1PSFA

The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosystem i
molecule keywords PHOTOSYSTEM I ACCESSORY PROTEIN E
publication title Three-dimensional solution structure of PsaE from the cyanobacterium Synechococcus sp. strain PCC 7002, a photosystem I protein that shows structural homology with SH3 domains.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1psfA00
1IREB 1QP3A 2ZCFB 1UGQB 2WSCE 2PU9B 1DJ7B 3A8LB 4ZGJB 3A8GB 4OB3B 1UGSB 3X20B 2O01E 1PSFA 2DPPB 3X25B 2CZ0B 4ZGEB 2ZPHB 3A8OB 2DXCA 4OB0B 2ZPEB 4XK8E 3X26B 3QYGB 2DD4A 3QZ9B 2ZPBB 4ZGDB 2DD5A 2ZPGB 3QZ5B 1UGPB 1JB0E 2PVGB 3HHTB 2AHJB 2QDYB 1AHJB 3QYHB 1UGRB 2DXBA 4FM4B 3LW5E 1QP2A 3QXEB 2CZ1B 5L8RE 2ZPIB 3A8HB 2CZ6B 3VYGA 2PUOB 2PVOB 1PSEA 4OB1B 4Y28E 2WSEE 2ZPFB 4OB2B 2D0QB 3X24B 3VYHB 3A8MB 3WVEB 3WVDB 4L6V5 2WSFE 2PVDB 4KT0E 4RKUE 2PUKB 2CZ7B 3X28B 1V29B 2ZZDA 1GXIE 2CYZB
chains in the Genus database with same CATH superfamily
3CCEA 1GCQA 1VQ6Q 1FX7A 1UGQB 4WTOB 2DBMA 2FO0A 2K4YA 3H41A 4DEYA 1DJ7B 1QWEA 1QVGP 4C92C 4F16A 1RI0A 1VQLT 5FU6B 3SFMA 2YRDA 3OS5A 2X4YA 3A8OB 1BU1A 1HJDA 1RACB 3L2WA 1NBEB 1GCQC 1J3TA 3JCMQ 3I9QA 4E7HA 1R77A 1NJIC 2YRCA 2DLPA 5LL6S 1NG2A 1SPKA 3M0TA 3LGLA 2C0OA 7AT1B 3CXCP 1N27A 3C12A 1VQ8T 5A0GA 5GMKm 2LQWA 3META 3AT1B 2DRKA 2DTOA 3OYJA 1ZBXA 4D8KA 2FVUA 5L8RE 2J6FA 2FEIA 4GY5A 2COWA 4F04B 2E12A 2J6OA 1QVGA 1PHTA 4FYWB 2C0TA 4J9DA 1WHJA 1AEYA 1SG5A 2ESWA 5M9OA 4MDXA 3NMZC 3EG3A 2K3BA 2OAUA 1WHMA 2CH4A 4KT0E 5LJ5h 5GANe 2D6FA 2PUKB 3V7CA 4ESRA 3EH2A 1KQ1A 3BY7A 4OMMA 4B6MA 5FWBA 4FW1A 3SEMA 2HQHA 3EGXB 3EG1A 1ZSZA 1W2BP 5GAOr 2AKLA 3R6OA 2R5AA 3CXCA 4AMCA 5KYYA 4LXCA 3DB3A 5GJWB 3H0FA 1SF9A 2QEXA 3A8GB 2JMCA 1WA7A 3KBGA 4FSSA 2CGHA 2DILA 2QQBA 4A4KA 1M27C 3OYCA 4HKEA 2CP3A 3HRSA 3X25B 1YJNQ 2MF2A 1MUZA 3OYFA 1IGQA 1RABB 2NLUA 2R58A 3S6WA 3J80E 4OF1A 1ZSZC 1N8RU 2RI3A 1RAGB 1NM7A 4J9HA 2W10A 1GFDA 1Z9ZA 2RMOA 3S3NA 2ED1A 2RK1A 4O6JA 1UDLA 1RLPC 1I07A 1JXOA 1TH7A 1WXBA 2KEAA 1JBMA 1MMNA 4D6WA 2RB6A 2YUQA 2F2XA 2P0PA 2JMAA 4PJOB 3I55A 1WJRA 4EMHA 3CCVA 2DE0X 4KGZB 1TWBA 4M75A 1W2BA 5DM7R 3VS7A 1N8RR 1W1FA 2KI7A 5HCKA 3QJYA 3L1AA 3M0UA 2V8IA 3CQTA 1X2KA 1U1TA 1E7OA 1MV0B 4DQ2A 4C5EA 3G71Q 2GGRA 2O88A 1TSFA 1PC0A 3URGA 3VYHB 4C8QB 4M75C 4FYYB 4PJOG 1VQPT 3RDVA 1ZA2B 5KE2A 1WX6A 2DXUA 3ER0A 2L0AA 2L3QA 2CP5A 3MEWA 3H8ZA 1FYNA 1Q82R 2DL8A 4KRTA 2DF6A 3CPWP 2XU8A 1EFNA 1JO8A 4MDWA 2FPEA 4PJOD 2L8DA 3V8KA 1U3OA 2MOXA 4ZGJB 5LJ5d 1WZOA 1K1ZA 2EQUA 1RAIB 4HVWA 2V1RA 4C8QG 1YITA 3G4SQ 1KG1A 4M7DB 3KXTA 4UC4A 4OMLA 5A2QE 1SSHA 1G3WA 2A7YA 1BIAA 4XU3A 3CCST 3MEVA 1GBRA 3OMGA 5LJ3e 2D8JA 1PM3A 2BTTA 3I5RA 2DMOA 3EGDB 4M77F 1OPKA 2RJCA 4C8QD 1CKAA 4XTZA 2KNBB 2RJDA 1AVZC 1NZ9A 4N4GA 4HCKA 2IVWA 3EAEA 3G6EQ 2R5MA 2AIRB 3DKMA 5CCAA 3CPWA 2LQNA 2V8KA 4M7DG 2VV5A 1VQKT 3PIOA 2RH2A 1G83A 4R55A 4C8QE 2QQRA 4X9CA 1PSEA 3JCMf 1AZGB 2G6FX 2JTFA 1GCPA 1IXDA 3ZFJA 3L2UA 3MO8A 2LP5A 1D0YA 4JRKA 2DM1A 1OV3A 2NUPA 3A8MB 3OQ5A 4M7DD 2DL3A 2HL3A 3VS0A 3EG2A 1PWTA 3VS6A 2VGMA 1OULA 3CMEQ 3CC4T 3REAB 1M2VB 4F17A 2JUFA 1H3ZA 1OX9A 2KR3A 1N9RA 4DEXA 2RQVA 2XDPA 2X9HA 3UF4A 1NPRA 2Y4YA 1M1FA 1GXIE 4PLLA 1KQSS 2KBTA 1VQ7Q 3RUXA 4A63B 4RTZA 2RI2A 2LT1A 2JS2A 4EPCA 1HK9A 1BBZA 4CC7A 2QG9B 2VYTA 3CD6A 2LJ0A 3JRZA 2RK2A 1Q7YR 2JM8A 1C1AA 2M51A 4RCCA 3PTAA 2O01E 5KCOA 1PSFA 2WACA 4BD3A 2COYA 4X34A 4JDSA 5GAN6 2CH4W 1ZUUA 2GFAA 4YTLA 1RADB 3FLGA 5CQXA 2HSPA 3DB4A 5KYXA 1SRMA 1K8AC 4B9XA 2RNAA 2K79A 1KK7A 2YWWA 2E41A 1N5ZA 3S3OA 1M1KU 4J6WA 1YJ9T 1WDXA 5CO7A 3PVQA 3VS1A 1JJ2S 2DKGA 3J81E 1V1CA 1K9MU 3H6ZA 1D3BB 2ATCB 3I55T 4JLGA 2M0OA 4RTUA 2RPNA 1D0XA 4CC2A 4CI0C 5I21A 1WHKA 3C0CA 1VQ8A 4DBFA 2NUTA 3QDRB 2X3WD 1VUBA 3PE0A 4J6YA 4KULA 3V8LA 4LD9K 1M1KR 2MK5A 3QIIA 4QQ6A 4KH0B 1Q86U 3CCUA 4Z88A 2E1HA 3O8VA 3F70A 1QCOA 2EYZA 1BKBA 2EYXA 5DLQE 3X24B 2I2LA 1VQMT 2NUZA 4M7AA 3M0SA 4N4HA 2IIMA 1H3HA 1K9MR 4K11A 2EKHA 1JQQA 1OQKA 1UJ0A 3CMAQ 5ECAA 4VUBA 2LX9A 2OTJA 2AZVA 4AFZC 2JNGA 3JCMX 1QP3A 1WHLA 2KT8A 4RMOA 2X3XD 1KC8U 1WQ7A 1TXQA 2X4XA 1RLQC 2DETA 2IPOB 2VXFA 2W0ZA 3BW1A 3M59A 3LYIA 5LJ5g 5I2MA 3E19A 2YRVA 2ZPHB 4KH1B 4BY6C 2F5TX 2DXCA 3OYAA 1QKXA 1KD1U 1VQ5Q 2KT1A 5KYNA 3CPFA 3G71T 2F69A 2D9TA 1YITT 1B34A 3C94A 4J9CA 1X6OA 3OA6A 1PRLC 4QW2A 2ZPBB 2MYSA 3RESA 2VGNA 3CC7Q 1BI0A 2R57A 1JB0E 3OYDA 3JCMg 4LDWA 1Q81R 4HCBA 4PKCC 1V76A 5FRNA 5I22A 2AHJB 5FW9A 2K5FA 5GAN3 5GMKl 1VA7A 4XTYA 1YCSB 2AZSA 2RHUA 1KD1R 1YJWQ 2EGCA 2JTMA 3CBOA 5J39A 1KHIA 2CZ1B 1HSQA 3P8DA 4Z8AA 1WNLA 1A0NB 2CZ6B 2XI9A 5GAN7 4LDYA 1NEGA 1ZUYA 1VYTA 3G4ST 2RO0A 4OGCA 2BKDN 3M0RA 4JRQA 1O9SA 4EMKA 3LX7A 4D8DA 1LVKA 2F2VA 5CAIA 3CBMA 2QI2A 2B8AA 1SHFA 4ORZA 3MP1A 4A54A 1T0HA 5C6SA 1JJ2P 5CKHA 4RTXA 2HL5C 1N8RC 4FSXA 2ROTA 1T3SA 5GMKe 1T0JA 3M9QA 3CCJQ 2VVKA 2KROA 2QTVA 2X51A 1XOVA 1R0BG 5IXBA 3G6ET 1I8FA 3I56Q 2DEUA 2WSCE 4EMKC 3CCEQ 3HTRA 1K4US 1LNXA 2EBPA 4E7IA 1WQWA 4N0AC 4MMLA 3PMTA 3HRUA 4TVRA 2D8HA 1SRLA 2EPDA 1GFCA 2BIVA 5GANj 2L5QA 2F5KA 4MMKA 5GAOp 5CKBA 2E6NA 2GQVA 1QVFS 2FRWA 1S72Q 4J9FA 1D1BA 1JRIA 3X26B 4A4GA 4QVDA 3JAME 3RMQA 1Q82C 3ZBDA 4JLIA 2A28A 1TTHB 2CSIA 3CCSA 2V1QA 2Y4XA 1JJ2A 4XTUA 1YHQA 1K73R 2CS7A 4HT9A 1WXTA 2DZCA 3HFOA 1W70A 4XTXA 1AWJA 1PD0A 1BCOA 3CCQT 3EG0A 3FJ5A 3JCMe 9ATCB 2JOYA 2O4XA 3EFSA 2PVOB 2JXBA 4OB1B 2J05A 1VQ4T 2M9UA 3OW2S 4Y28E 4O5VA 4XQ3A 1VQKA 2ZPFB 3MEUA 3PNWC 1PD1A 1RAAB 5EC7A 1OU8A 1ZA1B 3M57A 3CCUT 1YWOA 5A0LA 2MCNA 4JJNK 1V29B 3EFOB 1IB8A 3E2UA 1YIJQ 3OSVA 1U1SA 3M5AA 1TUGB 3CC4A 4FT4A 2OTJT 2X4WA 3SWNC 2FZGB 1Y57A 2J7IA 5C0MA 2QEXQ 1NPPA 5J3BA 1PRMC 5IN1A 1NE8A 2FZCB 1M3AA 2Y90A 2RQWA 4XK8E 4M78F 2HQEA 4A4HA 3SHWA 1YI2Q 4FU6A 4ZTFA 5HY6A 3S3MA 1R0CB 3QWXX 3QSUA 1VQNQ 2DZ9A 4HCCA 5GAMd 2MIOA 1M90U 2YLBA 4CC4B 2EAYA 2KGTA 4RTYA 1NYFA 3OS0A 2B86A 1Q7YC 3VS5A 3QYHB 3CCMT 2EQMA 3PVLA 3CCVQ 3OYYA 3OYIA 3UDCA 4C5GA 3KFVA 4OGEA 1YJ9A 3FEOA 5LJ3j 3DLLA 1QVFP 4PLIA 1HD3A 3OYEA 2XD0A 2VKNA 4PK4A 2GF7A 1JXMA 3H0IA 3EG9B 5KCHA 2YHTA 5GAMf 1M90R 4M78B 2QK0A 2M0YA 2CKKA 2QAZA 4PJMA 2OAWA 2VWFA 4QT7A 3M56A 1I5LA 2BZXA 4A4FA 3GP8A 2Z0WA 2LC4A 3RBBB 3UA7A 5FU7B 3M4YA 4L6V5 5GAOn 1YCYA 1D1AA 2RD1A 1I5OB 3RKXA 4AFQC 5KYUB 1AT1B 3CC2Q 1VQMA 4JJDA 2KRMA 3M55A 3VS3A 1IREB 2H8HA 3M0PA 4JS4A 2L3SA 1OZ2A 1AOJA 2XK0A 1QCFA 3FC3A 2KXCA 2FZKB 1UUEA 1M1KC 5GANh 1WLPB 4E7ZA 4LD6A 4C0GA 3AHUA 4M78G 1ZX6A 3OW2P 1JEGA 4JZ4A 2CT4A 2HCKA 4Y91A 2RJEA 1QVFA 4QVZA 1VYVA 2OI3A 4PFPA 2HQXA 2FB7A 1K9MC 4L59A 3BE3A 4BE1A 1UG1A 3UA6A 5FU6C 1X75C 4M7AF 2EJFA 3FRNA 1RAEB 2RF0A 2QQ9A 1G3TA 1UE9A 4M78D 2K5IA 3IQLA 1OI1A 2L2PA 3NHNA 5GJVB 3G71A 2GCXA 1NJIU 2LCCA 3JCMb 4AG1C 4QQDA 3REBB 1WJSA 5D6WA 2RI5A 1YHQT 4M78E 3A8HB 2QA4Q 2DX1A 2KK4A 3OW2A 2KQWA 2KE9A 5LJ5f 3GIBA 3FB9A 4BI8B 8AT1B 1I4K1 4M7AB 3VS2A 3OYGA 2K2VA 2K5LA 4RTVA 1Q81C 2RHYA 1M1GA 3EGXA 1VQ6T 1MHNA 3WVEB 1Z9QA 2LVMA 4RCBA 2RA2A 4J9IA 1B07A 1P92A 3G4SA 2XIDA 4F7UF 3UWNA 2RM4A 5IAYA 1FXXA 3P8BB 2EKOA 1Y0MA 2DL7A 4IUTA 4QVCA 3LH5A 3CBPA 2VC8A 2LT4A 1W4SA 1Y96B 4E6RA 1W6XA 2DYBA 3A5ZB 4M77B 2EFIA 4M7AG 4IURA 1WXUA 2A08A 1XTDA 5IT9E 3CD6Q 2DPPB 2JT4A 3G6EA 1UB4A 4RTTA 1HYOA 2P4RA 3CCRQ 1H8KA 2LDMA 2O9VA 1SEMA 2KYBA 2XKOC 4C0DB 1WGSA 2CP7A 2QGFB 4PJOA 5HK0A 2LCLA 1TUCA 2JM9A 2LCSA 4B9WA 4M7AD 4F7UB 2X35A 3OB9A 5GANd 1VQLQ 4XTVA 1G5VA 2VXEA 2K7AA 1AWXA 2L3RA 5GAMg 4BI4A 4LDUA 2M02A 4M77G 2QDYB 3C4SA 4JS5A 3VS4A 4OMOA 4C92F 5LJ3h 1BB9A 3TU4K 4EIKA 4PJOC 3OYMA 2DIGA 5EG2A 4M7AE 1QVPA 2JTEA 3ULRB 1WHHA 4PL6A 4C8QA 2COZA 4ELYC 4J9GA 5GAN4 2HZYA 4A53A 2OTLQ 4XU1A 2K6DA 4M77D 2DL5A 1VQ8Q 2K9GA 4F7UG 4E47A 3CCQA 1X6GA 1M9SA 2KMTA 4II1A 4JUVA 4ATOA 4DOWA 1E6HA 3WVDB 1VQOQ 1K73C 2V8JA 3INZA 2WSFE 3FJPA 4L5GA 5FWCA 3JCMc 1VQ4A 1UECA 2QYZA 3X28B 4C8QC 3I35A 5GAN2 1FMVA 4M77E 4IIMA 3R6NA 2DJQA 3TCJA 2K57A 3BDLA 1YJNT 1VQ9Q 2HKQB 4RG2A 4FIBA 4C92B 4M7DA 1OZ3A 3EH1A 3HFNA 3L2RA 2E65A 2PU9B 2QASA 1K9AA 3GLXA 4OVAA 3J7AF 3EGDA 4X1VA 1B3QA 2GBQA 3E9FA 4PNOA 3QJ6A 4F7UE 2OJ2A 1EX4A 1NYGA 1RI9A 1KFZA 2D0NA 1TS9A 5GMKj 2SRCA 1Q86R 4M7DC 2GNCA 2MWOA 5IXFA 3L2QA 2VB6A 4DBHA 1YNZA 4C92G 1IHWA 1IZ6A 2LMJA 2KYMA 2EJGA 1RUWA 1PNJA 3V7SA 4V2SA 3HL8A 3CC2T 2DNUA 4GLMA 3A1PA 4CRIA 3UPUA 1BI1A 2JZ2A 3QXEB 2O4XB 3V7RA 2YSQA 1MNDA 3M4GA 4C92D 2CP2A 1KC8R 2BUDA 1KQSP 3CMAA 5GAMe 2EQKA 3CCMA 1OEBA 2SEMA 4JPBW 2QDLA 2CP6A 2RQUA 2AK5A 5LJ3d 1OOTA 4ANJA 4FCYA 2C06A 2JS0A 3L2ZA 3TSZA 4C92E 3OYBA 2P4TA 4Z89A 2CZ7B 1I81A 1K0SA 3GPLA 1VQ5A 2HBPA 1ACMB 2X4JA 2CDTA 2ZAEA 2NYSA 3VRYA 2ZCFB 4IKFA 4LUEA 1WJQA 3CC7A 1VQPQ 2YUOA 2KRNA 4N0AA 3CCLQ 4KGXB 3HRTA 4MZPA 1UHCA 1SSFA 2EW3A 3X20B 1M5Q1 1O75A 3QDFA 2MI6A 3M53A 1ZSZB 1PG5B 2EIFA 5FRMA 1XQHA 1KQSA 2CZ0B 2P0QA 1QWFA 1IO6A 4FYXB 4IIOA 3PGGA 4PFOA 3OYLA 5KYYB 4M75F 4PFZA 2RHZA 4BI3A 2DD4A 4JJCA 2QQAA 3QZ9B 3RNJA 2DD5A 3OYKA 1WYXA 2O9SA 3QZ5B 2HNIA 4XTWA 3TQ7P 5GANg 3WXMB 1K8AU 3QHSA 2RHXA 3GF5A 2GTOA 4KUIA 3TEEA 3CCSQ 4C0FA 2HD0A 1PKSA 3ASKA 4OMQA 4DBQA 2CREA 4EMGA 3PFSA 3LW5E 1QP2A 2O31A 3ME9A 3VV0A 1NEBA 3OSSC 1TOVA 5FLXE 5LJ5e 2RJFA 3CCJA 1LJOA 4X9DA 3CMET 2DIQA 1FWZA 2VASA 1LPLA 2EYWA 3I56A 4J9EA 2KY9A 2EGEA 4M75B 3CCRT 3JCMP 2FPFA 2A3LA 1VQ7T 3VU3C 4OB2B 3GNGA 2FRYA 3OYHA 2HBWA 2LRQA 1XJWB 1VQKQ 5D6YA 4BB7A 2ABLA 4E7JA 1S72A 2YXYA 4C5IA 3MHXA 2PTKA 1VOMA 1VQ6A 4KBMB 4Y92A 2MMPA 3QG1A 4N4IA 5GAN8 1M8VA 1ZQ1A 2DVEA 4J8OA 5AYFA 5DY9A 3SWNA 4M75G 4MZTA 1BYMA 3CC4Q 3NTKA 3TREA 1UGSB 1BIBA 1YFNA 1X01A 2I0NA 3M0QA 4HXJA 2HMAA 2ECZA 3BFMA 4ZGEB 5GMKh 2OTLT 5GAOq 2KAFA 3JCMV 2M1HA 2HAXA 3CEYA 1VYUA 2MPXC 4AG2C 4M75D 5GAOl 3CPWS 1AD5A 2P0KA 1UEBA 1VQOT 2QGGA 2KDSA 4ZGDB 1QKWA 1OX8A 3NPFA 4AFSC 1K76A 4J7IA 4OMNA 1GL5A 2KXDA 5CR2A 8ATCB 2F1LA 2KSSA 3EFRA 3TVTA 3JSCA 2GFUA 1VQ9T 3QO3A 4IUUA 4OMPA 5IHIA 4HVVA 3GOXA 5CVIA 2DJZA 5KYWA 4M75E 2HEQA 3EGUA 4F14A 2LJ1A 4AT1B 2EGAA 2BE7D 3VUBA 1UHFA 4IUVA 3G7ZA 4C5HA 3VYGA 3VRZA 5CK9A 1YIJA 1YJ9Q 2E10A 5I11A 3ZEHA 4PJOF 3CMAT 2AT1B 1SHGA 1C0MA 3H9NA 2D0QB 1NLOC 3RKYA 2M16A 1QLYA 4NL2A 1YWPA 3I55Q 2A36A 3MJXA 1LCKA 5LJ3g 2E5QA 3VJPA 2XG8D 3JB9J 1G2BA 3JCMh 4J9BA 4E7SA 2XICA 3MKDA 1H641 4LN2A 2NUPB 1YI2A 2DRMA 2DTHA 2DXTA 1VQ5T 2YLCA 4NS5A 1VQMQ 4ELZC 1VQNA 4OP0A 4C8QF 1M2OA 2FPDA 2EJ9A 4A4EA 1IRXA 1D0ZA 3THKA 2GQIA 4OB3B 3NTHA 4J5YA 1YJNA 2LQKA 4BUGA 1PKTA 3CC7T 1WI7A 1WPYA 5J26A 4GBQA 1JU5C 5IH2A 1ARKA 2QXFA 4OB0B 1KHCA 4GLKA 5GAN5 4BDZA 2JVVA 2LNVA 2A37A 4ZN3A 2MAMA 4JJBA 1YJWT 3SB2A 2O2OA 3QKJA 2E6ZA 1BCMA 1Q82U 3P8HA 1M8MA 1BI2A 4LNPA 4M7DF 3OS2A 5KYXB 4JRPA 2K3YA 4P5NA 1D09B 2XDDA 1YITQ 1MMDA 5I2SA 2E64A 2DK3A 4CC3A 1S1NA 3HPWA 3LGFA 2EVRA 3CCLT 2ZPIB 5GAOm 3MEAA 3CC2A 4FT2A 1CKBA 2HSEB 1Q86C 4BDYA 2JW4A 1ZSGA 2DTIA 2DA9A 3PT9A 5CKDA 1QW1A 1RAFB 2A0FB 1BK2A 3EFOA 3CCJT 4RUGA 2EQJA 1SKUB 1VIEA 3NGPA 2BZYA 3GNFB 3I56T 1G3YA 3O5ZA 3QUIA 3A98A 3CCET 2NUTB 1YN8A 4RKUE 3OYNA 4HA8A 2ED0A 1C6VX 3Q1JA 2L3PA 2HDAA 4QQGA 4QKUA 4HCZA 5DLOA 5HKCA 5AT1B 4IUQA 1KC8C 4J7FA 1LOJA 2F2WA 4R56A 2BE9B 3JB9F 4FYVB 1NJIR 4LDXA 1S72T 4PJOE 2OX7A 1UJYA 2J6KA 4BY6B 3A8LB 3JCMd 4HVUA 1Q95G 1MMGA 2EYQA 2YUPA 1TU0B 3QPHA 2DO3A 4XU0A 1KD1C 2J06A 2E70A 3V8JA 1M30A 4PJNA 3MP8A 3QWYA 2XDBA 3C95A 2QA4A 3U23A 3LWHA 2D1XA 1MMAA 3MP6A 2ZPGB 4IUPA 2DEQA 1H92A 2E5KA 3HHTB 3RMSA 4BACA 2H3EB 3LWIA 3HP9A 1B34B 2CUDA 2E3HA 3L42A 3SDZA 4DOVA 3EG9A 4BE0A 4FL6A 1K0XA 2XMFA 3JCMJ 2PNIA 4M78A 2JN0A 5A0DA 2JJ9A 2LQ8A 1KQ2A 1Q7YU 3FDRA 3PMIA 1IHVA 3JCMW 3NTIA 4RG8A 2GTJA 1XNIA 2PUOB 2V26A 1I0CA 1UFFA 5KH6A 1KSWA 4ME7A 2ZGWA 2WSEE 2DVJA 5KYUA 1YBYA 2KRSA 2K3XA 1YIJT 4M7DE 4BE2A 3RIRA 3CCQQ 4EDUA 1WFWA 3CMEA 3MPUB 4KUDK 4M78C 1M4ZA 3JB9G 3CCRA 1Y7XA 4AFUC 1VQ7A 3JB9H 1E6GA 1VQ4Q 1PCXA 2ZZDA 5GANf 4EMKB 2QEXT 5FU7C 4HT8A 5GAMj 3VUZA 1N9SA 1VQLA 3RR6A 1X2QA 1D1CA 1X6BA 3CCUQ 3PIPA 3JB9D 1G3SA 3JV3A 1ZHIA 1YI2T 2HKNA 3EHQA 1F1BB 4Z02A 2DBKA 1T3LA 1X27A 3SD4A 1VQNT 2LZ6B 4LUDA 1MNEA 1OPLA 4WCIA 1I1JA 3HKSA 2YT6A 1QCNA 3QBYA 4KGVB 1KJWA 3OBWA 2ENMA 2K2MA 4ZTJA 5IHKA 3BDUA 3D7SB 4ZNXA 3OMCA 2XHCA 4J83A 2LTOA 3VKIA 2OTJQ 1ZBJA 1UTIA 3CCVT 2OTLA 2QTXA 4RTWA 3UT1A 5CKEA 1Y07A 4FW2A 2PVGB 4XAXB 2ROLA 2EYYA 1M3CA 1AWOA 2MWPA 1QQJA 5D6XA 3I5SA 1AHJB 1VQOA 1U5SA 2C0IA 3OS1A 2RQTA 1Y71A 4DA4A 2CSQA 2QQSA 4WF2A 2RN8A 2RQRA 2KVQG 1ABOA 4NOYA 1TG0A 1VQ9A 2E3IA 2PQWA 3NFCA 5CQYA 1QVGS 3M54A 2L89A 2CP0A 3E9GA 3CCMQ 3JB9I 3OBYA 2IG0A 3LLRA 1UGVA 4E7KA 4M7AC 1Q81U 1Y96A 1X69A 4M77A 2DFUA 1K8AR 5LJ5j 5L23A 5CIUA 1IGUA 1M3BA 1M2VA 1EIFA 4ZN1A 1U8RA 3SWNB 5FROA 2NWMA 4JZ3A 1BI3A 2P84A 3MCAB 2CT3A 2LX7A 2AKKA 3CXCS 3OY9A 1VIFA 2EQIA 2PZ1A 3T9NA 4JRIA 2LJ3A 4NL3A 4MZMA 3EHRA 4F7UA 1KIKA 2EWNA 3HSBA 4M77C 4E2FB 1GRIA 3RKWA 1OU9A 2DAQA 1R8OB 2ZPEB 5D7UA 5GMKi 1WHGA 3GBQA 3E1SA 2FHDA 1ZUKA 3QYGB 1AZEA 3LH0A 3M58A 1M90C 1EZZB 5HK3A 3ZL7C 5LJ3f 4C0DC 1FMKA 2DYIA 1U06A 1UGPB 3G1JA 3FIFA 2QA4T 1YP5A 1MGQA 1N6AA 1TUDA 3DLMA 1NLPC 2FL7A 2FYKA 3KUFA 5KYWB 1YJWA 1WIEA 4LDVA 6AT1B 1UGRB 1G8XA 4R0KA 2DXBA 4XU2A 1B7TA 1CSKA 1FMWA 1ZLMA 4FM4B 3UATA 2H3JA 3H0HA 5CKFA 1X43A 1GBQA 4E7LA 2BZ8A 1W2BS 2YDLA 1AWWA 4J6XA 2VUBA 3TSWA 4Q5WA 1D3BA 3L2VA 2RHIA 5KE3A 2DL4A 1ABQA 1VQPA 1MV3A 2E4HA 3CCLA 2FG0A 1YHQQ 2LNHB 2G3RA 4PJLA 1OYXA 4C92A 4LE9A 3N5BB 4C0ZA 2PVDB 1QMCA 2DERA 4PJJA 5GAMh 1HXDA 5IHNA 2YUNA 4DBRA 1K73U 3RERA 3CD6T 1RAHB 1RL2A 4OMFB 4M4ZA 2CUBA 2CYZB
chains in the Genus database with same CATH topology
3CCEA 2JNGA 3CBPA 3JCMX 1YI2A 2VC8A 1QP3A 2DTHA 2DXTA 1FX7A 2LT4A 1VQ5T 1W4SA 2YLCA 1UGQB 4NS5A 1Y96B 4ELZC 2OTJA 1VQNA 4RMOA 4OP0A 1KC8U 4C8QF 2K4YA 3A5ZB 4M77B 1WQ7A 2EFIA 1DJ7B 2EJ9A 4A4EA 2X4XA 4C92C 4OB3B 4IURA 4M7AG 3NTHA 1RI0A 4J5YA 1YJNA 2VXFA 1VQLT 3BW1A 3M59A 2LQKA 1XTDA 3LYIA 4BUGA 5LJ5g 5FU6B 5I2MA 5IT9E 3E19A 3SFMA 2DPPB 3CC7T 1WPYA 3OS5A 5J26A 3G6EA 1UB4A 2YRVA 2X4YA 2ZPHB 3A8OB 4BY6C 2LDMA 2QXFA 2F5TX 2DXCA 3OYAA 1KD1U 4OB0B 1KHCA 4GLKA 3CPFA 3G71T 2XKOC 4C0DB 1WGSA 2F69A 5GAN5 3L2WA 4BDZA 2D9TA 1YITT 4PJOA 1B34A 2JVVA 2LCLA 5HK0A 2LNVA 4ZN3A 2MAMA 3C94A 1X6OA 3JCMQ 1YJWT 3OA6A 4B9WA 4M7AD 4QW2A 4F7UB 2X35A 3OB9A 2ZPBB 3SB2A 5GANd 4E7HA 4XTVA 3QKJA 3RESA 1G5VA 2E6ZA 2VGNA 2VXEA 1BI0A 2R57A 1JB0E 3OYDA 3JCMg 1NJIC 4LDWA 4HCBA 2L3RA 1Q82U 4PKCC 5LL6S 4BI4A 5GAMg 3P8HA 4LDUA 5FRNA 1BI2A 2AHJB 4M77G 3HSBA 2QDYB 4M7DF 3C4SA 1VQ8A 3OS2A 2K5FA 3LGLA 5GAN3 4JRPA 5GMKl 2K3YA 4P5NA 2XDDA 4JS5A 1N27A 3C12A 1VQ8T 4XTYA 5A0GA 5I2SA 5GMKm 2E64A 2RHUA 4C92F 3META 5LJ3h 3TU4K 2DK3A 2JTMA 2DTOA 3CBOA 1ZBXA 5J39A 3OYMA 3OYJA 4PJOC 2DIGA 3HPWA 1KHIA 3LGFA 2CZ1B 1QVPA 5EG2A 4M7AE 2FVUA 4PL6A 5L8RE 2ZPIB 3P8DA 3CCLT 4C8QA 5GAOm 4GY5A 3CD6A 4ELYC 1WNLA 2E12A 3MEAA 2CZ6B 5GAN4 3CC2A 1QVGA 4FT2A 2XI9A 5GAN7 1Q86C 4LDYA 4A53A 4XU1A 4M77D 4BDYA 2DTIA 3G4ST 3PT9A 5CKDA 2RO0A 4F7UG 1QW1A 4OGCA 2BKDN 4JRQA 5M9OA 4E47A 3CCJT 3CCQA 1M9SA 1O9SA 4EMKA 4MDXA 2KMTA 4II1A 2EQJA 4JUVA 3LX7A 1VIEA 3GNFB 3I56T 4ATOA 4DOWA 1G3YA 2OAUA 3WVDB 3QUIA 5CAIA 3CCET 3CBMA 2QI2A 2B8AA 1K73C 2V8JA 3INZA 2WSFE 3FJPA 4L5GA 3MP1A 4KT0E 3JCMc 4A54A 5LJ5h 1VQ4A 5GANe 2D6FA 4RKUE 2PUKB 3V7CA 5C6SA 3OYNA 1KQ1A 4HA8A 3BY7A 3Q1JA 3X28B 4C8QC 5GAN2 5CKHA 4QQGA 4M77E 4HCZA 1N8RC 4FSXA 3TCJA 5DLOA 5HKCA 2K57A 3BDLA 5GMKe 1YJNT 3M9QA 4IUQA 1KC8C 4J7FA 4RG2A 4FIBA 1LOJA 1XOVA 4C92B 4R56A 5GAOr 3JB9F 3R6OA 3G6ET 1I8FA 1OZ3A 4LDXA 4M7DA 2R5AA 3HFNA 2WSCE 1S72T 3CXCA 3L2RA 2E65A 4EMKC 4PJOE 1LNXA 2PU9B 3DB3A 4BY6B 4E7IA 1WQWA 3A8LB 3GLXA 3JCMd 2QEXA 3A8GB 4N0AC 4MMLA 3PMTA 2EYQA 3HRUA 4OVAA 3KBGA 4TVRA 2CGHA 3QPHA 4A4KA 2QQBA 3OYCA 2DO3A 4HKEA 4XU0A 1KD1C 2BIVA 3HRSA 3X25B 3J7AF 5GANj 2L5QA 2F5KA 2MF2A 3E9FA 3QJ6A 4MMKA 4PNOA 5CKBA 4F7UE 5GAOp 3OYFA 2E6NA 2GQVA 2NLUA 1QVFS 2R58A 3S6WA 2E70A 3J80E 4OF1A 3V8JA 5GMKj 1N8RU 2RI3A 3MP8A 2XDBA 1JRIA 3X26B 4M7DC 2MWOA 3C95A 4A4GA 2QA4A 3L2QA 4QVDA 3JAME 3RMQA 3LWHA 3S3NA 1Q82C 3MP6A 3ZBDA 4JLIA 2ZPGB 2RK1A 4C92G 4O6JA 4IUPA 2DEQA 1IZ6A 3HHTB 3RMSA 1TH7A 1JBMA 4BACA 4D6WA 2RB6A 3CCSA 2P0PA 2Y4XA 2EJGA 3HP9A 3LWIA 1B34B 1JJ2A 4XTUA 3V7SA 4PJOB 1YHQA 4V2SA 3HL8A 3I55A 1WJRA 3L42A 2CS7A 3SDZA 4EMHA 3CC2T 4HT9A 3CCVA 2DZCA 3HFOA 4DOVA 4CRIA 4BE0A 4FL6A 4M75A 4XTXA 3UPUA 3JCMJ 1W2BA 4M78A 2JN0A 5A0DA 5DM7R 2LQ8A 1BI1A 2JZ2A 3QXEB 1Q7YU 3FDRA 1KQ2A 2O4XB 3V7RA 3PMIA 3CCQT 3M4GA 4C92D 3JCMW 3JCMe 2BUDA 3CMAA 3QJYA 3NTIA 4RG8A 2JOYA 5GAMe 2EQKA 1XNIA 2O4XA 2PUOB 3EFSA 3L1AA 3CCMA 2PVOB 2V8IA 4OB1B 5KH6A 1U1TA 4ME7A 1VQ4T 2M9UA 4DQ2A 3OW2S 4C5EA 2ZGWA 2WSEE 4Y28E 4O5VA 4XQ3A 1VQKA 2ZPFB 1YBYA 1YIJT 2K3XA 3MEUA 3PNWC 3URGA 5LJ3d 3VYHB 4C8QB 4M7DE 4BE2A 3RIRA 4EDUA 3CMEA 4M75C 4KUDK 2C06A 4PJOG 1VQPT 4M78C 3L2ZA 1M4ZA 3M57A 4C92E 3CCUT 3OYBA 3JB9G 2P4TA 3CCRA 5KE2A 2DXUA 2CZ7B 5A0LA 3ER0A 1I81A 1Y7XA 4JJNK 1VQ7A 3GPLA 1V29B 3JB9H 1VQ5A 2ZZDA 5GANf 3MEWA 4EMKB 2HBPA 2QEXT 5FU7C 2X4JA 3H8ZA 4HT8A 5GAMj 3VUZA 3OSVA 1N9SA 2XU8A 1U1SA 2ZCFB 1VQLA 4IKFA 3M5AA 1WJQA 4MDWA 3CC4A 4FT4A 3CC7A 4PJOD 2L8DA 3V8KA 2OTJT 3PIPA 4N0AA 3JB9D 3HRTA 4MZPA 1G3SA 4ZGJB 1ZHIA 2X4WA 1SSFA 5LJ5d 1YI2T 3SWNC 3X20B 4Z02A 1M5Q1 1O75A 5C0MA 3SD4A 2MI6A 2EQUA 1VQNT 3M53A 1NPPA 2EIFA 5J3BA 4C8QG 1XQHA 1YITA 1KQSA 5FRMA 2CZ0B 1KG1A 5IN1A 4M7DB 2P0QA 1NE8A 3KXTA 4UC4A 3HKSA 3PGGA 3QBYA 5A2QE 2Y90A 3OBWA 3OYLA 4ZTJA 3BDUA 4M75F 1G3WA 2A7YA 1BIAA 3OMCA 4M78F 2XHCA 2RHZA 4J83A 4XK8E 4XU3A 4BI3A 3CCST 2HQEA 3MEVA 2LTOA 3VKIA 3OMGA 4A4HA 5LJ3e 2DD4A 4FU6A 2QQAA 3QZ9B 3CCVT 4M77F 5HY6A 2QTXA 3S3MA 4ZTFA 2OTLA 3QSUA 2DD5A 3OYKA 2DZ9A 2RJCA 3QZ5B 5GANg 2HNIA 4XTWA 3UT1A 4HCCA 3WXMB 5CKEA 1Y07A 4C8QD 5GAMd 2PVGB 4XAXB 1K8AU 4XTZA 2RJDA 1M90U 1NZ9A 2YLBA 3QHSA 1BYMA 2MWPA 2EAYA 5D6XA 2RHXA 3GF5A 4N4GA 2IVWA 3EAEA 4KUIA 3OS0A 3TEEA 1AHJB 4C0FA 1Q7YC 2HD0A 2R5MA 3QYHB 3CCMT 2EQMA 1VQOA 3ASKA 3OS1A 3DKMA 1Y71A 4EMGA 3PFSA 5CCAA 3CPWA 3LW5E 1QP2A 3ME9A 3VV0A 4DA4A 2V8KA 3OYYA 3OYIA 2QQSA 2VV5A 4M7DG 3UDCA 4WF2A 1VQKT 4C5GA 3PIOA 2RH2A 3OSSC 4OGEA 1YJ9A 3FEOA 2KVQG 5LJ3j 4R55A 4NOYA 5FLXE 3DLLA 5LJ5e 2RJFA 4PLIA 4C8QE 1LJOA 2QQRA 3OYEA 3CCJA 4X9DA 4X9CA 1VQ9A 2XD0A 3CMET 2PQWA 3NFCA 5CQYA 2DIQA 1FWZA 1PSEA 3JCMf 2GF7A 1QVGS 3I56A 2KY9A 3M54A 5KCHA 4M75B 2YHTA 2JTFA 2L89A 3E9GA 5GAMf 3CCRT 3JCMP 4M78B 2A3LA 1VQ7T 3ZFJA 2CKKA 3VU3C 3L2UA 4OB2B 3GNGA 3M56A 3OYHA 1I5LA 3MO8A 4JRKA 2LRQA 4A4FA 3JB9I 3GP8A 3A8MB 3OBYA 2IG0A 3LLRA 3OQ5A 4M7DD 2LC4A 5D6YA 5FU7B 4BB7A 3M4YA 4E7KA 4L6V5 1Q81U 4M7AC 2VGMA 5GAOn 1Y96A 1YCYA 2RD1A 3CC4T 3RKXA 4M77A 2JUFA 1H3ZA 1N9RA 4E7JA 2XDPA 1S72A 4C5IA 1NPRA 2Y4YA 1M1FA 3MHXA 5CIUA 4PLLA 5LJ5j 1KQSS 1VQ6A 1GXIE 3RUXA 4KBMB 1VQMA 2MMPA 2RI2A 3M55A 3QG1A 1EIFA 1IREB 4N4IA 3SWNB 5FROA 4ZN1A 2LT1A 4JS4A 1U8RA 1OZ2A 5GAN8 1BI3A 1M8VA 2XK0A 4EPCA 1HK9A 1ZQ1A 2DVEA 3MCAB 4J8OA 3FC3A 5AYFA 3CXCS 5DY9A 2VYTA 3SWNA 3OY9A 4M75G 5GANh 1M1KC 1VIFA 4MZTA 3JRZA 4LD6A 4C0GA 3NTKA 3AHUA 2RK2A 4M78G 3TREA 3T9NA 1UGSB 1BIBA 4JRIA 4RCCA 1X01A 4NL3A 3PTAA 2O01E 5KCOA 4MZMA 1PSFA 4F7UA 2EWNA 2WACA 4BD3A 4X34A 4Y91A 2RJEA 1QVFA 3BFMA 4JDSA 4M77C 4QVZA 5GAN6 4ZGEB 5GMKh 5GAOq 2OTLT 2KAFA 2HQXA 2FB7A 3JCMV 2GFAA 4L59A 2M1HA 3RKWA 1K9MC 2DAQA 4BE1A 1R8OB 4YTLA 2HAXA 3CEYA 3FLGA 2ZPEB 5FU6C 1X75C 5GMKi 5CQXA 4M7AF 2EJFA 3FRNA 3DB4A 3E1SA 2FHDA 2QQ9A 1G3TA 3QYGB 4M75D 5GAOl 3CPWS 2P0KA 3LH0A 1UEBA 4M78D 2K5IA 3M58A 4B9XA 1K8AC 1M90C 5HK3A 1VQOT 2KDSA 4ZGDB 5LJ3f 4C0DC 1OI1A 2E41A 4J7IA 1UGPB 3FIFA 3G71A 3S3OA 2QA4T 5CR2A 4J6WA 1M1KU 1MGQA 1N6AA 2GCXA 3DLMA 1YJ9T 2KSSA 5CO7A 1NJIU 2FL7A 2FYKA 2LCCA 3KUFA 3JCMb 3EFRA 1YJWA 3JSCA 4LDVA 2GFUA 1VQ9T 1JJ2S 1UGRB 2DKGA 3QO3A 4IUUA 4QQDA 3J81E 2DXBA 4XU2A 3GOXA 4FM4B 5CVIA 2H3JA 1WJSA 2DJZA 5D6WA 5CKFA 3H6ZA 1K9MU 4M75E 2RI5A 1YHQT 1D3BB 3I55T 4E7LA 1W2BS 4M78E 4JLGA 4J6XA 3A8HB 3VUBA 2M0OA 2VUBA 4CI0C 4IUVA 3G7ZA 2KK4A 4Q5WA 3VYGA 4C5HA 5CK9A 1D3BA 2E10A 3QDRB 5I21A 3OW2A 3L2VA 2KQWA 1VUBA 2RHIA 5KE3A 5LJ5f 3GIBA 4J6YA 3ZEHA 3FB9A 4BI8B 4KULA 3V8LA 4LD9K 1YIJA 1I4K1 4PJOF 4M7AB 3QIIA 3OYGA 4QQ6A 1VQPA 1Q86U 3CMAT 3CCUA 2E1HA 3O8VA 3CCLA 2D0QB 3F70A 2K2VA 2K5LA 1BKBA 2RHYA 1Q81C 5DLQE 3X24B 1M1GA 2M16A 3RKYA 4NL2A 1VQ6T 2I2LA 1MHNA 2G3RA 3WVEB 1VQMT 1OYXA 2LVMA 4RCBA 4C92A 5LJ3g 2E5QA 2RA2A 3VJPA 4M7AA 3N5BB 2XG8D 4N4HA 4C0ZA 1P92A 3JCMh 3JB9J 3G4SA 2PVDB 2XIDA 4F7UF 3UWNA 5GAMh 1HXDA 2RM4A 5IAYA 1K73U 1FXXA 3P8BB 2EKOA 3RERA 3CD6T 2XICA 4IUTA 1RL2A 1H641 4OMFB 4QVCA 4VUBA 2LX9A 2CYZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRE B;  1QP3 A;  2ZCF B;  1UGQ B;  2WSC E;  2PU9 B;  1DJ7 B;  3A8L B;  4ZGJ B;  3A8G B;  4OB3 B;  1UGS B;  3X20 B;  2O01 E;  1PSF A;  2DPP B;  3X25 B;  2CZ0 B;  4ZGE B;  2ZPH B;  3A8O B;  2DXC A;  4OB0 B;  2ZPE B;  4XK8 E;  3X26 B;  3QYG B;  2DD4 A;  3QZ9 B;  2ZPB B;  4ZGD B;  2DD5 A;  2ZPG B;  3QZ5 B;  1UGP B;  1JB0 E;  2PVG B;  3HHT B;  2AHJ B;  2QDY B;  1AHJ B;  3QYH B;  1UGR B;  2DXB A;  4FM4 B;  3LW5 E;  1QP2 A;  3QXE B;  2CZ1 B;  5L8R E;  2ZPI B;  3A8H B;  2CZ6 B;  3VYG A;  2PUO B;  2PVO B;  1PSE A;  4OB1 B;  4Y28 E;  2WSE E;  2ZPF B;  4OB2 B;  2D0Q B;  3X24 B;  3VYH B;  3A8M B;  3WVE B;  3WVD B;  4L6V 5;  2WSF E;  2PVD B;  4KT0 E;  4RKU E;  2PUK B;  2CZ7 B;  3X28 B;  1V29 B;  2ZZD A;  1GXI E;  2CYZ B; 
#chains in the Genus database with same CATH topology
 3CCE A;  1GCQ A;  1VQ6 Q;  1FX7 A;  1UGQ B;  4WTO B;  2DBM A;  2FO0 A;  2K4Y A;  3H41 A;  4DEY A;  1DJ7 B;  1QWE A;  1QVG P;  4C92 C;  4F16 A;  1RI0 A;  1VQL T;  5FU6 B;  3SFM A;  2YRD A;  3OS5 A;  2X4Y A;  3A8O B;  1BU1 A;  1HJD A;  1RAC B;  3L2W A;  1NBE B;  1GCQ C;  1J3T A;  3JCM Q;  3I9Q A;  4E7H A;  1R77 A;  1NJI C;  2YRC A;  2DLP A;  5LL6 S;  1NG2 A;  1SPK A;  3M0T A;  3LGL A;  2C0O A;  7AT1 B;  3CXC P;  1N27 A;  3C12 A;  1VQ8 T;  5A0G A;  5GMK m;  2LQW A;  3MET A;  3AT1 B;  2DRK A;  2DTO A;  3OYJ A;  1ZBX A;  4D8K A;  2FVU A;  5L8R E;  2J6F A;  2FEI A;  4GY5 A;  2COW A;  4F04 B;  2E12 A;  2J6O A;  1QVG A;  1PHT A;  4FYW B;  2C0T A;  4J9D A;  1WHJ A;  1AEY A;  1SG5 A;  2ESW A;  5M9O A;  4MDX A;  3NMZ C;  3EG3 A;  2K3B A;  2OAU A;  1WHM A;  2CH4 A;  4KT0 E;  5LJ5 h;  5GAN e;  2D6F A;  2PUK B;  3V7C A;  4ESR A;  3EH2 A;  1KQ1 A;  3BY7 A;  4OMM A;  4B6M A;  5FWB A;  4FW1 A;  3SEM A;  2HQH A;  3EGX B;  3EG1 A;  1ZSZ A;  1W2B P;  5GAO r;  2AKL A;  3R6O A;  2R5A A;  3CXC A;  4AMC A;  5KYY A;  4LXC A;  3DB3 A;  5GJW B;  3H0F A;  1SF9 A;  2QEX A;  3A8G B;  2JMC A;  1WA7 A;  3KBG A;  4FSS A;  2CGH A;  2DIL A;  2QQB A;  4A4K A;  1M27 C;  3OYC A;  4HKE A;  2CP3 A;  3HRS A;  3X25 B;  1YJN Q;  2MF2 A;  1MUZ A;  3OYF A;  1IGQ A;  1RAB B;  2NLU A;  2R58 A;  3S6W A;  3J80 E;  4OF1 A;  1ZSZ C;  1N8R U;  2RI3 A;  1RAG B;  1NM7 A;  4J9H A;  2W10 A;  1GFD A;  1Z9Z A;  2RMO A;  3S3N A;  2ED1 A;  2RK1 A;  4O6J A;  1UDL A;  1RLP C;  1I07 A;  1JXO A;  1TH7 A;  1WXB A;  2KEA A;  1JBM A;  1MMN A;  4D6W A;  2RB6 A;  2YUQ A;  2F2X A;  2P0P A;  2JMA A;  4PJO B;  3I55 A;  1WJR A;  4EMH A;  3CCV A;  2DE0 X;  4KGZ B;  1TWB A;  4M75 A;  1W2B A;  5DM7 R;  3VS7 A;  1N8R R;  1W1F A;  2KI7 A;  5HCK A;  3QJY A;  3L1A A;  3M0U A;  2V8I A;  3CQT A;  1X2K A;  1U1T A;  1E7O A;  1MV0 B;  4DQ2 A;  4C5E A;  3G71 Q;  2GGR A;  2O88 A;  1TSF A;  1PC0 A;  3URG A;  3VYH B;  4C8Q B;  4M75 C;  4FYY B;  4PJO G;  1VQP T;  3RDV A;  1ZA2 B;  5KE2 A;  1WX6 A;  2DXU A;  3ER0 A;  2L0A A;  2L3Q A;  2CP5 A;  3MEW A;  3H8Z A;  1FYN A;  1Q82 R;  2DL8 A;  4KRT A;  2DF6 A;  3CPW P;  2XU8 A;  1EFN A;  1JO8 A;  4MDW A;  2FPE A;  4PJO D;  2L8D A;  3V8K A;  1U3O A;  2MOX A;  4ZGJ B;  5LJ5 d;  1WZO A;  1K1Z A;  2EQU A;  1RAI B;  4HVW A;  2V1R A;  4C8Q G;  1YIT A;  3G4S Q;  1KG1 A;  4M7D B;  3KXT A;  4UC4 A;  4OML A;  5A2Q E;  1SSH A;  1G3W A;  2A7Y A;  1BIA A;  4XU3 A;  3CCS T;  3MEV A;  1GBR A;  3OMG A;  5LJ3 e;  2D8J A;  1PM3 A;  2BTT A;  3I5R A;  2DMO A;  3EGD B;  4M77 F;  1OPK A;  2RJC A;  4C8Q D;  1CKA A;  4XTZ A;  2KNB B;  2RJD A;  1AVZ C;  1NZ9 A;  4N4G A;  4HCK A;  2IVW A;  3EAE A;  3G6E Q;  2R5M A;  2AIR B;  3DKM A;  5CCA A;  3CPW A;  2LQN A;  2V8K A;  4M7D G;  2VV5 A;  1VQK T;  3PIO A;  2RH2 A;  1G83 A;  4R55 A;  4C8Q E;  2QQR A;  4X9C A;  1PSE A;  3JCM f;  1AZG B;  2G6F X;  2JTF A;  1GCP A;  1IXD A;  3ZFJ A;  3L2U A;  3MO8 A;  2LP5 A;  1D0Y A;  4JRK A;  2DM1 A;  1OV3 A;  2NUP A;  3A8M B;  3OQ5 A;  4M7D D;  2DL3 A;  2HL3 A;  3VS0 A;  3EG2 A;  1PWT A;  3VS6 A;  2VGM A;  1OUL A;  3CME Q;  3CC4 T;  3REA B;  1M2V B;  4F17 A;  2JUF A;  1H3Z A;  1OX9 A;  2KR3 A;  1N9R A;  4DEX A;  2RQV A;  2XDP A;  2X9H A;  3UF4 A;  1NPR A;  2Y4Y A;  1M1F A;  1GXI E;  4PLL A;  1KQS S;  2KBT A;  1VQ7 Q;  3RUX A;  4A63 B;  4RTZ A;  2RI2 A;  2LT1 A;  2JS2 A;  4EPC A;  1HK9 A;  1BBZ A;  4CC7 A;  2QG9 B;  2VYT A;  3CD6 A;  2LJ0 A;  3JRZ A;  2RK2 A;  1Q7Y R;  2JM8 A;  1C1A A;  2M51 A;  4RCC A;  3PTA A;  2O01 E;  5KCO A;  1PSF A;  2WAC A;  4BD3 A;  2COY A;  4X34 A;  4JDS A;  5GAN 6;  2CH4 W;  1ZUU A;  2GFA A;  4YTL A;  1RAD B;  3FLG A;  5CQX A;  2HSP A;  3DB4 A;  5KYX A;  1SRM A;  1K8A C;  4B9X A;  2RNA A;  2K79 A;  1KK7 A;  2YWW A;  2E41 A;  1N5Z A;  3S3O A;  1M1K U;  4J6W A;  1YJ9 T;  1WDX A;  5CO7 A;  3PVQ A;  3VS1 A;  1JJ2 S;  2DKG A;  3J81 E;  1V1C A;  1K9M U;  3H6Z A;  1D3B B;  2ATC B;  3I55 T;  4JLG A;  2M0O A;  4RTU A;  2RPN A;  1D0X A;  4CC2 A;  4CI0 C;  5I21 A;  1WHK A;  3C0C A;  1VQ8 A;  4DBF A;  2NUT A;  3QDR B;  2X3W D;  1VUB A;  3PE0 A;  4J6Y A;  4KUL A;  3V8L A;  4LD9 K;  1M1K R;  2MK5 A;  3QII A;  4QQ6 A;  4KH0 B;  1Q86 U;  3CCU A;  4Z88 A;  2E1H A;  3O8V A;  3F70 A;  1QCO A;  2EYZ A;  1BKB A;  2EYX A;  5DLQ E;  3X24 B;  2I2L A;  1VQM T;  2NUZ A;  4M7A A;  3M0S A;  4N4H A;  2IIM A;  1H3H A;  1K9M R;  4K11 A;  2EKH A;  1JQQ A;  1OQK A;  1UJ0 A;  3CMA Q;  5ECA A;  4VUB A;  2LX9 A;  2OTJ A;  2AZV A;  4AFZ C;  2JNG A;  3JCM X;  1QP3 A;  1WHL A;  2KT8 A;  4RMO A;  2X3X D;  1KC8 U;  1WQ7 A;  1TXQ A;  2X4X A;  1RLQ C;  2DET A;  2IPO B;  2VXF A;  2W0Z A;  3BW1 A;  3M59 A;  3LYI A;  5LJ5 g;  5I2M A;  3E19 A;  2YRV A;  2ZPH B;  4KH1 B;  4BY6 C;  2F5T X;  2DXC A;  3OYA A;  1QKX A;  1KD1 U;  1VQ5 Q;  2KT1 A;  5KYN A;  3CPF A;  3G71 T;  2F69 A;  2D9T A;  1YIT T;  1B34 A;  3C94 A;  4J9C A;  1X6O A;  3OA6 A;  1PRL C;  4QW2 A;  2ZPB B;  2MYS A;  3RES A;  2VGN A;  3CC7 Q;  1BI0 A;  2R57 A;  1JB0 E;  3OYD A;  3JCM g;  4LDW A;  1Q81 R;  4HCB A;  4PKC C;  1V76 A;  5FRN A;  5I22 A;  2AHJ B;  5FW9 A;  2K5F A;  5GAN 3;  5GMK l;  1VA7 A;  4XTY A;  1YCS B;  2AZS A;  2RHU A;  1KD1 R;  1YJW Q;  2EGC A;  2JTM A;  3CBO A;  5J39 A;  1KHI A;  2CZ1 B;  1HSQ A;  3P8D A;  4Z8A A;  1WNL A;  1A0N B;  2CZ6 B;  2XI9 A;  5GAN 7;  4LDY A;  1NEG A;  1ZUY A;  1VYT A;  3G4S T;  2RO0 A;  4OGC A;  2BKD N;  3M0R A;  4JRQ A;  1O9S A;  4EMK A;  3LX7 A;  4D8D A;  1LVK A;  2F2V A;  5CAI A;  3CBM A;  2QI2 A;  2B8A A;  1SHF A;  4ORZ A;  3MP1 A;  4A54 A;  1T0H A;  5C6S A;  1JJ2 P;  5CKH A;  4RTX A;  2HL5 C;  1N8R C;  4FSX A;  2ROT A;  1T3S A;  5GMK e;  1T0J A;  3M9Q A;  3CCJ Q;  2VVK A;  2KRO A;  2QTV A;  2X51 A;  1XOV A;  1R0B G;  5IXB A;  3G6E T;  1I8F A;  3I56 Q;  2DEU A;  2WSC E;  4EMK C;  3CCE Q;  3HTR A;  1K4U S;  1LNX A;  2EBP A;  4E7I A;  1WQW A;  4N0A C;  4MML A;  3PMT A;  3HRU A;  4TVR A;  2D8H A;  1SRL A;  2EPD A;  1GFC A;  2BIV A;  5GAN j;  2L5Q A;  2F5K A;  4MMK A;  5GAO p;  5CKB A;  2E6N A;  2GQV A;  1QVF S;  2FRW A;  1S72 Q;  4J9F A;  1D1B A;  1JRI A;  3X26 B;  4A4G A;  4QVD A;  3JAM E;  3RMQ A;  1Q82 C;  3ZBD A;  4JLI A;  2A28 A;  1TTH B;  2CSI A;  3CCS A;  2V1Q A;  2Y4X A;  1JJ2 A;  4XTU A;  1YHQ A;  1K73 R;  2CS7 A;  4HT9 A;  1WXT A;  2DZC A;  3HFO A;  1W70 A;  4XTX A;  1AWJ A;  1PD0 A;  1BCO A;  3CCQ T;  3EG0 A;  3FJ5 A;  3JCM e;  9ATC B;  2JOY A;  2O4X A;  3EFS A;  2PVO B;  2JXB A;  4OB1 B;  2J05 A;  1VQ4 T;  2M9U A;  3OW2 S;  4Y28 E;  4O5V A;  4XQ3 A;  1VQK A;  2ZPF B;  3MEU A;  3PNW C;  1PD1 A;  1RAA B;  5EC7 A;  1OU8 A;  1ZA1 B;  3M57 A;  3CCU T;  1YWO A;  5A0L A;  2MCN A;  4JJN K;  1V29 B;  3EFO B;  1IB8 A;  3E2U A;  1YIJ Q;  3OSV A;  1U1S A;  3M5A A;  1TUG B;  3CC4 A;  4FT4 A;  2OTJ T;  2X4W A;  3SWN C;  2FZG B;  1Y57 A;  2J7I A;  5C0M A;  2QEX Q;  1NPP A;  5J3B A;  1PRM C;  5IN1 A;  1NE8 A;  2FZC B;  1M3A A;  2Y90 A;  2RQW A;  4XK8 E;  4M78 F;  2HQE A;  4A4H A;  3SHW A;  1YI2 Q;  4FU6 A;  4ZTF A;  5HY6 A;  3S3M A;  1R0C B;  3QWX X;  3QSU A;  1VQN Q;  2DZ9 A;  4HCC A;  5GAM d;  2MIO A;  1M90 U;  2YLB A;  4CC4 B;  2EAY A;  2KGT A;  4RTY A;  1NYF A;  3OS0 A;  2B86 A;  1Q7Y C;  3VS5 A;  3QYH B;  3CCM T;  2EQM A;  3PVL A;  3CCV Q;  3OYY A;  3OYI A;  3UDC A;  4C5G A;  3KFV A;  4OGE A;  1YJ9 A;  3FEO A;  5LJ3 j;  3DLL A;  1QVF P;  4PLI A;  1HD3 A;  3OYE A;  2XD0 A;  2VKN A;  4PK4 A;  2GF7 A;  1JXM A;  3H0I A;  3EG9 B;  5KCH A;  2YHT A;  5GAM f;  1M90 R;  4M78 B;  2QK0 A;  2M0Y A;  2CKK A;  2QAZ A;  4PJM A;  2OAW A;  2VWF A;  4QT7 A;  3M56 A;  1I5L A;  2BZX A;  4A4F A;  3GP8 A;  2Z0W A;  2LC4 A;  3RBB B;  3UA7 A;  5FU7 B;  3M4Y A;  4L6V 5;  5GAO n;  1YCY A;  1D1A A;  2RD1 A;  1I5O B;  3RKX A;  4AFQ C;  5KYU B;  1AT1 B;  3CC2 Q;  1VQM A;  4JJD A;  2KRM A;  3M55 A;  3VS3 A;  1IRE B;  2H8H A;  3M0P A;  4JS4 A;  2L3S A;  1OZ2 A;  1AOJ A;  2XK0 A;  1QCF A;  3FC3 A;  2KXC A;  2FZK B;  1UUE A;  1M1K C;  5GAN h;  1WLP B;  4E7Z A;  4LD6 A;  4C0G A;  3AHU A;  4M78 G;  1ZX6 A;  3OW2 P;  1JEG A;  4JZ4 A;  2CT4 A;  2HCK A;  4Y91 A;  2RJE A;  1QVF A;  4QVZ A;  1VYV A;  2OI3 A;  4PFP A;  2HQX A;  2FB7 A;  1K9M C;  4L59 A;  3BE3 A;  4BE1 A;  1UG1 A;  3UA6 A;  5FU6 C;  1X75 C;  4M7A F;  2EJF A;  3FRN A;  1RAE B;  2RF0 A;  2QQ9 A;  1G3T A;  1UE9 A;  4M78 D;  2K5I A;  3IQL A;  1OI1 A;  2L2P A;  3NHN A;  5GJV B;  3G71 A;  2GCX A;  1NJI U;  2LCC A;  3JCM b;  4AG1 C;  4QQD A;  3REB B;  1WJS A;  5D6W A;  2RI5 A;  1YHQ T;  4M78 E;  3A8H B;  2QA4 Q;  2DX1 A;  2KK4 A;  3OW2 A;  2KQW A;  2KE9 A;  5LJ5 f;  3GIB A;  3FB9 A;  4BI8 B;  8AT1 B;  1I4K 1;  4M7A B;  3VS2 A;  3OYG A;  2K2V A;  2K5L A;  4RTV A;  1Q81 C;  2RHY A;  1M1G A;  3EGX A;  1VQ6 T;  1MHN A;  3WVE B;  1Z9Q A;  2LVM A;  4RCB A;  2RA2 A;  4J9I A;  1B07 A;  1P92 A;  3G4S A;  2XID A;  4F7U F;  3UWN A;  2RM4 A;  5IAY A;  1FXX A;  3P8B B;  2EKO A;  1Y0M A;  2DL7 A;  4IUT A;  4QVC A;  3LH5 A;  3CBP A;  2VC8 A;  2LT4 A;  1W4S A;  1Y96 B;  4E6R A;  1W6X A;  2DYB A;  3A5Z B;  4M77 B;  2EFI A;  4M7A G;  4IUR A;  1WXU A;  2A08 A;  1XTD A;  5IT9 E;  3CD6 Q;  2DPP B;  2JT4 A;  3G6E A;  1UB4 A;  4RTT A;  1HYO A;  2P4R A;  3CCR Q;  1H8K A;  2LDM A;  2O9V A;  1SEM A;  2KYB A;  2XKO C;  4C0D B;  1WGS A;  2CP7 A;  2QGF B;  4PJO A;  5HK0 A;  2LCL A;  1TUC A;  2JM9 A;  2LCS A;  4B9W A;  4M7A D;  4F7U B;  2X35 A;  3OB9 A;  5GAN d;  1VQL Q;  4XTV A;  1G5V A;  2VXE A;  2K7A A;  1AWX A;  2L3R A;  5GAM g;  4BI4 A;  4LDU A;  2M02 A;  4M77 G;  2QDY B;  3C4S A;  4JS5 A;  3VS4 A;  4OMO A;  4C92 F;  5LJ3 h;  1BB9 A;  3TU4 K;  4EIK A;  4PJO C;  3OYM A;  2DIG A;  5EG2 A;  4M7A E;  1QVP A;  2JTE A;  3ULR B;  1WHH A;  4PL6 A;  4C8Q A;  2COZ A;  4ELY C;  4J9G A;  5GAN 4;  2HZY A;  4A53 A;  2OTL Q;  4XU1 A;  2K6D A;  4M77 D;  2DL5 A;  1VQ8 Q;  2K9G A;  4F7U G;  4E47 A;  3CCQ A;  1X6G A;  1M9S A;  2KMT A;  4II1 A;  4JUV A;  4ATO A;  4DOW A;  1E6H A;  3WVD B;  1VQO Q;  1K73 C;  2V8J A;  3INZ A;  2WSF E;  3FJP A;  4L5G A;  5FWC A;  3JCM c;  1VQ4 A;  1UEC A;  2QYZ A;  3X28 B;  4C8Q C;  3I35 A;  5GAN 2;  1FMV A;  4M77 E;  4IIM A;  3R6N A;  2DJQ A;  3TCJ A;  2K57 A;  3BDL A;  1YJN T;  1VQ9 Q;  2HKQ B;  4RG2 A;  4FIB A;  4C92 B;  4M7D A;  1OZ3 A;  3EH1 A;  3HFN A;  3L2R A;  2E65 A;  2PU9 B;  2QAS A;  1K9A A;  3GLX A;  4OVA A;  3J7A F;  3EGD A;  4X1V A;  1B3Q A;  2GBQ A;  3E9F A;  4PNO A;  3QJ6 A;  4F7U E;  2OJ2 A;  1EX4 A;  1NYG A;  1RI9 A;  1KFZ A;  2D0N A;  1TS9 A;  5GMK j;  2SRC A;  1Q86 R;  4M7D C;  2GNC A;  2MWO A;  5IXF A;  3L2Q A;  2VB6 A;  4DBH A;  1YNZ A;  4C92 G;  1IHW A;  1IZ6 A;  2LMJ A;  2KYM A;  2EJG A;  1RUW A;  1PNJ A;  3V7S A;  4V2S A;  3HL8 A;  3CC2 T;  2DNU A;  4GLM A;  3A1P A;  4CRI A;  3UPU A;  1BI1 A;  2JZ2 A;  3QXE B;  2O4X B;  3V7R A;  2YSQ A;  1MND A;  3M4G A;  4C92 D;  2CP2 A;  1KC8 R;  2BUD A;  1KQS P;  3CMA A;  5GAM e;  2EQK A;  3CCM A;  1OEB A;  2SEM A;  4JPB W;  2QDL A;  2CP6 A;  2RQU A;  2AK5 A;  5LJ3 d;  1OOT A;  4ANJ A;  4FCY A;  2C06 A;  2JS0 A;  3L2Z A;  3TSZ A;  4C92 E;  3OYB A;  2P4T A;  4Z89 A;  2CZ7 B;  1I81 A;  1K0S A;  3GPL A;  1VQ5 A;  2HBP A;  1ACM B;  2X4J A;  2CDT A;  2ZAE A;  2NYS A;  3VRY A;  2ZCF B;  4IKF A;  4LUE A;  1WJQ A;  3CC7 A;  1VQP Q;  2YUO A;  2KRN A;  4N0A A;  3CCL Q;  4KGX B;  3HRT A;  4MZP A;  1UHC A;  1SSF A;  2EW3 A;  3X20 B;  1M5Q 1;  1O75 A;  3QDF A;  2MI6 A;  3M53 A;  1ZSZ B;  1PG5 B;  2EIF A;  5FRM A;  1XQH A;  1KQS A;  2CZ0 B;  2P0Q A;  1QWF A;  1IO6 A;  4FYX B;  4IIO A;  3PGG A;  4PFO A;  3OYL A;  5KYY B;  4M75 F;  4PFZ A;  2RHZ A;  4BI3 A;  2DD4 A;  4JJC A;  2QQA A;  3QZ9 B;  3RNJ A;  2DD5 A;  3OYK A;  1WYX A;  2O9S A;  3QZ5 B;  2HNI A;  4XTW A;  3TQ7 P;  5GAN g;  3WXM B;  1K8A U;  3QHS A;  2RHX A;  3GF5 A;  2GTO A;  4KUI A;  3TEE A;  3CCS Q;  4C0F A;  2HD0 A;  1PKS A;  3ASK A;  4OMQ A;  4DBQ A;  2CRE A;  4EMG A;  3PFS A;  3LW5 E;  1QP2 A;  2O31 A;  3ME9 A;  3VV0 A;  1NEB A;  3OSS C;  1TOV A;  5FLX E;  5LJ5 e;  2RJF A;  3CCJ A;  1LJO A;  4X9D A;  3CME T;  2DIQ A;  1FWZ A;  2VAS A;  1LPL A;  2EYW A;  3I56 A;  4J9E A;  2KY9 A;  2EGE A;  4M75 B;  3CCR T;  3JCM P;  2FPF A;  2A3L A;  1VQ7 T;  3VU3 C;  4OB2 B;  3GNG A;  2FRY A;  3OYH A;  2HBW A;  2LRQ A;  1XJW B;  1VQK Q;  5D6Y A;  4BB7 A;  2ABL A;  4E7J A;  1S72 A;  2YXY A;  4C5I A;  3MHX A;  2PTK A;  1VOM A;  1VQ6 A;  4KBM B;  4Y92 A;  2MMP A;  3QG1 A;  4N4I A;  5GAN 8;  1M8V A;  1ZQ1 A;  2DVE A;  4J8O A;  5AYF A;  5DY9 A;  3SWN A;  4M75 G;  4MZT A;  1BYM A;  3CC4 Q;  3NTK A;  3TRE A;  1UGS B;  1BIB A;  1YFN A;  1X01 A;  2I0N A;  3M0Q A;  4HXJ A;  2HMA A;  2ECZ A;  3BFM A;  4ZGE B;  5GMK h;  2OTL T;  5GAO q;  2KAF A;  3JCM V;  2M1H A;  2HAX A;  3CEY A;  1VYU A;  2MPX C;  4AG2 C;  4M75 D;  5GAO l;  3CPW S;  1AD5 A;  2P0K A;  1UEB A;  1VQO T;  2QGG A;  2KDS A;  4ZGD B;  1QKW A;  1OX8 A;  3NPF A;  4AFS C;  1K76 A;  4J7I A;  4OMN A;  1GL5 A;  2KXD A;  5CR2 A;  8ATC B;  2F1L A;  2KSS A;  3EFR A;  3TVT A;  3JSC A;  2GFU A;  1VQ9 T;  3QO3 A;  4IUU A;  4OMP A;  5IHI A;  4HVV A;  3GOX A;  5CVI A;  2DJZ A;  5KYW A;  4M75 E;  2HEQ A;  3EGU A;  4F14 A;  2LJ1 A;  4AT1 B;  2EGA A;  2BE7 D;  3VUB A;  1UHF A;  4IUV A;  3G7Z A;  4C5H A;  3VYG A;  3VRZ A;  5CK9 A;  1YIJ A;  1YJ9 Q;  2E10 A;  5I11 A;  3ZEH A;  4PJO F;  3CMA T;  2AT1 B;  1SHG A;  1C0M A;  3H9N A;  2D0Q B;  1NLO C;  3RKY A;  2M16 A;  1QLY A;  4NL2 A;  1YWP A;  3I55 Q;  2A36 A;  3MJX A;  1LCK A;  5LJ3 g;  2E5Q A;  3VJP A;  2XG8 D;  3JB9 J;  1G2B A;  3JCM h;  4J9B A;  4E7S A;  2XIC A;  3MKD A;  1H64 1;  4LN2 A;  2NUP B;  1YI2 A;  2DRM A;  2DTH A;  2DXT A;  1VQ5 T;  2YLC A;  4NS5 A;  1VQM Q;  4ELZ C;  1VQN A;  4OP0 A;  4C8Q F;  1M2O A;  2FPD A;  2EJ9 A;  4A4E A;  1IRX A;  1D0Z A;  3THK A;  2GQI A;  4OB3 B;  3NTH A;  4J5Y A;  1YJN A;  2LQK A;  4BUG A;  1PKT A;  3CC7 T;  1WI7 A;  1WPY A;  5J26 A;  4GBQ A;  1JU5 C;  5IH2 A;  1ARK A;  2QXF A;  4OB0 B;  1KHC A;  4GLK A;  5GAN 5;  4BDZ A;  2JVV A;  2LNV A;  2A37 A;  4ZN3 A;  2MAM A;  4JJB A;  1YJW T;  3SB2 A;  2O2O A;  3QKJ A;  2E6Z A;  1BCM A;  1Q82 U;  3P8H A;  1M8M A;  1BI2 A;  4LNP A;  4M7D F;  3OS2 A;  5KYX B;  4JRP A;  2K3Y A;  4P5N A;  1D09 B;  2XDD A;  1YIT Q;  1MMD A;  5I2S A;  2E64 A;  2DK3 A;  4CC3 A;  1S1N A;  3HPW A;  3LGF A;  2EVR A;  3CCL T;  2ZPI B;  5GAO m;  3MEA A;  3CC2 A;  4FT2 A;  1CKB A;  2HSE B;  1Q86 C;  4BDY A;  2JW4 A;  1ZSG A;  2DTI A;  2DA9 A;  3PT9 A;  5CKD A;  1QW1 A;  1RAF B;  2A0F B;  1BK2 A;  3EFO A;  3CCJ T;  4RUG A;  2EQJ A;  1SKU B;  1VIE A;  3NGP A;  2BZY A;  3GNF B;  3I56 T;  1G3Y A;  3O5Z A;  3QUI A;  3A98 A;  3CCE T;  2NUT B;  1YN8 A;  4RKU E;  3OYN A;  4HA8 A;  2ED0 A;  1C6V X;  3Q1J A;  2L3P A;  2HDA A;  4QQG A;  4QKU A;  4HCZ A;  5DLO A;  5HKC A;  5AT1 B;  4IUQ A;  1KC8 C;  4J7F A;  1LOJ A;  2F2W A;  4R56 A;  2BE9 B;  3JB9 F;  4FYV B;  1NJI R;  4LDX A;  1S72 T;  4PJO E;  2OX7 A;  1UJY A;  2J6K A;  4BY6 B;  3A8L B;  3JCM d;  4HVU A;  1Q95 G;  1MMG A;  2EYQ A;  2YUP A;  1TU0 B;  3QPH A;  2DO3 A;  4XU0 A;  1KD1 C;  2J06 A;  2E70 A;  3V8J A;  1M30 A;  4PJN A;  3MP8 A;  3QWY A;  2XDB A;  3C95 A;  2QA4 A;  3U23 A;  3LWH A;  2D1X A;  1MMA A;  3MP6 A;  2ZPG B;  4IUP A;  2DEQ A;  1H92 A;  2E5K A;  3HHT B;  3RMS A;  4BAC A;  2H3E B;  3LWI A;  3HP9 A;  1B34 B;  2CUD A;  2E3H A;  3L42 A;  3SDZ A;  4DOV A;  3EG9 A;  4BE0 A;  4FL6 A;  1K0X A;  2XMF A;  3JCM J;  2PNI A;  4M78 A;  2JN0 A;  5A0D A;  2JJ9 A;  2LQ8 A;  1KQ2 A;  1Q7Y U;  3FDR A;  3PMI A;  1IHV A;  3JCM W;  3NTI A;  4RG8 A;  2GTJ A;  1XNI A;  2PUO B;  2V26 A;  1I0C A;  1UFF A;  5KH6 A;  1KSW A;  4ME7 A;  2ZGW A;  2WSE E;  2DVJ A;  5KYU A;  1YBY A;  2KRS A;  2K3X A;  1YIJ T;  4M7D E;  4BE2 A;  3RIR A;  3CCQ Q;  4EDU A;  1WFW A;  3CME A;  3MPU B;  4KUD K;  4M78 C;  1M4Z A;  3JB9 G;  3CCR A;  1Y7X A;  4AFU C;  1VQ7 A;  3JB9 H;  1E6G A;  1VQ4 Q;  1PCX A;  2ZZD A;  5GAN f;  4EMK B;  2QEX T;  5FU7 C;  4HT8 A;  5GAM j;  3VUZ A;  1N9S A;  1VQL A;  3RR6 A;  1X2Q A;  1D1C A;  1X6B A;  3CCU Q;  3PIP A;  3JB9 D;  1G3S A;  3JV3 A;  1ZHI A;  1YI2 T;  2HKN A;  3EHQ A;  1F1B B;  4Z02 A;  2DBK A;  1T3L A;  1X27 A;  3SD4 A;  1VQN T;  2LZ6 B;  4LUD A;  1MNE A;  1OPL A;  4WCI A;  1I1J A;  3HKS A;  2YT6 A;  1QCN A;  3QBY A;  4KGV B;  1KJW A;  3OBW A;  2ENM A;  2K2M A;  4ZTJ A;  5IHK A;  3BDU A;  3D7S B;  4ZNX A;  3OMC A;  2XHC A;  4J83 A;  2LTO A;  3VKI A;  2OTJ Q;  1ZBJ A;  1UTI A;  3CCV T;  2OTL A;  2QTX A;  4RTW A;  3UT1 A;  5CKE A;  1Y07 A;  4FW2 A;  2PVG B;  4XAX B;  2ROL A;  2EYY A;  1M3C A;  1AWO A;  2MWP A;  1QQJ A;  5D6X A;  3I5S A;  1AHJ B;  1VQO A;  1U5S A;  2C0I A;  3OS1 A;  2RQT A;  1Y71 A;  4DA4 A;  2CSQ A;  2QQS A;  4WF2 A;  2RN8 A;  2RQR A;  2KVQ G;  1ABO A;  4NOY A;  1TG0 A;  1VQ9 A;  2E3I A;  2PQW A;  3NFC A;  5CQY A;  1QVG S;  3M54 A;  2L89 A;  2CP0 A;  3E9G A;  3CCM Q;  3JB9 I;  3OBY A;  2IG0 A;  3LLR A;  1UGV A;  4E7K A;  4M7A C;  1Q81 U;  1Y96 A;  1X69 A;  4M77 A;  2DFU A;  1K8A R;  5LJ5 j;  5L23 A;  5CIU A;  1IGU A;  1M3B A;  1M2V A;  1EIF A;  4ZN1 A;  1U8R A;  3SWN B;  5FRO A;  2NWM A;  4JZ3 A;  1BI3 A;  2P84 A;  3MCA B;  2CT3 A;  2LX7 A;  2AKK A;  3CXC S;  3OY9 A;  1VIF A;  2EQI A;  2PZ1 A;  3T9N A;  4JRI A;  2LJ3 A;  4NL3 A;  4MZM A;  3EHR A;  4F7U A;  1KIK A;  2EWN A;  3HSB A;  4M77 C;  4E2F B;  1GRI A;  3RKW A;  1OU9 A;  2DAQ A;  1R8O B;  2ZPE B;  5D7U A;  5GMK i;  1WHG A;  3GBQ A;  3E1S A;  2FHD A;  1ZUK A;  3QYG B;  1AZE A;  3LH0 A;  3M58 A;  1M90 C;  1EZZ B;  5HK3 A;  3ZL7 C;  5LJ3 f;  4C0D C;  1FMK A;  2DYI A;  1U06 A;  1UGP B;  3G1J A;  3FIF A;  2QA4 T;  1YP5 A;  1MGQ A;  1N6A A;  1TUD A;  3DLM A;  1NLP C;  2FL7 A;  2FYK A;  3KUF A;  5KYW B;  1YJW A;  1WIE A;  4LDV A;  6AT1 B;  1UGR B;  1G8X A;  4R0K A;  2DXB A;  4XU2 A;  1B7T A;  1CSK A;  1FMW A;  1ZLM A;  4FM4 B;  3UAT A;  2H3J A;  3H0H A;  5CKF A;  1X43 A;  1GBQ A;  4E7L A;  2BZ8 A;  1W2B S;  2YDL A;  1AWW A;  4J6X A;  2VUB A;  3TSW A;  4Q5W A;  1D3B A;  3L2V A;  2RHI A;  5KE3 A;  2DL4 A;  1ABQ A;  1VQP A;  1MV3 A;  2E4H A;  3CCL A;  2FG0 A;  1YHQ Q;  2LNH B;  2G3R A;  4PJL A;  1OYX A;  4C92 A;  4LE9 A;  3N5B B;  4C0Z A;  2PVD B;  1QMC A;  2DER A;  4PJJ A;  5GAM h;  1HXD A;  5IHN A;  2YUN A;  4DBR A;  1K73 U;  3RER A;  3CD6 T;  1RAH B;  1RL2 A;  4OMF B;  4M4Z A;  2CUB A;  2CYZ B; 
#chains in the Genus database with same CATH homology
 3CCE A;  2JNG A;  3CBP A;  3JCM X;  1YI2 A;  2VC8 A;  1QP3 A;  2DTH A;  2DXT A;  1FX7 A;  2LT4 A;  1VQ5 T;  1W4S A;  2YLC A;  1UGQ B;  4NS5 A;  1Y96 B;  4ELZ C;  2OTJ A;  1VQN A;  4RMO A;  4OP0 A;  1KC8 U;  4C8Q F;  2K4Y A;  3A5Z B;  4M77 B;  1WQ7 A;  2EFI A;  1DJ7 B;  2EJ9 A;  4A4E A;  2X4X A;  4C92 C;  4OB3 B;  4IUR A;  4M7A G;  3NTH A;  1RI0 A;  4J5Y A;  1YJN A;  2VXF A;  1VQL T;  3BW1 A;  3M59 A;  2LQK A;  1XTD A;  3LYI A;  4BUG A;  5LJ5 g;  5FU6 B;  5I2M A;  5IT9 E;  3E19 A;  3SFM A;  2DPP B;  3CC7 T;  1WPY A;  3OS5 A;  5J26 A;  3G6E A;  1UB4 A;  2YRV A;  2X4Y A;  2ZPH B;  3A8O B;  4BY6 C;  2LDM A;  2QXF A;  2F5T X;  2DXC A;  3OYA A;  1KD1 U;  4OB0 B;  1KHC A;  4GLK A;  3CPF A;  3G71 T;  2XKO C;  4C0D B;  1WGS A;  2F69 A;  5GAN 5;  3L2W A;  4BDZ A;  2D9T A;  1YIT T;  4PJO A;  1B34 A;  2JVV A;  2LCL A;  5HK0 A;  2LNV A;  4ZN3 A;  2MAM A;  3C94 A;  1X6O A;  3JCM Q;  1YJW T;  3OA6 A;  4B9W A;  4M7A D;  4QW2 A;  4F7U B;  2X35 A;  3OB9 A;  2ZPB B;  3SB2 A;  5GAN d;  4E7H A;  4XTV A;  3QKJ A;  3RES A;  1G5V A;  2E6Z A;  2VGN A;  2VXE A;  1BI0 A;  2R57 A;  1JB0 E;  3OYD A;  3JCM g;  1NJI C;  4LDW A;  4HCB A;  2L3R A;  1Q82 U;  4PKC C;  5LL6 S;  4BI4 A;  5GAM g;  3P8H A;  4LDU A;  5FRN A;  1BI2 A;  2AHJ B;  4M77 G;  3HSB A;  2QDY B;  4M7D F;  3C4S A;  1VQ8 A;  3OS2 A;  2K5F A;  3LGL A;  5GAN 3;  4JRP A;  5GMK l;  2K3Y A;  4P5N A;  2XDD A;  4JS5 A;  1N27 A;  3C12 A;  1VQ8 T;  4XTY A;  5A0G A;  5I2S A;  5GMK m;  2E64 A;  2RHU A;  4C92 F;  3MET A;  5LJ3 h;  3TU4 K;  2DK3 A;  2JTM A;  2DTO A;  3CBO A;  1ZBX A;  5J39 A;  3OYM A;  3OYJ A;  4PJO C;  2DIG A;  3HPW A;  1KHI A;  3LGF A;  2CZ1 B;  1QVP A;  5EG2 A;  4M7A E;  2FVU A;  4PL6 A;  5L8R E;  2ZPI B;  3P8D A;  3CCL T;  4C8Q A;  5GAO m;  4GY5 A;  3CD6 A;  4ELY C;  1WNL A;  2E12 A;  3MEA A;  2CZ6 B;  5GAN 4;  3CC2 A;  1QVG A;  4FT2 A;  2XI9 A;  5GAN 7;  1Q86 C;  4LDY A;  4A53 A;  4XU1 A;  4M77 D;  4BDY A;  2DTI A;  3G4S T;  3PT9 A;  5CKD A;  2RO0 A;  4F7U G;  1QW1 A;  4OGC A;  2BKD N;  4JRQ A;  5M9O A;  4E47 A;  3CCJ T;  3CCQ A;  1M9S A;  1O9S A;  4EMK A;  4MDX A;  2KMT A;  4II1 A;  2EQJ A;  4JUV A;  3LX7 A;  1VIE A;  3GNF B;  3I56 T;  4ATO A;  4DOW A;  1G3Y A;  2OAU A;  3WVD B;  3QUI A;  5CAI A;  3CCE T;  3CBM A;  2QI2 A;  2B8A A;  1K73 C;  2V8J A;  3INZ A;  2WSF E;  3FJP A;  4L5G A;  3MP1 A;  4KT0 E;  3JCM c;  4A54 A;  5LJ5 h;  1VQ4 A;  5GAN e;  2D6F A;  4RKU E;  2PUK B;  3V7C A;  5C6S A;  3OYN A;  1KQ1 A;  4HA8 A;  3BY7 A;  3Q1J A;  3X28 B;  4C8Q C;  5GAN 2;  5CKH A;  4QQG A;  4M77 E;  4HCZ A;  1N8R C;  4FSX A;  3TCJ A;  5DLO A;  5HKC A;  2K57 A;  3BDL A;  5GMK e;  1YJN T;  3M9Q A;  4IUQ A;  1KC8 C;  4J7F A;  4RG2 A;  4FIB A;  1LOJ A;  1XOV A;  4C92 B;  4R56 A;  5GAO r;  3JB9 F;  3R6O A;  3G6E T;  1I8F A;  1OZ3 A;  4LDX A;  4M7D A;  2R5A A;  3HFN A;  2WSC E;  1S72 T;  3CXC A;  3L2R A;  2E65 A;  4EMK C;  4PJO E;  1LNX A;  2PU9 B;  3DB3 A;  4BY6 B;  4E7I A;  1WQW A;  3A8L B;  3GLX A;  3JCM d;  2QEX A;  3A8G B;  4N0A C;  4MML A;  3PMT A;  2EYQ A;  3HRU A;  4OVA A;  3KBG A;  4TVR A;  2CGH A;  3QPH A;  4A4K A;  2QQB A;  3OYC A;  2DO3 A;  4HKE A;  4XU0 A;  1KD1 C;  2BIV A;  3HRS A;  3X25 B;  3J7A F;  5GAN j;  2L5Q A;  2F5K A;  2MF2 A;  3E9F A;  3QJ6 A;  4MMK A;  4PNO A;  5CKB A;  4F7U E;  5GAO p;  3OYF A;  2E6N A;  2GQV A;  2NLU A;  1QVF S;  2R58 A;  3S6W A;  2E70 A;  3J80 E;  4OF1 A;  3V8J A;  5GMK j;  1N8R U;  2RI3 A;  3MP8 A;  2XDB A;  1JRI A;  3X26 B;  4M7D C;  2MWO A;  3C95 A;  4A4G A;  2QA4 A;  3L2Q A;  4QVD A;  3JAM E;  3RMQ A;  3LWH A;  3S3N A;  1Q82 C;  3MP6 A;  3ZBD A;  4JLI A;  2ZPG B;  2RK1 A;  4C92 G;  4O6J A;  4IUP A;  2DEQ A;  1IZ6 A;  3HHT B;  3RMS A;  1TH7 A;  1JBM A;  4BAC A;  4D6W A;  2RB6 A;  3CCS A;  2P0P A;  2Y4X A;  2EJG A;  3HP9 A;  3LWI A;  1B34 B;  1JJ2 A;  4XTU A;  3V7S A;  4PJO B;  1YHQ A;  4V2S A;  3HL8 A;  3I55 A;  1WJR A;  3L42 A;  2CS7 A;  3SDZ A;  4EMH A;  3CC2 T;  4HT9 A;  3CCV A;  2DZC A;  3HFO A;  4DOV A;  4CRI A;  4BE0 A;  4FL6 A;  4M75 A;  4XTX A;  3UPU A;  3JCM J;  1W2B A;  4M78 A;  2JN0 A;  5A0D A;  5DM7 R;  2LQ8 A;  1BI1 A;  2JZ2 A;  3QXE B;  1Q7Y U;  3FDR A;  1KQ2 A;  2O4X B;  3V7R A;  3PMI A;  3CCQ T;  3M4G A;  4C92 D;  3JCM W;  3JCM e;  2BUD A;  3CMA A;  3QJY A;  3NTI A;  4RG8 A;  2JOY A;  5GAM e;  2EQK A;  1XNI A;  2O4X A;  2PUO B;  3EFS A;  3L1A A;  3CCM A;  2PVO B;  2V8I A;  4OB1 B;  5KH6 A;  1U1T A;  4ME7 A;  1VQ4 T;  2M9U A;  4DQ2 A;  3OW2 S;  4C5E A;  2ZGW A;  2WSE E;  4Y28 E;  4O5V A;  4XQ3 A;  1VQK A;  2ZPF B;  1YBY A;  1YIJ T;  2K3X A;  3MEU A;  3PNW C;  3URG A;  5LJ3 d;  3VYH B;  4C8Q B;  4M7D E;  4BE2 A;  3RIR A;  4EDU A;  3CME A;  4M75 C;  4KUD K;  2C06 A;  4PJO G;  1VQP T;  4M78 C;  3L2Z A;  1M4Z A;  3M57 A;  4C92 E;  3CCU T;  3OYB A;  3JB9 G;  2P4T A;  3CCR A;  5KE2 A;  2DXU A;  2CZ7 B;  5A0L A;  3ER0 A;  1I81 A;  1Y7X A;  4JJN K;  1VQ7 A;  3GPL A;  1V29 B;  3JB9 H;  1VQ5 A;  2ZZD A;  5GAN f;  3MEW A;  4EMK B;  2HBP A;  2QEX T;  5FU7 C;  2X4J A;  3H8Z A;  4HT8 A;  5GAM j;  3VUZ A;  3OSV A;  1N9S A;  2XU8 A;  1U1S A;  2ZCF B;  1VQL A;  4IKF A;  3M5A A;  1WJQ A;  4MDW A;  3CC4 A;  4FT4 A;  3CC7 A;  4PJO D;  2L8D A;  3V8K A;  2OTJ T;  3PIP A;  4N0A A;  3JB9 D;  3HRT A;  4MZP A;  1G3S A;  4ZGJ B;  1ZHI A;  2X4W A;  1SSF A;  5LJ5 d;  1YI2 T;  3SWN C;  3X20 B;  4Z02 A;  1M5Q 1;  1O75 A;  5C0M A;  3SD4 A;  2MI6 A;  2EQU A;  1VQN T;  3M53 A;  1NPP A;  2EIF A;  5J3B A;  4C8Q G;  1XQH A;  1YIT A;  1KQS A;  5FRM A;  2CZ0 B;  1KG1 A;  5IN1 A;  4M7D B;  2P0Q A;  1NE8 A;  3KXT A;  4UC4 A;  3HKS A;  3PGG A;  3QBY A;  5A2Q E;  2Y90 A;  3OBW A;  3OYL A;  4ZTJ A;  3BDU A;  4M75 F;  1G3W A;  2A7Y A;  1BIA A;  3OMC A;  4M78 F;  2XHC A;  2RHZ A;  4J83 A;  4XK8 E;  4XU3 A;  4BI3 A;  3CCS T;  2HQE A;  3MEV A;  2LTO A;  3VKI A;  3OMG A;  4A4H A;  5LJ3 e;  2DD4 A;  4FU6 A;  2QQA A;  3QZ9 B;  3CCV T;  4M77 F;  5HY6 A;  2QTX A;  3S3M A;  4ZTF A;  2OTL A;  3QSU A;  2DD5 A;  3OYK A;  2DZ9 A;  2RJC A;  3QZ5 B;  5GAN g;  2HNI A;  4XTW A;  3UT1 A;  4HCC A;  3WXM B;  5CKE A;  1Y07 A;  4C8Q D;  5GAM d;  2PVG B;  4XAX B;  1K8A U;  4XTZ A;  2RJD A;  1M90 U;  1NZ9 A;  2YLB A;  3QHS A;  1BYM A;  2MWP A;  2EAY A;  5D6X A;  2RHX A;  3GF5 A;  4N4G A;  2IVW A;  3EAE A;  4KUI A;  3OS0 A;  3TEE A;  1AHJ B;  4C0F A;  1Q7Y C;  2HD0 A;  2R5M A;  3QYH B;  3CCM T;  2EQM A;  1VQO A;  3ASK A;  3OS1 A;  3DKM A;  1Y71 A;  4EMG A;  3PFS A;  5CCA A;  3CPW A;  3LW5 E;  1QP2 A;  3ME9 A;  3VV0 A;  4DA4 A;  2V8K A;  3OYY A;  3OYI A;  2QQS A;  2VV5 A;  4M7D G;  3UDC A;  4WF2 A;  1VQK T;  4C5G A;  3PIO A;  2RH2 A;  3OSS C;  4OGE A;  1YJ9 A;  3FEO A;  2KVQ G;  5LJ3 j;  4R55 A;  4NOY A;  5FLX E;  3DLL A;  5LJ5 e;  2RJF A;  4PLI A;  4C8Q E;  1LJO A;  2QQR A;  3OYE A;  3CCJ A;  4X9D A;  4X9C A;  1VQ9 A;  2XD0 A;  3CME T;  2PQW A;  3NFC A;  5CQY A;  2DIQ A;  1FWZ A;  1PSE A;  3JCM f;  2GF7 A;  1QVG S;  3I56 A;  2KY9 A;  3M54 A;  5KCH A;  4M75 B;  2YHT A;  2JTF A;  2L89 A;  3E9G A;  5GAM f;  3CCR T;  3JCM P;  4M78 B;  2A3L A;  1VQ7 T;  3ZFJ A;  2CKK A;  3VU3 C;  3L2U A;  4OB2 B;  3GNG A;  3M56 A;  3OYH A;  1I5L A;  3MO8 A;  4JRK A;  2LRQ A;  4A4F A;  3JB9 I;  3GP8 A;  3A8M B;  3OBY A;  2IG0 A;  3LLR A;  3OQ5 A;  4M7D D;  2LC4 A;  5D6Y A;  5FU7 B;  4BB7 A;  3M4Y A;  4E7K A;  4L6V 5;  1Q81 U;  4M7A C;  2VGM A;  5GAO n;  1Y96 A;  1YCY A;  2RD1 A;  3CC4 T;  3RKX A;  4M77 A;  2JUF A;  1H3Z A;  1N9R A;  4E7J A;  2XDP A;  1S72 A;  4C5I A;  1NPR A;  2Y4Y A;  1M1F A;  3MHX A;  5CIU A;  4PLL A;  5LJ5 j;  1KQS S;  1VQ6 A;  1GXI E;  3RUX A;  4KBM B;  1VQM A;  2MMP A;  2RI2 A;  3M55 A;  3QG1 A;  1EIF A;  1IRE B;  4N4I A;  3SWN B;  5FRO A;  4ZN1 A;  2LT1 A;  4JS4 A;  1U8R A;  1OZ2 A;  5GAN 8;  1BI3 A;  1M8V A;  2XK0 A;  4EPC A;  1HK9 A;  1ZQ1 A;  2DVE A;  3MCA B;  4J8O A;  3FC3 A;  5AYF A;  3CXC S;  5DY9 A;  2VYT A;  3SWN A;  3OY9 A;  4M75 G;  5GAN h;  1M1K C;  1VIF A;  4MZT A;  3JRZ A;  4LD6 A;  4C0G A;  3NTK A;  3AHU A;  2RK2 A;  4M78 G;  3TRE A;  3T9N A;  1UGS B;  1BIB A;  4JRI A;  4RCC A;  1X01 A;  4NL3 A;  3PTA A;  2O01 E;  5KCO A;  4MZM A;  1PSF A;  4F7U A;  2EWN A;  2WAC A;  4BD3 A;  4X34 A;  4Y91 A;  2RJE A;  1QVF A;  3BFM A;  4JDS A;  4M77 C;  4QVZ A;  5GAN 6;  4ZGE B;  5GMK h;  5GAO q;  2OTL T;  2KAF A;  2HQX A;  2FB7 A;  3JCM V;  2GFA A;  4L59 A;  2M1H A;  3RKW A;  1K9M C;  2DAQ A;  4BE1 A;  1R8O B;  4YTL A;  2HAX A;  3CEY A;  3FLG A;  2ZPE B;  5FU6 C;  1X75 C;  5GMK i;  5CQX A;  4M7A F;  2EJF A;  3FRN A;  3DB4 A;  3E1S A;  2FHD A;  2QQ9 A;  1G3T A;  3QYG B;  4M75 D;  5GAO l;  3CPW S;  2P0K A;  3LH0 A;  1UEB A;  4M78 D;  2K5I A;  3M58 A;  4B9X A;  1K8A C;  1M90 C;  5HK3 A;  1VQO T;  2KDS A;  4ZGD B;  5LJ3 f;  4C0D C;  1OI1 A;  2E41 A;  4J7I A;  1UGP B;  3FIF A;  3G71 A;  3S3O A;  2QA4 T;  5CR2 A;  4J6W A;  1M1K U;  1MGQ A;  1N6A A;  2GCX A;  3DLM A;  1YJ9 T;  2KSS A;  5CO7 A;  1NJI U;  2FL7 A;  2FYK A;  2LCC A;  3KUF A;  3JCM b;  3EFR A;  1YJW A;  3JSC A;  4LDV A;  2GFU A;  1VQ9 T;  1JJ2 S;  1UGR B;  2DKG A;  3QO3 A;  4IUU A;  4QQD A;  3J81 E;  2DXB A;  4XU2 A;  3GOX A;  4FM4 B;  5CVI A;  2H3J A;  1WJS A;  2DJZ A;  5D6W A;  5CKF A;  3H6Z A;  1K9M U;  4M75 E;  2RI5 A;  1YHQ T;  1D3B B;  3I55 T;  4E7L A;  1W2B S;  4M78 E;  4JLG A;  4J6X A;  3A8H B;  3VUB A;  2M0O A;  2VUB A;  4CI0 C;  4IUV A;  3G7Z A;  2KK4 A;  4Q5W A;  3VYG A;  4C5H A;  5CK9 A;  1D3B A;  2E10 A;  3QDR B;  5I21 A;  3OW2 A;  3L2V A;  2KQW A;  1VUB A;  2RHI A;  5KE3 A;  5LJ5 f;  3GIB A;  4J6Y A;  3ZEH A;  3FB9 A;  4BI8 B;  4KUL A;  3V8L A;  4LD9 K;  1YIJ A;  1I4K 1;  4PJO F;  4M7A B;  3QII A;  3OYG A;  4QQ6 A;  1VQP A;  1Q86 U;  3CMA T;  3CCU A;  2E1H A;  3O8V A;  3CCL A;  2D0Q B;  3F70 A;  2K2V A;  2K5L A;  1BKB A;  2RHY A;  1Q81 C;  5DLQ E;  3X24 B;  1M1G A;  2M16 A;  3RKY A;  4NL2 A;  1VQ6 T;  2I2L A;  1MHN A;  2G3R A;  3WVE B;  1VQM T;  1OYX A;  2LVM A;  4RCB A;  4C92 A;  5LJ3 g;  2E5Q A;  2RA2 A;  3VJP A;  4M7A A;  3N5B B;  2XG8 D;  4N4H A;  4C0Z A;  1P92 A;  3JCM h;  3JB9 J;  3G4S A;  2PVD B;  2XID A;  4F7U F;  3UWN A;  5GAM h;  1HXD A;  2RM4 A;  5IAY A;  1K73 U;  1FXX A;  3P8B B;  2EKO A;  3RER A;  3CD6 T;  2XIC A;  4IUT A;  1RL2 A;  1H64 1;  4OMF B;  4QVC A;  4VUB A;  2LX9 A;  2CYZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...