1NM7A

Solution structure of the scpex13p sh3 domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
FARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Peroxisomal Membrane Protein PAS20
publication title The ScPex13p SH3 Domain Exposes Two Distinct Binding Sites for Pex5p and Pex14p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 8
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nm7A00
1V1CA 3FJ5A 1T3LA 2DNUA 2DMOA 1G2BA 2EYXA 5IXBA 4DEXA 4AG2C 4IIMA 5EC7A 3R6NA 4Z88A 4R0KA 1JO8A 2DBMA 2YSQA 4J9EA 4ZNXA 3I9QA 1GBQA 2JMCA 2GTOA 1U5SA 2E5KA 1UHCA 3EGUA 1SEMA 2AKKA 2ED0A 2LJ1A 4D8DA 4JJBA 2EQIA 1W70A 3KFVA 1X6GA 2W0ZA 1IO6A 1YWPA 3JV3A 2KXDA 1NYFA 4Z89A 1I1JA 1VYTA 3I5SA 3REAB 2EGEA 1WIEA 2X3WD 3NGPA 1QWFA 3VS3A 2DRKA 1NM7A 2RQWA 4JZ4A 4AFZC 3THKA 4J9DA 4IIOA 1T3SA 2L0AA 2FPFA 2EBPA 2DILA 2MIOA 4ESRA 1JEGA 4AFSC 4F17A 1WYXA 1OEBA 2NUZA 3UF4A 2CT4A 1UDLA 3VS7A 4OMLA 4F14A 2D8HA 2RN8A 2CUBA 1VYUA 4AFQC 4HVUA 2K7AA 2KEAA 2YUPA 2M0YA 2J05A 2HSPA 1H92A 3PVLA 3H0FA 2JS0A 3EG3A 2DA9A 1WI7A 1NYGA 1Z9QA 1TUDA 4Y92A 4RTXA 1AZGB 5IHKA 5IHNA 1X27A 1OPLA 2ECZA 3NMZC 1JXOA 3M0SA 3RNJA 2DVJA 3VS2A 1KFZA 2EYZA 1YNZA 2K6DA 1YWOA 2JS2A 2DRMA 4A63B 5IXFA 2KNBB 3A98A 3UA6A 2HEQA 1X69A 3M0RA 2RQTA 2JXBA 3C0CA 1AD5A 1T0HA 4OMNA 4DEYA 2JMAA 1PKSA 1MV0B 1S1NA 1XOVA 3H0HA 4QT7A 1AWXA 2AZSA 3LH5A 1MUZA 1W6XA 1PNJA 4RTYA 2J7IA 3H0IA 4LUDA 5I22A 2CH4A 2CSQA 1K4US 2W10A 3EG1A 3I5RA 1OPKA 4OMQA 3SHWA 2K9GA 4K11A 2KRNA 3QWYA 2EGCA 1G83A 1NLOC 1M3BA 4AG1C 4KRTA 2X3XD 2C0IA 1X43A 1SPKA 4OMOA 2DBKA 4RUGA 2YDLA 2MOXA 4ORZA 1AZEA 1QCFA 5IH2A 4J9GA 3EHRA 3TSWA 2FRWA 2D8JA 2BZXA 4OMPA 1GBRA 2O2OA 1UUEA 2DYBA 2ENMA 4CC2A 4J9HA 2DL4A 2PNIA 1NEBA 5GJWB 2CDTA 3TSZA 5ECAA 4GLMA 3VS0A 1WDXA 1SHFA 4FSSA 3SEMA 3REBB 1E7OA 2VVKA 3O5ZA 4OMMA 2LCSA 1OOTA 1ZSGA 1W1FA 1BBZA 5L23A 4RTZA 1TG0A 2KYMA 2H8HA 2LJ0A 1UE9A 1K76A 2KBTA 1UJ0A 2JTEA 2VKNA 1GCPA 4HXJA 1LCKA 1UG1A 1WX6A 1OV3A 1NG2A 2SRCA 2CH4W 2VWFA 4M4ZA 1SHGA 2XMFA 2ED1A 2K2MA 1QKWA 2A08A 2HDAA 1AWJA 1PKTA 2YT6A 2JT4A 1B07A 1ZUKA 2K79A 1JXMA 2RMOA 2LQWA 2J6KA 1RI9A 1YN8A 2LMJA 1RLQC 1MV3A 4D8KA 2K3BA 2D0NA 1B3QA 3NHNA 4AFUC 1AWWA 2AK5A 2YUNA 1M27C 2I0NA 2GTJA 1RUWA 4CC3A 2RQVA 1HD3A 3IQLA 2LX7A 3RBBB 2RQUA 4LUEA 1I07A 4Z8AA 3M0QA 2CSIA 2J06A 5FWBA 1AWOA 2KT1A 2KYBA 3H41A 3UATA 2BTTA 2SEMA 2JM8A 3PVQA 1ABQA 2LNHB 2YUOA 1K9AA 1QLYA 1SRMA 2DLPA 1SRLA 2MCNA 2KE9A 4X1VA 2LQNA 2L3QA 3VS5A 1YP5A 2B86A 2GBQA 2RF0A 2LZ6B 4GBQA 1JQQA 1PWTA 1WFWA 2DE0X 2O9SA 3CQTA 3EHQA 1U3OA 1HSQA 1KJWA 1WXTA 1ZUYA 2DL5A 2JM9A 1X6BA 1E6GA 4HCKA 2F2VA 1GFCA 2DF6A 2GNCA 1JU5C 2JW4A 3GBQA 1Z9ZA 4JPBW 3QWXX 2J6FA 2EPDA 2G6FX 2FEIA 4E6RA 2C0OA 1I0CA 1UFFA 2GQIA 2OI3A 1H3HA 2DX1A 1E6HA 1U06A 2EGAA 2J6OA 3I35A 2OAWA 1AVZC 4JJDA 1KIKA 3M0TA 1TUCA 1QKXA 2F2WA 4HVVA 2KRMA 2DL8A 2FPEA 1ZX6A 5I11A 5GJVB 4CC7A 1ZBJA 4RTTA 2KROA 4RTWA 3VS1A 1X2QA 1NLPC 1T0JA 1GL5A 2FPDA 4LE9A 2A37A 2HBWA 2M51A 2L2PA 1CKAA 3M0UA 2C0TA 2KT8A 1K0XA 2V1RA 1AOJA 2EYYA 2D1XA 2HCKA 1BB9A 1UHFA 4LNPA 1H8KA 4EIKA 2DJQA 2F2XA 3EG0A 1PRMC 3PE0A 2V1QA 4CC4B 2A28A 1GCQA 2KXCA 3VRZA 2ROLA 1QWEA 2FRYA 2KGTA 4RTUA 2DL7A 1X2KA 1UECA 2BZYA 2IIMA 1K0SA 1Y57A 3U23A 1YCSB 2EYWA 1CKBA 2CUDA 1VYVA 1GCQC 1K1ZA 5IHIA 1UJYA 2QDLA 2FG0A 1WA7A 2RPNA 2RQRA 1M30A 2AZVA 3M0PA 2CREA 2RNAA 4LN2A 5FW9A 2DM1A 3UA7A 2PZ1A 1GRIA 2L3SA 2KRSA 2EVRA 1AEYA 1HJDA 1M3AA 2KR3A 2PTKA 1N5ZA 3VRYA 2LP5A 4J9BA 1WXUA 2EW3A 2O9VA 4JZ3A 2A36A 1WXBA 5FWCA 1BK2A 3VS6A 1ZLMA 2ROTA 1RLPC 2DL3A 1Y0MA 2LJ3A 1CSKA 4F16A 1WLPB 1FYNA 4RTVA 2OJ2A 1GFDA 4J9CA 1PHTA 5HCKA 2EKHA 2NWMA 1J3TA 1BU1A 2ABLA 4WCIA 1A0NB 2AKLA 2O31A 2O88A 1EFNA 4J9FA 2BZ8A 3ULRB 4HVWA 1ZUUA 4J9IA 3EG2A 1NEGA 2FO0A 1VA7A 1M8MA 3TVTA 2GGRA 1KSWA 2YUQA 1SSHA 3NPFA 1ARKA 1UGVA 2P4RA 3ZL7C 2L3PA 1PRLC 2CT3A 1UTIA 1FMKA 2ESWA 1ABOA 3VS4A 1M3CA 4JJCA
chains in the Genus database with same CATH superfamily
1V1CA 1RACB 1K73U 1T3LA 3MP8A 2I2LA 1LPLA 5KCOA 3TU4K 4AG2C 5KYWB 3SD4A 1M1FA 1W2BP 5GAOq 2E65A 5CKFA 2ZZDA 3QZ9B 4LD9K 3MO8A 4R0KA 4PJMA 1JO8A 2YSQA 5GAMf 3CMET 3OYLA 2JMCA 2GTOA 2OAUA 2BE9B 2VXEA 1SEMA 1TUGB 3QG1A 2WSFE 2FYKA 2ED0A 4D8DA 2EQIA 2QQBA 1W70A 5DLQE 1IO6A 2KXDA 4Z89A 3AT1B 2EGEA 3P8DA 2X3WD 3VS3A 4OB1B 2E3IA 1ZHIA 2QDYB 4Y91A 1NPRA 4A4HA 2DIQA 2FPFA 3X24B 5FRNA 2MWPA 1D1BA 2MIOA 4ESRA 2NUZA 1UDLA 1P92A 2YRCA 3CC7T 4IUQA 4E47A 2JOYA 2RHIA 4DBFA 1VYUA 3X28B 4HVUA 4M7DE 1IHVA 4NS5A 5GAOp 2QXFA 5GAN3 2ATCB 1KQSP 2M0YA 4L5GA 3RMSA 1MMNA 1H92A 1Z9QA 4Y92A 3JCMg 2E4HA 8AT1B 3VUZA 2HKNA 1FXXA 1X27A 1OPLA 2ECZA 4M78E 3NMZC 4PK4A 3CPWS 3M0SA 4IKFA 2DVJA 1QVFA 4OP0A 2RI3A 4C92B 4N4GA 4PJOF 3GF5A 4JRQA 5FU7B 1X69A 3QXEB 4AT1B 4EMGA 1NE8A 2KY9A 4XU0A 2EAYA 4M75G 3C0CA 1AD5A 1T0HA 3CBPA 4DEYA 4HKEA 1NPPA 4QT7A 1AWXA 3A8LB 3OQ5A 4LUDA 1MMGA 5I22A 2CH4A 2CSQA 2W10A 1OPKA 3SHWA 4ZGEB 1H641 4K11A 1D0ZA 3QWYA 1UGPB 2C0IA 4OMOA 1SPKA 1IXDA 3L2RA 2DBKA 3OW2S 2MPXC 2DEUA 1D1AA 1Y96A 3OS5A 3SWNA 3JSCA 2GF7A 1F1BB 3QDRB 1GBRA 2DYBA 2LCCA 4JLIA 2OTLA 4TVRA 1NEBA 3TSZA 5LJ3e 2K3YA 2OTLQ 1KC8C 1VQ8A 1BYMA 4E7HA 2VVKA 2H3EB 1Q81U 1I81A 3M4GA 2KMTA 1I5LA 2KYMA 3F70A 4A4GA 3QKJA 3HRUA 1VIEA 2VKNA 2CP6A 3PMTA 4II1A 4M77G 1M2OA 2CH4W 4X9DA 5HY6A 4EMKA 4JRPA 4PJLA 4ZN1A 2HL5C 1VQ7T 2AHJB 3CCUA 1OI1A 5CCAA 2HBPA 2YT6A 3G6EA 2R5AA 5CR2A 2RMOA 2LQWA 3RR6A 5CKBA 2LMJA 4D8KA 4QQGA 3I56A 3SDZA 2LCLA 4QVCA 1B3QA 2YUNA 3I56Q 3ZFJA 1Q7YC 3V7SA 1OQKA 2LX7A 5KYYB 4O6JA 3RBBB 2RQUA 5LJ5d 4MZPA 2J06A 4QVDA 2WSCE 4C8QB 5AT1B 2QEXT 1OYXA 2GQVA 4N0AA 3L2QA 3PVQA 3P8HA 3MEVA 2LNHB 3DLMA 2MCNA 5GAN8 2DJZA 3MP6A 4KUDK 2L3QA 1RAHB 3JRZA 2GBQA 1YITT 2DEQA 2LZ6B 4GBQA 3FEOA 2O9SA 2B8AA 1U3OA 2MWOA 2HD0A 3HHTB 4N4IA 1XJWB 3HKSA 2LDMA 1Y7XA 4M7DD 3H8ZA 2L3RA 1KQ1A 2OTJT 1K9MC 1BIBA 1U1SA 3OYEA 1W2BS 3CCLA 3OW2A 2EPDA 3CCLQ 1HYOA 3MEWA 3CCVA 1UFFA 2FZKB 3CCEA 1H3HA 4M78D 3CCVQ 1W4SA 3CCEQ 1Q81R 1YHQT 3SWNC 3I35A 4BI4A 1O9SA 1TUCA 2VXFA 4HVVA 3G4ST 2QQRA 2DL8A 1BI0A 3EH1A 5A2QE 2FPEA 1VQPA 4BUGA 1M1KU 2KROA 1M90U 3QPHA 2A37A 2HBWA 1FX7A 2M51A 1S72Q 1CKAA 3M0UA 5D7UA 4FW2A 3CCSA 3QZ5B 4BY6C 1AOJA 2HL3A 2VUBA 5CQYA 1WHHA 3CCSQ 5CKHA 3EFSA 4KGZB 3OBWA 3CC4A 2QQ9A 3A5ZB 3EG0A 3S6WA 3JCMe 3CC4Q 3PE0A 1VQNA 4EMKC 1ZBXA 1VQNQ 3INZA 1QWEA 3VV0A 5KYUB 4RTUA 1X2KA 1Y57A 2DETA 1YCSB 2KVQG 2EYWA 4XTUA 5KYXB 1XNIA 2ZPEB 1AT1B 1VYVA 1GCQC 2VYTA 1YBYA 4M7AA 2RJDA 1UJYA 4F7UA 2QDLA 2R57A 2QA4T 4DA4A 2RPNA 2RQRA 3S3MA 5LJ5h 3OYDA 1VQMQ 1RAAB 1D3BA 3KUFA 3EGXA 2VV5A 3OS0A 3UA7A 2LQ8A 2PVOB 4EMHA 3X20B 4R55A 3DLLA 4MDXA 1WXUA 4XTVA 4DOVA 2O9VA 4JZ3A 2A36A 5FWCA 1BK2A 3VS6A 2ROTA 4N0AC 4MMLA 2E3HA 3R6OA 1LJOA 4ANJA 4KULA 2DL3A 4DBQA 1CSKA 4F16A 2YHTA 3RKXA 5IN1A 1QVGS 2LRQA 3DKMA 4KT0E 5J3BA 3VYHB 3GIBA 3VU3C 1RAFB 2BIVA 3M54A 4J9FA 4HVWA 2DTIA 3DB3A 1NJIC 1KSWA 3JCMc 2JJ9A 1ARKA 1VQ4T 1PRLC 4J6YA 3CCMA 9ATCB 3MHXA 3DB4A 3CCMQ 3G71A 5HK3A 2ESWA 2JN0A 4XU1A 4JJCA 2NUTA 5GANj 1M1KR 5KYNA 3G71Q 4M77A 2DNUA 3JCMf 1G2BA 3GOXA 1M90R 1R8OB 1I8FA 4C8QG 2CZ1B 4XQ3A 3RDVA 3CMAT 3FLGA 3G1JA 4CRIA 3OBYA 3NFCA 4ZNXA 3I9QA 2DTOA 3M9QA 3HRSA 1FMVA 1EX4A 1JJ2P 1WGSA 2LJ1A 3HFOA 4PJNA 3MKDA 2M02A 4CI0C 3PMIA 4RCCA 3KFVA 3MP1A 5KYWA 1YJWA 1Q82C 3EG9A 1YWPA 2X4XA 2LTOA 1MMDA 4M75B 3M53A 1EZZB 1NYFA 4QW2A 4JS5A 3TQ7P 2R5MA 1XTDA 1WIEA 3BDUA 1YI2T 1VQ5A 2D0QB 1NM7A 2L89A 2LT4A 2RQWA 3OSVA 3THKA 4J9DA 1RL2A 2DERA 4FYVB 2GFUA 2HQEA 4WF2A 3UT1A 4F17A 1QCNA 1FMWA 5A0DA 3VS7A 3CCJA 2E1HA 3M4YA 3TREA 4M7AC 2CUBA 2EQUA 4AFQC 3CCJQ 2K5IA 2YLCA 3E19A 2HKQB 2YUPA 4X34A 2WSEE 2RI5A 1SKUB 5HKCA 2JS0A 4FT2A 1WI7A 3ZBDA 1U1TA 2IG0A 1LNXA 3HL8A 4D6WA 1KD1U 5IHKA 2EJGA 3V8KA 4BACA 4C5EA 1SG5A 3RNJA 3VS2A 5GAMj 1VQOT 4FIBA 2P0PA 1B7TA 1KFZA 1WHGA 4C0DB 1Q82U 1YNZA 1YWOA 4BD3A 2XDPA 1N8RC 2PQWA 1BCMA 1QVGA 4J7FA 4PJOB 1M1GA 1Q95G 2E6ZA 3GNFB 1K8AC 4YTLA 4OMNA 2JMAA 4IUTA 1VQ9T 2J7IA 2QTVA 3H0IA 4FYWB 3CC2A 4C92A 3I5RA 1YJNQ 1ZSZB 1VQ6T 5KE3A 3CC2Q 4IUVA 4AG1C 2CP7A 1PSEA 4RUGA 2YDLA 1AZEA 3PT9A 4A53A 2VGMA 4MDWA 4B6MA 1UB4A 4OMPA 3JB9J 2P0KA 4M77C 4ZN3A 4DBRA 1Y07A 2DL4A 3QHSA 1VQKA 2V8KA 3VS0A 2EYQA 1VQKQ 1I5OB 2LCSA 1OOTA 3CMEQ 1IRXA 1IHWA 1G3WA 2QK0A 1W1FA 3OYGA 2LJ0A 2EQMA 2M0OA 2KBTA 2VB6A 2HMAA 3VYGA 1OV3A 1NG2A 5D6WA 4M7AF 2YLBA 4F7UF 4E7IA 3EH2A 4QVZA 1ZA1B 2XMFA 4M7DG 2A08A 1AWJA 2HDAA 1PKTA 5LJ3d 4E2FB 1M8VA 1HK9A 1VIFA 4EDUA 1M2VB 4XTZA 4DQ2A 3CC7A 2K79A 1JXMA 4A54A 1OX9A 1OU8A 3CC7Q 3PFSA 1RLQC 1MV3A 3WXMB 1KD1R 2D0NA 4M78G 4XTYA 3QSUA 3NHNA 4AFUC 2G3RA 1AWWA 2AK5A 1G3SA 3M56A 1QVPA 3EFOB 2ZPBB 4ZGDB 5EG2A 1Q82R 1HD3A 1C6VX 2CS7A 1Y71A 1I07A 4Z8AA 3M0QA 5L8RE 1AWOA 5IT9E 2XG8D 3H41A 5LJ5g 3CXCA 2BTTA 2R58A 1ABQA 5FROA 4ZGJB 2HAXA 2GCXA 2KE9A 1QP3A 4X1VA 4EPCA 5KCHA 1X6OA 1IZ6A 2V8JA 4N4HA 3VS5A 1YP5A 3BE3A 4IUPA 3CBMA 1N9RA 5KYYA 2JNGA 4PL6A 1JQQA 3JCMX 3EHQA 2H3JA 2JTMA 2XDDA 1KJWA 1WXTA 2XHCA 1ZUYA 4BE2A 4C8QA 1K73R 1UGQB 4HCKA 2KAFA 1KK7A 1OULA 3OYCA 2GNCA 2RO0A 4M77F 3GBQA 2F5TX 4C92C 4PFZA 4RG2A 4JPBW 4M7AE 3FC3A 4F7UE 2J6FA 3M5AA 1RABB 3VJPA 1D0XA 2G6FX 3ZEHA 5FU7C 2FEIA 2QASA 3GNGA 3LWIA 5GAN7 1I0CA 1EIFA 2OI3A 2DX1A 3Q1JA 4RG8A 2J6OA 2ZGWA 3OMGA 1M9SA 3M0TA 1NBEB 3HSBA 4ZTFA 2DXCA 5GANg 1D1CA 2XIDA 5I11A 3I55T 4RTTA 2KSSA 5GAOr 1LOJA 1QP2A 4PJOG 1T0JA 3OMCA 2L5QA 4MMKA 2KDSA 1VQ8T 3VS4A 1K0XA 2D9TA 5D6YA 2EYYA 2ZPFB 2FHDA 5LJ3h 1UHFA 4LNPA 4HCBA 3KXTA 3JB9F 3OYJA 2LVMA 5C0MA 4EIKA 3UWNA 4LDUA 2F2XA 1VQ7Q 1PRMC 2EQKA 2KK4A 1GCQA 2BKDN 4OB3B 3VRZA 2COYA 2KGTA 1WPYA 2ZPHB 1UECA 2IIMA 1Q86C 3M57A 4LDWA 4BDYA 1CKBA 3CCUT 1K1ZA 3EGDB 1ZQ1A 4A4KA 1KC8U 3G6ET 1M30A 4M77E 3CCQA 3M0PA 1YIJT 1PCXA 1G3TA 3CPWA 2Y4YA 3CCQQ 2RNAA 5FW9A 2XICA 3JCMQ 5LL6S 2PVDB 2P0QA 2PZ1A 4BI3A 3I56T 2EVRA 1HJDA 2KR3A 3RKYA 3JCMd 2PTKA 2HQXA 5KYXA 2LP5A 4J9BA 2QEXQ 2EWNA 1ZLMA 2DKGA 2O4XB 1YITA 1R0BG 4FL6A 4NL3A 1Y0MA 1YITQ 3JCMV 4FSXA 5GAMg 2DZ9A 4C92F 5I2SA 1FYNA 5A0GA 1SSFA 2OJ2A 1GFDA 3MEUA 5LJ3f 2L8DA 3H9NA 3VKIA 3FB9A 5D6XA 2NWMA 1J3TA 1MGQA 2A3LA 2X9HA 4MZMA 2AKLA 5CQXA 1Q86U 1BI2A 3ULRB 4C8QC 4XU3A 3A8OB 4J9IA 3EG2A 5A0LA 1Y96B 1VA7A 4C5IA 4C5GA 3TVTA 4QQDA 1PD1A 1Q7YU 2XDBA 4KH0B 1TH7A 1RAEB 2DD4A 1UGVA 3OYBA 4JLGA 4VUBA 4FU6A 3ZL7C 4PFPA 2EJFA 1QVFP 1NZ9A 2QYZA 2DAQA 2NUPB 1YHQA 1FMKA 3CXCP 2YRDA 2FZGB 1YHQQ 1M3CA 3SFMA 4B9XA 3CCLT 3E9GA 3M59A 3FJ5A 2X4YA 3G4SA 5IXBA 1C0MA 3X25B 3CCVT 4DEXA 1R0CB 3G4SQ 3CCET 5GAOm 1BIAA 4IIMA 4DBHA 1S72A 4XTXA 2DBMA 3X26B 1TS9A 2DTHA 1PC0A 1MNDA 2E5KA 1AHJB 2AKKA 2YXYA 4JJBA 1VQPT 4Y28E 2Y4XA 1K9MU 2CP3A 4PLLA 4AMCA 1KQSS 4M7AD 3PTAA 2QGFB 4LDXA 1I1JA 1VYTA 2FVUA 4BB7A 3REAB 3CD6A 1KC8R 3QO3A 4WTOB 4C92E 3CD6Q 2IPOB 1VQLA 4JZ4A 3QIIA 4IIOA 5LJ5e 2L0AA 2DILA 1VQLQ 4NL2A 1JEGA 4AFSC 5KE2A 1WYXA 1VQMA 3UF4A 2CT4A 1VQNT 1MHNA 4C5HA 4OGEA 2EIFA 2DIGA 2D8HA 2QTXA 4M75A 4LDYA 3ER0A 3BDLA 5LJ5j 3P8BB 3JCMh 2ZAEA 2J05A 2HSPA 1VOMA 3H0FA 1GXIE 2DA9A 1NYGA 1TUDA 1AZGB 2AT1B 5IHNA 3CCRT 1JXOA 2X4JA 3E2UA 2K57A 7AT1B 2EYZA 1M4ZA 4C8QF 1Q86R 3BW1A 3GPLA 2YWWA 2DXUA 3A98A 1Q7YR 3UA6A 3V8JA 4JRKA 2RQTA 4ME7A 3GP8A 2JXBA 4JRIA 3OS1A 1W2BA 2COWA 3SB2A 3UDCA 4M7DB 1XOVA 2DZCA 2AZSA 3CPWP 5GANe 1PNJA 2DXBA 4M77D 3EG1A 4OMQA 1VQ4A 3C4SA 1ZA2B 2KRNA 2EGCA 1G83A 4BDZA 1NLOC 1VQ4Q 3FIFA 1BCOA 4KRTA 2X3XD 1X43A 4HT9A 4M78B 5GAN2 2MOXA 4ORZA 3LX7A 5IH2A 3TSWA 5DY9A 2D8JA 2BZXA 2JUFA 2BE7D 4J7IA 3TCJA 3CCMT 1UUEA 4CC2A 2YRVA 1TU0B 2A7YA 3G7ZA 2PNIA 3G71T 1ZSZA 4GLMA 1WDXA 1SHFA 1K9MR 3REBB 1E7OA 1G8XA 3O5ZA 2E10A 1BBZA 3OA6A 5L23A 4C0FA 3OW2P 1X01A 2H8HA 5GAN6 1YJ9A 1NJIU 1SF9A 4XTWA 4L6V5 1KQSA 1YJ9Q 2JTEA 2VC8A 2XKOC 4PLIA 1GCPA 3MEAA 5AYFA 4HXJA 4C8QE 3JB9D 4HCCA 1WX6A 2SRCA 2NYSA 2VWFA 4M4ZA 2ED1A 1G5VA 1R77A 1QKWA 3S3NA 1YJWT 2JT4A 5GMKh 2XD0A 1D3BB 4J8OA 1B07A 3J81E 4KBMB 5CO7A 2J6KA 1RI9A 2PUKB 1VQ5T 5CIUA 2DO3A 4M75C 5GAMe 1HXDA 2GTJA 3A1PA 3PIOA 1RUWA 2P84A 2RQVA 2PVGB 1QW1A 4LUEA 5FU6B 1M2VA 5GANf 5FWBA 1VQOQ 3UATA 2EQJA 4FYYB 2SEMA 2JM8A 2COZA 3OYFA 2DLPA 4F04B 3NTIA 2RB6A 2CZ0B 3MPUB 2LQNA 1FWZA 4C92D 2B86A 3CBOA 3N5BB 2DE0X 3CQTA 1QVFS 2BUDA 1HSQA 3J7AF 1RI0A 3QBYA 1G3YA 1OZ3A 1VQ9A 5J39A 4MZTA 1YJNA 3QJ6A 4NOYA 1X6BA 1E6GA 1VQ9Q 1GFCA 4C0DC 4J5YA 1JU5C 3QWXX 4PJOC 3OYIA 1B34B 8ATCB 4E6RA 2C0OA 1MMAA 2EFIA 3CC2T 2K3XA 4QQ6A 2NLUA 3O8VA 1E6HA 1U06A 3RKWA 2K5LA 1N8RU 1AVZC 4O5VA 1KIKA 3CMEA 1QKXA 2F2WA 1NJIR 4FYXB 2KRMA 3LW5E 1ZSZC 4OB0B 3EG9B 1K8AU 1ZBJA 4RTWA 3T9NA 2RD1A 3VS1A 2HNIA 1NLPC 3V8LA 1VQKT 3A8HB 3L42A 1GL5A 2QI2A 2L2PA 1XQHA 2KT8A 2XK0A 4IURA 1BB9A 3ME9A 4M75F 3OSSC 1JB0E 4LDVA 2V1QA 5GAN4 2A28A 1TSFA 1N9SA 2KXCA 3D7SB 2ROLA 2FRYA 1V29B 2X35A 1K0SA 3U23A 3META 2E12A 3JB9I 4BE1A 3JB9H 1WA7A 4ELZC 2AZVA 2V8IA 3LGFA 3PGGA 1ACMB 2E41A 2CREA 2K4YA 1PD0A 4E7SA 3WVEB 1GRIA 2X4WA 3BY7A 1U8RA 4A4EA 1H3ZA 1ABOA 1N5ZA 3VRYA 2EW3A 1IB8A 3EGDA 4XK8E 2DK3A 4C8QD 2ZPIB 1RLPC 2AIRB 4B9WA 3M58A 1WLPB 4RTVA 4J9CA 1PHTA 4M7AG 4KGVB 2VGNA 4F7UG 2EKHA 1BKBA 1MNEA 2RJCA 1BU1A 2ABLA 4RKUE 4WCIA 1Q81C 3E9FA 2F1LA 2XI9A 2KI7A 2O31A 2O88A 1ZUUA 1N27A 1NEGA 1M8MA 3S3OA 2O4XA 3RERA 1JBMA 3CPFA 1N8RR 4FCYA 1TOVA 2RM4A 5I21A 4M75E 2P4RA 3HP9A 2CT3A 2K5FA 1JJ2S 1QVGP 4X9CA 1WNLA 1K8AR 4LD6A 2F5KA 2DMOA 2EYXA 4PNOA 1WJSA 3L2ZA 3I55A 5EC7A 4IUUA 2JTFA 4P5NA 3R6NA 2O01E 4Z88A 4JUVA 3AHUA 3I55Q 2OTLT 1WQ7A 2RHXA 4J9EA 2NUPA 1GBQA 1U5SA 1UHCA 3EGUA 1VUBA 1VQ8Q 2RHYA 2M1HA 1VQ7A 3QDFA 4J6XA 5CAIA 5LJ3j 4FM4B 1X6GA 2W0ZA 2DYIA 4DOWA 3JV3A 1O75A 3HTRA 2CGHA 4A4FA 3I5SA 1UGRB 4E7ZA 3NGPA 1QWFA 2DRKA 4AFZC 1T3SA 4PJOE 5GMKm 2EBPA 2HSEB 2MAMA 1RAIB 1OEBA 3CCUQ 1KHIA 3LH0A 4OMLA 4F14A 1YIJA 2RN8A 2CP0A 3G6EQ 4E7LA 2K7AA 1YIJQ 2KEAA 4BI8B 1WHJA 5KYUA 4ATOA 3V7RA 3OYAA 2QEXA 3PVLA 1KQ2A 3EG3A 2RHZA 1C1AA 1PG5B 4RTXA 2OX7A 3CCQT 1OZ2A 3ASKA 3QJYA 1QMCA 2RJFA 2K6DA 3FJPA 2JS2A 2DRMA 4A63B 5IXFA 4HCZA 3OYYA 2KNBB 2VASA 3JCMb 2HEQA 4KH1B 2RH2A 1IREB 1WJRA 3JB9G 3M0RA 2DPPB 1BI1A 2CP2A 2K2VA 4E7JA 1M1KC 2OTJA 1PKSA 3SWNB 1MV0B 1S1NA 3H0HA 1M90C 2DXTA 4QKUA 2OTJQ 3LH5A 1MUZA 1W6XA 4RTYA 1KHCA 1WHMA 1OX8A 5I2MA 1K4US 3JCMW 4KUIA 5J26A 2K9GA 3L2VA 1JJ2A 2Z0WA 3QUIA 4PKCC 1M3BA 2FZCB 3L2UA 2PUOB 2WACA 1DJ7B 1QCFA 4J9GA 3EHRA 2IVWA 4Q5WA 4M7DA 2FRWA 2QQAA 1WZOA 4Z02A 2QAZA 2MI6A 2O2OA 4BY6B 2ENMA 3JCMJ 4OGCA 4J9HA 2DD5A 5GJWB 2CDTA 2JVVA 5ECAA 3OS2A 6AT1B 2E70A 4FSSA 3SEMA 5GANd 3NTHA 4J6WA 4EMKB 4OMMA 2CZ7B 3OYMA 1ZSGA 3H6ZA 2LNVA 4M78A 4RTZA 3MJXA 3GLXA 3M55A 1TG0A 2Y90A 4C92G 1VQPQ 5FRMA 1UE9A 1K76A 4UC4A 1S72T 1UJ0A 1YCYA 1LCKA 1YFNA 2EKOA 2RI2A 3CCST 3HPWA 1UG1A 3QYGB 4M75D 3RMQA 5FLXE 4OB2B 1SHGA 2RK1A 3CC4T 2K2MA 3OB9A 2QA4A 4PJJA 4OMFB 3JAME 2RHUA 2XU8A 1ZUKA 2QA4Q 3CD6T 4HT8A 3RIRA 2ZCFB 2ZPGB 1YN8A 5DLOA 2C06A 3C95A 1I4K1 1VQLT 2K3BA 1D09B 2CP5A 2HZYA 3RESA 5IAYA 1M27C 2I0NA 1VQMT 3UPUA 1RADB 4CC3A 1WQWA 3IQLA 3CCRA 2D6FA 2CSIA 4C0GA 3CCRQ 1IGQA 2KT1A 2KYBA 1PSFA 2V26A 4GLKA 3BFMA 4V2SA 3CEYA 5GAOn 5CKDA 2CKKA 2MYSA 2RA2A 2YUOA 1K9AA 1QLYA 1SRMA 2DVEA 1SRLA 2MK5A 2M16A 2M9UA 2FL7A 5GAMd 2QG9B 2RF0A 4E7KA 4PJOD 1PWTA 1WFWA 3JCMP 3FDRA 1WJQA 2DL5A 2JM9A 1UEBA 2F2VA 2DF6A 3LGLA 4FW1A 4PJOA 5CVIA 2E64A 1TTHB 2JW4A 5CK9A 1V76A 1Z9ZA 5GMKl 4GY5A 4BE0A 1LVKA 1IGUA 1BI3A 1TXQA 3PIPA 3C12A 3URGA 3TEEA 2GQIA 3OYHA 3CMAA 1WHKA 2EGAA 3EAEA 4J83A 5GANh 4M7DC 2PU9B 3CMAQ 2OAWA 5LJ5f 4JJDA 1KG1A 3EFRA 3KBGA 3OYKA 1D0YA 2A0FB 3PNWC 3C94A 1ZX6A 2EJ9A 1B34A 5GJVB 4CC7A 2DFUA 3HRTA 3MCAB 2LC4A 4LXCA 4M78C 3A8MB 1X2QA 2FPDA 4LE9A 2LT1A 1KD1C 2C0TA 1YI2A 2V1RA 5GMKe 4JJNK 2D1XA 2HCKA 4M7AB 4F7UB 4ELYC 1YI2Q 2MMPA 1H8KA 3LLRA 1YJ9T 2DJQA 1TWBA 4CC4B 3EGXB 1YJWQ 1N6AA 3NTKA 5LJ3g 5GMKj 4C0ZA 1X75C 2LQKA 3A8GB 2LX9A 2DL7A 2BZYA 5DM7R 3OYNA 5CKEA 4OF1A 4PFOA 2CUDA 1VQ5Q 5GAN5 5IHIA 3LYIA 2FG0A 4HA8A 2P4TA 4L59A 3FRNA 2QQSA 3CCJT 3E1SA 3J80E 1OU9A 2E5QA 3L1AA 2RK2A 4KGXB 5M9OA 1VQOA 5GAOl 4LN2A 4RCBA 2DM1A 3L2WA 2L3SA 2KRSA 1AEYA 1M3AA 2E6NA 1K73C 2MF2A 1RAGB 3EFOA 3VUBA 4XAXB 1WXBA 1QQJA 3WVDB 5GAMh 3LWHA 1WHLA 2JZ2A 4R56A 2HQHA 2LJ3A 3QYHB 3CXCS 1PM3A 5HCKA 5FU6C 4FT4A 1A0NB 5HK0A 3HFNA 1VQ6A 2CZ6B 5GMKi 2NUTB 1EFNA 2BZ8A 4M77B 2FO0A 1VQ6Q 2GGRA 4RMOA 4M7DF 2YUQA 4OVAA 4XU2A 1SSHA 2CYZB 3NPFA 2F69A 1JRIA 3OY9A 3RUXA 3V7CA 1YJNT 2RJEA 2L3PA 5C6SA 2QGGA 1UTIA 2KQWA 1UGSB 1QCOA 2FB7A 5KH6A 4ZTJA 1M5Q1 2X51A 2GFAA 4JDSA 4M78F 4JS4A
chains in the Genus database with same CATH topology
1V1CA 3FJ5A 1T3LA 2DNUA 2DMOA 1G2BA 2EYXA 5IXBA 4DEXA 4AG2C 4IIMA 5EC7A 3R6NA 4Z88A 4R0KA 1JO8A 2DBMA 2YSQA 4J9EA 4ZNXA 3I9QA 1GBQA 2JMCA 2GTOA 1U5SA 2E5KA 1UHCA 3EGUA 1SEMA 2AKKA 2ED0A 2LJ1A 4D8DA 4JJBA 2EQIA 1W70A 3KFVA 1X6GA 2W0ZA 1IO6A 1YWPA 3JV3A 2KXDA 1NYFA 4Z89A 1I1JA 1VYTA 3I5SA 3REAB 2EGEA 1WIEA 2X3WD 3NGPA 1QWFA 3VS3A 2DRKA 1NM7A 2RQWA 4JZ4A 4AFZC 3THKA 4J9DA 4IIOA 1T3SA 2L0AA 2FPFA 2EBPA 2DILA 2MIOA 4ESRA 1JEGA 4AFSC 4F17A 1WYXA 1OEBA 2NUZA 3UF4A 2CT4A 1UDLA 3VS7A 4OMLA 4F14A 2D8HA 2RN8A 2CUBA 1VYUA 4AFQC 4HVUA 2K7AA 2KEAA 2YUPA 2M0YA 2J05A 2HSPA 1H92A 3PVLA 3H0FA 2JS0A 3EG3A 2DA9A 1WI7A 1NYGA 1Z9QA 1TUDA 4Y92A 4RTXA 1AZGB 5IHKA 5IHNA 1X27A 1OPLA 2ECZA 3NMZC 1JXOA 3M0SA 3RNJA 2DVJA 3VS2A 1KFZA 2EYZA 1YNZA 2K6DA 1YWOA 2JS2A 2DRMA 4A63B 5IXFA 2KNBB 3A98A 3UA6A 2HEQA 1X69A 3M0RA 2RQTA 2JXBA 3C0CA 1AD5A 1T0HA 4OMNA 4DEYA 2JMAA 1PKSA 1MV0B 1S1NA 1XOVA 3H0HA 4QT7A 1AWXA 2AZSA 3LH5A 1MUZA 1W6XA 1PNJA 4RTYA 2J7IA 3H0IA 4LUDA 5I22A 2CH4A 2CSQA 1K4US 2W10A 3EG1A 3I5RA 1OPKA 4OMQA 3SHWA 2K9GA 4K11A 2KRNA 3QWYA 2EGCA 1G83A 1NLOC 1M3BA 4AG1C 4KRTA 2X3XD 2C0IA 1X43A 1SPKA 4OMOA 2DBKA 4RUGA 2YDLA 2MOXA 4ORZA 1AZEA 1QCFA 5IH2A 4J9GA 3EHRA 3TSWA 2FRWA 2D8JA 2BZXA 4OMPA 1GBRA 2O2OA 1UUEA 2DYBA 2ENMA 4CC2A 4J9HA 2DL4A 2PNIA 1NEBA 5GJWB 2CDTA 3TSZA 5ECAA 4GLMA 3VS0A 1WDXA 1SHFA 4FSSA 3SEMA 3REBB 1E7OA 2VVKA 3O5ZA 4OMMA 2LCSA 1OOTA 1ZSGA 1W1FA 1BBZA 5L23A 4RTZA 1TG0A 2KYMA 2H8HA 2LJ0A 1UE9A 1K76A 2KBTA 1UJ0A 2JTEA 2VKNA 1GCPA 4HXJA 1LCKA 1UG1A 1WX6A 1OV3A 1NG2A 2SRCA 2CH4W 2VWFA 4M4ZA 1SHGA 2XMFA 2ED1A 2K2MA 1QKWA 2A08A 2HDAA 1AWJA 1PKTA 2YT6A 2JT4A 1B07A 1ZUKA 2K79A 1JXMA 2RMOA 2LQWA 2J6KA 1RI9A 1YN8A 2LMJA 1RLQC 1MV3A 4D8KA 2K3BA 2D0NA 1B3QA 3NHNA 4AFUC 1AWWA 2AK5A 2YUNA 1M27C 2I0NA 2GTJA 1RUWA 4CC3A 2RQVA 1HD3A 3IQLA 2LX7A 3RBBB 2RQUA 4LUEA 1I07A 4Z8AA 3M0QA 2CSIA 2J06A 5FWBA 1AWOA 2KT1A 2KYBA 3H41A 3UATA 2BTTA 2SEMA 2JM8A 3PVQA 1ABQA 2LNHB 2YUOA 1K9AA 1QLYA 1SRMA 2DLPA 1SRLA 2MCNA 2KE9A 4X1VA 2LQNA 2L3QA 3VS5A 1YP5A 2B86A 2GBQA 2RF0A 2LZ6B 4GBQA 1JQQA 1PWTA 1WFWA 2DE0X 2O9SA 3CQTA 3EHQA 1U3OA 1HSQA 1KJWA 1WXTA 1ZUYA 2DL5A 2JM9A 1X6BA 1E6GA 4HCKA 2F2VA 1GFCA 2DF6A 2GNCA 1JU5C 2JW4A 3GBQA 1Z9ZA 4JPBW 3QWXX 2J6FA 2EPDA 2G6FX 2FEIA 4E6RA 2C0OA 1I0CA 1UFFA 2GQIA 2OI3A 1H3HA 2DX1A 1E6HA 1U06A 2EGAA 2J6OA 3I35A 2OAWA 1AVZC 4JJDA 1KIKA 3M0TA 1TUCA 1QKXA 2F2WA 4HVVA 2KRMA 2DL8A 2FPEA 1ZX6A 5I11A 5GJVB 4CC7A 1ZBJA 4RTTA 2KROA 4RTWA 3VS1A 1X2QA 1NLPC 1T0JA 1GL5A 2FPDA 4LE9A 2A37A 2HBWA 2M51A 2L2PA 1CKAA 3M0UA 2C0TA 2KT8A 1K0XA 2V1RA 1AOJA 2EYYA 2D1XA 2HCKA 1BB9A 1UHFA 4LNPA 1H8KA 4EIKA 2DJQA 2F2XA 3EG0A 1PRMC 3PE0A 2V1QA 4CC4B 2A28A 1GCQA 2KXCA 3VRZA 2ROLA 1QWEA 2FRYA 2KGTA 4RTUA 2DL7A 1X2KA 1UECA 2BZYA 2IIMA 1K0SA 1Y57A 3U23A 1YCSB 2EYWA 1CKBA 2CUDA 1VYVA 1GCQC 1K1ZA 5IHIA 1UJYA 2QDLA 2FG0A 1WA7A 2RPNA 2RQRA 1M30A 2AZVA 3M0PA 2CREA 2RNAA 4LN2A 5FW9A 2DM1A 3UA7A 2PZ1A 1GRIA 2L3SA 2KRSA 2EVRA 1AEYA 1HJDA 1M3AA 2KR3A 2PTKA 1N5ZA 3VRYA 2LP5A 4J9BA 1WXUA 2EW3A 2O9VA 4JZ3A 2A36A 1WXBA 5FWCA 1BK2A 3VS6A 1ZLMA 2ROTA 1RLPC 2DL3A 1Y0MA 2LJ3A 1CSKA 4F16A 1WLPB 1FYNA 4RTVA 2OJ2A 1GFDA 4J9CA 1PHTA 5HCKA 2EKHA 2NWMA 1J3TA 1BU1A 2ABLA 4WCIA 1A0NB 2AKLA 2O31A 2O88A 1EFNA 4J9FA 2BZ8A 3ULRB 4HVWA 1ZUUA 4J9IA 3EG2A 1NEGA 2FO0A 1VA7A 1M8MA 3TVTA 2GGRA 1KSWA 2YUQA 1SSHA 3NPFA 1ARKA 1UGVA 2P4RA 3ZL7C 2L3PA 1PRLC 2CT3A 1UTIA 1FMKA 2ESWA 1ABOA 3VS4A 1M3CA 4JJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  3FJ5 A;  1T3L A;  2DNU A;  2DMO A;  1G2B A;  2EYX A;  5IXB A;  4DEX A;  4AG2 C;  4IIM A;  5EC7 A;  3R6N A;  4Z88 A;  4R0K A;  1JO8 A;  2DBM A;  2YSQ A;  4J9E A;  4ZNX A;  3I9Q A;  1GBQ A;  2JMC A;  2GTO A;  1U5S A;  2E5K A;  1UHC A;  3EGU A;  1SEM A;  2AKK A;  2ED0 A;  2LJ1 A;  4D8D A;  4JJB A;  2EQI A;  1W70 A;  3KFV A;  1X6G A;  2W0Z A;  1IO6 A;  1YWP A;  3JV3 A;  2KXD A;  1NYF A;  4Z89 A;  1I1J A;  1VYT A;  3I5S A;  3REA B;  2EGE A;  1WIE A;  2X3W D;  3NGP A;  1QWF A;  3VS3 A;  2DRK A;  1NM7 A;  2RQW A;  4JZ4 A;  4AFZ C;  3THK A;  4J9D A;  4IIO A;  1T3S A;  2L0A A;  2FPF A;  2EBP A;  2DIL A;  2MIO A;  4ESR A;  1JEG A;  4AFS C;  4F17 A;  1WYX A;  1OEB A;  2NUZ A;  3UF4 A;  2CT4 A;  1UDL A;  3VS7 A;  4OML A;  4F14 A;  2D8H A;  2RN8 A;  2CUB A;  1VYU A;  4AFQ C;  4HVU A;  2K7A A;  2KEA A;  2YUP A;  2M0Y A;  2J05 A;  2HSP A;  1H92 A;  3PVL A;  3H0F A;  2JS0 A;  3EG3 A;  2DA9 A;  1WI7 A;  1NYG A;  1Z9Q A;  1TUD A;  4Y92 A;  4RTX A;  1AZG B;  5IHK A;  5IHN A;  1X27 A;  1OPL A;  2ECZ A;  3NMZ C;  1JXO A;  3M0S A;  3RNJ A;  2DVJ A;  3VS2 A;  1KFZ A;  2EYZ A;  1YNZ A;  2K6D A;  1YWO A;  2JS2 A;  2DRM A;  4A63 B;  5IXF A;  2KNB B;  3A98 A;  3UA6 A;  2HEQ A;  1X69 A;  3M0R A;  2RQT A;  2JXB A;  3C0C A;  1AD5 A;  1T0H A;  4OMN A;  4DEY A;  2JMA A;  1PKS A;  1MV0 B;  1S1N A;  1XOV A;  3H0H A;  4QT7 A;  1AWX A;  2AZS A;  3LH5 A;  1MUZ A;  1W6X A;  1PNJ A;  4RTY A;  2J7I A;  3H0I A;  4LUD A;  5I22 A;  2CH4 A;  2CSQ A;  1K4U S;  2W10 A;  3EG1 A;  3I5R A;  1OPK A;  4OMQ A;  3SHW A;  2K9G A;  4K11 A;  2KRN A;  3QWY A;  2EGC A;  1G83 A;  1NLO C;  1M3B A;  4AG1 C;  4KRT A;  2X3X D;  2C0I A;  1X43 A;  1SPK A;  4OMO A;  2DBK A;  4RUG A;  2YDL A;  2MOX A;  4ORZ A;  1AZE A;  1QCF A;  5IH2 A;  4J9G A;  3EHR A;  3TSW A;  2FRW A;  2D8J A;  2BZX A;  4OMP A;  1GBR A;  2O2O A;  1UUE A;  2DYB A;  2ENM A;  4CC2 A;  4J9H A;  2DL4 A;  2PNI A;  1NEB A;  5GJW B;  2CDT A;  3TSZ A;  5ECA A;  4GLM A;  3VS0 A;  1WDX A;  1SHF A;  4FSS A;  3SEM A;  3REB B;  1E7O A;  2VVK A;  3O5Z A;  4OMM A;  2LCS A;  1OOT A;  1ZSG A;  1W1F A;  1BBZ A;  5L23 A;  4RTZ A;  1TG0 A;  2KYM A;  2H8H A;  2LJ0 A;  1UE9 A;  1K76 A;  2KBT A;  1UJ0 A;  2JTE A;  2VKN A;  1GCP A;  4HXJ A;  1LCK A;  1UG1 A;  1WX6 A;  1OV3 A;  1NG2 A;  2SRC A;  2CH4 W;  2VWF A;  4M4Z A;  1SHG A;  2XMF A;  2ED1 A;  2K2M A;  1QKW A;  2A08 A;  2HDA A;  1AWJ A;  1PKT A;  2YT6 A;  2JT4 A;  1B07 A;  1ZUK A;  2K79 A;  1JXM A;  2RMO A;  2LQW A;  2J6K A;  1RI9 A;  1YN8 A;  2LMJ A;  1RLQ C;  1MV3 A;  4D8K A;  2K3B A;  2D0N A;  1B3Q A;  3NHN A;  4AFU C;  1AWW A;  2AK5 A;  2YUN A;  1M27 C;  2I0N A;  2GTJ A;  1RUW A;  4CC3 A;  2RQV A;  1HD3 A;  3IQL A;  2LX7 A;  3RBB B;  2RQU A;  4LUE A;  1I07 A;  4Z8A A;  3M0Q A;  2CSI A;  2J06 A;  5FWB A;  1AWO A;  2KT1 A;  2KYB A;  3H41 A;  3UAT A;  2BTT A;  2SEM A;  2JM8 A;  3PVQ A;  1ABQ A;  2LNH B;  2YUO A;  1K9A A;  1QLY A;  1SRM A;  2DLP A;  1SRL A;  2MCN A;  2KE9 A;  4X1V A;  2LQN A;  2L3Q A;  3VS5 A;  1YP5 A;  2B86 A;  2GBQ A;  2RF0 A;  2LZ6 B;  4GBQ A;  1JQQ A;  1PWT A;  1WFW A;  2DE0 X;  2O9S A;  3CQT A;  3EHQ A;  1U3O A;  1HSQ A;  1KJW A;  1WXT A;  1ZUY A;  2DL5 A;  2JM9 A;  1X6B A;  1E6G A;  4HCK A;  2F2V A;  1GFC A;  2DF6 A;  2GNC A;  1JU5 C;  2JW4 A;  3GBQ A;  1Z9Z A;  4JPB W;  3QWX X;  2J6F A;  2EPD A;  2G6F X;  2FEI A;  4E6R A;  2C0O A;  1I0C A;  1UFF A;  2GQI A;  2OI3 A;  1H3H A;  2DX1 A;  1E6H A;  1U06 A;  2EGA A;  2J6O A;  3I35 A;  2OAW A;  1AVZ C;  4JJD A;  1KIK A;  3M0T A;  1TUC A;  1QKX A;  2F2W A;  4HVV A;  2KRM A;  2DL8 A;  2FPE A;  1ZX6 A;  5I11 A;  5GJV B;  4CC7 A;  1ZBJ A;  4RTT A;  2KRO A;  4RTW A;  3VS1 A;  1X2Q A;  1NLP C;  1T0J A;  1GL5 A;  2FPD A;  4LE9 A;  2A37 A;  2HBW A;  2M51 A;  2L2P A;  1CKA A;  3M0U A;  2C0T A;  2KT8 A;  1K0X A;  2V1R A;  1AOJ A;  2EYY A;  2D1X A;  2HCK A;  1BB9 A;  1UHF A;  4LNP A;  1H8K A;  4EIK A;  2DJQ A;  2F2X A;  3EG0 A;  1PRM C;  3PE0 A;  2V1Q A;  4CC4 B;  2A28 A;  1GCQ A;  2KXC A;  3VRZ A;  2ROL A;  1QWE A;  2FRY A;  2KGT A;  4RTU A;  2DL7 A;  1X2K A;  1UEC A;  2BZY A;  2IIM A;  1K0S A;  1Y57 A;  3U23 A;  1YCS B;  2EYW A;  1CKB A;  2CUD A;  1VYV A;  1GCQ C;  1K1Z A;  5IHI A;  1UJY A;  2QDL A;  2FG0 A;  1WA7 A;  2RPN A;  2RQR A;  1M30 A;  2AZV A;  3M0P A;  2CRE A;  2RNA A;  4LN2 A;  5FW9 A;  2DM1 A;  3UA7 A;  2PZ1 A;  1GRI A;  2L3S A;  2KRS A;  2EVR A;  1AEY A;  1HJD A;  1M3A A;  2KR3 A;  2PTK A;  1N5Z A;  3VRY A;  2LP5 A;  4J9B A;  1WXU A;  2EW3 A;  2O9V A;  4JZ3 A;  2A36 A;  1WXB A;  5FWC A;  1BK2 A;  3VS6 A;  1ZLM A;  2ROT A;  1RLP C;  2DL3 A;  1Y0M A;  2LJ3 A;  1CSK A;  4F16 A;  1WLP B;  1FYN A;  4RTV A;  2OJ2 A;  1GFD A;  4J9C A;  1PHT A;  5HCK A;  2EKH A;  2NWM A;  1J3T A;  1BU1 A;  2ABL A;  4WCI A;  1A0N B;  2AKL A;  2O31 A;  2O88 A;  1EFN A;  4J9F A;  2BZ8 A;  3ULR B;  4HVW A;  1ZUU A;  4J9I A;  3EG2 A;  1NEG A;  2FO0 A;  1VA7 A;  1M8M A;  3TVT A;  2GGR A;  1KSW A;  2YUQ A;  1SSH A;  3NPF A;  1ARK A;  1UGV A;  2P4R A;  3ZL7 C;  2L3P A;  1PRL C;  2CT3 A;  1UTI A;  1FMK A;  2ESW A;  1ABO A;  3VS4 A;  1M3C A;  4JJC A; 
#chains in the Genus database with same CATH topology
 1V1C A;  1RAC B;  1K73 U;  1T3L A;  3MP8 A;  2I2L A;  1LPL A;  5KCO A;  3TU4 K;  4AG2 C;  5KYW B;  3SD4 A;  1M1F A;  1W2B P;  5GAO q;  2E65 A;  5CKF A;  2ZZD A;  3QZ9 B;  4LD9 K;  3MO8 A;  4R0K A;  4PJM A;  1JO8 A;  2YSQ A;  5GAM f;  3CME T;  3OYL A;  2JMC A;  2GTO A;  2OAU A;  2BE9 B;  2VXE A;  1SEM A;  1TUG B;  3QG1 A;  2WSF E;  2FYK A;  2ED0 A;  4D8D A;  2EQI A;  2QQB A;  1W70 A;  5DLQ E;  1IO6 A;  2KXD A;  4Z89 A;  3AT1 B;  2EGE A;  3P8D A;  2X3W D;  3VS3 A;  4OB1 B;  2E3I A;  1ZHI A;  2QDY B;  4Y91 A;  1NPR A;  4A4H A;  2DIQ A;  2FPF A;  3X24 B;  5FRN A;  2MWP A;  1D1B A;  2MIO A;  4ESR A;  2NUZ A;  1UDL A;  1P92 A;  2YRC A;  3CC7 T;  4IUQ A;  4E47 A;  2JOY A;  2RHI A;  4DBF A;  1VYU A;  3X28 B;  4HVU A;  4M7D E;  1IHV A;  4NS5 A;  5GAO p;  2QXF A;  5GAN 3;  2ATC B;  1KQS P;  2M0Y A;  4L5G A;  3RMS A;  1MMN A;  1H92 A;  1Z9Q A;  4Y92 A;  3JCM g;  2E4H A;  8AT1 B;  3VUZ A;  2HKN A;  1FXX A;  1X27 A;  1OPL A;  2ECZ A;  4M78 E;  3NMZ C;  4PK4 A;  3CPW S;  3M0S A;  4IKF A;  2DVJ A;  1QVF A;  4OP0 A;  2RI3 A;  4C92 B;  4N4G A;  4PJO F;  3GF5 A;  4JRQ A;  5FU7 B;  1X69 A;  3QXE B;  4AT1 B;  4EMG A;  1NE8 A;  2KY9 A;  4XU0 A;  2EAY A;  4M75 G;  3C0C A;  1AD5 A;  1T0H A;  3CBP A;  4DEY A;  4HKE A;  1NPP A;  4QT7 A;  1AWX A;  3A8L B;  3OQ5 A;  4LUD A;  1MMG A;  5I22 A;  2CH4 A;  2CSQ A;  2W10 A;  1OPK A;  3SHW A;  4ZGE B;  1H64 1;  4K11 A;  1D0Z A;  3QWY A;  1UGP B;  2C0I A;  4OMO A;  1SPK A;  1IXD A;  3L2R A;  2DBK A;  3OW2 S;  2MPX C;  2DEU A;  1D1A A;  1Y96 A;  3OS5 A;  3SWN A;  3JSC A;  2GF7 A;  1F1B B;  3QDR B;  1GBR A;  2DYB A;  2LCC A;  4JLI A;  2OTL A;  4TVR A;  1NEB A;  3TSZ A;  5LJ3 e;  2K3Y A;  2OTL Q;  1KC8 C;  1VQ8 A;  1BYM A;  4E7H A;  2VVK A;  2H3E B;  1Q81 U;  1I81 A;  3M4G A;  2KMT A;  1I5L A;  2KYM A;  3F70 A;  4A4G A;  3QKJ A;  3HRU A;  1VIE A;  2VKN A;  2CP6 A;  3PMT A;  4II1 A;  4M77 G;  1M2O A;  2CH4 W;  4X9D A;  5HY6 A;  4EMK A;  4JRP A;  4PJL A;  4ZN1 A;  2HL5 C;  1VQ7 T;  2AHJ B;  3CCU A;  1OI1 A;  5CCA A;  2HBP A;  2YT6 A;  3G6E A;  2R5A A;  5CR2 A;  2RMO A;  2LQW A;  3RR6 A;  5CKB A;  2LMJ A;  4D8K A;  4QQG A;  3I56 A;  3SDZ A;  2LCL A;  4QVC A;  1B3Q A;  2YUN A;  3I56 Q;  3ZFJ A;  1Q7Y C;  3V7S A;  1OQK A;  2LX7 A;  5KYY B;  4O6J A;  3RBB B;  2RQU A;  5LJ5 d;  4MZP A;  2J06 A;  4QVD A;  2WSC E;  4C8Q B;  5AT1 B;  2QEX T;  1OYX A;  2GQV A;  4N0A A;  3L2Q A;  3PVQ A;  3P8H A;  3MEV A;  2LNH B;  3DLM A;  2MCN A;  5GAN 8;  2DJZ A;  3MP6 A;  4KUD K;  2L3Q A;  1RAH B;  3JRZ A;  2GBQ A;  1YIT T;  2DEQ A;  2LZ6 B;  4GBQ A;  3FEO A;  2O9S A;  2B8A A;  1U3O A;  2MWO A;  2HD0 A;  3HHT B;  4N4I A;  1XJW B;  3HKS A;  2LDM A;  1Y7X A;  4M7D D;  3H8Z A;  2L3R A;  1KQ1 A;  2OTJ T;  1K9M C;  1BIB A;  1U1S A;  3OYE A;  1W2B S;  3CCL A;  3OW2 A;  2EPD A;  3CCL Q;  1HYO A;  3MEW A;  3CCV A;  1UFF A;  2FZK B;  3CCE A;  1H3H A;  4M78 D;  3CCV Q;  1W4S A;  3CCE Q;  1Q81 R;  1YHQ T;  3SWN C;  3I35 A;  4BI4 A;  1O9S A;  1TUC A;  2VXF A;  4HVV A;  3G4S T;  2QQR A;  2DL8 A;  1BI0 A;  3EH1 A;  5A2Q E;  2FPE A;  1VQP A;  4BUG A;  1M1K U;  2KRO A;  1M90 U;  3QPH A;  2A37 A;  2HBW A;  1FX7 A;  2M51 A;  1S72 Q;  1CKA A;  3M0U A;  5D7U A;  4FW2 A;  3CCS A;  3QZ5 B;  4BY6 C;  1AOJ A;  2HL3 A;  2VUB A;  5CQY A;  1WHH A;  3CCS Q;  5CKH A;  3EFS A;  4KGZ B;  3OBW A;  3CC4 A;  2QQ9 A;  3A5Z B;  3EG0 A;  3S6W A;  3JCM e;  3CC4 Q;  3PE0 A;  1VQN A;  4EMK C;  1ZBX A;  1VQN Q;  3INZ A;  1QWE A;  3VV0 A;  5KYU B;  4RTU A;  1X2K A;  1Y57 A;  2DET A;  1YCS B;  2KVQ G;  2EYW A;  4XTU A;  5KYX B;  1XNI A;  2ZPE B;  1AT1 B;  1VYV A;  1GCQ C;  2VYT A;  1YBY A;  4M7A A;  2RJD A;  1UJY A;  4F7U A;  2QDL A;  2R57 A;  2QA4 T;  4DA4 A;  2RPN A;  2RQR A;  3S3M A;  5LJ5 h;  3OYD A;  1VQM Q;  1RAA B;  1D3B A;  3KUF A;  3EGX A;  2VV5 A;  3OS0 A;  3UA7 A;  2LQ8 A;  2PVO B;  4EMH A;  3X20 B;  4R55 A;  3DLL A;  4MDX A;  1WXU A;  4XTV A;  4DOV A;  2O9V A;  4JZ3 A;  2A36 A;  5FWC A;  1BK2 A;  3VS6 A;  2ROT A;  4N0A C;  4MML A;  2E3H A;  3R6O A;  1LJO A;  4ANJ A;  4KUL A;  2DL3 A;  4DBQ A;  1CSK A;  4F16 A;  2YHT A;  3RKX A;  5IN1 A;  1QVG S;  2LRQ A;  3DKM A;  4KT0 E;  5J3B A;  3VYH B;  3GIB A;  3VU3 C;  1RAF B;  2BIV A;  3M54 A;  4J9F A;  4HVW A;  2DTI A;  3DB3 A;  1NJI C;  1KSW A;  3JCM c;  2JJ9 A;  1ARK A;  1VQ4 T;  1PRL C;  4J6Y A;  3CCM A;  9ATC B;  3MHX A;  3DB4 A;  3CCM Q;  3G71 A;  5HK3 A;  2ESW A;  2JN0 A;  4XU1 A;  4JJC A;  2NUT A;  5GAN j;  1M1K R;  5KYN A;  3G71 Q;  4M77 A;  2DNU A;  3JCM f;  1G2B A;  3GOX A;  1M90 R;  1R8O B;  1I8F A;  4C8Q G;  2CZ1 B;  4XQ3 A;  3RDV A;  3CMA T;  3FLG A;  3G1J A;  4CRI A;  3OBY A;  3NFC A;  4ZNX A;  3I9Q A;  2DTO A;  3M9Q A;  3HRS A;  1FMV A;  1EX4 A;  1JJ2 P;  1WGS A;  2LJ1 A;  3HFO A;  4PJN A;  3MKD A;  2M02 A;  4CI0 C;  3PMI A;  4RCC A;  3KFV A;  3MP1 A;  5KYW A;  1YJW A;  1Q82 C;  3EG9 A;  1YWP A;  2X4X A;  2LTO A;  1MMD A;  4M75 B;  3M53 A;  1EZZ B;  1NYF A;  4QW2 A;  4JS5 A;  3TQ7 P;  2R5M A;  1XTD A;  1WIE A;  3BDU A;  1YI2 T;  1VQ5 A;  2D0Q B;  1NM7 A;  2L89 A;  2LT4 A;  2RQW A;  3OSV A;  3THK A;  4J9D A;  1RL2 A;  2DER A;  4FYV B;  2GFU A;  2HQE A;  4WF2 A;  3UT1 A;  4F17 A;  1QCN A;  1FMW A;  5A0D A;  3VS7 A;  3CCJ A;  2E1H A;  3M4Y A;  3TRE A;  4M7A C;  2CUB A;  2EQU A;  4AFQ C;  3CCJ Q;  2K5I A;  2YLC A;  3E19 A;  2HKQ B;  2YUP A;  4X34 A;  2WSE E;  2RI5 A;  1SKU B;  5HKC A;  2JS0 A;  4FT2 A;  1WI7 A;  3ZBD A;  1U1T A;  2IG0 A;  1LNX A;  3HL8 A;  4D6W A;  1KD1 U;  5IHK A;  2EJG A;  3V8K A;  4BAC A;  4C5E A;  1SG5 A;  3RNJ A;  3VS2 A;  5GAM j;  1VQO T;  4FIB A;  2P0P A;  1B7T A;  1KFZ A;  1WHG A;  4C0D B;  1Q82 U;  1YNZ A;  1YWO A;  4BD3 A;  2XDP A;  1N8R C;  2PQW A;  1BCM A;  1QVG A;  4J7F A;  4PJO B;  1M1G A;  1Q95 G;  2E6Z A;  3GNF B;  1K8A C;  4YTL A;  4OMN A;  2JMA A;  4IUT A;  1VQ9 T;  2J7I A;  2QTV A;  3H0I A;  4FYW B;  3CC2 A;  4C92 A;  3I5R A;  1YJN Q;  1ZSZ B;  1VQ6 T;  5KE3 A;  3CC2 Q;  4IUV A;  4AG1 C;  2CP7 A;  1PSE A;  4RUG A;  2YDL A;  1AZE A;  3PT9 A;  4A53 A;  2VGM A;  4MDW A;  4B6M A;  1UB4 A;  4OMP A;  3JB9 J;  2P0K A;  4M77 C;  4ZN3 A;  4DBR A;  1Y07 A;  2DL4 A;  3QHS A;  1VQK A;  2V8K A;  3VS0 A;  2EYQ A;  1VQK Q;  1I5O B;  2LCS A;  1OOT A;  3CME Q;  1IRX A;  1IHW A;  1G3W A;  2QK0 A;  1W1F A;  3OYG A;  2LJ0 A;  2EQM A;  2M0O A;  2KBT A;  2VB6 A;  2HMA A;  3VYG A;  1OV3 A;  1NG2 A;  5D6W A;  4M7A F;  2YLB A;  4F7U F;  4E7I A;  3EH2 A;  4QVZ A;  1ZA1 B;  2XMF A;  4M7D G;  2A08 A;  1AWJ A;  2HDA A;  1PKT A;  5LJ3 d;  4E2F B;  1M8V A;  1HK9 A;  1VIF A;  4EDU A;  1M2V B;  4XTZ A;  4DQ2 A;  3CC7 A;  2K79 A;  1JXM A;  4A54 A;  1OX9 A;  1OU8 A;  3CC7 Q;  3PFS A;  1RLQ C;  1MV3 A;  3WXM B;  1KD1 R;  2D0N A;  4M78 G;  4XTY A;  3QSU A;  3NHN A;  4AFU C;  2G3R A;  1AWW A;  2AK5 A;  1G3S A;  3M56 A;  1QVP A;  3EFO B;  2ZPB B;  4ZGD B;  5EG2 A;  1Q82 R;  1HD3 A;  1C6V X;  2CS7 A;  1Y71 A;  1I07 A;  4Z8A A;  3M0Q A;  5L8R E;  1AWO A;  5IT9 E;  2XG8 D;  3H41 A;  5LJ5 g;  3CXC A;  2BTT A;  2R58 A;  1ABQ A;  5FRO A;  4ZGJ B;  2HAX A;  2GCX A;  2KE9 A;  1QP3 A;  4X1V A;  4EPC A;  5KCH A;  1X6O A;  1IZ6 A;  2V8J A;  4N4H A;  3VS5 A;  1YP5 A;  3BE3 A;  4IUP A;  3CBM A;  1N9R A;  5KYY A;  2JNG A;  4PL6 A;  1JQQ A;  3JCM X;  3EHQ A;  2H3J A;  2JTM A;  2XDD A;  1KJW A;  1WXT A;  2XHC A;  1ZUY A;  4BE2 A;  4C8Q A;  1K73 R;  1UGQ B;  4HCK A;  2KAF A;  1KK7 A;  1OUL A;  3OYC A;  2GNC A;  2RO0 A;  4M77 F;  3GBQ A;  2F5T X;  4C92 C;  4PFZ A;  4RG2 A;  4JPB W;  4M7A E;  3FC3 A;  4F7U E;  2J6F A;  3M5A A;  1RAB B;  3VJP A;  1D0X A;  2G6F X;  3ZEH A;  5FU7 C;  2FEI A;  2QAS A;  3GNG A;  3LWI A;  5GAN 7;  1I0C A;  1EIF A;  2OI3 A;  2DX1 A;  3Q1J A;  4RG8 A;  2J6O A;  2ZGW A;  3OMG A;  1M9S A;  3M0T A;  1NBE B;  3HSB A;  4ZTF A;  2DXC A;  5GAN g;  1D1C A;  2XID A;  5I11 A;  3I55 T;  4RTT A;  2KSS A;  5GAO r;  1LOJ A;  1QP2 A;  4PJO G;  1T0J A;  3OMC A;  2L5Q A;  4MMK A;  2KDS A;  1VQ8 T;  3VS4 A;  1K0X A;  2D9T A;  5D6Y A;  2EYY A;  2ZPF B;  2FHD A;  5LJ3 h;  1UHF A;  4LNP A;  4HCB A;  3KXT A;  3JB9 F;  3OYJ A;  2LVM A;  5C0M A;  4EIK A;  3UWN A;  4LDU A;  2F2X A;  1VQ7 Q;  1PRM C;  2EQK A;  2KK4 A;  1GCQ A;  2BKD N;  4OB3 B;  3VRZ A;  2COY A;  2KGT A;  1WPY A;  2ZPH B;  1UEC A;  2IIM A;  1Q86 C;  3M57 A;  4LDW A;  4BDY A;  1CKB A;  3CCU T;  1K1Z A;  3EGD B;  1ZQ1 A;  4A4K A;  1KC8 U;  3G6E T;  1M30 A;  4M77 E;  3CCQ A;  3M0P A;  1YIJ T;  1PCX A;  1G3T A;  3CPW A;  2Y4Y A;  3CCQ Q;  2RNA A;  5FW9 A;  2XIC A;  3JCM Q;  5LL6 S;  2PVD B;  2P0Q A;  2PZ1 A;  4BI3 A;  3I56 T;  2EVR A;  1HJD A;  2KR3 A;  3RKY A;  3JCM d;  2PTK A;  2HQX A;  5KYX A;  2LP5 A;  4J9B A;  2QEX Q;  2EWN A;  1ZLM A;  2DKG A;  2O4X B;  1YIT A;  1R0B G;  4FL6 A;  4NL3 A;  1Y0M A;  1YIT Q;  3JCM V;  4FSX A;  5GAM g;  2DZ9 A;  4C92 F;  5I2S A;  1FYN A;  5A0G A;  1SSF A;  2OJ2 A;  1GFD A;  3MEU A;  5LJ3 f;  2L8D A;  3H9N A;  3VKI A;  3FB9 A;  5D6X A;  2NWM A;  1J3T A;  1MGQ A;  2A3L A;  2X9H A;  4MZM A;  2AKL A;  5CQX A;  1Q86 U;  1BI2 A;  3ULR B;  4C8Q C;  4XU3 A;  3A8O B;  4J9I A;  3EG2 A;  5A0L A;  1Y96 B;  1VA7 A;  4C5I A;  4C5G A;  3TVT A;  4QQD A;  1PD1 A;  1Q7Y U;  2XDB A;  4KH0 B;  1TH7 A;  1RAE B;  2DD4 A;  1UGV A;  3OYB A;  4JLG A;  4VUB A;  4FU6 A;  3ZL7 C;  4PFP A;  2EJF A;  1QVF P;  1NZ9 A;  2QYZ A;  2DAQ A;  2NUP B;  1YHQ A;  1FMK A;  3CXC P;  2YRD A;  2FZG B;  1YHQ Q;  1M3C A;  3SFM A;  4B9X A;  3CCL T;  3E9G A;  3M59 A;  3FJ5 A;  2X4Y A;  3G4S A;  5IXB A;  1C0M A;  3X25 B;  3CCV T;  4DEX A;  1R0C B;  3G4S Q;  3CCE T;  5GAO m;  1BIA A;  4IIM A;  4DBH A;  1S72 A;  4XTX A;  2DBM A;  3X26 B;  1TS9 A;  2DTH A;  1PC0 A;  1MND A;  2E5K A;  1AHJ B;  2AKK A;  2YXY A;  4JJB A;  1VQP T;  4Y28 E;  2Y4X A;  1K9M U;  2CP3 A;  4PLL A;  4AMC A;  1KQS S;  4M7A D;  3PTA A;  2QGF B;  4LDX A;  1I1J A;  1VYT A;  2FVU A;  4BB7 A;  3REA B;  3CD6 A;  1KC8 R;  3QO3 A;  4WTO B;  4C92 E;  3CD6 Q;  2IPO B;  1VQL A;  4JZ4 A;  3QII A;  4IIO A;  5LJ5 e;  2L0A A;  2DIL A;  1VQL Q;  4NL2 A;  1JEG A;  4AFS C;  5KE2 A;  1WYX A;  1VQM A;  3UF4 A;  2CT4 A;  1VQN T;  1MHN A;  4C5H A;  4OGE A;  2EIF A;  2DIG A;  2D8H A;  2QTX A;  4M75 A;  4LDY A;  3ER0 A;  3BDL A;  5LJ5 j;  3P8B B;  3JCM h;  2ZAE A;  2J05 A;  2HSP A;  1VOM A;  3H0F A;  1GXI E;  2DA9 A;  1NYG A;  1TUD A;  1AZG B;  2AT1 B;  5IHN A;  3CCR T;  1JXO A;  2X4J A;  3E2U A;  2K57 A;  7AT1 B;  2EYZ A;  1M4Z A;  4C8Q F;  1Q86 R;  3BW1 A;  3GPL A;  2YWW A;  2DXU A;  3A98 A;  1Q7Y R;  3UA6 A;  3V8J A;  4JRK A;  2RQT A;  4ME7 A;  3GP8 A;  2JXB A;  4JRI A;  3OS1 A;  1W2B A;  2COW A;  3SB2 A;  3UDC A;  4M7D B;  1XOV A;  2DZC A;  2AZS A;  3CPW P;  5GAN e;  1PNJ A;  2DXB A;  4M77 D;  3EG1 A;  4OMQ A;  1VQ4 A;  3C4S A;  1ZA2 B;  2KRN A;  2EGC A;  1G83 A;  4BDZ A;  1NLO C;  1VQ4 Q;  3FIF A;  1BCO A;  4KRT A;  2X3X D;  1X43 A;  4HT9 A;  4M78 B;  5GAN 2;  2MOX A;  4ORZ A;  3LX7 A;  5IH2 A;  3TSW A;  5DY9 A;  2D8J A;  2BZX A;  2JUF A;  2BE7 D;  4J7I A;  3TCJ A;  3CCM T;  1UUE A;  4CC2 A;  2YRV A;  1TU0 B;  2A7Y A;  3G7Z A;  2PNI A;  3G71 T;  1ZSZ A;  4GLM A;  1WDX A;  1SHF A;  1K9M R;  3REB B;  1E7O A;  1G8X A;  3O5Z A;  2E10 A;  1BBZ A;  3OA6 A;  5L23 A;  4C0F A;  3OW2 P;  1X01 A;  2H8H A;  5GAN 6;  1YJ9 A;  1NJI U;  1SF9 A;  4XTW A;  4L6V 5;  1KQS A;  1YJ9 Q;  2JTE A;  2VC8 A;  2XKO C;  4PLI A;  1GCP A;  3MEA A;  5AYF A;  4HXJ A;  4C8Q E;  3JB9 D;  4HCC A;  1WX6 A;  2SRC A;  2NYS A;  2VWF A;  4M4Z A;  2ED1 A;  1G5V A;  1R77 A;  1QKW A;  3S3N A;  1YJW T;  2JT4 A;  5GMK h;  2XD0 A;  1D3B B;  4J8O A;  1B07 A;  3J81 E;  4KBM B;  5CO7 A;  2J6K A;  1RI9 A;  2PUK B;  1VQ5 T;  5CIU A;  2DO3 A;  4M75 C;  5GAM e;  1HXD A;  2GTJ A;  3A1P A;  3PIO A;  1RUW A;  2P84 A;  2RQV A;  2PVG B;  1QW1 A;  4LUE A;  5FU6 B;  1M2V A;  5GAN f;  5FWB A;  1VQO Q;  3UAT A;  2EQJ A;  4FYY B;  2SEM A;  2JM8 A;  2COZ A;  3OYF A;  2DLP A;  4F04 B;  3NTI A;  2RB6 A;  2CZ0 B;  3MPU B;  2LQN A;  1FWZ A;  4C92 D;  2B86 A;  3CBO A;  3N5B B;  2DE0 X;  3CQT A;  1QVF S;  2BUD A;  1HSQ A;  3J7A F;  1RI0 A;  3QBY A;  1G3Y A;  1OZ3 A;  1VQ9 A;  5J39 A;  4MZT A;  1YJN A;  3QJ6 A;  4NOY A;  1X6B A;  1E6G A;  1VQ9 Q;  1GFC A;  4C0D C;  4J5Y A;  1JU5 C;  3QWX X;  4PJO C;  3OYI A;  1B34 B;  8ATC B;  4E6R A;  2C0O A;  1MMA A;  2EFI A;  3CC2 T;  2K3X A;  4QQ6 A;  2NLU A;  3O8V A;  1E6H A;  1U06 A;  3RKW A;  2K5L A;  1N8R U;  1AVZ C;  4O5V A;  1KIK A;  3CME A;  1QKX A;  2F2W A;  1NJI R;  4FYX B;  2KRM A;  3LW5 E;  1ZSZ C;  4OB0 B;  3EG9 B;  1K8A U;  1ZBJ A;  4RTW A;  3T9N A;  2RD1 A;  3VS1 A;  2HNI A;  1NLP C;  3V8L A;  1VQK T;  3A8H B;  3L42 A;  1GL5 A;  2QI2 A;  2L2P A;  1XQH A;  2KT8 A;  2XK0 A;  4IUR A;  1BB9 A;  3ME9 A;  4M75 F;  3OSS C;  1JB0 E;  4LDV A;  2V1Q A;  5GAN 4;  2A28 A;  1TSF A;  1N9S A;  2KXC A;  3D7S B;  2ROL A;  2FRY A;  1V29 B;  2X35 A;  1K0S A;  3U23 A;  3MET A;  2E12 A;  3JB9 I;  4BE1 A;  3JB9 H;  1WA7 A;  4ELZ C;  2AZV A;  2V8I A;  3LGF A;  3PGG A;  1ACM B;  2E41 A;  2CRE A;  2K4Y A;  1PD0 A;  4E7S A;  3WVE B;  1GRI A;  2X4W A;  3BY7 A;  1U8R A;  4A4E A;  1H3Z A;  1ABO A;  1N5Z A;  3VRY A;  2EW3 A;  1IB8 A;  3EGD A;  4XK8 E;  2DK3 A;  4C8Q D;  2ZPI B;  1RLP C;  2AIR B;  4B9W A;  3M58 A;  1WLP B;  4RTV A;  4J9C A;  1PHT A;  4M7A G;  4KGV B;  2VGN A;  4F7U G;  2EKH A;  1BKB A;  1MNE A;  2RJC A;  1BU1 A;  2ABL A;  4RKU E;  4WCI A;  1Q81 C;  3E9F A;  2F1L A;  2XI9 A;  2KI7 A;  2O31 A;  2O88 A;  1ZUU A;  1N27 A;  1NEG A;  1M8M A;  3S3O A;  2O4X A;  3RER A;  1JBM A;  3CPF A;  1N8R R;  4FCY A;  1TOV A;  2RM4 A;  5I21 A;  4M75 E;  2P4R A;  3HP9 A;  2CT3 A;  2K5F A;  1JJ2 S;  1QVG P;  4X9C A;  1WNL A;  1K8A R;  4LD6 A;  2F5K A;  2DMO A;  2EYX A;  4PNO A;  1WJS A;  3L2Z A;  3I55 A;  5EC7 A;  4IUU A;  2JTF A;  4P5N A;  3R6N A;  2O01 E;  4Z88 A;  4JUV A;  3AHU A;  3I55 Q;  2OTL T;  1WQ7 A;  2RHX A;  4J9E A;  2NUP A;  1GBQ A;  1U5S A;  1UHC A;  3EGU A;  1VUB A;  1VQ8 Q;  2RHY A;  2M1H A;  1VQ7 A;  3QDF A;  4J6X A;  5CAI A;  5LJ3 j;  4FM4 B;  1X6G A;  2W0Z A;  2DYI A;  4DOW A;  3JV3 A;  1O75 A;  3HTR A;  2CGH A;  4A4F A;  3I5S A;  1UGR B;  4E7Z A;  3NGP A;  1QWF A;  2DRK A;  4AFZ C;  1T3S A;  4PJO E;  5GMK m;  2EBP A;  2HSE B;  2MAM A;  1RAI B;  1OEB A;  3CCU Q;  1KHI A;  3LH0 A;  4OML A;  4F14 A;  1YIJ A;  2RN8 A;  2CP0 A;  3G6E Q;  4E7L A;  2K7A A;  1YIJ Q;  2KEA A;  4BI8 B;  1WHJ A;  5KYU A;  4ATO A;  3V7R A;  3OYA A;  2QEX A;  3PVL A;  1KQ2 A;  3EG3 A;  2RHZ A;  1C1A A;  1PG5 B;  4RTX A;  2OX7 A;  3CCQ T;  1OZ2 A;  3ASK A;  3QJY A;  1QMC A;  2RJF A;  2K6D A;  3FJP A;  2JS2 A;  2DRM A;  4A63 B;  5IXF A;  4HCZ A;  3OYY A;  2KNB B;  2VAS A;  3JCM b;  2HEQ A;  4KH1 B;  2RH2 A;  1IRE B;  1WJR A;  3JB9 G;  3M0R A;  2DPP B;  1BI1 A;  2CP2 A;  2K2V A;  4E7J A;  1M1K C;  2OTJ A;  1PKS A;  3SWN B;  1MV0 B;  1S1N A;  3H0H A;  1M90 C;  2DXT A;  4QKU A;  2OTJ Q;  3LH5 A;  1MUZ A;  1W6X A;  4RTY A;  1KHC A;  1WHM A;  1OX8 A;  5I2M A;  1K4U S;  3JCM W;  4KUI A;  5J26 A;  2K9G A;  3L2V A;  1JJ2 A;  2Z0W A;  3QUI A;  4PKC C;  1M3B A;  2FZC B;  3L2U A;  2PUO B;  2WAC A;  1DJ7 B;  1QCF A;  4J9G A;  3EHR A;  2IVW A;  4Q5W A;  4M7D A;  2FRW A;  2QQA A;  1WZO A;  4Z02 A;  2QAZ A;  2MI6 A;  2O2O A;  4BY6 B;  2ENM A;  3JCM J;  4OGC A;  4J9H A;  2DD5 A;  5GJW B;  2CDT A;  2JVV A;  5ECA A;  3OS2 A;  6AT1 B;  2E70 A;  4FSS A;  3SEM A;  5GAN d;  3NTH A;  4J6W A;  4EMK B;  4OMM A;  2CZ7 B;  3OYM A;  1ZSG A;  3H6Z A;  2LNV A;  4M78 A;  4RTZ A;  3MJX A;  3GLX A;  3M55 A;  1TG0 A;  2Y90 A;  4C92 G;  1VQP Q;  5FRM A;  1UE9 A;  1K76 A;  4UC4 A;  1S72 T;  1UJ0 A;  1YCY A;  1LCK A;  1YFN A;  2EKO A;  2RI2 A;  3CCS T;  3HPW A;  1UG1 A;  3QYG B;  4M75 D;  3RMQ A;  5FLX E;  4OB2 B;  1SHG A;  2RK1 A;  3CC4 T;  2K2M A;  3OB9 A;  2QA4 A;  4PJJ A;  4OMF B;  3JAM E;  2RHU A;  2XU8 A;  1ZUK A;  2QA4 Q;  3CD6 T;  4HT8 A;  3RIR A;  2ZCF B;  2ZPG B;  1YN8 A;  5DLO A;  2C06 A;  3C95 A;  1I4K 1;  1VQL T;  2K3B A;  1D09 B;  2CP5 A;  2HZY A;  3RES A;  5IAY A;  1M27 C;  2I0N A;  1VQM T;  3UPU A;  1RAD B;  4CC3 A;  1WQW A;  3IQL A;  3CCR A;  2D6F A;  2CSI A;  4C0G A;  3CCR Q;  1IGQ A;  2KT1 A;  2KYB A;  1PSF A;  2V26 A;  4GLK A;  3BFM A;  4V2S A;  3CEY A;  5GAO n;  5CKD A;  2CKK A;  2MYS A;  2RA2 A;  2YUO A;  1K9A A;  1QLY A;  1SRM A;  2DVE A;  1SRL A;  2MK5 A;  2M16 A;  2M9U A;  2FL7 A;  5GAM d;  2QG9 B;  2RF0 A;  4E7K A;  4PJO D;  1PWT A;  1WFW A;  3JCM P;  3FDR A;  1WJQ A;  2DL5 A;  2JM9 A;  1UEB A;  2F2V A;  2DF6 A;  3LGL A;  4FW1 A;  4PJO A;  5CVI A;  2E64 A;  1TTH B;  2JW4 A;  5CK9 A;  1V76 A;  1Z9Z A;  5GMK l;  4GY5 A;  4BE0 A;  1LVK A;  1IGU A;  1BI3 A;  1TXQ A;  3PIP A;  3C12 A;  3URG A;  3TEE A;  2GQI A;  3OYH A;  3CMA A;  1WHK A;  2EGA A;  3EAE A;  4J83 A;  5GAN h;  4M7D C;  2PU9 B;  3CMA Q;  2OAW A;  5LJ5 f;  4JJD A;  1KG1 A;  3EFR A;  3KBG A;  3OYK A;  1D0Y A;  2A0F B;  3PNW C;  3C94 A;  1ZX6 A;  2EJ9 A;  1B34 A;  5GJV B;  4CC7 A;  2DFU A;  3HRT A;  3MCA B;  2LC4 A;  4LXC A;  4M78 C;  3A8M B;  1X2Q A;  2FPD A;  4LE9 A;  2LT1 A;  1KD1 C;  2C0T A;  1YI2 A;  2V1R A;  5GMK e;  4JJN K;  2D1X A;  2HCK A;  4M7A B;  4F7U B;  4ELY C;  1YI2 Q;  2MMP A;  1H8K A;  3LLR A;  1YJ9 T;  2DJQ A;  1TWB A;  4CC4 B;  3EGX B;  1YJW Q;  1N6A A;  3NTK A;  5LJ3 g;  5GMK j;  4C0Z A;  1X75 C;  2LQK A;  3A8G B;  2LX9 A;  2DL7 A;  2BZY A;  5DM7 R;  3OYN A;  5CKE A;  4OF1 A;  4PFO A;  2CUD A;  1VQ5 Q;  5GAN 5;  5IHI A;  3LYI A;  2FG0 A;  4HA8 A;  2P4T A;  4L59 A;  3FRN A;  2QQS A;  3CCJ T;  3E1S A;  3J80 E;  1OU9 A;  2E5Q A;  3L1A A;  2RK2 A;  4KGX B;  5M9O A;  1VQO A;  5GAO l;  4LN2 A;  4RCB A;  2DM1 A;  3L2W A;  2L3S A;  2KRS A;  1AEY A;  1M3A A;  2E6N A;  1K73 C;  2MF2 A;  1RAG B;  3EFO A;  3VUB A;  4XAX B;  1WXB A;  1QQJ A;  3WVD B;  5GAM h;  3LWH A;  1WHL A;  2JZ2 A;  4R56 A;  2HQH A;  2LJ3 A;  3QYH B;  3CXC S;  1PM3 A;  5HCK A;  5FU6 C;  4FT4 A;  1A0N B;  5HK0 A;  3HFN A;  1VQ6 A;  2CZ6 B;  5GMK i;  2NUT B;  1EFN A;  2BZ8 A;  4M77 B;  2FO0 A;  1VQ6 Q;  2GGR A;  4RMO A;  4M7D F;  2YUQ A;  4OVA A;  4XU2 A;  1SSH A;  2CYZ B;  3NPF A;  2F69 A;  1JRI A;  3OY9 A;  3RUX A;  3V7C A;  1YJN T;  2RJE A;  2L3P A;  5C6S A;  2QGG A;  1UTI A;  2KQW A;  1UGS B;  1QCO A;  2FB7 A;  5KH6 A;  4ZTJ A;  1M5Q 1;  2X51 A;  2GFA A;  4JDS A;  4M78 F;  4JS4 A; 
#chains in the Genus database with same CATH homology
 1V1C A;  3FJ5 A;  1T3L A;  2DNU A;  2DMO A;  1G2B A;  2EYX A;  5IXB A;  4DEX A;  4AG2 C;  4IIM A;  5EC7 A;  3R6N A;  4Z88 A;  4R0K A;  1JO8 A;  2DBM A;  2YSQ A;  4J9E A;  4ZNX A;  3I9Q A;  1GBQ A;  2JMC A;  2GTO A;  1U5S A;  2E5K A;  1UHC A;  3EGU A;  1SEM A;  2AKK A;  2ED0 A;  2LJ1 A;  4D8D A;  4JJB A;  2EQI A;  1W70 A;  3KFV A;  1X6G A;  2W0Z A;  1IO6 A;  1YWP A;  3JV3 A;  2KXD A;  1NYF A;  4Z89 A;  1I1J A;  1VYT A;  3I5S A;  3REA B;  2EGE A;  1WIE A;  2X3W D;  3NGP A;  1QWF A;  3VS3 A;  2DRK A;  1NM7 A;  2RQW A;  4JZ4 A;  4AFZ C;  3THK A;  4J9D A;  4IIO A;  1T3S A;  2L0A A;  2FPF A;  2EBP A;  2DIL A;  2MIO A;  4ESR A;  1JEG A;  4AFS C;  4F17 A;  1WYX A;  1OEB A;  2NUZ A;  3UF4 A;  2CT4 A;  1UDL A;  3VS7 A;  4OML A;  4F14 A;  2D8H A;  2RN8 A;  2CUB A;  1VYU A;  4AFQ C;  4HVU A;  2K7A A;  2KEA A;  2YUP A;  2M0Y A;  2J05 A;  2HSP A;  1H92 A;  3PVL A;  3H0F A;  2JS0 A;  3EG3 A;  2DA9 A;  1WI7 A;  1NYG A;  1Z9Q A;  1TUD A;  4Y92 A;  4RTX A;  1AZG B;  5IHK A;  5IHN A;  1X27 A;  1OPL A;  2ECZ A;  3NMZ C;  1JXO A;  3M0S A;  3RNJ A;  2DVJ A;  3VS2 A;  1KFZ A;  2EYZ A;  1YNZ A;  2K6D A;  1YWO A;  2JS2 A;  2DRM A;  4A63 B;  5IXF A;  2KNB B;  3A98 A;  3UA6 A;  2HEQ A;  1X69 A;  3M0R A;  2RQT A;  2JXB A;  3C0C A;  1AD5 A;  1T0H A;  4OMN A;  4DEY A;  2JMA A;  1PKS A;  1MV0 B;  1S1N A;  1XOV A;  3H0H A;  4QT7 A;  1AWX A;  2AZS A;  3LH5 A;  1MUZ A;  1W6X A;  1PNJ A;  4RTY A;  2J7I A;  3H0I A;  4LUD A;  5I22 A;  2CH4 A;  2CSQ A;  1K4U S;  2W10 A;  3EG1 A;  3I5R A;  1OPK A;  4OMQ A;  3SHW A;  2K9G A;  4K11 A;  2KRN A;  3QWY A;  2EGC A;  1G83 A;  1NLO C;  1M3B A;  4AG1 C;  4KRT A;  2X3X D;  2C0I A;  1X43 A;  1SPK A;  4OMO A;  2DBK A;  4RUG A;  2YDL A;  2MOX A;  4ORZ A;  1AZE A;  1QCF A;  5IH2 A;  4J9G A;  3EHR A;  3TSW A;  2FRW A;  2D8J A;  2BZX A;  4OMP A;  1GBR A;  2O2O A;  1UUE A;  2DYB A;  2ENM A;  4CC2 A;  4J9H A;  2DL4 A;  2PNI A;  1NEB A;  5GJW B;  2CDT A;  3TSZ A;  5ECA A;  4GLM A;  3VS0 A;  1WDX A;  1SHF A;  4FSS A;  3SEM A;  3REB B;  1E7O A;  2VVK A;  3O5Z A;  4OMM A;  2LCS A;  1OOT A;  1ZSG A;  1W1F A;  1BBZ A;  5L23 A;  4RTZ A;  1TG0 A;  2KYM A;  2H8H A;  2LJ0 A;  1UE9 A;  1K76 A;  2KBT A;  1UJ0 A;  2JTE A;  2VKN A;  1GCP A;  4HXJ A;  1LCK A;  1UG1 A;  1WX6 A;  1OV3 A;  1NG2 A;  2SRC A;  2CH4 W;  2VWF A;  4M4Z A;  1SHG A;  2XMF A;  2ED1 A;  2K2M A;  1QKW A;  2A08 A;  2HDA A;  1AWJ A;  1PKT A;  2YT6 A;  2JT4 A;  1B07 A;  1ZUK A;  2K79 A;  1JXM A;  2RMO A;  2LQW A;  2J6K A;  1RI9 A;  1YN8 A;  2LMJ A;  1RLQ C;  1MV3 A;  4D8K A;  2K3B A;  2D0N A;  1B3Q A;  3NHN A;  4AFU C;  1AWW A;  2AK5 A;  2YUN A;  1M27 C;  2I0N A;  2GTJ A;  1RUW A;  4CC3 A;  2RQV A;  1HD3 A;  3IQL A;  2LX7 A;  3RBB B;  2RQU A;  4LUE A;  1I07 A;  4Z8A A;  3M0Q A;  2CSI A;  2J06 A;  5FWB A;  1AWO A;  2KT1 A;  2KYB A;  3H41 A;  3UAT A;  2BTT A;  2SEM A;  2JM8 A;  3PVQ A;  1ABQ A;  2LNH B;  2YUO A;  1K9A A;  1QLY A;  1SRM A;  2DLP A;  1SRL A;  2MCN A;  2KE9 A;  4X1V A;  2LQN A;  2L3Q A;  3VS5 A;  1YP5 A;  2B86 A;  2GBQ A;  2RF0 A;  2LZ6 B;  4GBQ A;  1JQQ A;  1PWT A;  1WFW A;  2DE0 X;  2O9S A;  3CQT A;  3EHQ A;  1U3O A;  1HSQ A;  1KJW A;  1WXT A;  1ZUY A;  2DL5 A;  2JM9 A;  1X6B A;  1E6G A;  4HCK A;  2F2V A;  1GFC A;  2DF6 A;  2GNC A;  1JU5 C;  2JW4 A;  3GBQ A;  1Z9Z A;  4JPB W;  3QWX X;  2J6F A;  2EPD A;  2G6F X;  2FEI A;  4E6R A;  2C0O A;  1I0C A;  1UFF A;  2GQI A;  2OI3 A;  1H3H A;  2DX1 A;  1E6H A;  1U06 A;  2EGA A;  2J6O A;  3I35 A;  2OAW A;  1AVZ C;  4JJD A;  1KIK A;  3M0T A;  1TUC A;  1QKX A;  2F2W A;  4HVV A;  2KRM A;  2DL8 A;  2FPE A;  1ZX6 A;  5I11 A;  5GJV B;  4CC7 A;  1ZBJ A;  4RTT A;  2KRO A;  4RTW A;  3VS1 A;  1X2Q A;  1NLP C;  1T0J A;  1GL5 A;  2FPD A;  4LE9 A;  2A37 A;  2HBW A;  2M51 A;  2L2P A;  1CKA A;  3M0U A;  2C0T A;  2KT8 A;  1K0X A;  2V1R A;  1AOJ A;  2EYY A;  2D1X A;  2HCK A;  1BB9 A;  1UHF A;  4LNP A;  1H8K A;  4EIK A;  2DJQ A;  2F2X A;  3EG0 A;  1PRM C;  3PE0 A;  2V1Q A;  4CC4 B;  2A28 A;  1GCQ A;  2KXC A;  3VRZ A;  2ROL A;  1QWE A;  2FRY A;  2KGT A;  4RTU A;  2DL7 A;  1X2K A;  1UEC A;  2BZY A;  2IIM A;  1K0S A;  1Y57 A;  3U23 A;  1YCS B;  2EYW A;  1CKB A;  2CUD A;  1VYV A;  1GCQ C;  1K1Z A;  5IHI A;  1UJY A;  2QDL A;  2FG0 A;  1WA7 A;  2RPN A;  2RQR A;  1M30 A;  2AZV A;  3M0P A;  2CRE A;  2RNA A;  4LN2 A;  5FW9 A;  2DM1 A;  3UA7 A;  2PZ1 A;  1GRI A;  2L3S A;  2KRS A;  2EVR A;  1AEY A;  1HJD A;  1M3A A;  2KR3 A;  2PTK A;  1N5Z A;  3VRY A;  2LP5 A;  4J9B A;  1WXU A;  2EW3 A;  2O9V A;  4JZ3 A;  2A36 A;  1WXB A;  5FWC A;  1BK2 A;  3VS6 A;  1ZLM A;  2ROT A;  1RLP C;  2DL3 A;  1Y0M A;  2LJ3 A;  1CSK A;  4F16 A;  1WLP B;  1FYN A;  4RTV A;  2OJ2 A;  1GFD A;  4J9C A;  1PHT A;  5HCK A;  2EKH A;  2NWM A;  1J3T A;  1BU1 A;  2ABL A;  4WCI A;  1A0N B;  2AKL A;  2O31 A;  2O88 A;  1EFN A;  4J9F A;  2BZ8 A;  3ULR B;  4HVW A;  1ZUU A;  4J9I A;  3EG2 A;  1NEG A;  2FO0 A;  1VA7 A;  1M8M A;  3TVT A;  2GGR A;  1KSW A;  2YUQ A;  1SSH A;  3NPF A;  1ARK A;  1UGV A;  2P4R A;  3ZL7 C;  2L3P A;  1PRL C;  2CT3 A;  1UTI A;  1FMK A;  2ESW A;  1ABO A;  3VS4 A;  1M3C A;  4JJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...