5GMKi

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
83
structure length
75
Chain Sequence
b'MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
molecule tags Rna binding protein/rna
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 7
structure length 75
sequence length 83
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmki00
2YLBA 3JB9J 5LJ3e 5LJ3d 3JB9I 4M78E 2DZ9A 4C92F 4EMKC 5GAMe 4EMHA 4M7DF 3SWNB 4M7AA 1M8VA 4MMKA 4XTZA 3VU3C 5GAMj 1LOJA 5GANh 4M7DC 4X9CA 1I5LA 4C92C 5GMKh 4PJOD 2DXTA 4M75D 1U1TA 5GAN3 2E41A 1LNXA 3AHUA 4XTUA 5LJ3h 4QVDA 1TH7A 4XU1A 5LJ5h 3JB9G 2DTOA 1Y96B 2DEQA 5GMKi 1B34A 2RD1A 4M78D 4M78G 3RKXA 1YCYA 3JCMQ 5GAMg 4MMLA 4XTXA 5GAOr 2VXFA 2CGHA 2VC8A 4XTVA 2JN0A 5LJ5d 5GAOm 4C8QG 3RERA 5GMKe 2RB6A 3L1AA 3BW1A 4PJOG 4C92E 4A53A 4M7DE 5GAOn 2QTXA 2EJ9A 4PJOA 3RKYA 4C8QF 3JB9D 1LJOA 4RCCA 5GAN2 3BFMA 4M7AG 3EFSA 3JCMf 3V7SA 5GAMd 4M7DB 4M78C 3JB9H 5I21A 4C92B 1I8FA 2EWNA 4XU3A 5GAOl 3FB9A 4C8QC 3JB9F 4M77A 1M5Q1 4J6YA 4EMKB 5GAN4 4XU2A 5GAOp 4JUVA 5DY9A 2I2LA 4M77E 2FYKA 1WNLA 1WQ7A 4M7DG 2HNIA 1JBMA 4J5YA 1MGQA 2DJZA 2EJFA 2DXUA 4NOYA 4OP0A 4DQ2A 5LJ5j 1N9RA 2DTHA 4M7AB 3SWNA 5GAMh 3JCMP 4WF2A 5GANj 4C92A 3JCMJ 4JLIA 3BY7A 3HFNA 3QO3A 4PNOA 4C8QE 5GANd 2YLCA 4M77B 1I81A 4RCBA 3JCMV 5GMKm 2FB7A 5LJ3j 1JRIA 1D3BB 4M78B 4XTWA 3V8JA 4F7UA 5GAN8 3RKWA 3INZA 4QVCA 1B34B 4M75C 4F7UG 4C8QB 3M4GA 5GAN7 4HA8A 2YHTA 4M77F 4M75E 4N0AA 5LJ3f 1I4K1 4XU0A 4A54A 5GAN5 2EJGA 1HK9A 4EMGA 4V2SA 3JCMg 4M77G 4J6XA 2E1HA 3L2ZA 3V7RA 3RIRA 4M7AC 4M78A 4F7UB 4XTYA 5LJ5f 2RA2A 1BIAA 2E64A 4PJOF 5LJ3g 1KQ2A 4M7DA 4M7AE 3V8LA 4C8QA 3HSBA 4M77C 3BDUA 3JCMe 2DZCA 4PJOC 3PGGA 2E65A 5GANg 4EMKA 2Y90A 4F7UF 1HXDA 4NL2A 1X01A 2VXEA 5GAMf 4C8QD 4M75F 5CAIA 5GMKj 5LJ5e 3JCMd 3JCMW 4M7AD 3SWNC 4JRIA 3RUXA 1N9SA 3HFOA 3JCMX 4HT9A 3QHSA 1Y96A 3JCMh 5GMKl 3V8KA 5GAOq 2ZGWA 4M77D 2E10A 4M75B 5LJ5g 3QSUA 4Y91A 4XQ3A 4PJOE 4M7AF 4M78F 3EFRA 3QUIA 4J6WA 1D3BA 2DKGA 2RM4A 4JRKA 3RESA 1WQWA 4X9DA 1BIBA 1KQ1A 5GAN6 2K57A 4F7UE 4PJOB 3JCMc 2EAYA 3FIFA 4HT8A 4M75G 3V7CA 3FJPA 2DTIA 2DVEA 3JCMb 4M7DD 4M75A 1H641 1U1SA 4C92D 5GANe 4C92G 4NL3A 3GIBA 3SB2A 1WPYA 4N0AC 5GANf
chains in the Genus database with same CATH superfamily
2YLBA 2WSCE 2HQEA 2LZ6B 2KEAA 3GNFB 4MZTA 1HYOA 3CPFA 1LOJA 2CS7A 2P0QA 2KGTA 2KE9A 4DA4A 1RADB 2DA9A 4QQGA 4ANJA 4XTUA 4QVDA 5J26A 1YIJA 4P5NA 4Y28E 4J9HA 4OGCA 1YCYA 1T3SA 5CIUA 8AT1B 2EGCA 2GQIA 4IIOA 1BI0A 1MMGA 3C0CA 5I21A 3OW2S 1I8FA 3CBPA 5FLXE 1UJ0A 1PSFA 1X69A 1I0CA 1AHJB 3CC7A 2HSEB 5CO7A 2QDLA 4C5EA 3CCST 4DOWA 2P0KA 2JTFA 1SEMA 3UT1A 1YJ9A 4JDSA 3CQTA 5KYXA 2X9HA 1TU0B 4IUQA 2JTMA 2QA4Q 5I2MA 2AZVA 3F70A 2K6DA 5ECAA 3QKJA 3EHQA 5CVIA 4FCYA 1ZUKA 2DYIA 2E1HA 4M7DA 4LD6A 1NM7A 3DB3A 3CCMQ 3PVQA 3P8HA 1GXIE 3JCMe 4BY6B 4L59A 2JMAA 2L89A 4A63B 1M3CA 2M16A 3NGPA 2P4RA 4M75F 1D1BA 1W1FA 3VRZA 4QVZA 2QQSA 2V8KA 3CCMT 2KRMA 3P8DA 3PMIA 5CKEA 4Y91A 4XQ3A 1D3BA 1IHVA 2FEIA 5GAN6 3EFOA 1O9SA 5D6WA 3ZL7C 1NEGA 2CSIA 5IAYA 1OU8A 2OAWA 3H0IA 1Q81C 3FC3A 1JU5C 1Q82R 2NUTA 5GANe 4E7IA 2L5QA 4BE0A 3L42A 3ULRB 1J3TA 5GANf 1KG1A 1ZSZC 4M78E 2DIQA 2VGMA 1RAEB 1QWFA 4JJNK 2KVQG 5I11A 3CCQT 1LNXA 1VQMQ 3G7ZA 3QWXX 2H3JA 3MHXA 5GAMg 3HRSA 1PD0A 2RB6A 3HL8A 3OA6A 5GAOn 3PIOA 3G71Q 4F04B 1VQ8A 5A0GA 1SKUB 1YHQQ 1OI1A 1AZEA 5IHNA 4C0FA 4ZN1A 1M5Q1 5FWCA 1VUBA 2QK0A 1LPLA 5D6YA 4O5VA 4C0DC 1TXQA 1MV0B 1HD3A 3JCMV 1K1ZA 2LT4A 4XTWA 2K5LA 3CMAQ 2RNAA 1QMCA 3OB9A 1X6OA 1N8RR 4IUPA 3CC7T 3CCLT 2K2MA 2OJ2A 2RA2A 1M90R 1M90C 3EG9B 3E9GA 1SF9A 5FU7B 3HRTA 1D0ZA 4L6V5 4ZTJA 5GMKj 2BZXA 3RUXA 3MO8A 3SD4A 2LP5A 3CD6A 3MEVA 3I55Q 5KCHA 1VQ5A 2YUOA 4E7SA 2FO0A 1QCOA 2X4JA 1ARKA 1BIBA 5FU7C 2DK3A 2LMJA 5DLQE 1MMAA 1K4US 2M0YA 2LDMA 1JJ2S 3X25B 4HT8A 3JCMb 2DVEA 4M75A 1H8KA 1M2VA 4HVVA 4C92G 3M4YA 4N0AC 5IHIA 5J39A 2LQWA 4Z88A 3CCMA 2DZ9A 2J06A 2M1HA 3ME9A 1H3HA 3NMZC 2DL5A 5GANh 3FJ5A 1VQ6A 7AT1B 5GMKh 4B9XA 1D1AA 2ZPIB 1UFFA 4JJCA 2CGHA 4CC4B 3NTHA 5GAOm 4C8QG 3BW1A 4C92E 1M1KU 3E2UA 4J9DA 1M3BA 4AG1C 1YJNQ 4RCCA 2HL3A 4XU3A 4EDUA 1Q82C 4XU2A 1ABQA 3FRNA 2BIVA 2DM1A 2C0OA 2EJFA 4R0KA 3QWYA 3TSWA 2DTHA 3VYHB 3X26B 5GANj 3HFNA 1IHWA 1IB8A 3A8HB 1MMNA 3V8JA 1VQ9T 1KC8C 5L23A 3GLXA 2KROA 2YHTA 3VKIA 4M77F 2MYSA 2D8JA 2LJ0A 3J7AF 2EYYA 3MP1A 4BB7A 1HK9A 4QT7A 1TUGB 3CC2Q 1G8XA 2RHXA 1CSKA 4M78A 4FM4B 2E64A 1N27A 1FMVA 5HKCA 2QQBA 1OX9A 1RUWA 2EYQA 1GCQC 2VXEA 3CCVT 3SFMA 4B9WA 2YUNA 1AD5A 4IUTA 3OYMA 1OEBA 1Y71A 4K11A 1Y07A 1RL2A 2V26A 4DBFA 2F2VA 3NHNA 4E7LA 5FU6B 2L3SA 5CQXA 4WTOB 1H92A 5GAN7 2LVMA 2V1QA 2E12A 2X3WD 3E9FA 2AKKA 3WXMB 2D0QB 3OYHA 2XDPA 1ZLMA 3VU3C 1I5OB 2K5IA 3HPWA 1OV3A 2KBTA 1PM3A 2KDSA 3M53A 2RHUA 2RJDA 1VQMA 3QDRB 1WGSA 2E3IA 3PTAA 2PVDB 4M78G 5FU6C 1O75A 1WA7A 5IH2A 5KYYA 3CCSA 1WI7A 2CREA 5GMKe 1BI1A 3QXEB 3GOXA 4OMNA 2EJ9A 3ZFJA 4C8QF 5A2QE 1YJWT 2FVUA 1WJQA 1X43A 4RUGA 4JZ4A 2KR3A 2DJQA 2VASA 4BDZA 1RACB 1IRXA 1Q7YR 4JLIA 3LWHA 2FB7A 2YDLA 3A1PA 1W6XA 2FL7A 1YNZA 1C0MA 5AYFA 4OMQA 2IPOB 2PZ1A 3OS1A 4V2SA 1QP2A 4M77G 4J6XA 1VQOQ 4F7UB 2VGNA 2COWA 1G3WA 2LQNA 2PNIA 2OTJT 4PJOC 2D0NA 5FRMA 1YWOA 2D1XA 2DE0X 1JB0E 1OPLA 2V8JA 1VQNQ 3VS7A 4X1VA 2KMTA 2E4HA 3L2UA 3HFOA 5IT9E 3CCRT 3BDLA 5KYUA 4ME7A 1Q7YC 1VOMA 1T0HA 2JT4A 2HBPA 3KBGA 1VQ9Q 4PJOB 4F7UE 1M27C 3M0UA 2EAYA 3PNWC 4KGVB 1YWPA 1X6GA 3VS4A 5IXFA 2ATCB 3X20B 1V29B 2X51A 2D9TA 2R5MA 3R6NA 3SWNB 2HL5C 1PKSA 2GTOA 2DXTA 5GAN3 1OZ3A 3O5ZA 4GLMA 1M1KR 3GNGA 4JRPA 1LVKA 4AMCA 1WHLA 4QQDA 4KULA 1YCSB 2RI5A 5CKDA 2JUFA 3KFVA 4M4ZA 1KQSA 3X28B 2FYKA 2HNIA 3EGDB 3I35A 3M59A 2PU9B 4C8QE 2VKNA 2RQRA 4HCCA 2L2PA 3CXCP 2LTOA 4HVUA 1VQPT 1YHQA 2KYBA 1ZX6A 3I55T 4N0AA 3PVLA 3MJXA 3OMGA 4PL6A 4A54A 4HKEA 3EAEA 5LJ3g 1KQ2A 4DBQA 2EQJA 2WSEE 1SHFA 2ZPEB 2E65A 4OGEA 1NE8A 2Y90A 1VQ4Q 1HXDA 2XICA 1KC8R 4M7AD 2CP3A 1W4SA 4FSSA 1OU9A 2JNGA 2GGRA 5GAOq 2AIRB 1GL5A 1VQ6T 4N4HA 2J6KA 1KQ1A 4OMMA 2CP7A 3EGUA 3A8LB 5L8RE 3JV3A 4RG8A 4PKCC 2M02A 1NJIU 4C92D 3GIBA 1BYMA 2J7IA 4E6RA 3OS2A 4R55A 2L3QA 1VQLT 3R6OA 4EMKC 3RMQA 4DOVA 1K0XA 4M7AA 3OYFA 4KRTA 2DBKA 2ED1A 1VQ4A 1VQNT 1I5LA 2PQWA 2DAQA 2KAFA 2O4XB 3KUFA 2BTTA 3EG3A 1TSFA 2RD1A 1G3YA 4OB1B 1VQ7A 2P0PA 4R56A 2EQKA 1EX4A 5FRNA 4QW2A 3UA7A 3CMET 2O31A 1D1CA 1K8AC 1TOVA 2L3PA 1M1KC 1BBZA 3EFSA 5GAMd 3V7SA 1YP5A 1SRMA 4C92B 2DL3A 4C8QC 5I2SA 1KIKA 2KYMA 4ESRA 4XAXB 1RI9A 4QKUA 3CPWA 3JAME 1QLYA 2MMPA 2AHJB 5EC7A 4Q5WA 1K0SA 3ZBDA 2CZ7B 2CH4A 4FL6A 5M9OA 2DIGA 1F1BB 1SSFA 2VV5A 3H41A 4C8QB 1C1AA 1FMKA 4IIMA 4M75E 2L0AA 2F1LA 3A98A 1OYXA 2GNCA 2DLPA 4EMGA 3L2WA 2H8HA 1TG0A 2LQKA 1A0NB 2MIOA 1WJSA 2QDYB 4IKFA 4LUDA 1ZSZB 3I5RA 3QG1A 4J9FA 1VIFA 2Y4YA 3VS1A 3NTKA 2LRQA 4LDWA 5KE2A 3LWIA 3I55A 4M75B 5KYWA 5EG2A 3QSUA 1KHCA 1UE9A 4FIBA 3VYGA 4JJBA 4LXCA 2G6FX 1M1GA 3M0SA 2NWMA 3JB9J 4MDWA 5LJ3e 5FROA 1Z9ZA 1SPKA 2QASA 4EMHA 1NBEB 2LQ8A 3FLGA 4NS5A 3HP9A 2RI2A 4X9CA 1U1TA 2Y4XA 3G4SQ 4AFSC 3G4SA 4C0DB 2KQWA 3AT1B 5GMKi 1K9MC 2EQIA 4XTXA 2JMCA 3E1SA 3VUZA 3PIPA 1YJ9Q 4BI3A 1WHHA 4PJOA 3EFOB 3M57A 2SEMA 4ZGDB 3BFMA 1KD1R 2CKKA 3C12A 4M78C 1Q81R 2QQAA 2SRCA 4J6YA 4EMKB 1VQNA 2GF7A 3T9NA 1AOJA 1I1JA 1OULA 2DXUA 2PUOB 2O9SA 1UHFA 3CD6Q 2OTJQ 2RI3A 2XHCA 1UGQB 1VQKT 2JW4A 4M77B 9ATCB 2CH4W 2M51A 1K9MU 1YITT 2CUBA 3OYIA 4M78B 2OI3A 1NG2A 3E19A 1VQ8T 3DLLA 2HEQA 1JXOA 2C06A 4PFOA 3S3NA 2COZA 1RAFB 1X2KA 1QCNA 1Q82U 1PC0A 4DEXA 3JRZA 2GCXA 2DMOA 3EH1A 5GAMf 2JVVA 1XNIA 2FG0A 2ED0A 3H0FA 2DD5A 1Y96A 2F2XA 2ZGWA 4M77D 2LC4A 1NZ9A 4LNPA 2EYXA 1G83A 3VJPA 2W0ZA 2YXYA 1IO6A 3OYNA 1AWWA 1ZSGA 2K57A 4J83A 1CKBA 2R57A 4HCKA 2ZPFB 4F16A 1FYNA 3EG9A 1R77A 2DRMA 4J8OA 1S72A 4C92F 3G6EA 3C94A 3OYLA 2XI9A 2FHDA 1QVPA 4OMOA 5J3BA 4RTUA 3JB9G 2DTOA 5GJWB 2DNUA 3C95A 4DBRA 3J81E 4PJOG 4QQ6A 1RAIB 1NLOC 3JB9D 3EHRA 4E7HA 2BUDA 8ATCB 5GJVB 1B3QA 4M77E 2RJFA 1WQ7A 1FXXA 5LJ5j 4WF2A 5I22A 2KI7A 2EBPA 1G3SA 2YLCA 5IN1A 1QVGP 4ZGJB 2DBMA 4F7UA 3TU4K 1VQLQ 3VS3A 1X75C 3S6WA 4MZMA 4D8DA 4J9CA 2XD0A 4HCBA 4AG2C 2HDAA 4OB3B 3JCMg 2YUQA 2XK0A 2GBQA 1OX8A 3M55A 2J6FA 1S1NA 2AZSA 1UDLA 2QTVA 3MEAA 5KE3A 2DZCA 3VS6A 1BCOA 3SHWA 1VQ6Q 1YITA 3ASKA 3GPLA 1KD1U 1UGVA 1ZA2B 3D7SB 2RHYA 4GBQA 3JCMh 5HCKA 3WVDB 3UA6A 1M2OA 3OYKA 3P8BB 4FU6A 2X4YA 1VQ4T 2YRCA 3CXCS 1IGQA 3QUIA 2YT6A 1G5VA 3GP8A 4B6MA 6AT1B 4LN2A 2CYZB 2JXBA 4RKUE 1G2BA 1VQ7T 1NYGA 1YI2Q 3CMEA 1V1CA 3O8VA 1VQPQ 3TQ7P 2F69A 5KH6A 1QVFS 4M7DF 4MMKA 3QBYA 5GAMj 1VYTA 1QW1A 2QGGA 3QPHA 3TVTA 2R58A 3CCUA 4XU1A 2WACA 4FYXB 3JB9I 1B34A 1ABOA 3CXCA 4MMLA 1PRLC 3OYAA 3VS5A 4C5GA 1UECA 1Q95G 1JJ2P 2BE9B 3RKYA 1LJOA 1S72T 3JCMf 2QA4T 4HXJA 3JB9H 4PLLA 4BD3A 4JJDA 1PCXA 3CCJT 4BI4A 2K4YA 2GTJA 2FRWA 2CP5A 4RMOA 1B7TA 5IXBA 2DL7A 3G71A 1WFWA 1VQ8Q 1MMDA 2HAXA 3MEUA 5GAN8 3CCVQ 4FYWB 3RKWA 1OOTA 2B8AA 2HQXA 1X2QA 1AVZC 2KXDA 2EYWA 2MAMA 4FYVB 2G3RA 3CBMA 4BE1A 2HQHA 4HCZA 2D8HA 1VQOA 2LNVA 2KY9A 3BDUA 1UGPB 4OMFB 2HCKA 1K73U 2Z0WA 4F7UF 5CKFA 4E47A 2JTEA 4C8QD 1QVGA 3SWNC 3CCRQ 4ELZC 3GBQA 4PJJA 2C0IA 2K9GA 3CC4A 1DJ7B 3EFRA 1EZZB 3OYCA 3G4ST 2QEXT 3Q1JA 2YUPA 2LJ3A 3NPFA 3I56Q 3EH2A 2CZ6B 2IVWA 3CCQQ 1X27A 3DB4A 1WHJA 2D6FA 1R8OB 4XK8E 2QG9B 1YJNA 2LCLA 3A5ZB 3QZ9B 4A4GA 2OTLQ 1TUCA 1TH7A 4LDXA 3U23A 3RKXA 1S72Q 2PVGB 3CCEA 2XU8A 2EKHA 3RERA 1VQKA 3L1AA 4A53A 4GLKA 3M0PA 4M7DE 3OMCA 1I07A 4RTXA 4J7FA 1W2BA 1UEBA 2MPXC 3QDFA 1MHNA 3OBWA 3JB9F 1N6AA 1WX6A 1WNLA 1UB4A 1YIJT 4CC2A 1MGQA 1GCQA 1N5ZA 4N4IA 4E2FB 1N8RC 3SWNA 5HK0A 2ZPGB 3JCMP 3BY7A 2RQTA 1X6BA 2FZKB 1I81A 2ZAEA 1MV3A 1YI2T 2ENMA 3CCVA 3INZA 4F7UG 2HKQB 1SSHA 2DL4A 3UF4A 4AT1B 5GAN5 2EJGA 3V7RA 5KYXB 3HSBA 2RQVA 2LCCA 5GANg 1PG5B 2K3XA 1N8RU 1VQ5Q 4C0ZA 5HK3A 2GQVA 2GFAA 3EGDA 1WJRA 3UPUA 3QIIA 2VVKA 2DO3A 3UDCA 1ACMB 4J9GA 3G6ET 5C0MA 1GRIA 2KXCA 1D09B 4KBMB 2RM4A 1LCKA 3HTRA 3JCMc 5D7UA 5DLOA 4MZPA 4BUGA 1Y0MA 2BZYA 1FMWA 2RO0A 3LLRA 4NL3A 2ESWA 1WHMA 2KT1A 3H9NA 5CCAA 2E6NA 2OX7A 2JZ2A 3M0QA 4JS5A 3THKA 3OS5A 4ELYC 2NUPB 3G6EQ 4PLIA 2RQUA 4J9EA 2QEXA 2DEQA 3M54A 5GAOr 1PSEA 2ROTA 4UC4A 3TSZA 4XTVA 5LJ5d 1T3LA 4CI0C 1HSQA 2QTXA 4LDVA 2NLUA 2KK4A 1M3AA 4ZTFA 1YJNT 2COYA 5CQYA 1BK2A 2MI6A 3EG2A 1K8AR 4FT2A 3VS0A 1ZUYA 3CCQA 2DRKA 3H0HA 3DLMA 4M7DG 2CZ0B 1EFNA 2DJZA 4DQ2A 4M7AB 3VS2A 4CC3A 2OTJA 1H3ZA 3RBBB 3JCMJ 2ECZA 3QYHB 4RTZA 4JLGA 1M4ZA 4TVRA 1YIJQ 2PUKB 1B34B 1E6HA 4M75C 3H8ZA 3JSCA 3M4GA 4HA8A 1M30A 1TWBA 2IIMA 4VUBA 4M7AC 2O88A 4XTYA 1IXDA 1AWJA 1BIAA 4M7AE 1WHKA 1AWOA 1KSWA 2RF0A 3MCAB 3A8GB 4JRQA 2CP6A 1SHGA 5KYNA 1QVFA 1KQSS 4JRIA 1KHIA 4KUIA 1NJIC 2BZ8A 2HMAA 4OB2B 2RHIA 2XKOC 1PKTA 3CCLA 4KUDK 1UHCA 3CCLQ 1BCMA 1WXBA 1YITQ 3QHSA 4ZN3A 2CSQA 1WDXA 5LJ3d 3NFCA 3CMAT 3CD6T 1PNJA 4II1A 4RG2A 1KQSP 1M8VA 4RTVA 3LGFA 2E41A 3HHTB 2QAZA 1BB9A 1QQJA 2O2OA 3QYGB 2ZPHB 2F5KA 2RH2A 4CC7A 3JCMQ 1AWXA 3LYIA 1YJ9T 3OW2A 4E7ZA 3OW2P 4ORZA 2K7AA 1VQPA 2KT8A 1YHQT 1U8RA 2EQUA 2PVOB 4KT0E 2M9UA 3CCEQ 2EPDA 4JUVA 5DY9A 2E70A 1HJDA 1KK7A 2JJ9A 1MUZA 1VQOT 4NOYA 4J5YA 2I0NA 4D6WA 3LX7A 1Q81U 4KH1B 4A4FA 4C5HA 3REBB 3TCJA 1M8MA 1Q86R 1D0YA 1JRIA 2QGFB 2OAUA 1JQQA 3CEYA 2WSFE 2K3BA 2DETA 5CKBA 4RTTA 2X3XD 3G1JA 2B86A 2NUTB 4PFZA 3L2ZA 5CK9A 5IHKA 4D8KA 1YN8A 2CDTA 3M56A 3S3MA 3V8LA 2DD4A 1YJWQ 4EMKA 4Z02A 4NL2A 4PFPA 1GCPA 1ZA1B 3JCMd 3N5BB 5LJ5e 3JCMW 1UGRB 2FZGB 4HT9A 2QXFA 2KSSA 5GMKl 2E3HA 3J80E 2E10A 4EIKA 4M7AF 2DKGA 1WQWA 3X24B 3PE0A 2CP0A 2LCSA 3H6ZA 4KGZB 4M7DD 1VQ7Q 1H641 3LH5A 2EW3A 1T0JA 4OMLA 4BY6C 3OYGA 3QJ6A 1K8AU 2FPEA 4FT4A 5GAMe 2OTLA 1BI2A 4YTLA 2JS2A 1PD1A 2ZPBB 2YWWA 3MP8A 3OSSC 3TREA 3PMTA 2IG0A 2A37A 1B07A 1Y96B 1UGSB 4M78D 1RAAB 1WHGA 2VC8A 3CMEQ 1QWEA 3MP6A 2HSPA 1WZOA 1QKXA 2LT1A 2DILA 5KYYB 3FB9A 1XQHA 1C6VX 2VUBA 1RAHB 4JS4A 2A08A 2NYSA 3MPUB 3CC2T 1GBRA 2LX9A 5GAMh 1VA7A 2NUPA 2QI2A 1WXTA 1PHTA 2RPNA 3HRUA 2RN8A 1IZ6A 2XDBA 4QVCA 3GF5A 1XTDA 2HBWA 1YJWA 1Q86U 2F5TX 1SRLA 1ZSZA 1RLQC 1UJYA 2EYZA 1RLPC 1ZQ1A 2HKNA 2RK1A 2VWFA 2KNBB 4N4GA 2R5AA 4M77C 2EKOA 2DL8A 2O9VA 4RTYA 4FW2A 2A3LA 3OQ5A 2O01E 3EGXA 2ROLA 2DF6A 3BE3A 4IURA 3A8OB 4FSXA 4PJMA 1KC8U 1WLPB 2JM9A 3OYDA 3OBYA 4GY5A 4Z89A 4IUUA 2YRDA 4AFQC 3MKDA 2KRNA 1U1SA 2V1RA 1TUDA 3ZEHA 2W10A 1K9AA 1FX7A 1U3OA 3META 2RK2A 5GAOp 4LE9A 5A0DA 3NTIA 4X34A 4OB0B 1AEYA 4XTZA 3VUBA 3URGA 1VIEA 2E5KA 4E7KA 4RTWA 1K76A 1JJ2A 4ZGEB 4ZNXA 3I56A 1K9MR 4DBHA 2AK5A 1KJWA 2VXFA 3LGLA 3M0TA 2DERA 2KRSA 3SDZA 2K3YA 5FW9A 1GFCA 4OMPA 1VQ9A 1OZ2A 5GAN2 4M7AG 5AT1B 2OTLT 1WYXA 3M9QA 1MNDA 3LW5E 4M77A 3TEEA 2I2LA 3CC7Q 3VRYA 3CCUT 3OYYA 3CPWP 1K73R 1QCFA 1Y7XA 2L3RA 3OYJA 2XDDA 3FDRA 1VQKQ 1JO8A 2F2WA 3QO3A 3RNJA 5GMKm 4RCBA 4JPBW 3RMSA 3UWNA 2QA4A 2LX7A 3REAB 2V8IA 4E7JA 4Y92A 5LJ3f 4BI8B 4J9BA 2E6ZA 2RQWA 2JM8A 4XU0A 2RJCA 3CCJA 2DVJA 3CC2A 1YBYA 2EIFA 1W2BP 5LJ5f 1R0CB 1NPPA 4PJOF 3RR6A 2M0OA 2CT4A 1YFNA 2A36A 1QKWA 3OY9A 5LL6S 1X01A 3G71T 1E7OA 2HZYA 3CMAA 3JCMX 3QZ5B 3L2RA 3OSVA 2PTKA 1XJWB 2X4WA 4AFZC 1CKAA 2DPPB 4OVAA 1VQMT 1QP3A 1G3TA 3IQLA 3CCUQ 1AT1B 5DM7R 2L8DA 2XG8D 4LDUA 3FJPA 1Q86C 2VYTA 1NPRA 1RAGB 3CCJQ 4BE2A 1AZGB 2MOXA 4HVWA 2RJEA 3I5SA 1XOVA 1W70A 1WXUA 3FEOA 1ZBXA 1NEBA 1QVGS 3RDVA 3S3OA 1KFZA 2K79A 1OPKA 1W2BS 4M7DC 3CC4T 2A7YA 2DYBA 1M2VB 4PJNA 1Z9QA 3AHUA 5LJ5h 1Q7YU 2MWPA 1JXMA 2VB6A 2JN0A 1NLPC 3DKMA 2NUZA 3HKSA 5A0LA 2EGEA 4A4HA 2EFIA 2O4XA 2K5FA 1VQLA 3UATA 3ER0A 4M7DB 3M0RA 4LDYA 3A8MB 2DX1A 2EWNA 5GAOl 1U5SA 4C5IA 5GAN4 4FYYB 4MDXA 3OS0A 3L2QA 2EGAA 2ABLA 1QVFP 5C6SA 4OP0A 2FPFA 1N9RA 1RABB 3EG0A 4C92A 2XMFA 5GANd 3CC4Q 2CP2A 2DFUA 1D3BB 1WIEA 4LD9K 1KD1C 3PT9A 3CCRA 2EVRA 1K73C 5CKHA 3L2VA 3CCSQ 2X4XA 1UTIA 1D0XA 2BE7D 2JS0A 4A4EA 5KCOA 3OYBA 2HD0A 2RMOA 3VV0A 2ZCFB 4C8QA 1NJIR 4BDYA 1BU1A 1TTHB 1ZBJA 1PWTA 2ZZDA 4OF1A 1YI2A 5CAIA 3LH0A 1FWZA 2CUDA 3MEWA 1N9SA 3WVEB 1VYVA 3V8KA 2J6OA 4WCIA 2DXBA 2QYZA 1MNEA 2MCNA 2AKLA 4Z8AA 4PJOE 4CRIA 2X35A 4J6WA 2H3EB 4JRKA 2P84A 4X9DA 2A28A 3EG1A 1EIFA 3FIFA 1RI0A 3V7CA 2XIDA 2FPDA 1GFDA 5KYWB 2E5QA 2K2VA 3SB2A 1WPYA 1R0BG 1PRMC 1U06A 4O6JA 2EQMA 2MWOA 4KH0B 5D6XA 1M1FA 4C92C 2YRVA 1VQ5T 4J9IA 4M75D 2FZCB 3EGXB 4PJOD 5LJ3h 4ATOA 4FW1A 1E6GA 2AT1B 4C0GA 1UG1A 2J05A 1IGUA 4F17A 1BKBA 3I9QA 5CR2A 1IREB 4PJLA 4A4KA 2C0TA 3CPWS 4EPCA 3KXTA 2LJ1A 1JBMA 2MK5A 1ZHIA 2FRYA 4LUEA 1BI3A 4IUVA 4PNOA 3CBOA 4JZ3A 5FWBA 5LJ3j 4L5GA 5HY6A 3M58A 1ZUUA 1I4K1 1OQKA 4F14A 2GFUA 1NYFA 2YSQA 4J7IA 3PFSA 3RIRA 2DEUA 4BACA 3PGGA 1TS9A 1Y57A 2DXCA 2CZ1B 2JOYA 4KGXB 2RHZA 1SG5A 2LNHB 2QQRA 3C4SA 2CT3A 3SEMA 1VYUA 3OYEA 1UUEA 2MF2A 5LJ5g 2BKDN 2P4TA 4DEYA 4M78F 1GBQA 3QJYA 3RESA 3M5AA 3I56T 1M9SA 2QQ9A 2QEXQ 4M75G 3CCET 5KYUB 1P92A 2DTIA 1JEGA 2A0FB 4AFUC 1M90U 4PK4A 1V76A
chains in the Genus database with same CATH topology
1V29B 2YLBA 2D9TA 2WSCE 2HQEA 3O8VA 3QJ6A 1K8AU 4FT4A 2R5MA 2F69A 5GAMe 2OTLA 5KH6A 1QVFS 4M7DF 3SWNB 1BI2A 4YTLA 3GNFB 4MMKA 4MZTA 3QBYA 3CPFA 5GAMj 1LOJA 2CS7A 1QW1A 2P0QA 2ZPBB 4DA4A 3QPHA 2DXTA 3MP8A 4QQGA 5GAN3 3OSSC 3TREA 2R58A 4XTUA 3CCUA 4QVDA 1OZ3A 5J26A 4XU1A 3PMTA 2IG0A 4P5NA 1YIJA 2WACA 4Y28E 1Y96B 4OGCA 3JB9I 1B34A 1UGSB 3GNGA 4M78D 3CXCA 1YCYA 5CIUA 4MMLA 4JRPA 3OYAA 2VC8A 4C5GA 4QQDA 1BI0A 4KULA 3MP6A 2RI5A 5CKDA 3RKYA 2JUFA 1LJOA 1S72T 3JCMf 2LT1A 2QA4T 3JB9H 5I21A 3OW2S 1I8FA 3CBPA 4PLLA 5FLXE 1KQSA 1PSFA 3FB9A 1XQHA 4BD3A 2VUBA 4JS4A 3X28B 2FYKA 3CCJT 4BI4A 3CC2T 1AHJB 2K4YA 3CC7A 2HNIA 1GXIE 5CO7A 3M59A 2PU9B 2LX9A 5GAMh 4C5EA 4RMOA 3CCST 2QI2A 4C8QE 4DOWA 2P0KA 2JTFA 4HCCA 3UT1A 1YJ9A 4JDSA 3G71A 3HRUA 2HAXA 3MEUA 5GAN8 1IZ6A 2XDBA 3RKWA 2LTOA 4QVCA 1VQPT 4IUQA 2B8AA 2HQXA 2JTMA 3GF5A 5I2MA 1YHQA 1XTDA 3F70A 1YJWA 3I55T 1Q86U 4N0AA 2MAMA 3QKJA 3OMGA 4PL6A 2F5TX 2G3RA 5CVIA 4A54A 3CBMA 4BE1A 4HCZA 4HKEA 3EAEA 2E1HA 1VQOA 1ZQ1A 2RK1A 2LNVA 5LJ3g 1KQ2A 2EQJA 2WSEE 4LD6A 3DB3A 4N4GA 4M7DA 2KY9A 2R5AA 2ZPEB 3P8HA 4M77C 3BDUA 1UGPB 4OMFB 2EKOA 4BY6B 3JCMe 4L59A 1K73U 2E65A 4OGEA 1NE8A 2Y90A 2L89A 2A3LA 4F7UF 1HXDA 5CKFA 2XICA 4E47A 3OQ5A 2O01E 2M16A 4M75F 4C8QD 1QVGA 4M7AD 1W4SA 3SWNC 4ELZC 4QVZA 2QQSA 2JNGA 2V8KA 3CCMT 3P8DA 4IURA 3A8OB 3PMIA 5GAOq 4FSXA 5CKEA 4Y91A 4XQ3A 1KC8U 1DJ7B 3CC4A 1VQ6T 3EFRA 3OYDA 1D3BA 3OBYA 4GY5A 4N4HA 3OYCA 3G4ST 4IUUA 1KQ1A 5GAN6 2QEXT 3Q1JA 1O9SA 5D6WA 3A8LB 5L8RE 5IAYA 1Q81C 3FC3A 4RG8A 4PKCC 1NJIU 1U1SA 2CZ6B 3ZEHA 4C92D 5GANe 1FX7A 1VQ5T 3META 2L5QA 2RK2A 2IVWA 4BE0A 3DB4A 3L42A 5GAOp 4E7IA 5GANf 2D6FA 3GIBA 1BYMA 1R8OB 4XK8E 1KG1A 3OS2A 4R55A 5A0DA 1YJNA 1VQLT 4M78E 2LCLA 2DIQA 2VGMA 3NTIA 3R6OA 4OB0B 4X34A 3RMQA 4DOVA 3A5ZB 4EMKC 3QZ9B 4A4GA 3OYFA 4M7AA 4XTZA 4JJNK 3VUBA 3URGA 1VIEA 2KVQG 1VQ4A 1I5LA 1VQNT 2PQWA 3CCQT 1LNXA 4E7KA 2DAQA 2KAFA 1JJ2A 1TH7A 2O4XB 3G7ZA 3KUFA 4ZGEB 4LDXA 3I56A 2H3JA 3MHXA 5GAMg 2RD1A 3RKXA 2PVGB 2VXFA 1G3YA 3CCEA 3LGLA 4OB1B 2XU8A 3SDZA 3HRSA 1VQ7A 3RERA 2K3YA 2P0PA 1VQKA 4R56A 2EQKA 2RB6A 3L1AA 3HL8A 4QW2A 4A53A 5FRNA 3CMET 4GLKA 3OA6A 4M7DE 3OMCA 5GAOn 3PIOA 1VQ9A 1K8AC 1VQ8A 1M1KC 1OZ2A 5A0GA 5GAN2 4M7AG 3EFSA 5GAMd 3V7SA 4J7FA 1W2BA 2OTLT 1UEBA 1OI1A 4C92B 1MHNA 3OBWA 4C0FA 4C8QC 4ZN1A 3M9QA 4M77A 3LW5E 1M5Q1 5I2SA 3JB9F 1VUBA 1N6AA 4XAXB 3TEEA 2I2LA 1WNLA 3CCUT 1UB4A 3OYYA 1YIJT 1MGQA 4N4IA 5D6YA 1Y7XA 2L3RA 3SWNA 5HK0A 3JAME 3CPWA 2ZPGB 1N8RC 2MMPA 2XDDA 4O5VA 2AHJB 3FDRA 4Q5WA 4C0DC 3BY7A 3OYJA 3QO3A 3ZBDA 2CZ7B 4FL6A 1I81A 4RCBA 3JCMV 5M9OA 5GMKm 1YI2T 2DIGA 2LT4A 4XTWA 1SSFA 3CCVA 2VV5A 3INZA 2K5LA 3RMSA 3UWNA 4F7UG 4C8QB 2QA4A 3OB9A 4E7JA 2V8IA 4M75E 1X6OA 5LJ3f 1OYXA 4BI8B 2E6ZA 4IUPA 4XU0A 5GAN5 2EJGA 4EMGA 3L2WA 2RJCA 2LQKA 3CCJA 3V7RA 3CC2A 1YBYA 3CC7T 2EIFA 3CCLT 5LJ5f 2RA2A 1M90C 1NPPA 4PJOF 2M0OA 1WJSA 3HSBA 2QDYB 3E9GA 2LCCA 5FU7B 3HRTA 5GANg 4IKFA 2K3XA 3OY9A 1N8RU 5LL6S 4C0ZA 5HK3A 1X01A 2GQVA 4L6V5 3QG1A 2GFAA 4ZTJA 1VIFA 2Y4YA 5GMKj 3G71T 3NTKA 1WJRA 2LRQA 3UPUA 3QIIA 3CMAA 2DO3A 3MO8A 3RUXA 3SD4A 4LDWA 5KE2A 3JCMX 3UDCA 3LWIA 3QZ5B 3CD6A 3MEVA 3I55A 3L2RA 3OSVA 4M75B 5C0MA 3G6ET 5EG2A 3QSUA 1KHCA 4KBMB 5KCHA 1VQ5A 2X4WA 4FIBA 2DPPB 2RM4A 4OVAA 1QP3A 1VQMT 2X4JA 1G3TA 1BIBA 5FU7C 2DK3A 3VYGA 5DLQE 3JCMc 5DM7R 2LDMA 1JJ2S 2L8DA 2XG8D 4LDUA 3X25B 5DLOA 3FJPA 4HT8A 4MZPA 1Q86C 4BUGA 1M1GA 2DVEA 2VYTA 3JCMb 4M75A 2RO0A 3JCMP 1NPRA 3LLRA 4C92G 4PJOD 4NL3A 3M4YA 4N0AC 3JB9J 4MDWA 4BE2A 2RJEA 5FROA 1XOVA 5CCAA 5J39A 5LJ3e 2E6NA 3FEOA 2JZ2A 1ZBXA 3CCMA 2DZ9A 4JS5A 1QVGS 2M1HA 3S3OA 4EMHA 3OS5A 4ELYC 3ME9A 2LQ8A 3FLGA 5GANh 4NS5A 1W2BS 4M7DC 3CC4T 2A7YA 3HP9A 2RI2A 4X9CA 1VQ6A 5GMKh 1U1TA 4B9XA 2Y4XA 4PLIA 3AHUA 3G4SA 2ZPIB 4C0DB 2KQWA 2MWPA 5LJ5h 2QEXA 1Q7YU 5GMKi 2DEQA 3M54A 1K9MC 5GAOr 1PSEA 4XTXA 4UC4A 2CGHA 4XTVA 2JN0A 5LJ5d 3NTHA 5GAOm 4C8QG 3E1SA 3DKMA 3HKSA 3VUZA 3BW1A 5A0LA 4C92E 3PIPA 1M1KU 4CI0C 4A4HA 4BI3A 2QTXA 4PJOA 2NLUA 2EFIA 2KK4A 4LDVA 2O4XA 3M57A 2K5FA 4RCCA 4ZGDB 4ZTFA 3BFMA 1YJNT 1VQLA 2CKKA 3ER0A 3C12A 4M78C 5CQYA 4LDYA 4M7DB 2MI6A 3A8MB 2EWNA 4XU3A 4EDUA 5GAOl 2QQAA 4J6YA 4C5IA 4EMKB 5GAN4 4XU2A 1Q82C 1VQNA 2GF7A 3T9NA 4FT2A 3CCQA 4MDXA 3OS0A 3L2QA 3DLMA 4M7DG 3FRNA 2BIVA 2CZ0B 5C6SA 2DJZA 2DXUA 2EJFA 4OP0A 4DQ2A 2PUOB 1N9RA 2DTHA 4M7AB 3VYHB 2OTJA 1H3ZA 2RI3A 3X26B 4C92A 3JCMJ 5GANj 3HFNA 5GANd 2XHCA 3QYHB 1UGQB 1VQKT 4C92C 4M77B 3A8HB 1K9MU 4JLGA 1YITT 3OYIA 1D3BB 3V8JA 4M78B 4LD9K 1M4ZA 1VQ9T 3E19A 1VQ8T 4TVRA 3DLLA 1KC8C 2PUKB 1B34B 4M75C 3PT9A 1KD1C 3H8ZA 3JSCA 3GLXA 3M4GA 2YHTA 4HA8A 3VKIA 4M77F 3CCRA 1K73C 2C06A 5CKHA 3L2VA 3S3NA 2X4XA 3MP1A 3J7AF 4BB7A 1HK9A 4VUBA 4A4EA 5KCOA 2RHXA 4M7AC 4M78A 3OYBA 4XTYA 2HD0A 1BIAA 2E64A 2ZCFB 1N27A 4FM4B 3VV0A 1Q82U 4M7AE 4C8QA 3MCAB 3A8GB 4JRQA 3JRZA 2GCXA 5HKCA 4BDYA 2QQBA 4OF1A 2ZZDA 1YI2A 2EYQA 1KQSS 1QVFA 2VXEA 5GAMf 2JVVA 5CAIA 1XNIA 3LH0A 3CCVT 1FWZA 4JRIA 1KHIA 3MEWA 1N9SA 3SFMA 3WVEB 4KUIA 2DD5A 1Y96A 4B9WA 3V8KA 2ZGWA 4M77D 2LC4A 4IUTA 2DXBA 3OYMA 1NJIC 1Y71A 1Y07A 1NZ9A 4PJOE 1RL2A 4CRIA 2X35A 4OB2B 4J6WA 2RHIA 2XKOC 3VJPA 4JRKA 3OYNA 4X9DA 3CCLA 2K57A 4KUDK 4J83A 2R57A 1EIFA 3FIFA 1RI0A 3V7CA 2XIDA 4E7LA 5FU6B 2E5QA 2K2VA 5CQXA 2ZPFB 3SB2A 2LVMA 1WPYA 3QHSA 4ZN3A 2E12A 5GAN7 4O6JA 2EQMA 5LJ3d 3NFCA 3E9FA 3CMAT 4J8OA 1S72A 3WXMB 3CD6T 4C92F 2D0QB 2MWOA 3OYHA 2XDPA 4II1A 4RG2A 1M8VA 3VU3C 3G6EA 5D6XA 2K5IA 3HPWA 3C94A 3OYLA 1M1FA 2XI9A 2KDSA 2YRVA 3M53A 3LGFA 4M75D 2FHDA 2RHUA 2E41A 1QVPA 2RJDA 3HHTB 1VQMA 5LJ3h 4ATOA 3QDRB 5J3BA 3QYGB 2ZPHB 4C0GA 1WGSA 2F5KA 2DTOA 2RH2A 3PTAA 3JB9G 2PVDB 3JCMQ 4M78G 5FU6C 1O75A 3LYIA 3CCSA 3J81E 3C95A 5GMKe 1YJ9T 1BI1A 1BKBA 4PJOG 4QQ6A 3OW2A 3QXEB 3GOXA 2EJ9A 3ZFJA 5CR2A 1IREB 4C8QF 3JB9D 1VQPA 5A2QE 1YHQT 1U8RA 2EQUA 2PVOB 4E7HA 2BUDA 1YJWT 4A4KA 2FVUA 4KT0E 2M9UA 1WJQA 3CPWS 4EPCA 4JUVA 3KXTA 5DY9A 2E70A 4M77E 2RJFA 1WQ7A 1VQOT 1JBMA 4J5YA 4NOYA 1ZHIA 1FXXA 5LJ5j 4D6WA 3LX7A 4BDZA 1Q81U 4WF2A 4A4FA 1BI3A 4C5HA 4JLIA 4IUVA 4PNOA 1G3SA 2YLCA 3CBOA 3TCJA 3LWHA 2FB7A 5LJ3j 5IN1A 4L5GA 5HY6A 1JRIA 4ZGJB 4F7UA 3TU4K 2OAUA 2FL7A 1X75C 3CEYA 2WSFE 5AYFA 3S6WA 4MZMA 3M58A 5CKBA 1I4K1 4HCBA 2XD0A 3OS1A 2GFUA 4V2SA 4OB3B 3JCMg 1QP2A 4J7IA 2XK0A 4J6XA 3PFSA 4M77G 3L2ZA 3M55A 3RIRA 5CK9A 4F7UB 2VGNA 4BACA 3M56A 1G3WA 3MEAA 3S3MA 3V8LA 2OTJT 5KE3A 2DZCA 4PJOC 3PGGA 2DD4A 5FRMA 4EMKA 2DXCA 2CZ1B 1JB0E 2JOYA 4Z02A 4NL2A 2V8JA 2RHZA 1YITA 3JCMd 3ASKA 3N5BB 5LJ5e 2QQRA 3GPLA 3JCMW 3C4SA 1KD1U 1UGRB 2KMTA 3L2UA 3HFOA 2RHYA 5IT9E 3CCRT 4HT9A 2QXFA 3JCMh 2KSSA 5GMKl 3J80E 3BDLA 2E10A 4ME7A 3OYEA 3WVDB 1Q7YC 2MF2A 5LJ5g 2BKDN 3OYKA 3P8BB 4FU6A 2X4YA 2P4TA 2HBPA 1VQ4T 3KBGA 4M78F 3QUIA 3CXCS 4M7AF 1G5VA 3GP8A 2DKGA 3QJYA 3RESA 1WQWA 3X24B 3M5AA 4PJOB 4F7UE 1M9SA 2CYZB 3I56T 2QQ9A 2EAYA 3PNWC 4RKUE 4M75G 3H6ZA 3CCET 1P92A 2DTIA 1VQ7T 4M7DD 1H641 1M90U 4BY6C 3CMEA 3X20B 3OYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLB A;  3JB9 J;  5LJ3 e;  5LJ3 d;  3JB9 I;  4M78 E;  2DZ9 A;  4C92 F;  4EMK C;  5GAM e;  4EMH A;  4M7D F;  3SWN B;  4M7A A;  1M8V A;  4MMK A;  4XTZ A;  3VU3 C;  5GAM j;  1LOJ A;  5GAN h;  4M7D C;  4X9C A;  1I5L A;  4C92 C;  5GMK h;  4PJO D;  2DXT A;  4M75 D;  1U1T A;  5GAN 3;  2E41 A;  1LNX A;  3AHU A;  4XTU A;  5LJ3 h;  4QVD A;  1TH7 A;  4XU1 A;  5LJ5 h;  3JB9 G;  2DTO A;  1Y96 B;  2DEQ A;  5GMK i;  1B34 A;  2RD1 A;  4M78 D;  4M78 G;  3RKX A;  1YCY A;  3JCM Q;  5GAM g;  4MML A;  4XTX A;  5GAO r;  2VXF A;  2CGH A;  2VC8 A;  4XTV A;  2JN0 A;  5LJ5 d;  5GAO m;  4C8Q G;  3RER A;  5GMK e;  2RB6 A;  3L1A A;  3BW1 A;  4PJO G;  4C92 E;  4A53 A;  4M7D E;  5GAO n;  2QTX A;  2EJ9 A;  4PJO A;  3RKY A;  4C8Q F;  3JB9 D;  1LJO A;  4RCC A;  5GAN 2;  3BFM A;  4M7A G;  3EFS A;  3JCM f;  3V7S A;  5GAM d;  4M7D B;  4M78 C;  3JB9 H;  5I21 A;  4C92 B;  1I8F A;  2EWN A;  4XU3 A;  5GAO l;  3FB9 A;  4C8Q C;  3JB9 F;  4M77 A;  1M5Q 1;  4J6Y A;  4EMK B;  5GAN 4;  4XU2 A;  5GAO p;  4JUV A;  5DY9 A;  2I2L A;  4M77 E;  2FYK A;  1WNL A;  1WQ7 A;  4M7D G;  2HNI A;  1JBM A;  4J5Y A;  1MGQ A;  2DJZ A;  2EJF A;  2DXU A;  4NOY A;  4OP0 A;  4DQ2 A;  5LJ5 j;  1N9R A;  2DTH A;  4M7A B;  3SWN A;  5GAM h;  3JCM P;  4WF2 A;  5GAN j;  4C92 A;  3JCM J;  4JLI A;  3BY7 A;  3HFN A;  3QO3 A;  4PNO A;  4C8Q E;  5GAN d;  2YLC A;  4M77 B;  1I81 A;  4RCB A;  3JCM V;  5GMK m;  2FB7 A;  5LJ3 j;  1JRI A;  1D3B B;  4M78 B;  4XTW A;  3V8J A;  4F7U A;  5GAN 8;  3RKW A;  3INZ A;  4QVC A;  1B34 B;  4M75 C;  4F7U G;  4C8Q B;  3M4G A;  5GAN 7;  4HA8 A;  2YHT A;  4M77 F;  4M75 E;  4N0A A;  5LJ3 f;  1I4K 1;  4XU0 A;  4A54 A;  5GAN 5;  2EJG A;  1HK9 A;  4EMG A;  4V2S A;  3JCM g;  4M77 G;  4J6X A;  2E1H A;  3L2Z A;  3V7R A;  3RIR A;  4M7A C;  4M78 A;  4F7U B;  4XTY A;  5LJ5 f;  2RA2 A;  1BIA A;  2E64 A;  4PJO F;  5LJ3 g;  1KQ2 A;  4M7D A;  4M7A E;  3V8L A;  4C8Q A;  3HSB A;  4M77 C;  3BDU A;  3JCM e;  2DZC A;  4PJO C;  3PGG A;  2E65 A;  5GAN g;  4EMK A;  2Y90 A;  4F7U F;  1HXD A;  4NL2 A;  1X01 A;  2VXE A;  5GAM f;  4C8Q D;  4M75 F;  5CAI A;  5GMK j;  5LJ5 e;  3JCM d;  3JCM W;  4M7A D;  3SWN C;  4JRI A;  3RUX A;  1N9S A;  3HFO A;  3JCM X;  4HT9 A;  3QHS A;  1Y96 A;  3JCM h;  5GMK l;  3V8K A;  5GAO q;  2ZGW A;  4M77 D;  2E10 A;  4M75 B;  5LJ5 g;  3QSU A;  4Y91 A;  4XQ3 A;  4PJO E;  4M7A F;  4M78 F;  3EFR A;  3QUI A;  4J6W A;  1D3B A;  2DKG A;  2RM4 A;  4JRK A;  3RES A;  1WQW A;  4X9D A;  1BIB A;  1KQ1 A;  5GAN 6;  2K57 A;  4F7U E;  4PJO B;  3JCM c;  2EAY A;  3FIF A;  4HT8 A;  4M75 G;  3V7C A;  3FJP A;  2DTI A;  2DVE A;  3JCM b;  4M7D D;  4M75 A;  1H64 1;  1U1S A;  4C92 D;  5GAN e;  4C92 G;  4NL3 A;  3GIB A;  3SB2 A;  1WPY A;  4N0A C;  5GAN f; 
#chains in the Genus database with same CATH topology
 2YLB A;  2WSC E;  2HQE A;  2LZ6 B;  2KEA A;  3GNF B;  4MZT A;  1HYO A;  3CPF A;  1LOJ A;  2CS7 A;  2P0Q A;  2KGT A;  2KE9 A;  4DA4 A;  1RAD B;  2DA9 A;  4QQG A;  4ANJ A;  4XTU A;  4QVD A;  5J26 A;  1YIJ A;  4P5N A;  4Y28 E;  4J9H A;  4OGC A;  1YCY A;  1T3S A;  5CIU A;  8AT1 B;  2EGC A;  2GQI A;  4IIO A;  1BI0 A;  1MMG A;  3C0C A;  5I21 A;  3OW2 S;  1I8F A;  3CBP A;  5FLX E;  1UJ0 A;  1PSF A;  1X69 A;  1I0C A;  1AHJ B;  3CC7 A;  2HSE B;  5CO7 A;  2QDL A;  4C5E A;  3CCS T;  4DOW A;  2P0K A;  2JTF A;  1SEM A;  3UT1 A;  1YJ9 A;  4JDS A;  3CQT A;  5KYX A;  2X9H A;  1TU0 B;  4IUQ A;  2JTM A;  2QA4 Q;  5I2M A;  2AZV A;  3F70 A;  2K6D A;  5ECA A;  3QKJ A;  3EHQ A;  5CVI A;  4FCY A;  1ZUK A;  2DYI A;  2E1H A;  4M7D A;  4LD6 A;  1NM7 A;  3DB3 A;  3CCM Q;  3PVQ A;  3P8H A;  1GXI E;  3JCM e;  4BY6 B;  4L59 A;  2JMA A;  2L89 A;  4A63 B;  1M3C A;  2M16 A;  3NGP A;  2P4R A;  4M75 F;  1D1B A;  1W1F A;  3VRZ A;  4QVZ A;  2QQS A;  2V8K A;  3CCM T;  2KRM A;  3P8D A;  3PMI A;  5CKE A;  4Y91 A;  4XQ3 A;  1D3B A;  1IHV A;  2FEI A;  5GAN 6;  3EFO A;  1O9S A;  5D6W A;  3ZL7 C;  1NEG A;  2CSI A;  5IAY A;  1OU8 A;  2OAW A;  3H0I A;  1Q81 C;  3FC3 A;  1JU5 C;  1Q82 R;  2NUT A;  5GAN e;  4E7I A;  2L5Q A;  4BE0 A;  3L42 A;  3ULR B;  1J3T A;  5GAN f;  1KG1 A;  1ZSZ C;  4M78 E;  2DIQ A;  2VGM A;  1RAE B;  1QWF A;  4JJN K;  2KVQ G;  5I11 A;  3CCQ T;  1LNX A;  1VQM Q;  3G7Z A;  3QWX X;  2H3J A;  3MHX A;  5GAM g;  3HRS A;  1PD0 A;  2RB6 A;  3HL8 A;  3OA6 A;  5GAO n;  3PIO A;  3G71 Q;  4F04 B;  1VQ8 A;  5A0G A;  1SKU B;  1YHQ Q;  1OI1 A;  1AZE A;  5IHN A;  4C0F A;  4ZN1 A;  1M5Q 1;  5FWC A;  1VUB A;  2QK0 A;  1LPL A;  5D6Y A;  4O5V A;  4C0D C;  1TXQ A;  1MV0 B;  1HD3 A;  3JCM V;  1K1Z A;  2LT4 A;  4XTW A;  2K5L A;  3CMA Q;  2RNA A;  1QMC A;  3OB9 A;  1X6O A;  1N8R R;  4IUP A;  3CC7 T;  3CCL T;  2K2M A;  2OJ2 A;  2RA2 A;  1M90 R;  1M90 C;  3EG9 B;  3E9G A;  1SF9 A;  5FU7 B;  3HRT A;  1D0Z A;  4L6V 5;  4ZTJ A;  5GMK j;  2BZX A;  3RUX A;  3MO8 A;  3SD4 A;  2LP5 A;  3CD6 A;  3MEV A;  3I55 Q;  5KCH A;  1VQ5 A;  2YUO A;  4E7S A;  2FO0 A;  1QCO A;  2X4J A;  1ARK A;  1BIB A;  5FU7 C;  2DK3 A;  2LMJ A;  5DLQ E;  1MMA A;  1K4U S;  2M0Y A;  2LDM A;  1JJ2 S;  3X25 B;  4HT8 A;  3JCM b;  2DVE A;  4M75 A;  1H8K A;  1M2V A;  4HVV A;  4C92 G;  3M4Y A;  4N0A C;  5IHI A;  5J39 A;  2LQW A;  4Z88 A;  3CCM A;  2DZ9 A;  2J06 A;  2M1H A;  3ME9 A;  1H3H A;  3NMZ C;  2DL5 A;  5GAN h;  3FJ5 A;  1VQ6 A;  7AT1 B;  5GMK h;  4B9X A;  1D1A A;  2ZPI B;  1UFF A;  4JJC A;  2CGH A;  4CC4 B;  3NTH A;  5GAO m;  4C8Q G;  3BW1 A;  4C92 E;  1M1K U;  3E2U A;  4J9D A;  1M3B A;  4AG1 C;  1YJN Q;  4RCC A;  2HL3 A;  4XU3 A;  4EDU A;  1Q82 C;  4XU2 A;  1ABQ A;  3FRN A;  2BIV A;  2DM1 A;  2C0O A;  2EJF A;  4R0K A;  3QWY A;  3TSW A;  2DTH A;  3VYH B;  3X26 B;  5GAN j;  3HFN A;  1IHW A;  1IB8 A;  3A8H B;  1MMN A;  3V8J A;  1VQ9 T;  1KC8 C;  5L23 A;  3GLX A;  2KRO A;  2YHT A;  3VKI A;  4M77 F;  2MYS A;  2D8J A;  2LJ0 A;  3J7A F;  2EYY A;  3MP1 A;  4BB7 A;  1HK9 A;  4QT7 A;  1TUG B;  3CC2 Q;  1G8X A;  2RHX A;  1CSK A;  4M78 A;  4FM4 B;  2E64 A;  1N27 A;  1FMV A;  5HKC A;  2QQB A;  1OX9 A;  1RUW A;  2EYQ A;  1GCQ C;  2VXE A;  3CCV T;  3SFM A;  4B9W A;  2YUN A;  1AD5 A;  4IUT A;  3OYM A;  1OEB A;  1Y71 A;  4K11 A;  1Y07 A;  1RL2 A;  2V26 A;  4DBF A;  2F2V A;  3NHN A;  4E7L A;  5FU6 B;  2L3S A;  5CQX A;  4WTO B;  1H92 A;  5GAN 7;  2LVM A;  2V1Q A;  2E12 A;  2X3W D;  3E9F A;  2AKK A;  3WXM B;  2D0Q B;  3OYH A;  2XDP A;  1ZLM A;  3VU3 C;  1I5O B;  2K5I A;  3HPW A;  1OV3 A;  2KBT A;  1PM3 A;  2KDS A;  3M53 A;  2RHU A;  2RJD A;  1VQM A;  3QDR B;  1WGS A;  2E3I A;  3PTA A;  2PVD B;  4M78 G;  5FU6 C;  1O75 A;  1WA7 A;  5IH2 A;  5KYY A;  3CCS A;  1WI7 A;  2CRE A;  5GMK e;  1BI1 A;  3QXE B;  3GOX A;  4OMN A;  2EJ9 A;  3ZFJ A;  4C8Q F;  5A2Q E;  1YJW T;  2FVU A;  1WJQ A;  1X43 A;  4RUG A;  4JZ4 A;  2KR3 A;  2DJQ A;  2VAS A;  4BDZ A;  1RAC B;  1IRX A;  1Q7Y R;  4JLI A;  3LWH A;  2FB7 A;  2YDL A;  3A1P A;  1W6X A;  2FL7 A;  1YNZ A;  1C0M A;  5AYF A;  4OMQ A;  2IPO B;  2PZ1 A;  3OS1 A;  4V2S A;  1QP2 A;  4M77 G;  4J6X A;  1VQO Q;  4F7U B;  2VGN A;  2COW A;  1G3W A;  2LQN A;  2PNI A;  2OTJ T;  4PJO C;  2D0N A;  5FRM A;  1YWO A;  2D1X A;  2DE0 X;  1JB0 E;  1OPL A;  2V8J A;  1VQN Q;  3VS7 A;  4X1V A;  2KMT A;  2E4H A;  3L2U A;  3HFO A;  5IT9 E;  3CCR T;  3BDL A;  5KYU A;  4ME7 A;  1Q7Y C;  1VOM A;  1T0H A;  2JT4 A;  2HBP A;  3KBG A;  1VQ9 Q;  4PJO B;  4F7U E;  1M27 C;  3M0U A;  2EAY A;  3PNW C;  4KGV B;  1YWP A;  1X6G A;  3VS4 A;  5IXF A;  2ATC B;  3X20 B;  1V29 B;  2X51 A;  2D9T A;  2R5M A;  3R6N A;  3SWN B;  2HL5 C;  1PKS A;  2GTO A;  2DXT A;  5GAN 3;  1OZ3 A;  3O5Z A;  4GLM A;  1M1K R;  3GNG A;  4JRP A;  1LVK A;  4AMC A;  1WHL A;  4QQD A;  4KUL A;  1YCS B;  2RI5 A;  5CKD A;  2JUF A;  3KFV A;  4M4Z A;  1KQS A;  3X28 B;  2FYK A;  2HNI A;  3EGD B;  3I35 A;  3M59 A;  2PU9 B;  4C8Q E;  2VKN A;  2RQR A;  4HCC A;  2L2P A;  3CXC P;  2LTO A;  4HVU A;  1VQP T;  1YHQ A;  2KYB A;  1ZX6 A;  3I55 T;  4N0A A;  3PVL A;  3MJX A;  3OMG A;  4PL6 A;  4A54 A;  4HKE A;  3EAE A;  5LJ3 g;  1KQ2 A;  4DBQ A;  2EQJ A;  2WSE E;  1SHF A;  2ZPE B;  2E65 A;  4OGE A;  1NE8 A;  2Y90 A;  1VQ4 Q;  1HXD A;  2XIC A;  1KC8 R;  4M7A D;  2CP3 A;  1W4S A;  4FSS A;  1OU9 A;  2JNG A;  2GGR A;  5GAO q;  2AIR B;  1GL5 A;  1VQ6 T;  4N4H A;  2J6K A;  1KQ1 A;  4OMM A;  2CP7 A;  3EGU A;  3A8L B;  5L8R E;  3JV3 A;  4RG8 A;  4PKC C;  2M02 A;  1NJI U;  4C92 D;  3GIB A;  1BYM A;  2J7I A;  4E6R A;  3OS2 A;  4R55 A;  2L3Q A;  1VQL T;  3R6O A;  4EMK C;  3RMQ A;  4DOV A;  1K0X A;  4M7A A;  3OYF A;  4KRT A;  2DBK A;  2ED1 A;  1VQ4 A;  1VQN T;  1I5L A;  2PQW A;  2DAQ A;  2KAF A;  2O4X B;  3KUF A;  2BTT A;  3EG3 A;  1TSF A;  2RD1 A;  1G3Y A;  4OB1 B;  1VQ7 A;  2P0P A;  4R56 A;  2EQK A;  1EX4 A;  5FRN A;  4QW2 A;  3UA7 A;  3CME T;  2O31 A;  1D1C A;  1K8A C;  1TOV A;  2L3P A;  1M1K C;  1BBZ A;  3EFS A;  5GAM d;  3V7S A;  1YP5 A;  1SRM A;  4C92 B;  2DL3 A;  4C8Q C;  5I2S A;  1KIK A;  2KYM A;  4ESR A;  4XAX B;  1RI9 A;  4QKU A;  3CPW A;  3JAM E;  1QLY A;  2MMP A;  2AHJ B;  5EC7 A;  4Q5W A;  1K0S A;  3ZBD A;  2CZ7 B;  2CH4 A;  4FL6 A;  5M9O A;  2DIG A;  1F1B B;  1SSF A;  2VV5 A;  3H41 A;  4C8Q B;  1C1A A;  1FMK A;  4IIM A;  4M75 E;  2L0A A;  2F1L A;  3A98 A;  1OYX A;  2GNC A;  2DLP A;  4EMG A;  3L2W A;  2H8H A;  1TG0 A;  2LQK A;  1A0N B;  2MIO A;  1WJS A;  2QDY B;  4IKF A;  4LUD A;  1ZSZ B;  3I5R A;  3QG1 A;  4J9F A;  1VIF A;  2Y4Y A;  3VS1 A;  3NTK A;  2LRQ A;  4LDW A;  5KE2 A;  3LWI A;  3I55 A;  4M75 B;  5KYW A;  5EG2 A;  3QSU A;  1KHC A;  1UE9 A;  4FIB A;  3VYG A;  4JJB A;  4LXC A;  2G6F X;  1M1G A;  3M0S A;  2NWM A;  3JB9 J;  4MDW A;  5LJ3 e;  5FRO A;  1Z9Z A;  1SPK A;  2QAS A;  4EMH A;  1NBE B;  2LQ8 A;  3FLG A;  4NS5 A;  3HP9 A;  2RI2 A;  4X9C A;  1U1T A;  2Y4X A;  3G4S Q;  4AFS C;  3G4S A;  4C0D B;  2KQW A;  3AT1 B;  5GMK i;  1K9M C;  2EQI A;  4XTX A;  2JMC A;  3E1S A;  3VUZ A;  3PIP A;  1YJ9 Q;  4BI3 A;  1WHH A;  4PJO A;  3EFO B;  3M57 A;  2SEM A;  4ZGD B;  3BFM A;  1KD1 R;  2CKK A;  3C12 A;  4M78 C;  1Q81 R;  2QQA A;  2SRC A;  4J6Y A;  4EMK B;  1VQN A;  2GF7 A;  3T9N A;  1AOJ A;  1I1J A;  1OUL A;  2DXU A;  2PUO B;  2O9S A;  1UHF A;  3CD6 Q;  2OTJ Q;  2RI3 A;  2XHC A;  1UGQ B;  1VQK T;  2JW4 A;  4M77 B;  9ATC B;  2CH4 W;  2M51 A;  1K9M U;  1YIT T;  2CUB A;  3OYI A;  4M78 B;  2OI3 A;  1NG2 A;  3E19 A;  1VQ8 T;  3DLL A;  2HEQ A;  1JXO A;  2C06 A;  4PFO A;  3S3N A;  2COZ A;  1RAF B;  1X2K A;  1QCN A;  1Q82 U;  1PC0 A;  4DEX A;  3JRZ A;  2GCX A;  2DMO A;  3EH1 A;  5GAM f;  2JVV A;  1XNI A;  2FG0 A;  2ED0 A;  3H0F A;  2DD5 A;  1Y96 A;  2F2X A;  2ZGW A;  4M77 D;  2LC4 A;  1NZ9 A;  4LNP A;  2EYX A;  1G83 A;  3VJP A;  2W0Z A;  2YXY A;  1IO6 A;  3OYN A;  1AWW A;  1ZSG A;  2K57 A;  4J83 A;  1CKB A;  2R57 A;  4HCK A;  2ZPF B;  4F16 A;  1FYN A;  3EG9 A;  1R77 A;  2DRM A;  4J8O A;  1S72 A;  4C92 F;  3G6E A;  3C94 A;  3OYL A;  2XI9 A;  2FHD A;  1QVP A;  4OMO A;  5J3B A;  4RTU A;  3JB9 G;  2DTO A;  5GJW B;  2DNU A;  3C95 A;  4DBR A;  3J81 E;  4PJO G;  4QQ6 A;  1RAI B;  1NLO C;  3JB9 D;  3EHR A;  4E7H A;  2BUD A;  8ATC B;  5GJV B;  1B3Q A;  4M77 E;  2RJF A;  1WQ7 A;  1FXX A;  5LJ5 j;  4WF2 A;  5I22 A;  2KI7 A;  2EBP A;  1G3S A;  2YLC A;  5IN1 A;  1QVG P;  4ZGJ B;  2DBM A;  4F7U A;  3TU4 K;  1VQL Q;  3VS3 A;  1X75 C;  3S6W A;  4MZM A;  4D8D A;  4J9C A;  2XD0 A;  4HCB A;  4AG2 C;  2HDA A;  4OB3 B;  3JCM g;  2YUQ A;  2XK0 A;  2GBQ A;  1OX8 A;  3M55 A;  2J6F A;  1S1N A;  2AZS A;  1UDL A;  2QTV A;  3MEA A;  5KE3 A;  2DZC A;  3VS6 A;  1BCO A;  3SHW A;  1VQ6 Q;  1YIT A;  3ASK A;  3GPL A;  1KD1 U;  1UGV A;  1ZA2 B;  3D7S B;  2RHY A;  4GBQ A;  3JCM h;  5HCK A;  3WVD B;  3UA6 A;  1M2O A;  3OYK A;  3P8B B;  4FU6 A;  2X4Y A;  1VQ4 T;  2YRC A;  3CXC S;  1IGQ A;  3QUI A;  2YT6 A;  1G5V A;  3GP8 A;  4B6M A;  6AT1 B;  4LN2 A;  2CYZ B;  2JXB A;  4RKU E;  1G2B A;  1VQ7 T;  1NYG A;  1YI2 Q;  3CME A;  1V1C A;  3O8V A;  1VQP Q;  3TQ7 P;  2F69 A;  5KH6 A;  1QVF S;  4M7D F;  4MMK A;  3QBY A;  5GAM j;  1VYT A;  1QW1 A;  2QGG A;  3QPH A;  3TVT A;  2R58 A;  3CCU A;  4XU1 A;  2WAC A;  4FYX B;  3JB9 I;  1B34 A;  1ABO A;  3CXC A;  4MML A;  1PRL C;  3OYA A;  3VS5 A;  4C5G A;  1UEC A;  1Q95 G;  1JJ2 P;  2BE9 B;  3RKY A;  1LJO A;  1S72 T;  3JCM f;  2QA4 T;  4HXJ A;  3JB9 H;  4PLL A;  4BD3 A;  4JJD A;  1PCX A;  3CCJ T;  4BI4 A;  2K4Y A;  2GTJ A;  2FRW A;  2CP5 A;  4RMO A;  1B7T A;  5IXB A;  2DL7 A;  3G71 A;  1WFW A;  1VQ8 Q;  1MMD A;  2HAX A;  3MEU A;  5GAN 8;  3CCV Q;  4FYW B;  3RKW A;  1OOT A;  2B8A A;  2HQX A;  1X2Q A;  1AVZ C;  2KXD A;  2EYW A;  2MAM A;  4FYV B;  2G3R A;  3CBM A;  4BE1 A;  2HQH A;  4HCZ A;  2D8H A;  1VQO A;  2LNV A;  2KY9 A;  3BDU A;  1UGP B;  4OMF B;  2HCK A;  1K73 U;  2Z0W A;  4F7U F;  5CKF A;  4E47 A;  2JTE A;  4C8Q D;  1QVG A;  3SWN C;  3CCR Q;  4ELZ C;  3GBQ A;  4PJJ A;  2C0I A;  2K9G A;  3CC4 A;  1DJ7 B;  3EFR A;  1EZZ B;  3OYC A;  3G4S T;  2QEX T;  3Q1J A;  2YUP A;  2LJ3 A;  3NPF A;  3I56 Q;  3EH2 A;  2CZ6 B;  2IVW A;  3CCQ Q;  1X27 A;  3DB4 A;  1WHJ A;  2D6F A;  1R8O B;  4XK8 E;  2QG9 B;  1YJN A;  2LCL A;  3A5Z B;  3QZ9 B;  4A4G A;  2OTL Q;  1TUC A;  1TH7 A;  4LDX A;  3U23 A;  3RKX A;  1S72 Q;  2PVG B;  3CCE A;  2XU8 A;  2EKH A;  3RER A;  1VQK A;  3L1A A;  4A53 A;  4GLK A;  3M0P A;  4M7D E;  3OMC A;  1I07 A;  4RTX A;  4J7F A;  1W2B A;  1UEB A;  2MPX C;  3QDF A;  1MHN A;  3OBW A;  3JB9 F;  1N6A A;  1WX6 A;  1WNL A;  1UB4 A;  1YIJ T;  4CC2 A;  1MGQ A;  1GCQ A;  1N5Z A;  4N4I A;  4E2F B;  1N8R C;  3SWN A;  5HK0 A;  2ZPG B;  3JCM P;  3BY7 A;  2RQT A;  1X6B A;  2FZK B;  1I81 A;  2ZAE A;  1MV3 A;  1YI2 T;  2ENM A;  3CCV A;  3INZ A;  4F7U G;  2HKQ B;  1SSH A;  2DL4 A;  3UF4 A;  4AT1 B;  5GAN 5;  2EJG A;  3V7R A;  5KYX B;  3HSB A;  2RQV A;  2LCC A;  5GAN g;  1PG5 B;  2K3X A;  1N8R U;  1VQ5 Q;  4C0Z A;  5HK3 A;  2GQV A;  2GFA A;  3EGD A;  1WJR A;  3UPU A;  3QII A;  2VVK A;  2DO3 A;  3UDC A;  1ACM B;  4J9G A;  3G6E T;  5C0M A;  1GRI A;  2KXC A;  1D09 B;  4KBM B;  2RM4 A;  1LCK A;  3HTR A;  3JCM c;  5D7U A;  5DLO A;  4MZP A;  4BUG A;  1Y0M A;  2BZY A;  1FMW A;  2RO0 A;  3LLR A;  4NL3 A;  2ESW A;  1WHM A;  2KT1 A;  3H9N A;  5CCA A;  2E6N A;  2OX7 A;  2JZ2 A;  3M0Q A;  4JS5 A;  3THK A;  3OS5 A;  4ELY C;  2NUP B;  3G6E Q;  4PLI A;  2RQU A;  4J9E A;  2QEX A;  2DEQ A;  3M54 A;  5GAO r;  1PSE A;  2ROT A;  4UC4 A;  3TSZ A;  4XTV A;  5LJ5 d;  1T3L A;  4CI0 C;  1HSQ A;  2QTX A;  4LDV A;  2NLU A;  2KK4 A;  1M3A A;  4ZTF A;  1YJN T;  2COY A;  5CQY A;  1BK2 A;  2MI6 A;  3EG2 A;  1K8A R;  4FT2 A;  3VS0 A;  1ZUY A;  3CCQ A;  2DRK A;  3H0H A;  3DLM A;  4M7D G;  2CZ0 B;  1EFN A;  2DJZ A;  4DQ2 A;  4M7A B;  3VS2 A;  4CC3 A;  2OTJ A;  1H3Z A;  3RBB B;  3JCM J;  2ECZ A;  3QYH B;  4RTZ A;  4JLG A;  1M4Z A;  4TVR A;  1YIJ Q;  2PUK B;  1B34 B;  1E6H A;  4M75 C;  3H8Z A;  3JSC A;  3M4G A;  4HA8 A;  1M30 A;  1TWB A;  2IIM A;  4VUB A;  4M7A C;  2O88 A;  4XTY A;  1IXD A;  1AWJ A;  1BIA A;  4M7A E;  1WHK A;  1AWO A;  1KSW A;  2RF0 A;  3MCA B;  3A8G B;  4JRQ A;  2CP6 A;  1SHG A;  5KYN A;  1QVF A;  1KQS S;  4JRI A;  1KHI A;  4KUI A;  1NJI C;  2BZ8 A;  2HMA A;  4OB2 B;  2RHI A;  2XKO C;  1PKT A;  3CCL A;  4KUD K;  1UHC A;  3CCL Q;  1BCM A;  1WXB A;  1YIT Q;  3QHS A;  4ZN3 A;  2CSQ A;  1WDX A;  5LJ3 d;  3NFC A;  3CMA T;  3CD6 T;  1PNJ A;  4II1 A;  4RG2 A;  1KQS P;  1M8V A;  4RTV A;  3LGF A;  2E41 A;  3HHT B;  2QAZ A;  1BB9 A;  1QQJ A;  2O2O A;  3QYG B;  2ZPH B;  2F5K A;  2RH2 A;  4CC7 A;  3JCM Q;  1AWX A;  3LYI A;  1YJ9 T;  3OW2 A;  4E7Z A;  3OW2 P;  4ORZ A;  2K7A A;  1VQP A;  2KT8 A;  1YHQ T;  1U8R A;  2EQU A;  2PVO B;  4KT0 E;  2M9U A;  3CCE Q;  2EPD A;  4JUV A;  5DY9 A;  2E70 A;  1HJD A;  1KK7 A;  2JJ9 A;  1MUZ A;  1VQO T;  4NOY A;  4J5Y A;  2I0N A;  4D6W A;  3LX7 A;  1Q81 U;  4KH1 B;  4A4F A;  4C5H A;  3REB B;  3TCJ A;  1M8M A;  1Q86 R;  1D0Y A;  1JRI A;  2QGF B;  2OAU A;  1JQQ A;  3CEY A;  2WSF E;  2K3B A;  2DET A;  5CKB A;  4RTT A;  2X3X D;  3G1J A;  2B86 A;  2NUT B;  4PFZ A;  3L2Z A;  5CK9 A;  5IHK A;  4D8K A;  1YN8 A;  2CDT A;  3M56 A;  3S3M A;  3V8L A;  2DD4 A;  1YJW Q;  4EMK A;  4Z02 A;  4NL2 A;  4PFP A;  1GCP A;  1ZA1 B;  3JCM d;  3N5B B;  5LJ5 e;  3JCM W;  1UGR B;  2FZG B;  4HT9 A;  2QXF A;  2KSS A;  5GMK l;  2E3H A;  3J80 E;  2E10 A;  4EIK A;  4M7A F;  2DKG A;  1WQW A;  3X24 B;  3PE0 A;  2CP0 A;  2LCS A;  3H6Z A;  4KGZ B;  4M7D D;  1VQ7 Q;  1H64 1;  3LH5 A;  2EW3 A;  1T0J A;  4OML A;  4BY6 C;  3OYG A;  3QJ6 A;  1K8A U;  2FPE A;  4FT4 A;  5GAM e;  2OTL A;  1BI2 A;  4YTL A;  2JS2 A;  1PD1 A;  2ZPB B;  2YWW A;  3MP8 A;  3OSS C;  3TRE A;  3PMT A;  2IG0 A;  2A37 A;  1B07 A;  1Y96 B;  1UGS B;  4M78 D;  1RAA B;  1WHG A;  2VC8 A;  3CME Q;  1QWE A;  3MP6 A;  2HSP A;  1WZO A;  1QKX A;  2LT1 A;  2DIL A;  5KYY B;  3FB9 A;  1XQH A;  1C6V X;  2VUB A;  1RAH B;  4JS4 A;  2A08 A;  2NYS A;  3MPU B;  3CC2 T;  1GBR A;  2LX9 A;  5GAM h;  1VA7 A;  2NUP A;  2QI2 A;  1WXT A;  1PHT A;  2RPN A;  3HRU A;  2RN8 A;  1IZ6 A;  2XDB A;  4QVC A;  3GF5 A;  1XTD A;  2HBW A;  1YJW A;  1Q86 U;  2F5T X;  1SRL A;  1ZSZ A;  1RLQ C;  1UJY A;  2EYZ A;  1RLP C;  1ZQ1 A;  2HKN A;  2RK1 A;  2VWF A;  2KNB B;  4N4G A;  2R5A A;  4M77 C;  2EKO A;  2DL8 A;  2O9V A;  4RTY A;  4FW2 A;  2A3L A;  3OQ5 A;  2O01 E;  3EGX A;  2ROL A;  2DF6 A;  3BE3 A;  4IUR A;  3A8O B;  4FSX A;  4PJM A;  1KC8 U;  1WLP B;  2JM9 A;  3OYD A;  3OBY A;  4GY5 A;  4Z89 A;  4IUU A;  2YRD A;  4AFQ C;  3MKD A;  2KRN A;  1U1S A;  2V1R A;  1TUD A;  3ZEH A;  2W10 A;  1K9A A;  1FX7 A;  1U3O A;  3MET A;  2RK2 A;  5GAO p;  4LE9 A;  5A0D A;  3NTI A;  4X34 A;  4OB0 B;  1AEY A;  4XTZ A;  3VUB A;  3URG A;  1VIE A;  2E5K A;  4E7K A;  4RTW A;  1K76 A;  1JJ2 A;  4ZGE B;  4ZNX A;  3I56 A;  1K9M R;  4DBH A;  2AK5 A;  1KJW A;  2VXF A;  3LGL A;  3M0T A;  2DER A;  2KRS A;  3SDZ A;  2K3Y A;  5FW9 A;  1GFC A;  4OMP A;  1VQ9 A;  1OZ2 A;  5GAN 2;  4M7A G;  5AT1 B;  2OTL T;  1WYX A;  3M9Q A;  1MND A;  3LW5 E;  4M77 A;  3TEE A;  2I2L A;  3CC7 Q;  3VRY A;  3CCU T;  3OYY A;  3CPW P;  1K73 R;  1QCF A;  1Y7X A;  2L3R A;  3OYJ A;  2XDD A;  3FDR A;  1VQK Q;  1JO8 A;  2F2W A;  3QO3 A;  3RNJ A;  5GMK m;  4RCB A;  4JPB W;  3RMS A;  3UWN A;  2QA4 A;  2LX7 A;  3REA B;  2V8I A;  4E7J A;  4Y92 A;  5LJ3 f;  4BI8 B;  4J9B A;  2E6Z A;  2RQW A;  2JM8 A;  4XU0 A;  2RJC A;  3CCJ A;  2DVJ A;  3CC2 A;  1YBY A;  2EIF A;  1W2B P;  5LJ5 f;  1R0C B;  1NPP A;  4PJO F;  3RR6 A;  2M0O A;  2CT4 A;  1YFN A;  2A36 A;  1QKW A;  3OY9 A;  5LL6 S;  1X01 A;  3G71 T;  1E7O A;  2HZY A;  3CMA A;  3JCM X;  3QZ5 B;  3L2R A;  3OSV A;  2PTK A;  1XJW B;  2X4W A;  4AFZ C;  1CKA A;  2DPP B;  4OVA A;  1VQM T;  1QP3 A;  1G3T A;  3IQL A;  3CCU Q;  1AT1 B;  5DM7 R;  2L8D A;  2XG8 D;  4LDU A;  3FJP A;  1Q86 C;  2VYT A;  1NPR A;  1RAG B;  3CCJ Q;  4BE2 A;  1AZG B;  2MOX A;  4HVW A;  2RJE A;  3I5S A;  1XOV A;  1W70 A;  1WXU A;  3FEO A;  1ZBX A;  1NEB A;  1QVG S;  3RDV A;  3S3O A;  1KFZ A;  2K79 A;  1OPK A;  1W2B S;  4M7D C;  3CC4 T;  2A7Y A;  2DYB A;  1M2V B;  4PJN A;  1Z9Q A;  3AHU A;  5LJ5 h;  1Q7Y U;  2MWP A;  1JXM A;  2VB6 A;  2JN0 A;  1NLP C;  3DKM A;  2NUZ A;  3HKS A;  5A0L A;  2EGE A;  4A4H A;  2EFI A;  2O4X A;  2K5F A;  1VQL A;  3UAT A;  3ER0 A;  4M7D B;  3M0R A;  4LDY A;  3A8M B;  2DX1 A;  2EWN A;  5GAO l;  1U5S A;  4C5I A;  5GAN 4;  4FYY B;  4MDX A;  3OS0 A;  3L2Q A;  2EGA A;  2ABL A;  1QVF P;  5C6S A;  4OP0 A;  2FPF A;  1N9R A;  1RAB B;  3EG0 A;  4C92 A;  2XMF A;  5GAN d;  3CC4 Q;  2CP2 A;  2DFU A;  1D3B B;  1WIE A;  4LD9 K;  1KD1 C;  3PT9 A;  3CCR A;  2EVR A;  1K73 C;  5CKH A;  3L2V A;  3CCS Q;  2X4X A;  1UTI A;  1D0X A;  2BE7 D;  2JS0 A;  4A4E A;  5KCO A;  3OYB A;  2HD0 A;  2RMO A;  3VV0 A;  2ZCF B;  4C8Q A;  1NJI R;  4BDY A;  1BU1 A;  1TTH B;  1ZBJ A;  1PWT A;  2ZZD A;  4OF1 A;  1YI2 A;  5CAI A;  3LH0 A;  1FWZ A;  2CUD A;  3MEW A;  1N9S A;  3WVE B;  1VYV A;  3V8K A;  2J6O A;  4WCI A;  2DXB A;  2QYZ A;  1MNE A;  2MCN A;  2AKL A;  4Z8A A;  4PJO E;  4CRI A;  2X35 A;  4J6W A;  2H3E B;  4JRK A;  2P84 A;  4X9D A;  2A28 A;  3EG1 A;  1EIF A;  3FIF A;  1RI0 A;  3V7C A;  2XID A;  2FPD A;  1GFD A;  5KYW B;  2E5Q A;  2K2V A;  3SB2 A;  1WPY A;  1R0B G;  1PRM C;  1U06 A;  4O6J A;  2EQM A;  2MWO A;  4KH0 B;  5D6X A;  1M1F A;  4C92 C;  2YRV A;  1VQ5 T;  4J9I A;  4M75 D;  2FZC B;  3EGX B;  4PJO D;  5LJ3 h;  4ATO A;  4FW1 A;  1E6G A;  2AT1 B;  4C0G A;  1UG1 A;  2J05 A;  1IGU A;  4F17 A;  1BKB A;  3I9Q A;  5CR2 A;  1IRE B;  4PJL A;  4A4K A;  2C0T A;  3CPW S;  4EPC A;  3KXT A;  2LJ1 A;  1JBM A;  2MK5 A;  1ZHI A;  2FRY A;  4LUE A;  1BI3 A;  4IUV A;  4PNO A;  3CBO A;  4JZ3 A;  5FWB A;  5LJ3 j;  4L5G A;  5HY6 A;  3M58 A;  1ZUU A;  1I4K 1;  1OQK A;  4F14 A;  2GFU A;  1NYF A;  2YSQ A;  4J7I A;  3PFS A;  3RIR A;  2DEU A;  4BAC A;  3PGG A;  1TS9 A;  1Y57 A;  2DXC A;  2CZ1 B;  2JOY A;  4KGX B;  2RHZ A;  1SG5 A;  2LNH B;  2QQR A;  3C4S A;  2CT3 A;  3SEM A;  1VYU A;  3OYE A;  1UUE A;  2MF2 A;  5LJ5 g;  2BKD N;  2P4T A;  4DEY A;  4M78 F;  1GBQ A;  3QJY A;  3RES A;  3M5A A;  3I56 T;  1M9S A;  2QQ9 A;  2QEX Q;  4M75 G;  3CCE T;  5KYU B;  1P92 A;  2DTI A;  1JEG A;  2A0F B;  4AFU C;  1M90 U;  4PK4 A;  1V76 A; 
#chains in the Genus database with same CATH homology
 1V29 B;  2YLB A;  2D9T A;  2WSC E;  2HQE A;  3O8V A;  3QJ6 A;  1K8A U;  4FT4 A;  2R5M A;  2F69 A;  5GAM e;  2OTL A;  5KH6 A;  1QVF S;  4M7D F;  3SWN B;  1BI2 A;  4YTL A;  3GNF B;  4MMK A;  4MZT A;  3QBY A;  3CPF A;  5GAM j;  1LOJ A;  2CS7 A;  1QW1 A;  2P0Q A;  2ZPB B;  4DA4 A;  3QPH A;  2DXT A;  3MP8 A;  4QQG A;  5GAN 3;  3OSS C;  3TRE A;  2R58 A;  4XTU A;  3CCU A;  4QVD A;  1OZ3 A;  5J26 A;  4XU1 A;  3PMT A;  2IG0 A;  4P5N A;  1YIJ A;  2WAC A;  4Y28 E;  1Y96 B;  4OGC A;  3JB9 I;  1B34 A;  1UGS B;  3GNG A;  4M78 D;  3CXC A;  1YCY A;  5CIU A;  4MML A;  4JRP A;  3OYA A;  2VC8 A;  4C5G A;  4QQD A;  1BI0 A;  4KUL A;  3MP6 A;  2RI5 A;  5CKD A;  3RKY A;  2JUF A;  1LJO A;  1S72 T;  3JCM f;  2LT1 A;  2QA4 T;  3JB9 H;  5I21 A;  3OW2 S;  1I8F A;  3CBP A;  4PLL A;  5FLX E;  1KQS A;  1PSF A;  3FB9 A;  1XQH A;  4BD3 A;  2VUB A;  4JS4 A;  3X28 B;  2FYK A;  3CCJ T;  4BI4 A;  3CC2 T;  1AHJ B;  2K4Y A;  3CC7 A;  2HNI A;  1GXI E;  5CO7 A;  3M59 A;  2PU9 B;  2LX9 A;  5GAM h;  4C5E A;  4RMO A;  3CCS T;  2QI2 A;  4C8Q E;  4DOW A;  2P0K A;  2JTF A;  4HCC A;  3UT1 A;  1YJ9 A;  4JDS A;  3G71 A;  3HRU A;  2HAX A;  3MEU A;  5GAN 8;  1IZ6 A;  2XDB A;  3RKW A;  2LTO A;  4QVC A;  1VQP T;  4IUQ A;  2B8A A;  2HQX A;  2JTM A;  3GF5 A;  5I2M A;  1YHQ A;  1XTD A;  3F70 A;  1YJW A;  3I55 T;  1Q86 U;  4N0A A;  2MAM A;  3QKJ A;  3OMG A;  4PL6 A;  2F5T X;  2G3R A;  5CVI A;  4A54 A;  3CBM A;  4BE1 A;  4HCZ A;  4HKE A;  3EAE A;  2E1H A;  1VQO A;  1ZQ1 A;  2RK1 A;  2LNV A;  5LJ3 g;  1KQ2 A;  2EQJ A;  2WSE E;  4LD6 A;  3DB3 A;  4N4G A;  4M7D A;  2KY9 A;  2R5A A;  2ZPE B;  3P8H A;  4M77 C;  3BDU A;  1UGP B;  4OMF B;  2EKO A;  4BY6 B;  3JCM e;  4L59 A;  1K73 U;  2E65 A;  4OGE A;  1NE8 A;  2Y90 A;  2L89 A;  2A3L A;  4F7U F;  1HXD A;  5CKF A;  2XIC A;  4E47 A;  3OQ5 A;  2O01 E;  2M16 A;  4M75 F;  4C8Q D;  1QVG A;  4M7A D;  1W4S A;  3SWN C;  4ELZ C;  4QVZ A;  2QQS A;  2JNG A;  2V8K A;  3CCM T;  3P8D A;  4IUR A;  3A8O B;  3PMI A;  5GAO q;  4FSX A;  5CKE A;  4Y91 A;  4XQ3 A;  1KC8 U;  1DJ7 B;  3CC4 A;  1VQ6 T;  3EFR A;  3OYD A;  1D3B A;  3OBY A;  4GY5 A;  4N4H A;  3OYC A;  3G4S T;  4IUU A;  1KQ1 A;  5GAN 6;  2QEX T;  3Q1J A;  1O9S A;  5D6W A;  3A8L B;  5L8R E;  5IAY A;  1Q81 C;  3FC3 A;  4RG8 A;  4PKC C;  1NJI U;  1U1S A;  2CZ6 B;  3ZEH A;  4C92 D;  5GAN e;  1FX7 A;  1VQ5 T;  3MET A;  2L5Q A;  2RK2 A;  2IVW A;  4BE0 A;  3DB4 A;  3L42 A;  5GAO p;  4E7I A;  5GAN f;  2D6F A;  3GIB A;  1BYM A;  1R8O B;  4XK8 E;  1KG1 A;  3OS2 A;  4R55 A;  5A0D A;  1YJN A;  1VQL T;  4M78 E;  2LCL A;  2DIQ A;  2VGM A;  3NTI A;  3R6O A;  4OB0 B;  4X34 A;  3RMQ A;  4DOV A;  3A5Z B;  4EMK C;  3QZ9 B;  4A4G A;  3OYF A;  4M7A A;  4XTZ A;  4JJN K;  3VUB A;  3URG A;  1VIE A;  2KVQ G;  1VQ4 A;  1I5L A;  1VQN T;  2PQW A;  3CCQ T;  1LNX A;  4E7K A;  2DAQ A;  2KAF A;  1JJ2 A;  1TH7 A;  2O4X B;  3G7Z A;  3KUF A;  4ZGE B;  4LDX A;  3I56 A;  2H3J A;  3MHX A;  5GAM g;  2RD1 A;  3RKX A;  2PVG B;  2VXF A;  1G3Y A;  3CCE A;  3LGL A;  4OB1 B;  2XU8 A;  3SDZ A;  3HRS A;  1VQ7 A;  3RER A;  2K3Y A;  2P0P A;  1VQK A;  4R56 A;  2EQK A;  2RB6 A;  3L1A A;  3HL8 A;  4QW2 A;  4A53 A;  5FRN A;  3CME T;  4GLK A;  3OA6 A;  4M7D E;  3OMC A;  5GAO n;  3PIO A;  1VQ9 A;  1K8A C;  1VQ8 A;  1M1K C;  1OZ2 A;  5A0G A;  5GAN 2;  4M7A G;  3EFS A;  5GAM d;  3V7S A;  4J7F A;  1W2B A;  2OTL T;  1UEB A;  1OI1 A;  4C92 B;  1MHN A;  3OBW A;  4C0F A;  4C8Q C;  4ZN1 A;  3M9Q A;  4M77 A;  3LW5 E;  1M5Q 1;  5I2S A;  3JB9 F;  1VUB A;  1N6A A;  4XAX B;  3TEE A;  2I2L A;  1WNL A;  3CCU T;  1UB4 A;  3OYY A;  1YIJ T;  1MGQ A;  4N4I A;  5D6Y A;  1Y7X A;  2L3R A;  3SWN A;  5HK0 A;  3JAM E;  3CPW A;  2ZPG B;  1N8R C;  2MMP A;  2XDD A;  4O5V A;  2AHJ B;  3FDR A;  4Q5W A;  4C0D C;  3BY7 A;  3OYJ A;  3QO3 A;  3ZBD A;  2CZ7 B;  4FL6 A;  1I81 A;  4RCB A;  3JCM V;  5M9O A;  5GMK m;  1YI2 T;  2DIG A;  2LT4 A;  4XTW A;  1SSF A;  3CCV A;  2VV5 A;  3INZ A;  2K5L A;  3RMS A;  3UWN A;  4F7U G;  4C8Q B;  2QA4 A;  3OB9 A;  4E7J A;  2V8I A;  4M75 E;  1X6O A;  5LJ3 f;  1OYX A;  4BI8 B;  2E6Z A;  4IUP A;  4XU0 A;  5GAN 5;  2EJG A;  4EMG A;  3L2W A;  2RJC A;  2LQK A;  3CCJ A;  3V7R A;  3CC2 A;  1YBY A;  3CC7 T;  2EIF A;  3CCL T;  5LJ5 f;  2RA2 A;  1M90 C;  1NPP A;  4PJO F;  2M0O A;  1WJS A;  3HSB A;  2QDY B;  3E9G A;  2LCC A;  5FU7 B;  3HRT A;  5GAN g;  4IKF A;  2K3X A;  3OY9 A;  1N8R U;  5LL6 S;  4C0Z A;  5HK3 A;  1X01 A;  2GQV A;  4L6V 5;  3QG1 A;  2GFA A;  4ZTJ A;  1VIF A;  2Y4Y A;  5GMK j;  3G71 T;  3NTK A;  1WJR A;  2LRQ A;  3UPU A;  3QII A;  3CMA A;  2DO3 A;  3MO8 A;  3RUX A;  3SD4 A;  4LDW A;  5KE2 A;  3JCM X;  3UDC A;  3LWI A;  3QZ5 B;  3CD6 A;  3MEV A;  3I55 A;  3L2R A;  3OSV A;  4M75 B;  5C0M A;  3G6E T;  5EG2 A;  3QSU A;  1KHC A;  4KBM B;  5KCH A;  1VQ5 A;  2X4W A;  4FIB A;  2DPP B;  2RM4 A;  4OVA A;  1QP3 A;  1VQM T;  2X4J A;  1G3T A;  1BIB A;  5FU7 C;  2DK3 A;  3VYG A;  5DLQ E;  3JCM c;  5DM7 R;  2LDM A;  1JJ2 S;  2L8D A;  2XG8 D;  4LDU A;  3X25 B;  5DLO A;  3FJP A;  4HT8 A;  4MZP A;  1Q86 C;  4BUG A;  1M1G A;  2DVE A;  2VYT A;  3JCM b;  4M75 A;  2RO0 A;  3JCM P;  1NPR A;  3LLR A;  4C92 G;  4PJO D;  4NL3 A;  3M4Y A;  4N0A C;  3JB9 J;  4MDW A;  4BE2 A;  2RJE A;  5FRO A;  1XOV A;  5CCA A;  5J39 A;  5LJ3 e;  2E6N A;  3FEO A;  2JZ2 A;  1ZBX A;  3CCM A;  2DZ9 A;  4JS5 A;  1QVG S;  2M1H A;  3S3O A;  4EMH A;  3OS5 A;  4ELY C;  3ME9 A;  2LQ8 A;  3FLG A;  5GAN h;  4NS5 A;  1W2B S;  4M7D C;  3CC4 T;  2A7Y A;  3HP9 A;  2RI2 A;  4X9C A;  1VQ6 A;  5GMK h;  1U1T A;  4B9X A;  2Y4X A;  4PLI A;  3AHU A;  3G4S A;  2ZPI B;  4C0D B;  2KQW A;  2MWP A;  5LJ5 h;  2QEX A;  1Q7Y U;  5GMK i;  2DEQ A;  3M54 A;  1K9M C;  5GAO r;  1PSE A;  4XTX A;  4UC4 A;  2CGH A;  4XTV A;  2JN0 A;  5LJ5 d;  3NTH A;  5GAO m;  4C8Q G;  3E1S A;  3DKM A;  3HKS A;  3VUZ A;  3BW1 A;  5A0L A;  4C92 E;  3PIP A;  1M1K U;  4CI0 C;  4A4H A;  4BI3 A;  2QTX A;  4PJO A;  2NLU A;  2EFI A;  2KK4 A;  4LDV A;  2O4X A;  3M57 A;  2K5F A;  4RCC A;  4ZGD B;  4ZTF A;  3BFM A;  1YJN T;  1VQL A;  2CKK A;  3ER0 A;  3C12 A;  4M78 C;  5CQY A;  4LDY A;  4M7D B;  2MI6 A;  3A8M B;  2EWN A;  4XU3 A;  4EDU A;  5GAO l;  2QQA A;  4J6Y A;  4C5I A;  4EMK B;  5GAN 4;  4XU2 A;  1Q82 C;  1VQN A;  2GF7 A;  3T9N A;  4FT2 A;  3CCQ A;  4MDX A;  3OS0 A;  3L2Q A;  3DLM A;  4M7D G;  3FRN A;  2BIV A;  2CZ0 B;  5C6S A;  2DJZ A;  2DXU A;  2EJF A;  4OP0 A;  4DQ2 A;  2PUO B;  1N9R A;  2DTH A;  4M7A B;  3VYH B;  2OTJ A;  1H3Z A;  2RI3 A;  3X26 B;  4C92 A;  3JCM J;  5GAN j;  3HFN A;  5GAN d;  2XHC A;  3QYH B;  1UGQ B;  1VQK T;  4C92 C;  4M77 B;  3A8H B;  1K9M U;  4JLG A;  1YIT T;  3OYI A;  1D3B B;  3V8J A;  4M78 B;  4LD9 K;  1M4Z A;  1VQ9 T;  3E19 A;  1VQ8 T;  4TVR A;  3DLL A;  1KC8 C;  2PUK B;  1B34 B;  4M75 C;  3PT9 A;  1KD1 C;  3H8Z A;  3JSC A;  3GLX A;  3M4G A;  2YHT A;  4HA8 A;  3VKI A;  4M77 F;  3CCR A;  1K73 C;  2C06 A;  5CKH A;  3L2V A;  3S3N A;  2X4X A;  3MP1 A;  3J7A F;  4BB7 A;  1HK9 A;  4VUB A;  4A4E A;  5KCO A;  2RHX A;  4M7A C;  4M78 A;  3OYB A;  4XTY A;  2HD0 A;  1BIA A;  2E64 A;  2ZCF B;  1N27 A;  4FM4 B;  3VV0 A;  1Q82 U;  4M7A E;  4C8Q A;  3MCA B;  3A8G B;  4JRQ A;  3JRZ A;  2GCX A;  5HKC A;  4BDY A;  2QQB A;  4OF1 A;  2ZZD A;  1YI2 A;  2EYQ A;  1KQS S;  1QVF A;  2VXE A;  5GAM f;  2JVV A;  5CAI A;  1XNI A;  3LH0 A;  3CCV T;  1FWZ A;  4JRI A;  1KHI A;  3MEW A;  1N9S A;  3SFM A;  3WVE B;  4KUI A;  2DD5 A;  1Y96 A;  4B9W A;  3V8K A;  2ZGW A;  4M77 D;  2LC4 A;  4IUT A;  2DXB A;  3OYM A;  1NJI C;  1Y71 A;  1Y07 A;  1NZ9 A;  4PJO E;  1RL2 A;  4CRI A;  2X35 A;  4OB2 B;  4J6W A;  2RHI A;  2XKO C;  3VJP A;  4JRK A;  3OYN A;  4X9D A;  3CCL A;  2K57 A;  4KUD K;  4J83 A;  2R57 A;  1EIF A;  3FIF A;  1RI0 A;  3V7C A;  2XID A;  4E7L A;  5FU6 B;  2E5Q A;  2K2V A;  5CQX A;  2ZPF B;  3SB2 A;  2LVM A;  1WPY A;  3QHS A;  4ZN3 A;  2E12 A;  5GAN 7;  4O6J A;  2EQM A;  5LJ3 d;  3NFC A;  3E9F A;  3CMA T;  4J8O A;  1S72 A;  3WXM B;  3CD6 T;  4C92 F;  2D0Q B;  2MWO A;  3OYH A;  2XDP A;  4II1 A;  4RG2 A;  1M8V A;  3VU3 C;  3G6E A;  5D6X A;  2K5I A;  3HPW A;  3C94 A;  3OYL A;  1M1F A;  2XI9 A;  2KDS A;  2YRV A;  3M53 A;  3LGF A;  4M75 D;  2FHD A;  2RHU A;  2E41 A;  1QVP A;  2RJD A;  3HHT B;  1VQM A;  5LJ3 h;  4ATO A;  3QDR B;  5J3B A;  3QYG B;  2ZPH B;  4C0G A;  1WGS A;  2F5K A;  2DTO A;  2RH2 A;  3PTA A;  3JB9 G;  2PVD B;  3JCM Q;  4M78 G;  5FU6 C;  1O75 A;  3LYI A;  3CCS A;  3J81 E;  3C95 A;  5GMK e;  1YJ9 T;  1BI1 A;  1BKB A;  4PJO G;  4QQ6 A;  3OW2 A;  3QXE B;  3GOX A;  2EJ9 A;  3ZFJ A;  5CR2 A;  1IRE B;  4C8Q F;  3JB9 D;  1VQP A;  5A2Q E;  1YHQ T;  1U8R A;  2EQU A;  2PVO B;  4E7H A;  2BUD A;  1YJW T;  4A4K A;  2FVU A;  4KT0 E;  2M9U A;  1WJQ A;  3CPW S;  4EPC A;  4JUV A;  3KXT A;  5DY9 A;  2E70 A;  4M77 E;  2RJF A;  1WQ7 A;  1VQO T;  1JBM A;  4J5Y A;  4NOY A;  1ZHI A;  1FXX A;  5LJ5 j;  4D6W A;  3LX7 A;  4BDZ A;  1Q81 U;  4WF2 A;  4A4F A;  1BI3 A;  4C5H A;  4JLI A;  4IUV A;  4PNO A;  1G3S A;  2YLC A;  3CBO A;  3TCJ A;  3LWH A;  2FB7 A;  5LJ3 j;  5IN1 A;  4L5G A;  5HY6 A;  1JRI A;  4ZGJ B;  4F7U A;  3TU4 K;  2OAU A;  2FL7 A;  1X75 C;  3CEY A;  2WSF E;  5AYF A;  3S6W A;  4MZM A;  3M58 A;  5CKB A;  1I4K 1;  4HCB A;  2XD0 A;  3OS1 A;  2GFU A;  4V2S A;  4OB3 B;  3JCM g;  1QP2 A;  4J7I A;  2XK0 A;  4J6X A;  3PFS A;  4M77 G;  3L2Z A;  3M55 A;  3RIR A;  5CK9 A;  4F7U B;  2VGN A;  4BAC A;  3M56 A;  1G3W A;  3MEA A;  3S3M A;  3V8L A;  2OTJ T;  5KE3 A;  2DZC A;  4PJO C;  3PGG A;  2DD4 A;  5FRM A;  4EMK A;  2DXC A;  2CZ1 B;  1JB0 E;  2JOY A;  4Z02 A;  4NL2 A;  2V8J A;  2RHZ A;  1YIT A;  3JCM d;  3ASK A;  3N5B B;  5LJ5 e;  2QQR A;  3GPL A;  3JCM W;  3C4S A;  1KD1 U;  1UGR B;  2KMT A;  3L2U A;  3HFO A;  2RHY A;  5IT9 E;  3CCR T;  4HT9 A;  2QXF A;  3JCM h;  2KSS A;  5GMK l;  3J80 E;  3BDL A;  2E10 A;  4ME7 A;  3OYE A;  3WVD B;  1Q7Y C;  2MF2 A;  5LJ5 g;  2BKD N;  3OYK A;  3P8B B;  4FU6 A;  2X4Y A;  2P4T A;  2HBP A;  1VQ4 T;  3KBG A;  4M78 F;  3QUI A;  3CXC S;  4M7A F;  1G5V A;  3GP8 A;  2DKG A;  3QJY A;  3RES A;  1WQW A;  3X24 B;  3M5A A;  4PJO B;  4F7U E;  1M9S A;  2CYZ B;  3I56 T;  2QQ9 A;  2EAY A;  3PNW C;  4RKU E;  4M75 G;  3H6Z A;  3CCE T;  1P92 A;  2DTI A;  1VQ7 T;  4M7D D;  1H64 1;  1M90 U;  4BY6 C;  3CME A;  3X20 B;  3OYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...