1R77A

Crystal structure of the cell wall targeting domain of peptidylglycan hydrolase ale-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'DDDKVKLYKTNKYGTLYKSESASFTANTDIITRLTGPFRSMPQSGVLRKGLTIKYDEVMKQDGHVWVGYNTNSGKRVYLPVRTWNESTGELGPLWGTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell Wall Targeting Domain of Glycylglycine Endopeptidase AL
molecule tags Hydrolase
source organism Staphylococcus capitis
publication title Cell Wall-targeting Domain of Glycylglycine Endopeptidase Distinguishes among Peptidoglycan Cross-bridges.
pubmed doi rcsb
total genus 21
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 3.4.24.75: Lysostaphin.
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08460 SH3_5 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.410 Mainly Beta Roll SH3 type barrels. Cell wall targeting domain of glycylglycine endopeptidase 1r77A00
2MK5A 1R77A 4LXCA
chains in the Genus database with same CATH superfamily
1ZSZA 2RQTA 4IUTA 1O9SA 3CPWS 2E64A 4M75E 5FWBA 5A2QE 2DIQA 2HQHA 1WQ7A 2GCXA 1Q86C 2R5AA 3EH2A 3H6ZA 3V7RA 5KCOA 2RHIA 3WVEB 3GNFB 4AFZC 1QWFA 3OS2A 5IAYA 1VQ6T 2OTLQ 2X3WD 3M58A 4FIBA 1I07A 1M1KU 1UB4A 3RR6A 4J9DA 3CMEA 1T3SA 4J9EA 3J81E 4OMLA 1TUGB 2E4HA 2X4XA 2GNCA 1S72A 3JRZA 3CPWP 2D9TA 1OEBA 5LJ5g 3CXCP 2YDLA 4OB3B 4M75D 1WI7A 2F69A 2HBPA 1M1KC 2L5QA 1VQ8Q 2L3QA 4M7AE 5CQYA 5DM7R 2LJ1A 4FYYB 5GANj 5KYYA 3PE0A 1YFNA 3ZL7C 1X69A 2LQKA 4Z88A 3I56T 3UWNA 2M16A 1K73R 5CKDA 4E2FB 1QCNA 1Z9QA 4ANJA 1TTHB 5D6WA 3MEVA 3I9QA 4XTWA 3ME9A 2XI9A 1JRIA 4C92G 4CC7A 4OGEA 1I4K1 4EMGA 4GLKA 2KNBB 1QCFA 2D1XA 3CCLT 2QGFB 3TQ7P 5GAOq 1KQ1A 4KGXB 5KYUA 1UGQB 2MIOA 3QDRB 4E7ZA 1UUEA 1W70A 4M7AG 2OTJQ 2EKHA 2W10A 3G6EQ 5FROA 3CCQT 1MUZA 1GBRA 3OYEA 2DL3A 1ACMB 4EMKA 3C4SA 1PKTA 1QVFA 2KROA 2FL7A 4N4HA 1IHWA 2MMPA 2EYQA 1V76A 4BY6C 3L1AA 3JB9F 2FRYA 3NGPA 1M3CA 3CCET 4XU0A 1M90U 1ARKA 3THKA 2PUKB 1E6HA 3CC7A 1KQ2A 2JM9A 2EYZA 3JCMg 1MMAA 3JCMh 2M0OA 2Z0WA 2JOYA 1RAAB 4EIKA 5CIUA 4C5IA 8AT1B 3H0FA 1KJWA 3VYGA 4OMMA 1VQNT 2AKKA 1VQNA 4EDUA 3MO8A 1S1NA 4RTYA 1ZUUA 2KXCA 2CS7A 1BKBA 4ZGDB 1WJQA 1C1AA 1N27A 3KFVA 3C12A 2RJFA 1IREB 1G3WA 5GAMd 3TSWA 1YCYA 1RI0A 1RACB 2P0KA 5KYWB 1QMCA 1Q82C 5I21A 5IHIA 1D3BA 4A4HA 1PM3A 2BKDN 1B34A 1M30A 4PJOF 4KGVB 1YNZA 2ABLA 4C8QB 1T0JA 4LUDA 3VS6A 3REAB 3ZEHA 4BI3A 1N8RR 2KXDA 3M55A 3QHSA 1VQMT 4LD9K 3RDVA 3EFRA 4ZGJB 2VWFA 4M77G 4Q5WA 1QKXA 2VKNA 3A1PA 1UG1A 1W6XA 2PVOB 1OULA 1NJIC 1UDLA 3JCMb 3G71T 1ZLMA 1WNLA 4P5NA 4FYWB 4A54A 3S6WA 7AT1B 2NWMA 1AD5A 3JCMd 4JRIA 4OMNA 1ZSGA 2MPXC 2RK2A 2ROTA 2FB7A 2EKOA 4IUUA 4XU3A 3KUFA 2QI2A 1D0ZA 1M3BA 1YJNA 3H8ZA 1GCQA 2EVRA 5LJ5h 4JLGA 3V7CA 2DF6A 2OAWA 4IIMA 2PZ1A 4F7UG 4F7UB 3SFMA 1WHJA 4X1VA 2JMAA 3META 5A0DA 1KG1A 2GQVA 5GAMj 3NTKA 2E3IA 1YJ9Q 1PRMC 5C0MA 5LJ3d 3NTIA 1SHFA 1AZGB 2MYSA 2JS0A 2AKLA 2JW4A 4BDYA 2F5KA 2LNHB 2JUFA 4M4ZA 3A8GB 4E7KA 2FZCB 1RLQC 2O31A 1ZA2B 3H0HA 4ZTFA 1X6BA 3HFOA 2CSIA 1VQNQ 2DE0X 2YRDA 4NL3A 4KULA 2PNIA 3CC4Q 4EPCA 4L59A 5GAOr 3A8LB 2EGAA 2MK5A 4ZTJA 1T3LA 2DYIA 4L6V5 4CI0C 3LLRA 4F7UE 1JO8A 4JJNK 2NUTB 1VQMA 1R0CB 3JB9D 3JB9H 3CC7T 4MDWA 3CPWA 3LGFA 4RMOA 1MHNA 4R56A 2KK4A 4M78D 2VV5A 3ER0A 3WXMB 2VUBA 2L8DA 2RQVA 3KXTA 1QVPA 2DTOA 4LDVA 1XNIA 2GBQA 4PJLA 2XD0A 1K76A 2XHCA 4AG2C 1M1FA 5LJ5j 2XICA 4XAXB 4DBRA 1NZ9A 2DKGA 1WJRA 4NOYA 4DBQA 3FJ5A 2EJFA 3G6EA 2OTJA 1VOMA 3SDZA 3JCMQ 1M8MA 3PTAA 2RH2A 5C6SA 1RAEB 4B9XA 1OV3A 1AT1B 3V8JA 2XMFA 1JU5C 3REBB 4IUQA 5FU6C 1VQ8A 2CZ6B 1K8AR 2R58A 3CCUQ 3QO3A 2IG0A 2P0PA 2V26A 2HEQA 1M27C 3S3NA 3QJ6A 3I56A 2KE9A 4FM4B 3BDUA 2KRNA 1VUBA 2BE7D 1CKBA 5DLOA 2QQAA 4PK4A 2YRVA 3OSSC 2EBPA 2QG9B 2LT1A 1IO6A 3QWXX 3L2RA 4JJCA 5GANh 4BACA 1QQJA 3N5BB 2LX7A 4PLLA 2QA4A 1Q81R 3M56A 1R77A 5GMKi 3M0UA 1VA7A 3VS2A 2RI5A 3PMIA 1VQPT 1VQOT 5IHNA 2D8HA 2AZSA 2QASA 2FPEA 2DETA 2YUQA 3AT1B 2F5TX 2A08A 1VYTA 3M0RA 1WHKA 3S3MA 1HK9A 1OZ2A 4AMCA 3LWIA 3GLXA 2QEXA 2CZ0B 3VS0A 4O6JA 1QWEA 4BY6B 1MV0B 1K8AC 2ED0A 4PFZA 2VASA 4OP0A 2RI3A 4BE0A 1YJWQ 2D6FA 5CKEA 1ZUYA 2KYMA 1U1TA 3MP8A 2PUOB 3UDCA 2DM1A 5DY9A 5GMKm 2RMOA 4F04B 1VQLA 2V8IA 2NUPA 3OS5A 3DLLA 3RMQA 1D1CA 3OYAA 1WXUA 2LQ8A 2MOXA 2B8AA 1D3BB 1V29B 3G71A 1ZA1B 3QBYA 1YIJT 1O75A 2LDMA 4QT7A 5CK9A 4C0DB 1K9MC 3QG1A 4C8QA 5GANd 2CP7A 3CCMA 4LD6A 1TS9A 1QP3A 2DXBA 2NYSA 2DNUA 2VYTA 2WACA 2HL5C 2C06A 1Q7YC 2BZXA 2RQUA 4WTOB 3V8KA 1GFCA 4M77A 3CCLA 1QVGA 5CAIA 4QW2A 3U23A 3OSVA 3HPWA 1UE9A 2A37A 2FZGB 3G1JA 1YI2A 4PJMA 3PIOA 2AK5A 3CEYA 1G3TA 1ZX6A 5L23A 1X2KA 2D0NA 4RTWA 1RADB 2FYKA 3G4ST 3J7AF 3CCSQ 2DTIA 5AT1B 5CKBA 2KEAA 3EG0A 3UATA 2LTOA 4C92E 1ZSZB 1LCKA 4QVZA 1TG0A 1TH7A 1XTDA 3M0TA 1ABQA 4J9IA 3CC2Q 1YITA 3X28B 2DIGA 4M77B 3EGXA 3SWNB 4AFUC 1SSHA 1Q95G 3CCEA 4M7AA 2HNIA 2M9UA 1Q7YR 1WHMA 4DOWA 1WXBA 3VRYA 4M7DD 1SG5A 1W2BP 2E3HA 4E6RA 3OYNA 4X9DA 3JCMW 3G71Q 1YWPA 1JJ2S 4J9CA 4J9BA 4NL2A 4CC3A 4Z89A 4K11A 2EJ9A 2DERA 3M54A 3EGUA 4OMOA 2DILA 2ENMA 3I5SA 3I55T 2LT4A 3M0SA 4JS4A 2L89A 1K0XA 4PFPA 3CCST 2HD0A 3DB4A 4JJBA 2IPOB 3ZBDA 3OQ5A 2LJ0A 5GMKe 1W2BA 4XTYA 3JB9I 4HXJA 1NPPA 3HFNA 1PCXA 5GAN2 2J06A 3I55A 1X01A 1SPKA 5A0LA 5FRNA 3MEWA 4MZPA 1N8RC 2QYZA 2BE9B 1NG2A 2K57A 3V7SA 2L0AA 5GAMe 1J3TA 1WQWA 2DVJA 4OB2B 2EWNA 5GANf 4QKUA 4HKEA 4OGCA 3LW5E 4DBFA 3D7SB 4F14A 1OYXA 3ZFJA 1WPYA 1I8FA 4M78F 2E6ZA 1K0SA 4FW2A 1QCOA 2J7IA 3OY9A 2J6KA 1IGQA 4CC2A 4F7UF 1AWXA 2JVVA 2O4XB 4BE1A 3BY7A 1RAGB 2DK3A 2EYXA 4M7AC 1FMKA 2EGCA 2VC8A 4EMKC 4A4FA 2V1QA 4E7IA 4BB7A 3P8BB 4II1A 4RTUA 4QVDA 3GP8A 1RABB 1YJWA 2B86A 1VQMQ 2EQKA 3LH0A 4LN2A 4RCCA 3FC3A 3G4SQ 3CCEQ 1VQLQ 4M77E 4EMKB 1WDXA 4AG1C 2X4YA 2K6DA 3O8VA 3HKSA 1SKUB 2GGRA 2X51A 1KD1C 4PJOA 1TUDA 2DL8A 3OMCA 3I5RA 1JXMA 4ME7A 1YHQA 3CMAT 4PJOC 1VQ6A 3PNWC 2SEMA 1BI3A 3CCMT 1SF9A 1BIBA 1I5OB 4HVWA 2LQWA 1G83A 4IIOA 4XTUA 3RMSA 5J3BA 3X25B 4MMLA 4JJDA 1VQ4A 4HT8A 4LNPA 2OTJT 3PFSA 4F16A 5EG2A 3GPLA 2YLBA 3OS1A 2H3EB 2VVKA 3CCLQ 2GFAA 3QYGB 1AZEA 4PLIA 4PFOA 1BBZA 2F2VA 1OX9A 3M0PA 1OOTA 2JS2A 1JQQA 4RUGA 2RI2A 2VXFA 3OYJA 1S72T 1YITQ 4LDYA 4PJOG 1FMWA 1A0NB 4CRIA 3FEOA 1JJ2A 1YITT 3R6OA 1UEBA 1KQSS 2DVEA 2LMJA 1VYVA 2KYBA 4HVUA 1N9SA 3NPFA 4J9FA 2FZKB 5I2SA 2CP6A 1YP5A 2KBTA 3FRNA 3OYBA 1WHHA 2L3RA 3CCUT 3SD4A 4ORZA 2LVMA 2QXFA 5J26A 2QA4Q 1XJWB 2CDTA 2OI3A 1Q86U 3A8HB 3F70A 1V1CA 2NUPB 4J9GA 3SWNC 3G6ET 3CXCS 3LX7A 2CKKA 2RJCA 6AT1B 3E9FA 3RKYA 2F2XA 3M57A 3OYDA 2QA4T 4KUDK 4FSXA 2ZPFB 1QVGS 2CH4A 2CT3A 2CP5A 2ZPHB 3RKXA 1MNEA 2EFIA 1AVZC 1JBMA 1M5Q1 1K4US 2JM8A 1KD1R 4E47A 3I35A 2RHYA 2XDPA 4N0AC 1BYMA 5GAN6 4C5EA 1D1AA 1VQLT 2JN0A 4M7DF 2L3SA 1VQ5A 1B07A 2KY9A 3QYHB 2K7AA 3LH5A 1XOVA 2DO3A 4TVRA 1D0XA 1NJIU 2ZCFB 2RO0A 3JCMe 2V1RA 1E6GA 5CKHA 4VUBA 5J39A 4HCZA 4FSSA 1WJSA 5HK0A 1KQSA 1N5ZA 1IHVA 3M9QA 2E6NA 1KK7A 3EHRA 5GAOp 1GFDA 1QP2A 1WZOA 1N8RU 5FRMA 2PVDB 4PJNA 3TU4K 1KHCA 1X6OA 2EYWA 1ZUKA 2ZPBB 2JTMA 1M4ZA 2LC4A 2EPDA 4RTZA 3CCMQ 1N6AA 2O01E 1X2QA 3FB9A 1VQ6Q 3EFOB 1K73C 2F2WA 2HZYA 4C8QD 3X26B 3QXEB 2XG8D 5AYFA 3UF4A 1I5LA 1LOJA 2RHUA 4GLMA 2D8JA 5GAMg 4JZ4A 3X20B 5GJVB 3M59A 4UC4A 3MP6A 3QUIA 1QLYA 2K9GA 4A4GA 3G4SA 1OU8A 3LGLA 3FIFA 4J6WA 5D7UA 2DMOA 3Q1JA 4M7AD 4J83A 5KYXA 2LNVA 2EQIA 2HSEB 2RNAA 1VQ4T 1YI2T 4QQGA 2DD5A 4J9HA 2A3LA 4Z8AA 5GAMh 3QSUA 1UGSB 2PU9B 5GAOm 3R6NA 5KCHA 2CT4A 2QQBA 4HCKA 2CP3A 2O88A 2AIRB 2O4XA 5KYNA 2E41A 3CMAA 3CCUA 3KBGA 4ESRA 3QZ5B 2A36A 2LCLA 3SHWA 4C92F 2KI7A 2DJZA 3NMZC 3JCMf 1EFNA 5HK3A 4C5GA 1SEMA 2XKOC 3P8DA 1NEGA 4RCBA 1UHCA 4AT1B 1LNXA 2QTXA 4DBHA 2MWPA 1QVFS 1FXXA 1WLPB 5LJ5d 4ZGEB 1R0BG 2LP5A 2K4YA 3M4YA 1VQPA 2HAXA 2XDDA 1ZQ1A 2GTJA 2YUNA 4B9WA 5IH2A 4Y91A 3CD6T 1OPKA 5FU6B 4A53A 5LJ5f 2HSPA 3HRTA 2YHTA 4XTVA 3JCMP 2OJ2A 1QW1A 2AZVA 2ZPIB 1G5VA 1U5SA 3PGGA 1W4SA 3EGDA 1AWWA 1IGUA 1K9MR 4KT0E 1H92A 4HCBA 5GANe 2E5KA 1NYFA 2FPFA 3BE3A 1AWOA 4OF1A 1OX8A 4JRKA 2VGNA 3MCAB 4ZNXA 4C92A 3CXCA 3CC4A 3LYIA 1BB9A 1MMGA 3A8OB 4MDXA 1B3QA 2LCSA 4ELZC 1X6GA 1Y7XA 2M0YA 1JB0E 2FEIA 3UPUA 3QIIA 1K8AU 1H8KA 3CC2T 1Y71A 4LDXA 3MJXA 2KRSA 3CBPA 4C0FA 4J7FA 1M90C 4X34A 1H641 4LDWA 3FJPA 1K9MU 2X4JA 2Y4XA 1KFZA 2JTEA 4M7DB 4C92C 3OYMA 1M2VB 2D0QB 2E70A 3OMGA 4GY5A 3M53A 4OB0B 2NUTA 3HTRA 1VYUA 4RTTA 1G2BA 1RLPC 1M1GA 3P8HA 4J5YA 1VQ9Q 1GBQA 1QVGP 4JUVA 4M78C 2JZ2A 1JEGA 1MV3A 2H3JA 4D6WA 1ZBJA 2VXEA 1VQOQ 1GCQC 4KGZB 4GBQA 3EAEA 1Q7YU 2COYA 2HDAA 2MI6A 3DLMA 3M0QA 2DEUA 1LJOA 3RKWA 3VJPA 3OYGA 5LL6S 3GIBA 2K5LA 3QZ9B 3CBOA 2M51A 1MGQA 3EH1A 1YHQQ 4RKUE 1YJ9A 1M3AA 2KVQG 1T0HA 1Y0MA 1NM7A 2CP2A 2ED1A 1NE8A 3MP1A 2OAUA 4BUGA 1D0YA 1RL2A 3UT1A 1TWBA 3RERA 4FYXB 4A4KA 2DJQA 2FG0A 1HD3A 2P0QA 4RTVA 2BTTA 2CZ1B 4C0GA 1PRLC 4JRQA 3HP9A 2E1HA 3EG3A 2KMTA 1PD0A 1TU0B 2M02A 3OYYA 4RG8A 2EQMA 3L42A 1KHIA 9ATCB 1IB8A 4C8QG 1YJNT 3M5AA 2JTFA 1M9SA 2DD4A 2RJDA 4OMFB 3E2UA 3BW1A 3OYKA 3SEMA 3HRSA 2P4TA 2F1LA 3EHQA 4LDUA 3OW2A 5GANg 5LJ3j 1PNJA 1LPLA 4M7AB 2E5QA 3CQTA 2HBWA 1OPLA 3PVQA 4M7AF 2J05A 5DLQE 4M75A 3MEUA 1Y07A 1KQSP 2EGEA 2FO0A 4DQ2A 4MZMA 3EFSA 1PC0A 1GL5A 4A4EA 5KYXB 2QDYB 3EGXB 4C8QE 2XIDA 3GBQA 2GTOA 3I56Q 1TSFA 1S72Q 2WSFE 2YRCA 3VS3A 1VQKQ 1NBEB 4M7DG 1YN8A 1IXDA 2IVWA 3IQLA 4J6XA 3S3OA 2SRCA 4PKCC 2IIMA 4D8KA 2C0TA 4M75B 1U3OA 3L2QA 1TOVA 1IZ6A 3M4GA 2ATCB 2EYYA 5LJ3e 5GAOl 1K9AA 3CCJA 1WIEA 2P84A 3CC2A 3E1SA 3VS5A 2KR3A 5GMKh 2ZGWA 1FX7A 2CSQA 4E7LA 1PKSA 1YBYA 5FU7C 4N4GA 3OW2S 4Y28E 1YHQT 1YJ9T 3VS4A 4KH0B 4E7JA 3H9NA 2K2MA 2K3YA 3NTHA 4PJOE 2R57A 3OYHA 3GOXA 2QDLA 2ROLA 5FLXE 1VQ7Q 3EG9A 1KD1U 1HXDA 1OU9A 4BDZA 5GAN3 1SRLA 5LJ3g 3CC7Q 3OA6A 4M77C 3DKMA 1R8OB 1FMVA 5KE3A 2JXBA 4M7DC 3L2VA 5GAOn 2DLPA 1EX4A 2CP0A 4M75C 1ZSZC 4C92D 3OYCA 3HL8A 1M2VA 3RBBB 2BIVA 1VQ5T 1WFWA 1ZHIA 1K1ZA 4XTZA 3BDLA 1Z9ZA 1FWZA 1UTIA 2EAYA 3VRZA 1HJDA 2BUDA 4PJOD 1W2BS 2AHJB 3NFCA 3H41A 4M78A 1VQKA 1SRMA 4J8OA 1RI9A 2DL4A 4FT2A 3RNJA 3C94A 4JLIA 4M77F 4NS5A 5CO7A 1ZBXA 4N4IA 2KGTA 2HQEA 2YT6A 2Y4YA 3JB9J 4RG2A 3E19A 2O9VA 3UA7A 1U1SA 3MPUB 2X4WA 1RAFB 3URGA 2LCCA 1I1JA 4HA8A 1VQ9A 5GMKj 2FVUA 1WX6A 4BD3A 4LUEA 3UA6A 4OMQA 1I81A 4XTXA 3I55Q 2V8KA 2KRMA 2CGHA 3OB9A 1OI1A 2ESWA 1Q82R 1U8RA 1G8XA 4IUPA 3CCVT 2DTHA 3CD6A 2DXTA 3OS0A 2A28A 1D09B 2AT1B 2QQSA 4ATOA 2NUZA 3OYLA 1NJIR 2DBMA 2O2OA 2DXUA 4WF2A 3HSBA 4M75G 2J6OA 3MEAA 2LQNA 1K73U 5HCKA 2CYZB 3SWNA 5KYUB 2DFUA 4DA4A 2L3PA 1C6VX 4L5GA 2YUPA 5L8RE 3H0IA 2LZ6B 1WA7A 1YCSB 1UGPB 1PHTA 4DEYA 2OX7A 3MKDA 2CH4W 1Q81C 1WXTA 3C0CA 2EIFA 5IHKA 1OZ3A 4BI4A 5GAN4 2DZCA 1MNDA 4JPBW 2KAFA 3HRUA 2VB6A 4DOVA 2GF7A 2MF2A 2RPNA 3ASKA 5FW9A 4YTLA 3CCRA 3VYHB 3JV3A 1E7OA 4PJJA 2RK1A 2K5FA 1PG5B 2PTKA 1LVKA 2DL5A 4F7UA 2W0ZA 2DX1A 5IXFA 2FPDA 1VQOA 4MZTA 2QK0A 1X43A 2JT4A 2RQRA 4C8QF 3TSZA 1B34B 5D6YA 1YIJA 4QQDA 4IUVA 4OVAA 1QVFP 1KC8R 3JB9G 1RAHB 4XU1A 2X35A 3PIPA 3OW2P 4DEXA 3EFOA 5I2MA 1RAIB 1M90R 2FHDA 4C0ZA 4Y92A 2K3XA 3QJYA 1NLPC 2KT8A 1BIAA 3CCRQ 5GAN7 1N9RA 2I2LA 2DBKA 2Y90A 1YJWT 2RA2A 3OYIA 1VQ8T 3JCMc 3VUZA 2MCNA 5I11A 1VQ5Q 4C5HA 2EW3A 2WSCE 1HYOA 3CCQQ 4IKFA 2E10A 2HL3A 1UHFA 4F17A 4V2SA 3JSCA 1KSWA 4BI8B 1M8VA 1BU1A 2PQWA 4A63B 4ELYC 4MMKA 2QTVA 1VQPQ 2RN8A 3QKJA 2M1HA 4M75F 1PD1A 4BE2A 1DJ7B 1BI2A 2OTLT 5CQXA 3EG9B 3OBYA 2QQRA 2QGGA 5KE2A 1RUWA 1NPRA 2DL7A 4M78B 3RUXA 3OYFA 1VIFA 2CREA 2DRKA 2XDBA 2DEQA 2X9HA 4PL6A 1Q86R 2KT1A 1U06A 3TVTA 4KBMB 3QWYA 2QEXQ 3JAME 1Q81U 5HKCA 4R0KA 5GAN5 4AFQC 1C0MA 4HCCA 1I0CA 3PVLA 1CKAA 2ZPEB 2LX9A 5HY6A 3JCMX 5GAMf 1H3HA 5M9OA 4B6MA 4FL6A 1WHGA 2QAZA 3VUBA 1YJNQ 1UJ0A 2EQUA 2J6FA 2HCKA 2EQJA 2RQWA 4AFSC 3RIRA 4FCYA 3CCSA 3SB2A 3VU3C 5FWCA 1VQKT 1OQKA 4X9CA 2RD1A 2A0FB 4FYVB 3VV0A 1GCPA 2C0OA 3LWHA 2LJ3A 2BZ8A 5IXBA 2QEXT 1JXOA 2H8HA 5LJ5e 1ABOA 5IN1A 2RB6A 4EMHA 3CCJT 1WHLA 1AOJA 5EC7A 2QQ9A 2K5IA 3X24B 2C0IA 2MAMA 4LXCA 5A0GA 4WCIA 1PSEA 3E9GA 5CR2A 1NYGA 3O5ZA 4QQ6A 3EGDB 2KDSA 2DZ9A 2COZA 1SHGA 4C0DC 3L2ZA 3AHUA 1M2OA 3T9NA 4XU2A 3WVDB 4N0AA 1IRXA 2CUBA 2ZAEA 4JZ3A 2P4RA 1NLOC 4CC4B 1VQ9T 5IT9E 1EZZB 3NHNA 3CMAQ 3CC4T 1B7TA 4JDSA 5GMKl 3JCMV 3QDFA 1PSFA 2KQWA 2K3BA 3CCRT 4OB1B 1MMDA 2FRWA 4XK8E 4JRPA 1HSQA 5CVIA 2PVGB 5KYYB 4KUIA 3GF5A 1BCMA 2NLUA 2V8JA 1WYXA 2VGMA 5LJ3f 3PMTA 3CBMA 1GRIA 3FDRA 3RESA 1QKWA 1W1FA 3GNGA 2LRQA 3TEEA 4XQ3A 2R5MA 2ZZDA 5I22A 2RF0A 4J6YA 4HT9A 4PNOA 4KRTA 4M7DE 4C8QC 3VS1A 4JS5A 1UGRB 2YUOA 4E7SA 4M78E 3CMET 5D6XA 2RM4A 2E12A 1BI0A 3CCVA 3L2WA 2JNGA 2HKNA 3MHXA 1YWOA 1XQHA 3L2UA 3CCQA 3PT9A 2YWWA 2HMAA 2KSSA 1KC8C 2XU8A 3DB3A 2XK0A 1WGSA 5ECAA 1GXIE 1BI1A 3VS7A 1UFFA 4O5VA 5GJWB 4OMPA 4C92B 1X27A 2RHXA 3ULRB 2GQIA 2CZ7B 3V8LA 1AHJB 2HQXA 2RJEA 1D1BA 2YLCA 1H3ZA 1P92A 1UJYA 1BCOA 3C95A 3A8MB 4M78G 3BFMA 3VKIA 1UECA 1JJ2P 2JJ9A 2K79A 4QVCA 4M77D 5CKFA 2GFUA 4FW1A 1G3SA 2YSQA 3EG1A 2JMCA 4HVVA 1MMNA 1TXQA 1TUCA 4FU6A 3CPFA 3G7ZA 8ATCB 3CCVQ 4PJOB 1Q82U 4KH1B 2E65A 2O9SA 3FLGA 1VQ7A 1VQ4Q 1Y96A 1AEYA 3CMEQ 3OBWA 1PWTA 2L2PA 4LE9A 2MWOA 2G3RA 2OTLA 1EIFA 3HHTB 3QPHA 4R55A 5GAN8 2CUDA 1AWJA 3CD6Q 3EG2A 1VIEA 2EJGA 1Y57A 5LJ3h 4ZN3A 1VQ7T 2RHZA 2DRMA 4E7HA 2ECZA 1F1BB 2WSEE 3CCJQ 1CSKA 1G3YA 2A7YA 3INZA 1KIKA 4ZN1A 1BK2A 1UGVA 2G6FX 1NEBA 2X3XD 1Y96B 1X75C 2DA9A 3TCJA 2DPPB 5FU7B 5KYWA 2ZPGB 5KH6A 2COWA 4FT4A 2DYBA 2BZYA 2I0NA 3A5ZB 3A98A 2DAQA 2HKQB 4J7IA 4RTXA 4IURA 2K2VA 3TREA 1M1KR 5CCAA 1SSFA 1YIJQ 3JCMJ 3J80E 4D8DA 1FYNA 1YI2Q 2YXYA 4M7DA 4Z02A 2DXCA 1KC8U
chains in the Genus database with same CATH topology
2MK5A 1R77A 4LXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MK5 A;  1R77 A;  4LXC A; 
#chains in the Genus database with same CATH topology
 1ZSZ A;  2RQT A;  4IUT A;  1O9S A;  3CPW S;  2E64 A;  4M75 E;  5FWB A;  5A2Q E;  2DIQ A;  2HQH A;  1WQ7 A;  2GCX A;  1Q86 C;  2R5A A;  3EH2 A;  3H6Z A;  3V7R A;  5KCO A;  2RHI A;  3WVE B;  3GNF B;  4AFZ C;  1QWF A;  3OS2 A;  5IAY A;  1VQ6 T;  2OTL Q;  2X3W D;  3M58 A;  4FIB A;  1I07 A;  1M1K U;  1UB4 A;  3RR6 A;  4J9D A;  3CME A;  1T3S A;  4J9E A;  3J81 E;  4OML A;  1TUG B;  2E4H A;  2X4X A;  2GNC A;  1S72 A;  3JRZ A;  3CPW P;  2D9T A;  1OEB A;  5LJ5 g;  3CXC P;  2YDL A;  4OB3 B;  4M75 D;  1WI7 A;  2F69 A;  2HBP A;  1M1K C;  2L5Q A;  1VQ8 Q;  2L3Q A;  4M7A E;  5CQY A;  5DM7 R;  2LJ1 A;  4FYY B;  5GAN j;  5KYY A;  3PE0 A;  1YFN A;  3ZL7 C;  1X69 A;  2LQK A;  4Z88 A;  3I56 T;  3UWN A;  2M16 A;  1K73 R;  5CKD A;  4E2F B;  1QCN A;  1Z9Q A;  4ANJ A;  1TTH B;  5D6W A;  3MEV A;  3I9Q A;  4XTW A;  3ME9 A;  2XI9 A;  1JRI A;  4C92 G;  4CC7 A;  4OGE A;  1I4K 1;  4EMG A;  4GLK A;  2KNB B;  1QCF A;  2D1X A;  3CCL T;  2QGF B;  3TQ7 P;  5GAO q;  1KQ1 A;  4KGX B;  5KYU A;  1UGQ B;  2MIO A;  3QDR B;  4E7Z A;  1UUE A;  1W70 A;  4M7A G;  2OTJ Q;  2EKH A;  2W10 A;  3G6E Q;  5FRO A;  3CCQ T;  1MUZ A;  1GBR A;  3OYE A;  2DL3 A;  1ACM B;  4EMK A;  3C4S A;  1PKT A;  1QVF A;  2KRO A;  2FL7 A;  4N4H A;  1IHW A;  2MMP A;  2EYQ A;  1V76 A;  4BY6 C;  3L1A A;  3JB9 F;  2FRY A;  3NGP A;  1M3C A;  3CCE T;  4XU0 A;  1M90 U;  1ARK A;  3THK A;  2PUK B;  1E6H A;  3CC7 A;  1KQ2 A;  2JM9 A;  2EYZ A;  3JCM g;  1MMA A;  3JCM h;  2M0O A;  2Z0W A;  2JOY A;  1RAA B;  4EIK A;  5CIU A;  4C5I A;  8AT1 B;  3H0F A;  1KJW A;  3VYG A;  4OMM A;  1VQN T;  2AKK A;  1VQN A;  4EDU A;  3MO8 A;  1S1N A;  4RTY A;  1ZUU A;  2KXC A;  2CS7 A;  1BKB A;  4ZGD B;  1WJQ A;  1C1A A;  1N27 A;  3KFV A;  3C12 A;  2RJF A;  1IRE B;  1G3W A;  5GAM d;  3TSW A;  1YCY A;  1RI0 A;  1RAC B;  2P0K A;  5KYW B;  1QMC A;  1Q82 C;  5I21 A;  5IHI A;  1D3B A;  4A4H A;  1PM3 A;  2BKD N;  1B34 A;  1M30 A;  4PJO F;  4KGV B;  1YNZ A;  2ABL A;  4C8Q B;  1T0J A;  4LUD A;  3VS6 A;  3REA B;  3ZEH A;  4BI3 A;  1N8R R;  2KXD A;  3M55 A;  3QHS A;  1VQM T;  4LD9 K;  3RDV A;  3EFR A;  4ZGJ B;  2VWF A;  4M77 G;  4Q5W A;  1QKX A;  2VKN A;  3A1P A;  1UG1 A;  1W6X A;  2PVO B;  1OUL A;  1NJI C;  1UDL A;  3JCM b;  3G71 T;  1ZLM A;  1WNL A;  4P5N A;  4FYW B;  4A54 A;  3S6W A;  7AT1 B;  2NWM A;  1AD5 A;  3JCM d;  4JRI A;  4OMN A;  1ZSG A;  2MPX C;  2RK2 A;  2ROT A;  2FB7 A;  2EKO A;  4IUU A;  4XU3 A;  3KUF A;  2QI2 A;  1D0Z A;  1M3B A;  1YJN A;  3H8Z A;  1GCQ A;  2EVR A;  5LJ5 h;  4JLG A;  3V7C A;  2DF6 A;  2OAW A;  4IIM A;  2PZ1 A;  4F7U G;  4F7U B;  3SFM A;  1WHJ A;  4X1V A;  2JMA A;  3MET A;  5A0D A;  1KG1 A;  2GQV A;  5GAM j;  3NTK A;  2E3I A;  1YJ9 Q;  1PRM C;  5C0M A;  5LJ3 d;  3NTI A;  1SHF A;  1AZG B;  2MYS A;  2JS0 A;  2AKL A;  2JW4 A;  4BDY A;  2F5K A;  2LNH B;  2JUF A;  4M4Z A;  3A8G B;  4E7K A;  2FZC B;  1RLQ C;  2O31 A;  1ZA2 B;  3H0H A;  4ZTF A;  1X6B A;  3HFO A;  2CSI A;  1VQN Q;  2DE0 X;  2YRD A;  4NL3 A;  4KUL A;  2PNI A;  3CC4 Q;  4EPC A;  4L59 A;  5GAO r;  3A8L B;  2EGA A;  2MK5 A;  4ZTJ A;  1T3L A;  2DYI A;  4L6V 5;  4CI0 C;  3LLR A;  4F7U E;  1JO8 A;  4JJN K;  2NUT B;  1VQM A;  1R0C B;  3JB9 D;  3JB9 H;  3CC7 T;  4MDW A;  3CPW A;  3LGF A;  4RMO A;  1MHN A;  4R56 A;  2KK4 A;  4M78 D;  2VV5 A;  3ER0 A;  3WXM B;  2VUB A;  2L8D A;  2RQV A;  3KXT A;  1QVP A;  2DTO A;  4LDV A;  1XNI A;  2GBQ A;  4PJL A;  2XD0 A;  1K76 A;  2XHC A;  4AG2 C;  1M1F A;  5LJ5 j;  2XIC A;  4XAX B;  4DBR A;  1NZ9 A;  2DKG A;  1WJR A;  4NOY A;  4DBQ A;  3FJ5 A;  2EJF A;  3G6E A;  2OTJ A;  1VOM A;  3SDZ A;  3JCM Q;  1M8M A;  3PTA A;  2RH2 A;  5C6S A;  1RAE B;  4B9X A;  1OV3 A;  1AT1 B;  3V8J A;  2XMF A;  1JU5 C;  3REB B;  4IUQ A;  5FU6 C;  1VQ8 A;  2CZ6 B;  1K8A R;  2R58 A;  3CCU Q;  3QO3 A;  2IG0 A;  2P0P A;  2V26 A;  2HEQ A;  1M27 C;  3S3N A;  3QJ6 A;  3I56 A;  2KE9 A;  4FM4 B;  3BDU A;  2KRN A;  1VUB A;  2BE7 D;  1CKB A;  5DLO A;  2QQA A;  4PK4 A;  2YRV A;  3OSS C;  2EBP A;  2QG9 B;  2LT1 A;  1IO6 A;  3QWX X;  3L2R A;  4JJC A;  5GAN h;  4BAC A;  1QQJ A;  3N5B B;  2LX7 A;  4PLL A;  2QA4 A;  1Q81 R;  3M56 A;  1R77 A;  5GMK i;  3M0U A;  1VA7 A;  3VS2 A;  2RI5 A;  3PMI A;  1VQP T;  1VQO T;  5IHN A;  2D8H A;  2AZS A;  2QAS A;  2FPE A;  2DET A;  2YUQ A;  3AT1 B;  2F5T X;  2A08 A;  1VYT A;  3M0R A;  1WHK A;  3S3M A;  1HK9 A;  1OZ2 A;  4AMC A;  3LWI A;  3GLX A;  2QEX A;  2CZ0 B;  3VS0 A;  4O6J A;  1QWE A;  4BY6 B;  1MV0 B;  1K8A C;  2ED0 A;  4PFZ A;  2VAS A;  4OP0 A;  2RI3 A;  4BE0 A;  1YJW Q;  2D6F A;  5CKE A;  1ZUY A;  2KYM A;  1U1T A;  3MP8 A;  2PUO B;  3UDC A;  2DM1 A;  5DY9 A;  5GMK m;  2RMO A;  4F04 B;  1VQL A;  2V8I A;  2NUP A;  3OS5 A;  3DLL A;  3RMQ A;  1D1C A;  3OYA A;  1WXU A;  2LQ8 A;  2MOX A;  2B8A A;  1D3B B;  1V29 B;  3G71 A;  1ZA1 B;  3QBY A;  1YIJ T;  1O75 A;  2LDM A;  4QT7 A;  5CK9 A;  4C0D B;  1K9M C;  3QG1 A;  4C8Q A;  5GAN d;  2CP7 A;  3CCM A;  4LD6 A;  1TS9 A;  1QP3 A;  2DXB A;  2NYS A;  2DNU A;  2VYT A;  2WAC A;  2HL5 C;  2C06 A;  1Q7Y C;  2BZX A;  2RQU A;  4WTO B;  3V8K A;  1GFC A;  4M77 A;  3CCL A;  1QVG A;  5CAI A;  4QW2 A;  3U23 A;  3OSV A;  3HPW A;  1UE9 A;  2A37 A;  2FZG B;  3G1J A;  1YI2 A;  4PJM A;  3PIO A;  2AK5 A;  3CEY A;  1G3T A;  1ZX6 A;  5L23 A;  1X2K A;  2D0N A;  4RTW A;  1RAD B;  2FYK A;  3G4S T;  3J7A F;  3CCS Q;  2DTI A;  5AT1 B;  5CKB A;  2KEA A;  3EG0 A;  3UAT A;  2LTO A;  4C92 E;  1ZSZ B;  1LCK A;  4QVZ A;  1TG0 A;  1TH7 A;  1XTD A;  3M0T A;  1ABQ A;  4J9I A;  3CC2 Q;  1YIT A;  3X28 B;  2DIG A;  4M77 B;  3EGX A;  3SWN B;  4AFU C;  1SSH A;  1Q95 G;  3CCE A;  4M7A A;  2HNI A;  2M9U A;  1Q7Y R;  1WHM A;  4DOW A;  1WXB A;  3VRY A;  4M7D D;  1SG5 A;  1W2B P;  2E3H A;  4E6R A;  3OYN A;  4X9D A;  3JCM W;  3G71 Q;  1YWP A;  1JJ2 S;  4J9C A;  4J9B A;  4NL2 A;  4CC3 A;  4Z89 A;  4K11 A;  2EJ9 A;  2DER A;  3M54 A;  3EGU A;  4OMO A;  2DIL A;  2ENM A;  3I5S A;  3I55 T;  2LT4 A;  3M0S A;  4JS4 A;  2L89 A;  1K0X A;  4PFP A;  3CCS T;  2HD0 A;  3DB4 A;  4JJB A;  2IPO B;  3ZBD A;  3OQ5 A;  2LJ0 A;  5GMK e;  1W2B A;  4XTY A;  3JB9 I;  4HXJ A;  1NPP A;  3HFN A;  1PCX A;  5GAN 2;  2J06 A;  3I55 A;  1X01 A;  1SPK A;  5A0L A;  5FRN A;  3MEW A;  4MZP A;  1N8R C;  2QYZ A;  2BE9 B;  1NG2 A;  2K57 A;  3V7S A;  2L0A A;  5GAM e;  1J3T A;  1WQW A;  2DVJ A;  4OB2 B;  2EWN A;  5GAN f;  4QKU A;  4HKE A;  4OGC A;  3LW5 E;  4DBF A;  3D7S B;  4F14 A;  1OYX A;  3ZFJ A;  1WPY A;  1I8F A;  4M78 F;  2E6Z A;  1K0S A;  4FW2 A;  1QCO A;  2J7I A;  3OY9 A;  2J6K A;  1IGQ A;  4CC2 A;  4F7U F;  1AWX A;  2JVV A;  2O4X B;  4BE1 A;  3BY7 A;  1RAG B;  2DK3 A;  2EYX A;  4M7A C;  1FMK A;  2EGC A;  2VC8 A;  4EMK C;  4A4F A;  2V1Q A;  4E7I A;  4BB7 A;  3P8B B;  4II1 A;  4RTU A;  4QVD A;  3GP8 A;  1RAB B;  1YJW A;  2B86 A;  1VQM Q;  2EQK A;  3LH0 A;  4LN2 A;  4RCC A;  3FC3 A;  3G4S Q;  3CCE Q;  1VQL Q;  4M77 E;  4EMK B;  1WDX A;  4AG1 C;  2X4Y A;  2K6D A;  3O8V A;  3HKS A;  1SKU B;  2GGR A;  2X51 A;  1KD1 C;  4PJO A;  1TUD A;  2DL8 A;  3OMC A;  3I5R A;  1JXM A;  4ME7 A;  1YHQ A;  3CMA T;  4PJO C;  1VQ6 A;  3PNW C;  2SEM A;  1BI3 A;  3CCM T;  1SF9 A;  1BIB A;  1I5O B;  4HVW A;  2LQW A;  1G83 A;  4IIO A;  4XTU A;  3RMS A;  5J3B A;  3X25 B;  4MML A;  4JJD A;  1VQ4 A;  4HT8 A;  4LNP A;  2OTJ T;  3PFS A;  4F16 A;  5EG2 A;  3GPL A;  2YLB A;  3OS1 A;  2H3E B;  2VVK A;  3CCL Q;  2GFA A;  3QYG B;  1AZE A;  4PLI A;  4PFO A;  1BBZ A;  2F2V A;  1OX9 A;  3M0P A;  1OOT A;  2JS2 A;  1JQQ A;  4RUG A;  2RI2 A;  2VXF A;  3OYJ A;  1S72 T;  1YIT Q;  4LDY A;  4PJO G;  1FMW A;  1A0N B;  4CRI A;  3FEO A;  1JJ2 A;  1YIT T;  3R6O A;  1UEB A;  1KQS S;  2DVE A;  2LMJ A;  1VYV A;  2KYB A;  4HVU A;  1N9S A;  3NPF A;  4J9F A;  2FZK B;  5I2S A;  2CP6 A;  1YP5 A;  2KBT A;  3FRN A;  3OYB A;  1WHH A;  2L3R A;  3CCU T;  3SD4 A;  4ORZ A;  2LVM A;  2QXF A;  5J26 A;  2QA4 Q;  1XJW B;  2CDT A;  2OI3 A;  1Q86 U;  3A8H B;  3F70 A;  1V1C A;  2NUP B;  4J9G A;  3SWN C;  3G6E T;  3CXC S;  3LX7 A;  2CKK A;  2RJC A;  6AT1 B;  3E9F A;  3RKY A;  2F2X A;  3M57 A;  3OYD A;  2QA4 T;  4KUD K;  4FSX A;  2ZPF B;  1QVG S;  2CH4 A;  2CT3 A;  2CP5 A;  2ZPH B;  3RKX A;  1MNE A;  2EFI A;  1AVZ C;  1JBM A;  1M5Q 1;  1K4U S;  2JM8 A;  1KD1 R;  4E47 A;  3I35 A;  2RHY A;  2XDP A;  4N0A C;  1BYM A;  5GAN 6;  4C5E A;  1D1A A;  1VQL T;  2JN0 A;  4M7D F;  2L3S A;  1VQ5 A;  1B07 A;  2KY9 A;  3QYH B;  2K7A A;  3LH5 A;  1XOV A;  2DO3 A;  4TVR A;  1D0X A;  1NJI U;  2ZCF B;  2RO0 A;  3JCM e;  2V1R A;  1E6G A;  5CKH A;  4VUB A;  5J39 A;  4HCZ A;  4FSS A;  1WJS A;  5HK0 A;  1KQS A;  1N5Z A;  1IHV A;  3M9Q A;  2E6N A;  1KK7 A;  3EHR A;  5GAO p;  1GFD A;  1QP2 A;  1WZO A;  1N8R U;  5FRM A;  2PVD B;  4PJN A;  3TU4 K;  1KHC A;  1X6O A;  2EYW A;  1ZUK A;  2ZPB B;  2JTM A;  1M4Z A;  2LC4 A;  2EPD A;  4RTZ A;  3CCM Q;  1N6A A;  2O01 E;  1X2Q A;  3FB9 A;  1VQ6 Q;  3EFO B;  1K73 C;  2F2W A;  2HZY A;  4C8Q D;  3X26 B;  3QXE B;  2XG8 D;  5AYF A;  3UF4 A;  1I5L A;  1LOJ A;  2RHU A;  4GLM A;  2D8J A;  5GAM g;  4JZ4 A;  3X20 B;  5GJV B;  3M59 A;  4UC4 A;  3MP6 A;  3QUI A;  1QLY A;  2K9G A;  4A4G A;  3G4S A;  1OU8 A;  3LGL A;  3FIF A;  4J6W A;  5D7U A;  2DMO A;  3Q1J A;  4M7A D;  4J83 A;  5KYX A;  2LNV A;  2EQI A;  2HSE B;  2RNA A;  1VQ4 T;  1YI2 T;  4QQG A;  2DD5 A;  4J9H A;  2A3L A;  4Z8A A;  5GAM h;  3QSU A;  1UGS B;  2PU9 B;  5GAO m;  3R6N A;  5KCH A;  2CT4 A;  2QQB A;  4HCK A;  2CP3 A;  2O88 A;  2AIR B;  2O4X A;  5KYN A;  2E41 A;  3CMA A;  3CCU A;  3KBG A;  4ESR A;  3QZ5 B;  2A36 A;  2LCL A;  3SHW A;  4C92 F;  2KI7 A;  2DJZ A;  3NMZ C;  3JCM f;  1EFN A;  5HK3 A;  4C5G A;  1SEM A;  2XKO C;  3P8D A;  1NEG A;  4RCB A;  1UHC A;  4AT1 B;  1LNX A;  2QTX A;  4DBH A;  2MWP A;  1QVF S;  1FXX A;  1WLP B;  5LJ5 d;  4ZGE B;  1R0B G;  2LP5 A;  2K4Y A;  3M4Y A;  1VQP A;  2HAX A;  2XDD A;  1ZQ1 A;  2GTJ A;  2YUN A;  4B9W A;  5IH2 A;  4Y91 A;  3CD6 T;  1OPK A;  5FU6 B;  4A53 A;  5LJ5 f;  2HSP A;  3HRT A;  2YHT A;  4XTV A;  3JCM P;  2OJ2 A;  1QW1 A;  2AZV A;  2ZPI B;  1G5V A;  1U5S A;  3PGG A;  1W4S A;  3EGD A;  1AWW A;  1IGU A;  1K9M R;  4KT0 E;  1H92 A;  4HCB A;  5GAN e;  2E5K A;  1NYF A;  2FPF A;  3BE3 A;  1AWO A;  4OF1 A;  1OX8 A;  4JRK A;  2VGN A;  3MCA B;  4ZNX A;  4C92 A;  3CXC A;  3CC4 A;  3LYI A;  1BB9 A;  1MMG A;  3A8O B;  4MDX A;  1B3Q A;  2LCS A;  4ELZ C;  1X6G A;  1Y7X A;  2M0Y A;  1JB0 E;  2FEI A;  3UPU A;  3QII A;  1K8A U;  1H8K A;  3CC2 T;  1Y71 A;  4LDX A;  3MJX A;  2KRS A;  3CBP A;  4C0F A;  4J7F A;  1M90 C;  4X34 A;  1H64 1;  4LDW A;  3FJP A;  1K9M U;  2X4J A;  2Y4X A;  1KFZ A;  2JTE A;  4M7D B;  4C92 C;  3OYM A;  1M2V B;  2D0Q B;  2E70 A;  3OMG A;  4GY5 A;  3M53 A;  4OB0 B;  2NUT A;  3HTR A;  1VYU A;  4RTT A;  1G2B A;  1RLP C;  1M1G A;  3P8H A;  4J5Y A;  1VQ9 Q;  1GBQ A;  1QVG P;  4JUV A;  4M78 C;  2JZ2 A;  1JEG A;  1MV3 A;  2H3J A;  4D6W A;  1ZBJ A;  2VXE A;  1VQO Q;  1GCQ C;  4KGZ B;  4GBQ A;  3EAE A;  1Q7Y U;  2COY A;  2HDA A;  2MI6 A;  3DLM A;  3M0Q A;  2DEU A;  1LJO A;  3RKW A;  3VJP A;  3OYG A;  5LL6 S;  3GIB A;  2K5L A;  3QZ9 B;  3CBO A;  2M51 A;  1MGQ A;  3EH1 A;  1YHQ Q;  4RKU E;  1YJ9 A;  1M3A A;  2KVQ G;  1T0H A;  1Y0M A;  1NM7 A;  2CP2 A;  2ED1 A;  1NE8 A;  3MP1 A;  2OAU A;  4BUG A;  1D0Y A;  1RL2 A;  3UT1 A;  1TWB A;  3RER A;  4FYX B;  4A4K A;  2DJQ A;  2FG0 A;  1HD3 A;  2P0Q A;  4RTV A;  2BTT A;  2CZ1 B;  4C0G A;  1PRL C;  4JRQ A;  3HP9 A;  2E1H A;  3EG3 A;  2KMT A;  1PD0 A;  1TU0 B;  2M02 A;  3OYY A;  4RG8 A;  2EQM A;  3L42 A;  1KHI A;  9ATC B;  1IB8 A;  4C8Q G;  1YJN T;  3M5A A;  2JTF A;  1M9S A;  2DD4 A;  2RJD A;  4OMF B;  3E2U A;  3BW1 A;  3OYK A;  3SEM A;  3HRS A;  2P4T A;  2F1L A;  3EHQ A;  4LDU A;  3OW2 A;  5GAN g;  5LJ3 j;  1PNJ A;  1LPL A;  4M7A B;  2E5Q A;  3CQT A;  2HBW A;  1OPL A;  3PVQ A;  4M7A F;  2J05 A;  5DLQ E;  4M75 A;  3MEU A;  1Y07 A;  1KQS P;  2EGE A;  2FO0 A;  4DQ2 A;  4MZM A;  3EFS A;  1PC0 A;  1GL5 A;  4A4E A;  5KYX B;  2QDY B;  3EGX B;  4C8Q E;  2XID A;  3GBQ A;  2GTO A;  3I56 Q;  1TSF A;  1S72 Q;  2WSF E;  2YRC A;  3VS3 A;  1VQK Q;  1NBE B;  4M7D G;  1YN8 A;  1IXD A;  2IVW A;  3IQL A;  4J6X A;  3S3O A;  2SRC A;  4PKC C;  2IIM A;  4D8K A;  2C0T A;  4M75 B;  1U3O A;  3L2Q A;  1TOV A;  1IZ6 A;  3M4G A;  2ATC B;  2EYY A;  5LJ3 e;  5GAO l;  1K9A A;  3CCJ A;  1WIE A;  2P84 A;  3CC2 A;  3E1S A;  3VS5 A;  2KR3 A;  5GMK h;  2ZGW A;  1FX7 A;  2CSQ A;  4E7L A;  1PKS A;  1YBY A;  5FU7 C;  4N4G A;  3OW2 S;  4Y28 E;  1YHQ T;  1YJ9 T;  3VS4 A;  4KH0 B;  4E7J A;  3H9N A;  2K2M A;  2K3Y A;  3NTH A;  4PJO E;  2R57 A;  3OYH A;  3GOX A;  2QDL A;  2ROL A;  5FLX E;  1VQ7 Q;  3EG9 A;  1KD1 U;  1HXD A;  1OU9 A;  4BDZ A;  5GAN 3;  1SRL A;  5LJ3 g;  3CC7 Q;  3OA6 A;  4M77 C;  3DKM A;  1R8O B;  1FMV A;  5KE3 A;  2JXB A;  4M7D C;  3L2V A;  5GAO n;  2DLP A;  1EX4 A;  2CP0 A;  4M75 C;  1ZSZ C;  4C92 D;  3OYC A;  3HL8 A;  1M2V A;  3RBB B;  2BIV A;  1VQ5 T;  1WFW A;  1ZHI A;  1K1Z A;  4XTZ A;  3BDL A;  1Z9Z A;  1FWZ A;  1UTI A;  2EAY A;  3VRZ A;  1HJD A;  2BUD A;  4PJO D;  1W2B S;  2AHJ B;  3NFC A;  3H41 A;  4M78 A;  1VQK A;  1SRM A;  4J8O A;  1RI9 A;  2DL4 A;  4FT2 A;  3RNJ A;  3C94 A;  4JLI A;  4M77 F;  4NS5 A;  5CO7 A;  1ZBX A;  4N4I A;  2KGT A;  2HQE A;  2YT6 A;  2Y4Y A;  3JB9 J;  4RG2 A;  3E19 A;  2O9V A;  3UA7 A;  1U1S A;  3MPU B;  2X4W A;  1RAF B;  3URG A;  2LCC A;  1I1J A;  4HA8 A;  1VQ9 A;  5GMK j;  2FVU A;  1WX6 A;  4BD3 A;  4LUE A;  3UA6 A;  4OMQ A;  1I81 A;  4XTX A;  3I55 Q;  2V8K A;  2KRM A;  2CGH A;  3OB9 A;  1OI1 A;  2ESW A;  1Q82 R;  1U8R A;  1G8X A;  4IUP A;  3CCV T;  2DTH A;  3CD6 A;  2DXT A;  3OS0 A;  2A28 A;  1D09 B;  2AT1 B;  2QQS A;  4ATO A;  2NUZ A;  3OYL A;  1NJI R;  2DBM A;  2O2O A;  2DXU A;  4WF2 A;  3HSB A;  4M75 G;  2J6O A;  3MEA A;  2LQN A;  1K73 U;  5HCK A;  2CYZ B;  3SWN A;  5KYU B;  2DFU A;  4DA4 A;  2L3P A;  1C6V X;  4L5G A;  2YUP A;  5L8R E;  3H0I A;  2LZ6 B;  1WA7 A;  1YCS B;  1UGP B;  1PHT A;  4DEY A;  2OX7 A;  3MKD A;  2CH4 W;  1Q81 C;  1WXT A;  3C0C A;  2EIF A;  5IHK A;  1OZ3 A;  4BI4 A;  5GAN 4;  2DZC A;  1MND A;  4JPB W;  2KAF A;  3HRU A;  2VB6 A;  4DOV A;  2GF7 A;  2MF2 A;  2RPN A;  3ASK A;  5FW9 A;  4YTL A;  3CCR A;  3VYH B;  3JV3 A;  1E7O A;  4PJJ A;  2RK1 A;  2K5F A;  1PG5 B;  2PTK A;  1LVK A;  2DL5 A;  4F7U A;  2W0Z A;  2DX1 A;  5IXF A;  2FPD A;  1VQO A;  4MZT A;  2QK0 A;  1X43 A;  2JT4 A;  2RQR A;  4C8Q F;  3TSZ A;  1B34 B;  5D6Y A;  1YIJ A;  4QQD A;  4IUV A;  4OVA A;  1QVF P;  1KC8 R;  3JB9 G;  1RAH B;  4XU1 A;  2X35 A;  3PIP A;  3OW2 P;  4DEX A;  3EFO A;  5I2M A;  1RAI B;  1M90 R;  2FHD A;  4C0Z A;  4Y92 A;  2K3X A;  3QJY A;  1NLP C;  2KT8 A;  1BIA A;  3CCR Q;  5GAN 7;  1N9R A;  2I2L A;  2DBK A;  2Y90 A;  1YJW T;  2RA2 A;  3OYI A;  1VQ8 T;  3JCM c;  3VUZ A;  2MCN A;  5I11 A;  1VQ5 Q;  4C5H A;  2EW3 A;  2WSC E;  1HYO A;  3CCQ Q;  4IKF A;  2E10 A;  2HL3 A;  1UHF A;  4F17 A;  4V2S A;  3JSC A;  1KSW A;  4BI8 B;  1M8V A;  1BU1 A;  2PQW A;  4A63 B;  4ELY C;  4MMK A;  2QTV A;  1VQP Q;  2RN8 A;  3QKJ A;  2M1H A;  4M75 F;  1PD1 A;  4BE2 A;  1DJ7 B;  1BI2 A;  2OTL T;  5CQX A;  3EG9 B;  3OBY A;  2QQR A;  2QGG A;  5KE2 A;  1RUW A;  1NPR A;  2DL7 A;  4M78 B;  3RUX A;  3OYF A;  1VIF A;  2CRE A;  2DRK A;  2XDB A;  2DEQ A;  2X9H A;  4PL6 A;  1Q86 R;  2KT1 A;  1U06 A;  3TVT A;  4KBM B;  3QWY A;  2QEX Q;  3JAM E;  1Q81 U;  5HKC A;  4R0K A;  5GAN 5;  4AFQ C;  1C0M A;  4HCC A;  1I0C A;  3PVL A;  1CKA A;  2ZPE B;  2LX9 A;  5HY6 A;  3JCM X;  5GAM f;  1H3H A;  5M9O A;  4B6M A;  4FL6 A;  1WHG A;  2QAZ A;  3VUB A;  1YJN Q;  1UJ0 A;  2EQU A;  2J6F A;  2HCK A;  2EQJ A;  2RQW A;  4AFS C;  3RIR A;  4FCY A;  3CCS A;  3SB2 A;  3VU3 C;  5FWC A;  1VQK T;  1OQK A;  4X9C A;  2RD1 A;  2A0F B;  4FYV B;  3VV0 A;  1GCP A;  2C0O A;  3LWH A;  2LJ3 A;  2BZ8 A;  5IXB A;  2QEX T;  1JXO A;  2H8H A;  5LJ5 e;  1ABO A;  5IN1 A;  2RB6 A;  4EMH A;  3CCJ T;  1WHL A;  1AOJ A;  5EC7 A;  2QQ9 A;  2K5I A;  3X24 B;  2C0I A;  2MAM A;  4LXC A;  5A0G A;  4WCI A;  1PSE A;  3E9G A;  5CR2 A;  1NYG A;  3O5Z A;  4QQ6 A;  3EGD B;  2KDS A;  2DZ9 A;  2COZ A;  1SHG A;  4C0D C;  3L2Z A;  3AHU A;  1M2O A;  3T9N A;  4XU2 A;  3WVD B;  4N0A A;  1IRX A;  2CUB A;  2ZAE A;  4JZ3 A;  2P4R A;  1NLO C;  4CC4 B;  1VQ9 T;  5IT9 E;  1EZZ B;  3NHN A;  3CMA Q;  3CC4 T;  1B7T A;  4JDS A;  5GMK l;  3JCM V;  3QDF A;  1PSF A;  2KQW A;  2K3B A;  3CCR T;  4OB1 B;  1MMD A;  2FRW A;  4XK8 E;  4JRP A;  1HSQ A;  5CVI A;  2PVG B;  5KYY B;  4KUI A;  3GF5 A;  1BCM A;  2NLU A;  2V8J A;  1WYX A;  2VGM A;  5LJ3 f;  3PMT A;  3CBM A;  1GRI A;  3FDR A;  3RES A;  1QKW A;  1W1F A;  3GNG A;  2LRQ A;  3TEE A;  4XQ3 A;  2R5M A;  2ZZD A;  5I22 A;  2RF0 A;  4J6Y A;  4HT9 A;  4PNO A;  4KRT A;  4M7D E;  4C8Q C;  3VS1 A;  4JS5 A;  1UGR B;  2YUO A;  4E7S A;  4M78 E;  3CME T;  5D6X A;  2RM4 A;  2E12 A;  1BI0 A;  3CCV A;  3L2W A;  2JNG A;  2HKN A;  3MHX A;  1YWO A;  1XQH A;  3L2U A;  3CCQ A;  3PT9 A;  2YWW A;  2HMA A;  2KSS A;  1KC8 C;  2XU8 A;  3DB3 A;  2XK0 A;  1WGS A;  5ECA A;  1GXI E;  1BI1 A;  3VS7 A;  1UFF A;  4O5V A;  5GJW B;  4OMP A;  4C92 B;  1X27 A;  2RHX A;  3ULR B;  2GQI A;  2CZ7 B;  3V8L A;  1AHJ B;  2HQX A;  2RJE A;  1D1B A;  2YLC A;  1H3Z A;  1P92 A;  1UJY A;  1BCO A;  3C95 A;  3A8M B;  4M78 G;  3BFM A;  3VKI A;  1UEC A;  1JJ2 P;  2JJ9 A;  2K79 A;  4QVC A;  4M77 D;  5CKF A;  2GFU A;  4FW1 A;  1G3S A;  2YSQ A;  3EG1 A;  2JMC A;  4HVV A;  1MMN A;  1TXQ A;  1TUC A;  4FU6 A;  3CPF A;  3G7Z A;  8ATC B;  3CCV Q;  4PJO B;  1Q82 U;  4KH1 B;  2E65 A;  2O9S A;  3FLG A;  1VQ7 A;  1VQ4 Q;  1Y96 A;  1AEY A;  3CME Q;  3OBW A;  1PWT A;  2L2P A;  4LE9 A;  2MWO A;  2G3R A;  2OTL A;  1EIF A;  3HHT B;  3QPH A;  4R55 A;  5GAN 8;  2CUD A;  1AWJ A;  3CD6 Q;  3EG2 A;  1VIE A;  2EJG A;  1Y57 A;  5LJ3 h;  4ZN3 A;  1VQ7 T;  2RHZ A;  2DRM A;  4E7H A;  2ECZ A;  1F1B B;  2WSE E;  3CCJ Q;  1CSK A;  1G3Y A;  2A7Y A;  3INZ A;  1KIK A;  4ZN1 A;  1BK2 A;  1UGV A;  2G6F X;  1NEB A;  2X3X D;  1Y96 B;  1X75 C;  2DA9 A;  3TCJ A;  2DPP B;  5FU7 B;  5KYW A;  2ZPG B;  5KH6 A;  2COW A;  4FT4 A;  2DYB A;  2BZY A;  2I0N A;  3A5Z B;  3A98 A;  2DAQ A;  2HKQ B;  4J7I A;  4RTX A;  4IUR A;  2K2V A;  3TRE A;  1M1K R;  5CCA A;  1SSF A;  1YIJ Q;  3JCM J;  3J80 E;  4D8D A;  1FYN A;  1YI2 Q;  2YXY A;  4M7D A;  4Z02 A;  2DXC A;  1KC8 U; 
#chains in the Genus database with same CATH homology
 2MK5 A;  1R77 A;  4LXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...