2RQTA

Solution structure of the human ddef1 sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqtA00
2M0YA 1ARKA 2EYYA 2DL7A 1BBZA 1V1CA 2SEMA 2KNBB 1UFFA 2CSQA 4CC4B 4OMMA 1K1ZA 2FPFA 3VS6A 1UHFA 2MIOA 1AWJA 2EVRA 3H0FA 4J9BA 1FMKA 4J9IA 3REBB 3UF4A 1WI7A 1E7OA 1UDLA 1K9AA 2CH4W 3UATA 1UJ0A 1OEBA 3QWYA 3VS7A 2DL5A 2EBPA 2D8JA 3TSZA 1UE9A 4LNPA 1SHFA 2B86A 2DJQA 1NM7A 2ESWA 1NLPC 2PTKA 2CDTA 2HCKA 1AWWA 2YUNA 1RLPC 2DVJA 4J9HA 2YSQA 1YNZA 2XMFA 1YCSB 2M51A 2EPDA 1NG2A 2DBKA 1NEGA 3EHRA 2SRCA 5FW9A 2K9GA 2RQUA 3NMZC 5IHNA 2DA9A 4J9FA 4JJDA 4J9DA 2LMJA 3KFVA 2DLPA 4Z88A 2LX7A 1U3OA 3I5RA 3VRZA 1T3LA 2IIMA 4JJCA 2CH4A 3EG3A 2QDLA 1RI9A 4HVVA 4CC2A 4JPBW 2OI3A 1NYFA 2RPNA 3I35A 1WIEA 1M27C 4ORZA 2EW3A 4GLMA 3ULRB 1WYXA 1CKBA 4IIMA 1K76A 2G6FX 1YP5A 4LE9A 2BTTA 1X6GA 3PE0A 1PKTA 4LN2A 3I9QA 1HSQA 2YT6A 1ZSGA 1WFWA 2KXCA 1GBQA 2J05A 1AVZC 1GBRA 1A0NB 2DL8A 2RMOA 1GRIA 1ZBJA 1YWOA 2KEAA 1S1NA 1RUWA 2HSPA 3PVLA 2K6DA 1MUZA 2V1QA 2LQNA 4RTTA 5I11A 3M0RA 2LJ3A 1SSHA 4KRTA 2GNCA 3SEMA 1X27A 2EKHA 4AG1C 2LQWA 2YUQA 2BZXA 2CSIA 2JM8A 2KR3A 1TUDA 2X3WD 3EGUA 4CC3A 1PWTA 2L3SA 3IQLA 2AZVA 3M0QA 1AWOA 3U23A 1X43A 1PHTA 1YWPA 2DL3A 1K0XA 3THKA 1ZLMA 1W70A 1PKSA 5GJWB 4QT7A 4Z8AA 2JW4A 3CQTA 1OPKA 1TG0A 3PVQA 4AFZC 3RBBB 1M8MA 5HCKA 1JQQA 1VYTA 2KBTA 3UA6A 2CREA 2DILA 2L2PA 1SRLA 2FRYA 2ED0A 2L3QA 2DRKA 3VS4A 1QWEA 2JMAA 2DMOA 2RQVA 2ROTA 4RUGA 1AOJA 1XOVA 3M0TA 2A28A 2C0OA 4R0KA 2P4RA 2ED1A 2PZ1A 2EYXA 1I07A 1JU5C 1E6GA 5IHIA 1QLYA 3NHNA 1CKAA 1X2KA 4FSSA 1AD5A 2CUBA 3M0SA 1JXOA 2EGEA 2LNHB 2YUOA 1UUEA 1BB9A 3R6NA 1SPKA 5GJVB 4J9EA 1U06A 2J6KA 2DF6A 3O5ZA 1M3AA 2ABLA 4DEYA 1BK2A 3VS5A 2FG0A 2AKLA 1B07A 1UG1A 2K7AA 1X2QA 2CT3A 1I1JA 2E5KA 2X3XD 2OAWA 2L0AA 3VS2A 1E6HA 2O9VA 4AFUC 2FPDA 4OMNA 1WXBA 4F16A 3A98A 3FJ5A 4JZ3A 4A63B 2NUZA 1W6XA 3EG1A 3RNJA 2KRSA 1SRMA 4D8DA 1NEBA 1QCFA 4J9CA 1T0HA 1AZEA 2KT1A 2FEIA 2J6OA 1WXUA 1JXMA 3VS0A 4LUDA 1G2BA 1UTIA 2AK5A 2LJ1A 1GCQC 1G83A 2KE9A 4F17A 2LP5A 4F14A 1UHCA 3LH5A 4CC7A 2D8HA 5I22A 2VWFA 3ZL7C 4X1VA 2DYBA 1MV3A 1HD3A 4GBQA 2I0NA 3I5SA 2C0TA 3TVTA 1EFNA 1X69A 2VKNA 1J3TA 4AFQC 2DM1A 2NWMA 1HJDA 4D8KA 4RTUA 3VRYA 1ZUKA 1AEYA 5EC7A 1WXTA 2CUDA 1IO6A 2W10A 4WCIA 2LZ6B 2KYMA 1U5SA 2RQRA 2RNAA 4HXJA 1NYGA 2FPEA 4M4ZA 2O9SA 2ROLA 1GFCA 4J9GA 1KIKA 1H8KA 1ABQA 3VS1A 4ESRA 2W0ZA 2AZSA 1GCPA 4JJBA 2LCSA 4AFSC 2GTJA 1GCQA 4DEXA 1KJWA 1WA7A 4HCKA 1VYUA 3UA7A 2L3PA 1OPLA 2HBWA 3EG2A 4ZNXA 2MCNA 2OJ2A 2KROA 2RF0A 1PNJA 1ZUYA 1VA7A 1ZX6A 4LUEA 1YN8A 2VVKA 3VS3A 2A37A 2HEQA 2BZYA 2K79A 1Y57A 1X6BA 2RN8A 4AG2C 1K4US 2EYZA 1ZUUA 4RTZA 1WLPB 5FWCA 1RLQC 1UJYA 2DE0X 1OV3A 5IH2A 2ENMA 1AWXA 2D0NA 2D1XA 4HVWA 2LJ0A 5ECAA 1LCKA 3EHQA 2BZ8A 2GTOA 5IXBA 2A08A 2F2VA 2DBMA 1SHGA 2F2XA 2J06A 1GFDA 4RTWA 4OMOA 2A36A 2J7IA 1M3CA 1VYVA 1KFZA 2YDLA 1Z9ZA 2GQIA 4RTVA 1PRMC 1UGVA 2KRNA 4Z89A 1OOTA 1QKXA 2DL4A 5IXFA 1I0CA 3QWXX 2YUPA 1JEGA 2F2WA 3GBQA 2GBQA 2DNUA 1B3QA 2J6FA 2EYWA 1KSWA 4RTYA 2K2MA 4OMLA 2RQTA 2AKKA 3REAB 3EG0A 1NLOC 1M3BA 1WX6A 5L23A 1H3HA 2ECZA 1AZGB 1ABOA 2V1RA 1H92A 4JZ4A 2FO0A 4IIOA 4RTXA 2H8HA 1T3SA 4K11A 1W1FA 2PNIA 1TUCA 2JS2A 2FRWA 2O2OA 4OMPA 2C0IA 2EGAA 5FWBA 1T0JA 2EGCA 4EIKA 1FYNA 3H0IA 3M0UA 1QWFA 5IHKA 4OMQA 1GL5A 1SEMA 2MOXA 1N5ZA 2HDAA 2EQIA 3JV3A 4E6RA 1WDXA 1QKWA 3H0HA 2KT8A 2GGRA 1Z9QA 2JM9A 2O88A 2KGTA 3SHWA 2KXDA 3NPFA 1JO8A 1CSKA 4HVUA 2JS0A 2CT4A 1PRLC 2JTEA 1M30A 1Y0MA 2DRMA 2DX1A 3C0CA 2O31A 2JT4A 1K0SA 2JXBA 2RQWA 4Y92A 3TSWA 3M0PA 1BU1A 2KRMA 3NGPA 1MV0B 2K3BA 2KYBA 2JMCA 1UECA 3H41A
chains in the Genus database with same CATH superfamily
2HMAA 3OA6A 1ARKA 3A8HB 2HKNA 3SFMA 1M9SA 5KH6A 1G3TA 1VQ4Q 3QSUA 4CC4B 5C0MA 4OMMA 2FPFA 5KYXB 5KYNA 3EFRA 3H0FA 4MDXA 2MK5A 2GFAA 3HRTA 1WI7A 1E7OA 1KQ1A 4C92D 3JCMW 2DKGA 1UE9A 4LNPA 2ATCB 2B86A 2DJQA 1NLPC 2CP6A 2RHUA 2HCKA 2K4YA 2ZAEA 4J9HA 1K73R 1AHJB 2DIQA 3RERA 2XD0A 4PKCC 1NG2A 1NEGA 3QBYA 4M78A 5GANh 3S3OA 1HYOA 1WJSA 4M75D 5FU6C 4BUGA 4C8QF 2L3RA 8ATCB 4JJDA 4NL2A 2DEQA 2KI7A 2CZ1B 4Z88A 1U3OA 1T3LA 4JJCA 1QMCA 2CH4A 3INZA 1YJ9T 2QDLA 4XU1A 4JPBW 2RPNA 4FW2A 3JCMb 4EDUA 4BB7A 1M2VA 4R55A 5EG2A 3CMEA 3OYEA 4N0AA 5GAN6 5LJ3j 1I8FA 4GLMA 5LJ3f 4IIMA 1D09B 2VASA 1FWZA 5FROA 3G4SA 2G6FX 3MKDA 4LE9A 4JLGA 4LDWA 1PKTA 3SB2A 2P0QA 3L2QA 2K5LA 3EH2A 1MNDA 2YT6A 3LX7A 1WQ7A 1ZSGA 1GBQA 1HXDA 4A4EA 3QO3A 2DZ9A 4M78G 1YWOA 1ZBJA 4L6V5 1S1NA 3X26B 2MWPA 2K6DA 2RH2A 5GANd 1VQLA 1MUZA 2V1QA 3OBWA 3L2WA 1NE8A 3ER0A 3PMTA 5I11A 4PJOB 3JB9I 2LQKA 2M1HA 2LT1A 3FC3A 4IUVA 1X27A 2EKHA 2JM8A 2KR3A 3LH0A 3ZBDA 2X3WD 5AYFA 3H9NA 1BI3A 4QW2A 2RB6A 1X43A 2QEXQ 3THKA 4ZTJA 4FM4B 1W70A 1N8RR 2VC8A 4C8QA 4J7IA 4QT7A 4Z8AA 4F7UF 2A3LA 2JW4A 2QG9B 1M90C 4ZN1A 2IVWA 2V26A 3EGDA 1LOJA 5GMKl 3E19A 2DK3A 1VUBA 1QWEA 2DMOA 2RQVA 2WSCE 3X25B 2ROTA 2LCCA 3OYFA 2VUBA 3M0TA 2C0OA 4R0KA 4M77C 2CZ0B 2QA4T 1QLYA 1CKAA 3OYCA 2XDDA 5CIUA 1JB0E 1WQWA 2RO0A 4XTZA 3OYHA 3RIRA 3DLMA 2WACA 2RJDA 3J7AF 3OYGA 1BK2A 5HK3A 4M7AA 1UG1A 1U1SA 1VQ7A 1X2QA 2E5KA 4KULA 1OI1A 1Q86U 4M78E 3L42A 1E6HA 1BI2A 3VKIA 4AFUC 2XDPA 1WXBA 3P8HA 1YIJA 3CCSA 2DIGA 1W6XA 1YI2Q 1RAFB 2E65A 3RNJA 2KRSA 5M9OA 5C6SA 1IXDA 2J6OA 1JXMA 5KCOA 3VS0A 1G2BA 1TU0B 2V8JA 3JCMc 1G83A 3BDUA 1OU8A 1JJ2S 2LP5A 2NUTB 3M56A 3CPWA 3V7SA 5KYYA 3DLLA 2VWFA 1Y71A 3ZL7C 2CKKA 4C5EA 2CGHA 3CCJQ 5AT1B 2VXEA 4M7AG 1EFNA 2Y90A 3FB9A 5CQXA 4DBRA 3JCMQ 2ZPGB 4AFQC 5LL6S 2DERA 2JZ2A 2RD1A 2Y4YA 1BIBA 3A8LB 2OTLT 4RTUA 3VRYA 1M2OA 2X35A 4C5IA 5EC7A 4BI8B 2CUDA 1IO6A 1VQ5T 1WZOA 2GCXA 1U5SA 2JTMA 2RQRA 2AIRB 2FPEA 1UEBA 5KE3A 5CO7A 1NJIU 4M77F 4M78B 1H8KA 3X20B 1Q95G 2LDMA 1W2BP 2DFUA 2EQJA 4ZGDB 3R6OA 2AZSA 2EKOA 2CYZB 2QTXA 1GCQA 1VQNQ 1KJWA 3CCQA 1VYUA 5GAOm 3JB9G 4V2SA 4M7DE 4QVDA 1YITT 4ZNXA 3EG2A 3CCVQ 2PVGB 2O4XB 1ZUYA 2K5IA 1PSFA 3VS3A 1M2VB 2FVUA 3J80E 5GANg 2RN8A 4BDZA 2NLUA 2RHIA 2E41A 2EYZA 4RTZA 4IKFA 1I5LA 1YJNQ 2ENMA 4HVWA 1QQJA 4E7JA 1MMNA 1I81A 2GTOA 5IXBA 1QCNA 1D1CA 2F2VA 3CCLA 1SHGA 3G6EQ 2DTOA 3E1SA 2J7IA 1M3CA 2JJ9A 3MP1A 5CR2A 2HBPA 4RG2A 4M7AE 3HFNA 1V76A 4BACA 4RTVA 1UGVA 3BDLA 2P4TA 2KRNA 4XU2A 5LJ3d 1OOTA 3MCAB 2DL4A 3QWXX 3S3NA 3FIFA 4FT4A 5KYXA 2GBQA 1VIEA 3MJXA 2F5TX 4AT1B 4RTYA 3OW2P 5GMKi 3OS2A 2XG8D 3EG0A 1UGPB 1WX6A 1H3HA 2ECZA 5GANe 2V1RA 3HKSA 5GAOn 4M7DB 2FO0A 1T3SA 1M1KC 1W1FA 4IUTA 3MEVA 5FRNA 4N4GA 2EGAA 5FWBA 3CMET 1NPRA 1VQKQ 3CCUA 2DEUA 3OYBA 4XK8E 1SF9A 3H0IA 5HK0A 1GL5A 3T9NA 2HSEB 4C8QD 1Q7YR 3CCRA 2EQIA 1YHQQ 5FLXE 1WDXA 2DVEA 1QKWA 3VYHB 2YLBA 3H0HA 4F04B 2EAYA 2JTFA 5J3BA 4MDWA 1Z9QA 2O88A 1WHGA 3FJPA 1QP3A 4ELZC 1CSKA 1Y07A 1C6VX 2BE7D 4HVUA 2PU9B 2JTEA 1Y0MA 4M7AB 1VQLT 2O31A 4FSXA 1K0SA 4M78C 2JXBA 1BU1A 3M53A 2XIDA 3EGXB 4IUQA 2M0YA 2WSFE 3CMAQ 2EYYA 2DL7A 1S72A 1K9MU 2BIVA 7AT1B 2EQUA 2YRDA 2FZKB 1UGQB 3VS6A 3QXEB 1OX8A 4PLIA 4J9IA 3REBB 4N0AC 1PSEA 1WJRA 1K9AA 2Z0WA 1OU9A 1SSFA 1OEBA 3QWYA 1VQPA 3EG9B 3HFOA 2VGMA 3CBMA 1VQOQ 4PJOA 2EYQA 1HK9A 2ESWA 5A0DA 1VQ6Q 2P84A 4ME7A 4PL6A 1BKBA 3SWNB 3JCMV 1K8AR 2M51A 1M90R 4FYYB 2DBKA 3OYNA 1D3BB 2QQAA 3UPUA 3EHRA 3OY9A 2SRCA 3QYHB 2K9GA 2RQUA 4KBMB 3NMZC 4II1A 2RJEA 4LDXA 2GQVA 1M8VA 4C0GA 2LMJA 3GLXA 1Q82C 1VQ7T 4HT9A 1YJWA 2FB7A 4HVVA 3OYYA 3PTAA 2EWNA 4CC2A 1NYFA 2P0PA 3I35A 3MP8A 3CCST 2D9TA 1WIEA 1M27C 3JCMg 3OQ5A 4ZN3A 3ULRB 1WYXA 3JRZA 1QVGA 1K76A 1BI0A 3A8MB 1D0YA 4JDSA 4PJOG 4E7LA 3PE0A 4M78F 3JCMJ 4LN2A 1K73U 2DXCA 4C0FA 2R5MA 1N9RA 4KH0B 2J05A 2L89A 3CPWS 1AVZC 1GBRA 2RMOA 4BE0A 4R56A 3CD6A 1N27A 3L2UA 2ZPIB 5KE2A 5KCHA 1N6AA 2DD5A 4BD3A 1Q86C 1KC8U 3JCMX 5A0LA 2QEXT 3M0RA 2HD0A 3DKMA 2LJ3A 1FXXA 4Z02A 3CCMQ 2GNCA 3SEMA 4M7AC 4AG1C 2BZXA 2CSIA 3F70A 4WTOB 3ZFJA 3I55A 4CC3A 2L3SA 3DB4A 2AZVA 1MMGA 1YWPA 1Y96B 2NUTA 1LNXA 1K0XA 1ZLMA 2IG0A 3H6ZA 5GJWB 3QYGB 1OPKA 3RBBB 5HCKA 1JQQA 1VYTA 2KBTA 2DILA 2L2PA 4PJJA 3CCQT 1ZSZB 2A7YA 2JMAA 4OB2B 4IUPA 5GAOq 5LJ3e 2ED1A 2PZ1A 2QK0A 1KD1R 1DJ7B 3VJPA 5IN1A 3JB9H 1JU5C 4C5GA 3NHNA 3M5AA 2CUBA 2E6ZA 3M0SA 2EGEA 2LNHB 4M77D 2YUOA 3PGGA 5GMKm 4PJOE 1MMAA 4E7HA 2R57A 2DF6A 2E10A 1YI2T 1D0XA 1B07A 5D6XA 3LLRA 3JCMf 1BYMA 3CCLT 2E5QA 2L0AA 4PK4A 2O9VA 2FPDA 3OSSC 1N8RU 4KT0E 1KQSA 4JZ3A 2O4XA 3L1AA 5L8RE 2OTJA 5I2SA 1NEBA 2RI5A 4Q5WA 2DAQA 4J9CA 2FZCB 2VXFA 1AZEA 2FEIA 1VQ9Q 1IHVA 2E1HA 1WXUA 4EMKB 3GIBA 1UTIA 2DTHA 3OS5A 1MHNA 1GCQC 2COYA 2EIFA 3CC7Q 3O8VA 1LJOA 4F17A 4IURA 4DQ2A 4M7AF 1V29B 4VUBA 1ZQ1A 4ZGJB 5CAIA 4EMGA 5GAN5 3LH5A 2RI3A 3QIIA 4FIBA 5D7UA 1JJ2P 3EFSA 3HRSA 4C0DB 2DYBA 4J6WA 4GBQA 3I5SA 3TVTA 1VQ4A 3CCEQ 3CCUT 1YIJQ 2HQXA 3CC2T 4PLLA 4MZPA 2RM4A 4A53A 1PM3A 4P5NA 4D8KA 3Q1JA 3CCRT 1M1KR 1AEYA 3CC4Q 4OGCA 4OP0A 8AT1B 1NYGA 2O9SA 1VQ8Q 3JB9F 4LDVA 4J9GA 1KIKA 5DLQE 3VS1A 3LYIA 1MNEA 4M7DA 2KY9A 4KUIA 3HP9A 2W0ZA 4OB0B 3RMSA 4JJNK 1WHJA 3BY7A 4ANJA 1OPLA 2MCNA 1G3SA 4X9DA 4E7IA 1AT1B 1PNJA 2RF0A 5LJ5h 3G71Q 4LUEA 3NTKA 2A37A 2ZPFB 4AG2C 1Y57A 1X6BA 3NTHA 1WGSA 1VQMQ 3N5BB 3PFSA 1WLPB 1S72T 9ATCB 2DE0X 2ZPBB 2LJ0A 5ECAA 2MWOA 3EHQA 2F5KA 2A08A 3WVDB 2P0KA 3P8DA 4BI3A 3CXCA 2K2VA 2F2XA 2J06A 1VQPT 4HKEA 4Y91A 3OYIA 4B6MA 4ELYC 2LNVA 5GAMh 1KFZA 4RMOA 3EGXA 4M7DG 2HL3A 1Z9ZA 2GQIA 4PFOA 2LC4A 4Z89A 2KMTA 1VOMA 3HRUA 4QQGA 2ZGWA 2YUPA 4OF1A 2F2WA 1FX7A 2J6FA 1K9MC 1KSWA 1KK7A 2K2MA 4OMLA 4X9CA 4GLKA 1KHCA 3REAB 1VQKT 3ME9A 2D0QB 5L23A 2COWA 5HKCA 3QHSA 3EG9A 1RAAB 3OB9A 1H92A 1YJWT 4K11A 4E2FB 2YWWA 2O2OA 4OMPA 4L59A 1Q81C 3MP6A 1T0JA 2MF2A 2X4JA 2PUKB 3SWNA 1QVGS 1IB8A 1RAHB 2QEXA 1YJ9Q 1O75A 1QWFA 4OMQA 1Q82R 1D3BA 2MOXA 3JV3A 4E6RA 4DOVA 4KGXB 3TREA 3JCMh 2QDYB 2XICA 2KT8A 2GGRA 4LXCA 4PJOC 4CRIA 2KGTA 3A5ZB 4FU6A 2JS0A 3CD6T 3EH1A 4E7KA 3CEYA 3CMAT 1PRLC 3HTRA 1IRXA 2DX1A 4FYVB 4O5VA 2JT4A 4Y92A 1I5OB 3PMIA 2KRMA 4J83A 5I21A 2AT1B 4M78D 4ZGEB 1U8RA 2K3BA 3TQ7P 1UECA 1OX9A 2X4XA 2CS7A 3UDCA 4XTYA 3I55T 1Q86R 1BBZA 1G8XA 1UFFA 2CSQA 1UHFA 2MIOA 3QZ5B 3OMCA 4TVRA 2EVRA 3H8ZA 1Q7YU 1FMKA 1KG1A 1JBMA 3MO8A 1TWBA 1YI2A 2CH4W 5J39A 3UATA 2E3IA 3VS7A 1I4K1 2EBPA 3JCMd 3TSZA 5A0GA 1SHFA 2ZCFB 1KC8C 2QXFA 1NM7A 5CK9A 2CDTA 3E9GA 1QVFA 4OB1B 2YUNA 1RLPC 3V8JA 1YNZA 3WVEB 2XMFA 1YCSB 2HNIA 2KSSA 4E7SA 4JRPA 2R58A 5FW9A 5IHNA 1Y96A 2DA9A 4J9FA 3QJYA 1P92A 1RADB 2QA4Q 3CCJA 1WHLA 3KFVA 2DLPA 1R77A 3I5RA 2OAUA 1IGQA 2IIMA 1D1AA 2QQRA 5CKEA 3EG3A 3OS0A 2M0OA 1RI9A 1KQSS 1ZSZA 2RJFA 4PJLA 4PJOF 3CBPA 5GMKh 3X28B 1U1TA 1M5Q1 3TU4K 4ORZA 3VYGA 2OTJT 2DPPB 2EW3A 1CKBA 3I56Q 3E9FA 2LT4A 3CC2A 2CP5A 5KYUB 2JUFA 1HSQA 2KVQG 2JNGA 1K8AU 1WFWA 1M90U 1BIAA 2DXTA 1VQNA 2CP0A 3NTIA 4A54A 3LGFA 5DLOA 2HL5C 4M75A 2EFIA 2O01E 1GRIA 2M9UA 3CCVA 2DO3A 1RL2A 2HSPA 3PVLA 3CPWP 2E70A 1PD1A 5LJ5g 2LQNA 3HHTB 4RTTA 3RKWA 5J26A 4X34A 1MGQA 4BE2A 1VQ4T 1YJNA 2F1LA 4EMKA 3EGUA 1TUDA 2NUPB 4C92G 5GAOl 3IQLA 3HL8A 4GY5A 4UC4A 4M7AD 4AMCA 3VUBA 3G6EA 3OS1A 4OGEA 1AWOA 3GOXA 1RABB 2HKQB 3V7CA 2OX7A 2OTLQ 1BCMA 1M1GA 1TG0A 4AFZC 1VQ5Q 3OBYA 2QQSA 5GAMg 3RKXA 4DBQA 3OYDA 2RJCA 1C0MA 2FRYA 3VS4A 4M75G 4QQDA 1KHIA 2A28A 1WHMA 2EYXA 1I07A 1E6GA 5IHIA 4FSSA 4WF2A 3AHUA 2VV5A 3LWIA 1YITQ 3JB9D 1JXOA 2K5FA 1UUEA 1BB9A 2LTOA 2R5AA 1SPKA 1U06A 3LGLA 2YXYA 2ABLA 4E47A 1VIFA 3VS5A 4KUDK 2FG0A 5I2MA 2YLCA 2QAZA 3CXCS 1VQKA 1QCOA 2CT3A 4F7UB 3VS2A 4OMNA 4F16A 1XQHA 2KQWA 3A98A 3FJ5A 4A4HA 3GF5A 4A63B 1YHQA 3V7RA 4MMLA 2QGGA 3ZEHA 1SRMA 1QVFP 3L2RA 1QCFA 1WNLA 4N4IA 1EX4A 3DB3A 1B34B 2KT1A 5CKHA 4BY6B 4M7DC 2D6FA 3PNWC 1ZA2B 1H641 4C92E 4KH1B 4MZMA 2AK5A 1KD1U 2LJ1A 2CP2A 1OZ2A 5HY6A 3HSBA 5LJ5j 5LJ5f 3ASKA 2LQ8A 2VB6A 4F14A 4CC7A 4HT8A 3HPWA 5FU7B 3JCMP 3CMAA 5CCAA 4XTWA 1RAEB 1VQ8T 4M75E 4BI4A 1X01A 1X69A 2XKOC 1J3TA 2E4HA 1G5VA 1TOVA 2DM1A 2NWMA 2PUOB 1HJDA 4LD9K 2GFUA 3CMEQ 4N4HA 5GAMj 1WXTA 2EJ9A 4WCIA 2ZPHB 5GAMf 1Q81R 4PNOA 2RNAA 3OYMA 3G4SQ 4M4ZA 1VQOA 2DZCA 3QZ9B 1GFCA 4J6YA 3JCMe 1VQ6A 4XAXB 4JJBA 2LCSA 4A4GA 2PVOB 4AFSC 2A0FB 2X51A 4HCBA 1WA7A 4HCKA 3UA7A 1ZHIA 1H3ZA 2HBWA 4MZTA 2OJ2A 5CKFA 2KK4A 2KROA 3PT9A 1O9SA 1VA7A 1ZX6A 1YN8A 3OYAA 3JSCA 1NZ9A 2YRCA 4C92B 1VQLQ 2RK1A 2K79A 1K4US 4KGVB 1RLQC 1UJYA 1OV3A 5IH2A 2FL7A 3M54A 1AWXA 2D0NA 4JS5A 2LVMA 1LCKA 1M1KU 2BZ8A 2EJGA 3SWNC 2V8KA 1ZA1B 1TUGB 2DBMA 4M7DF 4M77B 3L2ZA 2H3JA 3SD4A 5DM7R 1NJIC 2VGNA 1QW1A 5IT9E 4OMOA 4M75B 2B8AA 1VYVA 2DETA 1QVFS 1YBYA 4OB3B 1PRMC 4XU0A 4B9WA 2AHJB 1R0BG 1QKXA 5IXFA 4ZTFA 4DOWA 1C1AA 3M4GA 3C12A 1KC8R 2DNUA 2EYWA 1TS9A 2WSEE 3BFMA 2AKKA 4YTLA 1NLOC 3CCJT 2EQMA 4BY6C 1M3BA 4JS4A 1Q7YC 4J8OA 2DD4A 3S3MA 1ACMB 2QYZA 4JZ4A 4IIOA 3CCMA 2H8HA 1EIFA 4FYWB 2PNIA 2FRWA 2C0IA 2HQHA 2RK2A 3RR6A 3L2VA 2LCLA 1VQ7Q 5GAN4 3META 2EGCA 3BE3A 3WXMB 4LDYA 5KYWB 3M0UA 5FU7C 1FMWA 2DJZA 4DBFA 2HDAA 4FT2A 5GMKe 3CCSQ 1IZ6A 4JRQA 1QVGP 3MPUB 2V8IA 4A4FA 1W2BA 3QJ6A 2COZA 2H3EB 4OVAA 1VQNT 2KXDA 3NPFA 5GAOr 2BE9B 4PJOD 4XTUA 3CCVT 2CT4A 1FMVA 2DRMA 3E2UA 3KBGA 1NBEB 2JVVA 4CI0C 3PIOA 5GAN2 3NFCA 5CKDA 4XTXA 3TSWA 1MV0B 2E3HA 1YJNT 2KYBA 3H41A 4XQ3A 2CZ6B 4J5YA 5KYUA 3SDZA 1V1CA 2HAXA 2E12A 2SEMA 4XTVA 2KNBB 1ZSZC 5GMKj 3G6ET 1K1ZA 1Q82U 3KXTA 4C92C 1AWJA 2DYIA 1K8AC 4J9BA 1X75C 3C4SA 3UF4A 4J6XA 1UDLA 2YRVA 2RHXA 3M4YA 2ZZDA 1UJ0A 2DL5A 1G3YA 2L8DA 2D8JA 1R0CB 2K3YA 1VQ9A 4A4KA 2PTKA 2PQWA 4FW1A 1TXQA 3V8KA 1AWWA 1OYXA 2DVJA 2JOYA 3CC7A 1UGSB 4RG8A 2YSQA 2I2LA 4NL3A 2NUPA 5GAN7 4M75C 2EPDA 3OW2A 3CCQQ 2VYTA 3G1JA 3MEAA 3FEOA 1Y7XA 3FRNA 2HZYA 4O6JA 4J9DA 3I56T 1SKUB 5LJ5d 3CCEA 2LX7A 3VRZA 4EMKC 3FLGA 4C8QG 2M02A 2OI3A 1LPLA 3TCJA 1YHQT 3D7SB 3CC4A 4HCCA 3MHXA 3CCLQ 1TH7A 1NPPA 5GAN8 1KQSP 4J7FA 2L5QA 1RI0A 2BUDA 1VQ8A 3QKJA 1YP5A 2BTTA 1X6GA 2QTVA 4C0DC 3CPFA 3I9QA 2KXCA 5GAMd 1D0ZA 4PFPA 1A0NB 3C95A 2DL8A 1RAGB 3A8GB 4FYXB 2X4YA 4F7UA 1LVKA 2QASA 2KEAA 1RUWA 3G71A 4PFZA 1JRIA 5D6WA 1VQMA 4C92F 2ZPEB 1WJQA 1BI1A 5D6YA 1SSHA 1R8OB 6AT1B 4KRTA 1B34A 2LQWA 2Y4XA 2YUQA 4QQ6A 4IUUA 3LWHA 1PWTA 2X4WA 3RESA 1XNIA 1RAIB 3M0QA 3CCUQ 3U23A 3CC2Q 1YFNA 1PHTA 2DL3A 3M9QA 1KD1C 1WPYA 1VQOT 3G7ZA 4B9XA 1OULA 1PKSA 5LJ3h 4M75F 3CCRQ 1K73C 3GP8A 3CQTA 3PVQA 1X6OA 1OZ3A 1M8MA 1VQ6T 2RI2A 3UA6A 2CREA 3MEUA 4C8QE 1SRLA 4MMKA 2ED0A 2L3QA 1PD0A 1EZZB 2DRKA 3TEEA 4RUGA 4JRIA 3VUZA 4F7UG 1AOJA 1XOVA 1IHWA 2XI9A 2P4RA 3QDFA 1QVPA 4RKUE 1N9SA 3RKYA 1X2KA 1AD5A 4PJMA 2XDBA 3R6NA 4BDYA 5GJVB 4J9EA 3A1PA 3M57A 2EQKA 1PCXA 2J6KA 3O5ZA 1M3AA 4DEYA 3RDVA 4QVZA 1TTHB 2AKLA 4HCZA 1S72Q 2K7AA 1I1JA 3UT1A 1M4ZA 2KAFA 2X3XD 2OAWA 2XHCA 1YJ9A 1QP2A 3EFOA 2DXUA 3CXCP 3MEWA 3FDRA 1BCOA 3OSVA 2NUZA 3GNFB 3V8LA 3EG1A 2MYSA 4FL6A 4C92A 4D8DA 1VQPQ 2CZ7B 1T0HA 1RACB 4E7ZA 1GXIE 1OQKA 1PG5B 1NJIR 4PJNA 4LUDA 5FRMA 3OYKA 2RA2A 3EAEA 4M7DD 2KE9A 3S6WA 4LDUA 4C0ZA 2JN0A 2X9HA 1F1BB 4M77A 1KQ2A 2QQ9A 4C8QB 1UHCA 3RMQA 3P8BB 2D8HA 5I22A 3JAME 4L5GA 3CCMT 3GNGA 4X1VA 1MV3A 4JRKA 3CBOA 3EGDB 1ZBXA 2QQBA 4OMFB 5CKBA 3X24B 4BE1A 1HD3A 4Y28E 2I0NA 2C0TA 3G4ST 3VV0A 2K57A 2VKNA 4F7UE 2M16A 1N8RC 1YJWQ 3QG1A 3JB9J 4C5HA 1ZUKA 1UB4A 1W2BS 4FCYA 2W10A 2FHDA 2LZ6B 2KYMA 4HXJA 1UGRB 1YCYA 2ROLA 2QGFB 1ABQA 5GANj 4D6WA 4ESRA 1XTDA 3OMGA 5GANf 1MMDA 5DY9A 3LW5E 1GCPA 3QPHA 1WHHA 2NYSA 2GTJA 4DEXA 2CP7A 2RHZA 4M77G 2L3PA 4QVCA 4JUVA 2HQEA 4DBHA 3OYLA 3CD6Q 3GPLA 1PC0A 5KYWA 2FYKA 2VVKA 3KUFA 2QA4A 2HEQA 2BZYA 2C06A 1W4SA 1ZUUA 4NOYA 5FWCA 2YHTA 2LX9A 3OYJA 2D1XA 5GAOp 5CQYA 5LJ5e 4JLIA 1B7TA 3I55Q 4DA4A 3AT1B 1Q81U 5KYYB 1IGUA 4RCCA 2CP3A 5GAN3 1GFDA 3I56A 4RTWA 2FZGB 2A36A 5A2QE 1VQ9T 2MMPA 2YDLA 4ATOA 2PVDB 1TSFA 5FU6B 1SG5A 3CC7T 3VU3C 3OW2S 1I0CA 2DXBA 4RCBA 1JEGA 2EJFA 3GBQA 5GAMe 3PIPA 1B3QA 1M1FA 2IPOB 3QUIA 3J81E 3UWNA 2K3XA 1G3WA 2RQTA 4HA8A 1JJ2A 2GF7A 1AZGB 1ABOA 3CCET 3C94A 3BW1A 1YIJT 2KDSA 4NS5A 4RTXA 2E6NA 1TUCA 1IREB 2MPXC 2JS2A 1D1BA 1WHKA 2BKDN 4QKUA 2XK0A 4C8QC 5CVIA 4M77E 3CC4T 4EMHA 4XU3A 1K9MR 4EIKA 1FYNA 2DTIA 1XJWB 5IHKA 2QI2A 3M59A 1SEMA 1N5ZA 2OTLA 3M55A 2MAMA 3A8OB 4EPCA 1VQ5A 2OTJQ 5LJ3g 3URGA 2JM9A 3SHWA 1JO8A 3RUXA 2F69A 4KGZB 3G71T 4LD6A 1M30A 3C0CA 2RQWA 1VQMT 3M58A 3M0PA 3QDRB 2E64A 1YITA 2MI6A 3NGPA 3EFOB 5IAYA 2XU8A 2G3RA 2RHYA 2JMCA 2LRQA
chains in the Genus database with same CATH topology
2M0YA 1ARKA 2EYYA 2DL7A 1BBZA 1V1CA 2SEMA 2KNBB 1UFFA 2CSQA 4CC4B 4OMMA 1K1ZA 2FPFA 3VS6A 1UHFA 2MIOA 1AWJA 2EVRA 3H0FA 4J9BA 1FMKA 4J9IA 3REBB 3UF4A 1WI7A 1E7OA 1UDLA 1K9AA 2CH4W 3UATA 1UJ0A 1OEBA 3QWYA 3VS7A 2DL5A 2EBPA 2D8JA 3TSZA 1UE9A 4LNPA 1SHFA 2B86A 2DJQA 1NM7A 2ESWA 1NLPC 2PTKA 2CDTA 2HCKA 1AWWA 2YUNA 1RLPC 2DVJA 4J9HA 2YSQA 1YNZA 2XMFA 1YCSB 2M51A 2EPDA 1NG2A 2DBKA 1NEGA 3EHRA 2SRCA 5FW9A 2K9GA 2RQUA 3NMZC 5IHNA 2DA9A 4J9FA 4JJDA 4J9DA 2LMJA 3KFVA 2DLPA 4Z88A 2LX7A 1U3OA 3I5RA 3VRZA 1T3LA 2IIMA 4JJCA 2CH4A 3EG3A 2QDLA 1RI9A 4HVVA 4CC2A 4JPBW 2OI3A 1NYFA 2RPNA 3I35A 1WIEA 1M27C 4ORZA 2EW3A 4GLMA 3ULRB 1WYXA 1CKBA 4IIMA 1K76A 2G6FX 1YP5A 4LE9A 2BTTA 1X6GA 3PE0A 1PKTA 4LN2A 3I9QA 1HSQA 2YT6A 1ZSGA 1WFWA 2KXCA 1GBQA 2J05A 1AVZC 1GBRA 1A0NB 2DL8A 2RMOA 1GRIA 1ZBJA 1YWOA 2KEAA 1S1NA 1RUWA 2HSPA 3PVLA 2K6DA 1MUZA 2V1QA 2LQNA 4RTTA 5I11A 3M0RA 2LJ3A 1SSHA 4KRTA 2GNCA 3SEMA 1X27A 2EKHA 4AG1C 2LQWA 2YUQA 2BZXA 2CSIA 2JM8A 2KR3A 1TUDA 2X3WD 3EGUA 4CC3A 1PWTA 2L3SA 3IQLA 2AZVA 3M0QA 1AWOA 3U23A 1X43A 1PHTA 1YWPA 2DL3A 1K0XA 3THKA 1ZLMA 1W70A 1PKSA 5GJWB 4QT7A 4Z8AA 2JW4A 3CQTA 1OPKA 1TG0A 3PVQA 4AFZC 3RBBB 1M8MA 5HCKA 1JQQA 1VYTA 2KBTA 3UA6A 2CREA 2DILA 2L2PA 1SRLA 2FRYA 2ED0A 2L3QA 2DRKA 3VS4A 1QWEA 2JMAA 2DMOA 2RQVA 2ROTA 4RUGA 1AOJA 1XOVA 3M0TA 2A28A 2C0OA 4R0KA 2P4RA 2ED1A 2PZ1A 2EYXA 1I07A 1JU5C 1E6GA 5IHIA 1QLYA 3NHNA 1CKAA 1X2KA 4FSSA 1AD5A 2CUBA 3M0SA 1JXOA 2EGEA 2LNHB 2YUOA 1UUEA 1BB9A 3R6NA 1SPKA 5GJVB 4J9EA 1U06A 2J6KA 2DF6A 3O5ZA 1M3AA 2ABLA 4DEYA 1BK2A 3VS5A 2FG0A 2AKLA 1B07A 1UG1A 2K7AA 1X2QA 2CT3A 1I1JA 2E5KA 2X3XD 2OAWA 2L0AA 3VS2A 1E6HA 2O9VA 4AFUC 2FPDA 4OMNA 1WXBA 4F16A 3A98A 3FJ5A 4JZ3A 4A63B 2NUZA 1W6XA 3EG1A 3RNJA 2KRSA 1SRMA 4D8DA 1NEBA 1QCFA 4J9CA 1T0HA 1AZEA 2KT1A 2FEIA 2J6OA 1WXUA 1JXMA 3VS0A 4LUDA 1G2BA 1UTIA 2AK5A 2LJ1A 1GCQC 1G83A 2KE9A 4F17A 2LP5A 4F14A 1UHCA 3LH5A 4CC7A 2D8HA 5I22A 2VWFA 3ZL7C 4X1VA 2DYBA 1MV3A 1HD3A 4GBQA 2I0NA 3I5SA 2C0TA 3TVTA 1EFNA 1X69A 2VKNA 1J3TA 4AFQC 2DM1A 2NWMA 1HJDA 4D8KA 4RTUA 3VRYA 1ZUKA 1AEYA 5EC7A 1WXTA 2CUDA 1IO6A 2W10A 4WCIA 2LZ6B 2KYMA 1U5SA 2RQRA 2RNAA 4HXJA 1NYGA 2FPEA 4M4ZA 2O9SA 2ROLA 1GFCA 4J9GA 1KIKA 1H8KA 1ABQA 3VS1A 4ESRA 2W0ZA 2AZSA 1GCPA 4JJBA 2LCSA 4AFSC 2GTJA 1GCQA 4DEXA 1KJWA 1WA7A 4HCKA 1VYUA 3UA7A 2L3PA 1OPLA 2HBWA 3EG2A 4ZNXA 2MCNA 2OJ2A 2KROA 2RF0A 1PNJA 1ZUYA 1VA7A 1ZX6A 4LUEA 1YN8A 2VVKA 3VS3A 2A37A 2HEQA 2BZYA 2K79A 1Y57A 1X6BA 2RN8A 4AG2C 1K4US 2EYZA 1ZUUA 4RTZA 1WLPB 5FWCA 1RLQC 1UJYA 2DE0X 1OV3A 5IH2A 2ENMA 1AWXA 2D0NA 2D1XA 4HVWA 2LJ0A 5ECAA 1LCKA 3EHQA 2BZ8A 2GTOA 5IXBA 2A08A 2F2VA 2DBMA 1SHGA 2F2XA 2J06A 1GFDA 4RTWA 4OMOA 2A36A 2J7IA 1M3CA 1VYVA 1KFZA 2YDLA 1Z9ZA 2GQIA 4RTVA 1PRMC 1UGVA 2KRNA 4Z89A 1OOTA 1QKXA 2DL4A 5IXFA 1I0CA 3QWXX 2YUPA 1JEGA 2F2WA 3GBQA 2GBQA 2DNUA 1B3QA 2J6FA 2EYWA 1KSWA 4RTYA 2K2MA 4OMLA 2RQTA 2AKKA 3REAB 3EG0A 1NLOC 1M3BA 1WX6A 5L23A 1H3HA 2ECZA 1AZGB 1ABOA 2V1RA 1H92A 4JZ4A 2FO0A 4IIOA 4RTXA 2H8HA 1T3SA 4K11A 1W1FA 2PNIA 1TUCA 2JS2A 2FRWA 2O2OA 4OMPA 2C0IA 2EGAA 5FWBA 1T0JA 2EGCA 4EIKA 1FYNA 3H0IA 3M0UA 1QWFA 5IHKA 4OMQA 1GL5A 1SEMA 2MOXA 1N5ZA 2HDAA 2EQIA 3JV3A 4E6RA 1WDXA 1QKWA 3H0HA 2KT8A 2GGRA 1Z9QA 2JM9A 2O88A 2KGTA 3SHWA 2KXDA 3NPFA 1JO8A 1CSKA 4HVUA 2JS0A 2CT4A 1PRLC 2JTEA 1M30A 1Y0MA 2DRMA 2DX1A 3C0CA 2O31A 2JT4A 1K0SA 2JXBA 2RQWA 4Y92A 3TSWA 3M0PA 1BU1A 2KRMA 3NGPA 1MV0B 2K3BA 2KYBA 2JMCA 1UECA 3H41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0Y A;  1ARK A;  2EYY A;  2DL7 A;  1BBZ A;  1V1C A;  2SEM A;  2KNB B;  1UFF A;  2CSQ A;  4CC4 B;  4OMM A;  1K1Z A;  2FPF A;  3VS6 A;  1UHF A;  2MIO A;  1AWJ A;  2EVR A;  3H0F A;  4J9B A;  1FMK A;  4J9I A;  3REB B;  3UF4 A;  1WI7 A;  1E7O A;  1UDL A;  1K9A A;  2CH4 W;  3UAT A;  1UJ0 A;  1OEB A;  3QWY A;  3VS7 A;  2DL5 A;  2EBP A;  2D8J A;  3TSZ A;  1UE9 A;  4LNP A;  1SHF A;  2B86 A;  2DJQ A;  1NM7 A;  2ESW A;  1NLP C;  2PTK A;  2CDT A;  2HCK A;  1AWW A;  2YUN A;  1RLP C;  2DVJ A;  4J9H A;  2YSQ A;  1YNZ A;  2XMF A;  1YCS B;  2M51 A;  2EPD A;  1NG2 A;  2DBK A;  1NEG A;  3EHR A;  2SRC A;  5FW9 A;  2K9G A;  2RQU A;  3NMZ C;  5IHN A;  2DA9 A;  4J9F A;  4JJD A;  4J9D A;  2LMJ A;  3KFV A;  2DLP A;  4Z88 A;  2LX7 A;  1U3O A;  3I5R A;  3VRZ A;  1T3L A;  2IIM A;  4JJC A;  2CH4 A;  3EG3 A;  2QDL A;  1RI9 A;  4HVV A;  4CC2 A;  4JPB W;  2OI3 A;  1NYF A;  2RPN A;  3I35 A;  1WIE A;  1M27 C;  4ORZ A;  2EW3 A;  4GLM A;  3ULR B;  1WYX A;  1CKB A;  4IIM A;  1K76 A;  2G6F X;  1YP5 A;  4LE9 A;  2BTT A;  1X6G A;  3PE0 A;  1PKT A;  4LN2 A;  3I9Q A;  1HSQ A;  2YT6 A;  1ZSG A;  1WFW A;  2KXC A;  1GBQ A;  2J05 A;  1AVZ C;  1GBR A;  1A0N B;  2DL8 A;  2RMO A;  1GRI A;  1ZBJ A;  1YWO A;  2KEA A;  1S1N A;  1RUW A;  2HSP A;  3PVL A;  2K6D A;  1MUZ A;  2V1Q A;  2LQN A;  4RTT A;  5I11 A;  3M0R A;  2LJ3 A;  1SSH A;  4KRT A;  2GNC A;  3SEM A;  1X27 A;  2EKH A;  4AG1 C;  2LQW A;  2YUQ A;  2BZX A;  2CSI A;  2JM8 A;  2KR3 A;  1TUD A;  2X3W D;  3EGU A;  4CC3 A;  1PWT A;  2L3S A;  3IQL A;  2AZV A;  3M0Q A;  1AWO A;  3U23 A;  1X43 A;  1PHT A;  1YWP A;  2DL3 A;  1K0X A;  3THK A;  1ZLM A;  1W70 A;  1PKS A;  5GJW B;  4QT7 A;  4Z8A A;  2JW4 A;  3CQT A;  1OPK A;  1TG0 A;  3PVQ A;  4AFZ C;  3RBB B;  1M8M A;  5HCK A;  1JQQ A;  1VYT A;  2KBT A;  3UA6 A;  2CRE A;  2DIL A;  2L2P A;  1SRL A;  2FRY A;  2ED0 A;  2L3Q A;  2DRK A;  3VS4 A;  1QWE A;  2JMA A;  2DMO A;  2RQV A;  2ROT A;  4RUG A;  1AOJ A;  1XOV A;  3M0T A;  2A28 A;  2C0O A;  4R0K A;  2P4R A;  2ED1 A;  2PZ1 A;  2EYX A;  1I07 A;  1JU5 C;  1E6G A;  5IHI A;  1QLY A;  3NHN A;  1CKA A;  1X2K A;  4FSS A;  1AD5 A;  2CUB A;  3M0S A;  1JXO A;  2EGE A;  2LNH B;  2YUO A;  1UUE A;  1BB9 A;  3R6N A;  1SPK A;  5GJV B;  4J9E A;  1U06 A;  2J6K A;  2DF6 A;  3O5Z A;  1M3A A;  2ABL A;  4DEY A;  1BK2 A;  3VS5 A;  2FG0 A;  2AKL A;  1B07 A;  1UG1 A;  2K7A A;  1X2Q A;  2CT3 A;  1I1J A;  2E5K A;  2X3X D;  2OAW A;  2L0A A;  3VS2 A;  1E6H A;  2O9V A;  4AFU C;  2FPD A;  4OMN A;  1WXB A;  4F16 A;  3A98 A;  3FJ5 A;  4JZ3 A;  4A63 B;  2NUZ A;  1W6X A;  3EG1 A;  3RNJ A;  2KRS A;  1SRM A;  4D8D A;  1NEB A;  1QCF A;  4J9C A;  1T0H A;  1AZE A;  2KT1 A;  2FEI A;  2J6O A;  1WXU A;  1JXM A;  3VS0 A;  4LUD A;  1G2B A;  1UTI A;  2AK5 A;  2LJ1 A;  1GCQ C;  1G83 A;  2KE9 A;  4F17 A;  2LP5 A;  4F14 A;  1UHC A;  3LH5 A;  4CC7 A;  2D8H A;  5I22 A;  2VWF A;  3ZL7 C;  4X1V A;  2DYB A;  1MV3 A;  1HD3 A;  4GBQ A;  2I0N A;  3I5S A;  2C0T A;  3TVT A;  1EFN A;  1X69 A;  2VKN A;  1J3T A;  4AFQ C;  2DM1 A;  2NWM A;  1HJD A;  4D8K A;  4RTU A;  3VRY A;  1ZUK A;  1AEY A;  5EC7 A;  1WXT A;  2CUD A;  1IO6 A;  2W10 A;  4WCI A;  2LZ6 B;  2KYM A;  1U5S A;  2RQR A;  2RNA A;  4HXJ A;  1NYG A;  2FPE A;  4M4Z A;  2O9S A;  2ROL A;  1GFC A;  4J9G A;  1KIK A;  1H8K A;  1ABQ A;  3VS1 A;  4ESR A;  2W0Z A;  2AZS A;  1GCP A;  4JJB A;  2LCS A;  4AFS C;  2GTJ A;  1GCQ A;  4DEX A;  1KJW A;  1WA7 A;  4HCK A;  1VYU A;  3UA7 A;  2L3P A;  1OPL A;  2HBW A;  3EG2 A;  4ZNX A;  2MCN A;  2OJ2 A;  2KRO A;  2RF0 A;  1PNJ A;  1ZUY A;  1VA7 A;  1ZX6 A;  4LUE A;  1YN8 A;  2VVK A;  3VS3 A;  2A37 A;  2HEQ A;  2BZY A;  2K79 A;  1Y57 A;  1X6B A;  2RN8 A;  4AG2 C;  1K4U S;  2EYZ A;  1ZUU A;  4RTZ A;  1WLP B;  5FWC A;  1RLQ C;  1UJY A;  2DE0 X;  1OV3 A;  5IH2 A;  2ENM A;  1AWX A;  2D0N A;  2D1X A;  4HVW A;  2LJ0 A;  5ECA A;  1LCK A;  3EHQ A;  2BZ8 A;  2GTO A;  5IXB A;  2A08 A;  2F2V A;  2DBM A;  1SHG A;  2F2X A;  2J06 A;  1GFD A;  4RTW A;  4OMO A;  2A36 A;  2J7I A;  1M3C A;  1VYV A;  1KFZ A;  2YDL A;  1Z9Z A;  2GQI A;  4RTV A;  1PRM C;  1UGV A;  2KRN A;  4Z89 A;  1OOT A;  1QKX A;  2DL4 A;  5IXF A;  1I0C A;  3QWX X;  2YUP A;  1JEG A;  2F2W A;  3GBQ A;  2GBQ A;  2DNU A;  1B3Q A;  2J6F A;  2EYW A;  1KSW A;  4RTY A;  2K2M A;  4OML A;  2RQT A;  2AKK A;  3REA B;  3EG0 A;  1NLO C;  1M3B A;  1WX6 A;  5L23 A;  1H3H A;  2ECZ A;  1AZG B;  1ABO A;  2V1R A;  1H92 A;  4JZ4 A;  2FO0 A;  4IIO A;  4RTX A;  2H8H A;  1T3S A;  4K11 A;  1W1F A;  2PNI A;  1TUC A;  2JS2 A;  2FRW A;  2O2O A;  4OMP A;  2C0I A;  2EGA A;  5FWB A;  1T0J A;  2EGC A;  4EIK A;  1FYN A;  3H0I A;  3M0U A;  1QWF A;  5IHK A;  4OMQ A;  1GL5 A;  1SEM A;  2MOX A;  1N5Z A;  2HDA A;  2EQI A;  3JV3 A;  4E6R A;  1WDX A;  1QKW A;  3H0H A;  2KT8 A;  2GGR A;  1Z9Q A;  2JM9 A;  2O88 A;  2KGT A;  3SHW A;  2KXD A;  3NPF A;  1JO8 A;  1CSK A;  4HVU A;  2JS0 A;  2CT4 A;  1PRL C;  2JTE A;  1M30 A;  1Y0M A;  2DRM A;  2DX1 A;  3C0C A;  2O31 A;  2JT4 A;  1K0S A;  2JXB A;  2RQW A;  4Y92 A;  3TSW A;  3M0P A;  1BU1 A;  2KRM A;  3NGP A;  1MV0 B;  2K3B A;  2KYB A;  2JMC A;  1UEC A;  3H41 A; 
#chains in the Genus database with same CATH topology
 2HMA A;  3OA6 A;  1ARK A;  3A8H B;  2HKN A;  3SFM A;  1M9S A;  5KH6 A;  1G3T A;  1VQ4 Q;  3QSU A;  4CC4 B;  5C0M A;  4OMM A;  2FPF A;  5KYX B;  5KYN A;  3EFR A;  3H0F A;  4MDX A;  2MK5 A;  2GFA A;  3HRT A;  1WI7 A;  1E7O A;  1KQ1 A;  4C92 D;  3JCM W;  2DKG A;  1UE9 A;  4LNP A;  2ATC B;  2B86 A;  2DJQ A;  1NLP C;  2CP6 A;  2RHU A;  2HCK A;  2K4Y A;  2ZAE A;  4J9H A;  1K73 R;  1AHJ B;  2DIQ A;  3RER A;  2XD0 A;  4PKC C;  1NG2 A;  1NEG A;  3QBY A;  4M78 A;  5GAN h;  3S3O A;  1HYO A;  1WJS A;  4M75 D;  5FU6 C;  4BUG A;  4C8Q F;  2L3R A;  8ATC B;  4JJD A;  4NL2 A;  2DEQ A;  2KI7 A;  2CZ1 B;  4Z88 A;  1U3O A;  1T3L A;  4JJC A;  1QMC A;  2CH4 A;  3INZ A;  1YJ9 T;  2QDL A;  4XU1 A;  4JPB W;  2RPN A;  4FW2 A;  3JCM b;  4EDU A;  4BB7 A;  1M2V A;  4R55 A;  5EG2 A;  3CME A;  3OYE A;  4N0A A;  5GAN 6;  5LJ3 j;  1I8F A;  4GLM A;  5LJ3 f;  4IIM A;  1D09 B;  2VAS A;  1FWZ A;  5FRO A;  3G4S A;  2G6F X;  3MKD A;  4LE9 A;  4JLG A;  4LDW A;  1PKT A;  3SB2 A;  2P0Q A;  3L2Q A;  2K5L A;  3EH2 A;  1MND A;  2YT6 A;  3LX7 A;  1WQ7 A;  1ZSG A;  1GBQ A;  1HXD A;  4A4E A;  3QO3 A;  2DZ9 A;  4M78 G;  1YWO A;  1ZBJ A;  4L6V 5;  1S1N A;  3X26 B;  2MWP A;  2K6D A;  2RH2 A;  5GAN d;  1VQL A;  1MUZ A;  2V1Q A;  3OBW A;  3L2W A;  1NE8 A;  3ER0 A;  3PMT A;  5I11 A;  4PJO B;  3JB9 I;  2LQK A;  2M1H A;  2LT1 A;  3FC3 A;  4IUV A;  1X27 A;  2EKH A;  2JM8 A;  2KR3 A;  3LH0 A;  3ZBD A;  2X3W D;  5AYF A;  3H9N A;  1BI3 A;  4QW2 A;  2RB6 A;  1X43 A;  2QEX Q;  3THK A;  4ZTJ A;  4FM4 B;  1W70 A;  1N8R R;  2VC8 A;  4C8Q A;  4J7I A;  4QT7 A;  4Z8A A;  4F7U F;  2A3L A;  2JW4 A;  2QG9 B;  1M90 C;  4ZN1 A;  2IVW A;  2V26 A;  3EGD A;  1LOJ A;  5GMK l;  3E19 A;  2DK3 A;  1VUB A;  1QWE A;  2DMO A;  2RQV A;  2WSC E;  3X25 B;  2ROT A;  2LCC A;  3OYF A;  2VUB A;  3M0T A;  2C0O A;  4R0K A;  4M77 C;  2CZ0 B;  2QA4 T;  1QLY A;  1CKA A;  3OYC A;  2XDD A;  5CIU A;  1JB0 E;  1WQW A;  2RO0 A;  4XTZ A;  3OYH A;  3RIR A;  3DLM A;  2WAC A;  2RJD A;  3J7A F;  3OYG A;  1BK2 A;  5HK3 A;  4M7A A;  1UG1 A;  1U1S A;  1VQ7 A;  1X2Q A;  2E5K A;  4KUL A;  1OI1 A;  1Q86 U;  4M78 E;  3L42 A;  1E6H A;  1BI2 A;  3VKI A;  4AFU C;  2XDP A;  1WXB A;  3P8H A;  1YIJ A;  3CCS A;  2DIG A;  1W6X A;  1YI2 Q;  1RAF B;  2E65 A;  3RNJ A;  2KRS A;  5M9O A;  5C6S A;  1IXD A;  2J6O A;  1JXM A;  5KCO A;  3VS0 A;  1G2B A;  1TU0 B;  2V8J A;  3JCM c;  1G83 A;  3BDU A;  1OU8 A;  1JJ2 S;  2LP5 A;  2NUT B;  3M56 A;  3CPW A;  3V7S A;  5KYY A;  3DLL A;  2VWF A;  1Y71 A;  3ZL7 C;  2CKK A;  4C5E A;  2CGH A;  3CCJ Q;  5AT1 B;  2VXE A;  4M7A G;  1EFN A;  2Y90 A;  3FB9 A;  5CQX A;  4DBR A;  3JCM Q;  2ZPG B;  4AFQ C;  5LL6 S;  2DER A;  2JZ2 A;  2RD1 A;  2Y4Y A;  1BIB A;  3A8L B;  2OTL T;  4RTU A;  3VRY A;  1M2O A;  2X35 A;  4C5I A;  5EC7 A;  4BI8 B;  2CUD A;  1IO6 A;  1VQ5 T;  1WZO A;  2GCX A;  1U5S A;  2JTM A;  2RQR A;  2AIR B;  2FPE A;  1UEB A;  5KE3 A;  5CO7 A;  1NJI U;  4M77 F;  4M78 B;  1H8K A;  3X20 B;  1Q95 G;  2LDM A;  1W2B P;  2DFU A;  2EQJ A;  4ZGD B;  3R6O A;  2AZS A;  2EKO A;  2CYZ B;  2QTX A;  1GCQ A;  1VQN Q;  1KJW A;  3CCQ A;  1VYU A;  5GAO m;  3JB9 G;  4V2S A;  4M7D E;  4QVD A;  1YIT T;  4ZNX A;  3EG2 A;  3CCV Q;  2PVG B;  2O4X B;  1ZUY A;  2K5I A;  1PSF A;  3VS3 A;  1M2V B;  2FVU A;  3J80 E;  5GAN g;  2RN8 A;  4BDZ A;  2NLU A;  2RHI A;  2E41 A;  2EYZ A;  4RTZ A;  4IKF A;  1I5L A;  1YJN Q;  2ENM A;  4HVW A;  1QQJ A;  4E7J A;  1MMN A;  1I81 A;  2GTO A;  5IXB A;  1QCN A;  1D1C A;  2F2V A;  3CCL A;  1SHG A;  3G6E Q;  2DTO A;  3E1S A;  2J7I A;  1M3C A;  2JJ9 A;  3MP1 A;  5CR2 A;  2HBP A;  4RG2 A;  4M7A E;  3HFN A;  1V76 A;  4BAC A;  4RTV A;  1UGV A;  3BDL A;  2P4T A;  2KRN A;  4XU2 A;  5LJ3 d;  1OOT A;  3MCA B;  2DL4 A;  3QWX X;  3S3N A;  3FIF A;  4FT4 A;  5KYX A;  2GBQ A;  1VIE A;  3MJX A;  2F5T X;  4AT1 B;  4RTY A;  3OW2 P;  5GMK i;  3OS2 A;  2XG8 D;  3EG0 A;  1UGP B;  1WX6 A;  1H3H A;  2ECZ A;  5GAN e;  2V1R A;  3HKS A;  5GAO n;  4M7D B;  2FO0 A;  1T3S A;  1M1K C;  1W1F A;  4IUT A;  3MEV A;  5FRN A;  4N4G A;  2EGA A;  5FWB A;  3CME T;  1NPR A;  1VQK Q;  3CCU A;  2DEU A;  3OYB A;  4XK8 E;  1SF9 A;  3H0I A;  5HK0 A;  1GL5 A;  3T9N A;  2HSE B;  4C8Q D;  1Q7Y R;  3CCR A;  2EQI A;  1YHQ Q;  5FLX E;  1WDX A;  2DVE A;  1QKW A;  3VYH B;  2YLB A;  3H0H A;  4F04 B;  2EAY A;  2JTF A;  5J3B A;  4MDW A;  1Z9Q A;  2O88 A;  1WHG A;  3FJP A;  1QP3 A;  4ELZ C;  1CSK A;  1Y07 A;  1C6V X;  2BE7 D;  4HVU A;  2PU9 B;  2JTE A;  1Y0M A;  4M7A B;  1VQL T;  2O31 A;  4FSX A;  1K0S A;  4M78 C;  2JXB A;  1BU1 A;  3M53 A;  2XID A;  3EGX B;  4IUQ A;  2M0Y A;  2WSF E;  3CMA Q;  2EYY A;  2DL7 A;  1S72 A;  1K9M U;  2BIV A;  7AT1 B;  2EQU A;  2YRD A;  2FZK B;  1UGQ B;  3VS6 A;  3QXE B;  1OX8 A;  4PLI A;  4J9I A;  3REB B;  4N0A C;  1PSE A;  1WJR A;  1K9A A;  2Z0W A;  1OU9 A;  1SSF A;  1OEB A;  3QWY A;  1VQP A;  3EG9 B;  3HFO A;  2VGM A;  3CBM A;  1VQO Q;  4PJO A;  2EYQ A;  1HK9 A;  2ESW A;  5A0D A;  1VQ6 Q;  2P84 A;  4ME7 A;  4PL6 A;  1BKB A;  3SWN B;  3JCM V;  1K8A R;  2M51 A;  1M90 R;  4FYY B;  2DBK A;  3OYN A;  1D3B B;  2QQA A;  3UPU A;  3EHR A;  3OY9 A;  2SRC A;  3QYH B;  2K9G A;  2RQU A;  4KBM B;  3NMZ C;  4II1 A;  2RJE A;  4LDX A;  2GQV A;  1M8V A;  4C0G A;  2LMJ A;  3GLX A;  1Q82 C;  1VQ7 T;  4HT9 A;  1YJW A;  2FB7 A;  4HVV A;  3OYY A;  3PTA A;  2EWN A;  4CC2 A;  1NYF A;  2P0P A;  3I35 A;  3MP8 A;  3CCS T;  2D9T A;  1WIE A;  1M27 C;  3JCM g;  3OQ5 A;  4ZN3 A;  3ULR B;  1WYX A;  3JRZ A;  1QVG A;  1K76 A;  1BI0 A;  3A8M B;  1D0Y A;  4JDS A;  4PJO G;  4E7L A;  3PE0 A;  4M78 F;  3JCM J;  4LN2 A;  1K73 U;  2DXC A;  4C0F A;  2R5M A;  1N9R A;  4KH0 B;  2J05 A;  2L89 A;  3CPW S;  1AVZ C;  1GBR A;  2RMO A;  4BE0 A;  4R56 A;  3CD6 A;  1N27 A;  3L2U A;  2ZPI B;  5KE2 A;  5KCH A;  1N6A A;  2DD5 A;  4BD3 A;  1Q86 C;  1KC8 U;  3JCM X;  5A0L A;  2QEX T;  3M0R A;  2HD0 A;  3DKM A;  2LJ3 A;  1FXX A;  4Z02 A;  3CCM Q;  2GNC A;  3SEM A;  4M7A C;  4AG1 C;  2BZX A;  2CSI A;  3F70 A;  4WTO B;  3ZFJ A;  3I55 A;  4CC3 A;  2L3S A;  3DB4 A;  2AZV A;  1MMG A;  1YWP A;  1Y96 B;  2NUT A;  1LNX A;  1K0X A;  1ZLM A;  2IG0 A;  3H6Z A;  5GJW B;  3QYG B;  1OPK A;  3RBB B;  5HCK A;  1JQQ A;  1VYT A;  2KBT A;  2DIL A;  2L2P A;  4PJJ A;  3CCQ T;  1ZSZ B;  2A7Y A;  2JMA A;  4OB2 B;  4IUP A;  5GAO q;  5LJ3 e;  2ED1 A;  2PZ1 A;  2QK0 A;  1KD1 R;  1DJ7 B;  3VJP A;  5IN1 A;  3JB9 H;  1JU5 C;  4C5G A;  3NHN A;  3M5A A;  2CUB A;  2E6Z A;  3M0S A;  2EGE A;  2LNH B;  4M77 D;  2YUO A;  3PGG A;  5GMK m;  4PJO E;  1MMA A;  4E7H A;  2R57 A;  2DF6 A;  2E10 A;  1YI2 T;  1D0X A;  1B07 A;  5D6X A;  3LLR A;  3JCM f;  1BYM A;  3CCL T;  2E5Q A;  2L0A A;  4PK4 A;  2O9V A;  2FPD A;  3OSS C;  1N8R U;  4KT0 E;  1KQS A;  4JZ3 A;  2O4X A;  3L1A A;  5L8R E;  2OTJ A;  5I2S A;  1NEB A;  2RI5 A;  4Q5W A;  2DAQ A;  4J9C A;  2FZC B;  2VXF A;  1AZE A;  2FEI A;  1VQ9 Q;  1IHV A;  2E1H A;  1WXU A;  4EMK B;  3GIB A;  1UTI A;  2DTH A;  3OS5 A;  1MHN A;  1GCQ C;  2COY A;  2EIF A;  3CC7 Q;  3O8V A;  1LJO A;  4F17 A;  4IUR A;  4DQ2 A;  4M7A F;  1V29 B;  4VUB A;  1ZQ1 A;  4ZGJ B;  5CAI A;  4EMG A;  5GAN 5;  3LH5 A;  2RI3 A;  3QII A;  4FIB A;  5D7U A;  1JJ2 P;  3EFS A;  3HRS A;  4C0D B;  2DYB A;  4J6W A;  4GBQ A;  3I5S A;  3TVT A;  1VQ4 A;  3CCE Q;  3CCU T;  1YIJ Q;  2HQX A;  3CC2 T;  4PLL A;  4MZP A;  2RM4 A;  4A53 A;  1PM3 A;  4P5N A;  4D8K A;  3Q1J A;  3CCR T;  1M1K R;  1AEY A;  3CC4 Q;  4OGC A;  4OP0 A;  8AT1 B;  1NYG A;  2O9S A;  1VQ8 Q;  3JB9 F;  4LDV A;  4J9G A;  1KIK A;  5DLQ E;  3VS1 A;  3LYI A;  1MNE A;  4M7D A;  2KY9 A;  4KUI A;  3HP9 A;  2W0Z A;  4OB0 B;  3RMS A;  4JJN K;  1WHJ A;  3BY7 A;  4ANJ A;  1OPL A;  2MCN A;  1G3S A;  4X9D A;  4E7I A;  1AT1 B;  1PNJ A;  2RF0 A;  5LJ5 h;  3G71 Q;  4LUE A;  3NTK A;  2A37 A;  2ZPF B;  4AG2 C;  1Y57 A;  1X6B A;  3NTH A;  1WGS A;  1VQM Q;  3N5B B;  3PFS A;  1WLP B;  1S72 T;  9ATC B;  2DE0 X;  2ZPB B;  2LJ0 A;  5ECA A;  2MWO A;  3EHQ A;  2F5K A;  2A08 A;  3WVD B;  2P0K A;  3P8D A;  4BI3 A;  3CXC A;  2K2V A;  2F2X A;  2J06 A;  1VQP T;  4HKE A;  4Y91 A;  3OYI A;  4B6M A;  4ELY C;  2LNV A;  5GAM h;  1KFZ A;  4RMO A;  3EGX A;  4M7D G;  2HL3 A;  1Z9Z A;  2GQI A;  4PFO A;  2LC4 A;  4Z89 A;  2KMT A;  1VOM A;  3HRU A;  4QQG A;  2ZGW A;  2YUP A;  4OF1 A;  2F2W A;  1FX7 A;  2J6F A;  1K9M C;  1KSW A;  1KK7 A;  2K2M A;  4OML A;  4X9C A;  4GLK A;  1KHC A;  3REA B;  1VQK T;  3ME9 A;  2D0Q B;  5L23 A;  2COW A;  5HKC A;  3QHS A;  3EG9 A;  1RAA B;  3OB9 A;  1H92 A;  1YJW T;  4K11 A;  4E2F B;  2YWW A;  2O2O A;  4OMP A;  4L59 A;  1Q81 C;  3MP6 A;  1T0J A;  2MF2 A;  2X4J A;  2PUK B;  3SWN A;  1QVG S;  1IB8 A;  1RAH B;  2QEX A;  1YJ9 Q;  1O75 A;  1QWF A;  4OMQ A;  1Q82 R;  1D3B A;  2MOX A;  3JV3 A;  4E6R A;  4DOV A;  4KGX B;  3TRE A;  3JCM h;  2QDY B;  2XIC A;  2KT8 A;  2GGR A;  4LXC A;  4PJO C;  4CRI A;  2KGT A;  3A5Z B;  4FU6 A;  2JS0 A;  3CD6 T;  3EH1 A;  4E7K A;  3CEY A;  3CMA T;  1PRL C;  3HTR A;  1IRX A;  2DX1 A;  4FYV B;  4O5V A;  2JT4 A;  4Y92 A;  1I5O B;  3PMI A;  2KRM A;  4J83 A;  5I21 A;  2AT1 B;  4M78 D;  4ZGE B;  1U8R A;  2K3B A;  3TQ7 P;  1UEC A;  1OX9 A;  2X4X A;  2CS7 A;  3UDC A;  4XTY A;  3I55 T;  1Q86 R;  1BBZ A;  1G8X A;  1UFF A;  2CSQ A;  1UHF A;  2MIO A;  3QZ5 B;  3OMC A;  4TVR A;  2EVR A;  3H8Z A;  1Q7Y U;  1FMK A;  1KG1 A;  1JBM A;  3MO8 A;  1TWB A;  1YI2 A;  2CH4 W;  5J39 A;  3UAT A;  2E3I A;  3VS7 A;  1I4K 1;  2EBP A;  3JCM d;  3TSZ A;  5A0G A;  1SHF A;  2ZCF B;  1KC8 C;  2QXF A;  1NM7 A;  5CK9 A;  2CDT A;  3E9G A;  1QVF A;  4OB1 B;  2YUN A;  1RLP C;  3V8J A;  1YNZ A;  3WVE B;  2XMF A;  1YCS B;  2HNI A;  2KSS A;  4E7S A;  4JRP A;  2R58 A;  5FW9 A;  5IHN A;  1Y96 A;  2DA9 A;  4J9F A;  3QJY A;  1P92 A;  1RAD B;  2QA4 Q;  3CCJ A;  1WHL A;  3KFV A;  2DLP A;  1R77 A;  3I5R A;  2OAU A;  1IGQ A;  2IIM A;  1D1A A;  2QQR A;  5CKE A;  3EG3 A;  3OS0 A;  2M0O A;  1RI9 A;  1KQS S;  1ZSZ A;  2RJF A;  4PJL A;  4PJO F;  3CBP A;  5GMK h;  3X28 B;  1U1T A;  1M5Q 1;  3TU4 K;  4ORZ A;  3VYG A;  2OTJ T;  2DPP B;  2EW3 A;  1CKB A;  3I56 Q;  3E9F A;  2LT4 A;  3CC2 A;  2CP5 A;  5KYU B;  2JUF A;  1HSQ A;  2KVQ G;  2JNG A;  1K8A U;  1WFW A;  1M90 U;  1BIA A;  2DXT A;  1VQN A;  2CP0 A;  3NTI A;  4A54 A;  3LGF A;  5DLO A;  2HL5 C;  4M75 A;  2EFI A;  2O01 E;  1GRI A;  2M9U A;  3CCV A;  2DO3 A;  1RL2 A;  2HSP A;  3PVL A;  3CPW P;  2E70 A;  1PD1 A;  5LJ5 g;  2LQN A;  3HHT B;  4RTT A;  3RKW A;  5J26 A;  4X34 A;  1MGQ A;  4BE2 A;  1VQ4 T;  1YJN A;  2F1L A;  4EMK A;  3EGU A;  1TUD A;  2NUP B;  4C92 G;  5GAO l;  3IQL A;  3HL8 A;  4GY5 A;  4UC4 A;  4M7A D;  4AMC A;  3VUB A;  3G6E A;  3OS1 A;  4OGE A;  1AWO A;  3GOX A;  1RAB B;  2HKQ B;  3V7C A;  2OX7 A;  2OTL Q;  1BCM A;  1M1G A;  1TG0 A;  4AFZ C;  1VQ5 Q;  3OBY A;  2QQS A;  5GAM g;  3RKX A;  4DBQ A;  3OYD A;  2RJC A;  1C0M A;  2FRY A;  3VS4 A;  4M75 G;  4QQD A;  1KHI A;  2A28 A;  1WHM A;  2EYX A;  1I07 A;  1E6G A;  5IHI A;  4FSS A;  4WF2 A;  3AHU A;  2VV5 A;  3LWI A;  1YIT Q;  3JB9 D;  1JXO A;  2K5F A;  1UUE A;  1BB9 A;  2LTO A;  2R5A A;  1SPK A;  1U06 A;  3LGL A;  2YXY A;  2ABL A;  4E47 A;  1VIF A;  3VS5 A;  4KUD K;  2FG0 A;  5I2M A;  2YLC A;  2QAZ A;  3CXC S;  1VQK A;  1QCO A;  2CT3 A;  4F7U B;  3VS2 A;  4OMN A;  4F16 A;  1XQH A;  2KQW A;  3A98 A;  3FJ5 A;  4A4H A;  3GF5 A;  4A63 B;  1YHQ A;  3V7R A;  4MML A;  2QGG A;  3ZEH A;  1SRM A;  1QVF P;  3L2R A;  1QCF A;  1WNL A;  4N4I A;  1EX4 A;  3DB3 A;  1B34 B;  2KT1 A;  5CKH A;  4BY6 B;  4M7D C;  2D6F A;  3PNW C;  1ZA2 B;  1H64 1;  4C92 E;  4KH1 B;  4MZM A;  2AK5 A;  1KD1 U;  2LJ1 A;  2CP2 A;  1OZ2 A;  5HY6 A;  3HSB A;  5LJ5 j;  5LJ5 f;  3ASK A;  2LQ8 A;  2VB6 A;  4F14 A;  4CC7 A;  4HT8 A;  3HPW A;  5FU7 B;  3JCM P;  3CMA A;  5CCA A;  4XTW A;  1RAE B;  1VQ8 T;  4M75 E;  4BI4 A;  1X01 A;  1X69 A;  2XKO C;  1J3T A;  2E4H A;  1G5V A;  1TOV A;  2DM1 A;  2NWM A;  2PUO B;  1HJD A;  4LD9 K;  2GFU A;  3CME Q;  4N4H A;  5GAM j;  1WXT A;  2EJ9 A;  4WCI A;  2ZPH B;  5GAM f;  1Q81 R;  4PNO A;  2RNA A;  3OYM A;  3G4S Q;  4M4Z A;  1VQO A;  2DZC A;  3QZ9 B;  1GFC A;  4J6Y A;  3JCM e;  1VQ6 A;  4XAX B;  4JJB A;  2LCS A;  4A4G A;  2PVO B;  4AFS C;  2A0F B;  2X51 A;  4HCB A;  1WA7 A;  4HCK A;  3UA7 A;  1ZHI A;  1H3Z A;  2HBW A;  4MZT A;  2OJ2 A;  5CKF A;  2KK4 A;  2KRO A;  3PT9 A;  1O9S A;  1VA7 A;  1ZX6 A;  1YN8 A;  3OYA A;  3JSC A;  1NZ9 A;  2YRC A;  4C92 B;  1VQL Q;  2RK1 A;  2K79 A;  1K4U S;  4KGV B;  1RLQ C;  1UJY A;  1OV3 A;  5IH2 A;  2FL7 A;  3M54 A;  1AWX A;  2D0N A;  4JS5 A;  2LVM A;  1LCK A;  1M1K U;  2BZ8 A;  2EJG A;  3SWN C;  2V8K A;  1ZA1 B;  1TUG B;  2DBM A;  4M7D F;  4M77 B;  3L2Z A;  2H3J A;  3SD4 A;  5DM7 R;  1NJI C;  2VGN A;  1QW1 A;  5IT9 E;  4OMO A;  4M75 B;  2B8A A;  1VYV A;  2DET A;  1QVF S;  1YBY A;  4OB3 B;  1PRM C;  4XU0 A;  4B9W A;  2AHJ B;  1R0B G;  1QKX A;  5IXF A;  4ZTF A;  4DOW A;  1C1A A;  3M4G A;  3C12 A;  1KC8 R;  2DNU A;  2EYW A;  1TS9 A;  2WSE E;  3BFM A;  2AKK A;  4YTL A;  1NLO C;  3CCJ T;  2EQM A;  4BY6 C;  1M3B A;  4JS4 A;  1Q7Y C;  4J8O A;  2DD4 A;  3S3M A;  1ACM B;  2QYZ A;  4JZ4 A;  4IIO A;  3CCM A;  2H8H A;  1EIF A;  4FYW B;  2PNI A;  2FRW A;  2C0I A;  2HQH A;  2RK2 A;  3RR6 A;  3L2V A;  2LCL A;  1VQ7 Q;  5GAN 4;  3MET A;  2EGC A;  3BE3 A;  3WXM B;  4LDY A;  5KYW B;  3M0U A;  5FU7 C;  1FMW A;  2DJZ A;  4DBF A;  2HDA A;  4FT2 A;  5GMK e;  3CCS Q;  1IZ6 A;  4JRQ A;  1QVG P;  3MPU B;  2V8I A;  4A4F A;  1W2B A;  3QJ6 A;  2COZ A;  2H3E B;  4OVA A;  1VQN T;  2KXD A;  3NPF A;  5GAO r;  2BE9 B;  4PJO D;  4XTU A;  3CCV T;  2CT4 A;  1FMV A;  2DRM A;  3E2U A;  3KBG A;  1NBE B;  2JVV A;  4CI0 C;  3PIO A;  5GAN 2;  3NFC A;  5CKD A;  4XTX A;  3TSW A;  1MV0 B;  2E3H A;  1YJN T;  2KYB A;  3H41 A;  4XQ3 A;  2CZ6 B;  4J5Y A;  5KYU A;  3SDZ A;  1V1C A;  2HAX A;  2E12 A;  2SEM A;  4XTV A;  2KNB B;  1ZSZ C;  5GMK j;  3G6E T;  1K1Z A;  1Q82 U;  3KXT A;  4C92 C;  1AWJ A;  2DYI A;  1K8A C;  4J9B A;  1X75 C;  3C4S A;  3UF4 A;  4J6X A;  1UDL A;  2YRV A;  2RHX A;  3M4Y A;  2ZZD A;  1UJ0 A;  2DL5 A;  1G3Y A;  2L8D A;  2D8J A;  1R0C B;  2K3Y A;  1VQ9 A;  4A4K A;  2PTK A;  2PQW A;  4FW1 A;  1TXQ A;  3V8K A;  1AWW A;  1OYX A;  2DVJ A;  2JOY A;  3CC7 A;  1UGS B;  4RG8 A;  2YSQ A;  2I2L A;  4NL3 A;  2NUP A;  5GAN 7;  4M75 C;  2EPD A;  3OW2 A;  3CCQ Q;  2VYT A;  3G1J A;  3MEA A;  3FEO A;  1Y7X A;  3FRN A;  2HZY A;  4O6J A;  4J9D A;  3I56 T;  1SKU B;  5LJ5 d;  3CCE A;  2LX7 A;  3VRZ A;  4EMK C;  3FLG A;  4C8Q G;  2M02 A;  2OI3 A;  1LPL A;  3TCJ A;  1YHQ T;  3D7S B;  3CC4 A;  4HCC A;  3MHX A;  3CCL Q;  1TH7 A;  1NPP A;  5GAN 8;  1KQS P;  4J7F A;  2L5Q A;  1RI0 A;  2BUD A;  1VQ8 A;  3QKJ A;  1YP5 A;  2BTT A;  1X6G A;  2QTV A;  4C0D C;  3CPF A;  3I9Q A;  2KXC A;  5GAM d;  1D0Z A;  4PFP A;  1A0N B;  3C95 A;  2DL8 A;  1RAG B;  3A8G B;  4FYX B;  2X4Y A;  4F7U A;  1LVK A;  2QAS A;  2KEA A;  1RUW A;  3G71 A;  4PFZ A;  1JRI A;  5D6W A;  1VQM A;  4C92 F;  2ZPE B;  1WJQ A;  1BI1 A;  5D6Y A;  1SSH A;  1R8O B;  6AT1 B;  4KRT A;  1B34 A;  2LQW A;  2Y4X A;  2YUQ A;  4QQ6 A;  4IUU A;  3LWH A;  1PWT A;  2X4W A;  3RES A;  1XNI A;  1RAI B;  3M0Q A;  3CCU Q;  3U23 A;  3CC2 Q;  1YFN A;  1PHT A;  2DL3 A;  3M9Q A;  1KD1 C;  1WPY A;  1VQO T;  3G7Z A;  4B9X A;  1OUL A;  1PKS A;  5LJ3 h;  4M75 F;  3CCR Q;  1K73 C;  3GP8 A;  3CQT A;  3PVQ A;  1X6O A;  1OZ3 A;  1M8M A;  1VQ6 T;  2RI2 A;  3UA6 A;  2CRE A;  3MEU A;  4C8Q E;  1SRL A;  4MMK A;  2ED0 A;  2L3Q A;  1PD0 A;  1EZZ B;  2DRK A;  3TEE A;  4RUG A;  4JRI A;  3VUZ A;  4F7U G;  1AOJ A;  1XOV A;  1IHW A;  2XI9 A;  2P4R A;  3QDF A;  1QVP A;  4RKU E;  1N9S A;  3RKY A;  1X2K A;  1AD5 A;  4PJM A;  2XDB A;  3R6N A;  4BDY A;  5GJV B;  4J9E A;  3A1P A;  3M57 A;  2EQK A;  1PCX A;  2J6K A;  3O5Z A;  1M3A A;  4DEY A;  3RDV A;  4QVZ A;  1TTH B;  2AKL A;  4HCZ A;  1S72 Q;  2K7A A;  1I1J A;  3UT1 A;  1M4Z A;  2KAF A;  2X3X D;  2OAW A;  2XHC A;  1YJ9 A;  1QP2 A;  3EFO A;  2DXU A;  3CXC P;  3MEW A;  3FDR A;  1BCO A;  3OSV A;  2NUZ A;  3GNF B;  3V8L A;  3EG1 A;  2MYS A;  4FL6 A;  4C92 A;  4D8D A;  1VQP Q;  2CZ7 B;  1T0H A;  1RAC B;  4E7Z A;  1GXI E;  1OQK A;  1PG5 B;  1NJI R;  4PJN A;  4LUD A;  5FRM A;  3OYK A;  2RA2 A;  3EAE A;  4M7D D;  2KE9 A;  3S6W A;  4LDU A;  4C0Z A;  2JN0 A;  2X9H A;  1F1B B;  4M77 A;  1KQ2 A;  2QQ9 A;  4C8Q B;  1UHC A;  3RMQ A;  3P8B B;  2D8H A;  5I22 A;  3JAM E;  4L5G A;  3CCM T;  3GNG A;  4X1V A;  1MV3 A;  4JRK A;  3CBO A;  3EGD B;  1ZBX A;  2QQB A;  4OMF B;  5CKB A;  3X24 B;  4BE1 A;  1HD3 A;  4Y28 E;  2I0N A;  2C0T A;  3G4S T;  3VV0 A;  2K57 A;  2VKN A;  4F7U E;  2M16 A;  1N8R C;  1YJW Q;  3QG1 A;  3JB9 J;  4C5H A;  1ZUK A;  1UB4 A;  1W2B S;  4FCY A;  2W10 A;  2FHD A;  2LZ6 B;  2KYM A;  4HXJ A;  1UGR B;  1YCY A;  2ROL A;  2QGF B;  1ABQ A;  5GAN j;  4D6W A;  4ESR A;  1XTD A;  3OMG A;  5GAN f;  1MMD A;  5DY9 A;  3LW5 E;  1GCP A;  3QPH A;  1WHH A;  2NYS A;  2GTJ A;  4DEX A;  2CP7 A;  2RHZ A;  4M77 G;  2L3P A;  4QVC A;  4JUV A;  2HQE A;  4DBH A;  3OYL A;  3CD6 Q;  3GPL A;  1PC0 A;  5KYW A;  2FYK A;  2VVK A;  3KUF A;  2QA4 A;  2HEQ A;  2BZY A;  2C06 A;  1W4S A;  1ZUU A;  4NOY A;  5FWC A;  2YHT A;  2LX9 A;  3OYJ A;  2D1X A;  5GAO p;  5CQY A;  5LJ5 e;  4JLI A;  1B7T A;  3I55 Q;  4DA4 A;  3AT1 B;  1Q81 U;  5KYY B;  1IGU A;  4RCC A;  2CP3 A;  5GAN 3;  1GFD A;  3I56 A;  4RTW A;  2FZG B;  2A36 A;  5A2Q E;  1VQ9 T;  2MMP A;  2YDL A;  4ATO A;  2PVD B;  1TSF A;  5FU6 B;  1SG5 A;  3CC7 T;  3VU3 C;  3OW2 S;  1I0C A;  2DXB A;  4RCB A;  1JEG A;  2EJF A;  3GBQ A;  5GAM e;  3PIP A;  1B3Q A;  1M1F A;  2IPO B;  3QUI A;  3J81 E;  3UWN A;  2K3X A;  1G3W A;  2RQT A;  4HA8 A;  1JJ2 A;  2GF7 A;  1AZG B;  1ABO A;  3CCE T;  3C94 A;  3BW1 A;  1YIJ T;  2KDS A;  4NS5 A;  4RTX A;  2E6N A;  1TUC A;  1IRE B;  2MPX C;  2JS2 A;  1D1B A;  1WHK A;  2BKD N;  4QKU A;  2XK0 A;  4C8Q C;  5CVI A;  4M77 E;  3CC4 T;  4EMH A;  4XU3 A;  1K9M R;  4EIK A;  1FYN A;  2DTI A;  1XJW B;  5IHK A;  2QI2 A;  3M59 A;  1SEM A;  1N5Z A;  2OTL A;  3M55 A;  2MAM A;  3A8O B;  4EPC A;  1VQ5 A;  2OTJ Q;  5LJ3 g;  3URG A;  2JM9 A;  3SHW A;  1JO8 A;  3RUX A;  2F69 A;  4KGZ B;  3G71 T;  4LD6 A;  1M30 A;  3C0C A;  2RQW A;  1VQM T;  3M58 A;  3M0P A;  3QDR B;  2E64 A;  1YIT A;  2MI6 A;  3NGP A;  3EFO B;  5IAY A;  2XU8 A;  2G3R A;  2RHY A;  2JMC A;  2LRQ A; 
#chains in the Genus database with same CATH homology
 2M0Y A;  1ARK A;  2EYY A;  2DL7 A;  1BBZ A;  1V1C A;  2SEM A;  2KNB B;  1UFF A;  2CSQ A;  4CC4 B;  4OMM A;  1K1Z A;  2FPF A;  3VS6 A;  1UHF A;  2MIO A;  1AWJ A;  2EVR A;  3H0F A;  4J9B A;  1FMK A;  4J9I A;  3REB B;  3UF4 A;  1WI7 A;  1E7O A;  1UDL A;  1K9A A;  2CH4 W;  3UAT A;  1UJ0 A;  1OEB A;  3QWY A;  3VS7 A;  2DL5 A;  2EBP A;  2D8J A;  3TSZ A;  1UE9 A;  4LNP A;  1SHF A;  2B86 A;  2DJQ A;  1NM7 A;  2ESW A;  1NLP C;  2PTK A;  2CDT A;  2HCK A;  1AWW A;  2YUN A;  1RLP C;  2DVJ A;  4J9H A;  2YSQ A;  1YNZ A;  2XMF A;  1YCS B;  2M51 A;  2EPD A;  1NG2 A;  2DBK A;  1NEG A;  3EHR A;  2SRC A;  5FW9 A;  2K9G A;  2RQU A;  3NMZ C;  5IHN A;  2DA9 A;  4J9F A;  4JJD A;  4J9D A;  2LMJ A;  3KFV A;  2DLP A;  4Z88 A;  2LX7 A;  1U3O A;  3I5R A;  3VRZ A;  1T3L A;  2IIM A;  4JJC A;  2CH4 A;  3EG3 A;  2QDL A;  1RI9 A;  4HVV A;  4CC2 A;  4JPB W;  2OI3 A;  1NYF A;  2RPN A;  3I35 A;  1WIE A;  1M27 C;  4ORZ A;  2EW3 A;  4GLM A;  3ULR B;  1WYX A;  1CKB A;  4IIM A;  1K76 A;  2G6F X;  1YP5 A;  4LE9 A;  2BTT A;  1X6G A;  3PE0 A;  1PKT A;  4LN2 A;  3I9Q A;  1HSQ A;  2YT6 A;  1ZSG A;  1WFW A;  2KXC A;  1GBQ A;  2J05 A;  1AVZ C;  1GBR A;  1A0N B;  2DL8 A;  2RMO A;  1GRI A;  1ZBJ A;  1YWO A;  2KEA A;  1S1N A;  1RUW A;  2HSP A;  3PVL A;  2K6D A;  1MUZ A;  2V1Q A;  2LQN A;  4RTT A;  5I11 A;  3M0R A;  2LJ3 A;  1SSH A;  4KRT A;  2GNC A;  3SEM A;  1X27 A;  2EKH A;  4AG1 C;  2LQW A;  2YUQ A;  2BZX A;  2CSI A;  2JM8 A;  2KR3 A;  1TUD A;  2X3W D;  3EGU A;  4CC3 A;  1PWT A;  2L3S A;  3IQL A;  2AZV A;  3M0Q A;  1AWO A;  3U23 A;  1X43 A;  1PHT A;  1YWP A;  2DL3 A;  1K0X A;  3THK A;  1ZLM A;  1W70 A;  1PKS A;  5GJW B;  4QT7 A;  4Z8A A;  2JW4 A;  3CQT A;  1OPK A;  1TG0 A;  3PVQ A;  4AFZ C;  3RBB B;  1M8M A;  5HCK A;  1JQQ A;  1VYT A;  2KBT A;  3UA6 A;  2CRE A;  2DIL A;  2L2P A;  1SRL A;  2FRY A;  2ED0 A;  2L3Q A;  2DRK A;  3VS4 A;  1QWE A;  2JMA A;  2DMO A;  2RQV A;  2ROT A;  4RUG A;  1AOJ A;  1XOV A;  3M0T A;  2A28 A;  2C0O A;  4R0K A;  2P4R A;  2ED1 A;  2PZ1 A;  2EYX A;  1I07 A;  1JU5 C;  1E6G A;  5IHI A;  1QLY A;  3NHN A;  1CKA A;  1X2K A;  4FSS A;  1AD5 A;  2CUB A;  3M0S A;  1JXO A;  2EGE A;  2LNH B;  2YUO A;  1UUE A;  1BB9 A;  3R6N A;  1SPK A;  5GJV B;  4J9E A;  1U06 A;  2J6K A;  2DF6 A;  3O5Z A;  1M3A A;  2ABL A;  4DEY A;  1BK2 A;  3VS5 A;  2FG0 A;  2AKL A;  1B07 A;  1UG1 A;  2K7A A;  1X2Q A;  2CT3 A;  1I1J A;  2E5K A;  2X3X D;  2OAW A;  2L0A A;  3VS2 A;  1E6H A;  2O9V A;  4AFU C;  2FPD A;  4OMN A;  1WXB A;  4F16 A;  3A98 A;  3FJ5 A;  4JZ3 A;  4A63 B;  2NUZ A;  1W6X A;  3EG1 A;  3RNJ A;  2KRS A;  1SRM A;  4D8D A;  1NEB A;  1QCF A;  4J9C A;  1T0H A;  1AZE A;  2KT1 A;  2FEI A;  2J6O A;  1WXU A;  1JXM A;  3VS0 A;  4LUD A;  1G2B A;  1UTI A;  2AK5 A;  2LJ1 A;  1GCQ C;  1G83 A;  2KE9 A;  4F17 A;  2LP5 A;  4F14 A;  1UHC A;  3LH5 A;  4CC7 A;  2D8H A;  5I22 A;  2VWF A;  3ZL7 C;  4X1V A;  2DYB A;  1MV3 A;  1HD3 A;  4GBQ A;  2I0N A;  3I5S A;  2C0T A;  3TVT A;  1EFN A;  1X69 A;  2VKN A;  1J3T A;  4AFQ C;  2DM1 A;  2NWM A;  1HJD A;  4D8K A;  4RTU A;  3VRY A;  1ZUK A;  1AEY A;  5EC7 A;  1WXT A;  2CUD A;  1IO6 A;  2W10 A;  4WCI A;  2LZ6 B;  2KYM A;  1U5S A;  2RQR A;  2RNA A;  4HXJ A;  1NYG A;  2FPE A;  4M4Z A;  2O9S A;  2ROL A;  1GFC A;  4J9G A;  1KIK A;  1H8K A;  1ABQ A;  3VS1 A;  4ESR A;  2W0Z A;  2AZS A;  1GCP A;  4JJB A;  2LCS A;  4AFS C;  2GTJ A;  1GCQ A;  4DEX A;  1KJW A;  1WA7 A;  4HCK A;  1VYU A;  3UA7 A;  2L3P A;  1OPL A;  2HBW A;  3EG2 A;  4ZNX A;  2MCN A;  2OJ2 A;  2KRO A;  2RF0 A;  1PNJ A;  1ZUY A;  1VA7 A;  1ZX6 A;  4LUE A;  1YN8 A;  2VVK A;  3VS3 A;  2A37 A;  2HEQ A;  2BZY A;  2K79 A;  1Y57 A;  1X6B A;  2RN8 A;  4AG2 C;  1K4U S;  2EYZ A;  1ZUU A;  4RTZ A;  1WLP B;  5FWC A;  1RLQ C;  1UJY A;  2DE0 X;  1OV3 A;  5IH2 A;  2ENM A;  1AWX A;  2D0N A;  2D1X A;  4HVW A;  2LJ0 A;  5ECA A;  1LCK A;  3EHQ A;  2BZ8 A;  2GTO A;  5IXB A;  2A08 A;  2F2V A;  2DBM A;  1SHG A;  2F2X A;  2J06 A;  1GFD A;  4RTW A;  4OMO A;  2A36 A;  2J7I A;  1M3C A;  1VYV A;  1KFZ A;  2YDL A;  1Z9Z A;  2GQI A;  4RTV A;  1PRM C;  1UGV A;  2KRN A;  4Z89 A;  1OOT A;  1QKX A;  2DL4 A;  5IXF A;  1I0C A;  3QWX X;  2YUP A;  1JEG A;  2F2W A;  3GBQ A;  2GBQ A;  2DNU A;  1B3Q A;  2J6F A;  2EYW A;  1KSW A;  4RTY A;  2K2M A;  4OML A;  2RQT A;  2AKK A;  3REA B;  3EG0 A;  1NLO C;  1M3B A;  1WX6 A;  5L23 A;  1H3H A;  2ECZ A;  1AZG B;  1ABO A;  2V1R A;  1H92 A;  4JZ4 A;  2FO0 A;  4IIO A;  4RTX A;  2H8H A;  1T3S A;  4K11 A;  1W1F A;  2PNI A;  1TUC A;  2JS2 A;  2FRW A;  2O2O A;  4OMP A;  2C0I A;  2EGA A;  5FWB A;  1T0J A;  2EGC A;  4EIK A;  1FYN A;  3H0I A;  3M0U A;  1QWF A;  5IHK A;  4OMQ A;  1GL5 A;  1SEM A;  2MOX A;  1N5Z A;  2HDA A;  2EQI A;  3JV3 A;  4E6R A;  1WDX A;  1QKW A;  3H0H A;  2KT8 A;  2GGR A;  1Z9Q A;  2JM9 A;  2O88 A;  2KGT A;  3SHW A;  2KXD A;  3NPF A;  1JO8 A;  1CSK A;  4HVU A;  2JS0 A;  2CT4 A;  1PRL C;  2JTE A;  1M30 A;  1Y0M A;  2DRM A;  2DX1 A;  3C0C A;  2O31 A;  2JT4 A;  1K0S A;  2JXB A;  2RQW A;  4Y92 A;  3TSW A;  3M0P A;  1BU1 A;  2KRM A;  3NGP A;  1MV0 B;  2K3B A;  2KYB A;  2JMC A;  1UEC A;  3H41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...