1PSFA

The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOSYSTEM I ACCESSORY PROTEIN E
molecule tags Photosystem i
source organism Synechococcus sp.
publication title Three-dimensional solution structure of PsaE from the cyanobacterium Synechococcus sp. strain PCC 7002, a photosystem I protein that shows structural homology with SH3 domains.
pubmed doi rcsb
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1psfA00
3QYHB 3A8GB 2QDYB 4KT0E 2WSCE 1QP3A 1PSFA 1QP2A 3QZ5B 3A8OB 3QYGB 1DJ7B 2PUOB 2ZPBB 3QZ9B 4RKUE 4ZGEB 2CZ6B 3LW5E 2ZPIB 1V29B 1UGQB 4FM4B 1UGPB 2O01E 3WVEB 3X26B 3VYGA 2DD4A 4OB2B 3HHTB 1AHJB 3WVDB 2PVGB 2DXBA 2ZPGB 2CZ1B 3X25B 2WSEE 1JB0E 2PU9B 3QXEB 3A8HB 1GXIE 2ZZDA 2ZCFB 2ZPHB 4OB1B 5L8RE 2PVDB 2PVOB 2WSFE 1PSEA 1IREB 2DXCA 2AHJB 3A8MB 2CYZB 3A8LB 2PUKB 2DD5A 4OB3B 2D0QB 2DPPB 4ZGJB 4OB0B 3VYHB 4ZGDB 2CZ7B 3X20B 1UGSB 2ZPFB 4L6V5 4Y28E 4XK8E 2ZPEB 3X28B 2CZ0B 3X24B 1UGRB
chains in the Genus database with same CATH superfamily
3CMAA 3LGLA 4J9DA 4X9CA 5CK9A 1VQ7Q 1NJIR 1M2OA 4ELYC 2MOXA 5J3BA 1X2KA 1WHHA 2G3RA 4M7AG 2RHYA 3UT1A 3M5AA 2LJ0A 3JCMQ 3MP1A 3OBYA 4M7AD 5C6SA 3EG2A 4M4ZA 3SHWA 5C0MA 4BE2A 2QGFB 1X6OA 2FB7A 2CP5A 1H92A 5GMKh 4IUPA 4MDWA 2D6FA 5CCAA 1G3YA 2D0NA 3WVDB 5LJ3h 2OTLT 2RF0A 2HBPA 3LW5E 2RQVA 3V8JA 3E1SA 1MNEA 4E7IA 2DRMA 4EMKA 2YLCA 2K2MA 1YI2A 2COWA 3JB9F 3LH0A 4N4HA 3CC2T 2DO3A 1EIFA 2A0FB 1RUWA 1WGSA 4C8QB 1GFCA 1KHIA 2EAYA 3JRZA 4LDXA 2EQIA 1N9SA 3MCAB 3CCST 2RN8A 1T0JA 2AZSA 1SPKA 3EGXB 2DEQA 2VXEA 1N9RA 3BW1A 3UDCA 6AT1B 2X9HA 1VQLQ 2CH4W 1BU1A 1OI1A 3OYEA 3OW2A 4C5GA 2M9UA 2F1LA 3QYHB 3OA6A 3G4SA 4IUQA 2GTOA 2DTOA 4XU0A 2RI5A 3JB9J 1G3SA 2X4WA 4HT8A 3X25B 2FEIA 4KH1B 2QGGA 4B6MA 5IN1A 1TWBA 2BZYA 1BCMA 4N4IA 2W0ZA 4OB3B 1RACB 1YJNA 4FU6A 3VS6A 2YXYA 1J3TA 3A8GB 4Q5WA 4QVCA 2EGEA 3BDUA 2JUFA 4ZGEB 5FROA 2HNIA 3CCRA 1UJYA 4WTOB 3CBOA 4LE9A 1AZGB 1X01A 1ZLMA 1R0CB 3JB9I 1PWTA 3WXMB 4J6WA 4DBHA 3P8BB 1OU8A 2DERA 2AHJB 2YRVA 3QZ5B 2A28A 4RTXA 3OQ5A 2YSQA 3CCEQ 3META 2BKDN 4M7DF 5GMKm 4OMQA 1AWOA 1VQLT 4KULA 4JJBA 3VS3A 4DOVA 2VUBA 2DKGA 3ME9A 2F2XA 2PVOB 4Z88A 1QWEA 3VKIA 1D3BB 1TXQA 5A2QE 1RAAB 3CPFA 1UTIA 4HCBA 2CUDA 3HFNA 1MGQA 2QK0A 2YUQA 4WF2A 4PFZA 2K5FA 2PU9B 5GAMe 2CUBA 3TCJA 4YTLA 5GAOl 4C0DC 1MUZA 2QEXQ 1QW1A 2EYYA 4CC2A 4FIBA 3G71A 2LVMA 1QVGP 5FWBA 4PFPA 2QDYB 1K73R 2EJFA 4M78B 3DKMA 2JS2A 2KXDA 1ZUUA 3T9NA 5DM7R 2FZCB 1ZSGA 4M77C 4F7UE 1QVPA 4ZTJA 4PJOB 4KBMB 2V8JA 4L6V5 2EJ9A 1XQHA 5IT9E 2K79A 2X4XA 4DQ2A 4HVUA 1VYTA 5FU6C 4PFOA 2ZPGB 3CC7A 1K0SA 2LC4A 1SHGA 5GAMf 2ZCFB 2X3XD 4LD6A 4O5VA 2KROA 4CC4B 2DAQA 3HSBA 5KE2A 1K1ZA 2F2WA 1WXTA 1TTHB 2DX1A 5HCKA 5GAMj 1VQNT 2DVJA 4CI0C 2LRQA 3OYNA 1NYFA 1W2BP 2O01E 3SWNB 4J9FA 4J9EA 2QA4Q 2RHZA 3FEOA 2AK5A 2LCCA 2DXBA 2J6KA 3VUBA 2EVRA 5LJ5h 3CCVT 1JRIA 3A8HB 4B9XA 3QWXX 1JBMA 5GAOm 3CCQA 5KYUB 1JO8A 1EZZB 3SWNC 1QKWA 3L2RA 8AT1B 1D09B 1I1JA 3M54A 2QTVA 2CP6A 4M77G 3OYFA 3PT9A 4X34A 3CXCP 4QT7A 4J8OA 2W10A 2JS0A 4EMHA 3KBGA 4MMLA 2CSQA 2B86A 5GAN5 1W2BS 5L8RE 2KNBB 2PZ1A 4C0FA 1TUDA 3H0FA 3CCJA 4OB0B 1VQKA 2MMPA 1X69A 3OYHA 3CC4Q 2KAFA 2LCLA 4JPBW 2D1XA 1K4US 3L42A 2YUPA 1KQSA 4ZN3A 4JRQA 4D8KA 1N8RU 2GQIA 4M7AE 5GAN7 3PMIA 2RMOA 4E6RA 3SDZA 3TSZA 3CCJQ 2J6FA 4J9GA 2EKHA 2WSFE 2K4YA 2F5KA 3G6EA 2DXTA 4IURA 4JRIA 3J7AF 4M7AF 2DZCA 1KJWA 4M78C 1IHWA 4KGXB 4BD3A 2M1HA 3MKDA 1D1CA 1VQ4A 3JCMh 2ECZA 4PJOE 2EYZA 2O9SA 3NPFA 5GANj 1ABOA 1SEMA 2C0IA 2QA4A 5GAOp 3CD6A 2J06A 4OF1A 1OOTA 2YLBA 1YN8A 2CZ0B 1I8FA 4J9IA 2O4XA 3PTAA 2H8HA 3I56Q 3CQTA 3RNJA 2DM1A 1W1FA 2ATCB 4J6XA 3S3OA 4OB2B 4OMLA 5CKEA 2K5LA 5L23A 4QQGA 1JB0E 2E3IA 2EGAA 2R5MA 1QMCA 4A4EA 3EFOA 2OI3A 3G6ET 3I55T 2L89A 2ENMA 1NE8A 1K8AU 2FRWA 1C6VX 2XKOC 5CKBA 1YHQA 4LUEA 4M78D 3O5ZA 3WVEB 4BI4A 1QVGS 2HAXA 1W6XA 1KQSP 4J7IA 5KE3A 3KUFA 3OS5A 3VYHB 5ECAA 3O8VA 4C8QA 1RI0A 1PSFA 1MMAA 1YJ9T 3MEVA 1R0BG 3CBMA 1AWWA 1VQ9A 1RL2A 1IRXA 2CREA 5GAMh 1V1CA 2EJGA 2BE9B 3JCMe 1B34B 3M0RA 1M2VB 4F7UF 4F14A 4C5IA 2CKKA 5I21A 3CCMA 1OZ2A 2BZ8A 4JDSA 1Q81U 1YFNA 5CKHA 5GMKe 1FMVA 3ER0A 2OJ2A 1Q95G 5GANe 1ZSZA 2YRCA 2DL7A 4MMKA 2PVGB 3OB9A 5LL6S 4XTZA 4JRPA 2LX7A 2P4TA 2CYZB 1KSWA 4XU1A 4J9HA 1G83A 4M7DG 4PNOA 2LTOA 3UPUA 5CVIA 4M75D 3KFVA 1IGUA 3J81E 4M7DB 4QKUA 2YUOA 1UB4A 1M8MA 3HHTB 3TU4K 4R0KA 3JCMg 5DY9A 2JJ9A 1NJIU 2ED0A 1YJ9Q 3H6ZA 1VQLA 3AHUA 4C92F 2DETA 4FYYB 5KCOA 3MP8A 1IZ6A 1I5LA 4IUTA 1FX7A 4BDYA 4NS5A 1QVGA 1WQ7A 4XU2A 2HSEB 4FM4B 3PVLA 4C92D 1QVFA 3E9GA 3CD6Q 2J05A 1B7TA 3VJPA 4GLMA 2WSEE 2FYKA 3MO8A 1X6GA 3CBPA 1XOVA 2JTEA 4UC4A 2MYSA 2GCXA 2DF6A 4C5EA 1JU5C 5GANg 3GBQA 4J83A 1SF9A 3RBBB 3BDLA 4X9DA 1K9AA 2RJDA 3A98A 1M3CA 2RM4A 3ASKA 2OTJA 1SSHA 4PLLA 2ZAEA 1HSQA 3KXTA 1R8OB 3GPLA 3FJPA 4OVAA 3GP8A 2LNHB 3FIFA 4C92C 2O88A 4C0DB 3VV0A 4BUGA 5LJ3f 3S3NA 2HL5C 2DL4A 1RI9A 2AT1B 2R58A 2MPXC 1LVKA 1JJ2A 1RADB 9ATCB 2KDSA 2RQUA 2EYQA 2HD0A 1U8RA 2K3BA 3OYAA 2Y4XA 2K9GA 3LX7A 3SB2A 3OY9A 4OGEA 2YT6A 1F1BB 4Y91A 2DEUA 3I55A 1WNLA 1KC8R 3TQ7P 1OX9A 2JZ2A 2HZYA 1WHJA 4N0AA 3PMTA 5GMKi 2DIGA 2PNIA 4GBQA 5GANd 2KRSA 4ORZA 3C4SA 4C92B 4M7AA 3E9FA 3VS0A 1QCFA 2CP2A 4M7DE 3E2UA 3I5RA 5LJ3e 3JCMJ 3UA6A 1C0MA 3M56A 2NYSA 1QP2A 4HKEA 4RKUE 2BUDA 1YIJA 1UE9A 4BDZA 2D8HA 1G5VA 4ESRA 1OU9A 3M0UA 4M7AC 2JOYA 4M7DA 3U23A 2RB6A 2J7IA 2RH2A 4JJCA 2LCSA 4IKFA 1Q82U 2M0YA 5CAIA 1PSEA 3CCQQ 1KD1R 4MZMA 1Q81R 3CCUQ 2E5KA 2OAUA 4FYXB 4DEYA 3OMCA 1PM3A 3CMAQ 1V29B 2ESWA 2OX7A 1M30A 4XTVA 3INZA 2DBKA 4JUVA 3MEUA 1YHQT 2LT4A 2VV5A 4ANJA 1NG2A 3LLRA 2P0QA 4PJOG 2AIRB 1JQQA 3ULRB 3QBYA 2YUNA 1VQNQ 1GL5A 1UFFA 3N5BB 2DA9A 3H0IA 4JZ3A 4C92A 1Q82R 1VQMA 1QP3A 3C0CA 4HCZA 1BCOA 4EMKC 2KT8A 5A0GA 3G71Q 5KYYB 1CKBA 2L5QA 4GLKA 4M7DD 2K6DA 2EPDA 2FL7A 2DIQA 4JS4A 2J6OA 1VQ7A 3M58A 2A08A 1VIFA 3P8HA 4C8QC 4A4HA 3CCQT 1TH7A 2HL3A 1T0HA 4XTYA 2JVVA 3UF4A 2RNAA 1VA7A 3EGDA 1OPLA 3VS5A 1S72T 1M1KU 1KG1A 5IHKA 7AT1B 4C92G 1YIJT 2LQWA 3EG9A 5FWCA 4C0ZA 3CXCA 3ZL7C 4EIKA 4OMNA 4F7UA 3CPWS 4CRIA 4C8QE 1NPPA 3GOXA 1HYOA 1GCPA 3CCLQ 4N0AC 2EWNA 4PJOC 3LGFA 5GAN4 3IQLA 4E7KA 3NTIA 1ZX6A 1QCOA 1VQ6T 2ROTA 2KRNA 3BFMA 4PJJA 3BE3A 2CP3A 3URGA 1WQWA 3JB9G 1M90U 1NEBA 2D9TA 3JAME 5EG2A 4CC3A 5HKCA 1YJWA 3RR6A 3OS0A 2YWWA 1U5SA 4BE1A 1M1GA 1M8VA 1BIAA 3EFSA 2ZPHB 4F7UB 2DILA 4OB1B 4P5NA 1WX6A 5KYWB 4ZGJB 2GFUA 4HCKA 2L3PA 1KK7A 1UUEA 2XU8A 1U1SA 2V1RA 1GRIA 4ATOA 5FU6B 2DMOA 2JW4A 2LQNA 4LUDA 4XTUA 3PE0A 2A36A 5GAN8 2FZGB 3OYGA 2QA4T 2NUTA 1YP5A 4PLIA 3SEMA 2DL3A 3A8OB 2QAZA 4QVZA 4XQ3A 1YHQQ 2GFAA 4EDUA 4HA8A 1GCQC 5D7UA 1U1TA 1FWZA 2EW3A 1VQPA 1ZSZB 2P0PA 3OMGA 1WHKA 4FW1A 4LDWA 2JM9A 3EG3A 3C95A 2H3JA 2LQKA 3RKXA 3V7RA 3MHXA 4V2SA 1VQOQ 1M2VA 2AZVA 1VYVA 2E65A 2XDDA 3OYJA 3FB9A 2HBWA 1CSKA 1M27C 5GAOn 1LOJA 1T3SA 3PGGA 2FZKB 4HT9A 2LX9A 4FT2A 1VQPT 1TUGB 4RTTA 2RJFA 4X1VA 2KI7A 1VQ8T 3FC3A 2EGCA 1E6GA 3QPHA 1Q7YU 3CCRT 1X2QA 2EBPA 3CMEQ 3CCMQ 1X27A 2RJCA 4N4GA 4C8QG 3OS1A 4L5GA 1NBEB 2M16A 3CCRQ 2JMCA 1WI7A 4M78E 3FDRA 4J6YA 1OPKA 1B07A 1W70A 1G3TA 1VQ8A 3OW2P 4LD9K 1HXDA 2E4HA 4J5YA 2CP7A 2QG9B 1D3BA 4OMPA 1M4ZA 2HQXA 3CCVA 4XU3A 1BIBA 2V8IA 4FW2A 2EYWA 2XK0A 4AT1B 3QSUA 1RAEB 4RTYA 1GBQA 2O4XB 2HKQB 1Y07A 4RTZA 1JXMA 3HRSA 2LZ6B 2B8AA 5GAOq 2KXCA 2PUKB 3VS7A 1Y96B 4JZ4A 3G1JA 2QXFA 1PRLC 4KUDK 1HK9A 1M1KC 1BI1A 3CCSA 2COZA 1K73C 3OYLA 2EIFA 2HSPA 4JLGA 2VGNA 4GY5A 2XIDA 3ZBDA 3GNFB 5IHNA 1LCKA 1U3OA 1A0NB 1GXIE 3C12A 5D6XA 2V8KA 1O9SA 1GFDA 1BKBA 3GNGA 2OTLA 3NTHA 4IIOA 3I55Q 2QTXA 2CGHA 4IIMA 2LT1A 1WHLA 1S72A 2JXBA 3VU3C 5FRNA 3UA7A 4M75C 4RCCA 2MF2A 3JCMc 1K8AC 1K9MR 4C0GA 2E10A 4AFUC 1Q82C 3HTRA 2QASA 4PK4A 3CEYA 4PJOA 4D8DA 2MWOA 1Y7XA 1B34A 4J7FA 3C94A 2PUOB 3R6OA 4HCCA 1YJ9A 1KHCA 1PNJA 1PG5B 5J39A 2P0KA 3SWNA 1N8RR 2C06A 1MV0B 2K2VA 2LMJA 3NGPA 3CC7T 1Q81C 1KQ1A 2MIOA 4A4KA 4M77F 1VQ6Q 4TVRA 4B9WA 4RG2A 2AKKA 2D0QB 1H8KA 3CC2A 2XD0A 2IG0A 1WLPB 1YWPA 3M0QA 3M4YA 3CCLT 1Y71A 4BACA 1BI2A 5CR2A 3VS2A 1VQOA 4M78G 1TSFA 2IVWA 1GBRA 2NLUA 2CP0A 3OBWA 4C92E 4JJNK 2H3EB 2GQVA 3JCMX 5GAOr 1ARKA 4F17A 4LDUA 2A37A 2RQWA 1QQJA 1BB9A 3TEEA 2DJZA 5LJ5j 3JV3A 3ZFJA 1UGRB 2IPOB 2I2LA 2XG8D 2ZPIB 5FW9A 5AYFA 1N8RC 1ZHIA 2D8JA 1UEBA 2RO0A 3F70A 1WPYA 1YITT 3LWIA 3V8KA 4KRTA 4E7ZA 1M90C 1ZQ1A 1WJSA 1MMNA 1P92A 5KH6A 3MPUB 2EFIA 2DYIA 1NYGA 2P84A 5GMKj 4PKCC 2M02A 4DA4A 3JB9D 2CZ6B 5GANf 3CC4A 4C5HA 3M0TA 1IHVA 2ZGWA 2JTFA 2HMAA 5GAMg 3LH5A 1Z9ZA 2DJQA 3CCVQ 5GJVB 5LJ5f 1IO6A 3VRYA 2C0OA 3R6NA 2M51A 1ZA2B 2KYBA 2XDPA 2HEQA 2NUPB 3MEAA 4M75A 3P8DA 3V7CA 1QKXA 2VC8A 3SD4A 4M75B 1NZ9A 2XICA 5M9OA 3QDFA 3REBB 4F04B 4PJMA 5CO7A 2L8DA 5CQXA 2JTMA 2HQHA 2RPNA 4LDVA 1BBZA 4ZTFA 4E7HA 3CCUT 2OAWA 2WACA 1WHMA 3TREA 3VS4A 1JXOA 2OTJQ 2ZPEB 4EMGA 2XMFA 2KRMA 1BI0A 1RAGB 4M77A 3HKSA 4BY6C 5J26A 4QQDA 1C1AA 5GJWB 2DNUA 4QW2A 3SFMA 4RMOA 1YI2Q 3V8LA 3M0PA 4BY6B 5CKFA 5LJ5e 2E64A 3QUIA 2K3XA 1RABB 3S3MA 2DRKA 4AFZC 3OSSC 4Y28E 3X28B 1Q7YR 1ZBXA 1VQ5T 2QEXT 1D0YA 2L0AA 2EQKA 3JB9H 1MNDA 4KGVB 4M7DC 2F69A 1QVFP 2FPEA 2DTHA 2R57A 2E3HA 3VRZA 4M78A 2X4JA 2F2VA 3L1AA 5CQYA 4C8QD 2EKOA 4QVDA 1U06A 1H641 3QJ6A 1OEBA 4E7LA 2BE7D 1FXXA 2DK3A 2VASA 2X3WD 2E1HA 5IXBA 1WFWA 2HQEA 1ZA1B 3EG1A 3RERA 1PD0A 1V76A 1NM7A 3NFCA 5HY6A 3G7ZA 5HK3A 4C8QF 4QQ6A 4AG1C 3D7SB 3PNWC 4AG2C 3X20B 1HJDA 3VS1A 4E7SA 5FRMA 2JNGA 1WYXA 2X51A 1NEGA 1E7OA 3EGXA 3HL8A 1W4SA 5FLXE 2CZ1B 2COYA 4HVVA 1MMDA 3CCUA 1SHFA 1X43A 4A63B 3GIBA 2LDMA 3NTKA 2K57A 1RLQC 1H3ZA 1Y96A 1LNXA 4JRKA 4KGZB 1WDXA 2L3SA 5GAN3 2JT4A 4LNPA 2LP5A 3TSWA 1UGPB 2Y90A 1AWXA 1OZ3A 4EMKB 4NL3A 4AFQC 1N6AA 3JCMW 5DLQE 2GTJA 2DYBA 3H0HA 4OGCA 4XTWA 2O9VA 1WIEA 4O6JA 2DPPB 5IAYA 1KD1U 5KCHA 2KYMA 5KYWA 1M90R 5IXFA 1M1FA 1PKSA 1Z9QA 2IIMA 4D6WA 2K3YA 4KH0B 1AHJB 5LJ3j 1YNZA 2XDBA 1KQ2A 2RD1A 1MHNA 1KC8C 3RKWA 2RHXA 2V26A 3OS2A 4OMMA 1ACMB 3EGUA 2Y4YA 2G6FX 2MWPA 1B3QA 2ED1A 2E70A 2RA2A 4RCBA 5LJ5d 3JCMP 1SRLA 2FO0A 1JEGA 5DLOA 2QQSA 5GAN6 3FJ5A 5FU7B 1G2BA 3UATA 2KEAA 1VQ9Q 1YI2T 4LN2A 1MMGA 4LXCA 3CCMT 4BI8B 1KC8U 1PKTA 1VQOT 4PJLA 2L2PA 4FSSA 1ZUYA 2RI3A 3RUXA 1VQ4Q 2A3LA 4MZTA 8ATCB 2OTJT 5GAN2 2WSCE 4MDXA 1BK2A 1XTDA 3M9QA 2HCKA 5EC7A 3RMSA 5A0LA 1Q86U 4JS5A 2I0NA 2VB6A 4HXJA 5A0DA 2DD4A 1SRMA 2QYZA 1K73U 2CT4A 3CCET 3L2ZA 2CDTA 2EYXA 1UHCA 2MK5A 2X4YA 2RI2A 2BZXA 2DXUA 4KT0E 1ZBJA 4ZGDB 4M78F 3DB3A 4PJOD 4XAXB 1NLOC 2Z0WA 3MP6A 3G6EQ 2JN0A 5GANh 2QEXA 4BE0A 2KQWA 4FT4A 3PVQA 2VGMA 1OQKA 3GLXA 1D0ZA 4Z89A 1AT1B 2KE9A 3OYIA 3I5SA 1NPRA 2DE0X 1PHTA 2VWFA 4PJOF 2EQUA 1PCXA 2R5AA 2BIVA 1RLPC 1I81A 1WZOA 1Y0MA 1YITQ 1KFZA 2PTKA 4XTXA 3RMQA 1VQKT 1K9MU 3HRTA 4E47A 4OMFB 3LWHA 2QI2A 1AVZC 1M9SA 3DB4A 4HVWA 3TVTA 3I56T 2QQAA 3JCMV 1EX4A 1I07A 5I11A 1YITA 2GF7A 2EQJA 1M5Q1 2L3RA 4RUGA 3RESA 3A1PA 3M57A 3OYDA 1K76A 3M59A 1VQ4T 2FRYA 1G3WA 3FRNA 3FLGA 2BTTA 4Y92A 1YBYA 3QZ9B 5LJ3g 1W2BA 5KYXA 3X26B 4WCIA 3G4ST 2P4RA 3H9NA 1SSFA 4Z8AA 2MCNA 1IB8A 1M3BA 4RG8A 3PFSA 1ABQA 2O31A 5AT1B 1UDLA 4M75F 4ZN1A 2LQ8A 3X24B 2HDAA 4M7AB 3CXCS 4ELZC 4IUUA 3OYBA 2RHUA 4DEXA 4EPCA 1UGVA 2GBQA 1Q7YC 1HD3A 2NWMA 2RK1A 3CCJT 1QCNA 2JMAA 2KVQG 3QHSA 5KYXB 2CSIA 3JCMf 3EHQA 2JM8A 1YIJQ 1FYNA 4K11A 2HKNA 2E41A 3CC7Q 2NUTB 3EH1A 5FU7C 2VXFA 3EH2A 1S72Q 1M1KR 3H41A 3REAB 3V7SA 4DBRA 2DZ9A 1VOMA 4OMOA 3LYIA 1PD1A 1N27A 5D6WA 1TUCA 1JJ2S 1E6HA 1AZEA 1VQKQ 1R77A 4BI3A 1RAIB 1PC0A 4RTUA 1RAHB 2KSSA 3M0SA 3MJXA 3A8MB 3RKYA 1OV3A 2ZPFB 2FVUA 3EFOB 2KGTA 3G71T 1WHGA 1DJ7B 3AT1B 1WXUA 1VQNA 4M77D 4RTVA 1VIEA 1X75C 3ZEHA 3CMAT 3E19A 1QWFA 4NOYA 3QIIA 2DBMA 4M75E 4DBQA 2QDLA 2RJEA 4FYWB 2LNVA 3OYCA 1YJWQ 2YDLA 1UG1A 3GF5A 1I4K1 2FG0A 4IUVA 3M4GA 3OSVA 4AFSC 5IHIA 2FPDA 4PJNA 1VQ5A 3S6WA 4FSXA 2DXCA 3DLMA 4FYVB 2QQBA 4NL2A 4R56A 2E6NA 2QQ9A 4DBFA 5KYYA 3M55A 1YJNQ 1BI3A 3L2VA 3M53A 3QG1A 1FMWA 5KYNA 3HP9A 4A54A 3JSCA 1OX8A 3QJYA 2O2OA 2KMTA 2KY9A 1WJRA 1VQ9T 1KD1C 1YJNT 4RTWA 3CMET 3HRUA 2DL5A 5GAMd 1WA7A 1YWOA 1UECA 3PIPA 4KUIA 1OULA 2VKNA 4MZPA 1VQ8Q 4PL6A 3I56A 1YCYA 5I22A 3UWNA 2E6ZA 2GNCA 1TG0A 4OP0A 3OYKA 4A4FA 5IH2A 2CT3A 4J9BA 5CKDA 5I2MA 1M3AA 1VQPQ 1RAFB 3EG9B 1XJWB 1X6BA 1SG5A 3RDVA 2K5IA 3VUZA 1AOJA 4VUBA 2RQTA 3OYYA 3NHNA 2DL8A 1Q86R 2L3QA 2SEMA 3Q1JA 3QO3A 1D1AA 4A4GA 1IREB 1K8AR 1K9MC 4LDYA 1LJOA 2AKLA 1UGSB 1UHFA 2DVEA 3CCEA 2VVKA 1KIKA 3QYGB 1NLPC 3HPWA 3EG0A 3EHRA 3CD6T 3CMEA 2V1QA 4II1A 2FPFA 4E2FB 5LJ5g 4DOWA 1QVFS 4M77B 3L2QA 3OW2S 3I9QA 3DLLA 1G8XA 4M75G 4J9CA 2VYTA 2RK2A 5GMKl 3JCMd 4JJDA 1K0XA 2ZPBB 1SKUB 4R55A 3L2WA 1Q86C 3RIRA 2YRDA 2XHCA 1N5ZA 4E7JA 3I35A 2RQRA 3A8LB 2C0TA 5CIUA 1AEYA 2CZ7B 1PRMC 2CS7A 1VYUA 2ABLA 3EGDB 1O75A 1Y57A 2DLPA 1UGQB 5HK0A 4F16A 1VQ5Q 2SRCA 3BY7A 4A53A 1GCQA 2DTIA 3NMZC 2A7YA 2ROLA 3CCSQ 1TU0B 1CKAA 4F7UG 3CC2Q 2FHDA 2E12A 1ZUKA 2KT1A 1LPLA 1VUBA 2LJ1A 4JLIA 3QDRB 1UJ0A 2RHIA 5D6YA 3OYMA 3L2UA 1WXBA 3CC4T 1ZSZC 2OTLQ 1JJ2P 1TOVA 1I5OB 2K7AA 3EAEA 1IGQA 2XI9A 3VYGA 1KQSS 2E5QA 3G4SQ 1TS9A 1D1BA 3QXEB 4L59A 2KK4A 3HFOA 4FCYA 2PVDB 3PIOA 5I2SA 2DD5A 4FL6A 2NUPA 1S1NA 4ME7A 2X35A 1VQ7T 2GGRA 3A5ZB 4CC7A 2LJ3A 1OYXA 5LJ3d 2YHTA 3QWYA 2PQWA 3JCMb 3EFRA 1YJWT 1XNIA 1H3HA 2NUZA 1BYMA 1T3LA 3THKA 1MV3A 3CCLA 1AD5A 5KYUA 2MI6A 3CPWP 1VQ6A 1FMKA 1NJIC 2F5TX 1VQMT 1I0CA 1VQMQ 3J80E 1AWJA 2MAMA 2M0OA 4M77E 2EQMA 1WJQA 2CH4A 3MEWA 4ZNXA 2DFUA 2KR3A 1YCSB 2KBTA 1IXDA 4Z02A 2ZZDA 3H8ZA 2QQRA 1EFNA 1QLYA 3QKJA 4AMCA 3CPWA 1D0XA 4XK8E 4BB7A
chains in the Genus database with same CATH topology
1M4ZA 2HQXA 3CMAA 3LGLA 4KT0E 4X9CA 5CK9A 4XU3A 3ER0A 4ZGDB 3CCVA 4M78F 4ELYC 3DB3A 4PJOD 1BIBA 4XAXB 5J3BA 2V8IA 5GANe 2XK0A 3QSUA 3MP6A 2G3RA 4M7AG 2JN0A 5GANh 2QEXA 4BE0A 2KQWA 2RHYA 2PVGB 4FT4A 2VGMA 3M5AA 4MMKA 3UT1A 3OB9A 3GLXA 3JCMQ 3MP1A 3OBYA 4XTZA 5LL6S 4M7AD 3OYIA 2O4XB 4JRPA 1NPRA 1Y07A 5C6SA 3HRSA 5C0MA 2B8AA 2P4TA 5GAOq 4BE2A 4PJOF 2EQUA 1X6OA 2CYZB 2FB7A 2PUKB 1Y96B 4XU1A 2R5AA 4IUPA 2BIVA 4MDWA 1I81A 5GMKh 4M7DG 2QXFA 4PNOA 2LTOA 2D6FA 4XTXA 3RMQA 1VQKT 3UPUA 5CVIA 4KUDK 5CCAA 1G3YA 1HK9A 4M75D 3HRTA 3WVDB 5LJ3h 1BI1A 3CCSA 4E47A 1M1KC 1K9MU 2OTLT 4OMFB 3LWHA 2QI2A 1K73C 2HBPA 3LW5E 3J81E 3V8JA 4M7DB 3E1SA 1M9SA 3OYLA 3DB4A 4E7IA 2EIFA 3I56T 4EMKA 2YLCA 2QQAA 4JLGA 1UB4A 2VGNA 3HHTB 4GY5A 3JCMV 3TU4K 3JCMg 2XIDA 1YI2A 3ZBDA 3GNFB 5DY9A 3JB9F 3LH0A 4N4HA 1YITA 2GF7A 1NJIU 2EQJA 3CC2T 1GXIE 1M5Q1 3C12A 3H6ZA 1VQLA 2DO3A 2L3RA 4C92F 1EIFA 5D6XA 3AHUA 3RESA 1WGSA 5KCOA 2V8KA 3MP8A 4C8QB 1O9SA 3M57A 2EAYA 1KHIA 3OYDA 1BKBA 3JRZA 1IZ6A 3M59A 1VQ4T 4IUTA 1FX7A 1I5LA 4LDXA 1G3WA 4BDYA 3GNGA 1N9SA 4NS5A 3MCAB 3FRNA 3FLGA 3NTHA 3CCST 1QVGA 2OTLA 2QTXA 1YBYA 3QZ9B 1WQ7A 5LJ3g 4XU2A 1W2BA 2CGHA 4FM4B 4C92D 1QVFA 3E9GA 3X26B 2LT1A 1S72A 2DEQA 3VU3C 2VXEA 1N9RA 3VJPA 5FRNA 4M75C 4RCCA 3G4ST 2MF2A 2FYKA 2WSEE 3BW1A 3MO8A 3JCMc 3UDCA 4C0GA 1SSFA 3CBPA 2E10A 1XOVA 1OI1A 3OYEA 1Q82C 4UC4A 3OW2A 4C5GA 4RG8A 2GCXA 3PFSA 4C5EA 4M75F 4ZN1A 5GANg 3CEYA 4PJOA 2LQ8A 2M9UA 4J83A 3X24B 3QYHB 2MWOA 4M7AB 1Y7XA 3OA6A 3CXCS 4ELZC 1B34A 4IUUA 2RHUA 3C94A 4IUQA 2PUOB 3BDLA 3R6OA 4J7FA 4X9DA 3OYBA 4HCCA 2DTOA 4EPCA 1VQMT 4XU0A 1YJ9A 2RJDA 1KHCA 2RI5A 3JB9J 1Q7YC 2RM4A 3ASKA 5J39A 2OTJA 1G3SA 2P0KA 2X4WA 3SWNA 4PLLA 2C06A 3CC7T 2K2VA 2RK1A 4HT8A 1Q81C 1KQ1A 3CCJT 3X25B 2KVQG 4A4KA 3QHSA 3KXTA 4M77F 4TVRA 4B9WA 1R8OB 3GPLA 3FJPA 4OVAA 5IN1A 3JCMf 3GP8A 3FIFA 4RG2A 4C92C 4C0DB 4N4IA 4OB3B 2D0QB 2E41A 3VV0A 5LJ3f 4BUGA 3S3NA 5FU7C 1YJNA 2VXFA 4FU6A 3CC2A 2XD0A 3A8GB 2R58A 2IG0A 4Q5WA 4QVCA 3BDUA 2JUFA 4ZGEB 1JJ2A 3V7SA 2DZ9A 2KDSA 5FROA 3M4YA 2HNIA 3CCLT 3CCRA 1Y71A 3LYIA 2EYQA 4BACA 1BI2A 1N27A 5GMKe 2HD0A 3CBOA 5D6WA 1U8RA 5CR2A 1JJ2S 1VQOA 4M78G 4BI3A 3OYAA 1X01A 2Y4XA 2IVWA 2NLUA 3JB9I 3WXMB 4J6WA 3OBWA 2KSSA 3P8BB 4C92E 4JJNK 3LX7A 2GQVA 3SB2A 2AHJB 3A8MB 4OGEA 3JCMX 3OY9A 5GAOr 3RKYA 4LDUA 2ZPFB 3TEEA 2FVUA 2DJZA 2YRVA 5LJ5j 3QZ5B 3ZFJA 1UGRB 3G71T 3OQ5A 4Y91A 1DJ7B 3META 3I55A 1WNLA 2BKDN 2I2LA 2XG8D 2ZPIB 5AYFA 4M7DF 1VQNA 1N8RC 5GMKm 1ZHIA 2JZ2A 4M77D 1VIEA 1UEBA 1VQLT 2RO0A 3F70A 1WPYA 4KULA 1X75C 4N0AA 3ZEHA 4DOVA 3CMAT 3E19A 3PMTA 1YITT 2VUBA 5GMKi 2DIGA 3LWIA 5GANd 2DKGA 3ME9A 4NOYA 3V8KA 2PVOB 3C4SA 4C92B 4M7AA 1M90C 3E9FA 3QIIA 1ZQ1A 1WJSA 3VKIA 1P92A 1D3BB 4M75E 4M7DE 5KH6A 5LJ3e 2EFIA 2RJEA 3JCMJ 5A2QE 3M56A 1QP2A 4HKEA 3CPFA 2LNVA 4RKUE 4PKCC 5GMKj 3OYCA 4DA4A 2CZ6B 5GANf 2BUDA 3HFNA 3JB9D 1MGQA 1YIJA 4BDZA 3CC4A 4C5HA 1G5VA 3GF5A 1I4K1 4WF2A 2ZGWA 2JTFA 4M7AC 2JOYA 4IUVA 3M4GA 5GAMg 4M7DA 2K5FA 2RB6A 3OSVA 2PU9B 5GAMe 5LJ5f 3TCJA 4YTLA 2RH2A 4IKFA 1Q82U 5CAIA 5GAOl 1VQ5A 1PSEA 3S6WA 2XDPA 4FSXA 4C0DC 2DXCA 3MEAA 4M75A 1QW1A 4MZMA 3P8DA 3DLMA 3V7CA 2VC8A 4FIBA 3G71A 2QQBA 3SD4A 4M75B 2LVMA 1NZ9A 2XICA 4NL2A 2OAUA 5M9OA 2E6NA 2QDYB 4R56A 2QQ9A 3OMCA 2EJFA 4M78B 3DKMA 1V29B 3M55A 5CO7A 4XTVA 3INZA 3T9NA 2L8DA 5CQXA 5DM7R 2JTMA 4JUVA 1BI3A 3MEUA 3L2VA 1YHQT 2LT4A 4LDVA 2VV5A 3M53A 3LLRA 3QG1A 2P0QA 4E7HA 4ZTFA 4PJOG 3HP9A 3CCUT 4A54A 4M77C 3JSCA 4F7UE 3QJYA 3QBYA 2KMTA 2WACA 1QVPA 2KY9A 3N5BB 3TREA 4ZTJA 4PJOB 1WJRA 1VQ9T 1KD1C 4KBMB 2V8JA 4L6V5 2EJ9A 1YJNT 2ZPEB 1XQHA 3HRUA 4EMGA 3CMET 5IT9E 4C92A 1VQMA 1QP3A 1BI0A 5GAMd 4HCZA 4BY6C 4M77A 3HKSA 3PIPA 4KUIA 5J26A 4MZPA 4PL6A 3I56A 1YCYA 2X4XA 3UWNA 4DQ2A 4QQDA 5FU6C 4EMKC 2E6ZA 2ZPGB 5A0GA 3CC7A 4RMOA 4QW2A 3SFMA 4OP0A 2LC4A 3V8LA 4BY6B 2L5QA 4GLKA 5CKFA 3OYKA 4M7DD 5GAMf 5LJ5e 2E64A 2ZCFB 4LD6A 4A4FA 3QUIA 4O5VA 2K3XA 2DAQA 3HSBA 5KE2A 3S3MA 5CKDA 5I2MA 3OSSC 2FL7A 4Y28E 2DIQA 3X28B 4JS4A 1VQ7A 3M58A 5GAMj 1VQNT 2K5IA 1VIFA 3VUZA 4CI0C 3P8HA 1ZBXA 4VUBA 2LRQA 4C8QC 1VQ5T 3OYNA 2QEXT 3OYYA 2EQKA 4A4HA 3JB9H 3CCQT 1TH7A 2O01E 4M7DC 3SWNB 2F69A 4XTYA 2JVVA 2RHZA 3FEOA 2LCCA 2DTHA 2DXBA 2R57A 1S72T 3VUBA 3CCVT 5LJ5h 1M1KU 1JRIA 1KG1A 3Q1JA 3A8HB 4M78A 3QO3A 4B9XA 1K8AC 4C92G 1YIJT 2X4JA 1JBMA 4A4GA 1IREB 3L1AA 5CQYA 5GAOm 4C0ZA 1K9MC 4LDYA 3CXCA 1LJOA 4C8QD 3CCQA 2EKOA 4QVDA 1UGSB 2DVEA 3SWNC 3L2RA 1H641 3CCEA 3QJ6A 4F7UA 3CPWS 4CRIA 4C8QE 3QYGB 3HPWA 1NPPA 4E7LA 3M54A 3GOXA 1FXXA 2DK3A 4N0AC 4M77G 3OYFA 2EWNA 2E1HA 3PT9A 3CMEA 4X34A 3CD6T 3LGFA 4PJOC 4II1A 5GAN4 4J8OA 2HQEA 4EMHA 5LJ5g 4DOWA 4E7KA 3RERA 3KBGA 3NTIA 1QVFS 4M77B 4MMLA 1VQ6T 5GAN5 3NFCA 3BFMA 5HY6A 5L8RE 1W2BS 3G7ZA 5HK3A 3L2QA 4C8QF 3OW2S 4C0FA 4QQ6A 1WQWA 3URGA 3JB9G 1M90U 3PNWC 3DLLA 2D9TA 4OB0B 4M75G 3CCJA 3X20B 3JAME 1VQKA 2MMPA 4HCBA 5EG2A 3OYHA 5HKCA 2VYTA 1YJWA 2KAFA 2RK2A 5GMKl 2LCLA 3JCMd 2ZPBB 5FRMA 2JNGA 4R55A 3L42A 1KQSA 3OS0A 4ZN3A 3L2WA 4JRQA 1N8RU 1Q86C 4M7AE 5GAN7 3HL8A 3PMIA 3RIRA 4BE1A 2XHCA 1W4SA 1M1GA 5FLXE 2CZ1B 3SDZA 1M8VA 3CCUA 1BIAA 3EFSA 4E7JA 2ZPHB 4F7UB 2LDMA 3NTKA 2K57A 4OB1B 3GIBA 2WSFE 2K4YA 2F5KA 4P5NA 3G6EA 2DXTA 3A8LB 4IURA 1H3ZA 4ZGJB 1Y96A 5CIUA 4JRIA 1LNXA 2CZ7B 2GFUA 4JRKA 3J7AF 4M7AF 2DZCA 2CS7A 5GAN3 4M78C 2XU8A 1O75A 4BD3A 2M1HA 1UGQB 5HK0A 1UGPB 1U1SA 2Y90A 3BY7A 4A53A 1OZ3A 4ATOA 2DTIA 5FU6B 4EMKB 2A7YA 4NL3A 1VQ4A 1N6AA 3JCMh 3JCMW 5DLQE 4PJOE 4XTUA 5GANj 4F7UG 2FHDA 5GAN8 2E12A 4OGCA 4XTWA 1VQ9A 2QA4A 5GAOp 3CD6A 1VUBA 4O6JA 4JLIA 3QDRB 4OF1A 3OYGA 2QA4T 2DPPB 2RHIA 2YLBA 4PLIA 5D6YA 3OYMA 3L2UA 5IAYA 3CC4T 2CZ0B 5KCHA 1KD1U 1I8FA 1M1FA 3A8OB 2O4XA 4QVZA 2K3YA 4D6WA 3PTAA 4XQ3A 3EAEA 2XI9A 4J6XA 2GFAA 3VYGA 4EDUA 4HA8A 4OB2B 3S3OA 1AHJB 5LJ3j 1KQSS 1U1TA 2E5QA 5CKEA 1FWZA 3G4SA 2K5LA 2XDBA 4QQGA 1VQPA 2P0PA 1MHNA 2RD1A 1KC8C 1KQ2A 1JB0E 3RKWA 2RHXA 3OMGA 3QXEB 4L59A 4LDWA 2KK4A 3OS2A 2R5MA 3HFOA 4A4EA 2PVDB 3PIOA 2Y4YA 3C95A 5I2SA 2DD5A 3G6ET 2H3JA 2MWPA 4FL6A 2LQKA 3RKXA 3V7RA 3MHXA 3I55T 2L89A 2E70A 2RA2A 4RCBA 4ME7A 5LJ5d 3JCMP 4V2SA 1NE8A 2X35A 1K8AU 1VQ7T 2E65A 2XKOC 3A5ZB 2XDDA 5CKBA 5DLOA 1YHQA 2QQSA 5GAN6 4M78D 5FU7B 3FB9A 1OYXA 3WVEB 5GAOn 3OYJA 1LOJA 5LJ3d 3PGGA 4HT9A 2YHTA 4BI4A 2LX9A 4FT2A 1VQPT 1YI2T 2PQWA 3CCMT 3JCMb 1QVGS 3EFRA 2HAXA 1YJWT 1XNIA 1BYMA 4BI8B 1KC8U 2RJFA 1VQOT 4J7IA 5KE3A 1VQ8T 3FC3A 3KUFA 3QPHA 2RI3A 1Q7YU 3RUXA 3CCRT 3CCLA 2A3LA 3OS5A 2MI6A 4MZTA 3VYHB 1VQ6A 3O8VA 4C8QA 2OTJT 1NJIC 2RJCA 2F5TX 2WSCE 1RI0A 5GAN2 1PSFA 1XTDA 3M9QA 4N4GA 3MEVA 4C8QG 1YJ9T 4MDXA 3J80E 3OS1A 3CBMA 3RMSA 4L5GA 2MAMA 5A0LA 1Q86U 4JS5A 2M0OA 2EQMA 1RL2A 4M77E 2M16A 1WJQA 5A0DA 2DD4A 3MEWA 5GAMh 1K73U 4M78E 3FDRA 2EJGA 3JCMe 4J6YA 3CCET 4Z02A 1B34B 2ZZDA 1G3TA 3L2ZA 3H8ZA 2QQRA 4XK8E 1VQ8A 4LD9K 4F7UF 1HXDA 4C5IA 2CKKA 5I21A 3QKJA 4J5YA 3CPWA 2X4YA 3CCMA 1OZ2A 4JDSA 1D3BA 1Q81U 2RI2A 5CKHA 2DXUA 4BB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYH B;  3A8G B;  2QDY B;  4KT0 E;  2WSC E;  1QP3 A;  1PSF A;  1QP2 A;  3QZ5 B;  3A8O B;  3QYG B;  1DJ7 B;  2PUO B;  2ZPB B;  3QZ9 B;  4RKU E;  4ZGE B;  2CZ6 B;  3LW5 E;  2ZPI B;  1V29 B;  1UGQ B;  4FM4 B;  1UGP B;  2O01 E;  3WVE B;  3X26 B;  3VYG A;  2DD4 A;  4OB2 B;  3HHT B;  1AHJ B;  3WVD B;  2PVG B;  2DXB A;  2ZPG B;  2CZ1 B;  3X25 B;  2WSE E;  1JB0 E;  2PU9 B;  3QXE B;  3A8H B;  1GXI E;  2ZZD A;  2ZCF B;  2ZPH B;  4OB1 B;  5L8R E;  2PVD B;  2PVO B;  2WSF E;  1PSE A;  1IRE B;  2DXC A;  2AHJ B;  3A8M B;  2CYZ B;  3A8L B;  2PUK B;  2DD5 A;  4OB3 B;  2D0Q B;  2DPP B;  4ZGJ B;  4OB0 B;  3VYH B;  4ZGD B;  2CZ7 B;  3X20 B;  1UGS B;  2ZPF B;  4L6V 5;  4Y28 E;  4XK8 E;  2ZPE B;  3X28 B;  2CZ0 B;  3X24 B;  1UGR B; 
#chains in the Genus database with same CATH topology
 3CMA A;  3LGL A;  4J9D A;  4X9C A;  5CK9 A;  1VQ7 Q;  1NJI R;  1M2O A;  4ELY C;  2MOX A;  5J3B A;  1X2K A;  1WHH A;  2G3R A;  4M7A G;  2RHY A;  3UT1 A;  3M5A A;  2LJ0 A;  3JCM Q;  3MP1 A;  3OBY A;  4M7A D;  5C6S A;  3EG2 A;  4M4Z A;  3SHW A;  5C0M A;  4BE2 A;  2QGF B;  1X6O A;  2FB7 A;  2CP5 A;  1H92 A;  5GMK h;  4IUP A;  4MDW A;  2D6F A;  5CCA A;  1G3Y A;  2D0N A;  3WVD B;  5LJ3 h;  2OTL T;  2RF0 A;  2HBP A;  3LW5 E;  2RQV A;  3V8J A;  3E1S A;  1MNE A;  4E7I A;  2DRM A;  4EMK A;  2YLC A;  2K2M A;  1YI2 A;  2COW A;  3JB9 F;  3LH0 A;  4N4H A;  3CC2 T;  2DO3 A;  1EIF A;  2A0F B;  1RUW A;  1WGS A;  4C8Q B;  1GFC A;  1KHI A;  2EAY A;  3JRZ A;  4LDX A;  2EQI A;  1N9S A;  3MCA B;  3CCS T;  2RN8 A;  1T0J A;  2AZS A;  1SPK A;  3EGX B;  2DEQ A;  2VXE A;  1N9R A;  3BW1 A;  3UDC A;  6AT1 B;  2X9H A;  1VQL Q;  2CH4 W;  1BU1 A;  1OI1 A;  3OYE A;  3OW2 A;  4C5G A;  2M9U A;  2F1L A;  3QYH B;  3OA6 A;  3G4S A;  4IUQ A;  2GTO A;  2DTO A;  4XU0 A;  2RI5 A;  3JB9 J;  1G3S A;  2X4W A;  4HT8 A;  3X25 B;  2FEI A;  4KH1 B;  2QGG A;  4B6M A;  5IN1 A;  1TWB A;  2BZY A;  1BCM A;  4N4I A;  2W0Z A;  4OB3 B;  1RAC B;  1YJN A;  4FU6 A;  3VS6 A;  2YXY A;  1J3T A;  3A8G B;  4Q5W A;  4QVC A;  2EGE A;  3BDU A;  2JUF A;  4ZGE B;  5FRO A;  2HNI A;  3CCR A;  1UJY A;  4WTO B;  3CBO A;  4LE9 A;  1AZG B;  1X01 A;  1ZLM A;  1R0C B;  3JB9 I;  1PWT A;  3WXM B;  4J6W A;  4DBH A;  3P8B B;  1OU8 A;  2DER A;  2AHJ B;  2YRV A;  3QZ5 B;  2A28 A;  4RTX A;  3OQ5 A;  2YSQ A;  3CCE Q;  3MET A;  2BKD N;  4M7D F;  5GMK m;  4OMQ A;  1AWO A;  1VQL T;  4KUL A;  4JJB A;  3VS3 A;  4DOV A;  2VUB A;  2DKG A;  3ME9 A;  2F2X A;  2PVO B;  4Z88 A;  1QWE A;  3VKI A;  1D3B B;  1TXQ A;  5A2Q E;  1RAA B;  3CPF A;  1UTI A;  4HCB A;  2CUD A;  3HFN A;  1MGQ A;  2QK0 A;  2YUQ A;  4WF2 A;  4PFZ A;  2K5F A;  2PU9 B;  5GAM e;  2CUB A;  3TCJ A;  4YTL A;  5GAO l;  4C0D C;  1MUZ A;  2QEX Q;  1QW1 A;  2EYY A;  4CC2 A;  4FIB A;  3G71 A;  2LVM A;  1QVG P;  5FWB A;  4PFP A;  2QDY B;  1K73 R;  2EJF A;  4M78 B;  3DKM A;  2JS2 A;  2KXD A;  1ZUU A;  3T9N A;  5DM7 R;  2FZC B;  1ZSG A;  4M77 C;  4F7U E;  1QVP A;  4ZTJ A;  4PJO B;  4KBM B;  2V8J A;  4L6V 5;  2EJ9 A;  1XQH A;  5IT9 E;  2K79 A;  2X4X A;  4DQ2 A;  4HVU A;  1VYT A;  5FU6 C;  4PFO A;  2ZPG B;  3CC7 A;  1K0S A;  2LC4 A;  1SHG A;  5GAM f;  2ZCF B;  2X3X D;  4LD6 A;  4O5V A;  2KRO A;  4CC4 B;  2DAQ A;  3HSB A;  5KE2 A;  1K1Z A;  2F2W A;  1WXT A;  1TTH B;  2DX1 A;  5HCK A;  5GAM j;  1VQN T;  2DVJ A;  4CI0 C;  2LRQ A;  3OYN A;  1NYF A;  1W2B P;  2O01 E;  3SWN B;  4J9F A;  4J9E A;  2QA4 Q;  2RHZ A;  3FEO A;  2AK5 A;  2LCC A;  2DXB A;  2J6K A;  3VUB A;  2EVR A;  5LJ5 h;  3CCV T;  1JRI A;  3A8H B;  4B9X A;  3QWX X;  1JBM A;  5GAO m;  3CCQ A;  5KYU B;  1JO8 A;  1EZZ B;  3SWN C;  1QKW A;  3L2R A;  8AT1 B;  1D09 B;  1I1J A;  3M54 A;  2QTV A;  2CP6 A;  4M77 G;  3OYF A;  3PT9 A;  4X34 A;  3CXC P;  4QT7 A;  4J8O A;  2W10 A;  2JS0 A;  4EMH A;  3KBG A;  4MML A;  2CSQ A;  2B86 A;  5GAN 5;  1W2B S;  5L8R E;  2KNB B;  2PZ1 A;  4C0F A;  1TUD A;  3H0F A;  3CCJ A;  4OB0 B;  1VQK A;  2MMP A;  1X69 A;  3OYH A;  3CC4 Q;  2KAF A;  2LCL A;  4JPB W;  2D1X A;  1K4U S;  3L42 A;  2YUP A;  1KQS A;  4ZN3 A;  4JRQ A;  4D8K A;  1N8R U;  2GQI A;  4M7A E;  5GAN 7;  3PMI A;  2RMO A;  4E6R A;  3SDZ A;  3TSZ A;  3CCJ Q;  2J6F A;  4J9G A;  2EKH A;  2WSF E;  2K4Y A;  2F5K A;  3G6E A;  2DXT A;  4IUR A;  4JRI A;  3J7A F;  4M7A F;  2DZC A;  1KJW A;  4M78 C;  1IHW A;  4KGX B;  4BD3 A;  2M1H A;  3MKD A;  1D1C A;  1VQ4 A;  3JCM h;  2ECZ A;  4PJO E;  2EYZ A;  2O9S A;  3NPF A;  5GAN j;  1ABO A;  1SEM A;  2C0I A;  2QA4 A;  5GAO p;  3CD6 A;  2J06 A;  4OF1 A;  1OOT A;  2YLB A;  1YN8 A;  2CZ0 B;  1I8F A;  4J9I A;  2O4X A;  3PTA A;  2H8H A;  3I56 Q;  3CQT A;  3RNJ A;  2DM1 A;  1W1F A;  2ATC B;  4J6X A;  3S3O A;  4OB2 B;  4OML A;  5CKE A;  2K5L A;  5L23 A;  4QQG A;  1JB0 E;  2E3I A;  2EGA A;  2R5M A;  1QMC A;  4A4E A;  3EFO A;  2OI3 A;  3G6E T;  3I55 T;  2L89 A;  2ENM A;  1NE8 A;  1K8A U;  2FRW A;  1C6V X;  2XKO C;  5CKB A;  1YHQ A;  4LUE A;  4M78 D;  3O5Z A;  3WVE B;  4BI4 A;  1QVG S;  2HAX A;  1W6X A;  1KQS P;  4J7I A;  5KE3 A;  3KUF A;  3OS5 A;  3VYH B;  5ECA A;  3O8V A;  4C8Q A;  1RI0 A;  1PSF A;  1MMA A;  1YJ9 T;  3MEV A;  1R0B G;  3CBM A;  1AWW A;  1VQ9 A;  1RL2 A;  1IRX A;  2CRE A;  5GAM h;  1V1C A;  2EJG A;  2BE9 B;  3JCM e;  1B34 B;  3M0R A;  1M2V B;  4F7U F;  4F14 A;  4C5I A;  2CKK A;  5I21 A;  3CCM A;  1OZ2 A;  2BZ8 A;  4JDS A;  1Q81 U;  1YFN A;  5CKH A;  5GMK e;  1FMV A;  3ER0 A;  2OJ2 A;  1Q95 G;  5GAN e;  1ZSZ A;  2YRC A;  2DL7 A;  4MMK A;  2PVG B;  3OB9 A;  5LL6 S;  4XTZ A;  4JRP A;  2LX7 A;  2P4T A;  2CYZ B;  1KSW A;  4XU1 A;  4J9H A;  1G83 A;  4M7D G;  4PNO A;  2LTO A;  3UPU A;  5CVI A;  4M75 D;  3KFV A;  1IGU A;  3J81 E;  4M7D B;  4QKU A;  2YUO A;  1UB4 A;  1M8M A;  3HHT B;  3TU4 K;  4R0K A;  3JCM g;  5DY9 A;  2JJ9 A;  1NJI U;  2ED0 A;  1YJ9 Q;  3H6Z A;  1VQL A;  3AHU A;  4C92 F;  2DET A;  4FYY B;  5KCO A;  3MP8 A;  1IZ6 A;  1I5L A;  4IUT A;  1FX7 A;  4BDY A;  4NS5 A;  1QVG A;  1WQ7 A;  4XU2 A;  2HSE B;  4FM4 B;  3PVL A;  4C92 D;  1QVF A;  3E9G A;  3CD6 Q;  2J05 A;  1B7T A;  3VJP A;  4GLM A;  2WSE E;  2FYK A;  3MO8 A;  1X6G A;  3CBP A;  1XOV A;  2JTE A;  4UC4 A;  2MYS A;  2GCX A;  2DF6 A;  4C5E A;  1JU5 C;  5GAN g;  3GBQ A;  4J83 A;  1SF9 A;  3RBB B;  3BDL A;  4X9D A;  1K9A A;  2RJD A;  3A98 A;  1M3C A;  2RM4 A;  3ASK A;  2OTJ A;  1SSH A;  4PLL A;  2ZAE A;  1HSQ A;  3KXT A;  1R8O B;  3GPL A;  3FJP A;  4OVA A;  3GP8 A;  2LNH B;  3FIF A;  4C92 C;  2O88 A;  4C0D B;  3VV0 A;  4BUG A;  5LJ3 f;  3S3N A;  2HL5 C;  2DL4 A;  1RI9 A;  2AT1 B;  2R58 A;  2MPX C;  1LVK A;  1JJ2 A;  1RAD B;  9ATC B;  2KDS A;  2RQU A;  2EYQ A;  2HD0 A;  1U8R A;  2K3B A;  3OYA A;  2Y4X A;  2K9G A;  3LX7 A;  3SB2 A;  3OY9 A;  4OGE A;  2YT6 A;  1F1B B;  4Y91 A;  2DEU A;  3I55 A;  1WNL A;  1KC8 R;  3TQ7 P;  1OX9 A;  2JZ2 A;  2HZY A;  1WHJ A;  4N0A A;  3PMT A;  5GMK i;  2DIG A;  2PNI A;  4GBQ A;  5GAN d;  2KRS A;  4ORZ A;  3C4S A;  4C92 B;  4M7A A;  3E9F A;  3VS0 A;  1QCF A;  2CP2 A;  4M7D E;  3E2U A;  3I5R A;  5LJ3 e;  3JCM J;  3UA6 A;  1C0M A;  3M56 A;  2NYS A;  1QP2 A;  4HKE A;  4RKU E;  2BUD A;  1YIJ A;  1UE9 A;  4BDZ A;  2D8H A;  1G5V A;  4ESR A;  1OU9 A;  3M0U A;  4M7A C;  2JOY A;  4M7D A;  3U23 A;  2RB6 A;  2J7I A;  2RH2 A;  4JJC A;  2LCS A;  4IKF A;  1Q82 U;  2M0Y A;  5CAI A;  1PSE A;  3CCQ Q;  1KD1 R;  4MZM A;  1Q81 R;  3CCU Q;  2E5K A;  2OAU A;  4FYX B;  4DEY A;  3OMC A;  1PM3 A;  3CMA Q;  1V29 B;  2ESW A;  2OX7 A;  1M30 A;  4XTV A;  3INZ A;  2DBK A;  4JUV A;  3MEU A;  1YHQ T;  2LT4 A;  2VV5 A;  4ANJ A;  1NG2 A;  3LLR A;  2P0Q A;  4PJO G;  2AIR B;  1JQQ A;  3ULR B;  3QBY A;  2YUN A;  1VQN Q;  1GL5 A;  1UFF A;  3N5B B;  2DA9 A;  3H0I A;  4JZ3 A;  4C92 A;  1Q82 R;  1VQM A;  1QP3 A;  3C0C A;  4HCZ A;  1BCO A;  4EMK C;  2KT8 A;  5A0G A;  3G71 Q;  5KYY B;  1CKB A;  2L5Q A;  4GLK A;  4M7D D;  2K6D A;  2EPD A;  2FL7 A;  2DIQ A;  4JS4 A;  2J6O A;  1VQ7 A;  3M58 A;  2A08 A;  1VIF A;  3P8H A;  4C8Q C;  4A4H A;  3CCQ T;  1TH7 A;  2HL3 A;  1T0H A;  4XTY A;  2JVV A;  3UF4 A;  2RNA A;  1VA7 A;  3EGD A;  1OPL A;  3VS5 A;  1S72 T;  1M1K U;  1KG1 A;  5IHK A;  7AT1 B;  4C92 G;  1YIJ T;  2LQW A;  3EG9 A;  5FWC A;  4C0Z A;  3CXC A;  3ZL7 C;  4EIK A;  4OMN A;  4F7U A;  3CPW S;  4CRI A;  4C8Q E;  1NPP A;  3GOX A;  1HYO A;  1GCP A;  3CCL Q;  4N0A C;  2EWN A;  4PJO C;  3LGF A;  5GAN 4;  3IQL A;  4E7K A;  3NTI A;  1ZX6 A;  1QCO A;  1VQ6 T;  2ROT A;  2KRN A;  3BFM A;  4PJJ A;  3BE3 A;  2CP3 A;  3URG A;  1WQW A;  3JB9 G;  1M90 U;  1NEB A;  2D9T A;  3JAM E;  5EG2 A;  4CC3 A;  5HKC A;  1YJW A;  3RR6 A;  3OS0 A;  2YWW A;  1U5S A;  4BE1 A;  1M1G A;  1M8V A;  1BIA A;  3EFS A;  2ZPH B;  4F7U B;  2DIL A;  4OB1 B;  4P5N A;  1WX6 A;  5KYW B;  4ZGJ B;  2GFU A;  4HCK A;  2L3P A;  1KK7 A;  1UUE A;  2XU8 A;  1U1S A;  2V1R A;  1GRI A;  4ATO A;  5FU6 B;  2DMO A;  2JW4 A;  2LQN A;  4LUD A;  4XTU A;  3PE0 A;  2A36 A;  5GAN 8;  2FZG B;  3OYG A;  2QA4 T;  2NUT A;  1YP5 A;  4PLI A;  3SEM A;  2DL3 A;  3A8O B;  2QAZ A;  4QVZ A;  4XQ3 A;  1YHQ Q;  2GFA A;  4EDU A;  4HA8 A;  1GCQ C;  5D7U A;  1U1T A;  1FWZ A;  2EW3 A;  1VQP A;  1ZSZ B;  2P0P A;  3OMG A;  1WHK A;  4FW1 A;  4LDW A;  2JM9 A;  3EG3 A;  3C95 A;  2H3J A;  2LQK A;  3RKX A;  3V7R A;  3MHX A;  4V2S A;  1VQO Q;  1M2V A;  2AZV A;  1VYV A;  2E65 A;  2XDD A;  3OYJ A;  3FB9 A;  2HBW A;  1CSK A;  1M27 C;  5GAO n;  1LOJ A;  1T3S A;  3PGG A;  2FZK B;  4HT9 A;  2LX9 A;  4FT2 A;  1VQP T;  1TUG B;  4RTT A;  2RJF A;  4X1V A;  2KI7 A;  1VQ8 T;  3FC3 A;  2EGC A;  1E6G A;  3QPH A;  1Q7Y U;  3CCR T;  1X2Q A;  2EBP A;  3CME Q;  3CCM Q;  1X27 A;  2RJC A;  4N4G A;  4C8Q G;  3OS1 A;  4L5G A;  1NBE B;  2M16 A;  3CCR Q;  2JMC A;  1WI7 A;  4M78 E;  3FDR A;  4J6Y A;  1OPK A;  1B07 A;  1W70 A;  1G3T A;  1VQ8 A;  3OW2 P;  4LD9 K;  1HXD A;  2E4H A;  4J5Y A;  2CP7 A;  2QG9 B;  1D3B A;  4OMP A;  1M4Z A;  2HQX A;  3CCV A;  4XU3 A;  1BIB A;  2V8I A;  4FW2 A;  2EYW A;  2XK0 A;  4AT1 B;  3QSU A;  1RAE B;  4RTY A;  1GBQ A;  2O4X B;  2HKQ B;  1Y07 A;  4RTZ A;  1JXM A;  3HRS A;  2LZ6 B;  2B8A A;  5GAO q;  2KXC A;  2PUK B;  3VS7 A;  1Y96 B;  4JZ4 A;  3G1J A;  2QXF A;  1PRL C;  4KUD K;  1HK9 A;  1M1K C;  1BI1 A;  3CCS A;  2COZ A;  1K73 C;  3OYL A;  2EIF A;  2HSP A;  4JLG A;  2VGN A;  4GY5 A;  2XID A;  3ZBD A;  3GNF B;  5IHN A;  1LCK A;  1U3O A;  1A0N B;  1GXI E;  3C12 A;  5D6X A;  2V8K A;  1O9S A;  1GFD A;  1BKB A;  3GNG A;  2OTL A;  3NTH A;  4IIO A;  3I55 Q;  2QTX A;  2CGH A;  4IIM A;  2LT1 A;  1WHL A;  1S72 A;  2JXB A;  3VU3 C;  5FRN A;  3UA7 A;  4M75 C;  4RCC A;  2MF2 A;  3JCM c;  1K8A C;  1K9M R;  4C0G A;  2E10 A;  4AFU C;  1Q82 C;  3HTR A;  2QAS A;  4PK4 A;  3CEY A;  4PJO A;  4D8D A;  2MWO A;  1Y7X A;  1B34 A;  4J7F A;  3C94 A;  2PUO B;  3R6O A;  4HCC A;  1YJ9 A;  1KHC A;  1PNJ A;  1PG5 B;  5J39 A;  2P0K A;  3SWN A;  1N8R R;  2C06 A;  1MV0 B;  2K2V A;  2LMJ A;  3NGP A;  3CC7 T;  1Q81 C;  1KQ1 A;  2MIO A;  4A4K A;  4M77 F;  1VQ6 Q;  4TVR A;  4B9W A;  4RG2 A;  2AKK A;  2D0Q B;  1H8K A;  3CC2 A;  2XD0 A;  2IG0 A;  1WLP B;  1YWP A;  3M0Q A;  3M4Y A;  3CCL T;  1Y71 A;  4BAC A;  1BI2 A;  5CR2 A;  3VS2 A;  1VQO A;  4M78 G;  1TSF A;  2IVW A;  1GBR A;  2NLU A;  2CP0 A;  3OBW A;  4C92 E;  4JJN K;  2H3E B;  2GQV A;  3JCM X;  5GAO r;  1ARK A;  4F17 A;  4LDU A;  2A37 A;  2RQW A;  1QQJ A;  1BB9 A;  3TEE A;  2DJZ A;  5LJ5 j;  3JV3 A;  3ZFJ A;  1UGR B;  2IPO B;  2I2L A;  2XG8 D;  2ZPI B;  5FW9 A;  5AYF A;  1N8R C;  1ZHI A;  2D8J A;  1UEB A;  2RO0 A;  3F70 A;  1WPY A;  1YIT T;  3LWI A;  3V8K A;  4KRT A;  4E7Z A;  1M90 C;  1ZQ1 A;  1WJS A;  1MMN A;  1P92 A;  5KH6 A;  3MPU B;  2EFI A;  2DYI A;  1NYG A;  2P84 A;  5GMK j;  4PKC C;  2M02 A;  4DA4 A;  3JB9 D;  2CZ6 B;  5GAN f;  3CC4 A;  4C5H A;  3M0T A;  1IHV A;  2ZGW A;  2JTF A;  2HMA A;  5GAM g;  3LH5 A;  1Z9Z A;  2DJQ A;  3CCV Q;  5GJV B;  5LJ5 f;  1IO6 A;  3VRY A;  2C0O A;  3R6N A;  2M51 A;  1ZA2 B;  2KYB A;  2XDP A;  2HEQ A;  2NUP B;  3MEA A;  4M75 A;  3P8D A;  3V7C A;  1QKX A;  2VC8 A;  3SD4 A;  4M75 B;  1NZ9 A;  2XIC A;  5M9O A;  3QDF A;  3REB B;  4F04 B;  4PJM A;  5CO7 A;  2L8D A;  5CQX A;  2JTM A;  2HQH A;  2RPN A;  4LDV A;  1BBZ A;  4ZTF A;  4E7H A;  3CCU T;  2OAW A;  2WAC A;  1WHM A;  3TRE A;  3VS4 A;  1JXO A;  2OTJ Q;  2ZPE B;  4EMG A;  2XMF A;  2KRM A;  1BI0 A;  1RAG B;  4M77 A;  3HKS A;  4BY6 C;  5J26 A;  4QQD A;  1C1A A;  5GJW B;  2DNU A;  4QW2 A;  3SFM A;  4RMO A;  1YI2 Q;  3V8L A;  3M0P A;  4BY6 B;  5CKF A;  5LJ5 e;  2E64 A;  3QUI A;  2K3X A;  1RAB B;  3S3M A;  2DRK A;  4AFZ C;  3OSS C;  4Y28 E;  3X28 B;  1Q7Y R;  1ZBX A;  1VQ5 T;  2QEX T;  1D0Y A;  2L0A A;  2EQK A;  3JB9 H;  1MND A;  4KGV B;  4M7D C;  2F69 A;  1QVF P;  2FPE A;  2DTH A;  2R57 A;  2E3H A;  3VRZ A;  4M78 A;  2X4J A;  2F2V A;  3L1A A;  5CQY A;  4C8Q D;  2EKO A;  4QVD A;  1U06 A;  1H64 1;  3QJ6 A;  1OEB A;  4E7L A;  2BE7 D;  1FXX A;  2DK3 A;  2VAS A;  2X3W D;  2E1H A;  5IXB A;  1WFW A;  2HQE A;  1ZA1 B;  3EG1 A;  3RER A;  1PD0 A;  1V76 A;  1NM7 A;  3NFC A;  5HY6 A;  3G7Z A;  5HK3 A;  4C8Q F;  4QQ6 A;  4AG1 C;  3D7S B;  3PNW C;  4AG2 C;  3X20 B;  1HJD A;  3VS1 A;  4E7S A;  5FRM A;  2JNG A;  1WYX A;  2X51 A;  1NEG A;  1E7O A;  3EGX A;  3HL8 A;  1W4S A;  5FLX E;  2CZ1 B;  2COY A;  4HVV A;  1MMD A;  3CCU A;  1SHF A;  1X43 A;  4A63 B;  3GIB A;  2LDM A;  3NTK A;  2K57 A;  1RLQ C;  1H3Z A;  1Y96 A;  1LNX A;  4JRK A;  4KGZ B;  1WDX A;  2L3S A;  5GAN 3;  2JT4 A;  4LNP A;  2LP5 A;  3TSW A;  1UGP B;  2Y90 A;  1AWX A;  1OZ3 A;  4EMK B;  4NL3 A;  4AFQ C;  1N6A A;  3JCM W;  5DLQ E;  2GTJ A;  2DYB A;  3H0H A;  4OGC A;  4XTW A;  2O9V A;  1WIE A;  4O6J A;  2DPP B;  5IAY A;  1KD1 U;  5KCH A;  2KYM A;  5KYW A;  1M90 R;  5IXF A;  1M1F A;  1PKS A;  1Z9Q A;  2IIM A;  4D6W A;  2K3Y A;  4KH0 B;  1AHJ B;  5LJ3 j;  1YNZ A;  2XDB A;  1KQ2 A;  2RD1 A;  1MHN A;  1KC8 C;  3RKW A;  2RHX A;  2V26 A;  3OS2 A;  4OMM A;  1ACM B;  3EGU A;  2Y4Y A;  2G6F X;  2MWP A;  1B3Q A;  2ED1 A;  2E70 A;  2RA2 A;  4RCB A;  5LJ5 d;  3JCM P;  1SRL A;  2FO0 A;  1JEG A;  5DLO A;  2QQS A;  5GAN 6;  3FJ5 A;  5FU7 B;  1G2B A;  3UAT A;  2KEA A;  1VQ9 Q;  1YI2 T;  4LN2 A;  1MMG A;  4LXC A;  3CCM T;  4BI8 B;  1KC8 U;  1PKT A;  1VQO T;  4PJL A;  2L2P A;  4FSS A;  1ZUY A;  2RI3 A;  3RUX A;  1VQ4 Q;  2A3L A;  4MZT A;  8ATC B;  2OTJ T;  5GAN 2;  2WSC E;  4MDX A;  1BK2 A;  1XTD A;  3M9Q A;  2HCK A;  5EC7 A;  3RMS A;  5A0L A;  1Q86 U;  4JS5 A;  2I0N A;  2VB6 A;  4HXJ A;  5A0D A;  2DD4 A;  1SRM A;  2QYZ A;  1K73 U;  2CT4 A;  3CCE T;  3L2Z A;  2CDT A;  2EYX A;  1UHC A;  2MK5 A;  2X4Y A;  2RI2 A;  2BZX A;  2DXU A;  4KT0 E;  1ZBJ A;  4ZGD B;  4M78 F;  3DB3 A;  4PJO D;  4XAX B;  1NLO C;  2Z0W A;  3MP6 A;  3G6E Q;  2JN0 A;  5GAN h;  2QEX A;  4BE0 A;  2KQW A;  4FT4 A;  3PVQ A;  2VGM A;  1OQK A;  3GLX A;  1D0Z A;  4Z89 A;  1AT1 B;  2KE9 A;  3OYI A;  3I5S A;  1NPR A;  2DE0 X;  1PHT A;  2VWF A;  4PJO F;  2EQU A;  1PCX A;  2R5A A;  2BIV A;  1RLP C;  1I81 A;  1WZO A;  1Y0M A;  1YIT Q;  1KFZ A;  2PTK A;  4XTX A;  3RMQ A;  1VQK T;  1K9M U;  3HRT A;  4E47 A;  4OMF B;  3LWH A;  2QI2 A;  1AVZ C;  1M9S A;  3DB4 A;  4HVW A;  3TVT A;  3I56 T;  2QQA A;  3JCM V;  1EX4 A;  1I07 A;  5I11 A;  1YIT A;  2GF7 A;  2EQJ A;  1M5Q 1;  2L3R A;  4RUG A;  3RES A;  3A1P A;  3M57 A;  3OYD A;  1K76 A;  3M59 A;  1VQ4 T;  2FRY A;  1G3W A;  3FRN A;  3FLG A;  2BTT A;  4Y92 A;  1YBY A;  3QZ9 B;  5LJ3 g;  1W2B A;  5KYX A;  3X26 B;  4WCI A;  3G4S T;  2P4R A;  3H9N A;  1SSF A;  4Z8A A;  2MCN A;  1IB8 A;  1M3B A;  4RG8 A;  3PFS A;  1ABQ A;  2O31 A;  5AT1 B;  1UDL A;  4M75 F;  4ZN1 A;  2LQ8 A;  3X24 B;  2HDA A;  4M7A B;  3CXC S;  4ELZ C;  4IUU A;  3OYB A;  2RHU A;  4DEX A;  4EPC A;  1UGV A;  2GBQ A;  1Q7Y C;  1HD3 A;  2NWM A;  2RK1 A;  3CCJ T;  1QCN A;  2JMA A;  2KVQ G;  3QHS A;  5KYX B;  2CSI A;  3JCM f;  3EHQ A;  2JM8 A;  1YIJ Q;  1FYN A;  4K11 A;  2HKN A;  2E41 A;  3CC7 Q;  2NUT B;  3EH1 A;  5FU7 C;  2VXF A;  3EH2 A;  1S72 Q;  1M1K R;  3H41 A;  3REA B;  3V7S A;  4DBR A;  2DZ9 A;  1VOM A;  4OMO A;  3LYI A;  1PD1 A;  1N27 A;  5D6W A;  1TUC A;  1JJ2 S;  1E6H A;  1AZE A;  1VQK Q;  1R77 A;  4BI3 A;  1RAI B;  1PC0 A;  4RTU A;  1RAH B;  2KSS A;  3M0S A;  3MJX A;  3A8M B;  3RKY A;  1OV3 A;  2ZPF B;  2FVU A;  3EFO B;  2KGT A;  3G71 T;  1WHG A;  1DJ7 B;  3AT1 B;  1WXU A;  1VQN A;  4M77 D;  4RTV A;  1VIE A;  1X75 C;  3ZEH A;  3CMA T;  3E19 A;  1QWF A;  4NOY A;  3QII A;  2DBM A;  4M75 E;  4DBQ A;  2QDL A;  2RJE A;  4FYW B;  2LNV A;  3OYC A;  1YJW Q;  2YDL A;  1UG1 A;  3GF5 A;  1I4K 1;  2FG0 A;  4IUV A;  3M4G A;  3OSV A;  4AFS C;  5IHI A;  2FPD A;  4PJN A;  1VQ5 A;  3S6W A;  4FSX A;  2DXC A;  3DLM A;  4FYV B;  2QQB A;  4NL2 A;  4R56 A;  2E6N A;  2QQ9 A;  4DBF A;  5KYY A;  3M55 A;  1YJN Q;  1BI3 A;  3L2V A;  3M53 A;  3QG1 A;  1FMW A;  5KYN A;  3HP9 A;  4A54 A;  3JSC A;  1OX8 A;  3QJY A;  2O2O A;  2KMT A;  2KY9 A;  1WJR A;  1VQ9 T;  1KD1 C;  1YJN T;  4RTW A;  3CME T;  3HRU A;  2DL5 A;  5GAM d;  1WA7 A;  1YWO A;  1UEC A;  3PIP A;  4KUI A;  1OUL A;  2VKN A;  4MZP A;  1VQ8 Q;  4PL6 A;  3I56 A;  1YCY A;  5I22 A;  3UWN A;  2E6Z A;  2GNC A;  1TG0 A;  4OP0 A;  3OYK A;  4A4F A;  5IH2 A;  2CT3 A;  4J9B A;  5CKD A;  5I2M A;  1M3A A;  1VQP Q;  1RAF B;  3EG9 B;  1XJW B;  1X6B A;  1SG5 A;  3RDV A;  2K5I A;  3VUZ A;  1AOJ A;  4VUB A;  2RQT A;  3OYY A;  3NHN A;  2DL8 A;  1Q86 R;  2L3Q A;  2SEM A;  3Q1J A;  3QO3 A;  1D1A A;  4A4G A;  1IRE B;  1K8A R;  1K9M C;  4LDY A;  1LJO A;  2AKL A;  1UGS B;  1UHF A;  2DVE A;  3CCE A;  2VVK A;  1KIK A;  3QYG B;  1NLP C;  3HPW A;  3EG0 A;  3EHR A;  3CD6 T;  3CME A;  2V1Q A;  4II1 A;  2FPF A;  4E2F B;  5LJ5 g;  4DOW A;  1QVF S;  4M77 B;  3L2Q A;  3OW2 S;  3I9Q A;  3DLL A;  1G8X A;  4M75 G;  4J9C A;  2VYT A;  2RK2 A;  5GMK l;  3JCM d;  4JJD A;  1K0X A;  2ZPB B;  1SKU B;  4R55 A;  3L2W A;  1Q86 C;  3RIR A;  2YRD A;  2XHC A;  1N5Z A;  4E7J A;  3I35 A;  2RQR A;  3A8L B;  2C0T A;  5CIU A;  1AEY A;  2CZ7 B;  1PRM C;  2CS7 A;  1VYU A;  2ABL A;  3EGD B;  1O75 A;  1Y57 A;  2DLP A;  1UGQ B;  5HK0 A;  4F16 A;  1VQ5 Q;  2SRC A;  3BY7 A;  4A53 A;  1GCQ A;  2DTI A;  3NMZ C;  2A7Y A;  2ROL A;  3CCS Q;  1TU0 B;  1CKA A;  4F7U G;  3CC2 Q;  2FHD A;  2E12 A;  1ZUK A;  2KT1 A;  1LPL A;  1VUB A;  2LJ1 A;  4JLI A;  3QDR B;  1UJ0 A;  2RHI A;  5D6Y A;  3OYM A;  3L2U A;  1WXB A;  3CC4 T;  1ZSZ C;  2OTL Q;  1JJ2 P;  1TOV A;  1I5O B;  2K7A A;  3EAE A;  1IGQ A;  2XI9 A;  3VYG A;  1KQS S;  2E5Q A;  3G4S Q;  1TS9 A;  1D1B A;  3QXE B;  4L59 A;  2KK4 A;  3HFO A;  4FCY A;  2PVD B;  3PIO A;  5I2S A;  2DD5 A;  4FL6 A;  2NUP A;  1S1N A;  4ME7 A;  2X35 A;  1VQ7 T;  2GGR A;  3A5Z B;  4CC7 A;  2LJ3 A;  1OYX A;  5LJ3 d;  2YHT A;  3QWY A;  2PQW A;  3JCM b;  3EFR A;  1YJW T;  1XNI A;  1H3H A;  2NUZ A;  1BYM A;  1T3L A;  3THK A;  1MV3 A;  3CCL A;  1AD5 A;  5KYU A;  2MI6 A;  3CPW P;  1VQ6 A;  1FMK A;  1NJI C;  2F5T X;  1VQM T;  1I0C A;  1VQM Q;  3J80 E;  1AWJ A;  2MAM A;  2M0O A;  4M77 E;  2EQM A;  1WJQ A;  2CH4 A;  3MEW A;  4ZNX A;  2DFU A;  2KR3 A;  1YCS B;  2KBT A;  1IXD A;  4Z02 A;  2ZZD A;  3H8Z A;  2QQR A;  1EFN A;  1QLY A;  3QKJ A;  4AMC A;  3CPW A;  1D0X A;  4XK8 E;  4BB7 A; 
#chains in the Genus database with same CATH homology
 1M4Z A;  2HQX A;  3CMA A;  3LGL A;  4KT0 E;  4X9C A;  5CK9 A;  4XU3 A;  3ER0 A;  4ZGD B;  3CCV A;  4M78 F;  4ELY C;  3DB3 A;  4PJO D;  1BIB A;  4XAX B;  5J3B A;  2V8I A;  5GAN e;  2XK0 A;  3QSU A;  3MP6 A;  2G3R A;  4M7A G;  2JN0 A;  5GAN h;  2QEX A;  4BE0 A;  2KQW A;  2RHY A;  2PVG B;  4FT4 A;  2VGM A;  3M5A A;  4MMK A;  3UT1 A;  3OB9 A;  3GLX A;  3JCM Q;  3MP1 A;  3OBY A;  4XTZ A;  5LL6 S;  4M7A D;  3OYI A;  2O4X B;  4JRP A;  1NPR A;  1Y07 A;  5C6S A;  3HRS A;  5C0M A;  2B8A A;  2P4T A;  5GAO q;  4BE2 A;  4PJO F;  2EQU A;  1X6O A;  2CYZ B;  2FB7 A;  2PUK B;  1Y96 B;  4XU1 A;  2R5A A;  4IUP A;  2BIV A;  4MDW A;  1I81 A;  5GMK h;  4M7D G;  2QXF A;  4PNO A;  2LTO A;  2D6F A;  4XTX A;  3RMQ A;  1VQK T;  3UPU A;  5CVI A;  4KUD K;  5CCA A;  1G3Y A;  1HK9 A;  4M75 D;  3HRT A;  3WVD B;  5LJ3 h;  1BI1 A;  3CCS A;  4E47 A;  1M1K C;  1K9M U;  2OTL T;  4OMF B;  3LWH A;  2QI2 A;  1K73 C;  2HBP A;  3LW5 E;  3J81 E;  3V8J A;  4M7D B;  3E1S A;  1M9S A;  3OYL A;  3DB4 A;  4E7I A;  2EIF A;  3I56 T;  4EMK A;  2YLC A;  2QQA A;  4JLG A;  1UB4 A;  2VGN A;  3HHT B;  4GY5 A;  3JCM V;  3TU4 K;  3JCM g;  2XID A;  1YI2 A;  3ZBD A;  3GNF B;  5DY9 A;  3JB9 F;  3LH0 A;  4N4H A;  1YIT A;  2GF7 A;  1NJI U;  2EQJ A;  3CC2 T;  1GXI E;  1M5Q 1;  3C12 A;  3H6Z A;  1VQL A;  2DO3 A;  2L3R A;  4C92 F;  1EIF A;  5D6X A;  3AHU A;  3RES A;  1WGS A;  5KCO A;  2V8K A;  3MP8 A;  4C8Q B;  1O9S A;  3M57 A;  2EAY A;  1KHI A;  3OYD A;  1BKB A;  3JRZ A;  1IZ6 A;  3M59 A;  1VQ4 T;  4IUT A;  1FX7 A;  1I5L A;  4LDX A;  1G3W A;  4BDY A;  3GNG A;  1N9S A;  4NS5 A;  3MCA B;  3FRN A;  3FLG A;  3NTH A;  3CCS T;  1QVG A;  2OTL A;  2QTX A;  1YBY A;  3QZ9 B;  1WQ7 A;  5LJ3 g;  4XU2 A;  1W2B A;  2CGH A;  4FM4 B;  4C92 D;  1QVF A;  3E9G A;  3X26 B;  2LT1 A;  1S72 A;  2DEQ A;  3VU3 C;  2VXE A;  1N9R A;  3VJP A;  5FRN A;  4M75 C;  4RCC A;  3G4S T;  2MF2 A;  2FYK A;  2WSE E;  3BW1 A;  3MO8 A;  3JCM c;  3UDC A;  4C0G A;  1SSF A;  3CBP A;  2E10 A;  1XOV A;  1OI1 A;  3OYE A;  1Q82 C;  4UC4 A;  3OW2 A;  4C5G A;  4RG8 A;  2GCX A;  3PFS A;  4C5E A;  4M75 F;  4ZN1 A;  5GAN g;  3CEY A;  4PJO A;  2LQ8 A;  2M9U A;  4J83 A;  3X24 B;  3QYH B;  2MWO A;  4M7A B;  1Y7X A;  3OA6 A;  3CXC S;  4ELZ C;  1B34 A;  4IUU A;  2RHU A;  3C94 A;  4IUQ A;  2PUO B;  3BDL A;  3R6O A;  4J7F A;  4X9D A;  3OYB A;  4HCC A;  2DTO A;  4EPC A;  1VQM T;  4XU0 A;  1YJ9 A;  2RJD A;  1KHC A;  2RI5 A;  3JB9 J;  1Q7Y C;  2RM4 A;  3ASK A;  5J39 A;  2OTJ A;  1G3S A;  2P0K A;  2X4W A;  3SWN A;  4PLL A;  2C06 A;  3CC7 T;  2K2V A;  2RK1 A;  4HT8 A;  1Q81 C;  1KQ1 A;  3CCJ T;  3X25 B;  2KVQ G;  4A4K A;  3QHS A;  3KXT A;  4M77 F;  4TVR A;  4B9W A;  1R8O B;  3GPL A;  3FJP A;  4OVA A;  5IN1 A;  3JCM f;  3GP8 A;  3FIF A;  4RG2 A;  4C92 C;  4C0D B;  4N4I A;  4OB3 B;  2D0Q B;  2E41 A;  3VV0 A;  5LJ3 f;  4BUG A;  3S3N A;  5FU7 C;  1YJN A;  2VXF A;  4FU6 A;  3CC2 A;  2XD0 A;  3A8G B;  2R58 A;  2IG0 A;  4Q5W A;  4QVC A;  3BDU A;  2JUF A;  4ZGE B;  1JJ2 A;  3V7S A;  2DZ9 A;  2KDS A;  5FRO A;  3M4Y A;  2HNI A;  3CCL T;  3CCR A;  1Y71 A;  3LYI A;  2EYQ A;  4BAC A;  1BI2 A;  1N27 A;  5GMK e;  2HD0 A;  3CBO A;  5D6W A;  1U8R A;  5CR2 A;  1JJ2 S;  1VQO A;  4M78 G;  4BI3 A;  3OYA A;  1X01 A;  2Y4X A;  2IVW A;  2NLU A;  3JB9 I;  3WXM B;  4J6W A;  3OBW A;  2KSS A;  3P8B B;  4C92 E;  4JJN K;  3LX7 A;  2GQV A;  3SB2 A;  2AHJ B;  3A8M B;  4OGE A;  3JCM X;  3OY9 A;  5GAO r;  3RKY A;  4LDU A;  2ZPF B;  3TEE A;  2FVU A;  2DJZ A;  2YRV A;  5LJ5 j;  3QZ5 B;  3ZFJ A;  1UGR B;  3G71 T;  3OQ5 A;  4Y91 A;  1DJ7 B;  3MET A;  3I55 A;  1WNL A;  2BKD N;  2I2L A;  2XG8 D;  2ZPI B;  5AYF A;  4M7D F;  1VQN A;  1N8R C;  5GMK m;  1ZHI A;  2JZ2 A;  4M77 D;  1VIE A;  1UEB A;  1VQL T;  2RO0 A;  3F70 A;  1WPY A;  4KUL A;  1X75 C;  4N0A A;  3ZEH A;  4DOV A;  3CMA T;  3E19 A;  3PMT A;  1YIT T;  2VUB A;  5GMK i;  2DIG A;  3LWI A;  5GAN d;  2DKG A;  3ME9 A;  4NOY A;  3V8K A;  2PVO B;  3C4S A;  4C92 B;  4M7A A;  1M90 C;  3E9F A;  3QII A;  1ZQ1 A;  1WJS A;  3VKI A;  1P92 A;  1D3B B;  4M75 E;  4M7D E;  5KH6 A;  5LJ3 e;  2EFI A;  2RJE A;  3JCM J;  5A2Q E;  3M56 A;  1QP2 A;  4HKE A;  3CPF A;  2LNV A;  4RKU E;  4PKC C;  5GMK j;  3OYC A;  4DA4 A;  2CZ6 B;  5GAN f;  2BUD A;  3HFN A;  3JB9 D;  1MGQ A;  1YIJ A;  4BDZ A;  3CC4 A;  4C5H A;  1G5V A;  3GF5 A;  1I4K 1;  4WF2 A;  2ZGW A;  2JTF A;  4M7A C;  2JOY A;  4IUV A;  3M4G A;  5GAM g;  4M7D A;  2K5F A;  2RB6 A;  3OSV A;  2PU9 B;  5GAM e;  5LJ5 f;  3TCJ A;  4YTL A;  2RH2 A;  4IKF A;  1Q82 U;  5CAI A;  5GAO l;  1VQ5 A;  1PSE A;  3S6W A;  2XDP A;  4FSX A;  4C0D C;  2DXC A;  3MEA A;  4M75 A;  1QW1 A;  4MZM A;  3P8D A;  3DLM A;  3V7C A;  2VC8 A;  4FIB A;  3G71 A;  2QQB A;  3SD4 A;  4M75 B;  2LVM A;  1NZ9 A;  2XIC A;  4NL2 A;  2OAU A;  5M9O A;  2E6N A;  2QDY B;  4R56 A;  2QQ9 A;  3OMC A;  2EJF A;  4M78 B;  3DKM A;  1V29 B;  3M55 A;  5CO7 A;  4XTV A;  3INZ A;  3T9N A;  2L8D A;  5CQX A;  5DM7 R;  2JTM A;  4JUV A;  1BI3 A;  3MEU A;  3L2V A;  1YHQ T;  2LT4 A;  4LDV A;  2VV5 A;  3M53 A;  3LLR A;  3QG1 A;  2P0Q A;  4E7H A;  4ZTF A;  4PJO G;  3HP9 A;  3CCU T;  4A54 A;  4M77 C;  3JSC A;  4F7U E;  3QJY A;  3QBY A;  2KMT A;  2WAC A;  1QVP A;  2KY9 A;  3N5B B;  3TRE A;  4ZTJ A;  4PJO B;  1WJR A;  1VQ9 T;  1KD1 C;  4KBM B;  2V8J A;  4L6V 5;  2EJ9 A;  1YJN T;  2ZPE B;  1XQH A;  3HRU A;  4EMG A;  3CME T;  5IT9 E;  4C92 A;  1VQM A;  1QP3 A;  1BI0 A;  5GAM d;  4HCZ A;  4BY6 C;  4M77 A;  3HKS A;  3PIP A;  4KUI A;  5J26 A;  4MZP A;  4PL6 A;  3I56 A;  1YCY A;  2X4X A;  3UWN A;  4DQ2 A;  4QQD A;  5FU6 C;  4EMK C;  2E6Z A;  2ZPG B;  5A0G A;  3CC7 A;  4RMO A;  4QW2 A;  3SFM A;  4OP0 A;  2LC4 A;  3V8L A;  4BY6 B;  2L5Q A;  4GLK A;  5CKF A;  3OYK A;  4M7D D;  5GAM f;  5LJ5 e;  2E64 A;  2ZCF B;  4LD6 A;  4A4F A;  3QUI A;  4O5V A;  2K3X A;  2DAQ A;  3HSB A;  5KE2 A;  3S3M A;  5CKD A;  5I2M A;  3OSS C;  2FL7 A;  4Y28 E;  2DIQ A;  3X28 B;  4JS4 A;  1VQ7 A;  3M58 A;  5GAM j;  1VQN T;  2K5I A;  1VIF A;  3VUZ A;  4CI0 C;  3P8H A;  1ZBX A;  4VUB A;  2LRQ A;  4C8Q C;  1VQ5 T;  3OYN A;  2QEX T;  3OYY A;  2EQK A;  4A4H A;  3JB9 H;  3CCQ T;  1TH7 A;  2O01 E;  4M7D C;  3SWN B;  2F69 A;  4XTY A;  2JVV A;  2RHZ A;  3FEO A;  2LCC A;  2DTH A;  2DXB A;  2R57 A;  1S72 T;  3VUB A;  3CCV T;  5LJ5 h;  1M1K U;  1JRI A;  1KG1 A;  3Q1J A;  3A8H B;  4M78 A;  3QO3 A;  4B9X A;  1K8A C;  4C92 G;  1YIJ T;  2X4J A;  1JBM A;  4A4G A;  1IRE B;  3L1A A;  5CQY A;  5GAO m;  4C0Z A;  1K9M C;  4LDY A;  3CXC A;  1LJO A;  4C8Q D;  3CCQ A;  2EKO A;  4QVD A;  1UGS B;  2DVE A;  3SWN C;  3L2R A;  1H64 1;  3CCE A;  3QJ6 A;  4F7U A;  3CPW S;  4CRI A;  4C8Q E;  3QYG B;  3HPW A;  1NPP A;  4E7L A;  3M54 A;  3GOX A;  1FXX A;  2DK3 A;  4N0A C;  4M77 G;  3OYF A;  2EWN A;  2E1H A;  3PT9 A;  3CME A;  4X34 A;  3CD6 T;  3LGF A;  4PJO C;  4II1 A;  5GAN 4;  4J8O A;  2HQE A;  4EMH A;  5LJ5 g;  4DOW A;  4E7K A;  3RER A;  3KBG A;  3NTI A;  1QVF S;  4M77 B;  4MML A;  1VQ6 T;  5GAN 5;  3NFC A;  3BFM A;  5HY6 A;  5L8R E;  1W2B S;  3G7Z A;  5HK3 A;  3L2Q A;  4C8Q F;  3OW2 S;  4C0F A;  4QQ6 A;  1WQW A;  3URG A;  3JB9 G;  1M90 U;  3PNW C;  3DLL A;  2D9T A;  4OB0 B;  4M75 G;  3CCJ A;  3X20 B;  3JAM E;  1VQK A;  2MMP A;  4HCB A;  5EG2 A;  3OYH A;  5HKC A;  2VYT A;  1YJW A;  2KAF A;  2RK2 A;  5GMK l;  2LCL A;  3JCM d;  2ZPB B;  5FRM A;  2JNG A;  4R55 A;  3L42 A;  1KQS A;  3OS0 A;  4ZN3 A;  3L2W A;  4JRQ A;  1N8R U;  1Q86 C;  4M7A E;  5GAN 7;  3HL8 A;  3PMI A;  3RIR A;  4BE1 A;  2XHC A;  1W4S A;  1M1G A;  5FLX E;  2CZ1 B;  3SDZ A;  1M8V A;  3CCU A;  1BIA A;  3EFS A;  4E7J A;  2ZPH B;  4F7U B;  2LDM A;  3NTK A;  2K57 A;  4OB1 B;  3GIB A;  2WSF E;  2K4Y A;  2F5K A;  4P5N A;  3G6E A;  2DXT A;  3A8L B;  4IUR A;  1H3Z A;  4ZGJ B;  1Y96 A;  5CIU A;  4JRI A;  1LNX A;  2CZ7 B;  2GFU A;  4JRK A;  3J7A F;  4M7A F;  2DZC A;  2CS7 A;  5GAN 3;  4M78 C;  2XU8 A;  1O75 A;  4BD3 A;  2M1H A;  1UGQ B;  5HK0 A;  1UGP B;  1U1S A;  2Y90 A;  3BY7 A;  4A53 A;  1OZ3 A;  4ATO A;  2DTI A;  5FU6 B;  4EMK B;  2A7Y A;  4NL3 A;  1VQ4 A;  1N6A A;  3JCM h;  3JCM W;  5DLQ E;  4PJO E;  4XTU A;  5GAN j;  4F7U G;  2FHD A;  5GAN 8;  2E12 A;  4OGC A;  4XTW A;  1VQ9 A;  2QA4 A;  5GAO p;  3CD6 A;  1VUB A;  4O6J A;  4JLI A;  3QDR B;  4OF1 A;  3OYG A;  2QA4 T;  2DPP B;  2RHI A;  2YLB A;  4PLI A;  5D6Y A;  3OYM A;  3L2U A;  5IAY A;  3CC4 T;  2CZ0 B;  5KCH A;  1KD1 U;  1I8F A;  1M1F A;  3A8O B;  2O4X A;  4QVZ A;  2K3Y A;  4D6W A;  3PTA A;  4XQ3 A;  3EAE A;  2XI9 A;  4J6X A;  2GFA A;  3VYG A;  4EDU A;  4HA8 A;  4OB2 B;  3S3O A;  1AHJ B;  5LJ3 j;  1KQS S;  1U1T A;  2E5Q A;  5CKE A;  1FWZ A;  3G4S A;  2K5L A;  2XDB A;  4QQG A;  1VQP A;  2P0P A;  1MHN A;  2RD1 A;  1KC8 C;  1KQ2 A;  1JB0 E;  3RKW A;  2RHX A;  3OMG A;  3QXE B;  4L59 A;  4LDW A;  2KK4 A;  3OS2 A;  2R5M A;  3HFO A;  4A4E A;  2PVD B;  3PIO A;  2Y4Y A;  3C95 A;  5I2S A;  2DD5 A;  3G6E T;  2H3J A;  2MWP A;  4FL6 A;  2LQK A;  3RKX A;  3V7R A;  3MHX A;  3I55 T;  2L89 A;  2E70 A;  2RA2 A;  4RCB A;  4ME7 A;  5LJ5 d;  3JCM P;  4V2S A;  1NE8 A;  2X35 A;  1K8A U;  1VQ7 T;  2E65 A;  2XKO C;  3A5Z B;  2XDD A;  5CKB A;  5DLO A;  1YHQ A;  2QQS A;  5GAN 6;  4M78 D;  5FU7 B;  3FB9 A;  1OYX A;  3WVE B;  5GAO n;  3OYJ A;  1LOJ A;  5LJ3 d;  3PGG A;  4HT9 A;  2YHT A;  4BI4 A;  2LX9 A;  4FT2 A;  1VQP T;  1YI2 T;  2PQW A;  3CCM T;  3JCM b;  1QVG S;  3EFR A;  2HAX A;  1YJW T;  1XNI A;  1BYM A;  4BI8 B;  1KC8 U;  2RJF A;  1VQO T;  4J7I A;  5KE3 A;  1VQ8 T;  3FC3 A;  3KUF A;  3QPH A;  2RI3 A;  1Q7Y U;  3RUX A;  3CCR T;  3CCL A;  2A3L A;  3OS5 A;  2MI6 A;  4MZT A;  3VYH B;  1VQ6 A;  3O8V A;  4C8Q A;  2OTJ T;  1NJI C;  2RJC A;  2F5T X;  2WSC E;  1RI0 A;  5GAN 2;  1PSF A;  1XTD A;  3M9Q A;  4N4G A;  3MEV A;  4C8Q G;  1YJ9 T;  4MDX A;  3J80 E;  3OS1 A;  3CBM A;  3RMS A;  4L5G A;  2MAM A;  5A0L A;  1Q86 U;  4JS5 A;  2M0O A;  2EQM A;  1RL2 A;  4M77 E;  2M16 A;  1WJQ A;  5A0D A;  2DD4 A;  3MEW A;  5GAM h;  1K73 U;  4M78 E;  3FDR A;  2EJG A;  3JCM e;  4J6Y A;  3CCE T;  4Z02 A;  1B34 B;  2ZZD A;  1G3T A;  3L2Z A;  3H8Z A;  2QQR A;  4XK8 E;  1VQ8 A;  4LD9 K;  4F7U F;  1HXD A;  4C5I A;  2CKK A;  5I21 A;  3QKJ A;  4J5Y A;  3CPW A;  2X4Y A;  3CCM A;  1OZ2 A;  4JDS A;  1D3B A;  1Q81 U;  2RI2 A;  5CKH A;  2DXU A;  4BB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...