5GMKi

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
83
structure length
75
Chain Sequence
MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 7
structure length 75
sequence length 83
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
i PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmki00
4F7UG 3HFNA 3HFOA 5GAN5 2DTOA 2DXUA 3BFMA 4XU3A 3JCMc 4C92D 4M75B 5GAMf 4M7DC 5GANg 3EFSA 4M78C 4XU0A 5LJ3d 5GANh 4C8QA 5GAMg 1D3BA 2RB6A 3QHSA 3V7RA 2E41A 5GAMh 5GAN8 3RKWA 4A54A 2HNIA 4X9DA 5DY9A 1LNXA 4XQ3A 5GAN4 4M7AB 3AHUA 4F7UF 2ZGWA 4EMKA 5CAIA 2DVEA 5GAMe 1U1TA 4M75G 2EAYA 4J6XA 4C8QC 5GAOr 4M77A 4C92G 3JCMf 2DXTA 4M78E 1B34A 4EMKC 4F7UB 5LJ5j 4M7AG 5GAOm 4XTXA 3JCMP 5GAN3 4M77C 1U1SA 1M5Q1 5GANd 3V8JA 4M75F 5GAN7 5GAMd 1HK9A 4A53A 4PJOE 4C92F 4M7DD 2DEQA 4V2SA 4EMGA 1I81A 2VXEA 4M78D 3RKYA 4QVCA 5I21A 3HSBA 4M7AF 3RKXA 3L2ZA 3JB9I 4Y91A 2DZCA 2K57A 4M77E 4C92B 1WQWA 1H641 3JCMW 4PJOA 1BIAA 1WNLA 3SWNB 1TH7A 2DTIA 4N0AA 1N9RA 1LOJA 4PNOA 4C8QD 4F7UA 5GMKi 2E1HA 4M7DG 4WF2A 4DQ2A 5GMKj 2DZ9A 4NL3A 4PJOC 1Y96A 2E10A 1X01A 1KQ2A 2FYKA 3JCMb 4N0AC 1YCYA 4M77D 5GAOl 3JB9H 3FIFA 2JN0A 3JCMg 3PGGA 4C8QG 4QVDA 3JCMh 4M75A 4M7DF 2DKGA 5LJ5f 2RM4A 5GMKe 4XTYA 3BDUA 3JCMe 5LJ5g 1WQ7A 3JB9D 5LJ5h 2YLBA 2YLCA 4M77G 1MGQA 4F7UE 4M7AA 5GMKm 5GAOq 2VC8A 4M7DB 1B34B 5LJ5e 4M78B 2E64A 1KQ1A 2FB7A 1HXDA 4J6YA 3RIRA 3V8LA 2EJFA 3RUXA 4C8QF 5LJ3j 3JCMJ 2E65A 3QO3A 4C8QE 4HT8A 4PJOD 1M8VA 3JCMd 3V7SA 1JBMA 4M78G 4C8QB 4M77F 1D3BB 3QSUA 2QTXA 1LJOA 4M75E 4XTWA 2YHTA 3RERA 2I2LA 4XTZA 3RESA 2DJZA 4XU2A 3JCMV 4C92E 5LJ5d 4EMKB 5GAOn 2EJ9A 1JRIA 4M77B 4MMKA 4XU1A 4PJOG 4XTVA 5GMKh 4M7AE 5GAN2 3V8KA 4MMLA 5GANj 4XTUA 3V7CA 4M78F 4EMHA 4JRKA 5GAMj 4C92A 3FJPA 2EJGA 4M75D 4NL2A 4RCBA 3SB2A 3SWNA 5GMKl 5GANf 3VU3C 3JB9J 3QUIA 4NOYA 3GIBA 4M75C 1I4K1 4M7AD 3JCMQ 4OP0A 1WPYA 4J6WA 4PJOF 4C92C 5GANe 3SWNC 4HA8A 4J5YA 4JLIA 1I8FA 4X9CA 3L1AA 5GAN6 2DTHA 4M7AC 5LJ3f 3JCMX 2EWNA 1N9SA 3JB9G 4HT9A 3FB9A 3BW1A 2Y90A 4RCCA 5LJ3g 4M7DE 4PJOB 3INZA 5LJ3h 3BY7A 2RD1A 4JRIA 4JUVA 5LJ3e 3M4GA 5GAOp 1I5LA 2VXFA 2RA2A 1Y96B 1BIBA 4M7DA 2CGHA 4M78A 3EFRA 3JB9F
chains in the Genus database with same CATH superfamily
2E5QA 2XU8A 4E7SA 2DAQA 4B9WA 4OMLA 1QQJA 1ABOA 2XMFA 3NFCA 5CAIA 2ZPEB 1KG1A 2EKHA 5I11A 2WSFE 3CEYA 4IUVA 2JTFA 5KYUA 4J9BA 5L8RE 1KC8U 2K2MA 1QVFP 2E12A 2XI9A 2D0NA 1HSQA 1UGVA 4CI0C 2DEQA 2KRNA 1I81A 1KHIA 3L2ZA 2K57A 2O9VA 4IKFA 1D0ZA 3OYAA 2EQKA 1EZZB 1VQ9T 2KRSA 2CZ6B 1A0NB 4JRPA 4QKUA 3I5SA 1X43A 1YCYA 2CP2A 2ROLA 3JCMh 1IZ6A 1X6OA 3EG9B 4XAXB 2X4WA 2D8HA 3PVQA 5CKDA 1KD1C 2VGMA 2LT4A 5LJ5e 4C8QF 1UGRB 2K3BA 1LPLA 1JEGA 1LVKA 4LDYA 2E5KA 1BBZA 2DILA 3X24B 2KBTA 2JMCA 1VQ7Q 3A8GB 2DPPB 4C92E 2P4TA 1K8AR 1YFNA 1JRIA 4XU1A 2FZCB 3OYDA 2IIMA 4PL6A 2O4XB 3JCMQ 4OP0A 2NUZA 3CCRA 4PJLA 3L1AA 3VYHB 2LQ8A 2CZ0B 2RN8A 2MOXA 2Y90A 4PJOB 4BD3A 2BZYA 2M02A 2K5FA 1PSFA 1WHGA 3M55A 1G3TA 1I1JA 1C0MA 3VS1A 1ZUUA 3HFOA 1Q95G 3LH5A 3VS2A 3UWNA 5LJ3d 3H0IA 5A0LA 5GAMh 2OTLT 2FL7A 4CC2A 4FT2A 4JZ3A 5FW9A 2DVEA 2G6FX 1S1NA 2KYBA 3E1SA 2M0YA 4EMKC 1D1CA 2CP5A 1M5Q1 2C0OA 2DL7A 3L2QA 2DX1A 5I21A 2VWFA 2KVQG 3A8HB 1WDXA 2QASA 3CXCS 1BIAA 3X25B 3G6EQ 4PFPA 3CCEA 3G1JA 3FJ5A 3DLLA 1ZHIA 2ED0A 1K8AU 2VGNA 2CREA 3FIFA 2H8HA 1WHMA 3H6ZA 4ZTJA 2XK0A 3CPFA 4A4HA 3JB9D 1N27A 3I56Q 2RJEA 4LN2A 2HEQA 4A4FA 3JCMJ 4ATOA 1UTIA 3CQTA 3VRZA 2RPNA 2PU9B 4IUQA 5LJ5d 2MK5A 1R77A 4PJOG 4MMLA 3G71A 3GNGA 4M75D 3E9FA 3QDFA 3VU3C 4JZ4A 3C95A 2GBQA 4LDXA 4C92C 4JLIA 3L2WA 4FW1A 2HMAA 1WHKA 2AIRB 2FVUA 3H8ZA 3NMZC 3QG1A 3ZEHA 4RTXA 1BIBA 1KD1U 3MP8A 1QP3A 2NWMA 3NTKA 3MEVA 1X6BA 2V8IA 1M3BA 1X2QA 1AZGB 5GANg 1VQLQ 3TEEA 2GQVA 3RKWA 2RQTA 2A28A 4HKEA 4F7UF 4B6MA 5IH2A 3KBGA 2BZXA 1VQ7A 2D1XA 3CCQQ 2FRYA 1C6VX 1NPPA 2BKDN 2KSSA 4LXCA 3EG2A 1UFFA 2CYZB 2R5MA 1WXUA 3GPLA 1YJWT 4M7DD 2CP7A 2LDMA 3M0QA 1K1ZA 2HL3A 4M78D 3TSZA 1AWWA 2OX7A 3VS4A 4M7AF 2COYA 2DZCA 2DXBA 2EFIA 3TVTA 2KI7A 4AFQC 1QVGP 1ZSGA 4NL3A 4PLLA 2E10A 2G3RA 4C5EA 2QQ9A 2KE9A 2YUOA 3I55Q 2RJCA 2XDBA 3VUBA 2HQHA 3MKDA 2BIVA 1IGUA 3EH2A 3L2UA 4DBQA 3CD6T 4J6YA 1UGSB 2JUFA 2BZ8A 4C8QB 2LRQA 3R6OA 3DB3A 1X6GA 4QQ6A 5D6WA 4XTVA 1N8RU 4LD9K 4FM4B 5CCAA 1Q7YU 3SWNA 3H41A 5C0MA 5GMKl 3JB9J 2HZYA 2P0KA 1ZBJA 2VV5A 3QWXX 2L0AA 1G8XA 2L3SA 1S72Q 1RAIB 4HVUA 2DO3A 2RQWA 4II1A 4AMCA 1OI1A 2A36A 4JJDA 1YJ9A 2HBWA 3JAME 2PUOB 1FWZA 3ASKA 4C5IA 3RNJA 3H0FA 4E6RA 2PZ1A 1GRIA 5J26A 3SFMA 4DEXA 2M0OA 2EKOA 3M0RA 3QJ6A 5GAN8 2KT8A 1VQ5Q 1IB8A 2VVKA 3CCJQ 1MMDA 2COZA 2JT4A 1VQPQ 1MUZA 3TQ7P 1ZX6A 3JCMP 2JJ9A 3L2VA 3OS0A 5GAN7 5KYXB 4PJOE 2CP0A 3OBWA 1BI2A 2O88A 4F14A 5ECAA 1AVZC 5CR2A 2P0QA 3OSSC 4M77E 3OYGA 3QXEB 4Z89A 3OYLA 5KE2A 1X01A 2KXCA 2P4RA 1Z9ZA 2XG8D 3Q1JA 2DL4A 1NJIR 4DBHA 4C8QG 4M7DF 2GGRA 1T0JA 2X3XD 2GQIA 3F70A 3KFVA 3NTHA 5GMKm 1VQ4Q 2QEXA 4OGEA 2YXYA 2RO0A 4RTWA 1G83A 5LJ3j 1M1KC 1YI2Q 3M53A 1GCQC 2X4XA 3ZBDA 2CT4A 2ESWA 4DA4A 2PVOB 3CCQA 2LCCA 1JQQA 1P92A 2LZ6B 2LX9A 3CCMQ 3MCAB 4RTTA 3V7CA 2F2WA 2V8KA 3N5BB 5IXFA 3FJPA 1WHJA 3MJXA 1AWXA 1UHFA 2RK1A 3WVDB 2J06A 2GFUA 4LDUA 1I8FA 3CCLA 3MHXA 3ZFJA 2EVRA 3A5ZB 2KXDA 2RD1A 1X69A 4RKUE 5CQXA 1VQOQ 3QIIA 3OMCA 2YRCA 3CC2T 1M27C 3M0SA 3ME9A 1E6HA 2L5QA 5KYWB 1AZEA 1UECA 2LVMA 1VQKQ 4XU3A 2E6NA 2XDPA 4J8OA 3E19A 2RB6A 3QPHA 2DRKA 1UJYA 1MV3A 2LJ1A 9ATCB 4J6XA 4C5HA 2ED1A 4RG2A 2OTJT 2F5TX 3CCVT 5EC7A 4ESRA 1QVFS 1RAAB 2JNGA 4F7UB 5IXBA 5LJ5j 4XTXA 5GANd 2CZ1B 5CKEA 1GCQA 4KUDK 1M1KR 1B07A 1PKTA 5HK0A 5KYNA 1QLYA 1G2BA 2DTIA 4PNOA 1N9RA 2EYXA 1BI1A 4ZGJB 2H3JA 4R0KA 1VYTA 4DQ2A 4KT0E 4PJOC 1KQ2A 4N0AC 4ZGEB 2JS2A 2ZZDA 2DBKA 2E4HA 1OPKA 1Q82C 2LCSA 3IQLA 3JCMg 2AT1B 1BB9A 2EQMA 2FEIA 4A63B 3CMET 4DOVA 1AWJA 3MP1A 4C0DB 1XQHA 2F1LA 3RUXA 2QA4A 1KQSP 1ABQA 1EX4A 2E65A 3O8VA 1UE9A 3CC4T 1M8VA 2JXBA 3H0HA 1WHHA 3OYKA 4JDSA 3UF4A 4J9FA 2AZSA 3JCMV 2JZ2A 2RJFA 1VQPA 1V29B 4AFSC 2QTVA 2VKNA 2WSEE 3QDRB 4EMHA 5GANf 2GFAA 4OMQA 1M2VB 1UEBA 4GBQA 1X27A 3NGPA 3EG3A 3I55T 2GTJA 3SEMA 2CSQA 2RI2A 5KCOA 4J7FA 1WYXA 3OYNA 3CCSA 4F16A 3BW1A 4RCCA 1YJNT 2CUDA 1OULA 2VXFA 2O31A 4C8QE 1WIEA 1TTHB 2A7YA 2EQIA 4D6WA 4F7UG 5GAN5 2YUQA 2DTOA 2EYZA 2LCLA 4M75B 1VQ4A 4B9XA 3GLXA 1MNEA 2EQJA 5GAMg 2RQRA 1K0SA 3HRUA 3AHUA 2F2XA 4E7HA 4M77A 1Q82R 4NS5A 3CCEQ 4M7AG 4BI3A 2DD5A 1S72T 4WTOB 1ZSZB 1JXOA 3EAEA 3G7ZA 3EFOB 4HVVA 1W2BP 3HRSA 3OW2P 2JS0A 1Y57A 1I5OB 1JJ2S 3JCMW 1QCNA 4DBFA 2CH4W 2EW3A 1NM7A 5A2QE 3ZL7C 2WACA 4MZPA 4BI8B 2DIGA 2MF2A 1VQOA 4PKCC 1ACMB 4FSSA 1RI9A 3G71Q 2A3LA 3JCMe 3EGXA 1VQKA 1OU9A 4M7DB 4M78B 1FYNA 1XNIA 1GBRA 2R58A 4HCBA 1YITT 4LNPA 3GBQA 3LYIA 3VS5A 1IRXA 2QQBA 3G4SA 2ZPHB 4HXJA 1K9MC 2EJ9A 2DBMA 4KBMB 1WJRA 2LQWA 3VS3A 3CCUT 2DEUA 4HCKA 2LJ0A 2DIQA 4JRKA 4RCBA 2EJGA 3SB2A 3FDRA 4R56A 2X9HA 1QCFA 1O9SA 4NOYA 1KSWA 2LT1A 4EIKA 2MWPA 2L3RA 2XD0A 4R55A 2NYSA 2HDAA 2CT3A 1Q82U 2CUBA 2HL5C 1PWTA 2YRDA 1U3OA 1SRMA 4LUDA 3M9QA 2DYIA 4BY6C 4L5GA 5CK9A 4ZN3A 1OEBA 2D9TA 2O01E 3P8BB 4XU0A 2DK3A 1M8MA 3QHSA 4X9DA 1K0XA 4BB7A 5GAMe 3L42A 1BI3A 4C8QC 2EYQA 1T0HA 1QWFA 2DMOA 2JTMA 1VQ8Q 1OX8A 1QVPA 2XKOC 4JJNK 4GLMA 2EGAA 1M30A 1RABB 2CP6A 1PHTA 3RKYA 1X2KA 4LUEA 1ZUYA 1W6XA 1VIEA 4E7JA 4M4ZA 4E7IA 4IIOA 4RMOA 1YIJT 2K2VA 1WQWA 4HCCA 1QVGS 1K73C 4M7DG 5DM7R 1Q86C 5D6XA 1WI7A 4L6V5 5GMKj 2HQXA 1K9MR 5GAOl 3OYJA 3VS7A 4QVDA 2MIOA 3L2RA 2X4YA 4F7UE 3H9NA 3OS5A 4FYVB 5HKCA 5GAOq 2E70A 4OB2B 2E3HA 3JCMd 1VQ6T 2H3EB 2LQKA 3LH0A 2YHTA 1KHCA 2LMJA 1YHQT 1H92A 1YJ9Q 4MMKA 4M7AE 5GANj 5KYUB 3CC7Q 4E2FB 1PCXA 4ELYC 2L3PA 1BK2A 3TCJA 3OY9A 4FYWB 1Y71A 2DTHA 5LJ3f 3MP6A 1K76A 3U23A 3EG1A 1NYGA 3CCRT 2R5AA 4GY5A 2X4JA 3CMAQ 2RJDA 2JOYA 2EGEA 4PLIA 2PQWA 1B7TA 3C0CA 1TU0B 3URGA 4AG2C 2KK4A 1DJ7B 1K73R 1OYXA 1D3BA 1Q86R 4EPCA 4ZTFA 2ZGWA 4EMKA 4JJBA 1TXQA 2JM9A 1K9MU 1SG5A 5FWBA 3JCMf 2DE0X 2K3XA 3CD6A 3OQ5A 5GAOm 1TUDA 3PT9A 4C0FA 4FCYA 3JV3A 5GAMd 3X26B 4OF1A 3HSBA 4O6JA 2J05A 4AFZC 2QEXQ 4J9IA 4Z02A 5CKBA 5FLXE 2E1HA 4WF2A 2RMOA 1VQNQ 2B8AA 5J3BA 1G5VA 1MMAA 3JCMb 4IUUA 2M9UA 1AT1B 2P84A 3PNWC 3PGGA 3EHRA 4JS5A 5LJ5f 3JRZA 3QZ9B 2NLUA 1PD0A 1NLOC 3MEAA 2O2OA 2K79A 2RI5A 4FT4A 2EBPA 1BYMA 3GNFB 2HBPA 5LL6S 1WX6A 3CCLQ 2OI3A 1VQ8A 1VQMQ 1OPLA 3ER0A 3P8HA 3I5RA 2YT6A 5GAN2 2LQNA 2LJ3A 4C92A 1WXTA 2PVDB 5HK3A 2NUTA 5D6YA 3HKSA 1JU5C 1Q86U 2LP5A 3LX7A 3JCMX 4M7AC 2DLPA 4M7DE 2V8JA 2VUBA 3UA6A 4BACA 3M4GA 1I5LA 1O75A 2FZGB 1HD3A 2EIFA 1B34A 5HY6A 3JB9F 4XK8E 1NJIC 3S3NA 2HD0A 1PNJA 5IHNA 3VV0A 1W4SA 4C0DC 4DBRA 2K7AA 2QGGA 1U1TA 1FMKA 4QW2A 1MMNA 3DKMA 3C12A 2ENMA 4LDVA 3T9NA 2NUPA 4ANJA 4M75F 3EHQA 2MCNA 3CC7A 3M0TA 3TU4K 2KAFA 1QWEA 1VQ7T 3JSCA 2KMTA 2RF0A 3RKXA 4F7UA 2VASA 1KJWA 2QA4Q 2W0ZA 2GNCA 1FMVA 2DZ9A 1Y96A 1G3YA 2DA9A 4M77D 2LX7A 3CMAA 2JN0A 3QBYA 2DL5A 5CKHA 4IUPA 4XTYA 1OV3A 2YUNA 3OMGA 2D0QB 3UDCA 4M7AA 3MEWA 1SPKA 1KQSS 3OYIA 5A0DA 3MO8A 1NE8A 1RAHB 2XICA 3RMSA 1M90C 1QMCA 3CCSQ 3OS1A 2FZKB 1T3LA 3UA7A 3HPWA 1Y7XA 2F2VA 3EGDA 3UT1A 1ZSZC 3V8KA 1EFNA 4YTLA 4AFUC 4M78F 1VQ9Q 4N4GA 2YSQA 4KH1B 5KYYA 4IUTA 5HCKA 1M9SA 1MV0B 1VQNA 3VJPA 2BTTA 1UUEA 3G6ET 2RA2A 2RNAA 1Q81R 2DD4A 3OSVA 3HFNA 2ECZA 3FEOA 1YWPA 1D1BA 4M7DC 4OB3B 2MI6A 4M78C 5IT9E 3S3OA 1SF9A 2AZVA 2FPDA 3VKIA 5DY9A 4XQ3A 2ROTA 2DETA 3OBYA 1VQMA 5FU6B 3I56T 3M5AA 5CO7A 2AHJB 1WHLA 5GAN3 2QQAA 3CPWS 4A4KA 2M16A 3VYGA 1W2BS 2X51A 1TS9A 1NG2A 4MZMA 3OW2S 1RLPC 1H641 2KROA 1X75C 3SWNB 1M90R 1SKUB 1ZUKA 3LWHA 3R6NA 2CS7A 3KUFA 5FRMA 4RUGA 4BDZA 4GLKA 1Z9QA 5J39A 3G4SQ 4A4EA 1CKAA 1FX7A 1K4US 1U06A 1NJIU 2JVVA 2OTLQ 3LGLA 5FROA 1TUCA 1EIFA 5KH6A 1YBYA 1PRMC 1JXMA 4KULA 1PC0A 1HXDA 2RHXA 3V8LA 4ME7A 1C1AA 2J6KA 3MPUB 1M3CA 4M77F 1YNZA 1VQLT 4XTZA 3QJYA 4XU2A 2D8JA 3PVLA 2V1RA 2OJ2A 2ZPGB 1WLPB 3A98A 5GAMj 1MMGA 2K4YA 3CCQT 3QUIA 2YUPA 2RI3A 4ZNXA 3LLRA 4J5YA 3M0PA 4X9CA 1NPRA 2RHYA 4JLGA 2ZPBB 1PKSA 3INZA 5FWCA 3EG9A 4D8DA 5KCHA 1OQKA 2Y4YA 1SEMA 1XTDA 2X3WD 2DXCA 2HKQB 4ELZC 4WCIA 1M1FA 1XJWB 2DXUA 3GP8A 3I35A 4J9GA 3A8OB 4Q5WA 3EFSA 1RL2A 1E7OA 2KQWA 2KR3A 2HQEA 2CDTA 2QAZA 2KRMA 2DM1A 3GF5A 3LW5E 1TG0A 2DXTA 1R0CB 2RK2A 1AHJB 2K5LA 1JB0E 1U1SA 4OB1B 2E6ZA 1OZ3A 8ATCB 4E7ZA 2O4XA 1VQ9A 2DRMA 4QVCA 2PNIA 1M1KU 1WXBA 2D6FA 4PJOA 2DL3A 3EG0A 1GFCA 1AEYA 3DB4A 3CCUA 1TH7A 4N0AA 3X20B 5GMKi 4HCZA 3WXMB 4RTZA 2JTEA 2RQVA 4DOWA 1M4ZA 1IXDA 1YCSB 5EG2A 2RH2A 1FMWA 1QCOA 1Y0MA 2DKGA 7AT1B 2V1QA 1RAFB 5CQYA 2VB6A 1TOVA 1UGPB 4N4HA 1GXIE 2ATCB 2EJFA 1OZ2A 3QO3A 3M56A 3P8DA 2FRWA 1JO8A 3HRTA 1R0BG 4XTWA 3M54A 2OAWA 1UGQB 1IGQA 1GBQA 1VQ5T 2A37A 4PJJA 2IG0A 3CCJT 5IAYA 4DEYA 4IIMA 1VQPT 1R8OB 5FU7B 3QYHB 1V76A 1XOVA 5D7UA 1QKXA 4PFZA 3M4YA 3OYCA 5GAN6 2EWNA 5A0GA 3JB9G 3MEUA 3FB9A 5LJ3h 1YIJA 1SSHA 2CZ7B 3CD6Q 3OYYA 2OTLA 4F17A 4J83A 2LTOA 3CCST 4C92D 2QK0A 1VOMA 2E41A 1K9AA 2Z0WA 2HNIA 5GAN4 2COWA 1LNXA 3X28B 4Y92A 3PMIA 2XDDA 2CKKA 1UB4A 2LNHB 1CSKA 4M75G 4QQDA 4RTYA 1VQ4T 4BE0A 1FXXA 4TVRA 2P0PA 1YI2T 4CC4B 1JJ2A 2HCKA 2LNVA 1HK9A 1VQ6A 2AKKA 5I2MA 4E7KA 4JJCA 1BI0A 1KK7A 3JB9I 3CCMT 1YHQA 2LC4A 1OX9A 1VYUA 3VRYA 3SHWA 4X1VA 1M2OA 1H3ZA 4KGVB 2MAMA 5I2SA 5LJ5h 2YLBA 2HAXA 1VQOT 2C0IA 4QT7A 2JMAA 1B3QA 4M78G 3PIOA 1VQKT 2QDLA 3RERA 3RESA 1ZBXA 1LCKA 2DJQA 1V1CA 1NZ9A 3QZ5B 2C06A 4M77B 1VIFA 3S6WA 2OAUA 2L89A 2X35A 2EQUA 1QKWA 3G4ST 2KY9A 4FIBA 2QQRA 4N4IA 1I4K1 4M7AD 2F69A 2DFUA 4J6WA 3PFSA 1I07A 2ZPIB 2M51A 4HT9A 2GCXA 1WJQA 1OOTA 3RR6A 3PMTA 4BDYA 1Y07A 3BY7A 3RMQA 4ZN1A 1KD1R 3EGUA 1RACB 4AT1B 2CGHA 1YP5A 3EFRA 4JRQA 3TSWA 1VUBA 3QKJA 4BI4A 1N8RC 3JCMc 1Q7YC 4C8QA 3V7RA 3EGXB 5GJVB 2L3QA 1JJ2P 1YJWA 4K11A 4X34A 5KE3A 1KIKA 2XHCA 2L2PA 5FRNA 1QVGA 1GCPA 4JPBW 2ZPFB 4C92F 3VS6A 2VXEA 2DERA 4QVZA 1RUWA 1NLPC 2YWWA 3CC2Q 2FYKA 3META 1ZQ1A 4UC4A 1U8RA 1OU8A 3SDZA 1HJDA 4FYYB 1UDLA 3CXCA 3UATA 2RM4A 5AYFA 4ZGDB 2PUKB 2YLCA 3O5ZA 4M77G 1MGQA 3CCVQ 2OTJQ 1BCMA 2L8DA 2FHDA 3OYHA 3M0UA 2RHZA 3E2UA 3PTAA 3QSUA 4M75E 5FU6C 5KYXA 4A4GA 2YRVA 1NEBA 2BUDA 1MHNA 4Y28E 1N8RR 1NEGA 1AWOA 1Q7YR 3CCET 1BKBA 1IHVA 2DL8A 3SWNC 3D7SB 3FLGA 2DF6A 3REAB 3QWYA 3CMEQ 2JM8A 4OMMA 1M1GA 2I0NA 2JW4A 4KRTA 3CC4Q 1WZOA 4F04B 5GAMf 5IHIA 3M58A 1K73U 4O5VA 3WVEB 4A54A 2CH4A 1RADB 1T3SA 3OYEA 3G71T 3S3MA 1UG1A 5GAOr 2QYZA 4M78E 4KH0B 4ORZA 4E7LA 3CBMA 2HKNA 3J81E 4BY6B 1IHWA 4MDWA 4FW2A 1YWOA 2E3IA 4EMGA 1YJNQ 1W70A 4OGCA 3RDVA 3LGFA 3CXCP 1G3SA 2AKLA 3A8LB 1GL5A 2QXFA 2V26A 1RI0A 5KYWA 4FYXB 3REBB 1PD1A 3OYBA 3BDLA 4C0ZA 4BE2A 1PRLC 2KEAA 3EH1A 5GMKe 3BDUA 1WQ7A 3A1PA 4QQGA 1Q81C 4OMOA 2VC8A 3OYFA 2FB7A 3G6EA 3RIRA 1RAGB 1TWBA 4P5NA 1KFZA 4HT8A 4PJOD 5I22A 1D3BB 2FPEA 1N5ZA 2QTXA 1TUGB 4Z8AA 2DJZA 4EMKB 5IHKA 3AT1B 5GMKh 4FSXA 1WFWA 4PK4A 4NL2A 1VQ8T 4HVWA 3I56A 2KYMA 2QQSA 1MNDA 4M75C 4EDUA 1YN8A 1WPYA 2MWOA 1QP2A 5GANe 2J7IA 3HHTB 1VA7A 3CC2A 1D0XA 1N9SA 4LD6A 4RTVA 5CIUA 3THKA 4D8KA 4J9EA 4CC7A 5GAOp 4JUVA 2C0TA 1SHFA 5CKFA 3PE0A 2IVWA 3PIPA 4MZTA 1D0YA 1YITQ 1CKBA 2OTJA 3BFMA 3CCVA 5GANh 2XIDA 3OA6A 1ZA2B 3BE3A 3FRNA 1G3WA 2PVGB 3CCUQ 2EAYA 2KDSA 3LWIA 1U5SA 4KGZB 2ZCFB 1M2VA 3E9GA 2QGFB 3V8JA 3ULRB 1SSFA 3RBBB 3FC3A 4PJNA 3NPFA 4OB0B 1VQLA 4JS4A 2DYBA 3DLMA 5DLQE 4Y91A 5FU7C 1VYVA 1YJ9T 4OMNA 4C92B 4RG8A 3CC7T 2NUTB 5L23A 5AT1B 1PG5B 3CMEA 2EPDA 2MPXC 3JB9H 1KQSA 2M1HA 4M75A 3NHNA 3CC4A 1M3AA 2PTKA 4RTUA 1B34B 1H8KA 4LDWA 3CMAT 1KQ1A 4FL6A 4C5GA 4LE9A 3SD4A 2SEMA 1IO6A 4L59A 3CBOA 4FU6A 1WA7A 3V7SA 2YDLA 1JBMA 1PM3A 2RHIA 2RQUA 1ZSZA 4KUIA 1QW1A 3EFOA 4IURA 4OMPA 3I55A 1YIJQ 2EGCA 4CC3A 2BE7D 2KGTA 2EYYA 2DVJA 1KC8C 8AT1B 3C94A 1HYOA 1YJNA 3GIBA 2NUPB 4AG1C 1I0CA 2ABLA 4PJOF 4HA8A 2W10A 1H3HA 5LJ3g 5CVIA 2DNUA 2MYSA 4J9HA 5IN1A 2QI2A 1RLQC 1BCOA 1D1AA 2QEXT 2HSPA 3KXTA 1Y96B 3OB9A 4M7DA 2CSIA 3GOXA 4M78A 3VS0A 1Q81U 1GFDA 2FO0A 1VQNT 1NYFA 1VQ6Q 2WSCE 2VYTA 2J6OA 4Z88A 6AT1B 3A8MB 1UJ0A 3M57A 1YHQQ 2A0FB 4VUBA 1SRLA 4M7AB 3CPWA 1S72A 1N6AA 1W2BA 2A08A 3M59A 4J9CA 4C0GA 4C92G 3OW2A 3QYGB 4M77C 3VUZA 5M9OA 4A53A 3J80E 2FPFA 3CCLT 1VQMT 1TSFA 4J9DA 4V2SA 4E47A 3EGDB 1SHGA 2Y4XA 4J7IA 1AOJA 1RAEB 1ZLMA 2SRCA 3CCRQ 1QVFA 1WNLA 1PSEA 1VQ5A 2GF7A 1LOJA 4C8QD 1M90U 1IREB 2HSEB 3HP9A 5KYYB 3CCJA 5GJWB 3C4SA 1WJSA 3CBPA 1ZA1B 1KC8R 1E6GA 2K3YA 2R57A 1AD5A 2B86A 2BE9B 2J6FA 2F5KA 5LJ5g 1YITA 3NTIA 2QDYB 4PFOA 2AK5A 2E64A 1NBEB 3UPUA 2MMPA 1WGSA 4OMFB 3TREA 1F1BB 2RHUA 2ZAEA 2IPOB 1LJOA 2K9GA 2I2LA 1BU1A 3OS2A 5GAOn 4KGXB 3J7AF 4XTUA 2KT1A 2O9SA 2GTOA 4CRIA 5DLOA 1W1FA 1YI2A 4BUGA 1UHCA 2CP3A 3OYMA 2EYWA 5C6SA 4MDXA 1J3TA 4PJMA 2K6DA 1YJWQ 3I9QA 1D09B 4BE1A 3CCMA 4JRIA 5LJ3e 2KNBB 2QG9B 3HTRA 3HL8A 2K5IA 2FG0A 4OVAA 2QA4T 1ARKA 3CPWP 1K8AC
chains in the Genus database with same CATH topology
3ME9A 2E5QA 4JRQA 4XK8E 1NJIC 2L5QA 1VUBA 3QKJA 2XU8A 2HD0A 3S3NA 4BI4A 1N8RC 2LVMA 4XU3A 3JCMc 2E6NA 3VV0A 2DAQA 4B9WA 1Q7YC 1W4SA 2XDPA 4J8OA 4C8QA 3E19A 2RB6A 3V7RA 3QPHA 4C0DC 3NFCA 5CAIA 1U1TA 4QW2A 2ZPEB 4J6XA 4C5HA 1YJWA 1KG1A 4RG2A 2OTJT 2F5TX 2WSFE 3CEYA 3DKMA 3C12A 3CCVT 4IUVA 2JTFA 1QVFS 2JNGA 1B34A 4F7UB 4LDVA 4X34A 5L8RE 5KE3A 5LJ5j 1KC8U 4XTXA 2XHCA 5GANd 3T9NA 2E12A 5FRNA 2XI9A 1QVGA 4M75F 2CZ1B 3CC7A 2ZPFB 4C92F 5CKEA 4CI0C 3TU4K 2DEQA 2KAFA 1I81A 1KHIA 2VXEA 3JSCA 1VQ7T 4KUDK 2KMTA 5HK0A 3RKXA 3L2ZA 4QVZA 2K57A 4IKFA 3OYAA 2DTIA 2EQKA 1N9RA 4PNOA 1BI1A 4F7UA 4ZGJB 2H3JA 4DQ2A 1VQ9T 2DZ9A 4KT0E 1Y96A 4PJOC 1G3YA 1KQ2A 2FYKA 3META 2CZ6B 4N0AC 4JRPA 1ZQ1A 4ZGEB 4UC4A 1YCYA 2ZZDA 4M77D 1U8RA 3SDZA 3CMAA 2JN0A 3JCMg 1Q82C 3QBYA 3JCMh 4PJOA 1IZ6A 1X6OA 3CXCA 2RM4A 4IUPA 2EQMA 5CKHA 5AYFA 4XTYA 4XAXB 4ZGDB 2X4WA 2PUKB 2D0QB 3OMGA 5CKDA 4DOVA 3CMET 1KD1C 2YLCA 3UDCA 4M77G 1MGQA 3MP1A 2VGMA 4M7AA 2LT4A 3MEWA 2L8DA 5LJ5e 1KQSS 4C8QF 3OYIA 1UGRB 4C0DB 3MO8A 1XQHA 1NE8A 3RUXA 2FHDA 5A0DA 2QA4A 3OYHA 3O8VA 2E65A 3CC4T 2XICA 2RHZA 1M8VA 4LDYA 3RMSA 3PTAA 3OYKA 4JDSA 3X24B 1M90C 3QSUA 4M75E 5FU6C 3A8GB 2DPPB 3JCMV 2JZ2A 2P4TA 4C92E 4A4GA 3OS1A 2RJFA 2YRVA 1VQPA 1V29B 2BUDA 3HPWA 1Y7XA 1JRIA 4XU1A 1MHNA 4Y28E 3UT1A 3V8KA 4YTLA 3OYDA 2WSEE 3QDRB 4M78F 4EMHA 5GANf 2GFAA 4N4GA 4PL6A 1UEBA 3CCET 1BKBA 3I55T 2O4XB 3JCMQ 4OP0A 3CCRA 4IUTA 3SWNC 1M9SA 3L1AA 3VYHB 2RI2A 5KCOA 2LQ8A 4J7FA 3FLGA 3OYNA 3CCSA 2CZ0B 3BW1A 2Y90A 4RCCA 1YJNT 1VQNA 4PJOB 4BD3A 3VJPA 2K5FA 1PSFA 3M55A 1M1GA 1G3TA 2VXFA 3G6ET 2RA2A 4C8QE 2DD4A 3OSVA 2A7YA 3HFNA 4D6WA 3HFOA 4F7UG 5GAN5 2DTOA 3FEOA 2LCLA 4M75B 5GAMf 4OB3B 1VQ4A 2MI6A 3GLXA 3M58A 4M78C 3UWNA 4B9XA 5LJ3d 5IT9E 3S3OA 2EQJA 5GAMg 1K73U 4O5VA 3WVEB 5A0LA 4A54A 3HRUA 2FL7A 3VKIA 4FT2A 5DY9A 4XQ3A 5GAMh 2OTLT 3AHUA 3OYEA 3G71T 4E7HA 2DVEA 3S3MA 3OBYA 5GAOr 4M77A 1VQMA 3E1SA 5FU6B 4NS5A 3M5AA 3I56T 4M78E 5CO7A 2AHJB 4EMKC 4M7AG 4E7LA 3CBMA 4BI3A 5GAN3 2DD5A 2QQAA 3CPWS 1M5Q1 1S72T 4A4KA 2M16A 3VYGA 3J81E 1W2BS 3EAEA 4BY6B 3G7ZA 3L2QA 4MDWA 4MZMA 3OW2S 4EMGA 5I21A 2KVQG 3HRSA 3A8HB 1JJ2S 3CXCS 3JCMW 1H641 1BIAA 1X75C 3SWNB 3X25B 4OGCA 3LWHA 3LGFA 4M7DA 1G3SA 2CS7A 3KUFA 5FRMA 4BDZA 5A2QE 4GLKA 3CCEA 3A8LB 2WACA 2QXFA 4MZPA 3DLLA 5J39A 1ZHIA 1RI0A 4BI8B 2DIGA 2MF2A 1VQOA 4PKCC 4A4EA 1FX7A 2VGNA 3FIFA 1K8AU 3OYBA 1NJIU 3BDLA 4C0ZA 4BE2A 2JVVA 3H6ZA 3LGLA 4ZTJA 5GMKe 2XK0A 3CPFA 5FROA 3BDUA 2A3LA 4A4HA 3JCMe 1WQ7A 4M7DC 1EIFA 3JB9D 5KH6A 1VQKA 1N27A 4QQGA 1Q81C 1YBYA 4M7DB 2VC8A 2RJEA 4M78B 4KULA 3OYFA 1HXDA 2FB7A 4A4FA 2RHXA 3RIRA 3V8LA 3G6EA 4ME7A 3JCMJ 1XNIA 4P5NA 4ATOA 2R58A 4HCBA 4HT8A 4PJOD 1YITT 4M77F 1D3BB 3LYIA 2QTXA 2PU9B 2QQBA 1VQLT 4XTZA 3G4SA 3QJYA 2DJZA 4IUQA 4XU2A 5LJ5d 4EMKB 2ZPHB 1K9MC 2EJ9A 4KBMB 4PJOG 1WJRA 5GMKh 3CCUT 2OTLA 4FSXA 2ZPGB 4MMLA 3G71A 5GAMj 2DIQA 2K4YA 3GNGA 4JRKA 2EJGA 4M75D 3FDRA 4NL2A 4RCBA 3SB2A 3E9FA 4R56A 3VU3C 1VQ8T 3CCQT 3I56A 1O9SA 3QUIA 3C95A 2QQSA 4NOYA 4M75C 4EDUA 2RI3A 4LDXA 2LT1A 1WPYA 4C92C 2MWOA 1QP2A 3LLRA 5GANe 4J5YA 2MWPA 2L3RA 3HHTB 4JLIA 4X9CA 4R55A 3L2WA 3CC2A 2XD0A 1NPRA 1N9SA 2RHYA 4LD6A 4JLGA 2ZPBB 3INZA 1Q82U 5CIUA 2FVUA 3H8ZA 3QG1A 5KCHA 2Y4YA 3ZEHA 5GAOp 4JUVA 1XTDA 1K8AC 1BIBA 5CKFA 1KD1U 2DXCA 3MP8A 1QP3A 3M9QA 2IVWA 4BY6C 3NTKA 4ELZC 4L5GA 4MZTA 1M1FA 3MEVA 3PIPA 1S72A 2DXUA 2V8IA 5CK9A 3GP8A 3BFMA 4ZN3A 3CCVA 2OTJA 2D9TA 3A8OB 2O01E 3P8BB 4Q5WA 3EFSA 5GANg 4XU0A 2DK3A 1RL2A 3TEEA 5GANh 2GQVA 2KQWA 3QHSA 2XIDA 3RKWA 2HQEA 3OA6A 4X9DA 3FRNA 1G3WA 2PVGB 4HKEA 4BB7A 4F7UF 5GAMe 3L42A 1BI3A 2EAYA 4C8QC 3GF5A 2EYQA 3KBGA 2KDSA 3LW5E 2JTMA 1VQ7A 3LWIA 1QVPA 2DXTA 2RK2A 2XKOC 1AHJB 2ZCFB 2K5LA 1NPPA 2BKDN 1JB0E 2KSSA 3E9GA 4JJNK 1U1SA 4OB1B 3V8JA 2E6ZA 1OZ3A 2CYZB 2R5MA 3GPLA 2O4XA 1YJWT 1SSFA 1VQ9A 3FC3A 4M7DD 2LDMA 4M78D 3RKYA 4QVCA 4OB0B 1VQLA 4JS4A 3DLMA 1M1KU 4M7AF 1VIEA 4E7JA 4E7IA 5DLQE 4Y91A 4RMOA 2DZCA 2DXBA 2EFIA 2K2VA 5FU7C 4C92B 1WQWA 1YIJT 1YJ9T 2D6FA 4HCCA 3DB4A 3CCUA 1TH7A 4N0AA 3X20B 5GMKi 1QVGS 4RG8A 1K73C 4M7DG 3CC7T 4HCZA 5DM7R 5D6XA 1Q86C 4L6V5 5GMKj 2HQXA 3WXMB 4NL3A 4PLLA 2E10A 2G3RA 4C5EA 3CMEA 4DOWA 1M4ZA 2QQ9A 5GAOl 3JB9H 5EG2A 2RH2A 1KQSA 3OYJA 2M1HA 4QVDA 4M75A 2DKGA 3L2RA 2RJCA 3CC4A 2XDBA 2X4YA 3VUBA 2BIVA 5CQYA 4F7UE 3OS5A 5HKCA 1UGPB 5GAOq 1B34B 4LDWA 4N4HA 1GXIE 3L2UA 3CD6T 2E70A 1KQ1A 4FL6A 4OB2B 4J6YA 4C5GA 3CMAT 2EJFA 1OZ2A 3SD4A 1UGSB 4L59A 3QO3A 3M56A 3P8DA 2JUFA 3CBOA 4FU6A 3V7SA 3JCMd 1VQ6T 1JBMA 3HRTA 4C8QB 2RHIA 2LRQA 2LQKA 3LH0A 4XTWA 3R6OA 2YHTA 1KHCA 3DB3A 4KUIA 3M54A 1UGQB 1QW1A 4IURA 1YHQT 4QQ6A 3I55A 5D6WA 4MMKA 4M7AE 1VQ5T 4XTVA 5GANj 1N8RU 1KC8C 4LD9K 4FM4B 2IG0A 5CCAA 1Q7YU 3CCJT 3SWNA 5C0MA 5GMKl 5IAYA 3JB9J 3C94A 4ELYC 1YJNA 3GIBA 2P0KA 1VQPT 2VV5A 1R8OB 5FU7B 3QYHB 3TCJA 4PJOF 3OY9A 4HA8A 1XOVA 1Y71A 3M4YA 3OYCA 5GAN6 2DTHA 5LJ3f 2EWNA 5A0GA 3MP6A 3JB9G 3MEUA 3FB9A 5LJ3g 2DO3A 4II1A 5CVIA 5LJ3h 5IN1A 2QI2A 1OI1A 2QEXT 3KXTA 3CCRT 1YIJA 2R5AA 4GY5A 2CZ7B 1YJ9A 2X4JA 3OYYA 2PUOB 3JAME 1Y96B 2RJDA 2JOYA 3OB9A 1FWZA 4PLIA 3ASKA 4C5IA 3GOXA 2PQWA 4J83A 2LTOA 4M78A 3CCST 1Q81U 1VQNT 5J26A 3SFMA 2M0OA 2WSCE 3URGA 2VYTA 2EKOA 4C92D 2KK4A 1DJ7B 3QJ6A 1OYXA 3A8MB 1D3BA 3M57A 2E41A 5GAN8 5GAN4 2HNIA 4EPCA 4VUBA 1LNXA 3X28B 4M7AB 3CPWA 4ZTFA 3PMIA 1N6AA 2ZGWA 2CKKA 4EMKA 1UB4A 2XDDA 4M75G 1W2BA 3M59A 4C0GA 4QQDA 4C92G 1K9MU 3OW2A 1VQ4T 3JCMf 4BE0A 1FXXA 4TVRA 2K3XA 2P0PA 3CD6A 1YI2T 3OQ5A 5GAOm 3QYGB 3JCMP 4M77C 3PT9A 3VUZA 4C0FA 1JJ2A 3L2VA 2LNVA 3OS0A 5M9OA 5GAN7 5GAMd 1HK9A 4A53A 3J80E 3OBWA 1VQ6A 1BI2A 3CCLT 4PJOE 3X26B 4OF1A 1VQMT 4V2SA 5I2MA 4E47A 4E7KA 2Y4XA 3HSBA 1BI0A 4O6JA 5CR2A 4J7IA 3JB9I 2P0QA 3CCMT 3OSSC 1YHQA 4M77E 1QVFA 4Z02A 5CKBA 2LC4A 1WNLA 1PSEA 1VQ5A 3OYGA 2GF7A 1LOJA 3QXEB 4C8QD 1M90U 5FLXE 1IREB 2E1HA 3HP9A 4WF2A 3OYLA 5KE2A 3CCJA 1G5VA 1X01A 2B8AA 5J3BA 3JCMb 4IUUA 2XG8D 2M9UA 3C4SA 3Q1JA 1WJSA 3CBPA 3PNWC 4C8QG 3PGGA 2K3YA 4JS5A 4M7DF 2R57A 5LJ5f 3JRZA 3QZ9B 1H3ZA 2F5KA 2NLUA 2MAMA 5LJ5g 3F70A 1YITA 5I2SA 3NTIA 5LJ5h 2YLBA 3NTHA 5GMKm 3MEAA 2HAXA 2QDYB 2QEXA 4OGEA 1VQOT 2E64A 2RI5A 2RO0A 4FT4A 5LJ3j 1M1KC 3UPUA 3M53A 1BYMA 2MMPA 1WGSA 4OMFB 3GNFB 3TREA 2HBPA 5LL6S 2RHUA 2X4XA 4M78G 3ZBDA 3PIOA 1VQKT 4DA4A 1VQ8A 1LJOA 2PVOB 3RERA 3CCQA 2I2LA 3RESA 1ZBXA 2LCCA 1P92A 3ER0A 1NZ9A 3OS2A 2LX9A 3QZ5B 3P8HA 5GAOn 2C06A 4M77B 3MCAB 5GAN2 3J7AF 4XTUA 3V7CA 1VIFA 3S6WA 2V8KA 3N5BB 2OAUA 2L89A 4C92A 3FJPA 2PVDB 2X35A 5HK3A 2EQUA 3G4ST 2KY9A 2RK1A 4CRIA 5DLOA 4FIBA 2QQRA 5D6YA 3HKSA 4N4IA 3WVDB 1YI2A 1I4K1 4M7AD 1Q86U 2F69A 4J6WA 2GFUA 4LDUA 1I8FA 4BUGA 3PFSA 3LX7A 4M7AC 3JCMX 2ZPIB 3OYMA 5C6SA 3CCLA 4HT9A 3MHXA 4MDXA 2GCXA 4M7DE 3ZFJA 2V8JA 1WJQA 3PMTA 4BDYA 4BE1A 1Y07A 2VUBA 3BY7A 3A5ZB 3CCMA 4BACA 2RD1A 4JRIA 4RKUE 5CQXA 3M4GA 3RMQA 4ZN1A 5LJ3e 3OMCA 3QIIA 1I5LA 3HL8A 1O75A 2K5IA 4OVAA 2EIFA 2QA4T 3CC2T 2CGHA 5HY6A 3EFRA 3JB9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U G;  3HFN A;  3HFO A;  5GAN 5;  2DTO A;  2DXU A;  3BFM A;  4XU3 A;  3JCM c;  4C92 D;  4M75 B;  5GAM f;  4M7D C;  5GAN g;  3EFS A;  4M78 C;  4XU0 A;  5LJ3 d;  5GAN h;  4C8Q A;  5GAM g;  1D3B A;  2RB6 A;  3QHS A;  3V7R A;  2E41 A;  5GAM h;  5GAN 8;  3RKW A;  4A54 A;  2HNI A;  4X9D A;  5DY9 A;  1LNX A;  4XQ3 A;  5GAN 4;  4M7A B;  3AHU A;  4F7U F;  2ZGW A;  4EMK A;  5CAI A;  2DVE A;  5GAM e;  1U1T A;  4M75 G;  2EAY A;  4J6X A;  4C8Q C;  5GAO r;  4M77 A;  4C92 G;  3JCM f;  2DXT A;  4M78 E;  1B34 A;  4EMK C;  4F7U B;  5LJ5 j;  4M7A G;  5GAO m;  4XTX A;  3JCM P;  5GAN 3;  4M77 C;  1U1S A;  1M5Q 1;  5GAN d;  3V8J A;  4M75 F;  5GAN 7;  5GAM d;  1HK9 A;  4A53 A;  4PJO E;  4C92 F;  4M7D D;  2DEQ A;  4V2S A;  4EMG A;  1I81 A;  2VXE A;  4M78 D;  3RKY A;  4QVC A;  5I21 A;  3HSB A;  4M7A F;  3RKX A;  3L2Z A;  3JB9 I;  4Y91 A;  2DZC A;  2K57 A;  4M77 E;  4C92 B;  1WQW A;  1H64 1;  3JCM W;  4PJO A;  1BIA A;  1WNL A;  3SWN B;  1TH7 A;  2DTI A;  4N0A A;  1N9R A;  1LOJ A;  4PNO A;  4C8Q D;  4F7U A;  5GMK i;  2E1H A;  4M7D G;  4WF2 A;  4DQ2 A;  5GMK j;  2DZ9 A;  4NL3 A;  4PJO C;  1Y96 A;  2E10 A;  1X01 A;  1KQ2 A;  2FYK A;  3JCM b;  4N0A C;  1YCY A;  4M77 D;  5GAO l;  3JB9 H;  3FIF A;  2JN0 A;  3JCM g;  3PGG A;  4C8Q G;  4QVD A;  3JCM h;  4M75 A;  4M7D F;  2DKG A;  5LJ5 f;  2RM4 A;  5GMK e;  4XTY A;  3BDU A;  3JCM e;  5LJ5 g;  1WQ7 A;  3JB9 D;  5LJ5 h;  2YLB A;  2YLC A;  4M77 G;  1MGQ A;  4F7U E;  4M7A A;  5GMK m;  5GAO q;  2VC8 A;  4M7D B;  1B34 B;  5LJ5 e;  4M78 B;  2E64 A;  1KQ1 A;  2FB7 A;  1HXD A;  4J6Y A;  3RIR A;  3V8L A;  2EJF A;  3RUX A;  4C8Q F;  5LJ3 j;  3JCM J;  2E65 A;  3QO3 A;  4C8Q E;  4HT8 A;  4PJO D;  1M8V A;  3JCM d;  3V7S A;  1JBM A;  4M78 G;  4C8Q B;  4M77 F;  1D3B B;  3QSU A;  2QTX A;  1LJO A;  4M75 E;  4XTW A;  2YHT A;  3RER A;  2I2L A;  4XTZ A;  3RES A;  2DJZ A;  4XU2 A;  3JCM V;  4C92 E;  5LJ5 d;  4EMK B;  5GAO n;  2EJ9 A;  1JRI A;  4M77 B;  4MMK A;  4XU1 A;  4PJO G;  4XTV A;  5GMK h;  4M7A E;  5GAN 2;  3V8K A;  4MML A;  5GAN j;  4XTU A;  3V7C A;  4M78 F;  4EMH A;  4JRK A;  5GAM j;  4C92 A;  3FJP A;  2EJG A;  4M75 D;  4NL2 A;  4RCB A;  3SB2 A;  3SWN A;  5GMK l;  5GAN f;  3VU3 C;  3JB9 J;  3QUI A;  4NOY A;  3GIB A;  4M75 C;  1I4K 1;  4M7A D;  3JCM Q;  4OP0 A;  1WPY A;  4J6W A;  4PJO F;  4C92 C;  5GAN e;  3SWN C;  4HA8 A;  4J5Y A;  4JLI A;  1I8F A;  4X9C A;  3L1A A;  5GAN 6;  2DTH A;  4M7A C;  5LJ3 f;  3JCM X;  2EWN A;  1N9S A;  3JB9 G;  4HT9 A;  3FB9 A;  3BW1 A;  2Y90 A;  4RCC A;  5LJ3 g;  4M7D E;  4PJO B;  3INZ A;  5LJ3 h;  3BY7 A;  2RD1 A;  4JRI A;  4JUV A;  5LJ3 e;  3M4G A;  5GAO p;  1I5L A;  2VXF A;  2RA2 A;  1Y96 B;  1BIB A;  4M7D A;  2CGH A;  4M78 A;  3EFR A;  3JB9 F; 
#chains in the Genus database with same CATH topology
 2E5Q A;  2XU8 A;  4E7S A;  2DAQ A;  4B9W A;  4OML A;  1QQJ A;  1ABO A;  2XMF A;  3NFC A;  5CAI A;  2ZPE B;  1KG1 A;  2EKH A;  5I11 A;  2WSF E;  3CEY A;  4IUV A;  2JTF A;  5KYU A;  4J9B A;  5L8R E;  1KC8 U;  2K2M A;  1QVF P;  2E12 A;  2XI9 A;  2D0N A;  1HSQ A;  1UGV A;  4CI0 C;  2DEQ A;  2KRN A;  1I81 A;  1KHI A;  3L2Z A;  2K57 A;  2O9V A;  4IKF A;  1D0Z A;  3OYA A;  2EQK A;  1EZZ B;  1VQ9 T;  2KRS A;  2CZ6 B;  1A0N B;  4JRP A;  4QKU A;  3I5S A;  1X43 A;  1YCY A;  2CP2 A;  2ROL A;  3JCM h;  1IZ6 A;  1X6O A;  3EG9 B;  4XAX B;  2X4W A;  2D8H A;  3PVQ A;  5CKD A;  1KD1 C;  2VGM A;  2LT4 A;  5LJ5 e;  4C8Q F;  1UGR B;  2K3B A;  1LPL A;  1JEG A;  1LVK A;  4LDY A;  2E5K A;  1BBZ A;  2DIL A;  3X24 B;  2KBT A;  2JMC A;  1VQ7 Q;  3A8G B;  2DPP B;  4C92 E;  2P4T A;  1K8A R;  1YFN A;  1JRI A;  4XU1 A;  2FZC B;  3OYD A;  2IIM A;  4PL6 A;  2O4X B;  3JCM Q;  4OP0 A;  2NUZ A;  3CCR A;  4PJL A;  3L1A A;  3VYH B;  2LQ8 A;  2CZ0 B;  2RN8 A;  2MOX A;  2Y90 A;  4PJO B;  4BD3 A;  2BZY A;  2M02 A;  2K5F A;  1PSF A;  1WHG A;  3M55 A;  1G3T A;  1I1J A;  1C0M A;  3VS1 A;  1ZUU A;  3HFO A;  1Q95 G;  3LH5 A;  3VS2 A;  3UWN A;  5LJ3 d;  3H0I A;  5A0L A;  5GAM h;  2OTL T;  2FL7 A;  4CC2 A;  4FT2 A;  4JZ3 A;  5FW9 A;  2DVE A;  2G6F X;  1S1N A;  2KYB A;  3E1S A;  2M0Y A;  4EMK C;  1D1C A;  2CP5 A;  1M5Q 1;  2C0O A;  2DL7 A;  3L2Q A;  2DX1 A;  5I21 A;  2VWF A;  2KVQ G;  3A8H B;  1WDX A;  2QAS A;  3CXC S;  1BIA A;  3X25 B;  3G6E Q;  4PFP A;  3CCE A;  3G1J A;  3FJ5 A;  3DLL A;  1ZHI A;  2ED0 A;  1K8A U;  2VGN A;  2CRE A;  3FIF A;  2H8H A;  1WHM A;  3H6Z A;  4ZTJ A;  2XK0 A;  3CPF A;  4A4H A;  3JB9 D;  1N27 A;  3I56 Q;  2RJE A;  4LN2 A;  2HEQ A;  4A4F A;  3JCM J;  4ATO A;  1UTI A;  3CQT A;  3VRZ A;  2RPN A;  2PU9 B;  4IUQ A;  5LJ5 d;  2MK5 A;  1R77 A;  4PJO G;  4MML A;  3G71 A;  3GNG A;  4M75 D;  3E9F A;  3QDF A;  3VU3 C;  4JZ4 A;  3C95 A;  2GBQ A;  4LDX A;  4C92 C;  4JLI A;  3L2W A;  4FW1 A;  2HMA A;  1WHK A;  2AIR B;  2FVU A;  3H8Z A;  3NMZ C;  3QG1 A;  3ZEH A;  4RTX A;  1BIB A;  1KD1 U;  3MP8 A;  1QP3 A;  2NWM A;  3NTK A;  3MEV A;  1X6B A;  2V8I A;  1M3B A;  1X2Q A;  1AZG B;  5GAN g;  1VQL Q;  3TEE A;  2GQV A;  3RKW A;  2RQT A;  2A28 A;  4HKE A;  4F7U F;  4B6M A;  5IH2 A;  3KBG A;  2BZX A;  1VQ7 A;  2D1X A;  3CCQ Q;  2FRY A;  1C6V X;  1NPP A;  2BKD N;  2KSS A;  4LXC A;  3EG2 A;  1UFF A;  2CYZ B;  2R5M A;  1WXU A;  3GPL A;  1YJW T;  4M7D D;  2CP7 A;  2LDM A;  3M0Q A;  1K1Z A;  2HL3 A;  4M78 D;  3TSZ A;  1AWW A;  2OX7 A;  3VS4 A;  4M7A F;  2COY A;  2DZC A;  2DXB A;  2EFI A;  3TVT A;  2KI7 A;  4AFQ C;  1QVG P;  1ZSG A;  4NL3 A;  4PLL A;  2E10 A;  2G3R A;  4C5E A;  2QQ9 A;  2KE9 A;  2YUO A;  3I55 Q;  2RJC A;  2XDB A;  3VUB A;  2HQH A;  3MKD A;  2BIV A;  1IGU A;  3EH2 A;  3L2U A;  4DBQ A;  3CD6 T;  4J6Y A;  1UGS B;  2JUF A;  2BZ8 A;  4C8Q B;  2LRQ A;  3R6O A;  3DB3 A;  1X6G A;  4QQ6 A;  5D6W A;  4XTV A;  1N8R U;  4LD9 K;  4FM4 B;  5CCA A;  1Q7Y U;  3SWN A;  3H41 A;  5C0M A;  5GMK l;  3JB9 J;  2HZY A;  2P0K A;  1ZBJ A;  2VV5 A;  3QWX X;  2L0A A;  1G8X A;  2L3S A;  1S72 Q;  1RAI B;  4HVU A;  2DO3 A;  2RQW A;  4II1 A;  4AMC A;  1OI1 A;  2A36 A;  4JJD A;  1YJ9 A;  2HBW A;  3JAM E;  2PUO B;  1FWZ A;  3ASK A;  4C5I A;  3RNJ A;  3H0F A;  4E6R A;  2PZ1 A;  1GRI A;  5J26 A;  3SFM A;  4DEX A;  2M0O A;  2EKO A;  3M0R A;  3QJ6 A;  5GAN 8;  2KT8 A;  1VQ5 Q;  1IB8 A;  2VVK A;  3CCJ Q;  1MMD A;  2COZ A;  2JT4 A;  1VQP Q;  1MUZ A;  3TQ7 P;  1ZX6 A;  3JCM P;  2JJ9 A;  3L2V A;  3OS0 A;  5GAN 7;  5KYX B;  4PJO E;  2CP0 A;  3OBW A;  1BI2 A;  2O88 A;  4F14 A;  5ECA A;  1AVZ C;  5CR2 A;  2P0Q A;  3OSS C;  4M77 E;  3OYG A;  3QXE B;  4Z89 A;  3OYL A;  5KE2 A;  1X01 A;  2KXC A;  2P4R A;  1Z9Z A;  2XG8 D;  3Q1J A;  2DL4 A;  1NJI R;  4DBH A;  4C8Q G;  4M7D F;  2GGR A;  1T0J A;  2X3X D;  2GQI A;  3F70 A;  3KFV A;  3NTH A;  5GMK m;  1VQ4 Q;  2QEX A;  4OGE A;  2YXY A;  2RO0 A;  4RTW A;  1G83 A;  5LJ3 j;  1M1K C;  1YI2 Q;  3M53 A;  1GCQ C;  2X4X A;  3ZBD A;  2CT4 A;  2ESW A;  4DA4 A;  2PVO B;  3CCQ A;  2LCC A;  1JQQ A;  1P92 A;  2LZ6 B;  2LX9 A;  3CCM Q;  3MCA B;  4RTT A;  3V7C A;  2F2W A;  2V8K A;  3N5B B;  5IXF A;  3FJP A;  1WHJ A;  3MJX A;  1AWX A;  1UHF A;  2RK1 A;  3WVD B;  2J06 A;  2GFU A;  4LDU A;  1I8F A;  3CCL A;  3MHX A;  3ZFJ A;  2EVR A;  3A5Z B;  2KXD A;  2RD1 A;  1X69 A;  4RKU E;  5CQX A;  1VQO Q;  3QII A;  3OMC A;  2YRC A;  3CC2 T;  1M27 C;  3M0S A;  3ME9 A;  1E6H A;  2L5Q A;  5KYW B;  1AZE A;  1UEC A;  2LVM A;  1VQK Q;  4XU3 A;  2E6N A;  2XDP A;  4J8O A;  3E19 A;  2RB6 A;  3QPH A;  2DRK A;  1UJY A;  1MV3 A;  2LJ1 A;  9ATC B;  4J6X A;  4C5H A;  2ED1 A;  4RG2 A;  2OTJ T;  2F5T X;  3CCV T;  5EC7 A;  4ESR A;  1QVF S;  1RAA B;  2JNG A;  4F7U B;  5IXB A;  5LJ5 j;  4XTX A;  5GAN d;  2CZ1 B;  5CKE A;  1GCQ A;  4KUD K;  1M1K R;  1B07 A;  1PKT A;  5HK0 A;  5KYN A;  1QLY A;  1G2B A;  2DTI A;  4PNO A;  1N9R A;  2EYX A;  1BI1 A;  4ZGJ B;  2H3J A;  4R0K A;  1VYT A;  4DQ2 A;  4KT0 E;  4PJO C;  1KQ2 A;  4N0A C;  4ZGE B;  2JS2 A;  2ZZD A;  2DBK A;  2E4H A;  1OPK A;  1Q82 C;  2LCS A;  3IQL A;  3JCM g;  2AT1 B;  1BB9 A;  2EQM A;  2FEI A;  4A63 B;  3CME T;  4DOV A;  1AWJ A;  3MP1 A;  4C0D B;  1XQH A;  2F1L A;  3RUX A;  2QA4 A;  1KQS P;  1ABQ A;  1EX4 A;  2E65 A;  3O8V A;  1UE9 A;  3CC4 T;  1M8V A;  2JXB A;  3H0H A;  1WHH A;  3OYK A;  4JDS A;  3UF4 A;  4J9F A;  2AZS A;  3JCM V;  2JZ2 A;  2RJF A;  1VQP A;  1V29 B;  4AFS C;  2QTV A;  2VKN A;  2WSE E;  3QDR B;  4EMH A;  5GAN f;  2GFA A;  4OMQ A;  1M2V B;  1UEB A;  4GBQ A;  1X27 A;  3NGP A;  3EG3 A;  3I55 T;  2GTJ A;  3SEM A;  2CSQ A;  2RI2 A;  5KCO A;  4J7F A;  1WYX A;  3OYN A;  3CCS A;  4F16 A;  3BW1 A;  4RCC A;  1YJN T;  2CUD A;  1OUL A;  2VXF A;  2O31 A;  4C8Q E;  1WIE A;  1TTH B;  2A7Y A;  2EQI A;  4D6W A;  4F7U G;  5GAN 5;  2YUQ A;  2DTO A;  2EYZ A;  2LCL A;  4M75 B;  1VQ4 A;  4B9X A;  3GLX A;  1MNE A;  2EQJ A;  5GAM g;  2RQR A;  1K0S A;  3HRU A;  3AHU A;  2F2X A;  4E7H A;  4M77 A;  1Q82 R;  4NS5 A;  3CCE Q;  4M7A G;  4BI3 A;  2DD5 A;  1S72 T;  4WTO B;  1ZSZ B;  1JXO A;  3EAE A;  3G7Z A;  3EFO B;  4HVV A;  1W2B P;  3HRS A;  3OW2 P;  2JS0 A;  1Y57 A;  1I5O B;  1JJ2 S;  3JCM W;  1QCN A;  4DBF A;  2CH4 W;  2EW3 A;  1NM7 A;  5A2Q E;  3ZL7 C;  2WAC A;  4MZP A;  4BI8 B;  2DIG A;  2MF2 A;  1VQO A;  4PKC C;  1ACM B;  4FSS A;  1RI9 A;  3G71 Q;  2A3L A;  3JCM e;  3EGX A;  1VQK A;  1OU9 A;  4M7D B;  4M78 B;  1FYN A;  1XNI A;  1GBR A;  2R58 A;  4HCB A;  1YIT T;  4LNP A;  3GBQ A;  3LYI A;  3VS5 A;  1IRX A;  2QQB A;  3G4S A;  2ZPH B;  4HXJ A;  1K9M C;  2EJ9 A;  2DBM A;  4KBM B;  1WJR A;  2LQW A;  3VS3 A;  3CCU T;  2DEU A;  4HCK A;  2LJ0 A;  2DIQ A;  4JRK A;  4RCB A;  2EJG A;  3SB2 A;  3FDR A;  4R56 A;  2X9H A;  1QCF A;  1O9S A;  4NOY A;  1KSW A;  2LT1 A;  4EIK A;  2MWP A;  2L3R A;  2XD0 A;  4R55 A;  2NYS A;  2HDA A;  2CT3 A;  1Q82 U;  2CUB A;  2HL5 C;  1PWT A;  2YRD A;  1U3O A;  1SRM A;  4LUD A;  3M9Q A;  2DYI A;  4BY6 C;  4L5G A;  5CK9 A;  4ZN3 A;  1OEB A;  2D9T A;  2O01 E;  3P8B B;  4XU0 A;  2DK3 A;  1M8M A;  3QHS A;  4X9D A;  1K0X A;  4BB7 A;  5GAM e;  3L42 A;  1BI3 A;  4C8Q C;  2EYQ A;  1T0H A;  1QWF A;  2DMO A;  2JTM A;  1VQ8 Q;  1OX8 A;  1QVP A;  2XKO C;  4JJN K;  4GLM A;  2EGA A;  1M30 A;  1RAB B;  2CP6 A;  1PHT A;  3RKY A;  1X2K A;  4LUE A;  1ZUY A;  1W6X A;  1VIE A;  4E7J A;  4M4Z A;  4E7I A;  4IIO A;  4RMO A;  1YIJ T;  2K2V A;  1WQW A;  4HCC A;  1QVG S;  1K73 C;  4M7D G;  5DM7 R;  1Q86 C;  5D6X A;  1WI7 A;  4L6V 5;  5GMK j;  2HQX A;  1K9M R;  5GAO l;  3OYJ A;  3VS7 A;  4QVD A;  2MIO A;  3L2R A;  2X4Y A;  4F7U E;  3H9N A;  3OS5 A;  4FYV B;  5HKC A;  5GAO q;  2E70 A;  4OB2 B;  2E3H A;  3JCM d;  1VQ6 T;  2H3E B;  2LQK A;  3LH0 A;  2YHT A;  1KHC A;  2LMJ A;  1YHQ T;  1H92 A;  1YJ9 Q;  4MMK A;  4M7A E;  5GAN j;  5KYU B;  3CC7 Q;  4E2F B;  1PCX A;  4ELY C;  2L3P A;  1BK2 A;  3TCJ A;  3OY9 A;  4FYW B;  1Y71 A;  2DTH A;  5LJ3 f;  3MP6 A;  1K76 A;  3U23 A;  3EG1 A;  1NYG A;  3CCR T;  2R5A A;  4GY5 A;  2X4J A;  3CMA Q;  2RJD A;  2JOY A;  2EGE A;  4PLI A;  2PQW A;  1B7T A;  3C0C A;  1TU0 B;  3URG A;  4AG2 C;  2KK4 A;  1DJ7 B;  1K73 R;  1OYX A;  1D3B A;  1Q86 R;  4EPC A;  4ZTF A;  2ZGW A;  4EMK A;  4JJB A;  1TXQ A;  2JM9 A;  1K9M U;  1SG5 A;  5FWB A;  3JCM f;  2DE0 X;  2K3X A;  3CD6 A;  3OQ5 A;  5GAO m;  1TUD A;  3PT9 A;  4C0F A;  4FCY A;  3JV3 A;  5GAM d;  3X26 B;  4OF1 A;  3HSB A;  4O6J A;  2J05 A;  4AFZ C;  2QEX Q;  4J9I A;  4Z02 A;  5CKB A;  5FLX E;  2E1H A;  4WF2 A;  2RMO A;  1VQN Q;  2B8A A;  5J3B A;  1G5V A;  1MMA A;  3JCM b;  4IUU A;  2M9U A;  1AT1 B;  2P84 A;  3PNW C;  3PGG A;  3EHR A;  4JS5 A;  5LJ5 f;  3JRZ A;  3QZ9 B;  2NLU A;  1PD0 A;  1NLO C;  3MEA A;  2O2O A;  2K79 A;  2RI5 A;  4FT4 A;  2EBP A;  1BYM A;  3GNF B;  2HBP A;  5LL6 S;  1WX6 A;  3CCL Q;  2OI3 A;  1VQ8 A;  1VQM Q;  1OPL A;  3ER0 A;  3P8H A;  3I5R A;  2YT6 A;  5GAN 2;  2LQN A;  2LJ3 A;  4C92 A;  1WXT A;  2PVD B;  5HK3 A;  2NUT A;  5D6Y A;  3HKS A;  1JU5 C;  1Q86 U;  2LP5 A;  3LX7 A;  3JCM X;  4M7A C;  2DLP A;  4M7D E;  2V8J A;  2VUB A;  3UA6 A;  4BAC A;  3M4G A;  1I5L A;  1O75 A;  2FZG B;  1HD3 A;  2EIF A;  1B34 A;  5HY6 A;  3JB9 F;  4XK8 E;  1NJI C;  3S3N A;  2HD0 A;  1PNJ A;  5IHN A;  3VV0 A;  1W4S A;  4C0D C;  4DBR A;  2K7A A;  2QGG A;  1U1T A;  1FMK A;  4QW2 A;  1MMN A;  3DKM A;  3C12 A;  2ENM A;  4LDV A;  3T9N A;  2NUP A;  4ANJ A;  4M75 F;  3EHQ A;  2MCN A;  3CC7 A;  3M0T A;  3TU4 K;  2KAF A;  1QWE A;  1VQ7 T;  3JSC A;  2KMT A;  2RF0 A;  3RKX A;  4F7U A;  2VAS A;  1KJW A;  2QA4 Q;  2W0Z A;  2GNC A;  1FMV A;  2DZ9 A;  1Y96 A;  1G3Y A;  2DA9 A;  4M77 D;  2LX7 A;  3CMA A;  2JN0 A;  3QBY A;  2DL5 A;  5CKH A;  4IUP A;  4XTY A;  1OV3 A;  2YUN A;  3OMG A;  2D0Q B;  3UDC A;  4M7A A;  3MEW A;  1SPK A;  1KQS S;  3OYI A;  5A0D A;  3MO8 A;  1NE8 A;  1RAH B;  2XIC A;  3RMS A;  1M90 C;  1QMC A;  3CCS Q;  3OS1 A;  2FZK B;  1T3L A;  3UA7 A;  3HPW A;  1Y7X A;  2F2V A;  3EGD A;  3UT1 A;  1ZSZ C;  3V8K A;  1EFN A;  4YTL A;  4AFU C;  4M78 F;  1VQ9 Q;  4N4G A;  2YSQ A;  4KH1 B;  5KYY A;  4IUT A;  5HCK A;  1M9S A;  1MV0 B;  1VQN A;  3VJP A;  2BTT A;  1UUE A;  3G6E T;  2RA2 A;  2RNA A;  1Q81 R;  2DD4 A;  3OSV A;  3HFN A;  2ECZ A;  3FEO A;  1YWP A;  1D1B A;  4M7D C;  4OB3 B;  2MI6 A;  4M78 C;  5IT9 E;  3S3O A;  1SF9 A;  2AZV A;  2FPD A;  3VKI A;  5DY9 A;  4XQ3 A;  2ROT A;  2DET A;  3OBY A;  1VQM A;  5FU6 B;  3I56 T;  3M5A A;  5CO7 A;  2AHJ B;  1WHL A;  5GAN 3;  2QQA A;  3CPW S;  4A4K A;  2M16 A;  3VYG A;  1W2B S;  2X51 A;  1TS9 A;  1NG2 A;  4MZM A;  3OW2 S;  1RLP C;  1H64 1;  2KRO A;  1X75 C;  3SWN B;  1M90 R;  1SKU B;  1ZUK A;  3LWH A;  3R6N A;  2CS7 A;  3KUF A;  5FRM A;  4RUG A;  4BDZ A;  4GLK A;  1Z9Q A;  5J39 A;  3G4S Q;  4A4E A;  1CKA A;  1FX7 A;  1K4U S;  1U06 A;  1NJI U;  2JVV A;  2OTL Q;  3LGL A;  5FRO A;  1TUC A;  1EIF A;  5KH6 A;  1YBY A;  1PRM C;  1JXM A;  4KUL A;  1PC0 A;  1HXD A;  2RHX A;  3V8L A;  4ME7 A;  1C1A A;  2J6K A;  3MPU B;  1M3C A;  4M77 F;  1YNZ A;  1VQL T;  4XTZ A;  3QJY A;  4XU2 A;  2D8J A;  3PVL A;  2V1R A;  2OJ2 A;  2ZPG B;  1WLP B;  3A98 A;  5GAM j;  1MMG A;  2K4Y A;  3CCQ T;  3QUI A;  2YUP A;  2RI3 A;  4ZNX A;  3LLR A;  4J5Y A;  3M0P A;  4X9C A;  1NPR A;  2RHY A;  4JLG A;  2ZPB B;  1PKS A;  3INZ A;  5FWC A;  3EG9 A;  4D8D A;  5KCH A;  1OQK A;  2Y4Y A;  1SEM A;  1XTD A;  2X3W D;  2DXC A;  2HKQ B;  4ELZ C;  4WCI A;  1M1F A;  1XJW B;  2DXU A;  3GP8 A;  3I35 A;  4J9G A;  3A8O B;  4Q5W A;  3EFS A;  1RL2 A;  1E7O A;  2KQW A;  2KR3 A;  2HQE A;  2CDT A;  2QAZ A;  2KRM A;  2DM1 A;  3GF5 A;  3LW5 E;  1TG0 A;  2DXT A;  1R0C B;  2RK2 A;  1AHJ B;  2K5L A;  1JB0 E;  1U1S A;  4OB1 B;  2E6Z A;  1OZ3 A;  8ATC B;  4E7Z A;  2O4X A;  1VQ9 A;  2DRM A;  4QVC A;  2PNI A;  1M1K U;  1WXB A;  2D6F A;  4PJO A;  2DL3 A;  3EG0 A;  1GFC A;  1AEY A;  3DB4 A;  3CCU A;  1TH7 A;  4N0A A;  3X20 B;  5GMK i;  4HCZ A;  3WXM B;  4RTZ A;  2JTE A;  2RQV A;  4DOW A;  1M4Z A;  1IXD A;  1YCS B;  5EG2 A;  2RH2 A;  1FMW A;  1QCO A;  1Y0M A;  2DKG A;  7AT1 B;  2V1Q A;  1RAF B;  5CQY A;  2VB6 A;  1TOV A;  1UGP B;  4N4H A;  1GXI E;  2ATC B;  2EJF A;  1OZ2 A;  3QO3 A;  3M56 A;  3P8D A;  2FRW A;  1JO8 A;  3HRT A;  1R0B G;  4XTW A;  3M54 A;  2OAW A;  1UGQ B;  1IGQ A;  1GBQ A;  1VQ5 T;  2A37 A;  4PJJ A;  2IG0 A;  3CCJ T;  5IAY A;  4DEY A;  4IIM A;  1VQP T;  1R8O B;  5FU7 B;  3QYH B;  1V76 A;  1XOV A;  5D7U A;  1QKX A;  4PFZ A;  3M4Y A;  3OYC A;  5GAN 6;  2EWN A;  5A0G A;  3JB9 G;  3MEU A;  3FB9 A;  5LJ3 h;  1YIJ A;  1SSH A;  2CZ7 B;  3CD6 Q;  3OYY A;  2OTL A;  4F17 A;  4J83 A;  2LTO A;  3CCS T;  4C92 D;  2QK0 A;  1VOM A;  2E41 A;  1K9A A;  2Z0W A;  2HNI A;  5GAN 4;  2COW A;  1LNX A;  3X28 B;  4Y92 A;  3PMI A;  2XDD A;  2CKK A;  1UB4 A;  2LNH B;  1CSK A;  4M75 G;  4QQD A;  4RTY A;  1VQ4 T;  4BE0 A;  1FXX A;  4TVR A;  2P0P A;  1YI2 T;  4CC4 B;  1JJ2 A;  2HCK A;  2LNV A;  1HK9 A;  1VQ6 A;  2AKK A;  5I2M A;  4E7K A;  4JJC A;  1BI0 A;  1KK7 A;  3JB9 I;  3CCM T;  1YHQ A;  2LC4 A;  1OX9 A;  1VYU A;  3VRY A;  3SHW A;  4X1V A;  1M2O A;  1H3Z A;  4KGV B;  2MAM A;  5I2S A;  5LJ5 h;  2YLB A;  2HAX A;  1VQO T;  2C0I A;  4QT7 A;  2JMA A;  1B3Q A;  4M78 G;  3PIO A;  1VQK T;  2QDL A;  3RER A;  3RES A;  1ZBX A;  1LCK A;  2DJQ A;  1V1C A;  1NZ9 A;  3QZ5 B;  2C06 A;  4M77 B;  1VIF A;  3S6W A;  2OAU A;  2L89 A;  2X35 A;  2EQU A;  1QKW A;  3G4S T;  2KY9 A;  4FIB A;  2QQR A;  4N4I A;  1I4K 1;  4M7A D;  2F69 A;  2DFU A;  4J6W A;  3PFS A;  1I07 A;  2ZPI B;  2M51 A;  4HT9 A;  2GCX A;  1WJQ A;  1OOT A;  3RR6 A;  3PMT A;  4BDY A;  1Y07 A;  3BY7 A;  3RMQ A;  4ZN1 A;  1KD1 R;  3EGU A;  1RAC B;  4AT1 B;  2CGH A;  1YP5 A;  3EFR A;  4JRQ A;  3TSW A;  1VUB A;  3QKJ A;  4BI4 A;  1N8R C;  3JCM c;  1Q7Y C;  4C8Q A;  3V7R A;  3EGX B;  5GJV B;  2L3Q A;  1JJ2 P;  1YJW A;  4K11 A;  4X34 A;  5KE3 A;  1KIK A;  2XHC A;  2L2P A;  5FRN A;  1QVG A;  1GCP A;  4JPB W;  2ZPF B;  4C92 F;  3VS6 A;  2VXE A;  2DER A;  4QVZ A;  1RUW A;  1NLP C;  2YWW A;  3CC2 Q;  2FYK A;  3MET A;  1ZQ1 A;  4UC4 A;  1U8R A;  1OU8 A;  3SDZ A;  1HJD A;  4FYY B;  1UDL A;  3CXC A;  3UAT A;  2RM4 A;  5AYF A;  4ZGD B;  2PUK B;  2YLC A;  3O5Z A;  4M77 G;  1MGQ A;  3CCV Q;  2OTJ Q;  1BCM A;  2L8D A;  2FHD A;  3OYH A;  3M0U A;  2RHZ A;  3E2U A;  3PTA A;  3QSU A;  4M75 E;  5FU6 C;  5KYX A;  4A4G A;  2YRV A;  1NEB A;  2BUD A;  1MHN A;  4Y28 E;  1N8R R;  1NEG A;  1AWO A;  1Q7Y R;  3CCE T;  1BKB A;  1IHV A;  2DL8 A;  3SWN C;  3D7S B;  3FLG A;  2DF6 A;  3REA B;  3QWY A;  3CME Q;  2JM8 A;  4OMM A;  1M1G A;  2I0N A;  2JW4 A;  4KRT A;  3CC4 Q;  1WZO A;  4F04 B;  5GAM f;  5IHI A;  3M58 A;  1K73 U;  4O5V A;  3WVE B;  4A54 A;  2CH4 A;  1RAD B;  1T3S A;  3OYE A;  3G71 T;  3S3M A;  1UG1 A;  5GAO r;  2QYZ A;  4M78 E;  4KH0 B;  4ORZ A;  4E7L A;  3CBM A;  2HKN A;  3J81 E;  4BY6 B;  1IHW A;  4MDW A;  4FW2 A;  1YWO A;  2E3I A;  4EMG A;  1YJN Q;  1W70 A;  4OGC A;  3RDV A;  3LGF A;  3CXC P;  1G3S A;  2AKL A;  3A8L B;  1GL5 A;  2QXF A;  2V26 A;  1RI0 A;  5KYW A;  4FYX B;  3REB B;  1PD1 A;  3OYB A;  3BDL A;  4C0Z A;  4BE2 A;  1PRL C;  2KEA A;  3EH1 A;  5GMK e;  3BDU A;  1WQ7 A;  3A1P A;  4QQG A;  1Q81 C;  4OMO A;  2VC8 A;  3OYF A;  2FB7 A;  3G6E A;  3RIR A;  1RAG B;  1TWB A;  4P5N A;  1KFZ A;  4HT8 A;  4PJO D;  5I22 A;  1D3B B;  2FPE A;  1N5Z A;  2QTX A;  1TUG B;  4Z8A A;  2DJZ A;  4EMK B;  5IHK A;  3AT1 B;  5GMK h;  4FSX A;  1WFW A;  4PK4 A;  4NL2 A;  1VQ8 T;  4HVW A;  3I56 A;  2KYM A;  2QQS A;  1MND A;  4M75 C;  4EDU A;  1YN8 A;  1WPY A;  2MWO A;  1QP2 A;  5GAN e;  2J7I A;  3HHT B;  1VA7 A;  3CC2 A;  1D0X A;  1N9S A;  4LD6 A;  4RTV A;  5CIU A;  3THK A;  4D8K A;  4J9E A;  4CC7 A;  5GAO p;  4JUV A;  2C0T A;  1SHF A;  5CKF A;  3PE0 A;  2IVW A;  3PIP A;  4MZT A;  1D0Y A;  1YIT Q;  1CKB A;  2OTJ A;  3BFM A;  3CCV A;  5GAN h;  2XID A;  3OA6 A;  1ZA2 B;  3BE3 A;  3FRN A;  1G3W A;  2PVG B;  3CCU Q;  2EAY A;  2KDS A;  3LWI A;  1U5S A;  4KGZ B;  2ZCF B;  1M2V A;  3E9G A;  2QGF B;  3V8J A;  3ULR B;  1SSF A;  3RBB B;  3FC3 A;  4PJN A;  3NPF A;  4OB0 B;  1VQL A;  4JS4 A;  2DYB A;  3DLM A;  5DLQ E;  4Y91 A;  5FU7 C;  1VYV A;  1YJ9 T;  4OMN A;  4C92 B;  4RG8 A;  3CC7 T;  2NUT B;  5L23 A;  5AT1 B;  1PG5 B;  3CME A;  2EPD A;  2MPX C;  3JB9 H;  1KQS A;  2M1H A;  4M75 A;  3NHN A;  3CC4 A;  1M3A A;  2PTK A;  4RTU A;  1B34 B;  1H8K A;  4LDW A;  3CMA T;  1KQ1 A;  4FL6 A;  4C5G A;  4LE9 A;  3SD4 A;  2SEM A;  1IO6 A;  4L59 A;  3CBO A;  4FU6 A;  1WA7 A;  3V7S A;  2YDL A;  1JBM A;  1PM3 A;  2RHI A;  2RQU A;  1ZSZ A;  4KUI A;  1QW1 A;  3EFO A;  4IUR A;  4OMP A;  3I55 A;  1YIJ Q;  2EGC A;  4CC3 A;  2BE7 D;  2KGT A;  2EYY A;  2DVJ A;  1KC8 C;  8AT1 B;  3C94 A;  1HYO A;  1YJN A;  3GIB A;  2NUP B;  4AG1 C;  1I0C A;  2ABL A;  4PJO F;  4HA8 A;  2W10 A;  1H3H A;  5LJ3 g;  5CVI A;  2DNU A;  2MYS A;  4J9H A;  5IN1 A;  2QI2 A;  1RLQ C;  1BCO A;  1D1A A;  2QEX T;  2HSP A;  3KXT A;  1Y96 B;  3OB9 A;  4M7D A;  2CSI A;  3GOX A;  4M78 A;  3VS0 A;  1Q81 U;  1GFD A;  2FO0 A;  1VQN T;  1NYF A;  1VQ6 Q;  2WSC E;  2VYT A;  2J6O A;  4Z88 A;  6AT1 B;  3A8M B;  1UJ0 A;  3M57 A;  1YHQ Q;  2A0F B;  4VUB A;  1SRL A;  4M7A B;  3CPW A;  1S72 A;  1N6A A;  1W2B A;  2A08 A;  3M59 A;  4J9C A;  4C0G A;  4C92 G;  3OW2 A;  3QYG B;  4M77 C;  3VUZ A;  5M9O A;  4A53 A;  3J80 E;  2FPF A;  3CCL T;  1VQM T;  1TSF A;  4J9D A;  4V2S A;  4E47 A;  3EGD B;  1SHG A;  2Y4X A;  4J7I A;  1AOJ A;  1RAE B;  1ZLM A;  2SRC A;  3CCR Q;  1QVF A;  1WNL A;  1PSE A;  1VQ5 A;  2GF7 A;  1LOJ A;  4C8Q D;  1M90 U;  1IRE B;  2HSE B;  3HP9 A;  5KYY B;  3CCJ A;  5GJW B;  3C4S A;  1WJS A;  3CBP A;  1ZA1 B;  1KC8 R;  1E6G A;  2K3Y A;  2R57 A;  1AD5 A;  2B86 A;  2BE9 B;  2J6F A;  2F5K A;  5LJ5 g;  1YIT A;  3NTI A;  2QDY B;  4PFO A;  2AK5 A;  2E64 A;  1NBE B;  3UPU A;  2MMP A;  1WGS A;  4OMF B;  3TRE A;  1F1B B;  2RHU A;  2ZAE A;  2IPO B;  1LJO A;  2K9G A;  2I2L A;  1BU1 A;  3OS2 A;  5GAO n;  4KGX B;  3J7A F;  4XTU A;  2KT1 A;  2O9S A;  2GTO A;  4CRI A;  5DLO A;  1W1F A;  1YI2 A;  4BUG A;  1UHC A;  2CP3 A;  3OYM A;  2EYW A;  5C6S A;  4MDX A;  1J3T A;  4PJM A;  2K6D A;  1YJW Q;  3I9Q A;  1D09 B;  4BE1 A;  3CCM A;  4JRI A;  5LJ3 e;  2KNB B;  2QG9 B;  3HTR A;  3HL8 A;  2K5I A;  2FG0 A;  4OVA A;  2QA4 T;  1ARK A;  3CPW P;  1K8A C; 
#chains in the Genus database with same CATH homology
 3ME9 A;  2E5Q A;  4JRQ A;  4XK8 E;  1NJI C;  2L5Q A;  1VUB A;  3QKJ A;  2XU8 A;  2HD0 A;  3S3N A;  4BI4 A;  1N8R C;  2LVM A;  4XU3 A;  3JCM c;  2E6N A;  3VV0 A;  2DAQ A;  4B9W A;  1Q7Y C;  1W4S A;  2XDP A;  4J8O A;  4C8Q A;  3E19 A;  2RB6 A;  3V7R A;  3QPH A;  4C0D C;  3NFC A;  5CAI A;  1U1T A;  4QW2 A;  2ZPE B;  4J6X A;  4C5H A;  1YJW A;  1KG1 A;  4RG2 A;  2OTJ T;  2F5T X;  2WSF E;  3CEY A;  3DKM A;  3C12 A;  3CCV T;  4IUV A;  2JTF A;  1QVF S;  2JNG A;  1B34 A;  4F7U B;  4LDV A;  4X34 A;  5L8R E;  5KE3 A;  5LJ5 j;  1KC8 U;  4XTX A;  2XHC A;  5GAN d;  3T9N A;  2E12 A;  5FRN A;  2XI9 A;  1QVG A;  4M75 F;  2CZ1 B;  3CC7 A;  2ZPF B;  4C92 F;  5CKE A;  4CI0 C;  3TU4 K;  2DEQ A;  2KAF A;  1I81 A;  1KHI A;  2VXE A;  3JSC A;  1VQ7 T;  4KUD K;  2KMT A;  5HK0 A;  3RKX A;  3L2Z A;  4QVZ A;  2K57 A;  4IKF A;  3OYA A;  2DTI A;  2EQK A;  1N9R A;  4PNO A;  1BI1 A;  4F7U A;  4ZGJ B;  2H3J A;  4DQ2 A;  1VQ9 T;  2DZ9 A;  4KT0 E;  1Y96 A;  4PJO C;  1G3Y A;  1KQ2 A;  2FYK A;  3MET A;  2CZ6 B;  4N0A C;  4JRP A;  1ZQ1 A;  4ZGE B;  4UC4 A;  1YCY A;  2ZZD A;  4M77 D;  1U8R A;  3SDZ A;  3CMA A;  2JN0 A;  3JCM g;  1Q82 C;  3QBY A;  3JCM h;  4PJO A;  1IZ6 A;  1X6O A;  3CXC A;  2RM4 A;  4IUP A;  2EQM A;  5CKH A;  5AYF A;  4XTY A;  4XAX B;  4ZGD B;  2X4W A;  2PUK B;  2D0Q B;  3OMG A;  5CKD A;  4DOV A;  3CME T;  1KD1 C;  2YLC A;  3UDC A;  4M77 G;  1MGQ A;  3MP1 A;  2VGM A;  4M7A A;  2LT4 A;  3MEW A;  2L8D A;  5LJ5 e;  1KQS S;  4C8Q F;  3OYI A;  1UGR B;  4C0D B;  3MO8 A;  1XQH A;  1NE8 A;  3RUX A;  2FHD A;  5A0D A;  2QA4 A;  3OYH A;  3O8V A;  2E65 A;  3CC4 T;  2XIC A;  2RHZ A;  1M8V A;  4LDY A;  3RMS A;  3PTA A;  3OYK A;  4JDS A;  3X24 B;  1M90 C;  3QSU A;  4M75 E;  5FU6 C;  3A8G B;  2DPP B;  3JCM V;  2JZ2 A;  2P4T A;  4C92 E;  4A4G A;  3OS1 A;  2RJF A;  2YRV A;  1VQP A;  1V29 B;  2BUD A;  3HPW A;  1Y7X A;  1JRI A;  4XU1 A;  1MHN A;  4Y28 E;  3UT1 A;  3V8K A;  4YTL A;  3OYD A;  2WSE E;  3QDR B;  4M78 F;  4EMH A;  5GAN f;  2GFA A;  4N4G A;  4PL6 A;  1UEB A;  3CCE T;  1BKB A;  3I55 T;  2O4X B;  3JCM Q;  4OP0 A;  3CCR A;  4IUT A;  3SWN C;  1M9S A;  3L1A A;  3VYH B;  2RI2 A;  5KCO A;  2LQ8 A;  4J7F A;  3FLG A;  3OYN A;  3CCS A;  2CZ0 B;  3BW1 A;  2Y90 A;  4RCC A;  1YJN T;  1VQN A;  4PJO B;  4BD3 A;  3VJP A;  2K5F A;  1PSF A;  3M55 A;  1M1G A;  1G3T A;  2VXF A;  3G6E T;  2RA2 A;  4C8Q E;  2DD4 A;  3OSV A;  2A7Y A;  3HFN A;  4D6W A;  3HFO A;  4F7U G;  5GAN 5;  2DTO A;  3FEO A;  2LCL A;  4M75 B;  5GAM f;  4OB3 B;  1VQ4 A;  2MI6 A;  3GLX A;  3M58 A;  4M78 C;  3UWN A;  4B9X A;  5LJ3 d;  5IT9 E;  3S3O A;  2EQJ A;  5GAM g;  1K73 U;  4O5V A;  3WVE B;  5A0L A;  4A54 A;  3HRU A;  2FL7 A;  3VKI A;  4FT2 A;  5DY9 A;  4XQ3 A;  5GAM h;  2OTL T;  3AHU A;  3OYE A;  3G71 T;  4E7H A;  2DVE A;  3S3M A;  3OBY A;  5GAO r;  4M77 A;  1VQM A;  3E1S A;  5FU6 B;  4NS5 A;  3M5A A;  3I56 T;  4M78 E;  5CO7 A;  2AHJ B;  4EMK C;  4M7A G;  4E7L A;  3CBM A;  4BI3 A;  5GAN 3;  2DD5 A;  2QQA A;  3CPW S;  1M5Q 1;  1S72 T;  4A4K A;  2M16 A;  3VYG A;  3J81 E;  1W2B S;  3EAE A;  4BY6 B;  3G7Z A;  3L2Q A;  4MDW A;  4MZM A;  3OW2 S;  4EMG A;  5I21 A;  2KVQ G;  3HRS A;  3A8H B;  1JJ2 S;  3CXC S;  3JCM W;  1H64 1;  1BIA A;  1X75 C;  3SWN B;  3X25 B;  4OGC A;  3LWH A;  3LGF A;  4M7D A;  1G3S A;  2CS7 A;  3KUF A;  5FRM A;  4BDZ A;  5A2Q E;  4GLK A;  3CCE A;  3A8L B;  2WAC A;  2QXF A;  4MZP A;  3DLL A;  5J39 A;  1ZHI A;  1RI0 A;  4BI8 B;  2DIG A;  2MF2 A;  1VQO A;  4PKC C;  4A4E A;  1FX7 A;  2VGN A;  3FIF A;  1K8A U;  3OYB A;  1NJI U;  3BDL A;  4C0Z A;  4BE2 A;  2JVV A;  3H6Z A;  3LGL A;  4ZTJ A;  5GMK e;  2XK0 A;  3CPF A;  5FRO A;  3BDU A;  2A3L A;  4A4H A;  3JCM e;  1WQ7 A;  4M7D C;  1EIF A;  3JB9 D;  5KH6 A;  1VQK A;  1N27 A;  4QQG A;  1Q81 C;  1YBY A;  4M7D B;  2VC8 A;  2RJE A;  4M78 B;  4KUL A;  3OYF A;  1HXD A;  2FB7 A;  4A4F A;  2RHX A;  3RIR A;  3V8L A;  3G6E A;  4ME7 A;  3JCM J;  1XNI A;  4P5N A;  4ATO A;  2R58 A;  4HCB A;  4HT8 A;  4PJO D;  1YIT T;  4M77 F;  1D3B B;  3LYI A;  2QTX A;  2PU9 B;  2QQB A;  1VQL T;  4XTZ A;  3G4S A;  3QJY A;  2DJZ A;  4IUQ A;  4XU2 A;  5LJ5 d;  4EMK B;  2ZPH B;  1K9M C;  2EJ9 A;  4KBM B;  4PJO G;  1WJR A;  5GMK h;  3CCU T;  2OTL A;  4FSX A;  2ZPG B;  4MML A;  3G71 A;  5GAM j;  2DIQ A;  2K4Y A;  3GNG A;  4JRK A;  2EJG A;  4M75 D;  3FDR A;  4NL2 A;  4RCB A;  3SB2 A;  3E9F A;  4R56 A;  3VU3 C;  1VQ8 T;  3CCQ T;  3I56 A;  1O9S A;  3QUI A;  3C95 A;  2QQS A;  4NOY A;  4M75 C;  4EDU A;  2RI3 A;  4LDX A;  2LT1 A;  1WPY A;  4C92 C;  2MWO A;  1QP2 A;  3LLR A;  5GAN e;  4J5Y A;  2MWP A;  2L3R A;  3HHT B;  4JLI A;  4X9C A;  4R55 A;  3L2W A;  3CC2 A;  2XD0 A;  1NPR A;  1N9S A;  2RHY A;  4LD6 A;  4JLG A;  2ZPB B;  3INZ A;  1Q82 U;  5CIU A;  2FVU A;  3H8Z A;  3QG1 A;  5KCH A;  2Y4Y A;  3ZEH A;  5GAO p;  4JUV A;  1XTD A;  1K8A C;  1BIB A;  5CKF A;  1KD1 U;  2DXC A;  3MP8 A;  1QP3 A;  3M9Q A;  2IVW A;  4BY6 C;  3NTK A;  4ELZ C;  4L5G A;  4MZT A;  1M1F A;  3MEV A;  3PIP A;  1S72 A;  2DXU A;  2V8I A;  5CK9 A;  3GP8 A;  3BFM A;  4ZN3 A;  3CCV A;  2OTJ A;  2D9T A;  3A8O B;  2O01 E;  3P8B B;  4Q5W A;  3EFS A;  5GAN g;  4XU0 A;  2DK3 A;  1RL2 A;  3TEE A;  5GAN h;  2GQV A;  2KQW A;  3QHS A;  2XID A;  3RKW A;  2HQE A;  3OA6 A;  4X9D A;  3FRN A;  1G3W A;  2PVG B;  4HKE A;  4BB7 A;  4F7U F;  5GAM e;  3L42 A;  1BI3 A;  2EAY A;  4C8Q C;  3GF5 A;  2EYQ A;  3KBG A;  2KDS A;  3LW5 E;  2JTM A;  1VQ7 A;  3LWI A;  1QVP A;  2DXT A;  2RK2 A;  2XKO C;  1AHJ B;  2ZCF B;  2K5L A;  1NPP A;  2BKD N;  1JB0 E;  2KSS A;  3E9G A;  4JJN K;  1U1S A;  4OB1 B;  3V8J A;  2E6Z A;  1OZ3 A;  2CYZ B;  2R5M A;  3GPL A;  2O4X A;  1YJW T;  1SSF A;  1VQ9 A;  3FC3 A;  4M7D D;  2LDM A;  4M78 D;  3RKY A;  4QVC A;  4OB0 B;  1VQL A;  4JS4 A;  3DLM A;  1M1K U;  4M7A F;  1VIE A;  4E7J A;  4E7I A;  5DLQ E;  4Y91 A;  4RMO A;  2DZC A;  2DXB A;  2EFI A;  2K2V A;  5FU7 C;  4C92 B;  1WQW A;  1YIJ T;  1YJ9 T;  2D6F A;  4HCC A;  3DB4 A;  3CCU A;  1TH7 A;  4N0A A;  3X20 B;  5GMK i;  1QVG S;  4RG8 A;  1K73 C;  4M7D G;  3CC7 T;  4HCZ A;  5DM7 R;  5D6X A;  1Q86 C;  4L6V 5;  5GMK j;  2HQX A;  3WXM B;  4NL3 A;  4PLL A;  2E10 A;  2G3R A;  4C5E A;  3CME A;  4DOW A;  1M4Z A;  2QQ9 A;  5GAO l;  3JB9 H;  5EG2 A;  2RH2 A;  1KQS A;  3OYJ A;  2M1H A;  4QVD A;  4M75 A;  2DKG A;  3L2R A;  2RJC A;  3CC4 A;  2XDB A;  2X4Y A;  3VUB A;  2BIV A;  5CQY A;  4F7U E;  3OS5 A;  5HKC A;  1UGP B;  5GAO q;  1B34 B;  4LDW A;  4N4H A;  1GXI E;  3L2U A;  3CD6 T;  2E70 A;  1KQ1 A;  4FL6 A;  4OB2 B;  4J6Y A;  4C5G A;  3CMA T;  2EJF A;  1OZ2 A;  3SD4 A;  1UGS B;  4L59 A;  3QO3 A;  3M56 A;  3P8D A;  2JUF A;  3CBO A;  4FU6 A;  3V7S A;  3JCM d;  1VQ6 T;  1JBM A;  3HRT A;  4C8Q B;  2RHI A;  2LRQ A;  2LQK A;  3LH0 A;  4XTW A;  3R6O A;  2YHT A;  1KHC A;  3DB3 A;  4KUI A;  3M54 A;  1UGQ B;  1QW1 A;  4IUR A;  1YHQ T;  4QQ6 A;  3I55 A;  5D6W A;  4MMK A;  4M7A E;  1VQ5 T;  4XTV A;  5GAN j;  1N8R U;  1KC8 C;  4LD9 K;  4FM4 B;  2IG0 A;  5CCA A;  1Q7Y U;  3CCJ T;  3SWN A;  5C0M A;  5GMK l;  5IAY A;  3JB9 J;  3C94 A;  4ELY C;  1YJN A;  3GIB A;  2P0K A;  1VQP T;  2VV5 A;  1R8O B;  5FU7 B;  3QYH B;  3TCJ A;  4PJO F;  3OY9 A;  4HA8 A;  1XOV A;  1Y71 A;  3M4Y A;  3OYC A;  5GAN 6;  2DTH A;  5LJ3 f;  2EWN A;  5A0G A;  3MP6 A;  3JB9 G;  3MEU A;  3FB9 A;  5LJ3 g;  2DO3 A;  4II1 A;  5CVI A;  5LJ3 h;  5IN1 A;  2QI2 A;  1OI1 A;  2QEX T;  3KXT A;  3CCR T;  1YIJ A;  2R5A A;  4GY5 A;  2CZ7 B;  1YJ9 A;  2X4J A;  3OYY A;  2PUO B;  3JAM E;  1Y96 B;  2RJD A;  2JOY A;  3OB9 A;  1FWZ A;  4PLI A;  3ASK A;  4C5I A;  3GOX A;  2PQW A;  4J83 A;  2LTO A;  4M78 A;  3CCS T;  1Q81 U;  1VQN T;  5J26 A;  3SFM A;  2M0O A;  2WSC E;  3URG A;  2VYT A;  2EKO A;  4C92 D;  2KK4 A;  1DJ7 B;  3QJ6 A;  1OYX A;  3A8M B;  1D3B A;  3M57 A;  2E41 A;  5GAN 8;  5GAN 4;  2HNI A;  4EPC A;  4VUB A;  1LNX A;  3X28 B;  4M7A B;  3CPW A;  4ZTF A;  3PMI A;  1N6A A;  2ZGW A;  2CKK A;  4EMK A;  1UB4 A;  2XDD A;  4M75 G;  1W2B A;  3M59 A;  4C0G A;  4QQD A;  4C92 G;  1K9M U;  3OW2 A;  1VQ4 T;  3JCM f;  4BE0 A;  1FXX A;  4TVR A;  2K3X A;  2P0P A;  3CD6 A;  1YI2 T;  3OQ5 A;  5GAO m;  3QYG B;  3JCM P;  4M77 C;  3PT9 A;  3VUZ A;  4C0F A;  1JJ2 A;  3L2V A;  2LNV A;  3OS0 A;  5M9O A;  5GAN 7;  5GAM d;  1HK9 A;  4A53 A;  3J80 E;  3OBW A;  1VQ6 A;  1BI2 A;  3CCL T;  4PJO E;  3X26 B;  4OF1 A;  1VQM T;  4V2S A;  5I2M A;  4E47 A;  4E7K A;  2Y4X A;  3HSB A;  1BI0 A;  4O6J A;  5CR2 A;  4J7I A;  3JB9 I;  2P0Q A;  3CCM T;  3OSS C;  1YHQ A;  4M77 E;  1QVF A;  4Z02 A;  5CKB A;  2LC4 A;  1WNL A;  1PSE A;  1VQ5 A;  3OYG A;  2GF7 A;  1LOJ A;  3QXE B;  4C8Q D;  1M90 U;  5FLX E;  1IRE B;  2E1H A;  3HP9 A;  4WF2 A;  3OYL A;  5KE2 A;  3CCJ A;  1G5V A;  1X01 A;  2B8A A;  5J3B A;  3JCM b;  4IUU A;  2XG8 D;  2M9U A;  3C4S A;  3Q1J A;  1WJS A;  3CBP A;  3PNW C;  4C8Q G;  3PGG A;  2K3Y A;  4JS5 A;  4M7D F;  2R57 A;  5LJ5 f;  3JRZ A;  3QZ9 B;  1H3Z A;  2F5K A;  2NLU A;  2MAM A;  5LJ5 g;  3F70 A;  1YIT A;  5I2S A;  3NTI A;  5LJ5 h;  2YLB A;  3NTH A;  5GMK m;  3MEA A;  2HAX A;  2QDY B;  2QEX A;  4OGE A;  1VQO T;  2E64 A;  2RI5 A;  2RO0 A;  4FT4 A;  5LJ3 j;  1M1K C;  3UPU A;  3M53 A;  1BYM A;  2MMP A;  1WGS A;  4OMF B;  3GNF B;  3TRE A;  2HBP A;  5LL6 S;  2RHU A;  2X4X A;  4M78 G;  3ZBD A;  3PIO A;  1VQK T;  4DA4 A;  1VQ8 A;  1LJO A;  2PVO B;  3RER A;  3CCQ A;  2I2L A;  3RES A;  1ZBX A;  2LCC A;  1P92 A;  3ER0 A;  1NZ9 A;  3OS2 A;  2LX9 A;  3QZ5 B;  3P8H A;  5GAO n;  2C06 A;  4M77 B;  3MCA B;  5GAN 2;  3J7A F;  4XTU A;  3V7C A;  1VIF A;  3S6W A;  2V8K A;  3N5B B;  2OAU A;  2L89 A;  4C92 A;  3FJP A;  2PVD B;  2X35 A;  5HK3 A;  2EQU A;  3G4S T;  2KY9 A;  2RK1 A;  4CRI A;  5DLO A;  4FIB A;  2QQR A;  5D6Y A;  3HKS A;  4N4I A;  3WVD B;  1YI2 A;  1I4K 1;  4M7A D;  1Q86 U;  2F69 A;  4J6W A;  2GFU A;  4LDU A;  1I8F A;  4BUG A;  3PFS A;  3LX7 A;  4M7A C;  3JCM X;  2ZPI B;  3OYM A;  5C6S A;  3CCL A;  4HT9 A;  3MHX A;  4MDX A;  2GCX A;  4M7D E;  3ZFJ A;  2V8J A;  1WJQ A;  3PMT A;  4BDY A;  4BE1 A;  1Y07 A;  2VUB A;  3BY7 A;  3A5Z B;  3CCM A;  4BAC A;  2RD1 A;  4JRI A;  4RKU E;  5CQX A;  3M4G A;  3RMQ A;  4ZN1 A;  5LJ3 e;  3OMC A;  3QII A;  1I5L A;  3HL8 A;  1O75 A;  2K5I A;  4OVA A;  2EIF A;  2QA4 T;  3CC2 T;  2CGH A;  5HY6 A;  3EFR A;  3JB9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...