5GMKi

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
total genus 7
structure length 75
sequence length 83
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmki00
3JCMc 4NOYA 4XQ3A 2JN0A 5LJ3d 5GAN8 1I81A 3QUIA 5GMKm 3JB9J 4M78A 2VXFA 2E10A 3HSBA 3JCMW 4M75E 4M75F 4HA8A 1H641 2E64A 2VXEA 4M75C 4NL3A 5LJ3g 2DZCA 1B34B 5LJ5f 4XU0A 4M7DF 4M7DE 1M5Q1 4M78C 4M77B 5GAMf 3JCMd 4EMKA 4C8QC 1Y96A 4A53A 4WF2A 4M7AB 3JCMQ 4J5YA 4XU3A 4XTUA 4C8QD 1D3BB 4F7UF 4F7UE 1N9SA 5LJ5d 4JUVA 5GANd 2DVEA 1HXDA 3FIFA 1U1SA 1WQWA 3SWNB 1LNXA 3GIBA 2EJ9A 5GMKi 3V7CA 2K57A 1WNLA 4QVDA 5GAMd 4M77A 5GAN7 2DXTA 3V8LA 4DQ2A 5LJ3j 5GAOl 4JRIA 3JCMP 3RERA 1U1TA 4F7UB 4M7AA 4M7AG 3RKXA 4M77D 1D3BA 4A54A 4HT9A 4N0AA 3RIRA 2FYKA 1I4K1 4QVCA 2Y90A 3SWNA 3INZA 2E41A 2YLCA 3BDUA 2E1HA 4M77G 5GMKl 5GANh 2RM4A 5GAN6 3V7RA 4N0AC 4PJOF 4PJOE 2YHTA 4C92D 5GAN2 4F7UA 5GAMh 4M78E 4M78F 5GAOp 2DJZA 4C8QA 1YCYA 4HT8A 5GANg 4RCCA 4M7DC 1JBMA 4C92C 4M77F 4M77E 4NL2A 4EMHA 4Y91A 3HFOA 5GAN4 2ZGWA 1N9RA 5GMKj 4EMKC 5LJ5g 4M7DB 5LJ3e 4J6XA 1LOJA 5GANf 3JCMf 3VU3C 1WPYA 2RD1A 3AHUA 4PJOG 4M78D 5GAMg 4M7AE 2YLBA 4M75G 4M7AF 2DTHA 2DTOA 1JRIA 2I2LA 3M4GA 1MGQA 4MMLA 2FB7A 3JCMg 5GAOn 5GAOr 3L1AA 4M78G 4JRKA 5LJ5h 4V2SA 3JCMe 5GMKh 2EJGA 5LJ3f 3JCMV 3BY7A 4JLIA 4C8QG 4M7AD 3L2ZA 4XTWA 2QTXA 3BFMA 5LJ5j 1TH7A 4M7DA 3JCMJ 3JB9D 5I21A 5GAN5 3EFSA 4F7UG 4J6YA 3JCMh 1X01A 4M75A 4XU2A 5LJ5e 4X9CA 3V8KA 5GANe 2DKGA 3RESA 2DEQA 3JCMX 4PJOA 4PJOC 3JB9H 3QSUA 4OP0A 5DY9A 1I5LA 3QHSA 1KQ2A 5GANj 3FJPA 4RCBA 5GAMe 5GAOq 4MMKA 1LJOA 4C92A 5CAIA 4C8QB 1BIAA 2EJFA 2RB6A 3SWNC 5GMKe 2VC8A 3RKWA 1KQ1A 4M7AC 4X9DA 1BIBA 1B34A 2HNIA 1WQ7A 4EMGA 3JB9F 3EFRA 2DZ9A 3HFNA 4J6WA 4XTVA 4XTZA 4XU1A 3JCMb 4PJOB 5GAOm 4PJOD 2E65A 3V8JA 4M77C 4C8QE 3FB9A 3PGGA 4M78B 4C8QF 3RUXA 4EMKB 5GAMj 2EWNA 4C92B 2DXUA 1M8VA 4M7DD 4M75B 3JB9I 3SB2A 3JB9G 2RA2A 2CGHA 4M75D 4PNOA 3RKYA 5GAN3 3V7SA 3QO3A 5LJ3h 4M7DG 1HK9A 2EAYA 4XTXA 4C92F 4C92G 2DTIA 4C92E 1Y96B 1I8FA 3BW1A 4XTYA
chains in the Genus database with same CATH superfamily
1PM3A 1YP5A 1MUZA 1SG5A 5M9OA 2VXFA 4KGVB 5FU6C 4PJOC 2VXEA 4JZ4A 5IHNA 1MMAA 2K3YA 4Z02A 4C8QC 1T0JA 4QVZA 4XTUA 5FLXE 4ELYC 2ZPIB 2RK2A 2DO3A 2LJ3A 4PJMA 5GAMd 5I22A 2VV5A 2DRMA 1ZUKA 3PTAA 4DQ2A 2ZCFB 5LJ3j 3JCMP 1FWZA 2KY9A 4HT9A 2D0NA 1NG2A 1UGPB 4JJDA 1ZBXA 2YLCA 3NTKA 2JMCA 1OZ3A 2L3RA 4HVWA 2NUTA 2HCKA 3QWYA 1VQKA 4HCBA 2PZ1A 3LH0A 1KSWA 1QMCA 4BDYA 4F16A 5KYYA 3I56A 3CC4A 5GAOn 1W2BA 1S72Q 2M16A 2CT3A 2RQWA 2VVKA 2EIFA 2R5AA 4VUBA 1X27A 3A8MB 5EC7A 1YWOA 3EFSA 4OMMA 4CC3A 2BKDN 5FWBA 3CC2A 2GQIA 1QVGP 1KQ2A 3OB9A 3RBBB 3CCMT 2RO0A 2OX7A 2HEQA 4QW2A 3L2UA 1ZSZA 4IUTA 3VS3A 2YDLA 2J7IA 3CC7A 2BTTA 1H92A 1V76A 2B86A 2EWNA 2XU8A 1C6VX 5KYUA 1Q7YC 1MNDA 4M75B 2L89A 3GLXA 2M9UA 1LVKA 4QT7A 3V7SA 2X4JA 1HK9A 1QLYA 3THKA 4OB2B 4XTYA 2L8DA 1M30A 1VQNT 5IT9E 1QVPA 3JCMW 1VQ8T 2A28A 2PVGB 2W0ZA 1W6XA 1XNIA 2JM8A 5D6YA 1UB4A 2FZKB 3FRNA 1YN8A 2QEXA 4OB1B 5GMKi 1NZ9A 1BK2A 1Y57A 1UTIA 3NFCA 2ENMA 4AMCA 3M0RA 2QQRA 2FRYA 4M7AA 2RHUA 5KYYB 2CREA 5CKBA 4ZGDB 4J8OA 1XJWB 1NJIU 2GTJA 1ABQA 3M4YA 3CC2T 1H8KA 4M78E 1MV3A 1JBMA 3OYKA 1ZX6A 1RAFB 1MMNA 2DIQA 2X3WD 3LH5A 4K11A 1VQNQ 2F2XA 3PNWC 3VUBA 2L3PA 3P8HA 5GANe 3JCMX 4YTLA 4ELZC 1Q81U 3CCSQ 4CRIA 5CAIA 3IQLA 2RB6A 4FCYA 2MWPA 1G3YA 2LJ1A 5IHIA 2K4YA 3OS0A 2C0IA 2KYMA 3VRZA 3J80E 2KGTA 3SDZA 5KCHA 4C8QE 4P5NA 2AK5A 1K76A 1KFZA 4E7ZA 2VWFA 1NYGA 3EAEA 2O01E 1NJIR 5ECAA 4RMOA 4A4EA 4A4GA 2EYZA 4NOYA 2HL3A 6AT1B 3ASKA 2FHDA 1QKWA 2E64A 3H0IA 4CC2A 1LCKA 3G71A 2KSSA 3OYBA 1R77A 2E6ZA 4HCKA 3REBB 1PC0A 5KCOA 4A53A 4WF2A 4LDVA 8AT1B 4F7UF 1T0HA 1KC8R 5A2QE 3SHWA 2YSQA 1X6BA 2KXCA 2XDBA 1AWXA 1AZEA 4LDYA 3C12A 4M7AG 2OJ2A 1RL2A 3R6OA 1I4K1 3MP1A 4A4KA 3QDFA 1FMWA 2BE9B 3UA6A 4LXCA 2E70A 5J3BA 1VQLQ 1ZSZC 3P8BB 2V8JA 2YHTA 5C6SA 3OYJA 4QKUA 4KRTA 4M77E 1M27C 1N9RA 3M0PA 4M78D 1VQLA 2DL4A 3FLGA 3OS2A 2K5IA 2LX7A 3BY7A 4GLKA 1W70A 4M7AD 1OZ2A 2WACA 4CC7A 2FPDA 3M56A 3JAME 2O88A 2JOYA 3JB9H 3CPWS 2KDSA 4PJNA 2CYZB 3KXTA 3MEWA 4MMKA 4IURA 1PG5B 1AD5A 2XMFA 2QGGA 2C06A 2CP7A 4JDSA 1YJ9T 1MV0B 3EG3A 1Q7YU 1OU9A 3VKIA 3QWXX 3I35A 4PNOA 3OYIA 2R57A 2DTIA 1IO6A 4OVAA 5J39A 1TUDA 2K9GA 2XIDA 1YJNT 2JJ9A 3VYGA 2LNVA 5KE2A 1M5Q1 3BE3A 3L2RA 3NPFA 4LUDA 2MOXA 4RTZA 4J9CA 4RUGA 1T3LA 2XI9A 3EG9A 3G6EA 4MDWA 3C94A 5KYWA 1WX6A 5CIUA 1YWPA 4Z88A 2HKQB 1K8AR 3EGDB 4JJCA 2OI3A 1KQSP 1VIFA 3NTHA 3CD6T 2Y90A 2P4RA 3CC7T 1KHIA 2GGRA 2MAMA 4NS5A 1Y0MA 2KRNA 4PFPA 2L0AA 4KGXB 2DJZA 2DD5A 4HT8A 3CMAQ 3UATA 1JJ2P 4DBQA 1WXBA 2DTHA 1JRIA 1WFWA 3E1SA 2YUQA 1MHNA 4XTWA 3M0SA 3NHNA 2H3JA 1JO8A 1M9SA 5LJ5e 2CP5A 3QXEB 2YXYA 3OW2A 2IG0A 4C92A 3SEMA 5I2MA 1BU1A 3N5BB 3OYNA 2CP2A 4M7AC 2DEUA 3QG1A 1UHCA 5GAOm 2AKLA 1AWOA 4N4GA 5CVIA 3CCEQ 3OYYA 1QP2A 5J26A 4J9IA 3CCQT 4IUUA 4ZN1A 2A36A 4XAXB 2VB6A 2F2VA 4O5VA 2JN0A 5GMKm 4FT2A 1K73C 2DBMA 4M75F 3MP6A 2HQHA 1ZBJA 2DIGA 3OSSC 3OYFA 3G4SQ 1PRLC 4HVVA 4M7DF 2FPFA 3QZ9B 4LN2A 5IH2A 3JCMd 2X4YA 3CXCP 2PTKA 3X28B 3CMAT 3JCMQ 1CKBA 1B3QA 2HSEB 3LGLA 4OMQA 2M0OA 1PHTA 2SRCA 1D1AA 3C0CA 2RHYA 2HMAA 3CC7Q 1LPLA 1H3ZA 2K2VA 1YITQ 3V8LA 3UT1A 1RAEB 2ABLA 2VUBA 3I9QA 4JRIA 5KE3A 1XOVA 3OYHA 2D1XA 4QVCA 1YJ9A 4R55A 2M1HA 2DXBA 1RUWA 4D6WA 2FRWA 3CMET 1JJ2A 1FX7A 4C92D 3X24B 2MYSA 3TREA 4C5IA 4JLGA 1VOMA 5GAN4 5GMKj 3QIIA 1WJQA 2O9SA 1WPYA 3AHUA 4N4HA 5GAMg 2KI7A 4GLMA 2EPDA 2CDTA 1X43A 2P0KA 5KYXB 3CCVQ 3S6WA 4C8QG 2LCLA 2ZZDA 1WI7A 1YIJA 5GAN5 5FROA 2CSQA 4X34A 3PIOA 3V8KA 4KT0E 1OPLA 2DEQA 2KYBA 5HK0A 2YRVA 2ZPHB 1ZA2B 5DY9A 3URGA 5GAOq 5KYUB 2QK0A 5GMKe 1G83A 2KAFA 4LNPA 4J9FA 2YUOA 2QQ9A 1SF9A 2NUPB 2P84A 3TSWA 3UDCA 4C5GA 4J9BA 3X20B 2CGHA 4M75D 3CCQA 4ZN3A 2NUZA 4QQGA 1VQNA 4ATOA 2EQMA 5GAN8 4J9DA 4JJBA 4M78A 2E10A 4BE2A 4M75C 2O4XA 1JXOA 2X4WA 4JRQA 3ZBDA 1I1JA 2DYIA 3A5ZB 1JJ2S 1YCSB 2AIRB 4ZGEB 3C95A 4M7AB 1N5ZA 4J9GA 3ME9A 1LNXA 2EJ9A 1IGQA 2A3LA 2ROTA 4QVDA 2RHXA 1VQKT 5GAN7 2DXTA 1VQ6A 2GTOA 3R6NA 2LT4A 4FL6A 1H3HA 2DNUA 1HJDA 1VQ8A 2HAXA 1TTHB 2GFAA 3E9FA 1PKSA 2QQBA 4PKCC 4N0AC 3RDVA 4RG8A 1GBQA 2QG9B 5GAN2 4F7UA 1KHCA 2OAUA 2RQVA 1I07A 1YCYA 2AKKA 4DBFA 3EHRA 5LJ5g 5LJ3e 1Y07A 2IIMA 4OMFB 2I0NA 2XG8D 2DETA 4A4HA 5L8RE 1N27A 3I55A 2CZ6B 2XDPA 2X4XA 3GNGA 2NUPA 2RHIA 2CKKA 2E3IA 2DL5A 2KROA 2QTVA 1V29B 2FO0A 2WSEE 1VQMQ 1YIJT 3CMAA 1W2BP 3HTRA 1G5VA 2C0TA 1ACMB 2RJCA 2O31A 4RCBA 3EG0A 1E6HA 1BIAA 1FMKA 1WHLA 3G71T 2O4XB 2IVWA 5IAYA 2MI6A 1FMVA 2XDDA 4IIMA 3PE0A 1PSFA 3CPFA 3QBYA 1WZOA 4EMKB 3CCST 2CP0A 3D7SB 5DM7R 3CCSA 3CMEA 1YJWA 4JZ3A 3M0QA 2AT1B 2LJ0A 2KBTA 4C92G 2CZ0B 3M54A 3ULRB 3QUIA 2HD0A 5CR2A 2OTLA 2E3HA 1Q82R 1G3SA 3RMSA 1PRMC 1IHVA 4EDUA 2EGEA 4BY6B 1E6GA 2E4HA 3CCEA 1BB9A 2O2OA 4R0KA 3VV0A 2V8IA 3LGFA 3TVTA 3TQ7P 4OGCA 3SWNB 2MK5A 1UUEA 5D7UA 3GIBA 2EQJA 4ORZA 2B8AA 4PJLA 1M90C 2FVUA 5GAOl 3CD6A 1W2BS 2EYYA 2DD4A 4A54A 3FC3A 4FT4A 3KFVA 3MKDA 4DEXA 1EIFA 4PJOE 4LE9A 2LQWA 1MNEA 2QDLA 4JS5A 2J6KA 1WHJA 5GAOp 1UEBA 2DA9A 1BI0A 4EMKC 5LL6S 9ATCB 1VQ7T 3DB3A 3CPWA 1C1AA 4M75G 1D0YA 2LQKA 2LVMA 3M4GA 1AHJB 2FB7A 4ESRA 3QYGB 3MJXA 3OSVA 3MEVA 3OQ5A 4PK4A 1YITA 1TOVA 5A0DA 3QYHB 3JCMh 3S3MA 5DLOA 3RESA 3JRZA 3CBMA 1FXXA 1WHHA 2DL3A 3EG1A 3MPUB 1IGUA 4N4IA 4M77C 5GAMj 2QDYB 1Z9QA 2AZVA 4QQDA 1K9MR 3I5RA 3RNJA 3SB2A 1YBYA 2G6FX 4XTXA 2J6FA 4MDXA 1Y96B 1VQ5A 2H3EB 2GF7A 3MEUA 3JCMc 1OOTA 4XQ3A 1KJWA 1BCMA 1I81A 2DILA 1AT1B 1G2BA 3HSBA 4HXJA 3FEOA 4D8KA 3C4SA 5IN1A 1U5SA 3CC4Q 3OMCA 1ZUYA 4KULA 4E7HA 2XK0A 2RHZA 4RG2A 1MMDA 2LQNA 1NM7A 3T9NA 2FPEA 3ZFJA 2K2MA 4BE1A 2YWWA 1W1FA 1TWBA 5EG2A 3V7CA 1WNLA 1IHWA 2CH4A 1M3CA 1BI1A 4B9XA 1WHGA 2EYXA 3EG9B 3VRYA 2ZPFB 1D3BA 5KYWB 2GFUA 5FRMA 4RTYA 4OB0B 2LDMA 3UF4A 1WXTA 3FDRA 1W4SA 3VUZA 1YI2A 4PL6A 1NPPA 2HDAA 1N8RU 4EIKA 2DM1A 2RJFA 1VYVA 2DF6A 1LOJA 1M2VB 4M7AE 4B6MA 3REAB 3L2QA 4V2SA 1RAIB 3QJ6A 4DBRA 2ZPBB 2LC4A 5DLQE 3L2VA 3OA6A 2JZ2A 2OTLQ 3A8HB 2JUFA 2DKGA 2LZ6B 1MMGA 1YJNQ 4RKUE 2L3QA 1LJOA 4C8QB 1VQ5Q 3QZ5B 1VQ4A 3CCRT 3GPLA 2ZAEA 4E7KA 1N6AA 3QDRB 4JJNK 3PFSA 1GFCA 3OY9A 3RUXA 1Q95G 4OMOA 4C92B 4BE0A 1M8VA 4M7DD 2QASA 3G71Q 4DOWA 2Z0WA 5LJ3h 1X2KA 4C92F 4X1VA 4F04B 5CCAA 3JB9J 4AG2C 1Q7YR 3VS2A 1RI0A 2AHJB 5CO7A 2V1RA 2ECZA 4LD9K 2E5QA 2XKOC 2EW3A 2BZ8A 1VQPT 3H0FA 2J05A 2K57A 1QW1A 3TU4K 4B9WA 1OV3A 2EQKA 1B07A 2M02A 1IRXA 3SD4A 3H41A 3HRSA 4IUPA 4M77D 1VQ9Q 2J06A 2K6DA 3RIRA 3VS7A 4J9EA 4M77G 4EPCA 4J83A 2RF0A 2LP5A 1KQSA 1TS9A 2JXBA 1ZQ1A 1QCOA 3OW2P 5KYXA 2EBPA 1VQKQ 5AYFA 1IXDA 1YJNA 2EVRA 3H6ZA 1BI2A 3HHTB 1Q81R 2A37A 1M3BA 2RD1A 2P0QA 4FW1A 3CCLQ 1ZLMA 4C0FA 5GMKh 1S1NA 1PD1A 3L2WA 3U23A 3CXCA 3JB9D 5I21A 2SEMA 1U8RA 1RACB 2JNGA 3RR6A 1NYFA 3EGXB 4FSSA 2GBQA 3NGPA 4GBQA 1I5LA 1X2QA 2W10A 4AFUC 3M55A 2M0YA 1KD1U 1R0BG 1D1CA 2KNBB 3CCMA 3Q1JA 1WGSA 1AVZC 3WVEB 1SKUB 2DPPB 3OYCA 3JB9F 4EMGA 3EFRA 4XTZA 3JCMb 4KH0B 3NMZC 2E65A 3I55T 3HKSA 1M4ZA 2A7YA 4M78B 1WXUA 1VQOT 4PLIA 5GAN3 1BI3A 3E19A 5LJ3d 7AT1B 3G6EQ 2DRKA 1RAAB 3S3OA 1M1KC 1NEBA 2HL5C 2X9HA 1B34B 2JTFA 1VQMA 2ED0A 3A98A 2QA4Q 2P0PA 2YUNA 3CCLA 1QWFA 4C0DC 3EFOA 2PVDB 2F2WA 1M1FA 4J5YA 4ZTJA 2DVEA 2NWMA 4FYXB 1WQWA 3EGUA 3OYLA 3OYDA 3H8ZA 4E7IA 1X6OA 2RH2A 1OYXA 5CKEA 2ATCB 2E5KA 4F7UB 1SSFA 4BI4A 2F5TX 3EH1A 2FYKA 3I5SA 1K9AA 2F69A 2E41A 2OAWA 5GJWB 1VYUA 2KRSA 2OTJQ 4M78F 2JVVA 2ZGWA 5FW9A 5HKCA 4O6JA 1QVFP 1SHFA 2HZYA 1X6GA 2COWA 3OBYA 1VQ8Q 2I2LA 3JCMg 4JPBW 3TEEA 2EJGA 1NLPC 3M0UA 1VIEA 3OYMA 1GRIA 1X01A 4M75A 4X9CA 4PJOA 4WTOB 1GCPA 3G6ET 2KVQG 2DXCA 5HY6A 3I55Q 5CQXA 3CBPA 1ZHIA 3RKWA 2R5MA 2BIVA 3PVQA 3EHQA 3L42A 2RNAA 2QQSA 1B34A 5D6WA 4ZGJB 3V8JA 4C8QF 2EGAA 3EFOB 4AFSC 4DOVA 2DERA 4M4ZA 1GBRA 3A8GB 3JB9G 3CCMQ 3M57A 4R56A 1ZA1B 4MZTA 3H9NA 4FIBA 1PKTA 3CCRA 1IREB 1S72T 2K3BA 1UJYA 1WYXA 3VS5A 1KG1A 3UPUA 4M78C 5KH6A 3NTIA 4PFOA 2PUOB 1Y71A 1M90R 1EZZB 1RAGB 3CCLT 2RI3A 1D1BA 4C8QD 4F7UE 3CEYA 4ANJA 1B7TA 2ROLA 4Y92A 1U06A 4WCIA 2F5KA 3EH2A 1NBEB 1UFFA 5D6XA 1QVGS 2BUDA 1VQ9T 3MCAB 2X35A 1HYOA 3SWNA 4Y28E 1SEMA 1K0XA 2CT4A 3PMIA 3VYHB 1VA7A 5GANg 1I5OB 2JM9A 2R58A 4C92C 4M77F 4NL2A 4Y91A 4ZNXA 1QKXA 1RADB 2JS0A 2D9TA 3EGDA 5GANf 4RTVA 2ZPEB 4MMLA 5GAOr 3L1AA 4JRKA 3LWHA 3BDLA 2DK3A 3HP9A 4OMPA 1UGVA 1EX4A 1KQSS 2K3XA 2K5FA 2NLUA 3CCUA 2YRDA 3QSUA 2EYQA 2EYWA 1M1KU 4F17A 4OP0A 1RI9A 1T3SA 2PNIA 3O5ZA 1O75A 1SPKA 4DBHA 3I56Q 1SRMA 1M2OA 5CQYA 2OTJA 5CKHA 2CH4W 4MZPA 2WSCE 3GBQA 1N8RR 2DMOA 3KBGA 1YNZA 4CI0C 2RA2A 3RKYA 3QO3A 1GCQC 1QVFA 8ATCB 5A0LA 3GF5A 1TG0A 1UE9A 2DZCA 2OTLT 2BE7D 2ED1A 2KQWA 2CP6A 2DL7A 1Y96A 3UA7A 3DKMA 5IXFA 3E9GA 3MEAA 1SHGA 2DFUA 1NE8A 3PT9A 1D3BB 1X75C 2KE9A 1HXDA 2VKNA 2QEXQ 2GNCA 1V1CA 3J7AF 4M77A 1JEGA 2D8JA 1UGRB 5I2SA 3TCJA 3G4SA 2CZ1B 2MIOA 2D6FA 1KIKA 3M9QA 1VQLT 1M90U 2V1QA 2ZPGB 2KK4A 3H0HA 2FEIA 2M51A 2E12A 2LQ8A 3A8LB 1YI2T 3CCUT 1E7OA 3OBWA 1FYNA 3JSCA 3KUFA 2AZSA 5IXBA 1YHQQ 4Z8AA 3OYEA 4MZMA 4M7DB 1A0NB 1UG1A 3VU3C 3CC4T 1JQQA 1AEYA 2X3XD 3F70A 3JCMV 5LJ3f 2RQTA 1UGQB 4JLIA 3CPWP 1N8RC 3ER0A 1PWTA 1OI1A 1M2VA 4II1A 1ZUUA 4J7IA 2FZGB 1R0CB 3QHSA 3M58A 2Y4YA 2QAZA 4BI8B 1WJSA 3CCVA 4X9DA 1Q81C 2DZ9A 2COZA 3HFNA 4XTVA 1OU8A 3PGGA 3ZEHA 4A4FA 1J3TA 2RK1A 3META 2Y4XA 2LTOA 1M1KR 5FU7C 1UDLA 2PVOB 5FU7B 3HL8A 2HBWA 2EQIA 4OMNA 4M7DG 2EAYA 1WHMA 2RJDA 3LW5E 2RMOA 3X25B 4BACA 4M75E 4NL3A 4PLLA 2RPNA 2YUPA 4L5GA 2DAQA 3FJ5A 4M7DE 4ZTFA 4E7LA 1F1BB 3PVLA 1O9SA 3VS0A 3CBOA 1QWEA 2PQWA 1YHQT 1PCXA 1BCOA 5CKFA 2QYZA 4RTWA 1AOJA 5LJ5d 4AFQC 1VQ7Q 1YI2Q 3UWNA 3X26B 3DB4A 4UC4A 2JW4A 2OTJT 2D0QB 4BY6C 2NUTB 3CD6Q 1U1TA 3RERA 2MCNA 1HSQA 4N0AA 4D8DA 2YT6A 4LUEA 2HQXA 3INZA 2E1HA 1OX9A 4TVRA 2LX9A 2GCXA 1VQ6Q 1DJ7B 1QCNA 3LX7A 2MPXC 1WJRA 2X51A 3GNFB 2JTMA 4RCCA 1K8AU 2A08A 2YRCA 3HFOA 5I11A 5AT1B 1D0ZA 2H8HA 4LDWA 2YLBA 4HCZA 3M53A 1OQKA 4FU6A 3VS6A 2VGNA 1QCFA 3M5AA 2RI5A 3L2ZA 5LJ5j 1G3TA 1TH7A 2LT1A 2KT8A 1GFDA 3E2UA 5HK3A 2KEAA 1JXMA 1OEBA 1X69A 3HRTA 1M3AA 1YFNA 5GANj 3QKJA 2HKNA 1VQ7A 3SWNC 1M8MA 1KQ1A 3JV3A 1VQOQ 4J6WA 3EGXA 2ESWA 3CCJQ 3FB9A 4E7JA 1IB8A 4E2FB 1QVFS 1ZSZB 1Q86U 2DJQA 2LCCA 3PMTA 2EKOA 4C5HA 1VQMT 1YIJQ 5GJVB 5LJ3g 2J6OA 4BD3A 4L6V5 4XU0A 4RTXA 1HD3A 5GAMf 1XTDA 3MO8A 4EMKA 2GQVA 1RLQC 1GL5A 4IUVA 1NPRA 4BI3A 1GCQA 4FSXA 2KR3A 4XU3A 4KGZB 1RABB 1U3OA 1N9SA 5GANd 3FIFA 1VQOA 1U1SA 4J7FA 2CUBA 1AWWA 3LYIA 2KRMA 2F1LA 1NEGA 1QP3A 2DX1A 2VYTA 4E47A 5CK9A 1VQ4T 4Q5WA 2COYA 2E6NA 2A0FB 1CSKA 3GP8A 4HCCA 4J9HA 4FYWB 1R8OB 2FL7A 3BDUA 5GANh 5GMKl 1VQ4Q 4AT1B 1KD1R 4GY5A 3VJPA 3V7RA 5GAN6 1K0SA 4C5EA 2HQEA 4LDUA 3CQTA 4JRPA 5IHKA 1Q82U 2EFIA 2XD0A 4M7DC 2QA4A 1JB0E 2PU9B 3EG2A 1VQPQ 1TUCA 3RMQA 1UJ0A 3M59A 2KXDA 2O9VA 2DTOA 4BUGA 2BZXA 1G3WA 1VUBA 1TSFA 1KC8U 2DL8A 4OF1A 2IPOB 1WIEA 2JS2A 2CZ7B 3GOXA 1D0XA 3TSZA 1EFNA 3G1JA 4J6YA 2XICA 3VS4A 4Z89A 1YHQA 2LRQA 2MWOA 5CKDA 2EJFA 2L2PA 2LCSA 2LMJA 1K1ZA 4A63B 2L3SA 4FYYB 1WQ7A 3SFMA 1SSHA 5FU6B 4PJOB 1OX8A 3CCJT 1UGSB 2PUKB 4IUQA 2P4TA 2CSIA 1PNJA 4OMLA 1P92A 2VGMA 4RTTA 3JB9I 1VQ5T 4KUDK 2RI2A 2L5QA 3BW1A 3MHXA 3CCVT 1K9MC 4HA8A 1H641 5LJ5f 4QQ6A 1D09B 1TU0B 3LLRA 4XK8E 1Q86C 1KC8C 2LNHB 3VS1A 1K73U 3CC2Q 4F14A 4HKEA 1UECA 3CXCS 1KK7A 1PD0A 1PSEA 2CP3A 2JTEA 2JT4A 1Q82C 1VQ6T 4L59A 4KUIA 3RKXA 3CMEQ 1NLOC 1TUGB 4C0DB 2KMTA 2FZCB 1YITT 2BZYA 2RM4A 1G8XA 3M0TA 4PJOF 2QXFA 2HSPA 4PJJA 3A8OB 4J6XA 2QA4T 4PJOG 3QJYA 3OW2S 3AT1B 3G4ST 2HBPA 4LDXA 1ARKA 2C0OA 1OPKA 2KT1A 2MMPA 4M78G 5LJ5h 4HVUA 1UHFA 3S3NA 4BB7A 1K8AC 3HRUA 3PIPA 3J81E 3JCMJ 2V8KA 1VQPA 4XU2A 1TXQA 3HPWA 3CCQQ 4KH1B 5FWCA 4C0GA 4DA4A 1Z9ZA 4KBMB 3OMGA 1BKBA 1YJWQ 2XHCA 3G7ZA 4PFZA 1WLPB 2CS7A 3ZL7C 1K73R 2RQUA 3CCET 2DE0X 2RN8A 2WSFE 4PJOD 1XQHA 1I0CA 4E7SA 4IKFA 2DXUA 2NYSA 3OS5A 3P8DA 2RJEA 2VASA 1JU5C 1YJWT 1ZSGA 3OYGA 4C8QA 1KD1C 1AZGB 2DVJA 5FRNA 1K4US 4FYVB 4AFZC 5L23A 2G3RA 3DLMA 4M77B 4C0ZA 2DYBA 2EKHA 1BBZA 4JUVA 3QPHA 5HCKA 1QVGA 3WXMB 2K7AA 4ME7A 3CCUQ 2V26A 2D8HA 3CCJA 3WVDB 1VQ9A 4BDZA 2QI2A 2DBKA 3OYAA 1WDXA 2MF2A 2QGFB 2K79A 1OULA 3LWIA 5C0MA 2QEXT 1VYTA 4RTUA 5GAMh 1BYMA 1RAHB 2RQRA 1GXIE 3OS1A 4EMHA 2QQAA 1AWJA 2CUDA 2FG0A 1WA7A 1K9MU 1M1GA 4JS4A 3JCMf 1Y7XA 4M7AF 5KYNA 1ABOA 4E6RA 3O8VA 1MGQA 3JCMe 2DLPA 4DEYA 1CKAA 2QTXA 3BFMA 4M7DA 1QQJA 4F7UG 1C0MA 2EQUA 2K5LA 3FJPA 5GAMe 4AG1C 1RLPC 1Q86R 4OB3B 4FM4B 4OGEA 2VC8A 1S72A 1BIBA 2HNIA 3A1PA 1SRLA 4XU1A 3CCRQ 3I56T 4FW2A 3MP8A 4IIOA 4CC4B 5A0GA 1YJ9Q 1WHKA 2JMAA 1NJIC 1IZ6A 2EGCA 4C92E 4LD6A 1I8FA 3DLLA
chains in the Genus database with same CATH topology
2JN0A 2RJDA 3LW5E 5CCAA 4FT2A 5GMKm 3JB9J 5M9OA 2VXFA 3X25B 1K73C 4BACA 5FU6C 4M75E 3MP6A 3OSSC 4M75F 2DIGA 2VXEA 4PLLA 4NL3A 4PJOC 3OYFA 4L5GA 2DAQA 4M7DF 4M7DE 1RI0A 3QZ9B 2AHJB 4ZTFA 2K3YA 4Z02A 3JCMd 5CO7A 4E7LA 4C8QC 2X4YA 1O9SA 3CBOA 3X28B 2PQWA 1YHQT 4QVZA 3JCMQ 3CMAT 2E5QA 4XTUA 5CKFA 2XKOC 5FLXE 4LD9K 4ELYC 3LGLA 5LJ5d 2M0OA 2ZPIB 1VQPT 3UWNA 3X26B 3DB4A 2RK2A 2DO3A 2K57A 2RHYA 4UC4A 5GAMd 1QW1A 2VV5A 3TU4K 1H3ZA 2K2VA 4B9WA 2EQKA 3V8LA 3PTAA 4DQ2A 2ZCFB 5LJ3j 3UT1A 2OTJT 2D0QB 2VUBA 4JRIA 1FWZA 1U1TA 4BY6C 3JCMP 3RERA 3SD4A 1XOVA 3HRSA 4IUPA 5KE3A 2KY9A 3OYHA 1M8VA 4M77D 4HT9A 4N0AA 1UGPB 3RIRA 4QVCA 1YJ9A 1ZBXA 2HQXA 2YLCA 3INZA 3NTKA 2E1HA 4M77G 1OZ3A 4R55A 2M1HA 4EPCA 4J83A 4TVRA 5KCHA 1KQSA 2DXBA 4D6WA 3CMET 2L3RA 1JJ2A 2LX9A 1FX7A 2GCXA 1ZQ1A 4C92D 1DJ7B 3LX7A 3X24B 1WJRA 3GNFB 3TREA 4C5IA 2JTMA 4JLGA 4RCCA 1K8AU 1VQKA 5AYFA 4HCBA 1YJNA 3HFOA 3LH0A 5GAN4 3H6ZA 5GMKj 3QIIA 1BI2A 1WJQA 3HHTB 1WPYA 2RD1A 4LDWA 3AHUA 4N4HA 5GAMg 4BDYA 2P0QA 2YLBA 3CC4A 4HCZA 3I56A 5GAOn 3M53A 4FU6A 1W2BA 4C0FA 2P0KA 2VGNA 2M16A 3S6WA 5GMKh 4C8QG 3M5AA 2LCLA 2EIFA 2R5AA 2ZZDA 2RI5A 3L2ZA 3L2WA 5LJ5j 1G3TA 1YIJA 1TH7A 3CXCA 2LT1A 4VUBA 3A8MB 5I21A 5GAN5 5HK3A 5FROA 3EFSA 3JB9D 4X34A 1U8RA 2BKDN 3PIOA 3CC2A 3V8KA 2JNGA 4KT0E 2DEQA 3HRTA 5HK0A 2YRVA 2ZPHB 5DY9A 3URGA 1I5LA 1KQ2A 5GANj 3QKJA 1VQ7A 5GAOq 3M55A 3OB9A 3SWNC 3CCMT 2RO0A 5GMKe 2KAFA 1KD1U 1KQ1A 3CCMA 3Q1JA 1WGSA 4QW2A 3WVEB 3L2UA 2DPPB 2QQ9A 3OYCA 4IUTA 3JB9F 4EMGA 3EFRA 4J6WA 4XTZA 3JCMb 3CC7A 2E65A 3I55T 3HKSA 3FB9A 1M4ZA 2A7YA 4M78B 4E7JA 2XU8A 2EWNA 1Q7YC 1VQOT 4M75B 3UDCA 2L89A 3GLXA 4C5GA 3X20B 3CCQA 2CGHA 2M9UA 4M75D 4PLIA 5GAN3 1QVFS 3V7SA 2X4JA 1HK9A 1Q86U 4ZN3A 1BI3A 4QQGA 1VQNA 3DLLA 2LCCA 4OB2B 3PMTA 3E19A 2L8DA 4XTYA 5LJ3d 2EQMA 5GAN8 4ATOA 1VQNT 3S3OA 2EKOA 4M78A 1QVPA 2E10A 4C5HA 5IT9E 4BE2A 3JCMW 1VQMT 1M1KC 4M75C 2O4XA 5LJ3g 1B34B 1VQ8T 2JTFA 4BD3A 1VQMA 4L6V5 4XU0A 2X4WA 4JRQA 2PVGB 3ZBDA 5GAMf 1XTDA 3MO8A 2P0PA 4EMKA 3CCLA 2GQVA 4C0DC 3A5ZB 1JJ2S 4IUVA 2PVDB 1NPRA 4ZGEB 1XNIA 1M1FA 4BI3A 3C95A 4FSXA 4M7AB 4J5YA 4XU3A 5D6YA 1UB4A 3FRNA 1N9SA 4ZTJA 5GANd 2DVEA 3FIFA 1VQOA 2QEXA 4OB1B 1U1SA 3ME9A 1WQWA 4J7FA 3OYLA 1LNXA 2EJ9A 5GMKi 3OYDA 1NZ9A 2A3LA 3LYIA 3H8ZA 4QVDA 2RHXA 2VYTA 1VQ4T 1QP3A 4E7IA 1VQKT 3NFCA 1X6OA 4E47A 2RH2A 2DXTA 4Q5WA 1OYXA 2E6NA 5CKEA 5CK9A 1VQ6A 2QQRA 4F7UB 2LT4A 4M7AA 1SSFA 4FL6A 2RHUA 4BI4A 2F5TX 5CKBA 3GP8A 4HCCA 4ZGDB 2FYKA 1VQ8A 4J8OA 2F69A 2E41A 2HAXA 1R8OB 2FL7A 2GFAA 3BDUA 5GMKl 5GANh 3E9FA 1NJIU 2QQBA 3M4YA 4GY5A 4PKCC 4N0AC 3V7RA 3VJPA 5GAN6 3CC2T 4C5EA 2HQEA 4LDUA 4RG8A 5GAN2 4JRPA 4F7UA 1KHCA 2OAUA 4M78E 4M78F 1Q82U 2EFIA 2XD0A 1YCYA 4M7DC 1JBMA 2JVVA 3OYKA 2QA4A 1JB0E 2PU9B 2ZGWA 5HKCA 5LJ5g 5LJ3e 4O6JA 1Y07A 3RMQA 4OMFB 3M59A 2DIQA 2XG8D 3OBYA 2DTOA 2I2LA 5L8RE 4A4HA 4BUGA 3JCMg 1N27A 3I55A 1G3WA 1VUBA 3TEEA 1KC8U 2CZ6B 2EJGA 2XDPA 2X4XA 3GNGA 4OF1A 3PNWC 2RHIA 2CZ7B 3VUBA 3GOXA 2CKKA 2WSEE 1V29B 1VIEA 3OYMA 3P8HA 4J6YA 1YIJT 1X01A 2XICA 4M75A 4X9CA 5GANe 3CMAA 3JCMX 4YTLA 1YHQA 4PJOA 3G6ET 1G5VA 2KVQG 2RJCA 4ELZC 2LRQA 2MWOA 4RCBA 2DXCA 1Q81U 4CRIA 5CAIA 5HY6A 5CKDA 1BIAA 2EJFA 2RB6A 2MWPA 1G3YA 3CBPA 5CQXA 1ZHIA 3RKWA 2R5MA 2BIVA 3G71T 2K4YA 3L42A 3OS0A 2O4XB 2IVWA 2QQSA 1B34A 2MI6A 1WQ7A 5D6WA 3SFMA 5IAYA 3J80E 5FU6B 2XDDA 4PJOB 4ZGJB 3SDZA 3CCJT 1UGSB 2PUKB 1PSFA 3CPFA 3QBYA 4IUQA 3V8JA 2P4TA 4P5NA 4C8QE 4C8QF 4EMKB 3CCST 4DOVA 1P92A 5DM7R 3A8GB 3CCSA 2VGMA 3JB9I 3CMEA 1YJWA 3EAEA 3JB9G 2O01E 1VQ5T 4KUDK 3M57A 4R56A 4MZTA 2RI2A 4C92G 4RMOA 2CZ0B 4FIBA 4A4EA 3M54A 4A4GA 2L5QA 3BW1A 4NOYA 3CCRA 3QUIA 1IREB 3MHXA 3ASKA 2HD0A 5CR2A 3CCVT 1S72T 2OTLA 2FHDA 4HA8A 1H641 2E64A 1G3SA 1K9MC 3RMSA 5LJ5f 4QQ6A 3G71A 4EDUA 2KSSA 3OYBA 4BY6B 3UPUA 3LLRA 2E6ZA 4M78C 1KG1A 5KH6A 3CCEA 3NTIA 4XK8E 2PUOB 1Y71A 1Q86C 5KCOA 1KC8C 3CCLT 4A53A 2RI3A 4WF2A 4LDVA 4C8QD 4F7UF 3CEYA 3VV0A 4F7UE 2V8IA 3LGFA 4OGCA 5A2QE 3SWNB 1K73U 3GIBA 2XDBA 2EQJA 2B8AA 4HKEA 4LDYA 3CXCS 1M90C 2F5KA 2FVUA 1PSEA 5GAOl 3C12A 5D6XA 1Q82C 1QVGS 2BUDA 4L59A 1VQ9T 1VQ6T 4KUIA 3CD6A 3RKXA 1W2BS 4M7AG 3MCAB 2DD4A 2X35A 4A54A 1RL2A 3R6OA 4C0DB 2KMTA 1I4K1 3MP1A 4FT4A 4A4KA 3FC3A 3SWNA 4Y28E 1YITT 2RM4A 2E70A 5J3BA 1EIFA 4PJOF 4PJOE 2QXFA 3P8BB 2V8JA 2YHTA 3PMIA 5C6SA 3VYHB 3OYJA 4JS5A 5GAOp 5GANg 2R58A 1UEBA 4C92C 4M77F 4M77E 4NL2A 3A8OB 4Y91A 1BI0A 1N9RA 4EMKC 5LL6S 4J6XA 2D9TA 2QA4T 1VQ7T 5GANf 3DB3A 3CPWA 4PJOG 3QJYA 4M78D 4M75G 1VQLA 3OW2S 3FLGA 3G4ST 2HBPA 2LQKA 2LVMA 2ZPEB 1AHJB 2K5IA 3M4GA 2FB7A 4MMLA 3OS2A 5GAOr 3L1AA 2MMPA 4JRKA 3QYGB 4M78G 3OSVA 5LJ5h 3LWHA 3MEVA 3BY7A 3BDLA 4GLKA 2DK3A 3OQ5A 4BB7A 3S3NA 1K8AC 1OZ2A 3HRUA 4M7AD 3PIPA 3J81E 1YITA 2WACA 3JCMJ 3HP9A 5A0DA 1KQSS 3QYHB 2V8KA 3M56A 3JCMh 1VQPA 4XU2A 5DLOA 3JAME 2K3XA 2K5FA 3S3MA 2NLUA 3RESA 3CCUA 2JOYA 3JB9H 3HPWA 2EYQA 2KDSA 3CPWS 1M1KU 4DA4A 4OP0A 4C0GA 2CYZB 3QSUA 3KXTA 3JRZA 4KBMB 3MEWA 4MMKA 3OMGA 1O75A 1BKBA 3CBMA 4IURA 2XHCA 3G7ZA 1FXXA 2CS7A 5CQYA 2C06A 4JDSA 5CKHA 2OTJA 1YJ9T 3CCET 4MZPA 1Q7YU 2WSCE 2WSFE 4PJOD 4N4IA 4M77C 1XQHA 3VKIA 5GAMj 2QDYB 4IKFA 2DXUA 4QQDA 3KBGA 3OS5A 3P8DA 4CI0C 3SB2A 2RA2A 2RJEA 4PNOA 3RKYA 1YBYA 1YJWT 3OYIA 3QO3A 4XTXA 2R57A 2DTIA 3OYGA 4MDXA 1Y96B 1VQ5A 2GF7A 3MEUA 4OVAA 5J39A 4C8QA 3JCMc 4XQ3A 2XIDA 1KD1C 1QVFA 1I81A 1YJNT 3HSBA 5A0LA 3GF5A 3VYGA 3FEOA 2LNVA 2DZCA 5FRNA 5KE2A 2OTLT 3C4SA 5IN1A 2G3RA 1M5Q1 3DLMA 2KQWA 4M77B 3L2RA 4C0ZA 3OMCA 4KULA 4E7HA 1Y96A 3DKMA 2XK0A 3E9GA 2RHZA 2XI9A 4RG2A 3MEAA 1NE8A 3PT9A 1D3BB 3T9NA 1X75C 3C94A 4MDWA 4JUVA 3ZFJA 3G6EA 1HXDA 4BE1A 3QPHA 5EG2A 5CIUA 3V7CA 3J7AF 1WNLA 4M77A 1QVGA 1UGRB 1BI1A 3WXMB 4B9XA 5I2SA 3TCJA 3G4SA 2CZ1B 1VIFA 2D6FA 4ME7A 3NTHA 3M9QA 2ZPFB 3CCJA 1D3BA 3WVDB 1VQLT 1VQ9A 3CD6T 4BDZA 2QI2A 1M90U 2GFUA 2Y90A 3OYAA 5FRMA 2ZPGB 2MF2A 2KK4A 3CC7T 3LWIA 1KHIA 5C0MA 2MAMA 2E12A 2LDMA 2LQ8A 3A8LB 4NS5A 4OB0B 2QEXT 3CCUT 1YI2T 3FDRA 1W4SA 3OBWA 5GAN7 3JSCA 3KUFA 3VUZA 5GAMh 1YI2A 1BYMA 2DJZA 2DD5A 1NPPA 4PL6A 1N8RU 4HT8A 3OYEA 1GXIE 4MZMA 3OS1A 2RJFA 4EMHA 2QQAA 4M7DB 1K9MU 1M1GA 1LOJA 4JS4A 3JCMf 3VU3C 3CC4T 1Y7XA 4M7AE 4M7AF 2DTHA 3O8VA 1JRIA 3L2QA 1MGQA 3E1SA 4V2SA 3F70A 3JCMe 3QJ6A 3JCMV 2ZPBB 5LJ3f 1UGQB 4JLIA 2LC4A 5DLQE 3L2VA 1MHNA 1N8RC 4XTWA 2QTXA 2JZ2A 3BFMA 3OA6A 3ER0A 4M7DA 2H3JA 1OI1A 3A8HB 4F7UG 1M9SA 2JUFA 5LJ5e 2DKGA 4II1A 2EQUA 4J7IA 2K5LA 3QXEB 4RKUE 3QHSA 3OW2A 3FJPA 5GAMe 2IG0A 1LJOA 3M58A 2Y4YA 4C8QB 4C92A 3QZ5B 4FM4B 4OB3B 4OGEA 2VC8A 1VQ4A 4BI8B 3CCRT 5I2MA 3N5BB 3OYNA 1WJSA 4M7AC 3CCVA 4X9DA 1BIBA 2HNIA 3GPLA 4E7KA 1S72A 1N6AA 1Q81C 2DZ9A 3HFNA 4XTVA 3QDRB 3QG1A 4XU1A 3I56T 4LDXA 5GAOm 3MP8A 4JJNK 3PFSA 3PGGA 4N4GA 5CVIA 3ZEHA 3RUXA 3OY9A 4A4FA 5A0GA 2RK1A 4C92B 3META 3OYYA 1QP2A 5J26A 2Y4XA 3CCQT 1IZ6A 4IUUA 2LTOA 4BE0A 1NJIC 4M7DD 5FU7C 4ZN1A 2PVOB 5FU7B 3HL8A 4DOWA 5LJ3h 4M7DG 2EAYA 4LD6A 4C92F 4C92E 1I8FA 4XAXB 4O5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM c;  4NOY A;  4XQ3 A;  2JN0 A;  5LJ3 d;  5GAN 8;  1I81 A;  3QUI A;  5GMK m;  3JB9 J;  4M78 A;  2VXF A;  2E10 A;  3HSB A;  3JCM W;  4M75 E;  4M75 F;  4HA8 A;  1H64 1;  2E64 A;  2VXE A;  4M75 C;  4NL3 A;  5LJ3 g;  2DZC A;  1B34 B;  5LJ5 f;  4XU0 A;  4M7D F;  4M7D E;  1M5Q 1;  4M78 C;  4M77 B;  5GAM f;  3JCM d;  4EMK A;  4C8Q C;  1Y96 A;  4A53 A;  4WF2 A;  4M7A B;  3JCM Q;  4J5Y A;  4XU3 A;  4XTU A;  4C8Q D;  1D3B B;  4F7U F;  4F7U E;  1N9S A;  5LJ5 d;  4JUV A;  5GAN d;  2DVE A;  1HXD A;  3FIF A;  1U1S A;  1WQW A;  3SWN B;  1LNX A;  3GIB A;  2EJ9 A;  5GMK i;  3V7C A;  2K57 A;  1WNL A;  4QVD A;  5GAM d;  4M77 A;  5GAN 7;  2DXT A;  3V8L A;  4DQ2 A;  5LJ3 j;  5GAO l;  4JRI A;  3JCM P;  3RER A;  1U1T A;  4F7U B;  4M7A A;  4M7A G;  3RKX A;  4M77 D;  1D3B A;  4A54 A;  4HT9 A;  4N0A A;  3RIR A;  2FYK A;  1I4K 1;  4QVC A;  2Y90 A;  3SWN A;  3INZ A;  2E41 A;  2YLC A;  3BDU A;  2E1H A;  4M77 G;  5GMK l;  5GAN h;  2RM4 A;  5GAN 6;  3V7R A;  4N0A C;  4PJO F;  4PJO E;  2YHT A;  4C92 D;  5GAN 2;  4F7U A;  5GAM h;  4M78 E;  4M78 F;  5GAO p;  2DJZ A;  4C8Q A;  1YCY A;  4HT8 A;  5GAN g;  4RCC A;  4M7D C;  1JBM A;  4C92 C;  4M77 F;  4M77 E;  4NL2 A;  4EMH A;  4Y91 A;  3HFO A;  5GAN 4;  2ZGW A;  1N9R A;  5GMK j;  4EMK C;  5LJ5 g;  4M7D B;  5LJ3 e;  4J6X A;  1LOJ A;  5GAN f;  3JCM f;  3VU3 C;  1WPY A;  2RD1 A;  3AHU A;  4PJO G;  4M78 D;  5GAM g;  4M7A E;  2YLB A;  4M75 G;  4M7A F;  2DTH A;  2DTO A;  1JRI A;  2I2L A;  3M4G A;  1MGQ A;  4MML A;  2FB7 A;  3JCM g;  5GAO n;  5GAO r;  3L1A A;  4M78 G;  4JRK A;  5LJ5 h;  4V2S A;  3JCM e;  5GMK h;  2EJG A;  5LJ3 f;  3JCM V;  3BY7 A;  4JLI A;  4C8Q G;  4M7A D;  3L2Z A;  4XTW A;  2QTX A;  3BFM A;  5LJ5 j;  1TH7 A;  4M7D A;  3JCM J;  3JB9 D;  5I21 A;  5GAN 5;  3EFS A;  4F7U G;  4J6Y A;  3JCM h;  1X01 A;  4M75 A;  4XU2 A;  5LJ5 e;  4X9C A;  3V8K A;  5GAN e;  2DKG A;  3RES A;  2DEQ A;  3JCM X;  4PJO A;  4PJO C;  3JB9 H;  3QSU A;  4OP0 A;  5DY9 A;  1I5L A;  3QHS A;  1KQ2 A;  5GAN j;  3FJP A;  4RCB A;  5GAM e;  5GAO q;  4MMK A;  1LJO A;  4C92 A;  5CAI A;  4C8Q B;  1BIA A;  2EJF A;  2RB6 A;  3SWN C;  5GMK e;  2VC8 A;  3RKW A;  1KQ1 A;  4M7A C;  4X9D A;  1BIB A;  1B34 A;  2HNI A;  1WQ7 A;  4EMG A;  3JB9 F;  3EFR A;  2DZ9 A;  3HFN A;  4J6W A;  4XTV A;  4XTZ A;  4XU1 A;  3JCM b;  4PJO B;  5GAO m;  4PJO D;  2E65 A;  3V8J A;  4M77 C;  4C8Q E;  3FB9 A;  3PGG A;  4M78 B;  4C8Q F;  3RUX A;  4EMK B;  5GAM j;  2EWN A;  4C92 B;  2DXU A;  1M8V A;  4M7D D;  4M75 B;  3JB9 I;  3SB2 A;  3JB9 G;  2RA2 A;  2CGH A;  4M75 D;  4PNO A;  3RKY A;  5GAN 3;  3V7S A;  3QO3 A;  5LJ3 h;  4M7D G;  1HK9 A;  2EAY A;  4XTX A;  4C92 F;  4C92 G;  2DTI A;  4C92 E;  1Y96 B;  1I8F A;  3BW1 A;  4XTY A; 
#chains in the Genus database with same CATH topology
 1PM3 A;  1YP5 A;  1MUZ A;  1SG5 A;  5M9O A;  2VXF A;  4KGV B;  5FU6 C;  4PJO C;  2VXE A;  4JZ4 A;  5IHN A;  1MMA A;  2K3Y A;  4Z02 A;  4C8Q C;  1T0J A;  4QVZ A;  4XTU A;  5FLX E;  4ELY C;  2ZPI B;  2RK2 A;  2DO3 A;  2LJ3 A;  4PJM A;  5GAM d;  5I22 A;  2VV5 A;  2DRM A;  1ZUK A;  3PTA A;  4DQ2 A;  2ZCF B;  5LJ3 j;  3JCM P;  1FWZ A;  2KY9 A;  4HT9 A;  2D0N A;  1NG2 A;  1UGP B;  4JJD A;  1ZBX A;  2YLC A;  3NTK A;  2JMC A;  1OZ3 A;  2L3R A;  4HVW A;  2NUT A;  2HCK A;  3QWY A;  1VQK A;  4HCB A;  2PZ1 A;  3LH0 A;  1KSW A;  1QMC A;  4BDY A;  4F16 A;  5KYY A;  3I56 A;  3CC4 A;  5GAO n;  1W2B A;  1S72 Q;  2M16 A;  2CT3 A;  2RQW A;  2VVK A;  2EIF A;  2R5A A;  4VUB A;  1X27 A;  3A8M B;  5EC7 A;  1YWO A;  3EFS A;  4OMM A;  4CC3 A;  2BKD N;  5FWB A;  3CC2 A;  2GQI A;  1QVG P;  1KQ2 A;  3OB9 A;  3RBB B;  3CCM T;  2RO0 A;  2OX7 A;  2HEQ A;  4QW2 A;  3L2U A;  1ZSZ A;  4IUT A;  3VS3 A;  2YDL A;  2J7I A;  3CC7 A;  2BTT A;  1H92 A;  1V76 A;  2B86 A;  2EWN A;  2XU8 A;  1C6V X;  5KYU A;  1Q7Y C;  1MND A;  4M75 B;  2L89 A;  3GLX A;  2M9U A;  1LVK A;  4QT7 A;  3V7S A;  2X4J A;  1HK9 A;  1QLY A;  3THK A;  4OB2 B;  4XTY A;  2L8D A;  1M30 A;  1VQN T;  5IT9 E;  1QVP A;  3JCM W;  1VQ8 T;  2A28 A;  2PVG B;  2W0Z A;  1W6X A;  1XNI A;  2JM8 A;  5D6Y A;  1UB4 A;  2FZK B;  3FRN A;  1YN8 A;  2QEX A;  4OB1 B;  5GMK i;  1NZ9 A;  1BK2 A;  1Y57 A;  1UTI A;  3NFC A;  2ENM A;  4AMC A;  3M0R A;  2QQR A;  2FRY A;  4M7A A;  2RHU A;  5KYY B;  2CRE A;  5CKB A;  4ZGD B;  4J8O A;  1XJW B;  1NJI U;  2GTJ A;  1ABQ A;  3M4Y A;  3CC2 T;  1H8K A;  4M78 E;  1MV3 A;  1JBM A;  3OYK A;  1ZX6 A;  1RAF B;  1MMN A;  2DIQ A;  2X3W D;  3LH5 A;  4K11 A;  1VQN Q;  2F2X A;  3PNW C;  3VUB A;  2L3P A;  3P8H A;  5GAN e;  3JCM X;  4YTL A;  4ELZ C;  1Q81 U;  3CCS Q;  4CRI A;  5CAI A;  3IQL A;  2RB6 A;  4FCY A;  2MWP A;  1G3Y A;  2LJ1 A;  5IHI A;  2K4Y A;  3OS0 A;  2C0I A;  2KYM A;  3VRZ A;  3J80 E;  2KGT A;  3SDZ A;  5KCH A;  4C8Q E;  4P5N A;  2AK5 A;  1K76 A;  1KFZ A;  4E7Z A;  2VWF A;  1NYG A;  3EAE A;  2O01 E;  1NJI R;  5ECA A;  4RMO A;  4A4E A;  4A4G A;  2EYZ A;  4NOY A;  2HL3 A;  6AT1 B;  3ASK A;  2FHD A;  1QKW A;  2E64 A;  3H0I A;  4CC2 A;  1LCK A;  3G71 A;  2KSS A;  3OYB A;  1R77 A;  2E6Z A;  4HCK A;  3REB B;  1PC0 A;  5KCO A;  4A53 A;  4WF2 A;  4LDV A;  8AT1 B;  4F7U F;  1T0H A;  1KC8 R;  5A2Q E;  3SHW A;  2YSQ A;  1X6B A;  2KXC A;  2XDB A;  1AWX A;  1AZE A;  4LDY A;  3C12 A;  4M7A G;  2OJ2 A;  1RL2 A;  3R6O A;  1I4K 1;  3MP1 A;  4A4K A;  3QDF A;  1FMW A;  2BE9 B;  3UA6 A;  4LXC A;  2E70 A;  5J3B A;  1VQL Q;  1ZSZ C;  3P8B B;  2V8J A;  2YHT A;  5C6S A;  3OYJ A;  4QKU A;  4KRT A;  4M77 E;  1M27 C;  1N9R A;  3M0P A;  4M78 D;  1VQL A;  2DL4 A;  3FLG A;  3OS2 A;  2K5I A;  2LX7 A;  3BY7 A;  4GLK A;  1W70 A;  4M7A D;  1OZ2 A;  2WAC A;  4CC7 A;  2FPD A;  3M56 A;  3JAM E;  2O88 A;  2JOY A;  3JB9 H;  3CPW S;  2KDS A;  4PJN A;  2CYZ B;  3KXT A;  3MEW A;  4MMK A;  4IUR A;  1PG5 B;  1AD5 A;  2XMF A;  2QGG A;  2C06 A;  2CP7 A;  4JDS A;  1YJ9 T;  1MV0 B;  3EG3 A;  1Q7Y U;  1OU9 A;  3VKI A;  3QWX X;  3I35 A;  4PNO A;  3OYI A;  2R57 A;  2DTI A;  1IO6 A;  4OVA A;  5J39 A;  1TUD A;  2K9G A;  2XID A;  1YJN T;  2JJ9 A;  3VYG A;  2LNV A;  5KE2 A;  1M5Q 1;  3BE3 A;  3L2R A;  3NPF A;  4LUD A;  2MOX A;  4RTZ A;  4J9C A;  4RUG A;  1T3L A;  2XI9 A;  3EG9 A;  3G6E A;  4MDW A;  3C94 A;  5KYW A;  1WX6 A;  5CIU A;  1YWP A;  4Z88 A;  2HKQ B;  1K8A R;  3EGD B;  4JJC A;  2OI3 A;  1KQS P;  1VIF A;  3NTH A;  3CD6 T;  2Y90 A;  2P4R A;  3CC7 T;  1KHI A;  2GGR A;  2MAM A;  4NS5 A;  1Y0M A;  2KRN A;  4PFP A;  2L0A A;  4KGX B;  2DJZ A;  2DD5 A;  4HT8 A;  3CMA Q;  3UAT A;  1JJ2 P;  4DBQ A;  1WXB A;  2DTH A;  1JRI A;  1WFW A;  3E1S A;  2YUQ A;  1MHN A;  4XTW A;  3M0S A;  3NHN A;  2H3J A;  1JO8 A;  1M9S A;  5LJ5 e;  2CP5 A;  3QXE B;  2YXY A;  3OW2 A;  2IG0 A;  4C92 A;  3SEM A;  5I2M A;  1BU1 A;  3N5B B;  3OYN A;  2CP2 A;  4M7A C;  2DEU A;  3QG1 A;  1UHC A;  5GAO m;  2AKL A;  1AWO A;  4N4G A;  5CVI A;  3CCE Q;  3OYY A;  1QP2 A;  5J26 A;  4J9I A;  3CCQ T;  4IUU A;  4ZN1 A;  2A36 A;  4XAX B;  2VB6 A;  2F2V A;  4O5V A;  2JN0 A;  5GMK m;  4FT2 A;  1K73 C;  2DBM A;  4M75 F;  3MP6 A;  2HQH A;  1ZBJ A;  2DIG A;  3OSS C;  3OYF A;  3G4S Q;  1PRL C;  4HVV A;  4M7D F;  2FPF A;  3QZ9 B;  4LN2 A;  5IH2 A;  3JCM d;  2X4Y A;  3CXC P;  2PTK A;  3X28 B;  3CMA T;  3JCM Q;  1CKB A;  1B3Q A;  2HSE B;  3LGL A;  4OMQ A;  2M0O A;  1PHT A;  2SRC A;  1D1A A;  3C0C A;  2RHY A;  2HMA A;  3CC7 Q;  1LPL A;  1H3Z A;  2K2V A;  1YIT Q;  3V8L A;  3UT1 A;  1RAE B;  2ABL A;  2VUB A;  3I9Q A;  4JRI A;  5KE3 A;  1XOV A;  3OYH A;  2D1X A;  4QVC A;  1YJ9 A;  4R55 A;  2M1H A;  2DXB A;  1RUW A;  4D6W A;  2FRW A;  3CME T;  1JJ2 A;  1FX7 A;  4C92 D;  3X24 B;  2MYS A;  3TRE A;  4C5I A;  4JLG A;  1VOM A;  5GAN 4;  5GMK j;  3QII A;  1WJQ A;  2O9S A;  1WPY A;  3AHU A;  4N4H A;  5GAM g;  2KI7 A;  4GLM A;  2EPD A;  2CDT A;  1X43 A;  2P0K A;  5KYX B;  3CCV Q;  3S6W A;  4C8Q G;  2LCL A;  2ZZD A;  1WI7 A;  1YIJ A;  5GAN 5;  5FRO A;  2CSQ A;  4X34 A;  3PIO A;  3V8K A;  4KT0 E;  1OPL A;  2DEQ A;  2KYB A;  5HK0 A;  2YRV A;  2ZPH B;  1ZA2 B;  5DY9 A;  3URG A;  5GAO q;  5KYU B;  2QK0 A;  5GMK e;  1G83 A;  2KAF A;  4LNP A;  4J9F A;  2YUO A;  2QQ9 A;  1SF9 A;  2NUP B;  2P84 A;  3TSW A;  3UDC A;  4C5G A;  4J9B A;  3X20 B;  2CGH A;  4M75 D;  3CCQ A;  4ZN3 A;  2NUZ A;  4QQG A;  1VQN A;  4ATO A;  2EQM A;  5GAN 8;  4J9D A;  4JJB A;  4M78 A;  2E10 A;  4BE2 A;  4M75 C;  2O4X A;  1JXO A;  2X4W A;  4JRQ A;  3ZBD A;  1I1J A;  2DYI A;  3A5Z B;  1JJ2 S;  1YCS B;  2AIR B;  4ZGE B;  3C95 A;  4M7A B;  1N5Z A;  4J9G A;  3ME9 A;  1LNX A;  2EJ9 A;  1IGQ A;  2A3L A;  2ROT A;  4QVD A;  2RHX A;  1VQK T;  5GAN 7;  2DXT A;  1VQ6 A;  2GTO A;  3R6N A;  2LT4 A;  4FL6 A;  1H3H A;  2DNU A;  1HJD A;  1VQ8 A;  2HAX A;  1TTH B;  2GFA A;  3E9F A;  1PKS A;  2QQB A;  4PKC C;  4N0A C;  3RDV A;  4RG8 A;  1GBQ A;  2QG9 B;  5GAN 2;  4F7U A;  1KHC A;  2OAU A;  2RQV A;  1I07 A;  1YCY A;  2AKK A;  4DBF A;  3EHR A;  5LJ5 g;  5LJ3 e;  1Y07 A;  2IIM A;  4OMF B;  2I0N A;  2XG8 D;  2DET A;  4A4H A;  5L8R E;  1N27 A;  3I55 A;  2CZ6 B;  2XDP A;  2X4X A;  3GNG A;  2NUP A;  2RHI A;  2CKK A;  2E3I A;  2DL5 A;  2KRO A;  2QTV A;  1V29 B;  2FO0 A;  2WSE E;  1VQM Q;  1YIJ T;  3CMA A;  1W2B P;  3HTR A;  1G5V A;  2C0T A;  1ACM B;  2RJC A;  2O31 A;  4RCB A;  3EG0 A;  1E6H A;  1BIA A;  1FMK A;  1WHL A;  3G71 T;  2O4X B;  2IVW A;  5IAY A;  2MI6 A;  1FMV A;  2XDD A;  4IIM A;  3PE0 A;  1PSF A;  3CPF A;  3QBY A;  1WZO A;  4EMK B;  3CCS T;  2CP0 A;  3D7S B;  5DM7 R;  3CCS A;  3CME A;  1YJW A;  4JZ3 A;  3M0Q A;  2AT1 B;  2LJ0 A;  2KBT A;  4C92 G;  2CZ0 B;  3M54 A;  3ULR B;  3QUI A;  2HD0 A;  5CR2 A;  2OTL A;  2E3H A;  1Q82 R;  1G3S A;  3RMS A;  1PRM C;  1IHV A;  4EDU A;  2EGE A;  4BY6 B;  1E6G A;  2E4H A;  3CCE A;  1BB9 A;  2O2O A;  4R0K A;  3VV0 A;  2V8I A;  3LGF A;  3TVT A;  3TQ7 P;  4OGC A;  3SWN B;  2MK5 A;  1UUE A;  5D7U A;  3GIB A;  2EQJ A;  4ORZ A;  2B8A A;  4PJL A;  1M90 C;  2FVU A;  5GAO l;  3CD6 A;  1W2B S;  2EYY A;  2DD4 A;  4A54 A;  3FC3 A;  4FT4 A;  3KFV A;  3MKD A;  4DEX A;  1EIF A;  4PJO E;  4LE9 A;  2LQW A;  1MNE A;  2QDL A;  4JS5 A;  2J6K A;  1WHJ A;  5GAO p;  1UEB A;  2DA9 A;  1BI0 A;  4EMK C;  5LL6 S;  9ATC B;  1VQ7 T;  3DB3 A;  3CPW A;  1C1A A;  4M75 G;  1D0Y A;  2LQK A;  2LVM A;  3M4G A;  1AHJ B;  2FB7 A;  4ESR A;  3QYG B;  3MJX A;  3OSV A;  3MEV A;  3OQ5 A;  4PK4 A;  1YIT A;  1TOV A;  5A0D A;  3QYH B;  3JCM h;  3S3M A;  5DLO A;  3RES A;  3JRZ A;  3CBM A;  1FXX A;  1WHH A;  2DL3 A;  3EG1 A;  3MPU B;  1IGU A;  4N4I A;  4M77 C;  5GAM j;  2QDY B;  1Z9Q A;  2AZV A;  4QQD A;  1K9M R;  3I5R A;  3RNJ A;  3SB2 A;  1YBY A;  2G6F X;  4XTX A;  2J6F A;  4MDX A;  1Y96 B;  1VQ5 A;  2H3E B;  2GF7 A;  3MEU A;  3JCM c;  1OOT A;  4XQ3 A;  1KJW A;  1BCM A;  1I81 A;  2DIL A;  1AT1 B;  1G2B A;  3HSB A;  4HXJ A;  3FEO A;  4D8K A;  3C4S A;  5IN1 A;  1U5S A;  3CC4 Q;  3OMC A;  1ZUY A;  4KUL A;  4E7H A;  2XK0 A;  2RHZ A;  4RG2 A;  1MMD A;  2LQN A;  1NM7 A;  3T9N A;  2FPE A;  3ZFJ A;  2K2M A;  4BE1 A;  2YWW A;  1W1F A;  1TWB A;  5EG2 A;  3V7C A;  1WNL A;  1IHW A;  2CH4 A;  1M3C A;  1BI1 A;  4B9X A;  1WHG A;  2EYX A;  3EG9 B;  3VRY A;  2ZPF B;  1D3B A;  5KYW B;  2GFU A;  5FRM A;  4RTY A;  4OB0 B;  2LDM A;  3UF4 A;  1WXT A;  3FDR A;  1W4S A;  3VUZ A;  1YI2 A;  4PL6 A;  1NPP A;  2HDA A;  1N8R U;  4EIK A;  2DM1 A;  2RJF A;  1VYV A;  2DF6 A;  1LOJ A;  1M2V B;  4M7A E;  4B6M A;  3REA B;  3L2Q A;  4V2S A;  1RAI B;  3QJ6 A;  4DBR A;  2ZPB B;  2LC4 A;  5DLQ E;  3L2V A;  3OA6 A;  2JZ2 A;  2OTL Q;  3A8H B;  2JUF A;  2DKG A;  2LZ6 B;  1MMG A;  1YJN Q;  4RKU E;  2L3Q A;  1LJO A;  4C8Q B;  1VQ5 Q;  3QZ5 B;  1VQ4 A;  3CCR T;  3GPL A;  2ZAE A;  4E7K A;  1N6A A;  3QDR B;  4JJN K;  3PFS A;  1GFC A;  3OY9 A;  3RUX A;  1Q95 G;  4OMO A;  4C92 B;  4BE0 A;  1M8V A;  4M7D D;  2QAS A;  3G71 Q;  4DOW A;  2Z0W A;  5LJ3 h;  1X2K A;  4C92 F;  4X1V A;  4F04 B;  5CCA A;  3JB9 J;  4AG2 C;  1Q7Y R;  3VS2 A;  1RI0 A;  2AHJ B;  5CO7 A;  2V1R A;  2ECZ A;  4LD9 K;  2E5Q A;  2XKO C;  2EW3 A;  2BZ8 A;  1VQP T;  3H0F A;  2J05 A;  2K57 A;  1QW1 A;  3TU4 K;  4B9W A;  1OV3 A;  2EQK A;  1B07 A;  2M02 A;  1IRX A;  3SD4 A;  3H41 A;  3HRS A;  4IUP A;  4M77 D;  1VQ9 Q;  2J06 A;  2K6D A;  3RIR A;  3VS7 A;  4J9E A;  4M77 G;  4EPC A;  4J83 A;  2RF0 A;  2LP5 A;  1KQS A;  1TS9 A;  2JXB A;  1ZQ1 A;  1QCO A;  3OW2 P;  5KYX A;  2EBP A;  1VQK Q;  5AYF A;  1IXD A;  1YJN A;  2EVR A;  3H6Z A;  1BI2 A;  3HHT B;  1Q81 R;  2A37 A;  1M3B A;  2RD1 A;  2P0Q A;  4FW1 A;  3CCL Q;  1ZLM A;  4C0F A;  5GMK h;  1S1N A;  1PD1 A;  3L2W A;  3U23 A;  3CXC A;  3JB9 D;  5I21 A;  2SEM A;  1U8R A;  1RAC B;  2JNG A;  3RR6 A;  1NYF A;  3EGX B;  4FSS A;  2GBQ A;  3NGP A;  4GBQ A;  1I5L A;  1X2Q A;  2W10 A;  4AFU C;  3M55 A;  2M0Y A;  1KD1 U;  1R0B G;  1D1C A;  2KNB B;  3CCM A;  3Q1J A;  1WGS A;  1AVZ C;  3WVE B;  1SKU B;  2DPP B;  3OYC A;  3JB9 F;  4EMG A;  3EFR A;  4XTZ A;  3JCM b;  4KH0 B;  3NMZ C;  2E65 A;  3I55 T;  3HKS A;  1M4Z A;  2A7Y A;  4M78 B;  1WXU A;  1VQO T;  4PLI A;  5GAN 3;  1BI3 A;  3E19 A;  5LJ3 d;  7AT1 B;  3G6E Q;  2DRK A;  1RAA B;  3S3O A;  1M1K C;  1NEB A;  2HL5 C;  2X9H A;  1B34 B;  2JTF A;  1VQM A;  2ED0 A;  3A98 A;  2QA4 Q;  2P0P A;  2YUN A;  3CCL A;  1QWF A;  4C0D C;  3EFO A;  2PVD B;  2F2W A;  1M1F A;  4J5Y A;  4ZTJ A;  2DVE A;  2NWM A;  4FYX B;  1WQW A;  3EGU A;  3OYL A;  3OYD A;  3H8Z A;  4E7I A;  1X6O A;  2RH2 A;  1OYX A;  5CKE A;  2ATC B;  2E5K A;  4F7U B;  1SSF A;  4BI4 A;  2F5T X;  3EH1 A;  2FYK A;  3I5S A;  1K9A A;  2F69 A;  2E41 A;  2OAW A;  5GJW B;  1VYU A;  2KRS A;  2OTJ Q;  4M78 F;  2JVV A;  2ZGW A;  5FW9 A;  5HKC A;  4O6J A;  1QVF P;  1SHF A;  2HZY A;  1X6G A;  2COW A;  3OBY A;  1VQ8 Q;  2I2L A;  3JCM g;  4JPB W;  3TEE A;  2EJG A;  1NLP C;  3M0U A;  1VIE A;  3OYM A;  1GRI A;  1X01 A;  4M75 A;  4X9C A;  4PJO A;  4WTO B;  1GCP A;  3G6E T;  2KVQ G;  2DXC A;  5HY6 A;  3I55 Q;  5CQX A;  3CBP A;  1ZHI A;  3RKW A;  2R5M A;  2BIV A;  3PVQ A;  3EHQ A;  3L42 A;  2RNA A;  2QQS A;  1B34 A;  5D6W A;  4ZGJ B;  3V8J A;  4C8Q F;  2EGA A;  3EFO B;  4AFS C;  4DOV A;  2DER A;  4M4Z A;  1GBR A;  3A8G B;  3JB9 G;  3CCM Q;  3M57 A;  4R56 A;  1ZA1 B;  4MZT A;  3H9N A;  4FIB A;  1PKT A;  3CCR A;  1IRE B;  1S72 T;  2K3B A;  1UJY A;  1WYX A;  3VS5 A;  1KG1 A;  3UPU A;  4M78 C;  5KH6 A;  3NTI A;  4PFO A;  2PUO B;  1Y71 A;  1M90 R;  1EZZ B;  1RAG B;  3CCL T;  2RI3 A;  1D1B A;  4C8Q D;  4F7U E;  3CEY A;  4ANJ A;  1B7T A;  2ROL A;  4Y92 A;  1U06 A;  4WCI A;  2F5K A;  3EH2 A;  1NBE B;  1UFF A;  5D6X A;  1QVG S;  2BUD A;  1VQ9 T;  3MCA B;  2X35 A;  1HYO A;  3SWN A;  4Y28 E;  1SEM A;  1K0X A;  2CT4 A;  3PMI A;  3VYH B;  1VA7 A;  5GAN g;  1I5O B;  2JM9 A;  2R58 A;  4C92 C;  4M77 F;  4NL2 A;  4Y91 A;  4ZNX A;  1QKX A;  1RAD B;  2JS0 A;  2D9T A;  3EGD A;  5GAN f;  4RTV A;  2ZPE B;  4MML A;  5GAO r;  3L1A A;  4JRK A;  3LWH A;  3BDL A;  2DK3 A;  3HP9 A;  4OMP A;  1UGV A;  1EX4 A;  1KQS S;  2K3X A;  2K5F A;  2NLU A;  3CCU A;  2YRD A;  3QSU A;  2EYQ A;  2EYW A;  1M1K U;  4F17 A;  4OP0 A;  1RI9 A;  1T3S A;  2PNI A;  3O5Z A;  1O75 A;  1SPK A;  4DBH A;  3I56 Q;  1SRM A;  1M2O A;  5CQY A;  2OTJ A;  5CKH A;  2CH4 W;  4MZP A;  2WSC E;  3GBQ A;  1N8R R;  2DMO A;  3KBG A;  1YNZ A;  4CI0 C;  2RA2 A;  3RKY A;  3QO3 A;  1GCQ C;  1QVF A;  8ATC B;  5A0L A;  3GF5 A;  1TG0 A;  1UE9 A;  2DZC A;  2OTL T;  2BE7 D;  2ED1 A;  2KQW A;  2CP6 A;  2DL7 A;  1Y96 A;  3UA7 A;  3DKM A;  5IXF A;  3E9G A;  3MEA A;  1SHG A;  2DFU A;  1NE8 A;  3PT9 A;  1D3B B;  1X75 C;  2KE9 A;  1HXD A;  2VKN A;  2QEX Q;  2GNC A;  1V1C A;  3J7A F;  4M77 A;  1JEG A;  2D8J A;  1UGR B;  5I2S A;  3TCJ A;  3G4S A;  2CZ1 B;  2MIO A;  2D6F A;  1KIK A;  3M9Q A;  1VQL T;  1M90 U;  2V1Q A;  2ZPG B;  2KK4 A;  3H0H A;  2FEI A;  2M51 A;  2E12 A;  2LQ8 A;  3A8L B;  1YI2 T;  3CCU T;  1E7O A;  3OBW A;  1FYN A;  3JSC A;  3KUF A;  2AZS A;  5IXB A;  1YHQ Q;  4Z8A A;  3OYE A;  4MZM A;  4M7D B;  1A0N B;  1UG1 A;  3VU3 C;  3CC4 T;  1JQQ A;  1AEY A;  2X3X D;  3F70 A;  3JCM V;  5LJ3 f;  2RQT A;  1UGQ B;  4JLI A;  3CPW P;  1N8R C;  3ER0 A;  1PWT A;  1OI1 A;  1M2V A;  4II1 A;  1ZUU A;  4J7I A;  2FZG B;  1R0C B;  3QHS A;  3M58 A;  2Y4Y A;  2QAZ A;  4BI8 B;  1WJS A;  3CCV A;  4X9D A;  1Q81 C;  2DZ9 A;  2COZ A;  3HFN A;  4XTV A;  1OU8 A;  3PGG A;  3ZEH A;  4A4F A;  1J3T A;  2RK1 A;  3MET A;  2Y4X A;  2LTO A;  1M1K R;  5FU7 C;  1UDL A;  2PVO B;  5FU7 B;  3HL8 A;  2HBW A;  2EQI A;  4OMN A;  4M7D G;  2EAY A;  1WHM A;  2RJD A;  3LW5 E;  2RMO A;  3X25 B;  4BAC A;  4M75 E;  4NL3 A;  4PLL A;  2RPN A;  2YUP A;  4L5G A;  2DAQ A;  3FJ5 A;  4M7D E;  4ZTF A;  4E7L A;  1F1B B;  3PVL A;  1O9S A;  3VS0 A;  3CBO A;  1QWE A;  2PQW A;  1YHQ T;  1PCX A;  1BCO A;  5CKF A;  2QYZ A;  4RTW A;  1AOJ A;  5LJ5 d;  4AFQ C;  1VQ7 Q;  1YI2 Q;  3UWN A;  3X26 B;  3DB4 A;  4UC4 A;  2JW4 A;  2OTJ T;  2D0Q B;  4BY6 C;  2NUT B;  3CD6 Q;  1U1T A;  3RER A;  2MCN A;  1HSQ A;  4N0A A;  4D8D A;  2YT6 A;  4LUE A;  2HQX A;  3INZ A;  2E1H A;  1OX9 A;  4TVR A;  2LX9 A;  2GCX A;  1VQ6 Q;  1DJ7 B;  1QCN A;  3LX7 A;  2MPX C;  1WJR A;  2X51 A;  3GNF B;  2JTM A;  4RCC A;  1K8A U;  2A08 A;  2YRC A;  3HFO A;  5I11 A;  5AT1 B;  1D0Z A;  2H8H A;  4LDW A;  2YLB A;  4HCZ A;  3M53 A;  1OQK A;  4FU6 A;  3VS6 A;  2VGN A;  1QCF A;  3M5A A;  2RI5 A;  3L2Z A;  5LJ5 j;  1G3T A;  1TH7 A;  2LT1 A;  2KT8 A;  1GFD A;  3E2U A;  5HK3 A;  2KEA A;  1JXM A;  1OEB A;  1X69 A;  3HRT A;  1M3A A;  1YFN A;  5GAN j;  3QKJ A;  2HKN A;  1VQ7 A;  3SWN C;  1M8M A;  1KQ1 A;  3JV3 A;  1VQO Q;  4J6W A;  3EGX A;  2ESW A;  3CCJ Q;  3FB9 A;  4E7J A;  1IB8 A;  4E2F B;  1QVF S;  1ZSZ B;  1Q86 U;  2DJQ A;  2LCC A;  3PMT A;  2EKO A;  4C5H A;  1VQM T;  1YIJ Q;  5GJV B;  5LJ3 g;  2J6O A;  4BD3 A;  4L6V 5;  4XU0 A;  4RTX A;  1HD3 A;  5GAM f;  1XTD A;  3MO8 A;  4EMK A;  2GQV A;  1RLQ C;  1GL5 A;  4IUV A;  1NPR A;  4BI3 A;  1GCQ A;  4FSX A;  2KR3 A;  4XU3 A;  4KGZ B;  1RAB B;  1U3O A;  1N9S A;  5GAN d;  3FIF A;  1VQO A;  1U1S A;  4J7F A;  2CUB A;  1AWW A;  3LYI A;  2KRM A;  2F1L A;  1NEG A;  1QP3 A;  2DX1 A;  2VYT A;  4E47 A;  5CK9 A;  1VQ4 T;  4Q5W A;  2COY A;  2E6N A;  2A0F B;  1CSK A;  3GP8 A;  4HCC A;  4J9H A;  4FYW B;  1R8O B;  2FL7 A;  3BDU A;  5GAN h;  5GMK l;  1VQ4 Q;  4AT1 B;  1KD1 R;  4GY5 A;  3VJP A;  3V7R A;  5GAN 6;  1K0S A;  4C5E A;  2HQE A;  4LDU A;  3CQT A;  4JRP A;  5IHK A;  1Q82 U;  2EFI A;  2XD0 A;  4M7D C;  2QA4 A;  1JB0 E;  2PU9 B;  3EG2 A;  1VQP Q;  1TUC A;  3RMQ A;  1UJ0 A;  3M59 A;  2KXD A;  2O9V A;  2DTO A;  4BUG A;  2BZX A;  1G3W A;  1VUB A;  1TSF A;  1KC8 U;  2DL8 A;  4OF1 A;  2IPO B;  1WIE A;  2JS2 A;  2CZ7 B;  3GOX A;  1D0X A;  3TSZ A;  1EFN A;  3G1J A;  4J6Y A;  2XIC A;  3VS4 A;  4Z89 A;  1YHQ A;  2LRQ A;  2MWO A;  5CKD A;  2EJF A;  2L2P A;  2LCS A;  2LMJ A;  1K1Z A;  4A63 B;  2L3S A;  4FYY B;  1WQ7 A;  3SFM A;  1SSH A;  5FU6 B;  4PJO B;  1OX8 A;  3CCJ T;  1UGS B;  2PUK B;  4IUQ A;  2P4T A;  2CSI A;  1PNJ A;  4OML A;  1P92 A;  2VGM A;  4RTT A;  3JB9 I;  1VQ5 T;  4KUD K;  2RI2 A;  2L5Q A;  3BW1 A;  3MHX A;  3CCV T;  1K9M C;  4HA8 A;  1H64 1;  5LJ5 f;  4QQ6 A;  1D09 B;  1TU0 B;  3LLR A;  4XK8 E;  1Q86 C;  1KC8 C;  2LNH B;  3VS1 A;  1K73 U;  3CC2 Q;  4F14 A;  4HKE A;  1UEC A;  3CXC S;  1KK7 A;  1PD0 A;  1PSE A;  2CP3 A;  2JTE A;  2JT4 A;  1Q82 C;  1VQ6 T;  4L59 A;  4KUI A;  3RKX A;  3CME Q;  1NLO C;  1TUG B;  4C0D B;  2KMT A;  2FZC B;  1YIT T;  2BZY A;  2RM4 A;  1G8X A;  3M0T A;  4PJO F;  2QXF A;  2HSP A;  4PJJ A;  3A8O B;  4J6X A;  2QA4 T;  4PJO G;  3QJY A;  3OW2 S;  3AT1 B;  3G4S T;  2HBP A;  4LDX A;  1ARK A;  2C0O A;  1OPK A;  2KT1 A;  2MMP A;  4M78 G;  5LJ5 h;  4HVU A;  1UHF A;  3S3N A;  4BB7 A;  1K8A C;  3HRU A;  3PIP A;  3J81 E;  3JCM J;  2V8K A;  1VQP A;  4XU2 A;  1TXQ A;  3HPW A;  3CCQ Q;  4KH1 B;  5FWC A;  4C0G A;  4DA4 A;  1Z9Z A;  4KBM B;  3OMG A;  1BKB A;  1YJW Q;  2XHC A;  3G7Z A;  4PFZ A;  1WLP B;  2CS7 A;  3ZL7 C;  1K73 R;  2RQU A;  3CCE T;  2DE0 X;  2RN8 A;  2WSF E;  4PJO D;  1XQH A;  1I0C A;  4E7S A;  4IKF A;  2DXU A;  2NYS A;  3OS5 A;  3P8D A;  2RJE A;  2VAS A;  1JU5 C;  1YJW T;  1ZSG A;  3OYG A;  4C8Q A;  1KD1 C;  1AZG B;  2DVJ A;  5FRN A;  1K4U S;  4FYV B;  4AFZ C;  5L23 A;  2G3R A;  3DLM A;  4M77 B;  4C0Z A;  2DYB A;  2EKH A;  1BBZ A;  4JUV A;  3QPH A;  5HCK A;  1QVG A;  3WXM B;  2K7A A;  4ME7 A;  3CCU Q;  2V26 A;  2D8H A;  3CCJ A;  3WVD B;  1VQ9 A;  4BDZ A;  2QI2 A;  2DBK A;  3OYA A;  1WDX A;  2MF2 A;  2QGF B;  2K79 A;  1OUL A;  3LWI A;  5C0M A;  2QEX T;  1VYT A;  4RTU A;  5GAM h;  1BYM A;  1RAH B;  2RQR A;  1GXI E;  3OS1 A;  4EMH A;  2QQA A;  1AWJ A;  2CUD A;  2FG0 A;  1WA7 A;  1K9M U;  1M1G A;  4JS4 A;  3JCM f;  1Y7X A;  4M7A F;  5KYN A;  1ABO A;  4E6R A;  3O8V A;  1MGQ A;  3JCM e;  2DLP A;  4DEY A;  1CKA A;  2QTX A;  3BFM A;  4M7D A;  1QQJ A;  4F7U G;  1C0M A;  2EQU A;  2K5L A;  3FJP A;  5GAM e;  4AG1 C;  1RLP C;  1Q86 R;  4OB3 B;  4FM4 B;  4OGE A;  2VC8 A;  1S72 A;  1BIB A;  2HNI A;  3A1P A;  1SRL A;  4XU1 A;  3CCR Q;  3I56 T;  4FW2 A;  3MP8 A;  4IIO A;  4CC4 B;  5A0G A;  1YJ9 Q;  1WHK A;  2JMA A;  1NJI C;  1IZ6 A;  2EGC A;  4C92 E;  4LD6 A;  1I8F A;  3DLL A; 
#chains in the Genus database with same CATH homology
 2JN0 A;  2RJD A;  3LW5 E;  5CCA A;  4FT2 A;  5GMK m;  3JB9 J;  5M9O A;  2VXF A;  3X25 B;  1K73 C;  4BAC A;  5FU6 C;  4M75 E;  3MP6 A;  3OSS C;  4M75 F;  2DIG A;  2VXE A;  4PLL A;  4NL3 A;  4PJO C;  3OYF A;  4L5G A;  2DAQ A;  4M7D F;  4M7D E;  1RI0 A;  3QZ9 B;  2AHJ B;  4ZTF A;  2K3Y A;  4Z02 A;  3JCM d;  5CO7 A;  4E7L A;  4C8Q C;  2X4Y A;  1O9S A;  3CBO A;  3X28 B;  2PQW A;  1YHQ T;  4QVZ A;  3JCM Q;  3CMA T;  2E5Q A;  4XTU A;  5CKF A;  2XKO C;  5FLX E;  4LD9 K;  4ELY C;  3LGL A;  5LJ5 d;  2M0O A;  2ZPI B;  1VQP T;  3UWN A;  3X26 B;  3DB4 A;  2RK2 A;  2DO3 A;  2K57 A;  2RHY A;  4UC4 A;  5GAM d;  1QW1 A;  2VV5 A;  3TU4 K;  1H3Z A;  2K2V A;  4B9W A;  2EQK A;  3V8L A;  3PTA A;  4DQ2 A;  2ZCF B;  5LJ3 j;  3UT1 A;  2OTJ T;  2D0Q B;  2VUB A;  4JRI A;  1FWZ A;  1U1T A;  4BY6 C;  3JCM P;  3RER A;  3SD4 A;  1XOV A;  3HRS A;  4IUP A;  5KE3 A;  2KY9 A;  3OYH A;  1M8V A;  4M77 D;  4HT9 A;  4N0A A;  1UGP B;  3RIR A;  4QVC A;  1YJ9 A;  1ZBX A;  2HQX A;  2YLC A;  3INZ A;  3NTK A;  2E1H A;  4M77 G;  1OZ3 A;  4R55 A;  2M1H A;  4EPC A;  4J83 A;  4TVR A;  5KCH A;  1KQS A;  2DXB A;  4D6W A;  3CME T;  2L3R A;  1JJ2 A;  2LX9 A;  1FX7 A;  2GCX A;  1ZQ1 A;  4C92 D;  1DJ7 B;  3LX7 A;  3X24 B;  1WJR A;  3GNF B;  3TRE A;  4C5I A;  2JTM A;  4JLG A;  4RCC A;  1K8A U;  1VQK A;  5AYF A;  4HCB A;  1YJN A;  3HFO A;  3LH0 A;  5GAN 4;  3H6Z A;  5GMK j;  3QII A;  1BI2 A;  1WJQ A;  3HHT B;  1WPY A;  2RD1 A;  4LDW A;  3AHU A;  4N4H A;  5GAM g;  4BDY A;  2P0Q A;  2YLB A;  3CC4 A;  4HCZ A;  3I56 A;  5GAO n;  3M53 A;  4FU6 A;  1W2B A;  4C0F A;  2P0K A;  2VGN A;  2M16 A;  3S6W A;  5GMK h;  4C8Q G;  3M5A A;  2LCL A;  2EIF A;  2R5A A;  2ZZD A;  2RI5 A;  3L2Z A;  3L2W A;  5LJ5 j;  1G3T A;  1YIJ A;  1TH7 A;  3CXC A;  2LT1 A;  4VUB A;  3A8M B;  5I21 A;  5GAN 5;  5HK3 A;  5FRO A;  3EFS A;  3JB9 D;  4X34 A;  1U8R A;  2BKD N;  3PIO A;  3CC2 A;  3V8K A;  2JNG A;  4KT0 E;  2DEQ A;  3HRT A;  5HK0 A;  2YRV A;  2ZPH B;  5DY9 A;  3URG A;  1I5L A;  1KQ2 A;  5GAN j;  3QKJ A;  1VQ7 A;  5GAO q;  3M55 A;  3OB9 A;  3SWN C;  3CCM T;  2RO0 A;  5GMK e;  2KAF A;  1KD1 U;  1KQ1 A;  3CCM A;  3Q1J A;  1WGS A;  4QW2 A;  3WVE B;  3L2U A;  2DPP B;  2QQ9 A;  3OYC A;  4IUT A;  3JB9 F;  4EMG A;  3EFR A;  4J6W A;  4XTZ A;  3JCM b;  3CC7 A;  2E65 A;  3I55 T;  3HKS A;  3FB9 A;  1M4Z A;  2A7Y A;  4M78 B;  4E7J A;  2XU8 A;  2EWN A;  1Q7Y C;  1VQO T;  4M75 B;  3UDC A;  2L89 A;  3GLX A;  4C5G A;  3X20 B;  3CCQ A;  2CGH A;  2M9U A;  4M75 D;  4PLI A;  5GAN 3;  1QVF S;  3V7S A;  2X4J A;  1HK9 A;  1Q86 U;  4ZN3 A;  1BI3 A;  4QQG A;  1VQN A;  3DLL A;  2LCC A;  4OB2 B;  3PMT A;  3E19 A;  2L8D A;  4XTY A;  5LJ3 d;  2EQM A;  5GAN 8;  4ATO A;  1VQN T;  3S3O A;  2EKO A;  4M78 A;  1QVP A;  2E10 A;  4C5H A;  5IT9 E;  4BE2 A;  3JCM W;  1VQM T;  1M1K C;  4M75 C;  2O4X A;  5LJ3 g;  1B34 B;  1VQ8 T;  2JTF A;  4BD3 A;  1VQM A;  4L6V 5;  4XU0 A;  2X4W A;  4JRQ A;  2PVG B;  3ZBD A;  5GAM f;  1XTD A;  3MO8 A;  2P0P A;  4EMK A;  3CCL A;  2GQV A;  4C0D C;  3A5Z B;  1JJ2 S;  4IUV A;  2PVD B;  1NPR A;  4ZGE B;  1XNI A;  1M1F A;  4BI3 A;  3C95 A;  4FSX A;  4M7A B;  4J5Y A;  4XU3 A;  5D6Y A;  1UB4 A;  3FRN A;  1N9S A;  4ZTJ A;  5GAN d;  2DVE A;  3FIF A;  1VQO A;  2QEX A;  4OB1 B;  1U1S A;  3ME9 A;  1WQW A;  4J7F A;  3OYL A;  1LNX A;  2EJ9 A;  5GMK i;  3OYD A;  1NZ9 A;  2A3L A;  3LYI A;  3H8Z A;  4QVD A;  2RHX A;  2VYT A;  1VQ4 T;  1QP3 A;  4E7I A;  1VQK T;  3NFC A;  1X6O A;  4E47 A;  2RH2 A;  2DXT A;  4Q5W A;  1OYX A;  2E6N A;  5CKE A;  5CK9 A;  1VQ6 A;  2QQR A;  4F7U B;  2LT4 A;  4M7A A;  1SSF A;  4FL6 A;  2RHU A;  4BI4 A;  2F5T X;  5CKB A;  3GP8 A;  4HCC A;  4ZGD B;  2FYK A;  1VQ8 A;  4J8O A;  2F69 A;  2E41 A;  2HAX A;  1R8O B;  2FL7 A;  2GFA A;  3BDU A;  5GMK l;  5GAN h;  3E9F A;  1NJI U;  2QQB A;  3M4Y A;  4GY5 A;  4PKC C;  4N0A C;  3V7R A;  3VJP A;  5GAN 6;  3CC2 T;  4C5E A;  2HQE A;  4LDU A;  4RG8 A;  5GAN 2;  4JRP A;  4F7U A;  1KHC A;  2OAU A;  4M78 E;  4M78 F;  1Q82 U;  2EFI A;  2XD0 A;  1YCY A;  4M7D C;  1JBM A;  2JVV A;  3OYK A;  2QA4 A;  1JB0 E;  2PU9 B;  2ZGW A;  5HKC A;  5LJ5 g;  5LJ3 e;  4O6J A;  1Y07 A;  3RMQ A;  4OMF B;  3M59 A;  2DIQ A;  2XG8 D;  3OBY A;  2DTO A;  2I2L A;  5L8R E;  4A4H A;  4BUG A;  3JCM g;  1N27 A;  3I55 A;  1G3W A;  1VUB A;  3TEE A;  1KC8 U;  2CZ6 B;  2EJG A;  2XDP A;  2X4X A;  3GNG A;  4OF1 A;  3PNW C;  2RHI A;  2CZ7 B;  3VUB A;  3GOX A;  2CKK A;  2WSE E;  1V29 B;  1VIE A;  3OYM A;  3P8H A;  4J6Y A;  1YIJ T;  1X01 A;  2XIC A;  4M75 A;  4X9C A;  5GAN e;  3CMA A;  3JCM X;  4YTL A;  1YHQ A;  4PJO A;  3G6E T;  1G5V A;  2KVQ G;  2RJC A;  4ELZ C;  2LRQ A;  2MWO A;  4RCB A;  2DXC A;  1Q81 U;  4CRI A;  5CAI A;  5HY6 A;  5CKD A;  1BIA A;  2EJF A;  2RB6 A;  2MWP A;  1G3Y A;  3CBP A;  5CQX A;  1ZHI A;  3RKW A;  2R5M A;  2BIV A;  3G71 T;  2K4Y A;  3L42 A;  3OS0 A;  2O4X B;  2IVW A;  2QQS A;  1B34 A;  2MI6 A;  1WQ7 A;  5D6W A;  3SFM A;  5IAY A;  3J80 E;  5FU6 B;  2XDD A;  4PJO B;  4ZGJ B;  3SDZ A;  3CCJ T;  1UGS B;  2PUK B;  1PSF A;  3CPF A;  3QBY A;  4IUQ A;  3V8J A;  2P4T A;  4P5N A;  4C8Q E;  4C8Q F;  4EMK B;  3CCS T;  4DOV A;  1P92 A;  5DM7 R;  3A8G B;  3CCS A;  2VGM A;  3JB9 I;  3CME A;  1YJW A;  3EAE A;  3JB9 G;  2O01 E;  1VQ5 T;  4KUD K;  3M57 A;  4R56 A;  4MZT A;  2RI2 A;  4C92 G;  4RMO A;  2CZ0 B;  4FIB A;  4A4E A;  3M54 A;  4A4G A;  2L5Q A;  3BW1 A;  4NOY A;  3CCR A;  3QUI A;  1IRE B;  3MHX A;  3ASK A;  2HD0 A;  5CR2 A;  3CCV T;  1S72 T;  2OTL A;  2FHD A;  4HA8 A;  1H64 1;  2E64 A;  1G3S A;  1K9M C;  3RMS A;  5LJ5 f;  4QQ6 A;  3G71 A;  4EDU A;  2KSS A;  3OYB A;  4BY6 B;  3UPU A;  3LLR A;  2E6Z A;  4M78 C;  1KG1 A;  5KH6 A;  3CCE A;  3NTI A;  4XK8 E;  2PUO B;  1Y71 A;  1Q86 C;  5KCO A;  1KC8 C;  3CCL T;  4A53 A;  2RI3 A;  4WF2 A;  4LDV A;  4C8Q D;  4F7U F;  3CEY A;  3VV0 A;  4F7U E;  2V8I A;  3LGF A;  4OGC A;  5A2Q E;  3SWN B;  1K73 U;  3GIB A;  2XDB A;  2EQJ A;  2B8A A;  4HKE A;  4LDY A;  3CXC S;  1M90 C;  2F5K A;  2FVU A;  1PSE A;  5GAO l;  3C12 A;  5D6X A;  1Q82 C;  1QVG S;  2BUD A;  4L59 A;  1VQ9 T;  1VQ6 T;  4KUI A;  3CD6 A;  3RKX A;  1W2B S;  4M7A G;  3MCA B;  2DD4 A;  2X35 A;  4A54 A;  1RL2 A;  3R6O A;  4C0D B;  2KMT A;  1I4K 1;  3MP1 A;  4FT4 A;  4A4K A;  3FC3 A;  3SWN A;  4Y28 E;  1YIT T;  2RM4 A;  2E70 A;  5J3B A;  1EIF A;  4PJO F;  4PJO E;  2QXF A;  3P8B B;  2V8J A;  2YHT A;  3PMI A;  5C6S A;  3VYH B;  3OYJ A;  4JS5 A;  5GAO p;  5GAN g;  2R58 A;  1UEB A;  4C92 C;  4M77 F;  4M77 E;  4NL2 A;  3A8O B;  4Y91 A;  1BI0 A;  1N9R A;  4EMK C;  5LL6 S;  4J6X A;  2D9T A;  2QA4 T;  1VQ7 T;  5GAN f;  3DB3 A;  3CPW A;  4PJO G;  3QJY A;  4M78 D;  4M75 G;  1VQL A;  3OW2 S;  3FLG A;  3G4S T;  2HBP A;  2LQK A;  2LVM A;  2ZPE B;  1AHJ B;  2K5I A;  3M4G A;  2FB7 A;  4MML A;  3OS2 A;  5GAO r;  3L1A A;  2MMP A;  4JRK A;  3QYG B;  4M78 G;  3OSV A;  5LJ5 h;  3LWH A;  3MEV A;  3BY7 A;  3BDL A;  4GLK A;  2DK3 A;  3OQ5 A;  4BB7 A;  3S3N A;  1K8A C;  1OZ2 A;  3HRU A;  4M7A D;  3PIP A;  3J81 E;  1YIT A;  2WAC A;  3JCM J;  3HP9 A;  5A0D A;  1KQS S;  3QYH B;  2V8K A;  3M56 A;  3JCM h;  1VQP A;  4XU2 A;  5DLO A;  3JAM E;  2K3X A;  2K5F A;  3S3M A;  2NLU A;  3RES A;  3CCU A;  2JOY A;  3JB9 H;  3HPW A;  2EYQ A;  2KDS A;  3CPW S;  1M1K U;  4DA4 A;  4OP0 A;  4C0G A;  2CYZ B;  3QSU A;  3KXT A;  3JRZ A;  4KBM B;  3MEW A;  4MMK A;  3OMG A;  1O75 A;  1BKB A;  3CBM A;  4IUR A;  2XHC A;  3G7Z A;  1FXX A;  2CS7 A;  5CQY A;  2C06 A;  4JDS A;  5CKH A;  2OTJ A;  1YJ9 T;  3CCE T;  4MZP A;  1Q7Y U;  2WSC E;  2WSF E;  4PJO D;  4N4I A;  4M77 C;  1XQH A;  3VKI A;  5GAM j;  2QDY B;  4IKF A;  2DXU A;  4QQD A;  3KBG A;  3OS5 A;  3P8D A;  4CI0 C;  3SB2 A;  2RA2 A;  2RJE A;  4PNO A;  3RKY A;  1YBY A;  1YJW T;  3OYI A;  3QO3 A;  4XTX A;  2R57 A;  2DTI A;  3OYG A;  4MDX A;  1Y96 B;  1VQ5 A;  2GF7 A;  3MEU A;  4OVA A;  5J39 A;  4C8Q A;  3JCM c;  4XQ3 A;  2XID A;  1KD1 C;  1QVF A;  1I81 A;  1YJN T;  3HSB A;  5A0L A;  3GF5 A;  3VYG A;  3FEO A;  2LNV A;  2DZC A;  5FRN A;  5KE2 A;  2OTL T;  3C4S A;  5IN1 A;  2G3R A;  1M5Q 1;  3DLM A;  2KQW A;  4M77 B;  3L2R A;  4C0Z A;  3OMC A;  4KUL A;  4E7H A;  1Y96 A;  3DKM A;  2XK0 A;  3E9G A;  2RHZ A;  2XI9 A;  4RG2 A;  3MEA A;  1NE8 A;  3PT9 A;  1D3B B;  3T9N A;  1X75 C;  3C94 A;  4MDW A;  4JUV A;  3ZFJ A;  3G6E A;  1HXD A;  4BE1 A;  3QPH A;  5EG2 A;  5CIU A;  3V7C A;  3J7A F;  1WNL A;  4M77 A;  1QVG A;  1UGR B;  1BI1 A;  3WXM B;  4B9X A;  5I2S A;  3TCJ A;  3G4S A;  2CZ1 B;  1VIF A;  2D6F A;  4ME7 A;  3NTH A;  3M9Q A;  2ZPF B;  3CCJ A;  1D3B A;  3WVD B;  1VQL T;  1VQ9 A;  3CD6 T;  4BDZ A;  2QI2 A;  1M90 U;  2GFU A;  2Y90 A;  3OYA A;  5FRM A;  2ZPG B;  2MF2 A;  2KK4 A;  3CC7 T;  3LWI A;  1KHI A;  5C0M A;  2MAM A;  2E12 A;  2LDM A;  2LQ8 A;  3A8L B;  4NS5 A;  4OB0 B;  2QEX T;  3CCU T;  1YI2 T;  3FDR A;  1W4S A;  3OBW A;  5GAN 7;  3JSC A;  3KUF A;  3VUZ A;  5GAM h;  1YI2 A;  1BYM A;  2DJZ A;  2DD5 A;  1NPP A;  4PL6 A;  1N8R U;  4HT8 A;  3OYE A;  1GXI E;  4MZM A;  3OS1 A;  2RJF A;  4EMH A;  2QQA A;  4M7D B;  1K9M U;  1M1G A;  1LOJ A;  4JS4 A;  3JCM f;  3VU3 C;  3CC4 T;  1Y7X A;  4M7A E;  4M7A F;  2DTH A;  3O8V A;  1JRI A;  3L2Q A;  1MGQ A;  3E1S A;  4V2S A;  3F70 A;  3JCM e;  3QJ6 A;  3JCM V;  2ZPB B;  5LJ3 f;  1UGQ B;  4JLI A;  2LC4 A;  5DLQ E;  3L2V A;  1MHN A;  1N8R C;  4XTW A;  2QTX A;  2JZ2 A;  3BFM A;  3OA6 A;  3ER0 A;  4M7D A;  2H3J A;  1OI1 A;  3A8H B;  4F7U G;  1M9S A;  2JUF A;  5LJ5 e;  2DKG A;  4II1 A;  2EQU A;  4J7I A;  2K5L A;  3QXE B;  4RKU E;  3QHS A;  3OW2 A;  3FJP A;  5GAM e;  2IG0 A;  1LJO A;  3M58 A;  2Y4Y A;  4C8Q B;  4C92 A;  3QZ5 B;  4FM4 B;  4OB3 B;  4OGE A;  2VC8 A;  1VQ4 A;  4BI8 B;  3CCR T;  5I2M A;  3N5B B;  3OYN A;  1WJS A;  4M7A C;  3CCV A;  4X9D A;  1BIB A;  2HNI A;  3GPL A;  4E7K A;  1S72 A;  1N6A A;  1Q81 C;  2DZ9 A;  3HFN A;  4XTV A;  3QDR B;  3QG1 A;  4XU1 A;  3I56 T;  4LDX A;  5GAO m;  3MP8 A;  4JJN K;  3PFS A;  3PGG A;  4N4G A;  5CVI A;  3ZEH A;  3RUX A;  3OY9 A;  4A4F A;  5A0G A;  2RK1 A;  4C92 B;  3MET A;  3OYY A;  1QP2 A;  5J26 A;  2Y4X A;  3CCQ T;  1IZ6 A;  4IUU A;  2LTO A;  4BE0 A;  1NJI C;  4M7D D;  5FU7 C;  4ZN1 A;  2PVO B;  5FU7 B;  3HL8 A;  4DOW A;  5LJ3 h;  4M7D G;  2EAY A;  4LD6 A;  4C92 F;  4C92 E;  1I8F A;  4XAX B;  4O5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...