1XTDA

Structural analysis of leishmania mexicana eukaryotic initiation factor 5a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
149
structure length
149
Chain Sequence
NASKTYPMAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTHNVEVPFVKTFTYSVLDIQPNEDPSLPSHLSLMDDEGESREDLDMPPDAALATQIKEQFDSGKEVLVVVVSAMGTEQVLQTKNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
rcsb
source organism Leishmania mexicana
molecule tags Translation
molecule keywords eukaryotic initiation factor 5a
total genus 26
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xtdA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xtdA02
1UE6A 1WYDA 1V9PA 2I5MX 2UUCQ 3HOWH 4DR6L 3TREA 1TWHH 2QGQA 3CC7T 5EAYA 1EUJA 4HIDA 1YJWT 1YI2T 4A93H 2K5NA 1HZAA 3K7UC 4OO1I 5GAHC 1S3OA 1HNZQ 1M1GA 1M90U 5K36G 4LF7Q 4GLVB 1XNQL 3LH0A 1VQIA 1LUZA 1YIJA 1X9NA 1I94L 2C35B 1VQAA 4B3RL 4MZ9A 2EIFA 4GKJL 1N9WA 3W1BA 3CCUT 2MFIA 4DNIA 1VQ9T 5IYCG 4JV5L 4DR5L 1N8RU 1QVFA 1VQKA 3S2HH 3RZDH 4DR4Q 3IRBA 3CCRA 2I0QA 1YJNT 2AMCB 1HNWQ 4OXPA 2UU9Q 1XPUA 1JE5A 2VUMH 4X6AH 5AJ3Q 2VW9A 1X3EA 2MO0A 1E1TA 3H15A 4DR6Q 1L1OA 4DV6L 4JI8Q 3M4PA 4LUVA 1PH6A 5M5XH 3VDYA 1Q8KA 1IYJB 1U0LA 3EBEA 4QL5A 4A3FG 2UXBQ 4JV5Q 2DO3A 3HKZE 1XNIA 1L1OC 5IYCH 2JA7G 3CC2A 1N36Q 2PQAB 2AKWB 1Q1BA 4JI3L 3KFUA 2QA4T 1JJ2A 3GDEA 3OTOQ 4KHPQ 3CCET 4KLKA 4C3IH 1W2BS 4GOPB 2JVVA 4DV2L 4IOCA 4Y7NH 2HHHL 2Y0SG 2UUAL 1YJWA 1PYSB 2ZTCA 1JMCA 4JI5Q 4A93G 1KHIA 2JNGA 4A3CH 2OCEA 1K8AU 1E7ZA 2UUBL 3I55T 1CUKA 2K14A 4AH6A 3PF5A 1QZHA 1JJCB 1KQSS 1VQLT 3CMAT 3CCQT 1TWAH 1PHJA 1SN8A 3I7FA 4GKKQ 1YIJT 3HFZB 4IPHA 1NBWA 3CCMT 2VNUD 1SR3A 4O0AA 4DV6Q 4JI0Q 1PA6A 1V43A 3ZJYC 4LWCA 1KQSA 1YEZA 3RLOA 1Q7YU 4TQUS 4YY3Q 3WWVA 2BA0A 4IPCA 3HOZH 1HNWL 2E2IH 2JA6G 1YITA 1EOVA 1K0RA 1SRUA 3FP9A 4WJ3M 1H95A 4R4QA 4L5RC 2KCMA 3KJOA 2D62A 3J80E 4JI1L 3KYHC 3CCQA 2Q2IA 2OWOA 4PG3A 1AE2A 2UXCQ 3PUYA 1K73C 5IE8A 1WCMH 2JA6H 1CKNA 4YWMA 1KC8C 4YHHQ 1CKNB 3BZKA 3F8TA 1S40A 4B3MQ 2E2JH 5A2QE 1E22A 5M3MH 2WAQE 1PV4A 1YJ9T 4YWLA 4YHHL 4JI0L 1C7YA 1IBKL 4CRIA 3MXNB 1J5EL 3M3YH 4DR3Q 2A8VA 4YWKA 1QVGS 1YNXA 1NPRA 3L2PA 1VQ7T 1HZBA 2D0PA 3UDGA 4GNXA 1UE7A 2WB1E 5DM7R 3CD6T 3KLWA 4DK6C 1TWCH 3ER0A 5FLMG 1FVIA 3GTGH 2MWPA 4DV5L 3K8AA 1RL2A 3J80i 2Q2UA 2Z0SA 3F2CA 1PYBA 4DV5Q 1A0IA 3T1HQ 1XNRL 1VQ8A 2RCNA 3KF6A 3KOJA 2KENA 5C3EG 5C4JH 3RNUA 4POGA 1VQ5T 3J81j 4JI2L 1YBYA 3G48A 3CF5A 1I5FA 3BU2A 5IWAL 1PVOA 5M3FG 1E1OA 1XPOA 5BR8L 4YTLA 1T9HA 4DV7L 5IP9H 4X66L 2IG0A 1O7IA 1IBKQ 1VQ6T 2R7ZH 4A76A 1MKHA 1LTLA 2B3GA 5C0XI 2RHSB 4HJ9A 2NVXH 1PH7A 4PZ7A 5LMNL 3FHWA 3S2DH 4J15A 1I50H 4YCUA 1D8LA 2JK8A 4BA1I 4DV4Q 4HJ5A 1HR0L 4JI3Q 2VUMG 4A3GH 2JOYA 4X62Q 1ASZA 2CCZA 1HR0W 5LMUQ 1GD7A 4IJLA 4A3KH 2UXBL 4GN5A 4JOIC 2ZTDA 3PO2G 2OQKA 1VQHA 4OWTB 3HOUH 3DM3A 3K80C 3J81i 1Q1EA 3CC4T 3CCLA 3W1GA 1VQPT 1N32L 3AYHB 4AQYL 2BH2A 4DV4L 2JEAI 1FL0A 3GTLH 2ALYB 1JB7A 2EQSA 4GLAC 4UP8A 3HOVG 1Y14B 3M85A 2UU9L 4C2MH 1BBUA 1XMOL 4X66Q 3HOYH 2R92H 3GTPH 3CCSA 1K83H 1B8AA 1IXRA 2NZOA 1VQMA 3H0GH 2F4VL 3H3VI 3HOWG 4JYAL 3T1YQ 3BZCA 1N33Q 3KJPA 1SMXA 2H5XA 2LQ8A 2DUDA 3DLLA 2AWNA 1SSFA 1HH2P 4AYBE 1S72T 2K52A 1C9OA 2L15A 2PI2A 3RN2A 3ULPA 1MJCA 3M9BA 4DR5Q 4BBSH 4GS3A 1NJIC 4BY7G 3G4SA 1LYLA 5LMNW 1E3PA 1U5KA 4A3JH 4OWWB 3J81E 4OO1G 3SGIA 3CCST 1UEBA 1L2FA 2K5HA 1QVFS 1PH8A 3T1YL 4R4OA 2DGYA 4GOPA 2UUBQ 1N33L 1JJGA 3PO3G 3S1QH 3E9IA 1EYGA 3A5UA 3I4NG 2JJQA 2JEBI 3NELA 2EXDA 1XJVA 4POFA 4L5SA 2JA8G 1OXTA 5C44G 3TEHB 2XGTA 2R7FA 1N32Q 1VQGA 2YU9H 2F3IA 1B70B 4YY3L 5HY6A 1VQOA 2LVMA 1WFQA 1G51A 1X6OA 2MO1A 4MTNA 4HIMA 1V1QA 3PUZA 3I56T 2ZJPA 1VQKT 5C4XH 2E8GA 2HIVA 1MIUA 1Y1WG 2VY3A 2Z6KC 4IOAA 2UXDL 3STBC 1Y1VG 5FJ8H 2B29A 2IX0A 4PMWA 1QVCA 1TXYA 2A19A 2WB1G 4YCWA 1CKOA 1SLJA 2WFWA 2IY5B 2VQEQ 2QEXT 1EQQA 1HZCA 2PMZE 3CCJT 1X65A 3K7AH 4YCVA 4DV2Q 1IBMQ 3NEMA 3KDFB 3Q8DA 1IBLQ 3CCVT 4RG2A 3UDFA 3S1MH 3AQQA 4H02A 3HKZG 3D0FA 3J7A5 1NMGA 3MEFA 2MQHA 4B3TQ 2AHOB 4A3LH 5LMUL 4Y52H 3CXCS 5C0XG 4JI5L 4KHZA 1GM5A 2VS1A 4DUZQ 4PZ8A 1NPPA 1IBML 4UP7A 3G71T 1K8GA 3CMET 4PZ6A 5C0XJ 1XTDA 4BY1H 2HQLA 1KRSA 3W5OA 1VQNT 4DV7Q 1QUQB 5JJKA 4A3EG 1IL2A 4B3SQ 3RLNA 3RN5A 3HOXH 2JA5H 3D31A 1NE3A 1IBLL 1FJGL 4DR3L 5IP7G 4K0KL 4KI0A 4HJ8A 4LFBL 2VQFQ 2GN5A 5ELOA 3ULLA 5IYDH 3JC66 1VS0A 3G71A 1CSQA 3CP0A 2Q2TA 2IX1A 4A3BG 4C3JH 1Q46A 2VQFL 1YHQA 2E6ZA 3CCJA 4IFDJ 2UUCL 4P72A 2RF4A 4C3HH 4A3MG 3G4ST 3PGZA 1AE3A 1I3QH 4LFCQ 3J81c 3GTMH 4DR7Q 4B3ML 1VQCA 3RR5A 2IT1A 3GTQH 3CXCA 4A4IA 4XTCS 1BBWA 4LF6Q 2GVAA 2YV5A 2JE6I 1UWVA 4P71A 3U58A 2R93G 5J26A 4IPDA 2WP8J 4TVAB 3A0JA 1VCIA 5GROA 1FJGQ 1VQ6A 1WOCA 2PI2E 3G6EA 1PH3A 3H3VH 1J6QA 1X3FA 1YVCA 2PQAA 3GO5A 3UE0A 4NXML 2YYZA 3DB3A 2LCLA 4X34A 4ALPA 1KIXA 2OTJA 5IYBG 3UDXA 2F4VQ 4A3BH 1Q81U 2B63H 1PH1A 4LW1A 4LF6L 1HZ9A 4GN4B 3CCEA 1SROA 1QZGA 1KXLA 4JI4Q 4A3DG 4DPGA 2I5LX 1HR0Q 1K9MC 2LXKA 3STBD 1Q12A 5IWAQ 2VQEL 4A3DH 3TS0A 1EQRA 1X56A 3EN2A 4LUZA 4BBRH 1PH4A 1PH9A 4JI1Q 4A3EH 3TRZA 3CCVA 3GTOH 1A8VA 4P74A 2UXCL 2CKKA 3OW2S 1XMOQ 2XHCA 3S14H 3CPWA 1HNZL 3ICEA 2CKZB 2V1CC 4X62L 4A3IH 4P73A 1PH5A 5C4XG 3P8BB 3KBGA 4AQYQ 3FKIH 1N36L 1EFWA 3GTJH 2E5LL 4BXXG 2UXDQ 3OTOL 1YHBA 2JQOA 4NPSA 2K50A 3I4OA 3RZOH 4BA2I 2ZJRA 1GVPA 2VZAA 4DR4L 4GKKL 4LUOA 2E70A 1W2BA 1VQDA 3PF4A 1L1OB 4O2DA 5M5YH 1JT8A 5LL6S 1DGSA 3KF6B 5GAEC 4BXXH 4DK3C 1UE5A 1Q7YC 2NVYH 3JAMi 1PH2A 2QA4A 4DUZL 4MNOA 2VL6A 2XTIA 3U4ZA 4NXNQ 3I4MH 1VQFA 3OYYA 5IT9E 3AFPA 4NB3A 5FJ8G 4DV0L 5IYDG 3TS2A 1A63A 2ZM6L 2OQ0A 1HNXL 4DV1Q 4IO9A 1OXXK 2NVTH 4DR2Q 3M4OH 1VQ7A 3E0EA 4JBWA 2MNAA 1OXUA 3OW2A 1EIFA 1Q81C 3KDFA 3HOXG 3K0XA 3T1HL 3CPWS 2K75A 2OTLA 5C44H 1VQNA 2NZHA 3S24A 3CW2C 2AWOA 3I2ZA 2IHEA 1KRTA 3CC2T 2YTXA 1BKBA 3B6YA 2ES2A 4LF8Q 4OX9Q 2JA7H 2YTYA 4GLXA 5IYBH 4A75A 3I4NH 4WJ4A 3I4MG 3NBHB 1WI5A 5IAYA 3PCOB 4DAMA 2BA1A 3CAMA 5GADC 1SE8A 4ME3A 1N34L 1KL9A 3J80c 3HKSA 3F2BA 2ZJQA 4LF9Q 2ASBA 2KBNA 3LGFA 2HT1A 4ZN1A 4QQDA 2Q2HA 3PUXA 1J5EQ 1D7QA 3TQYA 5H1SE 2N8NA 2G3RA 4JI7L 5GQOA 4DV1L 5JJIA 3PIOA 1QUQA 1P8LA 4UY8C 4IJHA 4LFBQ 3FKIG 3BJUA 1VQMT 2R6GA 4A3IG 1KD1U 1EWIA 2BH8A 4EQ5A 1YITT 2R92G 2RHQB 4AIMA 3PSIA 3RLFA 4JI8L 3CPFA 1Y1WH 3LGLA 1OXSC 1S72A 2CFMA 1HJPA 1WJJA 3LGJA 3UDIA 2K4KA 4AYBG 4BBRG 2E2HH 3L0OA 3CCLT 3CC4A 4X65L 4LF5L 4GNXB 2GVBA 3CQZH 1K3RA 4R4CA 4XIGS 5BR8Q 1NY4A 4L5QA 4DUYL 2JA5G 3PIPA 1VQ4A 2ID0A 1MJEA 3PO2H 3EIVA 2B63G 3CCRT 1VQ8T 5IY0A 4QQBX 2KHJA 1OXVA 4DR7L 3S16H 4LF9L 3KF8B 3PO3H 2KHIA 1E24A 2NN6I 3PV0A 5AJ3L 4A3GG 4UP9A 1K8AC 1Q86C 4B3RQ 1OTCA 2CQOA 1XNRQ 4GKJQ 1N8RC 2CWAA 4JOIA 5LMNQ 3CMEA 3CD6A 1VQOT 1NTGA 1FGUA 4DUYQ 5IP9G 3K81C 4A3JG 1XMQL 2Z6KA 2R93H 2N78A 1PFSA 1I6HH 4GNXC 1CKMA 1EIYB 1G291 1Q82C 2HIXA 1M90C 1GKHA 5C3EH 3GD7A 3S1RH 4JC0A 5GAGC 2PNHA 2JUFA 2KVQG 2JA9A 2D0OA 3M4QA 3E9HA 2QEXA 2ZTEA 1HNXQ 4L5TA 1XNQQ 1VQ5A 3GTKH 5JJLA 4A3MH 3H0GG 4FDBA 4JI4L 4QY7A 2NVQH 2WAQG 4JI6L 3NENA 1YHQT 4NXNL 1Y1VH 2MWOA 1LM0A 2OTLT 1KAWA 4JBMA 1QVGA 3CCUA 2OTJT 2FXQA 4JCVE 4RG1A 4GOPC 4X64Q 4R4IA 4LF8L 1GO3E 4EX5A 5IP7H 4ZN3A 4P75A 2MI6A 4DV3L 1YJNA 1BVSA 2CWPA 4OONA 1YJ9A 4B3TL 4X64L 5FLXE 3J7AF 4JBJA 4RMFA 1RIPA 5M3MG 4DV3Q 3S15H 1N34Q 2JA8H 2IHFA 1KD1C 1M1KC 5J3BA 1JJ2S 5JEAG 3ERSX 4DKAC 4JI6Q 2ZM6Q 4BY1G 2E5LQ 1G6PA 1IZ6A 3ULJA 2A1AA 4APVA 1YHAA 3U4VA 4IFDI 4R4TA 1VQPA 1XMQQ 3S17H 1NJIU 5JEAJ 3M7NA 5E7NA 4KHPL 4K0KQ 1P16A 4B3SL 1AH9A 4A3LG 1TWFH 2N49A 3AFQA 3JAMc 2R7ZG 2R7DA 3U50C 4BY7H 4HIKA 5M3FH 2HHHQ 2UUAQ 4BBSG 2ATWA 3F1ZA 4IPGA 5DLQE 4QJFA 4HJ7A 1TWGH 2F52A 2Y0SE 4LF4L 4LFAQ 1VQEA 4HIOA 1XPRA 1M1KU 3PUWA 4QIWE 3CCMA 3PUVA 4LFAL 4UPAA 2I5HA 4X65Q 4LF5Q 1C0AA 2K5VA 4DR1Q 2YTVA 4TVRA 3HOYG 5FLMH 4GN3B 2N3SA 4A3CG 4JI2Q 1ASYA 1B7YB 3HOVH 1Z47A 1L0WA 1Z9FA 3F2DA 5M5WH 1VQJA 1YI2A 4R1JA 1R9TH 4LF4Q 4JG2A 2KDSA 1CSPA 3HOUG 2KCTA 1A62A 1UE1A 4JBKA 1SFOH 3I55A 1X54A 1K9MU 4HJAA 3CMAA 1VQLA 5IT9c 1I94Q 4A3KG 1WCMG 3L7ZC 4NXMQ 4A3FH 1VQ9A 3JAME 1Q82U 1X3GA 4DR2L 2NN6G 4LNQA 3AEVA 2L3RA 1VQ4T 1KC8U 1YZ6A 3UE1A 1NZ9A 1K73U 4IFDG 3I56A 4LF7L 4DAYB 4OWXB 5ELNA 4DV0Q 3CC7A 5HGQA 1VQBA 1X55A 3S1NH 2LXJA 4OX9L 1Q86U 1W3SA 3DB4A 1NMFA 3A74A 4JI7Q 3HOZG 4LFCL 3A5ZB 2LSSA 3G6ET 5FLXc 3J7ZC 4DR1L 4JYAQ 4QGUA
chains in the Genus database with same CATH superfamily
1U1SA 2JTMA 1UE6A 1WYDA 2B8GA 3TREA 2EQMA 4OIJA 5D3DA 5EAYA 3K5OA 1BBZA 3BVGA 1R9TB 4ELYC 2RDGA 3PVQA 3E19A 4JRPA 3VKIA 1OPKA 3K7UC 4OO1I 5GANe 2AKKA 5GAN7 1PFMA 1M90U 1S3OA 4IFDH 3UF4A 1CZGA 1DM0B 2ICEC 2DTIA 2HEQA 1BU1A 2C35B 4B3RL 4GKJL 4MZ9A 1HFGA 5KYYA 4IKFA 1UGPB 4C1NK 4TKOB 5EGTA 4JV5L 2Y4YA 3RKXA 1VQ9T 4I65A 1WGSA 1QVFA 1VQKA 1BCPD 4DR4Q 1QILA 2AMCB 5KYIA 5CIUA 1XPUA 2NYZD 4M78C 1JE5A 3TBIB 5A0DA 5GANg 3PTAA 5CBEE 3BW1A 1Z9ZA 2DVEA 1X3EA 1Y1VB 3R8BA 3SWNC 3RUZA 5I9PA 4E7JA 2HAXA 2KT8A 5FRNA 5M5XH 1IYJB 3OYLA 1HTLD 4A3FG 4C5HA 3TQ7P 2V4DA 3PMIA 5IYCH 1B07A 2MMPA 4OF1A 2QQBA 3RIRA 2PQAB 2QA4T 4KHPQ 4KT0E 2D1XA 3CCET 4C3IH 1PKTA 1W2BS 3GNGA 3M9QA 2UUAL 2Y0SG 1NEBA 2LCSA 1PWTA 2AK5A 1GXDC 1KHIA 2BUDA 3JB9H 4F7UB 4DEYA 1R4PB 2D2CC 2YDLA 1JJCB 3CCQT 1PRTD 3EROA 3HFZB 2B2YA 2LS01 2VNUD 5KNBA 4JI0Q 5GMKm 1WYXA 5CCAA 3RD4A 3ZJYC 4A3KB 1XYIA 4IUQA 1OULA 1QWEA 3TEEA 3MO8A 1Q7YU 4TQUS 4RTZA 4IPCA 2B2YC 3H8ZA 3A8JE 4FVMA 2E2IH 1K0RA 2F0JA 4L5RC 2P0PA 1E2VA 5LL6X 3KJOA 2R92B 1BI1A 4AFSC 1SBBB 2XU8A 3MEWA 2OWOA 1I6HB 4EDUA 2SDFA 1AE2A 1HHVA 1CSKA 4F7UF 1EEID 1F77A 1KDBA 2MK5A 1KLGD 1NR4A 1CKNB 2H3JA 3BZKA 3F8TA 4YHHQ 1S40A 2JA5B 2VUBA 1GOZA 5M3MH 2IX3A 2DTHA 1I6VC 1BCPC 1C7YA 3MXNB 2I46A 2GTOA 1J5EL 3MXNA 2CT3A 2WSEE 1R4QB 4YWKA 3M3YH 2E3HA 3H9NA 1YNXA 1NPRA 3CCLQ 4KY5A 1SNDA 3FPPA 4A3GB 4GNXA 5DM7R 3KLWA 1TWCH 5FLMG 1VQ9Q 1TUGB 3I90A 5EBCA 3K8AA 1RL2A 3EFRA 5C0MA 3OSOA 4MN3A 2ECZA 1OEBA 2RO0A 2Z0SA 4LDUA 3F2CA 4DV5Q 5CV9A 1D3BA 3T1HQ 1J8IA 4MHEA 4M7AD 1VQ8A 3KF6A 3KOJA 2KENA 1T0JA 4EMHA 5KE3A 5C3EG 1VQ5T 5EJWA 3J81j 3RNUA 3A8MB 2FZGB 5IWAL 3MHBA 4M78F 5KRUA 3KLSX 3BFMA 1TKWB 4DXFA 1XPOA 1T9HA 4DV7L 1NYGA 1O7IA 1HSQA 1VQ6T 1TIID 3UI2A 2NVXH 1LTLA 5DLOA 2FHDA 4ZCKA 2BE9B 4OGEA 5GANf 3QDRB 3QDFA 2JOYA 2X4WA 2ZPFB 3A8IE 2DLPA 4AFQC 2RJDA 4PJOF 1YNZA 1W70A 4GN5A 1AZEA 4M7AE 1RHPA 5CV8A 3CU7A 1TWAB 3JCMe 5M3MB 4PL6A 1JE4A 3HOUH 2ESWA 2EQJA 2BIVA 1G8XA 1Q1EA 3CC4T 2BZYA 4RTVA 1VQPT 3AYHB 4DV4L 3GTLH 3GTJB 3LLRA 4UP8A 3KUFA 1JC7A 3M58A 2RI2A 1EZ6A 1TSFA 2F0KA 1XMOL 3D7SB 4OIKA 3HOYH 4FYDA 2O9VA 4FYWB 2E6NA 1HXYD 1K83H 1IXRA 2NZOA 1MSHA 4LD9K 3T1YQ 1N33Q 3DLLA 5C6AA 3H3VC 2OX7A 1S72T 1RCVD 4KJNA 2Q8IB 1RLQC 1X6GA 2DIGA 4DR5Q 4AT1B 3ULPA 1FWZA 4BE0A 1LYLA 4A3JH 4OO1G 5C4HA 1JJ2P 3SGIA 3RBBB 1UEBA 5GMKj 4R4OA 5CBAE 4GOPA 1OYXA 1F9SA 2XNAC 4Y7NB 1WTRA 4JDSA 3S1QH 1JJGA 3I4NG 1EQVA 4MDXA 3MVVA 5I2MA 2KRNA 2LJ3A 1QVFP 3MEUA 1AZGB 3M5AA 2YU9H 4XTUA 1GJXA 5GAMg 1E2ZA 1LT3D 2DL7A 1BO0A 1WFQA 1D1KA 5CV4A 2H4OA 3M0TA 2AUKA 2ZJPA 4A4GA 1MSGA 3PUZA 5C4XH 2VXEA 2E8GA 4HIMA 2UXDL 5IHIA 2VY3A 4J6WA 4HEDA 4R8NA 3SK8A 2B29A 4CKBA 1QVCA 1TXYA 2WB1G 2NVXB 4YCWA 1CKOA 3I35A 3VRYA 4D8DA 1H3HA 2VQEQ 4RCNA 1PH7A 1SJED 1X65A 3S3MA 3NEMA 1JOKA 1UECA 3P1HA 3OYHA 2M51A 2FJ2A 4ZRZA 1UHFA 4EVOA 4GLMA 3AQQA 4PMBA 4JLIA 3SEBA 3SK4A 4FCYA 4CDDC 3VYRA 8AT1B 3OYCA 3MEFA 1MV0B 5FOBB 4PK4A 2HZYA 2AHOB 1JEGA 1SE4A 4FW2A 3CXCS 1TS3A 3SHLA 2LFNA 2VS1A 4FF4A 4PZ8A 4Q0FA 2D6FA 3JCMd 2XD0A 2B2UA 5CORA 1K8GA 1I5LA 2J05A 1KD1R 1HTPA 3CMET 4BY1H 2HQLA 3BDOA 1VQNT 1QWFA 1LT6D 4PJNA 3I91A 3QG1A 3MXGA 4FYYB 3HOXH 1WTOA 3M0QA 1WHLA 2YLCA 4UAIA 5ELBA 4J9GA 3NWSA 4PFOA 2JA6B 3E3XA 5IP7G 4KI0A 4RGTA 4X3TA 4HJ8A 4LFBL 2D0NA 1VUBA 4OMPA 2M1HA 3WVDB 5GAMh 1TUDA 5ELOA 3SE0A 1ESRA 3ULLA 5KGUA 1R8OB 2J0TD 3G71A 3M0SA 3TN2A 2OAUA 2Q2TA 5IYDH 1YITQ 1VQ8Q 2MPXC 3EGDB 2E6ZA 5KYYB 2CQAA 1IREB 4M77F 4A3MG 1D0XA 2FZCB 1G5VA 1JWUD 1VMCA 2LX9A 3GTGB 4OHJA 2DNCA 1YN8A 2MIOA 3X3MA 4M7DA 4FW1A 4DR7Q 4V2SA 5DEHA 4OMNA 2LZ6B 2DBMA 2HSEB 1W6JA 4P71A 4LJZC 3MCAB 3HSBA 2WP8J 2FZKB 1BBXC 5KIXA 3I4NB 4IUUA 5LJ5f 2DTOA 1VQ6A 1WOCA 2KSSA 1WCMB 2E75C 3RZOB 2E64A 2HCKA 5GMKh 3UE0A 4FXKC 1RAHB 3CBOA 3Q1JA 4M4ZA 4Q5VA 2K3XA 3P8DA 2B63H 1ZUUA 2K5LA 4ZGJB 2O2LD 1KXLA 2I2LA 2SRCA 2LJ0A 3C2PA 1HR0Q 3MKDA 1Q12A 1HPCA 2ATCB 3X24B 5GANh 1EQRA 1QJOA 1X56A 2L5QA 3TS0A 1PH9A 4JI1Q 2MCNA 1JU5C 1A15A 2R61A 3CMEQ 2CKKA 2PNRC 4KV6A 1XMOQ 3QWXX 1OV3A 1HNZL 1RABB 3ICEA 4A3IH 4P73A 2YRVA 3MWYW 2DFUA 5LJ3h 3VS1A 1SYDA 1MMNA 2JS0A 4DA2A 2MJ8A 1JCKB 4NPSA 4GKKL 1JRIA 1Q7YR 3PF4A 2NUPB 1L1OB 1G91A 1Z7TA 1NR2A 2DN8A 4BXXH 3EFOA 2MOXA 2ZXRA 3RKWA 3BG3A 1O9SA 1UE5A 1PTOH 1PH2A 2C0OA 1V1PB 1J3TA 4MNOA 2XTIA 1NCVA 1X69A 4NXNQ 4B9XA 2PNIA 5FJ8G 1BXTA 4DV0L 5IYDG 1ML0D 2ZM6L 4C0DB 2F0OA 3C1EA 3OY9A 3DEPA 1UGSB 1VQ7A 4XQNA 5FO9B 5NUCA 1RAEB 1W6KA 1EEFD 1OXUA 1BIAA 2MNAA 3HOXG 3KLRA 3T1HL 2H8HA 1PDQA 1N6AA 4OMLA 5C44H 2B2VC 3S24A 4A4KA 1OZ3A 1T3SA 1V29B 2AWOA 2IHEA 5ELDA 3MPUB 3JCMc 2JTFA 2RBMA 4RMOA 4A75A 4XTWA 3GOXA 4ZLTF 2B2VA 3S16B 4JJDA 3PIP3 1QCOA 4HKEA 4Y28E 4ME3A 2HMAA 4M1UB 3PO2B 4YIJA 2KYMA 1J5EQ 2Q2HA 2PW5A 1DOKA 2KOLA 2N8NA 1CM9A 3M3YB 4IIMA 4C0FA 2YXYA 3PIOA 5M5WB 1RAGB 2F1MA 4TRDA 4IJHA 1KJWA 2YUPA 3FKIG 1H92A 2X35A 1A2UA 2RK1A 1ACMB 1TS9A 5I22A 3C46A 3C4SA 1K8OA 1VQ4Q 2KE9A 2PZWA 2LQWA 3JB9F 2WB1B 2R92G 1GXIE 2HDLA 1M3CA 4JPBW 4CHTB 3M4OB 4E7KA 3LGLA 3GF5A 3L2ZA 3QZ5B 4C5GA 3LX7A 1HJPA 1WJJA 2DD5A 2K4KA 3UDIA 2CSQA 2CZ6B 2F2VA 3X20B 2WAQB 3OS5A 3L0OA 3WOFA 4Z02A 2EYMA 2GVBA 1K3RA 3CQZH 2D8HA 5I2XA 4L5QA 2JA5G 3PIPA 2GFAA 4CC7A 3FC3A 5FU6C 1T5EA 1W1FA 3QJ6A 4EGVA 3NMZC 4JRKA 4LDXA 3PO2H 4JK1C 2E5KA 2KHJA 4U68A 1OXVA 1C6VX 4BWGB 3A8HB 5AJ3L 4A3GG 2CQOA 3VA7A 3CC4Q 1N8RC 3OIPA 4HVVA 4JOIA 3RUXA 4O1NA 3BS1A 5LMNQ 4J8QA 2JA8B 4A3JG 4M75D 2Z4HA 5C4ZA 4M78G 2EJGA 4OMQA 5AYFA 1I6HH 4K8JA 4GNXC 1FMWA 4C92F 1WQWA 4X1VA 4KUIA 2AQ1B 2HCIA 4ULLA 1BI2A 2EYHA 3GD7A 1SYCA 5GANj 2CH4A 5GAGC 2PNHA 2JUFA 1I4RA 4QVZA 4UDUC 2KCCA 3DM1A 3AT1B 1TWFB 2L0CA 1SMYC 2WAQG 1WD1A 2FRWA 2P4RA 1Y1VH 1LM0A 1YHQQ 2OTLT 3BVMA 2VXFA 2SNMA 2VKNA 3CCUA 2M0YA 3FJPA 1P92A 2FXQA 3G71Q 4KN7C 2DZCA 3OIQA 3FRNA 2MHVA 4ZN3A 3RZDB 4DV3L 1YJNA 2QDBA 3HKZB 4B3TL 5FLXE 2QA4Q 2E65A 2VVKA 2QEXQ 4FP5D 3TP6A 2JA8H 5JOBA 1KDAA 1JJ2S 1M1KC 1H9SA 3T53B 4C3IB 2DYIA 2OTLQ 3ERSX 1VQ5Q 1AW7A 2EXZA 4K2LA 1G6PA 4APVA 5C3WA 2X3XD 2O4XB 3U4VA 1M2VB 3OBYA 2O9SA 3OYBA 3OYJA 4BUGA 3M7NA 4K0KQ 5KEEA 2NVQB 4H7BA 3ERQA 2N88A 2X6GA 3V2TA 1WX6A 2R7DA 2I07B 3JAMc 3NFCA 2HHHQ 3GTMB 4BY7H 4BBSG 5JVG3 1NNXA 3F1ZA 1QNKA 3PMFA 1EOTA 2F2WA 2GFUA 3CRLC 3QHSA 1K8MA 2F52A 4OEMB 3LX0A 5I4DA 1VQEA 1XPRA 2G9HD 2SOBA 2EDGA 3OYIA 3OS2A 5T1IA 5CV6A 2EE1A 3CCMA 4F7UA 1BCPF 2QTVA 1EU4A 2F0FA 2H1EA 3NXWA 1C0AA 2K5VA 2JA7B 2FPDA 4DR1Q 5FLMH 1U5SA 4QQ6A 1B7YB 2RI5A 1Z47A 2R57A 1Z9FA 5M5WH 4M7DD 1KQ2A 3I8ZA 1ZBXA 2B39A 3JRZA 2F1LA 1R77A 2BE5D 1QMCA 2D9TA 5GAMd 3OWEB 1LOJA 2O5IC 1I50B 1FMKA 3CMAA 1I94Q 3VV0A 4HT9A 1ZUKA 1IHWA 3BVZA 1GHKA 2XWBB 6AT1B 4OB3B 1EYCA 1K3BC 1Q82U 4ZK9B 2MUYA 4LNQA 2L3RA 1KC8U 3ND9A 1K73U 3I56A 1BI3A 2CH4W 3CQTA 4DAYB 1QZHA 4DV0Q 2DXUA 3CC7A 4A53A 5IHKA 1X55A 1WJQA 4OX9L 4HT8A 2K5DA 2VXWA 4J9FA 2ZPEB 4HCCA 2KQ3A 2A6HC 3NQIA 1BI0A 3DB4A 2DL8A 3EH2A 4IUPA 3I70A 2B86A 3BDLA 2PCFB 1PFBA 4DR1L 4JYAQ 3BDUA 3M7GA 1V9PA 2AZVA 1C48A 3C94A 2NVYB 1EY9A 2GQIA 3AHUA 3D6WA 1MUZA 1FNVA 2NZ1D 4HIDA 1YJWT 5IIFA 1LT5D 4ESRA 5GAMe 1K8AR 1LTAD 1ZSZB 3EG9A 2X9HA 2AHJB 4B6MA 1LACA 1E6HA 2EZVA 3FPUB 1HNZQ 2E2JB 4H13C 4C3IG 1ILQA 1WTVA 1XNQL 4UHVA 5C6SA 1QQJA 2DM1A 1E7OA 2XDPA 1YIJA 1S5CD 4X9CA 1X9NA 1I94L 2K9GA 4J9IA 4E7ZA 2PVOB 2FG0A 5GAOn 3OS1A 4JS5A 1CT1D 1WPYA 1N9WA 5IYCG 4RKBA 4DR5L 1YCSB 2PUOB 1N8RU 4M77G 1M8MA 1KAAA 2A6EC 3NQTA 1SSOA 2F0EA 3IRBA 3T51B 4A3IB 2EYJA 2RSNA 3HL8A 2I0QA 1HNWQ 1K73R 5K5PA 4DXGA 2UU9Q 4X6AH 5FWCA 5GAMj 1UG1A 5LJ3j 1E1TA 2MO0A 3H15A 4DV6L 4DR6Q 3FIFA 4M75E 4KD3A 4JI8Q 5C4XB 4N8FA 1PRTF 3MP1A 1A3VA 4M75C 1STYA 4P5NA 1Q8KA 1U0LA 2K7AA 2E74C 3EBEA 3HEJA 1C8CA 2UXBQ 3K5MA 4JV5Q 2DO3A 1GFCA 1S72Q 1XNIA 1STHA 4QCLA 3META 4J9DA 3RMQA 3BYTB 2AKWB 1Q1BA 5KYXA 3CCVQ 1QW1A 3GDEA 2X4XA 2K3BA 3LW5E 2F0QA 1QP2A 3OYKA 3Q22A 4GOPB 2VC8A 4ME7A 2A69C 1TVXA 2HD0A 2JM9A 2HHHL 4QB4A 2EAYA 2ED1A 1YJWA 1PYSB 2ZTCA 1WTXA 2ZAEA 2UUBL 5EPLA 2A3LA 3I55T 2DD4A 2K14A 4AH6A 4M7DB 1LCKA 1KQSS 2RM4A 1VQLT 4M7DE 4AMCA 2KEEA 3TU4K 1YIJT 4IPHA 1NBWA 4DFAA 2PQEA 4O0AA 4ZUIA 1Y96A 2L0AA 1PNJA 1Y96B 1JOOA 2LCCA 1V43A 4LWCA 3SVMA 1SEMA 2A36A 4IURA 3G1JA 3WWVA 2BA0A 1NE8A 2NB0A 4LMQD 1WI7A 5CC4A 3OYDA 1VF7A 2JA6G 1OQKA 2PUKB 3JCMQ 3FP9A 4R4QA 4R56A 2F0SA 1EWCA 1MGQA 3HRZC 3EG1A 3J80E 3GIBA 4VUBA 3KYHC 4LK1C 3CCQA 2F0PA 5C4JB 2XDDA 1CTMA 1KSWA 3PUYA 1WCMH 1JWSD 4YWMA 3MEVA 3QWNA 2KROA 1RJTA 1E22A 3OHXC 1PV4A 4YWLA 1STBA 1TWCB 1TH7A 5EKKA 1MMAA 2QGGA 1QVGS 2OT2A 5K36H 4ME5A 3L2PA 3OOCA 1HZBA 3V05A 3JCMW 2EYXA 2WB1E 1RLPC 3H6ZA 5GJWB 3GTGH 5GJVB 1LTSD 1G2SA 1VQ7Q 3T9NA 4EQOA 2KAFA 5IGBA 2AIRB 1VQMQ 2C0TA 2EGAA 2E2DC 2YRDA 3MP6A 5KNDA 4C8QD 3QWYA 4POGA 2JA7H 5C4JH 1BCPB 3CF5A 4ID6A 3A8OB 1PVOA 5AFWA 3V8JA 3CC7Q 1E1OA 1JOQA 4C8QF 2CP7A 1O78A 1IBKQ 4EIKA 4A76A 4XTVA 2B3GA 1IGUA 1RTNA 2L1BA 3ULRB 1QCBD 5LMNL 5JPNC 3C95A 3FJ5A 1H3ZA 4HJ5A 2B2WC 1Y8NB 4YCUA 4BA1I 4DV4Q 1CA5A 2VUMG 4CJ0B 4A3GH 3MFYA 2CCZA 1HR0W 1EYAA 5G3LF 2OI3A 1FR3A 1II3A 1G3YA 4JOIC 5EPKA 2ZTDA 3PO2G 1VQHA 4BY6B 3JAML 2RN8A 1KTKA 3K80C 2RQTA 3J81i 3G6EQ 3VU3C 2BH2A 3NSWA 1G2BA 4GLAC 2K5IA 3FKIB 1Y14B 3JCMV 2CP2A 3JV3A 1W6XA 1QNUA 4UC4A 1EQTA 2R92H 1AT1B 2VW9A 1B8AA 1UGQB 1VQMA 3HOWG 1EIGA 3BZCA 1U9RA 2QTXA 2RHYA 1TU0B 2FO0A 1SSFA 2GTJA 3FDRA 4N0AA 1RKNA 2CW0C 2Q8RE 4QF4A 5DM73 1I07A 2K52A 4BBRB 1TUCA 1C9OA 3QR8A 2PI2A 3LWIA 4OB1B 3ITPA 1D5XC 4HVUA 2Q8TA 3S1RB 1EX4A 3G4SA 2VV5A 3G7ZA 1U5KA 2RHXA 3VUZA 1PH8A 1AHJB 1GFDA 2A37A 3T1YL 1N33L 2DGYA 1MD2D 3FEWX 2HQEA 2PVGB 1QKXA 4RCCA 4HCSA 1ZYRC 3A5UA 2A7YA 3P7JA 2EXDA 4JW0A 1XJVA 5C44G 3TEHB 5CKBA 2R7FA 2BKDN 4Q5WA 1VQGA 3E2UA 2ENBA 5BN5A 5DM63 2F3IA 1B70B 5HY6A 1XWEA 5C5MA 3FLGA 3CBPA 1G51A 1V1OA 4IALA 4MTNA 3AU7A 2K5WA 3HOWB 1MIUA 2E3IA 3T4AC 4PJOD 2CGHA 3MTSA 5FJ8H 3DWPA 2WFWA 1C1AA 2DNUA 3QOJA 1PRLC 2CT4A 1NUCA 1EQQA 2DZ9A 1LNXA 4IN3A 1M8VA 4YCVA 4DV2Q 1IBMQ 4A3BB 4JRQA 2QK0A 3Q8DA 3CCVT 4RG2A 4ILWA 1KG1A 3DHQA 1ZEQX 3EFOB 5I6YA 3D4DA 1I4K1 2EFIA 3J7A5 3NBIA 3H0IA 4B3TQ 1ZA1B 4A3LH 3MC0B 2KMTA 1PYWD 4DUZQ 1M9SA 1B4OA 4K5VA 2QDLA 2YSQA 2QEJC 4E7IA 1UNSA 2QAZA 4DEXA 1Y07A 3W5OA 1HYOA 1QUQB 1AZPA 5JJKA 1X2QA 1M27C 1WXTA 3HOVB 1L0YB 5IN1A 1GUGA 2RKSA 3D31A 2X4JA 1NE3A 1IBLL 1G3TA 2A74C 3G7LA 1ZSZA 2XICA 3EG9B 2VQFQ 2GN5A 4OB0B 1B34B 1Y8OB 1VS0A 4ZYSA 3CP0A 2IX1A 2J6KA 3QBYA 1Q46A 4IFDJ 3L9AX 5E4WC 1LTGD 4J6HA 5GAN4 2B2TA 2RF4A 4P72A 1AWXA 1OZ2A 2Z1CA 2DILA 4C3HH 4A3FB 3DKMA 1AP0A 1SNOA 3PGZA 1AE3A 4ZNXA 1JQQA 5D6YA 3GTMH 3HP3A 3J81c 4BY7B 4FT4A 3IQLA 4B3ML 1M2VA 1AFPA 2EYFA 2GQVA 2RJEA 3K58A 1HA6A 5I6WA 5CVIA 4DNTB 2GVAA 1Y7XA 1ZX6A 5L8RE 3U58A 2M02A 2W10A 1ZXTA 2KECA 2WIIB 4KY7A 2R93G 3A0JA 3G4SQ 5GROA 1FJGQ 2CYZB 3G6EA 1YVCA 1X3FA 5C3XA 5ECAA 2A69D 2JN4A 2YYZA 4ALPA 4X34A 2OTJA 2F4VQ 3UDXA 1Q81U 5CK9A 1JR0D 1IB8A 2C0IA 4CGYB 5GAN6 3V7CA 5GMKe 1PH1A 3EHRA 4GN4B 3CCEA 5TSSA 2DJQA 3R6OA 4JI4Q 3CBMA 2I5LX 3VYUA 2LXKA 5FROA 2NBFA 3STBD 1B3AA 3TP5A 5M3FB 2RI3A 3MXUA 1M3BA 1IO6A 4M78A 1D5ZC 5ISRA 1BF4A 3GTOH 1A8VA 4HSPA 3VYHB 3RR6A 3TP8A 3OW2S 1D3BB 2K6DA 2XHCA 2QXFA 3S14H 1YP5A 1AD5A 3TVTA 2V1CC 4X62L 1Y0MA 2BDOA 4AQYQ 2E41A 1N36L 1EFWA 4J6YA 3PF5A 4K2KA 1A0NB 4MTKA 2E5LL 2UXDQ 4XU1A 1B1ZA 2JQOA 3I4OA 2K3YA 4G7ZC 1FYCA 2ZJRA 2L55A 2SEBD 4DR4L 4LUOA 1VQDA 5LHY1 3BY7A 5M5YH 4OGCA 5LL6S 1DGSA 1Y8PB 5GAEC 4BE2A 3UATA 2GGRA 1QVPA 1VOMA 5KH6A 5CYUA 4M77B 1Q7YC 3JAMi 4DUZL 3U4ZA 3GV6A 1UUPA 3I4MH 1YJNQ 1CHQD 1X43A 1VQFA 3OYYA 5IT9E 1VYVA 2HQXA 2VYTA 4N0AC 3PIO3 3TS2A 1A63A 2OQ0A 1HNXL 4DV1Q 4C92G 2NVTH 2A6HD 2DRKA 4PJJA 2A68D 1EIFA 2LNVA 1LV9A 1IW7D 3K0XA 5LJ3f 3KDFA 4HMIA 4M7AC 2K75A 1T3LA 4XTXA 2OTJQ 4OX9Q 3CC2T 1BKBA 4DU9A 2RA2A 5IYBH 1SSHA 3I4NH 3I4MG 2OEOA 5DNFA 4HSVA 4PNYA 3R2IA 5D7UA 1STGA 5GADC 3J80c 2KCNA 3HKSA 4LF9Q 3T56B 3M0RA 5IGFA 4OL7A 1I4QA 2HT1A 4A4HA 2DBKA 3JCMX 3TQYA 3NWTA 5H1SE 4EMKA 4KGZB 2G3RA 1KK7A 2M9VA 1CK1A 2F0HA 5EBDA 5GQOA 3J80L 4DV1L 4Z89A 1SHGA 2COYA 4PJOB 1ONLA 1P8LA 4UY8C 4KBMB 1GCQC 1NBEB 3HTRA 3VR5A 1FYNA 3G6JB 2R6GA 2K2VA 2NUTA 2EGEA 1C0MA 1KD1U 4HTHA 4JJCA 1M5Q1 5KYLA 1B3QA 3VS4A 1DCZA 1YITT 1UJ0A 2JT4A 4LNPA 3VRZA 1ZHIA 2V8KA 3PSIA 3RLFA 2O88A 1Y1WH 2DEQA 1S72A 1PM3A 1OXSC 2CFMA 2F3VA 3L2UA 1GHJA 2MF2A 4AYBG 5JVH3 3CC4A 4XK8E 4ZKBB 1UGRB 1Q8IA 4R4CA 5E4XA 3BDCA 3FMCA 1Z6HA 4XIGS 1RD9D 3GQBA 4ODGA 4DUYL 1VQ4A 3KLSA 1ABOA 2ID0A 3KK7A 1VQLQ 3CCRT 4QQBX 2IL8A 2DRMA 4DR7L 3S16H 1PCXA 3TCJA 4C92A 2NN6I 5COYA 3PO3H 2K01A 1Q86C 1OTCA 1MHWC 1XNRQ 1F2ZA 4PNOA 1AWWA 2CZ0B 2PQWA 2CWAA 2JP1A 2KEDA 3HG9A 3CD6A 4H44C 4M77E 1DXMA 2LT1A 2R93H 4MIUA 5FU6B 4MMKA 2N55A 4OMOA 1ZA2B 3ZL7C 1XTCD 1WNLA 4KRTA 2FPEA 3HRTA 4XT3B 5C3EH 2F0GA 2R5MA 3S1RH 5AT1B 5GAN2 1EZ8A 4BBSB 3GPLA 2JA9A 3E9HA 1B50A 3NUCA 1M4ZA 3GTKH 5JJLA 1HRJA 1QLYA 2KR3A 3H0GG 4HCZA 3RESA 2BDNA 3NENA 3HP9A 3DWQA 1LVKA 1QVGA 2OTJT 1N9RA 2D9UA 1LO5D 3I4LA 2EJFC 4NMZA 4X64Q 1SKUB 1GO3E 4EX5A 4LF8L 3REAB 1AZQA 7AT1B 1HQMC 2F2XA 2OF1A 1EY0A 4X64L 3S15B 4EQPA 2BZ8A 2XG8D 5M3MG 4DV3Q 3S15H 1N34Q 2VGNA 1JB0E 2PO4A 1RADB 4M75A 1KLUD 4DKAC 4F88A 5JPMC 3ULJA 2A1AA 3S17H 1O80A 1PMRA 1SXTA 3NE5B 1P16A 2DJFC 2Z8LA 5GANd 3KUPA 4B3SL 1ABQA 2DK3A 1YNJC 4A3LG 1AH9A 2N49A 2R7ZG 3U50C 2UUAQ 4QJFA 2EYZA 2DJGC 5CKHA 5C3EB 2VB2X 1I4PA 1KNAA 4DK0A 1X3PA 3KBXA 2I5HA 3LNNA 4X65Q 1WHJA 3SHWA 2L8DA 4M77C 4LF5Q 1WTQA 2E5QA 2LT4A 1AEYA 2F0DA 3EGUA 3K0YA 1ASYA 3HOVH 1D2BA 2LRQA 4LAAA 2LTOA 3HRUA 3WVEB 4X3UA 3RDVA 3ME9A 1R9TH 1YFNA 2KDSA 4LF4Q 4PFPA 1NG2A 4ZTJA 1FNWA 1A62A 1QVGP 1UE1A 4JBKA 2DVJA 1K9MU 4HXJA 1S5ED 1G8ZD 2B8FA 2VB3X 4A3KG 1TT2A 4RTYA 4XXEA 4A3FH 3JAME 5IGDA 1X3GA 1ENFA 3JB9D 4J1MA 1IRXA 3I73A 5FW9A 4B08A 2JTEA 4N4IA 4LF7L 3CCQQ 3S1NB 5HGQA 1SYEA 5FO7B 2O01E 2O2OA 2LXJA 1EL0A 1SYGA 3OWFA 1BK2A 3HOXB 2PW7A 3HOZG 3WDNA 4LFCL 2JXMB 1M1KR 1JO8A 3CHBD 4KKSA 3R93A 1AEXA 2R3ZA 5FLXc 1B44D 3J7ZC 3C12A 1KIKA 1D09B 4QGUA 4KH0B 2KRMA 5CR3A 2UUCQ 3HOWH 3I4MB 3JB9I 4DR6L 3M0PA 5FLXL 1FXXA 4RHSA 3CC7T 2AUJD 2XIDA 2EYOA 4LDWA 1V8QA 3CPWP 4A93H 4QW2A 2K5NA 2Y0SB 4ZQ3A 3LWHA 4Y91A 3FDTA 4M75G 2V26A 2CP5A 3LH0A 1CQVA 1TS2A 1VQIA 1LUZA 5BN3A 3LWEA 5GAN3 1Y69U 1VQAA 4HCKA 4D6WA 3OMGA 2D8JA 2F0MA 2ICIA 2NLUA 3W1BA 4DNIA 2A08A 4FSSA 3THKA 3CCRA 3VR2A 5EKIA 1NYFA 1VA7A 3VR6A 2VUMH 1GRIA 2RHIA 4KULA 3OBWA 4C92C 1VMPA 4AG2C 1O7ZA 1S4ZA 2RJFA 3A54A 2KRSA 3M4PA 1MMDA 1F2YA 4LUVA 5A35A 3VDYA 3EGXA 1PH6A 2SEMA 4M7AG 1WLPB 4PV1C 1SG5A 3SWNA 5IXFA 4V190 2JA7G 3MAQA 4X9DA 1N36Q 4RTWA 4JI3L 1JBMA 4LDVA 4RKLA 4NP5A 3HOYB 1JJ2A 2V8IA 1GUWA 1ET9A 3K59A 2JVVA 3M4GA 4KGXB 4QUFA 3R6NA 5HK0A 2FFKB 3EFXD 5IGGA 2JNGA 2RH2A 4A3CH 4QKUA 3E5SA 1E7ZA 3ZYYX 2CVRA 3OS0A 1HCZA 1TWAH 4F7UE 3I7FA 1WJRA 2KQWA 3CCEQ 1SR3A 4DV6Q 1PA6A 4Y92A 3VS2A 2DPPB 4A3EB 2L5TA 1K1ZA 1YEZA 2RJCA 4YY3Q 1HNWL 2GF7A 4RCOA 2H3EB 3AB9A 4L6V5 4BI3A 1H95A 4X3SA 3MHXA 5GAOm 3H0GB 4ANJA 1K83B 4KD4A 3K5NA 2XI9A 3J7YW 5LJ5d 4F8MA 1RF2D 2QI2A 2EY6A 3I72A 2RK2A 4PG3A 2NUPA 2W0ZA 3QKJA 2AQ2B 4KJOA 1DJ7B 2PVDB 3RNJA 1K73C 2JA6H 1A2TA 2O31A 1CKNA 1EY4A 2XN9C 5JEAH 4B3MQ 1MNEA 1GBQA 4AG1C 5A2QE 3X3NA 2XRSD 1KDCA 4FXGC 2E2JH 1YJ9T 1RACB 3TZDA 2BZXA 1IBKL 2Z4IA 5CQYA 4CJ2C 2PZ1A 4DR3Q 4E2FB 4NW2A 2A8VA 3EJIA 4FXDA 4CC3A 1LABA 1X75C 2LQKA 3SK6A 3W2DA 1OU9A 5CKFA 2D0PA 3UDGA 2QDYB 1I3QB 4DK6C 3IL8A 3ER0A 1PKSA 2C06A 1FVIA 4KGVB 1WDXA 1M8AA 3T13A 4PJOE 2Q2UA 2EJMA 5M9OA 4PJOC 1PYBA 4F14A 4C1NI 3H0HA 3PT9A 3KXTA 2ROLA 3RERA 4RGOS 3LH5A 1MV3A 4BBRG 1MGSA 4WTOB 4JI2L 4IUTA 1S5DD 3M53A 1XX8A 1I5FA 2M9UA 3BU2A 1X6BA 3OQ5A 3H09A 5M3FG 2JN0A 3QJYA 4YTLA 5BR8L 5IP9H 2IG0A 1B53A 3D4RA 4PFZA 4AFZC 1MKHA 3EQLC 5C0XI 2CUBA 1SNPA 1A3TA 2RHSB 4ZAIA 3M56A 4KN4C 5KYNA 4DA4A 3FHWA 4PZ7A 3S2DH 1SYBA 4N4HA 1HR0L 2J4XA 4JI3Q 4TSSA 5CO7A 4X62Q 2F69A 4RCBA 3DMUA 1OOTA 4PJMA 1NM7A 1GD7A 4IJLA 1MI2A 4A3KH 2CP6A 2F0TA 1WQ7A 1IL8A 2OQKA 1E6GA 3GP7A 3S2HH 1SDFA 4C56C 1TTHB 2KA7A 4KK7A 2EYWA 4F17A 1L0XB 1SE3A 2TMPA 5HURA 3CCLA 1YCYA 1W4SA 2E1HA 3EAEA 4HMJA 4K6DA 3S1QB 3E6ZX 2ALYB 3FVQA 2R58A 2EQSA 3M0UA 1AOJA 2P84A 5CKEA 3HOVG 2UU9L 1IKLA 1E0BA 4X66Q 4DBFA 1UJYA 1H9RA 3GTPH 3CCSA 2F4VL 3OYAA 5J1ZA 3VR3A 3BZDB 3H3VI 4JYAL 1PTOC 3SK5A 3K6OA 2DE0X 1PSFA 1JORA 3KJPA 1SMXA 2H5XA 2DUDA 2COZA 1PZKD 2AWNA 4AYBE 2RQUA 3U9SA 4MDWA 1YNJD 3QIAA 1N8RR 1PTOB 2L15A 2X3WD 4C8QE 3RN2A 4CKCA 4GS3A 1I1JA 1RAAB 5LMNW 2EWNA 1K0XA 1E3PA 1OO9B 4OWWB 2CREA 4LE9A 1IHZA 2EY1A 1FX7A 2COWA 1L2FA 2K5HA 5IT9L 1QVFS 3NK9A 3EFSA 4XU2A 2L3SA 2K28A 1R0CB 2YUQA 4C0ZA 4JJNK 3E9IA 1EYGA 2V8JA 5CQXA 1TU2B 2AKLA 5CGKA 1GL5A 1OX9A 1R0BG 4FIBA 2RHZA 1OXTA 2SNSA 4J6XA 4YY3L 1UTIA 2ABLA 4JLGA 1VQOA 3A7LA 3HFNA 1X27A 1ICWA 4H0LC 1X6OA 1X3QA 3I56T 4RGNA 2HIVA 2QQAA 2Z6KC 2GBQA 1I4XA 2IX0A 3J81L 3QYGB 4D8KA 2A19A 5T1GA 2IY5B 1SLJA 1STAA 3QOLA 4Z9CB 3GTPB 2QEXT 4N9TA 3PFSA 2AZSA 4C3JB 3GLXA 5J22A 3CCJT 1E2WA 3TP7A 3K57A 2AQ3B 1WHGA 1QKWA 3KDFB 4IQZA 5FK9C 4Z8AA 4R55A 3UDFA 5L23A 1B34A 1PLFA 1QB5D 4H02A 1TQOA 4BI8B 3D0FA 1CKBA 3J7AV 2ZPHB 4JI5L 4KHZA 1GM5A 1NPPA 1IBML 2CP0A 5A0GA 3M54A 2HDMA 4UP7A 1MHNA 4OP0A 2YHTA 3OSVA 1LLRD 4PZ6A 5KYXB 1XTDA 4KKTA 1KRSA 3MP8A 4DV7Q 2HDAA 2KT1A 4XQ3A 2EVRA 3GBQA 4B3SQ 3RN5A 1EU3A 4XQQA 4XAXB 1B9MA 1WA7A 5LJ3g 4S3SA 3QXEB 3H6MA 2MAMA 3SFMA 4K0KL 1IKMA 2WINB 1Q3LA 3IKJA 1UUEA 2O5JC 4A3BG 5KCOA 2NVTB 2VQFL 3CCJA 2EPBA 2LKVA 1EFNA 4RTXA 4DBHA 2LQNA 3SXHA 3L2QA 4BE1A 1SFOB 4PLIA 2LY7A 3NTHA 4PJOA 3ND8A 3RMHA 4O5VA 1D1CA 3RR5A 3GTQH 2IJ0A 3CXCA 1YWOA 4XTCS 4MZTA 1I4HA 2FL7A 5FU7B 1BBWA 3VR4A 4E47A 1D1AA 4FU6A 2YV5A 2JXBA 4M7DC 1UWVA 3HZXA 3TSZA 4RFBA 5J26A 1AVZC 3L2VA 2PZUA 2R5AA 4IPDA 1EY5A 4TVAB 5M5YB 3QYHB 1BDOA 2PI2E 2EGCA 1PH3A 3CCJQ 4F7UG 4J7FA 3H3VH 2PQAA 4NXML 1QCNA 1D0YA 3U23A 3BE3A 3Q0AA 1KIXA 5IYBG 2JMAA 2ZCFB 1N9SA 2ENMA 1BOSA 1D1IA 1B7TA 2DAQA 4J9BA 1HZ9A 1SROA 1QZGA 4RWSC 1IYUA 4A3DG 4RUGA 2JJ9A 3NHNA 1K9MC 2YT6A 4HN7A 4ABNA 2PPBC 4A3DH 5GAMf 3OSSC 2A5HA 3RKYA 4L59A 3EN2A 4LUZA 3L2WA 4C92B 3OA6A 3VYSA 1SHFA 4BBRH 4A3EH 3TRZA 4GZYC 4CKEA 4NOYA 4P74A 3S17B 2EPDA 2YU9B 4KMUC 3CPWA 2M16A 1F9RA 3URGA 5C4XG 5GAN5 1PH5A 3S2HB 3P8BB 1ZBJA 3Q6SA 5C0XH 3FKIH 4JUVA 1F2LA 5JAVA 1SF9A 3GTLB 2K7VA 4C5EA 2A73B 4G4KA 1YHBA 3SR1A 4ZGDB 2LX7A 1STEA 2QW7A 2E2HH 4BA2I 1GVPA 2NWGA 2E10A 4ZGEB 2VZAA 5HCKA 5IGCA 2YUNA 4KY6A 1AN8A 1D6EC 1IYVA 3UWNA 3CRKC 4DK3C 1G6ZA 1GUNA 2KXDA 3I9QA 3DXJC 2NVYH 4IUVA 2FPFA 2QA4A 4E7LA 4PJOG 2VL6A 4M8AA 5IOCA 3OYMA 2NTSA 4A3DB 1STNA 2XVSA 4NB3A 3AFPA 4J9CA 1PTOD 1YWPA 4M78D 3W3AA 2CHBD 1BCOA 2DYBA 4IO9A 1UFFA 4GLKA 1K76A 4DR2Q 3LWUA 4LXCA 1EY7A 3E0EA 4JBWA 3M4OH 1AWJA 3HS0C 2G5DA 2QASA 2DY7A 1BUVT 4CJ1B 2OTLA 1VQNA 1CI3M 2RDFA 3CW2C 2ES2A 4LF8Q 1KRTA 3SEMA 4GY5A 4Z88A 1H9SB 4GLXA 2DMOA 1KFZA 2KBTA 2KK4A 4IIOA 2CDTA 3ZBDA 5KE2A 2BA1A 4DGZA 2J7ZA 4NS5A 3CAMA 1SE8A 2DL5A 2ED0A 3F2BA 2ZJQA 2ASBA 3LGFA 2OAWA 4PKCC 4QQDA 1M3AA 4ZN1A 2IW3A 3PUXA 4QUCA 4RHRA 3VYGA 1CFMA 4I7ZC 2B2TC 5CKDA 2QILA 4JI7L 1U3OA 2PTKA 2XIWA 3I56Q 1QUQA 2B8AA 2PMZB 3D6CA 5JJIA 3T16A 2X69A 4LFBQ 4R9WA 5DY9A 3SDZA 4F04B 3BJUA 4KTAA 1VQMT 5KYWA 5LJ5g 4A3IG 5KYWB 2IWHA 1EWIA 4C3HG 4BB7A 5GAOp 4EQ5A 3VS0A 1N5ZA 4AIMA 4HCBA 3CC2Q 5C5LA 4OB2B 4JI8L 3CPFA 3BYYB 1PTOF 3PGGA 3DWAA 3A7AB 1K0SA 3LGJA 3QZ9B 1X01A 4FM4B 2E2IB 1SNCA 5D14A 3O8VA 1WTPA 1H9MA 1NLPC 2Y4XA 2B63G 1VQ8T 5IY0A 3S9WA 2YWWA 2RCFA 4LF9L 3KF8B 5FWBA 5J39A 2L12A 2YRCA 3N52A 3PV0A 4B3RQ 4GKJQ 1X2KA 4AFUC 4LUDA 2NYSA 1NTGA 3DEOA 1H641 1XMQL 2GCXA 3X25B 1FGBD 3TSSA 1PC0A 4RG8A 1CKMA 1G291 1KQ1A 1Q82C 2AT1B 3EG0A 1M90C 3I3CA 5FU7C 1O7LA 3S14B 1OPLA 4WRDA 1SEBD 1X32A 5A0LA 2EQUA 2D0OA 3M4QA 1PFNA 2LMCB 3EA6A 2ZPIB 1HNXQ 2ZTEA 4L5TA 1XNQQ 1VQ5A 3HOZB 4A3MH 3JCMf 2L89A 1AWOA 4FDBA 1HA5A 4QY7A 3TSWA 1YHQT 1UHCA 2MWOA 1NSNS 1KAWA 4I7AA 3GV3A 4JBMA 2F3WA 4GOPC 4R4IA 5IODA 1WFWA 3SD4A 5IP7H 4OONA 2CS7A 5I2SA 1YJ9A 4C92E 5I9OA 2RPNA 5ELFA 2M00A 3J7AF 4RMFA 2R93B 1SRMA 3HHTB 1CA6A 2G6FX 4BD3A 5J3BA 2LC4A 2F0IA 4BY1G 3V96A 2E5LQ 4G7OC 3PNWC 1G3WA 1IZ6A 4CDEC 1YHAA 1LTBD 4A3JB 4R4TA 1VQPA 2KUMA 1XMQQ 4U673 3CCSQ 2HUGA 3VJPA 4RH6A 4II1A 4KH1B 1ZYRD 4V0BA 5E7NA 4CBVA 4J83A 1TWFH 3AFQA 4ZUJA 1CKAA 1KHCA 2FYKA 4E6IA 4HIKA 2BE5C 5M3FH 1EWHA 2RA4A 2ATWA 4C92D 4IPGA 4OMMA 2L11A 4HJ7A 1ESFA 1TWGH 1I0CA 1SNQA 2F4IA 2EQIA 1TXQA 4LF4L 3A8LB 1RI0A 4HIOA 4C8QB 3URYA 2EY2A 3D4WA 1BCMA 1CZWA 3PUVA 4EMKC 4AYBB 2HNIA 1GUSA 3PQIA 1VIEA 2BTTA 2QQ9A 4EPCA 4LFAL 1Q95G 4TVRA 2MGSA 2YTVA 1DONA 2HBPA 2N3SA 2PU9B 4HCEA 3CD6Q 4F7XA 4J8OA 3S3NA 2EYLA 4M7AF 3F2DA 4A93B 1VQJA 1YI2A 2BOSA 4R1JA 5F2DA 1ARKA 4IUNA 4C0GA 2CP3A 2MP1A 2WKDA 4CC2A 3OYGA 3REBB 2WSCE 5FRMA 3ASKA 2EOTA 3X28B 2K05A 2KCTA 3I55A 1X54A 3QB3A 4XDXA 2J06A 3D3RA 5D65A 5CAIA 3VS7A 1VQLA 5JJZA 4HJAA 2D5DA 4HR7B 4NXMQ 3F2UA 2K2MA 1TY0A 4DR2L 2A0FB 2NN6G 4M78B 4G57A 5EKLA 2LNHB 3UE1A 1OU8A 1H9KA 4DOWA 3AEVA 4IFDG 2ZGWA 3VYTA 1MMGA 4E7HA 5ELNA 4OWXB 5HKCA 2RQRA 2YUOA 4DAYA 4OO1H 2MPMA 3H94A 3S1NH 3JCMh 4DF7A 1W3SA 1NMFA 1EFID 3A74A 4K5WA 3UA7A 3G6ET 2LSSA 3NGPA 2RNAA 4A54A 2KGTA 4N9PA 2I5MX 1ILPA 2DNEA 4FT2A 2F0WA 1TWHH 5D6XA 2QGQA 2DA9A 3JCMg 1EUJA 4NDXA 3SWNB 1YI2T 1Z9QA 1LTTD 1WZOA 4DBRA 2EYPA 3VS6A 1HZAA 4O6JA 5GAHC 2C5CA 4M7DF 1M1GA 5K36G 3Q23A 4LF7Q 1S5FD 4GLVB 1Y71A 4QQGA 4WORA 1TG0A 2EIFA 4JVZA 3MEAA 3CCUT 2MFIA 2EJFA 3PE0A 5AJ3Q 3RZDH 2K79A 1YJNT 1WJSA 2CZ7B 3E0JA 1TS5A 2BCOA 4OXPA 2EJ9A 1TOVA 1GUOA 3QIIA 4GBQA 1XQHA 1EZZB 4LDYA 1L1OA 3NBHA 1UAPA 1M2OA 2CW0D 2NN6H 1Q81R 1I4GA 4QL5A 2JMCA 3FB9A 4BS9A 1T0HA 3NTKA 4JS4A 2C9OA 3HKZE 2EVBA 2DIQA 4FYVB 5IH2A 2IIMA 1VQKQ 2NUTB 1IGQA 1L1OC 2RHUA 3CC2A 3AMUA 4QT7A 1PD1A 3KFUA 3OTOQ 2L4NA 4KLKA 2XK0A 4RTUA 2RSOA 1WVLA 2XRQD 4DV2L 4IOCA 3EG2A 1ZKOA 1IW7C 4Y7NH 4A93G 4JI5Q 1JMCA 2F0VA 4BDYA 2DY8A 1K8AU 2OCEA 3V8KA 1JWMD 1TS4A 1CUKA 2UXCQ 3CMAT 2DX1A 1PHJA 5G3LD 1SN8A 4GKKQ 3CCMT 3QO3A 3MEHA 3M59A 3ZEHA 3NTIA 5HGTA 3GTQB 5GMKl 1YJ9Q 1KQSA 3RLOA 3HOZH 4MZPA 4J9EA 1OX8A 2MYSA 5GAOl 4XYQA 1YITA 1EOVA 4MZMA 1DJRD 1SRUA 4WJ3M 4M78E 1U06A 1H8KA 2KCMA 5I2YA 4WF2A 1RAFB 1IXDA 2D62A 4JI1L 2Q2IA 3A55A 1NLOC 2JSOA 3MFGA 4WCIA 3K5LA 5IE8A 1KC8C 1JB3A 5FO8B 2WSFE 1UEAB 1HFNA 2EQKA 2VB6A 2WAQE 3DLMA 2KEAA 1QWYA 2A6ED 4YHHL 2NTTA 4JI0L 4CRIA 2Y90A 2XSCA 1D5MC 1NAPA 2DJZA 1V76A 1OI1A 1VQ7T 4M77D 1YI2Q 4MMLA 3EH1A 3H91A 1UE7A 4ZKCB 1FMVA 3CD6T 2QF7A 3JB9G 2DEUA 3CQZB 3NHHA 2F03A 3OW7A 2G9DA 2MWPA 4DV5L 2DETA 4LD6A 3J80i 5EPJA 3A8KE 5KNCA 1KABA 4ELZC 1HJDA 1A0IA 1XNRL 2I0NA 3OW2P 2K4YA 1A3UA 1HUMA 1PZJD 2RCNA 4XYOA 2FRYA 2P0KA 1YBYA 3OYEA 3G48A 1SNMA 3EGDA 1WHKA 3VA5A 4J9HA 2R7ZH 2P4TA 4X66L 1SAPA 4BI4A 2VWFA 2M0OA 1UGVA 3MA2B 4HJ9A 3JCMJ 4IZ8A 2QG9B 4J15A 1I50H 1LJOA 1D8LA 2JK8A 3JB9J 3R3OA 2IPOB 1ASZA 3OYNA 1Q86R 2J7IA 3C0CA 5I21A 5LMUQ 3EVQA 3V8LA 1Y57A 2L3PA 1JQYD 1QP3A 2UXBL 1RUWA 5ELCA 3A1PA 2KVMA 3CKIB 3EGXB 4OWTB 1DD2A 2EJGC 4P2CB 3DM3A 2EKHA 3V7RA 1I5OB 1YIJQ 3W1GA 1N32L 4LN2A 4AQYL 4FYXB 5LJ3d 5C44B 2JEAI 1FL0A 1JB7A 3M85A 3E1SA 1BBUA 4C2MH 2CZ1B 1WHMA 4FL6A 2V1RA 3H0GH 1HXDA 1YNNC 1PG5B 3A98A 1XXGA 2NWMA 1B2TA 5DAUA 1DZ1A 3MJXA 2E12A 1JXMA 1PD0A 2LQ8A 2QGFB 3M4YA 1LPLA 2EW3A 1HH2P 5KYUB 3IFDA 1QCFA 3HGBA 1K9AA 2A68C 4DN4M 4G7HC 3TZUA 1VYUA 2X6LA 2ZXOA 1MJCA 3M9BA 4BBSH 1YNND 2JS2A 1NJIC 1O7YA 3O13A 4BY7G 4DAVA 2KYBA 3S3OA 2DXBA 4CC4B 1VQOQ 3J81E 1RTOA 2RQXA 5D3IB 3CCST 2HCCA 4PMCA 1HUNA 4X3KA 2QCPX 2UUBQ 3PO3G 3UT1A 5CMDA 4DOVA 4O42A 1S1NA 4C8QC 2JJQA 2JEBI 1XOVA 3NELA 4POFA 4L5SA 2JA8G 4M75F 1QG7A 3HOUB 1N32Q 2XGTA 3IFTA 2HKNA 1V1CA 2X4YA 1G3SA 9ATCB 2VASA 2LVMA 1NEGA 1CHPD 1TWHB 2K5QA 3M55A 1SMYD 3JCMb 3CEYA 1V1QA 4JZ4A 2MO1A 1VQKT 1GBRA 2E4HA 3A8GB 1Y1WG 3X26B 4IOAA 1GCQA 3STBC 4A63B 1Y1VG 2VGMA 4PMWA 2FINB 3O5ZA 3JCMP 2EBPA 1NJIR 1SJHD 2FMCA 3A56A 1HZCA 2PMZE 3K7AH 2HSPA 4JZ3A 1IBLQ 1TY2A 2L9HA 2M2LA 3S1MH 4LUEA 2P0QA 5E3FA 1RI9A 2QQRA 3HKZG 1NMGA 1VIFA 2MQHA 2HL5C 4XU0A 5LMUL 1ZUYA 4Y52H 3QPHA 1WHHA 5C0XG 1M30A 1Q82R 2KHSA 4BY1B 1KC8R 5GAN8 1GCPA 2WV6D 1TWBA 3G71T 1SRLA 4XU3A 2F0LA 5C0XJ 1QE6A 1ENAA 1BB9A 2ROTA 3HFOA 1RDPD 4L6TB 4A3EG 1IL2A 3OPOA 1QOHA 3RLNA 2R7ZB 2FB7A 2JA5H 4OGQC 4ZTFA 4QMGA 3I5SA 4OVAA 1FJGL 2EYYA 4DR3L 1KQSP 1K4US 2O4XA 5I11A 3JC66 1CSQA 2ZZDA 4C3JH 5GAOq 1YHQA 2HL3A 2F0NA 4OELB 2UUCL 1D0ZA 2QKIC 3OMCA 4K8IA 4NL2A 4ORZA 3G4ST 2HD3A 1I3QH 4PQXA 4LFCQ 1U4RA 1VQCA 4QIWB 1N27A 2IT1A 2JZ2A 1C4QA 4A4IA 2K6AA 1T5XD 1ET6A 4LF6Q 2JE6I 5GMKi 3NPPA 4WFN3 2F5KA 1VYTA 4XTZA 5EG2A 1VCIA 1JXOA 2EY5A 4L8JA 3H0FA 2PYKA 1VDZA 1J6QA 3GO5A 2KNBB 1PZID 3DB3A 2LCLA 3NPFA 5D6WA 4ATOA 4RTTA 2ZPGB 3RMSA 4A3BH 2FMMA 1I8FA 1D1BA 4WJWA 4CDCC 5IXBA 1VF5C 4HAEA 4LW1A 4LF6L 1U1TA 3JSCA 1U4PA 3E9FA 4DPGA 2FEIA 4F87A 1V1PA 3GNFB 1WIEA 2LDMA 5IWAQ 2VQEL 1M4VA 3KF8A 1PH4A 4K11A 3CCVA 4L5GA 2CSIA 2UXCL 2P5ZX 1I81A 3PVLA 3QO2A 2OJ2A 5LJ5j 2VUMB 5LJ3e 1PSEA 2DL4A 2ZXPA 2CKZB 5IHNA 3KBGA 1PXUA 4N8X1 3L2RA 4C2MB 1UE9A 4RGMA 2PZTA 3GTJH 2XKOC 3VS3A 1DOMA 4BXXG 2DL3A 5CR2A 3OTOL 4NKLA 2WKCA 4DK1A 2RVLA 2K50A 3RZOH 3FEOA 2E70A 2RD1A 1W2BA 4FNFA 3TMEA 4O2DA 1JT8A 3WOEA 3EG3A 1M1FA 3KF6B 2EYQA 4HA8A 1G83A 1ZQ1A 1GUTA 3GP8A 4M77A 2OXPA 2DXTA 2RQVA 1SYFA 2Z0WA 1VQ6Q 1BIBA 5GAOr 1JICA 3OYFA 2L3QA 3V7SA 4OMFB 4KUDK 2K5FA 3KFVA 1ZSGA 1B9NA 2JW4A 1OXXK 4M7AB 2B2UC 2NUZA 1CQFA 3OW2A 1Q81C 1HD3A 4PJLA 1Q90A 3CPWS 2EKOA 3P20A 4E7SA 2K04A 2NZHA 5ELEA 3I2ZA 2YTXA 3MZ5A 1WXUA 4C0DC 3B6YA 4DQ2A 1K9MR 2YTYA 4WJ4A 5LJ5e 4XTYA 3NBHB 1WI5A 5IAYA 1UDLA 3VUBA 3PCOB 4DAMA 3IAYA 1LTRD 4DNRB 1N34L 2DXCA 1PRTB 2XWJB 1KL9A 5CV7A 8ATCB 1M90R 1HQRD 3LYIA 2K33A 4CDFC 4JJBA 4M7DG 2KBNA 4HVWA 4B9WA 4FF3A 1D7QA 4E6RA 3S2DB 1G2TA 3I5RA 1EY6A 4KKUA 2HQHA 2F0UA 2J6OA 3CCMQ 4XT1B 5FKAC 4J7IA 2Z6BA 2Z9HA 3INZA 2BH8A 4R8IA 3VS5A 4R0KA 1HK9A 2WACA 4QVCA 2RHQB 3C3LA 3M57A 4DBQA 2K03A 4BACA 2DERA 2TSSA 4KHVA 5IGEA 1EIHA 5CV5A 4RKUE 3EHQA 3CCLT 3U9OA 3C1FA 4X65L 4GNXB 4LF5L 2DF6A 4A4FA 4BY6C 1TR5A 5BR8Q 3Q24A 1NY4A 2CUDA 3WXMB 3DUZA 4FF1A 3HRSA 1EY8A 1MJEA 3CMAQ 5KCHA 2YLBA 3EIVA 3QUIA 4DAPA 1ZSZC 1U4LA 5KYUA 4FO2A 1J9OA 1E24A 2KHIA 3NP8A 4UP9A 1K8AC 4PLLA 2K32A 4RA8A 1MNDA 3CMEA 2ZPBB 3S1MB 1VQOT 4DUYQ 1FGUA 5IP9G 3K81C 5EC7A 2JYOA 2Z6KA 2N78A 1PFSA 3K7AB 3N6RA 3SB2A 3E9GA 1EIYB 3CCUQ 1PRMC 2HIXA 3PMTA 1GKHA 4J5YA 1F9PA 2HBWA 2A28A 2L2PA 1TWGB 4JC0A 4F16A 2KVQG 4K14A 2ZT9C 3GTOB 2QEXA 2FHTA 2KJXA 2KI7A 3R2TA 4JI4L 4A3MB 2NVQH 4C5IA 4JRIA 1O75A 1FNUA 4C3JG 4JI6L 4NXNL 3P75A 3GTKB 1SFOH 3ZFJA 1DYQA 3P8HA 4RG1A 4JCVE 2RF0A 4A4EA 1XJWB 2LMJA 4P75A 4C8QA 2B63B 2MI6A 2IVWA 2LJ1A 4M7AA 1BVSA 1WTHA 1K28A 5LJ5h 2CWPA 4RAUC 1MBYA 1DOLA 1S5BD 1BR9A 3QSUA 1RIPA 2B2WA 1PHTA 3H41A 1KNEA 4JBJA 5EQ0A 4XQJA 2IHFA 1KD1C 4CI0C 4M75B 1VQNQ 5JEAG 5L37A 4JI6Q 2ZM6Q 2RMOA 2BE7D 4IFDI 4K6LA 1PRTC 2QQSA 2IPKD 1H9JA 1RODA 1F9QA 3L3OC 1NJIU 5JEAJ 4NL3A 1RAIB 2RDHA 4KHPL 4FF2A 5M5XB 4K5XA 1BNZA 3HPWA 4EMKB 2KXCA 3D8GA 1BQQT 5DLQE 1LT4D 3MXPA 3UPUA 4C3HB 2D0QB 1U8RA 2Y0SE 1F1BB 4LFAQ 3S6WA 3L42A 1M1KU 2F5TX 3PUWA 1WXBA 1WD0A 4QIWE 2GA4B 4UPAA 3I55Q 2RQWA 2XMFA 3CXCP 3HOYG 1A6XA 4GN3B 1YJWQ 4N4GA 3UA6A 2HKQB 5E1FA 4JI2Q 1UB4A 4A3CG 1WTWA 3CCRQ 1L0WA 3PO3B 1U4MA 2V1QA 5A2QL 2DKGA 2J6FA 3F70A 4JG2A 3L1AA 1ENCA 1CSPA 5HK3A 3HOUG 1ZLMA 4EQNA 2K1BA 5IT9c 1W2BP 3OB9A 1ICFB 1WCMG 3L7ZC 1VQ9A 3UDCA 2XDBA 2E2HB 2LP5A 4EMGA 2NUCA 1EYDA 2RB6A 1VQ4T 1YZ6A 1Y1WB 1NZ9A 5BN4A 1SPKA 1F2MA 4L63B 4QVDA 2X51A 1VQBA 2K57A 2KY9A 3N5BB 1BYMA 4C8QG 1SE2A 4BDZA 3FRPB 2QYZA 1Q86U 1IHVA 3TDQA 2GNCA 4JI7Q 2JM8A 4FSXA 2FVUA 3A5ZB 1VQPQ 1FD7D 1LTID 3ONAB 2E76C
chains in the Genus database with same CATH topology
1U1SA 2JTMA 1UE6A 1WYDA 3TREA 2EQMA 5EAYA 4ELYC 4JRPA 3E19A 3VKIA 3K7UC 4OO1I 5GANe 5GAN7 1S3OA 1M90U 2DTIA 2C35B 4B3RL 4GKJL 4MZ9A 4IKFA 1UGPB 4JV5L 2Y4YA 3RKXA 1VQ9T 1WGSA 1QVFA 1VQKA 4DR4Q 2AMCB 5CIUA 1XPUA 4M78C 1JE5A 5A0DA 5GANg 3PTAA 5AJ3Q 3BW1A 1X3EA 2DVEA 2VW9A 3SWNC 4E7JA 2HAXA 5FRNA 5M5XH 1IYJB 3OYLA 4A3FG 4C5HA 3PMIA 5IYCH 2MMPA 4OF1A 2QQBA 3RIRA 2PQAB 2QA4T 4KHPQ 4KT0E 3CCET 4C3IH 1W2BS 3GNGA 3M9QA 2UUAL 2Y0SG 1KHIA 2BUDA 3JB9H 4F7UB 1JJCB 3CCQT 3HFZB 2VNUD 4JI0Q 5GMKm 5CCAA 3ZJYC 4IUQA 3TEEA 3MO8A 1Q7YU 4TQUS 4IPCA 3H8ZA 2E2IH 1K0RA 4L5RC 2P0PA 3KJOA 1BI1A 2XU8A 3MEWA 2OWOA 4EDUA 1AE2A 4F7UF 4YHHQ 1CKNB 2H3JA 3BZKA 3F8TA 1S40A 2VUBA 5M3MH 2DTHA 1C7YA 3MXNB 1J5EL 3M3YH 2WSEE 4YWKA 1YNXA 1NPRA 4GNXA 5DM7R 3KLWA 1TWCH 5FLMG 3K8AA 1RL2A 3EFRA 5C0MA 2Z0SA 2RO0A 4LDUA 3F2CA 4DV5Q 3T1HQ 1D3BA 4M7AD 1VQ8A 3KF6A 3KOJA 2KENA 5KE3A 4EMHA 5C3EG 3RNUA 1VQ5T 3J81j 3A8MB 5IWAL 4M78F 1XPOA 3BFMA 1T9HA 4DV7L 1O7IA 1VQ6T 2NVXH 1LTLA 5DLOA 2FHDA 4OGEA 5GANf 3QDRB 2JOYA 2X4WA 2ZPFB 2RJDA 4PJOF 4GN5A 4M7AE 3JCMe 4PL6A 3HOUH 2EQJA 2BIVA 1Q1EA 3CC4T 1VQPT 3AYHB 4DV4L 3GTLH 3LLRA 4UP8A 3KUFA 3M58A 2RI2A 1XMOL 3HOYH 2E6NA 1K83H 1IXRA 2NZOA 4LD9K 3T1YQ 1N33Q 3DLLA 1S72T 2DIGA 3ULPA 4DR5Q 1FWZA 4BE0A 1LYLA 4A3JH 4OO1G 3SGIA 1UEBA 5GMKj 4R4OA 4GOPA 1JJGA 1OYXA 4JDSA 3S1QH 3I4NG 4MDXA 5I2MA 3MEUA 3M5AA 2YU9H 4XTUA 5GAMg 1WFQA 4HIMA 2ZJPA 4A4GA 3PUZA 5C4XH 2VXEA 2E8GA 2UXDL 2VY3A 4J6WA 2B29A 1QVCA 1TXYA 2WB1G 4YCWA 1CKOA 2VQEQ 1X65A 3S3MA 3NEMA 3OYHA 3AQQA 4JLIA 3OYCA 3MEFA 2AHOB 3CXCS 2VS1A 4PZ8A 2D6FA 3JCMd 2XD0A 1K8GA 1I5LA 3CMET 4BY1H 2HQLA 1VQNT 3QG1A 3HOXH 2YLCA 5IP7G 4KI0A 4HJ8A 4LFBL 1VUBA 2M1HA 3WVDB 5GAMh 5ELOA 3ULLA 5IYDH 1R8OB 2Q2TA 3G71A 2OAUA 2E6ZA 1IREB 4M77F 4A3MG 1G5VA 2LX9A 4M7DA 4DR7Q 4V2SA 4P71A 3MCAB 3HSBA 2WP8J 4IUUA 5LJ5f 2DTOA 1VQ6A 1WOCA 2KSSA 2E64A 5GMKh 3UE0A 3CBOA 3Q1JA 2B63H 2K3XA 3P8DA 4ZGJB 2K5LA 1KXLA 2I2LA 1HR0Q 1Q12A 5GANh 3X24B 1EQRA 1X56A 3TS0A 2L5QA 1PH9A 4JI1Q 2CKKA 1XMOQ 1HNZL 3ICEA 4A3IH 4P73A 2YRVA 5LJ3h 4NPSA 4GKKL 1JRIA 3PF4A 1L1OB 4BXXH 3RKWA 1O9SA 1UE5A 1PH2A 4MNOA 2XTIA 4NXNQ 4B9XA 5FJ8G 4DV0L 5IYDG 2ZM6L 4C0DB 3OY9A 1UGSB 1VQ7A 2MNAA 1OXUA 1BIAA 3HOXG 3T1HL 1N6AA 5C44H 3S24A 4A4KA 1OZ3A 1V29B 2AWOA 2IHEA 3JCMc 2JTFA 4A75A 4RMOA 4XTWA 3GOXA 4HKEA 4Y28E 4ME3A 1J5EQ 2Q2HA 2N8NA 4C0FA 3PIOA 4IJHA 3FKIG 2X35A 2RK1A 3C4SA 3JB9F 2R92G 1GXIE 4E7KA 3LGLA 3GF5A 3L2ZA 3QZ5B 1HJPA 1WJJA 3LX7A 4C5GA 2K4KA 2DD5A 3UDIA 2CZ6B 3X20B 3L0OA 4BBRG 2E2HH 3OS5A 4Z02A 2GVBA 3CQZH 1K3RA 4L5QA 2JA5G 3PIPA 2GFAA 3FC3A 5FU6C 3QJ6A 3PO2H 4LDXA 4JRKA 2KHJA 1OXVA 3A8HB 5AJ3L 4A3GG 2CQOA 1N8RC 4JOIA 5LMNQ 3RUXA 4A3JG 4M75D 4M78G 2EJGA 5AYFA 1I6HH 4GNXC 4C92F 1WQWA 4KUIA 1BI2A 3GD7A 5GANj 5GAGC 2PNHA 2JUFA 4QVZA 2WAQG 1Y1VH 1LM0A 2OTLT 2VXFA 3CCUA 2FXQA 3FJPA 1P92A 2DZCA 3FRNA 4ZN3A 4DV3L 1YJNA 4B3TL 5FLXE 2E65A 2JA8H 1JJ2S 1M1KC 3ERSX 1G6PA 4APVA 2O4XB 3U4VA 3OBYA 3OYBA 3OYJA 4BUGA 3M7NA 4K0KQ 3JAMc 2R7DA 4BY7H 4BBSG 3NFCA 2HHHQ 3F1ZA 2GFUA 3QHSA 2F52A 1VQEA 1XPRA 3OYIA 3OS2A 3CCMA 4F7UA 1C0AA 2K5VA 4DR1Q 5FLMH 4QQ6A 1B7YB 2RI5A 1Z47A 2R57A 1Z9FA 5M5WH 4M7DD 1KQ2A 1ZBXA 3JRZA 2D9TA 5GAMd 1LOJA 3CMAA 1I94Q 3VV0A 4HT9A 4OB3B 1Q82U 4LNQA 2L3RA 1KC8U 1K73U 3I56A 1BI3A 1QZHA 4DAYB 4DV0Q 2DXUA 3CC7A 4A53A 1X55A 1WJQA 4OX9L 4HT8A 4HCCA 2ZPEB 1BI0A 3DB4A 4IUPA 3BDLA 4DR1L 4JYAQ 3BDUA 1V9PA 3C94A 3AHUA 4HIDA 1YJWT 5GAMe 2AHJB 1HNZQ 1XNQL 5C6SA 2XDPA 1YIJA 1X9NA 1I94L 4X9CA 4JS5A 5GAOn 2PVOB 1N9WA 3OS1A 1WPYA 5IYCG 4DR5L 2PUOB 1N8RU 4M77G 3S2HH 3IRBA 2I0QA 1HNWQ 3HL8A 2UU9Q 4X6AH 5GAMj 5LJ3j 2MO0A 1E1TA 3H15A 4DR6Q 4DV6L 3FIFA 4M75E 4JI8Q 3MP1A 4M75C 4P5NA 1Q8KA 1U0LA 3EBEA 2UXBQ 4JV5Q 2DO3A 1XNIA 3META 3RMQA 2AKWB 1Q1BA 1QW1A 3GDEA 2X4XA 3LW5E 1QP2A 3OYKA 4GOPB 2VC8A 4ME7A 2HD0A 2HHHL 2EAYA 1YJWA 1PYSB 2ZTCA 2UUBL 2A3LA 3I55T 2DD4A 2K14A 4AH6A 4M7DB 4M7DE 1KQSS 2RM4A 1VQLT 3PF5A 4K0KL 3TU4K 1YIJT 4IPHA 1NBWA 4O0AA 1Y96A 1V43A 1Y96B 4LWCA 2LCCA 4IURA 3WWVA 2BA0A 1NE8A 3OYDA 2JA6G 2PUKB 3JCMQ 3FP9A 4R4QA 4R56A 1MGQA 3J80E 3GIBA 4VUBA 3KYHC 3CCQA 2XDDA 3PUYA 1WCMH 4YWMA 3MEVA 1E22A 1PV4A 4YWLA 1TH7A 1QVGS 3L2PA 1HZBA 3JCMW 2WB1E 3H6ZA 3GTGH 3T9NA 2KAFA 3MP6A 4C8QD 4POGA 2JA7H 5C4JH 3CF5A 3A8OB 1PVOA 3V8JA 1E1OA 4C8QF 1IBKQ 4A76A 4XTVA 2B3GA 1PH7A 5LMNL 3C95A 1H3ZA 4HJ5A 4YCUA 4DV4Q 4BA1I 2VUMG 4A3GH 2CCZA 1HR0W 1G3YA 4JOIC 2ZTDA 3PO2G 1VQHA 4BY6B 3K80C 3J81i 3VU3C 2BH2A 4GLAC 2K5IA 1Y14B 3JCMV 4UC4A 2R92H 1B8AA 1UGQB 1VQMA 3HOWG 3BZCA 2QTXA 2RHYA 3FDRA 4N0AA 1SSFA 2K52A 1C9OA 2PI2A 3LWIA 4OB1B 3G4SA 2VV5A 3G7ZA 1U5KA 2RHXA 3VUZA 1PH8A 1AHJB 3T1YL 1N33L 2DGYA 2HQEA 2PVGB 4RCCA 3A5UA 2A7YA 2EXDA 1XJVA 5C44G 3TEHB 5CKBA 2R7FA 2BKDN 4Q5WA 1VQGA 2F3IA 1B70B 5HY6A 3FLGA 3CBPA 1G51A 4MTNA 1MIUA 4PJOD 2CGHA 5FJ8H 2WFWA 1EQQA 2DZ9A 1LNXA 1IBMQ 1M8VA 4YCVA 4DV2Q 4JRQA 3Q8DA 3CCVT 4RG2A 1KG1A 1I4K1 2EFIA 3J7A5 4B3TQ 4A3LH 2KMTA 4DUZQ 1M9SA 4E7IA 3W5OA 1Y07A 1QUQB 5JJKA 5IN1A 3D31A 2X4JA 1NE3A 1IBLL 1G3TA 2XICA 2VQFQ 2GN5A 4OB0B 1B34B 1VS0A 3CP0A