1XTDA

Structural analysis of leishmania mexicana eukaryotic initiation factor 5a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
149
structure length
149
Chain Sequence
NASKTYPMAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTHNVEVPFVKTFTYSVLDIQPNEDPSLPSHLSLMDDEGESREDLDMPPDAALATQIKEQFDSGKEVLVVVVSAMGTEQVLQTKNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords eukaryotic initiation factor 5a
publication title Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
rcsb
source organism Leishmania mexicana
total genus 26
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xtdA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xtdA02
1Q82C 4OWXB 4A3GG 1VCIA 2V1CC 1QVCA 1QVGS 3E0EA 3ULPA 1J5EL 1TWAH 3KDFB 2AKWB 2UXBQ 4KI0A 4LUVA 1M1KC 4NB3A 2JNGA 4HIOA 4OONA 2HIVA 1PYSB 3ERSX 4WJ4A 5LMNQ 3LGFA 2NVQH 4OWWB 2R7DA 4GKJQ 3DB3A 1X3GA 5GAHC 4L5SA 1DGSA 3H3VH 5JJKA 1HH2P 2UUAQ 4LF9L 4A3BG 1K3RA 1CSQA 4JBWA 4DR6L 4DV7Q 3K7AH 2Y0SE 3M7NA 5FLMH 2CWAA 2CCZA 2VW9A 1VQOT 2YTXA 3MEFA 1VQNA 3PUWA 4YWMA 1KRTA 3U58A 4OX9Q 1EQQA 3S1QH 3CD6T 3CCQT 3KYHC 2ZTEA 3S1MH 3P8BB 1G51A 1KC8C 2RF4A 2K5VA 3PSIA 4HIMA 1LYLA 4KLKA 1YHQT 3CCUT 4JBJA 4A3CG 5M3FH 2ZTCA 4GNXC 5JJLA 4B3RL 4JOIC 3I55T 2JA6G 4AIMA 3CCVA 3SGIA 2QA4A 1CKOA 1KXLA 3GO5A 4YHHQ 3S2DH 1NMGA 3CP0A 3F1ZA 3TS0A 2D62A 5ELOA 3HOVH 3L7ZC 4EQ5A 1H95A 4LF7Q 1XNIA 4GS3A 5C4XH 1CKNB 2UXDQ 4JI2L 2OTLT 4LF5Q 4IFDI 4IJHA 4IPHA 1YHAA 1K8AU 2R7FA 4JI6L 1XMQL 1OXUA 3J80E 3F2DA 1VQ6A 4A3MH 4X6AH 3J80c 1W3SA 2UU9L 1VQLA 2IX1A 4K0KQ 4LFAL 1VS0A 3CCST 1VQ9A 1KRSA 2AWNA 2JA7H 4IFDG 2Z0SA 4BBSH 4YCVA 3CCRT 1E24A 1LM0A 4ZN1A 2C35B 3K80C 2UXBL 2B63H 2MWPA 1L1OA 4R4QA 3KFUA 2GVAA 2XGTA 4A3GH 1VQMA 1NBWA 4HIKA 1VQJA 3CCEA 5LMNL 1HZBA 2HT1A 1XTDA 2R93H 5M5YH 4BXXH 1WI5A 1XMOQ 1IL2A 5IY0A 2LQ8A 4TQUS 3WWVA 1NJIU 3F2CA 4HJ7A 2UUAL 1NZ9A 3CCUA 1GO3E 3UE1A 4DV7L 5IYBG 1PH1A 2KENA 2ASBA 2N78A 4B3TL 1BKBA 1ASYA 4OX9L 3JAMi 2QEXA 3I4MH 4A3JG 3OW2A 3DM3A 1CSPA 3PCOB 3HOWG 1K83H 1MJCA 1VQKT 1Q7YC 4BY1G 1KHIA 1Z47A 1VQ7A 3Q8DA 5IP7H 5HY6A 1IBMQ 4ALPA 1AE3A 3UDXA 5IWAQ 1P8LA 1VQ5T 1VQPA 1X56A 1YEZA 2BH8A 2F52A 1VQ4T 2N3SA 1S3OA 2WFWA 4P73A 3CCJA 2D0OA 4DR5Q 4P74A 3J7ZC 1K0RA 4YHHL 1EYGA 4GOPC 1HR0W 4LF6Q 4YCWA 1YITA 3CCSA 1EOVA 4LF8Q 4LF7L 2R7ZG 3S15H 3B6YA 4JI1Q 2UXDL 3KF8B 4LF5L 1YJNT 4L5QA 3KF6B 2HIXA 3UE0A 4DV0Q 1D7QA 2JA9A 3PO2H 1Q82U 2F4VQ 1QVFS 2NVTH 1GVPA 3HOZH 1X3FA 4K0KL 3UDIA 1Q86C 1YI2A 2AWOA 1YJWT 1GM5A 3M4OH 1M1KU 3M9BA 5IYDG 3FKIG 3CPFA 1SN8A 2YYZA 4X64Q 2LXJA 5EAYA 4YTLA 3KLWA 4PG3A 3J81i 3F2BA 2UXCQ 5M3MH 2MFIA 3IRBA 2YV5A 2QGQA 2E2IH 1WCMH 3FHWA 1A8VA 2K52A 1VQKA 4MTNA 4JOIA 4DK6C 2RHSB 2LXKA 3NBHB 2RHQB 1Y1VH 4IJLA 5DLQE 1BBUA 4JCVE 2UU9Q 1VQNT 2CKZB 4C3IH 4QY7A 3S14H 4A3DH 3PIOA 2ALYB 3H0GG 2B3GA 2KCTA 4A3IH 4DUYQ 3HOXG 4BY7H 2DUDA 4HJAA 1HNXQ 4DNIA 1L1OB 1C7YA 4BA1I 4JI4Q 1KC8U 2LSSA 4BBRH 2JEAI 1UWVA 2L3RA 1LTLA 5M5WH 2KBNA 3LGLA 2RCNA 3RR5A 1WYDA 4P71A 1VQGA 1VQ8T 1IBML 3CCVT 1YJNA 3K0XA 2PQAA 4DAYB 3HOYH 2QA4T 4DV1Q 5IWAL 4H02A 5J3BA 1N33L 4TVRA 4DR5L 4CRIA 1YZ6A 2JEBI 5ELNA 4AH6A 2ZJRA 1XJVA 4A3LH 4DUZQ 5C0XJ 1HNZQ 1N32Q 1PV4A 1PHJA 4B3SQ 4NXMQ 3H3VI 4LF8L 4JI1L 1YJWA 1OXTA 4KHZA 4AYBG 1VQ6T 3RLFA 4DV0L 1VQLT 2VY3A 3J81j 3OYYA 1NTGA 1VQ9T 3CPWS 2F4VL 1IYJB 2JQOA 2EXDA 2NVYH 4R4TA 4TVAB 5IYCG 3OTOQ 1D8LA 1R9TH 1I94Q 2Z6KC 2VNUD 1RL2A 1MJEA 1A63A 1VQIA 2XHCA 1VQMT 5FLMG 1Y14B 2ZJPA 1QUQB 1EIFA 1K73C 3CCET 2PMZE 3ULLA 4DKAC 3CF5A 1UEBA 1HZ9A 1Q12A 3CW2C 1EUJA 2R6GA 4LUOA 4X64L 3U4VA 4BXXG 2OQKA 2KHIA 4OO1I 5JEAJ 2UXCL 2L15A 1GKHA 2UUBQ 1C0AA 3BJUA 3ER0A 4GLAC 4JI8Q 5E7NA 1XPUA 4NXNQ 4L5TA 5GADC 1NMFA 5M3FG 1X9NA 1X54A 4HJ9A 1WJJA 3VDYA 3PF5A 1HNWQ 4O2DA 1Q81C 1VQ8A 1SROA 2YU9H 3OW2S 3GTLH 3HKZE 4A3FH 4HJ8A 2QEXT 4UP7A 3RZOH 4OO1G 4DPGA 2NN6I 4GOPA 4LFCQ 3U50C 1TWFH 4DUYL 4JBKA 3DLLA 4P75A 1SE8A 1G291 1NY4A 1XPRA 3HOVG 4JI4L 1VQ7T 1SSFA 1Q7YU 3ULJA 5C4XG 4PZ8A 3K81C 4LWCA 1EQRA 2K4KA 2KVQG 2MO1A 2Q2TA 1VQPT 1VQDA 3M85A 4EX5A 4LUZA 1G6PA 2AHOB 3CCJT 5BR8Q 4DV1L 4LW1A 3RNUA 3RLOA 2F3IA 3W1GA 1OXXK 4A3MG 3A74A 1YITT 1YBYA 4QJFA 1HNZL 2MWOA 1TWGH 2JA7G 2OCEA 1N32L 2Y0SG 3PUVA 4B3SL 2CQOA 3UDFA 4X62Q 4NXML 4BBSG 4O0AA 4POFA 2B63G 4L5RC 4A3KG 3I4OA 1OXSC 1PVOA 4UP8A 5C0XI 2K75A 5FLXE 3TRZA 1VQBA 1PH9A 3HOUH 4GKJL 2K50A 1OTCA 4GKKQ 2R93G 4A76A 1YI2T 2GN5A 2PQAB 3GDEA 1PH4A 3OTOL 1Q86U 3U4ZA 2KHJA 2WB1E 2N49A 4ME3A 1I94L 1JJGA 2EIFA 2K5HA 3KBGA 4KHPQ 4QGUA 5C0XG 2CKKA 2WP8J 2IG0A 5A2QE 1KD1C 2JA5H 5JJIA 1Q1EA 3I4MG 3AFQA 4GLXA 2ZTDA 2UUBL 4JYAQ 4JI8L 2MQHA 4NXNL 5IP7G 4A3EH 2VZAA 1N8RC 1HNWL 3S1RH 3TEHB 4DK3C 5LMUQ 2OQ0A 1Q1BA 1IBKQ 3PIPA 1S40A 1P16A 3RZDH 4LFCL 2JJQA 1MIUA 3STBD 1PH7A 3CC2A 1E1OA 3G48A 4Y7NH 3J80i 1VQEA 1KQSA 3KDFA 4IPDA 1A62A 1AH9A 1I50H 3EIVA 3TQYA 2VUMH 3W5OA 3GD7A 5BR8L 2ZJQA 1Q46A 4IPGA 2BA0A 5C3EH 2Z6KA 3HOZG 1X3EA 1WOCA 1JJ2A 4PZ7A 1UE7A 4GLVB 4GOPB 4X62L 4R4IA 1KL9A 4OWTB 4LFBQ 4J15A 3PV0A 2E8GA 1EWIA 4DV6Q 2IY5B 4DV5Q 3H15A 1V9PA 5C44H 4OXPA 5M3MG 3PGZA 3I4NH 3CXCA 3CC7A 3BU2A 4GKKL 2MO0A 1WCMG 1PFSA 1N34Q 2R92G 1PH8A 2BA1A 4RMFA 4YWLA 1Y1WH 2JA8H 4Y52H 4A4IA 4UPAA 1IXRA 1K73U 2AMCB 1N9WA 1YJ9T 3AFPA 4A3DG 4KHPL 3A5ZB 2HQLA 1B70B 1E22A 4A3IG 3D0FA 4JI7Q 2GVBA 2N8NA 4GN5A 4B3MQ 5LMNW 4GNXA 3AYHB 1RIPA 2JE6I 5FJ8H 3FKIH 4BBRG 3CCMA 4JYAL 1TWHH 1N36Q 1W2BA 1B8AA 4A93H 2A8VA 3J7AF 1CKNA 3G4SA 3G71A 1LUZA 2D0PA 2EQSA 2NZHA 1Q81U 4DV2Q 3HOYG 1NPPA 2NZOA 5IP9G 3I7FA 5LMUL 2JK8A 1XNQQ 1KIXA 4DV3Q 4XIGS 1IBKL 4B3TQ 1JT8A 1IBLQ 4R4CA 4X66Q 3TS2A 1BBWA 2A19A 4A3LG 4LF6L 1PH5A 3HKSA 3CMAA 2VQFQ 3KJOA 5IT9E 3PO3H 2VQEQ 4YCUA 1CKMA 5IT9c 1OXVA 4AQYQ 4DR2Q 3DB4A 5GROA 4NPSA 4R1JA 5LL6S 1T9HA 3RN5A 3CMEA 1NPRA 1K9MC 1SR3A 1FL0A 1U5KA 4JI3Q 3CC4A 4DAMA 4HIDA 4DR1Q 4QQBX 4XTCS 1SMXA 3KOJA 1ASZA 2OTJA 1HZCA 4LFAQ 1YJ9A 5GAEC 3F8TA 4LFBL 4DV6L 4UY8C 2XTIA 4DV5L 4IO9A 1QVFA 5AJ3Q 1O7IA 1VQAA 1VQFA 2PI2E 1KAWA 1Z9FA 1XNRQ 4R4OA 3GTOH 1I5FA 2VL6A 1M90C 1A0IA 3CQZH 4JI0Q 2I5MX 1YHBA 3A5UA 1N34L 4JV5Q 1I3QH 2IT1A 2R92H 1V43A 5IYCH 1L2FA 4A3FG 1EFWA 4A3BH 4LNQA 1V1QA 1KD1U 4JI7L 5HGQA 1UE1A 1HNXL 1PA6A 4B3ML 3T1HQ 5GQOA 4IOAA 2YTYA 4QQDA 3I56A 3HFZB 1Q8KA 3T1YQ 3RLNA 1N36L 1E1TA 3CCLA 3A0JA 5IE8A 3S2HH 2ZM6Q 1HR0L 1N8RU 3JC66 2NN6G 2OWOA 3S24A 2IHEA 3KF6A 4DV2L 4GNXB 2E2HH 4DR4Q 3PUZA 3JAME 1EIYB 4YY3Q 1XNQL 4A3CH 4DV3L 1JMCA 3BZCA 1GD7A 2ID0A 4PZ6A 3CC2T 4FDBA 3JAMc 1KQSS 4X66L 3EN2A 4DUZL 1IBLL 1FJGQ 2KCMA 2UUCQ 3MXNB 2JA6H 2B29A 1S72A 4QL5A 1X65A 2VQFL 1JE5A 4GN3B 2H5XA 4C3JH 2VQEL 4DV4Q 2E5LQ 3GTKH 4P72A 1JJ2S 1AE2A 4AQYL 4DR2L 4JI5Q 3L2PA 5FLXc 3HOUG 2HHHQ 1XPOA 2VS1A 2CFMA 1QVGA 4RG1A 3S16H 2E2JH 4DR3Q 1E3PA 1HJPA 1WFQA 4JI3L 3UDGA 5J26A 3HKZG 3GTJH 4QIWE 1XMOL 2MI6A 3K7UC 4DR1L 2IX0A 3D31A 1U0LA 3CXCS 1VQHA 1FGUA 2PNHA 3M4PA 4MNOA 2ES2A 3GTGH 4DR7Q 2JA5G 2Q2UA 1HZAA 3W1BA 3CC7T 3S1NH 3CPWA 4JC0A 5AJ3L 4ZN3A 3LGJA 3G6ET 3M3YH 1XNRL 2WAQE 3RN2A 2JOYA 1M1GA 1VQOA 4IPCA 4JI0L 3NELA 1SRUA 4A3EG 3PUXA 4JV5L 3CD6A 3CCQA 1C9OA 1X55A 3EBEA 4WJ3M 3CAMA 5C4JH 1SLJA 3J81E 4A75A 1W2BS 4X65Q 1YHQA 1CUKA 3J81c 5IYBH 3CCMT 3T1HL 3AEVA 2PI2A 4PMWA 3I55A 3G4ST 3G71T 4LF4Q 3T1YL 1B7YB 1MKHA 3FP9A 4APVA 5JEAG 4YWKA 4HJ5A 4A3JH 1JJCB 2ZM6L 5K36G 1BVSA 3HOWH 2DGYA 4DR4L 3PF4A 2VUMG 4BY1H 2DO3A 3PO2G 1I6HH 4YY3L 1J6QA 5C3EG 1FJGL 2OTLA 2WB1G 3CMAT 1K8AC 4A3KH 1N33Q 2IHFA 2UUCL 2I5HA 3E9HA 4UP9A 5GAGC 2A1AA 2I5LX 3GTMH 2LCLA 2E5LL 4DV4L 1J5EQ 2FXQA 3GTPH 1QUQA 2NVXH 2R7ZH 3S17H 5DM7R 4JI5L 3GTQH 5C44G 3CMET 2HHHL 4POGA 2JVVA 3CCRA 2CWPA 3I4NG 1K9MU 2WAQG 2MNAA 3G6EA 3CC4T 1YIJT 1VQCA 1Y1VG 1YVCA 3L0OA 4DR3L 1SFOH 1JB7A 1UE5A 1Y1WG 2JA8G 4C2MH 2OTJT 3TREA 4GN4B 1QZGA 4JBMA 4LF9Q 4IOCA 2G3RA 3PUYA 5H1SE 4BY7G 4DR6Q 4DR7L 1NJIC 2Q2IA 1UE6A 1IZ6A 3STBC 5IYDH 1E7ZA 5FJ8G 2E70A 1X6OA 3NEMA 1M90U 4AYBE 1L1OC 3ZJYC 3LH0A 1PH6A 4A93G 1PYBA 4RG2A 3J7A5 1FVIA 1TWCH 1PH2A 2K14A 1HR0Q 3BZKA 5IAYA 2E6ZA 2ATWA 4BA2I 2LVMA 2Q2HA 2YTVA 3NENA 4X65L 3I56T 1K8GA 5M5XH 2BH2A 3E9IA 4B3RQ 1NE3A 3CCLT 3H0GH 2JUFA 4IFDJ 1TXYA 4LF4L 1VQ5A 3KJPA 3HOXH 3PO3G 2KDSA 1VQ4A 1L0WA 4X34A 2K5NA 4MZ9A 3AQQA 1QZHA 2I0QA 4JI2Q 1PH3A 3M4QA 4C3HH 3ICEA 4JI6Q 1YNXA 1XMQQ 3K8AA 1S72T 5IP9H 4JG2A 3I2ZA 1YIJA
chains in the Genus database with same CATH superfamily
1Q82C 2CREA 4A3GG 2YXYA 3E0EA 1IYVA 1ENAA 1SE2A 3Q22A 4CC3A 1TUDA 2DL7A 2UXBQ 4KI0A 1G91A 2F4IA 3HRSA 2JNGA 5I22A 4HIOA 3VJPA 1ONLA 4LN2A 3E19A 1PYSB 2V26A 4BD3A 3ERSX 3LGFA 3SWNC 4OWWB 1G83A 1AWOA 3OWEB 1MSGA 4GKJQ 3DB3A 1NR4A 1NEGA 4C5HA 1CSKA 2JA5B 1PFNA 3PE0A 5JJKA 1EOTA 2F0IA 4QKUA 5C0MA 2LQNA 1CSQA 2LRQA 2BZXA 1NCVA 3HG9A 4JBWA 3K7AH 5GANj 4CHTB 1AZQA 3M7NA 1DD2A 5FLMH 3CC7Q 1ZUYA 1AZGB 2VW9A 2A36A 3PUWA 2QASA 3JCMd 2K9GA 4FO2A 4YWMA 1KRTA 2XKOC 4BS9A 1SYBA 1SMYC 4C1NI 2ZTEA 4LDUA 3S1MH 1UGPB 2DRKA 1II3A 1PRMC 1WQ7A 2RF4A 3R2TA 3PSIA 4F7XA 1J8IA 5CKBA 3CCUT 4A3CG 3EFOA 2PNIA 5M3FH 2G9DA 4FYDA 2E65A 1I4PA 2B2VA 1K8OA 1M2VA 3SGIA 2QA4A 1CKOA 1R0BG 3PO2B 3G71Q 1D5MC 2K33A 3CP0A 5KYXA 5ELOA 4C0GA 5C3EB 3W2DA 4LF7Q 2QQAA 4UDUC 3QHSA 2KEDA 4C5GA 3DWQA 5J1ZA 2LZ6B 4IPHA 2IPOB 3T4AC 1NNXA 4OB2B 4A3MH 4FYYB 1W3SA 3J80c 1K73R 4CGYB 2IX1A 3OSOA 5I4DA 1VS0A 1VQ9A 3A8OB 2GGRA 4BBSH 4YCVA 4N0AA 3X20B 2C35B 2B8GA 1L1OA 4XTXA 1GUTA 1Y1WB 1QMCA 4ZKCB 1JQQA 3S14B 4I7ZC 5HURA 2J05A 1G3TA 2YLBA 1WI5A 5C4ZA 1XMOQ 1ZSZA 5GMKe 2L0CA 2UUAL 2WIIB 1NJIU 2X4YA 3WWVA 1MNDA 1Y96A 4H44C 1TWHB 3HRUA 3OYDA 1N27A 3DMUA 5IYBG 5FU7C 5C0XH 1BUVT 3QIIA 3VS1A 1D5XC 3CBOA 2H4OA 4OX9L 5J39A 4A3JG 3NGPA 1D3BA 4QT7A 3PCOB 4II1A 1K83H 1VQKT 1Z47A 5CV4A 2BDNA 5HY6A 1PFBA 4K8JA 3M0SA 4ALPA 3I56Q 3UDXA 1IKMA 1GBRA 2ECZA 5HGTA 1N33Q 2F52A 2K3XA 4DR5Q 3CCLQ 1Y0MA 3M59A 4IURA 3J7ZC 2M51A 3VS6A 1LT6D 2MF2A 1HR0W 1EOVA 4LF8Q 4PJLA 2CW0D 3S15H 4JI1Q 5C3WA 3KF8B 4ANJA 4EQNA 5GMKl 1YJNT 4DN4M 1CA6A 2X3WD 3R6OA 3UE0A 4IUPA 1S72Q 3PO2H 3EFOB 1PCXA 2ATCB 1Q82U 1CQVA 2F5KA 3V7CA 2J0TD 1H641 3VS4A 4MHEA 1Y8OB 1DOMA 4K0KL 1M2VB 3CQZB 2HZYA 3X28B 2AT1B 2YYZA 5FU6B 4C92B 2NTTA 4A3BB 4QW2A 5GMKh 1IGQA 3FLGA 2MFIA 2ZT9C 1WGSA 2YV5A 3IRBA 4GNXA 4MTNA 5L8RE 4IUTA 3TN2A 2RF0A 2VV5A 2KY9A 4KTAA 1FXXA 3S2HB 2X51A 2CKZB 2BE5C 5BN4A 3S14H 4LDVA 2PQWA 2ALYB 3H0GG 3EHQA 2KCTA 3MXNA 4DUYQ 1OI1A 4C0DC 4DA4A 1UG1A 3FDTA 4HJAA 3CD6Q 1L1OB 3GBQA 2JEAI 3H0HA 1UWVA 2L3RA 2CW0C 1WFWA 1JQYD 2KBNA 1AZEA 2RCNA 3RR5A 2MPXC 4E7SA 5LJ5g 2JA6B 3CCVT 1EY6A 3K0XA 4LE9A 2PQAA 4ZUJA 2PPBC 2KMTA 2LX7A 3I55Q 4BE2A 4J9HA 5LL6X 4IFDH 2EPDA 4A3LH 4DUZQ 1EEID 2C06A 1HNZQ 2X4WA 5CORA 3QZ5B 4FSSA 2J4XA 1N32Q 2GQIA 2LC4A 1R0CB 2BE7D 2DM1A 3ERQA 1YJWA 1K3BC 1H9RA 4HR7B 1VQ6T 2L12A 1SNQA 2LTOA 4M78D 4R55A 4BE1A 4DV0L 4J7FA 2DXTA 2L5QA 1A15A 3E0JA 5IODA 2F4VL 2JMCA 1IYJB 2EXDA 1RODA 2EYYA 4TVAB 1Q8IA 1D8LA 2WSCE 2DAQA 2M0OA 1I94Q 1DZ1A 3CCSQ 1WHJA 1T3SA 1RL2A 2QQSA 1SNCA 5TSSA 2WV6D 1EYAA 1WLPB 2XHCA 4ZYSA 5GAN7 3WVEB 2L3QA 5FKAC 1FYCA 2PMZE 4MTKA 3VR5A 4LUOA 3RD4A 2COWA 3TEEA 4X64L 4BUGA 2FPDA 3E9GA 2OQKA 3U4VA 2KHIA 2FYKA 2H1EA 1GKHA 1C0AA 2E75C 3GIBA 1ZLMA 4FYWB 4KGXB 3R3OA 3H8ZA 2QEJC 1M27C 1X9NA 4HEDA 1X54A 4HJ9A 3PF5A 4O2DA 1Q81C 1MMAA 2E3IA 1TUGB 4A3FH 5I9PA 2CZ7B 2QEXT 4IN3A 3RZOH 3SFMA 4GOPA 4LFCQ 2H8HA 4G57A 4BY1B 3DLLA 3EG9A 4WJWA 1NY4A 2QTVA 3PMTA 4C8QA 2BTTA 1OYXA 4DBRA 1AEYA 4K14A 4A3KB 4LWCA 2SRCA 5LJ3d 2ESWA 2KVQG 1K9MR 2A6EC 2K4KA 2DNEA 4HMJA 5EKLA 2HCIA 2O2LD 5JPNC 3M85A 1DONA 1G6PA 2LQKA 4LUZA 3EHRA 2JJ9A 4DV1L 1KLGD 4WRDA 5D3DA 2F3IA 2K01A 4J83A 1OXXK 1RTNA 4B08A 2EVRA 1VQ4Q 3A74A 3K5NA 3MHXA 2NVXB 3KXTA 1OEBA 3QWXX 2OCEA 2GTOA 2F2VA 1WDXA 5D3IB 4XTVA 2H3EB 4NXML 1TS9A 4EPCA 2B63G 1SFOB 4Y91A 4FT2A 1PVOA 5C0XI 1RUWA 5FLXE 3UATA 1G2SA 4FXDA 2R93G 3HRTA 4A76A 1WHMA 1YI2T 2PQAB 4K5WA 4BXXG 3TZDA 1JJGA 2OI3A 5ELDA 3FPPA 2BZ8A 1HFGA 3NPFA 1T0JA 4M78E 1BCPF 1FWZA 3V2TA 4QGUA 3T9NA 2CKKA 2K05A 1RCVD 1Q90A 5NUCA 3I4MG 1AOJA 1WTOA 4GLXA 3QPHA 2UUBL 4KUDK 4JI8L 4RTZA 2MQHA 3FVQA 4NXNL 1QWYA 2RDGA 1QKWA 3OSVA 3SB2A 2F0GA 3HOXB 3HP9A 2C0IA 1Q1BA 3C46A 1UHCA 1VA7A 1I0CA 5EJWA 5FO7B 1SYDA 3RR6A 2F2XA 4DU9A 1VOMA 3QOJA 2XDBA 4KKUA 3EGXA 1KQSA 2Y4YA 1AH9A 1A62A 8ATCB 1D6EC 1I50H 3EIVA 3TQYA 5A0DA 2CP2A 2GQVA 4NMZA 1IGUA 3W5OA 4M77A 5BR8L 3QR8A 2X9HA 3ZFJA 3HOZG 1M30A 2FVUA 1X3EA 2O5JC 4RKUE 4XQNA 1MUZA 1ZA1B 4GOPB 1K9AA 2JN4A 4X62L 4RTUA 3J81L 1LCKA 3EG9B 3H0IA 1EIGA 1IHVA 1RAGB 2HKNA 2XK0A 4CC7A 2I2LA 4MDXA 4NDXA 5CQXA 3VR6A 4DV6Q 3D6WA 2IY5B 4DV5Q 3PMIA 4RCBA 1V9PA 2M00A 3HS0C 1TY2A 4FP5D 2RH2A 3KK7A 2KSSA 3T13A 2MOXA 1RAFB 2EGAA 2R92G 3OYJA 1M8VA 2DJGC 3OMCA 4YWLA 4ZUIA 4EQOA 4HTHA 5GAN2 4UPAA 2L8DA 2KRSA 3AFPA 3O13A 3R93A 2HQLA 1G3SA 3I9QA 3QYHB 4EIKA 3CCEQ 1E22A 3D0FA 5ELBA 1HQRD 2A74C 2QF7A 4GN5A 5JPMC 1AN8A 3MA2B 5LMNW 3TSZA 4M75B 4NP5A 4ZTJA 4XTYA 3H9NA 4Q5WA 3HSBA 4XYQA 1LUZA 4DK0A 3GQBA 1Q81U 2PNRC 3I90A 3HOYG 5IP9G 2CYZB 4XU3A 4XU1A 3A7AB 3HOVB 1KLUD 3KLRA 1WZOA 2DL8A 3NXWA 5C4XB 5AT1B 4M4ZA 1ZUUA 2X4XA 2XMFA 3HKSA 3G6JB 3Q6SA 1GUGA 4DXGA 1VQ7Q 1WXBA 4OGQC 4N4HA 1CKMA 3P7JA 2D5DA 3HRZC 3MXPA 4RTVA 4C8QG 2JA7B 4JRIA 3S1NB 2CQAA 1BQQT 1S5FD 1S4ZA 2FMCA 3CMEA 1PWTA 3AU7A 3GPLA 1YITQ 1U5KA 4RGNA 2YSQA 5GANf 2IWHA 4DNTB 3OS2A 2EE1A 1TR5A 2DF6A 4XTCS 4H0LC 1YJ9A 3V7SA 4ZNXA 1EQVA 3EGXB 4KT0E 3NTHA 3SWNB 1QVFA 5AJ3Q 1ENFA 1VQAA 2PI2E 4F14A 3TP6A 4R4OA 1A0IA 2V4DA 4JI0Q 2I5MX 2B8FA 2XNAC 5D65A 1N34L 2KRMA 3J7AV 1K0XA 4OB1B 5KGUA 4C8QF 4JZ3A 1SYCA 1EZ6A 2A68D 5HGQA 2HAXA 3NQTA 4KMUC 2DVEA 5GQOA 5I2YA 2COZA 5IN1A 4LXCA 4UC4A 1N36L 1C8CA 1SBBB 5IE8A 1HR0L 3QDRB 4Y92A 1HA5A 2NUTB 4NL2A 3JC66 1X69A 4CI0C 1K8MA 2RJFA 4EDUA 3MWYW 2HMAA 2F0UA 3CU7A 1JMCA 1NLOC 3JAMc 1GD7A 2ID0A 3BYTB 3CC2T 4FDBA 4WORA 4BACA 4X66L 3EN2A 2ROLA 5KNCA 1FJGQ 2KCMA 4FVMA 3C0CA 3M55A 3C94A 1BIAA 4ULLA 2H5XA 1GUSA 4RGMA 2RBMA 1JJ2S 4OGEA 2DETA 2KE9A 5FLXc 3HOUG 4HCCA 2VS1A 1QVGA 1U4MA 2TMPA 2ZXRA 4DR3Q 1E3PA 3Q1JA 2DN8A 3MVVA 3HKZG 1BR9A 4FM4B 4M77G 3LWIA 3GP8A 3D31A 1JO8A 5GAMj 4BE0A 1EQTA 5M3MB 1KQSP 3DEOA 2ES2A 3GP7A 5T1IA 4QVZA 2AKKA 3GTGH 3K5LA 3S1NH 1WCMB 3CC7T 2KUMA 2DK3A 3W1BA 3OBWA 4EMGA 3CPWA 1KC8R 1FYNA 1JBMA 1STHA 4E7ZA 5FWBA 1VYVA 1ZEQX 2Z1CA 1SE3A 2A5HA 2TSSA 3C1EA 5COYA 1M1GA 3RN2A 4A3DB 1C0MA 1SRUA 3NELA 4WJ3M 2VGMA 1NLPC 2YRCA 2G9HD 2EW3A 5FU7B 2NUPA 1RAEB 3J81E 2P4TA 3EG3A 3QYGB 4MZTA 2IL8A 4OEMB 4BBRB 3MXUA 4L8JA 3H41A 3OS1A 3J80L 2NZ1D 4A75A 4OO1I 3BVGA 3UDCA 4PMWA 1Y07A 3G71T 1RACB 2GCXA 3FP9A 4HJ5A 1G2TA 3C95A 2HQXA 2W10A 1JJCB 1XJWB 2M02A 1TQOA 2DGYA 4DR4L 2VUMG 2DO3A 5IGGA 3K6OA 1I6HH 1WQWA 4ZGDB 1OPLA 1UTIA 3RKYA 3BDUA 4D8DA 2A1AA 2B2VC 2AZVA 4O1NA 2DL3A 3GTMH 3HGBA 4DV4L 1F9SA 4I65A 1M2OA 2DX1A 2R7ZH 2A0FB 3S1RB 1M4VA 4OGCA 5DM7R 1R9TB 5C44G 5KYLA 3R6NA 4FXGC 1JORA 1TWBA 1WHHA 1XOVA 4XTWA 4FCYA 4F88A 3H3VC 1YWPA 2MNAA 4BA2I 1VQCA 5JJLA 3V8LA 3K0YA 3VR4A 4M7DF 3AB9A 3TREA 3HEJA 1QJOA 4LF9Q 2G3RA 2DD4A 1KAAA 4MMKA 1Z7TA 3TVTA 2Q2IA 2L3PA 1IZ6A 2BE9B 4OL7A 4N0AC 5C6SA 3NEMA 1L1OC 4L63B 3LH0A 3ZJYC 4TSSA 4K5VA 4A93G 1YCYA 1SHGA 2F5TX 4M78A 5KE2A 5ELEA 1WD0A 1K28A 2J06A 4L5GA 3SHWA 2CH4A 2PVDB 3JRZA 3OY9A 2L55A 2LVMA 1FJGL 1ET6A 4P5NA 1ZSZC 3I56T 3NENA 4LJZC 1RJTA 1SSHA 3CCLT 1DXMA 3SVMA 1QVFP 4LF4L 1J9OA 4V2SA 2YRDA 3PO3G 3MEHA 3L42A 3VA7A 3VS7A 1SG5A 2W0ZA 4K8IA 1QZHA 1JB3A 2DTOA 2OAWA 2KA7A 3L2UA 4JI2Q 1WVLA 1U1SA 4C3HH 3ICEA 3OMGA 1XMQQ 2PMZB 4EMKA 1S72T 4K5XA 2NUPB 4JG2A 4LMQD 4PNYA 2UU9Q 3P8HA 2CH4W 5E1FA 4OWXB 1ABOA 2RSNA 1QVCA 2A37A 3KUFA 3BS1A 4D8KA 3KDFB 2AKWB 4GY5A 1M8AA 3S9WA 5IHNA 3SDZA 2JTFA 1MGSA 2HIVA 1EFID 1IB8A 3ZL7C 2DJZA 1D1KA 4WJ4A 2NVQH 1M3AA 4GLKA 2RHUA 3T53B 1BI1A 5JJZA 2DZCA 4A4FA 1B34B 4M7AG 4DV7Q 3ZYYX 2A28A 2OJ2A 4A3EB 2DY7A 3MEFA 5DLOA 4NL3A 1YWOA 3S1QH 3CD6T 4UHVA 3HP3A 1BU1A 3P8BB 1EY8A 3RZDB 5GAOr 3JCMV 1G51A 1PRTF 2K5VA 2L11A 2VASA 2RQUA 2EYMA 4F8MA 4RFBA 4Y7NB 4GNXC 3A1PA 3IKJA 3I55T 4AIMA 3CCVA 2QILA 3EA6A 2DL5A 3RESA 3CPWP 1KXLA 3G4SQ 4YHHQ 4C3JG 3S2DH 4NS5A 3TS0A 1CZGA 2ZPGB 1H95A 4M7AF 1H9JA 1I4GA 4IZ8A 1CTMA 1TIID 4LF5Q 2VB2X 4IFDI 1PG5B 4M78B 2GBQA 2XDPA 4BB7A 2D1XA 4AFQC 1YHAA 2R7FA 1TVXA 4KY7A 4RGOS 3J80E 1VQ6A 4AFUC 5D6WA 4LD6A 2HD3A 4LFAL 4KH0B 1X6BA 3CCST 2AWNA 3I4NB 4C8QD 1LM0A 1E24A 3OYFA 4QVDA 3OW2P 2B2TA 3E6ZX 4R4QA 2JA8B 2WSEE 2GVAA 2QXFA 4C3IB 2VKNA 1V8QA 1VQJA 5LMNL 1HZBA 2C0TA 5M5YH 3X24B 4OB3B 2OTJQ 5M5WH 1IL2A 5IY0A 3O8VA 4RA8A 4TQUS 2LDMA 4KD3A 2AKLA 4HJ7A 5GANh 2RI5A 1PH1A 2ASBA 2LJ0A 4DOVA 5IHIA 5I2SA 2WKDA 1TT2A 1ZYRD 1U06A 1MMNA 2QEXA 4C0ZA 3S3OA 1G6ZA 3PVQA 2M0YA 1CSPA 3HOWG 1MJCA 1D0YA 1IHWA 5IP7H 2CP5A 2A6HC 2YRVA 2KQWA 1AE3A 2XWJB 4LD9K 1YEZA 1VQ4T 4P73A 1S3OA 2RM4A 2EQUA 3P20A 4R9WA 1K0RA 5F2DA 4ZGJB 5I21A 4A63B 1AD5A 5FRNA 3I72A 4GOPC 4YCWA 2ZPBB 4XU0A 1C48A 1ZHIA 3F2UA 3B6YA 1MSHA 2UXDL 5G3LD 4U68A 3MFYA 4A3GB 1M1FA 2CP6A 2F2WA 3WVDB 1J3TA 1B44D 4M8AA 1GVPA 4QUCA 1ZXTA 4RUGA 4WTOB 1TG0A 4KKSA 1YI2A 4JUVA 2LJ1A 2RQXA 1GM5A 1JXOA 1G3WA 2OX7A 3A8LB 2EOTA 3BVZA 2RJCA 1D1BA 1ESRA 1I3QB 4AMCA 1SN8A 3MZ5A 1MNEA 1E6HA 3H6ZA 1ZYRC 1RDPD 2ED1A 4YTLA 2DD5A 5IHKA 4ZTFA 3KLWA 3J81i 3F2BA 2UXCQ 4M77D 4C8QE 2FINB 1KSWA 5KNBA 2A08A 2FRYA 1PKSA 4XQ3A 3MO8A 4JOIA 4DK6C 2RHSB 4IJLA 3C1FA 2RHQB 3NBHB 5BN3A 1BBUA 2AQ1B 4JCVE 2PQEA 4C3IH 2KNBB 3Q0AA 4RH6A 3PIOA 4XQQA 5KYUB 4A3IH 1ENCA 3I8ZA 1LJOA 4HA8A 2HEQA 1C7YA 3LWEA 3EG1A 4BA1I 2LSSA 4V0BA 2B2WA 1DCZA 1LTLA 2L0AA 1KQ1A 1WYDA 1IBML 3FEOA 5KCOA 1EY5A 5I9OA 1OV3A 1NEBA 2K79A 1I8FA 3INZA 2ZGWA 5IWAL 4H02A 5J3BA 1B7TA 1EY7A 1VUBA 2P0PA 1NUCA 2JEBI 1CI3M 3QO3A 1STEA 4FF4A 2E64A 1VF5C 3I5RA 1ILPA 4BY6C 4B3SQ 1EU4A 1HCZA 3ASKA 4HKEA 2OTLQ 4KHZA 2LY7A 3GTJB 2O9SA 3OYCA 1YN8A 3RLFA 2BZYA 2P84A 2EYJA 2VY3A 1PZKD 3VYGA 5IYCG 2NVYH 4M77C 4R4TA 1SJED 3OTOQ 2JP1A 2FL7A 3ND8A 5FLMG 1QUQB 1K73C 2DNUA 3CCET 4A3GH 1W4SA 2XVSA 1UEBA 3VS2A 1Q12A 3CW2C 1D5ZC 2R6GA 4FF1A 4PL6A 4DBFA 1JE4A 5JEAJ 2R5AA 3FJPA 1PZJD 5E7NA 4LUDA 2MCNA 1KNEA 4E47A 2XSCA 1TTHB 3KBXA 3D4WA 2EWNA 5CV7A 5M3FG 1YCSB 4Z89A 5IXBA 1VQ8A 2YU9H 1PMRA 5LJ5d 1PTOD 2SEMA 3MEAA 3D4RA 3HKZE 4A3JB 3GTLH 4M77E 1CKAA 1FR3A 4IQZA 4JBKA 2M9UA 1XXGA 3NP8A 5LJ3e 5AFWA 1XYIA 1G291 5JVH3 1BI3A 4JI4L 1VQ7T 1HXDA 2N88A 1VDZA 3K81C 1EQRA 1SKUB 2MO1A 2CZ6B 1VQDA 2Q2TA 1WTXA 1EFNA 2AHOB 1SAPA 4J8QA 4RHRA 2SOBA 3GTPB 4A3MG 1VQ5Q 3W1GA 1CQFA 4ODGA 3S17B 3GTQB 2F69A 3EG2A 1YITT 3HPWA 1TWGH 3CBPA 2LCSA 2Y0SG 2EAYA 1MD2D 4C5IA 4BBSG 2XDDA 3JCMQ 1B3AA 2MGSA 2LNHB 2F0SA 5DEHA 3QSUA 5EBDA 4L5RC 1SHFA 1BDOA 3I4OA 1B1ZA 4F04B 3HFOA 4C2MB 3TRZA 3M9QA 4Q0FA 4U673 1PH9A 2PU9B 4K2KA 5CBAE 3GDEA 3M0PA 1PH7A 2L3SA 1PRTD 1UAPA 3LNNA 1QWEA 1ESFA 3OWFA 3JAML 2K5HA 2K7AA 1YJWQ 1EZZB 1UDLA 3GV3A 2K57A 4HCBA 1B9NA 4ORZA 5C0XG 3Q24A 4KHPQ 1PTOC 2EQIA 2IG0A 2JA5H 2QQBA 1AWJA 4DOWA 1A3VA 1VMPA 4JYAQ 5LHY1 4JVZA 4M7AD 2WSFE 1EY4A 5FLXL 4ATOA 1XTCD 3H0GB 4H7BA 2CZ1B 1OOTA 4X3UA 3I73A 3RIRA 3S1RH 1HNWL 2PTKA 4N4IA 4X9CA 2OQ0A 1VQNQ 3VRYA 1IBKQ 3KUPA 4XAXB 2KXDA 1MIUA 3M57A 3CC2A 2YUQA 1E1OA 1HHVA 4J9IA 1UGRB 2BKDN 3OYKA 2RQVA 2X4JA 5A0LA 1FNUA 2XWBB 3FRPB 4OMOA 3MTSA 3J80i 1WPYA 2G5DA 1IKLA 5C5MA 5K36H 5K5PA 9ATCB 4DAVA 1ZSGA 2KBTA 2Q8RE 2ZJQA 1NYGA 1TWAB 1OX9A 4IPGA 3KFVA 5C3EH 4NOYA 2Z6KA 4PZ7A 1WJRA 3NHHA 3A98A 4X1VA 3RDVA 3EG0A 1UE9A 2KT8A 1HXYD 3IFDA 3GTOB 5KYXB 1U4PA 1U1TA 1GCPA 2LCCA 3DM1A 3QB3A 1OPKA 3G1JA 2BDOA 4J15A 3S3MA 3GF5A 2E8GA 3F70A 2YDLA 3OS0A 1YP5A 3OYAA 4OMFB 4HVUA 1XQHA 2K6AA 1VQLQ 1JCKB 3CXCA 3CC7A 4GKKL 2MO0A 1SRLA 1LACA 1KK7A 1PFSA 4CDEC 3U9SA 1PH8A 3NFCA 3NPPA 4EGVA 1Y1WH 4A4IA 4P2CB 1K73U 4QVCA 1VQMQ 5CKFA 3A5ZB 2E2HB 4EMHA 4JI7Q 3L2ZA 1K1ZA 2K2MA 2QTXA 2GVBA 3A56A 3A7LA 4RAUC 4CJ0B 1GJXA 1GL5A 2ZPHB 5KYYA 2L5TA 1PKTA 1TWHH 3BDOA 1B8AA 2NLUA 3UI2A 3J7AF 1CKNA 1PFMA 3G71A 2EQSA 3P1HA 4L59A 1QWFA 4DV2Q 3AMUA 4QCLA 1ZSZB 2P0KA 2EJGA 5GAN4 5LMUL 1Y96B 2M16A 2JK8A 1KIXA 4DV3Q 1JT8A 3CBMA 4R4CA 4A3IB 3PGGA 2A19A 3WOFA 2SEBD 4LF6L 4A3LG 1WTWA 3V7RA 2VQFQ 2R3ZA 2E2JB 2QGFB 2D6FA 4C0FA 2VQEQ 1D3BB 4YCUA 5GANg 2AIRB 2J6KA 3VS5A 3REBB 2JS2A 2BUDA 1VQPQ 4AQYQ 4DR2Q 3FMCA 3DB4A 2R61A 4D6WA 2CZ0B 3CCJQ 1E2VA 2PW5A 4XDXA 5LL6S 4A4HA 5GROA 3BFMA 1FGBD 1T9HA 4OMPA 2EDGA 3D8GA 1NPRA 7AT1B 1K9MC 5GMKm 1FL0A 3RN5A 2B63B 3MKDA 5E3FA 4B9WA 1S5ED 2VUBA 2F0OA 3SR1A 1UGSB 1SMXA 3KOJA 4I7AA 4LFAQ 4LFBL 2R93B 2R58A 2DEUA 1SNMA 4DNRB 2EY5A 4J9BA 1DOLA 1SF9A 4N4GA 1TKWB 1KAWA 4KRTA 3GTOH 1I5FA 3CQZH 5CVIA 5CKEA 4MN3A 2D0QB 3TBIB 4JV5Q 1Z6HA 2K2VA 5LJ3j 3EJIA 3I4MB 1L2FA 4A3FG 4A3BH 2EKHA 5C5LA 4V190 1SYEA 2DKGA 1UE1A 1PA6A 4B3ML 3PVLA 3I56A 4JS4A 4L6TB 5EPLA 3HFZB 3FB9A 3T1YQ 3S2HH 3A8MB 3CCLA 3Q23A 3I4LA 2NN6G 2OWOA 4GNXB 4DF7A 3KF6A 1WIEA 3JB9H 2E2HH 1N6AA 4M78C 3JAME 4YY3Q 1XNQL 3PNWC 3BYYB 2EGEA 2NUZA 1IBLL 2O5IC 1KQSS 4KGZB 1O7ZA 4CKBA 4IUUA 2UUCQ 3MXNB 2CGHA 2JA6H 1S72A 1M1KR 2FHDA 4CC4B 1JE5A 2E5LQ 2K5FA 4C92F 1QNUA 2K04A 3RUZA 1IREB 1A3UA 5KYWA 2DIQA 4P72A 3HOZB 1AE2A 3L2VA 4JI5Q 2HD0A 2HHHQ 3REAB 2KYMA 2E2DC 1JOOA 1JWUD 1XPOA 2PCFB 3M4OB 4PFOA 2VXFA 2PW7A 2E2JH 2HUGA 1WFQA 3CEYA 4EMKC 4JI3L 4GBQA 2DZ9A 5J26A 1SEBD 5GAN6 2RA4A 3TDQA 4ABNA 2MI6A 3NBIA 5KIXA 4DR1L 2IX0A 2DMOA 3OPOA 1VQHA 2YHTA 2QGGA 4NKLA 4PJOA 5FK9C 1RKNA 1HZAA 2Q2UA 5GAMe 2R92B 4JC0A 2RHZA 4A4KA 3SK4A 4KV6A 4JK1C 1XNRL 1H9SA 4DK1A 3FC3A 1BBXC 3CD6A 1C9OA 1PNJA 1S5BD 4PMBA 4KN4C 2KEAA 5C4JH 3CAMA 4DAYA 1YJ9Q 1U9RA 5I6WA 4X65Q 2QI2A 3T1HL 4RMOA 4G4KA 2DIGA 1UEAB 2K7VA 3OOCA 3I55A 3G4ST 1KFZA 2Z4IA 3HOYB 1EL0A 1B7YB 3CXCP 3D7SB 5JEAG 2DNCA 2ZM6L 1JU5C 1BVSA 1D1IA 2DXCA 2N55A 5DAUA 1S1NA 4BY1H 1Q95G 3I2ZA 1NG2A 4J6XA 2WB1G 1D2BA 4X3KA 2AHJB 5D7UA 4A3KH 2IHFA 2LJ3A 1SYFA 3QIAA 3E9HA 5CYUA 4XQJA 3TQ7P 5GAGC 1ZKOA 2I5LX 4C8QB 2LCLA 3M4GA 1C4QA 2FXQA 2NVXH 2F03A 1WTPA 2CWPA 1K9MU 2WAQG 2X6LA 2EBPA 3DHQA 3OSSC 3G6EA 2FPEA 2KR3A 1Y1VG 1JRIA 4E6RA 1YVCA 2EXZA 1UE5A 2QW7A 4ELYC 3CKIB 5C4HA 2OTJT 1SFOH 2PZWA 5CBEE 5IH2A 4E7KA 1B07A 4M7DA 2YUNA 3WOEA 4BY7G 4O5VA 2XIDA 4DR6Q 1WX6A 1UE6A 2D8HA 2DY8A 3SK5A 5IYDH 1E7ZA 5KYWB 4XXEA 2B2TC 1WJSA 1D0XA 3JCMP 4PLIA 3QWYA 5J22A 2R57A 4RG2A 2DVJA 3SE0A 1TWFB 2DJQA 1IHZA 2E6ZA 5DM63 5AYFA 2Q2HA 3SEBA 2RKSA 1AVZC 4CJ1B 4B6MA 1NE3A 4J9DA 1G5VA 4J9FA 1EEFD 4J9EA 1TXYA 3MFGA 4QF4A 2MMPA 3VA5A 3KJPA 3HOXH 2KDSA 1VQ4A 3EH1A 1X01A 2KEEA 2K5NA 4O42A 4PQXA 4MZ9A 2RB6A 3AQQA 2Z6BA 2E76C 3FRNA 3JCMf 4IUVA 1NYFA 2FZKB 1IW7D 3VYTA 1Q86R 1YNXA 3CHBD 3R2IA 3K8AA 4FIBA 1QCOA 3HHTB 3NTKA 5IP9H 2IJ0A 4MDWA 4BY6B 1YIJA 4DAMA 3MEVA 1X75C 2HCKA 3M0QA 1U5SA 1RHPA 2YLCA 2V1CC 1DOKA 3ULPA 1QVGS 1J5EL 3HOUB 4HCEA 2CP0A 4K2LA 4NW2A 1I4QA 5BN5A 4X3TA 2XRQD 4BI8B 4LUVA 5E4XA 1SEMA 3MHBA 4HXJA 3HKZB 1UGVA 2GF7A 4M77B 5JOBA 1GUOA 3VUZA 4DEXA 2R7DA 3N5BB 1UUEA 2DBKA 1X3GA 3A8HB 4L5SA 1HH2P 2ICIA 3U9OA 2UUAQ 2JTEA 3RKWA 3JB9I 2X35A 4GLMA 1V1OA 1LVKA 4UAIA 2V8KA 1GHJA 2Y0SE 1BOSA 1LOJA 2CCZA 1C6VX 3C4SA 1A0NB 4OX9Q 1F9QA 1EQQA 3N6RA 5M9OA 4FSXA 5GMKi 4PJOG 2EQJA 2QQ9A 1KC8C 2AUJD 2CHBD 1LYLA 3LX7A 4KLKA 1Q3LA 1SDFA 1HD3A 2ZTCA 4B3RL 4JOIC 2FMMA 2MP1A 4Z02A 3CCMQ 2F0WA 4FYXB 4OO1H 4R8NA 3E9FA 1LTTD 1Y8NB 3GO5A 2LT4A 2VUMB 4IIMA 3HOVH 4J6WA 3L7ZC 4EQ5A 4LAAA 2XI9A 1XNIA 5C4XH 5KYIA 2OTLT 3ZEHA 1ZA2B 4M7AA 2B2WC 1KDAA 2Z8LA 4IJHA 2E41A 4RCCA 3E5SA 5L37A 4JI6L 4IALA 3M58A 3CMAQ 1OXUA 1HJDA 1WNLA 3NWTA 4QMGA 3FJ5A 3VV0A 1Y57A 4X3SA 4PJOF 5C44B 4K0KQ 4WF2A 4LK1C 2JA7H 2B86A 2RHXA 2E2IB 2B2UA 3NSWA 4IFDG 3GOXA 4J5YA 2A68C 2F3VA 3E2UA 2ZPIB 4ZN1A 5CKDA 2D2CC 2KJXA 2UXBL 1OZ2A 2MWPA 4M75F 3KFUA 2XGTA 2QYZA 4RTTA 1NBWA 2KT1A 3TSSA 3M7GA 3CCEA 3CC4Q 1QCBD 2KOLA 4DBHA 1D1CA 2PVGB 3I5SA 2E10A 4IIOA 2LQ8A 3F2CA 3NTIA 1KJWA 1PTOB 1NZ9A 3EFSA 3CCUA 1SJHD 3FKIB 4A93B 4OELB 3M0TA 4B3TL 2E1HA 1ASYA 1B50A 3JAMi 4M7DG 3VS0A 3OW2A 1X43A 4C92D 1G3YA 1KHIA 5CR3A 3W3AA 1VQ7A 5EPJA 1U3OA 2NUCA 3PO3B 1P92A 1VQ5T 4RTXA 1X27A 5CR2A 2ICEC 1BCPD 1EYGA 5EQ0A 4ZLTF 1XWEA 4LF6Q 1YITA 2R7ZG 4VUBA 4LF7L 1ILQA 1X3QA 2RO0A 4L5QA 4ZAIA 1HYOA 2O4XA 2YUOA 2HIXA 4K11A 2OT2A 2M1HA 3E1SA 3M0RA 4FU6A 4DV0Q 4G7OC 2F4VQ 4PFZA 5CV8A 1X3FA 3L2WA 2Z0WA 1IXDA 3JSCA 3OYGA 4F16A 1YJWT 2AWOA 4J1MA 2DTHA 3FKIG 3CPFA 1B4OA 4X64Q 2LQWA 4ZCKA 4FW2A 1N8RR 4H13C 4HSPA 4PG3A 2E3HA 5M3MH 2FPFA 2X3XD 4M7AB 1CK1A 3OW7A 2ROTA 3M0UA 4JLIA 1GOZA 2QGQA 1F2YA 1MBYA 1A8VA 1WCMH 1VQKA 3O5ZA 3FHWA 1XMOL 2E2IH 2LXKA 4RCOA 3L2RA 2EFIA 1VQNT 2A69D 2RDFA 3NQIA 4KHVA 4A3DH 1KG1A 2E4HA 1LLRD 2B3GA 4QB4A 1VQOQ 4KBMB 4RHSA 2MUYA 3MCAB 4DNIA 3CCQQ 1BCPC 3OYNA 1KC8U 3G7ZA 4BBRH 2BOSA 3TZUA 4PNOA 4C3HG 1YHQQ 4LDXA 1QOHA 1VQGA 4FF2A 1F1BB 1YJNA 4C3JB 3GTKB 4DV1Q 4CJ2C 1N33L 4F7UG 1FX7A 3NHNA 1SSOA 1YZ6A 2KCNA 5ELNA 4AH6A 2ZJRA 4DR5L 1XJVA 4OMMA 5C0XJ 2K5IA 1LO5D 2DFUA 4NXMQ 4J6YA 4LF8L 4XU2A 2MIOA 4JI1L 2K3YA 5KCHA 4BI4A 1N9RA 4AYBG 1AWXA 2F0VA 1HUMA 2K5WA 5E4WC 1VQLT 3J81j 3OYYA 1BI2A 4YIJA 1STGA 5LJ3f 5FWCA 1BCMA 2JQOA 2M9VA 3VYRA 2CSIA 1R9TH 4HVVA 3JCMe 2Z6KC 3M3YB 1MJEA 1VQIA 3P8DA 1VQMT 3GLXA 3CCRQ 5GAOq 1EIFA 4JLGA 1JWMD 3DXJC 2ZJPA 3N52A 4F7UF 5L23A 4J7IA 4MMLA 5CAIA 2DERA 4JJNK 2L15A 2NYZD 3K57A 3BJUA 4JI8Q 2UUBQ 5T1GA 4WCIA 5LJ5e 5IGFA 4NXNQ 2FHTA 4L5TA 1Y8PB 3VDYA 1QNKA 5KE3A 2RSOA 3UT1A 4MZMA 1SROA 2V8JA 4HJ8A 4UP7A 3HOWB 4KY6A 4AG1C 4DUYL 2FRWA 2MJ8A 2GTJA 1SE8A 3DEPA 5I6YA 2NYSA 3ULJA 1ZBJA 2MYSA 4ZRZA 4PFPA 4JRQA 2EYZA 2JXMB 1VQPT 1ZX6A 4R56A 3CCJT 5BR8Q 2F0MA 3NUCA 3I91A 4RKLA 3RLOA 4HT8A 2EJGC 2DA9A 1PDQA 2HDAA 2MAMA 1IRXA 2ENBA 1YBYA 5IGEA 3VR2A 5I2MA 1HNZL 1N32L 2FZCB 2ZCFB 3PUVA 4XT1B 4OMQA 4X62Q 3QJ6A 4PLLA 4KULA 3G7LA 4O0AA 2RI2A 1NE8A 1KABA 3CRKC 2DILA 3HTRA 1M90R 1SYGA 3TP7A 4CBVA 4JJDA 2K75A 1VQBA 1A2UA 4FYVB 4HCZA 1HTPA 2K50A 3JCMh 4EMKB 1OTCA 5HK0A 4KUIA 4X9DA 3U4ZA 4ZKBB 1ZUKA 2WB1E 4ME3A 4CDCC 5IGCA 1I94L 5JAVA 3MEWA 4OP0A 5ECAA 4XYOA 1FMWA 1TWCB 5JJIA 2K5QA 1BB9A 2JMAA 3AFQA 1K76A 3A54A 5M5XB 3M54A 1S5DD 5IP7G 4ELZC 5GAOl 2K5DA 4A3EH 1JJ2P 2VZAA 1TXQA 2NB0A 2F3WA 4PV1C 4DK3C 2JTMA 1RTOA 1RLPC 3VYHB 3PIPA 3JV3A 3RBBB 1S40A 2EYOA 5DM73 3V8KA 3RZDH 4LFCL 2JJQA 1PM3A 3NMZC 4PJOD 3STBD 5A35A 1AZPA 3URGA 4C8QC 1EY9A 4Y7NH 2B8AA 5CMDA 1GUNA 4PJJA 4IPDA 2EYQA 1JB0E 4M75D 5CQYA 4PMCA 2QG9B 1JWSD 3GD7A 2QA4Q 2PUOB 3R8BA 2BA0A 1O9SA 2RHIA 1WA7A 2FEIA 1WD1A 4XK8E 4KH1B 2PZ1A 5JVG3 4B9XA 1UJ0A 1R77A 2I07B 1NBEB 1D09B 2XRSD 4OWTB 2EVBA 3PV0A 3CQTA 4XT3B 4OXPA 3PGZA 3I4NH 3K7AB 3UPUA 1BK2A 3GNGA 1VQ9Q 3A8IE 5CV9A 1N34Q 1PD1A 4RMFA 2JA8H 1M5Q1 5HK3A 1I4XA 1STAA 2HQEA 2L89A 1IXRA 1N9WA 3QBYA 1YJ9T 2AMCB 1KTKA 3S1MB 1B70B 4E2FB 4A3IG 5D6YA 1Y7XA 2N8NA 1HK9A 2EYPA 5M3FB 1W6KA 1N9SA 5FJ8H 3L2QA 1ML0D 1W2BA 3BZDB 1N36Q 2A8VA 2NZHA 1HR0Q 3G4SA 5KH6A 2AQ3B 1NAPA 1I4K1 1NPPA 2NZOA 5D14A 3I7FA 2EYFA 4CKEA 4DXFA 4B3TQ 3AHUA 3FPUB 4M7DD 3VU3C 1OULA 1MI2A 4X66Q 4DAPA 3TS2A 1OU9A 1EWCA 2O01E 3S16B 2NWGA 3VKIA 4AFZC 3KJOA 1LABA 1QCFA 2BIVA 1OQKA 4EQPA 3EGUA 4A3MB 2IIMA 3PMFA 2CP7A 1U4LA 5IT9c 2NWMA 1TU2B 3IAYA 3MEUA 4PJOE 3TU4K 5CCAA 4MIUA 1SRMA 2Y0SB 4BBSB 2GA4B 1QILA 3A55A 1NJIR 1R4PB 1M8MA 1QLYA 5CV5A 1SXTA 4HIDA 4QQBX 3EGDA 3OS5A 3NE5B 4C56C 4EVOA 1ASZA 2OTJA 1HZCA 5CGKA 2LKVA 4DV6L 4G7ZC 5LJ5j 2CP3A 2LMCB 3H09A 4DV5L 4IO9A 1EYDA 2FO0A 3THKA 1T5EA 4CKCA 3URYA 1F2MA 3HZXA 2VL6A 3DKMA 3GV6A 3A5UA 1UHFA 2QCPX 1I3QH 2EJ9A 1PLFA 2SNSA 2OXPA 5IYCH 4DA2A 4Q5VA 1HRJA 2HCCA 2RMOA 1K83B 1HNXL 4M7DC 1EYCA 4M1UB 4IOAA 2YTYA 2C0OA 4QQDA 4R8IA 3RLNA 1E1TA 3ULRB 3EAEA 2HDLA 3KF8A 2PO4A 3S24A 4DR4Q 5GANd 3E3XA 3PUZA 1Q82R 2KVMA 1D1AA 4A3CH 2NBFA 4PZ6A 5GAMf 2A7YA 3S15B 3VUBA 4N9TA 2B29A 3JCMJ 8AT1B 4QL5A 1X65A 1I4HA 2EY1A 1A2TA 4DV4Q 5I11A 5M3MG 4M7DE 5D6XA 4RWSC 4C92A 2P0QA 1GRIA 2DYIA 1CM9A 3I70A 2CFMA 2CSQA 1I07A 1PRLC 3S16H 3FIFA 2ZPFB 2F1MA 1HJPA 3GTJH 3OYBA 4QIWE 1ICWA 3K7UC 1F77A 4KGVB 1STNA 3CXCS 3M4PA 1FGUA 4MNOA 4DR7Q 1CHPD 2JA5G 2RDHA 1E6GA 5AJ3L 1MV0B 3M56A 1QG7A 4ZN3A 2LMJA 5CC4A 3SK6A 3CRLC 4JI0L 4A4EA 3HFNA 4OIKA 3RMSA 3EBEA 4JRKA 1WHKA 2CUBA 5LJ3h 2E74C 2YWWA 3SXHA 4J8OA 1HTLD 2G6FX 4DBQA 2VGNA 3V05A 5IGDA 3EVQA 5IYBH 3EGDB 3JCMc 3CCMT 5M5WB 3S6WA 3AEVA 2GFUA 1ET9A 4LF4Q 3TCJA 2KYBA 1MKHA 4APVA 1KHCA 5KEEA 4YWKA 4OMNA 3QJYA 1YFNA 2XG8D 4C5EA 3JCMX 5GAN3 4A3JH 3C3LA 1EU3A 5K36G 5IGBA 1AWWA 1HPCA 1BO0A 4LDYA 2B2YA 3PO2G 1I5LA 5C3EG 3A8KE 2HNIA 2OTLA 3CMAT 1K8AC 3L9AX 5EKIA 4DGZA 2BE5D 1PRTC 2LFNA 4IUQA 4K6DA 3SHLA 2AUKA 4UP9A 1WTQA 3DWAA 2ZXOA 4HCSA 3BDLA 2PVOB 1W2BP 2F0KA 3GTPH 1RI9A 3S17H 3KLSX 3GTQH 4LUEA 1L0XB 2DRMA 2HSEB 2Y4XA 4JW0A 1ACMB 4JS5A 1DJRD 4KK7A 3CC4T 4M7AC 1HQMC 3H91A 3L0OA 4DR3L 5GJWB 1NM7A 1Y1WG 4C2MH 4GN4B 4F7UE 4QQ6A 5GJVB 4HT9A 4IOCA 4RTWA 5H1SE 4DR7L 3IL8A 2KRNA 5CO7A 3TP8A 2E5QA 2F0FA 4JZ4A 2B2UC 4RTYA 1E2WA 4TRDA 1X6OA 4AYBE 2Q8IB 3C2PA 1K8AR 4A3FB 3RZOB 5EPKA 1MHNA 1FVIA 1UB4A 2WINB 2K14A 3BZKA 5IAYA 1QW1A 2YTVA 1QCNA 4M7AE 1RD9D 1BYMA 3E9IA 3JCMg 1X32A 1GCQA 1OU8A 1PC0A 3H0GH 1BCPB 2JUFA 2RJDA 4IFDJ 4XTUA 1VQ5A 1Z9ZA 1L0WA 2RQWA 2QAZA 4Z88A 1EZ8A 2EZVA 2Y90A 2I0QA 1PH3A 2OF1A 2ED0A 1ARKA 1MMGA 2L9HA 1KDCA 4PJNA 5GAN5 1NSNS 3H15A 2MK5A 2K5LA 1BXTA 1SNPA 1VCIA 2EPBA 2DL4A 1W6JA 1WTHA 1TWAH 1LTID 1RADB 1LTAD 2RPNA 5GAOp 1JOKA 1M1KC 2A6ED 2E5KA 4NB3A 4OONA 4CC2A 4PKCC 3LX0A 5LMNQ 3KLSA 2QKIC 2RI3A 1Z9QA 2CUDA 5GAHC 3BG3A 4C92G 3LWHA 1DGSA 5FROA 3H3VH 1PHTA 3JCMW 3SK8A 2LX9A 4LF9L 4A3BG 1K3RA 3GNFB 1OX8A 2CWAA 5KNDA 3VYSA 1VQOT 2YTXA 3P75A 4FT4A 1VQNA 3OHXC 3G6EQ 3ITPA 3KYHC 3CCQT 3OYEA 2HBPA 2A73B 5EGTA 2AK5A 3JB9G 2F0QA 4HIMA 2ZPEB 1YHQT 1I4RA 3RMHA 4JBJA 2RVLA 3OIQA 3AT1B 3IFTA 4FW1A 3OYHA 2F0PA 2F0JA 2JA6G 1I50B 4OF1A 1B9MA 1F2LA 4BWGB 1JICA 1NMGA 3F1ZA 2NVTB 1TSFA 5KYYB 2D62A 1CA5A 1AP0A 2WB1B 4GS3A 1CKNB 2UXDQ 4JI2L 1OZ3A 2RHYA 1LTBD 3V8JA 1K8AU 1XMQL 2NN6H 4E7HA 1SNDA 4PJMA 3F2DA 2D8JA 3UWNA 2ZXPA 2UU9L 4X6AH 3QUIA 1QKXA 3TP5A 3K5MA 1VQLA 3I35A 3OA6A 3JB9F 2AQ2B 1WTVA 1KRSA 2VYTA 2WAQB 2Z0SA 1H3HA 3A8JE 3BY7A 3CCRT 3K80C 4HAEA 1T3LA 1Y1VB 5C6AA 2B63H 3OBYA 3CMEQ 1BIBA 1UECA 4KJOA 1VQMA 4JJCA 1WTRA 4HIKA 1LNXA 1B3QA 4M75A 1KIKA 3U58A 1BF4A 1Q81R 3FEWX 1WYXA 3DLMA 5GMKj 2QK0A 2RQRA 4ME7A 1XTDA 1YIJQ 1SE4A 2HT1A 2R93H 4BXXH 1EIHA 3ND9A 1GO3E 1WXTA 4J9GA 3UE1A 4DV7L 2KENA 3J7YW 2N78A 3VYUA 2LT1A 1BKBA 4PK4A 1ABQA 3OYMA 2EJFA 4N8FA 1V1PA 2KECA 3BE3A 3I4MH 3LWUA 2O9VA 3DM3A 1RAHB 5C3XA 2I0NA 1Q7YC 4BY1G 1VMCA 1BCOA 2VB3X 2ZZDA 3Q8DA 1IBMQ 1GFCA 1AHJB 4A54A 4A3KG 5IWAQ 1P8LA 1X56A 1VQPA 1W1FA 5HKCA 2BH8A 2N3SA 1G8XA 2JM9A 1NR2A 2WFWA 3NK9A 3EH2A 3CCJA 2D0OA 1IO6A 1W70A 4P74A 1HA6A 4YHHL 3QXEB 3CCSA 1QE6A 2H3JA 5A2QL 4LF5L 5JEAH 3KF6B 3SWNA 1DYQA 3BDCA 2L4NA 1E2ZA 3QOLA 2J6FA 2QDLA 1D7QA 2JA9A 2KI7A 2NVTH 1QVFS 3X26B 3LLRA 3HOZH 2EYXA 5GAMh 2M2LA 2Q8TA 3UDIA 1Q86C 2V1QA 1EX4A 3M4OH 4OIJA 2KROA 1Q7YR 1M1KU 3M9BA 5IYDG 1H8KA 2E6NA 1ICFB 2LXJA 4WFN3 3LH5A 5EAYA 2IX3A 1SPKA 5IXFA 1QB5D 1A3TA 4S3SA 2FG0A 2VXEA 2NUTA 2QDYB 2ATWA 2K52A 2R92H 1RAIB 1Y1VH 5DLQE 1WJQA 3WXMB 3K58A 4HCKA 2FB7A 2HL5C 2F0EA 4QY7A 2L1BA 1HUNA 4PJOB 5FO9B 1WHLA 3HOXG 4BY7H 2DUDA 1HNXQ 2JZ2A 3VR3A 4JI4Q 4HSVA 1H9SB 1CFMA 1QQJA 3LGLA 2KGTA 4A4GA 2HQHA 3CCUQ 1VQ8T 2K28A 4P71A 1M3BA 4KKTA 4HVWA 1DM0B 3X3NA 1YNJD 4DAYB 2QA4T 3HOYH 4IKFA 4TVRA 1UNSA 4CRIA 2EY2A 2RD1A 1PSEA 2F0DA 1Y71A 1PV4A 1PHJA 5LJ3g 5LJ5f 1TS3A 3H3VI 2HKQB 1V1PB 2J7ZA 1F2ZA 1OXTA 2DJFC 5FW9A 2DBMA 1CZWA 1O80A 3D4DA 3GTGB 1NTGA 1XX8A 1VQ9T 1RAAB 3CPWS 3ONAB 2VNUD 1EWHA 2ZAEA 1N5ZA 2DYBA 4A53A 1PYWD 5EG2A 1BBZA 3X25B 1Y14B 3CF5A 4OMLA 3ULLA 4DKAC 1D0ZA 1HZ9A 2KK4A 1EUJA 1GXDC 1HFNA 1M4ZA 5C4JB 2UXCL 1A6XA 4F7UA 5IT9L 3ER0A 4GLAC 1XPUA 1V76A 2JYOA 1CKBA 4OHJA 5GADC 1NMFA 2V8IA 3OYLA 1IW7C 1LT3D 1WJJA 4KN7C 1HNWQ 3M4YA 4M75G 3M53A 3OW2S 4M7DB 4KD4A 1YNJC 4BI3A 1VF7A 4OO1G 4DPGA 1YNZA 2NN6I 3U50C 1WXUA 1TWFH 4J6HA 4P75A 1XPRA 1I6HB 2HSPA 2VVKA 5CIUA 1I6VC 3DUZA 3RKXA 3HOVG 1SSFA 1Q7YU 2Z4HA 5C4XG 4PZ8A 5CV6A 3OYIA 1VQKQ 4ZK9B 4QIWB 2RQTA 4EX5A 3GTMB 1I5OB 1GXIE 4LW1A 3L3OC 3RNUA 2R7ZB 5I2XA 1I1JA 2BCOA 1RABB 4E7IA 4QJFA 1OO9B 3RERA 2MWOA 1SNOA 2JA7G 5FRMA 2JM8A 4B3SL 2CQOA 3UDFA 4RG8A 4POFA 2Z9HA 2RJEA 1MGQA 2CDTA 1YJNQ 1OXSC 4CDFC 4QUFA 4DR6L 4UP8A 5EBCA 5CK9A 4ZQ3A 2IVWA 3HOUH 4GKJL 2FJ2A 3BVMA 1IL8A 4JJBA 4GKKQ 2GN5A 1PH4A 3OTOL 1Q86U 1FNWA 2KHJA 2N49A 2EIFA 3V96A 2DXBA 3KBGA 3MXGA 1TS5A 5KRUA 1X2KA 2XU8A 1KQ2A 1H9MA 1STBA 2WP8J 1GUWA 5A2QE 1KD1C 5A0GA 5HCKA 1CT1D 2K3BA 1Q1EA 2ZTDA 2P5ZX 1O7LA 3D6CA 5G3LF 3LYIA 3L1AA 2K4YA 2R5MA 5GAMd 3RMQA 1N8RC 2K32A 2KHSA 2RK1A 3TEHB 5LMUQ 1STYA 2OEOA 2EKOA 4ME5A 1P16A 5ELCA 1MHWC 3A8GB 3WDNA 1RLQC 2QQRA 2RA2A 4LNPA 3UF4A 4C3HB 3JB9D 3M5AA 2C9OA 3EQLC 3G48A 2D9TA 4Z9CB 3SD4A 1VQEA 3KDFA 1KNAA 4IUNA 2A3LA 4F7UB 4G7HC 4M77F 3PT9A 1JC7A 1WHGA 2I46A 3CCVQ 2VUMH 2F0HA 1PRTB 4OVAA 1Q46A 2IW3A 2JSOA 1MV3A 4TKOB 3MP8A 4HMIA 4ILWA 2RCFA 3PTAA 1KD1R 2FZGB 1JJ2A 1WOCA 2JS0A 1PZID 1UE7A 4AYBB 4GLVB 1O7YA 1B34A 1AW7A 2XIWA 2NVQB 2C5CA 4R4IA 1RI0A 1KL9A 4LFBQ 3DWPA 1ZBXA 1EWIA 4JPBW 4DEYA 3PQIA 1VYTA 1VQ6Q 3U23A 5ELFA 1A63A 5C44H 3QWNA 1VIFA 4C1NK 1VIEA 1X2QA 4RGTA 5FU6C 2LS01 4C92C 3BU2A 1UUPA 2JT4A 4RKBA 4BY7B 1WCMG 1T0HA 3MAQA 4BDYA 3QZ9B 1UFFA 1AEXA 2HBWA 1CHQD 1T5XD 2BA1A 4ID6A 4Y52H 3S1QB 4KHPL 1TUCA 3RNJA 1U8RA 4A3DG 2DPPB 2PYKA 4GZYC 2RN8A 3H0FA 1TU0B 4BDZA 1VYUA 1JR0D 5DNFA 2OAUA 4B3MQ 1F9PA 1H9KA 4MZPA 3ZBDA 1RIPA 2JE6I 3AYHB 2SNMA 2XICA 1PTOH 3CCMA 3FKIH 4BBRG 4JYAL 4A93H 3RUXA 2D0PA 3K5OA 4L6V5 2PZUA 3S2DB 4XTZA 1XNQQ 4C92E 1LT5D 1IBKL 4XIGS 2CT3A 2DLPA 2QEXQ 1IBLQ 2ABLA 5EKKA 2XN9C 1BBWA 5GAOn 1FMVA 3QKJA 2F1LA 4C0DB 1PH5A 3CMAA 2VWFA 2O2OA 5IT9E 2X6GA 3PO3H 2LP5A 2MPMA 2GNCA 1OXVA 2CVRA 3NWSA 2RNAA 4FXKC 4K6LA 2IPKD 4NPSA 3H6MA 4R1JA 2B2YC 2GFAA 1SR3A 3C12A 1H3ZA 1S5CD 1PTOF 1TY0A 1U4RA 4JI3Q 2KAFA 1LTRD 3CC4A 2X69A 1LPLA 2F0LA 2QDBA 2A69C 1UJYA 4DR1Q 1G2BA 4AFSC 1KDBA 5GAEC 3F8TA 4UY8C 1L0YB 5M5YB 2XTIA 3PIP3 1E7OA 2O4XB 1EY0A 2MHVA 1O7IA 1VQFA 1Z9FA 1XNRQ 1K0SA 1YI2Q 1M90C 1YHBA 2YUPA 2KXCA 2IT1A 2EJMA 1V29B 2D0NA 3OB9A 1LTGD 2COYA 2DEQA 3OQ5A 1V43A 1EFWA 1QVPA 4LNQA 1V1QA 1KD1U 1TOVA 2J6OA 5KYNA 2F0NA 4JI7L 2O88A 3T1HQ 3EROA 1BNZA 5GAMg 2CS7A 2F0TA 4Z8AA 1YNND 1Q8KA 5GANe 4AT1B 3A0JA 2WACA 1QVGP 2B39A 2ZM6Q 1N8RU 2K6DA 1TS4A 4F87A 4DV2L 2IHEA 2L2PA 3FDRA 1EIYB 1H92A 4DFAA 4DV3L 1M3CA 3BZCA 4DUZL 4JV5L 4N9PA 2DE0X 1X6GA 5CKHA 1QP3A 1GCQC 2LNVA 2VQFL 2O31A 4GN3B 4C3JH 1FD7D 2VQEL 3GTKH 1O78A 6AT1B 2FFKB 2EYWA 4FF3A 3PIO3 4ZGEB 4KJNA 4AQYL 4DR2L 3L2PA 2WKCA 2A6HD 1IYUA 1GBQA 3HL8A 4JRPA 4RG1A 2EGCA 3T16A 1HSQA 1PSFA 4RCNA 1W6XA 4E7LA 2D9UA 3UDGA 1JXMA 3NBHA 4E7JA 3EFRA 4O6JA 2DTIA 1U0LA 2K03A 4LDWA 2PNHA 3MPUB 2VB6A 5KYUA 4DQ2A 5LJ5h 2VC8A 3VRZA 1E0BA 3LGJA 3G6ET 3I3CA 5ISRA 2WAQE 2CT4A 3M3YH 1YNNC 2JOYA 1VQOA 4IPCA 4A3EG 1K4US 1FNVA 2EYHA 4R0KA 3PUXA 1PXUA 3PFSA 3CCQA 1X55A 3EFXD 2XD0A 5IOCA 3S3NA 1SLJA 1AFPA 3H94A 1M9SA 2J7IA 3OIPA 2SDFA 1W2BS 4Y28E 1YHQA 1CUKA 3D3RA 4JDSA 3J81c 2HDMA 3LW5E 5EC7A 2HL3A 3UA7A 3MC0B 1RF2D 2PI2A 4N8X1 3TSWA 1GHKA 3T1YL 1B53A 1WI7A 1V1CA 4ESRA 2E12A 1VQ8Q 2VXWA 1B2TA 3HOWH 1BI0A 1O75A 3PF4A 2DXUA 2JN0A 5DY9A 1X3PA 4YY3L 2P4RA 4AG2C 1J6QA 1LTSD 3K59A 1AT1B 3SEMA 2UUCL 2I5HA 1DJ7B 4M78G 3TMEA 2AZSA 2PUKB 3MJXA 3ME9A 2E5LL 5FO8B 1GFDA 3QO2A 1J5EQ 4F17A 1F9RA 1FMKA 1QUQA 2NVYB 4CDDC 4JI5L 2NTSA 3CMET 2HHHL 4POGA 2JVVA 3CCRA 3I4NG 3JB9J 3QG1A 1JB7A 1YIJT 1ZQ1A 2JA8G 2JXBA 2KCCA 4C3IG 1QZGA 4JBMA 1PD0A 1LT4D 2EQMA 3PUYA 5FOBB 1JOQA 4FL6A 1C1AA 1NJIC 3BW1A 3X3MA 3UA6A 1QP2A 5GAN8 4J9CA 4PJOC 1MMDA 3MP6A 3IQLA 3STBC 4KY5A 5FJ8G 2JW4A 2E70A 3JCMb 1M90U 4M78F 2PZTA 2YU9B 3GTLB 1PH6A 1PYBA 3QDFA 3META 4QQGA 1TH7A 4M75C 3VS3A 3J7A5 1TWCH 1Y69U 1PH2A 1G8ZD 2EY6A 3T56B 2RK2A 1I81A 4X65L 4FNFA 4E6IA 5M5XH 1K8GA 2BH2A 4B3RQ 5GAOm 2V1RA 2EQKA 1TS2A 1SMYD 2ENMA 1R4QB 1JEGA 4HN7A 2EYLA 4X34A 1UGQB 2K1BA 2YT6A 3T51B 2EJFC 5IIFA 3MP1A 1TWGB 3M4QA 4JI6Q 4OB0B 1R8OB 3CC2Q 4M75E 1LV9A 2KQ3A
chains in the Genus database with same CATH topology
1Q82C 4A3GG 3E0EA 2UXBQ 4KI0A 3HRSA 2JNGA 4HIOA 3VJPA 3E19A 1PYSB 4BD3A 3ERSX 3LGFA 3SWNC 4OWWB 4GKJQ 3DB3A 4C5HA 5JJKA 5C0MA 1CSQA 4JBWA 2LRQA 4DR6L 3K7AH 5GANj 3M7NA 5FLMH 2VW9A 3PUWA 1KRTA 3JCMd 4YWMA 3U58A 2XKOC 2ZTEA 4LDUA 3S1MH 1UGPB 1WQ7A 2RF4A 3PSIA 5CKBA 3CCUT 4A3CG 5M3FH 2E65A 3SGIA 2QA4A 1CKOA 3CP0A 5ELOA 4C0GA 4LF7Q 2QQAA 3QHSA 4C5GA 4IPHA 4OB2B 4A3MH 3J80c 1W3SA 2IX1A 1VS0A 1VQ9A 3A8OB 4BBSH 4YCVA 4N0AA 3X20B 2C35B 1L1OA 4XTXA 1G3TA 2YLBA 1WI5A 1XMOQ 5GMKe 2UUAL 3WWVA 1NJIU 2X4YA 1Y96A 3HRUA 3OYDA 1N27A 5IYBG 5FU7C 3QIIA 3CBOA 4OX9L 5J39A 4A3JG 1D3BA 3PCOB 4II1A 1K83H 1VQKT 1Z47A 5HY6A 4ALPA 3UDXA 1N33Q 2F52A 2K3XA 4DR5Q 3M59A 4IURA 3J7ZC 2MF2A 1HR0W 1EOVA 4LF8Q 3S15H 4JI1Q 3KF8B 5GMKl 1YJNT 3R6OA 3UE0A 4IUPA 3PO2H 1Q82U 2F5KA 3V7CA 1H641 4K0KL 3X28B 2YYZA 5FU6B 4C92B 4QW2A 5GMKh 3FLGA 2MFIA 1WGSA 2YV5A 3IRBA 4GNXA 4MTNA 5L8RE 4IUTA 2VV5A 2KY9A 1FXXA 2CKZB 3S14H 4LDVA 2PQWA 2ALYB 3H0GG 2KCTA 4DUYQ 1OI1A 4C0DC 4DA4A 4HJAA 1L1OB 2JEAI 1UWVA 2L3RA 5M5WH 2KBNA 2RCNA 3RR5A 5LJ5g 3CCVT 3K0XA 2PQAA 2KMTA 4BE2A 4A3LH 4DUZQ 1HNZQ 2C06A 1N32Q 2X4WA 3QZ5B 2LC4A 1YJWA 1VQ6T 2LTOA 4M78D 4R55A 4BE1A 4DV0L 4J7FA 2DXTA 2L5QA 2F4VL 1IYJB 2EXDA 4TVAB 1D8LA 2WSCE 2DAQA 2M0OA 1I94Q 2QQSA 1RL2A 1A63A 2XHCA 5GAN7 3WVEB 2PMZE 4LUOA 4X64L 3TEEA 4BUGA 3U4VA 3E9GA 2OQKA 2KHIA 2FYKA 1C0AA 1GKHA 3GIBA 3H8ZA 1X9NA 1X54A 4HJ9A 3PF5A 4O2DA 1Q81C 4A3FH 2CZ7B 2QEXT 3RZOH 3SFMA 4GOPA 4LFCQ 3DLLA 1NY4A 3PMTA 4C8QA 1OYXA 4LWCA 5LJ3d 2K4KA 2KVQG 3M85A 1G6PA 2LQKA 4LUZA 4DV1L 2F3IA 4J83A 1OXXK 3A74A 3MHXA 3KXTA 2OCEA 4XTVA 4NXML 4EPCA 2B63G 4Y91A 4FT2A 1PVOA 5C0XI 5FLXE 2R93G 3HRTA 4A76A 1YI2T 2PQAB 4BXXG 1JJGA 4M78E 1FWZA 4QGUA 3T9NA 2CKKA 3I4MG 4GLXA 3QPHA 2UUBL 4KUDK 4JI8L 2MQHA 4NXNL 3OSVA 3SB2A 3HP9A 1Q1BA 2XDBA 1KQSA 2Y4YA 1AH9A 1A62A 1I50H 3EIVA 3TQYA 5A0DA 2GQVA 3W5OA 5BR8L 4M77A 3ZFJA 3HOZG 2FVUA 1X3EA 4RKUE 4GOPB 4X62L 2XK0A 2I2LA 4MDXA 5CQXA 4DV6Q 2IY5B 4DV5Q 3PMIA 4RCBA 1V9PA 2RH2A 2KSSA 2R92G 3OYJA 1M8VA 3OMCA 4YWLA 5GAN2 4UPAA 2L8DA 3AFPA 2HQLA 1G3SA 3QYHB 1E22A 3D0FA 4GN5A 5LMNW 4M75B 4ZTJA 4XTYA 4Q5WA 3HSBA 1LUZA 1Q81U 3HOYG 5IP9G 2CYZB 4XU3A 4XU1A 2X4XA 3HKSA 4N4HA 1CKMA 4C8QG 4JRIA 3CMEA 3GPLA 1U5KA 5GANf 3OS2A 4XTCS 1YJ9A 3V7SA 4KT0E 3NTHA 3SWNB 1QVFA 5AJ3Q 1VQAA 2PI2E 4R4OA 1A0IA 4JI0Q 2I5MX 1N34L 4OB1B 4C8QF 5HGQA 2HAXA 5GQOA 2DVEA 5IN1A 4UC4A 1N36L 5IE8A 1HR0L 3QDRB 3JC66 4NL2A 4CI0C 2RJFA 4EDUA 1JMCA 4B3TL 3JAMc 1GD7A 2ID0A 1FJGQ 3CC2T 4FDBA 4BACA 4X66L 3EN2A 2KCMA 3M55A 3C94A 1BIAA 2H5XA 1JJ2S 4OGEA 5FLXc 3HOUG 4HCCA 2VS1A 1QVGA 4DR3Q 1E3PA 3Q1JA 3HKZG 4FM4B 4M77G 3LWIA 3GP8A 3D31A 4BE0A 5GAMj 4DR7Q 2ES2A 3GTGH 4QVZA 3S1NH 3W1BA 3CC7T 2DK3A 3OBWA 4EMGA 3CPWA 1JBMA 3RN2A 1M1GA 3NELA 1SRUA 4WJ3M 2VGMA 5FU7B 5C4JH 3J81E 2P4TA 3QYGB 4MZTA 4A75A 3OS1A 3UDCA 4PMWA 1Y07A 3G71T 3FP9A 2GCXA 4HJ5A 3C95A 2HQXA 1JJCB 2DGYA 4DR4L 2VUMG 2DO3A 1I6HH 1WQWA 4ZGDB 3RKYA 3BDUA 2A1AA 3GTMH 4DV4L 2R7ZH 4OGCA 5DM7R 5C44G 1XOVA 4XTWA 2MNAA 4BA2I 1VQCA 5JJLA 3V8LA 4M7DF 3TREA 4LF9Q 2G3RA 2DD4A 4MMKA 2Q2IA 1IZ6A 4N0AC 5C6SA 3NEMA 1L1OC 3ZJYC 3LH0A 4A93G 1YCYA 2F5TX 4M78A 5KE2A 4L5GA 2PVDB 3JRZA 3OY9A 2LVMA 4P5NA 3NENA 3I56T 3CCLT 4LF4L 4V2SA 3PO3G 3L42A 1QZHA 4JI2Q 2DTOA 3L2UA 1U1SA 4C3HH 3ICEA 3OMGA 1XMQQ 4EMKA 1S72T 4JG2A 2UU9Q 3P8HA 4OWXB 1QVCA 3KUFA 3KDFB 2AKWB 4GY5A 3SDZA 2JTFA 2HIVA 2DJZA 4WJ4A 2NVQH 4GLKA 2RHUA 1BI1A 2DZCA 4A4FA 1B34B 4M7AG 4DV7Q 3MEFA 5DLOA 4NL3A 3S1QH 3CD6T 3P8BB 5GAOr 3JCMV 1G51A 2K5VA 4GNXC 3I55T 4AIMA 3CCVA 3RESA 1KXLA 4YHHQ 3S2DH 4NS5A 3TS0A 2ZPGB 1H95A 4M7AF 4LF5Q 4IFDI 4M78B 2XDPA 4BB7A 1YHAA 2R7FA 3J80E 1VQ6A 5D6WA 4LD6A 4LFAL 3CCST 2AWNA 4C8QD 1LM0A 1E24A 3OYFA 4QVDA 4R4QA 2WSEE 2GVAA 2QXFA 1VQJA 5LMNL 1HZBA 5M5YH 3X24B 4OB3B 1IL2A 5IY0A 3O8VA 4TQUS 2LDMA 4HJ7A 5GANh 2RI5A 1PH1A 2ASBA 4DOVA 5I2SA 2QEXA 4C0ZA 3S3OA 1CSPA 3HOWG 1MJCA 5IP7H 2YRVA 2KQWA 1AE3A 4LD9K 1YEZA 1VQ4T 4P73A 1S3OA 2RM4A 2EQUA 1K0RA 4ZGJB 5I21A 5FRNA 4GOPC 4YCWA 2ZPBB 4XU0A 1ZHIA 3B6YA 2UXDL 1M1FA 3WVDB 1GVPA 1YI2A 4JUVA 1GM5A 1G3WA 3A8LB 2RJCA 1SN8A 3H6ZA 4YTLA 2DD5A 4ZTFA 3KLWA 3J81i 3F2BA 2UXCQ 4M77D 4C8QE 4XQ3A 4DK6C 3MO8A 4JOIA 2RHSB 4IJLA 3NBHB 2RHQB 1BBUA 4JCVE 4C3IH 3PIOA 4A3IH 1LJOA 4HA8A 1C7YA 4BA1I 2LSSA 1LTLA 1KQ1A 1WYDA 1IBML 3FEOA 5KCOA 1I8FA 3INZA 2ZGWA 5IWAL 4H02A 5J3BA 1VUBA 2P0PA 2JEBI 3QO3A 2E64A 4BY6C 4B3SQ 3ASKA 4HKEA 4KHZA 3OYCA 3RLFA 2VY3A 3VYGA 5IYCG 2NVYH 4M77C 4R4TA 3OTOQ 2FL7A 5FLMG 1QUQB 1K73C 3CCET 4A3GH 1W4SA 1UEBA 1Q12A 3CW2C 2R6GA 4PL6A 5JEAJ 2R5AA 3FJPA 5E7NA 4E47A 2EWNA 5M3FG 1VQ8A 2YU9H 3GTLH 5LJ5d 3HKZE 3MEAA 4M77E 4JBKA 2M9UA 5LJ3e 1G291 1BI3A 4JI4L 1VQ7T 1HXDA 3K81C 1EQRA 2MO1A 2CZ6B 1VQDA 2Q2TA 2AHOB 4A3MG 3W1GA 2F69A 1YITT 3HPWA 1TWGH 3CBPA 2Y0SG 2EAYA 4C5IA 4BBSG 2XDDA 3JCMQ 3QSUA 4L5RC 3I4OA 3HFOA 3TRZA 3M9QA 1PH9A 2PU9B 3GDEA 2K5HA 4KHPQ 2K57A 4HCBA 5C0XG 2IG0A 2JA5H 2QQBA 4DOWA 4JYAQ 4M7AD 2WSFE 4ATOA 2CZ1B 1HNWL 3RIRA 3S1RH 4N4IA 4X9CA 2OQ0A 1IBKQ 4XAXB 1MIUA 3M57A 3CC2A 1E1OA 1UGRB 2BKDN 3OYKA 2X4JA