1PSFA

The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I ACCESSORY PROTEIN E
publication title Three-dimensional solution structure of PsaE from the cyanobacterium Synechococcus sp. strain PCC 7002, a photosystem I protein that shows structural homology with SH3 domains.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Photosystem i
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1psfA00
2PUOB 3A8LB 4L6V5 3QXEB 5L8RE 1QP2A 2CZ1B 3VYHB 4FM4B 2CZ7B 1UGRB 2AHJB 3HHTB 4ZGDB 2DD4A 2DD5A 1JB0E 3X24B 4ZGJB 4Y28E 2ZPHB 1GXIE 1V29B 1UGSB 1AHJB 3WVDB 2D0QB 3A8HB 3A8GB 2PVDB 1UGPB 2QDYB 3A8MB 3X20B 2PVOB 3WVEB 3LW5E 3QYHB 2ZPFB 2WSFE 4KT0E 4RKUE 3X25B 2ZZDA 2DPPB 1UGQB 3QZ9B 2O01E 3VYGA 1IREB 4OB2B 4ZGEB 2PUKB 4OB1B 1QP3A 4OB0B 3X28B 3QZ5B 1PSFA 2DXBA 2DXCA 1DJ7B 1PSEA 2WSEE 2CZ6B 3QYGB 2ZPIB 4XK8E 2ZCFB 3A8OB 2WSCE 2PVGB 2PU9B 2ZPEB 4OB3B 3X26B 2ZPBB 2CYZB 2CZ0B 2ZPGB
chains in the Genus database with same CATH superfamily
1YITA 3CC2T 1K9MU 1OULA 1WHJA 3JCMh 1UGVA 5FWBA 1QMCA 1WLPB 1O9SA 2DL5A 5KYYA 5GAMe 1OX9A 2WACA 2AIRB 4N0AC 3CC7A 1BU1A 4M78D 2KR3A 1RABB 4J9BA 3EHRA 1VQ8T 4ZN1A 1D0ZA 2F2XA 2DD5A 2LMJA 5IHIA 2LNVA 2LP5A 4GBQA 4Y28E 1QLYA 4HA8A 1Y71A 5I22A 1PNJA 2K7AA 3VV0A 5I21A 2EQIA 1YJWA 3NTKA 4M7AE 1WQWA 1E6HA 5LJ3g 3UATA 1QVFA 4KULA 3L2RA 2KRSA 3CC2A 4M75E 2VASA 2WSFE 4J7IA 3L1AA 4J9CA 2RI3A 2HDAA 4J9EA 3C95A 1VQ8A 2CP7A 2HKNA 5FW9A 2ABLA 4FYYB 2VGNA 4C0DB 1D0YA 2JM8A 2FZGB 2K9GA 2XI9A 4QQDA 4C0ZA 2DRKA 2RH2A 3HSBA 3V8LA 1JXOA 4J7FA 3OYDA 1I5OB 1RL2A 3LGLA 5LJ3f 1OZ2A 4EDUA 2RQUA 2JTMA 5KH6A 3LGFA 2DXTA 2AZSA 4A53A 4AG1C 4PJLA 1ACMB 1HK9A 2EYXA 5EC7A 3OQ5A 4M7DD 3OYJA 4CC2A 2ZPGB 3D7SB 2QQAA 4JRKA 2V8IA 2QK0A 1P92A 4MDWA 1I1JA 3ZEHA 2X4YA 1R77A 2X9HA 2CSQA 4EMKB 2VGMA 1H8KA 4LUEA 1Y07A 2O31A 3E1SA 3ZL7C 3J80E 4ZGDB 3QG1A 1BKBA 2R5MA 2RF0A 4PFOA 3CCSQ 4C5IA 4EMKA 5CK9A 4ORZA 5GJWB 2HAXA 4FU6A 4LDXA 3G4ST 2EGCA 1Z9QA 4PFZA 3A8MB 4IUUA 5GMKh 3CCRA 2M02A 3INZA 4AFQC 5KYXB 4XTZA 3JSCA 2CUDA 1N8RU 3PMTA 2HMAA 4Z88A 5CVIA 2HEQA 2ZZDA 1IREB 3L2QA 3DLMA 2RHXA 2RK1A 4JLGA 5HY6A 1YWPA 4N4GA 1WJQA 4OB1B 1WHHA 5KYXA 3S3NA 2XD0A 2LVMA 5CKBA 1OU9A 4QW2A 2CP6A 3HKSA 3MEAA 1JRIA 2VUBA 3RR6A 4PJNA 3G4SA 1YIJA 2RHYA 4C0DC 4ZNXA 2DBMA 3JCMQ 2OTLT 1QKWA 4KGVB 1Q81C 2EGEA 4HCBA 2KAFA 1HYOA 2EVRA 1VUBA 3JB9F 2J6FA 1M2OA 2PZ1A 5FLXE 3FJ5A 1YJNT 1EIFA 1KQSA 3M59A 1H3ZA 3VS3A 4BI3A 1WFWA 3QXEB 5GAOl 1YFNA 2JMAA 3HFOA 2DZCA 5GAOq 1T3SA 2KEAA 1M90C 2LZ6B 2DJZA 3C0CA 1UGRB 4EMKC 1M9SA 1IHWA 1YITQ 4AT1B 3X24B 3EH2A 1TU0B 4M77F 1VQLT 1ZA2B 2O2OA 1WGSA 2A08A 4PL6A 3HRSA 5A0GA 2K57A 4M78G 3WVDB 2G6FX 1W1FA 3CC7Q 3JB9G 1G3YA 2DL8A 4LE9A 5IN1A 3WVEB 2JM9A 1YJNA 4KGZB 1K0XA 2DL7A 3M0PA 1VQ9T 1Q86R 2H3JA 3JCMW 2LT4A 5C0MA 1M1GA 1WHKA 2KNBB 3OMGA 3OYKA 2Y90A 1GFCA 5CKEA 2E10A 1F1BB 2J6KA 4EMGA 2JZ2A 2BZYA 1YJ9T 2DEQA 4A4KA 2VC8A 4M77G 1J3TA 3PE0A 3M53A 3UDCA 4KBMB 1VQLA 4M7DF 4BI4A 1KC8R 2DAQA 2YXYA 1VQ5T 4BDYA 1OOTA 3CCET 3UWNA 3WXMB 2AKKA 4ZTJA 4M77B 2QQ9A 2RHZA 3OS2A 4J9DA 4LDVA 1EX4A 2WSCE 2HSEB 2PU9B 1TUCA 2CGHA 4MZMA 1ABQA 1PRMC 1YHQQ 2NUPB 3SD4A 3JRZA 3PFSA 1UHCA 2GGRA 4RMOA 1VQ9A 4M77A 1TUGB 3I9QA 1PG5B 2HSPA 2EAYA 2E4HA 3PVQA 3CD6T 1W2BA 3GNFB 4ZTFA 3DB4A 5GANh 1YJ9A 3ULRB 2NUPA 4FYXB 4M7DG 4HCKA 2LRQA 3LLRA 1FMVA 3DLLA 1TTHB 1VQ5A 2GF7A 2DA9A 3OYAA 2Y4YA 3CCEA 1KD1C 4EMHA 3CCJT 4M7DB 2MWOA 3GNGA 3JCMe 3MEUA 2MWPA 1G83A 1GXIE 2MPXC 2NLUA 1PCXA 2HKQB 3PMIA 2KXCA 3VS7A 1K8AC 4CC7A 1G3SA 4C92F 1NJIU 3M58A 4L59A 4M7DA 3CXCP 3M54A 3CPWP 2A0FB 4YTLA 2P0KA 1IGQA 4KT0E 4QVDA 2GQVA 2IVWA 3HFNA 5GMKl 3NTIA 2ROTA 2DPPB 2V1RA 2QTXA 2KYBA 2O01E 1FMKA 1NG2A 4DOVA 2BTTA 2P0PA 1RADB 1W70A 1JU5C 3CCRQ 1Y0MA 4IURA 2O88A 1MNDA 4IIMA 3CCJA 1MV3A 2EJ9A 1M2VB 1YI2T 5GAMf 4D8KA 1M1KU 1LOJA 2QAZA 2XKOC 4C92G 3QUIA 1I4K1 1U3OA 3QYGB 3RERA 1QVFS 3OYYA 2F69A 3DB3A 1G8XA 2DL4A 2RA2A 2EIFA 1QKXA 1M2VA 3VRZA 3CCQA 1C0MA 2I0NA 4M77C 4C92B 1U06A 4LXCA 3QWXX 1VQ4T 3GBQA 2YDLA 1AT1B 3QPHA 4KUDK 2EFIA 2QQRA 3G4SQ 1YIJQ 1AZGB 2FO0A 2ESWA 5IHNA 4A4HA 2JT4A 4KGXB 1MMAA 2R5AA 4C92A 3CCVA 2OTJQ 1AZEA 1PC0A 4A4FA 1WI7A 3I55T 5CKFA 1XQHA 3AT1B 4F7UF 2LJ3A 1S72Q 3JB9J 2L3SA 1M5Q1 3CCMQ 2E64A 4Y91A 1N9RA 4J6YA 3E2UA 3RNJA 2AT1B 4XTYA 2QDLA 1Q86U 5KYUB 2DKGA 4RTZA 1IGUA 4M7DC 4C5GA 1BI2A 1UUEA 1VIFA 1VQ4A 2H8HA 4X9CA 1FX7A 1OX8A 1K1ZA 4ME7A 2R57A 1KC8U 2LTOA 2L3PA 2AZVA 3S3OA 3I55A 3PIPA 4F7UG 1WXTA 1JO8A 2HZYA 3CEYA 5LJ5j 4E7IA 2GCXA 5GMKe 4J6WA 1YJNQ 1H641 3X28B 1VA7A 4F7UB 1VYTA 2E6ZA 1VQOQ 3I56T 2BZ8A 2KSSA 1X43A 3LWHA 1MHNA 1BI3A 2ZPIB 4F7UA 2YUPA 2VVKA 1VQLQ 4RCCA 1LCKA 3M0SA 4C92C 3CCUT 2P84A 2DFUA 3A98A 3OY9A 1G5VA 4QQGA 3FJPA 3V7CA 1ZSZB 4BACA 3THKA 1K73C 4J9FA 4M77E 3QBYA 1R0BG 1BI1A 4FM4B 4TVRA 3UA6A 3OSSC 3I56A 1VQNT 1U5SA 1ZSZA 1ZUKA 2AK5A 1YJ9Q 2CUBA 4E7HA 2EQUA 3PNWC 2V8JA 1RI9A 1JQQA 4PJOD 3M56A 2PVDB 2BUDA 2QASA 2VXEA 3CCEQ 1G3WA 3VU3C 2QDYB 4J8OA 4OP0A 4RTWA 3CCUA 4A63B 1KQSS 2KY9A 2K5IA 1BCMA 2ATCB 3I5RA 2MYSA 3HRTA 1UGQB 2GTOA 2YLCA 2DEUA 1SRLA 3VYGA 4M7DE 4ZGEB 1Q7YC 2YSQA 1VQNA 3J7AF 3EGXB 1SSHA 3MEVA 1Q81R 2CP2A 2CH4A 3CPFA 4PNOA 3TSWA 4PLIA 3VUBA 2E5QA 1ZSGA 1UE9A 3VKIA 2DYBA 3H0IA 2SRCA 3RUXA 5CQXA 2RHIA 3EGXA 4JZ3A 4C8QD 2EW3A 1NYGA 1BBZA 3TREA 2EGAA 3EFRA 1M90R 5GAN3 4QQ6A 2DETA 8ATCB 4ZN3A 2RMOA 2JTFA 1VYVA 2BE7D 3CCQQ 3PGGA 1HJDA 4E7KA 3CMAQ 1PKSA 4JRIA 2LCCA 3OBWA 2EQMA 1Q95G 3CC4T 2COYA 2B86A 3OYIA 1N9SA 2DD4A 3LWIA 4KUIA 1RLPC 4ELZC 3OMCA 4C92E 4JRPA 5J26A 5LJ5g 3CCVQ 2BE9B 5GANe 5HK3A 4JRQA 4J6XA 4Y92A 5IXFA 2RHUA 3LX7A 1AHJB 5I11A 5KYWB 2R58A 1MV0B 5FU6B 2CREA 1UECA 1W2BS 2LQNA 4N4IA 1G2BA 3JCMb 4JJCA 4M7AD 2ZPFB 2DNUA 5KYWA 3PVLA 4AG2C 3GLXA 4OGCA 1QCNA 2QEXT 1VQ4Q 2PQWA 2HL3A 4M75D 4X9DA 3NFCA 4FSXA 5LJ3d 1VQ7T 4OMNA 3CC4A 8AT1B 2MOXA 1ZLMA 4HKEA 3FEOA 2XDDA 1K9AA 4BY6B 2F2VA 3O5ZA 5LJ5f 5L23A 3TQ7P 3RKXA 2E6NA 1X69A 3GP8A 3OBYA 2DX1A 3I55Q 2ED0A 3GIBA 3JCMP 5GAOp 2LT1A 2WSEE 3BE3A 4LD6A 5IAYA 4B9WA 7AT1B 2D8HA 2K4YA 3JCMf 3CBOA 4R0KA 1PKTA 2DJQA 3UPUA 5GAMj 2LX9A 1VQPT 3MP1A 3NHNA 1YCSB 2X4XA 2K79A 2CYZB 2DL3A 1WZOA 2QEXA 2DF6A 4HT8A 3A5ZB 5HKCA 1KD1R 4BB7A 1VQ7A 4F7UE 3M0RA 4DBRA 1M8MA 1X2QA 2KROA 2QYZA 2KT1A 3NMZC 3CPWA 1RAIB 5HK0A 3RDVA 2RPNA 1U1SA 4PJOF 3M55A 1K8AR 2KVQG 2CZ7B 3BY7A 2K3BA 4M78F 4NOYA 1QWEA 3HHTB 4XTWA 2RQTA 3EHQA 2Y4XA 2GQIA 4HCCA 4FW1A 2FVUA 3TU4K 4ZGJB 2DIQA 1VQKT 2DO3A 2IG0A 2XDBA 1HSQA 1KQ2A 2YRCA 1V29B 1XJWB 2K3YA 1JJ2S 4LDYA 1JBMA 5D6WA 2ENMA 2VYTA 1Q82R 3G7ZA 3I56Q 5C6SA 1NLOC 2JS0A 1TH7A 2COZA 1NEBA 5FU6C 4RKUE 1WXUA 2EJGA 1W4SA 2DXUA 3OW2S 4BE1A 1RAHB 4PJOG 2CP0A 2OTLA 3ME9A 1YN8A 1ZUYA 3MP6A 1UFFA 4C0FA 1C1AA 2HCKA 1SG5A 4C8QF 3CCUQ 3JAME 2KK4A 3SHWA 1I81A 1I0CA 4PJOB 2KXDA 3QZ5B 4F17A 3OS5A 1C6VX 2M16A 2W0ZA 4M78B 2V1QA 1FMWA 1M90U 4IUTA 2QA4T 4DBHA 1WHLA 3VS4A 5GAN2 1YJWQ 2NYSA 4PJOA 2C06A 2FB7A 1VQNQ 3MO8A 4XK8E 2YUOA 1QVGS 1KFZA 4M78A 1JXMA 2PVGB 1WA7A 5CQYA 3C94A 1OU8A 3CC2Q 2C0OA 2JN0A 2L3QA 2MCNA 3EGUA 5LJ3e 4WF2A 2FPFA 1OPLA 3CQTA 4FW2A 4C8QG 2P0QA 1N5ZA 3NTHA 2DLPA 2YRVA 3FB9A 1ZQ1A 1VQ8Q 3G6ET 5CAIA 1SHGA 2K3XA 1IRXA 1QP2A 1AWXA 3VYHB 3RESA 3V7SA 4C8QB 1X2KA 2HNIA 1UG1A 4LN2A 2EYWA 4FT4A 3L2WA 1W6XA 2IPOB 2DTIA 3L42A 2QA4A 3DKMA 2MI6A 1XOVA 2L5QA 1YNZA 5CIUA 5IHKA 1H92A 3I5SA 1A0NB 2E5KA 1NPPA 2CS7A 2DK3A 4C8QA 4M75F 2K6DA 1PM3A 3OYGA 3P8HA 2HQXA 2X3WD 4FYVB 1WQ7A 4XTXA 3ASKA 3CMET 4HVWA 1YP5A 4DEYA 4LDUA 3JCMX 1OEBA 2O9SA 1SF9A 2EQKA 2F5KA 5GMKi 4QVCA 1AEYA 4XTVA 1QWFA 4ESRA 3L2VA 3X25B 4OMPA 3R6NA 1NJIC 1TXQA 5KE3A 3CBMA 5GAMg 1GL5A 1E7OA 2CH4W 1M4ZA 5FU7B 1FYNA 4M7AG 2LQ8A 2COWA 3ZFJA 2YWWA 1XTDA 4KRTA 1T0HA 3CD6A 3CBPA 2KI7A 3O8VA 4M75G 2FPEA 4PJOC 4M7AB 1AWJA 4QVZA 2DILA 1BCOA 3CC4Q 1KD1U 4MZPA 4M78C 2VWFA 1VQ6T 2MIOA 1Q82C 2E41A 2GNCA 4M75B 3CMEA 1ZBXA 2YUNA 1VQMT 5IT9E 5DM7R 1M1KC 1K8AU 2P4RA 4HVVA 4M7AA 1K73R 3AHUA 4RTTA 3LH0A 3JB9I 4L5GA 2E70A 2M9UA 2MF2A 2X4WA 3M4YA 2O4XB 4M75A 3A8LB 1BI0A 2J05A 4R55A 2I2LA 3L2UA 2NUTB 1M3CA 3OSVA 4CI0C 5GAOm 4BD3A 1N6AA 2M51A 1B07A 4RTUA 1KQSP 5I2MA 4M4ZA 3EG0A 5AT1B 1VQ7Q 1VOMA 2JOYA 2NUTA 2EYYA 5D6XA 4BE0A 4C8QC 1VQ6A 2RI5A 3MJXA 2DTHA 3KUFA 1VQMA 1B3QA 4XQ3A 1ZA1B 4JS5A 2V26A 2ED1A 3C4SA 4J5YA 3RMSA 2RQWA 4XU2A 2FZKB 1UDLA 3GPLA 2LX7A 1YI2A 2YHTA 1Q7YR 3X20B 3LW5E 1WXBA 1OPKA 1TWBA 5GAMd 1KQ1A 2JXBA 1NYFA 3EG2A 4JJNK 3HPWA 1M3AA 2XICA 1M1FA 2VXFA 3EFOB 2DE0X 2EPDA 2ZAEA 3H8ZA 1XNIA 2LJ1A 4B6MA 1IB8A 2C0IA 1D1AA 4A4EA 4RTYA 3S3MA 2XHCA 1QCOA 3VS5A 5KYUA 1GBRA 2DXCA 3UA7A 2OTLQ 4OF1A 5GJVB 5J39A 2E3IA 3VS0A 5J3BA 1M27C 2NUZA 2K5LA 2LCLA 4PK4A 1IZ6A 3P8BB 3NPFA 1BK2A 3JCMV 2YT6A 1Y57A 5GANf 3A8OB 1OI1A 4NL2A 3M9QA 4OB3B 2IIMA 4M75C 4N0AA 1MUZA 2CP3A 4PFPA 4BDZA 1D0XA 2HQEA 3OYCA 1KHCA 4LNPA 4LD9K 2CSIA 2RJCA 3FRNA 5LJ3h 4M78E 2KBTA 4E7ZA 3OYNA 3M0TA 1JEGA 1O75A 1W2BP 1KIKA 4X34A 1ZHIA 3HRUA 2OI3A 4J83A 1NLPC 1ZBJA 1VYUA 3FIFA 2HL5C 4OMOA 1GFDA 1UGSB 1YITT 4XTUA 3RKYA 2H3EB 2A37A 2QA4Q 4DOWA 2FRYA 3BDUA 1VQ9Q 1AWOA 4AMCA 3E19A 1TUDA 3G71T 3REAB 3C12A 5CR2A 4E7LA 1K9MC 1EZZB 3RKWA 2RJDA 4PJJA 2JNGA 2D0NA 2LNHB 4C8QE 4IUPA 3KXTA 3TSZA 1TSFA 5DLOA 5GMKm 3QZ9B 2QG9B 3U23A 1U8RA 4JZ4A 1D1CA 1VQ5Q 1UJ0A 4VUBA 4DA4A 2C0TA 2B8AA 1SKUB 2FPDA 3TEEA 1UHFA 1PSFA 1Z9ZA 2CT4A 1NPRA 1YCYA 1HD3A 2DXBA 5EG2A 4PJMA 2MMPA 5IH2A 4C5HA 4A4GA 3G71A 1X6GA 3H9NA 1RI0A 5GAN6 3CD6Q 3MCAB 4QKUA 3JB9D 2QGGA 4Z8AA 2CZ0B 2XU8A 1TG0A 3H0HA 2L89A 1JJ2P 2FEIA 1UEBA 1YHQT 3L2ZA 4E7SA 2DRMA 3CMEQ 1T0JA 1OQKA 3MEWA 1AD5A 4AFSC 5L8RE 2VKNA 3CCJQ 5FRMA 4Q5WA 2HBPA 1H3HA 2RQRA 1Q7YU 4NS5A 4E2FB 2RI2A 2AHJB 2FZCB 3NGPA 3EG9B 4MDXA 3OW2P 2EKHA 1GCQA 1KK7A 3G1JA 4M77D 1NZ9A 3OB9A 2LQKA 4JPBW 1D1BA 2NWMA 3VRYA 4WCIA 4BUGA 5CO7A 4IUQA 4OMQA 1LVKA 1OZ3A 3MP8A 3EG9A 2FYKA 3META 2LQWA 4R56A 2YRDA 5GMKj 5CCAA 3CCLT 1ZSZC 4MMKA 1SHFA 1VQ6Q 1KSWA 2DTOA 1YHQA 2P4TA 4J9GA 5GAOr 2K2MA 1VQMQ 5LL6S 1R0CB 4OMMA 5A2QE 4OMFB 2GFUA 1QVGP 1M3BA 3VS6A 1E6GA 3RBBB 1VIEA 1WPYA 1YI2Q 2PUKB 1D3BB 2JJ9A 3MHXA 2BZXA 4BI8B 4RTXA 3JCMg 4JJBA 2EKOA 4KH0B 2RM4A 3SDZA 4FYWB 3CCRT 2LJ0A 2XMFA 3VS2A 1DJ7B 2SEMA 1PSEA 1D3BA 1BIAA 2DM1A 5HCKA 1Y7XA 1PD0A 1CKBA 3EG1A 3CCLA 3HL8A 1MGQA 4XU0A 3V7RA 4EPCA 3OS1A 1FWZA 2ZPEB 1B7TA 4OGEA 1N8RC 3JCMJ 4RTVA 3FLGA 2FL7A 2DZ9A 3LYIA 5IXBA 5D7UA 2CT3A 1QW1A 2DVJA 3TCJA 4E7JA 1EFNA 2LC4A 2M0OA 3JB9H 4D6WA 1YIJT 1UB4A 5KE2A 3UF4A 2F5TX 3URGA 1GCQC 2D9TA 2OTJT 1U1TA 3HTRA 2CKKA 2HQHA 2RN8A 2A36A 2EJFA 5DLQE 1S72T 2ZPHB 4V2SA 2QQSA 1KG1A 2L3RA 3M5AA 3CCMT 1WIEA 3CXCA 2JMCA 1NJIR 4C92D 2VB6A 3A8HB 3QHSA 1WDXA 1QCFA 2PNIA 4LDWA 1SSFA 4Z89A 2PVOB 3QJYA 5I2SA 5LJ5d 3OYMA 1WHMA 1YBYA 2ECZA 4F04B 2KRNA 3OYBA 2OAUA 2J7IA 3QDFA 2KRMA 3RIRA 4CRIA 4UC4A 2KDSA 3JCMd 2E12A 3VUZA 4FL6A 2OTJA 1QP3A 1VQPA 4E47A 1OYXA 4OB0B 1MNEA 2QGFB 4FCYA 1M1KR 1Q81U 1S72A 1I5LA 3GF5A 2EWNA 1TOVA 3FDRA 4HT9A 4IUVA 3CCMA 3QKJA 2O9VA 3ZBDA 3J81E 1QVFP 3H6ZA 4GLMA 1QQJA 1AVZC 1BIBA 2M1HA 4J9IA 1VQOT 3RMQA 2L8DA 5D6YA 4RG2A 1WNLA 1PRLC 5GAMh 3X26B 1I8FA 3REBB 3M4GA 1VQKA 2ZPBB 1K4US 4BY6C 1PHTA 4F16A 1PWTA 2PUOB 4L6V5 2F2WA 1I07A 2KGTA 5GANj 3EG3A 2RD1A 3G71Q 3F70A 4CC3A 1LJOA 2YUQA 4DQ2A 3JV3A 2F1LA 3SB2A 2XDPA 1SEMA 1T3LA 3SWNB 2XK0A 1WJSA 3R6OA 2CP5A 4DBFA 3ER0A 2GFAA 1VQOA 3BDLA 2E65A 2OX7A 2JW4A 3H0FA 4A54A 1R8OB 4II1A 4JJDA 2HBWA 3A8GB 2PTKA 3SWNA 4KH1B 2X4JA 3BW1A 3E9GA 4RCBA 2QQBA 4M7AF 1MMNA 1YWOA 5AYFA 3MPUB 2E1HA 2MAMA 4AFUC 3M0UA 3GOXA 2GBQA 3OYEA 4OB2B 2YLBA 1KJWA 1ZUUA 4WTOB 4XU1A 1X75C 4XAXB 4O6JA 3LH5A 1IXDA 2QI2A 1OV3A 2CDTA 2LDMA 3I35A 5GAN7 2FHDA 2L2PA 4Z02A 3PIOA 4DBQA 3G6EA 2A3LA 2D6FA 5LJ5e 2X35A 2D1XA 3SEMA 1SRMA 3QIIA 2D8JA 1LPLA 2ROLA 4DEXA 3E9FA 1KHIA 1LNXA 3M57A 5FWCA 1S1NA 4FSSA 2RO0A 2J06A 2V8KA 2EBPA 2JS2A 3CCLQ 5DY9A 2KE9A 4QT7A 3PT9A 2DERA 1NEGA 1RAGB 9ATCB 1ABOA 3CCQT 4FT2A 4RG8A 2K2VA 5KYNA 1GBQA 3CMAT 2RJEA 4X1VA 1IO6A 1Y96B 3V8KA 1CSKA 3M0QA 1K9MR 3QWYA 3TVTA 3SWNC 5A0DA 2BIVA 1ZX6A 3OS0A 3QSUA 1M8VA 3CCVT 1X6BA 1B34B 1BYMA 2RQVA 1UGPB 3T9NA 1Q82U 1Y96A 4P5NA 2O4XA 2QEXQ 3QYHB 5GAN5 1X6OA 1GRIA 2OJ2A 3N5BB 2RJFA 3EH1A 1WYXA 1SPKA 4PKCC 5M9OA 1B34A 1RLQC 1N27A 2GTJA 3P8DA 4EIKA 2HD0A 1PD1A 3SFMA 3CCST 3H41A 2M0YA 1GCPA 2DVEA 2DBKA 1AWWA 1JJ2A 4MZTA 3CMAA 2XIDA 4HXJA 1TS9A 3FC3A 5GANg 2EYQA 1Q86C 2W10A 4B9XA 1V1CA 1IHVA 2VV5A 1WHGA 3IQLA 3OYHA 4D8DA 5LJ3j 5KCHA 4HCZA 4AFZC 2CZ6B 4JLIA 4JS4A 1VQPQ 2X51A 3OYFA 2DYIA 3OW2A 3UT1A 3Q1JA 3V8JA 1KC8C 2DIGA 1G3TA 2QTVA 1X01A 1V76A 4OVAA 5A0LA 4NL3A 4XU3A 5FU7C 1M30A 1NBEB 3EFOA 2RB6A 1BB9A 1NM7A 2G3RA 4ELYC 3CCSA 3HP9A 3QO3A 3VJPA 4RUGA 2XG8D 4ANJA 3EGDB 3QDRB 3QJ6A 2KYMA 4MMLA 4BE2A 1K76A 4C5EA 4OMLA 4M7AC 3OA6A 3S6WA 1RAAB 2CZ1B 1VQKQ 1RAFB 2BKDN 1UJYA 4LUDA 1QVGA 1ARKA 5GAN4 1FXXA 4PLLA 2A7YA 1WJRA 1JB0E 4O5VA 4JDSA 2FG0A 3EGDA 4JUVA 4PJOE 4K11A 3MKDA 1QVPA 1AOJA 4IIOA 2RK2A 2QXFA 2L0AA 4E6RA 2EYZA 2ZGWA 5GAOn 2LCSA 1K0SA 1D09B 2D0QB 5CKDA 2MK5A 2AKLA 4FIBA 2JTEA 4CC4B 3EFSA 2Z0WA 2RNAA 2K5FA 5KCOA 2DMOA 1HXDA 2E3HA 1WX6A 3A1PA 4GLKA 4HVUA 5ECAA 2KQWA 5FROA 1RUWA 5GANd 4J9HA 3PTAA 4F14A 2KMTA 2KT8A 1NE8A 3KFVA 3BFMA 2A28A 1N8RR 3CC7T 3CXCS 3EAEA 4N4HA 2X3XD 3CPWS 4GY5A 1MMDA 2EQJA 6AT1B 2JUFA 5CKHA 5GAN8 1CKAA 3KBGA 1RACB 4IKFA 2JVVA 1RAEB 2ZCFB 2J6OA 3JCMc 5LJ5h 2OAWA 1UTIA 1YJWT 3VS1A 1X27A 3OYLA 5KYYB 4ATOA 1K73U 5FRNA 3G6EQ 1MMGA 4C0GA 2FRWA
chains in the Genus database with same CATH topology
1YITA 3CC2T 4C8QG 1K9MU 1QW1A 3JCMh 2P0QA 2R5AA 3TCJA 4C92A 3NTHA 4E7JA 2LC4A 2YRVA 3CCVA 2M0OA 3JB9H 3FB9A 1ZQ1A 3G6ET 4A4FA 4D6WA 1YIJT 1UB4A 3I55T 5KE2A 5CKFA 5CAIA 1O9SA 1XQHA 2K3XA 5GAMe 1QP2A 2WACA 2F5TX 3URGA 3RESA 3VYHB 3V7SA 4C8QB 4N0AC 4F7UF 3CC7A 4M78D 2D9TA 2HNIA 3JB9J 4FT4A 3L2WA 2OTJT 1U1TA 3JCMW 1M5Q1 2DTIA 3L42A 2E64A 4Y91A 1N9RA 2CKKA 2DD5A 3DKMA 4J6YA 2MI6A 4ZN1A 1XOVA 4XTYA 2EJFA 2LNVA 2L5QA 4Y28E 5CIUA 5DLQE 4HA8A 2ZPHB 1S72T 1Y71A 1Q86U 4V2SA 2QQSA 2DKGA 1NPPA 2CS7A 1KG1A 2DK3A 2L3RA 3VV0A 3M5AA 5I21A 3CCMT 4C8QA 3CXCA 4M75F 4C5GA 4M7DC 3OYGA 4C92D 1BI2A 1YJWA 1VIFA 3A8HB 3NTKA 3P8HA 1VQ4A 4M7AE 1WQWA 3QHSA 2HQXA 4LDWA 1SSFA 1WQ7A 4X9CA 1FX7A 5LJ3g 4XTXA 2PVOB 3QJYA 5I2SA 3ASKA 5LJ5d 3OYMA 3CMET 1QVFA 4KULA 1YBYA 4LDUA 3JCMX 3L2RA 4ME7A 3CC2A 4M75E 2EQKA 2F5KA 2R57A 4QVCA 5GMKi 3CCQA 4XTVA 2WSFE 1KC8U 3L2VA 3OYBA 2LTOA 3X25B 2OAUA 3S3OA 1NJIC 4J7IA 3L1AA 5KE3A 3I55A 3CBMA 3RIRA 5GAMg 3PIPA 4F7UG 4CRIA 4UC4A 2KDSA 2RI3A 3JCMd 2E12A 5LJ5j 1M4ZA 3CEYA 5FU7B 3VUZA 4E7IA 4FL6A 2GCXA 1QP3A 3C95A 2OTJA 5GMKe 1VQPA 4J6WA 1VQ8A 4M7AG 1H641 1OYXA 2LQ8A 4OB0B 4E47A 3ZFJA 3X28B 4F7UB 2VGNA 1XTDA 2E6ZA 1Q81U 1S72A 1I5LA 3GF5A 4C0DB 3CD6A 3CBPA 3O8VA 2EWNA 3FDRA 4M75G 4HT9A 2XI9A 4IUVA 4QQDA 4C0ZA 3CCMA 4PJOC 2RH2A 3QKJA 4M7AB 3V8LA 3HSBA 4J7FA 4QVZA 3I56T 3ZBDA 3J81E 3OYDA 1KD1U 2KSSA 1RL2A 3LWHA 3H6ZA 4MZPA 4M78C 1MHNA 1BIBA 3LGLA 1VQ6T 1BI3A 2E41A 5LJ3f 1Q82C 2ZPIB 2M1HA 1OZ2A 4EDUA 4F7UA 4M75B 2JTMA 5KH6A 1VQOT 3CMEA 1ZBXA 3LGFA 2DXTA 2L8DA 3RMQA 1VQMT 4A53A 5D6YA 5IT9E 5DM7R 4RCCA 4RG2A 1M1KC 1HK9A 1K8AU 1WNLA 4M7AA 5GAMh 3X26B 1I8FA 3OQ5A 3M4GA 3AHUA 4M7DD 1VQKA 3LH0A 2ZPBB 3JB9I 4L5GA 3OYJA 2ZPGB 2E70A 2M9UA 4C92C 2MF2A 3CCUT 2X4WA 3M4YA 2O4XB 2QQAA 4M75A 4BY6C 4JRKA 2PUOB 2V8IA 3A8LB 4L6V5 3OY9A 1BI0A 1P92A 4R55A 2I2LA 5GANj 2RD1A 3L2UA 4MDWA 4QQGA 1G5VA 3FJPA 3V7CA 3OSVA 4CI0C 3ZEHA 2X4YA 4EMKB 3F70A 4BD3A 1N6AA 5GAOm 4BACA 2VGMA 1K73C 4M77E 3QBYA 1LJOA 4FM4B 1BI1A 4DQ2A 4TVRA 3SB2A 1Y07A 3E1SA 5I2MA 3J80E 2XDPA 4ZGDB 3QG1A 3OSSC 1BKBA 2R5MA 3I56A 1VQNT 4C5IA 3SWNB 2JOYA 2XK0A 1WJSA 5D6XA 4BE0A 4C8QC 4EMKA 3R6OA 1VQ6A 5CK9A 4E7HA 3ER0A 2RI5A 2DTHA 2GFAA 2EQUA 1VQOA 3KUFA 3PNWC 2V8JA 3BDLA 1VQMA 2E65A 4XQ3A 4A54A 4FU6A 2HAXA 4JS5A 1R8OB 4II1A 3C4SA 4LDXA 3G4ST 4J5YA 3RMSA 4PJOD 3M56A 3A8GB 2PVDB 4XU2A 2BUDA 3SWNA 2VXEA 3GPLA 1G3WA 3VU3C 1YI2A 2QDYB 2YHTA 3A8MB 4J8OA 3X20B 4OP0A 4IUUA 5GMKh 3CCRA 3LW5E 3CCUA 3INZA 4XTZA 1KQSS 2KY9A 2X4JA 3JSCA 3BW1A 3E9GA 5GAMd 1KQ1A 2K5IA 1N8RU 3PMTA 4RCBA 2QQBA 4JJNK 3HPWA 4M7AF 5CVIA 3HRTA 2ZZDA 5AYFA 1UGQB 2XICA 2E1HA 2MAMA 2YLCA 1M1FA 2VXFA 3GOXA 3OYEA 3VYGA 1IREB 2YLBA 4OB2B 4M7DE 3L2QA 3DLMA 2RHXA 4ZGEB 1Q7YC 2RK1A 4JLGA 5HY6A 4N4GA 1WJQA 4OB1B 1X75C 3H8ZA 1XNIA 4XAXB 4XU1A 3S3NA 2XD0A 4O6JA 2LVMA 1VQNA 2QI2A 3J7AF 3CD6T 3MEVA 2LDMA 4A4EA 3S3MA 2XHCA 3CPFA 5GAN7 2FHDA 4PNOA 4PLIA 3VUBA 2E5QA 2DXCA 5CKBA 4Z02A 4OF1A 4QW2A 3HKSA 5J39A 3MEAA 3VKIA 1JRIA 3PIOA 2VUBA 5J3BA 3G6EA 3G4SA 1YIJA 2A3LA 2K5LA 3RUXA 2RHYA 4C0DC 2LCLA 5LJ5e 2D6FA 1IZ6A 3P8BB 5CQXA 2RHIA 2X35A 3JCMV 3JCMQ 5GANf 2OTLT 3A8OB 4C8QD 1Q81C 1OI1A 3QIIA 4NL2A 4HCBA 3M9QA 2KAFA 4OB3B 3TREA 1VUBA 3EFRA 4M75C 4N0AA 3JB9F 5GAN3 4QQ6A 4BDZA 3E9FA 1KHIA 1LNXA 3M57A 4ZN3A 2HQEA 5FLXE 3OYCA 2RO0A 1YJNT 1KHCA 2JTFA 2V8KA 4LD9K 4M7DF 2RJCA 1EIFA 3FRNA 5LJ3h 1KQSA 3M59A 4M78E 1H3ZA 4BI3A 3QXEB 5GAOl 3PGGA 3OYNA 5DY9A 3HFOA 4E7KA 1O75A 3PT9A 4JRIA 2DZCA 2LCCA 2EQMA 3OBWA 5GAOq 4X34A 1M90C 2DJZA 3CC4T 3OYIA 1UGRB 1ZHIA 4EMKC 3CCQT 4FT2A 3HRUA 1N9SA 1M9SA 2DD4A 3LWIA 4KUIA 4RG8A 3X24B 4J83A 2K2VA 3OMCA 4ELZC 4C92E 3CMAT 4JRPA 2RJEA 5J26A 5LJ5g 3FIFA 4M77F 1Y96B 3V8KA 1VQLT 5GANe 5HK3A 4JRQA 4J6XA 1WGSA 2RHUA 3LX7A 4PL6A 1UGSB 1AHJB 3HRSA 3SWNC 2K57A 4M78G 3WVDB 5A0DA 5A0GA 1YITT 2R58A 4XTUA 2BIVA 3OS0A 3QSUA 1M8VA 3CCVT 3RKYA 3JB9G 5FU6B 1B34B 1BYMA 1G3YA 1UGPB 3T9NA 4DOWA 3BDUA 1Q82U 5IN1A 3E19A 1Y96A 3WVEB 4P5NA 2O4XA 3G71T 3QYHB 5GAN5 3C12A 4N4IA 5CR2A 4E7LA 1X6OA 1YJNA 1W2BS 1K9MC 3RKWA 3JCMb 2RJDA 3N5BB 4M7AD 2RJFA 2ZPFB 2JNGA 4C8QE 4IUPA 3KXTA 1VQ9T 5DLOA 2H3JA 3GLXA 4OGCA 5GMKm 4PKCC 2LT4A 5C0MA 5M9OA 1M1GA 3QZ9B 1B34A 2QEXT 3OMGA 1N27A 3OYKA 2Y90A 3P8DA 2PQWA 2HD0A 5CKEA 4M75D 4X9DA 2E10A 1U8RA 3SFMA 3NFCA 3CCST 4FSXA 5LJ3d 1VQ7T 4EMGA 3CC4A 2JZ2A 2DVEA 1YJ9T 4HKEA 4VUBA 4DA4A 2DEQA 3FEOA 4A4KA 2VC8A 2B8AA 2XDDA 4BY6B 1JJ2A 4MZTA 5LJ5f 4M77G 3CMAA 2XIDA 3M53A 3FC3A 3UDCA 3RKXA 3TEEA 5GANg 2E6NA 2EYQA 4KBMB 3GP8A 2QA4A 1PSFA 1Q86C 4BI4A 1NPRA 4B9XA 1VQLA 1YCYA 2DAQA 2VV5A 3OBYA 1VQ5T 2DXBA 3OYHA 3GIBA 3JCMP 5LJ3j 5GAOp 2LT1A 2WSEE 4LD6A 4BDYA 5EG2A 5IAYA 3CCET 3UWNA 3WXMB 2MMPA 5KCHA 4HCZA 4M77B 4B9WA 4ZTJA 2CZ6B 2K4YA 2QQ9A 4JLIA 4C5HA 4A4GA 4JS4A 2RHZA 3OS2A 3JCMf 4LDVA 3OYFA 3CBOA 3OW2A 3UT1A 3G71A 2WSCE 1QVGA 3Q1JA 3UPUA 1RI0A 2PU9B 3V8JA 5GAN6 5GAMj 2CGHA 2DIGA 2LX9A 3MCAB 1G3TA 4MZMA 1KC8C 1X01A 3SD4A 1VQPT 3JRZA 3MP1A 3PFSA 4OVAA 3JB9D 1VQ8T 5A0LA 4RMOA 2X4XA 4NL3A 4M77A 4XU3A 1VQ9A 2CYZB 5FU7C 2CZ0B 2XU8A 2QEXA 2RB6A 2L89A 2EAYA 4HT8A 2G3RA 3A5ZB 4ELYC 5HKCA 4BB7A 3HP9A 3CCSA 4F7UE 1VQ7A 1UEBA 3QO3A 1YHQT 3L2ZA 3VJPA 3GNFB 2XG8D 1W2BA 4ZTFA 3DB4A 5GANh 1YJ9A 3MEWA 3CPWA 3QDRB 3QJ6A 5L8RE 4MMLA 5HK0A 4M7DG 4BE2A 4M7AC 4C5EA 1U1SA 4Q5WA 4PJOF 2HBPA 3OA6A 2LRQA 3S6WA 2CZ1B 3LLRA 3M55A 2KVQG 2CZ7B 3BY7A 3DLLA 1Q7YU 1VQ5A 2BKDN 2GF7A 4NS5A 4M78F 4NOYA 2RI2A 2AHJB 3HHTB 1FXXA 4XTWA 5GAN4 4PLLA 2A7YA 2Y4YA 1WJRA 2Y4XA 4EMHA 3OYAA 3CCEA 1JB0E 1KD1C 4MDXA 4O5VA 4HCCA 3CCJT 4M7DB 2FVUA 2MWOA 3GNGA 4JDSA 4M77D 4ZGJB 3TU4K 2DIQA 1NZ9A 3JCMe 1VQKT 2DO3A 2IG0A 3MEUA 4JUVA 2MWPA 3OB9A 2XDBA 4PJOE 1KQ2A 1GXIE 2LQKA 2NLUA 1QVPA 4BUGA 1V29B 5CO7A 2RK2A 2QXFA 3PMIA 4IUQA 2ZGWA 5GAOn 2K3YA 1K8AC 1G3SA 1JJ2S 4LDYA 1OZ3A 2D0QB 5CKDA 4FIBA 1JBMA 5D6WA 4C92F 3MP8A 1NJIU 2FYKA 2VYTA 3M58A 3META 4R56A 3G7ZA 4L59A 4M7DA 3EFSA 5GMKj 5C6SA 5FRMA 5CCAA 3CCLT 3M54A 4MMKA 1TH7A 2K5FA 5KCOA 4YTLA 2DTOA 2P0KA 1YHQA 2P4TA 5FU6C 1HXDA 4KT0E 4QVDA 2GQVA 2IVWA 3HFNA 4RKUE 5GAOr 2EJGA 1W4SA 5GMKl 3NTIA 5LL6S 2DXUA 3OW2S 4BE1A 2DPPB 5A2QE 2QTXA 4GLKA 4PJOG 4OMFB 2GFUA 2O01E 2OTLA 4DOVA 3ME9A 2P0PA 2KQWA 3MP6A 5FROA 1VIEA 1WPYA 4C0FA 2PUKB 5GANd 1D3BB 4C8QF 4IURA 3MHXA 2KK4A 3JAME 1I81A 4PJOB 3CCJA 3QZ5B 4BI8B 3PTAA 3JCMg 2KMTA 3OS5A 1NE8A 2EKOA 2EJ9A 2M16A 3BFMA 4M78B 2RM4A 3SDZA 5GAMf 1YI2T 3CC7T 3CXCS 3CCRT 3EAEA 4IUTA 1M90U 4N4HA 1LOJA 1M1KU 1DJ7B 4GY5A 3CPWS 2XKOC 2EQJA 2QA4T 1PSEA 4C92G 2JUFA 3QUIA 1I4K1 1D3BA 5CKHA 5GAN8 1BIAA 3QYGB 5GAN2 3KBGA 3RERA 4PJOA 4IKFA 1QVFS 2JVVA 1Y7XA 3OYYA 2FB7A 2F69A 3DB3A 3MO8A 2C06A 4XK8E 3CCLA 1QVGS 2RA2A 2ZCFB 2EIFA 3HL8A 1MGQA 4M78A 4XU0A 3JCMc 2PVGB 4M77C 5CQYA 3V7RA 4C92B 4EPCA 3C94A 1FWZA 5LJ5h 3OS1A 2ZPEB 4OGEA 1N8RC 1YJWT 3JCMJ 1VQ4T 3FLGA 2JN0A 3OYLA 2FL7A 4ATOA 1K73U 2DZ9A 3QPHA 5FRNA 3LYIA 4KUDK 2EFIA 2QQRA 4WF2A 5LJ3e 4C0GA 4A4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUO B;  3A8L B;  4L6V 5;  3QXE B;  5L8R E;  1QP2 A;  2CZ1 B;  3VYH B;  4FM4 B;  2CZ7 B;  1UGR B;  2AHJ B;  3HHT B;  4ZGD B;  2DD4 A;  2DD5 A;  1JB0 E;  3X24 B;  4ZGJ B;  4Y28 E;  2ZPH B;  1GXI E;  1V29 B;  1UGS B;  1AHJ B;  3WVD B;  2D0Q B;  3A8H B;  3A8G B;  2PVD B;  1UGP B;  2QDY B;  3A8M B;  3X20 B;  2PVO B;  3WVE B;  3LW5 E;  3QYH B;  2ZPF B;  2WSF E;  4KT0 E;  4RKU E;  3X25 B;  2ZZD A;  2DPP B;  1UGQ B;  3QZ9 B;  2O01 E;  3VYG A;  1IRE B;  4OB2 B;  4ZGE B;  2PUK B;  4OB1 B;  1QP3 A;  4OB0 B;  3X28 B;  3QZ5 B;  1PSF A;  2DXB A;  2DXC A;  1DJ7 B;  1PSE A;  2WSE E;  2CZ6 B;  3QYG B;  2ZPI B;  4XK8 E;  2ZCF B;  3A8O B;  2WSC E;  2PVG B;  2PU9 B;  2ZPE B;  4OB3 B;  3X26 B;  2ZPB B;  2CYZ B;  2CZ0 B;  2ZPG B; 
#chains in the Genus database with same CATH topology
 1YIT A;  3CC2 T;  1K9M U;  1OUL A;  1WHJ A;  3JCM h;  1UGV A;  5FWB A;  1QMC A;  1WLP B;  1O9S A;  2DL5 A;  5KYY A;  5GAM e;  1OX9 A;  2WAC A;  2AIR B;  4N0A C;  3CC7 A;  1BU1 A;  4M78 D;  2KR3 A;  1RAB B;  4J9B A;  3EHR A;  1VQ8 T;  4ZN1 A;  1D0Z A;  2F2X A;  2DD5 A;  2LMJ A;  5IHI A;  2LNV A;  2LP5 A;  4GBQ A;  4Y28 E;  1QLY A;  4HA8 A;  1Y71 A;  5I22 A;  1PNJ A;  2K7A A;  3VV0 A;  5I21 A;  2EQI A;  1YJW A;  3NTK A;  4M7A E;  1WQW A;  1E6H A;  5LJ3 g;  3UAT A;  1QVF A;  4KUL A;  3L2R A;  2KRS A;  3CC2 A;  4M75 E;  2VAS A;  2WSF E;  4J7I A;  3L1A A;  4J9C A;  2RI3 A;  2HDA A;  4J9E A;  3C95 A;  1VQ8 A;  2CP7 A;  2HKN A;  5FW9 A;  2ABL A;  4FYY B;  2VGN A;  4C0D B;  1D0Y A;  2JM8 A;  2FZG B;  2K9G A;  2XI9 A;  4QQD A;  4C0Z A;  2DRK A;  2RH2 A;  3HSB A;  3V8L A;  1JXO A;  4J7F A;  3OYD A;  1I5O B;  1RL2 A;  3LGL A;  5LJ3 f;  1OZ2 A;  4EDU A;  2RQU A;  2JTM A;  5KH6 A;  3LGF A;  2DXT A;  2AZS A;  4A53 A;  4AG1 C;  4PJL A;  1ACM B;  1HK9 A;  2EYX A;  5EC7 A;  3OQ5 A;  4M7D D;  3OYJ A;  4CC2 A;  2ZPG B;  3D7S B;  2QQA A;  4JRK A;  2V8I A;  2QK0 A;  1P92 A;  4MDW A;  1I1J A;  3ZEH A;  2X4Y A;  1R77 A;  2X9H A;  2CSQ A;  4EMK B;  2VGM A;  1H8K A;  4LUE A;  1Y07 A;  2O31 A;  3E1S A;  3ZL7 C;  3J80 E;  4ZGD B;  3QG1 A;  1BKB A;  2R5M A;  2RF0 A;  4PFO A;  3CCS Q;  4C5I A;  4EMK A;  5CK9 A;  4ORZ A;  5GJW B;  2HAX A;  4FU6 A;  4LDX A;  3G4S T;  2EGC A;  1Z9Q A;  4PFZ A;  3A8M B;  4IUU A;  5GMK h;  3CCR A;  2M02 A;  3INZ A;  4AFQ C;  5KYX B;  4XTZ A;  3JSC A;  2CUD A;  1N8R U;  3PMT A;  2HMA A;  4Z88 A;  5CVI A;  2HEQ A;  2ZZD A;  1IRE B;  3L2Q A;  3DLM A;  2RHX A;  2RK1 A;  4JLG A;  5HY6 A;  1YWP A;  4N4G A;  1WJQ A;  4OB1 B;  1WHH A;  5KYX A;  3S3N A;  2XD0 A;  2LVM A;  5CKB A;  1OU9 A;  4QW2 A;  2CP6 A;  3HKS A;  3MEA A;  1JRI A;  2VUB A;  3RR6 A;  4PJN A;  3G4S A;  1YIJ A;  2RHY A;  4C0D C;  4ZNX A;  2DBM A;  3JCM Q;  2OTL T;  1QKW A;  4KGV B;  1Q81 C;  2EGE A;  4HCB A;  2KAF A;  1HYO A;  2EVR A;  1VUB A;  3JB9 F;  2J6F A;  1M2O A;  2PZ1 A;  5FLX E;  3FJ5 A;  1YJN T;  1EIF A;  1KQS A;  3M59 A;  1H3Z A;  3VS3 A;  4BI3 A;  1WFW A;  3QXE B;  5GAO l;  1YFN A;  2JMA A;  3HFO A;  2DZC A;  5GAO q;  1T3S A;  2KEA A;  1M90 C;  2LZ6 B;  2DJZ A;  3C0C A;  1UGR B;  4EMK C;  1M9S A;  1IHW A;  1YIT Q;  4AT1 B;  3X24 B;  3EH2 A;  1TU0 B;  4M77 F;  1VQL T;  1ZA2 B;  2O2O A;  1WGS A;  2A08 A;  4PL6 A;  3HRS A;  5A0G A;  2K57 A;  4M78 G;  3WVD B;  2G6F X;  1W1F A;  3CC7 Q;  3JB9 G;  1G3Y A;  2DL8 A;  4LE9 A;  5IN1 A;  3WVE B;  2JM9 A;  1YJN A;  4KGZ B;  1K0X A;  2DL7 A;  3M0P A;  1VQ9 T;  1Q86 R;  2H3J A;  3JCM W;  2LT4 A;  5C0M A;  1M1G A;  1WHK A;  2KNB B;  3OMG A;  3OYK A;  2Y90 A;  1GFC A;  5CKE A;  2E10 A;  1F1B B;  2J6K A;  4EMG A;  2JZ2 A;  2BZY A;  1YJ9 T;  2DEQ A;  4A4K A;  2VC8 A;  4M77 G;  1J3T A;  3PE0 A;  3M53 A;  3UDC A;  4KBM B;  1VQL A;  4M7D F;  4BI4 A;  1KC8 R;  2DAQ A;  2YXY A;  1VQ5 T;  4BDY A;  1OOT A;  3CCE T;  3UWN A;  3WXM B;  2AKK A;  4ZTJ A;  4M77 B;  2QQ9 A;  2RHZ A;  3OS2 A;  4J9D A;  4LDV A;  1EX4 A;  2WSC E;  2HSE B;  2PU9 B;  1TUC A;  2CGH A;  4MZM A;  1ABQ A;  1PRM C;  1YHQ Q;  2NUP B;  3SD4 A;  3JRZ A;  3PFS A;  1UHC A;  2GGR A;  4RMO A;  1VQ9 A;  4M77 A;  1TUG B;  3I9Q A;  1PG5 B;  2HSP A;  2EAY A;  2E4H A;  3PVQ A;  3CD6 T;  1W2B A;  3GNF B;  4ZTF A;  3DB4 A;  5GAN h;  1YJ9 A;  3ULR B;  2NUP A;  4FYX B;  4M7D G;  4HCK A;  2LRQ A;  3LLR A;  1FMV A;  3DLL A;  1TTH B;  1VQ5 A;  2GF7 A;  2DA9 A;  3OYA A;  2Y4Y A;  3CCE A;  1KD1 C;  4EMH A;  3CCJ T;  4M7D B;  2MWO A;  3GNG A;  3JCM e;  3MEU A;  2MWP A;  1G83 A;  1GXI E;  2MPX C;  2NLU A;  1PCX A;  2HKQ B;  3PMI A;  2KXC A;  3VS7 A;  1K8A C;  4CC7 A;  1G3S A;  4C92 F;  1NJI U;  3M58 A;  4L59 A;  4M7D A;  3CXC P;  3M54 A;  3CPW P;  2A0F B;  4YTL A;  2P0K A;  1IGQ A;  4KT0 E;  4QVD A;  2GQV A;  2IVW A;  3HFN A;  5GMK l;  3NTI A;  2ROT A;  2DPP B;  2V1R A;  2QTX A;  2KYB A;  2O01 E;  1FMK A;  1NG2 A;  4DOV A;  2BTT A;  2P0P A;  1RAD B;  1W70 A;  1JU5 C;  3CCR Q;  1Y0M A;  4IUR A;  2O88 A;  1MND A;  4IIM A;  3CCJ A;  1MV3 A;  2EJ9 A;  1M2V B;  1YI2 T;  5GAM f;  4D8K A;  1M1K U;  1LOJ A;  2QAZ A;  2XKO C;  4C92 G;  3QUI A;  1I4K 1;  1U3O A;  3QYG B;  3RER A;  1QVF S;  3OYY A;  2F69 A;  3DB3 A;  1G8X A;  2DL4 A;  2RA2 A;  2EIF A;  1QKX A;  1M2V A;  3VRZ A;  3CCQ A;  1C0M A;  2I0N A;  4M77 C;  4C92 B;  1U06 A;  4LXC A;  3QWX X;  1VQ4 T;  3GBQ A;  2YDL A;  1AT1 B;  3QPH A;  4KUD K;  2EFI A;  2QQR A;  3G4S Q;  1YIJ Q;  1AZG B;  2FO0 A;  2ESW A;  5IHN A;  4A4H A;  2JT4 A;  4KGX B;  1MMA A;  2R5A A;  4C92 A;  3CCV A;  2OTJ Q;  1AZE A;  1PC0 A;  4A4F A;  1WI7 A;  3I55 T;  5CKF A;  1XQH A;  3AT1 B;  4F7U F;  2LJ3 A;  1S72 Q;  3JB9 J;  2L3S A;  1M5Q 1;  3CCM Q;  2E64 A;  4Y91 A;  1N9R A;  4J6Y A;  3E2U A;  3RNJ A;  2AT1 B;  4XTY A;  2QDL A;  1Q86 U;  5KYU B;  2DKG A;  4RTZ A;  1IGU A;  4M7D C;  4C5G A;  1BI2 A;  1UUE A;  1VIF A;  1VQ4 A;  2H8H A;  4X9C A;  1FX7 A;  1OX8 A;  1K1Z A;  4ME7 A;  2R57 A;  1KC8 U;  2LTO A;  2L3P A;  2AZV A;  3S3O A;  3I55 A;  3PIP A;  4F7U G;  1WXT A;  1JO8 A;  2HZY A;  3CEY A;  5LJ5 j;  4E7I A;  2GCX A;  5GMK e;  4J6W A;  1YJN Q;  1H64 1;  3X28 B;  1VA7 A;  4F7U B;  1VYT A;  2E6Z A;  1VQO Q;  3I56 T;  2BZ8 A;  2KSS A;  1X43 A;  3LWH A;  1MHN A;  1BI3 A;  2ZPI B;  4F7U A;  2YUP A;  2VVK A;  1VQL Q;  4RCC A;  1LCK A;  3M0S A;  4C92 C;  3CCU T;  2P84 A;  2DFU A;  3A98 A;  3OY9 A;  1G5V A;  4QQG A;  3FJP A;  3V7C A;  1ZSZ B;  4BAC A;  3THK A;  1K73 C;  4J9F A;  4M77 E;  3QBY A;  1R0B G;  1BI1 A;  4FM4 B;  4TVR A;  3UA6 A;  3OSS C;  3I56 A;  1VQN T;  1U5S A;  1ZSZ A;  1ZUK A;  2AK5 A;  1YJ9 Q;  2CUB A;  4E7H A;  2EQU A;  3PNW C;  2V8J A;  1RI9 A;  1JQQ A;  4PJO D;  3M56 A;  2PVD B;  2BUD A;  2QAS A;  2VXE A;  3CCE Q;  1G3W A;  3VU3 C;  2QDY B;  4J8O A;  4OP0 A;  4RTW A;  3CCU A;  4A63 B;  1KQS S;  2KY9 A;  2K5I A;  1BCM A;  2ATC B;  3I5R A;  2MYS A;  3HRT A;  1UGQ B;  2GTO A;  2YLC A;  2DEU A;  1SRL A;  3VYG A;  4M7D E;  4ZGE B;  1Q7Y C;  2YSQ A;  1VQN A;  3J7A F;  3EGX B;  1SSH A;  3MEV A;  1Q81 R;  2CP2 A;  2CH4 A;  3CPF A;  4PNO A;  3TSW A;  4PLI A;  3VUB A;  2E5Q A;  1ZSG A;  1UE9 A;  3VKI A;  2DYB A;  3H0I A;  2SRC A;  3RUX A;  5CQX A;  2RHI A;  3EGX A;  4JZ3 A;  4C8Q D;  2EW3 A;  1NYG A;  1BBZ A;  3TRE A;  2EGA A;  3EFR A;  1M90 R;  5GAN 3;  4QQ6 A;  2DET A;  8ATC B;  4ZN3 A;  2RMO A;  2JTF A;  1VYV A;  2BE7 D;  3CCQ Q;  3PGG A;  1HJD A;  4E7K A;  3CMA Q;  1PKS A;  4JRI A;  2LCC A;  3OBW A;  2EQM A;  1Q95 G;  3CC4 T;  2COY A;  2B86 A;  3OYI A;  1N9S A;  2DD4 A;  3LWI A;  4KUI A;  1RLP C;  4ELZ C;  3OMC A;  4C92 E;  4JRP A;  5J26 A;  5LJ5 g;  3CCV Q;  2BE9 B;  5GAN e;  5HK3 A;  4JRQ A;  4J6X A;  4Y92 A;  5IXF A;  2RHU A;  3LX7 A;  1AHJ B;  5I11 A;  5KYW B;  2R58 A;  1MV0 B;  5FU6 B;  2CRE A;  1UEC A;  1W2B S;  2LQN A;  4N4I A;  1G2B A;  3JCM b;  4JJC A;  4M7A D;  2ZPF B;  2DNU A;  5KYW A;  3PVL A;  4AG2 C;  3GLX A;  4OGC A;  1QCN A;  2QEX T;  1VQ4 Q;  2PQW A;  2HL3 A;  4M75 D;  4X9D A;  3NFC A;  4FSX A;  5LJ3 d;  1VQ7 T;  4OMN A;  3CC4 A;  8AT1 B;  2MOX A;  1ZLM A;  4HKE A;  3FEO A;  2XDD A;  1K9A A;  4BY6 B;  2F2V A;  3O5Z A;  5LJ5 f;  5L23 A;  3TQ7 P;  3RKX A;  2E6N A;  1X69 A;  3GP8 A;  3OBY A;  2DX1 A;  3I55 Q;  2ED0 A;  3GIB A;  3JCM P;  5GAO p;  2LT1 A;  2WSE E;  3BE3 A;  4LD6 A;  5IAY A;  4B9W A;  7AT1 B;  2D8H A;  2K4Y A;  3JCM f;  3CBO A;  4R0K A;  1PKT A;  2DJQ A;  3UPU A;  5GAM j;  2LX9 A;  1VQP T;  3MP1 A;  3NHN A;  1YCS B;  2X4X A;  2K79 A;  2CYZ B;  2DL3 A;  1WZO A;  2QEX A;  2DF6 A;  4HT8 A;  3A5Z B;  5HKC A;  1KD1 R;  4BB7 A;  1VQ7 A;  4F7U E;  3M0R A;  4DBR A;  1M8M A;  1X2Q A;  2KRO A;  2QYZ A;  2KT1 A;  3NMZ C;  3CPW A;  1RAI B;  5HK0 A;  3RDV A;  2RPN A;  1U1S A;  4PJO F;  3M55 A;  1K8A R;  2KVQ G;  2CZ7 B;  3BY7 A;  2K3B A;  4M78 F;  4NOY A;  1QWE A;  3HHT B;  4XTW A;  2RQT A;  3EHQ A;  2Y4X A;  2GQI A;  4HCC A;  4FW1 A;  2FVU A;  3TU4 K;  4ZGJ B;  2DIQ A;  1VQK T;  2DO3 A;  2IG0 A;  2XDB A;  1HSQ A;  1KQ2 A;  2YRC A;  1V29 B;  1XJW B;  2K3Y A;  1JJ2 S;  4LDY A;  1JBM A;  5D6W A;  2ENM A;  2VYT A;  1Q82 R;  3G7Z A;  3I56 Q;  5C6S A;  1NLO C;  2JS0 A;  1TH7 A;  2COZ A;  1NEB A;  5FU6 C;  4RKU E;  1WXU A;  2EJG A;  1W4S A;  2DXU A;  3OW2 S;  4BE1 A;  1RAH B;  4PJO G;  2CP0 A;  2OTL A;  3ME9 A;  1YN8 A;  1ZUY A;  3MP6 A;  1UFF A;  4C0F A;  1C1A A;  2HCK A;  1SG5 A;  4C8Q F;  3CCU Q;  3JAM E;  2KK4 A;  3SHW A;  1I81 A;  1I0C A;  4PJO B;  2KXD A;  3QZ5 B;  4F17 A;  3OS5 A;  1C6V X;  2M16 A;  2W0Z A;  4M78 B;  2V1Q A;  1FMW A;  1M90 U;  4IUT A;  2QA4 T;  4DBH A;  1WHL A;  3VS4 A;  5GAN 2;  1YJW Q;  2NYS A;  4PJO A;  2C06 A;  2FB7 A;  1VQN Q;  3MO8 A;  4XK8 E;  2YUO A;  1QVG S;  1KFZ A;  4M78 A;  1JXM A;  2PVG B;  1WA7 A;  5CQY A;  3C94 A;  1OU8 A;  3CC2 Q;  2C0O A;  2JN0 A;  2L3Q A;  2MCN A;  3EGU A;  5LJ3 e;  4WF2 A;  2FPF A;  1OPL A;  3CQT A;  4FW2 A;  4C8Q G;  2P0Q A;  1N5Z A;  3NTH A;  2DLP A;  2YRV A;  3FB9 A;  1ZQ1 A;  1VQ8 Q;  3G6E T;  5CAI A;  1SHG A;  2K3X A;  1IRX A;  1QP2 A;  1AWX A;  3VYH B;  3RES A;  3V7S A;  4C8Q B;  1X2K A;  2HNI A;  1UG1 A;  4LN2 A;  2EYW A;  4FT4 A;  3L2W A;  1W6X A;  2IPO B;  2DTI A;  3L42 A;  2QA4 A;  3DKM A;  2MI6 A;  1XOV A;  2L5Q A;  1YNZ A;  5CIU A;  5IHK A;  1H92 A;  3I5S A;  1A0N B;  2E5K A;  1NPP A;  2CS7 A;  2DK3 A;  4C8Q A;  4M75 F;  2K6D A;  1PM3 A;  3OYG A;  3P8H A;  2HQX A;  2X3W D;  4FYV B;  1WQ7 A;  4XTX A;  3ASK A;  3CME T;  4HVW A;  1YP5 A;  4DEY A;  4LDU A;  3JCM X;  1OEB A;  2O9S A;  1SF9 A;  2EQK A;  2F5K A;  5GMK i;  4QVC A;  1AEY A;  4XTV A;  1QWF A;  4ESR A;  3L2V A;  3X25 B;  4OMP A;  3R6N A;  1NJI C;  1TXQ A;  5KE3 A;  3CBM A;  5GAM g;  1GL5 A;  1E7O A;  2CH4 W;  1M4Z A;  5FU7 B;  1FYN A;  4M7A G;  2LQ8 A;  2COW A;  3ZFJ A;  2YWW A;  1XTD A;  4KRT A;  1T0H A;  3CD6 A;  3CBP A;  2KI7 A;  3O8V A;  4M75 G;  2FPE A;  4PJO C;  4M7A B;  1AWJ A;  4QVZ A;  2DIL A;  1BCO A;  3CC4 Q;  1KD1 U;  4MZP A;  4M78 C;  2VWF A;  1VQ6 T;  2MIO A;  1Q82 C;  2E41 A;  2GNC A;  4M75 B;  3CME A;  1ZBX A;  2YUN A;  1VQM T;  5IT9 E;  5DM7 R;  1M1K C;  1K8A U;  2P4R A;  4HVV A;  4M7A A;  1K73 R;  3AHU A;  4RTT A;  3LH0 A;  3JB9 I;  4L5G A;  2E70 A;  2M9U A;  2MF2 A;  2X4W A;  3M4Y A;  2O4X B;  4M75 A;  3A8L B;  1BI0 A;  2J05 A;  4R55 A;  2I2L A;  3L2U A;  2NUT B;  1M3C A;  3OSV A;  4CI0 C;  5GAO m;  4BD3 A;  1N6A A;  2M51 A;  1B07 A;  4RTU A;  1KQS P;  5I2M A;  4M4Z A;  3EG0 A;  5AT1 B;  1VQ7 Q;  1VOM A;  2JOY A;  2NUT A;  2EYY A;  5D6X A;  4BE0 A;  4C8Q C;  1VQ6 A;  2RI5 A;  3MJX A;  2DTH A;  3KUF A;  1VQM A;  1B3Q A;  4XQ3 A;  1ZA1 B;  4JS5 A;  2V26 A;  2ED1 A;  3C4S A;  4J5Y A;  3RMS A;  2RQW A;  4XU2 A;  2FZK B;  1UDL A;  3GPL A;  2LX7 A;  1YI2 A;  2YHT A;  1Q7Y R;  3X20 B;  3LW5 E;  1WXB A;  1OPK A;  1TWB A;  5GAM d;  1KQ1 A;  2JXB A;  1NYF A;  3EG2 A;  4JJN K;  3HPW A;  1M3A A;  2XIC A;  1M1F A;  2VXF A;  3EFO B;  2DE0 X;  2EPD A;  2ZAE A;  3H8Z A;  1XNI A;  2LJ1 A;  4B6M A;  1IB8 A;  2C0I A;  1D1A A;  4A4E A;  4RTY A;  3S3M A;  2XHC A;  1QCO A;  3VS5 A;  5KYU A;  1GBR A;  2DXC A;  3UA7 A;  2OTL Q;  4OF1 A;  5GJV B;  5J39 A;  2E3I A;  3VS0 A;  5J3B A;  1M27 C;  2NUZ A;  2K5L A;  2LCL A;  4PK4 A;  1IZ6 A;  3P8B B;  3NPF A;  1BK2 A;  3JCM V;  2YT6 A;  1Y57 A;  5GAN f;  3A8O B;  1OI1 A;  4NL2 A;  3M9Q A;  4OB3 B;  2IIM A;  4M75 C;  4N0A A;  1MUZ A;  2CP3 A;  4PFP A;  4BDZ A;  1D0X A;  2HQE A;  3OYC A;  1KHC A;  4LNP A;  4LD9 K;  2CSI A;  2RJC A;  3FRN A;  5LJ3 h;  4M78 E;  2KBT A;  4E7Z A;  3OYN A;  3M0T A;  1JEG A;  1O75 A;  1W2B P;  1KIK A;  4X34 A;  1ZHI A;  3HRU A;  2OI3 A;  4J83 A;  1NLP C;  1ZBJ A;  1VYU A;  3FIF A;  2HL5 C;  4OMO A;  1GFD A;  1UGS B;  1YIT T;  4XTU A;  3RKY A;  2H3E B;  2A37 A;  2QA4 Q;  4DOW A;  2FRY A;  3BDU A;  1VQ9 Q;  1AWO A;  4AMC A;  3E19 A;  1TUD A;  3G71 T;  3REA B;  3C12 A;  5CR2 A;  4E7L A;  1K9M C;  1EZZ B;  3RKW A;  2RJD A;  4PJJ A;  2JNG A;  2D0N A;  2LNH B;  4C8Q E;  4IUP A;  3KXT A;  3TSZ A;  1TSF A;  5DLO A;  5GMK m;  3QZ9 B;  2QG9 B;  3U23 A;  1U8R A;  4JZ4 A;  1D1C A;  1VQ5 Q;  1UJ0 A;  4VUB A;  4DA4 A;  2C0T A;  2B8A A;  1SKU B;  2FPD A;  3TEE A;  1UHF A;  1PSF A;  1Z9Z A;  2CT4 A;  1NPR A;  1YCY A;  1HD3 A;  2DXB A;  5EG2 A;  4PJM A;  2MMP A;  5IH2 A;  4C5H A;  4A4G A;  3G71 A;  1X6G A;  3H9N A;  1RI0 A;  5GAN 6;  3CD6 Q;  3MCA B;  4QKU A;  3JB9 D;  2QGG A;  4Z8A A;  2CZ0 B;  2XU8 A;  1TG0 A;  3H0H A;  2L89 A;  1JJ2 P;  2FEI A;  1UEB A;  1YHQ T;  3L2Z A;  4E7S A;  2DRM A;  3CME Q;  1T0J A;  1OQK A;  3MEW A;  1AD5 A;  4AFS C;  5L8R E;  2VKN A;  3CCJ Q;  5FRM A;  4Q5W A;  2HBP A;  1H3H A;  2RQR A;  1Q7Y U;  4NS5 A;  4E2F B;  2RI2 A;  2AHJ B;  2FZC B;  3NGP A;  3EG9 B;  4MDX A;  3OW2 P;  2EKH A;  1GCQ A;  1KK7 A;  3G1J A;  4M77 D;  1NZ9 A;  3OB9 A;  2LQK A;  4JPB W;  1D1B A;  2NWM A;  3VRY A;  4WCI A;  4BUG A;  5CO7 A;  4IUQ A;  4OMQ A;  1LVK A;  1OZ3 A;  3MP8 A;  3EG9 A;  2FYK A;  3MET A;  2LQW A;  4R56 A;  2YRD A;  5GMK j;  5CCA A;  3CCL T;  1ZSZ C;  4MMK A;  1SHF A;  1VQ6 Q;  1KSW A;  2DTO A;  1YHQ A;  2P4T A;  4J9G A;  5GAO r;  2K2M A;  1VQM Q;  5LL6 S;  1R0C B;  4OMM A;  5A2Q E;  4OMF B;  2GFU A;  1QVG P;  1M3B A;  3VS6 A;  1E6G A;  3RBB B;  1VIE A;  1WPY A;  1YI2 Q;  2PUK B;  1D3B B;  2JJ9 A;  3MHX A;  2BZX A;  4BI8 B;  4RTX A;  3JCM g;  4JJB A;  2EKO A;  4KH0 B;  2RM4 A;  3SDZ A;  4FYW B;  3CCR T;  2LJ0 A;  2XMF A;  3VS2 A;  1DJ7 B;  2SEM A;  1PSE A;  1D3B A;  1BIA A;  2DM1 A;  5HCK A;  1Y7X A;  1PD0 A;  1CKB A;  3EG1 A;  3CCL A;  3HL8 A;  1MGQ A;  4XU0 A;  3V7R A;  4EPC A;  3OS1 A;  1FWZ A;  2ZPE B;  1B7T A;  4OGE A;  1N8R C;  3JCM J;  4RTV A;  3FLG A;  2FL7 A;  2DZ9 A;  3LYI A;  5IXB A;  5D7U A;  2CT3 A;  1QW1 A;  2DVJ A;  3TCJ A;  4E7J A;  1EFN A;  2LC4 A;  2M0O A;  3JB9 H;  4D6W A;  1YIJ T;  1UB4 A;  5KE2 A;  3UF4 A;  2F5T X;  3URG A;  1GCQ C;  2D9T A;  2OTJ T;  1U1T A;  3HTR A;  2CKK A;  2HQH A;  2RN8 A;  2A36 A;  2EJF A;  5DLQ E;  1S72 T;  2ZPH B;  4V2S A;  2QQS A;  1KG1 A;  2L3R A;  3M5A A;  3CCM T;  1WIE A;  3CXC A;  2JMC A;  1NJI R;  4C92 D;  2VB6 A;  3A8H B;  3QHS A;  1WDX A;  1QCF A;  2PNI A;  4LDW A;  1SSF A;  4Z89 A;  2PVO B;  3QJY A;  5I2S A;  5LJ5 d;  3OYM A;  1WHM A;  1YBY A;  2ECZ A;  4F04 B;  2KRN A;  3OYB A;  2OAU A;  2J7I A;  3QDF A;  2KRM A;  3RIR A;  4CRI A;  4UC4 A;  2KDS A;  3JCM d;  2E12 A;  3VUZ A;  4FL6 A;  2OTJ A;  1QP3 A;  1VQP A;  4E47 A;  1OYX A;  4OB0 B;  1MNE A;  2QGF B;  4FCY A;  1M1K R;  1Q81 U;  1S72 A;  1I5L A;  3GF5 A;  2EWN A;  1TOV A;  3FDR A;  4HT9 A;  4IUV A;  3CCM A;  3QKJ A;  2O9V A;  3ZBD A;  3J81 E;  1QVF P;  3H6Z A;  4GLM A;  1QQJ A;  1AVZ C;  1BIB A;  2M1H A;  4J9I A;  1VQO T;  3RMQ A;  2L8D A;  5D6Y A;  4RG2 A;  1WNL A;  1PRL C;  5GAM h;  3X26 B;  1I8F A;  3REB B;  3M4G A;  1VQK A;  2ZPB B;  1K4U S;  4BY6 C;  1PHT A;  4F16 A;  1PWT A;  2PUO B;  4L6V 5;  2F2W A;  1I07 A;  2KGT A;  5GAN j;  3EG3 A;  2RD1 A;  3G71 Q;  3F70 A;  4CC3 A;  1LJO A;  2YUQ A;  4DQ2 A;  3JV3 A;  2F1L A;  3SB2 A;  2XDP A;  1SEM A;  1T3L A;  3SWN B;  2XK0 A;  1WJS A;  3R6O A;  2CP5 A;  4DBF A;  3ER0 A;  2GFA A;  1VQO A;  3BDL A;  2E65 A;  2OX7 A;  2JW4 A;  3H0F A;  4A54 A;  1R8O B;  4II1 A;  4JJD A;  2HBW A;  3A8G B;  2PTK A;  3SWN A;  4KH1 B;  2X4J A;  3BW1 A;  3E9G A;  4RCB A;  2QQB A;  4M7A F;  1MMN A;  1YWO A;  5AYF A;  3MPU B;  2E1H A;  2MAM A;  4AFU C;  3M0U A;  3GOX A;  2GBQ A;  3OYE A;  4OB2 B;  2YLB A;  1KJW A;  1ZUU A;  4WTO B;  4XU1 A;  1X75 C;  4XAX B;  4O6J A;  3LH5 A;  1IXD A;  2QI2 A;  1OV3 A;  2CDT A;  2LDM A;  3I35 A;  5GAN 7;  2FHD A;  2L2P A;  4Z02 A;  3PIO A;  4DBQ A;  3G6E A;  2A3L A;  2D6F A;  5LJ5 e;  2X35 A;  2D1X A;  3SEM A;  1SRM A;  3QII A;  2D8J A;  1LPL A;  2ROL A;  4DEX A;  3E9F A;  1KHI A;  1LNX A;  3M57 A;  5FWC A;  1S1N A;  4FSS A;  2RO0 A;  2J06 A;  2V8K A;  2EBP A;  2JS2 A;  3CCL Q;  5DY9 A;  2KE9 A;  4QT7 A;  3PT9 A;  2DER A;  1NEG A;  1RAG B;  9ATC B;  1ABO A;  3CCQ T;  4FT2 A;  4RG8 A;  2K2V A;  5KYN A;  1GBQ A;  3CMA T;  2RJE A;  4X1V A;  1IO6 A;  1Y96 B;  3V8K A;  1CSK A;  3M0Q A;  1K9M R;  3QWY A;  3TVT A;  3SWN C;  5A0D A;  2BIV A;  1ZX6 A;  3OS0 A;  3QSU A;  1M8V A;  3CCV T;  1X6B A;  1B34 B;  1BYM A;  2RQV A;  1UGP B;  3T9N A;  1Q82 U;  1Y96 A;  4P5N A;  2O4X A;  2QEX Q;  3QYH B;  5GAN 5;  1X6O A;  1GRI A;  2OJ2 A;  3N5B B;  2RJF A;  3EH1 A;  1WYX A;  1SPK A;  4PKC C;  5M9O A;  1B34 A;  1RLQ C;  1N27 A;  2GTJ A;  3P8D A;  4EIK A;  2HD0 A;  1PD1 A;  3SFM A;  3CCS T;  3H41 A;  2M0Y A;  1GCP A;  2DVE A;  2DBK A;  1AWW A;  1JJ2 A;  4MZT A;  3CMA A;  2XID A;  4HXJ A;  1TS9 A;  3FC3 A;  5GAN g;  2EYQ A;  1Q86 C;  2W10 A;  4B9X A;  1V1C A;  1IHV A;  2VV5 A;  1WHG A;  3IQL A;  3OYH A;  4D8D A;  5LJ3 j;  5KCH A;  4HCZ A;  4AFZ C;  2CZ6 B;  4JLI A;  4JS4 A;  1VQP Q;  2X51 A;  3OYF A;  2DYI A;  3OW2 A;  3UT1 A;  3Q1J A;  3V8J A;  1KC8 C;  2DIG A;  1G3T A;  2QTV A;  1X01 A;  1V76 A;  4OVA A;  5A0L A;  4NL3 A;  4XU3 A;  5FU7 C;  1M30 A;  1NBE B;  3EFO A;  2RB6 A;  1BB9 A;  1NM7 A;  2G3R A;  4ELY C;  3CCS A;  3HP9 A;  3QO3 A;  3VJP A;  4RUG A;  2XG8 D;  4ANJ A;  3EGD B;  3QDR B;  3QJ6 A;  2KYM A;  4MML A;  4BE2 A;  1K76 A;  4C5E A;  4OML A;  4M7A C;  3OA6 A;  3S6W A;  1RAA B;  2CZ1 B;  1VQK Q;  1RAF B;  2BKD N;  1UJY A;  4LUD A;  1QVG A;  1ARK A;  5GAN 4;  1FXX A;  4PLL A;  2A7Y A;  1WJR A;  1JB0 E;  4O5V A;  4JDS A;  2FG0 A;  3EGD A;  4JUV A;  4PJO E;  4K11 A;  3MKD A;  1QVP A;  1AOJ A;  4IIO A;  2RK2 A;  2QXF A;  2L0A A;  4E6R A;  2EYZ A;  2ZGW A;  5GAO n;  2LCS A;  1K0S A;  1D09 B;  2D0Q B;  5CKD A;  2MK5 A;  2AKL A;  4FIB A;  2JTE A;  4CC4 B;  3EFS A;  2Z0W A;  2RNA A;  2K5F A;  5KCO A;  2DMO A;  1HXD A;  2E3H A;  1WX6 A;  3A1P A;  4GLK A;  4HVU A;  5ECA A;  2KQW A;  5FRO A;  1RUW A;  5GAN d;  4J9H A;  3PTA A;  4F14 A;  2KMT A;  2KT8 A;  1NE8 A;  3KFV A;  3BFM A;  2A28 A;  1N8R R;  3CC7 T;  3CXC S;  3EAE A;  4N4H A;  2X3X D;  3CPW S;  4GY5 A;  1MMD A;  2EQJ A;  6AT1 B;  2JUF A;  5CKH A;  5GAN 8;  1CKA A;  3KBG A;  1RAC B;  4IKF A;  2JVV A;  1RAE B;  2ZCF B;  2J6O A;  3JCM c;  5LJ5 h;  2OAW A;  1UTI A;  1YJW T;  3VS1 A;  1X27 A;  3OYL A;  5KYY B;  4ATO A;  1K73 U;  5FRN A;  3G6E Q;  1MMG A;  4C0G A;  2FRW A; 
#chains in the Genus database with same CATH homology
 1YIT A;  3CC2 T;  4C8Q G;  1K9M U;  1QW1 A;  3JCM h;  2P0Q A;  2R5A A;  3TCJ A;  4C92 A;  3NTH A;  4E7J A;  2LC4 A;  2YRV A;  3CCV A;  2M0O A;  3JB9 H;  3FB9 A;  1ZQ1 A;  3G6E T;  4A4F A;  4D6W A;  1YIJ T;  1UB4 A;  3I55 T;  5KE2 A;  5CKF A;  5CAI A;  1O9S A;  1XQH A;  2K3X A;  5GAM e;  1QP2 A;  2WAC A;  2F5T X;  3URG A;  3RES A;  3VYH B;  3V7S A;  4C8Q B;  4N0A C;  4F7U F;  3CC7 A;  4M78 D;  2D9T A;  2HNI A;  3JB9 J;  4FT4 A;  3L2W A;  2OTJ T;  1U1T A;  3JCM W;  1M5Q 1;  2DTI A;  3L42 A;  2E64 A;  4Y91 A;  1N9R A;  2CKK A;  2DD5 A;  3DKM A;  4J6Y A;  2MI6 A;  4ZN1 A;  1XOV A;  4XTY A;  2EJF A;  2LNV A;  2L5Q A;  4Y28 E;  5CIU A;  5DLQ E;  4HA8 A;  2ZPH B;  1S72 T;  1Y71 A;  1Q86 U;  4V2S A;  2QQS A;  2DKG A;  1NPP A;  2CS7 A;  1KG1 A;  2DK3 A;  2L3R A;  3VV0 A;  3M5A A;  5I21 A;  3CCM T;  4C8Q A;  3CXC A;  4M75 F;  4C5G A;  4M7D C;  3OYG A;  4C92 D;  1BI2 A;  1YJW A;  1VIF A;  3A8H B;  3NTK A;  3P8H A;  1VQ4 A;  4M7A E;  1WQW A;  3QHS A;  2HQX A;  4LDW A;  1SSF A;  1WQ7 A;  4X9C A;  1FX7 A;  5LJ3 g;  4XTX A;  2PVO B;  3QJY A;  5I2S A;  3ASK A;  5LJ5 d;  3OYM A;  3CME T;  1QVF A;  4KUL A;  1YBY A;  4LDU A;  3JCM X;  3L2R A;  4ME7 A;  3CC2 A;  4M75 E;  2EQK A;  2F5K A;  2R57 A;  4QVC A;  5GMK i;  3CCQ A;  4XTV A;  2WSF E;  1KC8 U;  3L2V A;  3OYB A;  2LTO A;  3X25 B;  2OAU A;  3S3O A;  1NJI C;  4J7I A;  3L1A A;  5KE3 A;  3I55 A;  3CBM A;  3RIR A;  5GAM g;  3PIP A;  4F7U G;  4CRI A;  4UC4 A;  2KDS A;  2RI3 A;  3JCM d;  2E12 A;  5LJ5 j;  1M4Z A;  3CEY A;  5FU7 B;  3VUZ A;  4E7I A;  4FL6 A;  2GCX A;  1QP3 A;  3C95 A;  2OTJ A;  5GMK e;  1VQP A;  4J6W A;  1VQ8 A;  4M7A G;  1H64 1;  1OYX A;  2LQ8 A;  4OB0 B;  4E47 A;  3ZFJ A;  3X28 B;  4F7U B;  2VGN A;  1XTD A;  2E6Z A;  1Q81 U;  1S72 A;  1I5L A;  3GF5 A;  4C0D B;  3CD6 A;  3CBP A;  3O8V A;  2EWN A;  3FDR A;  4M75 G;  4HT9 A;  2XI9 A;  4IUV A;  4QQD A;  4C0Z A;  3CCM A;  4PJO C;  2RH2 A;  3QKJ A;  4M7A B;  3V8L A;  3HSB A;  4J7F A;  4QVZ A;  3I56 T;  3ZBD A;  3J81 E;  3OYD A;  1KD1 U;  2KSS A;  1RL2 A;  3LWH A;  3H6Z A;  4MZP A;  4M78 C;  1MHN A;  1BIB A;  3LGL A;  1VQ6 T;  1BI3 A;  2E41 A;  5LJ3 f;  1Q82 C;  2ZPI B;  2M1H A;  1OZ2 A;  4EDU A;  4F7U A;  4M75 B;  2JTM A;  5KH6 A;  1VQO T;  3CME A;  1ZBX A;  3LGF A;  2DXT A;  2L8D A;  3RMQ A;  1VQM T;  4A53 A;  5D6Y A;  5IT9 E;  5DM7 R;  4RCC A;  4RG2 A;  1M1K C;  1HK9 A;  1K8A U;  1WNL A;  4M7A A;  5GAM h;  3X26 B;  1I8F A;  3OQ5 A;  3M4G A;  3AHU A;  4M7D D;  1VQK A;  3LH0 A;  2ZPB B;  3JB9 I;  4L5G A;  3OYJ A;  2ZPG B;  2E70 A;  2M9U A;  4C92 C;  2MF2 A;  3CCU T;  2X4W A;  3M4Y A;  2O4X B;  2QQA A;  4M75 A;  4BY6 C;  4JRK A;  2PUO B;  2V8I A;  3A8L B;  4L6V 5;  3OY9 A;  1BI0 A;  1P92 A;  4R55 A;  2I2L A;  5GAN j;  2RD1 A;  3L2U A;  4MDW A;  4QQG A;  1G5V A;  3FJP A;  3V7C A;  3OSV A;  4CI0 C;  3ZEH A;  2X4Y A;  4EMK B;  3F70 A;  4BD3 A;  1N6A A;  5GAO m;  4BAC A;  2VGM A;  1K73 C;  4M77 E;  3QBY A;  1LJO A;  4FM4 B;  1BI1 A;  4DQ2 A;  4TVR A;  3SB2 A;  1Y07 A;  3E1S A;  5I2M A;  3J80 E;  2XDP A;  4ZGD B;  3QG1 A;  3OSS C;  1BKB A;  2R5M A;  3I56 A;  1VQN T;  4C5I A;  3SWN B;  2JOY A;  2XK0 A;  1WJS A;  5D6X A;  4BE0 A;  4C8Q C;  4EMK A;  3R6O A;  1VQ6 A;  5CK9 A;  4E7H A;  3ER0 A;  2RI5 A;  2DTH A;  2GFA A;  2EQU A;  1VQO A;  3KUF A;  3PNW C;  2V8J A;  3BDL A;  1VQM A;  2E65 A;  4XQ3 A;  4A54 A;  4FU6 A;  2HAX A;  4JS5 A;  1R8O B;  4II1 A;  3C4S A;  4LDX A;  3G4S T;  4J5Y A;  3RMS A;  4PJO D;  3M56 A;  3A8G B;  2PVD B;  4XU2 A;  2BUD A;  3SWN A;  2VXE A;  3GPL A;  1G3W A;  3VU3 C;  1YI2 A;  2QDY B;  2YHT A;  3A8M B;  4J8O A;  3X20 B;  4OP0 A;  4IUU A;  5GMK h;  3CCR A;  3LW5 E;  3CCU A;  3INZ A;  4XTZ A;  1KQS S;  2KY9 A;  2X4J A;  3JSC A;  3BW1 A;  3E9G A;  5GAM d;  1KQ1 A;  2K5I A;  1N8R U;  3PMT A;  4RCB A;  2QQB A;  4JJN K;  3HPW A;  4M7A F;  5CVI A;  3HRT A;  2ZZD A;  5AYF A;  1UGQ B;  2XIC A;  2E1H A;  2MAM A;  2YLC A;  1M1F A;  2VXF A;  3GOX A;  3OYE A;  3VYG A;  1IRE B;  2YLB A;  4OB2 B;  4M7D E;  3L2Q A;  3DLM A;  2RHX A;  4ZGE B;  1Q7Y C;  2RK1 A;  4JLG A;  5HY6 A;  4N4G A;  1WJQ A;  4OB1 B;  1X75 C;  3H8Z A;  1XNI A;  4XAX B;  4XU1 A;  3S3N A;  2XD0 A;  4O6J A;  2LVM A;  1VQN A;  2QI2 A;  3J7A F;  3CD6 T;  3MEV A;  2LDM A;  4A4E A;  3S3M A;  2XHC A;  3CPF A;  5GAN 7;  2FHD A;  4PNO A;  4PLI A;  3VUB A;  2E5Q A;  2DXC A;  5CKB A;  4Z02 A;  4OF1 A;  4QW2 A;  3HKS A;  5J39 A;  3MEA A;  3VKI A;  1JRI A;  3PIO A;  2VUB A;  5J3B A;  3G6E A;  3G4S A;  1YIJ A;  2A3L A;  2K5L A;  3RUX A;  2RHY A;  4C0D C;  2LCL A;  5LJ5 e;  2D6F A;  1IZ6 A;  3P8B B;  5CQX A;  2RHI A;  2X35 A;  3JCM V;  3JCM Q;  5GAN f;  2OTL T;  3A8O B;  4C8Q D;  1Q81 C;  1OI1 A;  3QII A;  4NL2 A;  4HCB A;  3M9Q A;  2KAF A;  4OB3 B;  3TRE A;  1VUB A;  3EFR A;  4M75 C;  4N0A A;  3JB9 F;  5GAN 3;  4QQ6 A;  4BDZ A;  3E9F A;  1KHI A;  1LNX A;  3M57 A;  4ZN3 A;  2HQE A;  5FLX E;  3OYC A;  2RO0 A;  1YJN T;  1KHC A;  2JTF A;  2V8K A;  4LD9 K;  4M7D F;  2RJC A;  1EIF A;  3FRN A;  5LJ3 h;  1KQS A;  3M59 A;  4M78 E;  1H3Z A;  4BI3 A;  3QXE B;  5GAO l;  3PGG A;  3OYN A;  5DY9 A;  3HFO A;  4E7K A;  1O75 A;  3PT9 A;  4JRI A;  2DZC A;  2LCC A;  2EQM A;  3OBW A;  5GAO q;  4X34 A;  1M90 C;  2DJZ A;  3CC4 T;  3OYI A;  1UGR B;  1ZHI A;  4EMK C;  3CCQ T;  4FT2 A;  3HRU A;  1N9S A;  1M9S A;  2DD4 A;  3LWI A;  4KUI A;  4RG8 A;  3X24 B;  4J83 A;  2K2V A;  3OMC A;  4ELZ C;  4C92 E;  3CMA T;  4JRP A;  2RJE A;  5J26 A;  5LJ5 g;  3FIF A;  4M77 F;  1Y96 B;  3V8K A;  1VQL T;  5GAN e;  5HK3 A;  4JRQ A;  4J6X A;  1WGS A;  2RHU A;  3LX7 A;  4PL6 A;  1UGS B;  1AHJ B;  3HRS A;  3SWN C;  2K57 A;  4M78 G;  3WVD B;  5A0D A;  5A0G A;  1YIT T;  2R58 A;  4XTU A;  2BIV A;  3OS0 A;  3QSU A;  1M8V A;  3CCV T;  3RKY A;  3JB9 G;  5FU6 B;  1B34 B;  1BYM A;  1G3Y A;  1UGP B;  3T9N A;  4DOW A;  3BDU A;  1Q82 U;  5IN1 A;  3E19 A;  1Y96 A;  3WVE B;  4P5N A;  2O4X A;  3G71 T;  3QYH B;  5GAN 5;  3C12 A;  4N4I A;  5CR2 A;  4E7L A;  1X6O A;  1YJN A;  1W2B S;  1K9M C;  3RKW A;  3JCM b;  2RJD A;  3N5B B;  4M7A D;  2RJF A;  2ZPF B;  2JNG A;  4C8Q E;  4IUP A;  3KXT A;  1VQ9 T;  5DLO A;  2H3J A;  3GLX A;  4OGC A;  5GMK m;  4PKC C;  2LT4 A;  5C0M A;  5M9O A;  1M1G A;  3QZ9 B;  1B34 A;  2QEX T;  3OMG A;  1N27 A;  3OYK A;  2Y90 A;  3P8D A;  2PQW A;  2HD0 A;  5CKE A;  4M75 D;  4X9D A;  2E10 A;  1U8R A;  3SFM A;  3NFC A;  3CCS T;  4FSX A;  5LJ3 d;  1VQ7 T;  4EMG A;  3CC4 A;  2JZ2 A;  2DVE A;  1YJ9 T;  4HKE A;  4VUB A;  4DA4 A;  2DEQ A;  3FEO A;  4A4K A;  2VC8 A;  2B8A A;  2XDD A;  4BY6 B;  1JJ2 A;  4MZT A;  5LJ5 f;  4M77 G;  3CMA A;  2XID A;  3M53 A;  3FC3 A;  3UDC A;  3RKX A;  3TEE A;  5GAN g;  2E6N A;  2EYQ A;  4KBM B;  3GP8 A;  2QA4 A;  1PSF A;  1Q86 C;  4BI4 A;  1NPR A;  4B9X A;  1VQL A;  1YCY A;  2DAQ A;  2VV5 A;  3OBY A;  1VQ5 T;  2DXB A;  3OYH A;  3GIB A;  3JCM P;  5LJ3 j;  5GAO p;  2LT1 A;  2WSE E;  4LD6 A;  4BDY A;  5EG2 A;  5IAY A;  3CCE T;  3UWN A;  3WXM B;  2MMP A;  5KCH A;  4HCZ A;  4M77 B;  4B9W A;  4ZTJ A;  2CZ6 B;  2K4Y A;  2QQ9 A;  4JLI A;  4C5H A;  4A4G A;  4JS4 A;  2RHZ A;  3OS2 A;  3JCM f;  4LDV A;  3OYF A;  3CBO A;  3OW2 A;  3UT1 A;  3G71 A;  2WSC E;  1QVG A;  3Q1J A;  3UPU A;  1RI0 A;  2PU9 B;  3V8J A;  5GAN 6;  5GAM j;  2CGH A;  2DIG A;  2LX9 A;  3MCA B;  1G3T A;  4MZM A;  1KC8 C;  1X01 A;  3SD4 A;  1VQP T;  3JRZ A;  3MP1 A;  3PFS A;  4OVA A;  3JB9 D;  1VQ8 T;  5A0L A;  4RMO A;  2X4X A;  4NL3 A;  4M77 A;  4XU3 A;  1VQ9 A;  2CYZ B;  5FU7 C;  2CZ0 B;  2XU8 A;  2QEX A;  2RB6 A;  2L89 A;  2EAY A;  4HT8 A;  2G3R A;  3A5Z B;  4ELY C;  5HKC A;  4BB7 A;  3HP9 A;  3CCS A;  4F7U E;  1VQ7 A;  1UEB A;  3QO3 A;  1YHQ T;  3L2Z A;  3VJP A;  3GNF B;  2XG8 D;  1W2B A;  4ZTF A;  3DB4 A;  5GAN h;  1YJ9 A;  3MEW A;  3CPW A;  3QDR B;  3QJ6 A;  5L8R E;  4MML A;  5HK0 A;  4M7D G;  4BE2 A;  4M7A C;  4C5E A;  1U1S A;  4Q5W A;  4PJO F;  2HBP A;  3OA6 A;  2LRQ A;  3S6W A;  2CZ1 B;  3LLR A;  3M55 A;  2KVQ G;  2CZ7 B;  3BY7 A;  3DLL A;  1Q7Y U;  1VQ5 A;  2BKD N;  2GF7 A;  4NS5 A;  4M78 F;  4NOY A;  2RI2 A;  2AHJ B;  3HHT B;  1FXX A;  4XTW A;  5GAN 4;  4PLL A;  2A7Y A;  2Y4Y A;  1WJR A;  2Y4X A;  4EMH A;  3OYA A;  3CCE A;  1JB0 E;  1KD1 C;  4MDX A;  4O5V A;  4HCC A;  3CCJ T;  4M7D B;  2FVU A;  2MWO A;  3GNG A;  4JDS A;  4M77 D;  4ZGJ B;  3TU4 K;  2DIQ A;  1NZ9 A;  3JCM e;  1VQK T;  2DO3 A;  2IG0 A;  3MEU A;  4JUV A;  2MWP A;  3OB9 A;  2XDB A;  4PJO E;  1KQ2 A;  1GXI E;  2LQK A;  2NLU A;  1QVP A;  4BUG A;  1V29 B;  5CO7 A;  2RK2 A;  2QXF A;  3PMI A;  4IUQ A;  2ZGW A;  5GAO n;  2K3Y A;  1K8A C;  1G3S A;  1JJ2 S;  4LDY A;  1OZ3 A;  2D0Q B;  5CKD A;  4FIB A;  1JBM A;  5D6W A;  4C92 F;  3MP8 A;  1NJI U;  2FYK A;  2VYT A;  3M58 A;  3MET A;  4R56 A;  3G7Z A;  4L59 A;  4M7D A;  3EFS A;  5GMK j;  5C6S A;  5FRM A;  5CCA A;  3CCL T;  3M54 A;  4MMK A;  1TH7 A;  2K5F A;  5KCO A;  4YTL A;  2DTO A;  2P0K A;  1YHQ A;  2P4T A;  5FU6 C;  1HXD A;  4KT0 E;  4QVD A;  2GQV A;  2IVW A;  3HFN A;  4RKU E;  5GAO r;  2EJG A;  1W4S A;  5GMK l;  3NTI A;  5LL6 S;  2DXU A;  3OW2 S;  4BE1 A;  2DPP B;  5A2Q E;  2QTX A;  4GLK A;  4PJO G;  4OMF B;  2GFU A;  2O01 E;  2OTL A;  4DOV A;  3ME9 A;  2P0P A;  2KQW A;  3MP6 A;  5FRO A;  1VIE A;  1WPY A;  4C0F A;  2PUK B;  5GAN d;  1D3B B;  4C8Q F;  4IUR A;  3MHX A;  2KK4 A;  3JAM E;  1I81 A;  4PJO B;  3CCJ A;  3QZ5 B;  4BI8 B;  3PTA A;  3JCM g;  2KMT A;  3OS5 A;  1NE8 A;  2EKO A;  2EJ9 A;  2M16 A;  3BFM A;  4M78 B;  2RM4 A;  3SDZ A;  5GAM f;  1YI2 T;  3CC7 T;  3CXC S;  3CCR T;  3EAE A;  4IUT A;  1M90 U;  4N4H A;  1LOJ A;  1M1K U;  1DJ7 B;  4GY5 A;  3CPW S;  2XKO C;  2EQJ A;  2QA4 T;  1PSE A;  4C92 G;  2JUF A;  3QUI A;  1I4K 1;  1D3B A;  5CKH A;  5GAN 8;  1BIA A;  3QYG B;  5GAN 2;  3KBG A;  3RER A;  4PJO A;  4IKF A;  1QVF S;  2JVV A;  1Y7X A;  3OYY A;  2FB7 A;  2F69 A;  3DB3 A;  3MO8 A;  2C06 A;  4XK8 E;  3CCL A;  1QVG S;  2RA2 A;  2ZCF B;  2EIF A;  3HL8 A;  1MGQ A;  4M78 A;  4XU0 A;  3JCM c;  2PVG B;  4M77 C;  5CQY A;  3V7R A;  4C92 B;  4EPC A;  3C94 A;  1FWZ A;  5LJ5 h;  3OS1 A;  2ZPE B;  4OGE A;  1N8R C;  1YJW T;  3JCM J;  1VQ4 T;  3FLG A;  2JN0 A;  3OYL A;  2FL7 A;  4ATO A;  1K73 U;  2DZ9 A;  3QPH A;  5FRN A;  3LYI A;  4KUD K;  2EFI A;  2QQR A;  4WF2 A;  5LJ3 e;  4C0G A;  4A4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...