2MWOA

Solution structure of 53bp1 tandem tudor domains in complex with a p53k370me2 peptide
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural Plasticity of Methyllysine Recognition by the Tandem Tudor Domain of 53BP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/antitumor protein
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwoA01
2GF7A 2JVVA 2YRVA 3KUFA 4RG2A 3PNWC 4QW2A 3I55A 5C0MA 3P8BB 2FHDA 2LCLA 3ME9A 4QQGA 1KC8U 4PLIA 1YIJA 3CD6T 3G71T 3DB4A 2RHZA 3OYFA 2PQWA 2E6ZA 5KE3A 2RI5A 2OTJT 4BACA 2DAQA 4BE1A 1VQ7T 2MWPA 2JZ2A 3L2QA 4N4HA 5J39A 1M1KC 3OYDA 3CD6A 3G71A 1Q86U 5IT9E 4N4GA 4C5HA 4TVRA 1K73U 3MP8A 4A4FA 1N8RC 2OTJA 4Z02A 2HQXA 2BUDA 3QBYA 1VQ7A 3QIIA 3OYIA 3ER0A 2XHCA 3OYYA 3S3NA 2JNGA 5M9OA 3NTIA 1K8AU 4QVZA 2JTFA 3FC3A 1NJIC 3QJ6A 4L59A 4FL6A 3J80E 3HKSA 2F5KA 3OW2S 1Q7YC 3NTKA 3H6ZA 3MEAA 2BIVA 2JUFA 1BKBA 1NPRA 3GOXA 2EQJA 1W2BS 4C5GA 3I56T 3OW2A 2EQUA 4IUTA 3PMTA 2QA4T 4Q5WA 3MO8A 1VQ6T 5KH6A 3OYBA 1KHIA 4PLLA 3S3MA 5HY6A 1W2BA 2WACA 3S3OA 1OYXA 3OA6A 1VQ5T 4B9WA 3SD4A 3I56A 3MEUA 1K9MC 3P8DA 2QA4A 1Q81C 1VQ6A 3A5ZB 1YJNT 3OS0A 4E7JA 1G5VA 1M1KU 4C5IA 1VQ5A 1QVGS 3L2WA 5FRMA 3S6WA 3DLLA 1N8RU 1VQ4T 4A4GA 1YJNA 1JJ2S 1QVGA 4E7KA 3OMCA 2X4WA 2EIFA 1IZ6A 2OTLT 3DB3A 2M16A 2NLUA 1VQ4A 3LGFA 2EKOA 1JJ2A 1OZ2A 1NJIU 1RI0A 3CCRT 3CC7T 2G3RA 5D6XA 4B9XA 3MEWA 4QQ6A 4A4HA 3LGLA 2OTLA 1Q7YU 3OS1A 2RJEA 3OYLA 3LLRA 4LD6A 4A4EA 1YJ9T 2CKKA 4ZN1A 2R5AA 2O4XB 3CCRA 3CC7A 2LVMA 3ZEHA 1KD1C 2O4XA 1KQSS 4GY5A 2R57A 2EQKA 1VQNT 3CCUT 1VQ8T 3Q1JA 2X4YA 3O8VA 1M90C 1YJ9A 2EQMA 5D6WA 1X6OA 4IKFA 3CMAT 1KQSA 4UC4A 1K9MU 4BDYA 4YTLA 1Q81U 1YHQT 3QKJA 4CRIA 1VQNA 3CCUA 5A2QE 3CC4T 1VQ8A 2X35A 4X34A 1WJRA 1KHCA 2QQRA 2RHUA 3NTHA 3CCQT 3CMAA 1M1GA 3MEVA 2LCCA 4BD3A 4BE0A 3CMET 1YHQA 3LH0A 3MP6A 3E9FA 1QVFS 3CC4A 1NZ9A 4ZN3A 4EDUA 1NPPA 5KCOA 2D9TA 1KC8C 3JAME 4IUPA 5CIUA 5DLQE 1EIFA 3CCQA 1MHNA 3OYCA 4NS5A 3OQ5A 4C5EA 1WGSA 1QVFA 3CMEA 2P0KA 4ZTFA 2RJCA 4QQDA 4IUQA 2K3YA 3C4SA 2KDSA 3LYIA 4IURA 5C6SA 2E70A 2MI6A 1K73C 1VQLT 3OYKA 3FDRA 3META 1KD1U 3UWNA 4FU6A 3CCJT 2DIQA 3OYGA 3CC2T 1M90U 1K8AC 3L42A 1VQLA 4E7HA 2E6NA 3CCLT 3CCJA 3CCVT 4N4IA 1VQ9T 3CEYA 3CC2A 4HCZA 3KBGA 3CCMT 2MWOA 5DM7R 2KVQG 1S72T 3LX7A 2XDPA 3PFSA 3CCLA 2QQSA 3MP1A 4ZTJA 1RL2A 3CCVA 4BE2A 3H8ZA 1VQ9A 3OYAA 2XK0A 3FEOA 3CCMA 3OYEA 5J3BA 3OYHA 3L2VA 1WJSA 1S72A 2RI3A 2B8AA 3BDLA 2JOYA 4IUVA 4E7IA 2VYTA 3M9QA 4BDZA 3CPFA 2RJDA 3TREA 1VQOT 1H3ZA 1VQPT 3OY9A 2K3XA 3J7AF 5IN1A 1Q82C 1XTDA 5LL6S 2L89A 3CCET 1XNIA 1VQOA 2QEXT 2GFUA 4PL6A 2IG0A 1WJQA 1VQPA 2EFIA 2LDMA 1OZ3A 1YITT 2RHIA 4IUUA 1VQKT 2M1HA 3CCEA 3OS2A 3F70A 2RHXA 2QEXA 3OYMA 2HQEA 2DO3A 5J26A 2RHYA 1YBYA 3FLGA 1YITA 3E9GA 3OYJA 5D6YA 5KCHA 1YI2T 1VQKA 2LRQA 2L8DA 5FRNA 3ASKA 1SSFA 3CXCS 1Q86C 3L2UA 5KE2A 3CCST 1VQMT 2GFAA 3EAEA 5IAYA 3G6ET 2R5MA 2LTOA 1YI2A 3CXCA 4OVAA 2RJFA 2X4XA 5FLXE 2RO0A 3PIOA 3G4ST 1YJWT 3CPWS 3CCSA 2RI2A 1VQMA 3J81E 2BKDN 1UEBA 3DLMA 3G6EA 2LQ8A 3P8HA 2DIGA 1N27A 3UT1A 2M0OA 4E7LA 5FROA 3OYNA 3OB9A 3CPWA 3I55T 4II1A 1Q82U 3G4SA 1YJWA 3PIPA 1YIJT 3OMGA 2R58A 3L2RA 1OI1A 3PMIA 2L3RA 2E5QA
chains in the Genus database with same CATH superfamily
2GF7A 2P4TA 2JVVA 2YRVA 1VIEA 1JO8A 4A53A 1TOVA 2CZ7B 1QKXA 2CS7A 3CCQQ 2FHDA 2LCLA 3ME9A 3REBB 1YNZA 2PVOB 5CCAA 2HD0A 3X25B 4Y91A 1NM7A 4ORZA 3JV3A 2E6ZA 5KE3A 2RI5A 4BACA 2YHTA 3EG2A 3LWIA 3AT1B 4KGXB 3T9NA 3OYDA 1ZUYA 4PK4A 3CD6A 4J6WA 5IT9E 2JM9A 1AWXA 4A4FA 1N8RC 4LUDA 2RQUA 2HQXA 1M3BA 4M4ZA 1WI7A 2BZYA 4M78F 1VQLQ 4C0FA 3QXEB 4PJOF 4BB7A 2O2OA 1IREB 2KRSA 1QQJA 4FYXB 4M75C 5EG2A 5ECAA 3JB9J 2ZGWA 5IH2A 1UUEA 2ESWA 3HKSA 3J80E 4KULA 3OW2S 1Q7YC 4M7DD 3PGGA 3CQTA 3H6ZA 1GL5A 4MDWA 3CCLQ 5CKHA 4CC3A 1BKBA 1NPRA 1RLQC 5GAMh 3E1SA 1M4ZA 2DNUA 5GAN5 2OAWA 4C5GA 4Z89A 3V7RA 2QA4T 3MO8A 5AT1B 2QQAA 2GTJA 1PD1A 4PLLA 2WACA 3S3OA 1W2BA 3GF5A 4AFQC 3OA6A 1VQ5T 1U06A 4MZMA 3JCMb 3VS3A 4PFOA 3EFRA 1TTHB 1ABOA 1WFWA 1K9MC 2FYKA 3U23A 4CI0C 1OPKA 5KYUA 1MV3A 3A5ZB 1I07A 3JCMf 2C0IA 4E7JA 3QDFA 2VXFA 4Z88A 1X6BA 4M77G 3L2WA 1WXBA 2IPOB 1Y07A 2CZ1B 4AT1B 4JJCA 4A4GA 1YJNA 1G3SA 2EGCA 5KYXB 1KFZA 2PNIA 2KAFA 5KYXA 3RKXA 4OMPA 2FPFA 1VQ4A 3CCEQ 1C0MA 4HCKA 1HXDA 1NJIU 3CC7T 1YCYA 2J6FA 2PZ1A 5D6XA 4B9XA 3H41A 3V8JA 2DERA 1G3TA 1EZZB 1YITQ 1ARKA 3EH1A 4JLIA 4MDXA 1ZX6A 1YP5A 3OS1A 4J9DA 3OYLA 4LD6A 4ZN1A 4C0ZA 2FRYA 2FZGB 3QDRB 2VGNA 3CCRA 3JCMJ 1X43A 3VUBA 2R57A 5KYYB 1IHWA 1VQ8T 3GNGA 1JQQA 1LVKA 1T0HA 2EQMA 3INZA 2D0QB 2C06A 3JCMg 2DL3A 3VRYA 2P0PA 4BDYA 1M3AA 1A0NB 3M0QA 2CGHA 2DBMA 3VYHB 3M0UA 4M7AB 2LJ0A 1PG5B 1X6GA 4FSSA 3RR6A 2K57A 3OS5A 4CRIA 4OF1A 3CC4T 4X34A 4LXCA 1WJRA 1PM3A 1K4US 1QW1A 1B07A 3NTHA 1GXIE 1D1BA 1P92A 2HQHA 4JUVA 4CC2A 2CP3A 3EHQA 5HK3A 1AZGB 1VYTA 2DK3A 3FJ5A 3LH0A 2KMTA 3MP6A 1ZBXA 5LJ5h 1R0BG 4ZN3A 4EDUA 1KG1A 2WSEE 1NPPA 1M2VA 3RUXA 1KQ1A 4XTWA 3CCQA 1MHNA 3RBBB 3TSZA 4M77D 2P0KA 2FPEA 2G6FX 4F14A 2BZXA 5GANh 4FIBA 2JS0A 3C4SA 2DKGA 1H92A 2KDSA 2LZ6B 4E2FB 5LJ3f 1B34B 1UHCA 4PJLA 3META 5GAMj 1B34A 3C95A 1D09B 4XK8E 3RESA 1VQ7Q 1SPKA 1SHFA 4C8QB 2A0FB 3VKIA 3I9QA 3L42A 3RKYA 1VQLA 1M8VA 1ZSZB 4RCBA 2E3HA 2KYBA 4MZTA 1UE9A 4ATOA 4M75F 2NYSA 3GPLA 2PUKB 2ZAEA 3CCVT 1N9SA 1GCQC 2V26A 5FU7B 4N4IA 2KY9A 2LNHB 1VQ9T 1ZHIA 2MWOA 1FYNA 2LT4A 5CKFA 1IGQA 4KGZB 1HJDA 2AIRB 2KVQG 2EGAA 2XDPA 5CAIA 2YUOA 3MP1A 4ZTJA 4RTWA 3CCLA 3C94A 4BE2A 4F7UG 2DL5A 1X2QA 1OU9A 3BFMA 1G3YA 3OYEA 2LC4A 3M0RA 4M7AG 4KUDK 1J3TA 3JCMe 3QWYA 1I81A 3EFOB 4D8KA 2VYTA 1M1FA 3I56Q 3M9QA 2M51A 2KK4A 3ZBDA 5LJ3g 1H641 1VQ6Q 1OEBA 1N5ZA 3NGPA 2O9VA 1M2OA 1YCSB 2D6FA 2CREA 2IIMA 1VQPT 2DPPB 2RPNA 1AVZC 2K3XA 3TQ7P 1Q82C 1W1FA 5HKCA 1V29B 3FIFA 3I5SA 4A4KA 4J9FA 1RAGB 2LNVA 1ZSGA 2Y4XA 4EMGA 2EFIA 4QVDA 2LJ3A 2RHIA 4C8QC 3A8HB 4IUUA 8ATCB 3CCEA 3OS2A 2ABLA 1K0XA 2RHXA 1ZSZC 4LDYA 2H8HA 4JJDA 2YLCA 5J26A 2OTLQ 4AG2C 1YBYA 5FU7C 2OI3A 2K9GA 3E9GA 1MMDA 1YITA 1RAHB 4J5YA 2L5QA 1KSWA 2KXDA 4C8QG 2X3WD 5FRNA 1UECA 4NL3A 4DBFA 1Q86C 3L2UA 3HTRA 5KE2A 3CCST 3A98A 1GCPA 2MK5A 5LJ5j 2EWNA 2GFAA 2A08A 2DTOA 1R0CB 4C92G 4GLKA 1YJ9Q 1U8RA 2X4XA 2LQKA 2DBKA 3HPWA 5FLXE 2YSQA 1G83A 2A7YA 4D6WA 5I11A 1UEBA 2VWFA 4ELZC 3ZL7C 5GANj 3CCUQ 1B3QA 4LDXA 3P8HA 5GAN3 3UT1A 2VC8A 3OYNA 2F2XA 4M7DA 4M7AD 1G3WA 4PJNA 4JJBA 4F7UE 5A0LA 1YIJT 1Q95G 3OMGA 3L2RA 3JB9G 1UFFA 2HSEB 2D0NA 4XTVA 2E5QA 3OBYA 2LP5A 2DZ9A 2ECZA 4QW2A 2AZSA 1NG2A 5C0MA 2ROTA 4MZPA 3V7CA 1PD0A 3MPUB 2XI9A 4RCCA 4QQGA 2DXCA 4PLIA 1AWWA 4FSXA 2K5IA 4F16A 4FYWB 5LJ3e 4ELYC 3G71T 1W70A 2ROLA 3BW1A 2V1QA 5A0DA 1X2KA 2OTJT 2XIDA 2HZYA 5A0GA 2JZ2A 5J39A 3BY7A 1M1KC 4EMKB 1RAIB 4EMKA 2QTVA 4R55A 3MP8A 1NEGA 1FMVA 1VQ7A 1BI3A 3A1PA 3ER0A 3VYGA 1JB0E 3ZFJA 1K1ZA 2K5FA 3NTIA 1QP3A 4KT0E 4QVZA 3X28B 1GFDA 3VS0A 4C8QD 2YUNA 4QVCA 3EG3A 4MMKA 3QJ6A 3CC2Q 4AG1C 2EJ9A 2DD5A 2F5KA 1FMKA 3A8GB 3NFCA 2CDTA 3NTKA 2BIVA 2P4RA 4C92D 1FWZA 2DXUA 4F04B 2RD1A 4HT9A 1BK2A 1WQ7A 2E3IA 2KE9A 4OGEA 3VS4A 1S72Q 2FRWA 2V1RA 2J7IA 4XTUA 2K79A 2VXEA 5HY6A 1Y57A 4J9BA 1SEMA 1SG5A 4B9WA 1MV0B 1LCKA 3I56A 2O31A 5GMKe 2MPXC 3P8DA 1O9SA 5IHKA 3VV0A 3JB9D 1Q81C 2QDYB 1N9RA 1VQ6A 2QQ9A 1VIFA 3QYGB 1N8RR 2X3XD 3M0PA 1Y71A 2NWMA 3MCAB 1QVGS 3S6WA 2WSCE 3DLLA 4EMKC 2JMCA 5IXFA 1JJ2S 4IIMA 1BIAA 2JT4A 5GMKi 3H9NA 4KH1B 4M78E 4M77B 2W10A 4J9EA 1PSEA 4M77A 4PJOE 2VV5A 3IQLA 2RK2A 3M0SA 4RTZA 1Q7YR 1WHLA 2QEXQ 1RI0A 4A54A 3MEWA 3GNFB 1OX8A 1U3OA 4A4HA 3LGLA 2OTLA 3X24B 4HKEA 1VQKQ 2X4JA 3LLRA 2KI7A 1RAFB 4DBQA 2LX9A 2R5AA 4OB1B 1KD1C 3UDCA 2HSPA 3H0FA 2CP7A 4GY5A 1KQSS 1QCNA 1K9MR 1VQNT 2JXBA 1YI2Q 1M90C 1YJ9A 3THKA 2DL7A 5D6WA 1IGUA 4JS5A 4LUEA 3CMAT 4UC4A 3VS6A 1OV3A 3RMSA 1YHQT 3QKJA 4E6RA 1JEGA 3CCUA 5A2QE 2X35A 5CO7A 3KXTA 1TUGB 3HSBA 1CKAA 4FW2A 3G4SQ 2K6DA 2RHUA 2HKNA 1MNEA 3CMET 3PTAA 1ZBJA 4OB0B 1QVFS 5AYFA 5KCOA 3I55Q 3O5ZA 1UHFA 1TS9A 2D9TA 4IUPA 5CIUA 1V1CA 1EIFA 3JCMh 2YUPA 2ENMA 4NS5A 3OQ5A 2OAUA 4BY6B 1WNLA 1ABQA 2H3JA 2XU8A 4M77C 1W2BP 4HVUA 2HL5C 1LPLA 2HEQA 3WVDB 1JRIA 4QQDA 4IUQA 4FM4B 1W6XA 2DJZA 4XU2A 3FRNA 2LJ1A 5GMKm 2COYA 4EPCA 2J6OA 3CCJT 4L5GA 2DVEA 3G1JA 1ZA1B 7AT1B 3OYGA 4LDUA 3G7ZA 3JCMV 3JCMc 2M0YA 1R8OB 2E6NA 2MAMA 2FO0A 2YRCA 1WPYA 2RB6A 3CC2A 1SSHA 3CCMT 4JRQA 2MCNA 5DM7R 3NMZC 4M7DF 2RN8A 5CKEA 3EG0A 3RKWA 5I21A 1EX4A 2EYWA 1D3BB 3H8ZA 2VUBA 1V76A 2HBWA 2EJFA 5J3BA 3M59A 1WA7A 2K2MA 1QCOA 1S72A 1HYOA 3ULRB 4E7IA 4D8DA 4OB2B 4J6YA 1MGQA 2DTHA 5KYYA 4F7UB 4BDZA 2NUZA 2QA4Q 1UGRB 4BY6C 2EYQA 2RJDA 4F7UA 2KNBB 1GCQA 1VQOT 2DXTA 3GBQA 4XU1A 1VQ5Q 3SFMA 2CZ0B 4M7AA 2LCSA 2ZPFB 2W0ZA 1AOJA 4DOVA 3GP8A 1FXXA 5D7UA 1QMCA 1OULA 2GFUA 1WJQA 4HXJA 4RKUE 2EJGA 3QO3A 3UPUA 1AZEA 1H8KA 2PTKA 3LH5A 3N5BB 1CKBA 2IVWA 5LJ3h 1YWPA 2M1HA 4XTZA 2B86A 1XQHA 4AFZC 2QEXA 2DL8A 4M75E 1K0SA 2X51A 5DY9A 4DBRA 3OYJA 5D6YA 3VS2A 5KCHA 3MJXA 1VQKA 2KT8A 4QT7A 3C0CA 3ASKA 3CC7Q 1SSFA 1X27A 2YUQA 4WTOB 2YXYA 1VQMT 2CUBA 2FL7A 1FX7A 3EAEA 3HRTA 2EYZA 3G6ET 2L2PA 3HRUA 2DE0X 1WYXA 3EGDB 5GAN4 5GAOm 2KBTA 1MMNA 1BB9A 4OVAA 3CXCA 3CXCP 1YI2A 3EGDA 2EYXA 2RJFA 1BIBA 5HK0A 1QLYA 1TH7A 2VVKA 1OU8A 5FWCA 1WHJA 4PKCC 2RI2A 1YJWT 3NPFA 4C8QA 3JB9I 1Q82R 1VA7A 3SDZA 1PNJA 2O88A 1ZUUA 1ZSZA 1VQ8Q 2E5KA 2V8IA 3HL8A 1PKSA 2M0OA 3QWXX 3M53A 4F17A 4C92B 2ZPBB 2EBPA 3OB9A 3CPWP 3CPWA 2DLPA 2KSSA 4II1A 3G4SA 4C92A 4Z8AA 5GAMd 4M7AC 4XTYA 3PIPA 1I5OB 1KC8R 2L3RA 3CC4Q 2DEQA 3KUFA 3JCMW 2J06A 1VUBA 1TU0B 3I55A 2F2WA 2E4HA 3UF4A 1I5LA 3CD6T 1T3LA 2EQIA 4M77F 2CP0A 1NEBA 2FVUA 2DD4A 2PQWA 2Y90A 1OQKA 1T0JA 5GMKh 3EFOA 1Q86R 2DAQA 4BE1A 2C0TA 2MWPA 1K73R 1IXDA 1AT1B 4N4HA 1BI2A 4OB3B 1BI1A 1RACB 2J05A 1S1NA 4N4GA 4C5HA 4OMNA 2O01E 5IHIA 3QBYA 2H3EB 1K8AR 2NUPB 2F2VA 1AWJA 2PUOB 2HNIA 3QYHB 2XHCA 3L2ZA 3REAB 2VASA 2JNGA 3RIRA 2LT1A 1UB4A 4R56A 4JPBW 4PNOA 2JTFA 4Y28E 3FC3A 1OOTA 2FB7A 4JDSA 4LDVA 1NJIC 2ZZDA 4ZGJB 3HHTB 1TUDA 3M56A 4L59A 2KXCA 4FL6A 1M27C 1WIEA 1WHKA 2ZCFB 4JLGA 3MEAA 4X1VA 4J8OA 4C92C 3CCVQ 3E2UA 2EQJA 1VYVA 1W2BS 1VQ9Q 3A8MB 1AWOA 3OW2A 2EQUA 3OW2P 1ZQ1A 4GBQA 3JCMX 3PMTA 3X26B 4A63B 2JTMA 2RK1A 3R6NA 2ED0A 3OYBA 4J9GA 3PE0A 1RAAB 1SRMA 2EVRA 3D7SB 4HVWA 2QQBA 1T3SA 1QP2A 4BUGA 3SD4A 5LJ3j 1M1KR 2V8KA 2FPDA 2VGMA 2JMAA 3A8LB 2QXFA 2EPDA 5IXBA 2QA4A 2DX1A 1QVPA 2I2LA 1YJNT 3OS0A 3RDVA 4BI3A 2A37A 1VQ5A 1NBEB 3QG1A 1WX6A 4B6MA 3FB9A 5FRMA 2YT6A 3DKMA 1N8RU 1VQ4T 1BCMA 5LJ5d 1WHHA 1K76A 4J6XA 1VQPQ 1PHTA 4E7KA 2A3LA 3OMCA 2X4WA 1B7TA 5GAOn 2EIFA 1IZ6A 1MMGA 3KFVA 2HAXA 3DB3A 4EMHA 2M16A 4QKUA 1AEYA 2EKOA 5CKBA 1D0ZA 1M9SA 2FEIA 4M78G 3CCRT 4RTXA 2G3RA 3PT9A 4RTTA 4PJOG 1SRLA 4OMLA 2KEAA 1Q7YU 4JZ3A 2J6KA 2CKKA 2DETA 2O4XB 3CC7A 2GQVA 3GIBA 3JSCA 3X20B 2LVMA 2O4XA 5FWBA 4JRIA 2F1LA 2KT1A 2XD0A 3Q1JA 1Q81R 4LDWA 3O8VA 2YLBA 1WLPB 3TCJA 3CCSQ 4LE9A 4IKFA 1PRLC 1KQ2A 1U1SA 2RA2A 4OGCA 1K9MU 2A36A 4YTLA 5GMKj 3RMQA 4JRKA 4F7UF 1VQ8A 3UA7A 4LD9K 2DMOA 1KHCA 5GAN6 1BCOA 2PVGB 1OPLA 4OMQA 4M7AF 3CCQT 1RAEB 1M1GA 3MEVA 1N6AA 2LCCA 4BD3A 5GJVB 2AZVA 4E7ZA 4K11A 3CC4A 1EFNA 3JAME 2YDLA 2DJQA 5DLQE 1KJWA 1YIJQ 1ZLMA 3URGA 5CQYA 3OYCA 1G2BA 2HDAA 3VRZA 4ZTFA 4X9CA 1XJWB 4OP0A 2LX7A 2K3YA 1KD1R 5I2MA 4IURA 2ZPIB 5C6SA 1NLOC 3G71Q 1YWOA 2MI6A 1VQLT 3OYKA 1M90R 2OTJQ 2BE7D 4XAXB 3UWNA 2M9UA 4FU6A 4HCBA 1LNXA 4PFZA 3LWHA 3OBWA 1WHGA 4M78D 3QJYA 4DEYA 1UGVA 1I0CA 4PJOD 2XDBA 1G8XA 1RABB 4E7HA 4KH0B 4C0GA 2DYBA 1DJ7B 4ANJA 2VKNA 3FJPA 4HVVA 4OMMA 3CCLT 2MOXA 4J7IA 4C8QF 2COZA 1M5Q1 4GLMA 3MKDA 1C6VX 1NLPC 4HCZA 4LN2A 1Y96B 2E41A 1TUCA 2XMFA 2CT3A 4KRTA 2KROA 2QASA 1H3HA 1Y96A 1D0XA 1LOJA 4C92F 1UGQB 3CCVA 4FW1A 4DOWA 1X01A 1VQ9A 2XK0A 1NYGA 1Y0MA 1NE8A 3OYHA 4VUBA 2QGFB 2JOYA 2PVDB 1UGSB 4FYYB 4NL2A 1UGPB 3HRSA 2EAYA 2DL4A 3CPFA 2MMPA 2DXBA 3JB9F 4R0KA 1VYUA 2F5TX 1FMWA 3H0HA 4ESRA 3EH2A 1WXUA 3OY9A 2K7AA 1KK7A 2ZPGB 3VS5A 2F69A 3J7AF 5CKDA 2DTIA 1GBRA 1XTDA 1GFCA 2L3QA 1PSFA 3CCET 1C1AA 2KQWA 1VQPA 4J9HA 2DILA 1HK9A 1OZ3A 4WCIA 1SHGA 1YITT 4ME7A 1AHJB 3F70A 1D0YA 4HA8A 3OYMA 2EKHA 3SB2A 4O6JA 3NHNA 2DZCA 3BE3A 4O5VA 1HSQA 5HCKA 1UJYA 4M75G 4IIOA 2QGGA 5GAOr 2L8DA 3HFOA 4M7DE 2OX7A 2GNCA 2EW3A 1WZOA 3M4YA 1KIKA 2P0QA 4V2SA 2HBPA 2LTOA 2D8JA 4XQ3A 2RF0A 1JXMA 4PFPA 2RO0A 5GAMf 5KYUB 3PIOA 1BU1A 5DLOA 3CCSA 4JS4A 4RUGA 6AT1B 1VQNQ 3JB9H 2QDLA 5FROA 1LJOA 2X9HA 3CMAQ 3V8LA 1Q82U 1PKTA 3UATA 4FT4A 3VS7A 1YHQQ 3QZ9B 3PMIA 4HCCA 2E10A 2JM8A 2XICA 3RERA 2CYZB 2CH4W 1I1JA 1UJ0A 5GAOq 2GBQA 4RG2A 3PNWC 1IRXA 1D3BA 3AHUA 3P8BB 1I8FA 2L0AA 1RI9A 3BDUA 1U5SA 4J9IA 2L3SA 1KC8U 2QAZA 4ZGEB 3CMEQ 1YIJA 4P5NA 4RTYA 3DB4A 4JZ4A 2RHZA 3OYFA 9ATCB 2RQWA 4NOYA 1VQ7T 4C0DB 3EGUA 3L2QA 2CT4A 2QI2A 2XKOC 3HFNA 3QPHA 4KBMB 3G71A 2M02A 3CBMA 1Q86U 1BBZA 2EGEA 4TVRA 1K73U 5GAOp 4Z02A 2OTJA 5GAMg 1YN8A 2BUDA 3QIIA 2K2VA 3OYIA 3JCMQ 3OYYA 3S3NA 1RUWA 5M9OA 4RMOA 1K8AU 4M75D 3CCJQ 2RM4A 3V7SA 4ZNXA 2BTTA 1M8MA 2XG8D 2K3BA 1X75C 3RNJA 2GTOA 2JUFA 1M2VB 1QCFA 3GOXA 2LQNA 1JBMA 4L6V5 5KYNA 4RG8A 5IHNA 3I56T 2RMOA 3CCMQ 5FU6B 4BI4A 4IUTA 4CC7A 4Q5WA 1VQ6T 5KH6A 1KHIA 3S3MA 1OYXA 1M30A 1QKWA 1PWTA 1E6HA 5LJ5f 3MEUA 3TEEA 4M77E 1Y7XA 3L1AA 4FT2A 1MMAA 4J9CA 2YRDA 5CR2A 3EFSA 1QWEA 1G5VA 1M1KU 4C5IA 4LNPA 1UTIA 1IB8A 3GLXA 4C0DC 4DQ2A 4E7SA 3M5AA 1QWFA 5GANf 2CH4A 1VQOQ 1TXQA 2HL3A 5CQXA 2Z0WA 1IO6A 1PC0A 2CUDA 2JS2A 1QVGP 1QVGA 3JCMd 1NJIR 4N0AA 2WSFE 1WDXA 2OTLT 2RH2A 2GQIA 3I5RA 1O75A 2NLUA 3LGFA 3EHRA 4EIKA 2JW4A 1JJ2P 1JJ2A 3EGXB 1OZ2A 2FZKB 5L23A 3OSSC 2DRKA 3EGXA 2I0NA 4QQ6A 3HP9A 4OMFB 4WF2A 2JN0A 2AHJB 3LW5E 3EG9B 2RJEA 4J7FA 1TWBA 4FCYA 2PU9B 4KGVB 4A4EA 1YJ9T 2K5LA 5GAMe 1ZUKA 3EG9A 1WQWA 1OX9A 2KRNA 4M78B 3ZEHA 2HMAA 1AD5A 2MF2A 3MHXA 4M78A 4PJOB 1Z9ZA 1X69A 3EG1A 2CP2A 2EQKA 3M0TA 5LJ5g 2DVJA 2CP5A 3CCUT 4PJOA 4JRPA 2OJ2A 5FU6C 4AFUC 2X4YA 5I22A 1TG0A 3VUZA 2NUPA 1X6OA 4OMOA 1VQMQ 1KQSA 1KQSP 2AKKA 5FW9A 3TU4K 3G6EQ 1Q81U 5GAN8 2CP6A 1VQNA 2CSQA 2FG0A 2RQRA 5GANg 5GMKl 4XTXA 2D8HA 1K9AA 2QQRA 1YJWQ 2DA9A 3CMAA 4JJNK 1WXTA 4MMLA 2CSIA 1RLPC 4BE0A 1GRIA 2AT1B 1YHQA 3E9FA 3WXMB 1IHVA 3QUIA 3SEMA 1NZ9A 3A8OB 2XDDA 2O9SA 1KC8C 2COWA 4N0AC 3QSUA 1UG1A 4C5EA 2RNAA 1WGSA 1QVFP 2KYMA 2DFUA 2QG9B 3CMEA 1QVFA 3QHSA 2RJCA 2AK5A 3I35A 1RADB 2CZ6B 4AMCA 3PVQA 4J83A 3SWNB 2ZPEB 2BE9B 3LYIA 2VB6A 3SWNA 4PJMA 1BI0A 1XOVA 1NYFA 1W4SA 2E70A 3CD6Q 3VS1A 5KYWB 1K73C 3C12A 3FDRA 5GAN7 5KYWA 2C0OA 1KD1U 3JRZA 3CBPA 4KUIA 2D1XA 4E47A 2KR3A 2DIQA 4M78C 2DF6A 1F1BB 1R77A 3CC2T 3R6OA 3JCMP 1M90U 1K8AC 4PJOC 1BYMA 5LJ3d 2ZPHB 2KRMA 1UDLA 4PJJA 1MNDA 4M7DB 2RQVA 3CCJA 3M58A 2YWWA 3CEYA 1I4K1 5GANd 3KBGA 4DA4A 1PCXA 3SHWA 5I2SA 2DRMA 1S72T 5EC7A 3LX7A 3M55A 3PFSA 2QQSA 1RL2A 2MYSA 1JXOA 4M7AE 2GGRA 2SRCA 5LJ5e 3OYAA 1HD3A 3FEOA 5CK9A 3OSVA 3CCMA 2JTEA 1E6GA 1YFNA 1WJSA 8AT1B 3L2VA 2RI3A 3VU3C 2B8AA 3BDLA 4IUVA 2LMJA 5GANe 3TREA 1H3ZA 4XU0A 4X9DA 2DEUA 3V8KA 3VJPA 2E1HA 3SWNC 2SEMA 5IN1A 2EYYA 5GAOl 5LL6S 2L3PA 2RQTA 2L89A 2LQWA 5L8RE 1XNIA 1YJNQ 1VQOA 2ATCB 2DM1A 2QEXT 2HKQB 2E64A 4PL6A 2IG0A 4CC4B 3QZ5B 2LDMA 3H0IA 3WVEB 5GJWB 1D1AA 2A28A 2QTXA 3UA6A 4DEXA 1VOMA 1JU5C 1VQ4Q 1VQKT 4FYVB 3E19A 1ACMB 2ED1A 2KGTA 2HQEA 4RTUA 2DO3A 2QK0A 4XU3A 4C8QE 2RHYA 1E7OA 4M7DC 2P84A 4ZGDB 2MIOA 1U1TA 1M3CA 3FLGA 4Y92A 3TSWA 1PRMC 4BI8B 1YI2T 2LRQA 3M54A 2NUTB 1GBQA 3CCRQ 3CXCS 4C92E 2NUTA 1ZA2B 2V8JA 3PVLA 3TVTA 1CSKA 2FZCB 5IAYA 5GAN2 3M57A 4HT8A 1WHMA 2QYZA 2R5MA 3M4GA 4M7DG 4AFSC 1SKUB 1Z9QA 2K4YA 4M75B 3G4ST 4M75A 3CPWS 3CBOA 1VQMA 3J81E 2BKDN 5CVIA 2E12A 3DLMA 3G6EA 2LQ8A 2DIGA 2Y4YA 1N27A 4E7LA 1SF9A 4RTVA 3I55T 2E65A 2AKLA 1YJWA 1MUZA 2GCXA 1TSFA 4DBHA 2R58A 1OI1A 2JJ9A 1D1CA 2DYIA 2BZ8A 2HCKA
chains in the Genus database with same CATH topology
2GF7A 2DEQA 2P4TA 2JVVA 2YRVA 3OBYA 3KUFA 5GAOq 4RG2A 1VIEA 2DZ9A 1VUBA 3PNWC 4A53A 4QW2A 3JCMW 2CZ7B 2CS7A 3I55A 5C0MA 1D3BA 4MZPA 3V7CA 3P8BB 1I8FA 2FHDA 2LCLA 3ME9A 3BDUA 3AHUA 2XI9A 4RCCA 4QQGA 1KC8U 2DXCA 4PLIA 4ZGEB 4FSXA 2PVOB 2K5IA 5CCAA 2HD0A 5LJ3e 1YIJA 4ELYC 4P5NA 1I5LA 3X25B 4Y91A 3G71T 3CD6T 4M77F 2FVUA 3DB4A 2RHZA 2DD4A 3OYFA 3BW1A 2PQWA 2Y90A 5A0DA 2E6ZA 5KE3A 5GMKh 4NOYA 2RI5A 4BACA 2XIDA 2OTJT 2DAQA 4BE1A 1VQ7T 2MWPA 4C0DB 2YHTA 2JZ2A 5A0GA 3L2QA 2QI2A 2XKOC 4N4HA 3HFNA 1BI2A 3QPHA 4OB3B 5J39A 3LWIA 3T9NA 3BY7A 1BI1A 4KBMB 4EMKB 3OYDA 1M1KC 3CD6A 3G71A 4J6WA 3CBMA 1Q86U 4EMKA 5IT9E 4N4GA 4C5HA 4TVRA 4R55A 1K73U 5GAOp 3MP8A 2O01E 4A4FA 1N8RC 4Z02A 2OTJA 5GAMg 2HQXA 2BUDA 3QBYA 1VQ7A 1BI3A 3QIIA 2K2VA 2PUOB 3OYIA 2HNIA 3ER0A 4M78F 3JCMQ 3QYHB 3VYGA 2XHCA 3OYYA 3S3NA 4C0FA 3QXEB 1JB0E 3L2ZA 4PJOF 3ZFJA 4BB7A 2K5FA 2JNGA 5M9OA 3RIRA 2LT1A 1UB4A 1IREB 3NTIA 4RMOA 1QP3A 4R56A 1K8AU 4KT0E 4M75D 4QVZA 4PNOA 3X28B 2JTFA 4M75C 5EG2A 2RM4A 4Y28E 4C8QD 3V7SA 4QVCA 3FC3A 3JB9J 2ZGWA 4JDSA 2FB7A 4LDVA 1NJIC 4MMKA 3QJ6A 2ZZDA 4ZGJB 3HHTB 2EJ9A 3M56A 4L59A 2XG8D 4FL6A 2DD5A 3J80E 1X75C 2F5KA 2ZCFB 3HKSA 4KULA 3OW2S 3A8GB 3NFCA 1Q7YC 4JLGA 4M7DD 3NTKA 3PGGA 3H6ZA 3MEAA 2BIVA 4MDWA 4C92D 5CKHA 4J8OA 1FWZA 2JUFA 4C92C 2DXUA 1BKBA 1NPRA 3GOXA 2EQJA 5GAMh 1W2BS 2RD1A 1M4ZA 3E1SA 4L6V5 1JBMA 5GAN5 4HT9A 4RG8A 4C5GA 3I56T 1WQ7A 3A8MB 5FU6B 2EQUA 3OW2A 1ZQ1A 4BI4A 4IUTA 3JCMX 3PMTA 4OGEA 4Q5WA 3V7RA 3MO8A 3X26B 2JTMA 2QQAA 2RK1A 2QA4T 1VQ6T 5KH6A 4XTUA 3OYBA 1KHIA 2VXEA 4PLLA 5HY6A 2WACA 3S3OA 3S3MA 1W2BA 1OYXA 3GF5A 3OA6A 1VQ5T 2QQBA 1QP2A 4MZMA 4B9WA 3SD4A 4BUGA 5LJ3j 3JCMb 5LJ5f 2V8KA 3I56A 3EFRA 5GMKe 3MEUA 2VGMA 3A8LB 3TEEA 1K9MC 2FYKA 2QXFA 3P8DA 4M77E 1O9SA 1Y7XA 3L1AA 4FT2A 4CI0C 2QA4A 3VV0A 3JB9D 1Q81C 2QDYB 1N9RA 1QVPA 2I2LA 1VIFA 2QQ9A 3A5ZB 3QYGB 1YJNT 5CR2A 3EFSA 3OS0A 4BI3A 3JCMf 4E7JA 1Y71A 1G5VA 3MCAB 4C5IA 2VXFA 1M1KU 1VQ5A 4M77G 3QG1A 3GLXA 4C0DC 1QVGS 3L2WA 3FB9A 5FRMA 3S6WA 4DQ2A 1Y07A 2WSCE 3DKMA 2CZ1B 3DLLA 1N8RU 1VQ4T 3M5AA 4EMKC 5LJ5d 5GANf 5CQXA 4A4GA 4J6XA 1YJNA 1G3SA 1JJ2S 1BIAA 4E7KA 2A3LA 1QVGA 3OMCA 2X4WA 5GMKi 5GAOn 2EIFA 3JCMd 1IZ6A 4N0AA 2WSFE 2OTLT 4M78E 2RH2A 4M77B 2HAXA 3DB3A 4EMHA 2KAFA 2M16A 3RKXA 1PSEA 4M77A 1O75A 2NLUA 2VV5A 3LGFA 1VQ4A 4PJOE 2EKOA 2RK2A 5CKBA 1JJ2A 1M9SA 1HXDA 1OZ2A 1RI0A 1NJIU 3OSSC 4M78G 4A54A 3CCRT 1YCYA 3CC7T 2G3RA 3PT9A 5D6XA 4B9XA 3MEWA 3GNFB 4QQ6A 3V8JA 3HP9A 4PJOG 4A4HA 4OMFB 1G3TA 2JN0A 3LGLA 4WF2A 2OTLA 3X24B 1Q7YU 2AHJB 3LW5E 4JLIA 4MDXA 4HKEA 2X4JA 3OS1A 2RJEA 3OYLA 3LLRA 4LD6A 4J7FA 2PU9B 4A4EA 1YJ9T 2CKKA 2K5LA 5GAMe 4ZN1A 2LX9A 2R5AA 1WQWA 3QDRB 4C0ZA 2O4XB 2VGNA 3CCRA 3CC7A 2GQVA 3GIBA 3JSCA 4OB1B 3X20B 3JCMJ 2LVMA 4M78B 3ZEHA 1KD1C 2MF2A 2O4XA 3VUBA 3UDCA 3MHXA 4GY5A 1KQSS 4M78A 4PJOB 2R57A 2EQKA 5LJ5g 4JRIA 1VQNT 3CCUT 4PJOA 1VQ8T 4JRPA 5FU6C 3GNGA 2XD0A 3Q1JA 2X4YA 4LDWA 3O8VA 3INZA 2EQMA 1YJ9A 1M90C 2D0QB 2C06A 2YLBA 5D6WA 3TCJA 3VUZA 1X6OA 3JCMg 4IKFA 1KQ2A 1U1SA 4JS5A 2RA2A 4UC4A 1KQSA 3CMAT 2P0PA 4OGCA 4BDYA 1K9MU 2CGHA 3RMSA 3TU4K 3VYHB 4YTLA 4M7AB 5GMKj 5GAN8 1YHQT 1Q81U 3RMQA 2K57A 3QKJA 4JRKA 3OS5A 4CRIA 4F7UF 1VQNA 3CCUA 4OF1A 2X35A 5CO7A 5A2QE 3CC4T 1VQ8A 5GANg 4X34A 5GMKl 3KXTA 1WJRA 4LD9K 3HSBA 4XTXA 1KHCA 1QW1A 5GAN6 2QQRA 2PVGB 2RHUA 4M7AF 3NTHA 3CCQT 1GXIE 3CMAA 1P92A 4JJNK 1M1GA 3MEVA 4JUVA 1N6AA 4MMLA 2LCCA 4BD3A 5HK3A 3CMET 4BE0A 3PTAA 2DK3A 1YHQA 3LH0A 2KMTA 3MP6A 4OB0B 3E9FA 3WXMB 1ZBXA 1QVFS 5LJ5h 3QUIA 2XDDA 1NZ9A 3A8OB 4EDUA 4ZN3A 5AYFA 2WSEE 3CC4A 1KG1A 1NPPA 5KCOA 2D9TA 3RUXA 1KC8C 3JAME 4IUPA 5CIUA 5DLQE 1EIFA 1KQ1A 4XTWA 3CCQA 1MHNA 4N0AC 3JCMh 3QSUA 3URGA 5CQYA 3OYCA 4NS5A 3OQ5A 4C5EA 2OAUA 1WGSA 4BY6B 3CMEA 1QVFA 1WNLA 4M77D 3QHSA 2H3JA 2P0KA 2XU8A 4M77C 4ZTFA 2RJCA 4X9CA 2CZ6B 3WVDB 1JRIA 4OP0A 4J83A 4QQDA 4IUQA 2K3YA 3SWNB 5GANh 4FIBA 2ZPEB 3C4SA 2DKGA 2KDSA 3LYIA 5I2MA 4FM4B 4IURA 3SWNA 1BI0A 2ZPIB 1XOVA 5C6SA 1W4SA 2E70A 2DJZA 2MI6A 5LJ3f 1B34B 4XU2A 1K73C 3C12A 3FRNA 3OYKA 1VQLT 3FDRA 3META 5GAN7 5GAMj 1B34A 1KD1U 3JRZA 5GMKm 4XAXB 3UWNA 2M9UA 3C95A 4FU6A 3CBPA 4KUIA 4XK8E 3RESA 1LNXA 4EPCA 4HCBA 3LWHA 3CCJT 4E47A 4L5GA 2DVEA 3OBWA 4M78D 2DIQA 4M78C 3QJYA 4C8QB 3OYGA 4LDUA 3CC2T 3R6OA 3G7ZA 3JCMP 1M90U 4PJOD 3VKIA 3JCMV 2XDBA 3L42A 1K8AC 3JCMc 4PJOC 1BYMA 3RKYA 1VQLA 1M8VA 5LJ3d 4E7HA 4C0GA 2ZPHB 4RCBA 1R8OB 2E6NA 1DJ7B 4MZTA 4ATOA 3FJPA 4M75F 2MAMA 3CCLT 4J7IA 3GPLA 4M7DB 2PUKB 4C8QF 3CCJA 1N9SA 3CCVT 5FU7B 1WPYA 4N4IA 1M5Q1 2KY9A 3M58A 1VQ9T 2RB6A 3CEYA 3CC2A 1I4K1 4HCZA 5GANd 1ZHIA 3KBGA 3CCMT 4JRQA 4DA4A 5I2SA 1Y96B 2E41A 2MWOA 2LT4A 5CKFA 5DM7R 2KVQG 1S72T 4M7DF 1Y96A 3LX7A 3M55A 2XDPA 5CAIA 5CKEA 1LOJA 4C92F 3PFSA 2QQSA 1UGQB 3MP1A 3RKWA 1RL2A 5I21A 4ZTJA 3CCLA 1VQ6A 3CCVA 1D3BB 4M7AE 3C94A 4BE2A 4F7UG 3H8ZA 4DOWA 5LJ5e 2VUBA 1X01A 1VQ9A 3OYAA 2XK0A 3FEOA 3BFMA 5CK9A 3OSVA 1G3YA 2EJFA 3OYEA 2LC4A 3CCMA 5J3BA 3M59A 1NE8A 3OYHA 3L2VA 1WJSA 4VUBA 4KUDK 4M7AG 2RI3A 1S72A 3VU3C 3JCMe 2B8AA 3BDLA 1I81A 2JOYA 2PVDB 4IUVA 4E7IA 1UGSB 4NL2A 2VYTA 4OB2B 1M1FA 4J6YA 1MGQA 2DTHA 1UGPB 3M9QA 3HRSA 2KK4A 2EAYA 4F7UB 3ZBDA 4BDZA 5LJ3g 1UGRB 4BY6C 5GANe 2EYQA 1H641 2RJDA 3CPFA 3TREA 4F7UA 2MMPA 2DXBA 1VQOT 3JB9F 4XU0A 1H3ZA 2DXTA 4X9DA 2D6FA 4XU1A 3V8KA 3VJPA 2E1HA 2F5TX 3SFMA 3SWNC 2CZ0B 2DPPB 1VQPT 4M7AA 3OY9A 2ZPFB 2ZPGB 2F69A 2K3XA 3J7AF 5IN1A 1Q82C 5CKDA 2DTIA 1XTDA 5HKCA 5GAOl 5LL6S 1V29B 4DOVA 3FIFA 2L89A 3GP8A 1FXXA 1PSFA 3CCET 5L8RE 1XNIA 1VQOA 4A4KA 2GFUA 2KQWA 2QEXT 2E64A 4PL6A 2IG0A 1WJQA 3QZ5B 2LNVA 4EMGA 2Y4XA 1VQPA 4RKUE 1HK9A 2EFIA 2LDMA 3WVEB 1OZ3A 2EJGA 3QO3A 3UPUA 2QTXA 4QVDA 1YITT 2RHIA 4C8QC 3A8HB 3N5BB 4IUUA 4ME7A 1AHJB 2IVWA 1VQKT 5LJ3h 4XTZA 2M1HA 3CCEA 3OS2A 1XQHA 3F70A 3E19A 2RHXA 4HA8A 4LDYA 2QEXA 3OYMA 4M75E 3SB2A 2HQEA 2YLCA 2DO3A 5J26A 4O6JA 4XU3A 5DY9A 4C8QE 2RHYA 1YBYA 4M7DC 2DZCA 5FU7C 4ZGDB 1U1TA 3FLGA 4O5VA 3E9GA 1YITA 3OYJA 5D6YA 4J5YA 4M75G 4BI8B 5KCHA 1YI2T 2L5QA 2LRQA 1VQKA 5GAOr 3M54A 2L8DA 4C8QG 5FRNA 3ASKA 3HFOA 4NL3A 4M7DE 1SSFA 3CXCS 1Q86C 3L2UA 5KE2A 4C92E 3CCST 2V8JA 1VQMT 2FL7A 5LJ5j 1FX7A 2EWNA 2GFAA 3EAEA 3M4YA 2DTOA 2P0QA 5IAYA 3M57A 5GAN2 3HRTA 4HT8A 3G6ET 2R5MA 3M4GA 3HRUA 4V2SA 4M7DG 2HBPA 5GAN4 5GAOm 2LTOA 4C92G 2K4YA 4GLKA 4OVAA 4XQ3A 3CXCA 1YI2A 1U8RA 2RJFA 2X4XA 2LQKA 1BIBA 3HPWA 4M75B 5FLXE 5HK0A 2RO0A 5GAMf 1TH7A 3PIOA 3G4ST 4M75A 1YJWT 4PKCC 2RI2A 5DLOA 3CPWS 3CCSA 2A7YA 3CBOA 4C8QA 4JS4A 1VQMA 3JB9I 4D6WA 3J81E 2BKDN 1UEBA 3SDZA 5CVIA 4ELZC 2E12A 3DLMA 3G6EA 2LQ8A 5GANj 4LDXA 3P8HA 2DIGA 2Y4YA 3JB9H 2V8IA 1N27A 3HL8A 5GAN3 3UT1A 2M0OA 2VC8A 3M53A 5FROA 4C92B 4E7LA 2ZPBB 3OYNA 3OB9A 3CPWA 3I55T 1LJOA 4M7DA 2KSSA 4II1A 3V8LA 2E65A 1G3WA 4C92A 3G4SA 1Q82U 4M7AD 5GAMd 1YJWA 4M7AC 4XTYA 3PIPA 4FT4A 4F7UE 5A0LA 2GCXA 1YIJT 3OMGA 2R58A 3QZ9B 3L2RA 1OI1A 3PMIA 4HCCA 3JB9G 2E10A 2L3RA 2XICA 3RERA 4XTVA 2CYZB 2E5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF7 A;  2JVV A;  2YRV A;  3KUF A;  4RG2 A;  3PNW C;  4QW2 A;  3I55 A;  5C0M A;  3P8B B;  2FHD A;  2LCL A;  3ME9 A;  4QQG A;  1KC8 U;  4PLI A;  1YIJ A;  3CD6 T;  3G71 T;  3DB4 A;  2RHZ A;  3OYF A;  2PQW A;  2E6Z A;  5KE3 A;  2RI5 A;  2OTJ T;  4BAC A;  2DAQ A;  4BE1 A;  1VQ7 T;  2MWP A;  2JZ2 A;  3L2Q A;  4N4H A;  5J39 A;  1M1K C;  3OYD A;  3CD6 A;  3G71 A;  1Q86 U;  5IT9 E;  4N4G A;  4C5H A;  4TVR A;  1K73 U;  3MP8 A;  4A4F A;  1N8R C;  2OTJ A;  4Z02 A;  2HQX A;  2BUD A;  3QBY A;  1VQ7 A;  3QII A;  3OYI A;  3ER0 A;  2XHC A;  3OYY A;  3S3N A;  2JNG A;  5M9O A;  3NTI A;  1K8A U;  4QVZ A;  2JTF A;  3FC3 A;  1NJI C;  3QJ6 A;  4L59 A;  4FL6 A;  3J80 E;  3HKS A;  2F5K A;  3OW2 S;  1Q7Y C;  3NTK A;  3H6Z A;  3MEA A;  2BIV A;  2JUF A;  1BKB A;  1NPR A;  3GOX A;  2EQJ A;  1W2B S;  4C5G A;  3I56 T;  3OW2 A;  2EQU A;  4IUT A;  3PMT A;  2QA4 T;  4Q5W A;  3MO8 A;  1VQ6 T;  5KH6 A;  3OYB A;  1KHI A;  4PLL A;  3S3M A;  5HY6 A;  1W2B A;  2WAC A;  3S3O A;  1OYX A;  3OA6 A;  1VQ5 T;  4B9W A;  3SD4 A;  3I56 A;  3MEU A;  1K9M C;  3P8D A;  2QA4 A;  1Q81 C;  1VQ6 A;  3A5Z B;  1YJN T;  3OS0 A;  4E7J A;  1G5V A;  1M1K U;  4C5I A;  1VQ5 A;  1QVG S;  3L2W A;  5FRM A;  3S6W A;  3DLL A;  1N8R U;  1VQ4 T;  4A4G A;  1YJN A;  1JJ2 S;  1QVG A;  4E7K A;  3OMC A;  2X4W A;  2EIF A;  1IZ6 A;  2OTL T;  3DB3 A;  2M16 A;  2NLU A;  1VQ4 A;  3LGF A;  2EKO A;  1JJ2 A;  1OZ2 A;  1NJI U;  1RI0 A;  3CCR T;  3CC7 T;  2G3R A;  5D6X A;  4B9X A;  3MEW A;  4QQ6 A;  4A4H A;  3LGL A;  2OTL A;  1Q7Y U;  3OS1 A;  2RJE A;  3OYL A;  3LLR A;  4LD6 A;  4A4E A;  1YJ9 T;  2CKK A;  4ZN1 A;  2R5A A;  2O4X B;  3CCR A;  3CC7 A;  2LVM A;  3ZEH A;  1KD1 C;  2O4X A;  1KQS S;  4GY5 A;  2R57 A;  2EQK A;  1VQN T;  3CCU T;  1VQ8 T;  3Q1J A;  2X4Y A;  3O8V A;  1M90 C;  1YJ9 A;  2EQM A;  5D6W A;  1X6O A;  4IKF A;  3CMA T;  1KQS A;  4UC4 A;  1K9M U;  4BDY A;  4YTL A;  1Q81 U;  1YHQ T;  3QKJ A;  4CRI A;  1VQN A;  3CCU A;  5A2Q E;  3CC4 T;  1VQ8 A;  2X35 A;  4X34 A;  1WJR A;  1KHC A;  2QQR A;  2RHU A;  3NTH A;  3CCQ T;  3CMA A;  1M1G A;  3MEV A;  2LCC A;  4BD3 A;  4BE0 A;  3CME T;  1YHQ A;  3LH0 A;  3MP6 A;  3E9F A;  1QVF S;  3CC4 A;  1NZ9 A;  4ZN3 A;  4EDU A;  1NPP A;  5KCO A;  2D9T A;  1KC8 C;  3JAM E;  4IUP A;  5CIU A;  5DLQ E;  1EIF A;  3CCQ A;  1MHN A;  3OYC A;  4NS5 A;  3OQ5 A;  4C5E A;  1WGS A;  1QVF A;  3CME A;  2P0K A;  4ZTF A;  2RJC A;  4QQD A;  4IUQ A;  2K3Y A;  3C4S A;  2KDS A;  3LYI A;  4IUR A;  5C6S A;  2E70 A;  2MI6 A;  1K73 C;  1VQL T;  3OYK A;  3FDR A;  3MET A;  1KD1 U;  3UWN A;  4FU6 A;  3CCJ T;  2DIQ A;  3OYG A;  3CC2 T;  1M90 U;  1K8A C;  3L42 A;  1VQL A;  4E7H A;  2E6N A;  3CCL T;  3CCJ A;  3CCV T;  4N4I A;  1VQ9 T;  3CEY A;  3CC2 A;  4HCZ A;  3KBG A;  3CCM T;  2MWO A;  5DM7 R;  2KVQ G;  1S72 T;  3LX7 A;  2XDP A;  3PFS A;  3CCL A;  2QQS A;  3MP1 A;  4ZTJ A;  1RL2 A;  3CCV A;  4BE2 A;  3H8Z A;  1VQ9 A;  3OYA A;  2XK0 A;  3FEO A;  3CCM A;  3OYE A;  5J3B A;  3OYH A;  3L2V A;  1WJS A;  1S72 A;  2RI3 A;  2B8A A;  3BDL A;  2JOY A;  4IUV A;  4E7I A;  2VYT A;  3M9Q A;  4BDZ A;  3CPF A;  2RJD A;  3TRE A;  1VQO T;  1H3Z A;  1VQP T;  3OY9 A;  2K3X A;  3J7A F;  5IN1 A;  1Q82 C;  1XTD A;  5LL6 S;  2L89 A;  3CCE T;  1XNI A;  1VQO A;  2QEX T;  2GFU A;  4PL6 A;  2IG0 A;  1WJQ A;  1VQP A;  2EFI A;  2LDM A;  1OZ3 A;  1YIT T;  2RHI A;  4IUU A;  1VQK T;  2M1H A;  3CCE A;  3OS2 A;  3F70 A;  2RHX A;  2QEX A;  3OYM A;  2HQE A;  2DO3 A;  5J26 A;  2RHY A;  1YBY A;  3FLG A;  1YIT A;  3E9G A;  3OYJ A;  5D6Y A;  5KCH A;  1YI2 T;  1VQK A;  2LRQ A;  2L8D A;  5FRN A;  3ASK A;  1SSF A;  3CXC S;  1Q86 C;  3L2U A;  5KE2 A;  3CCS T;  1VQM T;  2GFA A;  3EAE A;  5IAY A;  3G6E T;  2R5M A;  2LTO A;  1YI2 A;  3CXC A;  4OVA A;  2RJF A;  2X4X A;  5FLX E;  2RO0 A;  3PIO A;  3G4S T;  1YJW T;  3CPW S;  3CCS A;  2RI2 A;  1VQM A;  3J81 E;  2BKD N;  1UEB A;  3DLM A;  3G6E A;  2LQ8 A;  3P8H A;  2DIG A;  1N27 A;  3UT1 A;  2M0O A;  4E7L A;  5FRO A;  3OYN A;  3OB9 A;  3CPW A;  3I55 T;  4II1 A;  1Q82 U;  3G4S A;  1YJW A;  3PIP A;  1YIJ T;  3OMG A;  2R58 A;  3L2R A;  1OI1 A;  3PMI A;  2L3R A;  2E5Q A; 
#chains in the Genus database with same CATH topology
 2GF7 A;  2P4T A;  2JVV A;  2YRV A;  1VIE A;  1JO8 A;  4A53 A;  1TOV A;  2CZ7 B;  1QKX A;  2CS7 A;  3CCQ Q;  2FHD A;  2LCL A;  3ME9 A;  3REB B;  1YNZ A;  2PVO B;  5CCA A;  2HD0 A;  3X25 B;  4Y91 A;  1NM7 A;  4ORZ A;  3JV3 A;  2E6Z A;  5KE3 A;  2RI5 A;  4BAC A;  2YHT A;  3EG2 A;  3LWI A;  3AT1 B;  4KGX B;  3T9N A;  3OYD A;  1ZUY A;  4PK4 A;  3CD6 A;  4J6W A;  5IT9 E;  2JM9 A;  1AWX A;  4A4F A;  1N8R C;  4LUD A;  2RQU A;  2HQX A;  1M3B A;  4M4Z A;  1WI7 A;  2BZY A;  4M78 F;  1VQL Q;  4C0F A;  3QXE B;  4PJO F;  4BB7 A;  2O2O A;  1IRE B;  2KRS A;  1QQJ A;  4FYX B;  4M75 C;  5EG2 A;  5ECA A;  3JB9 J;  2ZGW A;  5IH2 A;  1UUE A;  2ESW A;  3HKS A;  3J80 E;  4KUL A;  3OW2 S;  1Q7Y C;  4M7D D;  3PGG A;  3CQT A;  3H6Z A;  1GL5 A;  4MDW A;  3CCL Q;  5CKH A;  4CC3 A;  1BKB A;  1NPR A;  1RLQ C;  5GAM h;  3E1S A;  1M4Z A;  2DNU A;  5GAN 5;  2OAW A;  4C5G A;  4Z89 A;  3V7R A;  2QA4 T;  3MO8 A;  5AT1 B;  2QQA A;  2GTJ A;  1PD1 A;  4PLL A;  2WAC A;  3S3O A;  1W2B A;  3GF5 A;  4AFQ C;  3OA6 A;  1VQ5 T;  1U06 A;  4MZM A;  3JCM b;  3VS3 A;  4PFO A;  3EFR A;  1TTH B;  1ABO A;  1WFW A;  1K9M C;  2FYK A;  3U23 A;  4CI0 C;  1OPK A;  5KYU A;  1MV3 A;  3A5Z B;  1I07 A;  3JCM f;  2C0I A;  4E7J A;  3QDF A;  2VXF A;  4Z88 A;  1X6B A;  4M77 G;  3L2W A;  1WXB A;  2IPO B;  1Y07 A;  2CZ1 B;  4AT1 B;  4JJC A;  4A4G A;  1YJN A;  1G3S A;  2EGC A;  5KYX B;  1KFZ A;  2PNI A;  2KAF A;  5KYX A;  3RKX A;  4OMP A;  2FPF A;  1VQ4 A;  3CCE Q;  1C0M A;  4HCK A;  1HXD A;  1NJI U;  3CC7 T;  1YCY A;  2J6F A;  2PZ1 A;  5D6X A;  4B9X A;  3H41 A;  3V8J A;  2DER A;  1G3T A;  1EZZ B;  1YIT Q;  1ARK A;  3EH1 A;  4JLI A;  4MDX A;  1ZX6 A;  1YP5 A;  3OS1 A;  4J9D A;  3OYL A;  4LD6 A;  4ZN1 A;  4C0Z A;  2FRY A;  2FZG B;  3QDR B;  2VGN A;  3CCR A;  3JCM J;  1X43 A;  3VUB A;  2R57 A;  5KYY B;  1IHW A;  1VQ8 T;  3GNG A;  1JQQ A;  1LVK A;  1T0H A;  2EQM A;  3INZ A;  2D0Q B;  2C06 A;  3JCM g;  2DL3 A;  3VRY A;  2P0P A;  4BDY A;  1M3A A;  1A0N B;  3M0Q A;  2CGH A;  2DBM A;  3VYH B;  3M0U A;  4M7A B;  2LJ0 A;  1PG5 B;  1X6G A;  4FSS A;  3RR6 A;  2K57 A;  3OS5 A;  4CRI A;  4OF1 A;  3CC4 T;  4X34 A;  4LXC A;  1WJR A;  1PM3 A;  1K4U S;  1QW1 A;  1B07 A;  3NTH A;  1GXI E;  1D1B A;  1P92 A;  2HQH A;  4JUV A;  4CC2 A;  2CP3 A;  3EHQ A;  5HK3 A;  1AZG B;  1VYT A;  2DK3 A;  3FJ5 A;  3LH0 A;  2KMT A;  3MP6 A;  1ZBX A;  5LJ5 h;  1R0B G;  4ZN3 A;  4EDU A;  1KG1 A;  2WSE E;  1NPP A;  1M2V A;  3RUX A;  1KQ1 A;  4XTW A;  3CCQ A;  1MHN A;  3RBB B;  3TSZ A;  4M77 D;  2P0K A;  2FPE A;  2G6F X;  4F14 A;  2BZX A;  5GAN h;  4FIB A;  2JS0 A;  3C4S A;  2DKG A;  1H92 A;  2KDS A;  2LZ6 B;  4E2F B;  5LJ3 f;  1B34 B;  1UHC A;  4PJL A;  3MET A;  5GAM j;  1B34 A;  3C95 A;  1D09 B;  4XK8 E;  3RES A;  1VQ7 Q;  1SPK A;  1SHF A;  4C8Q B;  2A0F B;  3VKI A;  3I9Q A;  3L42 A;  3RKY A;  1VQL A;  1M8V A;  1ZSZ B;  4RCB A;  2E3H A;  2KYB A;  4MZT A;  1UE9 A;  4ATO A;  4M75 F;  2NYS A;  3GPL A;  2PUK B;  2ZAE A;  3CCV T;  1N9S A;  1GCQ C;  2V26 A;  5FU7 B;  4N4I A;  2KY9 A;  2LNH B;  1VQ9 T;  1ZHI A;  2MWO A;  1FYN A;  2LT4 A;  5CKF A;  1IGQ A;  4KGZ B;  1HJD A;  2AIR B;  2KVQ G;  2EGA A;  2XDP A;  5CAI A;  2YUO A;  3MP1 A;  4ZTJ A;  4RTW A;  3CCL A;  3C94 A;  4BE2 A;  4F7U G;  2DL5 A;  1X2Q A;  1OU9 A;  3BFM A;  1G3Y A;  3OYE A;  2LC4 A;  3M0R A;  4M7A G;  4KUD K;  1J3T A;  3JCM e;  3QWY A;  1I81 A;  3EFO B;  4D8K A;  2VYT A;  1M1F A;  3I56 Q;  3M9Q A;  2M51 A;  2KK4 A;  3ZBD A;  5LJ3 g;  1H64 1;  1VQ6 Q;  1OEB A;  1N5Z A;  3NGP A;  2O9V A;  1M2O A;  1YCS B;  2D6F A;  2CRE A;  2IIM A;  1VQP T;  2DPP B;  2RPN A;  1AVZ C;  2K3X A;  3TQ7 P;  1Q82 C;  1W1F A;  5HKC A;  1V29 B;  3FIF A;  3I5S A;  4A4K A;  4J9F A;  1RAG B;  2LNV A;  1ZSG A;  2Y4X A;  4EMG A;  2EFI A;  4QVD A;  2LJ3 A;  2RHI A;  4C8Q C;  3A8H B;  4IUU A;  8ATC B;  3CCE A;  3OS2 A;  2ABL A;  1K0X A;  2RHX A;  1ZSZ C;  4LDY A;  2H8H A;  4JJD A;  2YLC A;  5J26 A;  2OTL Q;  4AG2 C;  1YBY A;  5FU7 C;  2OI3 A;  2K9G A;  3E9G A;  1MMD A;  1YIT A;  1RAH B;  4J5Y A;  2L5Q A;  1KSW A;  2KXD A;  4C8Q G;  2X3W D;  5FRN A;  1UEC A;  4NL3 A;  4DBF A;  1Q86 C;  3L2U A;  3HTR A;  5KE2 A;  3CCS T;  3A98 A;  1GCP A;  2MK5 A;  5LJ5 j;  2EWN A;  2GFA A;  2A08 A;  2DTO A;  1R0C B;  4C92 G;  4GLK A;  1YJ9 Q;  1U8R A;  2X4X A;  2LQK A;  2DBK A;  3HPW A;  5FLX E;  2YSQ A;  1G83 A;  2A7Y A;  4D6W A;  5I11 A;  1UEB A;  2VWF A;  4ELZ C;  3ZL7 C;  5GAN j;  3CCU Q;  1B3Q A;  4LDX A;  3P8H A;  5GAN 3;  3UT1 A;  2VC8 A;  3OYN A;  2F2X A;  4M7D A;  4M7A D;  1G3W A;  4PJN A;  4JJB A;  4F7U E;  5A0L A;  1YIJ T;  1Q95 G;  3OMG A;  3L2R A;  3JB9 G;  1UFF A;  2HSE B;  2D0N A;  4XTV A;  2E5Q A;  3OBY A;  2LP5 A;  2DZ9 A;  2ECZ A;  4QW2 A;  2AZS A;  1NG2 A;  5C0M A;  2ROT A;  4MZP A;  3V7C A;  1PD0 A;  3MPU B;  2XI9 A;  4RCC A;  4QQG A;  2DXC A;  4PLI A;  1AWW A;  4FSX A;  2K5I A;  4F16 A;  4FYW B;  5LJ3 e;  4ELY C;  3G71 T;  1W70 A;  2ROL A;  3BW1 A;  2V1Q A;  5A0D A;  1X2K A;  2OTJ T;  2XID A;  2HZY A;  5A0G A;  2JZ2 A;  5J39 A;  3BY7 A;  1M1K C;  4EMK B;  1RAI B;  4EMK A;  2QTV A;  4R55 A;  3MP8 A;  1NEG A;  1FMV A;  1VQ7 A;  1BI3 A;  3A1P A;  3ER0 A;  3VYG A;  1JB0 E;  3ZFJ A;  1K1Z A;  2K5F A;  3NTI A;  1QP3 A;  4KT0 E;  4QVZ A;  3X28 B;  1GFD A;  3VS0 A;  4C8Q D;  2YUN A;  4QVC A;  3EG3 A;  4MMK A;  3QJ6 A;  3CC2 Q;  4AG1 C;  2EJ9 A;  2DD5 A;  2F5K A;  1FMK A;  3A8G B;  3NFC A;  2CDT A;  3NTK A;  2BIV A;  2P4R A;  4C92 D;  1FWZ A;  2DXU A;  4F04 B;  2RD1 A;  4HT9 A;  1BK2 A;  1WQ7 A;  2E3I A;  2KE9 A;  4OGE A;  3VS4 A;  1S72 Q;  2FRW A;  2V1R A;  2J7I A;  4XTU A;  2K79 A;  2VXE A;  5HY6 A;  1Y57 A;  4J9B A;  1SEM A;  1SG5 A;  4B9W A;  1MV0 B;  1LCK A;  3I56 A;  2O31 A;  5GMK e;  2MPX C;  3P8D A;  1O9S A;  5IHK A;  3VV0 A;  3JB9 D;  1Q81 C;  2QDY B;  1N9R A;  1VQ6 A;  2QQ9 A;  1VIF A;  3QYG B;  1N8R R;  2X3X D;  3M0P A;  1Y71 A;  2NWM A;  3MCA B;  1QVG S;  3S6W A;  2WSC E;  3DLL A;  4EMK C;  2JMC A;  5IXF A;  1JJ2 S;  4IIM A;  1BIA A;  2JT4 A;  5GMK i;  3H9N A;  4KH1 B;  4M78 E;  4M77 B;  2W10 A;  4J9E A;  1PSE A;  4M77 A;  4PJO E;  2VV5 A;  3IQL A;  2RK2 A;  3M0S A;  4RTZ A;  1Q7Y R;  1WHL A;  2QEX Q;  1RI0 A;  4A54 A;  3MEW A;  3GNF B;  1OX8 A;  1U3O A;  4A4H A;  3LGL A;  2OTL A;  3X24 B;  4HKE A;  1VQK Q;  2X4J A;  3LLR A;  2KI7 A;  1RAF B;  4DBQ A;  2LX9 A;  2R5A A;  4OB1 B;  1KD1 C;  3UDC A;  2HSP A;  3H0F A;  2CP7 A;  4GY5 A;  1KQS S;  1QCN A;  1K9M R;  1VQN T;  2JXB A;  1YI2 Q;  1M90 C;  1YJ9 A;  3THK A;  2DL7 A;  5D6W A;  1IGU A;  4JS5 A;  4LUE A;  3CMA T;  4UC4 A;  3VS6 A;  1OV3 A;  3RMS A;  1YHQ T;  3QKJ A;  4E6R A;  1JEG A;  3CCU A;  5A2Q E;  2X35 A;  5CO7 A;  3KXT A;  1TUG B;  3HSB A;  1CKA A;  4FW2 A;  3G4S Q;  2K6D A;  2RHU A;  2HKN A;  1MNE A;  3CME T;  3PTA A;  1ZBJ A;  4OB0 B;  1QVF S;  5AYF A;  5KCO A;  3I55 Q;  3O5Z A;  1UHF A;  1TS9 A;  2D9T A;  4IUP A;  5CIU A;  1V1C A;  1EIF A;  3JCM h;  2YUP A;  2ENM A;  4NS5 A;  3OQ5 A;  2OAU A;  4BY6 B;  1WNL A;  1ABQ A;  2H3J A;  2XU8 A;  4M77 C;  1W2B P;  4HVU A;  2HL5 C;  1LPL A;  2HEQ A;  3WVD B;  1JRI A;  4QQD A;  4IUQ A;  4FM4 B;  1W6X A;  2DJZ A;  4XU2 A;  3FRN A;  2LJ1 A;  5GMK m;  2COY A;  4EPC A;  2J6O A;  3CCJ T;  4L5G A;  2DVE A;  3G1J A;  1ZA1 B;  7AT1 B;  3OYG A;  4LDU A;  3G7Z A;  3JCM V;  3JCM c;  2M0Y A;  1R8O B;  2E6N A;  2MAM A;  2FO0 A;  2YRC A;  1WPY A;  2RB6 A;  3CC2 A;  1SSH A;  3CCM T;  4JRQ A;  2MCN A;  5DM7 R;  3NMZ C;  4M7D F;  2RN8 A;  5CKE A;  3EG0 A;  3RKW A;  5I21 A;  1EX4 A;  2EYW A;  1D3B B;  3H8Z A;  2VUB A;  1V76 A;  2HBW A;  2EJF A;  5J3B A;  3M59 A;  1WA7 A;  2K2M A;  1QCO A;  1S72 A;  1HYO A;  3ULR B;  4E7I A;  4D8D A;  4OB2 B;  4J6Y A;  1MGQ A;  2DTH A;  5KYY A;  4F7U B;  4BDZ A;  2NUZ A;  2QA4 Q;  1UGR B;  4BY6 C;  2EYQ A;  2RJD A;  4F7U A;  2KNB B;  1GCQ A;  1VQO T;  2DXT A;  3GBQ A;  4XU1 A;  1VQ5 Q;  3SFM A;  2CZ0 B;  4M7A A;  2LCS A;  2ZPF B;  2W0Z A;  1AOJ A;  4DOV A;  3GP8 A;  1FXX A;  5D7U A;  1QMC A;  1OUL A;  2GFU A;  1WJQ A;  4HXJ A;  4RKU E;  2EJG A;  3QO3 A;  3UPU A;  1AZE A;  1H8K A;  2PTK A;  3LH5 A;  3N5B B;  1CKB A;  2IVW A;  5LJ3 h;  1YWP A;  2M1H A;  4XTZ A;  2B86 A;  1XQH A;  4AFZ C;  2QEX A;  2DL8 A;  4M75 E;  1K0S A;  2X51 A;  5DY9 A;  4DBR A;  3OYJ A;  5D6Y A;  3VS2 A;  5KCH A;  3MJX A;  1VQK A;  2KT8 A;  4QT7 A;  3C0C A;  3ASK A;  3CC7 Q;  1SSF A;  1X27 A;  2YUQ A;  4WTO B;  2YXY A;  1VQM T;  2CUB A;  2FL7 A;  1FX7 A;  3EAE A;  3HRT A;  2EYZ A;  3G6E T;  2L2P A;  3HRU A;  2DE0 X;  1WYX A;  3EGD B;  5GAN 4;  5GAO m;  2KBT A;  1MMN A;  1BB9 A;  4OVA A;  3CXC A;  3CXC P;  1YI2 A;  3EGD A;  2EYX A;  2RJF A;  1BIB A;  5HK0 A;  1QLY A;  1TH7 A;  2VVK A;  1OU8 A;  5FWC A;  1WHJ A;  4PKC C;  2RI2 A;  1YJW T;  3NPF A;  4C8Q A;  3JB9 I;  1Q82 R;  1VA7 A;  3SDZ A;  1PNJ A;  2O88 A;  1ZUU A;  1ZSZ A;  1VQ8 Q;  2E5K A;  2V8I A;  3HL8 A;  1PKS A;  2M0O A;  3QWX X;  3M53 A;  4F17 A;  4C92 B;  2ZPB B;  2EBP A;  3OB9 A;  3CPW P;  3CPW A;  2DLP A;  2KSS A;  4II1 A;  3G4S A;  4C92 A;  4Z8A A;  5GAM d;  4M7A C;  4XTY A;  3PIP A;  1I5O B;  1KC8 R;  2L3R A;  3CC4 Q;  2DEQ A;  3KUF A;  3JCM W;  2J06 A;  1VUB A;  1TU0 B;  3I55 A;  2F2W A;  2E4H A;  3UF4 A;  1I5L A;  3CD6 T;  1T3L A;  2EQI A;  4M77 F;  2CP0 A;  1NEB A;  2FVU A;  2DD4 A;  2PQW A;  2Y90 A;  1OQK A;  1T0J A;  5GMK h;  3EFO A;  1Q86 R;  2DAQ A;  4BE1 A;  2C0T A;  2MWP A;  1K73 R;  1IXD A;  1AT1 B;  4N4H A;  1BI2 A;  4OB3 B;  1BI1 A;  1RAC B;  2J05 A;  1S1N A;  4N4G A;  4C5H A;  4OMN A;  2O01 E;  5IHI A;  3QBY A;  2H3E B;  1K8A R;  2NUP B;  2F2V A;  1AWJ A;  2PUO B;  2HNI A;  3QYH B;  2XHC A;  3L2Z A;  3REA B;  2VAS A;  2JNG A;  3RIR A;  2LT1 A;  1UB4 A;  4R56 A;  4JPB W;  4PNO A;  2JTF A;  4Y28 E;  3FC3 A;  1OOT A;  2FB7 A;  4JDS A;  4LDV A;  1NJI C;  2ZZD A;  4ZGJ B;  3HHT B;  1TUD A;  3M56 A;  4L59 A;  2KXC A;  4FL6 A;  1M27 C;  1WIE A;  1WHK A;  2ZCF B;  4JLG A;  3MEA A;  4X1V A;  4J8O A;  4C92 C;  3CCV Q;  3E2U A;  2EQJ A;  1VYV A;  1W2B S;  1VQ9 Q;  3A8M B;  1AWO A;  3OW2 A;  2EQU A;  3OW2 P;  1ZQ1 A;  4GBQ A;  3JCM X;  3PMT A;  3X26 B;  4A63 B;  2JTM A;  2RK1 A;  3R6N A;  2ED0 A;  3OYB A;  4J9G A;  3PE0 A;  1RAA B;  1SRM A;  2EVR A;  3D7S B;  4HVW A;  2QQB A;  1T3S A;  1QP2 A;  4BUG A;  3SD4 A;  5LJ3 j;  1M1K R;  2V8K A;  2FPD A;  2VGM A;  2JMA A;  3A8L B;  2QXF A;  2EPD A;  5IXB A;  2QA4 A;  2DX1 A;  1QVP A;  2I2L A;  1YJN T;  3OS0 A;  3RDV A;  4BI3 A;  2A37 A;  1VQ5 A;  1NBE B;  3QG1 A;  1WX6 A;  4B6M A;  3FB9 A;  5FRM A;  2YT6 A;  3DKM A;  1N8R U;  1VQ4 T;  1BCM A;  5LJ5 d;  1WHH A;  1K76 A;  4J6X A;  1VQP Q;  1PHT A;  4E7K A;  2A3L A;  3OMC A;  2X4W A;  1B7T A;  5GAO n;  2EIF A;  1IZ6 A;  1MMG A;  3KFV A;  2HAX A;  3DB3 A;  4EMH A;  2M16 A;  4QKU A;  1AEY A;  2EKO A;  5CKB A;  1D0Z A;  1M9S A;  2FEI A;  4M78 G;  3CCR T;  4RTX A;  2G3R A;  3PT9 A;  4RTT A;  4PJO G;  1SRL A;  4OML A;  2KEA A;  1Q7Y U;  4JZ3 A;  2J6K A;  2CKK A;  2DET A;  2O4X B;  3CC7 A;  2GQV A;  3GIB A;  3JSC A;  3X20 B;  2LVM A;  2O4X A;  5FWB A;  4JRI A;  2F1L A;  2KT1 A;  2XD0 A;  3Q1J A;  1Q81 R;  4LDW A;  3O8V A;  2YLB A;  1WLP B;  3TCJ A;  3CCS Q;  4LE9 A;  4IKF A;  1PRL C;  1KQ2 A;  1U1S A;  2RA2 A;  4OGC A;  1K9M U;  2A36 A;  4YTL A;  5GMK j;  3RMQ A;  4JRK A;  4F7U F;  1VQ8 A;  3UA7 A;  4LD9 K;  2DMO A;  1KHC A;  5GAN 6;  1BCO A;  2PVG B;  1OPL A;  4OMQ A;  4M7A F;  3CCQ T;  1RAE B;  1M1G A;  3MEV A;  1N6A A;  2LCC A;  4BD3 A;  5GJV B;  2AZV A;  4E7Z A;  4K11 A;  3CC4 A;  1EFN A;  3JAM E;  2YDL A;  2DJQ A;  5DLQ E;  1KJW A;  1YIJ Q;  1ZLM A;  3URG A;  5CQY A;  3OYC A;  1G2B A;  2HDA A;  3VRZ A;  4ZTF A;  4X9C A;  1XJW B;  4OP0 A;  2LX7 A;  2K3Y A;  1KD1 R;  5I2M A;  4IUR A;  2ZPI B;  5C6S A;  1NLO C;  3G71 Q;  1YWO A;  2MI6 A;  1VQL T;  3OYK A;  1M90 R;  2OTJ Q;  2BE7 D;  4XAX B;  3UWN A;  2M9U A;  4FU6 A;  4HCB A;  1LNX A;  4PFZ A;  3LWH A;  3OBW A;  1WHG A;  4M78 D;  3QJY A;  4DEY A;  1UGV A;  1I0C A;  4PJO D;  2XDB A;  1G8X A;  1RAB B;  4E7H A;  4KH0 B;  4C0G A;  2DYB A;  1DJ7 B;  4ANJ A;  2VKN A;  3FJP A;  4HVV A;  4OMM A;  3CCL T;  2MOX A;  4J7I A;  4C8Q F;  2COZ A;  1M5Q 1;  4GLM A;  3MKD A;  1C6V X;  1NLP C;  4HCZ A;  4LN2 A;  1Y96 B;  2E41 A;  1TUC A;  2XMF A;  2CT3 A;  4KRT A;  2KRO A;  2QAS A;  1H3H A;  1Y96 A;  1D0X A;  1LOJ A;  4C92 F;  1UGQ B;  3CCV A;  4FW1 A;  4DOW A;  1X01 A;  1VQ9 A;  2XK0 A;  1NYG A;  1Y0M A;  1NE8 A;  3OYH A;  4VUB A;  2QGF B;  2JOY A;  2PVD B;  1UGS B;  4FYY B;  4NL2 A;  1UGP B;  3HRS A;  2EAY A;  2DL4 A;  3CPF A;  2MMP A;  2DXB A;  3JB9 F;  4R0K A;  1VYU A;  2F5T X;  1FMW A;  3H0H A;  4ESR A;  3EH2 A;  1WXU A;  3OY9 A;  2K7A A;  1KK7 A;  2ZPG B;  3VS5 A;  2F69 A;  3J7A F;  5CKD A;  2DTI A;  1GBR A;  1XTD A;  1GFC A;  2L3Q A;  1PSF A;  3CCE T;  1C1A A;  2KQW A;  1VQP A;  4J9H A;  2DIL A;  1HK9 A;  1OZ3 A;  4WCI A;  1SHG A;  1YIT T;  4ME7 A;  1AHJ B;  3F70 A;  1D0Y A;  4HA8 A;  3OYM A;  2EKH A;  3SB2 A;  4O6J A;  3NHN A;  2DZC A;  3BE3 A;  4O5V A;  1HSQ A;  5HCK A;  1UJY A;  4M75 G;  4IIO A;  2QGG A;  5GAO r;  2L8D A;  3HFO A;  4M7D E;  2OX7 A;  2GNC A;  2EW3 A;  1WZO A;  3M4Y A;  1KIK A;  2P0Q A;  4V2S A;  2HBP A;  2LTO A;  2D8J A;  4XQ3 A;  2RF0 A;  1JXM A;  4PFP A;  2RO0 A;  5GAM f;  5KYU B;  3PIO A;  1BU1 A;  5DLO A;  3CCS A;  4JS4 A;  4RUG A;  6AT1 B;  1VQN Q;  3JB9 H;  2QDL A;  5FRO A;  1LJO A;  2X9H A;  3CMA Q;  3V8L A;  1Q82 U;  1PKT A;  3UAT A;  4FT4 A;  3VS7 A;  1YHQ Q;  3QZ9 B;  3PMI A;  4HCC A;  2E10 A;  2JM8 A;  2XIC A;  3RER A;  2CYZ B;  2CH4 W;  1I1J A;  1UJ0 A;  5GAO q;  2GBQ A;  4RG2 A;  3PNW C;  1IRX A;  1D3B A;  3AHU A;  3P8B B;  1I8F A;  2L0A A;  1RI9 A;  3BDU A;  1U5S A;  4J9I A;  2L3S A;  1KC8 U;  2QAZ A;  4ZGE B;  3CME Q;  1YIJ A;  4P5N A;  4RTY A;  3DB4 A;  4JZ4 A;  2RHZ A;  3OYF A;  9ATC B;  2RQW A;  4NOY A;  1VQ7 T;  4C0D B;  3EGU A;  3L2Q A;  2CT4 A;  2QI2 A;  2XKO C;  3HFN A;  3QPH A;  4KBM B;  3G71 A;  2M02 A;  3CBM A;  1Q86 U;  1BBZ A;  2EGE A;  4TVR A;  1K73 U;  5GAO p;  4Z02 A;  2OTJ A;  5GAM g;  1YN8 A;  2BUD A;  3QII A;  2K2V A;  3OYI A;  3JCM Q;  3OYY A;  3S3N A;  1RUW A;  5M9O A;  4RMO A;  1K8A U;  4M75 D;  3CCJ Q;  2RM4 A;  3V7S A;  4ZNX A;  2BTT A;  1M8M A;  2XG8 D;  2K3B A;  1X75 C;  3RNJ A;  2GTO A;  2JUF A;  1M2V B;  1QCF A;  3GOX A;  2LQN A;  1JBM A;  4L6V 5;  5KYN A;  4RG8 A;  5IHN A;  3I56 T;  2RMO A;  3CCM Q;  5FU6 B;  4BI4 A;  4IUT A;  4CC7 A;  4Q5W A;  1VQ6 T;  5KH6 A;  1KHI A;  3S3M A;  1OYX A;  1M30 A;  1QKW A;  1PWT A;  1E6H A;  5LJ5 f;  3MEU A;  3TEE A;  4M77 E;  1Y7X A;  3L1A A;  4FT2 A;  1MMA A;  4J9C A;  2YRD A;  5CR2 A;  3EFS A;  1QWE A;  1G5V A;  1M1K U;  4C5I A;  4LNP A;  1UTI A;  1IB8 A;  3GLX A;  4C0D C;  4DQ2 A;  4E7S A;  3M5A A;  1QWF A;  5GAN f;  2CH4 A;  1VQO Q;  1TXQ A;  2HL3 A;  5CQX A;  2Z0W A;  1IO6 A;  1PC0 A;  2CUD A;  2JS2 A;  1QVG P;  1QVG A;  3JCM d;  1NJI R;  4N0A A;  2WSF E;  1WDX A;  2OTL T;  2RH2 A;  2GQI A;  3I5R A;  1O75 A;  2NLU A;  3LGF A;  3EHR A;  4EIK A;  2JW4 A;  1JJ2 P;  1JJ2 A;  3EGX B;  1OZ2 A;  2FZK B;  5L23 A;  3OSS C;  2DRK A;  3EGX A;  2I0N A;  4QQ6 A;  3HP9 A;  4OMF B;  4WF2 A;  2JN0 A;  2AHJ B;  3LW5 E;  3EG9 B;  2RJE A;  4J7F A;  1TWB A;  4FCY A;  2PU9 B;  4KGV B;  4A4E A;  1YJ9 T;  2K5L A;  5GAM e;  1ZUK A;  3EG9 A;  1WQW A;  1OX9 A;  2KRN A;  4M78 B;  3ZEH A;  2HMA A;  1AD5 A;  2MF2 A;  3MHX A;  4M78 A;  4PJO B;  1Z9Z A;  1X69 A;  3EG1 A;  2CP2 A;  2EQK A;  3M0T A;  5LJ5 g;  2DVJ A;  2CP5 A;  3CCU T;  4PJO A;  4JRP A;  2OJ2 A;  5FU6 C;  4AFU C;  2X4Y A;  5I22 A;  1TG0 A;  3VUZ A;  2NUP A;  1X6O A;  4OMO A;  1VQM Q;  1KQS A;  1KQS P;  2AKK A;  5FW9 A;  3TU4 K;  3G6E Q;  1Q81 U;  5GAN 8;  2CP6 A;  1VQN A;  2CSQ A;  2FG0 A;  2RQR A;  5GAN g;  5GMK l;  4XTX A;  2D8H A;  1K9A A;  2QQR A;  1YJW Q;  2DA9 A;  3CMA A;  4JJN K;  1WXT A;  4MML A;  2CSI A;  1RLP C;  4BE0 A;  1GRI A;  2AT1 B;  1YHQ A;  3E9F A;  3WXM B;  1IHV A;  3QUI A;  3SEM A;  1NZ9 A;  3A8O B;  2XDD A;  2O9S A;  1KC8 C;  2COW A;  4N0A C;  3QSU A;  1UG1 A;  4C5E A;  2RNA A;  1WGS A;  1QVF P;  2KYM A;  2DFU A;  2QG9 B;  3CME A;  1QVF A;  3QHS A;  2RJC A;  2AK5 A;  3I35 A;  1RAD B;  2CZ6 B;  4AMC A;  3PVQ A;  4J83 A;  3SWN B;  2ZPE B;  2BE9 B;  3LYI A;  2VB6 A;  3SWN A;  4PJM A;  1BI0 A;  1XOV A;  1NYF A;  1W4S A;  2E70 A;  3CD6 Q;  3VS1 A;  5KYW B;  1K73 C;  3C12 A;  3FDR A;  5GAN 7;  5KYW A;  2C0O A;  1KD1 U;  3JRZ A;  3CBP A;  4KUI A;  2D1X A;  4E47 A;  2KR3 A;  2DIQ A;  4M78 C;  2DF6 A;  1F1B B;  1R77 A;  3CC2 T;  3R6O A;  3JCM P;  1M90 U;  1K8A C;  4PJO C;  1BYM A;  5LJ3 d;  2ZPH B;  2KRM A;  1UDL A;  4PJJ A;  1MND A;  4M7D B;  2RQV A;  3CCJ A;  3M58 A;  2YWW A;  3CEY A;  1I4K 1;  5GAN d;  3KBG A;  4DA4 A;  1PCX A;  3SHW A;  5I2S A;  2DRM A;  1S72 T;  5EC7 A;  3LX7 A;  3M55 A;  3PFS A;  2QQS A;  1RL2 A;  2MYS A;  1JXO A;  4M7A E;  2GGR A;  2SRC A;  5LJ5 e;  3OYA A;  1HD3 A;  3FEO A;  5CK9 A;  3OSV A;  3CCM A;  2JTE A;  1E6G A;  1YFN A;  1WJS A;  8AT1 B;  3L2V A;  2RI3 A;  3VU3 C;  2B8A A;  3BDL A;  4IUV A;  2LMJ A;  5GAN e;  3TRE A;  1H3Z A;  4XU0 A;  4X9D A;  2DEU A;  3V8K A;  3VJP A;  2E1H A;  3SWN C;  2SEM A;  5IN1 A;  2EYY A;  5GAO l;  5LL6 S;  2L3P A;  2RQT A;  2L89 A;  2LQW A;  5L8R E;  1XNI A;  1YJN Q;  1VQO A;  2ATC B;  2DM1 A;  2QEX T;  2HKQ B;  2E64 A;  4PL6 A;  2IG0 A;  4CC4 B;  3QZ5 B;  2LDM A;  3H0I A;  3WVE B;  5GJW B;  1D1A A;  2A28 A;  2QTX A;  3UA6 A;  4DEX A;  1VOM A;  1JU5 C;  1VQ4 Q;  1VQK T;  4FYV B;  3E19 A;  1ACM B;  2ED1 A;  2KGT A;  2HQE A;  4RTU A;  2DO3 A;  2QK0 A;  4XU3 A;  4C8Q E;  2RHY A;  1E7O A;  4M7D C;  2P84 A;  4ZGD B;  2MIO A;  1U1T A;  1M3C A;  3FLG A;  4Y92 A;  3TSW A;  1PRM C;  4BI8 B;  1YI2 T;  2LRQ A;  3M54 A;  2NUT B;  1GBQ A;  3CCR Q;  3CXC S;  4C92 E;  2NUT A;  1ZA2 B;  2V8J A;  3PVL A;  3TVT A;  1CSK A;  2FZC B;  5IAY A;  5GAN 2;  3M57 A;  4HT8 A;  1WHM A;  2QYZ A;  2R5M A;  3M4G A;  4M7D G;  4AFS C;  1SKU B;  1Z9Q A;  2K4Y A;  4M75 B;  3G4S T;  4M75 A;  3CPW S;  3CBO A;  1VQM A;  3J81 E;  2BKD N;  5CVI A;  2E12 A;  3DLM A;  3G6E A;  2LQ8 A;  2DIG A;  2Y4Y A;  1N27 A;  4E7L A;  1SF9 A;  4RTV A;  3I55 T;  2E65 A;  2AKL A;  1YJW A;  1MUZ A;  2GCX A;  1TSF A;  4DBH A;  2R58 A;  1OI1 A;  2JJ9 A;  1D1C A;  2DYI A;  2BZ8 A;  2HCK A; 
#chains in the Genus database with same CATH homology
 2GF7 A;  2DEQ A;  2P4T A;  2JVV A;  2YRV A;  3OBY A;  3KUF A;  5GAO q;  4RG2 A;  1VIE A;  2DZ9 A;  1VUB A;  3PNW C;  4A53 A;  4QW2 A;  3JCM W;  2CZ7 B;  2CS7 A;  3I55 A;  5C0M A;  1D3B A;  4MZP A;  3V7C A;  3P8B B;  1I8F A;  2FHD A;  2LCL A;  3ME9 A;  3BDU A;  3AHU A;  2XI9 A;  4RCC A;  4QQG A;  1KC8 U;  2DXC A;  4PLI A;  4ZGE B;  4FSX A;  2PVO B;  2K5I A;  5CCA A;  2HD0 A;  5LJ3 e;  1YIJ A;  4ELY C;  4P5N A;  1I5L A;  3X25 B;  4Y91 A;  3G71 T;  3CD6 T;  4M77 F;  2FVU A;  3DB4 A;  2RHZ A;  2DD4 A;  3OYF A;  3BW1 A;  2PQW A;  2Y90 A;  5A0D A;  2E6Z A;  5KE3 A;  5GMK h;  4NOY A;  2RI5 A;  4BAC A;  2XID A;  2OTJ T;  2DAQ A;  4BE1 A;  1VQ7 T;  2MWP A;  4C0D B;  2YHT A;  2JZ2 A;  5A0G A;  3L2Q A;  2QI2 A;  2XKO C;  4N4H A;  3HFN A;  1BI2 A;  3QPH A;  4OB3 B;  5J39 A;  3LWI A;  3T9N A;  3BY7 A;  1BI1 A;  4KBM B;  4EMK B;  3OYD A;  1M1K C;  3CD6 A;  3G71 A;  4J6W A;  3CBM A;  1Q86 U;  4EMK A;  5IT9 E;  4N4G A;  4C5H A;  4TVR A;  4R55 A;  1K73 U;  5GAO p;  3MP8 A;  2O01 E;  4A4F A;  1N8R C;  4Z02 A;  2OTJ A;  5GAM g;  2HQX A;  2BUD A;  3QBY A;  1VQ7 A;  1BI3 A;  3QII A;  2K2V A;  2PUO B;  3OYI A;  2HNI A;  3ER0 A;  4M78 F;  3JCM Q;  3QYH B;  3VYG A;  2XHC A;  3OYY A;  3S3N A;  4C0F A;  3QXE B;  1JB0 E;  3L2Z A;  4PJO F;  3ZFJ A;  4BB7 A;  2K5F A;  2JNG A;  5M9O A;  3RIR A;  2LT1 A;  1UB4 A;  1IRE B;  3NTI A;  4RMO A;  1QP3 A;  4R56 A;  1K8A U;  4KT0 E;  4M75 D;  4QVZ A;  4PNO A;  3X28 B;  2JTF A;  4M75 C;  5EG2 A;  2RM4 A;  4Y28 E;  4C8Q D;  3V7S A;  4QVC A;  3FC3 A;  3JB9 J;  2ZGW A;  4JDS A;  2FB7 A;  4LDV A;  1NJI C;  4MMK A;  3QJ6 A;  2ZZD A;  4ZGJ B;  3HHT B;  2EJ9 A;  3M56 A;  4L59 A;  2XG8 D;  4FL6 A;  2DD5 A;  3J80 E;  1X75 C;  2F5K A;  2ZCF B;  3HKS A;  4KUL A;  3OW2 S;  3A8G B;  3NFC A;  1Q7Y C;  4JLG A;  4M7D D;  3NTK A;  3PGG A;  3H6Z A;  3MEA A;  2BIV A;  4MDW A;  4C92 D;  5CKH A;  4J8O A;  1FWZ A;  2JUF A;  4C92 C;  2DXU A;  1BKB A;  1NPR A;  3GOX A;  2EQJ A;  5GAM h;  1W2B S;  2RD1 A;  1M4Z A;  3E1S A;  4L6V 5;  1JBM A;  5GAN 5;  4HT9 A;  4RG8 A;  4C5G A;  3I56 T;  1WQ7 A;  3A8M B;  5FU6 B;  2EQU A;  3OW2 A;  1ZQ1 A;  4BI4 A;  4IUT A;  3JCM X;  3PMT A;  4OGE A;  4Q5W A;  3V7R A;  3MO8 A;  3X26 B;  2JTM A;  2QQA A;  2RK1 A;  2QA4 T;  1VQ6 T;  5KH6 A;  4XTU A;  3OYB A;  1KHI A;  2VXE A;  4PLL A;  5HY6 A;  2WAC A;  3S3O A;  3S3M A;  1W2B A;  1OYX A;  3GF5 A;  3OA6 A;  1VQ5 T;  2QQB A;  1QP2 A;  4MZM A;  4B9W A;  3SD4 A;  4BUG A;  5LJ3 j;  3JCM b;  5LJ5 f;  2V8K A;  3I56 A;  3EFR A;  5GMK e;  3MEU A;  2VGM A;  3A8L B;  3TEE A;  1K9M C;  2FYK A;  2QXF A;  3P8D A;  4M77 E;  1O9S A;  1Y7X A;  3L1A A;  4FT2 A;  4CI0 C;  2QA4 A;  3VV0 A;  3JB9 D;  1Q81 C;  2QDY B;  1N9R A;  1QVP A;  2I2L A;  1VIF A;  2QQ9 A;  3A5Z B;  3QYG B;  1YJN T;  5CR2 A;  3EFS A;  3OS0 A;  4BI3 A;  3JCM f;  4E7J A;  1Y71 A;  1G5V A;  3MCA B;  4C5I A;  2VXF A;  1M1K U;  1VQ5 A;  4M77 G;  3QG1 A;  3GLX A;  4C0D C;  1QVG S;  3L2W A;  3FB9 A;  5FRM A;  3S6W A;  4DQ2 A;  1Y07 A;  2WSC E;  3DKM A;  2CZ1 B;  3DLL A;  1N8R U;  1VQ4 T;  3M5A A;  4EMK C;  5LJ5 d;  5GAN f;  5CQX A;  4A4G A;  4J6X A;  1YJN A;  1G3S A;  1JJ2 S;  1BIA A;  4E7K A;  2A3L A;  1QVG A;  3OMC A;  2X4W A;  5GMK i;  5GAO n;  2EIF A;  3JCM d;  1IZ6 A;  4N0A A;  2WSF E;  2OTL T;  4M78 E;  2RH2 A;  4M77 B;  2HAX A;  3DB3 A;  4EMH A;  2KAF A;  2M16 A;  3RKX A;  1PSE A;  4M77 A;  1O75 A;  2NLU A;  2VV5 A;  3LGF A;  1VQ4 A;  4PJO E;  2EKO A;  2RK2 A;  5CKB A;  1JJ2 A;  1M9S A;  1HXD A;  1OZ2 A;  1RI0 A;  1NJI U;  3OSS C;  4M78 G;  4A54 A;  3CCR T;  1YCY A;  3CC7 T;  2G3R A;  3PT9 A;  5D6X A;  4B9X A;  3MEW A;  3GNF B;  4QQ6 A;  3V8J A;  3HP9 A;  4PJO G;  4A4H A;  4OMF B;  1G3T A;  2JN0 A;  3LGL A;  4WF2 A;  2OTL A;  3X24 B;  1Q7Y U;  2AHJ B;  3LW5 E;  4JLI A;  4MDX A;  4HKE A;  2X4J A;  3OS1 A;  2RJE A;  3OYL A;  3LLR A;  4LD6 A;  4J7F A;  2PU9 B;  4A4E A;  1YJ9 T;  2CKK A;  2K5L A;  5GAM e;  4ZN1 A;  2LX9 A;  2R5A A;  1WQW A;  3QDR B;  4C0Z A;  2O4X B;  2VGN A;  3CCR A;  3CC7 A;  2GQV A;  3GIB A;  3JSC A;  4OB1 B;  3X20 B;  3JCM J;  2LVM A;  4M78 B;  3ZEH A;  1KD1 C;  2MF2 A;  2O4X A;  3VUB A;  3UDC A;  3MHX A;  4GY5 A;  1KQS S;  4M78 A;  4PJO B;  2R57 A;  2EQK A;  5LJ5 g;  4JRI A;  1VQN T;  3CCU T;  4PJO A;  1VQ8 T;  4JRP A;  5FU6 C;  3GNG A;  2XD0 A;  3Q1J A;  2X4Y A;  4LDW A;  3O8V A;  3INZ A;  2EQM A;  1YJ9 A;  1M90 C;  2D0Q B;  2C06 A;  2YLB A;  5D6W A;  3TCJ A;  3VUZ A;  1X6O A;  3JCM g;  4IKF A;  1KQ2 A;  1U1S A;  4JS5 A;  2RA2 A;  4UC4 A;  1KQS A;  3CMA T;  2P0P A;  4OGC A;  4BDY A;  1K9M U;  2CGH A;  3RMS A;  3TU4 K;  3VYH B;  4YTL A;  4M7A B;  5GMK j;  5GAN 8;  1YHQ T;  1Q81 U;  3RMQ A;  2K57 A;  3QKJ A;  4JRK A;  3OS5 A;  4CRI A;  4F7U F;  1VQN A;  3CCU A;  4OF1 A;  2X35 A;  5CO7 A;  5A2Q E;  3CC4 T;  1VQ8 A;  5GAN g;  4X34 A;  5GMK l;  3KXT A;  1WJR A;  4LD9 K;  3HSB A;  4XTX A;  1KHC A;  1QW1 A;  5GAN 6;  2QQR A;  2PVG B;  2RHU A;  4M7A F;  3NTH A;  3CCQ T;  1GXI E;  3CMA A;  1P92 A;  4JJN K;  1M1G A;  3MEV A;  4JUV A;  1N6A A;  4MML A;  2LCC A;  4BD3 A;  5HK3 A;  3CME T;  4BE0 A;  3PTA A;  2DK3 A;  1YHQ A;  3LH0 A;  2KMT A;  3MP6 A;  4OB0 B;  3E9F A;  3WXM B;  1ZBX A;  1QVF S;  5LJ5 h;  3QUI A;  2XDD A;  1NZ9 A;  3A8O B;  4EDU A;  4ZN3 A;  5AYF A;  2WSE E;  3CC4 A;  1KG1 A;  1NPP A;  5KCO A;  2D9T A;  3RUX A;  1KC8 C;  3JAM E;  4IUP A;  5CIU A;  5DLQ E;  1EIF A;  1KQ1 A;  4XTW A;  3CCQ A;  1MHN A;  4N0A C;  3JCM h;  3QSU A;  3URG A;  5CQY A;  3OYC A;  4NS5 A;  3OQ5 A;  4C5E A;  2OAU A;  1WGS A;  4BY6 B;  3CME A;  1QVF A;  1WNL A;  4M77 D;  3QHS A;  2H3J A;  2P0K A;  2XU8 A;  4M77 C;  4ZTF A;  2RJC A;  4X9C A;  2CZ6 B;  3WVD B;  1JRI A;  4OP0 A;  4J83 A;  4QQD A;  4IUQ A;  2K3Y A;  3SWN B;  5GAN h;  4FIB A;  2ZPE B;  3C4S A;  2DKG A;  2KDS A;  3LYI A;  5I2M A;  4FM4 B;  4IUR A;  3SWN A;  1BI0 A;  2ZPI B;  1XOV A;  5C6S A;  1W4S A;  2E70 A;  2DJZ A;  2MI6 A;  5LJ3 f;  1B34 B;  4XU2 A;  1K73 C;  3C12 A;  3FRN A;  3OYK A;  1VQL T;  3FDR A;  3MET A;  5GAN 7;  5GAM j;  1B34 A;  1KD1 U;  3JRZ A;  5GMK m;  4XAX B;  3UWN A;  2M9U A;  3C95 A;  4FU6 A;  3CBP A;  4KUI A;  4XK8 E;  3RES A;  1LNX A;  4EPC A;  4HCB A;  3LWH A;  3CCJ T;  4E47 A;  4L5G A;  2DVE A;  3OBW A;  4M78 D;  2DIQ A;  4M78 C;  3QJY A;  4C8Q B;  3OYG A;  4LDU A;  3CC2 T;  3R6O A;  3G7Z A;  3JCM P;  1M90 U;  4PJO D;  3VKI A;  3JCM V;  2XDB A;  3L42 A;  1K8A C;  3JCM c;  4PJO C;  1BYM A;  3RKY A;  1VQL A;  1M8V A;  5LJ3 d;  4E7H A;  4C0G A;  2ZPH B;  4RCB A;  1R8O B;  2E6N A;  1DJ7 B;  4MZT A;  4ATO A;  3FJP A;  4M75 F;  2MAM A;  3CCL T;  4J7I A;  3GPL A;  4M7D B;  2PUK B;  4C8Q F;  3CCJ A;  1N9S A;  3CCV T;  5FU7 B;  1WPY A;  4N4I A;  1M5Q 1;  2KY9 A;  3M58 A;  1VQ9 T;  2RB6 A;  3CEY A;  3CC2 A;  1I4K 1;  4HCZ A;  5GAN d;  1ZHI A;  3KBG A;  3CCM T;  4JRQ A;  4DA4 A;  5I2S A;  1Y96 B;  2E41 A;  2MWO A;  2LT4 A;  5CKF A;  5DM7 R;  2KVQ G;  1S72 T;  4M7D F;  1Y96 A;  3LX7 A;  3M55 A;  2XDP A;  5CAI A;  5CKE A;  1LOJ A;  4C92 F;  3PFS A;  2QQS A;  1UGQ B;  3MP1 A;  3RKW A;  1RL2 A;  5I21 A;  4ZTJ A;  3CCL A;  1VQ6 A;  3CCV A;  1D3B B;  4M7A E;  3C94 A;  4BE2 A;  4F7U G;  3H8Z A;  4DOW A;  5LJ5 e;  2VUB A;  1X01 A;  1VQ9 A;  3OYA A;  2XK0 A;  3FEO A;  3BFM A;  5CK9 A;  3OSV A;  1G3Y A;  2EJF A;  3OYE A;  2LC4 A;  3CCM A;  5J3B A;  3M59 A;  1NE8 A;  3OYH A;  3L2V A;  1WJS A;  4VUB A;  4KUD K;  4M7A G;  2RI3 A;  1S72 A;  3VU3 C;  3JCM e;  2B8A A;  3BDL A;  1I81 A;  2JOY A;  2PVD B;  4IUV A;  4E7I A;  1UGS B;  4NL2 A;  2VYT A;  4OB2 B;  1M1F A;  4J6Y A;  1MGQ A;  2DTH A;  1UGP B;  3M9Q A;  3HRS A;  2KK4 A;  2EAY A;  4F7U B;  3ZBD A;  4BDZ A;  5LJ3 g;  1UGR B;  4BY6 C;  5GAN e;  2EYQ A;  1H64 1;  2RJD A;  3CPF A;  3TRE A;  4F7U A;  2MMP A;  2DXB A;  1VQO T;  3JB9 F;  4XU0 A;  1H3Z A;  2DXT A;  4X9D A;  2D6F A;  4XU1 A;  3V8K A;  3VJP A;  2E1H A;  2F5T X;  3SFM A;  3SWN C;  2CZ0 B;  2DPP B;  1VQP T;  4M7A A;  3OY9 A;  2ZPF B;  2ZPG B;  2F69 A;  2K3X A;  3J7A F;  5IN1 A;  1Q82 C;  5CKD A;  2DTI A;  1XTD A;  5HKC A;  5GAO l;  5LL6 S;  1V29 B;  4DOV A;  3FIF A;  2L89 A;  3GP8 A;  1FXX A;  1PSF A;  3CCE T;  5L8R E;  1XNI A;  1VQO A;  4A4K A;  2GFU A;  2KQW A;  2QEX T;  2E64 A;  4PL6 A;  2IG0 A;  1WJQ A;  3QZ5 B;  2LNV A;  4EMG A;  2Y4X A;  1VQP A;  4RKU E;  1HK9 A;  2EFI A;  2LDM A;  3WVE B;  1OZ3 A;  2EJG A;  3QO3 A;  3UPU A;  2QTX A;  4QVD A;  1YIT T;  2RHI A;  4C8Q C;  3A8H B;  3N5B B;  4IUU A;  4ME7 A;  1AHJ B;  2IVW A;  1VQK T;  5LJ3 h;  4XTZ A;  2M1H A;  3CCE A;  3OS2 A;  1XQH A;  3F70 A;  3E19 A;  2RHX A;  4HA8 A;  4LDY A;  2QEX A;  3OYM A;  4M75 E;  3SB2 A;  2HQE A;  2YLC A;  2DO3 A;  5J26 A;  4O6J A;  4XU3 A;  5DY9 A;  4C8Q E;  2RHY A;  1YBY A;  4M7D C;  2DZC A;  5FU7 C;  4ZGD B;  1U1T A;  3FLG A;  4O5V A;  3E9G A;  1YIT A;  3OYJ A;  5D6Y A;  4J5Y A;  4M75 G;  4BI8 B;  5KCH A;  1YI2 T;  2L5Q A;  2LRQ A;  1VQK A;  5GAO r;  3M54 A;  2L8D A;  4C8Q G;  5FRN A;  3ASK A;  3HFO A;  4NL3 A;  4M7D E;  1SSF A;  3CXC S;  1Q86 C;  3L2U A;  5KE2 A;  4C92 E;  3CCS T;  2V8J A;  1VQM T;  2FL7 A;  5LJ5 j;  1FX7 A;  2EWN A;  2GFA A;  3EAE A;  3M4Y A;  2DTO A;  2P0Q A;  5IAY A;  3M57 A;  5GAN 2;  3HRT A;  4HT8 A;  3G6E T;  2R5M A;  3M4G A;  3HRU A;  4V2S A;  4M7D G;  2HBP A;  5GAN 4;  5GAO m;  2LTO A;  4C92 G;  2K4Y A;  4GLK A;  4OVA A;  4XQ3 A;  3CXC A;  1YI2 A;  1U8R A;  2RJF A;  2X4X A;  2LQK A;  1BIB A;  3HPW A;  4M75 B;  5FLX E;  5HK0 A;  2RO0 A;  5GAM f;  1TH7 A;  3PIO A;  3G4S T;  4M75 A;  1YJW T;  4PKC C;  2RI2 A;  5DLO A;  3CPW S;  3CCS A;  2A7Y A;  3CBO A;  4C8Q A;  4JS4 A;  1VQM A;  3JB9 I;  4D6W A;  3J81 E;  2BKD N;  1UEB A;  3SDZ A;  5CVI A;  4ELZ C;  2E12 A;  3DLM A;  3G6E A;  2LQ8 A;  5GAN j;  4LDX A;  3P8H A;  2DIG A;  2Y4Y A;  3JB9 H;  2V8I A;  1N27 A;  3HL8 A;  5GAN 3;  3UT1 A;  2M0O A;  2VC8 A;  3M53 A;  5FRO A;  4C92 B;  4E7L A;  2ZPB B;  3OYN A;  3OB9 A;  3CPW A;  3I55 T;  1LJO A;  4M7D A;  2KSS A;  4II1 A;  3V8L A;  2E65 A;  1G3W A;  4C92 A;  3G4S A;  1Q82 U;  4M7A D;  5GAM d;  1YJW A;  4M7A C;  4XTY A;  3PIP A;  4FT4 A;  4F7U E;  5A0L A;  2GCX A;  1YIJ T;  3OMG A;  2R58 A;  3QZ9 B;  3L2R A;  1OI1 A;  3PMI A;  4HCC A;  3JB9 G;  2E10 A;  2L3R A;  2XIC A;  3RER A;  4XTV A;  2CYZ B;  2E5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...