1XTDA

Structural analysis of leishmania mexicana eukaryotic initiation factor 5a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
149
structure length
149
Chain Sequence
b'NASKTYPMAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTHNVEVPFVKTFTYSVLDIQPNEDPSLPSHLSLMDDEGESREDLDMPPDAALATQIKEQFDSGKEVLVVVVSAMGTEQVLQTKNAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eukaryotic initiation factor 5a
molecule tags Translation
source organism Leishmania mexicana
publication title Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
rcsb
total genus 26
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xtdA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xtdA02
5C3EG 1CSPA 2K5NA 2K52A 4DV5L 3S16H 3HOWG 3PUVA 3CPWA 3BZCA 2R7ZG 1A63A 2NVTH 1GO3E 5AJ3Q 3HKZG 4PZ7A 4LF5Q 3J7A5 3G71T 1XMOQ 5IYBH 4DV3Q 1IBLQ 3KOJA 3F2CA 3TS2A 3P8BB 3CC4T 3UE0A 5IY0A 4BA1I 3PUWA 4DUZQ 4DV1Q 1LUZA 2LXJA 2VQFL 1PH9A 4B3MQ 5GADC 4YHHL 1S72T 2JUFA 4GN4B 4B3SL 1K9MU 1VQ6A 2MFIA 3T1YQ 2NVXH 4QY7A 2MNAA 3RZDH 4DUZL 4LF8L 1D8LA 1WCMH 2YTYA 3J80i 4LUVA 3K7AH 1V43A 4QQBX 1IL2A 5HGQA 4GLXA 1X3EA 3CQZH 3T1HQ 5LMUQ 2N49A 1SE8A 2MWPA 1G291 1YVCA 3LGFA 3M85A 2Q2TA 1OXTA 1YJWT 4JI3L 2AKWB 1UWVA 5M5XH 1Y14B 2A8VA 1UE7A 1X9NA 5J3BA 4JI6L 1I50H 1K8GA 5LMNL 5JJKA 3BJUA 4LW1A 2V1CC 4BBRH 1EIFA 4A3JG 4YY3L 5ELNA 1G51A 3H0GG 3HKZE 4HJ5A 1PH2A 3FKIG 5LMNQ 3H3VH 3CC7T 3ULJA 1IBLL 1AE3A 3ZJYC 4X66Q 4FDBA 2WAQE 4ALPA 2R7FA 4AQYL 4L5QA 1V1QA 4EX5A 3RNUA 4JBKA 4HIKA 4LFAL 3GTQH 4GKKQ 2QEXT 2UXBL 5IP9G 3S1NH 2GVAA 1L1OB 2KCMA 1CKOA 2F3IA 5ELOA 4C3JH 5IWAL 4NXMQ 1WOCA 1ASYA 3W1BA 4B3TQ 3E0EA 3TQYA 4POGA 2UXCQ 3CPWS 4IOCA 3AYHB 3Q8DA 1LTLA 2D0PA 4YY3Q 1N8RC 4A3GH 4JI5L 1VQ9A 1EUJA 4A75A 1YI2A 3I7FA 3FP9A 4QL5A 3U58A 3ICEA 1LM0A 2K14A 1PA6A 4IPHA 2UUBL 3HOVG 3CCUA 1YI2T 1RL2A 1KC8C 3CCLT 3J81E 1NMFA 4IJHA 1X54A 1WI5A 4DV4L 4UP7A 2HIVA 3K80C 1PH4A 1AE2A 5C0XG 4Y52H 1PYBA 4A3LG 4KHZA 1M1KU 4A3GG 1SR3A 2PQAA 2AWOA 2Q2IA 4KLKA 1KC8U 1VQKT 3KJOA 1EIYB 1Q7YC 3T1HL 3U50C 1HZCA 3TEHB 1KRTA 1FJGL 3EIVA 3I4OA 2UXBQ 2QEXA 1GVPA 3U4ZA 5FLMH 3HOZG 1Q8KA 2MO0A 1E1OA 4HJ9A 3CCEA 4O2DA 3ULLA 1R9TH 3CC7A 1RIPA 2MQHA 2R93H 1VQ4T 1Y1VG 4YHHQ 1JJ2S 1QVCA 4LF6Q 1BKBA 2C35B 3RLOA 1YBYA 4JI5Q 2BH8A 1PH6A 4GN3B 1EFWA 5IP7H 1UE1A 1VQ4A 3FKIH 1VQCA 3L0OA 4A3IG 1IBKQ 1H95A 1YHAA 2ID0A 2G3RA 4GLAC 1BVSA 3AFPA 5IT9c 1YJ9T 1Q82C 3TS0A 4JYAQ 3DB3A 3CC4A 1P8LA 1Z47A 4YCVA 2CCZA 4IFDJ 3G4SA 1B7YB 2OTJT 1VQHA 1VQMA 3KF8B 3BZKA 1D7QA 3NEMA 3OTOQ 1YITT 2PI2A 2KCTA 4XIGS 3PIPA 5FLXc 1QUQB 1E7ZA 1WJJA 1M90C 2NN6G 4LFAQ 4GKKL 3M7NA 4POFA 1CKNA 3KYHC 4HIOA 3CCUT 1K73U 1SN8A 1L0WA 3S1MH 5C4XG 1QVFA 2F52A 5IYCG 3CPFA 1OXSC 4GOPA 3GTMH 1NE3A 3TREA 1KQSS 1VQEA 1IYJB 2XTIA 4PG3A 1KD1C 1MJCA 1TXYA 3CCMT 3S15H 2HIXA 1A0IA 5FLXE 1KD1U 1T9HA 2CWPA 2UUCL 5M5YH 4JI4Q 1JJCB 4BY7H 2E8GA 1YITA 4DR4Q 1QVGA 1CSQA 1X55A 1TWHH 2JA9A 3JAMc 5GAGC 3J7ZC 1MJEA 3I4NG 4IPCA 4JI7L 3A0JA 5M3MG 5A2QE 1VQNA 2JK8A 1XPUA 3HOZH 4BY7G 1XNRQ 3CXCA 1PFSA 3CC2A 4UY8C 2UXDL 1VQNT 2I0QA 1KIXA 4BBRG 4DKAC 1EYGA 4DAYB 3KJPA 4OXPA 2OTLT 1QUQA 1WFQA 5IYCH 4B3SQ 1E22A 1J6QA 2JQOA 2UUBQ 4LF4L 2LVMA 2ZJPA 1CKNB 3CW2C 4DV6Q 3RLNA 3CCJA 1PVOA 5K36G 3JAME 1KHIA 1IZ6A 2MI6A 4X62L 4X6AH 3GTPH 2H5XA 4XTCS 3HOUG 4A3FH 4LF4Q 2JA7H 1Q81U 3HOVH 5IYDH 1KRSA 4IFDI 2PI2E 4QGUA 3OW2S 4B3RQ 2GN5A 1PH1A 1VS0A 5AJ3L 5M5WH 2JA8H 3CCQA 4NXNQ 5DLQE 4R4CA 4P71A 1YJWA 4LFCL 2IX0A 2Q2UA 2VUMH 1JJ2A 5BR8L 3GTGH 1N36Q 2ZTDA 3F8TA 4RG1A 1K8AC 2Z0SA 3SGIA 3ULPA 5LL6S 2IHFA 4R1JA 4B3RL 2D0OA 5GAEC 1NJIU 5M3MH 2CKZB 1Y1VH 1VQPT 4X64L 2B3GA 2JJQA 2KHIA 1PHJA 4GNXB 2IY5B 5IP9H 3L2PA 1TWGH 2R92G 1YIJA 2ZTCA 3STBC 2E2HH 3EBEA 3I55T 3M4PA 2IT1A 1K9MC 3BU2A 3PUYA 3PIOA 2K5VA 2L15A 3GO5A 4JBWA 2HHHL 2OTLA 2PMZE 4C3HH 2XHCA 3DB4A 1HZAA 2CFMA 2JEBI 2VQEQ 2JA5H 3M4OH 4JBJA 1DGSA 3K7UC 4DR6L 1C9OA 4DK6C 3K8AA 3VDYA 4JV5L 4ZN3A 3GTJH 1NY4A 4DV0Q 4OWWB 3PV0A 1K73C 3KDFB 4OWTB 1XNRL 5C4XH 4A3LH 3J81c 1QVFS 2E2IH 5IYDG 4C2MH 1PH7A 4DV2L 2JA7G 4DV7Q 4OONA 4DR4L 4DPGA 4JV5Q 3GD7A 1OXVA 3A5ZB 5FJ8H 4LF8Q 4IPGA 1YEZA 4JI8L 2B63G 1N32Q 3S24A 3CCJT 1E3PA 4UP9A 4LF7L 2DUDA 4DK3C 4B3ML 1NZ9A 4DNIA 1HZ9A 4JI2Q 3NELA 1UE5A 3K0XA 3KBGA 1S72A 4DR7L 1VQPA 1I5FA 4TQUS 4A3EG 3D0FA 2E5LQ 3CCET 3I2ZA 2A1AA 1Q1BA 1Q86U 1XNIA 4NPSA 4LF5L 3KF6A 2IX1A 2R92H 3I4NH 1K83H 2RHQB 3J80c 5BR8Q 2MWOA 4TVAB 3CC2T 1Q81C 1YZ6A 5IYBG 2L3RA 1XMQQ 4LUZA 1J5EQ 1I3QH 2I5MX 4AIMA 1XTDA 2PQAB 2RCNA 4ZN1A 1SMXA 4OX9L 4HIDA 4A3JH 2VUMG 1YJNA 1KL9A 1Z9FA 1CKMA 4HJ7A 2Q2HA 4WJ3M 3CCMA 2NVYH 4APVA 3PO2G 1VQLA 2N3SA 5FJ8G 3J81i 1VQIA 2UU9L 3CP0A 4PZ8A 1MIUA 1BBUA 4HIMA 5JEAJ 1IXRA 2UXCL 1HNWQ 4L5TA 1B8AA 1EWIA 1PH3A 1NTGA 4DV7L 1V9PA 1TWAH 4C3IH 3CXCS 4JI1L 3F2BA 1VQMT 4OX9Q 1XNQL 4HJAA 1FVIA 3W5OA 1VQAA 2Y0SG 2Z6KC 4BXXH 3LGLA 3S14H 2NN6I 2WP8J 3I4MG 1JE5A 4A3DH 3OYYA 1L1OA 1W2BS 1X56A 1O7IA 2EQSA 5IP7G 3RN5A 4A3IH 1B70B 1XJVA 1TWFH 2OWOA 3UDGA 4GOPB 4OO1I 1HR0L 2F4VQ 2R93G 4DR2Q 1IBKL 4YCWA 4RMFA 1E1TA 1K8AU 3J7AF 1YHBA 4P72A 1N34Q 3CMEA 5C0XJ 4LF7Q 1Q82U 2NVQH 2VY3A 1U0LA 3PGZA 2YU9H 4DV3L 2ES2A 2E6ZA 3HOWH 4WJ4A 4B3TL 2JA8G 5C44H 3UE1A 1HNXL 2AWNA 1FGUA 2XGTA 1YJNT 2UXDQ 5GAHC 2ZJRA 2VL6A 3OTOL 4A76A 4J15A 1PV4A 1PH5A 4AYBE 4MTNA 1I6HH 1AH9A 2QA4A 4DV5Q 3PSIA 3UDIA 4LF9Q 3PF5A 3E9HA 1PYSB 1U5KA 3ER0A 2PNHA 1VQFA 3CF5A 1YHQT 3HOUH 1HJPA 5E7NA 3U4VA 1XNQQ 1W2BA 1OXUA 4X66L 2LSSA 2YYZA 4JI4L 3AEVA 3DM3A 4BY1H 3LH0A 3CCVT 2DGYA 2ZTEA 4IOAA 4K0KQ 4A3CH 1VQJA 1JJGA 1UEBA 1Q12A 3M9BA 4JI2L 1Y1WG 2UU9Q 4LF6L 5IE8A 5IT9E 1QZHA 1WCMG 3GTLH 4LFBQ 1NPPA 4QIWE 4KHPQ 1SLJA 4JI0L 4A3KG 4A3KH 4IFDG 2RHSB 4JI8Q 4YWMA 3OW2A 4K0KL 4X64Q 1N8RU 1X6OA 4IPDA 1Q7YU 4P73A 2I5LX 3HKSA 2BA1A 2WFWA 4ME3A 4O0AA 1XMOL 2JA6G 1G6PA 2UUAQ 3CCQT 2KBNA 2YTXA 3DLLA 3TRZA 1NJIC 4BY1G 3G4ST 2EIFA 3I56A 3ERSX 1CUKA 3KLWA 1QVGS 2YTVA 5H1SE 5IWAQ 4BA2I 2CKKA 4A93H 2ZM6Q 1VQ7A 2OCEA 3WWVA 3I56T 2I5HA 3H0GH 4GNXA 4DR6Q 2AHOB 1GM5A 2BH2A 5GQOA 1VQDA 3CMET 4X65L 3JAMi 4GOPC 3T1YL 4MNOA 4RG2A 3G6ET 4EQ5A 1VQ6T 4HJ8A 4PZ6A 3A74A 2HHHQ 3HOXG 4BBSG 4GKJL 4KHPL 1HH2P 3H15A 1W3SA 1NPRA 2K50A 4CRIA 2ATWA 1EQQA 3K81C 2WB1G 3L7ZC 1SFOH 2VZAA 3CAMA 4QJFA 2VW9A 4DUYQ 3CCVA 4NB3A 3D31A 3LGJA 1YIJT 4GKJQ 2WB1E 1XPRA 1N32L 4PMWA 4JBMA 1YHQA 1IBMQ 4DR5Q 4YCUA 2KENA 3S2HH 1N36L 4DR3L 3F1ZA 3S1RH 1OXXK 4DR1L 4A3BH 2WAQG 4JI3Q 2D62A 3RZOH 2ASBA 5IAYA 1ASZA 3PO2H 2ALYB 1L1OC 1SRUA 2JOYA 2K75A 2YV5A 1GD7A 4JI1Q 1K3RA 1UE6A 1S3OA 3CCLA 2CWAA 4LWCA 3EN2A 4DV0L 3CMAT 4AQYQ 3I4MH 3UDFA 4BXXG 4JYAL 2N78A 4DV4Q 4DUYL 2QGQA 3I55A 4A3CG 4L5RC 1X3GA 1SSFA 4JI6Q 5C4JH 5FLMG 4X34A 1XPOA 2VQFQ 4A4IA 2F4VL 1I94L 1BBWA 4YWKA 4X65Q 3MEFA 1HZBA 4UP8A 2LCLA 5LMNW 2R7ZH 3B6YA 1P16A 3RN2A 2QA4T 2ZM6L 4JOIC 3UDXA 4R4IA 1VQBA 4YTLA 5C44G 1KXLA 1M1KC 3PUZA 5EAYA 2DO3A 1NBWA 3KF6B 5LMUL 1X3FA 3GTKH 4DR1Q 2VNUD 2KDSA 1VQKA 3CCST 3IRBA 3CCRA 2IHEA 3E9IA 3NENA 4GN5A 3F2DA 1TWCH 4DAMA 2Z6KA 1IBML 2VQEL 3PO3G 5JJIA 3W1GA 1VQOA 1JB7A 5GROA 4YWLA 1M1GA 4P74A 3MXNB 2B29A 1N33L 4DR7Q 3J80E 2OQKA 4P75A 4Y7NH 2ZJQA 1MKHA 1K0RA 4X62Q 3M4QA 3KFUA 1S40A 4JC0A 1HR0W 1L2FA 1VQ5T 2NZOA 1C7YA 3JC66 2JEAI 4DR2L 1M90U 3GTOH 2OQ0A 2LQ8A 1HR0Q 2E2JH 4R4OA 1E24A 4IJLA 1Y1WH 1N9WA 3G48A 4R4QA 3PCOB 2LXKA 1XMQL 1J5EL 3CMAA 3HFZB 3CCSA 3G71A 3GDEA 1VQ7T 2CQOA 1A62A 2KHJA 5C0XI 4DV2Q 4A3MG 4LFCQ 2JNGA 3PO3H 2OTJA 3FHWA 4L5SA 3HOYG 2HT1A 1JT8A 2GVBA 3KDFA 4H02A 4IO9A 1VQ8T 1EQRA 5J26A 4GNXC 2UUAL 1HNZQ 1PH8A 1GKHA 4R4TA 4OO1G 1VQGA 1HNWL 2Y0SE 2UUCQ 5C3EH 2R6GA 1VQ5A 3S17H 3S2DH 2KVQG 3A5UA 1I94Q 1YJ9A 4BBSH 5DM7R 4JCVE 5M3FG 4LFBL 2JVVA 2EXDA 1N33Q 2JA5G 1FL0A 5HY6A 3PF4A 2E70A 4MZ9A 1VQ9T 3AFQA 2FXQA 1EOVA 1SROA 3CD6A 4DV1L 2RF4A 3AQQA 2R7DA 3H3VI 3HOYH 3S1QH 4A93G 1YNXA 2N8NA 4JOIA 3CCRT 4AH6A 4A3MH 2AMCB 4UPAA 1FJGQ 4JG2A 1HNZL 2K5HA 2K4KA 1KAWA 2JA6H 1VQ8A 1JMCA 3NBHB 4TVRA 1LYLA 1OTCA 4JI7Q 4A3EH 2A19A 4NXML 4NXNL 1QZGA 4GS3A 4DR3Q 2MO1A 2NZHA 4A3DG 5JJLA 4DR5L 1HNXQ 4KI0A 4A3BG 1VCIA 2E5LL 4JI0Q 1C0AA 3RLFA 4GLVB 2B63H 3CD6T 1A8VA 1N34L 1X65A 5JEAG 3M3YH 1NMGA 2JE6I 1Q86C 1VQOT 4A3FG 1KQSA 1VQLT 4DV6L 4LNQA 2BA0A 3STBD 1Q46A 4QQDA 3G6EA 1WYDA 3RR5A 2HQLA 2IG0A 2VS1A 4LUOA 4AYBG 3J81j 3HOXH 3PUXA 5M3FH 1Q1EA 4OWXB 4LF9L
chains in the Genus database with same CATH superfamily
2KMTA 4A3EB 2BIVA 1CSPA 3HOWG 3JCMh 3BZCA 1BUVT 3KK7A 4J1MA 2NVTH 3H0HA 1SAPA 1I6HB 1NSNS 1QVFP 2CW0C 2PPBC 2P5ZX 2A69C 5IYBH 1LACA 3HOWB 3F2CA 4A3KB 1RI9A 5IY0A 5HCKA 3DWPA 2LJ1A 3PUWA 4DV1Q 3PIP3 4JJDA 4H0LC 2VQFL 2LKVA 1G3SA 1SE4A 5GADC 4YHHL 5I22A 3GTPB 2CT4A 3L2WA 4EMHA 1I0CA 2R61A 3MAQA 1Z9QA 2YTYA 1WCMH 1V1CA 3OWEB 4PQXA 2KEAA 1V43A 4M77B 1IL2A 2EWNA 3T1HQ 2X9HA 4WTOB 1G291 1U06A 2A6EC 1OXTA 2L4NA 4JI3L 4OIJA 1WGSA 1Y14B 4OB3B 4OF1A 2QQRA 1NE8A 1TUDA 3X24B 4DBQA 2HMAA 1DOMA 2XK0A 4JW0A 4M7DD 3M53A 1M30A 2DM1A 2L5QA 1G51A 1FXXA 1O7YA 3FKIG 1I5OB 4JZ3A 2DJZA 5DAUA 2P0KA 4B6MA 4HT9A 3SHWA 3HFOA 2R7FA 3GTQH 1B2TA 3RNUA 2B2WA 3J7AV 2QEXT 2UXBL 5GAOp 2VYTA 2A69D 5IP9G 3CRLC 4N9TA 4NXMQ 3OSVA 5GMKl 5ELOA 3BVMA 3OQ5A 3J81L 1MMAA 2ROTA 4KH1B 3V8JA 1G8XA 3JCMc 1GUWA 4Y28E 3E0EA 3TQYA 1FD7D 4CKBA 1F9SA 4POGA 1D1CA 2DNUA 3SD4A 2D0PA 2E75C 4XTZA 4JI5L 1BB9A 2YUNA 5CO7A 4XU3A 2VUBA 4HKEA 3I55Q 1YI2A 5HK3A 4JRPA 4LJZC 4QL5A 3QBYA 4HAEA 2XKOC 4PJOA 3HRZC 2O9VA 4RKLA 2R93B 5CCAA 3CCLT 3J81E 1GUOA 2KK4A 3S6WA 1CHPD 1X54A 2PZ1A 4C8QE 1D1IA 1HTLD 2HIVA 2J0TD 4UP7A 1JXMA 4LUEA 3S3NA 5C0XG 1PH4A 1SPKA 2RQVA 1Z7TA 4KHZA 2FVUA 5LJ3j 1CZWA 4M78D 2PQAA 2Q2IA 1VQKT 5NUCA 2D9TA 3EHRA 2NUTB 1IYUA 3T1HL 1FJGL 4O1NA 1KRTA 3EIVA 4DK0A 2UXBQ 3REBB 2CH4A 2XWJB 5GAOn 3QWNA 1Q8KA 1QE6A 4OMLA 2QQSA 4RTXA 2XU8A 1LTGD 1RD9D 1RIPA 2MQHA 4O42A 4YHHQ 1MBYA 1Y1VG 4LF6Q 1PZKD 1YBYA 3JCMg 2FRYA 1EU4A 1KC8R 4M78E 2BH8A 3P20A 3A54A 3FKIH 4GN3B 4JK1C 4AFQC 1PRMC 1F77A 1VQCA 1O75A 4HCKA 2RDGA 2QILA 4J9DA 4F14A 4RGOS 1YJ9T 3C0CA 2VV5A 1Y1VB 4A4FA 1H9RA 3G6EQ 3LWEA 1ZUUA 4E7ZA 5A0LA 1JJ2P 2RI2A 1VF7A 3P8DA 1QJOA 1HQRD 1B7YB 4C2MB 3I56Q 3UT1A 1VQMA 2A6HD 1PTOC 4EMKC 2HUGA 2KCTA 1CQFA 4XIGS 2M1HA 2DTHA 3PIPA 3M7NA 1HRJA 4POFA 1CKNA 3KYHC 3CCUT 1IB8A 1AZEA 2BZ8A 1L0WA 1R0BG 2F0NA 3HTRA 2RQTA 2X4YA 3GTMH 3TVTA 1IGUA 4LDUA 1AZGB 1CQVA 2F0IA 3ZFJA 1KQSS 2V8IA 4RCNA 3D6CA 2QASA 5ELCA 3CCMT 4FW1A 1BI1A 3S15H 2M51A 4BY1B 3HP9A 2RHZA 2CWPA 1WTOA 2SEMA 1D5ZC 1F1BB 4JI4Q 4BY7H 1WZOA 2JA9A 2NBFA 5GAGC 3E2UA 1JQYD 3JAMc 3A0JA 5M3MG 1XPUA 4BY7G 1OULA 2O4XB 3IFDA 3HOZH 2F3VA 2EJFC 2DNCA 3CC2A 2OX7A 2RVLA 3W2DA 1TWHB 1YJNQ 2MK5A 2QAZA 4BBRG 4DKAC 1PWTA 4DAYB 2BE9B 4HVWA 4C8QC 2KE9A 2HQEA 4KD4A 1E22A 1J6QA 4B3SQ 4NMZA 1W70A 3LWHA 2EYHA 3NSWA 4HMIA 3BYYB 3JAME 4XXEA 1IZ6A 3FJPA 4ZGDB 4CHTB 1UE9A 3RKXA 3NWSA 4BS9A 4X66Q 1RF2D 3D6WA 3HOUG 1Q81U 1WTHA 4DBHA 2CZ7B 1KRSA 4IFDI 1K76A 2PI2E 2EYLA 2XIWA 1Z9ZA 4QGUA 2F1LA 3V7RA 2LC4A 1VS0A 5LHY1 2QTXA 4K11A 4ZUJA 1PTOB 5DM63 4M7DE 4P71A 3EHQA 4LFCL 1FMVA 1JJ2A 3GTGH 2R5AA 4TRDA 3F8TA 2L89A 1G5VA 8AT1B 2WACA 4M78C 1JB3A 1JO8A 2EKHA 4FM4B 2CP5A 2Z0SA 3NBHA 4B3RL 4HT8A 2D0OA 5LJ5g 2RSNA 2Z0WA 4WFN3 5GAEC 3GPLA 2DVEA 4EDUA 1GCPA 1VQPT 1LT6D 4JJBA 2B3GA 1A6XA 1Y71A 4J9IA 4N0AC 2TSSA 4KN7C 1STGA 3EBEA 4EGVA 3DHQA 2JM9A 3IAYA 5C4ZA 2F0JA 4LDVA 5IGBA 3ULRB 3PIOA 2ABLA 1G83A 1RCVD 2L15A 4JBWA 2QQ9A 3BG3A 2OTLA 1I4HA 2XHCA 2JXBA 2CFMA 3J7YW 2OF1A 3QB3A 4A3JB 3EA6A 3I72A 1ET6A 3K7UC 3NP8A 4DNTB 1TG0A 1IHVA 1MGQA 3PV0A 4OWTB 2RH2A 3OYHA 5GMKj 3SWNC 2DX1A 5BN5A 5IYDG 5IH2A 4C2MH 1PH7A 1T5EA 4J5YA 4OONA 3OIPA 4JV5Q 1RODA 5FJ8H 5KYYB 4LF8Q 4JPBW 1K4US 3MEUA 4JI8L 2JM8A 2B63G 3HOYB 3FKIB 2MOXA 3CCJT 5KNBA 4LF7L 1RLQC 2E5KA 1NZ9A 1AN8A 1G2SA 4XQNA 3K0XA 4C0FA 1I4QA 2LQNA 1STHA 3KBGA 1EY6A 5EQ0A 4BBSB 1VQPA 2K28A 1YWPA 1UGQB 1AWXA 1LTTD 3M56A 1O7ZA 3EH2A 4MMKA 3FLGA 1Q86U 2FZKB 1EX4A 2KI7A 4M4ZA 1Q1BA 2R92H 3J80c 3CC2T 1YFNA 1W2BP 1N6AA 3LLRA 9ATCB 5D14A 1XMQQ 2JYOA 4HN7A 1V1PA 3LYIA 4YIJA 1Q81R 4AIMA 5TSSA 2J4XA 4HIDA 1KLGD 3NQIA 5C3XA 3GTQB 3MCAB 4EMKA 1M3BA 1CKMA 1H9SA 5EKKA 4RWSC 5KNCA 4WJ3M 2HD0A 3CCMA 2R5MA 3G1JA 4OEMB 4KRTA 3TDQA 4Z9CB 4FU6A 4Z89A 1TWGB 2UU9L 3CP0A 4PZ8A 3N52A 1BXTA 5JEAJ 1IXRA 4C92D 2CP3A 4F7UA 1HNWQ 4A4EA 1L0YB 1BBZA 4ELYC 4X9DA 4L5TA 3RBBB 1TWAH 3F2BA 2VWFA 4M7AG 1FVIA 2ZXPA 1B7TA 2JTFA 2JA8B 3LGLA 4BXXH 1WXBA 2SRCA 3R93A 3OYMA 3PVLA 1IHZA 4PJLA 1B70B 3T13A 3IFTA 3UDGA 4JS5A 3SEBA 2I2LA 2M2LA 2ZCFB 3T56B 1X2QA 4DR2Q 2CZ0B 2FPFA 2NUPA 2DKGA 1IBKL 2LCSA 4JLGA 4FCYA 4RHSA 2MPMA 2TMPA 1N34Q 2EGEA 4LF7Q 1Q82U 1PFNA 2NVQH 3E19A 1U0LA 2A28A 1EYAA 1GUNA 2L11A 4FF3A 1ZUKA 3HOWH 2F0OA 2JW4A 2RHUA 2K2VA 1ZQ1A 2ENBA 1BO0A 4XQ3A 2KCCA 2UXDQ 1D6EC 3QSUA 4MTNA 2O5IC 2NVTB 3GP8A 2RA4A 3PF5A 4PJMA 3DXJC 1PYSB 2NN6H 3D8GA 3CF5A 3HOUH 1YHQT 2ROLA 5KCHA 2O4XA 1W2BA 1JWUD 1TT2A 1WCMB 2LS01 3S2HB 3WOEA 3VS7A 2YYZA 2F3WA 3LH0A 1JE4A 2E65A 1Y07A 2E1HA 2OEOA 1UEBA 1OPKA 3S3MA 4XAXB 3CC7Q 4LDYA 1WCMG 4LFBQ 2K32A 1NPPA 3M3YB 1S4ZA 3DKMA 1VQ6Q 3L2RA 1KFZA 1SLJA 3CU7A 1XXGA 2LJ3A 2DIGA 4JI8Q 3JCMP 4YWMA 2O9SA 1V76A 4PLIA 1X6OA 1QCOA 1Q7YU 1A3UA 1D5XC 3HKSA 5HK0A 1HTPA 2BA1A 1QP2A 1MGSA 2ED0A 2NYSA 2I5LX 1XMOL 3L2ZA 2JA6G 5FRNA 3TRZA 1KK7A 1D0YA 4HA8A 1Y7XA 2LRQA 2EIFA 1NJIC 3MKDA 4J9HA 1IGQA 3VUZA 1OZ3A 2D2CC 1C1AA 3ERSX 4K8JA 3VYSA 2PTKA 2FYKA 1KDBA 1MI2A 2I5HA 4FYWB 4RFBA 4DR6Q 5GQOA 1M90R 3GV3A 3NHNA 4RGTA 4A4GA 3T16A 1JR0D 4RG2A 3D4DA 4CJ1B 4HJ8A 1TVXA 2HHHQ 4KHPL 4RTWA 1WXUA 3QIIA 3CRKC 2VZAA 1M3CA 2QYZA 4KBMB 1R9TB 3CCVA 4DQ2A 4XU1A 1KDAA 2KHSA 3A8MB 5CV9A 1LT4D 5JEAH 1YHQQ 2ZT9C 4PMWA 5D65A 1NR4A 3SB2A 4BI8B 3IKJA 1ZBXA 2ICEC 4Y91A 5IHNA 4DR1L 1CA5A 1A2UA 1IXDA 1YCYA 2F5TX 2JJ9A 3DEOA 1HK9A 5E4WC 2ASBA 2M16A 4CC2A 1SRUA 5G3LF 4C92B 2XG8D 4PK4A 5KH6A 2XDPA 5FU6C 1GD7A 1PXUA 1UE6A 4CDCC 4Z02A 4ABNA 4BI4A 4DV4Q 3D3RA 1GFDA 4C3IG 3I55A 2NVQB 3A8JE 2DJFC 4IUTA 4EPCA 2PW7A 1VQLQ 1TY0A 5CYUA 4DGZA 2VXFA 4X34A 3TBIB 3S2DB 4D6WA 4A4IA 3EGDB 3TCJA 4WORA 5FKAC 4X65Q 3MEFA 1HZBA 1S5BD 1VMCA 3ND9A 1U3OA 2DJGC 3J80L 4FF1A 1NM7A 4M75B 4R4IA 2FL7A 4JRQA 5C44G 1M1KC 3RMHA 2KVMA 4M7AD 1NBWA 3KF6B 3MXUA 5GANd 3SXHA 1IL8A 3EG0A 1HSQA 3MP6A 4OB0B 1VQKA 2QXFA 3CCST 3CCRA 1V8QA 1Y1WB 2BCOA 2BKDN 5KYNA 4DAMA 3F2DA 5IT9L 3T53B 1JORA 3GP7A 2AZVA 2E3HA 2YLBA 2EQIA 2VXWA 4DR7Q 2PQWA 2RO0A 1VQ9Q 1EZ6A 2ZJQA 3KFUA 2EOTA 1NEBA 3M4QA 1S40A 2QK0A 3VS5A 4RCBA 1L2FA 4F7UB 1VQ5T 2L1BA 2NZOA 1C7YA 1HR0W 2VB2X 1WQWA 2Z4IA 2JEAI 5KYUA 4XTUA 1YNNC 3V96A 2M0YA 2RD1A 1KLUD 3RMSA 1E24A 2GTJA 3X20B 1NCVA 2F69A 4IUVA 2I07B 3PCOB 1PRTB 3GNGA 1XJWB 2GTOA 2KYMA 4E7LA 1VQ7T 1I3QB 1JU5C 2KHJA 5JJZA 1QNKA 2YSQA 4H02A 1CHQD 1PD1A 2HDLA 1ZYRD 4GNXC 3NE5B 1VQGA 1G2TA 2MGSA 2DXBA 1EFWA 2RQUA 2KVQG 4BE0A 1FNVA 3A5UA 2EJMA 1GFCA 2EQUA 4C8QA 4JCVE 4ZGJB 2EXDA 1N33Q 4OGEA 2GFUA 4QVDA 1S72Q 1FL0A 2E70A 4MZ9A 4KN4C 1VQ9T 1SNMA 3AFQA 2KQ3A 3FC3A 1K9MR 3HOYH 1SEBD 1GXDC 1K3BC 1YNXA 2N8NA 4QT7A 3I91A 1B53A 3CXCP 1BF4A 4JG2A 1F9RA 2K5HA 4N9PA 4X3KA 3NBHB 1I4XA 5EC7A 1KJWA 2RJCA 3P8HA 1LYLA 1SYBA 4EQNA 1OTCA 5K5PA 1UG1A 3RDVA 4M75G 1TUGB 1HHVA 2KT1A 2AIRB 3H3VC 2SDFA 4CC7A 2Q2UA 3FDTA 3UATA 1GL5A 2I0NA 1S5ED 2ATCB 2L8DA 4J83A 3BW1A 4XQJA 3RKWA 2P4RA 4N4GA 4LAAA 3AU7A 3M3YH 2JE6I 4BD3A 3IQLA 1SG5A 3ERQA 2PZTA 4G57A 3STBD 4KKUA 4DBFA 4M78G 3JB9F 3HPWA 4QQDA 3G6EA 1U5SA 2B8AA 1Q90A 3RR5A 4XTYA 2COYA 1Q1EA 2L2PA 2HKNA 4LF9L 3M59A 3URGA 2KJXA 3VS6A 1P92A 2EYQA 1E2WA 2R7ZG 1VQMQ 1A63A 2A0FB 3I73A 1LVKA 2XDBA 2AHJB 2D9UA 5AJ3Q 1T3SA 3OSOA 2FFKB 3A56A 3HKZG 4ZK9B 1X3PA 4PZ7A 3WXMB 3G71T 1W6XA 1H641 1OU8A 1H92A 1IBLQ 1STAA 1U1SA 3TS2A 1I5LA 3CC4T 3UE0A 3HOVB 2YU9B 5GANg 1GUTA 2P0PA 4HMJA 4KJOA 1UFFA 3JCMe 2OAWA 3JB9H 2LCCA 1ZA1B 3QYHB 2K5WA 4GN4B 5J1ZA 2HCCA 1K9MU 2J7ZA 4IUNA 4PJOC 2MFIA 4QY7A 2MNAA 2PQEA 1RDPD 4DUZL 5LJ5j 4HCCA 4LUVA 3K7AH 3NTHA 4M7AA 2CP2A 3JB9D 4GLXA 4E6IA 3CQZH 1JBMA 5LMUQ 2KRMA 1SE8A 1VQ8Q 5KYIA 2Q2TA 3H0IA 3KBXA 3BDCA 2DETA 2EXZA 2AKWB 3VA7A 1BR9A 2FJ2A 1VQ7Q 2RNAA 4M77E 2ESWA 1TWAB 5KRUA 4DR4Q 4V0BA 3MEHA 1UE7A 2LNVA 5GMKi 4IN3A 4JI6L 3QHSA 5LMNL 3X28B 1NNXA 2LMCB 2R3ZA 5FO8B 2DTOA 2H3EB 2B2YA 4ME5A 1EEID 2K03A 1PH2A 4FXDA 4AFSC 3OYGA 4KHVA 4M7DA 4XTXA 3ULJA 2DZCA 2EBPA 2WAQE 3HRSA 5GAMe 5CR2A 4FDBA 4L5QA 4ZQ3A 4ALPA 4A3DB 3HRUA 4XTVA 2GVAA 2Q8RE 5IODA 1T3LA 2KCMA 3CCSQ 2OTJQ 1CKOA 3EG3A 3BS1A 4C3IB 1KSWA 4F87A 2OI3A 3V2TA 1E7OA 4B3TQ 1UJ0A 1F9PA 1TS4A 2R7ZB 1UUEA 2E12A 4WCIA 4A54A 3AYHB 4HR7B 5CIUA 4E7SA 3TP7A 1N8RC 1E2VA 4YY3Q 4A75A 3JV3A 2KXDA 3FP9A 3TU4K 3I7FA 5I21A 4K2LA 2K14A 1GHKA 1EUJA 4IPHA 4CJ0B 3HOVG 4R56A 2AK5A 3NTIA 3CCUA 2F03A 5A0GA 4NL3A 4P73A 4DV4L 1FX7A 4DA2A 1M1KR 2K5QA 1BCPD 1AE2A 3D4WA 3K80C 1QLYA 1YN8A 4B9XA 3NHHA 4OGQC 4A3GG 2DTIA 5CKFA 1V1PB 1QOHA 1M9SA 3TSWA 1X2KA 1SNQA 3QWXX 1DYQA 1Q7YC 1M4VA 3OYJA 4UC4A 5JVG3 1U4LA 4LUDA 2EJFA 1VYVA 2XICA 1GXIE 1BOSA 3DWQA 3OYEA 2PYKA 5A0DA 4CI0C 1E1OA 3VYGA 3CCEA 3CC7A 1YNZA 3WOFA 4N0AA 4RTTA 5LJ3d 3S3OA 4M8AA 2J6KA 2BE5C 1QVCA 1TH7A 4EMKB 1GCQA 3QXEB 4CDDC 3N5BB 2D6FA 4JI5Q 1SBBB 1PHTA 4A3IG 4R0KA 1WXTA 3PFSA 1VQ4A 3FPUB 2DERA 3L0OA 4C56C 2G3RA 3AFPA 3DUZA 1BQQT 4CGYB 1K9AA 2COZA 3OS1A 4JYAQ 3NQTA 1Z47A 4L8JA 4YCVA 2RJFA 5GAOl 3MJXA 1BI3A 3G4SA 1C0MA 1VQHA 3INZA 3KF8B 4L6TB 1D7QA 3UWNA 1OX9A 1UUPA 3OTOQ 2HAXA 4ZAIA 2PVDB 2LT1A 4P2CB 5M5WB 2A7YA 3VS4A 2NN6G 2IIMA 5I2SA 2B2UA 2HCIA 2LX9A 1WFWA 4HIOA 1K73U 2B2VA 2IVWA 2EYYA 3X3NA 4F7UE 4NL2A 1VQEA 4PG3A 1KD1C 1MJCA 4KUIA 3T4AC 4C3HG 1BIBA 2RM4A 4J6HA 1A0IA 1VUBA 2HD3A 2CS7A 2DPPB 3R6NA 5M5YH 2CYZB 5FU7B 1JJCB 3ZYYX 1YITA 1F2LA 4FYXB 2DD5A 2D0QB 1CSQA 1TWHH 1X55A 2WB1B 4V190 5GAN8 1S5CD 5A2QE 5EPLA 3Q0AA 3HOZB 2XN9C 4XYQA 4L63B 2L5TA 1XNRQ 4FW2A 2MMPA 1PFSA 2PZUA 4C1NK 4ZKCB 5C44B 4KMUC 3M54A 4K14A 3OB9A 1PRTD 1LT5D 5CV5A 2RB6A 3KJPA 4OXPA 4LNPA 2F0PA 1ET9A 3EVQA 2JQOA 1KTKA 2UUBQ 4S3SA 2W0ZA 2ZJPA 1PVOA 4DV6Q 4HVUA 1UHCA 4L6V5 2V8JA 4J9FA 4CC3A 4X6AH 2MI6A 3GTPH 2H5XA 4M75F 3DWAA 2H8HA 1DXMA 3HOVH 2E4HA 3M0PA 3I90A 2QDYB 4X3TA 5C4HA 1SYGA 2EW3A 1LTSD 3CCQA 2JXMB 4R4CA 1YJWA 2SNSA 2IX0A 4ZCKA 2AUJD 5BR8L 1CFMA 4CDFC 2YUQA 2ZTDA 3Q24A 1SNPA 1K8AC 3A8IE 2VKNA 3ULPA 2AQ2B 4QCLA 2AKLA 3MFGA 4RAUC 2YRCA 3JB9G 5LJ3h 1VYTA 4E2FB 3K5LA 1Y1VH 4GLMA 1CZGA 2XWBB 2OJ2A 3STBC 4K8IA 1SYDA 2RK1A 4A53A 2X6LA 4QVZA 3GO5A 2F0EA 2E3IA 3C95A 1HZAA 2VQEQ 2JA5H 4DR6L 2VB6A 1VA7A 4MZMA 3TP8A 1RTOA 1RUWA 3C4SA 3GTJH 3H09A 4DV0Q 1K73C 3KDFB 5C4XH 2X35A 1JOOA 2GFAA 1STNA 2B2TC 3SFMA 2ZPEB 2E2IH 1PFBA 2AQ1B 1SE2A 4DPGA 3UI2A 2OXPA 2AUKA 2FINB 1OXVA 3GD7A 5E4XA 1Z6HA 1G91A 4IPGA 1ZA2B 4KD3A 4CJ2C 1DJRD 3S1QB 3CQTA 2M9UA 1A15A 1UAPA 2PMZB 3S24A 3KLRA 2L0CA 3QJ6A 4FL6A 1E3PA 5CQYA 2DUDA 2B8GA 4BB7A 4RUGA 1G8ZD 3A8GB 3NELA 2C0IA 3W3AA 2RQWA 3EAEA 1RAIB 2MJ8A 2E5LQ 4CKEA 3A7LA 4U673 2IX1A 2KBTA 1XNIA 1FMWA 1K73R 3KF6A 3VS3A 2CP7A 4M78B 2MWOA 4AT1B 1TS3A 2RMOA 3NK9A 3SR1A 1YZ6A 3L3OC 1STBA 5IYBG 1B3QA 3VUBA 2D5DA 1J5EQ 4LUZA 1I3QH 4LXCA 1BCOA 2I5MX 1R4PB 4OX9L 3D4RA 2F0WA 2LZ6B 1G3TA 1KL9A 5EPJA 4B08A 1JWMD 2E2JB 5GAN5 1X27A 2ICIA 3LWUA 3GTLB 4LMQD 4N8FA 1UHFA 1OO9B 3RIRA 2JS2A 4J9EA 2HQXA 3RUXA 1XQHA 1MMDA 2W10A 5FJ8G 4C5GA 3SHLA 1B1ZA 1VQ4Q 3RUZA 1BBUA 2AT1B 2WKDA 2IPOB 3OYDA 1Y69U 1PH3A 1V9PA 1XNQL 1ILPA 3CXCS 3JCMd 1II3A 4HJAA 3W5OA 5DY9A 3SGIA 2Y0SG 1KQ1A 4EIKA 2Z6KC 1ENCA 2RI5A 3BZDB 2RJEA 1JE5A 4M78A 3OYYA 1X56A 4K5VA 2EQSA 5IP7G 1PKTA 1TWFH 1C48A 3JSCA 3K5OA 5IGEA 2K3XA 1WX6A 4OMQA 5GANj 1ICFB 2XSCA 4OO1I 3MP8A 1TSFA 2R93G 4K5WA 5C0MA 2KR3A 4K5XA 5EGTA 1SYFA 3CMEA 1TS2A 1PRTC 1KD1R 3PGZA 4DV3L 2ES2A 2KNBB 1JXOA 1G3YA 4WJ4A 2LQKA 5L37A 4B3TL 4J7IA 4QVCA 3UF4A 3I4MB 2DLPA 3OIQA 5GAHC 1I6HH 2VL6A 1CK1A 4J15A 1AH9A 1EWCA 4AYBE 3M0RA 2QA4A 4XU2A 5A35A 1TY2A 1JWSD 4OL7A 3A8HB 3E9HA 1KIKA 2PNHA 1VQFA 2NUCA 2L3PA 3U4VA 1XNQQ 2B8FA 1I1JA 3CBMA 1SE3A 4RHRA 4X66L 3ZBDA 2JN4A 3AEVA 2DGYA 3CCVT 5EKIA 3V8LA 2KUMA 4OMMA 1B3AA 4PFPA 1ZSZA 1JJGA 2NTSA 3MO8A 3M9BA 2UU9Q 4M75D 4LF6L 5IE8A 5IT9E 1QZHA 3TN2A 1R77A 3MPUB 4RG8A 1VDZA 4QIWE 2IWHA 4JI0L 4C1NI 5C0XH 3C94A 1ABQA 1NLPC 1FR3A 4K0KL 2DBMA 4X64Q 4C3JG 1ENAA 2BDNA 4LE9A 4ME3A 4O0AA 3G6JB 4E7HA 4R9WA 2KBNA 2Z8LA 2QCPX 2JN0A 2EVRA 3I56A 4V2SA 4A93H 5IWAQ 4LD9K 2ZM6Q 1VQ7A 2AKKA 3WWVA 4GNXA 2AHOB 3SWNA 1VQDA 3OYLA 3T1YL 3NMZC 4H13C 2Q8TA 4GKJL 4DXGA 1I07A 2WSFE 3QO3A 2LFNA 2LY7A 1W3SA 2K50A 4CRIA 2ATWA 2B63B 1EIGA 3L7ZC 1SFOH 2IPKD 3QO2A 2VW9A 2C0TA 3FIFA 2WB1E 1RAAB 1KAAA 4C92E 3EFSA 1YHQA 3WVEB 1B34B 1QW1A 3S2HH 4NOYA 2NUTA 3S1RH 3OPOA 5CK9A 1SRLA 3KXTA 4JI3Q 1ESRA 1AWJA 1PD0A 1X69A 5C3WA 1M5Q1 3C46A 2QA4Q 4DF7A 5FWCA 1RACB 2WIIB 1X75C 1IKMA 5CV4A 1STEA 3GIBA 2CWAA 2CDTA 4JYAL 2FZGB 3CMAT 3BE3A 4TSSA 2ENMA 4F7UF 4Q5WA 2QGQA 2EY2A 2JSOA 1K0SA 1NR2A 3VYRA 4QF4A 4DU9A 1CSKA 1YI2Q 5C4JH 5I2MA 4M7DB 1G6PA 5IGDA 1JICA 2VQFQ 2F4VL 5FRMA 1N9SA 3UA6A 1SF9A 1GCQC 3RKYA 5GAOq 5LMNW 2VGMA 1HYOA 5C5LA 2R7ZH 4O6JA 3JCMQ 2ZM6L 3URYA 3A8KE 5GAMd 4RMOA 2F0LA 1W6KA 2BDOA 5EAYA 5D3IB 4HSPA 3T9NA 2E76C 3KLSX 3GTKH 4DR1Q 2KDSA 2V1QA 5LL6X 5LJ5e 2NUZA 5L23A 4GN5A 4XK8E 5LJ3f 1TWCH 1OEBA 2DJQA 2Z6KA 6AT1B 5JJIA 5D6YA 4JJNK 1JB7A 4YWLA 1M1GA 1CT1D 4P74A 5ELBA 3QR8A 2ZAEA 5GMKh 2OQKA 1LLRD 4P75A 4Y7NB 4X62Q 4O5VA 3SE0A 2IJ0A 4RTUA 1F2MA 3K57A 3CMEQ 4ESRA 4Q0FA 2DE0X 1M90U 3GTOH 2OQ0A 2LQ8A 1TWCB 7AT1B 3UPUA 4HCZA 2FEIA 5FU6B 1N27A 2DL8A 3LWIA 3PIO3 4XT3B 1XMQL 5C0XI 1BCPB 3GDEA 2CQOA 3BVGA 2JNGA 3HOYG 2HT1A 1RI0A 1JC7A 3VRZA 3KDFA 4PJOE 1KDCA 2GGRA 1VQ8T 5CKEA 2CGHA 4DBRA 1EQRA 2UUAL 1HXDA 4FYVB 1PH8A 4R4TA 2R92B 3QUIA 3LW5E 4N4IA 2F0DA 3HKZB 1QQJA 2VXEA 1VQ5A 3FDRA 3S17H 3TSSA 1WI7A 1PDQA 1YJ9A 5AFWA 5DM7R 5C4JB 4BBSH 4PNYA 2A74C 4J6XA 2MAMA 2JA5G 3PF4A 4Y92A 3LX0A 5GJVB 3OYNA 5D6XA 1EOVA 5CV6A 3CD6A 2KGTA 3AQQA 1I4PA 2R7DA 1EU3A 4IALA 4MIUA 3M57A 1I6VC 3CCRT 1FJGQ 1SMYC 4KY6A 1H9JA 3RZOB 3OW2P 4FYDA 4TVRA 3OS0A 3OYCA 1NUCA 1WA7A 4NXNL 5LJ5h 4ZRZA 4DR3Q 2NZHA 2LJ0A 5JJLA 2DK3A 5GAOm 1K8MA 2E5LL 2EJ9A 1DJ7B 2EPDA 1KQSP 2N88A 3M4OB 1C0AA 4M7AF 5GMKe 2B63H 3K5MA 3CD6T 1EWHA 1KABA 2DL7A 1U4RA 1WHMA 3TSZA 1Q86C 1XWEA 3AMUA 1M8AA 3TEEA 4A3FG 5CBEE 4LNQA 2BA0A 3NTKA 2O2LD 1Q46A 2XIDA 5G3LD 2CP6A 2H4OA 3J81j 3SVMA 3PO2H 4LUOA 5M3MB 3PUXA 1RAHB 4J8QA 2K5DA 1RAEB 3VA5A 2B2WC 2J6OA 2AZSA 2K5NA 2K52A 4ILWA 4K2KA 4DV5L 3PUVA 3CPWA 3S16H 2VUMB 4AQYL 4IIOA 2BOSA 4LD6A 4LF5Q 4M75E 3R2TA 1KG1A 3J7A5 1IW7D 4IQZA 1XMOQ 1XX8A 3KOJA 1WJSA 3P8BB 4BA1I 1B9MA 4IIMA 3EG2A 1M8VA 2LXJA 3OYKA 1AEXA 4B3MQ 4QUCA 1KQ2A 2JUFA 4EQPA 2X4XA 4B3SL 5GAN6 3L2QA 1RADB 2MIOA 2NVXH 3UA7A 1JB0E 4BY6B 1D8LA 1O78A 4A4HA 3J80i 4XTWA 4F8MA 1UB4A 4QQBX 2CP0A 4OB2B 1X3EA 3EROA 3DLMA 4R8IA 2K7AA 1YVCA 3LGFA 3SDZA 3S14B 4BE1A 1A3VA 1H9KA 3PMFA 3FEOA 1UWVA 5M5XH 3MVVA 2CSIA 2KQWA 4U68A 2A08A 3L9AX 1WPYA 5J3BA 2YRDA 2A37A 1K8GA 5JJKA 4FYYB 2F0QA 4LW1A 4BBRH 1EIFA 4A3JG 2K01A 1O9SA 1QNUA 1ZKOA 5ELNA 1N9RA 5LMNQ 3EQLC 3CC7T 1IBLL 1IRXA 1Q86R 1AE3A 1FNUA 1K28A 4ATOA 1ONLA 4PKCC 4ZUIA 3VR3A 3ZJYC 3QDFA 3JAML 2RA2A 4HIKA 4A3IB 4LFAL 4GKKQ 1A3TA 1IW7C 3L1AA 2EVBA 5KCOA 4C3JH 3I9QA 4FSXA 3M0SA 1ASYA 3W1BA 4ZTJA 2XRQD 2K5FA 1T0JA 2PVOB 2RN8A 3QJYA 3M0QA 4J6YA 5IXFA 5GAMh 2UXCQ 3CPWS 4MDWA 1PZID 3Q8DA 5J39A 2E6NA 3X3MA 4A3GH 5E3FA 2B2VC 1E6HA 5KYUB 4ID6A 2E5QA 4FIBA 2F0VA 3SEMA 1OX8A 3MXGA 2UUBL 3EG9B 1AOJA 1RL2A 2DFUA 4GBQA 1KC8C 5HGTA 1DD2A 1NMFA 4PJOF 4KGVB 3TQ7P 4HCSA 2PUKB 4HCEA 1M1KU 4ZLTF 4MDXA 2L3SA 1SR3A 1XTCD 4QB4A 2K33A 4C8QG 4N4HA 1KC8U 4HTHA 4KLKA 3KJOA 4RTVA 1K83B 2HDMA 3ZEHA 4NS5A 3I4OA 3RMQA 1GVPA 1ZSZB 2MF2A 3U4ZA 5FLMH 3HOZG 1SMYD 4ORZA 5J22A 2ECZA 2QQAA 4DOWA 3ULLA 1R9TH 1ML0D 1YIJQ 2F0GA 2RDFA 3C3LA 2R93H 2RHIA 1JJ2S 1BKBA 1E0BA 1FGBD 4FO2A 3HSBA 5C6SA 3E0JA 1PH6A 1XOVA 5IP7H 1UE1A 1YNJD 5IIFA 4KULA 5KE2A 3O8VA 3EH1A 1FYCA 1RHPA 1SJED 2ID0A 1Q82C 1K1ZA 4GLAC 4JJCA 4KJNA 2X4JA 3DB3A 1WNLA 2F0SA 2D0NA 1P8LA 2CCZA 5GANh 1EY8A 4IFDJ 1TWBA 3MHBA 1WTRA 4OVAA 1YITT 2F0UA 2FO0A 2K5LA 4D8KA 2O01E 2A6ED 1SXTA 1WJJA 1M90C 1BI0A 4M77D 2JA5B 2L3QA 1SN8A 3FPPA 1Y8NB 3S1MH 3CCEQ 4FSSA 1QVFA 2KEEA 3GNFB 2BTTA 3CPFA 1OXSC 4GOPA 1B44D 1D2BA 3TREA 4A63B 4DEXA 2EAYA 1IYJB 2K04A 2JTMA 1D3BA 3CCUQ 2HIXA 2MP1A 2VASA 2E8GA 2MPXC 2ZPBB 4KT0E 1QVGA 2EYPA 3M0TA 3J7ZC 4KTAA 3H9NA 4IUQA 2EDGA 4IPCA 4JI7L 5CC4A 3V7CA 1VQNA 2JK8A 3M4GA 2NWGA 4C0DB 4C5HA 3CXCA 3ITPA 5CQXA 1VF5C 2EY5A 4UY8C 2UXDL 1VQNT 2I0QA 1SHFA 1UGVA 2IX3A 5C6AA 4M7DF 2KRNA 2F5KA 2OTLT 1QUQA 3I5SA 5IYCH 5GAMj 4LF4L 1FWZA 3RLNA 3CCJA 1YNJC 3TZDA 2QGGA 1KHIA 4X62L 1D09B 5I11A 4XTCS 4M7AB 1VMPA 4A3FH 1WQ7A 2H3JA 2RHYA 1SJHD 3OW2S 2JP1A 4B3RQ 4GLKA 5AJ3L 3SK5A 4OIKA 1JCKB 3U23A 4QKUA 4DAVA 4NXNQ 5DLQE 3QPHA 4OMOA 3OW7A 1SSHA 2HSPA 2NZ1D 4J8OA 4RG1A 1N36Q 4OHJA 5LL6S 1NEGA 2F4IA 4R1JA 5M5YB 3MXNA 1NJIU 3P1HA 1JQQA 3CCLQ 3LH5A 1O7LA 2E2DC 2CKZB 2F0KA 4X64L 2RSOA 1VQOQ 2JJQA 4M7AE 2KA7A 2KHIA 1PHJA 5IP9H 2IY5B 3L2PA 1WTWA 2R92G 2A3LA 2ZTCA 2E2HH 2X3WD 5CKHA 3I55T 3M4PA 2IT1A 1K9MC 3BU2A 3PUYA 4VUBA 1PRTF 2IL8A 2HHHL 1RKNA 4NKLA 1IREB 4C3HH 2LMJA 3DB4A 1MMNA 5LJ3e 4CKCA 4JBJA 3VV0A 2F0FA 2H1EA 4DK6C 3K8AA 3VDYA 4JV5L 2M00A 1NY4A 2EZVA 3SK6A 3VKIA 4Q5VA 4OWWB 4A3LH 1XNRL 3J81c 2LNHB 1QCFA 3NBIA 4DR4L 5FO7B 3CC2Q 2B2UC 2P84A 2EGAA 1YEZA 3OY9A 4X1VA 3I5RA 4UP9A 2HSEB 2EY6A 4DK3C 1J9OA 4DN4M 1UE5A 4Z88A 1RTNA 3GLXA 3MC0B 2CT3A 1PZJD 4FXKC 2DIQA 4M75C 2PVGB 4TQUS 5C3EB 3D0FA 1JRIA 3CCET 3EFRA 3F2UA 2A1AA 4NPSA 4LF5L 4HXJA 1TR5A 1K83H 5CKDA 2RHQB 5IXBA 4AG1C 4TVAB 5BR8Q 4J9GA 1FYNA 1NYFA 1Q81C 3MXPA 2L3RA 1X01A 5ELEA 5JOBA 4F88A 5ELFA 2DILA 2O2OA 1BCPC 2EYOA 3GTJB 1LOJA 3OYIA 2PQAB 2RCNA 4ZN1A 1SMXA 4A3JH 2VUMG 1C6VX 2D8HA 5CVIA 1QCNA 1YJNA 1LTBD 1Z9FA 3VR4A 1B50A 2ZZDA 2SEBD 2ZXOA 1B9NA 1LCKA 4MZTA 4APVA 2P0QA 3FRPB 4KH0B 2N3SA 2DY7A 4BBRB 1QVPA 2EJGC 3HFNA 3NFCA 2X6GA 3CHBD 4HIMA 2JMCA 2UXCL 3QWYA 1M4ZA 2QGFB 1PNJA 2KY9A 2RF0A 1LTID 1EWIA 4FVMA 4MN3A 3SK4A 3S1NH 4OX9Q 4C3IH 3EG1A 3FMCA 1VQMT 5KYWA 1LV9A 2PW5A 5M5XB 3TZUA 3S14H 1MSHA 5CKBA 2HZYA 3VRYA 3PE0A 3OYBA 1QVGP 1PM3A 1W2BS 1L1OA 5CGKA 4A3DH 4A3IH 4PJOG 1X3QA 2KCNA 2Z4HA 2OWOA 2DD4A 1RABB 2F4VQ 2F0TA 1EY7A 1V1OA 4JLIA 4YCWA 4C8QF 4RMFA 1EQVA 3ONAB 1Q82R 3Q23A 1K8AU 1YHBA 3H6MA 2V26A 5C0XJ 3QZ5B 4PMBA 4EMGA 2E6ZA 1IO6A 2EYJA 2JA8G 5C44H 3OHXC 1HNXL 2XGTA 3RESA 3OWFA 1KHCA 2ZJRA 1PH5A 1PV4A 2BZXA 3PSIA 2KOLA 5EG2A 4FNFA 3CCRQ 1U5KA 3ER0A 3M5AA 4M77G 1BCPF 3K7AB 1HJPA 5E7NA 2JT4A 4L59A 1OXUA 4BY7B 2YLCA 4PJNA 1DOLA 1WHKA 4JI4L 3DM3A 2NVXB 4I7AA 3PO2B 2ZGWA 2MUYA 4A3CH 1MSGA 1Q12A 1Y1WG 4G7ZC 3GTMB 4J9BA 4KHPQ 4C8QD 1S5DD 2COWA 1ENFA 2RHSB 4IFDG 1FMKA 3V05A 3N6RA 1CKBA 1CA6A 1S1NA 1N8RU 4ULLA 4QIWB 2WFWA 1Q7YR 2PU9B 2UUAQ 4PMCA 2HL3A 3G4ST 5D3DA 4CDEC 2D8JA 1H3HA 3KLWA 2ZPFB 1QVGS 1U9RA 2YTVA 4E7IA 1YJWQ 2K5IA 5H1SE 3VU3C 4LDXA 2OCEA 4KK7A 5T1IA 2XVSA 1KNEA 3CMET 4GOPC 4PLLA 3JAMi 1QCBD 4EQ5A 1R0CB 3G6ET 1VQ5Q 1K0XA 1ARKA 1T0HA 1VIFA 3EG9A 1HH2P 2CVRA 1QB5D 3S9WA 1EQQA 1D1AA 2WB1G 3QIAA 1AP0A 5KEEA 4C0ZA 1EZ8A 1TOVA 4JRKA 3CCVQ 2EY1A 3CAMA 4DUYQ 1G3WA 2ZPHB 1GUGA 1YIJT 2DL5A 5D7UA 1BI2A 1EFNA 1N32L 4OB1B 4MHEA 1IBMQ 4ZTFA 2K05A 2KENA 3G71Q 3EJIA 3REAB 4DR3L 3BDUA 5EJWA 1OXXK 2QQBA 2J06A 1MNEA 4P5NA 1MV3A 1Y0MA 1Y96B 2D62A 1ASZA 3RZOH 1PLFA 2ALYB 2DXTA 2K75A 4JI1Q 1YWOA 1S3OA 2N55A 3I3CA 4DV0L 3UDFA 4ZGEB 2N78A 1I8FA 2R58A 4HEDA 2HNIA 4DAYA 1HXYD 2FHDA 1SSFA 2Y4XA 2EKOA 2CUDA 2A68C 3CD6Q 2RKSA 2YDLA 1IKLA 1BDOA 1BBWA 1VYUA 4YWKA 1I94L 4UP8A 5GAN3 4PNOA 1NG2A 5LJ3g 3THKA 1EY5A 2KECA 1HFNA 1D0ZA 1P16A 1ZHIA 4JOIC 3UDXA 2R57A 1AT1B 3PMIA 1VQBA 1KXLA 2RDHA 3AB9A 2DO3A 4X3UA 2FPEA 1B34A 5LMUL 1X3FA 5KIXA 1MHWC 2JTEA 1NJIR 1MHNA 2IHEA 2A6HC 3E9IA 3WDNA 4F7XA 5T1GA 3S1NB 1D0XA 1UDLA 1YP5A 1YNND 1SFOB 1ZSGA 2VQEL 3GTOB 1TIID 3W1GA 5GROA 1OYXA 3LX7A 2GCXA 2DYBA 2B29A 2L12A 3TP6A 1AVZC 4M7DC 3I35A 4Y7NH 1HD3A 4AG2C 1MKHA 1BK2A 3GBQA 2DEUA 5FROA 1Y8PB 3A7AB 4JC0A 3QKJA 2WSCE 4IFDH 2L55A 1ZLMA 4DR2L 5KYWB 1RJTA 3VYTA 1HR0Q 2KXCA 2O88A 1Y1WH 1ZBJA 1WJQA 2QG9B 2XD0A 3G48A 4RGMA 4FF2A 5AT1B 1D1KA 1SDFA 3CMAA 1J5EL 3CCSA 3G71A 4A3MG 1A62A 3QYGB 1PCXA 3FHWA 3MWYW 2GVBA 1Q95G 2CH4W 4Z8AA 2X69A 4IO9A 1RAFB 1AEYA 1E2ZA 3X26B 5J26A 5KGUA 3S1RB 1HNZQ 1EL0A 1M3AA 3G7ZA 1HNWL 2Y0SE 2KRSA 4XT1B 1F2ZA 2UUCQ 5C3EH 4RH6A 4H44C 2R6GA 2Y90A 3S2DH 1I94Q 3MA2B 2MHVA 3VR6A 2KEDA 2XMFA 3JCMb 3MTSA 3CCJQ 3H6ZA 2EYZA 4E47A 1HQMC 2JVVA 2RQRA 2KYBA 5HY6A 4UDUC 1LO5D 4E7JA 2FXQA 1SROA 5EBCA 2RF4A 3H3VI 4II1A 3OS2A 3NWTA 4MZPA 1IHWA 5IGCA 1WJRA 4AH6A 1QWYA 1VQ8A 1JMCA 1DOKA 2K7VA 4F16A 4JUVA 3NPPA 3BDLA 2P4TA 2QKIC 5KYXA 2A19A 4A3EH 1QZGA 4KKSA 2DRKA 5M9OA 4A3DG 2FPDA 1YCSB 1NYGA 2MO1A 4KI0A 3HS0C 1WD0A 3MFYA 4A3BG 2C0OA 4BDYA 2V1RA 1VCIA 1HA6A 2Z6BA 2ED1A 4C3HB 3OSSC 1MUZA 1DONA 1OI1A 2E10A 1A8VA 1HUMA 1X65A 5JEAG 4ODGA 1N34L 2XDDA 2VC8A 1VQOT 4PV1C 4IKFA 1VQPQ 1KQSA 1VQLT 2EFIA 2YUPA 3PVQA 2RCFA 4RKBA 2MCNA 4ZYSA 2E2HB 3VS1A 1UJYA 5L8RE 1WYDA 5IHKA 5A2QL 1RAGB 2IG0A 5M3FH 3CMAQ 4OELB 1GM5A 4OWXB 1F9QA 5C3EG 3QOLA 1J3TA 4FT4A 3SWNB 4AFZC 5KYYA 2DRMA 1GO3E 2M9VA 2JA6B 1PMRA 4C0GA 1EY4A 2DMOA 4BWGB 5KYXB 4DV3Q 1EIHA 3ASKA 1LT3D 4DUZQ 4EVOA 4XU0A 4MTKA 2M02A 1N5ZA 2A73B 1WHGA 1X32A 1UTIA 1LUZA 2KROA 1PH9A 1OQKA 1T5XD 1K8OA 2XNAC 4AMCA 1S72T 1LABA 3JRZA 1PFMA 3FVQA 5FO9B 2OTLQ 1X43A 1VIEA 4KGZB 3MHXA 4M77F 1VQ6A 4I65A 3T1YQ 3RZDH 4LF8L 3HL8A 2EE1A 1BU1A 1GUSA 5I6YA 3HOUB 4IUUA 1CTMA 5HGQA 2GNCA 4ZNXA 2N49A 5HURA 2MWPA 5FK9C 3M85A 1K8AR 1HA5A 2PCFB 1YJWT 4J6WA 5BN4A 1SNCA 2PNRC 1QP3A 2BUDA 3DEPA 2A8VA 1TXQA 5ECAA 5GAN4 1X9NA 1ZUYA 2HQHA 1I50H 4EQOA 4DEYA 1V29B 3BDOA 2RHXA 3BJUA 3EFOA 2V1CC 1AFPA 2HDAA 2F0MA 2G9DA 5ISRA 3MP1A 4YY3L 4HJ5A 3H0GG 1MMGA 3HKZE 3RERA 3H3VH 1SKUB 4JI6Q 1D1BA 3GTLH 1QKWA 4JBKA 3CPWP 4RTZA 1V1QA 3GV6A 4EX5A 2GA4B 5IT9c 2RJDA 3WVDB 1I4RA 1ZX6A 3L2UA 1WTVA 4RTYA 1L1OB 3OMGA 4BE2A 2F3IA 5IWAL 1X6GA 1WOCA 1LTAD 5GAN2 1EYDA 3VYHB 1SNOA 1TU2B 4E7KA 1N8RR 4J9CA 2D1XA 5CV8A 2B86A 4IOCA 5GAMg 4A4KA 1LTLA 3BFMA 1H3ZA 1VQ9A 3ICEA 3U58A 2X4WA 3E6ZX 5IGGA 1JOQA 1WTXA 5FLXL 1LM0A 2J6FA 2LQWA 4X9CA 5GAOr 1PA6A 1WTPA 1YI2T 5GAN7 3OBWA 3I70A 4IJHA 3PQIA 3UDCA 2K6AA 2FMMA 2K2MA 4JS4A 1WI5A 3KLSA 4F7UG 2EYXA 4Y52H 1PYBA 2DL3A 5DLOA 4A3LG 1GBQA 3NGPA 2AWOA 3JCMW 1WYXA 1EIYB 2WINB 2PNIA 3U50C 1HZCA 3TEHB 2ZPIB 2QEXA 4QMGA 2RQXA 2EPBA 4K6LA 1I81A 2MO0A 4HJ9A 4O2DA 4XDXA 3DM1A 3HG9A 2Z1CA 4PFZA 2Z9HA 3EGUA 1VQ4T 1WIEA 2B39A 2C35B 3RLOA 1DM0B 4K6DA 1PSEA 1CI3M 4FP5D 1TS5A 2VGNA 1R8OB 1EYCA 3H41A 1EFID 1IBKQ 4OMNA 1YHAA 3HZXA 4A3GB 1BVSA 3TS0A 4M77C 4MMLA 1JEGA 4DXFA 2Y0SB 2EQKA 5KE3A 3CC4A 3H0GB 3E9FA 4BY6C 1SNDA 2V4DA 1QKXA 3OA6A 3MEAA 2F2XA 2KSSA 3FEWX 4LDWA 3VJPA 1E6GA 2A36A 2OTJT 5F2DA 3BZKA 4XQQA 2O5JC 3NEMA 4BUGA 2LP5A 3MEWA 3QG1A 2PI2A 5C4XB 3OS5A 3M4YA 1TUCA 1WHLA 2WSEE 4CBVA 5FLXc 2CUBA 1E7ZA 1QUQB 3I8ZA 4LFAQ 4GKKL 5IGFA 1SEMA 2NUPB 4D8DA 5C4XG 4C92C 5GANe 3AT1B 3R2IA 3AHUA 2F52A 4A3FB 5IYCG 3EGXA 1NE3A 2DZ9A 2SOBA 4PL6A 2YT6A 2XTIA 4JDSA 1TXYA 1TTHB 3KUPA 3M0UA 3H8ZA 3U9SA 4B9WA 2K9GA 1MNDA 1I50B 5FLXE 2DXUA 1KD1U 1T9HA 2UUCL 2DVJA 1Y96A 2NTTA 2LTOA 1YITQ 4GZYC 3I4NG 2E64A 2HCKA 4WJWA 1MJEA 3K59A 1QILA 1DCZA 3JCMX 3PT9A 5ELDA 1KIXA 2DEQA 3Q6SA 4F17A 2DY8A 3V7SA 1EYGA 3KFVA 2DL4A 1ZXTA 3CKIB 1WFQA 4TKOB 1BCMA 2CHBD 2RK2A 2LVMA 3C2PA 1CKNB 3CW2C 5K36G 3TMEA 3M9QA 5D6WA 3A8LB 2PZWA 4G4KA 1BYMA 2EJGA 4M77A 4LF4Q 2I46A 2JA7H 1AZPA 4WF2A 4M75A 3S1MB 5IYDH 5GJWB 3ND8A 3QZ9B 1OPLA 2GN5A 3Q22A 1PH1A 2NLUA 1M2VA 5E1FA 1TQOA 2X3XD 5M5WH 2QEJC 2JA8H 1EZZB 1BNZA 1Y8OB 2VUMH 3META 3VR2A 3E3XA 2K3BA 2IHFA 3RNJA 4ME7A 4NW2A 5I9PA 3VS0A 4PJOD 5M3FB 5M3MH 3L42A 3S15B 3BYTB 4GNXB 1WVLA 1AW7A 1TWGH 1YIJA 2F1MA 1UECA 3C12A 5EKLA 1PYWD 2NVYB 3BVZA 4RGNA 2RI3A 1W1FA 3HP3A 2K5VA 2ZPGB 2PMZE 3M4OH 2JEBI 3RD4A 4DNRB 3R6OA 3PNWC 1DGSA 1FNWA 5CR3A 1OZ2A 1C9OA 4ZN3A 3ME9A 4OMFB 1PTOD 1QVFS 1AHJB 5FOBB 1WHHA 4DOVA 1NBEB 1L0XB 4DV2L 2KAFA 4DV7Q 2JA7G 3I4NB 1H9SB 1GBRA 3A5ZB 5EPKA 3K0YA 1N32Q 2DAQA 2EYWA 4C92A 3HGBA 2G5DA 1BIAA 4C92F 2KT8A 3CCMQ 4HCBA 3I4LA 1EEFD 4DNIA 1HZ9A 4JI2Q 4G7HC 3F70A 4B3ML 4N8X1 1S72A 4DR7L 1G2BA 4IURA 3H94A 1UGPB 1I5FA 2F0HA 1XYIA 3S17B 4A3EG 4H7BA 4KV6A 3I2ZA 1BBXC 5C5MA 4RCOA 3OMCA 3I4NH 1PSFA 2GQIA 1O80A 2E74C 1D5MC 1WLPB 2NYZD 2FB7A 2LT4A 2RPNA 1GOZA 3PTAA 2K3YA 2X51A 4GY5A 3Q1JA 5LJ5d 2VVKA 4C3JB 2QDLA 1XTDA 4JRIA 3CEYA 4KY5A 1A0NB 2GBQA 1I4K1 5HKCA 2NWMA 1HUNA 4HJ7A 2Q2HA 3EFXD 5DEHA 3M58A 1W6JA 2NVYH 3OBYA 2A68D 1HFGA 4NDXA 4BDZA 3PO2G 1VQLA 3J81i 2CZ6B 1CM9A 1VQIA 2CQAA 2CZ1B 1EOTA 2YUOA 4HVVA 1AWOA 1I4GA 5CV7A 1C8CA 1TU0B 5GMKm 1MIUA 4PJJA 4XYOA 1RLPC 4J7FA 3JCMV 1CKAA 1B8AA 1NTGA 1STYA 4DV7L 2B2TA 4JI1L 1HCZA 1ZEQX 3GTGB 1VQAA 4G7OC 1PTOH 2QTVA 1GJXA 2NN6I 1VQKQ 1M8MA 2WP8J 3I4MG 4X3SA 1B07A 2VB3X 1UGRB 3E9GA 3FJ5A 1O7IA 3L2VA 3RN5A 1XJVA 4M78F 2ZXRA 4DA4A 2YRVA 4BI3A 4GOPB 5CORA 1OU9A 2JA7B 1HR0L 1HJDA 5FWBA 2Q8IB 2BE7D 3HHTB 2WKCA 2AQ3B 3PGGA 1DZ1A 8ATCB 1E1TA 1LTRD 3J7AF 4P72A 4QUFA 2VY3A 2YU9H 4C8QB 1SRMA 3A8OB 2DF6A 2CREA 3UE1A 1F2YA 2AWNA 2HEQA 1FGUA 1YJNT 1X6BA 2EQJA 1VQNQ 1UEAB 3OTOL 3H0FA 4A76A 4DV5Q 2OAUA 2C06A 3UDIA 1OV3A 2DNEA 3CQZB 4M1UB 4LF9Q 3S16B 5COYA 2NB0A 3DMUA 2V8KA 3P7JA 1EY9A 2QEXQ 2LSSA 5JPMC 1QMCA 3VR5A 1LNXA 1SHGA 4BY1H 4IOAA 1ICWA 2ZTEA 4K0KQ 1U1TA 3HEJA 1VQJA 2HBPA 5I4DA 3BY7A 4JI2L 1Q3LA 2OT2A 4C0DC 2SNMA 4A3BH 5AYFA 4DFAA 1ESFA 4A3KG 4A3KH 5GANf 4DK1A 4ANJA 1MD2D 3OW2A 4UAIA 4C5EA 2L9HA 3CBPA 4IPDA 1LJOA 1B4OA 2HL5C 2QI2A 2MYSA 2QDBA 1QWEA 5IHIA 3TP5A 1OOTA 3VS2A 3CCQT 3O5ZA 1M2OA 3CBOA 3G4SQ 3DLLA 1U4PA 1EY0A 5FW9A 1ZYRC 2YTXA 3R3OA 2GQVA 2HBWA 1CUKA 5EBDA 4DAPA 4BA2I 2CKKA 2DXCA 4QQ6A 2EGCA 4WRDA 3HOXB 3JB9I 4JZ4A 2K57A 3I56T 3H0GH 4KGXB 5I2XA 2BH2A 2EQMA 4X65L 1A2TA 1Q8IA 4MNOA 1SYEA 4BBSG 4E6RA 1VQ6T 1M27C 2DA9A 3A74A 3O13A 4PZ6A 1YJ9Q 3HOXG 2K4YA 3H15A 1WDXA 1NPRA 1ACMB 4NP5A 3JCMf 3K81C 2J7IA 1GRIA 2G6FX 5CMDA 4RCCA 4LN2A 4QJFA 4NB3A 5DM73 3D31A 5FU7C 3LGJA 4GKJQ 2EYFA 4M7DG 5KYLA 1XPRA 1PTOF 4JBMA 1D3BB 4QW2A 4DR5Q 4YCUA 2BZYA 2K1BA 5JPNC 4FT2A 3F1ZA 1N36L 4UHVA 3KUFA 2WAQG 1KNAA 4LK1C 4BACA 2YXYA 2QW7A 1ABOA 2L0AA 5IAYA 5JVH3 3T51B 1L1OC 4KKTA 2JOYA 2YV5A 4I7ZC 4A3MB 1K3RA 3I4MH 3K58A 3CCLA 4LWCA 3EN2A 3ZL7C 4AQYQ 4BXXG 2WAQB 3C1FA 3EFOB 1ZSZC 4DUYL 1ILQA 4OMPA 1UGSB 4A3CG 2FMCA 1H9MA 4L5RC 1X3GA 2JS0A 3A55A 1TS9A 5JAVA 5FLMG 1HPCA 1XPOA 2EYMA 1QG7A 3LNNA 5BN3A 1W4SA 3P75A 4R55A 1H8KA 2LCLA 3NUCA 4ZKBB 1U4MA 3RR6A 1NAPA 2FZCB 3GOXA 3D7SB 3B6YA 1Y57A 2QA4T 2XI9A 2Y4YA 1TWFB 4KY7A 3RN2A 3M55A 2CW0D 4YTLA 2PUOB 4R8NA 2IW3A 3PUZA 3GTKB 3PO3B 3JB9J 3IL8A 4OO1H 2FG0A 5KNDA 1C4QA 2F2VA 4OP0A 3IRBA 3NENA 2VNUD 4CC4B 3NXWA 4RKUE 5I2YA 3K5NA 1IBML 1AZQA 3PO3G 1VQOA 2B2YC 4C5IA 3A1PA 4PJOB 2JMAA 2C5CA 3MXNB 1N33L 3J80E 1JOKA 4FXGC 1K0RA 3MEVA 3A98A 4BY1G 1EQTA 1G6ZA 2K6DA 3FB9A 3FRNA 4IUPA 3JC66 2F2WA 4FF4A 1IYVA 3MZ5A 2J05A 2JZ2A 1J8IA 2E2JH 4R4OA 2DBKA 4IJLA 2YWWA 1N9WA 4R4QA 5IOCA 3EGDA 2LXKA 3GF5A 3HFZB 4HSVA 3PMTA 4C92G 1SYCA 4LFCQ 4DV2Q 3CCQQ 3PO3H 2OTJA 4L5SA 1JT8A 1R4QB 3JCMJ 3SK8A 4L5GA 4KUDK 2DN8A 4A3BB 3V8KA 5I6WA 3HRTA 3E5SA 1QWFA 4OO1G 1GKHA 1AWWA 2FRWA 3OYAA 3U9OA 3RZDB 2FHTA 5CBAE 1MV0B 2CSQA 4F04B 3R8BA 3OYFA 1M1FA 5M3FG 2LX7A 3C1EA 4LFBL 1NLOC 1H95A 3M7GA 5CAIA 2LDMA 4DV1L 1M2VB 2QF7A 3S1QH 5GAMf 2YHTA 3NPFA 3CC4Q 2G9HD 1GHJA 3H91A 3KF8A 4JOIA 4A93G 4A3MH 2AMCB 5LJ5f 4UPAA 1HNZL 2E41A 4M7AC 1KAWA 2K4KA 4ELZC 2JA6H 1UNSA 1SSOA 3OOCA 1U8RA 5DNFA 4AFUC 4JI7Q 2E2IB 2RBMA 3X25B 4NXML 4A93B 4OGCA 4JVZA 4IZ8A 2XRSD 4GS3A 3G7LA 4RA8A 2O31A 2WV6D 4DR5L 1HNXQ 4QQGA 3EGXB 2GF7A 4JI0Q 5IN1A 3VYUA 3GQBA 3RLFA 4GLVB 2BE5D 4AYBB 3QOJA 2A5HA 1PC0A 3QDRB 3E1SA 1NMGA 2PO4A 1S5FD 1LPLA 1WD1A 4DV6L 1WTQA 1AD5A 1PKSA 4PFOA 1WHJA 4AYBG 2C9OA 2HQLA 1PRLC 2HKQB 1TKWB 2VS1A 2DYIA 2K79A 1PG5B 3K6OA 5K36H 1VOMA 3HOXH 5I9OA 2M0OA
chains in the Genus database with same CATH topology
2KMTA 2BIVA 1CSPA 3HOWG 3JCMh 3BZCA 2NVTH 5IYBH 3F2CA 5IY0A 3PUWA 4DV1Q 2VQFL 1G3SA 5GADC 4YHHL 3L2WA 4EMHA 2YTYA 1WCMH 1V43A 4M77B 1IL2A 2EWNA 3T1HQ 1G291 1OXTA 4JI3L 1WGSA 1Y14B 4OB3B 4OF1A 2QQRA 1NE8A 3X24B 2XK0A 4M7DD 3M53A 2L5QA 1G51A 1FXXA 3FKIG 2DJZA 2P0KA 4HT9A 3HFOA 2R7FA 3GTQH 3RNUA 2QEXT 2UXBL 5GAOp 2VYTA 5IP9G 4NXMQ 3OSVA 5GMKl 5ELOA 3OQ5A 3V8JA 3JCMc 4Y28E 3E0EA 3TQYA 4POGA 3SD4A 2D0PA 4XTZA 4JI5L 5CO7A 1EUJA 4XU3A 2VUBA 4HKEA 1YI2A 4QL5A 5HK3A 4JRPA 3QBYA 2XKOC 4PJOA 5CCAA 3CCLT 3J81E 2KK4A 3S6WA 1X54A 4C8QE 4UP7A 2HIVA 1PH4A 3S3NA 5C0XG 4KHZA 2FVUA 5LJ3j 4M78D 2PQAA 2Q2IA 1VQKT 2D9TA 3T1HL 1FJGL 1KRTA 3EIVA 2UXBQ 5GAOn 1Q8KA 2QQSA 1RIPA 2XU8A 2MQHA 4YHHQ 1Y1VG 4LF6Q 1YBYA 3JCMg 2BH8A 4M78E 4GN3B 1EFWA 3FKIH 1H95A 1VQCA 1O75A 1YJ9T 2VV5A 4A4FA 5A0LA 2RI2A 3P8DA 1B7YB 3UT1A 1VQMA 4EMKC 2KCTA 4XIGS 2M1HA 2DTHA 3PIPA 3M7NA 4POFA 1CKNA 3KYHC 3CCUT 1L0WA 2X4YA 3GTMH 4LDUA 3ZFJA 1KQSS 2V8IA 3CCMT 3S15H 1BI1A 3HP9A 2RHZA 2CWPA 4BY7H 4JI4Q 2JA9A 3JAMc 5GAGC 3A0JA 5M3MG 1XPUA 4BY7G 2O4XB 3HOZH 3CC2A 4BBRG 4DKAC 4DAYB 4C8QC 2HQEA 4B3SQ 1E22A 1J6QA 3LWHA 3JAME 1IZ6A 3FJPA 4ZGDB 3RKXA 3HOUG 1Q81U 2CZ7B 1KRSA 4IFDI 2PI2E 4QGUA 3V7RA 2LC4A 1VS0A 2QTXA 4M7DE 4P71A 4LFCL 1JJ2A 3GTGH 2R5AA 3F8TA 2L89A 1G5VA 2Z0SA 2WACA 4M78C 3SGIA 4FM4B 4B3RL 4HT8A 2D0OA 5LJ5g 5GAEC 3GPLA 2DVEA 4EDUA 1VQPT 2B3GA 1Y71A 4N0AC 3EBEA 4LDVA 3PIOA 2L15A 4JBWA 2QQ9A 2OTLA 2XHCA 2CFMA 3K7UC 1MGQA 3PV0A 4OWTB 2RH2A 3OYHA 5GMKj 3SWNC 5IYDG 4C2MH 1PH7A 4OONA 4J5YA 4JV5Q 5FJ8H 4LF8Q 3MEUA 4JI8L 2B63G 3CCJT 4LF7L 1NZ9A 3K0XA 4C0FA 3KBGA 1VQPA 1UGQB 3M56A 4MMKA 3FLGA 1Q86U 1Q1BA 2R92H 3J80c 3CC2T 1N6AA 3LLRA 1XMQQ 3LYIA 4AIMA 4HIDA 3MCAB 4EMKA 1CKMA 4WJ3M 2HD0A 3CCMA 2R5MA 4FU6A 2UU9L 3CP0A 4PZ8A 5JEAJ 1IXRA 4C92D 4F7UA 1HNWQ 4A4EA 4L5TA 4ELYC 4X9DA 1TWAH 3F2BA 4M7AG 1FVIA 2JTFA 4BXXH 3LGLA 3OYMA 1B70B 3UDGA 4JS5A 2I2LA 2ZCFB 4DR2Q 2CZ0B 2DKGA 1IBKL 4JLGA 1N34Q 4LF7Q 1Q82U 2NVQH 3E19A 1U0LA 3HOWH 2RHUA 2K2VA 1ZQ1A 4XQ3A 2UXDQ 3QSUA 4MTNA 3GP8A 3PF5A 1PYSB 3CF5A 3HOUH 1YHQT 5KCHA 2O4XA 1W2BA 2YYZA 3LH0A 2E65A 1Y07A 2E1HA 1UEBA 3S3MA 4XAXB 4LDYA 1WCMG 4LFBQ 1NPPA 3DKMA 3L2RA 1SLJA 2DIGA 4JI8Q 3JCMP 4YWMA 4PLIA 1X6OA 1Q7YU 4P73A 2I5LX 3HKSA 5HK0A 2BA1A 1XMOL 1QP2A 2JA6G 3L2ZA 5FRNA 3TRZA 1Y7XA 2LRQA 4HA8A 1NJIC 4BY1G 2EIFA 3ERSX 3VUZA 1OZ3A 2FYKA 2I5HA 4DR6Q 5GQOA 4A4GA 4RG2A 4HJ8A 2HHHQ 4KHPL 3QIIA 2VZAA 4KBMB 3CCVA 4DQ2A 4XU1A 3A8MB 4PMWA 3SB2A 4BI8B 1ZBXA 4Y91A 4DR1L 4A3BH 1YCYA 2F5TX 1HK9A 2ASBA 2M16A 1SRUA 4C92B 2XG8D 5KH6A 1GD7A 2XDPA 5FU6C 1UE6A 4Z02A 4BI4A 4DV4Q 3I55A 4IUTA 4EPCA 2VXFA 4X34A 4D6WA 4A4IA 3TCJA 4X65Q 3MEFA 1HZBA 4M75B 4R4IA 2FL7A 4JRQA 5C44G 1M1KC 4M7AD 1NBWA 3KF6B 5GANd 3MP6A 4OB0B 1VQKA 2QXFA 3CCST 3CCRA 3F2DA 2BKDN 4DAMA 2YLBA 4DR7Q 2PQWA 2RO0A 2ZJQA 3KFUA 3M4QA 1S40A 4RCBA 1L2FA 4F7UB 1VQ5T 2NZOA 1C7YA 1HR0W 1WQWA 2JEAI 4XTUA 2RD1A 3RMSA 1E24A 3X20B 2F69A 4IUVA 3PCOB 3GNGA 4E7LA 1VQ7T 2KHJA 4H02A 4GNXC 1VQGA 2DXBA 2KVQG 4BE0A 3A5UA 4JCVE 2EQUA 4C8QA 4ZGJB 2EXDA 1N33Q 4OGEA 2GFUA 4QVDA 1FL0A 2E70A 4MZ9A 1VQ9T 3AFQA 3FC3A 3HOYH 1YNXA 2N8NA 4JG2A 2K5HA 3NBHB 2RJCA 3P8HA 1LYLA 1OTCA 4M75G 4J83A 2L8DA 3BW1A 3RKWA 4N4GA 3M3YH 2JE6I 4BD3A 3STBD 4M78G 3JB9F 3HPWA 4QQDA 3G6EA 2B8AA 3RR5A 4XTYA 1Q1EA 4LF9L 3M59A 3URGA 1P92A 2EYQA 2R7ZG 1A63A 2XDBA 2AHJB 5AJ3Q 3HKZG 4PZ7A 3WXMB 3G71T 1H641 1IBLQ 1U1SA 3TS2A 1I5LA 3CC4T 3UE0A 5GANg 2P0PA 3JCMe 3JB9H 2LCCA 3QYHB 4GN4B 1K9MU 4PJOC 2MFIA 4QY7A 2MNAA 4DUZL 5LJ5j 4HCCA 4LUVA 3K7AH 3NTHA 4M7AA 3JB9D 4GLXA 3CQZH 1JBMA 5LMUQ 1SE8A 2Q2TA 2AKWB 4M77E 1UE7A 2LNVA 5GMKi 4JI6L 3QHSA 5LMNL 3X28B 2DTOA 1PH2A 3OYGA 3ULJA 4M7DA 4XTXA 4X66Q 2DZCA 2WAQE 4FDBA 3HRSA 5GAMe 5CR2A 4L5QA 4ALPA 3HRUA 4XTVA 2GVAA 2KCMA 1CKOA 4B3TQ 2E12A 4A54A 3AYHB 5CIUA 4YY3Q 1N8RC 4A75A 3I7FA 3FP9A 3TU4K 5I21A 2K14A 4IPHA 3HOVG 4R56A 3CCUA 3NTIA 5A0GA 4NL3A 4DV4L 1FX7A 3K80C 1AE2A 4B9XA 4A3GG 2DTIA 5CKFA 1M9SA 1Q7YC 3OYJA 4UC4A 2EJFA 2XICA 1GXIE 3OYEA 5A0DA 4CI0C 1E1OA 3VYGA 3CCEA 3CC7A 4N0AA 5LJ3d 3S3OA 1QVCA 1TH7A 4EMKB 3QXEB 3N5BB 2D6FA 4JI5Q 4A3IG 1VQ4A 3PFSA 3L0OA 2G3RA 3AFPA 3OS1A 4JYAQ 1Z47A 4YCVA 2RJFA 5GAOl 1BI3A 3G4SA 1VQHA 3INZA 3KF8B 1D7QA 3UWNA 3OTOQ 2HAXA 2PVDB 2LT1A 2A7YA 2NN6G 5I2SA 2LX9A 4HIOA 1K73U 2IVWA 4F7UE 4NL2A 1VQEA 4PG3A 1KD1C 1MJCA 4KUIA 1BIBA 2RM4A 1A0IA 1VUBA 2CS7A 2DPPB 5M5YH 2CYZB 5FU7B 1JJCB 1YITA 4DR4Q 2DD5A 2D0QB 1CSQA 1TWHH 1X55A 5GAN8 5A2QE 1XNRQ 2MMPA 1PFSA 3M54A 3OB9A 2RB6A 3KJPA 4OXPA 2JQOA 2UUBQ 1PVOA 2ZJPA 4DV6Q 2V8JA 4L6V5 4X6AH 2MI6A 3GTPH 2H5XA 4M75F 3HOVH 2QDYB 3CCQA 4R4CA 1YJWA 2IX0A 2Q2UA 5BR8L 2ZTDA 3ULPA 1K8AC 3JB9G 5LJ3h 1Y1VH 3STBC 2RK1A 4A53A 4QVZA 3GO5A 3C95A 1HZAA 2JA5H 2VQEQ 4DR6L 4MZMA 3GTJH 3C4SA 4DV0Q 1K73C 3KDFB 5C4XH 2X35A 2GFAA 3SFMA 2ZPEB 2E2IH 4DPGA 3GD7A 1OXVA 4IPGA 3S24A 2M9UA 3QJ6A 4FL6A 1E3PA 5CQYA 2DUDA 4BB7A 3A8GB 3NELA 3EAEA 2E5LQ 2IX1A 1XNIA 3KF6A 4M78B 2MWOA 1YZ6A 5IYBG 3VUBA 1J5EQ 4LUZA 1I3QH 2I5MX 4OX9L 1G3TA 1KL9A 5GAN5 3RIRA 3RUXA 2HQXA 1XQHA 5FJ8G 4C5GA 1BBUA