1R77A

Crystal structure of the cell wall targeting domain of peptidylglycan hydrolase ale-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'DDDKVKLYKTNKYGTLYKSESASFTANTDIITRLTGPFRSMPQSGVLRKGLTIKYDEVMKQDGHVWVGYNTNSGKRVYLPVRTWNESTGELGPLWGTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell Wall Targeting Domain of Glycylglycine Endopeptidase AL
publication title Cell Wall-targeting Domain of Glycylglycine Endopeptidase Distinguishes among Peptidoglycan Cross-bridges.
pubmed doi rcsb
source organism Staphylococcus capitis
molecule tags Hydrolase
total genus 21
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature ec 3.4.24.75: Lysostaphin.
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08460 SH3_5 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.410 Mainly Beta Roll SH3 type barrels. Cell wall targeting domain of glycylglycine endopeptidase 1r77A00
2MK5A 1R77A 4LXCA
chains in the Genus database with same CATH superfamily
3QZ9B 1YJNT 2K3YA 1BB9A 3V8JA 3CCJQ 4PJOC 3JCMc 3KBGA 1AOJA 3REBB 4BACA 3CCRT 4M7AE 3RKWA 1QMCA 4ZGDB 2KVQG 2L3SA 3G4SQ 1G3TA 4BDYA 2Y90A 1KFZA 1RACB 3QHSA 4FCYA 1PM3A 1VQ9Q 1WYXA 1Z9QA 1NJIU 1YWOA 4LD9K 1M3BA 3OYLA 4LXCA 2F69A 1UGVA 3CMAA 4IUTA 1HJDA 2JTEA 2L3PA 2BZYA 1YFNA 2RQTA 3M9QA 4OMFB 1WPYA 3OYAA 5KYYA 1WHKA 3OYIA 2DMOA 3M54A 3EG9B 2ED1A 3C4SA 2HCKA 5GAOm 4ESRA 2K3XA 5GANj 5J26A 1MMGA 1YITQ 2RK1A 2QDLA 4LDYA 2KGTA 5KCOA 4PJOF 2LCLA 2P0PA 2AKKA 3DLMA 3D7SB 3SWNA 4RCBA 4BDZA 4EMKA 4Z88A 3PFSA 2QEXQ 2G3RA 1OQKA 3EGXB 2P4RA 4X9DA 2OTJQ 5I22A 5CQYA 3QZ5B 2LNVA 1E6GA 1OI1A 3GLXA 1NE8A 1ZHIA 2CS7A 4RUGA 4HVWA 2K5IA 4M77C 2D6FA 5KYUA 1YHQA 3QO3A 3PNWC 5GMKh 2VV5A 1VQOT 3H41A 2VVKA 2F5TX 4HVUA 4C0DC 4J6YA 2EPDA 2AT1B 1QVFP 3ULRB 3OYYA 1TSFA 3TEEA 4LN2A 3CC4T 4B9WA 4A63B 2DYIA 3EFOA 2EKHA 1H3HA 1WHHA 1NLOC 4C8QB 1M5Q1 2DXUA 1F1BB 2RI5A 2DD4A 1X2KA 2K7AA 3M0RA 4OVAA 4FYYB 3JCMW 3I55T 5KH6A 2COYA 3G7ZA 2EFIA 1D1AA 3CCEQ 1Q86R 1BI3A 4M78C 1YWPA 3VS6A 4ELZC 4PJOD 2L2PA 3SDZA 1ZX6A 4J9BA 2XICA 1KHCA 4WF2A 2OJ2A 4PKCC 3LWHA 2FO0A 4ZNXA 2XDDA 2EAYA 3TVTA 1EX4A 3MHXA 1OPLA 2EQUA 1OULA 3HP9A 4OGCA 3G6EQ 5FRNA 5AT1B 3BW1A 3OYDA 1EZZB 3S3NA 2RH2A 3C94A 3M0PA 3L2VA 4ZGEB 5CK9A 4PFPA 4GLMA 2XIDA 1U1SA 2HNIA 3HRTA 1XOVA 3EAEA 3WVEB 1GFCA 2CDTA 5LL6S 1IGQA 3OYBA 1WX6A 3HFNA 2XD0A 4DA4A 1NEBA 5ECAA 1WXTA 2YSQA 4HCCA 3VV0A 1QP2A 2GTOA 1T0HA 1O9SA 4MMKA 1ABQA 3OYFA 2Z0WA 3CCJA 4E7IA 2HBPA 2HL5C 4JLIA 4Q5WA 2KRSA 3HKSA 3UA6A 1KQ1A 3JB9J 3M0SA 1IZ6A 3G4SA 5GAN2 3BDLA 3VJPA 2QA4Q 4BI8B 2DBKA 4C8QG 1VQ8Q 4A4GA 2A0FB 2DL8A 1KG1A 3FLGA 3I35A 1QVFS 1D0ZA 4E7ZA 2LQWA 4X1VA 3REAB 2YUNA 5GAOp 3J80E 3E9FA 1X75C 4N0AC 5DLQE 2QK0A 2E5QA 2IVWA 5GAMf 2FG0A 1AHJB 1JJ2P 1SRMA 1ZLMA 4F7UB 1WJSA 4BUGA 5IH2A 1T0JA 3CXCP 3VS1A 3R6NA 2L0AA 3VS0A 2YWWA 5GAOr 1MMAA 1UGQB 2SRCA 2RJFA 2LT1A 4PJLA 1GBQA 4FW1A 5I2SA 2PU9B 1VQPT 2V26A 1YITA 1X27A 5CKFA 4BY6B 3RESA 2JS0A 3QYHB 3VKIA 4M75C 5GAMj 4FSXA 1PG5B 4YTLA 1M1GA 1NLPC 3QUIA 1K73C 1I0CA 4JDSA 2DEUA 2RI2A 3PMIA 3X20B 5LJ5d 2CH4A 5CR2A 2K5LA 1M90U 4KBMB 2YRDA 1NM7A 2DL7A 3M56A 3R6OA 4FYVB 2J6OA 1FXXA 1X01A 5I11A 1SG5A 1VYVA 3J7AF 3RNJA 2O88A 2JMCA 3CCMQ 2MK5A 1SEMA 3VUBA 2CP0A 2ZPGB 1PRLC 3GIBA 3GNFB 2BTTA 4E7SA 3UF4A 3QG1A 2OAWA 2QASA 1CSKA 4C5HA 4OF1A 1ZQ1A 3NPFA 2A28A 2GGRA 1VQ7T 4RTXA 2VUBA 2D1XA 1KK7A 2DFUA 4CI0C 5GAN3 1WDXA 5GAOl 1XNIA 1IHVA 3LYIA 2K2MA 3VYGA 2CP2A 3HPWA 4M75F 3OYJA 3CCLT 3MO8A 1YJNA 2DEQA 4BE1A 1G5VA 4ANJA 2K6DA 2R5AA 2FEIA 3MJXA 3LH5A 4E47A 1Q82C 1OZ2A 3JCMP 4M7AA 5KYWB 3CEYA 2F2VA 5J3BA 3CMET 2VYTA 1ZBXA 4F7UG 3RKYA 4VUBA 2GF7A 1MUZA 3MPUB 1Y7XA 2P0KA 2D0QB 1TUDA 3LWIA 1OV3A 1IHWA 1M8MA 3OMGA 4NS5A 2EGAA 1O75A 2YDLA 4MDXA 5LJ5f 1FMKA 2K4YA 4AFSC 1M2VB 4M7DD 3I5SA 2J7IA 1Q82U 4II1A 2VASA 3G6EA 1JJ2S 3OSVA 2KMTA 2NUPB 2RMOA 3P8DA 1S72Q 3JB9F 2DILA 5KYXB 1RI0A 1QQJA 1UGPB 1WIEA 3A8GB 2RJEA 2JXBA 3CC7T 4AFUC 5A0GA 1IRXA 1PNJA 2QAZA 2DXCA 4BB7A 1KC8R 3A1PA 3H8ZA 1M3AA 3CCUT 2KI7A 1W2BS 1YI2T 1OU9A 5IXBA 3JCMJ 1OX9A 2A7YA 3WXMB 1V1CA 1G3YA 1Y07A 1TUCA 1Q95G 2L3QA 4M75D 2HQEA 2KAFA 1V76A 1VQ6Q 4FM4B 3OS5A 2XI9A 1NPRA 4XTWA 4QQGA 3MP1A 2KBTA 3PGGA 1ZUUA 2K57A 5GJWB 4AG2C 1Q7YR 4HT9A 4F7UE 1TG0A 2QA4A 3EH2A 3GNGA 1IB8A 3CQTA 3TREA 3OBYA 4OB3B 2M51A 3OYCA 4JRQA 1D1CA 5FU7C 2LZ6B 2H3EB 2CH4W 1HD3A 1A0NB 4AT1B 4XTXA 3OS2A 1WI7A 1FMVA 1RUWA 2EJGA 3FRNA 4C5GA 1K73R 1XQHA 2EKOA 1GCQA 3URGA 1XTDA 4M7DB 2JM8A 3JB9D 1ABOA 3QJ6A 2CREA 2GQIA 2K3BA 1M9SA 2CZ6B 4D8DA 3I55A 1X2QA 3TU4K 2RPNA 3CD6T 1AWJA 1D1BA 2YXYA 1Y96A 3MKDA 4JJDA 3I9QA 4J6XA 5GAMe 1ZSZA 4A54A 4MZTA 4CC7A 3JAME 4CRIA 4DBQA 2E10A 1MMDA 1X43A 1Q86C 1VQLQ 1KQSP 3H6ZA 1ZSGA 5GAN7 1VQKT 2PZ1A 3L2ZA 4PK4A 4FIBA 4OMQA 3META 3L2RA 1W70A 4M7DF 5GMKm 4C92C 4PJJA 4CC3A 1AWOA 2O31A 4QT7A 1IO6A 3V7SA 2P0QA 1Q86U 1YCYA 3M5AA 4HT8A 2QI2A 3M0QA 2JMAA 3JB9I 4E2FB 1ZBJA 1N9RA 3EFRA 3RIRA 3I56Q 1SSHA 4AG1C 2HL3A 1R0BG 3X25B 4PJOB 1E6HA 1PCXA 2DK3A 2I2LA 2QDYB 1YJWT 1WFWA 1PKTA 3OYMA 1OOTA 2JUFA 3PIOA 3LLRA 4N4HA 1QCNA 4QKUA 5LJ3d 1ZA2B 3I5RA 4QQ6A 2XMFA 2PTKA 4EMGA 1JBMA 1T3SA 4LNPA 1UTIA 3UPUA 2H3JA 2YUQA 4ZGJB 2JM9A 2EQMA 2HSPA 4C92F 5GMKi 2JTMA 2IIMA 2M1HA 3OBWA 3FJ5A 2W10A 5FLXE 2X4WA 4AFZC 3GP8A 3VS7A 1UHCA 2XKOC 2PUKB 1DJ7B 2V1RA 2V8JA 1VOMA 2MWOA 2VXFA 1S72A 1QW1A 3NFCA 1UJ0A 3QJYA 2RM4A 5GAMh 4PFOA 1OYXA 2QGGA 3EGXA 3BFMA 3PE0A 4J9FA 5A0DA 1VQPA 4MMLA 1VQ5T 1LNXA 2FPDA 3RR6A 2HMAA 3QDFA 1VQNT 3RBBB 1W6XA 3UDCA 1WHMA 1AWWA 1RI9A 2AZSA 3ER0A 3SWNC 3CCVT 3QYGB 1VQMT 4EMKC 2ATCB 2V8IA 4X9CA 1FWZA 3RMQA 3G71T 3CBOA 1YIJT 2CP7A 4OGEA 1VQ6A 2DVEA 3JCMd 4M77B 1KQSS 4BE2A 1GRIA 3LGLA 2JNGA 3VS4A 2Y4YA 5LJ3f 4C0DB 3WVDB 1HYOA 2KDSA 1D3BB 4C8QA 1X6GA 3OSSC 3CCST 2RNAA 3S3OA 3E2UA 2BKDN 4LDUA 2DM1A 4B9XA 4RKUE 4PJOG 1TTHB 4LUEA 5IAYA 4XTVA 1VQ4T 4C92D 2CZ7B 1AD5A 2QQBA 3S6WA 3HTRA 1UDLA 1RABB 3JSCA 5GAMg 1B07A 4J9DA 1YJNQ 5FRMA 2KXDA 5HCKA 4BI3A 3SD4A 2F5KA 1U8RA 1LCKA 4JJCA 3RKXA 1SRLA 1QWFA 4O6JA 2B8AA 5CQXA 5LJ3j 2HQXA 3CCRQ 1WQWA 1E7OA 4PLIA 1HK9A 2VWFA 2LQ8A 4M77F 5D7UA 4M78B 4HCBA 2KE9A 2PQWA 4QQDA 2CUDA 3TQ7P 4RTTA 2FB7A 1G83A 1HXDA 1OEBA 2H8HA 2R58A 4AFQC 3KFVA 2ZCFB 1I5LA 3NTHA 2CT4A 2PUOB 3HRUA 2OTLT 3CPWP 4RMOA 3UT1A 4LUDA 3CMEA 1WLPB 3RDVA 1VYUA 2RI3A 1AVZC 1JXOA 2O9VA 1QCOA 1I07A 1VQLA 4RTVA 2VXEA 4NL2A 2J05A 1U3OA 4JJBA 3A8LB 3JCMf 2DL4A 1I81A 1BIAA 1RL2A 2EGEA 1WHJA 3MP8A 1J3TA 4FSSA 2EWNA 2CP5A 4WTOB 4PJOE 4ZTFA 5LJ5h 4HKEA 3L1AA 2QTVA 3LX7A 4M78F 5EC7A 3OY9A 2ROTA 2AHJB 2LNHB 4XTYA 4J5YA 2F1LA 3DB3A 1FMWA 4RG2A 3EG3A 2DPPB 1ZUYA 3CC7A 3JB9H 1N6AA 4J7FA 3I56A 4N4GA 2DLPA 3CCUA 4OMNA 3OS1A 3OYNA 1H641 4DBHA 1LJOA 1VQOQ 4M77D 2XDPA 2FPEA 3RUXA 3UATA 4GBQA 1I1JA 1M1KC 1K0XA 2A08A 4XU3A 1KC8C 1QWEA 3HRSA 2MI6A 2GFUA 5CAIA 3M0UA 4PL6A 1WQ7A 3CC4Q 2DNUA 1U5SA 4F7UA 4LE9A 2QYZA 4JJNK 2RA2A 4NL3A 1QKXA 2DL3A 5DLOA 3QWYA 4XU1A 3KUFA 4J9CA 2E41A 2ECZA 4O5VA 3MEVA 1AWXA 2KT1A 5GMKl 2K79A 4JS4A 1Q7YC 3I55Q 1KC8U 1OX8A 2D8HA 3ME9A 1VYTA 5KE3A 1UG1A 2E64A 4JS5A 5L23A 2K2VA 4IURA 2CSQA 3S3MA 2DTHA 4C0ZA 3O5ZA 4M78D 2MYSA 2VB6A 2IG0A 1Q7YU 4JRPA 4M75B 3MEUA 1AEYA 1SF9A 4MDWA 2X4YA 2WACA 2VGMA 3CPWS 4C8QE 4ELYC 1YHQT 5I21A 3BE3A 5C0MA 4C0GA 2GCXA 2RK2A 2EYYA 1VIFA 2NUTB 4FW2A 2MF2A 1K73U 4DOWA 3CCQT 2DBMA 1EIFA 2RHYA 1BIBA 1YJ9T 4OB2B 1K8AR 2OI3A 1VQKA 1MV3A 4IUPA 4L5GA 4KGVB 2RJDA 4J6WA 4ORZA 1QVGP 2C0TA 3L2UA 1BK2A 1PSEA 2KEAA 5IXFA 1FX7A 2YUOA 4XQ3A 1EFNA 3H0IA 3BY7A 1PWTA 3JCMV 3OS0A 1R8OB 2GTJA 1RAGB 5FU6C 3DLLA 2D8JA 1KQ2A 1MNEA 5LJ3e 4HCZA 2LP5A 2MMPA 5KYWA 1HSQA 3QSUA 5A2QE 2NWMA 1M4ZA 3EHRA 2XU8A 3CCRA 2EQJA 1WJQA 1VIEA 1BKBA 3A8MB 1YJWA 2JN0A 2AK5A 3THKA 2KRNA 2RHXA 2BIVA 1QP3A 4LDVA 1GBRA 3C95A 2YT6A 2JS2A 4M7AC 1M2VA 1D09B 3KXTA 1TUGB 4IUUA 1KSWA 2NUPA 2QQ9A 1GCPA 2D9TA 2MIOA 5KYXA 3CXCS 4F04B 1G3SA 4J7IA 4OMPA 3UWNA 3V8KA 2E4HA 3CBPA 4V2SA 2I0NA 3AHUA 2DRKA 4AMCA 1SSFA 1VQPQ 4M75G 2CUBA 4L6V5 2X4JA 1UECA 3X26B 3MCAB 1M1KR 3CC2T 2R5MA 2L8DA 5LJ5j 1OZ3A 3FC3A 4PJMA 1SHGA 2KYBA 3JCMb 5GAOn 4J8OA 1JJ2A 3CCJT 1AZEA 1SPKA 3JCMe 2E6ZA 5GAN8 4FT2A 2FPFA 2LQKA 4PLLA 3VRYA 4M7AF 4KH0B 3G4ST 1VQ9T 3QWXX 1VQMA 4J9IA 3G71A 1VQOA 5IHNA 3GBQA 4FU6A 3P8HA 1YIJA 4MZPA 2HKNA 4HCKA 2LC4A 2E3HA 2KNBB 2DETA 3JB9G 3OYHA 1I8FA 3CCQQ 1W2BA 2JOYA 4XTUA 3QDRB 3L2WA 3CC4A 1M30A 4Z02A 1VQ7Q 3EGUA 1QVGS 1TH7A 5FU7B 4M7DA 1GXIE 2P84A 2KROA 5IT9E 3PVLA 3NTIA 4A4EA 5LJ3h 4GY5A 2YHTA 2ZPFB 1JEGA 4ZN1A 2YLCA 4JUVA 4LDWA 2MWPA 3P8BB 4KULA 1WHLA 4M75E 1D0YA 2XHCA 2A36A 4JRKA 1G2BA 2LJ3A 2KRMA 2KK4A 1GCQC 4A4KA 4C5EA 1TXQA 5HY6A 3CCLQ 1M8VA 1K1ZA 4FL6A 2FVUA 5HK0A 2PNIA 2C0IA 3M58A 2JT4A 3EG2A 2LTOA 5GANd 1RAIB 2FZCB 2X4XA 3OW2A 1NPPA 3RMSA 3VU3C 2QEXT 2DIQA 3CMEQ 2RQRA 3J81E 2OTJT 3M53A 3DKMA 3M59A 3ASKA 3EHQA 1G3WA 1ZSZC 5D6WA 3M4YA 1FYNA 2HKQB 1Y0MA 2LCCA 3ZBDA 1RLPC 1H92A 2MAMA 4ME7A 2EQIA 2OTLA 2EYQA 4M7AD 4Y28E 3EG0A 5IHIA 3EGDB 4FYXB 2EIFA 2E70A 2J6KA 2O4XB 3L42A 2ESWA 5D6YA 9ATCB 1B34B 3U23A 2LRQA 1LOJA 1K9AA 5LJ3g 4C92B 1S1NA 2CP3A 3CC7Q 1KD1R 3OB9A 2RQVA 2CGHA 3DB4A 3JCMh 2XDBA 4PJOA 2J06A 3QIIA 2ED0A 4XTZA 2MOXA 5CKDA 3CCUQ 2GFAA 1NJIC 2CZ1B 1R0CB 5IN1A 4ZN3A 1YI2Q 2DTOA 1MNDA 4OP0A 1ZUKA 3A8HB 3OA6A 3HFOA 2YRCA 6AT1B 2VC8A 3QBYA 3CCET 1IXDA 2ZGWA 3H9NA 2EYZA 1JO8A 2O2OA 4Y92A 4Z89A 1K9MR 4F16A 1BYMA 2JVVA 3QXEB 2BZ8A 1BU1A 3EG9A 4OB0B 5I2MA 5GANf 5GJVB 1JXMA 4IIOA 1PD0A 4QW2A 3HHTB 4M7DG 1R77A 2EJ9A 5DY9A 3SHWA 4E7LA 2F2XA 3PMTA 3H0FA 3MEWA 1KJWA 3G6ET 1Q81R 5FWBA 4DOVA 1NBEB 2KXCA 2QQRA 2X3XD 2A37A 2RQUA 5KYYB 1WXBA 3VS3A 4FYWB 1TU0B 4LD6A 4NOYA 1YP5A 3GOXA 1B3QA 4KUDK 4PFZA 2DD5A 4XK8E 4EIKA 3JCMg 4HA8A 1BBZA 2FL7A 3MP6A 4PNOA 2AZVA 5LJ5e 3CD6Q 3PTAA 5DM7R 2DTIA 4BE0A 2G6FX 4OMOA 2CKKA 1TWBA 2KT8A 3TCJA 4CC2A 3NHNA 2DRMA 1NEGA 3OMCA 4M77A 4JLGA 3SWNB 1VUBA 1QCFA 4EMKB 4EMHA 5CCAA 2BZXA 1G8XA 2DE0X 1CKBA 1D3BA 2QQSA 1AT1B 1W4SA 1ACMB 4IUQA 1VQKQ 5IHKA 2LX9A 4RTZA 4C92G 1YBYA 2EYXA 2QA4T 4M7DE 5HK3A 1VQ8T 4IUVA 2DVJA 5KYUB 1WGSA 2EVRA 1XJWB 2FRYA 3C12A 1RAHB 1NYFA 3CCQA 2FZGB 4C8QC 1JRIA 3VYHB 1YJ9A 2LT4A 2E5KA 3F70A 1VQ7A 3EFOB 4BI4A 1KQSA 3OQ5A 2LCSA 4QVZA 7AT1B 2QGFB 3M57A 4WCIA 3EFSA 4M78A 1M27C 4KGXB 1MHNA 4RTUA 1K8AC 1YJWQ 2L5QA 1SHFA 2RO0A 2XK0A 1X6OA 4DEYA 3CCLA 2FRWA 2LDMA 3VS5A 4RCCA 2QQAA 3JV3A 4OMMA 4RTYA 2B86A 3VRZA 1I5OB 1WA7A 2X9HA 1H3ZA 4F17A 3A8OB 5CO7A 2LQNA 3OYGA 2C06A 1K8AU 3QPHA 4R0KA 2CYZB 1X69A 2YRVA 4C92E 2DO3A 2LJ1A 5GAMd 1NJIR 3FJPA 2HZYA 4C8QF 1JQQA 2CSIA 4D6WA 2QTXA 3CCMT 1WNLA 1OPKA 3BDUA 4JRIA 1ZA1B 1PSFA 2COWA 1K4US 2E12A 2X35A 3RERA 1WHGA 4B6MA 3C0CA 5AYFA 1NYGA 1QVPA 5CKHA 2RB6A 5FWCA 3A5ZB 3IQLA 1V29B 2E65A 1H8KA 1LPLA 3V7CA 1VQ5Q 4M77G 3FB9A 2ZPIB 2KQWA 1VQNQ 4JZ4A 1JU5C 4OMLA 3CC2A 1RAFB 2JW4A 1KHIA 1BCMA 1U06A 3CCVQ 2NYSA 1VQMQ 1YI2A 4CC4B 4XAXB 1UGRB 3E19A 3TSZA 3G71Q 1PD1A 5GAOq 2DYBA 1YIJQ 2AKLA 5M9OA 3CMAT 1WJRA 1C0MA 4IIMA 2RD1A 1M3CA 4M4ZA 1K0SA 1N27A 4KRTA 3FIFA 5CIUA 1TOVA 3G1JA 1UJYA 1UFFA 4Y91A 1ARKA 4N0AA 2E1HA 1VQ9A 2HD0A 2QXFA 2JZ2A 3CCSQ 2HEQA 1PHTA 4J9EA 4PJNA 4GLKA 2KY9A 5GAN5 2RHUA 2KSSA 1YCSB 2HSEB 1M1KU 4M78G 5LJ5g 1VQ4Q 5FW9A 2WSEE 4DEXA 4C8QD 1MMNA 1S72T 4R56A 4L59A 1QVFA 2L89A 3SEMA 4A4FA 3INZA 5GANe 4XU2A 2WSFE 2JJ9A 4M77E 4M75A 5CVIA 4BY6C 1M2OA 1W1FA 2HDAA 1JB0E 5A0LA 2J6FA 3M55A 2DX1A 1M90C 8ATCB 4QVCA 3CD6A 3CBMA 3FEOA 2GNCA 4HVVA 2PVGB 1GL5A 3PIPA 3E1SA 1QKWA 5KE2A 1C1AA 2JTFA 4N4IA 4X34A 1PKSA 1YN8A 2CZ0B 2OTLQ 1W2BP 2CP6A 4IKFA 2YUPA 1UGSB 2NUTA 4E6RA 1N8RC 1RLQC 2RF0A 2QEXA 4BD3A 1N9SA 1VQ6T 2OTJA 4QVDA 4HXJA 2L3RA 2VGNA 2OAUA 4D8KA 2EQKA 4JZ3A 2GBQA 4R55A 1VA7A 3JCMQ 1U1TA 2XG8D 2YLBA 1NG2A 1YNZA 2SEMA 2HQHA 4F7UF 4C5IA 3VS2A 3N5BB 2RJCA 3ZFJA 5GMKj 3PT9A 3V8LA 1N8RU 2EGCA 3V7RA 4M78E 3EG1A 5D6XA 5GAN6 1P92A 4E7HA 3CPWA 2EYWA 4J83A 3PVQA 2RHZA 3NTKA 1IGUA 2FHDA 3OW2P 4JPBW 2V8KA 2M9UA 1D0XA 2DIGA 1UE9A 2M16A 4DBFA 4J9GA 1BCOA 5FU6B 3LGFA 3OYEA 3ZL7C 3X24B 2ZPEB 3JCMX 2BUDA 1GFDA 3EH1A 2WSCE 2VKNA 1KD1C 5CKBA 2O9SA 3CCEA 3CMAQ 4XU0A 4A4HA 2E6NA 1OU8A 2KR3A 4E7JA 5GAN4 3LW5E 2RN8A 2M02A 1N5ZA 2ENMA 4M7AB 2O01E 2DXBA 1Y57A 2V1QA 5KCHA 4A53A 1VQLT 2LJ0A 1K9MC 1KD1U 4EPCA 5GANh 2COZA 2NLUA 2R57A 2RQWA 3X28B 2KYMA 4FT4A 3MEAA 1RADB 2MPXC 1UB4A 1UHFA 3GF5A 4UC4A 2A3LA 1B7TA 1CKAA 3O8VA 1I4K1 1K9MU 2CT3A 2PVOB 2NUZA 1Q81C 3CXCA 1VQ5A 1SKUB 3JRZA 3SB2A 2Y4XA 2ZAEA 1VQNA 2RHIA 2PVDB 3TSWA 3HL8A 3I56T 4E7KA 1BI1A 1PRMC 4P5NA 2X3WD 5HKCA 2DF6A 4Z8AA 2DZ9A 3CCVA 2ZPBB 2ROLA 1YHQQ 3SFMA 3NMZC 1UEBA 2LX7A 4F14A 2DZCA 2BE9B 2LMJA 4KUIA 1RAAB 3HSBA 1WZOA 1Q81U 2ZPHB 2MCNA 3A98A 3T9NA 3UA7A 1YJ9Q 4EDUA 3L2QA 2QG9B 2HBWA 3M4GA 1KIKA 2P4TA 1WXUA 1M90R 1LVKA 1NZ9A 1MV0B 5GANg 1VQ8A 3CCSA 1Y71A 2HAXA 5L8RE 2X51A 1RAEB 5KYNA 2DJQA 1QLYA 1BI2A 5CKEA 1VQ4A 1N8RR 4M7DC 2FYKA 3OW2S 3ZEHA 1YITT 2ZZDA 4LDXA 1K76A 4K11A 2BE7D 2K5FA 2E3IA 3Q1JA 5FROA 4KGZB 1T3LA 1UUEA 2D0NA 1M1FA 2FZKB 3FDRA 4MZMA 5C6SA 4M7AG 2DXTA 2AIRB 1QVGA 2LVMA 1MGQA 3H0HA 4ZTJA 3OYKA 3CPFA 4OB1B 1BI0A 3VUZA 1AZGB 1C6VX 1PC0A 4TVRA 2F2WA 2DKGA 3LH0A 2GQVA 1Y96B 1X6BA 4J9HA 3EGDA 5J39A 1ZSZB 4DQ2A 2C0OA 5EG2A 2O4XA 2EBPA 4RG8A 1B34A 2DL5A 4KT0E 1Z9ZA 3AT1B 3NGPA 2K9GA 4C92A 3GPLA 2W0ZA 3QKJA 2DERA 2M0OA 1TS9A 2OX7A 2M0YA 4KH1B 3E9GA 4RTWA 8AT1B 2DA9A 5GMKe 4ATOA 4DBRA 4C0FA 3M0TA 3CCMA 2EJFA 1IREB 2EW3A 3CC2Q 2IPOB 1Q82R 2DJZA 2ABLA 2DAQA
chains in the Genus database with same CATH topology
2MK5A 1R77A 4LXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MK5 A;  1R77 A;  4LXC A; 
#chains in the Genus database with same CATH topology
 3QZ9 B;  1YJN T;  2K3Y A;  1BB9 A;  3V8J A;  3CCJ Q;  4PJO C;  3JCM c;  3KBG A;  1AOJ A;  3REB B;  4BAC A;  3CCR T;  4M7A E;  3RKW A;  1QMC A;  4ZGD B;  2KVQ G;  2L3S A;  3G4S Q;  1G3T A;  4BDY A;  2Y90 A;  1KFZ A;  1RAC B;  3QHS A;  4FCY A;  1PM3 A;  1VQ9 Q;  1WYX A;  1Z9Q A;  1NJI U;  1YWO A;  4LD9 K;  1M3B A;  3OYL A;  4LXC A;  2F69 A;  1UGV A;  3CMA A;  4IUT A;  1HJD A;  2JTE A;  2L3P A;  2BZY A;  1YFN A;  2RQT A;  3M9Q A;  4OMF B;  1WPY A;  3OYA A;  5KYY A;  1WHK A;  3OYI A;  2DMO A;  3M54 A;  3EG9 B;  2ED1 A;  3C4S A;  2HCK A;  5GAO m;  4ESR A;  2K3X A;  5GAN j;  5J26 A;  1MMG A;  1YIT Q;  2RK1 A;  2QDL A;  4LDY A;  2KGT A;  5KCO A;  4PJO F;  2LCL A;  2P0P A;  2AKK A;  3DLM A;  3D7S B;  3SWN A;  4RCB A;  4BDZ A;  4EMK A;  4Z88 A;  3PFS A;  2QEX Q;  2G3R A;  1OQK A;  3EGX B;  2P4R A;  4X9D A;  2OTJ Q;  5I22 A;  5CQY A;  3QZ5 B;  2LNV A;  1E6G A;  1OI1 A;  3GLX A;  1NE8 A;  1ZHI A;  2CS7 A;  4RUG A;  4HVW A;  2K5I A;  4M77 C;  2D6F A;  5KYU A;  1YHQ A;  3QO3 A;  3PNW C;  5GMK h;  2VV5 A;  1VQO T;  3H41 A;  2VVK A;  2F5T X;  4HVU A;  4C0D C;  4J6Y A;  2EPD A;  2AT1 B;  1QVF P;  3ULR B;  3OYY A;  1TSF A;  3TEE A;  4LN2 A;  3CC4 T;  4B9W A;  4A63 B;  2DYI A;  3EFO A;  2EKH A;  1H3H A;  1WHH A;  1NLO C;  4C8Q B;  1M5Q 1;  2DXU A;  1F1B B;  2RI5 A;  2DD4 A;  1X2K A;  2K7A A;  3M0R A;  4OVA A;  4FYY B;  3JCM W;  3I55 T;  5KH6 A;  2COY A;  3G7Z A;  2EFI A;  1D1A A;  3CCE Q;  1Q86 R;  1BI3 A;  4M78 C;  1YWP A;  3VS6 A;  4ELZ C;  4PJO D;  2L2P A;  3SDZ A;  1ZX6 A;  4J9B A;  2XIC A;  1KHC A;  4WF2 A;  2OJ2 A;  4PKC C;  3LWH A;  2FO0 A;  4ZNX A;  2XDD A;  2EAY A;  3TVT A;  1EX4 A;  3MHX A;  1OPL A;  2EQU A;  1OUL A;  3HP9 A;  4OGC A;  3G6E Q;  5FRN A;  5AT1 B;  3BW1 A;  3OYD A;  1EZZ B;  3S3N A;  2RH2 A;  3C94 A;  3M0P A;  3L2V A;  4ZGE B;  5CK9 A;  4PFP A;  4GLM A;  2XID A;  1U1S A;  2HNI A;  3HRT A;  1XOV A;  3EAE A;  3WVE B;  1GFC A;  2CDT A;  5LL6 S;  1IGQ A;  3OYB A;  1WX6 A;  3HFN A;  2XD0 A;  4DA4 A;  1NEB A;  5ECA A;  1WXT A;  2YSQ A;  4HCC A;  3VV0 A;  1QP2 A;  2GTO A;  1T0H A;  1O9S A;  4MMK A;  1ABQ A;  3OYF A;  2Z0W A;  3CCJ A;  4E7I A;  2HBP A;  2HL5 C;  4JLI A;  4Q5W A;  2KRS A;  3HKS A;  3UA6 A;  1KQ1 A;  3JB9 J;  3M0S A;  1IZ6 A;  3G4S A;  5GAN 2;  3BDL A;  3VJP A;  2QA4 Q;  4BI8 B;  2DBK A;  4C8Q G;  1VQ8 Q;  4A4G A;  2A0F B;  2DL8 A;  1KG1 A;  3FLG A;  3I35 A;  1QVF S;  1D0Z A;  4E7Z A;  2LQW A;  4X1V A;  3REA B;  2YUN A;  5GAO p;  3J80 E;  3E9F A;  1X75 C;  4N0A C;  5DLQ E;  2QK0 A;  2E5Q A;  2IVW A;  5GAM f;  2FG0 A;  1AHJ B;  1JJ2 P;  1SRM A;  1ZLM A;  4F7U B;  1WJS A;  4BUG A;  5IH2 A;  1T0J A;  3CXC P;  3VS1 A;  3R6N A;  2L0A A;  3VS0 A;  2YWW A;  5GAO r;  1MMA A;  1UGQ B;  2SRC A;  2RJF A;  2LT1 A;  4PJL A;  1GBQ A;  4FW1 A;  5I2S A;  2PU9 B;  1VQP T;  2V26 A;  1YIT A;  1X27 A;  5CKF A;  4BY6 B;  3RES A;  2JS0 A;  3QYH B;  3VKI A;  4M75 C;  5GAM j;  4FSX A;  1PG5 B;  4YTL A;  1M1G A;  1NLP C;  3QUI A;  1K73 C;  1I0C A;  4JDS A;  2DEU A;  2RI2 A;  3PMI A;  3X20 B;  5LJ5 d;  2CH4 A;  5CR2 A;  2K5L A;  1M90 U;  4KBM B;  2YRD A;  1NM7 A;  2DL7 A;  3M56 A;  3R6O A;  4FYV B;  2J6O A;  1FXX A;  1X01 A;  5I11 A;  1SG5 A;  1VYV A;  3J7A F;  3RNJ A;  2O88 A;  2JMC A;  3CCM Q;  2MK5 A;  1SEM A;  3VUB A;  2CP0 A;  2ZPG B;  1PRL C;  3GIB A;  3GNF B;  2BTT A;  4E7S A;  3UF4 A;  3QG1 A;  2OAW A;  2QAS A;  1CSK A;  4C5H A;  4OF1 A;  1ZQ1 A;  3NPF A;  2A28 A;  2GGR A;  1VQ7 T;  4RTX A;  2VUB A;  2D1X A;  1KK7 A;  2DFU A;  4CI0 C;  5GAN 3;  1WDX A;  5GAO l;  1XNI A;  1IHV A;  3LYI A;  2K2M A;  3VYG A;  2CP2 A;  3HPW A;  4M75 F;  3OYJ A;  3CCL T;  3MO8 A;  1YJN A;  2DEQ A;  4BE1 A;  1G5V A;  4ANJ A;  2K6D A;  2R5A A;  2FEI A;  3MJX A;  3LH5 A;  4E47 A;  1Q82 C;  1OZ2 A;  3JCM P;  4M7A A;  5KYW B;  3CEY A;  2F2V A;  5J3B A;  3CME T;  2VYT A;  1ZBX A;  4F7U G;  3RKY A;  4VUB A;  2GF7 A;  1MUZ A;  3MPU B;  1Y7X A;  2P0K A;  2D0Q B;  1TUD A;  3LWI A;  1OV3 A;  1IHW A;  1M8M A;  3OMG A;  4NS5 A;  2EGA A;  1O75 A;  2YDL A;  4MDX A;  5LJ5 f;  1FMK A;  2K4Y A;  4AFS C;  1M2V B;  4M7D D;  3I5S A;  2J7I A;  1Q82 U;  4II1 A;  2VAS A;  3G6E A;  1JJ2 S;  3OSV A;  2KMT A;  2NUP B;  2RMO A;  3P8D A;  1S72 Q;  3JB9 F;  2DIL A;  5KYX B;  1RI0 A;  1QQJ A;  1UGP B;  1WIE A;  3A8G B;  2RJE A;  2JXB A;  3CC7 T;  4AFU C;  5A0G A;  1IRX A;  1PNJ A;  2QAZ A;  2DXC A;  4BB7 A;  1KC8 R;  3A1P A;  3H8Z A;  1M3A A;  3CCU T;  2KI7 A;  1W2B S;  1YI2 T;  1OU9 A;  5IXB A;  3JCM J;  1OX9 A;  2A7Y A;  3WXM B;  1V1C A;  1G3Y A;  1Y07 A;  1TUC A;  1Q95 G;  2L3Q A;  4M75 D;  2HQE A;  2KAF A;  1V76 A;  1VQ6 Q;  4FM4 B;  3OS5 A;  2XI9 A;  1NPR A;  4XTW A;  4QQG A;  3MP1 A;  2KBT A;  3PGG A;  1ZUU A;  2K57 A;  5GJW B;  4AG2 C;  1Q7Y R;  4HT9 A;  4F7U E;  1TG0 A;  2QA4 A;  3EH2 A;  3GNG A;  1IB8 A;  3CQT A;  3TRE A;  3OBY A;  4OB3 B;  2M51 A;  3OYC A;  4JRQ A;  1D1C A;  5FU7 C;  2LZ6 B;  2H3E B;  2CH4 W;  1HD3 A;  1A0N B;  4AT1 B;  4XTX A;  3OS2 A;  1WI7 A;  1FMV A;  1RUW A;  2EJG A;  3FRN A;  4C5G A;  1K73 R;  1XQH A;  2EKO A;  1GCQ A;  3URG A;  1XTD A;  4M7D B;  2JM8 A;  3JB9 D;  1ABO A;  3QJ6 A;  2CRE A;  2GQI A;  2K3B A;  1M9S A;  2CZ6 B;  4D8D A;  3I55 A;  1X2Q A;  3TU4 K;  2RPN A;  3CD6 T;  1AWJ A;  1D1B A;  2YXY A;  1Y96 A;  3MKD A;  4JJD A;  3I9Q A;  4J6X A;  5GAM e;  1ZSZ A;  4A54 A;  4MZT A;  4CC7 A;  3JAM E;  4CRI A;  4DBQ A;  2E10 A;  1MMD A;  1X43 A;  1Q86 C;  1VQL Q;  1KQS P;  3H6Z A;  1ZSG A;  5GAN 7;  1VQK T;  2PZ1 A;  3L2Z A;  4PK4 A;  4FIB A;  4OMQ A;  3MET A;  3L2R A;  1W70 A;  4M7D F;  5GMK m;  4C92 C;  4PJJ A;  4CC3 A;  1AWO A;  2O31 A;  4QT7 A;  1IO6 A;  3V7S A;  2P0Q A;  1Q86 U;  1YCY A;  3M5A A;  4HT8 A;  2QI2 A;  3M0Q A;  2JMA A;  3JB9 I;  4E2F B;  1ZBJ A;  1N9R A;  3EFR A;  3RIR A;  3I56 Q;  1SSH A;  4AG1 C;  2HL3 A;  1R0B G;  3X25 B;  4PJO B;  1E6H A;  1PCX A;  2DK3 A;  2I2L A;  2QDY B;  1YJW T;  1WFW A;  1PKT A;  3OYM A;  1OOT A;  2JUF A;  3PIO A;  3LLR A;  4N4H A;  1QCN A;  4QKU A;  5LJ3 d;  1ZA2 B;  3I5R A;  4QQ6 A;  2XMF A;  2PTK A;  4EMG A;  1JBM A;  1T3S A;  4LNP A;  1UTI A;  3UPU A;  2H3J A;  2YUQ A;  4ZGJ B;  2JM9 A;  2EQM A;  2HSP A;  4C92 F;  5GMK i;  2JTM A;  2IIM A;  2M1H A;  3OBW A;  3FJ5 A;  2W10 A;  5FLX E;  2X4W A;  4AFZ C;  3GP8 A;  3VS7 A;  1UHC A;  2XKO C;  2PUK B;  1DJ7 B;  2V1R A;  2V8J A;  1VOM A;  2MWO A;  2VXF A;  1S72 A;  1QW1 A;  3NFC A;  1UJ0 A;  3QJY A;  2RM4 A;  5GAM h;  4PFO A;  1OYX A;  2QGG A;  3EGX A;  3BFM A;  3PE0 A;  4J9F A;  5A0D A;  1VQP A;  4MML A;  1VQ5 T;  1LNX A;  2FPD A;  3RR6 A;  2HMA A;  3QDF A;  1VQN T;  3RBB B;  1W6X A;  3UDC A;  1WHM A;  1AWW A;  1RI9 A;  2AZS A;  3ER0 A;  3SWN C;  3CCV T;  3QYG B;  1VQM T;  4EMK C;  2ATC B;  2V8I A;  4X9C A;  1FWZ A;  3RMQ A;  3G71 T;  3CBO A;  1YIJ T;  2CP7 A;  4OGE A;  1VQ6 A;  2DVE A;  3JCM d;  4M77 B;  1KQS S;  4BE2 A;  1GRI A;  3LGL A;  2JNG A;  3VS4 A;  2Y4Y A;  5LJ3 f;  4C0D B;  3WVD B;  1HYO A;  2KDS A;  1D3B B;  4C8Q A;  1X6G A;  3OSS C;  3CCS T;  2RNA A;  3S3O A;  3E2U A;  2BKD N;  4LDU A;  2DM1 A;  4B9X A;  4RKU E;  4PJO G;  1TTH B;  4LUE A;  5IAY A;  4XTV A;  1VQ4 T;  4C92 D;  2CZ7 B;  1AD5 A;  2QQB A;  3S6W A;  3HTR A;  1UDL A;  1RAB B;  3JSC A;  5GAM g;  1B07 A;  4J9D A;  1YJN Q;  5FRM A;  2KXD A;  5HCK A;  4BI3 A;  3SD4 A;  2F5K A;  1U8R A;  1LCK A;  4JJC A;  3RKX A;  1SRL A;  1QWF A;  4O6J A;  2B8A A;  5CQX A;  5LJ3 j;  2HQX A;  3CCR Q;  1WQW A;  1E7O A;  4PLI A;  1HK9 A;  2VWF A;  2LQ8 A;  4M77 F;  5D7U A;  4M78 B;  4HCB A;  2KE9 A;  2PQW A;  4QQD A;  2CUD A;  3TQ7 P;  4RTT A;  2FB7 A;  1G83 A;  1HXD A;  1OEB A;  2H8H A;  2R58 A;  4AFQ C;  3KFV A;  2ZCF B;  1I5L A;  3NTH A;  2CT4 A;  2PUO B;  3HRU A;  2OTL T;  3CPW P;  4RMO A;  3UT1 A;  4LUD A;  3CME A;  1WLP B;  3RDV A;  1VYU A;  2RI3 A;  1AVZ C;  1JXO A;  2O9V A;  1QCO A;  1I07 A;  1VQL A;  4RTV A;  2VXE A;  4NL2 A;  2J05 A;  1U3O A;  4JJB A;  3A8L B;  3JCM f;  2DL4 A;  1I81 A;  1BIA A;  1RL2 A;  2EGE A;  1WHJ A;  3MP8 A;  1J3T A;  4FSS A;  2EWN A;  2CP5 A;  4WTO B;  4PJO E;  4ZTF A;  5LJ5 h;  4HKE A;  3L1A A;  2QTV A;  3LX7 A;  4M78 F;  5EC7 A;  3OY9 A;  2ROT A;  2AHJ B;  2LNH B;  4XTY A;  4J5Y A;  2F1L A;  3DB3 A;  1FMW A;  4RG2 A;  3EG3 A;  2DPP B;  1ZUY A;  3CC7 A;  3JB9 H;  1N6A A;  4J7F A;  3I56 A;  4N4G A;  2DLP A;  3CCU A;  4OMN A;  3OS1 A;  3OYN A;  1H64 1;  4DBH A;  1LJO A;  1VQO Q;  4M77 D;  2XDP A;  2FPE A;  3RUX A;  3UAT A;  4GBQ A;  1I1J A;  1M1K C;  1K0X A;  2A08 A;  4XU3 A;  1KC8 C;  1QWE A;  3HRS A;  2MI6 A;  2GFU A;  5CAI A;  3M0U A;  4PL6 A;  1WQ7 A;  3CC4 Q;  2DNU A;  1U5S A;  4F7U A;  4LE9 A;  2QYZ A;  4JJN K;  2RA2 A;  4NL3 A;  1QKX A;  2DL3 A;  5DLO A;  3QWY A;  4XU1 A;  3KUF A;  4J9C A;  2E41 A;  2ECZ A;  4O5V A;  3MEV A;  1AWX A;  2KT1 A;  5GMK l;  2K79 A;  4JS4 A;  1Q7Y C;  3I55 Q;  1KC8 U;  1OX8 A;  2D8H A;  3ME9 A;  1VYT A;  5KE3 A;  1UG1 A;  2E64 A;  4JS5 A;  5L23 A;  2K2V A;  4IUR A;  2CSQ A;  3S3M A;  2DTH A;  4C0Z A;  3O5Z A;  4M78 D;  2MYS A;  2VB6 A;  2IG0 A;  1Q7Y U;  4JRP A;  4M75 B;  3MEU A;  1AEY A;  1SF9 A;  4MDW A;  2X4Y A;  2WAC A;  2VGM A;  3CPW S;  4C8Q E;  4ELY C;  1YHQ T;  5I21 A;  3BE3 A;  5C0M A;  4C0G A;  2GCX A;  2RK2 A;  2EYY A;  1VIF A;  2NUT B;  4FW2 A;  2MF2 A;  1K73 U;  4DOW A;  3CCQ T;  2DBM A;  1EIF A;  2RHY A;  1BIB A;  1YJ9 T;  4OB2 B;  1K8A R;  2OI3 A;  1VQK A;  1MV3 A;  4IUP A;  4L5G A;  4KGV B;  2RJD A;  4J6W A;  4ORZ A;  1QVG P;  2C0T A;  3L2U A;  1BK2 A;  1PSE A;  2KEA A;  5IXF A;  1FX7 A;  2YUO A;  4XQ3 A;  1EFN A;  3H0I A;  3BY7 A;  1PWT A;  3JCM V;  3OS0 A;  1R8O B;  2GTJ A;  1RAG B;  5FU6 C;  3DLL A;  2D8J A;  1KQ2 A;  1MNE A;  5LJ3 e;  4HCZ A;  2LP5 A;  2MMP A;  5KYW A;  1HSQ A;  3QSU A;  5A2Q E;  2NWM A;  1M4Z A;  3EHR A;  2XU8 A;  3CCR A;  2EQJ A;  1WJQ A;  1VIE A;  1BKB A;  3A8M B;  1YJW A;  2JN0 A;  2AK5 A;  3THK A;  2KRN A;  2RHX A;  2BIV A;  1QP3 A;  4LDV A;  1GBR A;  3C95 A;  2YT6 A;  2JS2 A;  4M7A C;  1M2V A;  1D09 B;  3KXT A;  1TUG B;  4IUU A;  1KSW A;  2NUP A;  2QQ9 A;  1GCP A;  2D9T A;  2MIO A;  5KYX A;  3CXC S;  4F04 B;  1G3S A;  4J7I A;  4OMP A;  3UWN A;  3V8K A;  2E4H A;  3CBP A;  4V2S A;  2I0N A;  3AHU A;  2DRK A;  4AMC A;  1SSF A;  1VQP Q;  4M75 G;  2CUB A;  4L6V 5;  2X4J A;  1UEC A;  3X26 B;  3MCA B;  1M1K R;  3CC2 T;  2R5M A;  2L8D A;  5LJ5 j;  1OZ3 A;  3FC3 A;  4PJM A;  1SHG A;  2KYB A;  3JCM b;  5GAO n;  4J8O A;  1JJ2 A;  3CCJ T;  1AZE A;  1SPK A;  3JCM e;  2E6Z A;  5GAN 8;  4FT2 A;  2FPF A;  2LQK A;  4PLL A;  3VRY A;  4M7A F;  4KH0 B;  3G4S T;  1VQ9 T;  3QWX X;  1VQM A;  4J9I A;  3G71 A;  1VQO A;  5IHN A;  3GBQ A;  4FU6 A;  3P8H A;  1YIJ A;  4MZP A;  2HKN A;  4HCK A;  2LC4 A;  2E3H A;  2KNB B;  2DET A;  3JB9 G;  3OYH A;  1I8F A;  3CCQ Q;  1W2B A;  2JOY A;  4XTU A;  3QDR B;  3L2W A;  3CC4 A;  1M30 A;  4Z02 A;  1VQ7 Q;  3EGU A;  1QVG S;  1TH7 A;  5FU7 B;  4M7D A;  1GXI E;  2P84 A;  2KRO A;  5IT9 E;  3PVL A;  3NTI A;  4A4E A;  5LJ3 h;  4GY5 A;  2YHT A;  2ZPF B;  1JEG A;  4ZN1 A;  2YLC A;  4JUV A;  4LDW A;  2MWP A;  3P8B B;  4KUL A;  1WHL A;  4M75 E;  1D0Y A;  2XHC A;  2A36 A;  4JRK A;  1G2B A;  2LJ3 A;  2KRM A;  2KK4 A;  1GCQ C;  4A4K A;  4C5E A;  1TXQ A;  5HY6 A;  3CCL Q;  1M8V A;  1K1Z A;  4FL6 A;  2FVU A;  5HK0 A;  2PNI A;  2C0I A;  3M58 A;  2JT4 A;  3EG2 A;  2LTO A;  5GAN d;  1RAI B;  2FZC B;  2X4X A;  3OW2 A;  1NPP A;  3RMS A;  3VU3 C;  2QEX T;  2DIQ A;  3CME Q;  2RQR A;  3J81 E;  2OTJ T;  3M53 A;  3DKM A;  3M59 A;  3ASK A;  3EHQ A;  1G3W A;  1ZSZ C;  5D6W A;  3M4Y A;  1FYN A;  2HKQ B;  1Y0M A;  2LCC A;  3ZBD A;  1RLP C;  1H92 A;  2MAM A;  4ME7 A;  2EQI A;  2OTL A;  2EYQ A;  4M7A D;  4Y28 E;  3EG0 A;  5IHI A;  3EGD B;  4FYX B;  2EIF A;  2E70 A;  2J6K A;  2O4X B;  3L42 A;  2ESW A;  5D6Y A;  9ATC B;  1B34 B;  3U23 A;  2LRQ A;  1LOJ A;  1K9A A;  5LJ3 g;  4C92 B;  1S1N A;  2CP3 A;  3CC7 Q;  1KD1 R;  3OB9 A;  2RQV A;  2CGH A;  3DB4 A;  3JCM h;  2XDB A;  4PJO A;  2J06 A;  3QII A;  2ED0 A;  4XTZ A;  2MOX A;  5CKD A;  3CCU Q;  2GFA A;  1NJI C;  2CZ1 B;  1R0C B;  5IN1 A;  4ZN3 A;  1YI2 Q;  2DTO A;  1MND A;  4OP0 A;  1ZUK A;  3A8H B;  3OA6 A;  3HFO A;  2YRC A;  6AT1 B;  2VC8 A;  3QBY A;  3CCE T;  1IXD A;  2ZGW A;  3H9N A;  2EYZ A;  1JO8 A;  2O2O A;  4Y92 A;  4Z89 A;  1K9M R;  4F16 A;  1BYM A;  2JVV A;  3QXE B;  2BZ8 A;  1BU1 A;  3EG9 A;  4OB0 B;  5I2M A;  5GAN f;  5GJV B;  1JXM A;  4IIO A;  1PD0 A;  4QW2 A;  3HHT B;  4M7D G;  1R77 A;  2EJ9 A;  5DY9 A;  3SHW A;  4E7L A;  2F2X A;  3PMT A;  3H0F A;  3MEW A;  1KJW A;  3G6E T;  1Q81 R;  5FWB A;  4DOV A;  1NBE B;  2KXC A;  2QQR A;  2X3X D;  2A37 A;  2RQU A;  5KYY B;  1WXB A;  3VS3 A;  4FYW B;  1TU0 B;  4LD6 A;  4NOY A;  1YP5 A;  3GOX A;  1B3Q A;  4KUD K;  4PFZ A;  2DD5 A;  4XK8 E;  4EIK A;  3JCM g;  4HA8 A;  1BBZ A;  2FL7 A;  3MP6 A;  4PNO A;  2AZV A;  5LJ5 e;  3CD6 Q;  3PTA A;  5DM7 R;  2DTI A;  4BE0 A;  2G6F X;  4OMO A;  2CKK A;  1TWB A;  2KT8 A;  3TCJ A;  4CC2 A;  3NHN A;  2DRM A;  1NEG A;  3OMC A;  4M77 A;  4JLG A;  3SWN B;  1VUB A;  1QCF A;  4EMK B;  4EMH A;  5CCA A;  2BZX A;  1G8X A;  2DE0 X;  1CKB A;  1D3B A;  2QQS A;  1AT1 B;  1W4S A;  1ACM B;  4IUQ A;  1VQK Q;  5IHK A;  2LX9 A;  4RTZ A;  4C92 G;  1YBY A;  2EYX A;  2QA4 T;  4M7D E;  5HK3 A;  1VQ8 T;  4IUV A;  2DVJ A;  5KYU B;  1WGS A;  2EVR A;  1XJW B;  2FRY A;  3C12 A;  1RAH B;  1NYF A;  3CCQ A;  2FZG B;  4C8Q C;  1JRI A;  3VYH B;  1YJ9 A;  2LT4 A;  2E5K A;  3F70 A;  1VQ7 A;  3EFO B;  4BI4 A;  1KQS A;  3OQ5 A;  2LCS A;  4QVZ A;  7AT1 B;  2QGF B;  3M57 A;  4WCI A;  3EFS A;  4M78 A;  1M27 C;  4KGX B;  1MHN A;  4RTU A;  1K8A C;  1YJW Q;  2L5Q A;  1SHF A;  2RO0 A;  2XK0 A;  1X6O A;  4DEY A;  3CCL A;  2FRW A;  2LDM A;  3VS5 A;  4RCC A;  2QQA A;  3JV3 A;  4OMM A;  4RTY A;  2B86 A;  3VRZ A;  1I5O B;  1WA7 A;  2X9H A;  1H3Z A;  4F17 A;  3A8O B;  5CO7 A;  2LQN A;  3OYG A;  2C06 A;  1K8A U;  3QPH A;  4R0K A;  2CYZ B;  1X69 A;  2YRV A;  4C92 E;  2DO3 A;  2LJ1 A;  5GAM d;  1NJI R;  3FJP A;  2HZY A;  4C8Q F;  1JQQ A;  2CSI A;  4D6W A;  2QTX A;  3CCM T;  1WNL A;  1OPK A;  3BDU A;  4JRI A;  1ZA1 B;  1PSF A;  2COW A;  1K4U S;  2E12 A;  2X35 A;  3RER A;  1WHG A;  4B6M A;  3C0C A;  5AYF A;  1NYG A;  1QVP A;  5CKH A;  2RB6 A;  5FWC A;  3A5Z B;  3IQL A;  1V29 B;  2E65 A;  1H8K A;  1LPL A;  3V7C A;  1VQ5 Q;  4M77 G;  3FB9 A;  2ZPI B;  2KQW A;  1VQN Q;  4JZ4 A;  1JU5 C;  4OML A;  3CC2 A;  1RAF B;  2JW4 A;  1KHI A;  1BCM A;  1U06 A;  3CCV Q;  2NYS A;  1VQM Q;  1YI2 A;  4CC4 B;  4XAX B;  1UGR B;  3E19 A;  3TSZ A;  3G71 Q;  1PD1 A;  5GAO q;  2DYB A;  1YIJ Q;  2AKL A;  5M9O A;  3CMA T;  1WJR A;  1C0M A;  4IIM A;  2RD1 A;  1M3C A;  4M4Z A;  1K0S A;  1N27 A;  4KRT A;  3FIF A;  5CIU A;  1TOV A;  3G1J A;  1UJY A;  1UFF A;  4Y91 A;  1ARK A;  4N0A A;  2E1H A;  1VQ9 A;  2HD0 A;  2QXF A;  2JZ2 A;  3CCS Q;  2HEQ A;  1PHT A;  4J9E A;  4PJN A;  4GLK A;  2KY9 A;  5GAN 5;  2RHU A;  2KSS A;  1YCS B;  2HSE B;  1M1K U;  4M78 G;  5LJ5 g;  1VQ4 Q;  5FW9 A;  2WSE E;  4DEX A;  4C8Q D;  1MMN A;  1S72 T;  4R56 A;  4L59 A;  1QVF A;  2L89 A;  3SEM A;  4A4F A;  3INZ A;  5GAN e;  4XU2 A;  2WSF E;  2JJ9 A;  4M77 E;  4M75 A;  5CVI A;  4BY6 C;  1M2O A;  1W1F A;  2HDA A;  1JB0 E;  5A0L A;  2J6F A;  3M55 A;  2DX1 A;  1M90 C;  8ATC B;  4QVC A;  3CD6 A;  3CBM A;  3FEO A;  2GNC A;  4HVV A;  2PVG B;  1GL5 A;  3PIP A;  3E1S A;  1QKW A;  5KE2 A;  1C1A A;  2JTF A;  4N4I A;  4X34 A;  1PKS A;  1YN8 A;  2CZ0 B;  2OTL Q;  1W2B P;  2CP6 A;  4IKF A;  2YUP A;  1UGS B;  2NUT A;  4E6R A;  1N8R C;  1RLQ C;  2RF0 A;  2QEX A;  4BD3 A;  1N9S A;  1VQ6 T;  2OTJ A;  4QVD A;  4HXJ A;  2L3R A;  2VGN A;  2OAU A;  4D8K A;  2EQK A;  4JZ3 A;  2GBQ A;  4R55 A;  1VA7 A;  3JCM Q;  1U1T A;  2XG8 D;  2YLB A;  1NG2 A;  1YNZ A;  2SEM A;  2HQH A;  4F7U F;  4C5I A;  3VS2 A;  3N5B B;  2RJC A;  3ZFJ A;  5GMK j;  3PT9 A;  3V8L A;  1N8R U;  2EGC A;  3V7R A;  4M78 E;  3EG1 A;  5D6X A;  5GAN 6;  1P92 A;  4E7H A;  3CPW A;  2EYW A;  4J83 A;  3PVQ A;  2RHZ A;  3NTK A;  1IGU A;  2FHD A;  3OW2 P;  4JPB W;  2V8K A;  2M9U A;  1D0X A;  2DIG A;  1UE9 A;  2M16 A;  4DBF A;  4J9G A;  1BCO A;  5FU6 B;  3LGF A;  3OYE A;  3ZL7 C;  3X24 B;  2ZPE B;  3JCM X;  2BUD A;  1GFD A;  3EH1 A;  2WSC E;  2VKN A;  1KD1 C;  5CKB A;  2O9S A;  3CCE A;  3CMA Q;  4XU0 A;  4A4H A;  2E6N A;  1OU8 A;  2KR3 A;  4E7J A;  5GAN 4;  3LW5 E;  2RN8 A;  2M02 A;  1N5Z A;  2ENM A;  4M7A B;  2O01 E;  2DXB A;  1Y57 A;  2V1Q A;  5KCH A;  4A53 A;  1VQL T;  2LJ0 A;  1K9M C;  1KD1 U;  4EPC A;  5GAN h;  2COZ A;  2NLU A;  2R57 A;  2RQW A;  3X28 B;  2KYM A;  4FT4 A;  3MEA A;  1RAD B;  2MPX C;  1UB4 A;  1UHF A;  3GF5 A;  4UC4 A;  2A3L A;  1B7T A;  1CKA A;  3O8V A;  1I4K 1;  1K9M U;  2CT3 A;  2PVO B;  2NUZ A;  1Q81 C;  3CXC A;  1VQ5 A;  1SKU B;  3JRZ A;  3SB2 A;  2Y4X A;  2ZAE A;  1VQN A;  2RHI A;  2PVD B;  3TSW A;  3HL8 A;  3I56 T;  4E7K A;  1BI1 A;  1PRM C;  4P5N A;  2X3W D;  5HKC A;  2DF6 A;  4Z8A A;  2DZ9 A;  3CCV A;  2ZPB B;  2ROL A;  1YHQ Q;  3SFM A;  3NMZ C;  1UEB A;  2LX7 A;  4F14 A;  2DZC A;  2BE9 B;  2LMJ A;  4KUI A;  1RAA B;  3HSB A;  1WZO A;  1Q81 U;  2ZPH B;  2MCN A;  3A98 A;  3T9N A;  3UA7 A;  1YJ9 Q;  4EDU A;  3L2Q A;  2QG9 B;  2HBW A;  3M4G A;  1KIK A;  2P4T A;  1WXU A;  1M90 R;  1LVK A;  1NZ9 A;  1MV0 B;  5GAN g;  1VQ8 A;  3CCS A;  1Y71 A;  2HAX A;  5L8R E;  2X51 A;  1RAE B;  5KYN A;  2DJQ A;  1QLY A;  1BI2 A;  5CKE A;  1VQ4 A;  1N8R R;  4M7D C;  2FYK A;  3OW2 S;  3ZEH A;  1YIT T;  2ZZD A;  4LDX A;  1K76 A;  4K11 A;  2BE7 D;  2K5F A;  2E3I A;  3Q1J A;  5FRO A;  4KGZ B;  1T3L A;  1UUE A;  2D0N A;  1M1F A;  2FZK B;  3FDR A;  4MZM A;  5C6S A;  4M7A G;  2DXT A;  2AIR B;  1QVG A;  2LVM A;  1MGQ A;  3H0H A;  4ZTJ A;  3OYK A;  3CPF A;  4OB1 B;  1BI0 A;  3VUZ A;  1AZG B;  1C6V X;  1PC0 A;  4TVR A;  2F2W A;  2DKG A;  3LH0 A;  2GQV A;  1Y96 B;  1X6B A;  4J9H A;  3EGD A;  5J39 A;  1ZSZ B;  4DQ2 A;  2C0O A;  5EG2 A;  2O4X A;  2EBP A;  4RG8 A;  1B34 A;  2DL5 A;  4KT0 E;  1Z9Z A;  3AT1 B;  3NGP A;  2K9G A;  4C92 A;  3GPL A;  2W0Z A;  3QKJ A;  2DER A;  2M0O A;  1TS9 A;  2OX7 A;  2M0Y A;  4KH1 B;  3E9G A;  4RTW A;  8AT1 B;  2DA9 A;  5GMK e;  4ATO A;  4DBR A;  4C0F A;  3M0T A;  3CCM A;  2EJF A;  1IRE B;  2EW3 A;  3CC2 Q;  2IPO B;  1Q82 R;  2DJZ A;  2ABL A;  2DAQ A; 
#chains in the Genus database with same CATH homology
 2MK5 A;  1R77 A;  4LXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...