1R77A

Crystal structure of the cell wall targeting domain of peptidylglycan hydrolase ale-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
DDDKVKLYKTNKYGTLYKSESASFTANTDIITRLTGPFRSMPQSGVLRKGLTIKYDEVMKQDGHVWVGYNTNSGKRVYLPVRTWNESTGELGPLWGTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Cell Wall Targeting Domain of Glycylglycine Endopeptidase AL
publication title Cell Wall-targeting Domain of Glycylglycine Endopeptidase Distinguishes among Peptidoglycan Cross-bridges.
pubmed doi rcsb
source organism Staphylococcus capitis
total genus 21
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 3.4.24.75: Lysostaphin.
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08460 SH3_5 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.410 Mainly Beta Roll SH3 type barrels. Cell wall targeting domain of glycylglycine endopeptidase 1r77A00
4LXCA 2MK5A 1R77A
chains in the Genus database with same CATH superfamily
1DJ7B 3CEYA 3FDRA 2MWPA 2RQTA 3TU4K 2HNIA 2RHZA 1C1AA 3OYEA 2QAZA 3QZ5B 4J9DA 1VYTA 5A0LA 4C0FA 4BI8B 1PKSA 2NYSA 4IUQA 2DBMA 1KD1U 1W70A 2EYZA 2X3WD 1GBQA 2A36A 4J9CA 4C0DC 5GJVB 3V7RA 1X69A 4R0KA 2Y4XA 2DKGA 4RG8A 2CDTA 2DE0X 1I0CA 2LQNA 1TH7A 2GFAA 3JCMJ 4OMNA 1UJ0A 2X4YA 3QO3A 4DOVA 1UGVA 2X9HA 4BI3A 5CKHA 1KHIA 3S6WA 3BW1A 3MPUB 2LMJA 3VU3C 1RL2A 2KXDA 3CBOA 2JXBA 1YJNQ 2OTLQ 3OW2P 4X1VA 3RKYA 1YHQT 4KUIA 1RACB 3EGXA 3CCJA 1KHCA 2RJEA 2O4XB 4PJMA 4IUPA 4AFZC 4ZGEB 4OMFB 5CKDA 1TUDA 4LN2A 5HK0A 3M0TA 4ORZA 1Q82U 3OS1A 4M7AD 1MMAA 2GF7A 1YWOA 4XTVA 2CT4A 5LJ3j 3MCAB 1W6XA 3VS0A 2GQVA 1FWZA 3HPWA 3JSCA 1VYUA 3CD6A 4ME7A 5KYUB 2AIRB 1QVFS 2DAQA 2DF6A 2V8KA 3DB3A 2A3LA 4JRPA 1VQMQ 1I07A 1D1AA 1BIBA 2FZKB 2V26A 3CCMT 2KMTA 2QQAA 2HCKA 2J6OA 3MP6A 3GIBA 1R8OB 1XOVA 1VQ8Q 3OYLA 2YRVA 4ZN3A 3EH1A 2BKDN 3X26B 1XTDA 5FROA 2ED0A 4AT1B 3X25B 2V1QA 3OB9A 1BKBA 4OMLA 4ESRA 5FLXE 5LJ5e 4D6WA 5CR2A 3RR6A 3CPWS 3HRTA 1XNIA 3VUZA 1WI7A 4MZPA 3OS5A 2COZA 4CI0C 1IREB 2EAYA 2X4XA 2DVJA 1KQSA 1UDLA 1AWWA 4UC4A 4FU6A 4N4IA 4CC2A 2P0PA 3G6ET 2RB6A 3G71T 3LWIA 1N9SA 2CT3A 2O2OA 4JS5A 2JTMA 3HL8A 2DZCA 1TXQA 1WHMA 3RMSA 2QEXT 2IG0A 1ABQA 1YNZA 2H3JA 1F1BB 3OYIA 1IZ6A 2DZ9A 4BY6B 1KD1C 4JJDA 4C8QD 1BI3A 1G8XA 2RHYA 4M78A 3RDVA 1QVFA 4C5GA 3QPHA 4MZMA 3PVQA 1RAGB 3CMET 4HKEA 4K11A 2RQRA 1YJNA 4XU0A 3OYAA 1D3BB 4QW2A 3I55T 1M90R 2CH4A 2AT1B 2L5QA 3TCJA 2DERA 1M5Q1 1U3OA 1B07A 2OX7A 4QT7A 1AWXA 1JQQA 2PVDB 2OJ2A 1M1FA 3H41A 3M57A 3HTRA 1K9AA 2F1LA 1NLPC 4RTXA 2KYBA 4HXJA 1MUZA 4IURA 2SRCA 2HL3A 2NUTB 1VQ9Q 4A4GA 1HD3A 3JCMW 3ASKA 4RUGA 3M56A 1LPLA 2XICA 3RBBB 1QP3A 3ULRB 3D7SB 1OX8A 1VQMA 1UJYA 2HKQB 2RH2A 4ANJA 2VYTA 2VKNA 2GNCA 2VWFA 4DOWA 1VQNQ 3LW5E 3MEVA 1WGSA 1GXIE 2QYZA 2K6DA 1VQ8A 1VQLT 4R56A 1IXDA 5LJ5f 1SPKA 5KH6A 3ZBDA 2B86A 3CC2Q 3BE3A 5KYYA 2KR3A 3E1SA 2EYYA 1SF9A 4RCBA 3CCUT 3JB9F 2J6FA 4M7DD 2FG0A 5GAN6 5GAOn 2YDLA 4OGEA 1K76A 4JDSA 3A98A 4HVUA 1VOMA 2DXTA 1MGQA 3ZFJA 2RJCA 1ZUYA 2JOYA 2LJ0A 4C92A 4C5EA 3OSSC 3CCLT 5GANg 1YJ9T 4QQGA 4XTUA 4E47A 2NWMA 1IHVA 2VVKA 4M78G 3UA7A 4EMKB 1MMNA 2O4XA 2EQUA 1JJ2S 2C06A 3UDCA 5GAN8 2WACA 2XDDA 4C0GA 4JRKA 4KUDK 1SEMA 5GAN3 1VQOQ 4FM4B 2K3XA 3KUFA 2GBQA 1M1KR 3OYKA 5CQXA 5ECAA 2KRMA 2L3RA 4HVVA 3E2UA 3RNJA 3GP8A 3CBPA 3A8GB 1YITT 1YJWA 1QWEA 3M5AA 4EMKC 2MYSA 3EG9B 1GCQA 1VQ6T 1W1FA 2IVWA 1BU1A 4LDXA 4KH0B 1SSFA 2FPDA 1PNJA 1KQ1A 1PWTA 4BACA 3CCET 1PD0A 2LQWA 2DX1A 4N4HA 5GAMg 3VUBA 4OB1B 1S72Q 1RUWA 4EDUA 2ROTA 2YUQA 1OULA 4M78F 1UECA 2QA4T 3GF5A 2VB6A 4PL6A 2EW3A 1O9SA 4M77G 2LCLA 1SRLA 2K5FA 1VQ9A 2GCXA 2B8AA 2OAUA 1G3WA 1OZ3A 1AD5A 4Z88A 1KIKA 3C94A 2HD0A 4ELYC 1OPLA 5IXFA 1K73C 1D0XA 2HQXA 1IRXA 3RUXA 2PUOB 1C6VX 4C92G 1JJ2A 2JVVA 2RHUA 2W0ZA 4J9FA 5FU7B 3UPUA 3FC3A 3CMAT 3O8VA 1JBMA 1YI2T 1Q81R 2G6FX 1WXBA 5GMKj 1JEGA 1TU0B 2J6KA 3I5SA 4PJOA 4FT4A 1OOTA 3A1PA 3BFMA 3FLGA 2AK5A 4IIMA 9ATCB 3HP9A 4RTUA 3EGXB 3MP1A 1D0ZA 2PVOB 4FW1A 5FU7C 2A7YA 4M77F 1YN8A 1EIFA 3RIRA 3PIPA 3X24B 1K8AC 4KULA 2H3EB 4M75G 1WLPB 1H92A 1E7OA 2J7IA 4JZ3A 1PSEA 2P0QA 1N8RR 4J7IA 1W2BA 2CZ6B 1ZBJA 5DM7R 2O31A 1Q86R 3VYHB 1JXMA 3LH0A 3LH5A 3OA6A 1YIJQ 4C92F 4E2FB 4LD6A 1I5OB 5GAMh 4F14A 4J6YA 4KT0E 1Y7XA 1JXOA 1UGRB 1H641 4L5GA 1Y0MA 3QBYA 3A5ZB 1PRMC 4XTYA 4ATOA 2OTLT 1V29B 2KAFA 2RJFA 1NYFA 2F2XA 3GNGA 1PSFA 2DIGA 2HDAA 3JCMg 4J5YA 1NM7A 2JMCA 4QVCA 2JW4A 3PE0A 1WQ7A 5GANj 5KCHA 3PMTA 2QASA 2PU9B 1S72A 1X43A 2QQSA 4ZTJA 2AHJB 3JCMP 2EFIA 2QK0A 1JO8A 1YCSB 1X6BA 2CP6A 5CKEA 3TSZA 2LT4A 4F17A 4DBHA 1IGUA 4PJNA 1M90U 2KRSA 2K4YA 4C92E 3OYDA 3EG0A 5GAMf 2HBPA 3QZ9B 1MNDA 4PJOG 3OW2S 1VIFA 5GAN7 5CIUA 2BTTA 1M8VA 3CCST 3QG1A 1NJIR 4DEXA 1VQ5Q 2YT6A 4LXCA 2LZ6B 5KYWB 1VQKQ 4ZNXA 3CCRT 2WSEE 3PT9A 4B9WA 4M78B 1RAAB 3V8KA 2JS0A 1VQ7A 1UGQB 3VS2A 3JV3A 3CBMA 5GAMj 2DEQA 3EFOA 2LVMA 2WSFE 3L1AA 3SDZA 2R5MA 2KY9A 3EG9A 2QXFA 4XTZA 1VQPT 4KGZB 3AT1B 2GTJA 2DFUA 4E7ZA 3BDLA 2O88A 4M78C 4F7UG 3INZA 2E5KA 3GBQA 5GAMd 2OTJA 3J7AF 2M9UA 4D8KA 1G2BA 1M3BA 1N6AA 4PLIA 3MEUA 1E6HA 3I35A 2CH4W 4PJOF 2EQMA 3OBWA 3X28B 4HCKA 2JTEA 1XJWB 3NPFA 2V8IA 4QQDA 3JCMh 2Y4YA 3RESA 1WHJA 1OQKA 2P0KA 2O01E 1YIJA 1V76A 2M02A 4AFSC 2ZPEB 2GQIA 1SKUB 1QWFA 1VQ4T 1TTHB 4Y92A 3G4SA 3UT1A 4A53A 5IN1A 2XHCA 4D8DA 2VUBA 1G3SA 2NUZA 5EG2A 4KRTA 3CC7Q 1AZEA 4JZ4A 4M77B 2JN0A 1GFCA 2HSEB 3ZL7C 2KRNA 2A0FB 5KYYB 1M1KU 4HCBA 1QVGA 3ME9A 2QI2A 5EC7A 1SHFA 3V8JA 5IH2A 2MIOA 2FHDA 3CCQQ 4BD3A 2DK3A 1QKWA 1H3ZA 2XDBA 1AWJA 3QDFA 4C92B 4GLMA 4RTZA 1G83A 2XMFA 3JCMf 2SEMA 4M77C 3KFVA 1UB4A 2XU8A 2EBPA 2VGNA 1VYVA 3Q1JA 5I2MA 1TUGB 4BB7A 2NUPB 4LUDA 4IKFA 1VQNT 3VS7A 5KCOA 4M7AA 5CQYA 3URGA 3I56Q 2L3SA 4C92C 1VQ5A 1G3YA 2CSIA 4NOYA 3VS3A 1P92A 3CC2T 5LJ5g 1VQKA 5CCAA 4V2SA 3UATA 1M90C 2K3BA 3JCMV 4XU2A 3OYNA 1WHHA 1M9SA 4M75B 2KSSA 2IIMA 4XAXB 3CCVT 2E10A 3V8LA 3VS6A 2OAWA 4J9EA 3DKMA 2Z0WA 2MPXC 2LCSA 3RKWA 3QJYA 2PTKA 2VASA 2F5KA 1BI1A 1PD1A 3JCMd 2EPDA 2L89A 3OMCA 1Q81U 3P8HA 3OYJA 4E7IA 1UHFA 2EQKA 4Y91A 4DA4A 3OMGA 4JPBW 3WVDB 4M75C 3NGPA 1GCQC 1Y96A 1SG5A 4B9XA 1AVZC 4HT9A 1AHJB 1VQOT 2BZ8A 4A4FA 2K79A 2COWA 4E6RA 5KE3A 2EJGA 2HQHA 4J8OA 4HA8A 2ENMA 3WVEB 1OYXA 5KYNA 3P8BB 1O75A 2E6NA 1N8RU 4IUVA 4J9IA 3C95A 2C0IA 2LCCA 3OS0A 3CC7A 2DL8A 5J26A 1Q86U 1LOJA 4JUVA 4LNPA 1HK9A 2X51A 5KYWA 2DA9A 4RTWA 4PJOB 2CKKA 1QW1A 1YJWQ 4KGVB 4AFQC 2AKKA 3CCQA 1MMGA 3JCMc 4M7AG 4FYVB 2KROA 3FJPA 2EGAA 2EJ9A 5IHKA 4PJLA 5GJWB 3HRSA 5LJ5h 1I1JA 2FRWA 2RD1A 2FRYA 1U1TA 3META 3HSBA 1WA7A 1KQSP 3MO8A 4PJOC 3VJPA 4BY6C 2KI7A 2JM8A 1OI1A 2O9VA 5CAIA 2LP5A 2DIQA 2QQRA 3I56A 3H6ZA 3OQ5A 2DYBA 4CC4B 2KDSA 2LT1A 3CPWA 2DTHA 1R77A 2P4RA 2PUKB 1PCXA 4OB0B 1RI9A 4F7UB 2D0NA 5IAYA 2XG8D 1K0SA 3E9GA 1ZSGA 3PMIA 3OYCA 4MDWA 1QVFP 1PG5B 3FEOA 5J3BA 1NJIU 5GAOp 2XD0A 2PQWA 1YFNA 1Q82C 1WIEA 2HMAA 4M7AF 2JMAA 3SFMA 1ZUKA 4E7SA 4M77A 2E70A 3VS1A 1EZZB 3CC4A 4M7DA 3LYIA 3J80E 2CZ1B 2R5AA 2CS7A 4EIKA 3RKXA 2QGGA 1ZA1B 3JB9J 2BZYA 2M0OA 2FPFA 2L8DA 1V1CA 2C0OA 4DBQA 1OZ2A 5I2SA 1AT1B 3EAEA 4RTVA 3M53A 1M3CA 2RQVA 3VRZA 2FEIA 1Z9ZA 2DRKA 4L59A 2EQJA 4BDYA 1PM3A 4J7FA 5LJ5j 2RF0A 4C8QG 2VC8A 4FSSA 4X9DA 2QDLA 1NZ9A 2H8HA 2F2VA 2NUPA 2CZ0B 1KFZA 1Z9QA 1TUCA 2K5LA 3CCMQ 4BI4A 1KG1A 4Q5WA 1M2OA 1GBRA 3F70A 5LJ5d 3EFOB 2D0QB 2M1HA 1G5VA 3QXEB 1H8KA 3LGFA 3M0UA 4M75A 2D6FA 2DBKA 1NPRA 2ABLA 1KSWA 1WNLA 2FYKA 2KE9A 3CCJT 5LL6S 1Q86C 2ROLA 2YRCA 5KE2A 4OP0A 2EJFA 5D6YA 2YRDA 1MV3A 3HRUA 1M2VA 3QHSA 3L2VA 4C5IA 2ECZA 4DEYA 2DRMA 4Z89A 2DJZA 2YUNA 3G71Q 3EH2A 2EKOA 2FO0A 5L8RE 1OX9A 2XKOC 1T3LA 5FWBA 2F5TX 2QEXQ 2KQWA 3CD6T 1AOJA 4ZGDB 3QYHB 3OBYA 5HY6A 3OSVA 4M7DG 3EG1A 2RJDA 1OU8A 4JRIA 1ZQ1A 4DQ2A 4PJJA 2E1HA 1LCKA 1D1BA 2X4WA 3C0CA 3QIIA 3CMEQ 4E7JA 3KXTA 4J9GA 2P84A 4OMOA 1YHQA 3I55Q 2DL5A 3MEAA 1K4US 2CREA 4E7HA 1VQ7Q 1NEGA 2ZGWA 4N0AA 6AT1B 2O9SA 3CXCP 1TOVA 4X34A 2K9GA 4QVDA 3OY9A 3A8HB 4PFPA 2DTOA 5A0GA 1UHCA 2MF2A 1A0NB 1QQJA 4FYXB 1NLOC 4M78E 1U06A 1NJIC 4CRIA 1UGSB 2M0YA 4O5VA 2K3YA 4E7KA 4RKUE 4PLLA 1MMDA 5GAN2 1Q7YR 2OTJQ 2ED1A 4M7AB 3UWNA 4J6WA 4M7DF 3NTHA 1FX7A 1QCFA 1QVPA 1Q95G 3CCMA 2DNUA 1U5SA 2D1XA 2BE9B 2HKNA 4PKCC 5CO7A 1OEBA 2COYA 3TVTA 1VQLQ 2JS2A 3N5BB 2RMOA 1QP2A 3HHTB 1QCNA 3G4SQ 1AZGB 3CCUQ 4CC3A 4F7UA 1PC0A 2ZAEA 4M7AC 2E41A 1YJNT 2ZZDA 3M0RA 3G1JA 1YCYA 2RHIA 4C0ZA 4WTOB 3M4GA 4XTXA 1D0YA 1WHGA 4KGXB 5GAN5 3CCLQ 1ZX6A 2D8JA 4NL2A 3TREA 1YJ9Q 2DL4A 4XQ3A 1RAFB 3JAME 4A54A 3UF4A 2BUDA 1CSKA 4JJBA 1SHGA 1RLPC 1Y96B 4M77E 3NTKA 3OYBA 2RK1A 4M7DE 3G6EA 3G71A 1BCMA 5LJ3g 2QQBA 4A4EA 1W2BP 2FZCB 4M75F 1FMVA 2RHXA 2R58A 5AT1B 2QEXA 3M55A 3U23A 4ZGJB 2KNBB 3M59A 1VQMT 4FL6A 3M0QA 2A08A 1J3TA 1LNXA 3L2QA 1K73R 2JZ2A 1YITQ 5GMKm 1BB9A 1I81A 2DPPB 2DXCA 2ZPBB 1VQ8T 3PNWC 5HK3A 5KYXA 2RPNA 1EX4A 3VS5A 3CMEA 4GBQA 1WZOA 1ZBXA 2CP0A 4C8QB 2Y90A 3NTIA 1B34A 3I55A 3NMZC 5CKFA 4OMMA 5LJ3e 3M9QA 5CVIA 3CCEQ 4R55A 3EFRA 3TQ7P 1K9MR 4FCYA 3MHXA 2CUBA 2GGRA 2EVRA 4J6XA 5FWCA 2KXCA 2KT8A 3FB9A 1FMKA 2QA4Q 2CSQA 4L6V5 8AT1B 4M75E 2YLCA 4X9CA 3BDUA 3M0SA 4XK8E 2YXYA 2E65A 2PNIA 3OYMA 4C8QC 1K8AR 2VXEA 4YTLA 2DL7A 2L3QA 4BE2A 3T9NA 3JCMX 2LNHB 2KYMA 1KC8R 1EFNA 5CK9A 3FJ5A 2X4JA 2K7AA 1MV0B 4PK4A 5IT9E 1B7TA 3X20B 1VQLA 3EHQA 1W4SA 3CMAQ 2FZGB 2F2WA 1N5ZA 5I21A 4KH1B 5GAOq 4BE1A 4OVAA 1YI2Q 1TG0A 1YJWT 2X35A 3CCUA 2LDMA 4II1A 1K1ZA 5LJ3h 4PNOA 2YHTA 3OW2A 1OPKA 1YP5A 2FB7A 4WF2A 2RI3A 3L2UA 1X6OA 3REBB 3TEEA 2DJQA 4MZTA 4XTWA 1M3AA 4M7DB 2VV5A 4BDZA 2RN8A 4LUEA 3CCLA 2QDYB 1YJ9A 2ZPFB 3LLRA 4IUTA 2MWOA 5IHIA 2LJ1A 5GAOm 3REAB 1HYOA 3P8DA 2R57A 3QWXX 1WX6A 1IO6A 1I4K1 4F7UF 2OI3A 2IPOB 2ZPIB 2K2MA 1PRLC 1YBYA 2JNGA 4PJOE 1VQ9T 2M51A 3KBGA 2PZ1A 2CYZB 2CP7A 3M4YA 2EYXA 3OS2A 3S3OA 3EGUA 3WXMB 3M54A 4DBRA 4M7DC 2DMOA 1HJDA 2XDPA 2EYQA 4OF1A 3THKA 1JU5C 2RO0A 3C4SA 1WJRA 1YITA 1IB8A 1X75C 2LC4A 5LJ3f 4A4HA 2FVUA 2EQIA 1VQ6A 3NHNA 3EHRA 1ZLMA 1B3QA 2HAXA 2D8HA 1KQSS 3VYGA 1NG2A 1RAIB 5D6XA 2BIVA 1ZSZA 2LQKA 3AHUA 2KK4A 1QVGP 1TSFA 2V1RA 1U8RA 3EGDA 3LWHA 2K5IA 5A2QE 3DLLA 3CCEA 2DLPA 4QVZA 2CZ7B 4RTTA 1RAEB 2DO3A 4AG1C 3ER0A 2J05A 4F7UE 2QA4A 4WCIA 3L2RA 5CKBA 3SWNA 3CQTA 1K0XA 1VUBA 3GPLA 5IHNA 3JB9D 1M2VB 7AT1B 1PKTA 3I5RA 3CC4Q 1NPPA 1SRMA 1R0CB 1TWBA 5FW9A 3OYGA 2X3XD 1LVKA 1GRIA 2E64A 1NBEB 2DM1A 4MMLA 2MK5A 3CCSQ 1I5LA 5LJ3d 2D9TA 4F16A 4JRQA 1NE8A 2QTVA 3GNFB 2HL5C 4Z8AA 3CMAA 3CCRQ 3JB9H 3BY7A 4OB2B 4QKUA 1Q7YU 5DLOA 2YWWA 1YI2A 4JLGA 2I2LA 3RMQA 1M1GA 3ZEHA 1ZHIA 3NFCA 1IHWA 1M27C 4A63B 1Y57A 3VKIA 2AZSA 1VQPQ 1RLQC 2YSQA 2JM9A 1ZUUA 1CKAA 2A28A 3EG3A 2MOXA 5AYFA 1S72T 4FYYB 4C8QA 3S3MA 1X6GA 1UG1A 4HCZA 1RI0A 2RI5A 2KVQG 1T3SA 1WJQA 3LX7A 4FT2A 3SHWA 1M1KC 4GY5A 4N0AC 1VQ4Q 3O5ZA 3OYFA 4M78D 2EGEA 1OV3A 3SB2A 3FIFA 1UUEA 2GTOA 5A0DA 1ARKA 2OTLA 4XU3A 2E3HA 3JB9G 2E4HA 4F04B 1UEBA 4C5HA 1VQ7T 4RTYA 2G3RA 2HSPA 2CGHA 2MAMA 1FMWA 4JJNK 1K73U 2GFUA 4AFUC 2MMPA 2KEAA 4OB3B 2L0AA 2RQUA 1XQHA 4NS5A 1U1SA 1VIEA 2YUPA 2LJ3A 3H0FA 2K57A 2DXBA 3M58A 1QMCA 3UA6A 3V7SA 2ZPGB 2DXUA 1YHQQ 1JB0E 3A8OB 1T0HA 2JJ9A 2OTJT 4RMOA 1I8FA 4BE0A 1K9MU 1BK2A 5J39A 2HQEA 1ACMB 5GMKe 2A37A 4FSXA 3CCSA 1HXDA 2I0NA 3CXCS 1YIJT 2BZXA 3CPWP 4VUBA 3HKSA 3JRZA 4P5NA 4M77D 1D1CA 1GCPA 2FPEA 3G4ST 1K8AU 3CCRA 1Q81C 3HFNA 5GMKl 4OGCA 4GLKA 4MDXA 4JJCA 3CCVQ 4AMCA 1KC8U 2WSCE 1X2KA 5KYXB 2LQ8A 3L42A 4HT8A 4C92D 2VXFA 4AG2C 2XI9A 1B34B 4DBFA 2HEQA 4FIBA 1VQPA 4M7AE 5FU6B 1IGQA 2EWNA 1KD1R 5FRNA 2JUFA 3JCMQ 2ESWA 2CP3A 1Q7YC 2AZVA 2QGFB 1RABB 2ZCFB 2QQ9A 4LDVA 3GOXA 1MHNA 1N8RC 2KBTA 1WHLA 1QKXA 4LDUA 3L2ZA 4KBMB 5FU6C 5GMKh 1UGPB 2J06A 4OMQA 4LE9A 5KYUA 3MKDA 4LDYA 1BYMA 1VQ4A 2L3PA 4RCCA 3A8MB 1AWOA 5GANe 3G7ZA 3IQLA 4C8QF 5GAN4 4M75D 1VQ5T 3DLMA 3G6EQ 1CKBA 2E3IA 4E7LA 3EG2A 2CP5A 1VQKT 2DILA 3QUIA 2L2PA 1E6GA 1FXXA 1WYXA 2DL3A 4IUUA 1OU9A 4IIOA 2YLBA 1H3HA 1PHTA 3CXCA 5C6SA 2KT1A 1W2BS 1BBZA 4RG2A 3JCMb 2DTIA 1Q82R 3EFSA 2E12A 1M30A 4M4ZA 5IXBA 5C0MA 3MJXA 2ZPHB 3DB4A 2EYWA 3QJ6A 1M8MA 4PFOA 2DYIA 2QTXA 1BI2A 5GAOl 3SEMA 1NYGA 4PFZA 1X2QA 2M16A 4O6JA 3V7CA 3C12A 4A4KA 1VQNA 4C8QE 2LX9A 1UE9A 2K2VA 2EKHA 5GAMe 2LTOA 5D7UA 1ABOA 4BUGA 1QCOA 4CC7A 4EMGA 4J83A 4EPCA 5HCKA 5GANh 2RA2A 5DLQE 3SD4A 3CC2A 1WPYA 1KK7A 1M4ZA 1X01A 1WQWA 2MCNA 1GL5A 2AKLA 1GFDA 4PJOD 4LDWA 3H0HA 1K9MC 3CCVA 5HKCA 3CC7T 1WXTA 5DY9A 4B6MA 2QG9B 4Y28E 5GAOr 2LNVA 2MI6A 2DD5A 1JJ2P 1ZSZB 4OMPA 2JTFA 4ELZC 3A8LB 3EGDB 1MNEA 1WDXA 4ZTFA 3S3NA 2NLUA 5I22A 1KQ2A 1UFFA 1D3BA 4Z02A 3FRNA 2CP2A 2HZYA 3H0IA 3CCQT 3QKJA 3MEWA 2E5QA 2LRQA 2XIDA 1S1NA 1WHKA 4JLIA 1KC8C 2EGCA 3SWNB 3QDRB 1VQOA 2DETA 3QWYA 5GANf 1ZSZC 3PFSA 2DD4A 1X27A 4EMHA 2NUTA 5D6WA 2HBWA 2JT4A 1Y71A 3VS4A 3H9NA 1SSHA 1C0MA 3I56T 4MMKA 2LX7A 1YWPA 1N9RA 2RI2A 4ZN1A 2RNAA 1FYNA 3SWNC 5GMKi 3VV0A 1KJWA 3R6NA 3M0PA 5L23A 2RQWA 4TVRA 8ATCB 1WXUA 1BCOA 1T0JA 3CPFA 4FYWB 3J81E 1VQ6Q 2FL7A 2RM4A 1G3TA 2V8JA 2BE7D 3H8ZA 3PGGA 4J9HA 3CCJQ 4HVWA 5GANd 3VRYA 4LD9K 1BIAA 3CC4T 4JS4A 3JCMe 3QYGB 1UTIA 1Y07A 4J9BA 4EMKA 5M9OA 3R6OA 1NEBA 5I11A 3E19A 1QVGS 2F69A 1BI0A 1TS9A 2XK0A 1VA7A 3PVLA 3I9QA 2C0TA 4XU1A 4QQ6A 3CD6Q 3OYYA 3L2WA 1WFWA 3RERA 1D09B 3GLXA 1R0BG 4FW2A 2PVGB 3PIOA 4N4GA 1WJSA 1QLYA 1LJOA 3TSWA 1JRIA 1N27A 2DEUA 1AEYA 2YUOA 2ATCB 3E9FA 3OYHA 3LGLA 2KGTA 4HCCA 5FRMA 2E6ZA 2CUDA 3MP8A 3PTAA 1RADB 1RAHB 1ZA2B 2VGMA 2EIFA 4NL3A 4C0DB 1HSQA 3HFOA 2RK2A 3QSUA 2P4TA 2DVEA 2W10A 3JB9I
chains in the Genus database with same CATH topology
4LXCA 2MK5A 1R77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LXC A;  2MK5 A;  1R77 A; 
#chains in the Genus database with same CATH topology
 1DJ7 B;  3CEY A;  3FDR A;  2MWP A;  2RQT A;  3TU4 K;  2HNI A;  2RHZ A;  1C1A A;  3OYE A;  2QAZ A;  3QZ5 B;  4J9D A;  1VYT A;  5A0L A;  4C0F A;  4BI8 B;  1PKS A;  2NYS A;  4IUQ A;  2DBM A;  1KD1 U;  1W70 A;  2EYZ A;  2X3W D;  1GBQ A;  2A36 A;  4J9C A;  4C0D C;  5GJV B;  3V7R A;  1X69 A;  4R0K A;  2Y4X A;  2DKG A;  4RG8 A;  2CDT A;  2DE0 X;  1I0C A;  2LQN A;  1TH7 A;  2GFA A;  3JCM J;  4OMN A;  1UJ0 A;  2X4Y A;  3QO3 A;  4DOV A;  1UGV A;  2X9H A;  4BI3 A;  5CKH A;  1KHI A;  3S6W A;  3BW1 A;  3MPU B;  2LMJ A;  3VU3 C;  1RL2 A;  2KXD A;  3CBO A;  2JXB A;  1YJN Q;  2OTL Q;  3OW2 P;  4X1V A;  3RKY A;  1YHQ T;  4KUI A;  1RAC B;  3EGX A;  3CCJ A;  1KHC A;  2RJE A;  2O4X B;  4PJM A;  4IUP A;  4AFZ C;  4ZGE B;  4OMF B;  5CKD A;  1TUD A;  4LN2 A;  5HK0 A;  3M0T A;  4ORZ A;  1Q82 U;  3OS1 A;  4M7A D;  1MMA A;  2GF7 A;  1YWO A;  4XTV A;  2CT4 A;  5LJ3 j;  3MCA B;  1W6X A;  3VS0 A;  2GQV A;  1FWZ A;  3HPW A;  3JSC A;  1VYU A;  3CD6 A;  4ME7 A;  5KYU B;  2AIR B;  1QVF S;  2DAQ A;  2DF6 A;  2V8K A;  3DB3 A;  2A3L A;  4JRP A;  1VQM Q;  1I07 A;  1D1A A;  1BIB A;  2FZK B;  2V26 A;  3CCM T;  2KMT A;  2QQA A;  2HCK A;  2J6O A;  3MP6 A;  3GIB A;  1R8O B;  1XOV A;  1VQ8 Q;  3OYL A;  2YRV A;  4ZN3 A;  3EH1 A;  2BKD N;  3X26 B;  1XTD A;  5FRO A;  2ED0 A;  4AT1 B;  3X25 B;  2V1Q A;  3OB9 A;  1BKB A;  4OML A;  4ESR A;  5FLX E;  5LJ5 e;  4D6W A;  5CR2 A;  3RR6 A;  3CPW S;  3HRT A;  1XNI A;  3VUZ A;  1WI7 A;  4MZP A;  3OS5 A;  2COZ A;  4CI0 C;  1IRE B;  2EAY A;  2X4X A;  2DVJ A;  1KQS A;  1UDL A;  1AWW A;  4UC4 A;  4FU6 A;  4N4I A;  4CC2 A;  2P0P A;  3G6E T;  2RB6 A;  3G71 T;  3LWI A;  1N9S A;  2CT3 A;  2O2O A;  4JS5 A;  2JTM A;  3HL8 A;  2DZC A;  1TXQ A;  1WHM A;  3RMS A;  2QEX T;  2IG0 A;  1ABQ A;  1YNZ A;  2H3J A;  1F1B B;  3OYI A;  1IZ6 A;  2DZ9 A;  4BY6 B;  1KD1 C;  4JJD A;  4C8Q D;  1BI3 A;  1G8X A;  2RHY A;  4M78 A;  3RDV A;  1QVF A;  4C5G A;  3QPH A;  4MZM A;  3PVQ A;  1RAG B;  3CME T;  4HKE A;  4K11 A;  2RQR A;  1YJN A;  4XU0 A;  3OYA A;  1D3B B;  4QW2 A;  3I55 T;  1M90 R;  2CH4 A;  2AT1 B;  2L5Q A;  3TCJ A;  2DER A;  1M5Q 1;  1U3O A;  1B07 A;  2OX7 A;  4QT7 A;  1AWX A;  1JQQ A;  2PVD B;  2OJ2 A;  1M1F A;  3H41 A;  3M57 A;  3HTR A;  1K9A A;  2F1L A;  1NLP C;  4RTX A;  2KYB A;  4HXJ A;  1MUZ A;  4IUR A;  2SRC A;  2HL3 A;  2NUT B;  1VQ9 Q;  4A4G A;  1HD3 A;  3JCM W;  3ASK A;  4RUG A;  3M56 A;  1LPL A;  2XIC A;  3RBB B;  1QP3 A;  3ULR B;  3D7S B;  1OX8 A;  1VQM A;  1UJY A;  2HKQ B;  2RH2 A;  4ANJ A;  2VYT A;  2VKN A;  2GNC A;  2VWF A;  4DOW A;  1VQN Q;  3LW5 E;  3MEV A;  1WGS A;  1GXI E;  2QYZ A;  2K6D A;  1VQ8 A;  1VQL T;  4R56 A;  1IXD A;  5LJ5 f;  1SPK A;  5KH6 A;  3ZBD A;  2B86 A;  3CC2 Q;  3BE3 A;  5KYY A;  2KR3 A;  3E1S A;  2EYY A;  1SF9 A;  4RCB A;  3CCU T;  3JB9 F;  2J6F A;  4M7D D;  2FG0 A;  5GAN 6;  5GAO n;  2YDL A;  4OGE A;  1K76 A;  4JDS A;  3A98 A;  4HVU A;  1VOM A;  2DXT A;  1MGQ A;  3ZFJ A;  2RJC A;  1ZUY A;  2JOY A;  2LJ0 A;  4C92 A;  4C5E A;  3OSS C;  3CCL T;  5GAN g;  1YJ9 T;  4QQG A;  4XTU A;  4E47 A;  2NWM A;  1IHV A;  2VVK A;  4M78 G;  3UA7 A;  4EMK B;  1MMN A;  2O4X A;  2EQU A;  1JJ2 S;  2C06 A;  3UDC A;  5GAN 8;  2WAC A;  2XDD A;  4C0G A;  4JRK A;  4KUD K;  1SEM A;  5GAN 3;  1VQO Q;  4FM4 B;  2K3X A;  3KUF A;  2GBQ A;  1M1K R;  3OYK A;  5CQX A;  5ECA A;  2KRM A;  2L3R A;  4HVV A;  3E2U A;  3RNJ A;  3GP8 A;  3CBP A;  3A8G B;  1YIT T;  1YJW A;  1QWE A;  3M5A A;  4EMK C;  2MYS A;  3EG9 B;  1GCQ A;  1VQ6 T;  1W1F A;  2IVW A;  1BU1 A;  4LDX A;  4KH0 B;  1SSF A;  2FPD A;  1PNJ A;  1KQ1 A;  1PWT A;  4BAC A;  3CCE T;  1PD0 A;  2LQW A;  2DX1 A;  4N4H A;  5GAM g;  3VUB A;  4OB1 B;  1S72 Q;  1RUW A;  4EDU A;  2ROT A;  2YUQ A;  1OUL A;  4M78 F;  1UEC A;  2QA4 T;  3GF5 A;  2VB6 A;  4PL6 A;  2EW3 A;  1O9S A;  4M77 G;  2LCL A;  1SRL A;  2K5F A;  1VQ9 A;  2GCX A;  2B8A A;  2OAU A;  1G3W A;  1OZ3 A;  1AD5 A;  4Z88 A;  1KIK A;  3C94 A;  2HD0 A;  4ELY C;  1OPL A;  5IXF A;  1K73 C;  1D0X A;  2HQX A;  1IRX A;  3RUX A;  2PUO B;  1C6V X;  4C92 G;  1JJ2 A;  2JVV A;  2RHU A;  2W0Z A;  4J9F A;  5FU7 B;  3UPU A;  3FC3 A;  3CMA T;  3O8V A;  1JBM A;  1YI2 T;  1Q81 R;  2G6F X;  1WXB A;  5GMK j;  1JEG A;  1TU0 B;  2J6K A;  3I5S A;  4PJO A;  4FT4 A;  1OOT A;  3A1P A;  3BFM A;  3FLG A;  2AK5 A;  4IIM A;  9ATC B;  3HP9 A;  4RTU A;  3EGX B;  3MP1 A;  1D0Z A;  2PVO B;  4FW1 A;  5FU7 C;  2A7Y A;  4M77 F;  1YN8 A;  1EIF A;  3RIR A;  3PIP A;  3X24 B;  1K8A C;  4KUL A;  2H3E B;  4M75 G;  1WLP B;  1H92 A;  1E7O A;  2J7I A;  4JZ3 A;  1PSE A;  2P0Q A;  1N8R R;  4J7I A;  1W2B A;  2CZ6 B;  1ZBJ A;  5DM7 R;  2O31 A;  1Q86 R;  3VYH B;  1JXM A;  3LH0 A;  3LH5 A;  3OA6 A;  1YIJ Q;  4C92 F;  4E2F B;  4LD6 A;  1I5O B;  5GAM h;  4F14 A;  4J6Y A;  4KT0 E;  1Y7X A;  1JXO A;  1UGR B;  1H64 1;  4L5G A;  1Y0M A;  3QBY A;  3A5Z B;  1PRM C;  4XTY A;  4ATO A;  2OTL T;  1V29 B;  2KAF A;  2RJF A;  1NYF A;  2F2X A;  3GNG A;  1PSF A;  2DIG A;  2HDA A;  3JCM g;  4J5Y A;  1NM7 A;  2JMC A;  4QVC A;  2JW4 A;  3PE0 A;  1WQ7 A;  5GAN j;  5KCH A;  3PMT A;  2QAS A;  2PU9 B;  1S72 A;  1X43 A;  2QQS A;  4ZTJ A;  2AHJ B;  3JCM P;  2EFI A;  2QK0 A;  1JO8 A;  1YCS B;  1X6B A;  2CP6 A;  5CKE A;  3TSZ A;  2LT4 A;  4F17 A;  4DBH A;  1IGU A;  4PJN A;  1M90 U;  2KRS A;  2K4Y A;  4C92 E;  3OYD A;  3EG0 A;  5GAM f;  2HBP A;  3QZ9 B;  1MND A;  4PJO G;  3OW2 S;  1VIF A;  5GAN 7;  5CIU A;  2BTT A;  1M8V A;  3CCS T;  3QG1 A;  1NJI R;  4DEX A;  1VQ5 Q;  2YT6 A;  4LXC A;  2LZ6 B;  5KYW B;  1VQK Q;  4ZNX A;  3CCR T;  2WSE E;  3PT9 A;  4B9W A;  4M78 B;  1RAA B;  3V8K A;  2JS0 A;  1VQ7 A;  1UGQ B;  3VS2 A;  3JV3 A;  3CBM A;  5GAM j;  2DEQ A;  3EFO A;  2LVM A;  2WSF E;  3L1A A;  3SDZ A;  2R5M A;  2KY9 A;  3EG9 A;  2QXF A;  4XTZ A;  1VQP T;  4KGZ B;  3AT1 B;  2GTJ A;  2DFU A;  4E7Z A;  3BDL A;  2O88 A;  4M78 C;  4F7U G;  3INZ A;  2E5K A;  3GBQ A;  5GAM d;  2OTJ A;  3J7A F;  2M9U A;  4D8K A;  1G2B A;  1M3B A;  1N6A A;  4PLI A;  3MEU A;  1E6H A;  3I35 A;  2CH4 W;  4PJO F;  2EQM A;  3OBW A;  3X28 B;  4HCK A;  2JTE A;  1XJW B;  3NPF A;  2V8I A;  4QQD A;  3JCM h;  2Y4Y A;  3RES A;  1WHJ A;  1OQK A;  2P0K A;  2O01 E;  1YIJ A;  1V76 A;  2M02 A;  4AFS C;  2ZPE B;  2GQI A;  1SKU B;  1QWF A;  1VQ4 T;  1TTH B;  4Y92 A;  3G4S A;  3UT1 A;  4A53 A;  5IN1 A;  2XHC A;  4D8D A;  2VUB A;  1G3S A;  2NUZ A;  5EG2 A;  4KRT A;  3CC7 Q;  1AZE A;  4JZ4 A;  4M77 B;  2JN0 A;  1GFC A;  2HSE B;  3ZL7 C;  2KRN A;  2A0F B;  5KYY B;  1M1K U;  4HCB A;  1QVG A;  3ME9 A;  2QI2 A;  5EC7 A;  1SHF A;  3V8J A;  5IH2 A;  2MIO A;  2FHD A;  3CCQ Q;  4BD3 A;  2DK3 A;  1QKW A;  1H3Z A;  2XDB A;  1AWJ A;  3QDF A;  4C92 B;  4GLM A;  4RTZ A;  1G83 A;  2XMF A;  3JCM f;  2SEM A;  4M77 C;  3KFV A;  1UB4 A;  2XU8 A;  2EBP A;  2VGN A;  1VYV A;  3Q1J A;  5I2M A;  1TUG B;  4BB7 A;  2NUP B;  4LUD A;  4IKF A;  1VQN T;  3VS7 A;  5KCO A;  4M7A A;  5CQY A;  3URG A;  3I56 Q;  2L3S A;  4C92 C;  1VQ5 A;  1G3Y A;  2CSI A;  4NOY A;  3VS3 A;  1P92 A;  3CC2 T;  5LJ5 g;  1VQK A;  5CCA A;  4V2S A;  3UAT A;  1M90 C;  2K3B A;  3JCM V;  4XU2 A;  3OYN A;  1WHH A;  1M9S A;  4M75 B;  2KSS A;  2IIM A;  4XAX B;  3CCV T;  2E10 A;  3V8L A;  3VS6 A;  2OAW A;  4J9E A;  3DKM A;  2Z0W A;  2MPX C;  2LCS A;  3RKW A;  3QJY A;  2PTK A;  2VAS A;  2F5K A;  1BI1 A;  1PD1 A;  3JCM d;  2EPD A;  2L89 A;  3OMC A;  1Q81 U;  3P8H A;  3OYJ A;  4E7I A;  1UHF A;  2EQK A;  4Y91 A;  4DA4 A;  3OMG A;  4JPB W;  3WVD B;  4M75 C;  3NGP A;  1GCQ C;  1Y96 A;  1SG5 A;  4B9X A;  1AVZ C;  4HT9 A;  1AHJ B;  1VQO T;  2BZ8 A;  4A4F A;  2K79 A;  2COW A;  4E6R A;  5KE3 A;  2EJG A;  2HQH A;  4J8O A;  4HA8 A;  2ENM A;  3WVE B;  1OYX A;  5KYN A;  3P8B B;  1O75 A;  2E6N A;  1N8R U;  4IUV A;  4J9I A;  3C95 A;  2C0I A;  2LCC A;  3OS0 A;  3CC7 A;  2DL8 A;  5J26 A;  1Q86 U;  1LOJ A;  4JUV A;  4LNP A;  1HK9 A;  2X51 A;  5KYW A;  2DA9 A;  4RTW A;  4PJO B;  2CKK A;  1QW1 A;  1YJW Q;  4KGV B;  4AFQ C;  2AKK A;  3CCQ A;  1MMG A;  3JCM c;  4M7A G;  4FYV B;  2KRO A;  3FJP A;  2EGA A;  2EJ9 A;  5IHK A;  4PJL A;  5GJW B;  3HRS A;  5LJ5 h;  1I1J A;  2FRW A;  2RD1 A;  2FRY A;  1U1T A;  3MET A;  3HSB A;  1WA7 A;  1KQS P;  3MO8 A;  4PJO C;  3VJP A;  4BY6 C;  2KI7 A;  2JM8 A;  1OI1 A;  2O9V A;  5CAI A;  2LP5 A;  2DIQ A;  2QQR A;  3I56 A;  3H6Z A;  3OQ5 A;  2DYB A;  4CC4 B;  2KDS A;  2LT1 A;  3CPW A;  2DTH A;  1R77 A;  2P4R A;  2PUK B;  1PCX A;  4OB0 B;  1RI9 A;  4F7U B;  2D0N A;  5IAY A;  2XG8 D;  1K0S A;  3E9G A;  1ZSG A;  3PMI A;  3OYC A;  4MDW A;  1QVF P;  1PG5 B;  3FEO A;  5J3B A;  1NJI U;  5GAO p;  2XD0 A;  2PQW A;  1YFN A;  1Q82 C;  1WIE A;  2HMA A;  4M7A F;  2JMA A;  3SFM A;  1ZUK A;  4E7S A;  4M77 A;  2E70 A;  3VS1 A;  1EZZ B;  3CC4 A;  4M7D A;  3LYI A;  3J80 E;  2CZ1 B;  2R5A A;  2CS7 A;  4EIK A;  3RKX A;  2QGG A;  1ZA1 B;  3JB9 J;  2BZY A;  2M0O A;  2FPF A;  2L8D A;  1V1C A;  2C0O A;  4DBQ A;  1OZ2 A;  5I2S A;  1AT1 B;  3EAE A;  4RTV A;  3M53 A;  1M3C A;  2RQV A;  3VRZ A;  2FEI A;  1Z9Z A;  2DRK A;  4L59 A;  2EQJ A;  4BDY A;  1PM3 A;  4J7F A;  5LJ5 j;  2RF0 A;  4C8Q G;  2VC8 A;  4FSS A;  4X9D A;  2QDL A;  1NZ9 A;  2H8H A;  2F2V A;  2NUP A;  2CZ0 B;  1KFZ A;  1Z9Q A;  1TUC A;  2K5L A;  3CCM Q;  4BI4 A;  1KG1 A;  4Q5W A;  1M2O A;  1GBR A;  3F70 A;  5LJ5 d;  3EFO B;  2D0Q B;  2M1H A;  1G5V A;  3QXE B;  1H8K A;  3LGF A;  3M0U A;  4M75 A;  2D6F A;  2DBK A;  1NPR A;  2ABL A;  1KSW A;  1WNL A;  2FYK A;  2KE9 A;  3CCJ T;  5LL6 S;  1Q86 C;  2ROL A;  2YRC A;  5KE2 A;  4OP0 A;  2EJF A;  5D6Y A;  2YRD A;  1MV3 A;  3HRU A;  1M2V A;  3QHS A;  3L2V A;  4C5I A;  2ECZ A;  4DEY A;  2DRM A;  4Z89 A;  2DJZ A;  2YUN A;  3G71 Q;  3EH2 A;  2EKO A;  2FO0 A;  5L8R E;  1OX9 A;  2XKO C;  1T3L A;  5FWB A;  2F5T X;  2QEX Q;  2KQW A;  3CD6 T;  1AOJ A;  4ZGD B;  3QYH B;  3OBY A;  5HY6 A;  3OSV A;  4M7D G;  3EG1 A;  2RJD A;  1OU8 A;  4JRI A;  1ZQ1 A;  4DQ2 A;  4PJJ A;  2E1H A;  1LCK A;  1D1B A;  2X4W A;  3C0C A;  3QII A;  3CME Q;  4E7J A;  3KXT A;  4J9G A;  2P84 A;  4OMO A;  1YHQ A;  3I55 Q;  2DL5 A;  3MEA A;  1K4U S;  2CRE A;  4E7H A;  1VQ7 Q;  1NEG A;  2ZGW A;  4N0A A;  6AT1 B;  2O9S A;  3CXC P;  1TOV A;  4X34 A;  2K9G A;  4QVD A;  3OY9 A;  3A8H B;  4PFP A;  2DTO A;  5A0G A;  1UHC A;  2MF2 A;  1A0N B;  1QQJ A;  4FYX B;  1NLO C;  4M78 E;  1U06 A;  1NJI C;  4CRI A;  1UGS B;  2M0Y A;  4O5V A;  2K3Y A;  4E7K A;  4RKU E;  4PLL A;  1MMD A;  5GAN 2;  1Q7Y R;  2OTJ Q;  2ED1 A;  4M7A B;  3UWN A;  4J6W A;  4M7D F;  3NTH A;  1FX7 A;  1QCF A;  1QVP A;  1Q95 G;  3CCM A;  2DNU A;  1U5S A;  2D1X A;  2BE9 B;  2HKN A;  4PKC C;  5CO7 A;  1OEB A;  2COY A;  3TVT A;  1VQL Q;  2JS2 A;  3N5B B;  2RMO A;  1QP2 A;  3HHT B;  1QCN A;  3G4S Q;  1AZG B;  3CCU Q;  4CC3 A;  4F7U A;  1PC0 A;  2ZAE A;  4M7A C;  2E41 A;  1YJN T;  2ZZD A;  3M0R A;  3G1J A;  1YCY A;  2RHI A;  4C0Z A;  4WTO B;  3M4G A;  4XTX A;  1D0Y A;  1WHG A;  4KGX B;  5GAN 5;  3CCL Q;  1ZX6 A;  2D8J A;  4NL2 A;  3TRE A;  1YJ9 Q;  2DL4 A;  4XQ3 A;  1RAF B;  3JAM E;  4A54 A;  3UF4 A;  2BUD A;  1CSK A;  4JJB A;  1SHG A;  1RLP C;  1Y96 B;  4M77 E;  3NTK A;  3OYB A;  2RK1 A;  4M7D E;  3G6E A;  3G71 A;  1BCM A;  5LJ3 g;  2QQB A;  4A4E A;  1W2B P;  2FZC B;  4M75 F;  1FMV A;  2RHX A;  2R58 A;  5AT1 B;  2QEX A;  3M55 A;  3U23 A;  4ZGJ B;  2KNB B;  3M59 A;  1VQM T;  4FL6 A;  3M0Q A;  2A08 A;  1J3T A;  1LNX A;  3L2Q A;  1K73 R;  2JZ2 A;  1YIT Q;  5GMK m;  1BB9 A;  1I81 A;  2DPP B;  2DXC A;  2ZPB B;  1VQ8 T;  3PNW C;  5HK3 A;  5KYX A;  2RPN A;  1EX4 A;  3VS5 A;  3CME A;  4GBQ A;  1WZO A;  1ZBX A;  2CP0 A;  4C8Q B;  2Y90 A;  3NTI A;  1B34 A;  3I55 A;  3NMZ C;  5CKF A;  4OMM A;  5LJ3 e;  3M9Q A;  5CVI A;  3CCE Q;  4R55 A;  3EFR A;  3TQ7 P;  1K9M R;  4FCY A;  3MHX A;  2CUB A;  2GGR A;  2EVR A;  4J6X A;  5FWC A;  2KXC A;  2KT8 A;  3FB9 A;  1FMK A;  2QA4 Q;  2CSQ A;  4L6V 5;  8AT1 B;  4M75 E;  2YLC A;  4X9C A;  3BDU A;  3M0S A;  4XK8 E;  2YXY A;  2E65 A;  2PNI A;  3OYM A;  4C8Q C;  1K8A R;  2VXE A;  4YTL A;  2DL7 A;  2L3Q A;  4BE2 A;  3T9N A;  3JCM X;  2LNH B;  2KYM A;  1KC8 R;  1EFN A;  5CK9 A;  3FJ5 A;  2X4J A;  2K7A A;  1MV0 B;  4PK4 A;  5IT9 E;  1B7T A;  3X20 B;  1VQL A;  3EHQ A;  1W4S A;  3CMA Q;  2FZG B;  2F2W A;  1N5Z A;  5I21 A;  4KH1 B;  5GAO q;  4BE1 A;  4OVA A;  1YI2 Q;  1TG0 A;  1YJW T;  2X35 A;  3CCU A;  2LDM A;  4II1 A;  1K1Z A;  5LJ3 h;  4PNO A;  2YHT A;  3OW2 A;  1OPK A;  1YP5 A;  2FB7 A;  4WF2 A;  2RI3 A;  3L2U A;  1X6O A;  3REB B;  3TEE A;  2DJQ A;  4MZT A;  4XTW A;  1M3A A;  4M7D B;  2VV5 A;  4BDZ A;  2RN8 A;  4LUE A;  3CCL A;  2QDY B;  1YJ9 A;  2ZPF B;  3LLR A;  4IUT A;  2MWO A;  5IHI A;  2LJ1 A;  5GAO m;  3REA B;  1HYO A;  3P8D A;  2R57 A;  3QWX X;  1WX6 A;  1IO6 A;  1I4K 1;  4F7U F;  2OI3 A;  2IPO B;  2ZPI B;  2K2M A;  1PRL C;  1YBY A;  2JNG A;  4PJO E;  1VQ9 T;  2M51 A;  3KBG A;  2PZ1 A;  2CYZ B;  2CP7 A;  3M4Y A;  2EYX A;  3OS2 A;  3S3O A;  3EGU A;  3WXM B;  3M54 A;  4DBR A;  4M7D C;  2DMO A;  1HJD A;  2XDP A;  2EYQ A;  4OF1 A;  3THK A;  1JU5 C;  2RO0 A;  3C4S A;  1WJR A;  1YIT A;  1IB8 A;  1X75 C;  2LC4 A;  5LJ3 f;  4A4H A;  2FVU A;  2EQI A;  1VQ6 A;  3NHN A;  3EHR A;  1ZLM A;  1B3Q A;  2HAX A;  2D8H A;  1KQS S;  3VYG A;  1NG2 A;  1RAI B;  5D6X A;  2BIV A;  1ZSZ A;  2LQK A;  3AHU A;  2KK4 A;  1QVG P;  1TSF A;  2V1R A;  1U8R A;  3EGD A;  3LWH A;  2K5I A;  5A2Q E;  3DLL A;  3CCE A;  2DLP A;  4QVZ A;  2CZ7 B;  4RTT A;  1RAE B;  2DO3 A;  4AG1 C;  3ER0 A;  2J05 A;  4F7U E;  2QA4 A;  4WCI A;  3L2R A;  5CKB A;  3SWN A;  3CQT A;  1K0X A;  1VUB A;  3GPL A;  5IHN A;  3JB9 D;  1M2V B;  7AT1 B;  1PKT A;  3I5R A;  3CC4 Q;  1NPP A;  1SRM A;  1R0C B;  1TWB A;  5FW9 A;  3OYG A;  2X3X D;  1LVK A;  1GRI A;  2E64 A;  1NBE B;  2DM1 A;  4MML A;  2MK5 A;  3CCS Q;  1I5L A;  5LJ3 d;  2D9T A;  4F16 A;  4JRQ A;  1NE8 A;  2QTV A;  3GNF B;  2HL5 C;  4Z8A A;  3CMA A;  3CCR Q;  3JB9 H;  3BY7 A;  4OB2 B;  4QKU A;  1Q7Y U;  5DLO A;  2YWW A;  1YI2 A;  4JLG A;  2I2L A;  3RMQ A;  1M1G A;  3ZEH A;  1ZHI A;  3NFC A;  1IHW A;  1M27 C;  4A63 B;  1Y57 A;  3VKI A;  2AZS A;  1VQP Q;  1RLQ C;  2YSQ A;  2JM9 A;  1ZUU A;  1CKA A;  2A28 A;  3EG3 A;  2MOX A;  5AYF A;  1S72 T;  4FYY B;  4C8Q A;  3S3M A;  1X6G A;  1UG1 A;  4HCZ A;  1RI0 A;  2RI5 A;  2KVQ G;  1T3S A;  1WJQ A;  3LX7 A;  4FT2 A;  3SHW A;  1M1K C;  4GY5 A;  4N0A C;  1VQ4 Q;  3O5Z A;  3OYF A;  4M78 D;  2EGE A;  1OV3 A;  3SB2 A;  3FIF A;  1UUE A;  2GTO A;  5A0D A;  1ARK A;  2OTL A;  4XU3 A;  2E3H A;  3JB9 G;  2E4H A;  4F04 B;  1UEB A;  4C5H A;  1VQ7 T;  4RTY A;  2G3R A;  2HSP A;  2CGH A;  2MAM A;  1FMW A;  4JJN K;  1K73 U;  2GFU A;  4AFU C;  2MMP A;  2KEA A;  4OB3 B;  2L0A A;  2RQU A;  1XQH A;  4NS5 A;  1U1S A;  1VIE A;  2YUP A;  2LJ3 A;  3H0F A;  2K57 A;  2DXB A;  3M58 A;  1QMC A;  3UA6 A;  3V7S A;  2ZPG B;  2DXU A;  1YHQ Q;  1JB0 E;  3A8O B;  1T0H A;  2JJ9 A;  2OTJ T;  4RMO A;  1I8F A;  4BE0 A;  1K9M U;  1BK2 A;  5J39 A;  2HQE A;  1ACM B;  5GMK e;  2A37 A;  4FSX A;  3CCS A;  1HXD A;  2I0N A;  3CXC S;  1YIJ T;  2BZX A;  3CPW P;  4VUB A;  3HKS A;  3JRZ A;  4P5N A;  4M77 D;  1D1C A;  1GCP A;  2FPE A;  3G4S T;  1K8A U;  3CCR A;  1Q81 C;  3HFN A;  5GMK l;  4OGC A;  4GLK A;  4MDX A;  4JJC A;  3CCV Q;  4AMC A;  1KC8 U;  2WSC E;  1X2K A;  5KYX B;  2LQ8 A;  3L42 A;  4HT8 A;  4C92 D;  2VXF A;  4AG2 C;  2XI9 A;  1B34 B;  4DBF A;  2HEQ A;  4FIB A;  1VQP A;  4M7A E;  5FU6 B;  1IGQ A;  2EWN A;  1KD1 R;  5FRN A;  2JUF A;  3JCM Q;  2ESW A;  2CP3 A;  1Q7Y C;  2AZV A;  2QGF B;  1RAB B;  2ZCF B;  2QQ9 A;  4LDV A;  3GOX A;  1MHN A;  1N8R C;  2KBT A;  1WHL A;  1QKX A;  4LDU A;  3L2Z A;  4KBM B;  5FU6 C;  5GMK h;  1UGP B;  2J06 A;  4OMQ A;  4LE9 A;  5KYU A;  3MKD A;  4LDY A;  1BYM A;  1VQ4 A;  2L3P A;  4RCC A;  3A8M B;  1AWO A;  5GAN e;  3G7Z A;  3IQL A;  4C8Q F;  5GAN 4;  4M75 D;  1VQ5 T;  3DLM A;  3G6E Q;  1CKB A;  2E3I A;  4E7L A;  3EG2 A;  2CP5 A;  1VQK T;  2DIL A;  3QUI A;  2L2P A;  1E6G A;  1FXX A;  1WYX A;  2DL3 A;  4IUU A;  1OU9 A;  4IIO A;  2YLB A;  1H3H A;  1PHT A;  3CXC A;  5C6S A;  2KT1 A;  1W2B S;  1BBZ A;  4RG2 A;  3JCM b;  2DTI A;  1Q82 R;  3EFS A;  2E12 A;  1M30 A;  4M4Z A;  5IXB A;  5C0M A;  3MJX A;  2ZPH B;  3DB4 A;  2EYW A;  3QJ6 A;  1M8M A;  4PFO A;  2DYI A;  2QTX A;  1BI2 A;  5GAO l;  3SEM A;  1NYG A;  4PFZ A;  1X2Q A;  2M16 A;  4O6J A;  3V7C A;  3C12 A;  4A4K A;  1VQN A;  4C8Q E;  2LX9 A;  1UE9 A;  2K2V A;  2EKH A;  5GAM e;  2LTO A;  5D7U A;  1ABO A;  4BUG A;  1QCO A;  4CC7 A;  4EMG A;  4J83 A;  4EPC A;  5HCK A;  5GAN h;  2RA2 A;  5DLQ E;  3SD4 A;  3CC2 A;  1WPY A;  1KK7 A;  1M4Z A;  1X01 A;  1WQW A;  2MCN A;  1GL5 A;  2AKL A;  1GFD A;  4PJO D;  4LDW A;  3H0H A;  1K9M C;  3CCV A;  5HKC A;  3CC7 T;  1WXT A;  5DY9 A;  4B6M A;  2QG9 B;  4Y28 E;  5GAO r;  2LNV A;  2MI6 A;  2DD5 A;  1JJ2 P;  1ZSZ B;  4OMP A;  2JTF A;  4ELZ C;  3A8L B;  3EGD B;  1MNE A;  1WDX A;  4ZTF A;  3S3N A;  2NLU A;  5I22 A;  1KQ2 A;  1UFF A;  1D3B A;  4Z02 A;  3FRN A;  2CP2 A;  2HZY A;  3H0I A;  3CCQ T;  3QKJ A;  3MEW A;  2E5Q A;  2LRQ A;  2XID A;  1S1N A;  1WHK A;  4JLI A;  1KC8 C;  2EGC A;  3SWN B;  3QDR B;  1VQO A;  2DET A;  3QWY A;  5GAN f;  1ZSZ C;  3PFS A;  2DD4 A;  1X27 A;  4EMH A;  2NUT A;  5D6W A;  2HBW A;  2JT4 A;  1Y71 A;  3VS4 A;  3H9N A;  1SSH A;  1C0M A;  3I56 T;  4MMK A;  2LX7 A;  1YWP A;  1N9R A;  2RI2 A;  4ZN1 A;  2RNA A;  1FYN A;  3SWN C;  5GMK i;  3VV0 A;  1KJW A;  3R6N A;  3M0P A;  5L23 A;  2RQW A;  4TVR A;  8ATC B;  1WXU A;  1BCO A;  1T0J A;  3CPF A;  4FYW B;  3J81 E;  1VQ6 Q;  2FL7 A;  2RM4 A;  1G3T A;  2V8J A;  2BE7 D;  3H8Z A;  3PGG A;  4J9H A;  3CCJ Q;  4HVW A;  5GAN d;  3VRY A;  4LD9 K;  1BIA A;  3CC4 T;  4JS4 A;  3JCM e;  3QYG B;  1UTI A;  1Y07 A;  4J9B A;  4EMK A;  5M9O A;  3R6O A;  1NEB A;  5I11 A;  3E19 A;  1QVG S;  2F69 A;  1BI0 A;  1TS9 A;  2XK0 A;  1VA7 A;  3PVL A;  3I9Q A;  2C0T A;  4XU1 A;  4QQ6 A;  3CD6 Q;  3OYY A;  3L2W A;  1WFW A;  3RER A;  1D09 B;  3GLX A;  1R0B G;  4FW2 A;  2PVG B;  3PIO A;  4N4G A;  1WJS A;  1QLY A;  1LJO A;  3TSW A;  1JRI A;  1N27 A;  2DEU A;  1AEY A;  2YUO A;  2ATC B;  3E9F A;  3OYH A;  3LGL A;  2KGT A;  4HCC A;  5FRM A;  2E6Z A;  2CUD A;  3MP8 A;  3PTA A;  1RAD B;  1RAH B;  1ZA2 B;  2VGM A;  2EIF A;  4NL3 A;  4C0D B;  1HSQ A;  3HFO A;  2RK2 A;  3QSU A;  2P4T A;  2DVE A;  2W10 A;  3JB9 I; 
#chains in the Genus database with same CATH homology
 4LXC A;  2MK5 A;  1R77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...