1NM7A

Solution structure of the scpex13p sh3 domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
FARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The ScPex13p SH3 Domain Exposes Two Distinct Binding Sites for Pex5p and Pex14p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Peroxisomal Membrane Protein PAS20
total genus 8
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1nm7A00
4DEXA 2CH4W 2AK5A 1WA7A 1JXMA 1XOVA 2J6KA 1Y57A 2JM8A 3H0FA 4FSSA 1UHCA 3GBQA 1FYNA 1V1CA 1K4US 2CT4A 3M0UA 2DBMA 2BTTA 4RTXA 3H0IA 2EYZA 3I5SA 4RTVA 4OMQA 3SEMA 3NPFA 1VA7A 3PVQA 1QLYA 1YNZA 2H8HA 3TSWA 3H0HA 1KJWA 1ABOA 2W10A 2D1XA 1NEGA 2J05A 2DE0X 1UG1A 1VYUA 2KRNA 2KYBA 1OPKA 2DBKA 1VYTA 5IXBA 1WLPB 2CUDA 4J9GA 3UA6A 2O9SA 1NYFA 1GL5A 1NYGA 4J9HA 2DA9A 4Z88A 1WDXA 1AZEA 2W0ZA 2YUNA 2DL3A 3EHRA 2FPDA 4DEYA 2RQWA 1K1ZA 2F2XA 1QKWA 2XMFA 3IQLA 2ESWA 2M51A 2EGEA 3O5ZA 4J9EA 2LJ1A 2HBWA 2ECZA 3M0RA 3EHQA 1H92A 1GFDA 2RQTA 2YT6A 1K9AA 4Z8AA 1T0JA 2LJ3A 2HEQA 1W1FA 1ZUYA 5GJWB 1CSKA 2ED1A 5I11A 3M0QA 1ZBJA 1K76A 1IO6A 1ZSGA 1G83A 2JW4A 4GBQA 2HDAA 1QKXA 2LQNA 1M8MA 3UATA 1T3LA 1HD3A 3VRYA 2O31A 1ARKA 2C0IA 1GFCA 1AZGB 2LCSA 3QWXX 4CC3A 4JPBW 1UUEA 1NG2A 4JZ3A 4J9IA 2LNHB 1X27A 1X69A 1WIEA 2EPDA 2A28A 2DILA 2KRSA 5I22A 2EQIA 2KBTA 3RBBB 1HJDA 1PKSA 1SSHA 5GJVB 1VYVA 4JJCA 2YUOA 1GBRA 4JJBA 1B3QA 2HCKA 1UTIA 2ROTA 2RNAA 1PWTA 2OJ2A 2V1RA 1U3OA 1WYXA 3I35A 2KNBB 2YSQA 2J6FA 2KROA 5IHKA 1YN8A 1U5SA 2ROLA 4AG1C 1GCPA 1SHGA 1X6GA 2EKHA 2FRWA 5IXFA 1OV3A 1J3TA 1KIKA 4HCKA 2MCNA 1JU5C 5IH2A 2GGRA 3NHNA 2HSPA 2OAWA 1E6GA 1I0CA 3U23A 1WFWA 3ZL7C 2GNCA 4ESRA 1KFZA 1JQQA 1NLPC 2JS2A 4ZNXA 1OEBA 2SRCA 2CH4A 1ZLMA 2L2PA 2YDLA 5L23A 4LNPA 2JM9A 2KT8A 1X43A 4HXJA 2NUZA 4D8DA 2KRMA 2VVKA 3I5RA 4WCIA 1Z9QA 4RTWA 1X2KA 4AFSC 1U06A 3VS3A 4J9BA 4RUGA 5FW9A 2K7AA 2B86A 2RPNA 1LCKA 3UF4A 1PKTA 3LH5A 4OMLA 2DVJA 2O9VA 4F14A 4QT7A 1M3CA 4IIMA 1NLOC 2E5KA 2JMAA 4LUDA 4CC7A 2K79A 2G6FX 1WXBA 1G2BA 2BZ8A 1QWEA 5ECAA 3VS4A 3CQTA 3FJ5A 2SEMA 1H8KA 3M0TA 1E7OA 1PRLC 4HVWA 4ORZA 4RTZA 2L3SA 4HVVA 2L3QA 2NWMA 4OMMA 3NGPA 4F16A 5IHNA 1WXUA 2CT3A 2A37A 2EVRA 1W70A 2DRKA 2J7IA 2LQWA 4Y92A 2LX7A 1K0XA 1YWOA 1I1JA 1QWFA 1ZUKA 2GTJA 3VS1A 2AKKA 2F2VA 2KYMA 3M0SA 1SEMA 1BU1A 1UECA 2QDLA 2DNUA 2D8HA 4A63B 1ZUUA 4R0KA 4JJDA 2X3WD 3TSZA 2MOXA 4D8KA 1WXTA 1YCSB 4K11A 1SPKA 1CKBA 3UA7A 1AVZC 1I07A 3KFVA 2LJ0A 2JS0A 1BK2A 3THKA 2DLPA 1W6XA 3RNJA 1RLPC 2CDTA 1N5ZA 2GTOA 2EYWA 1AEYA 3VS2A 4GLMA 1RI9A 2KE9A 2VKNA 1RUWA 2DL8A 2O88A 2RF0A 2DYBA 4JZ4A 4F17A 2K9GA 2KT1A 1UE9A 2EGAA 4AG2C 1YWPA 3REAB 1A0NB 1QCFA 2FO0A 2RMOA 3EG0A 1UJYA 2FPEA 1NEBA 1M3BA 1B07A 1M30A 2GBQA 2BZYA 2PZ1A 2AZSA 1PNJA 2F2WA 1H3HA 1FMKA 4EIKA 1KSWA 4J9DA 1NM7A 2EYYA 4LUEA 2OI3A 2CREA 4RTYA 4M4ZA 4LN2A 2PNIA 2KEAA 2ABLA 1SRMA 1SHFA 2JXBA 2K6DA 2RQVA 4AFQC 1T0HA 2D8JA 1UFFA 1MUZA 1GCQA 4J9FA 2M0YA 1OPLA 1PHTA 3EG1A 2DF6A 2EGCA 4RTTA 2DX1A 4LE9A 2K2MA 4X1VA 2L3PA 2DL7A 2DM1A 2D0NA 2EBPA 2DJQA 2KGTA 1CKAA 1PRMC 2VWFA 3TVTA 1AOJA 1AWXA 1ABQA 4KRTA 2FRYA 1K0SA 1T3SA 2RQUA 1YP5A 3PVLA 2DRMA 1MV0B 3ULRB 4CC2A 1X2QA 2DMOA 1TUDA 2LZ6B 4E6RA 5FWBA 2MIOA 1EFNA 3R6NA 1JO8A 1MV3A 1AWOA 1S1NA 2PTKA 2DL5A 2C0OA 5IHIA 2P4RA 1GBQA 2FG0A 1Z9ZA 3VS0A 2KR3A 2EW3A 2J6OA 1X6BA 2IIMA 4OMPA 4HVUA 1UGVA 2C0TA 2X3XD 2BZXA 2AZVA 2EYXA 2O2OA 2KXCA 1TUCA 4OMOA 2I0NA 2JMCA 3REBB 3VS6A 3PE0A 2CUBA 5HCKA 1M27C 2RN8A 2ENMA 2FEIA 4J9CA 5FWCA 3VS5A 2JT4A 1HSQA 2K3BA 3I9QA 3VRZA 1RLQC 4IIOA 1E6HA 2GQIA 1M3AA 3JV3A 4AFZC 2LMJA 3QWYA 2KXDA 3A98A 1JEGA 1Y0MA 1UDLA 1WI7A 2YUPA 4RTUA 1AWJA 2V1QA 1UHFA 1GRIA 3EG2A 1ZX6A 2L0AA 1BB9A 1BBZA 1AWWA 3NMZC 2DL4A 1JXOA 2ED0A 2CSIA 3M0PA 2LP5A 3EG3A 2J06A 1UJ0A 1AD5A 2JTEA 2AKLA 1SRLA 5EC7A 4Z89A 1GCQC 1WX6A 3C0CA 1TG0A 2A08A 2RQRA 2FPFA 3SHWA 2A36A 2YUQA 4CC4B 2CSQA 3H41A 4AFUC 4OMNA 1OOTA 3EGUA 3VS7A
chains in the Genus database with same CATH superfamily
4DEXA 1Q82R 3PMTA 1ZA2B 2JM8A 1VQOA 3GBQA 1V1CA 2WSCE 2EYZA 3I5SA 4OVAA 2LVMA 2CP6A 4M7AG 1YNZA 5GAOq 3TSWA 1ABOA 4C5GA 3CC2Q 2VB6A 4BI8B 3L2WA 2A3LA 3P8BB 3V8JA 4EMKC 5GANe 1K9MC 1WPYA 2KYBA 1NPPA 2NUPA 2DBKA 4M7AC 5CQYA 3EGDB 1VQKT 1NYFA 5J26A 4M7AB 1YJ9A 1JB0E 1NYGA 3MEWA 4J9HA 4LDVA 2JTFA 4Z88A 2LDMA 4QVDA 4Z02A 1QKWA 2M51A 1OQKA 2QTVA 1PCXA 3E19A 3I55T 4J9EA 3JB9F 1BI0A 4OB1B 3KXTA 3WXMB 3EHQA 1QCOA 2RQTA 2GQVA 3V8LA 2JJ9A 2YRDA 3OYHA 1T0JA 2LJ3A 1UGPB 2HEQA 2DERA 1CSKA 2ED1A 5I11A 4MDXA 3QO3A 1IO6A 2Z0WA 1G83A 3SB2A 3RERA 4HT9A 3LGFA 1PG5B 1WHLA 1KG1A 3JCMf 4PFZA 1TOVA 4PJOE 1HD3A 4BE1A 1D1BA 2QA4T 1C6VX 4M7DE 5LJ3g 5CQXA 1KQ2A 2I2LA 4CC3A 5GAN7 5CO7A 3JB9H 1X27A 1X69A 5I22A 4C5EA 2KBTA 4KGVB 3MP8A 2XDDA 1VYVA 1N8RR 4II1A 5A0GA 2QI2A 3WVDB 2RNAA 4J6XA 3LX7A 4ZN3A 1WYXA 4XU2A 2KNBB 2YSQA 2KROA 4BDZA 1YN8A 3OS0A 2ROLA 1X6GA 1SHGA 3CCSQ 5GANf 3DLLA 1I5OB 1OV3A 2L5QA 1K73C 1KIKA 4HCKA 3J80E 2MCNA 1PD1A 5FU7C 2GGRA 2DO3A 3GP8A 2OAWA 1E6GA 3ZL7C 3HSBA 4RKUE 1JQQA 4J7IA 4PJOA 2B8AA 1OU9A 1YIJA 3TU4K 1VQNA 2R57A 4HXJA 1D0XA 1PC0A 4D8DA 1VQ7Q 1U1SA 2VVKA 2CP7A 3OBYA 4WCIA 2HL3A 1Z9QA 2H3EB 2HD0A 2F5TX 1U06A 1Q86U 4RUGA 2K7AA 3HRSA 3J81E 1PKTA 3LH5A 4X34A 3M53A 1Y07A 4QT7A 5AYFA 1Q7YU 1N27A 1I81A 4N4GA 4XTWA 2C06A 3CBOA 4E47A 3L2UA 1VQMQ 2FZGB 1KK7A 2SEMA 2DVEA 1YI2A 4OB2B 5KYXA 1B34A 2X4YA 3JCMd 1IHWA 1VQ8T 4F16A 5LJ5g 3LWHA 2CT3A 3HKSA 3I55A 5KCOA 2J7IA 2LQWA 1TTHB 2LX7A 1YWOA 2DETA 1NZ9A 4ZN1A 2D8HA 4FW1A 1YIJT 1ZUUA 2LT1A 2ZPIB 4JJDA 3DLMA 2X3WD 3MJXA 2K4YA 1NJIC 4D8KA 1YCSB 2EQMA 1O75A 2FZCB 3UA7A 1N8RU 3CCMT 3HL8A 2MAMA 4XTYA 1BYMA 5KYUB 1RLPC 2CDTA 1YJ9Q 4YTLA 5FU7B 1UGSB 1N5ZA 1GXIE 1RAGB 4GLMA 2KE9A 2O88A 1VQLQ 2DYBA 4JZ4A 2KT1A 3JCMP 4LDXA 2EGAA 4PJOD 2COWA 1YITQ 2FPEA 1RAEB 3BW1A 3M4GA 5FRMA 2FVUA 3M5AA 2ZPBB 2OAUA 1Q81C 3OYIA 2QA4A 4E7HA 1FMKA 3OYNA 1QVFS 2E4HA 3E9FA 3OYDA 2CREA 4M4ZA 1WJQA 4LN2A 2CP3A 1VQ9A 4FM4B 2ABLA 2JXBA 3CMAA 2K6DA 5HK3A 3JSCA 2D8JA 1VQ5T 4P5NA 1VQ4Q 1BI2A 1GCQA 4J9FA 3EGDA 3FB9A 4ELYC 1PHTA 5IAYA 2LQ8A 4X9CA 4C8QB 2L3PA 1I4K1 3BDUA 3I56Q 2EQJA 2XKOC 1IRXA 2DM1A 2EBPA 2KGTA 3TVTA 1AOJA 3G4SA 1AWXA 2NLUA 4MZPA 5FLXE 2F5KA 1VQ6A 2RM4A 1K0SA 1T3SA 3HP9A 3MCAB 1N9SA 2RB6A 3JRZA 4CC2A 1X2QA 5M9OA 4XTUA 4C92D 5LJ3e 4F7UG 4C92F 2DFUA 2DK3A 1EX4A 2HAXA 2MI6A 5FWBA 1EFNA 2RHZA 1WJRA 3QJ6A 2DXBA 5GMKh 5C0MA 3D7SB 2C0OA 3DKMA 4J8OA 1GBQA 1QVFP 1Z9ZA 2KR3A 4IUPA 3CPWA 2J6OA 2OTLT 1AT1B 5LJ5j 2O4XA 2E12A 3C12A 2BZXA 2AZVA 4X9DA 2EYXA 2O2OA 2FL7A 1MNEA 1WQ7A 3LWIA 2CZ6B 4HT8A 2OTJA 3VS6A 1M90U 4MZTA 2JOYA 1YITA 3OW2S 1M27C 4RG8A 4C5HA 2FEIA 4FSXA 3GIBA 4J9CA 3M54A 1B7TA 4OGCA 2DAQA 2LX9A 4DQ2A 3QG1A 4BDYA 3EG9A 4DBRA 4FYVB 1QP2A 2LMJA 3CCLA 2EAYA 3QWYA 1K9MR 3A98A 1W2BS 1YFNA 4KH0B 1VQNT 3CCLT 4RTUA 1AWJA 2V1QA 1GRIA 2KAFA 4RMOA 3CPWP 2L0AA 1BBZA 3SWNC 2DL4A 2DZCA 1K8AU 4CRIA 1JRIA 2J06A 1UJ0A 1KQSS 1KC8C 1YIJQ 3CCVT 1AD5A 5I2SA 4FT4A 2AKLA 1SRLA 3V8KA 5EC7A 3OYMA 3PT9A 1TG0A 2QK0A 3QYHB 2RQRA 3PIPA 1Y71A 2VV5A 2A36A 1VQMA 4CC4B 7AT1B 2QTXA 3VS7A 2CH4W 1XOVA 4BI4A 4M77C 3QBYA 3CMET 5GAN6 5GMKl 1UHCA 4PJNA 4EMHA 3LGLA 4GLKA 4BD3A 4J5YA 2DBMA 2BTTA 1K8AC 3H0IA 4QW2A 2YRVA 3G6EQ 4JUVA 3CCST 3PVQA 4JRKA 4JJNK 1QLYA 4OMFB 4B6MA 4M77G 3H0HA 5LJ3j 2HQHA 3OYYA 5GMKm 3CCUA 1NEGA 2J05A 4ZTJA 1D0YA 1WHGA 3A1PA 3JB9J 1VYUA 2KRNA 4OF1A 2HKNA 1VQ4A 3M55A 4C92G 1VYTA 4N0AC 1VQ5A 5GAN5 4J9GA 1XTDA 1G3SA 2ATCB 1VQ9Q 2DA9A 3DB3A 4PLIA 4HCBA 2W0ZA 2KMTA 2DL3A 3EHRA 3SWNB 4DEYA 2RQWA 1K1ZA 2XMFA 4C8QE 4C92E 5GAMh 2EGEA 3O5ZA 3CBPA 2XK0A 5LL6S 4WF2A 3M0RA 2Y4YA 3A5ZB 4AMCA 1OX8A 1GFDA 2YT6A 3CCEA 1YI2T 3CC7Q 4IUTA 3MHXA 1ZUYA 5GJWB 3C4SA 3M0QA 1G5VA 1RACB 1ZSZB 1K76A 1MMGA 4WTOB 4F7UF 5A0DA 1M90R 3A8MB 3CCJA 1WHKA 2HDAA 5DY9A 4A4KA 5LJ5h 1QKXA 2CZ1B 3UATA 1T3LA 3V7SA 1RAIB 2RJDA 1TWBA 2RO0A 1AZGB 2LCSA 1VQOT 1XQHA 4J9IA 2LNHB 4DOVA 1WIEA 2GFAA 4XU3A 2E3HA 4GY5A 1D1AA 1HJDA 2LNVA 1PKSA 3MPUB 4C8QA 1QQJA 4JJCA 1RAAB 5A2QE 3HHTB 4E2FB 1QCNA 2OJ2A 2V1RA 2F1LA 3H9NA 5IHKA 3OB9A 1U5SA 1VQ8A 1OZ3A 5IXFA 1M1KR 1J3TA 3A8LB 3OW2A 1JU5C 1Q95G 3JCMh 3OSSC 5DLQE 1Q81U 1I0CA 3U23A 1WFWA 4NS5A 2K5LA 1S72T 1KFZA 2DXCA 3ZEHA 3OMCA 4BY6C 2EIFA 4ZNXA 3TEEA 1QVGA 3CMAT 1BCMA 2RHXA 1VQ9T 2L2PA 5L23A 4LNPA 1VQPA 2KT8A 1X43A 4JLIA 2O4XB 1VOMA 4JRIA 1H641 1TXQA 5GAOn 1BKBA 4AFSC 4DBFA 4EMGA 1HXDA 3UF4A 4F04B 1I5LA 2O9VA 1QVPA 1M3CA 4IIMA 2E5KA 1Q86C 1OZ2A 3I56A 2OX7A 1WXBA 2PQWA 1G2BA 2BZ8A 1MMAA 1QWEA 4A4GA 4FW2A 3VS4A 2RHIA 2XU8A 1H3ZA 3EG9B 2LT4A 1PRLC 4RTZA 1OYXA 4B9WA 3CCLQ 5IHNA 1WXUA 4M77D 2EVRA 4C0ZA 3VJPA 2DTOA 1ZUKA 2GTJA 3VS1A 3G7ZA 2F2VA 5LJ3d 3M0SA 3EFOA 2QDLA 3QZ5B 2GFUA 4M78D 5CAIA 3N5BB 3NTIA 4C8QD 2PVGB 5GAOr 2V8KA 4HA8A 4NOYA 4M7AE 2LJ0A 2HNIA 2DD4A 2JS0A 1I8FA 3I55Q 3THKA 2DLPA 3RNJA 3TCJA 2DEUA 2VASA 1V76A 3CC7A 2EYQA 2YXYA 2VKNA 5KYNA 1SF9A 2RF0A 1VQKQ 2AHJB 4F17A 2K9GA 3MP6A 2FHDA 4FCYA 4M75G 2V26A 1Q86R 4N0AA 3EG0A 3OA6A 4J7FA 3R6OA 2OTLA 1WHJA 3G6EA 3CMAQ 1M3BA 1B07A 2BZYA 2F2WA 1H3HA 4RCBA 1KSWA 4N4IA 2WSEE 4LUEA 1PD0A 2COYA 4RTYA 2BE7D 2PNIA 1SHFA 4FIBA 3JCMg 1YHQQ 4FYWB 3WVEB 1QVFA 4ME7A 1P92A 3OS1A 3VV0A 5GAN2 3CMEQ 2DF6A 4M7DC 4M7AA 4X1VA 1M5Q1 3UDCA 3QUIA 5GAOm 3CCRQ 4KBMB 3QJYA 2D0NA 3META 2VWFA 5KYWA 1HK9A 3AT1B 1UEBA 4JRPA 4M77A 1ABQA 2JN0A 4KRTA 2FRYA 1TH7A 4M7DG 2RQUA 2RHUA 1KD1R 2QGGA 3ULRB 2QASA 2YLCA 1TUDA 2LZ6B 4A4HA 5GANg 5GMKi 3CCET 2DXUA 3UWNA 3CD6A 1JJ2S 1NJIR 2RJFA 4ZGEB 1NPRA 2BKDN 1PM3A 2LCLA 3OYCA 4XTXA 1IZ6A 4L6V5 4OMPA 3G4SQ 3CXCA 2IG0A 2X3XD 4PL6A 4ZGJB 4JS4A 2FZKB 4OMOA 3JB9I 2I0NA 4A54A 3REBB 3PE0A 3OYLA 1KHCA 4A53A 2JNGA 5FWCA 4PJJA 2K3BA 1FMVA 4C8QF 3VRZA 3RKXA 1UGRB 1RLQC 4M78G 1E6HA 4M77E 3F70A 4KUIA 2RHYA 3URGA 4AFZC 4J83A 4XTVA 1JEGA 1VQ8Q 1WI7A 3GF5A 4M7AF 2QQ9A 2E10A 1JJ2A 4M78E 1UHFA 3EG2A 1ZX6A 2QQSA 1AWWA 4MZMA 2LP5A 1Q81R 3GPLA 2VGMA 4M7AD 3CD6T 1VQMT 2GF7A 1VQPT 1G3TA 3VUZA 4F7UE 1PSFA 2YWWA 1VQ6Q 4HKEA 4XTZA 4Z89A 5CCAA 1WX6A 3C0CA 4JS5A 4E7KA 4IKFA 4FU6A 3BE3A 3CCJT 2YUQA 5EG2A 4C8QC 5CR2A 2CSQA 4OMNA 2CS7A 3EGUA 4ANJA 2K5IA 2DJZA 4EDUA 1WA7A 3JCMW 2J6KA 4HCCA 2NUTA 3G71A 2RK1A 3H0FA 1M2VB 4FSSA 3L42A 1FYNA 1K4US 5FRNA 1N8RC 2CT4A 4IUQA 3M0UA 3OQ5A 2RJEA 3TREA 4XU0A 1PSEA 3C94A 2NUTB 3NPFA 3G1JA 4NL2A 1NJIU 2H8HA 1UGQB 3X25B 3QKJA 3L1AA 1D3BA 5GAN8 4KH1B 3HFOA 3FJPA 2KVQG 4XQ3A 1OPKA 1KHIA 5IXBA 3HRUA 3RKWA 2OTJQ 4M75E 3UA6A 1D3BB 2O9SA 2L8DA 5KCHA 1C1AA 4PK4A 3UPUA 3P8HA 3CC7T 3CCEQ 2F2XA 2XDBA 4KGXB 3IQLA 2ESWA 2LC4A 4LXCA 5KYYB 2ECZA 1ZSZA 4A4EA 6AT1B 2QQAA 3EGXB 4BI3A 3QSUA 1H92A 2QG9B 2ZPHB 3CCQA 1K9AA 2RD1A 4IUVA 3ZFJA 1W1FA 1RAFB 5KE2A 3JCMe 5DLOA 5KH6A 4QVCA 1ZSGA 1FWZA 1N9RA 3AHUA 4GBQA 2P0QA 3BFMA 1TSFA 2LQNA 2E65A 2E3IA 2P0KA 5GAMg 3HFNA 3CCVA 3QXEB 5AT1B 3OYKA 4BB7A 3FRNA 3FEOA 4M75A 3M58A 4PFOA 4KGZB 1NG2A 2EPDA 2A28A 2DILA 2KRSA 4EPCA 3OS5A 1M2OA 1SSHA 2Y90A 8ATCB 3CCSA 1GBRA 2YUOA 4JRQA 2HCKA 1QVGP 3C95A 3I56T 1PWTA 5KYWB 3E2UA 1YJWT 4AG1C 3KBGA 4M77B 1GCPA 1C0MA 2EKHA 2FRWA 1R0BG 2V8JA 1Y96A 2QEXA 2WSFE 5IH2A 3NHNA 4LDUA 4BE0A 3TQ7P 2YHTA 2O01E 3PMIA 4QQDA 2DIGA 1Q7YC 4ESRA 1YITT 4F7UB 5CKFA 2XHCA 2OTJT 1NLPC 3CD6Q 5LJ3h 5CVIA 1KQSA 2MYSA 1OEBA 2X4JA 1JBMA 1D0ZA 2CH4A 1ZLMA 2YDLA 3RKYA 2EFIA 4BY6B 2M1HA 5GANd 1KD1C 5D6WA 2P0PA 5IT9E 2GCXA 2WACA 3EFSA 1M1GA 1X2KA 2LQKA 2X4WA 2L89A 3QIIA 4J9BA 1LCKA 2JUFA 4DBQA 5J3BA 4PLLA 4IURA 1NLOC 3X20B 2CP0A 4CC7A 3JCMV 3QPHA 2G6FX 2R58A 3G71Q 1YJNA 3MKDA 3INZA 1MNDA 4QQGA 4OP0A 2EJGA 3OYFA 1EIFA 1H8KA 4ORZA 4HVWA 2L3SA 3EFOB 4HVVA 3SD4A 2IPOB 3NGPA 3RR6A 5CIUA 1X75C 1EZZB 2DRKA 4Y92A 3GNGA 1VIEA 3RIRA 1K0XA 4EMKA 3JCMQ 1I1JA 2E6NA 1QWFA 4M75D 5L8RE 2AKKA 5D7UA 2MF2A 1UECA 4C92A 2DNUA 4A63B 2QDYB 2ZPFB 2KDSA 4R0KA 1DJ7B 3H6ZA 4E7IA 2Y4XA 4D6WA 3E1SA 4EMKB 1IGUA 2MOXA 2E41A 1RABB 3S3OA 4C92B 1SPKA 1CKBA 3M57A 4BUGA 1AVZC 4DA4A 2BIVA 5HKCA 2QQRA 3OYBA 3RESA 1M90C 3S3NA 4VUBA 1RAHB 2VXEA 3E9GA 1BK2A 1W6XA 1KC8U 2JVVA 1MHNA 2K5FA 5CK9A 3OS2A 1MMNA 2PU9B 2ZGWA 1U8RA 1RUWA 3VUBA 1VQPQ 2DYIA 4C92C 3JB9D 4QQ6A 2YRCA 1YWPA 1IXDA 2RMOA 4M7DD 1NEBA 2JTMA 1VQ4T 2HL5C 1WGSA 2K3YA 4B9XA 1WJSA 5LJ3f 4EIKA 4J9DA 1TU0B 1NM7A 3CCUT 1W2BP 3ZBDA 1SRMA 3RMQA 1Q82C 2RQVA 2MWPA 4AFQC 4M7DF 1T0HA 3RUXA 1ZSZC 1X01A 2CZ7B 2KK4A 1BIAA 4M78B 2M0YA 2G3RA 3MEVA 2LRQA 2QYZA 2EGCA 1V29B 2K2MA 3CCVQ 3QYGB 2IVWA 2RH2A 3OW2P 4KUDK 2DJQA 4Y91A 1CKAA 3SWNA 1PRMC 1LVKA 2DZ9A 2M9UA 4NL3A 2D0QB 5A0LA 3BY7A 2DTHA 1YP5A 3PVLA 3CCMQ 1MV0B 3ASKA 5GAMe 1VQOQ 4M78C 4C0GA 4O5VA 2DMOA 1BI1A 1BI3A 4E6RA 3R6NA 2FYKA 2P84A 4OB3B 1JO8A 3KUFA 1AWOA 1S1NA 1ACMB 3DB4A 1QVGS 2DL5A 1D1CA 4M75F 4FYYB 5J39A 3X26B 1FMWA 2IIMA 2XDPA 5LJ5e 2VXFA 2CP5A 4XAXB 2KXCA 2VGNA 3VU3C 1VQKA 2JMCA 4M75B 3CEYA 2HZYA 1M1FA 1LOJA 2CUBA 4BE2A 1D09B 3UT1A 1M9SA 1KD1U 4MDWA 5CKEA 2RN8A 3CCUQ 4C5IA 3M9QA 1KC8R 2JT4A 1HSQA 3EH1A 1BIBA 4IIOA 2GQIA 2KY9A 4A4FA 4M7DA 3LW5E 8AT1B 1VQ5Q 3M4YA 3JV3A 1LNXA 3HRTA 4DBHA 5KYXB 3CXCP 1B34B 4R56A 1UDLA 2XIDA 2YUPA 3CCQQ 3MEAA 5GAOl 1F1BB 2MK5A 2CKKA 2HQEA 1BB9A 3LYIA 5DM7R 3CXCS 5KE3A 2RI5A 2A0FB 2L3RA 3VYHB 1QMCA 2VC8A 2LCCA 3RMSA 3PFSA 3HTRA 3L2QA 3SHWA 4PJOF 1M2VA 2E5QA 3FDRA 2BE9B 2CGHA 1WHHA 1IGQA 3G4ST 2X51A 2AK5A 3ER0A 1JXMA 5FU6B 3CCMA 1Y57A 1UB4A 1W4SA 2VYTA 3T9NA 1WZOA 4PNOA 5I2MA 1O9SA 2ZZDA 2LTOA 4RTXA 2M02A 1R77A 4RTVA 4OMQA 3SEMA 5GAMj 3L2RA 2R5MA 2EQUA 3OSVA 1VA7A 3PIOA 3M56A 1NBEB 3HPWA 2HKQB 1KJWA 2D9TA 3OY9A 1YJ9T 4V2SA 2W10A 4MMLA 2A7YA 3P8DA 4Y28E 2D1XA 5FROA 5I21A 2XICA 2DE0X 3J7AF 1UG1A 4M78F 4C8QG 1Q7YR 3G6ET 1WLPB 2CUDA 1AHJB 2BUDA 9ATCB 2PUOB 4ZTFA 1M1KU 3LH0A 1GL5A 3X28B 2MPXC 3OYJA 3EGXA 1WDXA 1AZEA 2QAZA 2YUNA 2E70A 2FPDA 3ME9A 3PNWC 1SKUB 1YBYA 2LJ1A 2HBWA 3H8ZA 4N4HA 5GAMd 1VQ7A 3MEUA 3Q1JA 1YJNQ 3S6WA 1Q82U 4Z8AA 5GMKe 2RK2A 1QW1A 1G8XA 1KQ1A 1YJWQ 1IHVA 4HCZA 1G3YA 1ZBJA 4OGEA 1MGQA 1YJNT 2JW4A 1K73U 4E7JA 1M8MA 4LDYA 5LJ5d 2M0OA 1SG5A 4TVRA 5FU6C 4J6YA 5LJ5f 1K73R 4PKCC 3VRYA 2O31A 3CC4Q 1ARKA 5GANh 2V8IA 2MMPA 4LD6A 2C0IA 1GFCA 5GAN3 3QWXX 4JPBW 3RDVA 4FT2A 1UUEA 4JZ3A 2K3XA 1VQ7T 2EQIA 4M78A 3FLGA 4E7SA 2ZPGB 3RBBB 5GJVB 2QXFA 4JJBA 1B3QA 3CPFA 5GAMf 1SSFA 1UTIA 1Y96B 2K57A 2ROTA 2PVOB 1K9MU 2E1HA 2DIQA 1QP3A 1JJ2P 1U3OA 3I35A 3X24B 2J6FA 2K2VA 3GLXA 4F7UA 4BACA 4DOWA 4FL6A 3L2VA 3NTHA 3CC2T 2HSPA 1WNLA 1K8AR 4M77F 3JB9G 1RADB 2GNCA 2JS2A 1G3WA 2SRCA 4PJOC 2JM9A 3CPWS 3JCMc 1VQLA 1YI2Q 2YLBA 2ZPEB 2NUZA 2KRMA 5CKBA 2EJFA 1YHQA 4PJOB 2KQWA 2PVDB 2H3JA 3I5RA 5GAOp 2RJCA 4RTWA 3S3MA 4KULA 3VS3A 1VQNQ 5FW9A 2B86A 2RPNA 4RCCA 2PUKB 2QA4Q 1OULA 4OMLA 2DVJA 2E6ZA 4IUUA 4F14A 4ELZC 4LUDA 2JMAA 2K79A 3M59A 1NE8A 2X35A 3EAEA 3CCRT 1LPLA 5ECAA 2FB7A 3CQTA 3A8HB 4M7DB 3JAME 3FJ5A 2D6FA 2RI3A 1S72Q 2HQXA 3M0TA 1E7OA 3CC4A 3QDFA 2DPPB 3CCQT 2MWOA 4AT1B 2L3QA 2NWMA 4OMMA 3CCJQ 2A37A 3L2ZA 1W70A 5GMKj 1VUBA 4MMKA 2DKGA 4KT0E 2EQKA 2KYMA 1LJOA 1SEMA 1BU1A 5D6XA 4JLGA 2NUPB 1ZHIA 3V7CA 1WHMA 3TSZA 2RA2A 2ZCFB 3LLRA 5CKDA 1WXTA 4K11A 3QZ9B 1ZBXA 1YHQT 2QQBA 4QVZA 3A8OB 1IB8A 1I07A 3KFVA 4E7ZA 2DEQA 4M75C 3OMGA 3OYAA 2GTOA 1AEYA 2EYWA 5HY6A 3VS2A 1RI9A 2NYSA 2KI7A 2QEXQ 2DL8A 2R5AA 1M8VA 3CC2A 1UE9A 4AG2C 3CMEA 3EH2A 3REAB 4J6WA 1A0NB 1QCFA 2FO0A 3G71T 2CP2A 1UJYA 1M30A 2GBQA 2PZ1A 1OX9A 2DD5A 2AZSA 2EWNA 2ZAEA 1PNJA 1TS9A 5GANj 2EYYA 3A8GB 2OI3A 2XD0A 4L5GA 3JCMb 1M1KC 2EJ9A 2KEAA 2OTLQ 3PGGA 2DXTA 1TUGB 1OI1A 2COZA 2HSEB 4LD9K 1UFFA 3PTAA 5C6SA 1MUZA 1OPLA 3EG1A 4RTTA 2DX1A 4LE9A 4XK8E 1XJWB 3GNFB 4JDSA 2DL7A 4ATOA 4CI0C 2QEXT 2M16A 1ZQ1A 1XNIA 2HBPA 4QKUA 4O6JA 1YJWA 3CC4T 3OBWA 2XG8D 5KYYA 2AIRB 1N6AA 3V7RA 3CCRA 2DRMA 3OYEA 1Y7XA 1KQSP 3QHSA 1R8OB 2P4TA 1W2BA 3EFRA 5CKHA 2MIOA 5IN1A 2KSSA 2RI2A 1MV3A 4C0DB 2X9HA 2PTKA 5IHIA 5D6YA 2P4RA 2FG0A 3VS0A 2EW3A 5HK0A 1IREB 1X6BA 3FIFA 4HVUA 2HMAA 1UGVA 4RG2A 2C0TA 1X6OA 1M4ZA 4L59A 4PJMA 3QDRB 4XU1A 1TUCA 1MMDA 2DTIA 1VIFA 2QGFB 4FYXB 5GAN4 5HCKA 4C0DC 2ENMA 4Q5WA 3VS5A 1R0CB 1FXXA 1RI0A 3I9QA 3VKIA 2JZ2A 2F69A 3BDLA 3NFCA 3GOXA 4PJLA 1M3AA 3CBMA 4PJOG 4UC4A 2AT1B 3MO8A 4ZGDB 2X4XA 1WQWA 2KXDA 4R55A 4C0FA 2CZ0B 1Y0MA 2E64A 2CYZB 1YCYA 1FX7A 3VYGA 4PFPA 3SDZA 1S72A 4E7LA 3NMZC 4OB0B 1JXOA 2ED0A 1U1TA 2CSIA 3M0PA 3NTKA 3EG3A 3O8VA 3JCMX 3FC3A 2VUBA 3JCMJ 2JTEA 1VQLT 3OYGA 4LDWA 1BCOA 1OU8A 3MP1A 1GCQC 2A08A 2FPFA 1HYOA 5KYUA 2XI9A 1RL2A 3H41A 3SFMA 4AFUC 1VQ6T 2EKOA 1OOTA 1ZA1B
chains in the Genus database with same CATH topology
4DEXA 2CH4W 2AK5A 1WA7A 1JXMA 1XOVA 2J6KA 1Y57A 2JM8A 3H0FA 4FSSA 1UHCA 3GBQA 1FYNA 1V1CA 1K4US 2CT4A 3M0UA 2DBMA 2BTTA 4RTXA 3H0IA 2EYZA 3I5SA 4RTVA 4OMQA 3SEMA 3NPFA 1VA7A 3PVQA 1QLYA 1YNZA 2H8HA 3TSWA 3H0HA 1KJWA 1ABOA 2W10A 2D1XA 1NEGA 2J05A 2DE0X 1UG1A 1VYUA 2KRNA 2KYBA 1OPKA 2DBKA 1VYTA 5IXBA 1WLPB 2CUDA 4J9GA 3UA6A 2O9SA 1NYFA 1GL5A 1NYGA 4J9HA 2DA9A 4Z88A 1WDXA 1AZEA 2W0ZA 2YUNA 2DL3A 3EHRA 2FPDA 4DEYA 2RQWA 1K1ZA 2F2XA 1QKWA 2XMFA 3IQLA 2ESWA 2M51A 2EGEA 3O5ZA 4J9EA 2LJ1A 2HBWA 2ECZA 3M0RA 3EHQA 1H92A 1GFDA 2RQTA 2YT6A 1K9AA 4Z8AA 1T0JA 2LJ3A 2HEQA 1W1FA 1ZUYA 5GJWB 1CSKA 2ED1A 5I11A 3M0QA 1ZBJA 1K76A 1IO6A 1ZSGA 1G83A 2JW4A 4GBQA 2HDAA 1QKXA 2LQNA 1M8MA 3UATA 1T3LA 1HD3A 3VRYA 2O31A 1ARKA 2C0IA 1GFCA 1AZGB 2LCSA 3QWXX 4CC3A 4JPBW 1UUEA 1NG2A 4JZ3A 4J9IA 2LNHB 1X27A 1X69A 1WIEA 2EPDA 2A28A 2DILA 2KRSA 5I22A 2EQIA 2KBTA 3RBBB 1HJDA 1PKSA 1SSHA 5GJVB 1VYVA 4JJCA 2YUOA 1GBRA 4JJBA 1B3QA 2HCKA 1UTIA 2ROTA 2RNAA 1PWTA 2OJ2A 2V1RA 1U3OA 1WYXA 3I35A 2KNBB 2YSQA 2J6FA 2KROA 5IHKA 1YN8A 1U5SA 2ROLA 4AG1C 1GCPA 1SHGA 1X6GA 2EKHA 2FRWA 5IXFA 1OV3A 1J3TA 1KIKA 4HCKA 2MCNA 1JU5C 5IH2A 2GGRA 3NHNA 2HSPA 2OAWA 1E6GA 1I0CA 3U23A 1WFWA 3ZL7C 2GNCA 4ESRA 1KFZA 1JQQA 1NLPC 2JS2A 4ZNXA 1OEBA 2SRCA 2CH4A 1ZLMA 2L2PA 2YDLA 5L23A 4LNPA 2JM9A 2KT8A 1X43A 4HXJA 2NUZA 4D8DA 2KRMA 2VVKA 3I5RA 4WCIA 1Z9QA 4RTWA 1X2KA 4AFSC 1U06A 3VS3A 4J9BA 4RUGA 5FW9A 2K7AA 2B86A 2RPNA 1LCKA 3UF4A 1PKTA 3LH5A 4OMLA 2DVJA 2O9VA 4F14A 4QT7A 1M3CA 4IIMA 1NLOC 2E5KA 2JMAA 4LUDA 4CC7A 2K79A 2G6FX 1WXBA 1G2BA 2BZ8A 1QWEA 5ECAA 3VS4A 3CQTA 3FJ5A 2SEMA 1H8KA 3M0TA 1E7OA 1PRLC 4HVWA 4ORZA 4RTZA 2L3SA 4HVVA 2L3QA 2NWMA 4OMMA 3NGPA 4F16A 5IHNA 1WXUA 2CT3A 2A37A 2EVRA 1W70A 2DRKA 2J7IA 2LQWA 4Y92A 2LX7A 1K0XA 1YWOA 1I1JA 1QWFA 1ZUKA 2GTJA 3VS1A 2AKKA 2F2VA 2KYMA 3M0SA 1SEMA 1BU1A 1UECA 2QDLA 2DNUA 2D8HA 4A63B 1ZUUA 4R0KA 4JJDA 2X3WD 3TSZA 2MOXA 4D8KA 1WXTA 1YCSB 4K11A 1SPKA 1CKBA 3UA7A 1AVZC 1I07A 3KFVA 2LJ0A 2JS0A 1BK2A 3THKA 2DLPA 1W6XA 3RNJA 1RLPC 2CDTA 1N5ZA 2GTOA 2EYWA 1AEYA 3VS2A 4GLMA 1RI9A 2KE9A 2VKNA 1RUWA 2DL8A 2O88A 2RF0A 2DYBA 4JZ4A 4F17A 2K9GA 2KT1A 1UE9A 2EGAA 4AG2C 1YWPA 3REAB 1A0NB 1QCFA 2FO0A 2RMOA 3EG0A 1UJYA 2FPEA 1NEBA 1M3BA 1B07A 1M30A 2GBQA 2BZYA 2PZ1A 2AZSA 1PNJA 2F2WA 1H3HA 1FMKA 4EIKA 1KSWA 4J9DA 1NM7A 2EYYA 4LUEA 2OI3A 2CREA 4RTYA 4M4ZA 4LN2A 2PNIA 2KEAA 2ABLA 1SRMA 1SHFA 2JXBA 2K6DA 2RQVA 4AFQC 1T0HA 2D8JA 1UFFA 1MUZA 1GCQA 4J9FA 2M0YA 1OPLA 1PHTA 3EG1A 2DF6A 2EGCA 4RTTA 2DX1A 4LE9A 2K2MA 4X1VA 2L3PA 2DL7A 2DM1A 2D0NA 2EBPA 2DJQA 2KGTA 1CKAA 1PRMC 2VWFA 3TVTA 1AOJA 1AWXA 1ABQA 4KRTA 2FRYA 1K0SA 1T3SA 2RQUA 1YP5A 3PVLA 2DRMA 1MV0B 3ULRB 4CC2A 1X2QA 2DMOA 1TUDA 2LZ6B 4E6RA 5FWBA 2MIOA 1EFNA 3R6NA 1JO8A 1MV3A 1AWOA 1S1NA 2PTKA 2DL5A 2C0OA 5IHIA 2P4RA 1GBQA 2FG0A 1Z9ZA 3VS0A 2KR3A 2EW3A 2J6OA 1X6BA 2IIMA 4OMPA 4HVUA 1UGVA 2C0TA 2X3XD 2BZXA 2AZVA 2EYXA 2O2OA 2KXCA 1TUCA 4OMOA 2I0NA 2JMCA 3REBB 3VS6A 3PE0A 2CUBA 5HCKA 1M27C 2RN8A 2ENMA 2FEIA 4J9CA 5FWCA 3VS5A 2JT4A 1HSQA 2K3BA 3I9QA 3VRZA 1RLQC 4IIOA 1E6HA 2GQIA 1M3AA 3JV3A 4AFZC 2LMJA 3QWYA 2KXDA 3A98A 1JEGA 1Y0MA 1UDLA 1WI7A 2YUPA 4RTUA 1AWJA 2V1QA 1UHFA 1GRIA 3EG2A 1ZX6A 2L0AA 1BB9A 1BBZA 1AWWA 3NMZC 2DL4A 1JXOA 2ED0A 2CSIA 3M0PA 2LP5A 3EG3A 2J06A 1UJ0A 1AD5A 2JTEA 2AKLA 1SRLA 5EC7A 4Z89A 1GCQC 1WX6A 3C0CA 1TG0A 2A08A 2RQRA 2FPFA 3SHWA 2A36A 2YUQA 4CC4B 2CSQA 3H41A 4AFUC 4OMNA 1OOTA 3EGUA 3VS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEX A;  2CH4 W;  2AK5 A;  1WA7 A;  1JXM A;  1XOV A;  2J6K A;  1Y57 A;  2JM8 A;  3H0F A;  4FSS A;  1UHC A;  3GBQ A;  1FYN A;  1V1C A;  1K4U S;  2CT4 A;  3M0U A;  2DBM A;  2BTT A;  4RTX A;  3H0I A;  2EYZ A;  3I5S A;  4RTV A;  4OMQ A;  3SEM A;  3NPF A;  1VA7 A;  3PVQ A;  1QLY A;  1YNZ A;  2H8H A;  3TSW A;  3H0H A;  1KJW A;  1ABO A;  2W10 A;  2D1X A;  1NEG A;  2J05 A;  2DE0 X;  1UG1 A;  1VYU A;  2KRN A;  2KYB A;  1OPK A;  2DBK A;  1VYT A;  5IXB A;  1WLP B;  2CUD A;  4J9G A;  3UA6 A;  2O9S A;  1NYF A;  1GL5 A;  1NYG A;  4J9H A;  2DA9 A;  4Z88 A;  1WDX A;  1AZE A;  2W0Z A;  2YUN A;  2DL3 A;  3EHR A;  2FPD A;  4DEY A;  2RQW A;  1K1Z A;  2F2X A;  1QKW A;  2XMF A;  3IQL A;  2ESW A;  2M51 A;  2EGE A;  3O5Z A;  4J9E A;  2LJ1 A;  2HBW A;  2ECZ A;  3M0R A;  3EHQ A;  1H92 A;  1GFD A;  2RQT A;  2YT6 A;  1K9A A;  4Z8A A;  1T0J A;  2LJ3 A;  2HEQ A;  1W1F A;  1ZUY A;  5GJW B;  1CSK A;  2ED1 A;  5I11 A;  3M0Q A;  1ZBJ A;  1K76 A;  1IO6 A;  1ZSG A;  1G83 A;  2JW4 A;  4GBQ A;  2HDA A;  1QKX A;  2LQN A;  1M8M A;  3UAT A;  1T3L A;  1HD3 A;  3VRY A;  2O31 A;  1ARK A;  2C0I A;  1GFC A;  1AZG B;  2LCS A;  3QWX X;  4CC3 A;  4JPB W;  1UUE A;  1NG2 A;  4JZ3 A;  4J9I A;  2LNH B;  1X27 A;  1X69 A;  1WIE A;  2EPD A;  2A28 A;  2DIL A;  2KRS A;  5I22 A;  2EQI A;  2KBT A;  3RBB B;  1HJD A;  1PKS A;  1SSH A;  5GJV B;  1VYV A;  4JJC A;  2YUO A;  1GBR A;  4JJB A;  1B3Q A;  2HCK A;  1UTI A;  2ROT A;  2RNA A;  1PWT A;  2OJ2 A;  2V1R A;  1U3O A;  1WYX A;  3I35 A;  2KNB B;  2YSQ A;  2J6F A;  2KRO A;  5IHK A;  1YN8 A;  1U5S A;  2ROL A;  4AG1 C;  1GCP A;  1SHG A;  1X6G A;  2EKH A;  2FRW A;  5IXF A;  1OV3 A;  1J3T A;  1KIK A;  4HCK A;  2MCN A;  1JU5 C;  5IH2 A;  2GGR A;  3NHN A;  2HSP A;  2OAW A;  1E6G A;  1I0C A;  3U23 A;  1WFW A;  3ZL7 C;  2GNC A;  4ESR A;  1KFZ A;  1JQQ A;  1NLP C;  2JS2 A;  4ZNX A;  1OEB A;  2SRC A;  2CH4 A;  1ZLM A;  2L2P A;  2YDL A;  5L23 A;  4LNP A;  2JM9 A;  2KT8 A;  1X43 A;  4HXJ A;  2NUZ A;  4D8D A;  2KRM A;  2VVK A;  3I5R A;  4WCI A;  1Z9Q A;  4RTW A;  1X2K A;  4AFS C;  1U06 A;  3VS3 A;  4J9B A;  4RUG A;  5FW9 A;  2K7A A;  2B86 A;  2RPN A;  1LCK A;  3UF4 A;  1PKT A;  3LH5 A;  4OML A;  2DVJ A;  2O9V A;  4F14 A;  4QT7 A;  1M3C A;  4IIM A;  1NLO C;  2E5K A;  2JMA A;  4LUD A;  4CC7 A;  2K79 A;  2G6F X;  1WXB A;  1G2B A;  2BZ8 A;  1QWE A;  5ECA A;  3VS4 A;  3CQT A;  3FJ5 A;  2SEM A;  1H8K A;  3M0T A;  1E7O A;  1PRL C;  4HVW A;  4ORZ A;  4RTZ A;  2L3S A;  4HVV A;  2L3Q A;  2NWM A;  4OMM A;  3NGP A;  4F16 A;  5IHN A;  1WXU A;  2CT3 A;  2A37 A;  2EVR A;  1W70 A;  2DRK A;  2J7I A;  2LQW A;  4Y92 A;  2LX7 A;  1K0X A;  1YWO A;  1I1J A;  1QWF A;  1ZUK A;  2GTJ A;  3VS1 A;  2AKK A;  2F2V A;  2KYM A;  3M0S A;  1SEM A;  1BU1 A;  1UEC A;  2QDL A;  2DNU A;  2D8H A;  4A63 B;  1ZUU A;  4R0K A;  4JJD A;  2X3W D;  3TSZ A;  2MOX A;  4D8K A;  1WXT A;  1YCS B;  4K11 A;  1SPK A;  1CKB A;  3UA7 A;  1AVZ C;  1I07 A;  3KFV A;  2LJ0 A;  2JS0 A;  1BK2 A;  3THK A;  2DLP A;  1W6X A;  3RNJ A;  1RLP C;  2CDT A;  1N5Z A;  2GTO A;  2EYW A;  1AEY A;  3VS2 A;  4GLM A;  1RI9 A;  2KE9 A;  2VKN A;  1RUW A;  2DL8 A;  2O88 A;  2RF0 A;  2DYB A;  4JZ4 A;  4F17 A;  2K9G A;  2KT1 A;  1UE9 A;  2EGA A;  4AG2 C;  1YWP A;  3REA B;  1A0N B;  1QCF A;  2FO0 A;  2RMO A;  3EG0 A;  1UJY A;  2FPE A;  1NEB A;  1M3B A;  1B07 A;  1M30 A;  2GBQ A;  2BZY A;  2PZ1 A;  2AZS A;  1PNJ A;  2F2W A;  1H3H A;  1FMK A;  4EIK A;  1KSW A;  4J9D A;  1NM7 A;  2EYY A;  4LUE A;  2OI3 A;  2CRE A;  4RTY A;  4M4Z A;  4LN2 A;  2PNI A;  2KEA A;  2ABL A;  1SRM A;  1SHF A;  2JXB A;  2K6D A;  2RQV A;  4AFQ C;  1T0H A;  2D8J A;  1UFF A;  1MUZ A;  1GCQ A;  4J9F A;  2M0Y A;  1OPL A;  1PHT A;  3EG1 A;  2DF6 A;  2EGC A;  4RTT A;  2DX1 A;  4LE9 A;  2K2M A;  4X1V A;  2L3P A;  2DL7 A;  2DM1 A;  2D0N A;  2EBP A;  2DJQ A;  2KGT A;  1CKA A;  1PRM C;  2VWF A;  3TVT A;  1AOJ A;  1AWX A;  1ABQ A;  4KRT A;  2FRY A;  1K0S A;  1T3S A;  2RQU A;  1YP5 A;  3PVL A;  2DRM A;  1MV0 B;  3ULR B;  4CC2 A;  1X2Q A;  2DMO A;  1TUD A;  2LZ6 B;  4E6R A;  5FWB A;  2MIO A;  1EFN A;  3R6N A;  1JO8 A;  1MV3 A;  1AWO A;  1S1N A;  2PTK A;  2DL5 A;  2C0O A;  5IHI A;  2P4R A;  1GBQ A;  2FG0 A;  1Z9Z A;  3VS0 A;  2KR3 A;  2EW3 A;  2J6O A;  1X6B A;  2IIM A;  4OMP A;  4HVU A;  1UGV A;  2C0T A;  2X3X D;  2BZX A;  2AZV A;  2EYX A;  2O2O A;  2KXC A;  1TUC A;  4OMO A;  2I0N A;  2JMC A;  3REB B;  3VS6 A;  3PE0 A;  2CUB A;  5HCK A;  1M27 C;  2RN8 A;  2ENM A;  2FEI A;  4J9C A;  5FWC A;  3VS5 A;  2JT4 A;  1HSQ A;  2K3B A;  3I9Q A;  3VRZ A;  1RLQ C;  4IIO A;  1E6H A;  2GQI A;  1M3A A;  3JV3 A;  4AFZ C;  2LMJ A;  3QWY A;  2KXD A;  3A98 A;  1JEG A;  1Y0M A;  1UDL A;  1WI7 A;  2YUP A;  4RTU A;  1AWJ A;  2V1Q A;  1UHF A;  1GRI A;  3EG2 A;  1ZX6 A;  2L0A A;  1BB9 A;  1BBZ A;  1AWW A;  3NMZ C;  2DL4 A;  1JXO A;  2ED0 A;  2CSI A;  3M0P A;  2LP5 A;  3EG3 A;  2J06 A;  1UJ0 A;  1AD5 A;  2JTE A;  2AKL A;  1SRL A;  5EC7 A;  4Z89 A;  1GCQ C;  1WX6 A;  3C0C A;  1TG0 A;  2A08 A;  2RQR A;  2FPF A;  3SHW A;  2A36 A;  2YUQ A;  4CC4 B;  2CSQ A;  3H41 A;  4AFU C;  4OMN A;  1OOT A;  3EGU A;  3VS7 A; 
#chains in the Genus database with same CATH topology
 4DEX A;  1Q82 R;  3PMT A;  1ZA2 B;  2JM8 A;  1VQO A;  3GBQ A;  1V1C A;  2WSC E;  2EYZ A;  3I5S A;  4OVA A;  2LVM A;  2CP6 A;  4M7A G;  1YNZ A;  5GAO q;  3TSW A;  1ABO A;  4C5G A;  3CC2 Q;  2VB6 A;  4BI8 B;  3L2W A;  2A3L A;  3P8B B;  3V8J A;  4EMK C;  5GAN e;  1K9M C;  1WPY A;  2KYB A;  1NPP A;  2NUP A;  2DBK A;  4M7A C;  5CQY A;  3EGD B;  1VQK T;  1NYF A;  5J26 A;  4M7A B;  1YJ9 A;  1JB0 E;  1NYG A;  3MEW A;  4J9H A;  4LDV A;  2JTF A;  4Z88 A;  2LDM A;  4QVD A;  4Z02 A;  1QKW A;  2M51 A;  1OQK A;  2QTV A;  1PCX A;  3E19 A;  3I55 T;  4J9E A;  3JB9 F;  1BI0 A;  4OB1 B;  3KXT A;  3WXM B;  3EHQ A;  1QCO A;  2RQT A;  2GQV A;  3V8L A;  2JJ9 A;  2YRD A;  3OYH A;  1T0J A;  2LJ3 A;  1UGP B;  2HEQ A;  2DER A;  1CSK A;  2ED1 A;  5I11 A;  4MDX A;  3QO3 A;  1IO6 A;  2Z0W A;  1G83 A;  3SB2 A;  3RER A;  4HT9 A;  3LGF A;  1PG5 B;  1WHL A;  1KG1 A;  3JCM f;  4PFZ A;  1TOV A;  4PJO E;  1HD3 A;  4BE1 A;  1D1B A;  2QA4 T;  1C6V X;  4M7D E;  5LJ3 g;  5CQX A;  1KQ2 A;  2I2L A;  4CC3 A;  5GAN 7;  5CO7 A;  3JB9 H;  1X27 A;  1X69 A;  5I22 A;  4C5E A;  2KBT A;  4KGV B;  3MP8 A;  2XDD A;  1VYV A;  1N8R R;  4II1 A;  5A0G A;  2QI2 A;  3WVD B;  2RNA A;  4J6X A;  3LX7 A;  4ZN3 A;  1WYX A;  4XU2 A;  2KNB B;  2YSQ A;  2KRO A;  4BDZ A;  1YN8 A;  3OS0 A;  2ROL A;  1X6G A;  1SHG A;  3CCS Q;  5GAN f;  3DLL A;  1I5O B;  1OV3 A;  2L5Q A;  1K73 C;  1KIK A;  4HCK A;  3J80 E;  2MCN A;  1PD1 A;  5FU7 C;  2GGR A;  2DO3 A;  3GP8 A;  2OAW A;  1E6G A;  3ZL7 C;  3HSB A;  4RKU E;  1JQQ A;  4J7I A;  4PJO A;  2B8A A;  1OU9 A;  1YIJ A;  3TU4 K;  1VQN A;  2R57 A;  4HXJ A;  1D0X A;  1PC0 A;  4D8D A;  1VQ7 Q;  1U1S A;  2VVK A;  2CP7 A;  3OBY A;  4WCI A;  2HL3 A;  1Z9Q A;  2H3E B;  2HD0 A;  2F5T X;  1U06 A;  1Q86 U;  4RUG A;  2K7A A;  3HRS A;  3J81 E;  1PKT A;  3LH5 A;  4X34 A;  3M53 A;  1Y07 A;  4QT7 A;  5AYF A;  1Q7Y U;  1N27 A;  1I81 A;  4N4G A;  4XTW A;  2C06 A;  3CBO A;  4E47 A;  3L2U A;  1VQM Q;  2FZG B;  1KK7 A;  2SEM A;  2DVE A;  1YI2 A;  4OB2 B;  5KYX A;  1B34 A;  2X4Y A;  3JCM d;  1IHW A;  1VQ8 T;  4F16 A;  5LJ5 g;  3LWH A;  2CT3 A;  3HKS A;  3I55 A;  5KCO A;  2J7I A;  2LQW A;  1TTH B;  2LX7 A;  1YWO A;  2DET A;  1NZ9 A;  4ZN1 A;  2D8H A;  4FW1 A;  1YIJ T;  1ZUU A;  2LT1 A;  2ZPI B;  4JJD A;  3DLM A;  2X3W D;  3MJX A;  2K4Y A;  1NJI C;  4D8K A;  1YCS B;  2EQM A;  1O75 A;  2FZC B;  3UA7 A;  1N8R U;  3CCM T;  3HL8 A;  2MAM A;  4XTY A;  1BYM A;  5KYU B;  1RLP C;  2CDT A;  1YJ9 Q;  4YTL A;  5FU7 B;  1UGS B;  1N5Z A;  1GXI E;  1RAG B;  4GLM A;  2KE9 A;  2O88 A;  1VQL Q;  2DYB A;  4JZ4 A;  2KT1 A;  3JCM P;  4LDX A;  2EGA A;  4PJO D;  2COW A;  1YIT Q;  2FPE A;  1RAE B;  3BW1 A;  3M4G A;  5FRM A;  2FVU A;  3M5A A;  2ZPB B;  2OAU A;  1Q81 C;  3OYI A;  2QA4 A;  4E7H A;  1FMK A;  3OYN A;  1QVF S;  2E4H A;  3E9F A;  3OYD A;  2CRE A;  4M4Z A;  1WJQ A;  4LN2 A;  2CP3 A;  1VQ9 A;  4FM4 B;  2ABL A;  2JXB A;  3CMA A;  2K6D A;  5HK3 A;  3JSC A;  2D8J A;  1VQ5 T;  4P5N A;  1VQ4 Q;  1BI2 A;  1GCQ A;  4J9F A;  3EGD A;  3FB9 A;  4ELY C;  1PHT A;  5IAY A;  2LQ8 A;  4X9C A;  4C8Q B;  2L3P A;  1I4K 1;  3BDU A;  3I56 Q;  2EQJ A;  2XKO C;  1IRX A;  2DM1 A;  2EBP A;  2KGT A;  3TVT A;  1AOJ A;  3G4S A;  1AWX A;  2NLU A;  4MZP A;  5FLX E;  2F5K A;  1VQ6 A;  2RM4 A;  1K0S A;  1T3S A;  3HP9 A;  3MCA B;  1N9S A;  2RB6 A;  3JRZ A;  4CC2 A;  1X2Q A;  5M9O A;  4XTU A;  4C92 D;  5LJ3 e;  4F7U G;  4C92 F;  2DFU A;  2DK3 A;  1EX4 A;  2HAX A;  2MI6 A;  5FWB A;  1EFN A;  2RHZ A;  1WJR A;  3QJ6 A;  2DXB A;  5GMK h;  5C0M A;  3D7S B;  2C0O A;  3DKM A;  4J8O A;  1GBQ A;  1QVF P;  1Z9Z A;  2KR3 A;  4IUP A;  3CPW A;  2J6O A;  2OTL T;  1AT1 B;  5LJ5 j;  2O4X A;  2E12 A;  3C12 A;  2BZX A;  2AZV A;  4X9D A;  2EYX A;  2O2O A;  2FL7 A;  1MNE A;  1WQ7 A;  3LWI A;  2CZ6 B;  4HT8 A;  2OTJ A;  3VS6 A;  1M90 U;  4MZT A;  2JOY A;  1YIT A;  3OW2 S;  1M27 C;  4RG8 A;  4C5H A;  2FEI A;  4FSX A;  3GIB A;  4J9C A;  3M54 A;  1B7T A;  4OGC A;  2DAQ A;  2LX9 A;  4DQ2 A;  3QG1 A;  4BDY A;  3EG9 A;  4DBR A;  4FYV B;  1QP2 A;  2LMJ A;  3CCL A;  2EAY A;  3QWY A;  1K9M R;  3A98 A;  1W2B S;  1YFN A;  4KH0 B;  1VQN T;  3CCL T;  4RTU A;  1AWJ A;  2V1Q A;  1GRI A;  2KAF A;  4RMO A;  3CPW P;  2L0A A;  1BBZ A;  3SWN C;  2DL4 A;  2DZC A;  1K8A U;  4CRI A;  1JRI A;  2J06 A;  1UJ0 A;  1KQS S;  1KC8 C;  1YIJ Q;  3CCV T;  1AD5 A;  5I2S A;  4FT4 A;  2AKL A;  1SRL A;  3V8K A;  5EC7 A;  3OYM A;  3PT9 A;  1TG0 A;  2QK0 A;  3QYH B;  2RQR A;  3PIP A;  1Y71 A;  2VV5 A;  2A36 A;  1VQM A;  4CC4 B;  7AT1 B;  2QTX A;  3VS7 A;  2CH4 W;  1XOV A;  4BI4 A;  4M77 C;  3QBY A;  3CME T;  5GAN 6;  5GMK l;  1UHC A;  4PJN A;  4EMH A;  3LGL A;  4GLK A;  4BD3 A;  4J5Y A;  2DBM A;  2BTT A;  1K8A C;  3H0I A;  4QW2 A;  2YRV A;  3G6E Q;  4JUV A;  3CCS T;  3PVQ A;  4JRK A;  4JJN K;  1QLY A;  4OMF B;  4B6M A;  4M77 G;  3H0H A;  5LJ3 j;  2HQH A;  3OYY A;  5GMK m;  3CCU A;  1NEG A;  2J05 A;  4ZTJ A;  1D0Y A;  1WHG A;  3A1P A;  3JB9 J;  1VYU A;  2KRN A;  4OF1 A;  2HKN A;  1VQ4 A;  3M55 A;  4C92 G;  1VYT A;  4N0A C;  1VQ5 A;  5GAN 5;  4J9G A;  1XTD A;  1G3S A;  2ATC B;  1VQ9 Q;  2DA9 A;  3DB3 A;  4PLI A;  4HCB A;  2W0Z A;  2KMT A;  2DL3 A;  3EHR A;  3SWN B;  4DEY A;  2RQW A;  1K1Z A;  2XMF A;  4C8Q E;  4C92 E;  5GAM h;  2EGE A;  3O5Z A;  3CBP A;  2XK0 A;  5LL6 S;  4WF2 A;  3M0R A;  2Y4Y A;  3A5Z B;  4AMC A;  1OX8 A;  1GFD A;  2YT6 A;  3CCE A;  1YI2 T;  3CC7 Q;  4IUT A;  3MHX A;  1ZUY A;  5GJW B;  3C4S A;  3M0Q A;  1G5V A;  1RAC B;  1ZSZ B;  1K76 A;  1MMG A;  4WTO B;  4F7U F;  5A0D A;  1M90 R;  3A8M B;  3CCJ A;  1WHK A;  2HDA A;  5DY9 A;  4A4K A;  5LJ5 h;  1QKX A;  2CZ1 B;  3UAT A;  1T3L A;  3V7S A;  1RAI B;  2RJD A;  1TWB A;  2RO0 A;  1AZG B;  2LCS A;  1VQO T;  1XQH A;  4J9I A;  2LNH B;  4DOV A;  1WIE A;  2GFA A;  4XU3 A;  2E3H A;  4GY5 A;  1D1A A;  1HJD A;  2LNV A;  1PKS A;  3MPU B;  4C8Q A;  1QQJ A;  4JJC A;  1RAA B;  5A2Q E;  3HHT B;  4E2F B;  1QCN A;  2OJ2 A;  2V1R A;  2F1L A;  3H9N A;  5IHK A;  3OB9 A;  1U5S A;  1VQ8 A;  1OZ3 A;  5IXF A;  1M1K R;  1J3T A;  3A8L B;  3OW2 A;  1JU5 C;  1Q95 G;  3JCM h;  3OSS C;  5DLQ E;  1Q81 U;  1I0C A;  3U23 A;  1WFW A;  4NS5 A;  2K5L A;  1S72 T;  1KFZ A;  2DXC A;  3ZEH A;  3OMC A;  4BY6 C;  2EIF A;  4ZNX A;  3TEE A;  1QVG A;  3CMA T;  1BCM A;  2RHX A;  1VQ9 T;  2L2P A;  5L23 A;  4LNP A;  1VQP A;  2KT8 A;  1X43 A;  4JLI A;  2O4X B;  1VOM A;  4JRI A;  1H64 1;  1TXQ A;  5GAO n;  1BKB A;  4AFS C;  4DBF A;  4EMG A;  1HXD A;  3UF4 A;  4F04 B;  1I5L A;  2O9V A;  1QVP A;  1M3C A;  4IIM A;  2E5K A;  1Q86 C;  1OZ2 A;  3I56 A;  2OX7 A;  1WXB A;  2PQW A;  1G2B A;  2BZ8 A;  1MMA A;  1QWE A;  4A4G A;  4FW2 A;  3VS4 A;  2RHI A;  2XU8 A;  1H3Z A;  3EG9 B;  2LT4 A;  1PRL C;  4RTZ A;  1OYX A;  4B9W A;  3CCL Q;  5IHN A;  1WXU A;  4M77 D;  2EVR A;  4C0Z A;  3VJP A;  2DTO A;  1ZUK A;  2GTJ A;  3VS1 A;  3G7Z A;  2F2V A;  5LJ3 d;  3M0S A;  3EFO A;  2QDL A;  3QZ5 B;  2GFU A;  4M78 D;  5CAI A;  3N5B B;  3NTI A;  4C8Q D;  2PVG B;  5GAO r;  2V8K A;  4HA8 A;  4NOY A;  4M7A E;  2LJ0 A;  2HNI A;  2DD4 A;  2JS0 A;  1I8F A;  3I55 Q;  3THK A;  2DLP A;  3RNJ A;  3TCJ A;  2DEU A;  2VAS A;  1V76 A;  3CC7 A;  2EYQ A;  2YXY A;  2VKN A;  5KYN A;  1SF9 A;  2RF0 A;  1VQK Q;  2AHJ B;  4F17 A;  2K9G A;  3MP6 A;  2FHD A;  4FCY A;  4M75 G;  2V26 A;  1Q86 R;  4N0A A;  3EG0 A;  3OA6 A;  4J7F A;  3R6O A;  2OTL A;  1WHJ A;  3G6E A;  3CMA Q;  1M3B A;  1B07 A;  2BZY A;  2F2W A;  1H3H A;  4RCB A;  1KSW A;  4N4I A;  2WSE E;  4LUE A;  1PD0 A;  2COY A;  4RTY A;  2BE7 D;  2PNI A;  1SHF A;  4FIB A;  3JCM g;  1YHQ Q;  4FYW B;  3WVE B;  1QVF A;  4ME7 A;  1P92 A;  3OS1 A;  3VV0 A;  5GAN 2;  3CME Q;  2DF6 A;  4M7D C;  4M7A A;  4X1V A;  1M5Q 1;  3UDC A;  3QUI A;  5GAO m;  3CCR Q;  4KBM B;  3QJY A;  2D0N A;  3MET A;  2VWF A;  5KYW A;  1HK9 A;  3AT1 B;  1UEB A;  4JRP A;  4M77 A;  1ABQ A;  2JN0 A;  4KRT A;  2FRY A;  1TH7 A;  4M7D G;  2RQU A;  2RHU A;  1KD1 R;  2QGG A;  3ULR B;  2QAS A;  2YLC A;  1TUD A;  2LZ6 B;  4A4H A;  5GAN g;  5GMK i;  3CCE T;  2DXU A;  3UWN A;  3CD6 A;  1JJ2 S;  1NJI R;  2RJF A;  4ZGE B;  1NPR A;  2BKD N;  1PM3 A;  2LCL A;  3OYC A;  4XTX A;  1IZ6 A;  4L6V 5;  4OMP A;  3G4S Q;  3CXC A;  2IG0 A;  2X3X D;  4PL6 A;  4ZGJ B;  4JS4 A;  2FZK B;  4OMO A;  3JB9 I;  2I0N A;  4A54 A;  3REB B;  3PE0 A;  3OYL A;  1KHC A;  4A53 A;  2JNG A;  5FWC A;  4PJJ A;  2K3B A;  1FMV A;  4C8Q F;  3VRZ A;  3RKX A;  1UGR B;  1RLQ C;  4M78 G;  1E6H A;  4M77 E;  3F70 A;  4KUI A;  2RHY A;  3URG A;  4AFZ C;  4J83 A;  4XTV A;  1JEG A;  1VQ8 Q;  1WI7 A;  3GF5 A;  4M7A F;  2QQ9 A;  2E10 A;  1JJ2 A;  4M78 E;  1UHF A;  3EG2 A;  1ZX6 A;  2QQS A;  1AWW A;  4MZM A;  2LP5 A;  1Q81 R;  3GPL A;  2VGM A;  4M7A D;  3CD6 T;  1VQM T;  2GF7 A;  1VQP T;  1G3T A;  3VUZ A;  4F7U E;  1PSF A;  2YWW A;  1VQ6 Q;  4HKE A;  4XTZ A;  4Z89 A;  5CCA A;  1WX6 A;  3C0C A;  4JS5 A;  4E7K A;  4IKF A;  4FU6 A;  3BE3 A;  3CCJ T;  2YUQ A;  5EG2 A;  4C8Q C;  5CR2 A;  2CSQ A;  4OMN A;  2CS7 A;  3EGU A;  4ANJ A;  2K5I A;  2DJZ A;  4EDU A;  1WA7 A;  3JCM W;  2J6K A;  4HCC A;  2NUT A;  3G71 A;  2RK1 A;  3H0F A;  1M2V B;  4FSS A;  3L42 A;  1FYN A;  1K4U S;  5FRN A;  1N8R C;  2CT4 A;  4IUQ A;  3M0U A;  3OQ5 A;  2RJE A;  3TRE A;  4XU0 A;  1PSE A;  3C94 A;  2NUT B;  3NPF A;  3G1J A;  4NL2 A;  1NJI U;  2H8H A;  1UGQ B;  3X25 B;  3QKJ A;  3L1A A;  1D3B A;  5GAN 8;  4KH1 B;  3HFO A;  3FJP A;  2KVQ G;  4XQ3 A;  1OPK A;  1KHI A;  5IXB A;  3HRU A;  3RKW A;  2OTJ Q;  4M75 E;  3UA6 A;  1D3B B;  2O9S A;  2L8D A;  5KCH A;  1C1A A;  4PK4 A;  3UPU A;  3P8H A;  3CC7 T;  3CCE Q;  2F2X A;  2XDB A;  4KGX B;  3IQL A;  2ESW A;  2LC4 A;  4LXC A;  5KYY B;  2ECZ A;  1ZSZ A;  4A4E A;  6AT1 B;  2QQA A;  3EGX B;  4BI3 A;  3QSU A;  1H92 A;  2QG9 B;  2ZPH B;  3CCQ A;  1K9A A;  2RD1 A;  4IUV A;  3ZFJ A;  1W1F A;  1RAF B;  5KE2 A;  3JCM e;  5DLO A;  5KH6 A;  4QVC A;  1ZSG A;  1FWZ A;  1N9R A;  3AHU A;  4GBQ A;  2P0Q A;  3BFM A;  1TSF A;  2LQN A;  2E65 A;  2E3I A;  2P0K A;  5GAM g;  3HFN A;  3CCV A;  3QXE B;  5AT1 B;  3OYK A;  4BB7 A;  3FRN A;  3FEO A;  4M75 A;  3M58 A;  4PFO A;  4KGZ B;  1NG2 A;  2EPD A;  2A28 A;  2DIL A;  2KRS A;  4EPC A;  3OS5 A;  1M2O A;  1SSH A;  2Y90 A;  8ATC B;  3CCS A;  1GBR A;  2YUO A;  4JRQ A;  2HCK A;  1QVG P;  3C95 A;  3I56 T;  1PWT A;  5KYW B;  3E2U A;  1YJW T;  4AG1 C;  3KBG A;  4M77 B;  1GCP A;  1C0M A;  2EKH A;  2FRW A;  1R0B G;  2V8J A;  1Y96 A;  2QEX A;  2WSF E;  5IH2 A;  3NHN A;  4LDU A;  4BE0 A;  3TQ7 P;  2YHT A;  2O01 E;  3PMI A;  4QQD A;  2DIG A;  1Q7Y C;  4ESR A;  1YIT T;  4F7U B;  5CKF A;  2XHC A;  2OTJ T;  1NLP C;  3CD6 Q;  5LJ3 h;  5CVI A;  1KQS A;  2MYS A;  1OEB A;  2X4J A;  1JBM A;  1D0Z A;  2CH4 A;  1ZLM A;  2YDL A;  3RKY A;  2EFI A;  4BY6 B;  2M1H A;  5GAN d;  1KD1 C;  5D6W A;  2P0P A;  5IT9 E;  2GCX A;  2WAC A;  3EFS A;  1M1G A;  1X2K A;  2LQK A;  2X4W A;  2L89 A;  3QII A;  4J9B A;  1LCK A;  2JUF A;  4DBQ A;  5J3B A;  4PLL A;  4IUR A;  1NLO C;  3X20 B;  2CP0 A;  4CC7 A;  3JCM V;  3QPH A;  2G6F X;  2R58 A;  3G71 Q;  1YJN A;  3MKD A;  3INZ A;  1MND A;  4QQG A;  4OP0 A;  2EJG A;  3OYF A;  1EIF A;  1H8K A;  4ORZ A;  4HVW A;  2L3S A;  3EFO B;  4HVV A;  3SD4 A;  2IPO B;  3NGP A;  3RR6 A;  5CIU A;  1X75 C;  1EZZ B;  2DRK A;  4Y92 A;  3GNG A;  1VIE A;  3RIR A;  1K0X A;  4EMK A;  3JCM Q;  1I1J A;  2E6N A;  1QWF A;  4M75 D;  5L8R E;  2AKK A;  5D7U A;  2MF2 A;  1UEC A;  4C92 A;  2DNU A;  4A63 B;  2QDY B;  2ZPF B;  2KDS A;  4R0K A;  1DJ7 B;  3H6Z A;  4E7I A;  2Y4X A;  4D6W A;  3E1S A;  4EMK B;  1IGU A;  2MOX A;  2E41 A;  1RAB B;  3S3O A;  4C92 B;  1SPK A;  1CKB A;  3M57 A;  4BUG A;  1AVZ C;  4DA4 A;  2BIV A;  5HKC A;  2QQR A;  3OYB A;  3RES A;  1M90 C;  3S3N A;  4VUB A;  1RAH B;  2VXE A;  3E9G A;  1BK2 A;  1W6X A;  1KC8 U;  2JVV A;  1MHN A;  2K5F A;  5CK9 A;  3OS2 A;  1MMN A;  2PU9 B;  2ZGW A;  1U8R A;  1RUW A;  3VUB A;  1VQP Q;  2DYI A;  4C92 C;  3JB9 D;  4QQ6 A;  2YRC A;  1YWP A;  1IXD A;  2RMO A;  4M7D D;  1NEB A;  2JTM A;  1VQ4 T;  2HL5 C;  1WGS A;  2K3Y A;  4B9X A;  1WJS A;  5LJ3 f;  4EIK A;  4J9D A;  1TU0 B;  1NM7 A;  3CCU T;  1W2B P;  3ZBD A;  1SRM A;  3RMQ A;  1Q82 C;  2RQV A;  2MWP A;  4AFQ C;  4M7D F;  1T0H A;  3RUX A;  1ZSZ C;  1X01 A;  2CZ7 B;  2KK4 A;  1BIA A;  4M78 B;  2M0Y A;  2G3R A;  3MEV A;  2LRQ A;  2QYZ A;  2EGC A;  1V29 B;  2K2M A;  3CCV Q;  3QYG B;  2IVW A;  2RH2 A;  3OW2 P;  4KUD K;  2DJQ A;  4Y91 A;  1CKA A;  3SWN A;  1PRM C;  1LVK A;  2DZ9 A;  2M9U A;  4NL3 A;  2D0Q B;  5A0L A;  3BY7 A;  2DTH A;  1YP5 A;  3PVL A;  3CCM Q;  1MV0 B;  3ASK A;  5GAM e;  1VQO Q;  4M78 C;  4C0G A;  4O5V A;  2DMO A;  1BI1 A;  1BI3 A;  4E6R A;  3R6N A;  2FYK A;  2P84 A;  4OB3 B;  1JO8 A;  3KUF A;  1AWO A;  1S1N A;  1ACM B;  3DB4 A;  1QVG S;  2DL5 A;  1D1C A;  4M75 F;  4FYY B;  5J39 A;  3X26 B;  1FMW A;  2IIM A;  2XDP A;  5LJ5 e;  2VXF A;  2CP5 A;  4XAX B;  2KXC A;  2VGN A;  3VU3 C;  1VQK A;  2JMC A;  4M75 B;  3CEY A;  2HZY A;  1M1F A;  1LOJ A;  2CUB A;  4BE2 A;  1D09 B;  3UT1 A;  1M9S A;  1KD1 U;  4MDW A;  5CKE A;  2RN8 A;  3CCU Q;  4C5I A;  3M9Q A;  1KC8 R;  2JT4 A;  1HSQ A;  3EH1 A;  1BIB A;  4IIO A;  2GQI A;  2KY9 A;  4A4F A;  4M7D A;  3LW5 E;  8AT1 B;  1VQ5 Q;  3M4Y A;  3JV3 A;  1LNX A;  3HRT A;  4DBH A;  5KYX B;  3CXC P;  1B34 B;  4R56 A;  1UDL A;  2XID A;  2YUP A;  3CCQ Q;  3MEA A;  5GAO l;  1F1B B;  2MK5 A;  2CKK A;  2HQE A;  1BB9 A;  3LYI A;  5DM7 R;  3CXC S;  5KE3 A;  2RI5 A;  2A0F B;  2L3R A;  3VYH B;  1QMC A;  2VC8 A;  2LCC A;  3RMS A;  3PFS A;  3HTR A;  3L2Q A;  3SHW A;  4PJO F;  1M2V A;  2E5Q A;  3FDR A;  2BE9 B;  2CGH A;  1WHH A;  1IGQ A;  3G4S T;  2X51 A;  2AK5 A;  3ER0 A;  1JXM A;  5FU6 B;  3CCM A;  1Y57 A;  1UB4 A;  1W4S A;  2VYT A;  3T9N A;  1WZO A;  4PNO A;  5I2M A;  1O9S A;  2ZZD A;  2LTO A;  4RTX A;  2M02 A;  1R77 A;  4RTV A;  4OMQ A;  3SEM A;  5GAM j;  3L2R A;  2R5M A;  2EQU A;  3OSV A;  1VA7 A;  3PIO A;  3M56 A;  1NBE B;  3HPW A;  2HKQ B;  1KJW A;  2D9T A;  3OY9 A;  1YJ9 T;  4V2S A;  2W10 A;  4MML A;  2A7Y A;  3P8D A;  4Y28 E;  2D1X A;  5FRO A;  5I21 A;  2XIC A;  2DE0 X;  3J7A F;  1UG1 A;  4M78 F;  4C8Q G;  1Q7Y R;  3G6E T;  1WLP B;  2CUD A;  1AHJ B;  2BUD A;  9ATC B;  2PUO B;  4ZTF A;  1M1K U;  3LH0 A;  1GL5 A;  3X28 B;  2MPX C;  3OYJ A;  3EGX A;  1WDX A;  1AZE A;  2QAZ A;  2YUN A;  2E70 A;  2FPD A;  3ME9 A;  3PNW C;  1SKU B;  1YBY A;  2LJ1 A;  2HBW A;  3H8Z A;  4N4H A;  5GAM d;  1VQ7 A;  3MEU A;  3Q1J A;  1YJN Q;  3S6W A;  1Q82 U;  4Z8A A;  5GMK e;  2RK2 A;  1QW1 A;  1G8X A;  1KQ1 A;  1YJW Q;  1IHV A;  4HCZ A;  1G3Y A;  1ZBJ A;  4OGE A;  1MGQ A;  1YJN T;  2JW4 A;  1K73 U;  4E7J A;  1M8M A;  4LDY A;  5LJ5 d;  2M0O A;  1SG5 A;  4TVR A;  5FU6 C;  4J6Y A;  5LJ5 f;  1K73 R;  4PKC C;  3VRY A;  2O31 A;  3CC4 Q;  1ARK A;  5GAN h;  2V8I A;  2MMP A;  4LD6 A;  2C0I A;  1GFC A;  5GAN 3;  3QWX X;  4JPB W;  3RDV A;  4FT2 A;  1UUE A;  4JZ3 A;  2K3X A;  1VQ7 T;  2EQI A;  4M78 A;  3FLG A;  4E7S A;  2ZPG B;  3RBB B;  5GJV B;  2QXF A;  4JJB A;  1B3Q A;  3CPF A;  5GAM f;  1SSF A;  1UTI A;  1Y96 B;  2K57 A;  2ROT A;  2PVO B;  1K9M U;  2E1H A;  2DIQ A;  1QP3 A;  1JJ2 P;  1U3O A;  3I35 A;  3X24 B;  2J6F A;  2K2V A;  3GLX A;  4F7U A;  4BAC A;  4DOW A;  4FL6 A;  3L2V A;  3NTH A;  3CC2 T;  2HSP A;  1WNL A;  1K8A R;  4M77 F;  3JB9 G;  1RAD B;  2GNC A;  2JS2 A;  1G3W A;  2SRC A;  4PJO C;  2JM9 A;  3CPW S;  3JCM c;  1VQL A;  1YI2 Q;  2YLB A;  2ZPE B;  2NUZ A;  2KRM A;  5CKB A;  2EJF A;  1YHQ A;  4PJO B;  2KQW A;  2PVD B;  2H3J A;  3I5R A;  5GAO p;  2RJC A;  4RTW A;  3S3M A;  4KUL A;  3VS3 A;  1VQN Q;  5FW9 A;  2B86 A;  2RPN A;  4RCC A;  2PUK B;  2QA4 Q;  1OUL A;  4OML A;  2DVJ A;  2E6Z A;  4IUU A;  4F14 A;  4ELZ C;  4LUD A;  2JMA A;  2K79 A;  3M59 A;  1NE8 A;  2X35 A;  3EAE A;  3CCR T;  1LPL A;  5ECA A;  2FB7 A;  3CQT A;  3A8H B;  4M7D B;  3JAM E;  3FJ5 A;  2D6F A;  2RI3 A;  1S72 Q;  2HQX A;  3M0T A;  1E7O A;  3CC4 A;  3QDF A;  2DPP B;  3CCQ T;  2MWO A;  4AT1 B;  2L3Q A;  2NWM A;  4OMM A;  3CCJ Q;  2A37 A;  3L2Z A;  1W70 A;  5GMK j;  1VUB A;  4MMK A;  2DKG A;  4KT0 E;  2EQK A;  2KYM A;  1LJO A;  1SEM A;  1BU1 A;  5D6X A;  4JLG A;  2NUP B;  1ZHI A;  3V7C A;  1WHM A;  3TSZ A;  2RA2 A;  2ZCF B;  3LLR A;  5CKD A;  1WXT A;  4K11 A;  3QZ9 B;  1ZBX A;  1YHQ T;  2QQB A;  4QVZ A;  3A8O B;  1IB8 A;  1I07 A;  3KFV A;  4E7Z A;  2DEQ A;  4M75 C;  3OMG A;  3OYA A;  2GTO A;  1AEY A;  2EYW A;  5HY6 A;  3VS2 A;  1RI9 A;  2NYS A;  2KI7 A;  2QEX Q;  2DL8 A;  2R5A A;  1M8V A;  3CC2 A;  1UE9 A;  4AG2 C;  3CME A;  3EH2 A;  3REA B;  4J6W A;  1A0N B;  1QCF A;  2FO0 A;  3G71 T;  2CP2 A;  1UJY A;  1M30 A;  2GBQ A;  2PZ1 A;  1OX9 A;  2DD5 A;  2AZS A;  2EWN A;  2ZAE A;  1PNJ A;  1TS9 A;  5GAN j;  2EYY A;  3A8G B;  2OI3 A;  2XD0 A;  4L5G A;  3JCM b;  1M1K C;  2EJ9 A;  2KEA A;  2OTL Q;  3PGG A;  2DXT A;  1TUG B;  1OI1 A;  2COZ A;  2HSE B;  4LD9 K;  1UFF A;  3PTA A;  5C6S A;  1MUZ A;  1OPL A;  3EG1 A;  4RTT A;  2DX1 A;  4LE9 A;  4XK8 E;  1XJW B;  3GNF B;  4JDS A;  2DL7 A;  4ATO A;  4CI0 C;  2QEX T;  2M16 A;  1ZQ1 A;  1XNI A;  2HBP A;  4QKU A;  4O6J A;  1YJW A;  3CC4 T;  3OBW A;  2XG8 D;  5KYY A;  2AIR B;  1N6A A;  3V7R A;  3CCR A;  2DRM A;  3OYE A;  1Y7X A;  1KQS P;  3QHS A;  1R8O B;  2P4T A;  1W2B A;  3EFR A;  5CKH A;  2MIO A;  5IN1 A;  2KSS A;  2RI2 A;  1MV3 A;  4C0D B;  2X9H A;  2PTK A;  5IHI A;  5D6Y A;  2P4R A;  2FG0 A;  3VS0 A;  2EW3 A;  5HK0 A;  1IRE B;  1X6B A;  3FIF A;  4HVU A;  2HMA A;  1UGV A;  4RG2 A;  2C0T A;  1X6O A;  1M4Z A;  4L59 A;  4PJM A;  3QDR B;  4XU1 A;  1TUC A;  1MMD A;  2DTI A;  1VIF A;  2QGF B;  4FYX B;  5GAN 4;  5HCK A;  4C0D C;  2ENM A;  4Q5W A;  3VS5 A;  1R0C B;  1FXX A;  1RI0 A;  3I9Q A;  3VKI A;  2JZ2 A;  2F69 A;  3BDL A;  3NFC A;  3GOX A;  4PJL A;  1M3A A;  3CBM A;  4PJO G;  4UC4 A;  2AT1 B;  3MO8 A;  4ZGD B;  2X4X A;  1WQW A;  2KXD A;  4R55 A;  4C0F A;  2CZ0 B;  1Y0M A;  2E64 A;  2CYZ B;  1YCY A;  1FX7 A;  3VYG A;  4PFP A;  3SDZ A;  1S72 A;  4E7L A;  3NMZ C;  4OB0 B;  1JXO A;  2ED0 A;  1U1T A;  2CSI A;  3M0P A;  3NTK A;  3EG3 A;  3O8V A;  3JCM X;  3FC3 A;  2VUB A;  3JCM J;  2JTE A;  1VQL T;  3OYG A;  4LDW A;  1BCO A;  1OU8 A;  3MP1 A;  1GCQ C;  2A08 A;  2FPF A;  1HYO A;  5KYU A;  2XI9 A;  1RL2 A;  3H41 A;  3SFM A;  4AFU C;  1VQ6 T;  2EKO A;  1OOT A;  1ZA1 B; 
#chains in the Genus database with same CATH homology
 4DEX A;  2CH4 W;  2AK5 A;  1WA7 A;  1JXM A;  1XOV A;  2J6K A;  1Y57 A;  2JM8 A;  3H0F A;  4FSS A;  1UHC A;  3GBQ A;  1FYN A;  1V1C A;  1K4U S;  2CT4 A;  3M0U A;  2DBM A;  2BTT A;  4RTX A;  3H0I A;  2EYZ A;  3I5S A;  4RTV A;  4OMQ A;  3SEM A;  3NPF A;  1VA7 A;  3PVQ A;  1QLY A;  1YNZ A;  2H8H A;  3TSW A;  3H0H A;  1KJW A;  1ABO A;  2W10 A;  2D1X A;  1NEG A;  2J05 A;  2DE0 X;  1UG1 A;  1VYU A;  2KRN A;  2KYB A;  1OPK A;  2DBK A;  1VYT A;  5IXB A;  1WLP B;  2CUD A;  4J9G A;  3UA6 A;  2O9S A;  1NYF A;  1GL5 A;  1NYG A;  4J9H A;  2DA9 A;  4Z88 A;  1WDX A;  1AZE A;  2W0Z A;  2YUN A;  2DL3 A;  3EHR A;  2FPD A;  4DEY A;  2RQW A;  1K1Z A;  2F2X A;  1QKW A;  2XMF A;  3IQL A;  2ESW A;  2M51 A;  2EGE A;  3O5Z A;  4J9E A;  2LJ1 A;  2HBW A;  2ECZ A;  3M0R A;  3EHQ A;  1H92 A;  1GFD A;  2RQT A;  2YT6 A;  1K9A A;  4Z8A A;  1T0J A;  2LJ3 A;  2HEQ A;  1W1F A;  1ZUY A;  5GJW B;  1CSK A;  2ED1 A;  5I11 A;  3M0Q A;  1ZBJ A;  1K76 A;  1IO6 A;  1ZSG A;  1G83 A;  2JW4 A;  4GBQ A;  2HDA A;  1QKX A;  2LQN A;  1M8M A;  3UAT A;  1T3L A;  1HD3 A;  3VRY A;  2O31 A;  1ARK A;  2C0I A;  1GFC A;  1AZG B;  2LCS A;  3QWX X;  4CC3 A;  4JPB W;  1UUE A;  1NG2 A;  4JZ3 A;  4J9I A;  2LNH B;  1X27 A;  1X69 A;  1WIE A;  2EPD A;  2A28 A;  2DIL A;  2KRS A;  5I22 A;  2EQI A;  2KBT A;  3RBB B;  1HJD A;  1PKS A;  1SSH A;  5GJV B;  1VYV A;  4JJC A;  2YUO A;  1GBR A;  4JJB A;  1B3Q A;  2HCK A;  1UTI A;  2ROT A;  2RNA A;  1PWT A;  2OJ2 A;  2V1R A;  1U3O A;  1WYX A;  3I35 A;  2KNB B;  2YSQ A;  2J6F A;  2KRO A;  5IHK A;  1YN8 A;  1U5S A;  2ROL A;  4AG1 C;  1GCP A;  1SHG A;  1X6G A;  2EKH A;  2FRW A;  5IXF A;  1OV3 A;  1J3T A;  1KIK A;  4HCK A;  2MCN A;  1JU5 C;  5IH2 A;  2GGR A;  3NHN A;  2HSP A;  2OAW A;  1E6G A;  1I0C A;  3U23 A;  1WFW A;  3ZL7 C;  2GNC A;  4ESR A;  1KFZ A;  1JQQ A;  1NLP C;  2JS2 A;  4ZNX A;  1OEB A;  2SRC A;  2CH4 A;  1ZLM A;  2L2P A;  2YDL A;  5L23 A;  4LNP A;  2JM9 A;  2KT8 A;  1X43 A;  4HXJ A;  2NUZ A;  4D8D A;  2KRM A;  2VVK A;  3I5R A;  4WCI A;  1Z9Q A;  4RTW A;  1X2K A;  4AFS C;  1U06 A;  3VS3 A;  4J9B A;  4RUG A;  5FW9 A;  2K7A A;  2B86 A;  2RPN A;  1LCK A;  3UF4 A;  1PKT A;  3LH5 A;  4OML A;  2DVJ A;  2O9V A;  4F14 A;  4QT7 A;  1M3C A;  4IIM A;  1NLO C;  2E5K A;  2JMA A;  4LUD A;  4CC7 A;  2K79 A;  2G6F X;  1WXB A;  1G2B A;  2BZ8 A;  1QWE A;  5ECA A;  3VS4 A;  3CQT A;  3FJ5 A;  2SEM A;  1H8K A;  3M0T A;  1E7O A;  1PRL C;  4HVW A;  4ORZ A;  4RTZ A;  2L3S A;  4HVV A;  2L3Q A;  2NWM A;  4OMM A;  3NGP A;  4F16 A;  5IHN A;  1WXU A;  2CT3 A;  2A37 A;  2EVR A;  1W70 A;  2DRK A;  2J7I A;  2LQW A;  4Y92 A;  2LX7 A;  1K0X A;  1YWO A;  1I1J A;  1QWF A;  1ZUK A;  2GTJ A;  3VS1 A;  2AKK A;  2F2V A;  2KYM A;  3M0S A;  1SEM A;  1BU1 A;  1UEC A;  2QDL A;  2DNU A;  2D8H A;  4A63 B;  1ZUU A;  4R0K A;  4JJD A;  2X3W D;  3TSZ A;  2MOX A;  4D8K A;  1WXT A;  1YCS B;  4K11 A;  1SPK A;  1CKB A;  3UA7 A;  1AVZ C;  1I07 A;  3KFV A;  2LJ0 A;  2JS0 A;  1BK2 A;  3THK A;  2DLP A;  1W6X A;  3RNJ A;  1RLP C;  2CDT A;  1N5Z A;  2GTO A;  2EYW A;  1AEY A;  3VS2 A;  4GLM A;  1RI9 A;  2KE9 A;  2VKN A;  1RUW A;  2DL8 A;  2O88 A;  2RF0 A;  2DYB A;  4JZ4 A;  4F17 A;  2K9G A;  2KT1 A;  1UE9 A;  2EGA A;  4AG2 C;  1YWP A;  3REA B;  1A0N B;  1QCF A;  2FO0 A;  2RMO A;  3EG0 A;  1UJY A;  2FPE A;  1NEB A;  1M3B A;  1B07 A;  1M30 A;  2GBQ A;  2BZY A;  2PZ1 A;  2AZS A;  1PNJ A;  2F2W A;  1H3H A;  1FMK A;  4EIK A;  1KSW A;  4J9D A;  1NM7 A;  2EYY A;  4LUE A;  2OI3 A;  2CRE A;  4RTY A;  4M4Z A;  4LN2 A;  2PNI A;  2KEA A;  2ABL A;  1SRM A;  1SHF A;  2JXB A;  2K6D A;  2RQV A;  4AFQ C;  1T0H A;  2D8J A;  1UFF A;  1MUZ A;  1GCQ A;  4J9F A;  2M0Y A;  1OPL A;  1PHT A;  3EG1 A;  2DF6 A;  2EGC A;  4RTT A;  2DX1 A;  4LE9 A;  2K2M A;  4X1V A;  2L3P A;  2DL7 A;  2DM1 A;  2D0N A;  2EBP A;  2DJQ A;  2KGT A;  1CKA A;  1PRM C;  2VWF A;  3TVT A;  1AOJ A;  1AWX A;  1ABQ A;  4KRT A;  2FRY A;  1K0S A;  1T3S A;  2RQU A;  1YP5 A;  3PVL A;  2DRM A;  1MV0 B;  3ULR B;  4CC2 A;  1X2Q A;  2DMO A;  1TUD A;  2LZ6 B;  4E6R A;  5FWB A;  2MIO A;  1EFN A;  3R6N A;  1JO8 A;  1MV3 A;  1AWO A;  1S1N A;  2PTK A;  2DL5 A;  2C0O A;  5IHI A;  2P4R A;  1GBQ A;  2FG0 A;  1Z9Z A;  3VS0 A;  2KR3 A;  2EW3 A;  2J6O A;  1X6B A;  2IIM A;  4OMP A;  4HVU A;  1UGV A;  2C0T A;  2X3X D;  2BZX A;  2AZV A;  2EYX A;  2O2O A;  2KXC A;  1TUC A;  4OMO A;  2I0N A;  2JMC A;  3REB B;  3VS6 A;  3PE0 A;  2CUB A;  5HCK A;  1M27 C;  2RN8 A;  2ENM A;  2FEI A;  4J9C A;  5FWC A;  3VS5 A;  2JT4 A;  1HSQ A;  2K3B A;  3I9Q A;  3VRZ A;  1RLQ C;  4IIO A;  1E6H A;  2GQI A;  1M3A A;  3JV3 A;  4AFZ C;  2LMJ A;  3QWY A;  2KXD A;  3A98 A;  1JEG A;  1Y0M A;  1UDL A;  1WI7 A;  2YUP A;  4RTU A;  1AWJ A;  2V1Q A;  1UHF A;  1GRI A;  3EG2 A;  1ZX6 A;  2L0A A;  1BB9 A;  1BBZ A;  1AWW A;  3NMZ C;  2DL4 A;  1JXO A;  2ED0 A;  2CSI A;  3M0P A;  2LP5 A;  3EG3 A;  2J06 A;  1UJ0 A;  1AD5 A;  2JTE A;  2AKL A;  1SRL A;  5EC7 A;  4Z89 A;  1GCQ C;  1WX6 A;  3C0C A;  1TG0 A;  2A08 A;  2RQR A;  2FPF A;  3SHW A;  2A36 A;  2YUQ A;  4CC4 B;  2CSQ A;  3H41 A;  4AFU C;  4OMN A;  1OOT A;  3EGU A;  3VS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...