2RQTA

Solution structure of the human ddef1 sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqtA00
3R6NA 5EC7A 2I0NA 1UUEA 2EQIA 1BBZA 4LNPA 1N5ZA 1YWOA 3REAB 4K11A 1WYXA 1NLPC 2CDTA 2OAWA 2L2PA 1VA7A 5I11A 5L23A 2FG0A 1TG0A 1K9AA 4J9HA 1WX6A 2PNIA 3U23A 1K0XA 2DNUA 4Z88A 2A36A 3I5RA 2AK5A 1RI9A 1T0HA 2KRSA 2LQWA 1CSKA 1SRMA 1AWXA 2BZXA 1PKSA 1SHFA 2HDAA 3THKA 4Z89A 1M27C 2FPDA 4Z8AA 1SSHA 1AZGB 1UJ0A 2RPNA 2J6FA 2V1QA 2X3XD 4RTTA 3UATA 4OMLA 3EG2A 2SEMA 2CT4A 2EBPA 2ESWA 4HCKA 1AEYA 1T0JA 3I35A 2CH4W 1NG2A 1GCQC 2DA9A 4AFUC 1GRIA 2DRMA 2DL3A 2W10A 3PE0A 1PNJA 2KRMA 2XMFA 3EGUA 1AZEA 2LMJA 1OPLA 2A28A 2D8HA 4LUEA 2W0ZA 2P4RA 2FPFA 2HEQA 3EG1A 5IXBA 5FWCA 4HVWA 2GGRA 4CC3A 1WXUA 1ZSGA 2CUDA 2ED1A 2KGTA 2LNHB 4J9FA 4F16A 1X6BA 1GBRA 2KROA 3VRZA 1U5SA 2DLPA 1S1NA 1W1FA 3LH5A 1JEGA 4F14A 4GLMA 4AFQC 4LE9A 4AG1C 3EHQA 2CH4A 2DRKA 1K76A 1YCSB 4HVVA 1BU1A 2AZSA 4R0KA 5IHNA 1JXOA 4D8DA 1JQQA 2EGCA 2YDLA 4QT7A 5IXFA 1H8KA 2CUBA 2A08A 2JM8A 1E7OA 1TUDA 2FPEA 4HVUA 4AFSC 4J9GA 3I5SA 1MV0B 2CSIA 2LP5A 1KJWA 2K2MA 2A37A 4J9DA 1QKXA 3M0PA 3RBBB 1A0NB 2J7IA 1GCPA 2YUPA 1T3SA 1YNZA 2BZ8A 4IIOA 4A63B 1K0SA 4LUDA 4OMQA 1UFFA 2DYBA 3H0IA 2JMAA 2FRYA 3NHNA 2GTOA 2NWMA 2DVJA 1SEMA 4RTWA 2F2VA 1NYFA 2JMCA 1LCKA 1K4US 1UJYA 2D8JA 4KRTA 2O88A 1VYVA 1UHFA 2YUQA 2YUOA 1BB9A 2DX1A 2O31A 1VYTA 2DL8A 4OMOA 1Z9ZA 2B86A 2JM9A 2M0YA 2KRNA 1AD5A 1X27A 2ENMA 2VWFA 3I9QA 2EKHA 2NUZA 2O9VA 3NMZC 3EG3A 1AWOA 4OMNA 3TSZA 5IH2A 3CQTA 2F2WA 1WFWA 1E6HA 2H8HA 2FO0A 2JTEA 4WCIA 1WA7A 2DL4A 3RNJA 4ZNXA 5HCKA 2EYXA 5I22A 1PRMC 2D1XA 2JT4A 2PZ1A 1BK2A 3EHRA 3UA6A 2ABLA 2GBQA 3NGPA 4J9CA 4OMMA 1HSQA 4FSSA 1X43A 2DF6A 2KE9A 1SRLA 3EG0A 2ROLA 2J6OA 3QWXX 3VS6A 5IHKA 2DL7A 2KBTA 2KYBA 3IQLA 1FYNA 1MUZA 2JS0A 1I07A 1YP5A 1ARKA 2EYWA 4RUGA 1YN8A 1QCFA 1B07A 1JO8A 1M3AA 1I0CA 3JV3A 4AG2C 1M8MA 1UECA 1UE9A 2EPDA 4RTXA 1Y0MA 2O2OA 1X2KA 3M0RA 1X2QA 4RTUA 3ULRB 2ED0A 3M0UA 2YSQA 2RQRA 2RMOA 1B3QA 2G6FX 3KFVA 2VVKA 1ZX6A 4M4ZA 1UG1A 4AFZC 2L3PA 4RTYA 5FW9A 2D0NA 4RTZA 2MOXA 2LCSA 1U06A 2HBWA 2RQWA 1WDXA 1W70A 1GCQA 2PTKA 1Z9QA 1QWEA 1RLPC 2DJQA 2AKLA 1EFNA 2J05A 2ROTA 2RQTA 1NEBA 3SEMA 2HCKA 2L3QA 1HD3A 1V1CA 2YUNA 1TUCA 1PWTA 4EIKA 1Y57A 1M3CA 2DBMA 3H41A 1X69A 2LJ3A 2GTJA 2QDLA 2SRCA 4J9IA 3VS4A 1QWFA 2M51A 2KT1A 2EGEA 3UA7A 1ZUKA 1ZUUA 1YWPA 2K9GA 2AZVA 2EVRA 1UHCA 3VS5A 2EYYA 4CC7A 4DEYA 3VS2A 2J6KA 1NM7A 5GJWB 1W6XA 1JU5C 4DEXA 1J3TA 3TSWA 1E6GA 1HJDA 1FMKA 2YT6A 1U3OA 2C0TA 4HXJA 1G2BA 1H92A 2HSPA 2C0OA 4IIMA 1ZLMA 1XOVA 4JJCA 3PVQA 2RNAA 4JJBA 2LQNA 2KXCA 2FRWA 2K3BA 1ABOA 1WIEA 2BTTA 1PRLC 4CC2A 1AVZC 3VS1A 3QWYA 1ABQA 1OV3A 2AKKA 4J9BA 2KYMA 5ECAA 2F2XA 1UGVA 2RF0A 2KR3A 2L0AA 2VKNA 1AWJA 4CC4B 2EGAA 3ZL7C 1KSWA 2DL5A 3SHWA 4ESRA 1X6GA 2LJ0A 1KFZA 3M0SA 4LN2A 1WI7A 1G83A 3VS0A 2ECZA 1M30A 3M0QA 3VS7A 1PKTA 2DE0X 5GJVB 2KXDA 1MV3A 1WLPB 1SHGA 1RLQC 2CREA 3FJ5A 1GBQA 1T3LA 2EYZA 1ZBJA 2JW4A 1QKWA 1M3BA 1GL5A 1NEGA 2LZ6B 4JZ4A 1AWWA 2DM1A 2J06A 1VYUA 1NLOC 1OOTA 2K79A 2C0IA 1IO6A 3GBQA 3NPFA 4Y92A 1I1JA 2CSQA 3O5ZA 1WXBA 1GFCA 2EW3A 1ZUYA 1NYGA 2DILA 2GNCA 4ORZA 3M0TA 2OJ2A 2E5KA 2CT3A 3REBB 2V1RA 2IIMA 4JJDA 4JPBW 4E6RA 1UTIA 1OEBA 4GBQA 5FWBA 1KIKA 2MCNA 4J9EA 2FEIA 5IHIA 2RQUA 3VS3A 3UF4A 4X1VA 2MIOA 3VRYA 1K1ZA 2DBKA 2GQIA 2KT8A 2BZYA 3C0CA 1OPKA 2KNBB 4D8KA 2K6DA 2X3WD 3A98A 1QLYA 2KEAA 2L3SA 1JXMA 1WXTA 4JZ3A 1PHTA 1SPKA 1CKBA 3H0HA 4OMPA 1H3HA 2RN8A 1RUWA 3H0FA 2JS2A 2LJ1A 2DMOA 2LX7A 3TVTA 2OI3A 4F17A 2K7AA 1GFDA 1UDLA 2RQVA 1AOJA 1CKAA 2JXBA 2O9SA 4RTVA 3PVLA
chains in the Genus database with same CATH superfamily
4M75A 2NUTB 2R58A 1YWOA 4A4GA 5FU7C 2LT4A 5IN1A 5FU7B 4M77C 1NLPC 3JB9I 2OX7A 3V7CA 3L2VA 2OAWA 2L2PA 3CC4T 2RH2A 3OSSC 2PVDB 2Y90A 1WHKA 3OYJA 2NUPA 4N0AC 4M78C 1PSFA 4M78B 1WX6A 2PNIA 3VUZA 1QCOA 4M78E 4WF2A 1X6OA 3MEUA 5HKCA 4Z88A 2HBPA 2CZ0B 2KRSA 4GLKA 2BZXA 2HDAA 3THKA 2RHYA 4Z89A 2FPDA 4Z8AA 4E7IA 1KHIA 1AZGB 1UJ0A 2RPNA 4L59A 4IUVA 3CBPA 2E10A 3EGXB 2EBPA 4HCKA 4PNOA 1RACB 2O4XB 3MP1A 1NG2A 4AFUC 9ATCB 2DRMA 1EIFA 6AT1B 2W10A 2KRMA 2XMFA 2WSCE 4ATOA 5CKDA 2W0ZA 2A3LA 2K5IA 2FPFA 4F7UA 4OGEA 3SWNA 2RI3A 4X34A 4CC3A 4A53A 2XU8A 3OYIA 2FHDA 2CYZB 4A54A 3VRZA 3HL8A 1BIBA 1W1FA 5KE3A 4E7ZA 4GLMA 4LE9A 2CH4A 2KI7A 1M1FA 2DYIA 1K76A 1JBMA 4KUIA 4D8DA 1KHCA 4PK4A 2EGCA 4QT7A 3BW1A 3SDZA 1D0YA 1VIFA 3QDFA 4J7IA 1PC0A 2CUBA 4JRIA 2JM8A 4AFSC 3MP6A 4M7DF 3SFMA 2LP5A 2A37A 2DZCA 4J9DA 1MMAA 2QK0A 4BE1A 1VQKT 5GAMj 2J7IA 3JCMh 5FRNA 1GCPA 1T3SA 4A63B 1Y96A 4C5GA 2DVJA 1SEMA 2HQHA 1D0XA 3VJPA 1NYFA 3MPUB 2JMCA 4HCBA 1UGSB 2O88A 1OQKA 2X35A 2YUOA 1BB9A 5GAOr 3ZEHA 2B86A 2VWFA 1X27A 3QO3A 1X75C 2NUZA 1K8AR 1VQ8T 1RAGB 1VQ5Q 3EG3A 2MF2A 4OMNA 3OYYA 3TU4K 2F2WA 3ZFJA 1E6HA 2H8HA 4WCIA 1WA7A 3CCEQ 1KQ2A 4ZNXA 2FYKA 4IUQA 3EAEA 2JT4A 2B8AA 1BK2A 2DD4A 4BE0A 5LJ5d 3JCMd 4CRIA 1TUGB 2NYSA 1DJ7B 2CP6A 4XTWA 2NUTA 4JRPA 1X43A 3CCQQ 4M77A 3EG0A 2ROLA 3CC2Q 1VQ6T 2HD0A 5GMKe 4N0AA 2ZCFB 2ZPGB 5IHKA 2DAQA 4M78A 2KYBA 1FYNA 3T9NA 2QI2A 1BKBA 1YP5A 1K73R 3X24B 1B07A 1JO8A 1M3AA 2LCLA 2DO3A 1ZBXA 1QP3A 1VQ5A 3JV3A 5D6XA 3HRSA 2K2VA 2O2OA 3M0RA 1X2QA 2F1LA 3AHUA 3TREA 3ULRB 4C0DB 3CCEA 5A2QE 1ACMB 4XTVA 1D1AA 1FWZA 4PFZA 2YSQA 1I5OB 2Z0WA 4M7DG 1PG5B 1UG1A 2LX9A 3JB9H 3EGXA 1OULA 1OU8A 2RQWA 2D9TA 2E1HA 3FB9A 2PTKA 4JRQA 2E64A 2OTJQ 3M55A 3CCQA 1R0BG 2AKLA 2J05A 2RQTA 3S6WA 3RDVA 1HD3A 3CC2A 4BACA 5GAMg 4HCCA 1M90R 3BFMA 4Q5WA 2K3YA 3VV0A 3H41A 2QDLA 4OGCA 3CBOA 3CD6Q 3VS4A 1OZ2A 4FYYB 1IGUA 1W4SA 1ZUKA 2MAMA 3NTKA 2X4YA 1V29B 1UHCA 4QVZA 4ZGDB 3VS5A 3UDCA 1JB0E 5D6WA 5GJWB 1YI2T 4M7DC 4M7DB 4M7DE 2BUDA 1JJ2A 3TCJA 2C0TA 1MNDA 1H92A 2OTJA 2HSPA 2EQJA 1VQNT 1XOVA 1K9MU 3CXCA 1M2OA 4FYWB 3P8BB 2KXCA 5J39A 5GAOp 5LJ3d 1YBYA 2M0OA 3GOXA 3PNWC 5GANf 1KC8R 3VS1A 4J83A 1ABQA 3CD6A 2AKKA 1VQ9T 1NPPA 4F04B 3META 5GMKj 2KY9A 3OYCA 3G71Q 1UGVA 2P0PA 2RF0A 2FB7A 1JRIA 3FJPA 3QPHA 1YFNA 3QXEB 3LX7A 1AWJA 5AYFA 1YITT 1QCNA 3M58A 1B7TA 2D6FA 1KSWA 2DL5A 3SHWA 4KBMB 4ANJA 3CCUQ 3OS0A 3VU3C 1IREB 1KFZA 5GAN8 1KK7A 2RM4A 3MEWA 3CCJA 4PJOF 1LOJA 2ECZA 1O9SA 2A0FB 3VS7A 2RA2A 1Q86U 1GXIE 3NTHA 1MV3A 3OW2P 5KYUB 4BB7A 1QVPA 1MMDA 4II1A 1M4ZA 2MPXC 2CP5A 1LPLA 1JJ2S 2LQKA 4C5HA 4E7KA 1G5VA 3QJYA 3KBGA 1M3BA 1MMGA 1NJIU 3JCMV 3BY7A 1OYXA 7AT1B 2LZ6B 1K9MC 4LXCA 3CXCS 3CCRQ 3CCST 3G71A 1VQ7T 2ATCB 4XTXA 4Y92A 1GFCA 4Z02A 1BIAA 3LWHA 3R6OA 2GNCA 4ZTFA 4ZTJA 2OJ2A 3PMIA 3H8ZA 3REBB 3OS5A 1OX9A 5GAN2 2K57A 2VGNA 3M59A 4C92F 4M75B 5DM7R 4M75E 5C6SA 5CAIA 5I2SA 3VRYA 3V8KA 2DBKA 2K4YA 2HZYA 1OPKA 2KNBB 4A4FA 2X3WD 2VXEA 1NPRA 2VUBA 3DB3A 1PHTA 1CKBA 5KYNA 4M77F 3OBYA 3H0HA 1QVFP 3CCLQ 3OMGA 1M1KC 2JS2A 1WQWA 3QYHB 2K7AA 4NS5A 1UDLA 1AOJA 2QQRA 4DBFA 1CKAA 3CCRA 1QQJA 1FMWA 2EQUA 4XK8E 4RTVA 2XDDA 2XICA 3PVLA 1NJIC 4FIBA 3R6NA 2I0NA 1UUEA 2QASA 4E7SA 1UGQB 4CI0C 5LJ5e 3JCMe 1WYXA 2RJCA 4X9CA 3GNGA 4PJOG 1ZA2B 2F69A 5I11A 1TG0A 4J9HA 3JB9G 2G3RA 2GCXA 4M7DA 5CR2A 4M78D 3CPWA 1BCMA 3I5RA 1T0HA 1CSKA 4J6WA 1SRMA 2FL7A 4HA8A 1SHFA 4FSXA 1VQPQ 1M27C 4L5GA 2PVGB 5KYYB 3JCMJ 3CCLA 3L2RA 1SSHA 3OA6A 4B9XA 1Q7YR 2V1QA 1SKUB 4OMLA 2ZPIB 4LDWA 4C0FA 2QDYB 3QIIA 3UWNA 2CT4A 4HCZA 2VB6A 1AEYA 4MMKA 2HKQB 4N4HA 3I35A 1YCYA 3OYFA 2DA9A 3CMEQ 4EMKC 4XU3A 4EMKB 3PE0A 4QVCA 4XQ3A 1VQMQ 3PIPA 3EFRA 2HQXA 2LMJA 1OPLA 1VQ4Q 4LUEA 4C92G 3QZ5B 1M9SA 3RERA 1G8XA 2P4RA 2HEQA 4PJOC 1XQHA 3QUIA 4ZGJB 4PJOB 4PJOE 2EWNA 2RK1A 4EDUA 3L2ZA 1Q81U 4HVWA 3JRZA 2CUDA 4M77G 2KROA 3MKDA 2DLPA 5KCOA 1YIJQ 1VIEA 4AG1C 3PMTA 3EHQA 1VQPA 3CCMQ 2EAYA 1BU1A 2AZSA 2XI9A 2NLUA 3CPWS 1YJWQ 5IXFA 1H8KA 1IHVA 1SF9A 2A08A 1TUDA 1Q95G 3BDLA 1N9RA 2FPEA 3A5ZB 4XTZA 1BI0A 3C4SA 4ZN3A 1MV0B 1KJWA 1QKXA 4C0GA 1A0NB 2QA4Q 1VQ4A 2YUPA 2YLCA 2BZ8A 3OQ5A 1K0SA 3I56Q 4LUDA 4C92B 1UB4A 5LJ5j 1TH7A 3NHNA 4C92E 5LJ3e 2F2VA 2XKOC 2D8JA 2PU9B 1UHFA 1PCXA 2DX1A 2DL8A 1TWBA 1YIJA 1IGQA 4M77B 4LDXA 1AD5A 3GNFB 2ENMA 4M77E 1H3ZA 1Q81C 2EKHA 2ZPHB 4KT0E 2EQKA 3NMZC 3CCMA 3OYKA 1VQOA 1LVKA 5IH2A 1HXDA 4XU0A 1S72Q 2MYSA 4X9DA 3GF5A 2QQSA 3RESA 3RNJA 2EYXA 4AMCA 4PJLA 1N9SA 3LLRA 1W2BP 2LVMA 2GBQA 5FLXE 3NGPA 1G3YA 4B6MA 2GFAA 4J9CA 4IURA 2V26A 4OMMA 4OP0A 3SB2A 4FSSA 3CCVQ 2QA4A 1KD1U 1RL2A 2DF6A 2KE9A 2L8DA 5D6YA 2J6OA 4JRKA 2H3JA 3VS6A 1VQLA 4ZGEB 3V7SA 1RABB 2RHIA 4FT2A 2JUFA 2JS0A 4IKFA 1ARKA 5A0DA 3A8GB 2DK3A 3NFCA 1Q82U 2FZCB 3HKSA 3LGLA 1UECA 4RTXA 2AIRB 5KYYA 1S72A 1ZSZC 2QG9B 3X25B 1YJNQ 2ED0A 3URGA 4RMOA 2RMOA 3OS1A 3KFVA 2VVKA 4RTYA 5FW9A 1VQ5T 1WDXA 2BIVA 1W70A 2RJDA 2V8IA 4J8OA 4JDSA 5EG2A 2BE7D 2KSSA 3OBWA 3CCVA 4EMKA 2C06A 3CCET 3QBYA 2DXTA 1EFNA 2ROTA 1NEBA 1RAFB 2L3QA 1TUCA 4EIKA 3E9GA 4IUTA 3HP9A 1M3CA 2DBMA 4M7AD 4PJOA 2AT1B 3QG1A 1KD1C 2LJ3A 5LJ5g 2SRCA 3JCMg 3CBMA 2M51A 2PVOB 5GAOq 5LJ3j 3LH0A 3BDUA 3CCQT 1ZA1B 4BI3A 3PGGA 1Y71A 2E41A 1QP2A 1ZUUA 3CC2T 2K9GA 1Y07A 2BE9B 1I8FA 3G7ZA 2MWOA 4XTYA 4DQ2A 2HAXA 4OF1A 4DEYA 3FC3A 4LDYA 1Q82C 1NM7A 1N6AA 4DEXA 4KGZB 1I4K1 1E6GA 1FMKA 2YT6A 2X51A 4M7DD 4NOYA 4E2FB 1ZLMA 2WSFE 4JJCA 2RD1A 2RNAA 2X4XA 3OY9A 2FRWA 3A1PA 4C92A 2OTJT 2CP3A 2KYMA 4JLGA 3OYMA 2E6NA 2F2XA 4HKEA 5GAMf 2QEXQ 2L0AA 3HHTB 4BDYA 4E7JA 2XIDA 1KG1A 2EGAA 3OYEA 2HL3A 4ME7A 1WGSA 2DIGA 1X6GA 4QQDA 4ESRA 3M4GA 3GIBA 3CD6T 1G3WA 2LJ0A 4JLIA 1XTDA 2F5KA 3OSVA 3OYNA 4RCBA 1AT1B 3M0QA 3DLLA 3UT1A 2EJGA 5C0MA 2KXDA 1WLPB 1SHGA 2CREA 3LW5E 4MMLA 2E3HA 3CMAQ 2EYZA 1RI0A 1P92A 3J81E 3G6EQ 3PFSA 5LL6S 4AT1B 3OYAA 3CCJT 4JZ4A 2K79A 1WHLA 2C0IA 1IO6A 3GBQA 2MI6A 2QEXA 1FXXA 1NZ9A 1NYGA 1M90C 2DILA 2DXUA 5LJ3g 4J6YA 4PLLA 4BY6C 1TS9A 2YRVA 4BY6B 4PKCC 4JJDA 5FWBA 1ZSZA 3G71T 1LJOA 5IHIA 2RQUA 3VS3A 2LC4A 1UGRB 2MIOA 3OMCA 3OYDA 2KT8A 4M75D 3C0CA 2YWWA 3KUFA 1TU0B 2KEAA 2L3SA 4RG2A 3CMAA 1SPKA 3A8LB 2RI2A 3G6EA 1H3HA 3FDRA 3A8HB 2VYTA 5CVIA 2RN8A 3H0FA 2COZA 2LX7A 2DZ9A 1Y7XA 2RQVA 4BDZA 2YRDA 2JNGA 5EC7A 2EQIA 4MZTA 1BBZA 3HTRA 4PFOA 2DTIA 3REAB 5L8RE 2EQMA 4DOWA 1ZHIA 3DKMA 2XG8D 3QHSA 5L23A 2FZGB 1B34B 4JUVA 4PJNA 5A0GA 3CCRT 3U23A 5KYXB 1MMNA 2DEQA 2P0QA 4D6WA 1OI1A 4XTUA 5FROA 4QQ6A 5IAYA 3WXMB 2AHJB 1R0CB 2J6FA 3E9FA 3VYHB 2X3XD 1U8RA 3CC7Q 3QDRB 4J7FA 4LDUA 5CCAA 3OW2A 3EG2A 2SEMA 3FRNA 2ESWA 1M1KU 1VOMA 3JB9F 1BI2A 4IUUA 1T0JA 2LTOA 1KQSA 5FRMA 2VASA 1KQSP 3CCLT 4QW2A 1M8VA 3S3OA 3I55Q 2M1HA 1YI2Q 1XNIA 3EGUA 1AZEA 2GF7A 1O75A 3JCMb 4BD3A 5CK9A 2EKOA 2DPPB 3JCMX 3A8MB 3EG1A 1TSFA 5IXBA 5FWCA 3RMSA 2GGRA 1V76A 3RKYA 4PJOD 2ED1A 2KGTA 2CP2A 1GBRA 4C8QF 1U5SA 3V8JA 3LH5A 2RI5A 1JEGA 4F14A 3M9QA 1BI1A 4NL3A 3CCUA 2QAZA 2RJEA 1YCSB 1VQ9Q 4HVVA 1K9MR 3CC7A 5HY6A 1OX8A 5GANh 4RKUE 3G4SQ 4KGXB 4HT8A 1QVFA 4HVUA 1VQPT 1D0ZA 3A8OB 2VV5A 2CSIA 3S3MA 2K2MA 2M9UA 2DETA 3I55A 1M2VB 3OW2S 3M0PA 3RBBB 2OTLQ 1YI2A 2RHXA 2DEUA 1YNZA 1WJRA 2RK2A 4IIOA 4OMQA 1QMCA 2K3XA 2NWMA 2QQ9A 1WHHA 4RTWA 3MJXA 2JOYA 3V7RA 1LCKA 1UJYA 4C92D 2YUQA 4O6JA 1VQ4T 1Z9ZA 2JM9A 4MDWA 2M0YA 2KRNA 3I9QA 1N8RU 4A4HA 1Q86R 1WHMA 2R5MA 4M77D 2P4TA 3X28B 5CQXA 5GANd 1IZ6A 1WFWA 2EJFA 2FO0A 1U1SA 1VQ7Q 2DL4A 3G4SA 1TXQA 3L2QA 2DJZA 1NJIR 2JZ2A 5HCKA 5I22A 1YIJT 1PRMC 2D1XA 3UA6A 3CCMT 3LGFA 3TEEA 4FYVB 4C5EA 1VQOT 4BI8B 2OTLA 4QVDA 2FZKB 1HSQA 1VUBA 2E6ZA 4KH0B 2GQVA 2OAUA 3P8DA 4RG8A 4PLIA 4R55A 1QVFS 4O5VA 1U1TA 1B34A 3OYLA 4C8QG 2KVQG 4NL2A 2X4JA 3QWXX 2DL7A 5GAOl 3GPLA 2VC8A 5A0LA 1MUZA 1BYMA 5KYXA 2QA4T 4L6V5 4RUGA 1YN8A 3M54A 1IRXA 1I0CA 1VQLQ 1C6VX 4AG2C 1UE9A 2EPDA 2LCCA 1X2KA 3BE3A 4DBQA 1VQLT 1VQ7A 5KCHA 3LYIA 1R77A 3M0UA 5I2MA 1N8RC 2G6FX 2R57A 1ZX6A 4M4ZA 4BE2A 1RAIB 4AFZC 5CKBA 2PUOB 1D09B 2MOXA 2LCSA 2HBWA 5CKHA 5GAOn 1QWEA 5M9OA 1S72T 1RLPC 3SEMA 3L2UA 5FU6C 1V1CA 2YUNA 5FU6B 1Y57A 2WSEE 2DFUA 3M5AA 4FM4B 4C8QC 2E70A 3CMEA 1X69A 5AT1B 4C8QB 2GTJA 4C8QE 4J9IA 2QTXA 2LRQA 3CCVT 4RCCA 1VQMA 2AZVA 1OZ3A 1PSEA 2MWPA 3UPUA 3CPFA 4CC7A 3VS2A 2DKGA 3OYGA 2JTMA 1W6XA 1JU5C 3EGDB 3HFOA 1J3TA 2L89A 3TSWA 8AT1B 3FLGA 2Y4YA 2JVVA 1U3OA 1SG5A 5KYWA 3PTAA 3EH1A 2C0OA 4A4EA 4IIMA 1M2VA 3M53A 3PVQA 1YJ9Q 4JJBA 1YJWA 2LQNA 4N4GA 2M16A 1W2BA 1R8OB 1ABOA 2K3BA 2CZ1B 2KDSA 4C5IA 4A4KA 1PRLC 4CC2A 1AVZC 4OB0B 3QWYA 3DLMA 4J9BA 4TVRA 1Q81R 3WVDB 2E3IA 3WVEB 3I56A 2VKNA 1EX4A 5GMKm 5LJ5f 3JCMf 3RMQA 3ZL7C 3FIFA 1YHQQ 1N27A 2E65A 4XU1A 4LD6A 3RR6A 5KE2A 1MNEA 2LQ8A 2ZAEA 3L2WA 2FVUA 1PKTA 2DE0X 2XDPA 3TQ7P 5GJVB 1K8AU 2YRCA 3FJ5A 3QZ9B 1GBQA 3QKJA 3MCAB 1IB8A 1ZSZB 1YJ9A 3RUXA 1QKWA 4FT4A 3M4YA 2EJ9A 2QQAA 2CGHA 3ME9A 3PT9A 3CC4Q 1TOVA 2DD5A 4ELZC 4M7AF 3X20B 2QTVA 3NPFA 3MO8A 1I1JA 1W2BS 3O5ZA 1ZUYA 3QSUA 2HSEB 2HKNA 2R5AA 4JS4A 2E5KA 2CT3A 2X4WA 2L5QA 2RJFA 2V1RA 1YHQA 2QYZA 2IIMA 4E6RA 1UTIA 1OEBA 4GBQA 1KIKA 4J9EA 4JS5A 3E1SA 3H6ZA 2M02A 2QEXT 1K73U 3UF4A 4V2SA 3JB9J 4D8KA 3A98A 2CP0A 2K6DA 3M56A 3Q1JA 1YJNA 1M1GA 4HT9A 1K8AC 1KD1R 5LJ5h 2XD0A 3E19A 5GANe 3JSCA 3CC4A 4C8QA 3CMAT 5GAN4 2JXBA 3C94A 1UGPB 3N5BB 3G6ET 3C95A 4QKUA 4LNPA 4MZMA 1N5ZA 1HK9A 1H641 2QGFB 4K11A 1MHNA 3MEVA 2CDTA 4MDXA 1Q82R 1M90U 3HFNA 1VA7A 2FG0A 1K9AA 2YHTA 2K5FA 2ZGWA 5LJ3f 3X26B 1AHJB 2QQBA 3EGDA 1K0XA 2DNUA 4N4IA 4OB2B 4DBHA 2A36A 4R56A 2AK5A 1RI9A 2LNVA 2LQWA 3LWIA 1AWXA 1PKSA 3EH2A 2QGGA 1K73C 2E12A 4J5YA 3S3NA 5CO7A 4QQGA 2COWA 1IXDA 4M7AG 3JAME 1VQKQ 4RTTA 3UATA 2CS7A 4FU6A 3F70A 5GAN6 4IUPA 2CH4W 3HRUA 1GCQC 1NE8A 2CKKA 1GRIA 3VYGA 2DL3A 2EIFA 3NTIA 2EFIA 5DLOA 1D3BB 1PNJA 2A28A 2D8HA 2JN0A 3AT1B 1KC8U 1VQ8Q 3RKXA 4UC4A 2KMTA 4B9WA 4C0DC 2VXFA 1OU9A 2O01E 1WXUA 1ZSGA 8ATCB 3ZBDA 4ZN1A 2LNHB 1RAAB 4J9FA 4F16A 1X6BA 4OVAA 1S1NA 3MP8A 3RKWA 4AFQC 2O4XA 5HK0A 2MK5A 3OB9A 4M75F 2DRKA 3HPWA 1QW1A 4R0KA 5IHNA 1JXOA 3OS2A 1VQKA 1JQQA 4J6XA 2DVEA 4WTOB 1TTHB 4M7AC 2YDLA 4M7AB 3DB4A 5IT9E 1PM3A 4M7AE 4VUBA 1PD0A 1WHGA 2XK0A 4OB3B 1VQ6Q 3H9NA 1E7OA 5CIUA 4FYXB 5LJ3h 5GANj 5GAMh 3CCUT 4J9GA 1FX7A 3I5SA 2CP7A 1WNLA 3CC7T 4KULA 1UFFA 3FEOA 1VQ8A 2DYBA 1FMVA 3H0IA 2JMAA 5GAN7 2FRYA 2GTOA 4FW1A 3EFSA 2EYQA 2H3EB 1K4US 4KRTA 1VYVA 2CZ7B 1KC8C 1M5Q1 5KH6A 3I55T 2O31A 1VYTA 4OMOA 3CCJQ 2I2LA 2E4HA 3JCMc 2O9VA 2HMAA 1JJ2P 5D7UA 1G3SA 1RAEB 3TSZA 2COYA 1AWOA 2MMPA 3CQTA 2JTEA 3EFOB 3RIRA 2DERA 1X01A 4F7UF 5GAMd 3CXCP 1VQ6A 1WHJA 4EMGA 2PZ1A 5J26A 3EHRA 4LD9K 2ABLA 2HNIA 4BUGA 3G4ST 1SRLA 2ZZDA 4Y28E 3VUBA 2RB6A 4PJMA 3J7AF 2KBTA 4FCYA 3IQLA 4M75G 2OTLT 2LT1A 4KUDK 1I07A 2EYWA 1SSFA 1QCFA 5J3BA 2KAFA 4OB1B 3ASKA 1M8MA 1Y0MA 4RTUA 1VQNQ 3E2UA 1F1BB 2K5LA 2RQRA 1B3QA 2RHUA 2L3PA 2D0NA 3CEYA 3JB9D 1MGQA 4RTZA 1U06A 3SD4A 3D7SB 3GP8A 1GCQA 1Z9QA 4YTLA 5GANg 5CKEA 2CZ6B 1D3BA 2DJQA 1Q7YU 3HRTA 1I5LA 1BI3A 2HCKA 1RAHB 2A7YA 2JJ9A 2D0QB 5GMKi 1PWTA 4PJJA 1YITQ 2DXBA 3MHXA 2BKDN 4MZPA 5CQYA 3VKIA 5KYWB 1QWFA 3GLXA 2F5TX 3EG9B 2DXCA 4M75C 4C8QD 2KT1A 2EGEA 1BCOA 3UA7A 4FL6A 5CKFA 1QVGA 1YWPA 2YXYA 1KQSS 3JCMQ 4DA4A 1D1CA 1QVGP 4F7UG 2EVRA 2P0KA 1VQNA 3CMET 2P84A 2NUPB 2EYYA 4XU2A 3M57A 2QXFA 2J6KA 4M7AA 1Q86C 2YLBA 1VQMT 4EPCA 1G3TA 1HJDA 1C1AA 4M78F 4HXJA 1M1KR 1G2BA 1VQ9A 2PQWA 4DBRA 1ZQ1A 3CCSQ 4GY5A 4E7LA 5GAN3 5DY9A 3C12A 2IG0A 4E7HA 1YITA 1WIEA 1WPYA 5GMKh 5GAN5 2BTTA 4P5NA 1Q7YC 1C0MA 1D1BA 1OV3A 3G1JA 5ECAA 3KXTA 2ZPBB 2KR3A 3INZA 2KK4A 1YJWT 4FW2A 2X9HA 2GFUA 4CC4B 2HQEA 1WJQA 2ZPFB 3CPWP 3O8VA 1XJWB 1IHWA 3JCMP 4KGVB 3SWNC 4F7UB 3OYHA 4F7UE 3SWNB 3EFOA 2RO0A 4EMHA 3M0SA 1HYOA 2LDMA 1QVGS 4LN2A 1WI7A 1G83A 1UEBA 1LNXA 2KQWA 3VS0A 2V8KA 1M30A 3I56T 2PUKB 2L3RA 3ER0A 2DIQA 1RLQC 5I21A 3CCSA 1T3LA 4DOVA 1ZBJA 1RADB 5DLQE 2JW4A 1NBEB 2IVWA 3QYGB 3PIOA 3L42A 1GL5A 1NEGA 4BI4A 1AWWA 2DM1A 3J80E 2J06A 1VYUA 4PL6A 2WACA 1NLOC 1OOTA 4JJNK 1I81A 1YJ9T 2CSQA 1WXBA 2EW3A 4ORZA 3OYBA 3M0TA 3HSBA 1N8RR 5KYUA 1Y96B 4KH1B 4JPBW 3QJ6A 2IPOB 4M78G 1VQOQ 2MCNA 2FEIA 4Y91A 3V8LA 1KQ1A 2XDBA 4X1VA 3L1AA 1K1ZA 2GQIA 4ELYC 2BZYA 5GMKl 2ZPEB 2RHZA 3MEAA 2XHCA 2Y4XA 1QLYA 4E47A 1YHQT 1JXMA 2V8JA 4JZ3A 1WXTA 2HL5C 5GAOm 3P8HA 4OMFB 1WJSA 4PFPA 4OMPA 1WZOA 1RUWA 1EZZB 2LJ1A 2DMOA 3TVTA 2DTHA 2OI3A 4C0ZA 4F17A 2E5QA 3JCMW 1GFDA 4C92C 1WQ7A 2DTOA 5GAMe 2JTFA 2O9SA 4XAXB 5HK3A 2VGMA 3EG9A 4LDVA 1YJNT 1PD1A
chains in the Genus database with same CATH topology
3R6NA 5EC7A 2I0NA 1UUEA 2EQIA 1BBZA 4LNPA 1N5ZA 1YWOA 3REAB 4K11A 1WYXA 1NLPC 2CDTA 2OAWA 2L2PA 1VA7A 5I11A 5L23A 2FG0A 1TG0A 1K9AA 4J9HA 1WX6A 2PNIA 3U23A 1K0XA 2DNUA 4Z88A 2A36A 3I5RA 2AK5A 1RI9A 1T0HA 2KRSA 2LQWA 1CSKA 1SRMA 1AWXA 2BZXA 1PKSA 1SHFA 2HDAA 3THKA 4Z89A 1M27C 2FPDA 4Z8AA 1SSHA 1AZGB 1UJ0A 2RPNA 2J6FA 2V1QA 2X3XD 4RTTA 3UATA 4OMLA 3EG2A 2SEMA 2CT4A 2EBPA 2ESWA 4HCKA 1AEYA 1T0JA 3I35A 2CH4W 1NG2A 1GCQC 2DA9A 4AFUC 1GRIA 2DRMA 2DL3A 2W10A 3PE0A 1PNJA 2KRMA 2XMFA 3EGUA 1AZEA 2LMJA 1OPLA 2A28A 2D8HA 4LUEA 2W0ZA 2P4RA 2FPFA 2HEQA 3EG1A 5IXBA 5FWCA 4HVWA 2GGRA 4CC3A 1WXUA 1ZSGA 2CUDA 2ED1A 2KGTA 2LNHB 4J9FA 4F16A 1X6BA 1GBRA 2KROA 3VRZA 1U5SA 2DLPA 1S1NA 1W1FA 3LH5A 1JEGA 4F14A 4GLMA 4AFQC 4LE9A 4AG1C 3EHQA 2CH4A 2DRKA 1K76A 1YCSB 4HVVA 1BU1A 2AZSA 4R0KA 5IHNA 1JXOA 4D8DA 1JQQA 2EGCA 2YDLA 4QT7A 5IXFA 1H8KA 2CUBA 2A08A 2JM8A 1E7OA 1TUDA 2FPEA 4HVUA 4AFSC 4J9GA 3I5SA 1MV0B 2CSIA 2LP5A 1KJWA 2K2MA 2A37A 4J9DA 1QKXA 3M0PA 3RBBB 1A0NB 2J7IA 1GCPA 2YUPA 1T3SA 1YNZA 2BZ8A 4IIOA 4A63B 1K0SA 4LUDA 4OMQA 1UFFA 2DYBA 3H0IA 2JMAA 2FRYA 3NHNA 2GTOA 2NWMA 2DVJA 1SEMA 4RTWA 2F2VA 1NYFA 2JMCA 1LCKA 1K4US 1UJYA 2D8JA 4KRTA 2O88A 1VYVA 1UHFA 2YUQA 2YUOA 1BB9A 2DX1A 2O31A 1VYTA 2DL8A 4OMOA 1Z9ZA 2B86A 2JM9A 2M0YA 2KRNA 1AD5A 1X27A 2ENMA 2VWFA 3I9QA 2EKHA 2NUZA 2O9VA 3NMZC 3EG3A 1AWOA 4OMNA 3TSZA 5IH2A 3CQTA 2F2WA 1WFWA 1E6HA 2H8HA 2FO0A 2JTEA 4WCIA 1WA7A 2DL4A 3RNJA 4ZNXA 5HCKA 2EYXA 5I22A 1PRMC 2D1XA 2JT4A 2PZ1A 1BK2A 3EHRA 3UA6A 2ABLA 2GBQA 3NGPA 4J9CA 4OMMA 1HSQA 4FSSA 1X43A 2DF6A 2KE9A 1SRLA 3EG0A 2ROLA 2J6OA 3QWXX 3VS6A 5IHKA 2DL7A 2KBTA 2KYBA 3IQLA 1FYNA 1MUZA 2JS0A 1I07A 1YP5A 1ARKA 2EYWA 4RUGA 1YN8A 1QCFA 1B07A 1JO8A 1M3AA 1I0CA 3JV3A 4AG2C 1M8MA 1UECA 1UE9A 2EPDA 4RTXA 1Y0MA 2O2OA 1X2KA 3M0RA 1X2QA 4RTUA 3ULRB 2ED0A 3M0UA 2YSQA 2RQRA 2RMOA 1B3QA 2G6FX 3KFVA 2VVKA 1ZX6A 4M4ZA 1UG1A 4AFZC 2L3PA 4RTYA 5FW9A 2D0NA 4RTZA 2MOXA 2LCSA 1U06A 2HBWA 2RQWA 1WDXA 1W70A 1GCQA 2PTKA 1Z9QA 1QWEA 1RLPC 2DJQA 2AKLA 1EFNA 2J05A 2ROTA 2RQTA 1NEBA 3SEMA 2HCKA 2L3QA 1HD3A 1V1CA 2YUNA 1TUCA 1PWTA 4EIKA 1Y57A 1M3CA 2DBMA 3H41A 1X69A 2LJ3A 2GTJA 2QDLA 2SRCA 4J9IA 3VS4A 1QWFA 2M51A 2KT1A 2EGEA 3UA7A 1ZUKA 1ZUUA 1YWPA 2K9GA 2AZVA 2EVRA 1UHCA 3VS5A 2EYYA 4CC7A 4DEYA 3VS2A 2J6KA 1NM7A 5GJWB 1W6XA 1JU5C 4DEXA 1J3TA 3TSWA 1E6GA 1HJDA 1FMKA 2YT6A 1U3OA 2C0TA 4HXJA 1G2BA 1H92A 2HSPA 2C0OA 4IIMA 1ZLMA 1XOVA 4JJCA 3PVQA 2RNAA 4JJBA 2LQNA 2KXCA 2FRWA 2K3BA 1ABOA 1WIEA 2BTTA 1PRLC 4CC2A 1AVZC 3VS1A 3QWYA 1ABQA 1OV3A 2AKKA 4J9BA 2KYMA 5ECAA 2F2XA 1UGVA 2RF0A 2KR3A 2L0AA 2VKNA 1AWJA 4CC4B 2EGAA 3ZL7C 1KSWA 2DL5A 3SHWA 4ESRA 1X6GA 2LJ0A 1KFZA 3M0SA 4LN2A 1WI7A 1G83A 3VS0A 2ECZA 1M30A 3M0QA 3VS7A 1PKTA 2DE0X 5GJVB 2KXDA 1MV3A 1WLPB 1SHGA 1RLQC 2CREA 3FJ5A 1GBQA 1T3LA 2EYZA 1ZBJA 2JW4A 1QKWA 1M3BA 1GL5A 1NEGA 2LZ6B 4JZ4A 1AWWA 2DM1A 2J06A 1VYUA 1NLOC 1OOTA 2K79A 2C0IA 1IO6A 3GBQA 3NPFA 4Y92A 1I1JA 2CSQA 3O5ZA 1WXBA 1GFCA 2EW3A 1ZUYA 1NYGA 2DILA 2GNCA 4ORZA 3M0TA 2OJ2A 2E5KA 2CT3A 3REBB 2V1RA 2IIMA 4JJDA 4JPBW 4E6RA 1UTIA 1OEBA 4GBQA 5FWBA 1KIKA 2MCNA 4J9EA 2FEIA 5IHIA 2RQUA 3VS3A 3UF4A 4X1VA 2MIOA 3VRYA 1K1ZA 2DBKA 2GQIA 2KT8A 2BZYA 3C0CA 1OPKA 2KNBB 4D8KA 2K6DA 2X3WD 3A98A 1QLYA 2KEAA 2L3SA 1JXMA 1WXTA 4JZ3A 1PHTA 1SPKA 1CKBA 3H0HA 4OMPA 1H3HA 2RN8A 1RUWA 3H0FA 2JS2A 2LJ1A 2DMOA 2LX7A 3TVTA 2OI3A 4F17A 2K7AA 1GFDA 1UDLA 2RQVA 1AOJA 1CKAA 2JXBA 2O9SA 4RTVA 3PVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6N A;  5EC7 A;  2I0N A;  1UUE A;  2EQI A;  1BBZ A;  4LNP A;  1N5Z A;  1YWO A;  3REA B;  4K11 A;  1WYX A;  1NLP C;  2CDT A;  2OAW A;  2L2P A;  1VA7 A;  5I11 A;  5L23 A;  2FG0 A;  1TG0 A;  1K9A A;  4J9H A;  1WX6 A;  2PNI A;  3U23 A;  1K0X A;  2DNU A;  4Z88 A;  2A36 A;  3I5R A;  2AK5 A;  1RI9 A;  1T0H A;  2KRS A;  2LQW A;  1CSK A;  1SRM A;  1AWX A;  2BZX A;  1PKS A;  1SHF A;  2HDA A;  3THK A;  4Z89 A;  1M27 C;  2FPD A;  4Z8A A;  1SSH A;  1AZG B;  1UJ0 A;  2RPN A;  2J6F A;  2V1Q A;  2X3X D;  4RTT A;  3UAT A;  4OML A;  3EG2 A;  2SEM A;  2CT4 A;  2EBP A;  2ESW A;  4HCK A;  1AEY A;  1T0J A;  3I35 A;  2CH4 W;  1NG2 A;  1GCQ C;  2DA9 A;  4AFU C;  1GRI A;  2DRM A;  2DL3 A;  2W10 A;  3PE0 A;  1PNJ A;  2KRM A;  2XMF A;  3EGU A;  1AZE A;  2LMJ A;  1OPL A;  2A28 A;  2D8H A;  4LUE A;  2W0Z A;  2P4R A;  2FPF A;  2HEQ A;  3EG1 A;  5IXB A;  5FWC A;  4HVW A;  2GGR A;  4CC3 A;  1WXU A;  1ZSG A;  2CUD A;  2ED1 A;  2KGT A;  2LNH B;  4J9F A;  4F16 A;  1X6B A;  1GBR A;  2KRO A;  3VRZ A;  1U5S A;  2DLP A;  1S1N A;  1W1F A;  3LH5 A;  1JEG A;  4F14 A;  4GLM A;  4AFQ C;  4LE9 A;  4AG1 C;  3EHQ A;  2CH4 A;  2DRK A;  1K76 A;  1YCS B;  4HVV A;  1BU1 A;  2AZS A;  4R0K A;  5IHN A;  1JXO A;  4D8D A;  1JQQ A;  2EGC A;  2YDL A;  4QT7 A;  5IXF A;  1H8K A;  2CUB A;  2A08 A;  2JM8 A;  1E7O A;  1TUD A;  2FPE A;  4HVU A;  4AFS C;  4J9G A;  3I5S A;  1MV0 B;  2CSI A;  2LP5 A;  1KJW A;  2K2M A;  2A37 A;  4J9D A;  1QKX A;  3M0P A;  3RBB B;  1A0N B;  2J7I A;  1GCP A;  2YUP A;  1T3S A;  1YNZ A;  2BZ8 A;  4IIO A;  4A63 B;  1K0S A;  4LUD A;  4OMQ A;  1UFF A;  2DYB A;  3H0I A;  2JMA A;  2FRY A;  3NHN A;  2GTO A;  2NWM A;  2DVJ A;  1SEM A;  4RTW A;  2F2V A;  1NYF A;  2JMC A;  1LCK A;  1K4U S;  1UJY A;  2D8J A;  4KRT A;  2O88 A;  1VYV A;  1UHF A;  2YUQ A;  2YUO A;  1BB9 A;  2DX1 A;  2O31 A;  1VYT A;  2DL8 A;  4OMO A;  1Z9Z A;  2B86 A;  2JM9 A;  2M0Y A;  2KRN A;  1AD5 A;  1X27 A;  2ENM A;  2VWF A;  3I9Q A;  2EKH A;  2NUZ A;  2O9V A;  3NMZ C;  3EG3 A;  1AWO A;  4OMN A;  3TSZ A;  5IH2 A;  3CQT A;  2F2W A;  1WFW A;  1E6H A;  2H8H A;  2FO0 A;  2JTE A;  4WCI A;  1WA7 A;  2DL4 A;  3RNJ A;  4ZNX A;  5HCK A;  2EYX A;  5I22 A;  1PRM C;  2D1X A;  2JT4 A;  2PZ1 A;  1BK2 A;  3EHR A;  3UA6 A;  2ABL A;  2GBQ A;  3NGP A;  4J9C A;  4OMM A;  1HSQ A;  4FSS A;  1X43 A;  2DF6 A;  2KE9 A;  1SRL A;  3EG0 A;  2ROL A;  2J6O A;  3QWX X;  3VS6 A;  5IHK A;  2DL7 A;  2KBT A;  2KYB A;  3IQL A;  1FYN A;  1MUZ A;  2JS0 A;  1I07 A;  1YP5 A;  1ARK A;  2EYW A;  4RUG A;  1YN8 A;  1QCF A;  1B07 A;  1JO8 A;  1M3A A;  1I0C A;  3JV3 A;  4AG2 C;  1M8M A;  1UEC A;  1UE9 A;  2EPD A;  4RTX A;  1Y0M A;  2O2O A;  1X2K A;  3M0R A;  1X2Q A;  4RTU A;  3ULR B;  2ED0 A;  3M0U A;  2YSQ A;  2RQR A;  2RMO A;  1B3Q A;  2G6F X;  3KFV A;  2VVK A;  1ZX6 A;  4M4Z A;  1UG1 A;  4AFZ C;  2L3P A;  4RTY A;  5FW9 A;  2D0N A;  4RTZ A;  2MOX A;  2LCS A;  1U06 A;  2HBW A;  2RQW A;  1WDX A;  1W70 A;  1GCQ A;  2PTK A;  1Z9Q A;  1QWE A;  1RLP C;  2DJQ A;  2AKL A;  1EFN A;  2J05 A;  2ROT A;  2RQT A;  1NEB A;  3SEM A;  2HCK A;  2L3Q A;  1HD3 A;  1V1C A;  2YUN A;  1TUC A;  1PWT A;  4EIK A;  1Y57 A;  1M3C A;  2DBM A;  3H41 A;  1X69 A;  2LJ3 A;  2GTJ A;  2QDL A;  2SRC A;  4J9I A;  3VS4 A;  1QWF A;  2M51 A;  2KT1 A;  2EGE A;  3UA7 A;  1ZUK A;  1ZUU A;  1YWP A;  2K9G A;  2AZV A;  2EVR A;  1UHC A;  3VS5 A;  2EYY A;  4CC7 A;  4DEY A;  3VS2 A;  2J6K A;  1NM7 A;  5GJW B;  1W6X A;  1JU5 C;  4DEX A;  1J3T A;  3TSW A;  1E6G A;  1HJD A;  1FMK A;  2YT6 A;  1U3O A;  2C0T A;  4HXJ A;  1G2B A;  1H92 A;  2HSP A;  2C0O A;  4IIM A;  1ZLM A;  1XOV A;  4JJC A;  3PVQ A;  2RNA A;  4JJB A;  2LQN A;  2KXC A;  2FRW A;  2K3B A;  1ABO A;  1WIE A;  2BTT A;  1PRL C;  4CC2 A;  1AVZ C;  3VS1 A;  3QWY A;  1ABQ A;  1OV3 A;  2AKK A;  4J9B A;  2KYM A;  5ECA A;  2F2X A;  1UGV A;  2RF0 A;  2KR3 A;  2L0A A;  2VKN A;  1AWJ A;  4CC4 B;  2EGA A;  3ZL7 C;  1KSW A;  2DL5 A;  3SHW A;  4ESR A;  1X6G A;  2LJ0 A;  1KFZ A;  3M0S A;  4LN2 A;  1WI7 A;  1G83 A;  3VS0 A;  2ECZ A;  1M30 A;  3M0Q A;  3VS7 A;  1PKT A;  2DE0 X;  5GJV B;  2KXD A;  1MV3 A;  1WLP B;  1SHG A;  1RLQ C;  2CRE A;  3FJ5 A;  1GBQ A;  1T3L A;  2EYZ A;  1ZBJ A;  2JW4 A;  1QKW A;  1M3B A;  1GL5 A;  1NEG A;  2LZ6 B;  4JZ4 A;  1AWW A;  2DM1 A;  2J06 A;  1VYU A;  1NLO C;  1OOT A;  2K79 A;  2C0I A;  1IO6 A;  3GBQ A;  3NPF A;  4Y92 A;  1I1J A;  2CSQ A;  3O5Z A;  1WXB A;  1GFC A;  2EW3 A;  1ZUY A;  1NYG A;  2DIL A;  2GNC A;  4ORZ A;  3M0T A;  2OJ2 A;  2E5K A;  2CT3 A;  3REB B;  2V1R A;  2IIM A;  4JJD A;  4JPB W;  4E6R A;  1UTI A;  1OEB A;  4GBQ A;  5FWB A;  1KIK A;  2MCN A;  4J9E A;  2FEI A;  5IHI A;  2RQU A;  3VS3 A;  3UF4 A;  4X1V A;  2MIO A;  3VRY A;  1K1Z A;  2DBK A;  2GQI A;  2KT8 A;  2BZY A;  3C0C A;  1OPK A;  2KNB B;  4D8K A;  2K6D A;  2X3W D;  3A98 A;  1QLY A;  2KEA A;  2L3S A;  1JXM A;  1WXT A;  4JZ3 A;  1PHT A;  1SPK A;  1CKB A;  3H0H A;  4OMP A;  1H3H A;  2RN8 A;  1RUW A;  3H0F A;  2JS2 A;  2LJ1 A;  2DMO A;  2LX7 A;  3TVT A;  2OI3 A;  4F17 A;  2K7A A;  1GFD A;  1UDL A;  2RQV A;  1AOJ A;  1CKA A;  2JXB A;  2O9S A;  4RTV A;  3PVL A; 
#chains in the Genus database with same CATH topology
 4M75 A;  2NUT B;  2R58 A;  1YWO A;  4A4G A;  5FU7 C;  2LT4 A;  5IN1 A;  5FU7 B;  4M77 C;  1NLP C;  3JB9 I;  2OX7 A;  3V7C A;  3L2V A;  2OAW A;  2L2P A;  3CC4 T;  2RH2 A;  3OSS C;  2PVD B;  2Y90 A;  1WHK A;  3OYJ A;  2NUP A;  4N0A C;  4M78 C;  1PSF A;  4M78 B;  1WX6 A;  2PNI A;  3VUZ A;  1QCO A;  4M78 E;  4WF2 A;  1X6O A;  3MEU A;  5HKC A;  4Z88 A;  2HBP A;  2CZ0 B;  2KRS A;  4GLK A;  2BZX A;  2HDA A;  3THK A;  2RHY A;  4Z89 A;  2FPD A;  4Z8A A;  4E7I A;  1KHI A;  1AZG B;  1UJ0 A;  2RPN A;  4L59 A;  4IUV A;  3CBP A;  2E10 A;  3EGX B;  2EBP A;  4HCK A;  4PNO A;  1RAC B;  2O4X B;  3MP1 A;  1NG2 A;  4AFU C;  9ATC B;  2DRM A;  1EIF A;  6AT1 B;  2W10 A;  2KRM A;  2XMF A;  2WSC E;  4ATO A;  5CKD A;  2W0Z A;  2A3L A;  2K5I A;  2FPF A;  4F7U A;  4OGE A;  3SWN A;  2RI3 A;  4X34 A;  4CC3 A;  4A53 A;  2XU8 A;  3OYI A;  2FHD A;  2CYZ B;  4A54 A;  3VRZ A;  3HL8 A;  1BIB A;  1W1F A;  5KE3 A;  4E7Z A;  4GLM A;  4LE9 A;  2CH4 A;  2KI7 A;  1M1F A;  2DYI A;  1K76 A;  1JBM A;  4KUI A;  4D8D A;  1KHC A;  4PK4 A;  2EGC A;  4QT7 A;  3BW1 A;  3SDZ A;  1D0Y A;  1VIF A;  3QDF A;  4J7I A;  1PC0 A;  2CUB A;  4JRI A;  2JM8 A;  4AFS C;  3MP6 A;  4M7D F;  3SFM A;  2LP5 A;  2A37 A;  2DZC A;  4J9D A;  1MMA A;  2QK0 A;  4BE1 A;  1VQK T;  5GAM j;  2J7I A;  3JCM h;  5FRN A;  1GCP A;  1T3S A;  4A63 B;  1Y96 A;  4C5G A;  2DVJ A;  1SEM A;  2HQH A;  1D0X A;  3VJP A;  1NYF A;  3MPU B;  2JMC A;  4HCB A;  1UGS B;  2O88 A;  1OQK A;  2X35 A;  2YUO A;  1BB9 A;  5GAO r;  3ZEH A;  2B86 A;  2VWF A;  1X27 A;  3QO3 A;  1X75 C;  2NUZ A;  1K8A R;  1VQ8 T;  1RAG B;  1VQ5 Q;  3EG3 A;  2MF2 A;  4OMN A;  3OYY A;  3TU4 K;  2F2W A;  3ZFJ A;  1E6H A;  2H8H A;  4WCI A;  1WA7 A;  3CCE Q;  1KQ2 A;  4ZNX A;  2FYK A;  4IUQ A;  3EAE A;  2JT4 A;  2B8A A;  1BK2 A;  2DD4 A;  4BE0 A;  5LJ5 d;  3JCM d;  4CRI A;  1TUG B;  2NYS A;  1DJ7 B;  2CP6 A;  4XTW A;  2NUT A;  4JRP A;  1X43 A;  3CCQ Q;  4M77 A;  3EG0 A;  2ROL A;  3CC2 Q;  1VQ6 T;  2HD0 A;  5GMK e;  4N0A A;  2ZCF B;  2ZPG B;  5IHK A;  2DAQ A;  4M78 A;  2KYB A;  1FYN A;  3T9N A;  2QI2 A;  1BKB A;  1YP5 A;  1K73 R;  3X24 B;  1B07 A;  1JO8 A;  1M3A A;  2LCL A;  2DO3 A;  1ZBX A;  1QP3 A;  1VQ5 A;  3JV3 A;  5D6X A;  3HRS A;  2K2V A;  2O2O A;  3M0R A;  1X2Q A;  2F1L A;  3AHU A;  3TRE A;  3ULR B;  4C0D B;  3CCE A;  5A2Q E;  1ACM B;  4XTV A;  1D1A A;  1FWZ A;  4PFZ A;  2YSQ A;  1I5O B;  2Z0W A;  4M7D G;  1PG5 B;  1UG1 A;  2LX9 A;  3JB9 H;  3EGX A;  1OUL A;  1OU8 A;  2RQW A;  2D9T A;  2E1H A;  3FB9 A;  2PTK A;  4JRQ A;  2E64 A;  2OTJ Q;  3M55 A;  3CCQ A;  1R0B G;  2AKL A;  2J05 A;  2RQT A;  3S6W A;  3RDV A;  1HD3 A;  3CC2 A;  4BAC A;  5GAM g;  4HCC A;  1M90 R;  3BFM A;  4Q5W A;  2K3Y A;  3VV0 A;  3H41 A;  2QDL A;  4OGC A;  3CBO A;  3CD6 Q;  3VS4 A;  1OZ2 A;  4FYY B;  1IGU A;  1W4S A;  1ZUK A;  2MAM A;  3NTK A;  2X4Y A;  1V29 B;  1UHC A;  4QVZ A;  4ZGD B;  3VS5 A;  3UDC A;  1JB0 E;  5D6W A;  5GJW B;  1YI2 T;  4M7D C;  4M7D B;  4M7D E;  2BUD A;  1JJ2 A;  3TCJ A;  2C0T A;  1MND A;  1H92 A;  2OTJ A;  2HSP A;  2EQJ A;  1VQN T;  1XOV A;  1K9M U;  3CXC A;  1M2O A;  4FYW B;  3P8B B;  2KXC A;  5J39 A;  5GAO p;  5LJ3 d;  1YBY A;  2M0O A;  3GOX A;  3PNW C;  5GAN f;  1KC8 R;  3VS1 A;  4J83 A;  1ABQ A;  3CD6 A;  2AKK A;  1VQ9 T;  1NPP A;  4F04 B;  3MET A;  5GMK j;  2KY9 A;  3OYC A;  3G71 Q;  1UGV A;  2P0P A;  2RF0 A;  2FB7 A;  1JRI A;  3FJP A;  3QPH A;  1YFN A;  3QXE B;  3LX7 A;  1AWJ A;  5AYF A;  1YIT T;  1QCN A;  3M58 A;  1B7T A;  2D6F A;  1KSW A;  2DL5 A;  3SHW A;  4KBM B;  4ANJ A;  3CCU Q;  3OS0 A;  3VU3 C;  1IRE B;  1KFZ A;  5GAN 8;  1KK7 A;  2RM4 A;  3MEW A;  3CCJ A;  4PJO F;  1LOJ A;  2ECZ A;  1O9S A;  2A0F B;  3VS7 A;  2RA2 A;  1Q86 U;  1GXI E;  3NTH A;  1MV3 A;  3OW2 P;  5KYU B;  4BB7 A;  1QVP A;  1MMD A;  4II1 A;  1M4Z A;  2MPX C;  2CP5 A;  1LPL A;  1JJ2 S;  2LQK A;  4C5H A;  4E7K A;  1G5V A;  3QJY A;  3KBG A;  1M3B A;  1MMG A;  1NJI U;  3JCM V;  3BY7 A;  1OYX A;  7AT1 B;  2LZ6 B;  1K9M C;  4LXC A;  3CXC S;  3CCR Q;  3CCS T;  3G71 A;  1VQ7 T;  2ATC B;  4XTX A;  4Y92 A;  1GFC A;  4Z02 A;  1BIA A;  3LWH A;  3R6O A;  2GNC A;  4ZTF A;  4ZTJ A;  2OJ2 A;  3PMI A;  3H8Z A;  3REB B;  3OS5 A;  1OX9 A;  5GAN 2;  2K57 A;  2VGN A;  3M59 A;  4C92 F;  4M75 B;  5DM7 R;  4M75 E;  5C6S A;  5CAI A;  5I2S A;  3VRY A;  3V8K A;  2DBK A;  2K4Y A;  2HZY A;  1OPK A;  2KNB B;  4A4F A;  2X3W D;  2VXE A;  1NPR A;  2VUB A;  3DB3 A;  1PHT A;  1CKB A;  5KYN A;  4M77 F;  3OBY A;  3H0H A;  1QVF P;  3CCL Q;  3OMG A;  1M1K C;  2JS2 A;  1WQW A;  3QYH B;  2K7A A;  4NS5 A;  1UDL A;  1AOJ A;  2QQR A;  4DBF A;  1CKA A;  3CCR A;  1QQJ A;  1FMW A;  2EQU A;  4XK8 E;  4RTV A;  2XDD A;  2XIC A;  3PVL A;  1NJI C;  4FIB A;  3R6N A;  2I0N A;  1UUE A;  2QAS A;  4E7S A;  1UGQ B;  4CI0 C;  5LJ5 e;  3JCM e;  1WYX A;  2RJC A;  4X9C A;  3GNG A;  4PJO G;  1ZA2 B;  2F69 A;  5I11 A;  1TG0 A;  4J9H A;  3JB9 G;  2G3R A;  2GCX A;  4M7D A;  5CR2 A;  4M78 D;  3CPW A;  1BCM A;  3I5R A;  1T0H A;  1CSK A;  4J6W A;  1SRM A;  2FL7 A;  4HA8 A;  1SHF A;  4FSX A;  1VQP Q;  1M27 C;  4L5G A;  2PVG B;  5KYY B;  3JCM J;  3CCL A;  3L2R A;  1SSH A;  3OA6 A;  4B9X A;  1Q7Y R;  2V1Q A;  1SKU B;  4OML A;  2ZPI B;  4LDW A;  4C0F A;  2QDY B;  3QII A;  3UWN A;  2CT4 A;  4HCZ A;  2VB6 A;  1AEY A;  4MMK A;  2HKQ B;  4N4H A;  3I35 A;  1YCY A;  3OYF A;  2DA9 A;  3CME Q;  4EMK C;  4XU3 A;  4EMK B;  3PE0 A;  4QVC A;  4XQ3 A;  1VQM Q;  3PIP A;  3EFR A;  2HQX A;  2LMJ A;  1OPL A;  1VQ4 Q;  4LUE A;  4C92 G;  3QZ5 B;  1M9S A;  3RER A;  1G8X A;  2P4R A;  2HEQ A;  4PJO C;  1XQH A;  3QUI A;  4ZGJ B;  4PJO B;  4PJO E;  2EWN A;  2RK1 A;  4EDU A;  3L2Z A;  1Q81 U;  4HVW A;  3JRZ A;  2CUD A;  4M77 G;  2KRO A;  3MKD A;  2DLP A;  5KCO A;  1YIJ Q;  1VIE A;  4AG1 C;  3PMT A;  3EHQ A;  1VQP A;  3CCM Q;  2EAY A;  1BU1 A;  2AZS A;  2XI9 A;  2NLU A;  3CPW S;  1YJW Q;  5IXF A;  1H8K A;  1IHV A;  1SF9 A;  2A08 A;  1TUD A;  1Q95 G;  3BDL A;  1N9R A;  2FPE A;  3A5Z B;  4XTZ A;  1BI0 A;  3C4S A;  4ZN3 A;  1MV0 B;  1KJW A;  1QKX A;  4C0G A;  1A0N B;  2QA4 Q;  1VQ4 A;  2YUP A;  2YLC A;  2BZ8 A;  3OQ5 A;  1K0S A;  3I56 Q;  4LUD A;  4C92 B;  1UB4 A;  5LJ5 j;  1TH7 A;  3NHN A;  4C92 E;  5LJ3 e;  2F2V A;  2XKO C;  2D8J A;  2PU9 B;  1UHF A;  1PCX A;  2DX1 A;  2DL8 A;  1TWB A;  1YIJ A;  1IGQ A;  4M77 B;  4LDX A;  1AD5 A;  3GNF B;  2ENM A;  4M77 E;  1H3Z A;  1Q81 C;  2EKH A;  2ZPH B;  4KT0 E;  2EQK A;  3NMZ C;  3CCM A;  3OYK A;  1VQO A;  1LVK A;  5IH2 A;  1HXD A;  4XU0 A;  1S72 Q;  2MYS A;  4X9D A;  3GF5 A;  2QQS A;  3RES A;  3RNJ A;  2EYX A;  4AMC A;  4PJL A;  1N9S A;  3LLR A;  1W2B P;  2LVM A;  2GBQ A;  5FLX E;  3NGP A;  1G3Y A;  4B6M A;  2GFA A;  4J9C A;  4IUR A;  2V26 A;  4OMM A;  4OP0 A;  3SB2 A;  4FSS A;  3CCV Q;  2QA4 A;  1KD1 U;  1RL2 A;  2DF6 A;  2KE9 A;  2L8D A;  5D6Y A;  2J6O A;  4JRK A;  2H3J A;  3VS6 A;  1VQL A;  4ZGE B;  3V7S A;  1RAB B;  2RHI A;  4FT2 A;  2JUF A;  2JS0 A;  4IKF A;  1ARK A;  5A0D A;  3A8G B;  2DK3 A;  3NFC A;  1Q82 U;  2FZC B;  3HKS A;  3LGL A;  1UEC A;  4RTX A;  2AIR B;  5KYY A;  1S72 A;  1ZSZ C;  2QG9 B;  3X25 B;  1YJN Q;  2ED0 A;  3URG A;  4RMO A;  2RMO A;  3OS1 A;  3KFV A;  2VVK A;  4RTY A;  5FW9 A;  1VQ5 T;  1WDX A;  2BIV A;  1W70 A;  2RJD A;  2V8I A;  4J8O A;  4JDS A;  5EG2 A;  2BE7 D;  2KSS A;  3OBW A;  3CCV A;  4EMK A;  2C06 A;  3CCE T;  3QBY A;  2DXT A;  1EFN A;  2ROT A;  1NEB A;  1RAF B;  2L3Q A;  1TUC A;  4EIK A;  3E9G A;  4IUT A;  3HP9 A;  1M3C A;  2DBM A;  4M7A D;  4PJO A;  2AT1 B;  3QG1 A;  1KD1 C;  2LJ3 A;  5LJ5 g;  2SRC A;  3JCM g;  3CBM A;  2M51 A;  2PVO B;  5GAO q;  5LJ3 j;  3LH0 A;  3BDU A;  3CCQ T;  1ZA1 B;  4BI3 A;  3PGG A;  1Y71 A;  2E41 A;  1QP2 A;  1ZUU A;  3CC2 T;  2K9G A;  1Y07 A;  2BE9 B;  1I8F A;  3G7Z A;  2MWO A;  4XTY A;  4DQ2 A;  2HAX A;  4OF1 A;  4DEY A;  3FC3 A;  4LDY A;  1Q82 C;  1NM7 A;  1N6A A;  4DEX A;  4KGZ B;  1I4K 1;  1E6G A;  1FMK A;  2YT6 A;  2X51 A;  4M7D D;  4NOY A;  4E2F B;  1ZLM A;  2WSF E;  4JJC A;  2RD1 A;  2RNA A;  2X4X A;  3OY9 A;  2FRW A;  3A1P A;  4C92 A;  2OTJ T;  2CP3 A;  2KYM A;  4JLG A;  3OYM A;  2E6N A;  2F2X A;  4HKE A;  5GAM f;  2QEX Q;  2L0A A;  3HHT B;  4BDY A;  4E7J A;  2XID A;  1KG1 A;  2EGA A;  3OYE A;  2HL3 A;  4ME7 A;  1WGS A;  2DIG A;  1X6G A;  4QQD A;  4ESR A;  3M4G A;  3GIB A;  3CD6 T;  1G3W A;  2LJ0 A;  4JLI A;  1XTD A;  2F5K A;  3OSV A;  3OYN A;  4RCB A;  1AT1 B;  3M0Q A;  3DLL A;  3UT1 A;  2EJG A;  5C0M A;  2KXD A;  1WLP B;  1SHG A;  2CRE A;  3LW5 E;  4MML A;  2E3H A;  3CMA Q;  2EYZ A;  1RI0 A;  1P92 A;  3J81 E;  3G6E Q;  3PFS A;  5LL6 S;  4AT1 B;  3OYA A;  3CCJ T;  4JZ4 A;  2K79 A;  1WHL A;  2C0I A;  1IO6 A;  3GBQ A;  2MI6 A;  2QEX A;  1FXX A;  1NZ9 A;  1NYG A;  1M90 C;  2DIL A;  2DXU A;  5LJ3 g;  4J6Y A;  4PLL A;  4BY6 C;  1TS9 A;  2YRV A;  4BY6 B;  4PKC C;  4JJD A;  5FWB A;  1ZSZ A;  3G71 T;  1LJO A;  5IHI A;  2RQU A;  3VS3 A;  2LC4 A;  1UGR B;  2MIO A;  3OMC A;  3OYD A;  2KT8 A;  4M75 D;  3C0C A;  2YWW A;  3KUF A;  1TU0 B;  2KEA A;  2L3S A;  4RG2 A;  3CMA A;  1SPK A;  3A8L B;  2RI2 A;  3G6E A;  1H3H A;  3FDR A;  3A8H B;  2VYT A;  5CVI A;  2RN8 A;  3H0F A;  2COZ A;  2LX7 A;  2DZ9 A;  1Y7X A;  2RQV A;  4BDZ A;  2YRD A;  2JNG A;  5EC7 A;  2EQI A;  4MZT A;  1BBZ A;  3HTR A;  4PFO A;  2DTI A;  3REA B;  5L8R E;  2EQM A;  4DOW A;  1ZHI A;  3DKM A;  2XG8 D;  3QHS A;  5L23 A;  2FZG B;  1B34 B;  4JUV A;  4PJN A;  5A0G A;  3CCR T;  3U23 A;  5KYX B;  1MMN A;  2DEQ A;  2P0Q A;  4D6W A;  1OI1 A;  4XTU A;  5FRO A;  4QQ6 A;  5IAY A;  3WXM B;  2AHJ B;  1R0C B;  2J6F A;  3E9F A;  3VYH B;  2X3X D;  1U8R A;  3CC7 Q;  3QDR B;  4J7F A;  4LDU A;  5CCA A;  3OW2 A;  3EG2 A;  2SEM A;  3FRN A;  2ESW A;  1M1K U;  1VOM A;  3JB9 F;  1BI2 A;  4IUU A;  1T0J A;  2LTO A;  1KQS A;  5FRM A;  2VAS A;  1KQS P;  3CCL T;  4QW2 A;  1M8V A;  3S3O A;  3I55 Q;  2M1H A;  1YI2 Q;  1XNI A;  3EGU A;  1AZE A;  2GF7 A;  1O75 A;  3JCM b;  4BD3 A;  5CK9 A;  2EKO A;  2DPP B;  3JCM X;  3A8M B;  3EG1 A;  1TSF A;  5IXB A;  5FWC A;  3RMS A;  2GGR A;  1V76 A;  3RKY A;  4PJO D;  2ED1 A;  2KGT A;  2CP2 A;  1GBR A;  4C8Q F;  1U5S A;  3V8J A;  3LH5 A;  2RI5 A;  1JEG A;  4F14 A;  3M9Q A;  1BI1 A;  4NL3 A;  3CCU A;  2QAZ A;  2RJE A;  1YCS B;  1VQ9 Q;  4HVV A;  1K9M R;  3CC7 A;  5HY6 A;  1OX8 A;  5GAN h;  4RKU E;  3G4S Q;  4KGX B;  4HT8 A;  1QVF A;  4HVU A;  1VQP T;  1D0Z A;  3A8O B;  2VV5 A;  2CSI A;  3S3M A;  2K2M A;  2M9U A;  2DET A;  3I55 A;  1M2V B;  3OW2 S;  3M0P A;  3RBB B;  2OTL Q;  1YI2 A;  2RHX A;  2DEU A;  1YNZ A;  1WJR A;  2RK2 A;  4IIO A;  4OMQ A;  1QMC A;  2K3X A;  2NWM A;  2QQ9 A;  1WHH A;  4RTW A;  3MJX A;  2JOY A;  3V7R A;  1LCK A;  1UJY A;  4C92 D;  2YUQ A;  4O6J A;  1VQ4 T;  1Z9Z A;  2JM9 A;  4MDW A;  2M0Y A;  2KRN A;  3I9Q A;  1N8R U;  4A4H A;  1Q86 R;  1WHM A;  2R5M A;  4M77 D;  2P4T A;  3X28 B;  5CQX A;  5GAN d;  1IZ6 A;  1WFW A;  2EJF A;  2FO0 A;  1U1S A;  1VQ7 Q;  2DL4 A;  3G4S A;  1TXQ A;  3L2Q A;  2DJZ A;  1NJI R;  2JZ2 A;  5HCK A;  5I22 A;  1YIJ T;  1PRM C;  2D1X A;  3UA6 A;  3CCM T;  3LGF A;  3TEE A;  4FYV B;  4C5E A;  1VQO T;  4BI8 B;  2OTL A;  4QVD A;  2FZK B;  1HSQ A;  1VUB A;  2E6Z A;  4KH0 B;  2GQV A;  2OAU A;  3P8D A;  4RG8 A;  4PLI A;  4R55 A;  1QVF S;  4O5V A;  1U1T A;  1B34 A;  3OYL A;  4C8Q G;  2KVQ G;  4NL2 A;  2X4J A;  3QWX X;  2DL7 A;  5GAO l;  3GPL A;  2VC8 A;  5A0L A;  1MUZ A;  1BYM A;  5KYX A;  2QA4 T;  4L6V 5;  4RUG A;  1YN8 A;  3M54 A;  1IRX A;  1I0C A;  1VQL Q;  1C6V X;  4AG2 C;  1UE9 A;  2EPD A;  2LCC A;  1X2K A;  3BE3 A;  4DBQ A;  1VQL T;  1VQ7 A;  5KCH A;  3LYI A;  1R77 A;  3M0U A;  5I2M A;  1N8R C;  2G6F X;  2R57 A;  1ZX6 A;  4M4Z A;  4BE2 A;  1RAI B;  4AFZ C;  5CKB A;  2PUO B;  1D09 B;  2MOX A;  2LCS A;  2HBW A;  5CKH A;  5GAO n;  1QWE A;  5M9O A;  1S72 T;  1RLP C;  3SEM A;  3L2U A;  5FU6 C;  1V1C A;  2YUN A;  5FU6 B;  1Y57 A;  2WSE E;  2DFU A;  3M5A A;  4FM4 B;  4C8Q C;  2E70 A;  3CME A;  1X69 A;  5AT1 B;  4C8Q B;  2GTJ A;  4C8Q E;  4J9I A;  2QTX A;  2LRQ A;  3CCV T;  4RCC A;  1VQM A;  2AZV A;  1OZ3 A;  1PSE A;  2MWP A;  3UPU A;  3CPF A;  4CC7 A;  3VS2 A;  2DKG A;  3OYG A;  2JTM A;  1W6X A;  1JU5 C;  3EGD B;  3HFO A;  1J3T A;  2L89 A;  3TSW A;  8AT1 B;  3FLG A;  2Y4Y A;  2JVV A;  1U3O A;  1SG5 A;  5KYW A;  3PTA A;  3EH1 A;  2C0O A;  4A4E A;  4IIM A;  1M2V A;  3M53 A;  3PVQ A;  1YJ9 Q;  4JJB A;  1YJW A;  2LQN A;  4N4G A;  2M16 A;  1W2B A;  1R8O B;  1ABO A;  2K3B A;  2CZ1 B;  2KDS A;  4C5I A;  4A4K A;  1PRL C;  4CC2 A;  1AVZ C;  4OB0 B;  3QWY A;  3DLM A;  4J9B A;  4TVR A;  1Q81 R;  3WVD B;  2E3I A;  3WVE B;  3I56 A;  2VKN A;  1EX4 A;  5GMK m;  5LJ5 f;  3JCM f;  3RMQ A;  3ZL7 C;  3FIF A;  1YHQ Q;  1N27 A;  2E65 A;  4XU1 A;  4LD6 A;  3RR6 A;  5KE2 A;  1MNE A;  2LQ8 A;  2ZAE A;  3L2W A;  2FVU A;  1PKT A;  2DE0 X;  2XDP A;  3TQ7 P;  5GJV B;  1K8A U;  2YRC A;  3FJ5 A;  3QZ9 B;  1GBQ A;  3QKJ A;  3MCA B;  1IB8 A;  1ZSZ B;  1YJ9 A;  3RUX A;  1QKW A;  4FT4 A;  3M4Y A;  2EJ9 A;  2QQA A;  2CGH A;  3ME9 A;  3PT9 A;  3CC4 Q;  1TOV A;  2DD5 A;  4ELZ C;  4M7A F;  3X20 B;  2QTV A;  3NPF A;  3MO8 A;  1I1J A;  1W2B S;  3O5Z A;  1ZUY A;  3QSU A;  2HSE B;  2HKN A;  2R5A A;  4JS4 A;  2E5K A;  2CT3 A;  2X4W A;  2L5Q A;  2RJF A;  2V1R A;  1YHQ A;  2QYZ A;  2IIM A;  4E6R A;  1UTI A;  1OEB A;  4GBQ A;  1KIK A;  4J9E A;  4JS5 A;  3E1S A;  3H6Z A;  2M02 A;  2QEX T;  1K73 U;  3UF4 A;  4V2S A;  3JB9 J;  4D8K A;  3A98 A;  2CP0 A;  2K6D A;  3M56 A;  3Q1J A;  1YJN A;  1M1G A;  4HT9 A;  1K8A C;  1KD1 R;  5LJ5 h;  2XD0 A;  3E19 A;  5GAN e;  3JSC A;  3CC4 A;  4C8Q A;  3CMA T;  5GAN 4;  2JXB A;  3C94 A;  1UGP B;  3N5B B;  3G6E T;  3C95 A;  4QKU A;  4LNP A;  4MZM A;  1N5Z A;  1HK9 A;  1H64 1;  2QGF B;  4K11 A;  1MHN A;  3MEV A;  2CDT A;  4MDX A;  1Q82 R;  1M90 U;  3HFN A;  1VA7 A;  2FG0 A;  1K9A A;  2YHT A;  2K5F A;  2ZGW A;  5LJ3 f;  3X26 B;  1AHJ B;  2QQB A;  3EGD A;  1K0X A;  2DNU A;  4N4I A;  4OB2 B;  4DBH A;  2A36 A;  4R56 A;  2AK5 A;  1RI9 A;  2LNV A;  2LQW A;  3LWI A;  1AWX A;  1PKS A;  3EH2 A;  2QGG A;  1K73 C;  2E12 A;  4J5Y A;  3S3N A;  5CO7 A;  4QQG A;  2COW A;  1IXD A;  4M7A G;  3JAM E;  1VQK Q;  4RTT A;  3UAT A;  2CS7 A;  4FU6 A;  3F70 A;  5GAN 6;  4IUP A;  2CH4 W;  3HRU A;  1GCQ C;  1NE8 A;  2CKK A;  1GRI A;  3VYG A;  2DL3 A;  2EIF A;  3NTI A;  2EFI A;  5DLO A;  1D3B B;  1PNJ A;  2A28 A;  2D8H A;  2JN0 A;  3AT1 B;  1KC8 U;  1VQ8 Q;  3RKX A;  4UC4 A;  2KMT A;  4B9W A;  4C0D C;  2VXF A;  1OU9 A;  2O01 E;  1WXU A;  1ZSG A;  8ATC B;  3ZBD A;  4ZN1 A;  2LNH B;  1RAA B;  4J9F A;  4F16 A;  1X6B A;  4OVA A;  1S1N A;  3MP8 A;  3RKW A;  4AFQ C;  2O4X A;  5HK0 A;  2MK5 A;  3OB9 A;  4M75 F;  2DRK A;  3HPW A;  1QW1 A;  4R0K A;  5IHN A;  1JXO A;  3OS2 A;  1VQK A;  1JQQ A;  4J6X A;  2DVE A;  4WTO B;  1TTH B;  4M7A C;  2YDL A;  4M7A B;  3DB4 A;  5IT9 E;  1PM3 A;  4M7A E;  4VUB A;  1PD0 A;  1WHG A;  2XK0 A;  4OB3 B;  1VQ6 Q;  3H9N A;  1E7O A;  5CIU A;  4FYX B;  5LJ3 h;  5GAN j;  5GAM h;  3CCU T;  4J9G A;  1FX7 A;  3I5S A;  2CP7 A;  1WNL A;  3CC7 T;  4KUL A;  1UFF A;  3FEO A;  1VQ8 A;  2DYB A;  1FMV A;  3H0I A;  2JMA A;  5GAN 7;  2FRY A;  2GTO A;  4FW1 A;  3EFS A;  2EYQ A;  2H3E B;  1K4U S;  4KRT A;  1VYV A;  2CZ7 B;  1KC8 C;  1M5Q 1;  5KH6 A;  3I55 T;  2O31 A;  1VYT A;  4OMO A;  3CCJ Q;  2I2L A;  2E4H A;  3JCM c;  2O9V A;  2HMA A;  1JJ2 P;  5D7U A;  1G3S A;  1RAE B;  3TSZ A;  2COY A;  1AWO A;  2MMP A;  3CQT A;  2JTE A;  3EFO B;  3RIR A;  2DER A;  1X01 A;  4F7U F;  5GAM d;  3CXC P;  1VQ6 A;  1WHJ A;  4EMG A;  2PZ1 A;  5J26 A;  3EHR A;  4LD9 K;  2ABL A;  2HNI A;  4BUG A;  3G4S T;  1SRL A;  2ZZD A;  4Y28 E;  3VUB A;  2RB6 A;  4PJM A;  3J7A F;  2KBT A;  4FCY A;  3IQL A;  4M75 G;  2OTL T;  2LT1 A;  4KUD K;  1I07 A;  2EYW A;  1SSF A;  1QCF A;  5J3B A;  2KAF A;  4OB1 B;  3ASK A;  1M8M A;  1Y0M A;  4RTU A;  1VQN Q;  3E2U A;  1F1B B;  2K5L A;  2RQR A;  1B3Q A;  2RHU A;  2L3P A;  2D0N A;  3CEY A;  3JB9 D;  1MGQ A;  4RTZ A;  1U06 A;  3SD4 A;  3D7S B;  3GP8 A;  1GCQ A;  1Z9Q A;  4YTL A;  5GAN g;  5CKE A;  2CZ6 B;  1D3B A;  2DJQ A;  1Q7Y U;  3HRT A;  1I5L A;  1BI3 A;  2HCK A;  1RAH B;  2A7Y A;  2JJ9 A;  2D0Q B;  5GMK i;  1PWT A;  4PJJ A;  1YIT Q;  2DXB A;  3MHX A;  2BKD N;  4MZP A;  5CQY A;  3VKI A;  5KYW B;  1QWF A;  3GLX A;  2F5T X;  3EG9 B;  2DXC A;  4M75 C;  4C8Q D;  2KT1 A;  2EGE A;  1BCO A;  3UA7 A;  4FL6 A;  5CKF A;  1QVG A;  1YWP A;  2YXY A;  1KQS S;  3JCM Q;  4DA4 A;  1D1C A;  1QVG P;  4F7U G;  2EVR A;  2P0K A;  1VQN A;  3CME T;  2P84 A;  2NUP B;  2EYY A;  4XU2 A;  3M57 A;  2QXF A;  2J6K A;  4M7A A;  1Q86 C;  2YLB A;  1VQM T;  4EPC A;  1G3T A;  1HJD A;  1C1A A;  4M78 F;  4HXJ A;  1M1K R;  1G2B A;  1VQ9 A;  2PQW A;  4DBR A;  1ZQ1 A;  3CCS Q;  4GY5 A;  4E7L A;  5GAN 3;  5DY9 A;  3C12 A;  2IG0 A;  4E7H A;  1YIT A;  1WIE A;  1WPY A;  5GMK h;  5GAN 5;  2BTT A;  4P5N A;  1Q7Y C;  1C0M A;  1D1B A;  1OV3 A;  3G1J A;  5ECA A;  3KXT A;  2ZPB B;  2KR3 A;  3INZ A;  2KK4 A;  1YJW T;  4FW2 A;  2X9H A;  2GFU A;  4CC4 B;  2HQE A;  1WJQ A;  2ZPF B;  3CPW P;  3O8V A;  1XJW B;  1IHW A;  3JCM P;  4KGV B;  3SWN C;  4F7U B;  3OYH A;  4F7U E;  3SWN B;  3EFO A;  2RO0 A;  4EMH A;  3M0S A;  1HYO A;  2LDM A;  1QVG S;  4LN2 A;  1WI7 A;  1G83 A;  1UEB A;  1LNX A;  2KQW A;  3VS0 A;  2V8K A;  1M30 A;  3I56 T;  2PUK B;  2L3R A;  3ER0 A;  2DIQ A;  1RLQ C;  5I21 A;  3CCS A;  1T3L A;  4DOV A;  1ZBJ A;  1RAD B;  5DLQ E;  2JW4 A;  1NBE B;  2IVW A;  3QYG B;  3PIO A;  3L42 A;  1GL5 A;  1NEG A;  4BI4 A;  1AWW A;  2DM1 A;  3J80 E;  2J06 A;  1VYU A;  4PL6 A;  2WAC A;  1NLO C;  1OOT A;  4JJN K;  1I81 A;  1YJ9 T;  2CSQ A;  1WXB A;  2EW3 A;  4ORZ A;  3OYB A;  3M0T A;  3HSB A;  1N8R R;  5KYU A;  1Y96 B;  4KH1 B;  4JPB W;  3QJ6 A;  2IPO B;  4M78 G;  1VQO Q;  2MCN A;  2FEI A;  4Y91 A;  3V8L A;  1KQ1 A;  2XDB A;  4X1V A;  3L1A A;  1K1Z A;  2GQI A;  4ELY C;  2BZY A;  5GMK l;  2ZPE B;  2RHZ A;  3MEA A;  2XHC A;  2Y4X A;  1QLY A;  4E47 A;  1YHQ T;  1JXM A;  2V8J A;  4JZ3 A;  1WXT A;  2HL5 C;  5GAO m;  3P8H A;  4OMF B;  1WJS A;  4PFP A;  4OMP A;  1WZO A;  1RUW A;  1EZZ B;  2LJ1 A;  2DMO A;  3TVT A;  2DTH A;  2OI3 A;  4C0Z A;  4F17 A;  2E5Q A;  3JCM W;  1GFD A;  4C92 C;  1WQ7 A;  2DTO A;  5GAM e;  2JTF A;  2O9S A;  4XAX B;  5HK3 A;  2VGM A;  3EG9 A;  4LDV A;  1YJN T;  1PD1 A; 
#chains in the Genus database with same CATH homology
 3R6N A;  5EC7 A;  2I0N A;  1UUE A;  2EQI A;  1BBZ A;  4LNP A;  1N5Z A;  1YWO A;  3REA B;  4K11 A;  1WYX A;  1NLP C;  2CDT A;  2OAW A;  2L2P A;  1VA7 A;  5I11 A;  5L23 A;  2FG0 A;  1TG0 A;  1K9A A;  4J9H A;  1WX6 A;  2PNI A;  3U23 A;  1K0X A;  2DNU A;  4Z88 A;  2A36 A;  3I5R A;  2AK5 A;  1RI9 A;  1T0H A;  2KRS A;  2LQW A;  1CSK A;  1SRM A;  1AWX A;  2BZX A;  1PKS A;  1SHF A;  2HDA A;  3THK A;  4Z89 A;  1M27 C;  2FPD A;  4Z8A A;  1SSH A;  1AZG B;  1UJ0 A;  2RPN A;  2J6F A;  2V1Q A;  2X3X D;  4RTT A;  3UAT A;  4OML A;  3EG2 A;  2SEM A;  2CT4 A;  2EBP A;  2ESW A;  4HCK A;  1AEY A;  1T0J A;  3I35 A;  2CH4 W;  1NG2 A;  1GCQ C;  2DA9 A;  4AFU C;  1GRI A;  2DRM A;  2DL3 A;  2W10 A;  3PE0 A;  1PNJ A;  2KRM A;  2XMF A;  3EGU A;  1AZE A;  2LMJ A;  1OPL A;  2A28 A;  2D8H A;  4LUE A;  2W0Z A;  2P4R A;  2FPF A;  2HEQ A;  3EG1 A;  5IXB A;  5FWC A;  4HVW A;  2GGR A;  4CC3 A;  1WXU A;  1ZSG A;  2CUD A;  2ED1 A;  2KGT A;  2LNH B;  4J9F A;  4F16 A;  1X6B A;  1GBR A;  2KRO A;  3VRZ A;  1U5S A;  2DLP A;  1S1N A;  1W1F A;  3LH5 A;  1JEG A;  4F14 A;  4GLM A;  4AFQ C;  4LE9 A;  4AG1 C;  3EHQ A;  2CH4 A;  2DRK A;  1K76 A;  1YCS B;  4HVV A;  1BU1 A;  2AZS A;  4R0K A;  5IHN A;  1JXO A;  4D8D A;  1JQQ A;  2EGC A;  2YDL A;  4QT7 A;  5IXF A;  1H8K A;  2CUB A;  2A08 A;  2JM8 A;  1E7O A;  1TUD A;  2FPE A;  4HVU A;  4AFS C;  4J9G A;  3I5S A;  1MV0 B;  2CSI A;  2LP5 A;  1KJW A;  2K2M A;  2A37 A;  4J9D A;  1QKX A;  3M0P A;  3RBB B;  1A0N B;  2J7I A;  1GCP A;  2YUP A;  1T3S A;  1YNZ A;  2BZ8 A;  4IIO A;  4A63 B;  1K0S A;  4LUD A;  4OMQ A;  1UFF A;  2DYB A;  3H0I A;  2JMA A;  2FRY A;  3NHN A;  2GTO A;  2NWM A;  2DVJ A;  1SEM A;  4RTW A;  2F2V A;  1NYF A;  2JMC A;  1LCK A;  1K4U S;  1UJY A;  2D8J A;  4KRT A;  2O88 A;  1VYV A;  1UHF A;  2YUQ A;  2YUO A;  1BB9 A;  2DX1 A;  2O31 A;  1VYT A;  2DL8 A;  4OMO A;  1Z9Z A;  2B86 A;  2JM9 A;  2M0Y A;  2KRN A;  1AD5 A;  1X27 A;  2ENM A;  2VWF A;  3I9Q A;  2EKH A;  2NUZ A;  2O9V A;  3NMZ C;  3EG3 A;  1AWO A;  4OMN A;  3TSZ A;  5IH2 A;  3CQT A;  2F2W A;  1WFW A;  1E6H A;  2H8H A;  2FO0 A;  2JTE A;  4WCI A;  1WA7 A;  2DL4 A;  3RNJ A;  4ZNX A;  5HCK A;  2EYX A;  5I22 A;  1PRM C;  2D1X A;  2JT4 A;  2PZ1 A;  1BK2 A;  3EHR A;  3UA6 A;  2ABL A;  2GBQ A;  3NGP A;  4J9C A;  4OMM A;  1HSQ A;  4FSS A;  1X43 A;  2DF6 A;  2KE9 A;  1SRL A;  3EG0 A;  2ROL A;  2J6O A;  3QWX X;  3VS6 A;  5IHK A;  2DL7 A;  2KBT A;  2KYB A;  3IQL A;  1FYN A;  1MUZ A;  2JS0 A;  1I07 A;  1YP5 A;  1ARK A;  2EYW A;  4RUG A;  1YN8 A;  1QCF A;  1B07 A;  1JO8 A;  1M3A A;  1I0C A;  3JV3 A;  4AG2 C;  1M8M A;  1UEC A;  1UE9 A;  2EPD A;  4RTX A;  1Y0M A;  2O2O A;  1X2K A;  3M0R A;  1X2Q A;  4RTU A;  3ULR B;  2ED0 A;  3M0U A;  2YSQ A;  2RQR A;  2RMO A;  1B3Q A;  2G6F X;  3KFV A;  2VVK A;  1ZX6 A;  4M4Z A;  1UG1 A;  4AFZ C;  2L3P A;  4RTY A;  5FW9 A;  2D0N A;  4RTZ A;  2MOX A;  2LCS A;  1U06 A;  2HBW A;  2RQW A;  1WDX A;  1W70 A;  1GCQ A;  2PTK A;  1Z9Q A;  1QWE A;  1RLP C;  2DJQ A;  2AKL A;  1EFN A;  2J05 A;  2ROT A;  2RQT A;  1NEB A;  3SEM A;  2HCK A;  2L3Q A;  1HD3 A;  1V1C A;  2YUN A;  1TUC A;  1PWT A;  4EIK A;  1Y57 A;  1M3C A;  2DBM A;  3H41 A;  1X69 A;  2LJ3 A;  2GTJ A;  2QDL A;  2SRC A;  4J9I A;  3VS4 A;  1QWF A;  2M51 A;  2KT1 A;  2EGE A;  3UA7 A;  1ZUK A;  1ZUU A;  1YWP A;  2K9G A;  2AZV A;  2EVR A;  1UHC A;  3VS5 A;  2EYY A;  4CC7 A;  4DEY A;  3VS2 A;  2J6K A;  1NM7 A;  5GJW B;  1W6X A;  1JU5 C;  4DEX A;  1J3T A;  3TSW A;  1E6G A;  1HJD A;  1FMK A;  2YT6 A;  1U3O A;  2C0T A;  4HXJ A;  1G2B A;  1H92 A;  2HSP A;  2C0O A;  4IIM A;  1ZLM A;  1XOV A;  4JJC A;  3PVQ A;  2RNA A;  4JJB A;  2LQN A;  2KXC A;  2FRW A;  2K3B A;  1ABO A;  1WIE A;  2BTT A;  1PRL C;  4CC2 A;  1AVZ C;  3VS1 A;  3QWY A;  1ABQ A;  1OV3 A;  2AKK A;  4J9B A;  2KYM A;  5ECA A;  2F2X A;  1UGV A;  2RF0 A;  2KR3 A;  2L0A A;  2VKN A;  1AWJ A;  4CC4 B;  2EGA A;  3ZL7 C;  1KSW A;  2DL5 A;  3SHW A;  4ESR A;  1X6G A;  2LJ0 A;  1KFZ A;  3M0S A;  4LN2 A;  1WI7 A;  1G83 A;  3VS0 A;  2ECZ A;  1M30 A;  3M0Q A;  3VS7 A;  1PKT A;  2DE0 X;  5GJV B;  2KXD A;  1MV3 A;  1WLP B;  1SHG A;  1RLQ C;  2CRE A;  3FJ5 A;  1GBQ A;  1T3L A;  2EYZ A;  1ZBJ A;  2JW4 A;  1QKW A;  1M3B A;  1GL5 A;  1NEG A;  2LZ6 B;  4JZ4 A;  1AWW A;  2DM1 A;  2J06 A;  1VYU A;  1NLO C;  1OOT A;  2K79 A;  2C0I A;  1IO6 A;  3GBQ A;  3NPF A;  4Y92 A;  1I1J A;  2CSQ A;  3O5Z A;  1WXB A;  1GFC A;  2EW3 A;  1ZUY A;  1NYG A;  2DIL A;  2GNC A;  4ORZ A;  3M0T A;  2OJ2 A;  2E5K A;  2CT3 A;  3REB B;  2V1R A;  2IIM A;  4JJD A;  4JPB W;  4E6R A;  1UTI A;  1OEB A;  4GBQ A;  5FWB A;  1KIK A;  2MCN A;  4J9E A;  2FEI A;  5IHI A;  2RQU A;  3VS3 A;  3UF4 A;  4X1V A;  2MIO A;  3VRY A;  1K1Z A;  2DBK A;  2GQI A;  2KT8 A;  2BZY A;  3C0C A;  1OPK A;  2KNB B;  4D8K A;  2K6D A;  2X3W D;  3A98 A;  1QLY A;  2KEA A;  2L3S A;  1JXM A;  1WXT A;  4JZ3 A;  1PHT A;  1SPK A;  1CKB A;  3H0H A;  4OMP A;  1H3H A;  2RN8 A;  1RUW A;  3H0F A;  2JS2 A;  2LJ1 A;  2DMO A;  2LX7 A;  3TVT A;  2OI3 A;  4F17 A;  2K7A A;  1GFD A;  1UDL A;  2RQV A;  1AOJ A;  1CKA A;  2JXB A;  2O9S A;  4RTV A;  3PVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...