2 A;  1WNL A;  1BCO A;  2DL7 A;  4J7F A;  3TVT A;  3GBQ A;  1YI2 A;  2GCX A;  1B34 B;  1LNX A;  2HL5 C;  4KUL A;  3QHS A;  5KYY A;  2BZY A;  4C0D B;  3OYH A;  3QJ6 A;  4Y92 A;  2VXF A;  1WZO A;  5FU6 B;  1VQL Q;  5AYF A;  1YIJ T;  2ENM A;  2W10 A; 
#chains in the Genus database with same CATH homology
 4BE1 A;  2O01 E;  2KMT A;  1JJ2 S;  2E5Q A;  4XQ3 A;  3C12 A;  3CCJ A;  2XG8 D;  3LWH A;  4XU1 A;  4RG2 A;  3MEU A;  1Q82 C;  4M7A B;  1LOJ A;  3QYG B;  1XOV A;  2EQU A;  1G3W A;  3SWN B;  3CPW S;  2RI5 A;  3DB4 A;  2LQK A;  2O4X A;  2RJC A;  1R8O B;  2DD4 A;  5IAY A;  4OB2 B;  1X01 A;  2EJ9 A;  1IRE B;  5LJ5 d;  1VQO A;  2QQR A;  4JLI A;  4A53 A;  1VQ7 T;  2ZPI B;  1N9S A;  4CI0 C;  3RMS A;  5HK0 A;  4M7D D;  4XTU A;  1YJ9 T;  2K3X A;  4ZTF A;  1VQ4 A;  3ZEH A;  3CC2 T;  1G3S A;  3G6E A;  4M77 A;  1VQ5 T;  3L2V A;  4JS5 A;  2OTL A;  2KY9 A;  3V8J A;  4MDW A;  3M54 A;  2QI2 A;  4M75 G;  2IVW A;  4MMK A;  2PU9 B;  4MML A;  4OB3 B;  4C92 A;  3OBY A;  1QVG S;  2XDP A;  3E1S A;  1JB0 E;  4Y91 A;  1Q82 U;  3X20 B;  4HCC A;  3NTH A;  3FJP A;  2L8D A;  3S3N A;  4N4H A;  2DIQ A;  2E6N A;  5GAN 7;  2K5I A;  2XKO C;  2L5Q A;  2VGM A;  2VXE A;  4QVD A;  3PIP A;  3OS0 A;  3OYN A;  3CME A;  1M1F A;  4OF1 A;  3X26 B;  4C5G A;  1M1K C;  3CPW A;  4O6J A;  3QKJ A;  5KCH A;  4M78 B;  5A2Q E;  1QP2 A;  3HRT A;  4C92 F;  2G3R A;  5HKC A;  5J26 A;  2QA4 T;  1Y07 A;  3CCR T;  2E64 A;  1KD1 C;  2DTO A;  2RHU A;  4J8O A;  2X4Y A;  1BI0 A;  1PSF A;  4TVR A;  5FU7 B;  4C0F A;  1QW1 A;  2RI2 A;  4IUQ A;  3TEE A;  5GAM e;  3HL8 A;  3LWI A;  1YJW A;  1RL2 A;  3CCL A;  1YJN T;  1QVG A;  4C92 E;  5CVI A;  5KE2 A;  3L2U A;  3OSV A;  2MMP A;  1M1K U;  4KBM B;  4ZN3 A;  1BI3 A;  4M78 G;  3OY9 A;  3GLX A;  3DLM A;  4ELY C;  5LJ5 f;  5LJ5 h;  3G71 T;  1U1T A;  4XAX B;  1VQK A;  1KC8 C;  3JB9 F;  5C0M A;  1VQP T;  1B34 A;  1M9S A;  3CC7 A;  2XU8 A;  5GMK j;  1KD1 U;  4E7I A;  3HPW A;  1W4S A;  5A0G A;  3C94 A;  2PUK B;  3QII A;  2FL7 A;  3CD6 T;  2A7Y A;  2F5K A;  3O8V A;  1H64 1;  1Q7Y C;  3CCE T;  1VQL A;  5GAO n;  1YHQ A;  5CKF A;  1O9S A;  3INZ A;  4DQ2 A;  4FT4 A;  3FIF A;  2WSF E;  4Y28 E;  2YLB A;  1BKB A;  2RB6 A;  5GAN 6;  4IUU A;  4ME7 A;  3JCM f;  1KC8 U;  4GY5 A;  2DTI A;  5GAN 8;  5IT9 E;  2EWN A;  3CCV A;  3J81 E;  4M7A A;  4M7D C;  4PJO A;  2LNV A;  1MHN A;  3CCM A;  2XDD A;  3SWN A;  4PJO C;  3RUX A;  4RG8 A;  2LVM A;  4XTV A;  3QYH B;  2OTJ A;  4FSX A;  1N27 A;  2DD5 A;  4JRP A;  4ATO A;  2D9T A;  5GAN f;  3PNW C;  1VQM A;  2VGN A;  3QBY A;  4IUV A;  1Q7Y U;  1YBY A;  4C92 D;  1YIT A;  2DXB A;  4J7I A;  4LDU A;  4OB0 B;  3V8K A;  5CIU A;  3OYA A;  1YIJ A;  4C8Q B;  4X34 A;  4BDY A;  3JCM P;  1WPY A;  2DXU A;  1VQ8 T;  3PT9 A;  2V8J A;  4PJO F;  4M7A F;  1VIE A;  2BKD N;  2DO3 A;  4JRK A;  4HT8 A;  3FRN A;  3SB2 A;  3OYI A;  4IUT A;  3L2Z A;  5LJ3 j;  5L8R E;  3CXC S;  4IKF A;  1U8R A;  3BY7 A;  4HKE A;  4HCZ A;  5LJ5 g;  3OYG A;  4BY6 B;  2ZPG B;  4EMK A;  5GAN 5;  1M1G A;  4UC4 A;  4DOV A;  3OA6 A;  3LX7 A;  4EMK C;  3G4S A;  2VV5 A;  1NE8 A;  2DPP B;  3A8O B;  3CCS A;  3HFN A;  4JS4 A;  4PJO E;  4M7A E;  2EJF A;  1NPR A;  2HQX A;  1M90 C;  4E7L A;  2DZC A;  1I8F A;  3JB9 D;  1YJ9 A;  5DLO A;  3MEW A;  1HK9 A;  3MCA B;  3CC2 A;  2VUB A;  2M9U A;  2EKO A;  5GAO q;  2EYQ A;  2XK0 A;  3P8B B;  4N4I A;  4A54 A;  3I56 T;  3QSU A;  5CR2 A;  4KT0 E;  3UT1 A;  2DXC A;  4JDS A;  1N8R C;  3CC4 A;  4ELZ C;  5M9O A;  1Y7X A;  2RJE A;  2VC8 A;  4XTX A;  4B9W A;  4LDV A;  3RMQ A;  3JCM g;  4N0A A;  5FRO A;  3N5B B;  3CXC A;  3OS2 A;  4LDX A;  2CZ1 B;  2LCC A;  1M90 U;  2X4W A;  2LT1 A;  2M16 A;  4FM4 B;  2KVQ G;  5A0L A;  4M75 B;  5LJ3 d;  4MZM A;  5KE3 A;  5GAN g;  1KQ2 A;  3FC3 A;  3CMA T;  4JJN K;  3ZFJ A;  1UB4 A;  3HHT B;  1VQ9 A;  5I21 A;  3V7C A;  2RHX A;  2A3L A;  1V29 B;  4L59 A;  4X9C A;  4Q5W A;  1KHI A;  2PUO B;  5CCA A;  3JAM E;  3CCR A;  2LT4 A;  2CYZ B;  5J39 A;  5GMK h;  1UGS B;  3OYL A;  3PMI A;  1S72 A;  1N8R U;  1K8A C;  1O75 A;  1QVF S;  3NTK A;  4JLG A;  3QPH A;  2LX9 A;  2R5A A;  1TH7 A;  4PJO D;  4LD6 A;  4C5E A;  1Y96 B;  3CCU T;  1I5L A;  4F7U A;  2QEX T;  4M7A D;  3FEO A;  1Q81 C;  1VQN T;  4M77 C;  2NLU A;  2DXT A;  4BI3 A;  3CBM A;  4C92 C;  2P0Q A;  2E1H A;  4EMG A;  1VIF A;  2R57 A;  3CBP A;  3OW2 A;  3VUZ A;  4MZT A;  2P0K A;  3AHU A;  2PQW A;  2L3R A;  2YLC A;  3I55 A;  5CKB A;  1YCY A;  2IG0 A;  3V8L A;  1K8A U;  5FLX E;  1SSF A;  4XTY A;  2RA2 A;  3QUI A;  3OYB A;  3PIO A;  4M77 F;  4F7U F;  4ZTJ A;  3SDZ A;  3GPL A;  2DKG A;  4BUG A;  1K9M U;  3KBG A;  5CKD A;  5GMK m;  1IZ6 A;  2YRV A;  3M5A A;  3M4Y A;  4C8Q A;  1YI2 T;  2E10 A;  1Q81 U;  1QVF A;  4M7D G;  2LC4 A;  3NFC A;  4E7K A;  2HAX A;  2XI9 A;  3L2W A;  4IUR A;  3QDR B;  1K73 C;  1KG1 A;  2XHC A;  2KSS A;  2E12 A;  4M77 E;  5LJ3 h;  4F7U E;  3P8D A;  1VQ6 A;  4A4E A;  3DLL A;  3JCM X;  2I2L A;  4X9D A;  2PVO B;  1FX7 A;  1JRI A;  1N9R A;  2C06 A;  4RMO A;  3BFM A;  2HBP A;  1X6O A;  5CKE A;  1W2B S;  3MHX A;  2GF7 A;  2V8K A;  3CCJ T;  3MO8 A;  1UGQ B;  4PKC C;  3T9N A;  3OS1 A;  1G3T A;  3JCM c;  2JOY A;  4NS5 A;  5GAM j;  2DK3 A;  3L42 A;  4NL3 A;  1I4K 1;  5CKH A;  4C0Z A;  5GAN 2;  5GAO p;  3MP6 A;  3M53 A;  3CCQ A;  1K73 U;  1LJO A;  1OI1 A;  1X75 C;  4D6W A;  2QQS A;  3VJP A;  3C4S A;  2HQE A;  4KUD K;  4C0D C;  1VQO T;  2E41 A;  2QQB A;  5GAN 3;  2WAC A;  4RKU E;  1FWZ A;  2Y4X A;  1VQ4 T;  1JBM A;  3DB3 A;  3G6E T;  5FU6 C;  4CRI A;  4QQD A;  4FU6 A;  2OTL T;  2DIG A;  4A4F A;  2M0O A;  4M75 A;  1G5V A;  4XU3 A;  2RHI A;  3E19 A;  4FIB A;  4RCC A;  1W2B A;  3RER A;  4R56 A;  4M7A C;  3QO3 A;  3SWN C;  1M5Q 1;  4M77 D;  4C0G A;  2AHJ B;  2WSE E;  2ZGW A;  2D6F A;  3CME T;  1WJS A;  2XD0 A;  4XK8 E;  2XID A;  4NL2 A;  4BI4 A;  3UPU A;  4E47 A;  1ZQ1 A;  5GAM d;  3M58 A;  2CZ7 B;  4A4K A;  4M75 F;  1PSE A;  2QTX A;  3DKM A;  4PLI A;  3GF5 A;  4IUP A;  4OGC A;  4QVZ A;  4C92 B;  3OYM A;  3RIR A;  2ZPB B;  2E65 A;  3BDL A;  3L2Q A;  3NTI A;  5IN1 A;  1YJW T;  5KH6 A;  1HXD A;  4PLL A;  2B8A A;  4A4G A;  5FRM A;  2RH2 A;  3OBW A;  4M75 E;  2H3J A;  3H8Z A;  4C8Q D;  5GAO r;  1K9M C;  2EJG A;  3FB9 A;  3KXT A;  3RKW A;  1VQ7 A;  3V7S A;  2F69 A;  3S6W A;  2EIF A;  4BE2 A;  2E70 A;  3M55 A;  4M78 A;  4BE0 A;  3JCM J;  2JNG A;  3HSB A;  1XTD A;  1BIB A;  2GQV A;  3OYK A;  4M78 C;  5EG2 A;  1VQ5 A;  1VQK T;  4C92 G;  2CZ6 B;  3V7R A;  5LJ5 e;  3CC7 T;  4QQG A;  4R55 A;  2R58 A;  2KDS A;  2RHZ A;  3LLR A;  4LD9 K;  1KQ1 A;  5HY6 A;  4C5H A;  2P4T A;  2ZPH B;  3ER0 A;  5FU7 C;  3JRZ A;  3QXE B;  4EDU A;  5CAI A;  1WQ7 A;  3VYH B;  1VQL T;  1YHQ T;  3VV0 A;  4P5N A;  4N0A C;  2EQJ A;  3H6Z A;  1OYX A;  3URG A;  3OYC A;  4M78 F;  3PTA A;  3QZ5 B;  2DEQ A;  3A8L B;  2HNI A;  4J83 A;  3KUF A;  3OW2 S;  1KQS A;  3VYG A;  1NJI C;  1WGS A;  3E9G A;  5DM7 R;  3JB9 H;  2DAQ A;  2Y4Y A;  1ZBX A;  2VYT A;  3ASK A;  4XU2 A;  4BI8 B;  3OMC A;  3VKI A;  3S3M A;  3MP1 A;  2QA4 A;  1QVP A;  5GAM h;  3JB9 G;  3CCM T;  4M78 E;  4OMF B;  3JCM e;  2BIV A;  2OTJ T;  2K4Y A;  2QXF A;  4EPC A;  1OZ3 A;  4L6V 5;  3CCL T;  2ZPF B;  1VQM T;  4A4H A;  4J6X A;  4J6Y A;  5HK3 A;  1YIT T;  1YJN A;  4MDX A;  4M75 D;  3R6O A;  3SFM A;  4NOY A;  4E7H A;  5GAN e;  2DJZ A;  1NPP A;  1NJI U;  5GMK i;  3M56 A;  3G71 A;  4M7D B;  2EQM A;  2YHT A;  4E7J A;  3GP8 A;  2GFU A;  4PJO B;  2RJF A;  3BW1 A;  3LW5 E;  4LDW A;  1VQP A;  3J7A F;  3GNG A;  3G4S T;  3HKS A;  4JRI A;  3CCS T;  3OB9 A;  5GAN j;  3CD6 A;  4HT9 A;  1RI0 A;  3M4G A;  1D3B B;  4BDZ A;  2X4J A;  3X24 B;  3CCE A;  4B9X A;  3MEV A;  2RK1 A;  2Y90 A;  3JB9 I;  1BI2 A;  3VUB A;  2EFI A;  4VUB A;  4FT2 A;  4HA8 A;  4C5I A;  2LCL A;  2DZ9 A;  3P8H A;  5C6S A;  4C8Q C;  5GAN 4;  4QW2 A;  4PJO G;  4M7A G;  3J80 E;  3CC4 T;  5LJ3 f;  2X4X A;  4EMK B;  1JJ2 A;  3FDR A;  4M78 D;  3JCM W;  2K5L A;  2JZ2 A;  3TU4 K;  2V8I A;  3Q1J A;  4BY6 C;  1I81 A;  2KK4 A;  3X25 B;  3JCM Q;  4J6W A;  2MWP A;  5GAM g;  2GFA A;  3JB9 J;  3JSC A;  3QJY A;  4BD3 A;  2JTF A;  2ZCF B;  1WJQ A;  4DOW A;  4XTZ A;  4ZGJ B;  5D6X A;  3LGL A;  4C8Q F;  3JCM d;  2EQK A;  1GXI E;  2CS7 A;  3GNF B;  3OYJ A;  1FXX A;  1H3Z A;  3FLG A;  3RES A;  1VQ8 A;  3LGF A;  1VQ9 T;  1UGP B;  3QZ9 B;  3UWN A;  5DLQ E;  5A0D A;  2LTO A;  3F70 A;  1DJ7 B;  5GAN d;  1S72 T;  5GMK l;  4C8Q E;  2PVG B;  3PMT A;  1XQH A;  4JRQ A;  2MI6 A;  3M59 A;  5GMK e;  2FVU A;  5D6W A;  4L5G A;  3SD4 A;  2P0P A;  5DY9 A;  3TRE A;  1Y71 A;  2M1H A;  1P92 A;  3TCJ A;  5KCO A;  3M57 A;  3S3O A;  1M8V A;  1M4Z A;  1UEB A;  2JVV A;  3WXM B;  1BIA A;  2JUF A;  1QP3 A;  3RKY A;  3VU3 C;  4BB7 A;  1U1S A;  3EFR A;  4M75 C;  1Q86 C;  3MET A;  2QQA A;  2OAU A;  4KUI A;  4PNO A;  3I56 A;  2L89 A;  3HFO A;  2O4X B;  2QDY B;  2LDM A;  3CBO A;  3I55 T;  2XDB A;  5GAO m;  2RK2 A;  2HD0 A;  3EFS A;  3MP8 A;  2FB7 A;  5CK9 A;  2EAY A;  2R5M A;  3RKX A;  2RO0 A;  2CZ0 B;  4OB1 B;  3ZBD A;  1G3Y A;  5LJ3 g;  3G7Z A;  2FHD A;  2JTM A;  2XIC A;  3E9F A;  3OS5 A;  1WQW A;  1Y96 A;  4M77 B;  4OGE A;  2KAF A;  3X28 B;  4F7U B;  3L1A A;  4ZGD B;  1ZHI A;  3UDC A;  3MEA A;  5CO7 A;  1AHJ B;  3HRS A;  3OMG A;  3OYF A;  4O5V A;  4M7D A;  4PL6 A;  4HCB A;  2K3Y A;  2ZZD A;  3CMA A;  3JCM h;  1Q86 U;  1MGQ A;  3A8G B;  3OQ5 A;  4RCB A;  1KQS S;  1VQ6 T;  3GIB A;  3WVD B;  2X35 A;  1BYM A;  4GLK A;  3GOX A;  4OP0 A;  3WVE B;  4XU0 A;  5LJ3 e;  2WSC E;  1UGR B;  1D3B A;  5LL6 S;  5GAN h;  2LRQ A;  2LQ8 A;  2BUD A;  2CGH A;  2PVD B;  2MAM A;  4J5Y A;  4M77 G;  3PFS A;  5CQX A;  4JUV A;  5D6Y A;  3PGG A;  4F7U G;  5FRN A;  2DTH A;  3CCU A;  5GAO l;  3HP9 A;  2QEX A;  4M7D F;  4OVA A;  1VQN A;  4FL6 A;  1WJR A;  1OZ2 A;  3C95 A;  4LDY A;  4N4G A;  2K2V A;  3M9Q A;  3OYY A;  3A8H B;  3CCQ T;  3JCM V;  2DVE A;  3CEY A;  4YTL A;  3QG1 A;  3L2R A;  2QQ9 A;  1XNI A;  2K5F A;  2RM4 A;  2ZPE B;  1BI1 A;  2RD1 A;  5I2M A;  4XTW A;  5I2S A;  4DA4 A;  3EAE A;  2MF2 A;  4M7D E;  4ZGE B;  4MZP A;  1WNL A;  2MWO A;  2RJD A;  2D0Q B;  3LYI A;  1NZ9 A;  2CKK A;  5LJ5 j;  4Z02 A;  4J7F A;  5CQY A;  3A5Z B;  4WF2 A;  4C8Q G;  2JN0 A;  3LH0 A;  2RHY A;  1YI2 A;  4QVC A;  2F5T X;  1KHC A;  3A8M B;  2GCX A;  3ME9 A;  4EMH A;  3BDU A;  1B34 B;  1LNX A;  5GAM f;  3OYE A;  3CPF A;  3CCV T;  4KUL A;  4V2S A;  3QHS A;  4II1 A;  1N6A A;  3JCM b;  2K57 A;  5J3B A;  1VUB A;  4C0D B;  2KQW A;  2RI3 A;  3OYD A;  3OYH A;  3QJ6 A;  2E6Z A;  4QQ6 A;  3OSS C;  2VXF A;  4ZN1 A;  1EIF A;  5FU6 B;  3HRU A;  2FYK A;  5AYF A;  1YIJ T;  4BAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...