5GANg

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
69
Chain Sequence
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 8
structure length 69
sequence length 75
chains with identical sequence r
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gang00
4M7AB 4F7UB 4PJOD 4M7AD 2EJFA 3QHSA 5LJ3d 4C8QE 1KQ1A 2RA2A 2RD1A 1YCYA 4M77F 1I4K1 3RKYA 2EJGA 4M77A 4J6WA 3SWNB 4A54A 5LJ5h 5GAMd 5GAN8 2E41A 1JRIA 4PJOC 3JCMe 4M78B 2DEQA 2QTXA 4XTZA 3FB9A 3FIFA 3JCMf 3V8JA 3BFMA 4XTVA 4MMLA 4PJOG 4F7UG 2RB6A 4C92E 4HT9A 4M7AG 4M7DB 1KQ2A 3HFOA 5LJ5e 3JCMb 3SB2A 5GANg 3QUIA 1WQWA 4M77D 4J6YA 5LJ5f 5GAN2 2DTHA 3SWNA 4M7DF 2FYKA 4M78F 4RCBA 4M7DA 4M78A 3JB9G 1U1SA 3V7SA 4C8QB 5GAN7 5GANf 4Y91A 3RIRA 5DY9A 2VXFA 3JCMg 4N0AC 3VU3C 5GAN3 4M77G 1TH7A 4XTUA 5GMKm 3V7CA 4JUVA 3RESA 3RUXA 1B34B 3PGGA 4M7AC 3RERA 4M75F 4OP0A 5GAN5 5LJ3h 4M75A 4WF2A 1D3BA 1N9SA 4M78D 4XU1A 4DQ2A 4EMKA 5LJ5g 4M7DD 4XU2A 3EFSA 4XTYA 3RKWA 3SWNC 3JB9D 2DKGA 5GAMh 4C8QF 2E1HA 4J6XA 1JBMA 3BY7A 4C8QA 4M7DE 1H641 1LJOA 5GAOn 1M8VA 3QO3A 4X9CA 4XU0A 2VC8A 4JRIA 5LJ3e 4HT8A 4M7DG 4M78G 4M75B 1B34A 1D3BB 1Y96A 2FB7A 4M75D 4XQ3A 5LJ3f 2K57A 4EMKB 1BIBA 5GAMe 4QVDA 4C92F 4M77C 1I5LA 4C92A 4PJOE 4F7UE 4M7AE 5GAMf 4RCCA 3V8KA 3L1AA 1I81A 3BW1A 4C8QD 5LJ5j 3JCMX 3JB9J 5GANd 1WQ7A 1N9RA 3JCMW 3HFNA 4M75G 1Y96B 2E10A 1U1TA 1I8FA 5GANj 4PJOF 3JCMP 3AHUA 1X01A 1LOJA 3M4GA 4XU3A 4C92B 5GMKj 4C92D 4C8QG 2YLBA 4X9DA 5LJ3g 3JCMQ 5GAN4 4V2SA 3JCMd 4M7DC 2JN0A 4M78C 2Y90A 2DJZA 4MMKA 5GAOr 4EMHA 4M77E 5GMKl 5GAOl 5GAMg 5GMKi 5CAIA 3BDUA 2HNIA 4HA8A 4XTXA 3JCMJ 1LNXA 5LJ5d 4C92G 4QVCA 4PJOB 3JCMc 2DZCA 2YLCA 4J5YA 2CGHA 2EJ9A 4NOYA 2E64A 5I21A 2DTOA 4M75C 5GAN6 4EMKC 1HK9A 1HXDA 5LJ3j 3FJPA 2VXEA 3JB9H 3JB9I 2ZGWA 5GAOq 2RM4A 2E65A 4M78E 4N0AA 4C8QC 1MGQA 2DTIA 5GAMj 5GAOp 5GAOm 4NL3A 5GANh 1BIAA 2DXTA 2I2LA 3JCMV 4F7UF 4EMGA 4A53A 4F7UA 2DZ9A 5GMKh 3QSUA 4M7AA 4PJOA 3RKXA 1WNLA 2EWNA 4M77B 3L2ZA 2YHTA 4JRKA 4XTWA 1WPYA 2EAYA 4JLIA 3V8LA 4C92C 4NL2A 1M5Q1 3V7RA 5GANe 4M75E 2DXUA 3HSBA 3JCMh 3GIBA 2DVEA 3EFRA 3JB9F 3INZA 4PNOA 4M7AF 5GMKe
chains in the Genus database with same CATH superfamily
3ER0A 2XK0A 4C8QE 3LX7A 2EQMA 2RD1A 4A54A 2LCSA 3QPHA 4PL6A 2COZA 3M56A 1Q82C 3L2VA 2QTXA 2WACA 1D0ZA 2K5IA 3PMTA 1BB9A 2L5QA 3I9QA 2DA9A 2JJ9A 3QWXX 3EG2A 1VQMA 2BE9B 3CCLT 1U1SA 3OSSC 1K0SA 1FMVA 1B7TA 4OGCA 3P8BB 1TH7A 3EG3A 2KBTA 5D7UA 2HQHA 3G6EQ 4AG1C 4ELZC 5CQYA 2D6FA 2KRNA 2C0IA 3CC4T 4M78G 5AYFA 5GAOm 4E6RA 3HRTA 2HL3A 4C92A 1JB0E 3L1AA 5LJ5j 3JB9J 1VQLQ 2BTTA 2DRKA 3ASKA 3CPWS 2E10A 2RMOA 1O75A 3CCUQ 5GJWB 1H92A 1LPLA 1X2KA 1ZSZB 1UGPB 2FRWA 4P5NA 3OYMA 4M7DC 5DM7R 1Q7YR 1OQKA 3MHXA 5I21A 2DTOA 5L8RE 2ED0A 1DJ7B 2NLUA 1YHQT 3OA6A 1Q81C 2OTJQ 3O8VA 2E3HA 2DZ9A 1M9SA 1WJQA 4EIKA 2J6KA 3M0TA 3A8MB 1MMAA 1YP5A 5GMKe 1KSWA 4JJBA 1PCXA 2RK2A 4ZGEB 1SRLA 2KY9A 2R5AA 1QMCA 5J26A 2JT4A 5KYUB 2RI3A 5HCKA 3EAEA 5LJ5e 1HD3A 1YI2A 4KGXB 1Y07A 5GANg 1A0NB 3H9NA 5D6XA 2EYZA 3CC2Q 2FYKA 2O4XB 1X27A 1RAGB 1Q95G 5I22A 1QVGS 2K5FA 1PRMC 2OTLA 2G3RA 4R55A 3Q1JA 2EW3A 2K5LA 3V7CA 1WDXA 3G71A 2H3EB 2IG0A 1M1KC 1UDLA 4C5EA 1D3BA 3DLMA 2HQEA 3CD6A 4DBQA 1LCKA 1WFWA 1JXMA 3MEVA 3KUFA 4J6XA 3DKMA 1JBMA 4B9WA 3JAME 1UFFA 2VC8A 2GBQA 5C0MA 1BIBA 3CCQT 3SDZA 3V8KA 1EIFA 3JCMX 3EH2A 4IUVA 3CCLQ 4OMMA 3CCRA 1N9RA 4JRQA 3G7ZA 1NJIR 3OYYA 3CCSA 5GANj 2NUTA 3E9GA 1KHIA 2FZGB 3MEAA 4PK4A 2K9GA 2JN0A 2KXCA 1Q86U 2AT1B 1WXBA 1W1FA 1K0XA 1ZUYA 2D0NA 3PT9A 3TU4K 2LC4A 3CC4Q 2EJ9A 4E7JA 1HJDA 1PSFA 1YITA 3VRZA 2RH2A 5FU7B 1WJRA 3PVQA 1CKBA 3CCVA 1N27A 1U8RA 2KNBB 4XTWA 3HPWA 2DJQA 4MDWA 4J7IA 1NG2A 4RTXA 2DL4A 4ZGDB 2GQIA 3RKYA 2DD4A 5GAMd 5GAN8 4TVRA 2E41A 2ZAEA 1YI2T 2F5KA 4RTUA 4DBFA 4C5GA 2AZVA 2BUDA 2L8DA 4KUDK 1YHQQ 2G6FX 3S3NA 4MZMA 1YJWT 2OAUA 2O88A 4M77D 1VQ7Q 1TWBA 3M9QA 4RG8A 3C12A 2QAZA 2RF0A 2W10A 1H3ZA 3S3OA 4C8QB 5GAN7 2L3RA 4LDWA 5KYUA 1YWOA 2ROLA 2BZ8A 4J9GA 4FU6A 1ZQ1A 5GAN5 1TUGB 2QK0A 3BE3A 5A0LA 3NTIA 1VQMQ 2DVJA 2RPNA 1WYXA 3BY7A 3X20B 3QO3A 2X4YA 1E6GA 4M7DG 4HXJA 4QVDA 2D8HA 1PM3A 3CMAA 3CCST 2DXCA 1W2BP 2O31A 3NHNA 5CKDA 2O9VA 2HKQB 1K73R 4AT1B 2H3JA 1X01A 1OU9A 2DLPA 5AT1B 2YLBA 4BDZA 1Y57A 2DJZA 1D1AA 4M77E 5KYXA 1UUEA 3VS3A 2KDSA 2DYIA 4WCIA 3TSZA 5HK0A 4LDYA 2BZYA 1Z9ZA 1AZEA 4ZNXA 3ZL7C 2CS7A 4PKCC 2B86A 3UF4A 3L2QA 2KRSA 4Y92A 5EC7A 4N0AA 3I56A 1VQ8T 2LT4A 1KD1U 4E7ZA 3LYIA 4ZN1A 1AZGB 4F04B 1SF9A 1ZSZC 5DLOA 1M5Q1 2COYA 2F69A 2ZZDA 3GIBA 1OI1A 2DVEA 2KYBA 1WGSA 1OPKA 1NLOC 3MP1A 4CRIA 1BYMA 3QHSA 1M8MA 2EQKA 1OPLA 1WX6A 4JLGA 3OYCA 4Q5WA 3HRUA 2DK3A 1RAFB 1VQ5T 2F5TX 2KK4A 5HKCA 2YDLA 1IREB 1WIEA 3OSVA 1SKUB 5GAN2 4RCBA 2DIQA 2E5KA 4JS4A 2J06A 4IIMA 1OULA 1ZA2B 2CDTA 1W4SA 4MDXA 3UPUA 1Q86C 1KC8U 2XI9A 1B34B 2CP0A 2RHUA 3PGGA 2RNAA 4RTTA 2HAXA 1X2QA 1YI2Q 3JB9D 4C8QA 4DBRA 4KBMB 4OMFB 1R8OB 1YJWQ 3CCET 4K11A 4M75D 4EMKB 1OYXA 2A37A 1YJNT 2FL7A 2OTLQ 2IIMA 4GBQA 4F7UE 1RI9A 3G71Q 5GANd 1S72A 1OX8A 2QGFB 3CD6Q 3REAB 4IUQA 2A08A 4Z88A 2RHXA 3JCMP 1LOJA 1M4ZA 2K3YA 1MV0B 2Y4XA 2RQRA 3JCMQ 2YRVA 1UGQB 2GGRA 2X3XD 2FZKB 1G3WA 1UHFA 1VOMA 4KGVB 1LNXA 1Q82U 1FWZA 1O9SA 3CCMA 3CCRQ 2V1RA 5A0GA 2C0TA 2LMJA 2EKHA 3CCSQ 2DX1A 3MEUA 2RI2A 5CKHA 5I2MA 3JCMV 4M7AF 1Y7XA 2EYQA 4JJCA 2J6FA 1UE9A 4M75E 5FRMA 3JCMh 1VQNT 3EFRA 2LT1A 4L59A 4B9XA 4M7AB 1YITQ 3X28B 1QVFA 4DOVA 1OZ2A 2KXDA 1VYVA 3VKIA 1ABOA 2QGGA 2DERA 2KT8A 2DEQA 1SPKA 4XTZA 3CCVQ 2QQBA 3V8JA 4PJOG 3RNJA 3H6ZA 5FU7C 4C5IA 2L89A 5LJ5f 3UATA 1UB4A 2RQTA 2DD5A 3QBYA 1GBRA 4RTZA 1IGQA 3L2WA 2XU8A 2KQWA 3M59A 4WTOB 3RERA 2DAQA 5LJ3h 2JTEA 4M78D 1M2OA 2LNHB 1AHJB 4EDUA 4F14A 3FEOA 1Q7YC 2CSQA 1C6VX 2CZ1B 1B34A 3A8HB 2RI5A 4Z89A 4C92F 1Q81U 1KD1C 1IGUA 3OQ5A 1I81A 2DL8A 3MP8A 1TUCA 1EZZB 4XU3A 4C92B 3QYGB 2PVOB 2E3IA 2ZPIB 3CMAQ 4QVCA 1QKXA 3NTHA 4FT2A 4J5YA 2K7AA 1WHGA 4E47A 5IHNA 1W2BS 1VQKT 1AWJA 2MAMA 1G3SA 2KAFA 3EHRA 4M78E 1WZOA 3WVEB 2DILA 2ENMA 4M77B 4BDYA 3OMGA 2MPXC 3CPFA 1CKAA 1ZHIA 2LQNA 2DO3A 4RTYA 3L42A 1M1KU 1GCPA 2K6DA 3IQLA 3UDCA 2JS2A 1YCYA 3OYFA 2EJGA 4DBHA 2QXFA 2RHIA 3I56Q 2BKDN 4PJNA 1UEBA 4KH1B 3FIFA 2IPOB 2YUNA 4A4FA 3EGDA 2GFUA 4MMLA 2IVWA 2QQSA 4PJJA 2L2PA 3GNGA 2RK1A 2QI2A 5IT9E 5GANf 1E7OA 5KCHA 1X69A 1YNZA 3OYNA 3RUXA 3J7AF 1G2BA 5LJ5g 3CC7T 1MMNA 4J9CA 2E1HA 3LH5A 1NYFA 3U23A 3M54A 1EFNA 2EGAA 1Y71A 1D3BB 4BE1A 1BI0A 1T0JA 2CZ7B 3MJXA 1FYNA 2E4HA 1Z9QA 1TU0B 3OBYA 1VQOT 2RJCA 1OU8A 2JNGA 5CKFA 4D8DA 3N5BB 8AT1B 4HCBA 1B3QA 1F1BB 2CP2A 5GMKj 4X9DA 2F2VA 5J39A 4YTLA 7AT1B 4O6JA 4FT4A 4X1VA 1FXXA 2B8AA 2WSEE 1W70A 1YJ9A 2EGEA 3FJ5A 4OMQA 2NUTB 4J83A 1QP3A 1S72Q 4EMKC 5C6SA 9ATCB 2DM1A 5LJ3j 2M02A 2DBKA 3CCQA 2LQ8A 1SSFA 4C0ZA 3R6NA 1QW1A 4EMGA 3L2ZA 1YFNA 2OX7A 5CQXA 2HKNA 3RBBB 4ZTJA 2DXUA 3CCMQ 3JB9F 3VYHB 1NM7A 4PJLA 2CT3A 4GLMA 2KE9A 4LUDA 2JM9A 3QZ5B 4LXCA 4PJMA 1M8VA 3CXCA 4M77A 4J6WA 3JCMe 2EPDA 3H0FA 3M53A 2V8IA 1U06A 4E7SA 2EQJA 3NPFA 2WSFE 2CYZB 1IXDA 2EFIA 3P8HA 2X4JA 2NUPB 2K79A 2VXFA 1WXTA 4JZ3A 4QQDA 4XTUA 2GNCA 1GCQC 4JUVA 4M7AC 2QQRA 1N9SA 1VQPT 4M7DD 4XU2A 2KYMA 4HVUA 5I11A 2NYSA 3J81E 5IHKA 3RR6A 2RJDA 5LJ3e 1G8XA 4JDSA 3CEYA 2CP6A 2M0OA 1YJWA 4KGZB 3VS5A 2PUKB 2JOYA 2DE0X 2PNIA 4F17A 2RJFA 3HFNA 2AKKA 3A8GB 3MO8A 1I8FA 3I5RA 2FO0A 1YJ9T 1K76A 2LZ6B 2XICA 1M90R 2V26A 5GAOr 6AT1B 3M55A 3QIIA 2DYBA 4FM4B 1UGRB 3BDUA 4J9HA 1MHNA 1N6AA 1V76A 1K9MR 2YLCA 2DFUA 2KT1A 2R58A 4C5HA 5KYXB 4E7HA 1BK2A 4M7DE 4ZGJB 4BI3A 4EPCA 1N8RU 4JS5A 1KQSP 4F7UA 4PFOA 5J3BA 2DXBA 1WHMA 1ZBXA 2HDAA 2X4WA 4C92C 3OW2P 2RQWA 2PTKA 3VV0A 1HSQA 4OMLA 4N4GA 2BIVA 4C0DC 1I4K1 3SWNB 1U5SA 4M78B 4J9IA 1Q82R 3BFMA 1YBYA 3C4SA 4QQ6A 4ZTFA 1K8AU 4LDVA 3X26B 3A8OB 3M0QA 1VQ8A 2XDBA 4L6V5 2DPPB 2SEMA 5I2SA 3ZBDA 4Y91A 3CCJT 2FPEA 2HSEB 1G5VA 3QDRB 4XK8E 3TCJA 4QT7A 2RHYA 1JJ2P 4PFPA 4OP0A 4M75A 3LGFA 1E6HA 2XDPA 5FRNA 3JRZA 4OMPA 2FRYA 3RMSA 4A4EA 4C8QF 1IO6A 2NUPA 4J8OA 1YCSB 1M3BA 2P0KA 4JRIA 2ED1A 2X35A 3OYLA 1VQ5A 3VS7A 4E7LA 1OOTA 3SEMA 1VIEA 2M0YA 1GFDA 4CC7A 2PVGB 1R0BG 2GQVA 5FWCA 4CC3A 1WHKA 4AFZC 3AHUA 1PG5B 2CP7A 2HL5C 5M9OA 5GMKl 3EGXA 4FYWB 2JS0A 2VGNA 2MMPA 3ZEHA 2KVQG 5LJ5d 3QJ6A 3X24B 4RMOA 1AD5A 2V1QA 2QA4T 4NOYA 1GL5A 2X4XA 3CCEA 1SSHA 4Y28E 2ZGWA 1YJNA 5GAOq 4A4GA 1I1JA 1I07A 1MGQA 3UA7A 1T3SA 1MNDA 4M4ZA 3QSUA 4J9DA 1YJ9Q 2P84A 3V8LA 2A0FB 3INZA 1RADB 2MK5A 2RN8A 2KRMA 4PJOD 2F2WA 2O01E 1V29B 3CCQQ 3OS1A 1Q7YU 1V1CA 3FDRA 2XD0A 2CSIA 2D1XA 2LJ1A 4M7AG 4ELYC 2AZSA 3M0UA 3SB2A 4AG2C 3SWNA 4FYYB 2D8JA 5ECAA 4M78A 4RUGA 3CXCP 3VUZA 1XQHA 5CK9A 3RIRA 2RQVA 3CMET 1MUZA 3EG9B 1VQNA 3VS6A 2ZPHB 3EFSA 4XTYA 1UTIA 1NEBA 2DKGA 3KXTA 4FCYA 1BCOA 1AT1B 1WXUA 1YIJT 3P8DA 4JJNK 4BY6B 1Y96A 3CBPA 1N8RC 1OZ3A 4QVZA 2K2VA 1IB8A 5HY6A 4PJOE 2EYWA 3TEEA 1KG1A 1X6OA 1WQ7A 1VQ4T 1ZA1B 2M9UA 3GBQA 2ESWA 1VQ6T 2GCXA 1KJWA 3I55T 3G4SA 5CO7A 4KUIA 3C0CA 5GAOl 1AOJA 1WHJA 2HNIA 4LE9A 5KH6A 1RAAB 4HA8A 1GXIE 4C92G 2MI6A 2AHJB 2VKNA 1G3YA 1K8AC 3OB9A 1HK9A 4C0FA 1WI7A 1RLQC 2A28A 5GAOp 4RTVA 2I2LA 2VGMA 3LGLA 3M0RA 2KSSA 2YHTA 1NJIU 1BI1A 4OB2B 4BUGA 2ZPBB 2GTJA 4CI0C 3UT1A 2LNVA 4BI4A 3DLLA 3LH0A 3EFOB 2RA2A 3G1JA 2EYXA 2CT4A 1TOVA 2DL3A 2K3BA 5CKEA 2QEXT 2L3SA 3FB9A 1WHLA 3JCMf 4OMNA 4FW1A 5FU6B 1VQKA 3TREA 4E2FB 1KQSS 3QUIA 1VIFA 2XKOC 1AVZC 3JSCA 2COWA 3EGDB 2RQUA 3OW2S 2YRCA 1QWFA 4Z02A 4LDUA 5DY9A 2Y4YA 4N0AC 1P92A 3NGPA 1GFCA 2F1LA 2BZXA 4O5VA 2MF2A 3VJPA 3QWYA 5IN1A 4QW2A 3SWNC 2VWFA 5GAMh 5FROA 1SHFA 1G83A 1ZUKA 3REBB 1VQ8Q 1TS9A 2J7IA 2FG0A 2XG8D 2FB7A 5LJ3f 3EG9A 2K57A 4LNPA 1I5LA 5CKBA 3WXMB 3G4ST 1ACMB 1IRXA 3RMQA 1M1FA 1JJ2S 2E70A 3OYJA 4JPBW 1PKSA 5GAN4 2H8HA 1BI3A 3PFSA 1ZUUA 4LD9K 2EVRA 4OGEA 2JVVA 2LJ0A 2HBPA 1VQ5Q 3CC7A 4XTXA 1UHCA 1WA7A 3PVLA 5CIUA 4FYVB 2J6OA 1R77A 3MEWA 3H8ZA 3CBOA 2YXYA 1M27C 2HSPA 1X6GA 3G6ET 4ME7A 4C8QC 3SD4A 4A4HA 1XJWB 3PIOA 1VQOA 3VS4A 4OB0B 2X3WD 3OYHA 2QTVA 4IUUA 2EQIA 2MIOA 5FLXE 1G3TA 1XTDA 1K73U 2YRDA 1UG1A 2LJ3A 1RACB 1VQLT 2PU9B 2L3QA 3H0IA 3CCEQ 4ATOA 1KQ1A 3CCUT 1YJNQ 4M77F 3TQ7P 1JRIA 1HYOA 3MP6A 2P0PA 1RUWA 1UGVA 2JTFA 4AMCA 3EG1A 5GJVB 4HT9A 3T9NA 2HBWA 3HFOA 3EFOA 2DETA 4IUPA 1WQWA 3C94A 1TUDA 2SRCA 4BE2A 4M7DA 2KROA 2A36A 3JB9G 2AIRB 3ZFJA 4RG2A 3JCMg 1Y0MA 2PZ1A 1QVPA 5GAN3 2OTJT 1AEYA 5KYYA 4NS5A 1Q86R 4HCCA 3EH1A 2DRMA 4XU1A 1D0YA 1M90C 1SHGA 2DEUA 1U3OA 2EBPA 4HT8A 4A4KA 1IHWA 1K9MC 2QQ9A 2Z0WA 3OS0A 4JRPA 1B07A 3CXCS 4QKUA 5FWBA 1NJIC 1VQNQ 1VA7A 1U1TA 8ATCB 1UGSB 4PJOF 1BU1A 2LRQA 3CC2T 5LJ3g 1MNEA 1M2VB 1X43A 3HKSA 3E9FA 2MYSA 2DNUA 3PNWC 1VQPA 1BKBA 3M57A 4FIBA 4AFQC 3JCMJ 1D0XA 1ZBJA 4PJOB 1KK7A 4Z8AA 2DZCA 2CGHA 2ECZA 2LX7A 3BDLA 4BY6C 2HD0A 2DF6A 3LW5E 1HXDA 5IXFA 1H3HA 3FJPA 3JB9I 3J80E 1D09B 4MZPA 3G4SQ 4GLKA 5GAMj 4NL3A 5GANh 4F7UF 2PQWA 2EWNA 3A5ZB 2EAYA 4CC2A 3V7RA 2O2OA 1D1BA 2E6NA 3A8LB 3A1PA 4LDXA 4F7UB 3D7SB 4HCZA 2CKKA 3M4YA 3META 1W2BA 2R57A 5A2QE 3UA6A 4B6MA 2FPDA 2KR3A 1I0CA 1TG0A 1K4US 2DL5A 1PSEA 1RLPC 3VUBA 1KIKA 1NE8A 4IIOA 4OB1B 3R6OA 4J9FA 2HCKA 3OS5A 2X9HA 4M75F 1ZX6A 4DQ2A 4LUEA 1VQKQ 2AK5A 1NYGA 2LQKA 1AWXA 5GAOn 4X9CA 3LWHA 2MWPA 5FU6C 5KYWB 4M75B 1TTHB 1QVFP 1JO8A 5GAMe 3HHTB 1RAHB 1QP2A 3GLXA 4HCKA 4N4IA 3EG0A 1KD1R 4IUTA 2FEIA 3JCMW 1K73C 4IURA 1FMKA 1QCOA 3JV3A 1MMDA 3CCJA 2OJ2A 4C8QG 1QCFA 1VQ7T 2BE7D 4OMOA 3C95A 4LN2A 5EG2A 5CAIA 3AT1B 2LVMA 5CCAA 3FLGA 2LP5A 2E12A 4HVWA 1TSFA 2M51A 2MOXA 3UWNA 3F70A 1M2VA 2EIFA 3EGXB 2D9TA 1VQMT 2E65A 5CVIA 2I0NA 2QQAA 4PJOA 3M0SA 4JZ4A 3FC3A 1WPYA 3CC7Q 5IH2A 3URGA 1KC8R 2JXBA 3PTAA 3EGUA 1WLPB 2ATCB 3OYBA 1AWWA 4PNOA 1T3LA 1CSKA 2V8JA 2LTOA 3MPUB 4M7AD 3GF5A 2A3LA 2E5QA 1YN8A 1QLYA 1K9AA 2VV5A 2QA4A 1VQOQ 3CPWA 1EX4A 3KBGA 1NLPC 4J6YA 4UC4A 1SG5A 2C06A 3OYDA 4M78F 3NTKA 5D6WA 2EQUA 2YUPA 3RESA 4J7FA 1XOVA 5CR2A 5IHIA 4D8KA 2DMOA 4WF2A 2M16A 2HQXA 4GY5A 3VYGA 2CP3A 4HKEA 2VASA 4BI8B 2EYYA 3X25B 1VQ9A 3WVDB 2VUBA 3VRYA 2M1HA 4AFSC 2KI7A 4XQ3A 4C0GA 1QWEA 4M77C 2O9SA 1ZSZA 2GTOA 3MCAB 4M7AE 2VVKA 3VS0A 1WHHA 3S3MA 1NEGA 1Y96B 5KYWA 3M58A 2K3XA 2E6ZA 2LX9A 1PRLC 1NPPA 4A63B 4BE0A 4C92D 2PUOB 3VS2A 3JCMd 4FSSA 2Y90A 1XNIA 4MMKA 3CMEA 3SFMA 5GMKi 1NZ9A 4ESRA 2QG9B 4OF1A 3QDFA 3OYEA 2CP5A 3LWIA 1QVGA 1YIJA 2NUZA 3EHQA 2CH4W 2MWOA 1BIAA 4MZTA 5FW9A 3CBMA 4A53A 3RKXA 1WNLA 1VQ4A 1VQPQ 2AKLA 3I35A 3GNFB 2OTLT 3LLRA 2OAWA 2QDYB 1VQ6A 3E19A 5GANe 3G71T 1H8KA 3HRSA 2P0QA 3I55A 3CD6T 2QASA 1UJYA 2YT6A 3E2UA 5LJ3d 2DBMA 3OYKA 2F2XA 1ABQA 4DEYA 4PJOC 1M1GA 1RL2A 4ORZA 1PD1A 1SEMA 2O4XA 2DIGA 2R5MA 4C92E 1Q81R 4FYXB 1JQQA 1OEBA 5IXBA 3CCRT 2DTHA 2RJEA 2K2MA 2ZPFB 2YSQA 1FX7A 3VU3C 4JJDA 2JW4A 1VQ9T 4KULA 1M3CA 2W0ZA 1S1NA 3RDVA 1H641 2L0AA 3HTRA 2QEXA 1YITT 3E1SA 4N4HA 3OYIA 1RAIB 2CH4A 3NMZC 4FSXA 2ROTA 2RHZA 1OV3A 1X6BA 3CCVT 4LD6A 1MMGA 3L2UA 4R0KA 1YWPA 2QDLA 1PKTA 3OYAA 2CUBA 4ANJA 1W6XA 2KGTA 1M1KR 4E7IA 5IAYA 1ZSGA 2OI3A 2QYZA 2YWWA 4PFZA 4EMHA 4BACA 2PVDB 4L5GA 1WJSA 3QKJA 2V8KA 3JCMc 4QQGA 3M5AA 1QVFS 4M75C 2C0OA 5GAN6 3L2RA 1X75C 2VXEA 3DB3A 3CCJQ 4KH0B 2WSCE 2P4TA 2P4RA 3OS2A 1C1AA 3OY9A 4JLIA 2CREA 1UECA 2GFAA 1SRMA 4VUBA 4NL2A 1PD0A 2KMTA 1VYUA 4DEXA 1M90U 2EJFA 1VUBA 2LCLA 2ZPGB 1LVKA 1ZLMA 2ABLA 1IZ6A 3O5ZA 1OX9A 1GRIA 3I5SA 1K9MU 3CMAT 2GF7A 3JCMb 3G6EA 3HP9A 3H41A 2LDMA 4M7DF 2YUQA 2CUDA 3OBWA 2ZCFB 3HL8A 5KE3A 4KT0E 2K4YA 1KFZA 4M77G 2YUOA 2FVUA 4II1A 3CPWP 3QYHB 2QA4Q 1UJ0A 4BB7A 4M7DB 1VQLA 4R56A 4DOWA 3CCUA 5KYNA 4XU0A 5KYYB 1GBQA 3PMIA 1NPRA 2ZPEB 2FPFA 3SHWA 3I56T 2X51A 5GAMf 4RCCA 2JM8A 4IKFA 1PC0A 3BW1A 2VYTA 2HMAA 2JMAA 3QG1A 3GOXA 4DA4A 4RKUE 1VQ9Q 3GPLA 4ZN3A 3PIPA 2VB6A 2OTJA 2A7YA 4V2SA 4M78C 3H0HA 3ME9A 1FMWA 1BCMA 4PLLA 4RTWA 2CZ6B 4KRTA 2E64A 5DLQE 3PE0A 5KE2A 3GP8A 2KEAA 3QXEB 2XHCA 4AFUC 2HZYA 2RM4A 5HK3A 1PNJA 1RI0A 1T0HA 2DXTA 3CMEQ 5GMKh 4E7KA 4JRKA 1JXOA 3QZ9B 1NBEB 1QVGP 3HSBA 4CC4B 1C0MA 3CC2A 2RO0A 1YIJQ 4XAXB 2JMCA 3DB4A 2LQWA 5LJ5h 5LL6S 1N5ZA 2CZ0B 2L3PA 1K1ZA 4XTVA 4F7UG 5A0DA 1VQ4Q 2RB6A 1RABB 3OYGA 1ARKA 4FW2A 1KQ2A 1TXQA 3OMCA 1VQ6Q 2EKOA 2FZCB 3ULRB 1S72T 3I55Q 2DL7A 1QQJA 5D6YA 3NFCA 3V7SA 1PWTA 2FHDA 1JU5C 1MV3A 4OVAA 3S6WA 3CCLA 2LCCA 3MKDA 1AWOA 4EMKA 2JTMA 3RKWA 2MCNA 2NWMA 3VS1A 3CCMT 1VYTA 4HVVA 1LJOA 3TSWA 5L23A 1KQSA 2HEQA 4F16A 4C0DB 5GMKm 2XIDA 1BBZA 1JEGA 1KHCA 1N8RR 3OW2A 4C8QD 3CC4A 3M0PA 2JZ2A 3CQTA 3QJYA 4M75G 1I5OB 3KFVA 3FRNA 1RAEB 2XMFA 3M4GA 2QEXQ 1KC8C 1R0CB 3A98A 3TVTA 1IHVA 1M30A 5GAMg 1D1CA 4FL6A 4BD3A 5KCOA 2D0QB 2XDDA 4J9BA 3THKA 1PHTA 1K8AR 2JUFA 3JB9H 2EGCA 2DTIA 1BI2A 1GCQA 4OB3B 1JJ2A 4M7AA 1YHQA 1M3AA 4X34A 4J9EA 2J05A 1QKWA 4PLIA 1VQ7A 4D6WA 1QCNA 1J3TA
chains in the Genus database with same CATH topology
3ER0A 4M7AB 4PJOD 4M7AD 3X28B 3GF5A 2XK0A 4C8QE 2A3LA 1QVFA 4DOVA 3LX7A 2O01E 2EQMA 2RD1A 1OZ2A 1V29B 2E5QA 4A54A 3QPHA 4PL6A 3VKIA 3OS1A 1Q7YU 3M56A 1Q82C 3FDRA 3L2VA 2DEQA 2QTXA 2WACA 4XTZA 2XD0A 2QQBA 2VV5A 2QA4A 3V8JA 4PJOG 3CPWA 4M7AG 2K5IA 2XDDA 3PMTA 4ELYC 3H6ZA 2L5QA 5FU7C 3SB2A 4C5IA 2L89A 1VQMA 3KBGA 4J6YA 5LJ5f 4UC4A 3SWNA 2C06A 3OYDA 4M78F 4M78A 3NTKA 3CCLT 1UB4A 1U1SA 3VUZA 1XQHA 5CK9A 3QBYA 2DD5A 3OSSC 3RIRA 4OGCA 3P8BB 1TH7A 5D6WA 3CMET 3L2WA 2EQUA 3RESA 4J7FA 1XOVA 2XU8A 2KQWA 3M59A 5CR2A 1VQNA 2DAQA 2ZPHB 4WF2A 5LJ3h 3RERA 4M78D 2M16A 2HQXA 3EFSA 4GY5A 4XTYA 3VYGA 4HKEA 1AHJB 2DKGA 4BI8B 4EDUA 3KXTA 3FEOA 3X25B 4ELZC 1Q7YC 5CQYA 1VQ9A 2D6FA 3WVDB 2VUBA 2M1HA 1YIJT 3P8DA 3CC4T 4M78G 2CZ1B 4JJNK 4BY6B 1B34A 1Y96A 5AYFA 3A8HB 2RI5A 4XQ3A 5GAOm 3CBPA 4C0GA 1N8RC 1OZ3A 2K2VA 3HRTA 4M77C 4QVZA 4C92F 1Q81U 4C92A 5HY6A 1KD1C 3MCAB 1JB0E 4M7AE 3OQ5A 3TEEA 4PJOE 1KG1A 1X6OA 3L1AA 1I81A 5LJ5j 3JB9J 1WQ7A 3MP8A 1VQ4T 3S3MA 3ASKA 1Y96B 2E10A 2M9UA 3CPWS 1O75A 2K3XA 3M58A 1VQ6T 2E6ZA 2GCXA 2LX9A 1NPPA 4XU3A 4C92B 3QYGB 4BE0A 4C92D 3I55T 3G4SA 5CO7A 1UGPB 4KUIA 2PUOB 4P5NA 2PVOB 3JCMd 3OYMA 4M7DC 3CMEA 2Y90A 1XNIA 4MMKA 5DM7R 3SFMA 5GAOl 5GMKi 2ZPIB 2HNIA 5KH6A 1NZ9A 4HA8A 4OF1A 1GXIE 1Q82U 4C92G 2MI6A 4QVCA 3OYEA 2AHJB 3MHXA 3NTHA 1G3YA 4FT2A 4J5YA 5I21A 1K8AC 3LWIA 2DTOA 5L8RE 1QVGA 3OB9A 1YIJA 1DJ7B 4E47A 2NLUA 1HK9A 4C0FA 1W2BS 1VQKT 1YHQT 2MAMA 1G3SA 2KAFA 3OA6A 5GAOp 1Q81C 4M78E 3O8VA 3WVEB 2MWOA 1BIAA 4MZTA 2I2LA 2VGMA 3LGLA 3CBMA 4A53A 2DZ9A 2KSSA 1M9SA 3RKXA 1WJQA 1WNLA 4M77B 1VQ4A 2YHTA 3GNFB 1NJIU 1BI1A 4OB2B 3LLRA 4BDYA 4BUGA 2ZPBB 2OTLT 3OMGA 3CPFA 1ZHIA 2QDYB 3A8MB 3E19A 5GANe 1VQ6A 4CI0C 3UT1A 2DO3A 2LNVA 3HRSA 3G71T 2P0QA 3L42A 3I55A 1M1KU 5GMKe 4BI4A 3CD6T 3DLLA 3LH0A 3UDCA 5LJ3d 2RA2A 2RK2A 4ZGEB 3OYKA 1YCYA 3OYFA 2EJGA 2QXFA 2KY9A 1M1GA 2RHIA 2BKDN 4PJOC 1UEBA 5CKEA 2QEXT 1RL2A 2O4XA 2R5AA 2LT1A 3FB9A 3FIFA 5J26A 2DIGA 3JCMf 4A4FA 2GFUA 2R5MA 4MMLA 5FU6B 2IVWA 4C92E 2QQSA 2RI3A 3EAEA 1VQKA 5LJ5e 1YI2A 3TREA 1Y07A 5GANg 1KQSS 3QUIA 1VIFA 3GNGA 2XKOC 3CCRT 5D6XA 2DTHA 2FYKA 3JSCA 2O4XB 2RJEA 2RK1A 2QI2A 2ZPFB 5IT9E 1QVGS 2K5FA 3OW2S 5GANf 4Z02A 1FX7A 4LDUA 5DY9A 2Y4YA 3VU3C 2G3RA 1P92A 3Q1JA 4N0AC 4R55A 5KCHA 2K5LA 2OTLA 1VQ9T 3V7CA 3OYNA 3RUXA 3G71A 2IG0A 3J7AF 4KULA 1M1KC 4C5EA 1D3BA 3DLMA 2HQEA 4O5VA 2MF2A 3CD6A 3VJPA 5LJ5g 5IN1A 3CC7T 4QW2A 3SWNC 5GAMh 3MEVA 5FROA 3KUFA 2E1HA 3DKMA 4J6XA 1JBMA 4B9WA 1H641 3JAME 3M54A 2XG8D 2VC8A 2QEXA 1YITT 3E1SA 4N4HA 3OYIA 1Y71A 1D3BB 4BE1A 2FB7A 1BI0A 5LJ3f 5C0MA 2K57A 2CZ7B 1BIBA 3CCQT 1I5LA 4FSXA 3SDZA 2RHZA 3V8KA 1EIFA 5CKBA 3WXMB 3JCMX 4IUVA 3OBYA 3CCVT 4LD6A 3G4ST 1N9RA 2RJCA 3CCRA 4JRQA 1VQOT 3G7ZA 3L2UA 2JNGA 5CKFA 3OYYA 3RMQA 1M1FA 3OYAA 3CCSA 3N5BB 4L59A 5GANj 3E9GA 1JJ2S 1KHIA 4HCBA 2E70A 3MEAA 5GMKj 3OYJA 4X9DA 4E7IA 5J39A 5GAN4 3PFSA 1BI3A 4YTLA 5IAYA 2JN0A 4O6JA 4LD9K 4FT4A 4EMHA 1FXXA 2B8AA 2WSEE 4BACA 1Q86U 4OGEA 1YJ9A 2JVVA 2HBPA 2PVDB 3CC7A 4L5GA 4XTXA 1WJSA 3PT9A 3QKJA 3TU4K 2V8KA 3JCMc 4J83A 2LC4A 1QP3A 3M5AA 4QQGA 5CIUA 1QVFS 2EJ9A 4E7JA 4M75C 5GAN6 3MEWA 1PSFA 3H8ZA 4EMKC 3CBOA 5C6SA 1YITA 5LJ3j 3L2RA 1X75C 2VXEA 3DB3A 3G6ET 4ME7A 2RH2A 5FU7B 1WJRA 4C8QC 3CCQA 2LQ8A 1SSFA 2WSCE 3SD4A 2P4TA 4A4HA 4C0ZA 1QW1A 3CCVA 4EMGA 1N27A 3PIOA 1VQOA 1U8RA 3OS2A 3L2ZA 4OB0B 3OY9A 3OYHA 4XTWA 4IUUA 4JLIA 5CQXA 3HPWA 2GFAA 5FLXE 1G3TA 1XTDA 4ZTJA 4VUBA 1K73U 4NL2A 2KMTA 2DXUA 3JB9F 3VYHB 4MDWA 4J7IA 1VQLT 1M90U 2PU9B 2EJFA 4ATOA 1VUBA 1KQ1A 3QZ5B 2LCLA 2ZPGB 4ZGDB 3CCUT 4M77F 1M8VA 3RKYA 3CXCA 4M77A 2DD4A 4J6WA 5GAMd 5GAN8 4TVRA 2E41A 1JRIA 3MP6A 3JCMe 1YI2T 2F5KA 2P0PA 1IZ6A 4C5GA 2BUDA 2L8DA 2JTFA 2V8IA 3M53A 4KUDK 1K9MU 3S3NA 4HT9A 2EQJA 4MZMA 3T9NA 1YJWT 3CMAT 3HFOA 2WSFE 2CYZB 2GF7A 2OAUA 4IUPA 3JCMb 3G6EA 1WQWA 3C94A 4M77D 3HP9A 2LDMA 4M7DF 4BE2A 4M7DA 3M9QA 3JB9G 4RG8A 3OBWA 2ZCFB 3C12A 2EFIA 3HL8A 3P8HA 5KE3A 4KT0E 3ZFJA 2X4JA 4C8QB 2K4YA 5GAN7 3S3OA 2L3RA 2VXFA 4LDWA 4RG2A 3JCMg 1QVPA 4M77G 4QQDA 5GAN3 2FVUA 2OTJT 4II1A 4PNOA 1H3ZA 4XTUA 3QYHB 4FU6A 4JUVA 4NS5A 4M7AC 4HCCA 2QQRA 1ZQ1A 4BB7A 5GAN5 4XU1A 4M7DB 1N9SA 1VQPT 1VQLA 1M90C 4M7DD 4XU2A 4R56A 5A0LA 3NTIA 4DOWA 3CCUA 3J81E 3BY7A 3X20B 3QO3A 2X4YA 4XU0A 2RJDA 4HT8A 5LJ3e 4JDSA 3PMIA 4M7DG 3CEYA 4A4KA 1K9MC 1NPRA 2ZPEB 2QQ9A 4QVDA 2M0OA 3I56T 1YJWA 3CMAA 3OS0A 3CCST 2DXCA 2PUKB 4JRPA 5GAMf 4RCCA 2JOYA 3CXCS 4IKFA 3BW1A 5CKDA 2VYTA 1NJIC 2RJFA 3HFNA 3QG1A 3GOXA 4DA4A 3A8GB 3MO8A 4RKUE 1U1TA 1I8FA 1UGSB 4PJOF 1YJ9T 3GPLA 2H3JA 1X01A 2LRQA 3CC2T 4ZN3A 2YLBA 2XICA 3PIPA 5LJ3g 4BDZA 2A7YA 2OTJA 4V2SA 3HKSA 4M78C 2DJZA 3E9FA 5GAOr 3ME9A 4M77E 3M55A 3QIIA 4FM4B 1UGRB 3PNWC 1VQPA 4PLLA 2KDSA 1BKBA 3BDUA 3M57A 4FIBA 3JCMJ 1MHNA 2CZ6B 4PJOB 1N6AA 2DZCA 4LDYA 5HK0A 2YLCA 2CGHA 2E64A 5DLQE 3BDLA 4BY6C 2HD0A 2R58A 2CS7A 4PKCC 3LW5E 1HXDA 4C5HA 5KE2A 3GP8A 3FJPA 3L2QA 3QXEB 3JB9I 3J80E 4E7HA 2XHCA 2RM4A 4MZPA 4N0AA 4M7DE 4GLKA 5GAMj 4ZGJB 3I56A 5HK3A 4NL3A 1VQ8T 5GANh 1RI0A 2LT4A 4BI3A 2DXTA 4EPCA 4F7UF 4JS5A 1N8RU 4F7UA 1KD1U 5GMKh 5J3BA 4E7KA 2PQWA 2EWNA 2DXBA 3LYIA 4ZN1A 4JRKA 3A5ZB 1ZBXA 2EAYA 2X4WA 3QZ9B 4C92C 5DLOA 1M5Q1 3V7RA 3HSBA 2F69A 2ZZDA 3GIBA 1OI1A 2DVEA 2E6NA 3CC2A 3A8LB 1WGSA 4CRIA 3MP1A 2RO0A 4LDXA 4F7UB 1BYMA 4XAXB 3VV0A 3QHSA 4HCZA 2CKKA 4N4GA 2EQKA 3DB4A 2BIVA 3M4YA 4C0DC 1I4K1 3META 5LL6S 3SWNB 5LJ5h 4JLGA 1W2BA 2CZ0B 4M78B 2R57A 5A2QE 3OYCA 4Q5WA 3HRUA 2DK3A 3BFMA 4XTVA 4F7UG 5A0DA 2RB6A 3OYGA 1YBYA 3C4SA 4QQ6A 4ZTFA 1VQ5T 2F5TX 2KK4A 5HKCA 1K8AU 3OMCA 1KQ2A 1IREB 2EKOA 3OSVA 4LDVA 1PSEA 3X26B 3A8OB 5GAN2 1S72T 1VQ8A 4RCBA 2DIQA 3VUBA 4JS4A 1NE8A 2XDBA 4OB1B 3R6OA 4L6V5 5D6YA 3NFCA 2DPPB 3V7SA 5I2SA 3ZBDA 4Y91A 3CCJT 2FHDA 1G5VA 1W4SA 3QDRB 3OS5A 4XK8E 3UPUA 1Q86C 3TCJA 1KC8U 2XI9A 4OVAA 3S6WA 4MDXA 2RHYA 3CCLA 1B34B 2LCCA 2RHUA 3PGGA 4M75F 4OP0A 2HAXA 4M75A 3LGFA 4DQ2A 4EMKA 2JTMA 2XDPA 5FRNA 3JRZA 3RKWA 3JB9D 3RMSA 4A4EA 4C8QF 4C8QA 3CCMT 2LQKA 4J8OA 1LJOA 5GAOn 4X9CA 4KBMB 4OMFB 2MWPA 3LWHA 2P0KA 1KQSA 1R8OB 4JRIA 5FU6C 3CCET 4C0DB 2X35A 4M75B 5GMKm 2XIDA 4M75D 1OYXA 4EMKB 1YJNT 5GAMe 3HHTB 2FL7A 1QP2A 3GLXA 3OYLA 1VQ5A 4N4IA 4F7UE 1KHCA 3OW2A 4C8QD 4IUTA 3CC4A 5GANd 4E7LA 1S72A 1VIEA 2JZ2A 3JCMW 1K73C 3QJYA 4IUQA 2PVGB 4IURA 4M75G 2GQVA 3FRNA 4B9XA 2RHXA 3JCMP 3AHUA 1LOJA 1M4ZA 2K3YA 3M4GA 3CCJA 4C8QG 1VQ7T 2Y4XA 3JCMQ 2YRVA 1UGQB 1KC8C 5M9OA 5GMKl 1G3WA 5GAMg 3C95A 5EG2A 5CAIA 2VGNA 4FL6A 2MMPA 2LVMA 3ZEHA 4BD3A 1LNXA 2D0QB 2KVQG 3FLGA 5CCAA 2E12A 3QJ6A 1FWZA 3X24B 5KCOA 5LJ5d 4RMOA 1O9SA 3CCMA 2QA4T 4NOYA 3UWNA 2X4XA 5A0GA 3F70A 3CCEA 2EIFA 2JUFA 2D9TA 4Y28E 1VQMT 3JB9H 2ZGWA 1YJNA 5GAOq 3MEUA 4A4GA 2RI2A 2E65A 1MGQA 2DTIA 5CVIA 5CKHA 1BI2A 4OB3B 5I2MA 2QQAA 3JCMV 4M7AF 1JJ2A 4PJOA 3QSUA 4M7AA 1Y7XA 2EYQA 3FC3A 1YHQA 1WPYA 3V8LA 3URGA 4X34A 3PTAA 4M75E 3OYBA 5FRMA 3JCMh 1VQNT 3EFRA 3INZA 4PLIA 1VQ7A 4D6WA 2V8JA 2LTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  4F7U B;  4PJO D;  4M7A D;  2EJF A;  3QHS A;  5LJ3 d;  4C8Q E;  1KQ1 A;  2RA2 A;  2RD1 A;  1YCY A;  4M77 F;  1I4K 1;  3RKY A;  2EJG A;  4M77 A;  4J6W A;  3SWN B;  4A54 A;  5LJ5 h;  5GAM d;  5GAN 8;  2E41 A;  1JRI A;  4PJO C;  3JCM e;  4M78 B;  2DEQ A;  2QTX A;  4XTZ A;  3FB9 A;  3FIF A;  3JCM f;  3V8J A;  3BFM A;  4XTV A;  4MML A;  4PJO G;  4F7U G;  2RB6 A;  4C92 E;  4HT9 A;  4M7A G;  4M7D B;  1KQ2 A;  3HFO A;  5LJ5 e;  3JCM b;  3SB2 A;  5GAN g;  3QUI A;  1WQW A;  4M77 D;  4J6Y A;  5LJ5 f;  5GAN 2;  2DTH A;  3SWN A;  4M7D F;  2FYK A;  4M78 F;  4RCB A;  4M7D A;  4M78 A;  3JB9 G;  1U1S A;  3V7S A;  4C8Q B;  5GAN 7;  5GAN f;  4Y91 A;  3RIR A;  5DY9 A;  2VXF A;  3JCM g;  4N0A C;  3VU3 C;  5GAN 3;  4M77 G;  1TH7 A;  4XTU A;  5GMK m;  3V7C A;  4JUV A;  3RES A;  3RUX A;  1B34 B;  3PGG A;  4M7A C;  3RER A;  4M75 F;  4OP0 A;  5GAN 5;  5LJ3 h;  4M75 A;  4WF2 A;  1D3B A;  1N9S A;  4M78 D;  4XU1 A;  4DQ2 A;  4EMK A;  5LJ5 g;  4M7D D;  4XU2 A;  3EFS A;  4XTY A;  3RKW A;  3SWN C;  3JB9 D;  2DKG A;  5GAM h;  4C8Q F;  2E1H A;  4J6X A;  1JBM A;  3BY7 A;  4C8Q A;  4M7D E;  1H64 1;  1LJO A;  5GAO n;  1M8V A;  3QO3 A;  4X9C A;  4XU0 A;  2VC8 A;  4JRI A;  5LJ3 e;  4HT8 A;  4M7D G;  4M78 G;  4M75 B;  1B34 A;  1D3B B;  1Y96 A;  2FB7 A;  4M75 D;  4XQ3 A;  5LJ3 f;  2K57 A;  4EMK B;  1BIB A;  5GAM e;  4QVD A;  4C92 F;  4M77 C;  1I5L A;  4C92 A;  4PJO E;  4F7U E;  4M7A E;  5GAM f;  4RCC A;  3V8K A;  3L1A A;  1I81 A;  3BW1 A;  4C8Q D;  5LJ5 j;  3JCM X;  3JB9 J;  5GAN d;  1WQ7 A;  1N9R A;  3JCM W;  3HFN A;  4M75 G;  1Y96 B;  2E10 A;  1U1T A;  1I8F A;  5GAN j;  4PJO F;  3JCM P;  3AHU A;  1X01 A;  1LOJ A;  3M4G A;  4XU3 A;  4C92 B;  5GMK j;  4C92 D;  4C8Q G;  2YLB A;  4X9D A;  5LJ3 g;  3JCM Q;  5GAN 4;  4V2S A;  3JCM d;  4M7D C;  2JN0 A;  4M78 C;  2Y90 A;  2DJZ A;  4MMK A;  5GAO r;  4EMH A;  4M77 E;  5GMK l;  5GAO l;  5GAM g;  5GMK i;  5CAI A;  3BDU A;  2HNI A;  4HA8 A;  4XTX A;  3JCM J;  1LNX A;  5LJ5 d;  4C92 G;  4QVC A;  4PJO B;  3JCM c;  2DZC A;  2YLC A;  4J5Y A;  2CGH A;  2EJ9 A;  4NOY A;  2E64 A;  5I21 A;  2DTO A;  4M75 C;  5GAN 6;  4EMK C;  1HK9 A;  1HXD A;  5LJ3 j;  3FJP A;  2VXE A;  3JB9 H;  3JB9 I;  2ZGW A;  5GAO q;  2RM4 A;  2E65 A;  4M78 E;  4N0A A;  4C8Q C;  1MGQ A;  2DTI A;  5GAM j;  5GAO p;  5GAO m;  4NL3 A;  5GAN h;  1BIA A;  2DXT A;  2I2L A;  3JCM V;  4F7U F;  4EMG A;  4A53 A;  4F7U A;  2DZ9 A;  5GMK h;  3QSU A;  4M7A A;  4PJO A;  3RKX A;  1WNL A;  2EWN A;  4M77 B;  3L2Z A;  2YHT A;  4JRK A;  4XTW A;  1WPY A;  2EAY A;  4JLI A;  3V8L A;  4C92 C;  4NL2 A;  1M5Q 1;  3V7R A;  5GAN e;  4M75 E;  2DXU A;  3HSB A;  3JCM h;  3GIB A;  2DVE A;  3EFR A;  3JB9 F;  3INZ A;  4PNO A;  4M7A F;  5GMK e; 
#chains in the Genus database with same CATH topology
 3ER0 A;  2XK0 A;  4C8Q E;  3LX7 A;  2EQM A;  2RD1 A;  4A54 A;  2LCS A;  3QPH A;  4PL6 A;  2COZ A;  3M56 A;  1Q82 C;  3L2V A;  2QTX A;  2WAC A;  1D0Z A;  2K5I A;  3PMT A;  1BB9 A;  2L5Q A;  3I9Q A;  2DA9 A;  2JJ9 A;  3QWX X;  3EG2 A;  1VQM A;  2BE9 B;  3CCL T;  1U1S A;  3OSS C;  1K0S A;  1FMV A;  1B7T A;  4OGC A;  3P8B B;  1TH7 A;  3EG3 A;  2KBT A;  5D7U A;  2HQH A;  3G6E Q;  4AG1 C;  4ELZ C;  5CQY A;  2D6F A;  2KRN A;  2C0I A;  3CC4 T;  4M78 G;  5AYF A;  5GAO m;  4E6R A;  3HRT A;  2HL3 A;  4C92 A;  1JB0 E;  3L1A A;  5LJ5 j;  3JB9 J;  1VQL Q;  2BTT A;  2DRK A;  3ASK A;  3CPW S;  2E10 A;  2RMO A;  1O75 A;  3CCU Q;  5GJW B;  1H92 A;  1LPL A;  1X2K A;  1ZSZ B;  1UGP B;  2FRW A;  4P5N A;  3OYM A;  4M7D C;  5DM7 R;  1Q7Y R;  1OQK A;  3MHX A;  5I21 A;  2DTO A;  5L8R E;  2ED0 A;  1DJ7 B;  2NLU A;  1YHQ T;  3OA6 A;  1Q81 C;  2OTJ Q;  3O8V A;  2E3H A;  2DZ9 A;  1M9S A;  1WJQ A;  4EIK A;  2J6K A;  3M0T A;  3A8M B;  1MMA A;  1YP5 A;  5GMK e;  1KSW A;  4JJB A;  1PCX A;  2RK2 A;  4ZGE B;  1SRL A;  2KY9 A;  2R5A A;  1QMC A;  5J26 A;  2JT4 A;  5KYU B;  2RI3 A;  5HCK A;  3EAE A;  5LJ5 e;  1HD3 A;  1YI2 A;  4KGX B;  1Y07 A;  5GAN g;  1A0N B;  3H9N A;  5D6X A;  2EYZ A;  3CC2 Q;  2FYK A;  2O4X B;  1X27 A;  1RAG B;  1Q95 G;  5I22 A;  1QVG S;  2K5F A;  1PRM C;  2OTL A;  2G3R A;  4R55 A;  3Q1J A;  2EW3 A;  2K5L A;  3V7C A;  1WDX A;  3G71 A;  2H3E B;  2IG0 A;  1M1K C;  1UDL A;  4C5E A;  1D3B A;  3DLM A;  2HQE A;  3CD6 A;  4DBQ A;  1LCK A;  1WFW A;  1JXM A;  3MEV A;  3KUF A;  4J6X A;  3DKM A;  1JBM A;  4B9W A;  3JAM E;  1UFF A;  2VC8 A;  2GBQ A;  5C0M A;  1BIB A;  3CCQ T;  3SDZ A;  3V8K A;  1EIF A;  3JCM X;  3EH2 A;  4IUV A;  3CCL Q;  4OMM A;  3CCR A;  1N9R A;  4JRQ A;  3G7Z A;  1NJI R;  3OYY A;  3CCS A;  5GAN j;  2NUT A;  3E9G A;  1KHI A;  2FZG B;  3MEA A;  4PK4 A;  2K9G A;  2JN0 A;  2KXC A;  1Q86 U;  2AT1 B;  1WXB A;  1W1F A;  1K0X A;  1ZUY A;  2D0N A;  3PT9 A;  3TU4 K;  2LC4 A;  3CC4 Q;  2EJ9 A;  4E7J A;  1HJD A;  1PSF A;  1YIT A;  3VRZ A;  2RH2 A;  5FU7 B;  1WJR A;  3PVQ A;  1CKB A;  3CCV A;  1N27 A;  1U8R A;  2KNB B;  4XTW A;  3HPW A;  2DJQ A;  4MDW A;  4J7I A;  1NG2 A;  4RTX A;  2DL4 A;  4ZGD B;  2GQI A;  3RKY A;  2DD4 A;  5GAM d;  5GAN 8;  4TVR A;  2E41 A;  2ZAE A;  1YI2 T;  2F5K A;  4RTU A;  4DBF A;  4C5G A;  2AZV A;  2BUD A;  2L8D A;  4KUD K;  1YHQ Q;  2G6F X;  3S3N A;  4MZM A;  1YJW T;  2OAU A;  2O88 A;  4M77 D;  1VQ7 Q;  1TWB A;  3M9Q A;  4RG8 A;  3C12 A;  2QAZ A;  2RF0 A;  2W10 A;  1H3Z A;  3S3O A;  4C8Q B;  5GAN 7;  2L3R A;  4LDW A;  5KYU A;  1YWO A;  2ROL A;  2BZ8 A;  4J9G A;  4FU6 A;  1ZQ1 A;  5GAN 5;  1TUG B;  2QK0 A;  3BE3 A;  5A0L A;  3NTI A;  1VQM Q;  2DVJ A;  2RPN A;  1WYX A;  3BY7 A;  3X20 B;  3QO3 A;  2X4Y A;  1E6G A;  4M7D G;  4HXJ A;  4QVD A;  2D8H A;  1PM3 A;  3CMA A;  3CCS T;  2DXC A;  1W2B P;  2O31 A;  3NHN A;  5CKD A;  2O9V A;  2HKQ B;  1K73 R;  4AT1 B;  2H3J A;  1X01 A;  1OU9 A;  2DLP A;  5AT1 B;  2YLB A;  4BDZ A;  1Y57 A;  2DJZ A;  1D1A A;  4M77 E;  5KYX A;  1UUE A;  3VS3 A;  2KDS A;  2DYI A;  4WCI A;  3TSZ A;  5HK0 A;  4LDY A;  2BZY A;  1Z9Z A;  1AZE A;  4ZNX A;  3ZL7 C;  2CS7 A;  4PKC C;  2B86 A;  3UF4 A;  3L2Q A;  2KRS A;  4Y92 A;  5EC7 A;  4N0A A;  3I56 A;  1VQ8 T;  2LT4 A;  1KD1 U;  4E7Z A;  3LYI A;  4ZN1 A;  1AZG B;  4F04 B;  1SF9 A;  1ZSZ C;  5DLO A;  1M5Q 1;  2COY A;  2F69 A;  2ZZD A;  3GIB A;  1OI1 A;  2DVE A;  2KYB A;  1WGS A;  1OPK A;  1NLO C;  3MP1 A;  4CRI A;  1BYM A;  3QHS A;  1M8M A;  2EQK A;  1OPL A;  1WX6 A;  4JLG A;  3OYC A;  4Q5W A;  3HRU A;  2DK3 A;  1RAF B;  1VQ5 T;  2F5T X;  2KK4 A;  5HKC A;  2YDL A;  1IRE B;  1WIE A;  3OSV A;  1SKU B;  5GAN 2;  4RCB A;  2DIQ A;  2E5K A;  4JS4 A;  2J06 A;  4IIM A;  1OUL A;  1ZA2 B;  2CDT A;  1W4S A;  4MDX A;  3UPU A;  1Q86 C;  1KC8 U;  2XI9 A;  1B34 B;  2CP0 A;  2RHU A;  3PGG A;  2RNA A;  4RTT A;  2HAX A;  1X2Q A;  1YI2 Q;  3JB9 D;  4C8Q A;  4DBR A;  4KBM B;  4OMF B;  1R8O B;  1YJW Q;  3CCE T;  4K11 A;  4M75 D;  4EMK B;  1OYX A;  2A37 A;  1YJN T;  2FL7 A;  2OTL Q;  2IIM A;  4GBQ A;  4F7U E;  1RI9 A;  3G71 Q;  5GAN d;  1S72 A;  1OX8 A;  2QGF B;  3CD6 Q;  3REA B;  4IUQ A;  2A08 A;  4Z88 A;  2RHX A;  3JCM P;  1LOJ A;  1M4Z A;  2K3Y A;  1MV0 B;  2Y4X A;  2RQR A;  3JCM Q;  2YRV A;  1UGQ B;  2GGR A;  2X3X D;  2FZK B;  1G3W A;  1UHF A;  1VOM A;  4KGV B;  1LNX A;  1Q82 U;  1FWZ A;  1O9S A;  3CCM A;  3CCR Q;  2V1R A;  5A0G A;  2C0T A;  2LMJ A;  2EKH A;  3CCS Q;  2DX1 A;  3MEU A;  2RI2 A;  5CKH A;  5I2M A;  3JCM V;  4M7A F;  1Y7X A;  2EYQ A;  4JJC A;  2J6F A;  1UE9 A;  4M75 E;  5FRM A;  3JCM h;  1VQN T;  3EFR A;  2LT1 A;  4L59 A;  4B9X A;  4M7A B;  1YIT Q;  3X28 B;  1QVF A;  4DOV A;  1OZ2 A;  2KXD A;  1VYV A;  3VKI A;  1ABO A;  2QGG A;  2DER A;  2KT8 A;  2DEQ A;  1SPK A;  4XTZ A;  3CCV Q;  2QQB A;  3V8J A;  4PJO G;  3RNJ A;  3H6Z A;  5FU7 C;  4C5I A;  2L89 A;  5LJ5 f;  3UAT A;  1UB4 A;  2RQT A;  2DD5 A;  3QBY A;  1GBR A;  4RTZ A;  1IGQ A;  3L2W A;  2XU8 A;  2KQW A;  3M59 A;  4WTO B;  3RER A;  2DAQ A;  5LJ3 h;  2JTE A;  4M78 D;  1M2O A;  2LNH B;  1AHJ B;  4EDU A;  4F14 A;  3FEO A;  1Q7Y C;  2CSQ A;  1C6V X;  2CZ1 B;  1B34 A;  3A8H B;  2RI5 A;  4Z89 A;  4C92 F;  1Q81 U;  1KD1 C;  1IGU A;  3OQ5 A;  1I81 A;  2DL8 A;  3MP8 A;  1TUC A;  1EZZ B;  4XU3 A;  4C92 B;  3QYG B;  2PVO B;  2E3I A;  2ZPI B;  3CMA Q;  4QVC A;  1QKX A;  3NTH A;  4FT2 A;  4J5Y A;  2K7A A;  1WHG A;  4E47 A;  5IHN A;  1W2B S;  1VQK T;  1AWJ A;  2MAM A;  1G3S A;  2KAF A;  3EHR A;  4M78 E;  1WZO A;  3WVE B;  2DIL A;  2ENM A;  4M77 B;  4BDY A;  3OMG A;  2MPX C;  3CPF A;  1CKA A;  1ZHI A;  2LQN A;  2DO3 A;  4RTY A;  3L42 A;  1M1K U;  1GCP A;  2K6D A;  3IQL A;  3UDC A;  2JS2 A;  1YCY A;  3OYF A;  2EJG A;  4DBH A;  2QXF A;  2RHI A;  3I56 Q;  2BKD N;  4PJN A;  1UEB A;  4KH1 B;  3FIF A;  2IPO B;  2YUN A;  4A4F A;  3EGD A;  2GFU A;  4MML A;  2IVW A;  2QQS A;  4PJJ A;  2L2P A;  3GNG A;  2RK1 A;  2QI2 A;  5IT9 E;  5GAN f;  1E7O A;  5KCH A;  1X69 A;  1YNZ A;  3OYN A;  3RUX A;  3J7A F;  1G2B A;  5LJ5 g;  3CC7 T;  1MMN A;  4J9C A;  2E1H A;  3LH5 A;  1NYF A;  3U23 A;  3M54 A;  1EFN A;  2EGA A;  1Y71 A;  1D3B B;  4BE1 A;  1BI0 A;  1T0J A;  2CZ7 B;  3MJX A;  1FYN A;  2E4H A;  1Z9Q A;  1TU0 B;  3OBY A;  1VQO T;  2RJC A;  1OU8 A;  2JNG A;  5CKF A;  4D8D A;  3N5B B;  8AT1 B;  4HCB A;  1B3Q A;  1F1B B;  2CP2 A;  5GMK j;  4X9D A;  2F2V A;  5J39 A;  4YTL A;  7AT1 B;  4O6J A;  4FT4 A;  4X1V A;  1FXX A;  2B8A A;  2WSE E;  1W70 A;  1YJ9 A;  2EGE A;  3FJ5 A;  4OMQ A;  2NUT B;  4J83 A;  1QP3 A;  1S72 Q;  4EMK C;  5C6S A;  9ATC B;  2DM1 A;  5LJ3 j;  2M02 A;  2DBK A;  3CCQ A;  2LQ8 A;  1SSF A;  4C0Z A;  3R6N A;  1QW1 A;  4EMG A;  3L2Z A;  1YFN A;  2OX7 A;  5CQX A;  2HKN A;  3RBB B;  4ZTJ A;  2DXU A;  3CCM Q;  3JB9 F;  3VYH B;  1NM7 A;  4PJL A;  2CT3 A;  4GLM A;  2KE9 A;  4LUD A;  2JM9 A;  3QZ5 B;  4LXC A;  4PJM A;  1M8V A;  3CXC A;  4M77 A;  4J6W A;  3JCM e;  2EPD A;  3H0F A;  3M53 A;  2V8I A;  1U06 A;  4E7S A;  2EQJ A;  3NPF A;  2WSF E;  2CYZ B;  1IXD A;  2EFI A;  3P8H A;  2X4J A;  2NUP B;  2K79 A;  2VXF A;  1WXT A;  4JZ3 A;  4QQD A;  4XTU A;  2GNC A;  1GCQ C;  4JUV A;  4M7A C;  2QQR A;  1N9S A;  1VQP T;  4M7D D;  4XU2 A;  2KYM A;  4HVU A;  5I11 A;  2NYS A;  3J81 E;  5IHK A;  3RR6 A;  2RJD A;  5LJ3 e;  1G8X A;  4JDS A;  3CEY A;  2CP6 A;  2M0O A;  1YJW A;  4KGZ B;  3VS5 A;  2PUK B;  2JOY A;  2DE0 X;  2PNI A;  4F17 A;  2RJF A;  3HFN A;  2AKK A;  3A8G B;  3MO8 A;  1I8F A;  3I5R A;  2FO0 A;  1YJ9 T;  1K76 A;  2LZ6 B;  2XIC A;  1M90 R;  2V26 A;  5GAO r;  6AT1 B;  3M55 A;  3QII A;  2DYB A;  4FM4 B;  1UGR B;  3BDU A;  4J9H A;  1MHN A;  1N6A A;  1V76 A;  1K9M R;  2YLC A;  2DFU A;  2KT1 A;  2R58 A;  4C5H A;  5KYX B;  4E7H A;  1BK2 A;  4M7D E;  4ZGJ B;  4BI3 A;  4EPC A;  1N8R U;  4JS5 A;  1KQS P;  4F7U A;  4PFO A;  5J3B A;  2DXB A;  1WHM A;  1ZBX A;  2HDA A;  2X4W A;  4C92 C;  3OW2 P;  2RQW A;  2PTK A;  3VV0 A;  1HSQ A;  4OML A;  4N4G A;  2BIV A;  4C0D C;  1I4K 1;  3SWN B;  1U5S A;  4M78 B;  4J9I A;  1Q82 R;  3BFM A;  1YBY A;  3C4S A;  4QQ6 A;  4ZTF A;  1K8A U;  4LDV A;  3X26 B;  3A8O B;  3M0Q A;  1VQ8 A;  2XDB A;  4L6V 5;  2DPP B;  2SEM A;  5I2S A;  3ZBD A;  4Y91 A;  3CCJ T;  2FPE A;  2HSE B;  1G5V A;  3QDR B;  4XK8 E;  3TCJ A;  4QT7 A;  2RHY A;  1JJ2 P;  4PFP A;  4OP0 A;  4M75 A;  3LGF A;  1E6H A;  2XDP A;  5FRN A;  3JRZ A;  4OMP A;  2FRY A;  3RMS A;  4A4E A;  4C8Q F;  1IO6 A;  2NUP A;  4J8O A;  1YCS B;  1M3B A;  2P0K A;  4JRI A;  2ED1 A;  2X35 A;  3OYL A;  1VQ5 A;  3VS7 A;  4E7L A;  1OOT A;  3SEM A;  1VIE A;  2M0Y A;  1GFD A;  4CC7 A;  2PVG B;  1R0B G;  2GQV A;  5FWC A;  4CC3 A;  1WHK A;  4AFZ C;  3AHU A;  1PG5 B;  2CP7 A;  2HL5 C;  5M9O A;  5GMK l;  3EGX A;  4FYW B;  2JS0 A;  2VGN A;  2MMP A;  3ZEH A;  2KVQ G;  5LJ5 d;  3QJ6 A;  3X24 B;  4RMO A;  1AD5 A;  2V1Q A;  2QA4 T;  4NOY A;  1GL5 A;  2X4X A;  3CCE A;  1SSH A;  4Y28 E;  2ZGW A;  1YJN A;  5GAO q;  4A4G A;  1I1J A;  1I07 A;  1MGQ A;  3UA7 A;  1T3S A;  1MND A;  4M4Z A;  3QSU A;  4J9D A;  1YJ9 Q;  2P84 A;  3V8L A;  2A0F B;  3INZ A;  1RAD B;  2MK5 A;  2RN8 A;  2KRM A;  4PJO D;  2F2W A;  2O01 E;  1V29 B;  3CCQ Q;  3OS1 A;  1Q7Y U;  1V1C A;  3FDR A;  2XD0 A;  2CSI A;  2D1X A;  2LJ1 A;  4M7A G;  4ELY C;  2AZS A;  3M0U A;  3SB2 A;  4AG2 C;  3SWN A;  4FYY B;  2D8J A;  5ECA A;  4M78 A;  4RUG A;  3CXC P;  3VUZ A;  1XQH A;  5CK9 A;  3RIR A;  2RQV A;  3CME T;  1MUZ A;  3EG9 B;  1VQN A;  3VS6 A;  2ZPH B;  3EFS A;  4XTY A;  1UTI A;  1NEB A;  2DKG A;  3KXT A;  4FCY A;  1BCO A;  1AT1 B;  1WXU A;  1YIJ T;  3P8D A;  4JJN K;  4BY6 B;  1Y96 A;  3CBP A;  1N8R C;  1OZ3 A;  4QVZ A;  2K2V A;  1IB8 A;  5HY6 A;  4PJO E;  2EYW A;  3TEE A;  1KG1 A;  1X6O A;  1WQ7 A;  1VQ4 T;  1ZA1 B;  2M9U A;  3GBQ A;  2ESW A;  1VQ6 T;  2GCX A;  1KJW A;  3I55 T;  3G4S A;  5CO7 A;  4KUI A;  3C0C A;  5GAO l;  1AOJ A;  1WHJ A;  2HNI A;  4LE9 A;  5KH6 A;  1RAA B;  4HA8 A;  1GXI E;  4C92 G;  2MI6 A;  2AHJ B;  2VKN A;  1G3Y A;  1K8A C;  3OB9 A;  1HK9 A;  4C0F A;  1WI7 A;  1RLQ C;  2A28 A;  5GAO p;  4RTV A;  2I2L A;  2VGM A;  3LGL A;  3M0R A;  2KSS A;  2YHT A;  1NJI U;  1BI1 A;  4OB2 B;  4BUG A;  2ZPB B;  2GTJ A;  4CI0 C;  3UT1 A;  2LNV A;  4BI4 A;  3DLL A;  3LH0 A;  3EFO B;  2RA2 A;  3G1J A;  2EYX A;  2CT4 A;  1TOV A;  2DL3 A;  2K3B A;  5CKE A;  2QEX T;  2L3S A;  3FB9 A;  1WHL A;  3JCM f;  4OMN A;  4FW1 A;  5FU6 B;  1VQK A;  3TRE A;  4E2F B;  1KQS S;  3QUI A;  1VIF A;  2XKO C;  1AVZ C;  3JSC A;  2COW A;  3EGD B;  2RQU A;  3OW2 S;  2YRC A;  1QWF A;  4Z02 A;  4LDU A;  5DY9 A;  2Y4Y A;  4N0A C;  1P92 A;  3NGP A;  1GFC A;  2F1L A;  2BZX A;  4O5V A;  2MF2 A;  3VJP A;  3QWY A;  5IN1 A;  4QW2 A;  3SWN C;  2VWF A;  5GAM h;  5FRO A;  1SHF A;  1G83 A;  1ZUK A;  3REB B;  1VQ8 Q;  1TS9 A;  2J7I A;  2FG0 A;  2XG8 D;  2FB7 A;  5LJ3 f;  3EG9 A;  2K57 A;  4LNP A;  1I5L A;  5CKB A;  3WXM B;  3G4S T;  1ACM B;  1IRX A;  3RMQ A;  1M1F A;  1JJ2 S;  2E70 A;  3OYJ A;  4JPB W;  1PKS A;  5GAN 4;  2H8H A;  1BI3 A;  3PFS A;  1ZUU A;  4LD9 K;  2EVR A;  4OGE A;  2JVV A;  2LJ0 A;  2HBP A;  1VQ5 Q;  3CC7 A;  4XTX A;  1UHC A;  1WA7 A;  3PVL A;  5CIU A;  4FYV B;  2J6O A;  1R77 A;  3MEW A;  3H8Z A;  3CBO A;  2YXY A;  1M27 C;  2HSP A;  1X6G A;  3G6E T;  4ME7 A;  4C8Q C;  3SD4 A;  4A4H A;  1XJW B;  3PIO A;  1VQO A;  3VS4 A;  4OB0 B;  2X3W D;  3OYH A;  2QTV A;  4IUU A;  2EQI A;  2MIO A;  5FLX E;  1G3T A;  1XTD A;  1K73 U;  2YRD A;  1UG1 A;  2LJ3 A;  1RAC B;  1VQL T;  2PU9 B;  2L3Q A;  3H0I A;  3CCE Q;  4ATO A;  1KQ1 A;  3CCU T;  1YJN Q;  4M77 F;  3TQ7 P;  1JRI A;  1HYO A;  3MP6 A;  2P0P A;  1RUW A;  1UGV A;  2JTF A;  4AMC A;  3EG1 A;  5GJV B;  4HT9 A;  3T9N A;  2HBW A;  3HFO A;  3EFO A;  2DET A;  4IUP A;  1WQW A;  3C94 A;  1TUD A;  2SRC A;  4BE2 A;  4M7D A;  2KRO A;  2A36 A;  3JB9 G;  2AIR B;  3ZFJ A;  4RG2 A;  3JCM g;  1Y0M A;  2PZ1 A;  1QVP A;  5GAN 3;  2OTJ T;  1AEY A;  5KYY A;  4NS5 A;  1Q86 R;  4HCC A;  3EH1 A;  2DRM A;  4XU1 A;  1D0Y A;  1M90 C;  1SHG A;  2DEU A;  1U3O A;  2EBP A;  4HT8 A;  4A4K A;  1IHW A;  1K9M C;  2QQ9 A;  2Z0W A;  3OS0 A;  4JRP A;  1B07 A;  3CXC S;  4QKU A;  5FWB A;  1NJI C;  1VQN Q;  1VA7 A;  1U1T A;  8ATC B;  1UGS B;  4PJO F;  1BU1 A;  2LRQ A;  3CC2 T;  5LJ3 g;  1MNE A;  1M2V B;  1X43 A;  3HKS A;  3E9F A;  2MYS A;  2DNU A;  3PNW C;  1VQP A;  1BKB A;  3M57 A;  4FIB A;  4AFQ C;  3JCM J;  1D0X A;  1ZBJ A;  4PJO B;  1KK7 A;  4Z8A A;  2DZC A;  2CGH A;  2ECZ A;  2LX7 A;  3BDL A;  4BY6 C;  2HD0 A;  2DF6 A;  3LW5 E;  1HXD A;  5IXF A;  1H3H A;  3FJP A;  3JB9 I;  3J80 E;  1D09 B;  4MZP A;  3G4S Q;  4GLK A;  5GAM j;  4NL3 A;  5GAN h;  4F7U F;  2PQW A;  2EWN A;  3A5Z B;  2EAY A;  4CC2 A;  3V7R A;  2O2O A;  1D1B A;  2E6N A;  3A8L B;  3A1P A;  4LDX A;  4F7U B;  3D7S B;  4HCZ A;  2CKK A;  3M4Y A;  3MET A;  1W2B A;  2R57 A;  5A2Q E;  3UA6 A;  4B6M A;  2FPD A;  2KR3 A;  1I0C A;  1TG0 A;  1K4U S;  2DL5 A;  1PSE A;  1RLP C;  3VUB A;  1KIK A;  1NE8 A;  4IIO A;  4OB1 B;  3R6O A;  4J9F A;  2HCK A;  3OS5 A;  2X9H A;  4M75 F;  1ZX6 A;  4DQ2 A;  4LUE A;  1VQK Q;  2AK5 A;  1NYG A;  2LQK A;  1AWX A;  5GAO n;  4X9C A;  3LWH A;  2MWP A;  5FU6 C;  5KYW B;  4M75 B;  1TTH B;  1QVF P;  1JO8 A;  5GAM e;  3HHT B;  1RAH B;  1QP2 A;  3GLX A;  4HCK A;  4N4I A;  3EG0 A;  1KD1 R;  4IUT A;  2FEI A;  3JCM W;  1K73 C;  4IUR A;  1FMK A;  1QCO A;  3JV3 A;  1MMD A;  3CCJ A;  2OJ2 A;  4C8Q G;  1QCF A;  1VQ7 T;  2BE7 D;  4OMO A;  3C95 A;  4LN2 A;  5EG2 A;  5CAI A;  3AT1 B;  2LVM A;  5CCA A;  3FLG A;  2LP5 A;  2E12 A;  4HVW A;  1TSF A;  2M51 A;  2MOX A;  3UWN A;  3F70 A;  1M2V A;  2EIF A;  3EGX B;  2D9T A;  1VQM T;  2E65 A;  5CVI A;  2I0N A;  2QQA A;  4PJO A;  3M0S A;  4JZ4 A;  3FC3 A;  1WPY A;  3CC7 Q;  5IH2 A;  3URG A;  1KC8 R;  2JXB A;  3PTA A;  3EGU A;  1WLP B;  2ATC B;  3OYB A;  1AWW A;  4PNO A;  1T3L A;  1CSK A;  2V8J A;  2LTO A;  3MPU B;  4M7A D;  3GF5 A;  2A3L A;  2E5Q A;  1YN8 A;  1QLY A;  1K9A A;  2VV5 A;  2QA4 A;  1VQO Q;  3CPW A;  1EX4 A;  3KBG A;  1NLP C;  4J6Y A;  4UC4 A;  1SG5 A;  2C06 A;  3OYD A;  4M78 F;  3NTK A;  5D6W A;  2EQU A;  2YUP A;  3RES A;  4J7F A;  1XOV A;  5CR2 A;  5IHI A;  4D8K A;  2DMO A;  4WF2 A;  2M16 A;  2HQX A;  4GY5 A;  3VYG A;  2CP3 A;  4HKE A;  2VAS A;  4BI8 B;  2EYY A;  3X25 B;  1VQ9 A;  3WVD B;  2VUB A;  3VRY A;  2M1H A;  4AFS C;  2KI7 A;  4XQ3 A;  4C0G A;  1QWE A;  4M77 C;  2O9S A;  1ZSZ A;  2GTO A;  3MCA B;  4M7A E;  2VVK A;  3VS0 A;  1WHH A;  3S3M A;  1NEG A;  1Y96 B;  5KYW A;  3M58 A;  2K3X A;  2E6Z A;  2LX9 A;  1PRL C;  1NPP A;  4A63 B;  4BE0 A;  4C92 D;  2PUO B;  3VS2 A;  3JCM d;  4FSS A;  2Y90 A;  1XNI A;  4MMK A;  3CME A;  3SFM A;  5GMK i;  1NZ9 A;  4ESR A;  2QG9 B;  4OF1 A;  3QDF A;  3OYE A;  2CP5 A;  3LWI A;  1QVG A;  1YIJ A;  2NUZ A;  3EHQ A;  2CH4 W;  2MWO A;  1BIA A;  4MZT A;  5FW9 A;  3CBM A;  4A53 A;  3RKX A;  1WNL A;  1VQ4 A;  1VQP Q;  2AKL A;  3I35 A;  3GNF B;  2OTL T;  3LLR A;  2OAW A;  2QDY B;  1VQ6 A;  3E19 A;  5GAN e;  3G71 T;  1H8K A;  3HRS A;  2P0Q A;  3I55 A;  3CD6 T;  2QAS A;  1UJY A;  2YT6 A;  3E2U A;  5LJ3 d;  2DBM A;  3OYK A;  2F2X A;  1ABQ A;  4DEY A;  4PJO C;  1M1G A;  1RL2 A;  4ORZ A;  1PD1 A;  1SEM A;  2O4X A;  2DIG A;  2R5M A;  4C92 E;  1Q81 R;  4FYX B;  1JQQ A;  1OEB A;  5IXB A;  3CCR T;  2DTH A;  2RJE A;  2K2M A;  2ZPF B;  2YSQ A;  1FX7 A;  3VU3 C;  4JJD A;  2JW4 A;  1VQ9 T;  4KUL A;  1M3C A;  2W0Z A;  1S1N A;  3RDV A;  1H64 1;  2L0A A;  3HTR A;  2QEX A;  1YIT T;  3E1S A;  4N4H A;  3OYI A;  1RAI B;  2CH4 A;  3NMZ C;  4FSX A;  2ROT A;  2RHZ A;  1OV3 A;  1X6B A;  3CCV T;  4LD6 A;  1MMG A;  3L2U A;  4R0K A;  1YWP A;  2QDL A;  1PKT A;  3OYA A;  2CUB A;  4ANJ A;  1W6X A;  2KGT A;  1M1K R;  4E7I A;  5IAY A;  1ZSG A;  2OI3 A;  2QYZ A;  2YWW A;  4PFZ A;  4EMH A;  4BAC A;  2PVD B;  4L5G A;  1WJS A;  3QKJ A;  2V8K A;  3JCM c;  4QQG A;  3M5A A;  1QVF S;  4M75 C;  2C0O A;  5GAN 6;  3L2R A;  1X75 C;  2VXE A;  3DB3 A;  3CCJ Q;  4KH0 B;  2WSC E;  2P4T A;  2P4R A;  3OS2 A;  1C1A A;  3OY9 A;  4JLI A;  2CRE A;  1UEC A;  2GFA A;  1SRM A;  4VUB A;  4NL2 A;  1PD0 A;  2KMT A;  1VYU A;  4DEX A;  1M90 U;  2EJF A;  1VUB A;  2LCL A;  2ZPG B;  1LVK A;  1ZLM A;  2ABL A;  1IZ6 A;  3O5Z A;  1OX9 A;  1GRI A;  3I5S A;  1K9M U;  3CMA T;  2GF7 A;  3JCM b;  3G6E A;  3HP9 A;  3H41 A;  2LDM A;  4M7D F;  2YUQ A;  2CUD A;  3OBW A;  2ZCF B;  3HL8 A;  5KE3 A;  4KT0 E;  2K4Y A;  1KFZ A;  4M77 G;  2YUO A;  2FVU A;  4II1 A;  3CPW P;  3QYH B;  2QA4 Q;  1UJ0 A;  4BB7 A;  4M7D B;  1VQL A;  4R56 A;  4DOW A;  3CCU A;  5KYN A;  4XU0 A;  5KYY B;  1GBQ A;  3PMI A;  1NPR A;  2ZPE B;  2FPF A;  3SHW A;  3I56 T;  2X51 A;  5GAM f;  4RCC A;  2JM8 A;  4IKF A;  1PC0 A;  3BW1 A;  2VYT A;  2HMA A;  2JMA A;  3QG1 A;  3GOX A;  4DA4 A;  4RKU E;  1VQ9 Q;  3GPL A;  4ZN3 A;  3PIP A;  2VB6 A;  2OTJ A;  2A7Y A;  4V2S A;  4M78 C;  3H0H A;  3ME9 A;  1FMW A;  1BCM A;  4PLL A;  4RTW A;  2CZ6 B;  4KRT A;  2E64 A;  5DLQ E;  3PE0 A;  5KE2 A;  3GP8 A;  2KEA A;  3QXE B;  2XHC A;  4AFU C;  2HZY A;  2RM4 A;  5HK3 A;  1PNJ A;  1RI0 A;  1T0H A;  2DXT A;  3CME Q;  5GMK h;  4E7K A;  4JRK A;  1JXO A;  3QZ9 B;  1NBE B;  1QVG P;  3HSB A;  4CC4 B;  1C0M A;  3CC2 A;  2RO0 A;  1YIJ Q;  4XAX B;  2JMC A;  3DB4 A;  2LQW A;  5LJ5 h;  5LL6 S;  1N5Z A;  2CZ0 B;  2L3P A;  1K1Z A;  4XTV A;  4F7U G;  5A0D A;  1VQ4 Q;  2RB6 A;  1RAB B;  3OYG A;  1ARK A;  4FW2 A;  1KQ2 A;  1TXQ A;  3OMC A;  1VQ6 Q;  2EKO A;  2FZC B;  3ULR B;  1S72 T;  3I55 Q;  2DL7 A;  1QQJ A;  5D6Y A;  3NFC A;  3V7S A;  1PWT A;  2FHD A;  1JU5 C;  1MV3 A;  4OVA A;  3S6W A;  3CCL A;  2LCC A;  3MKD A;  1AWO A;  4EMK A;  2JTM A;  3RKW A;  2MCN A;  2NWM A;  3VS1 A;  3CCM T;  1VYT A;  4HVV A;  1LJO A;  3TSW A;  5L23 A;  1KQS A;  2HEQ A;  4F16 A;  4C0D B;  5GMK m;  2XID A;  1BBZ A;  1JEG A;  1KHC A;  1N8R R;  3OW2 A;  4C8Q D;  3CC4 A;  3M0P A;  2JZ2 A;  3CQT A;  3QJY A;  4M75 G;  1I5O B;  3KFV A;  3FRN A;  1RAE B;  2XMF A;  3M4G A;  2QEX Q;  1KC8 C;  1R0C B;  3A98 A;  3TVT A;  1IHV A;  1M30 A;  5GAM g;  1D1C A;  4FL6 A;  4BD3 A;  5KCO A;  2D0Q B;  2XDD A;  4J9B A;  3THK A;  1PHT A;  1K8A R;  2JUF A;  3JB9 H;  2EGC A;  2DTI A;  1BI2 A;  1GCQ A;  4OB3 B;  1JJ2 A;  4M7A A;  1YHQ A;  1M3A A;  4X34 A;  4J9E A;  2J05 A;  1QKW A;  4PLI A;  1VQ7 A;  4D6W A;  1QCN A;  1J3T A; 
#chains in the Genus database with same CATH homology
 3ER0 A;  4M7A B;  4PJO D;  4M7A D;  3X28 B;  3GF5 A;  2XK0 A;  4C8Q E;  2A3L A;  1QVF A;  4DOV A;  3LX7 A;  2O01 E;  2EQM A;  2RD1 A;  1OZ2 A;  1V29 B;  2E5Q A;  4A54 A;  3QPH A;  4PL6 A;  3VKI A;  3OS1 A;  1Q7Y U;  3M56 A;  1Q82 C;  3FDR A;  3L2V A;  2DEQ A;  2QTX A;  2WAC A;  4XTZ A;  2XD0 A;  2QQB A;  2VV5 A;  2QA4 A;  3V8J A;  4PJO G;  3CPW A;  4M7A G;  2K5I A;  2XDD A;  3PMT A;  4ELY C;  3H6Z A;  2L5Q A;  5FU7 C;  3SB2 A;  4C5I A;  2L89 A;  1VQM A;  3KBG A;  4J6Y A;  5LJ5 f;  4UC4 A;  3SWN A;  2C06 A;  3OYD A;  4M78 F;  4M78 A;  3NTK A;  3CCL T;  1UB4 A;  1U1S A;  3VUZ A;  1XQH A;  5CK9 A;  3QBY A;  2DD5 A;  3OSS C;  3RIR A;  4OGC A;  3P8B B;  1TH7 A;  5D6W A;  3CME T;  3L2W A;  2EQU A;  3RES A;  4J7F A;  1XOV A;  2XU8 A;  2KQW A;  3M59 A;  5CR2 A;  1VQN A;  2DAQ A;  2ZPH B;  4WF2 A;  5LJ3 h;  3RER A;  4M78 D;  2M16 A;  2HQX A;  3EFS A;  4GY5 A;  4XTY A;  3VYG A;  4HKE A;  1AHJ B;  2DKG A;  4BI8 B;  4EDU A;  3KXT A;  3FEO A;  3X25 B;  4ELZ C;  1Q7Y C;  5CQY A;  1VQ9 A;  2D6F A;  3WVD B;  2VUB A;  2M1H A;  1YIJ T;  3P8D A;  3CC4 T;  4M78 G;  2CZ1 B;  4JJN K;  4BY6 B;  1B34 A;  1Y96 A;  5AYF A;  3A8H B;  2RI5 A;  4XQ3 A;  5GAO m;  3CBP A;  4C0G A;  1N8R C;  1OZ3 A;  2K2V A;  3HRT A;  4M77 C;  4QVZ A;  4C92 F;  1Q81 U;  4C92 A;  5HY6 A;  1KD1 C;  3MCA B;  1JB0 E;  4M7A E;  3OQ5 A;  3TEE A;  4PJO E;  1KG1 A;  1X6O A;  3L1A A;  1I81 A;  5LJ5 j;  3JB9 J;  1WQ7 A;  3MP8 A;  1VQ4 T;  3S3M A;  3ASK A;  1Y96 B;  2E10 A;  2M9U A;  3CPW S;  1O75 A;  2K3X A;  3M58 A;  1VQ6 T;  2E6Z A;  2GCX A;  2LX9 A;  1NPP A;  4XU3 A;  4C92 B;  3QYG B;  4BE0 A;  4C92 D;  3I55 T;  3G4S A;  5CO7 A;  1UGP B;  4KUI A;  2PUO B;  4P5N A;  2PVO B;  3JCM d;  3OYM A;  4M7D C;  3CME A;  2Y90 A;  1XNI A;  4MMK A;  5DM7 R;  3SFM A;  5GAO l;  5GMK i;  2ZPI B;  2HNI A;  5KH6 A;  1NZ9 A;  4HA8 A;  4OF1 A;  1GXI E;  1Q82 U;  4C92 G;  2MI6 A;  4QVC A;  3OYE A;  2AHJ B;  3MHX A;  3NTH A;  1G3Y A;  4FT2 A;  4J5Y A;  5I21 A;  1K8A C;  3LWI A;  2DTO A;  5L8R E;  1QVG A;  3OB9 A;  1YIJ A;  1DJ7 B;  4E47 A;  2NLU A;  1HK9 A;  4C0F A;  1W2B S;  1VQK T;  1YHQ T;  2MAM A;  1G3S A;  2KAF A;  3OA6 A;  5GAO p;  1Q81 C;  4M78 E;  3O8V A;  3WVE B;  2MWO A;  1BIA A;  4MZT A;  2I2L A;  2VGM A;  3LGL A;  3CBM A;  4A53 A;  2DZ9 A;  2KSS A;  1M9S A;  3RKX A;  1WJQ A;  1WNL A;  4M77 B;  1VQ4 A;  2YHT A;  3GNF B;  1NJI U;  1BI1 A;  4OB2 B;  3LLR A;  4BDY A;  4BUG A;  2ZPB B;  2OTL T;  3OMG A;  3CPF A;  1ZHI A;  2QDY B;  3A8M B;  3E19 A;  5GAN e;  1VQ6 A;  4CI0 C;  3UT1 A;  2DO3 A;  2LNV A;  3HRS A;  3G71 T;  2P0Q A;  3L42 A;  3I55 A;  1M1K U;  5GMK e;  4BI4 A;  3CD6 T;  3DLL A;  3LH0 A;  3UDC A;  5LJ3 d;  2RA2 A;  2RK2 A;  4ZGE B;  3OYK A;  1YCY A;  3OYF A;  2EJG A;  2QXF A;  2KY9 A;  1M1G A;  2RHI A;  2BKD N;  4PJO C;  1UEB A;  5CKE A;  2QEX T;  1RL2 A;  2O4X A;  2R5A A;  2LT1 A;  3FB9 A;  3FIF A;  5J26 A;  2DIG A;  3JCM f;  4A4F A;  2GFU A;  2R5M A;  4MML A;  5FU6 B;  2IVW A;  4C92 E;  2QQS A;  2RI3 A;  3EAE A;  1VQK A;  5LJ5 e;  1YI2 A;  3TRE A;  1Y07 A;  5GAN g;  1KQS S;  3QUI A;  1VIF A;  3GNG A;  2XKO C;  3CCR T;  5D6X A;  2DTH A;  2FYK A;  3JSC A;  2O4X B;  2RJE A;  2RK1 A;  2QI2 A;  2ZPF B;  5IT9 E;  1QVG S;  2K5F A;  3OW2 S;  5GAN f;  4Z02 A;  1FX7 A;  4LDU A;  5DY9 A;  2Y4Y A;  3VU3 C;  2G3R A;  1P92 A;  3Q1J A;  4N0A C;  4R55 A;  5KCH A;  2K5L A;  2OTL A;  1VQ9 T;  3V7C A;  3OYN A;  3RUX A;  3G71 A;  2IG0 A;  3J7A F;  4KUL A;  1M1K C;  4C5E A;  1D3B A;  3DLM A;  2HQE A;  4O5V A;  2MF2 A;  3CD6 A;  3VJP A;  5LJ5 g;  5IN1 A;  3CC7 T;  4QW2 A;  3SWN C;  5GAM h;  3MEV A;  5FRO A;  3KUF A;  2E1H A;  3DKM A;  4J6X A;  1JBM A;  4B9W A;  1H64 1;  3JAM E;  3M54 A;  2XG8 D;  2VC8 A;  2QEX A;  1YIT T;  3E1S A;  4N4H A;  3OYI A;  1Y71 A;  1D3B B;  4BE1 A;  2FB7 A;  1BI0 A;  5LJ3 f;  5C0M A;  2K57 A;  2CZ7 B;  1BIB A;  3CCQ T;  1I5L A;  4FSX A;  3SDZ A;  2RHZ A;  3V8K A;  1EIF A;  5CKB A;  3WXM B;  3JCM X;  4IUV A;  3OBY A;  3CCV T;  4LD6 A;  3G4S T;  1N9R A;  2RJC A;  3CCR A;  4JRQ A;  1VQO T;  3G7Z A;  3L2U A;  2JNG A;  5CKF A;  3OYY A;  3RMQ A;  1M1F A;  3OYA A;  3CCS A;  3N5B B;  4L59 A;  5GAN j;  3E9G A;  1JJ2 S;  1KHI A;  4HCB A;  2E70 A;  3MEA A;  5GMK j;  3OYJ A;  4X9D A;  4E7I A;  5J39 A;  5GAN 4;  3PFS A;  1BI3 A;  4YTL A;  5IAY A;  2JN0 A;  4O6J A;  4LD9 K;  4FT4 A;  4EMH A;  1FXX A;  2B8A A;  2WSE E;  4BAC A;  1Q86 U;  4OGE A;  1YJ9 A;  2JVV A;  2HBP A;  2PVD B;  3CC7 A;  4L5G A;  4XTX A;  1WJS A;  3PT9 A;  3QKJ A;  3TU4 K;  2V8K A;  3JCM c;  4J83 A;  2LC4 A;  1QP3 A;  3M5A A;  4QQG A;  5CIU A;  1QVF S;  2EJ9 A;  4E7J A;  4M75 C;  5GAN 6;  3MEW A;  1PSF A;  3H8Z A;  4EMK C;  3CBO A;  5C6S A;  1YIT A;  5LJ3 j;  3L2R A;  1X75 C;  2VXE A;  3DB3 A;  3G6E T;  4ME7 A;  2RH2 A;  5FU7 B;  1WJR A;  4C8Q C;  3CCQ A;  2LQ8 A;  1SSF A;  2WSC E;  3SD4 A;  2P4T A;  4A4H A;  4C0Z A;  1QW1 A;  3CCV A;  4EMG A;  1N27 A;  3PIO A;  1VQO A;  1U8R A;  3OS2 A;  3L2Z A;  4OB0 B;  3OY9 A;  3OYH A;  4XTW A;  4IUU A;  4JLI A;  5CQX A;  3HPW A;  2GFA A;  5FLX E;  1G3T A;  1XTD A;  4ZTJ A;  4VUB A;  1K73 U;  4NL2 A;  2KMT A;  2DXU A;  3JB9 F;  3VYH B;  4MDW A;  4J7I A;  1VQL T;  1M90 U;  2PU9 B;  2EJF A;  4ATO A;  1VUB A;  1KQ1 A;  3QZ5 B;  2LCL A;  2ZPG B;  4ZGD B;  3CCU T;  4M77 F;  1M8V A;  3RKY A;  3CXC A;  4M77 A;  2DD4 A;  4J6W A;  5GAM d;  5GAN 8;  4TVR A;  2E41 A;  1JRI A;  3MP6 A;  3JCM e;  1YI2 T;  2F5K A;  2P0P A;  1IZ6 A;  4C5G A;  2BUD A;  2L8D A;  2JTF A;  2V8I A;  3M53 A;  4KUD K;  1K9M U;  3S3N A;  4HT9 A;  2EQJ A;  4MZM A;  3T9N A;  1YJW T;  3CMA T;  3HFO A;  2WSF E;  2CYZ B;  2GF7 A;  2OAU A;  4IUP A;  3JCM b;  3G6E A;  1WQW A;  3C94 A;  4M77 D;  3HP9 A;  2LDM A;  4M7D F;  4BE2 A;  4M7D A;  3M9Q A;  3JB9 G;  4RG8 A;  3OBW A;  2ZCF B;  3C12 A;  2EFI A;  3HL8 A;  3P8H A;  5KE3 A;  4KT0 E;  3ZFJ A;  2X4J A;  4C8Q B;  2K4Y A;  5GAN 7;  3S3O A;  2L3R A;  2VXF A;  4LDW A;  4RG2 A;  3JCM g;  1QVP A;  4M77 G;  4QQD A;  5GAN 3;  2FVU A;  2OTJ T;  4II1 A;  4PNO A;  1H3Z A;  4XTU A;  3QYH B;  4FU6 A;  4JUV A;  4NS5 A;  4M7A C;  4HCC A;  2QQR A;  1ZQ1 A;  4BB7 A;  5GAN 5;  4XU1 A;  4M7D B;  1N9S A;  1VQP T;  1VQL A;  1M90 C;  4M7D D;  4XU2 A;  4R56 A;  5A0L A;  3NTI A;  4DOW A;  3CCU A;  3J81 E;  3BY7 A;  3X20 B;  3QO3 A;  2X4Y A;  4XU0 A;  2RJD A;  4HT8 A;  5LJ3 e;  4JDS A;  3PMI A;  4M7D G;  3CEY A;  4A4K A;  1K9M C;  1NPR A;  2ZPE B;  2QQ9 A;  4QVD A;  2M0O A;  3I56 T;  1YJW A;  3CMA A;  3OS0 A;  3CCS T;  2DXC A;  2PUK B;  4JRP A;  5GAM f;  4RCC A;  2JOY A;  3CXC S;  4IKF A;  3BW1 A;  5CKD A;  2VYT A;  1NJI C;  2RJF A;  3HFN A;  3QG1 A;  3GOX A;  4DA4 A;  3A8G B;  3MO8 A;  4RKU E;  1U1T A;  1I8F A;  1UGS B;  4PJO F;  1YJ9 T;  3GPL A;  2H3J A;  1X01 A;  2LRQ A;  3CC2 T;  4ZN3 A;  2YLB A;  2XIC A;  3PIP A;  5LJ3 g;  4BDZ A;  2A7Y A;  2OTJ A;  4V2S A;  3HKS A;  4M78 C;  2DJZ A;  3E9F A;  5GAO r;  3ME9 A;  4M77 E;  3M55 A;  3QII A;  4FM4 B;  1UGR B;  3PNW C;  1VQP A;  4PLL A;  2KDS A;  1BKB A;  3BDU A;  3M57 A;  4FIB A;  3JCM J;  1MHN A;  2CZ6 B;  4PJO B;  1N6A A;  2DZC A;  4LDY A;  5HK0 A;  2YLC A;  2CGH A;  2E64 A;  5DLQ E;  3BDL A;  4BY6 C;  2HD0 A;  2R58 A;  2CS7 A;  4PKC C;  3LW5 E;  1HXD A;  4C5H A;  5KE2 A;  3GP8 A;  3FJP A;  3L2Q A;  3QXE B;  3JB9 I;  3J80 E;  4E7H A;  2XHC A;  2RM4 A;  4MZP A;  4N0A A;  4M7D E;  4GLK A;  5GAM j;  4ZGJ B;  3I56 A;  5HK3 A;  4NL3 A;  1VQ8 T;  5GAN h;  1RI0 A;  2LT4 A;  4BI3 A;  2DXT A;  4EPC A;  4F7U F;  4JS5 A;  1N8R U;  4F7U A;  1KD1 U;  5GMK h;  5J3B A;  4E7K A;  2PQW A;  2EWN A;  2DXB A;  3LYI A;  4ZN1 A;  4JRK A;  3A5Z B;  1ZBX A;  2EAY A;  2X4W A;  3QZ9 B;  4C92 C;  5DLO A;  1M5Q 1;  3V7R A;  3HSB A;  2F69 A;  2ZZD A;  3GIB A;  1OI1 A;  2DVE A;  2E6N A;  3CC2 A;  3A8L B;  1WGS A;  4CRI A;  3MP1 A;  2RO0 A;  4LDX A;  4F7U B;  1BYM A;  4XAX B;  3VV0 A;  3QHS A;  4HCZ A;  2CKK A;  4N4G A;  2EQK A;  3DB4 A;  2BIV A;  3M4Y A;  4C0D C;  1I4K 1;  3MET A;  5LL6 S;  3SWN B;  5LJ5 h;  4JLG A;  1W2B A;  2CZ0 B;  4M78 B;  2R57 A;  5A2Q E;  3OYC A;  4Q5W A;  3HRU A;  2DK3 A;  3BFM A;  4XTV A;  4F7U G;  5A0D A;  2RB6 A;  3OYG A;  1YBY A;  3C4S A;  4QQ6 A;  4ZTF A;  1VQ5 T;  2F5T X;  2KK4 A;  5HKC A;  1K8A U;  3OMC A;  1KQ2 A;  1IRE B;  2EKO A;  3OSV A;  4LDV A;  1PSE A;  3X26 B;  3A8O B;  5GAN 2;  1S72 T;  1VQ8 A;  4RCB A;  2DIQ A;  3VUB A;  4JS4 A;  1NE8 A;  2XDB A;  4OB1 B;  3R6O A;  4L6V 5;  5D6Y A;  3NFC A;  2DPP B;  3V7S A;  5I2S A;  3ZBD A;  4Y91 A;  3CCJ T;  2FHD A;  1G5V A;  1W4S A;  3QDR B;  3OS5 A;  4XK8 E;  3UPU A;  1Q86 C;  3TCJ A;  1KC8 U;  2XI9 A;  4OVA A;  3S6W A;  4MDX A;  2RHY A;  3CCL A;  1B34 B;  2LCC A;  2RHU A;  3PGG A;  4M75 F;  4OP0 A;  2HAX A;  4M75 A;  3LGF A;  4DQ2 A;  4EMK A;  2JTM A;  2XDP A;  5FRN A;  3JRZ A;  3RKW A;  3JB9 D;  3RMS A;  4A4E A;  4C8Q F;  4C8Q A;  3CCM T;  2LQK A;  4J8O A;  1LJO A;  5GAO n;  4X9C A;  4KBM B;  4OMF B;  2MWP A;  3LWH A;  2P0K A;  1KQS A;  1R8O B;  4JRI A;  5FU6 C;  3CCE T;  4C0D B;  2X35 A;  4M75 B;  5GMK m;  2XID A;  4M75 D;  1OYX A;  4EMK B;  1YJN T;  5GAM e;  3HHT B;  2FL7 A;  1QP2 A;  3GLX A;  3OYL A;  1VQ5 A;  4N4I A;  4F7U E;  1KHC A;  3OW2 A;  4C8Q D;  4IUT A;  3CC4 A;  5GAN d;  4E7L A;  1S72 A;  1VIE A;  2JZ2 A;  3JCM W;  1K73 C;  3QJY A;  4IUQ A;  2PVG B;  4IUR A;  4M75 G;  2GQV A;  3FRN A;  4B9X A;  2RHX A;  3JCM P;  3AHU A;  1LOJ A;  1M4Z A;  2K3Y A;  3M4G A;  3CCJ A;  4C8Q G;  1VQ7 T;  2Y4X A;  3JCM Q;  2YRV A;  1UGQ B;  1KC8 C;  5M9O A;  5GMK l;  1G3W A;  5GAM g;  3C95 A;  5EG2 A;  5CAI A;  2VGN A;  4FL6 A;  2MMP A;  2LVM A;  3ZEH A;  4BD3 A;  1LNX A;  2D0Q B;  2KVQ G;  3FLG A;  5CCA A;  2E12 A;  3QJ6 A;  1FWZ A;  3X24 B;  5KCO A;  5LJ5 d;  4RMO A;  1O9S A;  3CCM A;  2QA4 T;  4NOY A;  3UWN A;  2X4X A;  5A0G A;  3F70 A;  3CCE A;  2EIF A;  2JUF A;  2D9T A;  4Y28 E;  1VQM T;  3JB9 H;  2ZGW A;  1YJN A;  5GAO q;  3MEU A;  4A4G A;  2RI2 A;  2E65 A;  1MGQ A;  2DTI A;  5CVI A;  5CKH A;  1BI2 A;  4OB3 B;  5I2M A;  2QQA A;  3JCM V;  4M7A F;  1JJ2 A;  4PJO A;  3QSU A;  4M7A A;  1Y7X A;  2EYQ A;  3FC3 A;  1YHQ A;  1WPY A;  3V8L A;  3URG A;  4X34 A;  3PTA A;  4M75 E;  3OYB A;  5FRM A;  3JCM h;  1VQN T;  3EFR A;  3INZ A;  4PLI A;  1VQ7 A;  4D6W A;  2V8J A;  2LTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...