2RQTA

Solution structure of the human ddef1 sh3 domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
61
structure length
61
Chain Sequence
VRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arf-GAP with SH3 domain, ANK repeat and PH domain-containing
publication title Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqtA00
2FEIA 1WX6A 1X27A 1AWXA 1T0JA 4A63B 2K9GA 2JW4A 1V1CA 1OOTA 2ED0A 2GBQA 2GQIA 2DBMA 1UJYA 2EYXA 1S1NA 2ROLA 3EGUA 4GLMA 3M0UA 4OMPA 1OPKA 2FPEA 4LE9A 3EG1A 5L23A 2CT3A 2DF6A 2EGEA 1UUEA 4J9FA 1TUCA 4OMQA 2O9VA 2DYBA 2DLPA 4D8KA 2CREA 2KGTA 1QKXA 2L0AA 2CH4W 1UHFA 2L3SA 5GJVB 1W70A 1QLYA 2F2XA 2VWFA 3R6NA 2LJ3A 1H3HA 1ZBJA 1WXUA 1M3AA 2CSIA 2O9SA 4ESRA 1YN8A 4AFSC 1VYTA 2OJ2A 4RTXA 4J9GA 2M0YA 1ABQA 1AD5A 2VKNA 3EHRA 2B86A 1ZUUA 1Y57A 5I11A 2YUPA 4QT7A 2H8HA 4IIOA 2V1RA 2YUNA 3QWXX 3QWYA 2CDTA 1RLQC 4J9IA 2EQIA 1G83A 2GNCA 1OV3A 1M8MA 2LCSA 4J9CA 2J6KA 3TVTA 2AKKA 2KROA 4OMOA 3VS4A 1U3OA 2C0IA 1M3BA 1E6GA 4AG2C 1X6BA 2LP5A 3VS0A 2JMCA 2JXBA 1QCFA 1OPLA 4FSSA 3VS5A 1QKWA 2RNAA 1SPKA 1MV3A 2ABLA 2LJ0A 5FWBA 1U06A 3LH5A 1GBQA 2ENMA 2KXDA 2JM9A 2KRMA 3UATA 4Z89A 2BTTA 2J7IA 1YCSB 2KRNA 1X69A 2FPFA 3RNJA 1BBZA 2OAWA 1UJ0A 3U23A 2NUZA 1A0NB 1PHTA 1RI9A 2I0NA 1G2BA 2K79A 1SEMA 1SRLA 4RTVA 2CSQA 2BZXA 2DNUA 2ROTA 4X1VA 2DL7A 4WCIA 2K7AA 2DRMA 3NMZC 1JXMA 1PRLC 5I22A 5IXFA 1LCKA 3RBBB 2YT6A 1B07A 2EKHA 2KEAA 3VS2A 1BK2A 2C0OA 2O88A 2RQUA 1KSWA 2GTJA 2KBTA 2HDAA 1PRMC 1TG0A 2A08A 2QDLA 4DEYA 2LJ1A 2E5KA 2DA9A 3CQTA 1YWPA 1JU5C 3THKA 1WDXA 2DL3A 2HSPA 4GBQA 2A36A 4HVWA 1E7OA 3M0QA 2IIMA 3ZL7C 2KR3A 2RF0A 1I07A 4ZNXA 1X43A 2RPNA 3UF4A 1T3SA 1FMKA 3M0PA 2RQRA 1WI7A 2VVKA 4AG1C 1JXOA 1ABOA 1J3TA 3M0TA 5EC7A 2P4RA 2GGRA 2YDLA 2DE0X 1UHCA 2SEMA 1EFNA 2BZYA 3M0SA 1WYXA 2DJQA 1M3CA 3KFVA 4M4ZA 1WXTA 4JZ4A 3SHWA 4RTZA 3ULRB 4OMMA 1I0CA 1HSQA 3VS1A 1ZUKA 3PVQA 4ORZA 4CC2A 5IXBA 1W1FA 5IHIA 4AFUC 4CC7A 1W6XA 4CC4B 1VYVA 4HCKA 1NLOC 4F17A 1KIKA 2DL4A 2EGCA 4AFZC 1T3LA 3VRYA 1UG1A 2ECZA 2KXCA 5GJWB 4HVVA 1H8KA 3FJ5A 2LMJA 2DBKA 2SRCA 3IQLA 3PE0A 3H0FA 4IIMA 1K76A 1RUWA 2RQWA 1BU1A 1UECA 2L2PA 2FG0A 4RTWA 1AZGB 4HVUA 1XOVA 2YSQA 4F14A 2PZ1A 5ECAA 2HCKA 4JJBA 3EHQA 4J9HA 5IHKA 2DL8A 2AZSA 3VS7A 1T0HA 2AKLA 1JO8A 2DRKA 2YUQA 1JEGA 3VS3A 3UA7A 2MCNA 1PWTA 4OMLA 4Y92A 3NHNA 1GCQC 1HJDA 2EYZA 4JZ3A 2FRWA 2F2WA 2KYBA 2CUBA 2GTOA 2L3QA 1GRIA 3EG3A 2DX1A 2K6DA 2D8HA 2EYWA 1VYUA 1NEBA 4F16A 3EG2A 4RTYA 1MUZA 1WIEA 1HD3A 1CKAA 1WA7A 1ZUYA 1UDLA 1PKTA 4J9EA 3C0CA 1E6HA 2KRSA 2ED1A 2OI3A 3GBQA 1X6GA 5IHNA 1YNZA 2DMOA 1SHGA 1WFWA 3H0IA 2D1XA 4DEXA 2RQTA 1Z9ZA 2AK5A 4R0KA 2JS2A 2FPDA 2C0TA 3REAB 4K11A 2PNIA 1CSKA 2BZ8A 3I35A 1KFZA 1NLPC 2MIOA 5FW9A 1RLPC 1SRMA 1AZEA 3H41A 1AWWA 1NM7A 4OMNA 2EW3A 2JMAA 1UFFA 1B3QA 4RTUA 2KE9A 2FRYA 3TSZA 4RTTA 1AOJA 1WXBA 4J9BA 1ZSGA 1K0SA 1GFDA 2XMFA 1TUDA 1U5SA 4EIKA 2LQNA 4AFQC 2J06A 4E6RA 2JT4A 1BB9A 1GFCA 2W0ZA 4CC3A 1N5ZA 2M51A 2D8JA 4LN2A 1IO6A 4JJDA 1Z9QA 2F2VA 1QWFA 2CT4A 2DILA 4J9DA 1AVZC 1FYNA 1I1JA 2RQVA 3REBB 4RUGA 2K3BA 1SHFA 1K0XA 2A28A 2EGAA 2MOXA 1X2QA 4JPBW 1QWEA 1X2KA 3H0HA 5HCKA 3SEMA 5IH2A 3PVLA 1M27C 2LNHB 1UTIA 1MV0B 4Z88A 4LUEA 3VS6A 2RMOA 1JQQA 2G6FX 2O31A 2RN8A 2EYYA 2CUDA 2L3PA 1VA7A 1GCPA 3M0RA 2DM1A 3JV3A 3TSWA 2JM8A 2YUOA 4D8DA 2DVJA 2LX7A 1NG2A 2LZ6B 2AZVA 2X3WD 1WLPB 2NWMA 4LNPA 1Y0MA 2ESWA 1YWOA 2J05A 1AWJA 1CKBA 3A98A 1ARKA 2LQWA 3VRZA 3I9QA 2K2MA 1GCQA 1NYFA 1UE9A 1NEGA 1ZLMA 1GBRA 2EPDA 4Z8AA 1OEBA 1AEYA 4KRTA 3UA6A 2JTEA 2HEQA 2D0NA 1ZX6A 1PKSA 1M30A 1SSHA 2KNBB 1YP5A 2V1QA 5FWCA 2CH4A 1K9AA 2PTKA 2KT1A 1GL5A 3I5SA 2W10A 2EVRA 4HXJA 1UGVA 3I5RA 2A37A 2J6FA 2J6OA 2KT8A 4JJCA 1K4US 2HBWA 3EG0A 1NYGA 1PNJA 4LUDA 1KJWA 2EBPA 3NGPA 2JS0A 2KYMA 2FO0A 3O5ZA 1H92A 3NPFA 2DL5A 2X3XD 1AWOA 1K1ZA 2O2OA
chains in the Genus database with same CATH superfamily
2DZ9A 1T0JA 2MYSA 1VQLQ 2K9GA 5KYNA 3Q1JA 1OOTA 4J6XA 4C5IA 4C92B 3DKMA 1TOVA 4QQDA 1XTDA 3LH0A 1RAIB 2DEUA 2YRDA 1OZ3A 1Y96B 2LC4A 3X25B 4OMPA 3V7RA 5L23A 4JDSA 5FU6C 4J9FA 1QVFA 1YJWQ 5GAOn 1QKXA 2CH4W 2L3SA 2C06A 1QLYA 2BE9B 2VWFA 3PIOA 2LJ3A 1Q81U 2YXYA 5FU6B 3G71A 4QQGA 3EAEA 4PJMA 4UC4A 5IT9E 2EWNA 1LNXA 4IUUA 1X01A 2OJ2A 3NTIA 1YI2A 2M0YA 3BDLA 2QQAA 1KHCA 3M9QA 3QYGB 3G6ET 1ZUUA 4AT1B 3A8MB 6AT1B 3QWYA 2CDTA 5KYWA 1Q7YR 5GANg 2QGGA 4Y91A 4V2SA 2GNCA 3H8ZA 1B34B 4XTXA 4J9CA 3L2WA 2AKKA 4OMOA 4IKFA 4ELZC 1D09B 3GLXA 3OY9A 4XTVA 4M7AD 1M3BA 1WNLA 4FU6A 1QCFA 3JCMh 3OYCA 1JJ2S 1VQNQ 1SPKA 1PSEA 2DVEA 4HT8A 2EJFA 3JB9G 2ABLA 2LJ0A 1U06A 3LGLA 2E4HA 2KXDA 4OB0B 3MJXA 5CKHA 3CC2Q 2FPFA 5GAMh 5LJ3j 2VXEA 3G7ZA 3CXCA 2RK2A 3CBOA 1PHTA 1ACMB 4FYVB 1ZA1B 3OYDA 1YIJT 1G3SA 2IG0A 1SEMA 2QXFA 2RA2A 2DL7A 2XHCA 4E47A 2QGFB 2DRMA 2CP5A 2MI6A 5D7UA 3TEEA 1LCKA 3RBBB 1QVFP 3J80E 2EKHA 3JCMP 3S6WA 4M75E 4ZN1A 1IREB 2KDSA 4RMOA 2QI2A 1TTHB 2RQUA 1Q81R 2HDAA 2FZKB 3OYAA 1TG0A 2HAXA 2LJ1A 3VV0A 1R0CB 3SB2A 2P0PA 1VQ4A 4MDXA 2QDYB 2HSPA 2PU9B 3PMIA 2DEQA 2RJEA 3M0QA 3ZL7C 2KR3A 3CCST 3PNWC 2QEXQ 1FXXA 3CC4A 1T3SA 3QJ6A 2RQRA 2RHIA 1ABOA 4N4IA 2DE0X 2SEMA 2H3EB 1VIFA 3ME9A 3CCJQ 2DK3A 4M4ZA 4LDUA 4PJOA 1FMVA 3OSVA 1YIJQ 5GANj 1W1FA 1NJIU 5IHIA 3CMET 2K5IA 4HCKA 2BKDN 2DL4A 2RI5A 2HL3A 3RKWA 3VRYA 2E41A 2ECZA 1YITT 3FJ5A 4WTOB 2DO3A 5GAN4 3PE0A 2CP0A 1TH7A 4M7DE 1K76A 2HKQB 5GANe 4RTWA 3M57A 1NZ9A 4KUIA 5ECAA 2HCKA 4LDXA 3EHQA 4A4HA 2XICA 5GAOr 4BACA 1WGSA 3UA7A 2MCNA 3RDVA 4OMLA 2JTFA 4Y92A 3NHNA 1GCQC 2Y4XA 2RM4A 1BIAA 1RAAB 2A0FB 2CGHA 2MK5A 2YHTA 2DJZA 1NEBA 3LW5E 3EG2A 1KQSP 4RTYA 3R6OA 2V8IA 3E9FA 1HD3A 4FL6A 4BUGA 4O6JA 2PQWA 2XI9A 4C0ZA 1M2OA 2EQJA 3V7SA 1VQ7T 3L1AA 4J8OA 2R57A 7AT1B 1WFWA 4DEXA 1Z9ZA 3OBYA 2QG9B 5KE2A 2K3XA 3VYGA 3M4YA 4XTWA 4QKUA 2FHDA 1VQLA 1M8VA 4P5NA 2CZ6B 4LDWA 3HFNA 2A3LA 5GMKl 1AZEA 4ELYC 1KD1U 4OMNA 2EW3A 1UFFA 2LCCA 5KYXB 1NJIR 2FRYA 5GAOq 4M7DG 1Q81C 4RTTA 3QDFA 5D6XA 3VJPA 4J9BA 1ZSGA 1K0SA 2DERA 4QVZA 2QK0A 4A4KA 4J7IA 2J06A 1YJWA 2LVMA 2YRCA 3JCMf 1VQMA 1QMCA 4DOVA 4WF2A 2ZGWA 1QWFA 1F1BB 5GAN5 4NOYA 3WVEB 4BY6C 3JCMb 2K3YA 1I1JA 2QQBA 5GAMf 2ZPFB 1DJ7B 2QQSA 1X2QA 4JPBW 1M2VA 1WPYA 2YLCA 3SEMA 1MV0B 5LL6S 4C8QE 4BY6B 3VS6A 4OGCA 2CUDA 1IHVA 2P0QA 4DBRA 2DM1A 3LWIA 2HQXA 5FLXE 1X6OA 2JM8A 1N8RC 5GAOm 1R0BG 4IURA 2F5TX 1OX8A 1ZA2B 2DXBA 5CQYA 1WLPB 1VQ5T 3ER0A 3T9NA 3QO3A 3MEVA 1CKBA 2CP2A 2OTJT 2DTHA 1VQNA 1NYFA 5LJ3d 3CC7Q 1JBMA 2G3RA 1RABB 2LQKA 3UA6A 2HEQA 2D0NA 3VKIA 3CXCS 3CPWA 4LDYA 1ZX6A 1YHQQ 1PKSA 5LJ5j 2KNBB 4OMFB 3CC2A 1WHLA 3GNGA 4F7UF 3TREA 1KD1R 3JCMW 4KT0E 2EFIA 3F70A 1JJ2A 2KT1A 3OYHA 2BIVA 4E7SA 2RD1A 3L2RA 4HXJA 1V29B 2A37A 3V8KA 4N4GA 5CKEA 3JB9I 1BCOA 2EJ9A 2M02A 2KT8A 1LJOA 4XQ3A 2CZ1B 4M7DA 5LJ5e 3OYGA 2JS0A 3OQ5A 2FO0A 3OW2P 4RKUE 2DL5A 2NUTA 5KYUB 1K1ZA 3CCVT 2ZPEB 1K73C 5EG2A 4A63B 2JW4A 2ED0A 2GBQA 1I4K1 2EYXA 1TUGB 4PLIA 4E7ZA 1S1NA 2ROLA 3TQ7P 1X75C 4PFOA 1N6AA 2D9TA 1RI0A 2BE7D 3M0UA 2QEXA 3SFMA 1Y7XA 1MNEA 1OPKA 5GANd 2XDDA 2DF6A 2QTXA 3CMAT 5GAN6 2RH2A 2LDMA 3GF5A 1BI0A 2CYZB 3ZEHA 5L8RE 3CCQT 1H3ZA 3CCJA 1WJQA 4F7UB 1I81A 1WHHA 3OMGA 1OZ2A 3CCLA 1PCXA 4RG2A 5GMKh 1M90U 2KVQG 1ZBJA 1M3AA 2L5QA 2EQUA 3INZA 2CSIA 5GAOl 2EQMA 1S72Q 3EFOB 5C6SA 1FMWA 3UPUA 3CBMA 4C5EA 1NBEB 1Y57A 1HXDA 1YJ9A 3QWXX 2D6FA 4HCBA 2LQ8A 3OS5A 3CCVQ 4ZN3A 3JSCA 4J9IA 1G83A 1RAGB 2QA4Q 3CCMT 1JJ2P 3SDZA 1IGUA 1M2VB 2LCSA 3JB9D 2HKNA 5J26A 2KROA 4OB1B 3X20B 3VS4A 3MHXA 2EAYA 5DLQE 4M7AC 2C0IA 2MPXC 1ZQ1A 2R58A 1E6GA 2P0KA 4AG2C 2DKGA 3CMAQ 3A8LB 2KSSA 3I55T 3VS0A 2JMCA 3P8HA 1QKWA 1D0ZA 5FWBA 4XU0A 4M7AB 2VXFA 1ZBXA 2XIDA 2KRMA 4AMCA 3RESA 3ASKA 3EGXA 3RMQA 1YCSB 2YWWA 1X69A 3TU4K 3HFOA 1BBZA 3RNJA 1VQKT 4MZTA 1KD1C 4XU1A 3CCEQ 3U23A 2NUZA 3PT9A 1JB0E 2I0NA 5KYYA 2K79A 1UEBA 1SRLA 3EGDB 3L42A 5LJ3g 2DNUA 2ROTA 3QDRB 4X1VA 4WCIA 2NUPB 1JXMA 5I22A 1MMNA 3KBGA 2ZCFB 2C0OA 3OYLA 3CCUA 2O88A 2AT1B 4PJLA 1M90R 1EIFA 1WJRA 2CZ7B 2KBTA 2ZPIB 4ZGDB 5CIUA 1QQJA 4ZGJB 1KQ2A 3CD6T 4Y28E 1JU5C 4D6WA 4OVAA 1VQOT 3I56T 3I55Q 4PK4A 1AHJB 3OB9A 1KK7A 4ZNXA 3X28B 1H641 1M9SA 4JRIA 2NUTB 5CK9A 3M0PA 2Z0WA 1RAFB 3M0TA 2P4RA 2WACA 1UHCA 1EFNA 4MZMA 2BZYA 2DJQA 3KFVA 5HK3A 2QAZA 4OMMA 1I0CA 3FRNA 2M9UA 1VQ8T 5HY6A 1W6XA 4CC4B 3OYKA 3HRTA 4MZPA 4F17A 3MP8A 4OB2B 4AFZC 1G3YA 3OBWA 4PJOG 1H8KA 3M5AA 2LMJA 3QKJA 2DBKA 2SRCA 5CR2A 5DLOA 4IIMA 2DXCA 2K4YA 5LJ5d 3CPWS 2FG0A 4HVUA 1XOVA 4KUDK 2PZ1A 2L8DA 3QIIA 4BD3A 2PVOB 1QW1A 4XTZA 3I56Q 3CC7A 1TS9A 2MMPA 2OTLT 1JO8A 2MF2A 1WHJA 3M56A 4B6MA 3VS3A 1VQPT 3G4SA 1YHQA 2HL5C 1N8RU 3JRZA 1VQ6T 1MMAA 1HJDA 3OYFA 2GTOA 3EG3A 2D8HA 2EYWA 2QASA 3JCMc 1R77A 2E64A 4JS4A 1PD0A 1MUZA 3NTKA 1WA7A 2V8KA 3L2UA 3GBQA 3G6EQ 1NE8A 3PGGA 2RI3A 4EPCA 1QVGS 2XU8A 2Y90A 2AIRB 2QQRA 2RO0A 5IAYA 3VUZA 3KUFA 2EJGA 4M77E 2C0TA 3D7SB 5LJ3e 2X51A 4M78E 2PNIA 3MEUA 1I5OB 3CCLT 1I8FA 3EGXB 2IVWA 1RLPC 1D1AA 4GLKA 1AWWA 2JMAA 3RKXA 4RTUA 4EMKA 2KE9A 2M1HA 5I2SA 1M90C 3BW1A 2E6ZA 3TSZA 2K5FA 5KYYB 5IN1A 1AOJA 5GMKm 2XMFA 1TUDA 1QVPA 1P92A 4AFQC 3ZFJA 2CP6A 3EH2A 3UDCA 3MO8A 4R55A 1K73U 4IUPA 3N5BB 4J7FA 2W0ZA 4CC3A 1N5ZA 1IO6A 1Z9QA 1FYNA 3CCRT 3REBB 4RUGA 1OU9A 4FYWB 4PL6A 5CVIA 1S72A 5KE3A 2CS7A 2E6NA 3KXTA 2KMTA 1RL2A 3H0HA 3A8HB 5IH2A 2V8JA 1N8RR 2RMOA 2G6FX 2O31A 4OP0A 4PNOA 2RHYA 1VA7A 1G8XA 1GCPA 4O5VA 2M0OA 2M16A 4OGEA 2QA4A 3LWHA 3M59A 4M75G 4M77G 2E1HA 3RUXA 2HD0A 3G1JA 4M78G 5KCHA 4D8DA 1W2BS 2JJ9A 2DVJA 1I5LA 3CXCP 1VQ9T 1N9RA 4C92E 3SWNA 2NWMA 2QQ9A 1ZSZA 4LNPA 3CCSQ 2ESWA 5GAN2 1AWJA 1K9MC 1YJNA 1B7TA 2LQWA 3VRZA 3S3NA 3I9QA 5KYWB 1BCMA 2KY9A 3GIBA 3OYYA 1SKUB 1WQWA 4A53A 1O75A 3CCUT 3MPUB 1M30A 3HP9A 4HT9A 2CH4A 1K9AA 2RJCA 3FIFA 3P8BB 1M4ZA 3CCEA 3CMEQ 2MAMA 5LJ5g 1WHGA 3I5SA 4R56A 2W10A 5GAOp 2J6OA 2KI7A 5I2MA 1D3BA 5AT1B 1YITQ 4BI4A 4JJCA 4DOWA 1K73R 1OULA 4LUDA 4OF1A 2EBPA 3X26B 2HMAA 1D1CA 3G71T 3O5ZA 4PJOF 3C95A 1AWOA 2OAUA 2O2OA 2YLBA 4RG8A 1YI2T 2EYQA 1W4SA 1G5VA 2VB6A 3EG9A 2GQIA 3NTHA 2DBMA 1UJYA 1IXDA 2GQVA 3EGUA 4C92G 3M54A 5CO7A 4NS5A 3WXMB 2VGMA 3HRUA 3JB9F 3EG1A 2CT3A 2ZPBB 1SSFA 3JB9H 4EDUA 2DYBA 2DLPA 4D8KA 4J6WA 2CREA 2KGTA 2PUOB 1UHFA 1VQ7Q 1W70A 2K57A 2F2XA 3BDUA 4HA8A 3R6NA 1H3HA 1UGQB 4C5HA 1G3WA 1WXUA 3DLMA 4M77A 2DXUA 4M75A 2XDPA 4M78A 3JCMQ 3G4ST 2XDBA 2O9SA 4QW2A 2COWA 2LRQA 2DAQA 4KGVB 1YN8A 4PJOC 5CKBA 4AFSC 1VYTA 5LJ3h 4RTXA 4J9GA 1AD5A 2A7YA 3L2QA 5GAMg 5FRMA 3URGA 2B86A 2YUPA 2H8HA 4IIOA 3GPLA 4FT2A 1RLQC 4E7IA 2NYSA 4PJOB 4FSXA 1KQ1A 2E3IA 4XAXB 2HZYA 1OV3A 2IPOB 3V8LA 2LT1A 2WSFE 2O4XA 4PFZA 1D1BA 1U3OA 2MWOA 1WQ7A 2FL7A 3GNFB 4TVRA 2DTIA 1MHNA 4FSSA 3VS5A 2RNAA 1MV3A 3AT1B 1RADB 1VQ4T 2ENMA 2JM9A 3UATA 2BTTA 3M4GA 3G6EA 2KRNA 8ATCB 2FZGB 2HNIA 2CP3A 2OAWA 3BE3A 4RCCA 2RHUA 3CC4T 1A0NB 2F69A 4N0AA 2BUDA 1U1SA 4JJNK 1RI9A 4RTVA 2CSQA 4C8QG 1PG5B 1TU0B 5GANh 2BZXA 4C92A 4BE0A 1QVGA 1PRLC 1Y96A 5D6WA 1KQSS 2AHJB 1Q82U 1VQ5Q 3PTAA 1K8AU 4M75F 1KSWA 2FB7A 5HKCA 2OTJQ 2GTJA 1PRMC 3DB3A 1WJSA 2A08A 2QDLA 4DEYA 1EZZB 2DA9A 2E5KA 3CQTA 3THKA 1WDXA 2DL3A 1QP3A 2A36A 1WHKA 2IIMA 1Q86C 2VUBA 4MMKA 3RR6A 3VUBA 2RPNA 3DB4A 1FMKA 2DTOA 1WI7A 2V26A 1JXOA 5EC7A 1YIJA 2PVDB 5GAMj 1C0MA 4Z02A 3M0SA 4C0DC 1WHMA 1WYXA 1M3CA 1WXTA 3SHWA 3ULRB 3JCMe 1HSQA 4PJOD 1ZUKA 2X4WA 2QTVA 3PVQA 2K5LA 1R8OB 3RIRA 4BI3A 5IXBA 1OQKA 4AFUC 2COZA 1VOMA 1B34A 3OSSC 4M75C 3CPWP 1VYVA 4C0DB 3HRSA 3EFSA 2OX7A 5GAMe 2EGCA 2CP7A 4KBMB 3CPFA 2JVVA 1UG1A 2KXCA 4E2FB 2L89A 1YFNA 5A0GA 3H0FA 4M75B 3CCSA 3E9GA 1RUWA 1BU1A 2E5QA 2LCLA 4M7DF 3OA6A 4LD6A 2COYA 2KK4A 1HYOA 2L3RA 4KH1B 2LX9A 3FLGA 4F04B 5IHKA 2DL8A 3VS7A 3RMSA 2AKLA 1BKBA 1W2BA 2DRKA 2YUQA 1VQLT 4GY5A 4C92F 3CCQQ 4J5YA 1JEGA 1KC8U 1PWTA 1D0YA 4E7HA 1IZ6A 2WSCE 4BI8B 4DBHA 4FIBA 3MP6A 4JZ3A 2FRWA 1YBYA 2F2WA 1Q82R 4C8QA 2KAFA 1GRIA 1K8AR 2DX1A 2CZ0B 3CMEA 4ATOA 4F16A 1K9MU 2JTMA 3A5ZB 1YJWT 1UDLA 1SG5A 3C0CA 2OI3A 1VQMT 1M1FA 1YITA 1YNZA 1SHGA 3OYNA 4E7KA 1M1KC 3M55A 1MMGA 4R0KA 4M7DC 2FPDA 3CCMQ 1C1AA 2P84A 4K11A 2BZ8A 3I35A 3OS0A 1NLPC 1JRIA 2JUFA 3A1PA 3QJYA 2DZCA 2VV5A 1SRMA 4ZGEB 1NM7A 4MDWA 4BE1A 4M7DB 1B3QA 3H6ZA 4DA4A 4OB3B 2X4XA 3CBPA 1U1TA 2EQKA 3J81E 1U5SA 4A4FA 3OW2S 4E7JA 3HTRA 3QXEB 4FYXB 1VQ7A 1GFCA 2EKOA 2M51A 3ZBDA 9ATCB 1VQKQ 4LN2A 1PM3A 5DM7R 5GAN8 4J9DA 5A0LA 5LJ5h 2RJFA 1VQNT 5CKDA 1AVZC 2RQVA 3X24B 1VQMQ 1VIEA 1K0XA 1N9SA 5A2QE 3RKYA 2EGAA 1QWEA 1X2KA 3QG1A 3CEYA 4M75D 4M77D 1KC8R 3PVLA 3CC2T 2LNHB 2GFUA 1UTIA 4JRQA 4M78D 1W2BP 4Z88A 4LUEA 1BI1A 1LVKA 4C8QF 5FRNA 2R5MA 2RN8A 5GANf 1AT1B 2L3PA 3M0RA 3GP8A 1Y71A 4Q5WA 1RAHB 3C4SA 3JV3A 1D0XA 3CD6Q 1K9MR 1FWZA 2YUOA 4DQ2A 4LDVA 1VQOQ 4JUVA 2LX7A 1KHIA 1NG2A 2LZ6B 2AZVA 3HKSA 3NFCA 2QYZA 2CKKA 2J05A 3A98A 4PFPA 1GCQA 5AYFA 1UE9A 1NEGA 4MMLA 2DIQA 1AEYA 2YRVA 2JNGA 1IB8A 5A0DA 2E3HA 1SSHA 4F7UE 1MMDA 4J6YA 3S3OA 3LGFA 5M9OA 2VGNA 1Q82C 1RACB 2FYKA 1VQ8Q 2QEXT 1MGQA 1K8AC 3PFSA 4KGZB 4C8QC 4PKCC 3VU3C 1GL5A 1IRXA 5CKFA 2XK0A 3OS1A 3I5RA 5D6YA 3CCJT 3OYBA 2NLUA 4M7DD 2LNVA 5KYXA 1NYGA 1PNJA 4C8QB 1KJWA 3PIPA 2FVUA 1VQ5A 2RB6A 2VASA 3JCMd 3QBYA 3BY7A 2OTJA 4C92D 3NPFA 2PUKB 2X3XD 2FEIA 5J3BA 1WX6A 1X27A 2OTLQ 1AWXA 4J83A 1VQPQ 1V1CA 3E19A 5GAMd 1YJ9T 4XK8E 5FROA 1KQSA 1VQ6Q 3JCMJ 4PJNA 3M58A 2GF7A 4XU3A 4IUQA 3WVDB 2XG8D 3LX7A 4GLMA 4QQ6A 2FPEA 4CI0C 4LE9A 3UWNA 4CRIA 2EGEA 1UUEA 3QYHB 4M7AE 1TUCA 4OMQA 2O9VA 2VC8A 1OU8A 3OYEA 2L0AA 5GJVB 5CQXA 2LT4A 4F7UG 1MNDA 1Q86U 3EFRA 3S3MA 3O8VA 1XNIA 4ESRA 5KH6A 3LYIA 3CCVA 3QSUA 1UGPB 3CCLQ 4DBQA 4DBFA 1ABQA 2VKNA 3EHRA 3QPHA 4VUBA 1KC8C 5I11A 4HCZA 2E10A 4QT7A 2ZPGB 1RAEB 2V1RA 2YUNA 3UT1A 3HSBA 2EQIA 2PVGB 8AT1B 1HK9A 2XKOC 1YJ9Q 4NL2A 3FEOA 1M8MA 3CMAA 3V8JA 3RERA 2J6KA 3TVTA 3CCQA 4KULA 2KQWA 1Q7YC 3JCMV 4L6V5 5J39A 2DPPB 1X6BA 2LP5A 2JXBA 4JRKA 2HBPA 4HCCA 1OPLA 2H3JA 3CCRQ 5GAN3 1QCNA 3LH5A 1GBQA 2DD4A 2X35A 5GMKj 2I2LA 4M7AG 4C8QD 4Z89A 3HPWA 4A4EA 3H9NA 5LJ5f 4QVDA 2J7IA 4B9WA 2DIGA 4X9DA 1UJ0A 5KYUA 1YCYA 1IHWA 1FX7A 1G2BA 3CCMA 3QHSA 5GMKe 1BYMA 2K7AA 1Y07A 3A8OB 4EMGA 3NMZC 1U8RA 5IXFA 1WZOA 1VQ9Q 2YT6A 1B07A 3MP1A 4BE2A 2KEAA 3VS2A 1BK2A 2X4JA 3MEWA 4JRPA 4ZTFA 4E7LA 3I55A 4FCYA 1Q86R 1M1KU 3C12A 3MEAA 2VYTA 4XTUA 4EMHA 5I21A 1YWPA 4L59A 4F7UA 1OYXA 3CCUQ 4EMKC 1QVFS 4GBQA 3FJPA 1GXIE 3C94A 4HVWA 1E7OA 2D0QB 1BIBA 1LOJA 3GOXA 3VYHB 2RF0A 1I07A 1VQKA 3J7AF 1X43A 1BI3A 3UF4A 3EFOA 1G3TA 2GFAA 2VVKA 4AG1C 3SD4A 3JCMg 4EMKB 1J3TA 3CC7T 2YDLA 2GGRA 2E65A 2Y4YA 5KCOA 3OW2A 1YHQT 2ZPHB 2MWPA 4JZ4A 4RTZA 1SF9A 2DFUA 3META 2EIFA 4HKEA 3VS1A 4ORZA 4CC2A 4CC7A 3G71Q 3JB9J 1NPPA 2DD5A 4BDYA 1NLOC 4KH0B 1KIKA 3CD6A 1YI2Q 1T3LA 2DXTA 2WSEE 2RK1A 5GJWB 1VQOA 4HVVA 3I56A 4II1A 3LLRA 4FW2A 2B8AA 3IQLA 2RHZA 1EX4A 2RQWA 1UECA 2L2PA 1AZGB 2YSQA 4F14A 1ZHIA 4JJBA 4M7AA 4RCBA 1QCOA 3OMCA 4J9HA 3V7CA 4KGXB 3SWNC 4C0FA 1ZSZC 2AZSA 1T0HA 3HHTB 2RHXA 3HL8A 2F5KA 4PLLA 1QP2A 3OYMA 4LD9K 1OI1A 1VUBA 3QUIA 2EYZA 4FM4B 2KYBA 2CUBA 2L3QA 1M1GA 2O01E 2K6DA 3SWNB 1VQ8A 1ZSZB 1VYUA 1PC0A 4PJJA 4NL3A 3G4SQ 3EGDA 1M1KR 2ATCB 2NUPA 1XQHA 1WIEA 1CKAA 1ZUYA 1PKTA 4J9EA 1E6HA 2KRSA 1OX9A 2ED1A 5C0MA 4IUVA 1X6GA 5IHNA 1BI2A 2DYIA 3E1SA 2DMOA 5CCAA 3A8GB 3H0IA 2D1XA 2RQTA 2AK5A 2E70A 4X9CA 3MCAB 2HQEA 2K2VA 4A4GA 2JS2A 1S72T 3REAB 3L2ZA 4ANJA 4M77F 4XU2A 4BDZA 3OYJA 2P4TA 1CSKA 4M78F 3TCJA 2OTLA 3L2VA 2MIOA 5FW9A 1KFZA 1VQPA 2RJDA 4LXCA 4X34A 1VQ6A 3AHUA 3H41A 1UB4A 4C5GA 1D3BB 1O9SA 2X4YA 1LPLA 3QZ5B 4JLGA 2QA4T 1WXBA 2R5AA 2JZ2A 1GFDA 1Q95G 4EIKA 1VQ4Q 2ZZDA 2LQNA 4E6RA 2JT4A 2XD0A 4FT4A 3DLLA 1NJIC 3EH1A 1BB9A 3FDRA 2X9HA 2D8JA 1KG1A 2ZAEA 3EG9B 2F1LA 4JJDA 5FU7C 2F2VA 5HK0A 2RI2A 1YJNT 2CT4A 1C6VX 5GMKi 2DILA 3CC4Q 4M7AF 4A54A 2K3BA 1NPRA 1SHFA 2HSEB 2A28A 3QZ9B 2MOXA 4M77C 5HCKA 4XTYA 1IGQA 4M78C 5FU7B 1M27C 4BB7A 5CAIA 1UGSB 2GCXA 3PMTA 1JQQA 2EYYA 3CCET 1TXQA 2FZCB 4M77B 3TSWA 4M78B 3FC3A 4QVCA 1UGRB 2X3WD 4FW1A 2HQHA 3JCMX 1Y0MA 1TSFA 1YWOA 1ARKA 1V76A 2K2MA 3CCRA 4ZTJA 1QVGP 1ZLMA 3M53A 3OYIA 1GBRA 2EPDA 4Z8AA 1OEBA 4KRTA 3MKDA 2JTEA 1M5Q1 1TWBA 4JS5A 1YJNQ 3OS2A 1YP5A 1XJWB 2O4XB 2V1QA 4L5GA 5FWCA 1Q7YU 2PTKA 3BFMA 2E12A 5LJ3f 2EVRA 1UGVA 4FYYB 5GAN7 2J6FA 3P8DA 4YTLA 3E2UA 2JN0A 4IUTA 1K4US 2HBWA 1PSFA 4N0AC 3EG0A 1VQ9A 2DETA 1PD1A 3NGPA 4N4HA 1N27A 2LTOA 3JAME 4PJOE 4C92C 2KYMA 5DY9A 4B9XA 1H92A 4ME7A 4C0GA 3FB9A 2JOYA 4JLIA
chains in the Genus database with same CATH topology
2FEIA 1WX6A 1X27A 1AWXA 1T0JA 4A63B 2K9GA 2JW4A 1V1CA 1OOTA 2ED0A 2GBQA 2GQIA 2DBMA 1UJYA 2EYXA 1S1NA 2ROLA 3EGUA 4GLMA 3M0UA 4OMPA 1OPKA 2FPEA 4LE9A 3EG1A 5L23A 2CT3A 2DF6A 2EGEA 1UUEA 4J9FA 1TUCA 4OMQA 2O9VA 2DYBA 2DLPA 4D8KA 2CREA 2KGTA 1QKXA 2L0AA 2CH4W 1UHFA 2L3SA 5GJVB 1W70A 1QLYA 2F2XA 2VWFA 3R6NA 2LJ3A 1H3HA 1ZBJA 1WXUA 1M3AA 2CSIA 2O9SA 4ESRA 1YN8A 4AFSC 1VYTA 2OJ2A 4RTXA 4J9GA 2M0YA 1ABQA 1AD5A 2VKNA 3EHRA 2B86A 1ZUUA 1Y57A 5I11A 2YUPA 4QT7A 2H8HA 4IIOA 2V1RA 2YUNA 3QWXX 3QWYA 2CDTA 1RLQC 4J9IA 2EQIA 1G83A 2GNCA 1OV3A 1M8MA 2LCSA 4J9CA 2J6KA 3TVTA 2AKKA 2KROA 4OMOA 3VS4A 1U3OA 2C0IA 1M3BA 1E6GA 4AG2C 1X6BA 2LP5A 3VS0A 2JMCA 2JXBA 1QCFA 1OPLA 4FSSA 3VS5A 1QKWA 2RNAA 1SPKA 1MV3A 2ABLA 2LJ0A 5FWBA 1U06A 3LH5A 1GBQA 2ENMA 2KXDA 2JM9A 2KRMA 3UATA 4Z89A 2BTTA 2J7IA 1YCSB 2KRNA 1X69A 2FPFA 3RNJA 1BBZA 2OAWA 1UJ0A 3U23A 2NUZA 1A0NB 1PHTA 1RI9A 2I0NA 1G2BA 2K79A 1SEMA 1SRLA 4RTVA 2CSQA 2BZXA 2DNUA 2ROTA 4X1VA 2DL7A 4WCIA 2K7AA 2DRMA 3NMZC 1JXMA 1PRLC 5I22A 5IXFA 1LCKA 3RBBB 2YT6A 1B07A 2EKHA 2KEAA 3VS2A 1BK2A 2C0OA 2O88A 2RQUA 1KSWA 2GTJA 2KBTA 2HDAA 1PRMC 1TG0A 2A08A 2QDLA 4DEYA 2LJ1A 2E5KA 2DA9A 3CQTA 1YWPA 1JU5C 3THKA 1WDXA 2DL3A 2HSPA 4GBQA 2A36A 4HVWA 1E7OA 3M0QA 2IIMA 3ZL7C 2KR3A 2RF0A 1I07A 4ZNXA 1X43A 2RPNA 3UF4A 1T3SA 1FMKA 3M0PA 2RQRA 1WI7A 2VVKA 4AG1C 1JXOA 1ABOA 1J3TA 3M0TA 5EC7A 2P4RA 2GGRA 2YDLA 2DE0X 1UHCA 2SEMA 1EFNA 2BZYA 3M0SA 1WYXA 2DJQA 1M3CA 3KFVA 4M4ZA 1WXTA 4JZ4A 3SHWA 4RTZA 3ULRB 4OMMA 1I0CA 1HSQA 3VS1A 1ZUKA 3PVQA 4ORZA 4CC2A 5IXBA 1W1FA 5IHIA 4AFUC 4CC7A 1W6XA 4CC4B 1VYVA 4HCKA 1NLOC 4F17A 1KIKA 2DL4A 2EGCA 4AFZC 1T3LA 3VRYA 1UG1A 2ECZA 2KXCA 5GJWB 4HVVA 1H8KA 3FJ5A 2LMJA 2DBKA 2SRCA 3IQLA 3PE0A 3H0FA 4IIMA 1K76A 1RUWA 2RQWA 1BU1A 1UECA 2L2PA 2FG0A 4RTWA 1AZGB 4HVUA 1XOVA 2YSQA 4F14A 2PZ1A 5ECAA 2HCKA 4JJBA 3EHQA 4J9HA 5IHKA 2DL8A 2AZSA 3VS7A 1T0HA 2AKLA 1JO8A 2DRKA 2YUQA 1JEGA 3VS3A 3UA7A 2MCNA 1PWTA 4OMLA 4Y92A 3NHNA 1GCQC 1HJDA 2EYZA 4JZ3A 2FRWA 2F2WA 2KYBA 2CUBA 2GTOA 2L3QA 1GRIA 3EG3A 2DX1A 2K6DA 2D8HA 2EYWA 1VYUA 1NEBA 4F16A 3EG2A 4RTYA 1MUZA 1WIEA 1HD3A 1CKAA 1WA7A 1ZUYA 1UDLA 1PKTA 4J9EA 3C0CA 1E6HA 2KRSA 2ED1A 2OI3A 3GBQA 1X6GA 5IHNA 1YNZA 2DMOA 1SHGA 1WFWA 3H0IA 2D1XA 4DEXA 2RQTA 1Z9ZA 2AK5A 4R0KA 2JS2A 2FPDA 2C0TA 3REAB 4K11A 2PNIA 1CSKA 2BZ8A 3I35A 1KFZA 1NLPC 2MIOA 5FW9A 1RLPC 1SRMA 1AZEA 3H41A 1AWWA 1NM7A 4OMNA 2EW3A 2JMAA 1UFFA 1B3QA 4RTUA 2KE9A 2FRYA 3TSZA 4RTTA 1AOJA 1WXBA 4J9BA 1ZSGA 1K0SA 1GFDA 2XMFA 1TUDA 1U5SA 4EIKA 2LQNA 4AFQC 2J06A 4E6RA 2JT4A 1BB9A 1GFCA 2W0ZA 4CC3A 1N5ZA 2M51A 2D8JA 4LN2A 1IO6A 4JJDA 1Z9QA 2F2VA 1QWFA 2CT4A 2DILA 4J9DA 1AVZC 1FYNA 1I1JA 2RQVA 3REBB 4RUGA 2K3BA 1SHFA 1K0XA 2A28A 2EGAA 2MOXA 1X2QA 4JPBW 1QWEA 1X2KA 3H0HA 5HCKA 3SEMA 5IH2A 3PVLA 1M27C 2LNHB 1UTIA 1MV0B 4Z88A 4LUEA 3VS6A 2RMOA 1JQQA 2G6FX 2O31A 2RN8A 2EYYA 2CUDA 2L3PA 1VA7A 1GCPA 3M0RA 2DM1A 3JV3A 3TSWA 2JM8A 2YUOA 4D8DA 2DVJA 2LX7A 1NG2A 2LZ6B 2AZVA 2X3WD 1WLPB 2NWMA 4LNPA 1Y0MA 2ESWA 1YWOA 2J05A 1AWJA 1CKBA 3A98A 1ARKA 2LQWA 3VRZA 3I9QA 2K2MA 1GCQA 1NYFA 1UE9A 1NEGA 1ZLMA 1GBRA 2EPDA 4Z8AA 1OEBA 1AEYA 4KRTA 3UA6A 2JTEA 2HEQA 2D0NA 1ZX6A 1PKSA 1M30A 1SSHA 2KNBB 1YP5A 2V1QA 5FWCA 2CH4A 1K9AA 2PTKA 2KT1A 1GL5A 3I5SA 2W10A 2EVRA 4HXJA 1UGVA 3I5RA 2A37A 2J6FA 2J6OA 2KT8A 4JJCA 1K4US 2HBWA 3EG0A 1NYGA 1PNJA 4LUDA 1KJWA 2EBPA 3NGPA 2JS0A 2KYMA 2FO0A 3O5ZA 1H92A 3NPFA 2DL5A 2X3XD 1AWOA 1K1ZA 2O2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEI A;  1WX6 A;  1X27 A;  1AWX A;  1T0J A;  4A63 B;  2K9G A;  2JW4 A;  1V1C A;  1OOT A;  2ED0 A;  2GBQ A;  2GQI A;  2DBM A;  1UJY A;  2EYX A;  1S1N A;  2ROL A;  3EGU A;  4GLM A;  3M0U A;  4OMP A;  1OPK A;  2FPE A;  4LE9 A;  3EG1 A;  5L23 A;  2CT3 A;  2DF6 A;  2EGE A;  1UUE A;  4J9F A;  1TUC A;  4OMQ A;  2O9V A;  2DYB A;  2DLP A;  4D8K A;  2CRE A;  2KGT A;  1QKX A;  2L0A A;  2CH4 W;  1UHF A;  2L3S A;  5GJV B;  1W70 A;  1QLY A;  2F2X A;  2VWF A;  3R6N A;  2LJ3 A;  1H3H A;  1ZBJ A;  1WXU A;  1M3A A;  2CSI A;  2O9S A;  4ESR A;  1YN8 A;  4AFS C;  1VYT A;  2OJ2 A;  4RTX A;  4J9G A;  2M0Y A;  1ABQ A;  1AD5 A;  2VKN A;  3EHR A;  2B86 A;  1ZUU A;  1Y57 A;  5I11 A;  2YUP A;  4QT7 A;  2H8H A;  4IIO A;  2V1R A;  2YUN A;  3QWX X;  3QWY A;  2CDT A;  1RLQ C;  4J9I A;  2EQI A;  1G83 A;  2GNC A;  1OV3 A;  1M8M A;  2LCS A;  4J9C A;  2J6K A;  3TVT A;  2AKK A;  2KRO A;  4OMO A;  3VS4 A;  1U3O A;  2C0I A;  1M3B A;  1E6G A;  4AG2 C;  1X6B A;  2LP5 A;  3VS0 A;  2JMC A;  2JXB A;  1QCF A;  1OPL A;  4FSS A;  3VS5 A;  1QKW A;  2RNA A;  1SPK A;  1MV3 A;  2ABL A;  2LJ0 A;  5FWB A;  1U06 A;  3LH5 A;  1GBQ A;  2ENM A;  2KXD A;  2JM9 A;  2KRM A;  3UAT A;  4Z89 A;  2BTT A;  2J7I A;  1YCS B;  2KRN A;  1X69 A;  2FPF A;  3RNJ A;  1BBZ A;  2OAW A;  1UJ0 A;  3U23 A;  2NUZ A;  1A0N B;  1PHT A;  1RI9 A;  2I0N A;  1G2B A;  2K79 A;  1SEM A;  1SRL A;  4RTV A;  2CSQ A;  2BZX A;  2DNU A;  2ROT A;  4X1V A;  2DL7 A;  4WCI A;  2K7A A;  2DRM A;  3NMZ C;  1JXM A;  1PRL C;  5I22 A;  5IXF A;  1LCK A;  3RBB B;  2YT6 A;  1B07 A;  2EKH A;  2KEA A;  3VS2 A;  1BK2 A;  2C0O A;  2O88 A;  2RQU A;  1KSW A;  2GTJ A;  2KBT A;  2HDA A;  1PRM C;  1TG0 A;  2A08 A;  2QDL A;  4DEY A;  2LJ1 A;  2E5K A;  2DA9 A;  3CQT A;  1YWP A;  1JU5 C;  3THK A;  1WDX A;  2DL3 A;  2HSP A;  4GBQ A;  2A36 A;  4HVW A;  1E7O A;  3M0Q A;  2IIM A;  3ZL7 C;  2KR3 A;  2RF0 A;  1I07 A;  4ZNX A;  1X43 A;  2RPN A;  3UF4 A;  1T3S A;  1FMK A;  3M0P A;  2RQR A;  1WI7 A;  2VVK A;  4AG1 C;  1JXO A;  1ABO A;  1J3T A;  3M0T A;  5EC7 A;  2P4R A;  2GGR A;  2YDL A;  2DE0 X;  1UHC A;  2SEM A;  1EFN A;  2BZY A;  3M0S A;  1WYX A;  2DJQ A;  1M3C A;  3KFV A;  4M4Z A;  1WXT A;  4JZ4 A;  3SHW A;  4RTZ A;  3ULR B;  4OMM A;  1I0C A;  1HSQ A;  3VS1 A;  1ZUK A;  3PVQ A;  4ORZ A;  4CC2 A;  5IXB A;  1W1F A;  5IHI A;  4AFU C;  4CC7 A;  1W6X A;  4CC4 B;  1VYV A;  4HCK A;  1NLO C;  4F17 A;  1KIK A;  2DL4 A;  2EGC A;  4AFZ C;  1T3L A;  3VRY A;  1UG1 A;  2ECZ A;  2KXC A;  5GJW B;  4HVV A;  1H8K A;  3FJ5 A;  2LMJ A;  2DBK A;  2SRC A;  3IQL A;  3PE0 A;  3H0F A;  4IIM A;  1K76 A;  1RUW A;  2RQW A;  1BU1 A;  1UEC A;  2L2P A;  2FG0 A;  4RTW A;  1AZG B;  4HVU A;  1XOV A;  2YSQ A;  4F14 A;  2PZ1 A;  5ECA A;  2HCK A;  4JJB A;  3EHQ A;  4J9H A;  5IHK A;  2DL8 A;  2AZS A;  3VS7 A;  1T0H A;  2AKL A;  1JO8 A;  2DRK A;  2YUQ A;  1JEG A;  3VS3 A;  3UA7 A;  2MCN A;  1PWT A;  4OML A;  4Y92 A;  3NHN A;  1GCQ C;  1HJD A;  2EYZ A;  4JZ3 A;  2FRW A;  2F2W A;  2KYB A;  2CUB A;  2GTO A;  2L3Q A;  1GRI A;  3EG3 A;  2DX1 A;  2K6D A;  2D8H A;  2EYW A;  1VYU A;  1NEB A;  4F16 A;  3EG2 A;  4RTY A;  1MUZ A;  1WIE A;  1HD3 A;  1CKA A;  1WA7 A;  1ZUY A;  1UDL A;  1PKT A;  4J9E A;  3C0C A;  1E6H A;  2KRS A;  2ED1 A;  2OI3 A;  3GBQ A;  1X6G A;  5IHN A;  1YNZ A;  2DMO A;  1SHG A;  1WFW A;  3H0I A;  2D1X A;  4DEX A;  2RQT A;  1Z9Z A;  2AK5 A;  4R0K A;  2JS2 A;  2FPD A;  2C0T A;  3REA B;  4K11 A;  2PNI A;  1CSK A;  2BZ8 A;  3I35 A;  1KFZ A;  1NLP C;  2MIO A;  5FW9 A;  1RLP C;  1SRM A;  1AZE A;  3H41 A;  1AWW A;  1NM7 A;  4OMN A;  2EW3 A;  2JMA A;  1UFF A;  1B3Q A;  4RTU A;  2KE9 A;  2FRY A;  3TSZ A;  4RTT A;  1AOJ A;  1WXB A;  4J9B A;  1ZSG A;  1K0S A;  1GFD A;  2XMF A;  1TUD A;  1U5S A;  4EIK A;  2LQN A;  4AFQ C;  2J06 A;  4E6R A;  2JT4 A;  1BB9 A;  1GFC A;  2W0Z A;  4CC3 A;  1N5Z A;  2M51 A;  2D8J A;  4LN2 A;  1IO6 A;  4JJD A;  1Z9Q A;  2F2V A;  1QWF A;  2CT4 A;  2DIL A;  4J9D A;  1AVZ C;  1FYN A;  1I1J A;  2RQV A;  3REB B;  4RUG A;  2K3B A;  1SHF A;  1K0X A;  2A28 A;  2EGA A;  2MOX A;  1X2Q A;  4JPB W;  1QWE A;  1X2K A;  3H0H A;  5HCK A;  3SEM A;  5IH2 A;  3PVL A;  1M27 C;  2LNH B;  1UTI A;  1MV0 B;  4Z88 A;  4LUE A;  3VS6 A;  2RMO A;  1JQQ A;  2G6F X;  2O31 A;  2RN8 A;  2EYY A;  2CUD A;  2L3P A;  1VA7 A;  1GCP A;  3M0R A;  2DM1 A;  3JV3 A;  3TSW A;  2JM8 A;  2YUO A;  4D8D A;  2DVJ A;  2LX7 A;  1NG2 A;  2LZ6 B;  2AZV A;  2X3W D;  1WLP B;  2NWM A;  4LNP A;  1Y0M A;  2ESW A;  1YWO A;  2J05 A;  1AWJ A;  1CKB A;  3A98 A;  1ARK A;  2LQW A;  3VRZ A;  3I9Q A;  2K2M A;  1GCQ A;  1NYF A;  1UE9 A;  1NEG A;  1ZLM A;  1GBR A;  2EPD A;  4Z8A A;  1OEB A;  1AEY A;  4KRT A;  3UA6 A;  2JTE A;  2HEQ A;  2D0N A;  1ZX6 A;  1PKS A;  1M30 A;  1SSH A;  2KNB B;  1YP5 A;  2V1Q A;  5FWC A;  2CH4 A;  1K9A A;  2PTK A;  2KT1 A;  1GL5 A;  3I5S A;  2W10 A;  2EVR A;  4HXJ A;  1UGV A;  3I5R A;  2A37 A;  2J6F A;  2J6O A;  2KT8 A;  4JJC A;  1K4U S;  2HBW A;  3EG0 A;  1NYG A;  1PNJ A;  4LUD A;  1KJW A;  2EBP A;  3NGP A;  2JS0 A;  2KYM A;  2FO0 A;  3O5Z A;  1H92 A;  3NPF A;  2DL5 A;  2X3X D;  1AWO A;  1K1Z A;  2O2O A; 
#chains in the Genus database with same CATH topology
 2DZ9 A;  1T0J A;  2MYS A;  1VQL Q;  2K9G A;  5KYN A;  3Q1J A;  1OOT A;  4J6X A;  4C5I A;  4C92 B;  3DKM A;  1TOV A;  4QQD A;  1XTD A;  3LH0 A;  1RAI B;  2DEU A;  2YRD A;  1OZ3 A;  1Y96 B;  2LC4 A;  3X25 B;  4OMP A;  3V7R A;  5L23 A;  4JDS A;  5FU6 C;  4J9F A;  1QVF A;  1YJW Q;  5GAO n;  1QKX A;  2CH4 W;  2L3S A;  2C06 A;  1QLY A;  2BE9 B;  2VWF A;  3PIO A;  2LJ3 A;  1Q81 U;  2YXY A;  5FU6 B;  3G71 A;  4QQG A;  3EAE A;  4PJM A;  4UC4 A;  5IT9 E;  2EWN A;  1LNX A;  4IUU A;  1X01 A;  2OJ2 A;  3NTI A;  1YI2 A;  2M0Y A;  3BDL A;  2QQA A;  1KHC A;  3M9Q A;  3QYG B;  3G6E T;  1ZUU A;  4AT1 B;  3A8M B;  6AT1 B;  3QWY A;  2CDT A;  5KYW A;  1Q7Y R;  5GAN g;  2QGG A;  4Y91 A;  4V2S A;  2GNC A;  3H8Z A;  1B34 B;  4XTX A;  4J9C A;  3L2W A;  2AKK A;  4OMO A;  4IKF A;  4ELZ C;  1D09 B;  3GLX A;  3OY9 A;  4XTV A;  4M7A D;  1M3B A;  1WNL A;  4FU6 A;  1QCF A;  3JCM h;  3OYC A;  1JJ2 S;  1VQN Q;  1SPK A;  1PSE A;  2DVE A;  4HT8 A;  2EJF A;  3JB9 G;  2ABL A;  2LJ0 A;  1U06 A;  3LGL A;  2E4H A;  2KXD A;  4OB0 B;  3MJX A;  5CKH A;  3CC2 Q;  2FPF A;  5GAM h;  5LJ3 j;  2VXE A;  3G7Z A;  3CXC A;  2RK2 A;  3CBO A;  1PHT A;  1ACM B;  4FYV B;  1ZA1 B;  3OYD A;  1YIJ T;  1G3S A;  2IG0 A;  1SEM A;  2QXF A;  2RA2 A;  2DL7 A;  2XHC A;  4E47 A;  2QGF B;  2DRM A;  2CP5 A;  2MI6 A;  5D7U A;  3TEE A;  1LCK A;  3RBB B;  1QVF P;  3J80 E;  2EKH A;  3JCM P;  3S6W A;  4M75 E;  4ZN1 A;  1IRE B;  2KDS A;  4RMO A;  2QI2 A;  1TTH B;  2RQU A;  1Q81 R;  2HDA A;  2FZK B;  3OYA A;  1TG0 A;  2HAX A;  2LJ1 A;  3VV0 A;  1R0C B;  3SB2 A;  2P0P A;  1VQ4 A;  4MDX A;  2QDY B;  2HSP A;  2PU9 B;  3PMI A;  2DEQ A;  2RJE A;  3M0Q A;  3ZL7 C;  2KR3 A;  3CCS T;  3PNW C;  2QEX Q;  1FXX A;  3CC4 A;  1T3S A;  3QJ6 A;  2RQR A;  2RHI A;  1ABO A;  4N4I A;  2DE0 X;  2SEM A;  2H3E B;  1VIF A;  3ME9 A;  3CCJ Q;  2DK3 A;  4M4Z A;  4LDU A;  4PJO A;  1FMV A;  3OSV A;  1YIJ Q;  5GAN j;  1W1F A;  1NJI U;  5IHI A;  3CME T;  2K5I A;  4HCK A;  2BKD N;  2DL4 A;  2RI5 A;  2HL3 A;  3RKW A;  3VRY A;  2E41 A;  2ECZ A;  1YIT T;  3FJ5 A;  4WTO B;  2DO3 A;  5GAN 4;  3PE0 A;  2CP0 A;  1TH7 A;  4M7D E;  1K76 A;  2HKQ B;  5GAN e;  4RTW A;  3M57 A;  1NZ9 A;  4KUI A;  5ECA A;  2HCK A;  4LDX A;  3EHQ A;  4A4H A;  2XIC A;  5GAO r;  4BAC A;  1WGS A;  3UA7 A;  2MCN A;  3RDV A;  4OML A;  2JTF A;  4Y92 A;  3NHN A;  1GCQ C;  2Y4X A;  2RM4 A;  1BIA A;  1RAA B;  2A0F B;  2CGH A;  2MK5 A;  2YHT A;  2DJZ A;  1NEB A;  3LW5 E;  3EG2 A;  1KQS P;  4RTY A;  3R6O A;  2V8I A;  3E9F A;  1HD3 A;  4FL6 A;  4BUG A;  4O6J A;  2PQW A;  2XI9 A;  4C0Z A;  1M2O A;  2EQJ A;  3V7S A;  1VQ7 T;  3L1A A;  4J8O A;  2R57 A;  7AT1 B;  1WFW A;  4DEX A;  1Z9Z A;  3OBY A;  2QG9 B;  5KE2 A;  2K3X A;  3VYG A;  3M4Y A;  4XTW A;  4QKU A;  2FHD A;  1VQL A;  1M8V A;  4P5N A;  2CZ6 B;  4LDW A;  3HFN A;  2A3L A;  5GMK l;  1AZE A;  4ELY C;  1KD1 U;  4OMN A;  2EW3 A;  1UFF A;  2LCC A;  5KYX B;  1NJI R;  2FRY A;  5GAO q;  4M7D G;  1Q81 C;  4RTT A;  3QDF A;  5D6X A;  3VJP A;  4J9B A;  1ZSG A;  1K0S A;  2DER A;  4QVZ A;  2QK0 A;  4A4K A;  4J7I A;  2J06 A;  1YJW A;  2LVM A;  2YRC A;  3JCM f;  1VQM A;  1QMC A;  4DOV A;  4WF2 A;  2ZGW A;  1QWF A;  1F1B B;  5GAN 5;  4NOY A;  3WVE B;  4BY6 C;  3JCM b;  2K3Y A;  1I1J A;  2QQB A;  5GAM f;  2ZPF B;  1DJ7 B;  2QQS A;  1X2Q A;  4JPB W;  1M2V A;  1WPY A;  2YLC A;  3SEM A;  1MV0 B;  5LL6 S;  4C8Q E;  4BY6 B;  3VS6 A;  4OGC A;  2CUD A;  1IHV A;  2P0Q A;  4DBR A;  2DM1 A;  3LWI A;  2HQX A;  5FLX E;  1X6O A;  2JM8 A;  1N8R C;  5GAO m;  1R0B G;  4IUR A;  2F5T X;  1OX8 A;  1ZA2 B;  2DXB A;  5CQY A;  1WLP B;  1VQ5 T;  3ER0 A;  3T9N A;  3QO3 A;  3MEV A;  1CKB A;  2CP2 A;  2OTJ T;  2DTH A;  1VQN A;  1NYF A;  5LJ3 d;  3CC7 Q;  1JBM A;  2G3R A;  1RAB B;  2LQK A;  3UA6 A;  2HEQ A;  2D0N A;  3VKI A;  3CXC S;  3CPW A;  4LDY A;  1ZX6 A;  1YHQ Q;  1PKS A;  5LJ5 j;  2KNB B;  4OMF B;  3CC2 A;  1WHL A;  3GNG A;  4F7U F;  3TRE A;  1KD1 R;  3JCM W;  4KT0 E;  2EFI A;  3F70 A;  1JJ2 A;  2KT1 A;  3OYH A;  2BIV A;  4E7S A;  2RD1 A;  3L2R A;  4HXJ A;  1V29 B;  2A37 A;  3V8K A;  4N4G A;  5CKE A;  3JB9 I;  1BCO A;  2EJ9 A;  2M02 A;  2KT8 A;  1LJO A;  4XQ3 A;  2CZ1 B;  4M7D A;  5LJ5 e;  3OYG A;  2JS0 A;  3OQ5 A;  2FO0 A;  3OW2 P;  4RKU E;  2DL5 A;  2NUT A;  5KYU B;  1K1Z A;  3CCV T;  2ZPE B;  1K73 C;  5EG2 A;  4A63 B;  2JW4 A;  2ED0 A;  2GBQ A;  1I4K 1;  2EYX A;  1TUG B;  4PLI A;  4E7Z A;  1S1N A;  2ROL A;  3TQ7 P;  1X75 C;  4PFO A;  1N6A A;  2D9T A;  1RI0 A;  2BE7 D;  3M0U A;  2QEX A;  3SFM A;  1Y7X A;  1MNE A;  1OPK A;  5GAN d;  2XDD A;  2DF6 A;  2QTX A;  3CMA T;  5GAN 6;  2RH2 A;  2LDM A;  3GF5 A;  1BI0 A;  2CYZ B;  3ZEH A;  5L8R E;  3CCQ T;  1H3Z A;  3CCJ A;  1WJQ A;  4F7U B;  1I81 A;  1WHH A;  3OMG A;  1OZ2 A;  3CCL A;  1PCX A;  4RG2 A;  5GMK h;  1M90 U;  2KVQ G;  1ZBJ A;  1M3A A;  2L5Q A;  2EQU A;  3INZ A;  2CSI A;  5GAO l;  2EQM A;  1S72 Q;  3EFO B;  5C6S A;  1FMW A;  3UPU A;  3CBM A;  4C5E A;  1NBE B;  1Y57 A;  1HXD A;  1YJ9 A;  3QWX X;  2D6F A;  4HCB A;  2LQ8 A;  3OS5 A;  3CCV Q;  4ZN3 A;  3JSC A;  4J9I A;  1G83 A;  1RAG B;  2QA4 Q;  3CCM T;  1JJ2 P;  3SDZ A;  1IGU A;  1M2V B;  2LCS A;  3JB9 D;  2HKN A;  5J26 A;  2KRO A;  4OB1 B;  3X20 B;  3VS4 A;  3MHX A;  2EAY A;  5DLQ E;  4M7A C;  2C0I A;  2MPX C;  1ZQ1 A;  2R58 A;  1E6G A;  2P0K A;  4AG2 C;  2DKG A;  3CMA Q;  3A8L B;  2KSS A;  3I55 T;  3VS0 A;  2JMC A;  3P8H A;  1QKW A;  1D0Z A;  5FWB A;  4XU0 A;  4M7A B;  2VXF A;  1ZBX A;  2XID A;  2KRM A;  4AMC A;  3RES A;  3ASK A;  3EGX A;  3RMQ A;  1YCS B;  2YWW A;  1X69 A;  3TU4 K;  3HFO A;  1BBZ A;  3RNJ A;  1VQK T;  4MZT A;  1KD1 C;  4XU1 A;  3CCE Q;  3U23 A;  2NUZ A;  3PT9 A;  1JB0 E;  2I0N A;  5KYY A;  2K79 A;  1UEB A;  1SRL A;  3EGD B;  3L42 A;  5LJ3 g;  2DNU A;  2ROT A;  3QDR B;  4X1V A;  4WCI A;  2NUP B;  1JXM A;  5I22 A;  1MMN A;  3KBG A;  2ZCF B;  2C0O A;  3OYL A;  3CCU A;  2O88 A;  2AT1 B;  4PJL A;  1M90 R;  1EIF A;  1WJR A;  2CZ7 B;  2KBT A;  2ZPI B;  4ZGD B;  5CIU A;  1QQJ A;  4ZGJ B;  1KQ2 A;  3CD6 T;  4Y28 E;  1JU5 C;  4D6W A;  4OVA A;  1VQO T;  3I56 T;  3I55 Q;  4PK4 A;  1AHJ B;  3OB9 A;  1KK7 A;  4ZNX A;  3X28 B;  1H64 1;  1M9S A;  4JRI A;  2NUT B;  5CK9 A;  3M0P A;  2Z0W A;  1RAF B;  3M0T A;  2P4R A;  2WAC A;  1UHC A;  1EFN A;  4MZM A;  2BZY A;  2DJQ A;  3KFV A;  5HK3 A;  2QAZ A;  4OMM A;  1I0C A;  3FRN A;  2M9U A;  1VQ8 T;  5HY6 A;  1W6X A;  4CC4 B;  3OYK A;  3HRT A;  4MZP A;  4F17 A;  3MP8 A;  4OB2 B;  4AFZ C;  1G3Y A;  3OBW A;  4PJO G;  1H8K A;  3M5A A;  2LMJ A;  3QKJ A;  2DBK A;  2SRC A;  5CR2 A;  5DLO A;  4IIM A;  2DXC A;  2K4Y A;  5LJ5 d;  3CPW S;  2FG0 A;  4HVU A;  1XOV A;  4KUD K;  2PZ1 A;  2L8D A;  3QII A;  4BD3 A;  2PVO B;  1QW1 A;  4XTZ A;  3I56 Q;  3CC7 A;  1TS9 A;  2MMP A;  2OTL T;  1JO8 A;  2MF2 A;  1WHJ A;  3M56 A;  4B6M A;  3VS3 A;  1VQP T;  3G4S A;  1YHQ A;  2HL5 C;  1N8R U;  3JRZ A;  1VQ6 T;  1MMA A;  1HJD A;  3OYF A;  2GTO A;  3EG3 A;  2D8H A;  2EYW A;  2QAS A;  3JCM c;  1R77 A;  2E64 A;  4JS4 A;  1PD0 A;  1MUZ A;  3NTK A;  1WA7 A;  2V8K A;  3L2U A;  3GBQ A;  3G6E Q;  1NE8 A;  3PGG A;  2RI3 A;  4EPC A;  1QVG S;  2XU8 A;  2Y90 A;  2AIR B;  2QQR A;  2RO0 A;  5IAY A;  3VUZ A;  3KUF A;  2EJG A;  4M77 E;  2C0T A;  3D7S B;  5LJ3 e;  2X51 A;  4M78 E;  2PNI A;  3MEU A;  1I5O B;  3CCL T;  1I8F A;  3EGX B;  2IVW A;  1RLP C;  1D1A A;  4GLK A;  1AWW A;  2JMA A;  3RKX A;  4RTU A;  4EMK A;  2KE9 A;  2M1H A;  5I2S A;  1M90 C;  3BW1 A;  2E6Z A;  3TSZ A;  2K5F A;  5KYY B;  5IN1 A;  1AOJ A;  5GMK m;  2XMF A;  1TUD A;  1QVP A;  1P92 A;  4AFQ C;  3ZFJ A;  2CP6 A;  3EH2 A;  3UDC A;  3MO8 A;  4R55 A;  1K73 U;  4IUP A;  3N5B B;  4J7F A;  2W0Z A;  4CC3 A;  1N5Z A;  1IO6 A;  1Z9Q A;  1FYN A;  3CCR T;  3REB B;  4RUG A;  1OU9 A;  4FYW B;  4PL6 A;  5CVI A;  1S72 A;  5KE3 A;  2CS7 A;  2E6N A;  3KXT A;  2KMT A;  1RL2 A;  3H0H A;  3A8H B;  5IH2 A;  2V8J A;  1N8R R;  2RMO A;  2G6F X;  2O31 A;  4OP0 A;  4PNO A;  2RHY A;  1VA7 A;  1G8X A;  1GCP A;  4O5V A;  2M0O A;  2M16 A;  4OGE A;  2QA4 A;  3LWH A;  3M59 A;  4M75 G;  4M77 G;  2E1H A;  3RUX A;  2HD0 A;  3G1J A;  4M78 G;  5KCH A;  4D8D A;  1W2B S;  2JJ9 A;  2DVJ A;  1I5L A;  3CXC P;  1VQ9 T;  1N9R A;  4C92 E;  3SWN A;  2NWM A;  2QQ9 A;  1ZSZ A;  4LNP A;  3CCS Q;  2ESW A;  5GAN 2;  1AWJ A;  1K9M C;  1YJN A;  1B7T A;  2LQW A;  3VRZ A;  3S3N A;  3I9Q A;  5KYW B;  1BCM A;  2KY9 A;  3GIB A;  3OYY A;  1SKU B;  1WQW A;  4A53 A;  1O75 A;  3CCU T;  3MPU B;  1M30 A;  3HP9 A;  4HT9 A;  2CH4 A;  1K9A A;  2RJC A;  3FIF A;  3P8B B;  1M4Z A;  3CCE A;  3CME Q;  2MAM A;  5LJ5 g;  1WHG A;  3I5S A;  4R56 A;  2W10 A;  5GAO p;  2J6O A;  2KI7 A;  5I2M A;  1D3B A;  5AT1 B;  1YIT Q;  4BI4 A;  4JJC A;  4DOW A;  1K73 R;  1OUL A;  4LUD A;  4OF1 A;  2EBP A;  3X26 B;  2HMA A;  1D1C A;  3G71 T;  3O5Z A;  4PJO F;  3C95 A;  1AWO A;  2OAU A;  2O2O A;  2YLB A;  4RG8 A;  1YI2 T;  2EYQ A;  1W4S A;  1G5V A;  2VB6 A;  3EG9 A;  2GQI A;  3NTH A;  2DBM A;  1UJY A;  1IXD A;  2GQV A;  3EGU A;  4C92 G;  3M54 A;  5CO7 A;  4NS5 A;  3WXM B;  2VGM A;  3HRU A;  3JB9 F;  3EG1 A;  2CT3 A;  2ZPB B;  1SSF A;  3JB9 H;  4EDU A;  2DYB A;  2DLP A;  4D8K A;  4J6W A;  2CRE A;  2KGT A;  2PUO B;  1UHF A;  1VQ7 Q;  1W70 A;  2K57 A;  2F2X A;  3BDU A;  4HA8 A;  3R6N A;  1H3H A;  1UGQ B;  4C5H A;  1G3W A;  1WXU A;  3DLM A;  4M77 A;  2DXU A;  4M75 A;  2XDP A;  4M78 A;  3JCM Q;  3G4S T;  2XDB A;  2O9S A;  4QW2 A;  2COW A;  2LRQ A;  2DAQ A;  4KGV B;  1YN8 A;  4PJO C;  5CKB A;  4AFS C;  1VYT A;  5LJ3 h;  4RTX A;  4J9G A;  1AD5 A;  2A7Y A;  3L2Q A;  5GAM g;  5FRM A;  3URG A;  2B86 A;  2YUP A;  2H8H A;  4IIO A;  3GPL A;  4FT2 A;  1RLQ C;  4E7I A;  2NYS A;  4PJO B;  4FSX A;  1KQ1 A;  2E3I A;  4XAX B;  2HZY A;  1OV3 A;  2IPO B;  3V8L A;  2LT1 A;  2WSF E;  2O4X A;  4PFZ A;  1D1B A;  1U3O A;  2MWO A;  1WQ7 A;  2FL7 A;  3GNF B;  4TVR A;  2DTI A;  1MHN A;  4FSS A;  3VS5 A;  2RNA A;  1MV3 A;  3AT1 B;  1RAD B;  1VQ4 T;  2ENM A;  2JM9 A;  3UAT A;  2BTT A;  3M4G A;  3G6E A;  2KRN A;  8ATC B;  2FZG B;  2HNI A;  2CP3 A;  2OAW A;  3BE3 A;  4RCC A;  2RHU A;  3CC4 T;  1A0N B;  2F69 A;  4N0A A;  2BUD A;  1U1S A;  4JJN K;  1RI9 A;  4RTV A;  2CSQ A;  4C8Q G;  1PG5 B;  1TU0 B;  5GAN h;  2BZX A;  4C92 A;  4BE0 A;  1QVG A;  1PRL C;  1Y96 A;  5D6W A;  1KQS S;  2AHJ B;  1Q82 U;  1VQ5 Q;  3PTA A;  1K8A U;  4M75 F;  1KSW A;  2FB7 A;  5HKC A;  2OTJ Q;  2GTJ A;  1PRM C;  3DB3 A;  1WJS A;  2A08 A;  2QDL A;  4DEY A;  1EZZ B;  2DA9 A;  2E5K A;  3CQT A;  3THK A;  1WDX A;  2DL3 A;  1QP3 A;  2A36 A;  1WHK A;  2IIM A;  1Q86 C;  2VUB A;  4MMK A;  3RR6 A;  3VUB A;  2RPN A;  3DB4 A;  1FMK A;  2DTO A;  1WI7 A;  2V26 A;  1JXO A;  5EC7 A;  1YIJ A;  2PVD B;  5GAM j;  1C0M A;  4Z02 A;  3M0S A;  4C0D C;  1WHM A;  1WYX A;  1M3C A;  1WXT A;  3SHW A;  3ULR B;  3JCM e;  1HSQ A;  4PJO D;  1ZUK A;  2X4W A;  2QTV A;  3PVQ A;  2K5L A;  1R8O B;  3RIR A;  4BI3 A;  5IXB A;  1OQK A;  4AFU C;  2COZ A;  1VOM A;  1B34 A;  3OSS C;  4M75 C;  3CPW P;  1VYV A;  4C0D B;  3HRS A;  3EFS A;  2OX7 A;  5GAM e;  2EGC A;  2CP7 A;  4KBM B;  3CPF A;  2JVV A;  1UG1 A;  2KXC A;  4E2F B;  2L89 A;  1YFN A;  5A0G A;  3H0F A;  4M75 B;  3CCS A;  3E9G A;  1RUW A;  1BU1 A;  2E5Q A;  2LCL A;  4M7D F;  3OA6 A;  4LD6 A;  2COY A;  2KK4 A;  1HYO A;  2L3R A;  4KH1 B;  2LX9 A;  3FLG A;  4F04 B;  5IHK A;  2DL8 A;  3VS7 A;  3RMS A;  2AKL A;  1BKB A;  1W2B A;  2DRK A;  2YUQ A;  1VQL T;  4GY5 A;  4C92 F;  3CCQ Q;  4J5Y A;  1JEG A;  1KC8 U;  1PWT A;  1D0Y A;  4E7H A;  1IZ6 A;  2WSC E;  4BI8 B;  4DBH A;  4FIB A;  3MP6 A;  4JZ3 A;  2FRW A;  1YBY A;  2F2W A;  1Q82 R;  4C8Q A;  2KAF A;  1GRI A;  1K8A R;  2DX1 A;  2CZ0 B;  3CME A;  4ATO A;  4F16 A;  1K9M U;  2JTM A;  3A5Z B;  1YJW T;  1UDL A;  1SG5 A;  3C0C A;  2OI3 A;  1VQM T;  1M1F A;  1YIT A;  1YNZ A;  1SHG A;  3OYN A;  4E7K A;  1M1K C;  3M55 A;  1MMG A;  4R0K A;  4M7D C;  2FPD A;  3CCM Q;  1C1A A;  2P84 A;  4K11 A;  2BZ8 A;  3I35 A;  3OS0 A;  1NLP C;  1JRI A;  2JUF A;  3A1P A;  3QJY A;  2DZC A;  2VV5 A;  1SRM A;  4ZGE B;  1NM7 A;  4MDW A;  4BE1 A;  4M7D B;  1B3Q A;  3H6Z A;  4DA4 A;  4OB3 B;  2X4X A;  3CBP A;  1U1T A;  2EQK A;  3J81 E;  1U5S A;  4A4F A;  3OW2 S;  4E7J A;  3HTR A;  3QXE B;  4FYX B;  1VQ7 A;  1GFC A;  2EKO A;  2M51 A;  3ZBD A;  9ATC B;  1VQK Q;  4LN2 A;  1PM3 A;  5DM7 R;  5GAN 8;  4J9D A;  5A0L A;  5LJ5 h;  2RJF A;  1VQN T;  5CKD A;  1AVZ C;  2RQV A;  3X24 B;  1VQM Q;  1VIE A;  1K0X A;  1N9S A;  5A2Q E;  3RKY A;  2EGA A;  1QWE A;  1X2K A;  3QG1 A;  3CEY A;  4M75 D;  4M77 D;  1KC8 R;  3PVL A;  3CC2 T;  2LNH B;  2GFU A;  1UTI A;  4JRQ A;  4M78 D;  1W2B P;  4Z88 A;  4LUE A;  1BI1 A;  1LVK A;  4C8Q F;  5FRN A;  2R5M A;  2RN8 A;  5GAN f;  1AT1 B;  2L3P A;  3M0R A;  3GP8 A;  1Y71 A;  4Q5W A;  1RAH B;  3C4S A;  3JV3 A;  1D0X A;  3CD6 Q;  1K9M R;  1FWZ A;  2YUO A;  4DQ2 A;  4LDV A;  1VQO Q;  4JUV A;  2LX7 A;  1KHI A;  1NG2 A;  2LZ6 B;  2AZV A;  3HKS A;  3NFC A;  2QYZ A;  2CKK A;  2J05 A;  3A98 A;  4PFP A;  1GCQ A;  5AYF A;  1UE9 A;  1NEG A;  4MML A;  2DIQ A;  1AEY A;  2YRV A;  2JNG A;  1IB8 A;  5A0D A;  2E3H A;  1SSH A;  4F7U E;  1MMD A;  4J6Y A;  3S3O A;  3LGF A;  5M9O A;  2VGN A;  1Q82 C;  1RAC B;  2FYK A;  1VQ8 Q;  2QEX T;  1MGQ A;  1K8A C;  3PFS A;  4KGZ B;  4C8Q C;  4PKC C;  3VU3 C;  1GL5 A;  1IRX A;  5CKF A;  2XK0 A;  3OS1 A;  3I5R A;  5D6Y A;  3CCJ T;  3OYB A;  2NLU A;  4M7D D;  2LNV A;  5KYX A;  1NYG A;  1PNJ A;  4C8Q B;  1KJW A;  3PIP A;  2FVU A;  1VQ5 A;  2RB6 A;  2VAS A;  3JCM d;  3QBY A;  3BY7 A;  2OTJ A;  4C92 D;  3NPF A;  2PUK B;  2X3X D;  2FEI A;  5J3B A;  1WX6 A;  1X27 A;  2OTL Q;  1AWX A;  4J83 A;  1VQP Q;  1V1C A;  3E19 A;  5GAM d;  1YJ9 T;  4XK8 E;  5FRO A;  1KQS A;  1VQ6 Q;  3JCM J;  4PJN A;  3M58 A;  2GF7 A;  4XU3 A;  4IUQ A;  3WVD B;  2XG8 D;  3LX7 A;  4GLM A;  4QQ6 A;  2FPE A;  4CI0 C;  4LE9 A;  3UWN A;  4CRI A;  2EGE A;  1UUE A;  3QYH B;  4M7A E;  1TUC A;  4OMQ A;  2O9V A;  2VC8 A;  1OU8 A;  3OYE A;  2L0A A;  5GJV B;  5CQX A;  2LT4 A;  4F7U G;  1MND A;  1Q86 U;  3EFR A;  3S3M A;  3O8V A;  1XNI A;  4ESR A;  5KH6 A;  3LYI A;  3CCV A;  3QSU A;  1UGP B;  3CCL Q;  4DBQ A;  4DBF A;  1ABQ A;  2VKN A;  3EHR A;  3QPH A;  4VUB A;  1KC8 C;  5I11 A;  4HCZ A;  2E10 A;  4QT7 A;  2ZPG B;  1RAE B;  2V1R A;  2YUN A;  3UT1 A;  3HSB A;  2EQI A;  2PVG B;  8AT1 B;  1HK9 A;  2XKO C;  1YJ9 Q;  4NL2 A;  3FEO A;  1M8M A;  3CMA A;  3V8J A;  3RER A;  2J6K A;  3TVT A;  3CCQ A;  4KUL A;  2KQW A;  1Q7Y C;  3JCM V;  4L6V 5;  5J39 A;  2DPP B;  1X6B A;  2LP5 A;  2JXB A;  4JRK A;  2HBP A;  4HCC A;  1OPL A;  2H3J A;  3CCR Q;  5GAN 3;  1QCN A;  3LH5 A;  1GBQ A;  2DD4 A;  2X35 A;  5GMK j;  2I2L A;  4M7A G;  4C8Q D;  4Z89 A;  3HPW A;  4A4E A;  3H9N A;  5LJ5 f;  4QVD A;  2J7I A;  4B9W A;  2DIG A;  4X9D A;  1UJ0 A;  5KYU A;  1YCY A;  1IHW A;  1FX7 A;  1G2B A;  3CCM A;  3QHS A;  5GMK e;  1BYM A;  2K7A A;  1Y07 A;  3A8O B;  4EMG A;  3NMZ C;  1U8R A;  5IXF A;  1WZO A;  1VQ9 Q;  2YT6 A;  1B07 A;  3MP1 A;  4BE2 A;  2KEA A;  3VS2 A;  1BK2 A;  2X4J A;  3MEW A;  4JRP A;  4ZTF A;  4E7L A;  3I55 A;  4FCY A;  1Q86 R;  1M1K U;  3C12 A;  3MEA A;  2VYT A;  4XTU A;  4EMH A;  5I21 A;  1YWP A;  4L59 A;  4F7U A;  1OYX A;  3CCU Q;  4EMK C;  1QVF S;  4GBQ A;  3FJP A;  1GXI E;  3C94 A;  4HVW A;  1E7O A;  2D0Q B;  1BIB A;  1LOJ A;  3GOX A;  3VYH B;  2RF0 A;  1I07 A;  1VQK A;  3J7A F;  1X43 A;  1BI3 A;  3UF4 A;  3EFO A;  1G3T A;  2GFA A;  2VVK A;  4AG1 C;  3SD4 A;  3JCM g;  4EMK B;  1J3T A;  3CC7 T;  2YDL A;  2GGR A;  2E65 A;  2Y4Y A;  5KCO A;  3OW2 A;  1YHQ T;  2ZPH B;  2MWP A;  4JZ4 A;  4RTZ A;  1SF9 A;  2DFU A;  3MET A;  2EIF A;  4HKE A;  3VS1 A;  4ORZ A;  4CC2 A;  4CC7 A;  3G71 Q;  3JB9 J;  1NPP A;  2DD5 A;  4BDY A;  1NLO C;  4KH0 B;  1KIK A;  3CD6 A;  1YI2 Q;  1T3L A;  2DXT A;  2WSE E;  2RK1 A;  5GJW B;  1VQO A;  4HVV A;  3I56 A;  4II1 A;  3LLR A;  4FW2 A;  2B8A A;  3IQL A;  2RHZ A;  1EX4 A;  2RQW A;  1UEC A;  2L2P A;  1AZG B;  2YSQ A;  4F14 A;  1ZHI A;  4JJB A;  4M7A A;  4RCB A;  1QCO A;  3OMC A;  4J9H A;  3V7C A;  4KGX B;  3SWN C;  4C0F A;  1ZSZ C;  2AZS A;  1T0H A;  3HHT B;  2RHX A;  3HL8 A;  2F5K A;  4PLL A;  1QP2 A;  3OYM A;  4LD9 K;  1OI1 A;  1VUB A;  3QUI A;  2EYZ A;  4FM4 B;  2KYB A;  2CUB A;  2L3Q A;  1M1G A;  2O01 E;  2K6D A;  3SWN B;  1VQ8 A;  1ZSZ B;  1VYU A;  1PC0 A;  4PJJ A;  4NL3 A;  3G4S Q;  3EGD A;  1M1K R;  2ATC B;  2NUP A;  1XQH A;  1WIE A;  1CKA A;  1ZUY A;  1PKT A;  4J9E A;  1E6H A;  2KRS A;  1OX9 A;  2ED1 A;  5C0M A;  4IUV A;  1X6G A;  5IHN A;  1BI2 A;  2DYI A;  3E1S A;  2DMO A;  5CCA A;  3A8G B;  3H0I A;  2D1X A;  2RQT A;  2AK5 A;  2E70 A;  4X9C A;  3MCA B;  2HQE A;  2K2V A;  4A4G A;  2JS2 A;  1S72 T;  3REA B;  3L2Z A;  4ANJ A;  4M77 F;  4XU2 A;  4BDZ A;  3OYJ A;  2P4T A;  1CSK A;  4M78 F;  3TCJ A;  2OTL A;  3L2V A;  2MIO A;  5FW9 A;  1KFZ A;  1VQP A;  2RJD A;  4LXC A;  4X34 A;  1VQ6 A;  3AHU A;  3H41 A;  1UB4 A;  4C5G A;  1D3B B;  1O9S A;  2X4Y A;  1LPL A;  3QZ5 B;  4JLG A;  2QA4 T;  1WXB A;  2R5A A;  2JZ2 A;  1GFD A;  1Q95 G;  4EIK A;  1VQ4 Q;  2ZZD A;  2LQN A;  4E6R A;  2JT4 A;  2XD0 A;  4FT4 A;  3DLL A;  1NJI C;  3EH1 A;  1BB9 A;  3FDR A;  2X9H A;  2D8J A;  1KG1 A;  2ZAE A;  3EG9 B;  2F1L A;  4JJD A;  5FU7 C;  2F2V A;  5HK0 A;  2RI2 A;  1YJN T;  2CT4 A;  1C6V X;  5GMK i;  2DIL A;  3CC4 Q;  4M7A F;  4A54 A;  2K3B A;  1NPR A;  1SHF A;  2HSE B;  2A28 A;  3QZ9 B;  2MOX A;  4M77 C;  5HCK A;  4XTY A;  1IGQ A;  4M78 C;  5FU7 B;  1M27 C;  4BB7 A;  5CAI A;  1UGS B;  2GCX A;  3PMT A;  1JQQ A;  2EYY A;  3CCE T;  1TXQ A;  2FZC B;  4M77 B;  3TSW A;  4M78 B;  3FC3 A;  4QVC A;  1UGR B;  2X3W D;  4FW1 A;  2HQH A;  3JCM X;  1Y0M A;  1TSF A;  1YWO A;  1ARK A;  1V76 A;  2K2M A;  3CCR A;  4ZTJ A;  1QVG P;  1ZLM A;  3M53 A;  3OYI A;  1GBR A;  2EPD A;  4Z8A A;  1OEB A;  4KRT A;  3MKD A;  2JTE A;  1M5Q 1;  1TWB A;  4JS5 A;  1YJN Q;  3OS2 A;  1YP5 A;  1XJW B;  2O4X B;  2V1Q A;  4L5G A;  5FWC A;  1Q7Y U;  2PTK A;  3BFM A;  2E12 A;  5LJ3 f;  2EVR A;  1UGV A;  4FYY B;  5GAN 7;  2J6F A;  3P8D A;  4YTL A;  3E2U A;  2JN0 A;  4IUT A;  1K4U S;  2HBW A;  1PSF A;  4N0A C;  3EG0 A;  1VQ9 A;  2DET A;  1PD1 A;  3NGP A;  4N4H A;  1N27 A;  2LTO A;  3JAM E;  4PJO E;  4C92 C;  2KYM A;  5DY9 A;  4B9X A;  1H92 A;  4ME7 A;  4C0G A;  3FB9 A;  2JOY A;  4JLI A; 
#chains in the Genus database with same CATH homology
 2FEI A;  1WX6 A;  1X27 A;  1AWX A;  1T0J A;  4A63 B;  2K9G A;  2JW4 A;  1V1C A;  1OOT A;  2ED0 A;  2GBQ A;  2GQI A;  2DBM A;  1UJY A;  2EYX A;  1S1N A;  2ROL A;  3EGU A;  4GLM A;  3M0U A;  4OMP A;  1OPK A;  2FPE A;  4LE9 A;  3EG1 A;  5L23 A;  2CT3 A;  2DF6 A;  2EGE A;  1UUE A;  4J9F A;  1TUC A;  4OMQ A;  2O9V A;  2DYB A;  2DLP A;  4D8K A;  2CRE A;  2KGT A;  1QKX A;  2L0A A;  2CH4 W;  1UHF A;  2L3S A;  5GJV B;  1W70 A;  1QLY A;  2F2X A;  2VWF A;  3R6N A;  2LJ3 A;  1H3H A;  1ZBJ A;  1WXU A;  1M3A A;  2CSI A;  2O9S A;  4ESR A;  1YN8 A;  4AFS C;  1VYT A;  2OJ2 A;  4RTX A;  4J9G A;  2M0Y A;  1ABQ A;  1AD5 A;  2VKN A;  3EHR A;  2B86 A;  1ZUU A;  1Y57 A;  5I11 A;  2YUP A;  4QT7 A;  2H8H A;  4IIO A;  2V1R A;  2YUN A;  3QWX X;  3QWY A;  2CDT A;  1RLQ C;  4J9I A;  2EQI A;  1G83 A;  2GNC A;  1OV3 A;  1M8M A;  2LCS A;  4J9C A;  2J6K A;  3TVT A;  2AKK A;  2KRO A;  4OMO A;  3VS4 A;  1U3O A;  2C0I A;  1M3B A;  1E6G A;  4AG2 C;  1X6B A;  2LP5 A;  3VS0 A;  2JMC A;  2JXB A;  1QCF A;  1OPL A;  4FSS A;  3VS5 A;  1QKW A;  2RNA A;  1SPK A;  1MV3 A;  2ABL A;  2LJ0 A;  5FWB A;  1U06 A;  3LH5 A;  1GBQ A;  2ENM A;  2KXD A;  2JM9 A;  2KRM A;  3UAT A;  4Z89 A;  2BTT A;  2J7I A;  1YCS B;  2KRN A;  1X69 A;  2FPF A;  3RNJ A;  1BBZ A;  2OAW A;  1UJ0 A;  3U23 A;  2NUZ A;  1A0N B;  1PHT A;  1RI9 A;  2I0N A;  1G2B A;  2K79 A;  1SEM A;  1SRL A;  4RTV A;  2CSQ A;  2BZX A;  2DNU A;  2ROT A;  4X1V A;  2DL7 A;  4WCI A;  2K7A A;  2DRM A;  3NMZ C;  1JXM A;  1PRL C;  5I22 A;  5IXF A;  1LCK A;  3RBB B;  2YT6 A;  1B07 A;  2EKH A;  2KEA A;  3VS2 A;  1BK2 A;  2C0O A;  2O88 A;  2RQU A;  1KSW A;  2GTJ A;  2KBT A;  2HDA A;  1PRM C;  1TG0 A;  2A08 A;  2QDL A;  4DEY A;  2LJ1 A;  2E5K A;  2DA9 A;  3CQT A;  1YWP A;  1JU5 C;  3THK A;  1WDX A;  2DL3 A;  2HSP A;  4GBQ A;  2A36 A;  4HVW A;  1E7O A;  3M0Q A;  2IIM A;  3ZL7 C;  2KR3 A;  2RF0 A;  1I07 A;  4ZNX A;  1X43 A;  2RPN A;  3UF4 A;  1T3S A;  1FMK A;  3M0P A;  2RQR A;  1WI7 A;  2VVK A;  4AG1 C;  1JXO A;  1ABO A;  1J3T A;  3M0T A;  5EC7 A;  2P4R A;  2GGR A;  2YDL A;  2DE0 X;  1UHC A;  2SEM A;  1EFN A;  2BZY A;  3M0S A;  1WYX A;  2DJQ A;  1M3C A;  3KFV A;  4M4Z A;  1WXT A;  4JZ4 A;  3SHW A;  4RTZ A;  3ULR B;  4OMM A;  1I0C A;  1HSQ A;  3VS1 A;  1ZUK A;  3PVQ A;  4ORZ A;  4CC2 A;  5IXB A;  1W1F A;  5IHI A;  4AFU C;  4CC7 A;  1W6X A;  4CC4 B;  1VYV A;  4HCK A;  1NLO C;  4F17 A;  1KIK A;  2DL4 A;  2EGC A;  4AFZ C;  1T3L A;  3VRY A;  1UG1 A;  2ECZ A;  2KXC A;  5GJW B;  4HVV A;  1H8K A;  3FJ5 A;  2LMJ A;  2DBK A;  2SRC A;  3IQL A;  3PE0 A;  3H0F A;  4IIM A;  1K76 A;  1RUW A;  2RQW A;  1BU1 A;  1UEC A;  2L2P A;  2FG0 A;  4RTW A;  1AZG B;  4HVU A;  1XOV A;  2YSQ A;  4F14 A;  2PZ1 A;  5ECA A;  2HCK A;  4JJB A;  3EHQ A;  4J9H A;  5IHK A;  2DL8 A;  2AZS A;  3VS7 A;  1T0H A;  2AKL A;  1JO8 A;  2DRK A;  2YUQ A;  1JEG A;  3VS3 A;  3UA7 A;  2MCN A;  1PWT A;  4OML A;  4Y92 A;  3NHN A;  1GCQ C;  1HJD A;  2EYZ A;  4JZ3 A;  2FRW A;  2F2W A;  2KYB A;  2CUB A;  2GTO A;  2L3Q A;  1GRI A;  3EG3 A;  2DX1 A;  2K6D A;  2D8H A;  2EYW A;  1VYU A;  1NEB A;  4F16 A;  3EG2 A;  4RTY A;  1MUZ A;  1WIE A;  1HD3 A;  1CKA A;  1WA7 A;  1ZUY A;  1UDL A;  1PKT A;  4J9E A;  3C0C A;  1E6H A;  2KRS A;  2ED1 A;  2OI3 A;  3GBQ A;  1X6G A;  5IHN A;  1YNZ A;  2DMO A;  1SHG A;  1WFW A;  3H0I A;  2D1X A;  4DEX A;  2RQT A;  1Z9Z A;  2AK5 A;  4R0K A;  2JS2 A;  2FPD A;  2C0T A;  3REA B;  4K11 A;  2PNI A;  1CSK A;  2BZ8 A;  3I35 A;  1KFZ A;  1NLP C;  2MIO A;  5FW9 A;  1RLP C;  1SRM A;  1AZE A;  3H41 A;  1AWW A;  1NM7 A;  4OMN A;  2EW3 A;  2JMA A;  1UFF A;  1B3Q A;  4RTU A;  2KE9 A;  2FRY A;  3TSZ A;  4RTT A;  1AOJ A;  1WXB A;  4J9B A;  1ZSG A;  1K0S A;  1GFD A;  2XMF A;  1TUD A;  1U5S A;  4EIK A;  2LQN A;  4AFQ C;  2J06 A;  4E6R A;  2JT4 A;  1BB9 A;  1GFC A;  2W0Z A;  4CC3 A;  1N5Z A;  2M51 A;  2D8J A;  4LN2 A;  1IO6 A;  4JJD A;  1Z9Q A;  2F2V A;  1QWF A;  2CT4 A;  2DIL A;  4J9D A;  1AVZ C;  1FYN A;  1I1J A;  2RQV A;  3REB B;  4RUG A;  2K3B A;  1SHF A;  1K0X A;  2A28 A;  2EGA A;  2MOX A;  1X2Q A;  4JPB W;  1QWE A;  1X2K A;  3H0H A;  5HCK A;  3SEM A;  5IH2 A;  3PVL A;  1M27 C;  2LNH B;  1UTI A;  1MV0 B;  4Z88 A;  4LUE A;  3VS6 A;  2RMO A;  1JQQ A;  2G6F X;  2O31 A;  2RN8 A;  2EYY A;  2CUD A;  2L3P A;  1VA7 A;  1GCP A;  3M0R A;  2DM1 A;  3JV3 A;  3TSW A;  2JM8 A;  2YUO A;  4D8D A;  2DVJ A;  2LX7 A;  1NG2 A;  2LZ6 B;  2AZV A;  2X3W D;  1WLP B;  2NWM A;  4LNP A;  1Y0M A;  2ESW A;  1YWO A;  2J05 A;  1AWJ A;  1CKB A;  3A98 A;  1ARK A;  2LQW A;  3VRZ A;  3I9Q A;  2K2M A;  1GCQ A;  1NYF A;  1UE9 A;  1NEG A;  1ZLM A;  1GBR A;  2EPD A;  4Z8A A;  1OEB A;  1AEY A;  4KRT A;  3UA6 A;  2JTE A;  2HEQ A;  2D0N A;  1ZX6 A;  1PKS A;  1M30 A;  1SSH A;  2KNB B;  1YP5 A;  2V1Q A;  5FWC A;  2CH4 A;  1K9A A;  2PTK A;  2KT1 A;  1GL5 A;  3I5S A;  2W10 A;  2EVR A;  4HXJ A;  1UGV A;  3I5R A;  2A37 A;  2J6F A;  2J6O A;  2KT8 A;  4JJC A;  1K4U S;  2HBW A;  3EG0 A;  1NYG A;  1PNJ A;  4LUD A;  1KJW A;  2EBP A;  3NGP A;  2JS0 A;  2KYM A;  2FO0 A;  3O5Z A;  1H92 A;  3NPF A;  2DL5 A;  2X3X D;  1AWO A;  1K1Z A;  2O2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...