1XTDA

Structural analysis of leishmania mexicana eukaryotic initiation factor 5a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
149
structure length
149
Chain Sequence
b'NASKTYPMAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTHNVEVPFVKTFTYSVLDIQPNEDPSLPSHLSLMDDEGESREDLDMPPDAALATQIKEQFDSGKEVLVVVVSAMGTEQVLQTKNAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eukaryotic initiation factor 5a
publication title Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
rcsb
source organism Leishmania mexicana
molecule tags Translation
total genus 26
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xtdA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xtdA02
1VQ9A 1OTCA 2JOYA 3HFZB 2N49A 3SGIA 3W1BA 1Z47A 4YWMA 4POGA 2PQAB 4B3TL 1N9WA 3FHWA 1YI2T 4OXPA 4GKJL 1NE3A 4LNQA 1YEZA 2K5NA 5IP7G 2WB1G 3PO3H 4APVA 3CMET 3KYHC 4PZ6A 4BXXH 4YY3Q 2MNAA 1R9TH 3CMAA 4DPGA 2D62A 1J5EL 3CPFA 2LCLA 2AMCB 1V9PA 3KDFA 3J80c 4UP7A 2VQFQ 4DR4Q 3I55T 4NPSA 5GQOA 3MXNB 1OXVA 1K9MU 4IPHA 3M85A 2YU9H 4LF6L 3UE0A 1N34Q 2RCNA 1VQ7T 4BA2I 3A0JA 2OTJA 4JI3L 1NPPA 2ZTDA 1KRTA 2YTYA 1RL2A 4A3FH 2B63G 5K36G 4BY1H 3HOVH 4ZN3A 1VQ8T 1Q12A 1Q8KA 3A74A 2QGQA 4JI6L 4A93G 2AHOB 2A8VA 1I5FA 2ASBA 1FVIA 3PF4A 4YCUA 1E24A 1Q82U 1GVPA 2Y0SE 1EIFA 3CCUT 2PMZE 1Y14B 2K5HA 2CWAA 1Y1VH 1Q81U 2AKWB 2VY3A 2YYZA 3U4VA 5M3FG 4JI7Q 3LGFA 3GTGH 3STBC 3KFUA 1VQKT 3M4PA 1X54A 1MKHA 3NBHB 3GTMH 1YI2A 4GKKL 3AQQA 4X65L 3CPWS 4WJ3M 4KLKA 3HKSA 2JA6H 3PV0A 3CMEA 2Q2IA 3CCQT 3F2CA 2AWNA 3OTOQ 1VQ6T 2VZAA 4C2MH 3M4OH 5IP9G 2CKKA 3TS2A 2QEXT 4A3KH 2HHHL 1K3RA 4DUYL 2MO0A 4DV1L 4L5SA 3I4NG 1PH3A 1PA6A 5IYBG 5EAYA 3P8BB 2IHEA 1JJCB 3MEFA 1K73U 4FDBA 1VQ7A 2GVAA 3HOXH 1Q46A 2ZJPA 1V43A 2NN6G 3H0GG 4JBWA 3TEHB 3LH0A 3PSIA 3HOUH 3HOZH 4JI0L 1VQPT 1J5EQ 1VQ8A 3KF6A 1VQMT 1Q1EA 4MTNA 1XNQQ 2WP8J 2EIFA 3E0EA 3F1ZA 3M9BA 4JBMA 2F52A 5M3MG 4LF8L 3PO3G 3BZCA 4B3SL 2QA4T 3H3VH 1QVFS 1VQEA 4JI5L 3CCVT 1G291 3B6YA 4LF6Q 4JV5L 1VQGA 4JI3Q 4IPCA 2ES2A 2MI6A 2A19A 5M5XH 3K80C 4OX9L 1MJCA 3CCUA 3L7ZC 3I4OA 4EX5A 1KQSA 2IT1A 1N36L 1MIUA 3J80E 4YCVA 4JI6Q 4BXXG 1VQKA 3CP0A 1CKNA 3W1GA 2PQAA 3RLOA 4GOPC 2E6ZA 1HZ9A 2EQSA 1DGSA 2Z6KA 5JEAJ 5JEAG 5M5WH 4DV7Q 2HIXA 4OO1I 3ULJA 1L2FA 1X3EA 3HKZE 1C0AA 2CCZA 1VQJA 3PUZA 3CCQA 1PYSB 2KHJA 4JC0A 4AIMA 1VQCA 4DR2L 1VQ6A 3U58A 3OW2A 2UUBQ 2IX1A 1IXRA 4X6AH 2QEXA 3K7UC 5JJLA 3EIVA 4A3FG 3U50C 2RHSB 1XPOA 4BY1G 1L0WA 3HOVG 3KJPA 1NJIC 4GKKQ 4QGUA 3PUVA 2NZHA 1Q82C 1G6PA 4DAYB 3NENA 3I56A 2GVBA 5FLXc 4YTLA 1Q81C 2MQHA 1VQPA 4A76A 3CCLT 1VQMA 4QIWE 1X9NA 3U4ZA 4DV1Q 1KAWA 1HZCA 3FKIH 1Y1VG 2WB1E 3CCVA 1PV4A 2I5LX 3K81C 4JOIA 1WOCA 2ALYB 4XTCS 5ELOA 1YBYA 1AE3A 1TWFH 3F8TA 3I7FA 4O2DA 5IY0A 1W2BS 2R6GA 3L2PA 4C3HH 4JI0Q 4O0AA 4PG3A 1CSPA 2JA6G 1Y1WH 1YHQT 4LF4L 2MFIA 2L3RA 5HGQA 4R4OA 4LF8Q 4B3SQ 3BJUA 4A3KG 2UUCL 1K73C 4JI5Q 4BBSH 4GNXC 4JI1Q 3HOYH 1XNRQ 1KHIA 4JYAL 3UDFA 3KF8B 5LMNL 1XMOL 5C0XJ 3E9IA 5C0XG 1I94L 3HOXG 1M90U 1WYDA 1K8AU 1N36Q 3GTPH 3HOUG 3HOZG 1U0LA 3KLWA 4LF5L 2KDSA 3S2HH 4QJFA 3J7A5 2AWOA 3RZDH 2UXCL 1HNWL 1PH9A 4YCWA 1CSQA 4GOPB 1QVGA 2OTLT 1B70B 4A3IH 1H95A 1PHJA 4GLVB 2LQ8A 2DUDA 4JBJA 1YNXA 4YHHL 4Y52H 5M5YH 1QUQB 4JI4L 1HNXQ 4J15A 4AYBG 1L1OA 1EQQA 1PH1A 3CCLA 2ID0A 2R7ZH 3RLNA 2RF4A 3CXCA 4C3JH 4LFBQ 1O7IA 1ASZA 1VQIA 4UP8A 5A2QE 4DR7L 3RN5A 1XJVA 5IYDH 1IBML 3M7NA 2LVMA 1A0IA 5GADC 3RZOH 2N3SA 1E1OA 4OWWB 1YHQA 1XMQQ 2VQEL 2WAQG 2E2IH 2UU9Q 3PIPA 4X66Q 1X3GA 1EIYB 1M1KU 3K8AA 3S1MH 3PIOA 4ME3A 4UPAA 5BR8Q 3RNUA 1D8LA 4A3BH 5FLXE 3S1QH 5J26A 1I6HH 2PI2A 1OXSC 1N32L 1PVOA 1YITT 5HY6A 1J6QA 4R4IA 3UDIA 1FJGL 4QQBX 4JG2A 2G3RA 1YZ6A 3CF5A 3STBD 3TREA 1Q7YU 3CC4T 4LF4Q 4DV3L 1S40A 1VCIA 4UY8C 2UUCQ 1YIJT 2OTLA 2NVQH 3PUWA 4DAMA 4DV0L 4B3ML 2ZM6L 4DV5L 3FKIG 4GNXB 2DO3A 1L1OC 1S3OA 1XMOQ 3TQYA 4A3DH 1KD1U 1KC8U 2JNGA 2L15A 1AH9A 3I2ZA 1I50H 1PH4A 3PCOB 1A62A 1WI5A 3H15A 1HNZL 4LF5Q 2UXCQ 4JI2L 1HNWQ 3S1RH 1IYJB 1LUZA 2ZTCA 2JQOA 4AQYL 4OWTB 4KHPL 4HIDA 3F2DA 1Y1WG 3GTKH 4DV6L 3CAMA 4YWLA 3PUXA 1JJ2S 2GN5A 3PO2H 2K50A 3PGZA 4P75A 4LF9L 1M90C 1CUKA 2DGYA 3AFPA 2KCTA 4HIMA 4IFDI 1XPUA 2PI2E 3HOWH 2OQKA 2ATWA 4LWCA 5GAHC 3AYHB 3I55A 4TVAB 1N8RU 2R7FA 4NXNL 1LTLA 2BA1A 2HQLA 2JK8A 3RN2A 1HR0L 4BY7H 4GKJQ 1UWVA 2K5VA 2V1CC 3GO5A 2UXBL 4A3IG 4EQ5A 1YJ9T 1HZBA 4DR3L 2I5HA 1EYGA 2XHCA 3CC7T 1GD7A 2ZJRA 2VQEQ 1QZGA 4X34A 1K8GA 3S2DH 4K0KL 2CKZB 3W5OA 1YIJA 3EN2A 5AJ3L 2B3GA 4MZ9A 2B29A 1HJPA 3J81i 3TS0A 3I4MH 5H1SE 3CD6T 3T1YL 3LGLA 1I3QH 1SLJA 1VQBA 4IPGA 2JA7H 5GAGC 2R7DA 2UXDL 4ALPA 5IYDG 1K9MC 1M1KC 2E70A 1EWIA 3ZJYC 4DUZL 2VUMH 4A3LH 2JVVA 4IFDJ 5IT9c 4DV4L 2R7ZG 4DV0Q 1QZHA 4IFDG 1HH2P 2ZM6Q 4DV5Q 1UE6A 3CXCS 1OXUA 4DKAC 1IL2A 4HJ8A 3ER0A 2NZOA 4A3BG 1D7QA 1EFWA 1LYLA 3AEVA 1TWGH 1PH7A 4LFAL 1Q7YC 1VQFA 1PH2A 3M3YH 2IHFA 3K7AH 4L5QA 4XIGS 4HJ9A 2KENA 4LF7L 3GTOH 3KOJA 4QQDA 3DM3A 4JI2Q 4PZ7A 4TVRA 3UE1A 4AQYQ 4X65Q 2E2HH 4L5RC 4A3MH 3KJOA 5FJ8H 4KHPQ 5JJIA 4DV6Q 1KXLA 2F3IA 4ZN1A 4AYBE 1KD1C 1KC8C 3JAME 5C3EH 2E5LL 1YJ9A 1PYBA 4GS3A 5E7NA 1JMCA 2HHHQ 2MWOA 3CC7A 2KBNA 3KDFB 4DUYQ 3GTQH 4LFCL 3G6ET 3F2BA 3LGJA 1VQLT 4A3DG 4BBRH 5C4XH 4DR5L 1HR0W 1PH5A 2QA4A 1HR0Q 4HIKA 3CCET 4JI8L 5JJKA 4DV2L 1ASYA 4P73A 1M1GA 3CCJT 3CD6A 4OO1G 1XNIA 1NPRA 2MO1A 2Z6KC 2WAQE 4X64L 2F4VL 3PO2G 1BBWA 1N8RC 4CRIA 3G71T 1Q1BA 1UE7A 1X55A 4A3CH 4B3RL 3GD7A 5GROA 3HOWG 3VDYA 3D0FA 4JV5Q 1CKMA 1PH8A 4YY3L 1PH6A 3JAMi 3PF5A 2R92H 4BY7G 2K4KA 4OX9Q 5IYCH 1A63A 4BA1I 2JEAI 3UDGA 3CPWA 3AFQA 3CW2C 3GDEA 1C7YA 3J81c 2OWOA 3S1NH 4HJ7A 4OWXB 1JE5A 2ZJQA 1PFSA 3J81j 1N34L 1NMFA 3A5ZB 4DR1L 2JA8H 4DV4Q 1NY4A 4MNOA 1YHBA 3CMAT 3EBEA 1X65A 4DR2Q 1TWCH 2JA5H 2HIVA 3GTJH 3D31A 2N8NA 1VS0A 4LF7Q 3G6EA 1T9HA 4QY7A 1VQLA 5IE8A 3I4MG 1TXYA 5IT9E 4GN5A 4C3IH 4JOIC 1TWAH 3T1HL 2Q2TA 1SFOH 3E9HA 1IBLL 1WJJA 3CCEA 3CC2T 2ZTEA 1KRSA 4A3LG 3BU2A 2VUMG 3CCJA 1QVFA 3KF6B 5C4JH 1GO3E 4LFCQ 1KQSS 3Q8DA 3G71A 1KL9A 1NBWA 3G48A 1W3SA 1XTDA 1E3PA 2R93H 1EQRA 2MWPA 4PMWA 4WJ4A 4JI8Q 5DLQE 4DR5Q 2CFMA 4A3MG 3KBGA 5FJ8G 2OCEA 1Q86U 1MJEA 4X64Q 1CKNB 1SSFA 2K14A 3CCRT 2F4VQ 1YJWT 3DB3A 2LSSA 4YWKA 3OW2S 2JEBI 5C3EG 4B3RQ 1K83H 1IBKL 3TRZA 3ULPA 1VQ4T 3RR5A 5LMNW 4JYAQ 2EXDA 4BBRG 4IOCA 5LMNQ 5C4XG 2WFWA 4IJLA 1XNQL 1I94Q 3JAMc 2I5MX 2JUFA 2VW9A 3OYYA 1VQDA 4JCVE 4DR1Q 1BKBA 1VQOT 1G51A 4YHHQ 2H5XA 4A3CG 3CC2A 3J7AF 1VQNT 4JI4Q 4JBKA 2C35B 3J81E 4BBSG 1K8AC 4Y7NH 1X56A 2NN6I 1JJGA 2R92G 2KHIA 5IYCG 4DV7L 1JB7A 2BH2A 4GLXA 2VS1A 1NJIU 5LMUL 4IOAA 1W2BA 1SR3A 3OTOL 4LUOA 3T1HQ 5C44H 1OXTA 2YTVA 1IBLQ 2UUBL 2OQ0A 4DR7Q 1RIPA 4HJAA 1WCMH 1NZ9A 1YITA 1IBMQ 2JA8G 1P8LA 2D0PA 2I0QA 3S17H 1OXXK 3CCMT 2NVTH 1SRUA 1SROA 3CCRA 4HJ5A 4IO9A 1YJWA 1NMGA 3CC4A 1U5KA 2JA5G 2Z0SA 5IWAL 4KI0A 1VQAA 4GOPA 2D0OA 5GAEC 3CCST 4GN3B 4P71A 1VQ4A 2VL6A 3S16H 1C9OA 2FXQA 1QUQA 4POFA 4A75A 1E22A 1QVGS 1E1TA 3NELA 4A3EH 1N32Q 1UE5A 1FJGQ 1SE8A 4PZ8A 1YJNT 4RMFA 3S15H 3J7ZC 2RHQB 3BZKA 4A3GH 4GN4B 4DV3Q 4IJHA 3WWVA 4R4TA 1IBKQ 2BH8A 1TWHH 3I56T 1K0RA 1X6OA 4B3MQ 2KVQG 1VQOA 3RLFA 4A3JH 2Q2HA 4KHZA 1VQNA 3L0OA 1L1OB 1Q86C 2R93G 5DM7R 1YVCA 2JA9A 2NVYH 3CQZH 1V1QA 2N78A 5FLMH 2A1AA 4DR6L 3FP9A 1FGUA 2JE6I 1HNZQ 4NXML 4R4CA 3GTLH 2PNHA 4JI1L 1XNRL 1B7YB 2K52A 3UDXA 2IG0A 1JT8A 2Y0SG 4X62L 4LF9Q 3ICEA 1HZAA 1EUJA 2UUAL 4IPDA 3G4ST 2CWPA 1CKOA 3CCMA 5IP7H 4QL5A 3IRBA 3DLLA 2XGTA 5LMUQ 4NXNQ 4DNIA 3CCSA 1SMXA 1LM0A 1N33L 1HNXL 3JC66 4GNXA 1VQHA 4LUVA 2UXBQ 1E7ZA 4RG1A 4DR3Q 1YJNA 5IAYA 4R4QA 3K0XA 5C0XI 3S14H 2B63H 1VQ5T 3ULLA 5IWAQ 5LL6S 2E2JH 4LFBL 1BBUA 4K0KQ 1S72T 4DK6C 4A93H 1GKHA 5AJ3Q 1QVCA 1GM5A 3J80i 4UP9A 1VQ9T 1FL0A 5C44G 3T1YQ 4AH6A 2VNUD 2IX0A 1XMQL 2UU9L 2XTIA 2VQFL 4HIOA 4DR4L 4X66L 2NVXH 3H3VI 1EOVA 1JJ2A 1WCMG 2UXDQ 5BR8L 4DUZQ 2HT1A 1AE2A 4LUZA 1NTGA 2KCMA 5M3FH 1XPRA 1UE1A 4B3TQ 3HOYG 1X3FA 1BVSA 4LW1A 4NB3A 4OONA 4P74A 2E8GA 1UEBA 1KIXA 4R1JA 3A5UA 2JJQA 1YHAA 1A8VA 2CQOA 4TQUS 2LXKA 3G4SA 4LFAQ 3NEMA 3S24A 2BA0A 2IY5B 4A3EG 3ERSX 4DR6Q 3M4QA 4NXMQ 1B8AA 5IP9H 4DK3C 2OTJT 4GLAC 2JA7G 3HKZG 2K75A 4A3GG 5ELNA 3I4NH 3DB4A 4JI7L 3PUYA 1SN8A 5IYBH 4L5TA 4X62Q 2E5LQ 5J3BA 2UUAQ 4A4IA 4A3JG 1IZ6A 3H0GH 4RG2A 1VQ5A 1Z9FA 2LXJA 1P16A 1S72A 4P72A 2Q2UA 1N33Q 5FLMG 4H02A 5M3MH 1WFQA 2YV5A 2YTXA 4DV2Q
chains in the Genus database with same CATH superfamily
1OTCA 2JOYA 5A35A 3OYKA 1I5LA 1K4US 1YJ9Q 4JS5A 4MZMA 4B3TL 2VYTA 2QDBA 1YEZA 2K5NA 1D0ZA 1OULA 2EFIA 5KYXB 2LCCA 1TT2A 2L9HA 4BB7A 2WB1G 3EJIA 3CEYA 5IP7G 3KYHC 2SEMA 2R61A 1OEBA 2F0OA 2G9HD 2MNAA 1R9TH 4PK4A 2HQEA 1V76A 4R8NA 4LXCA 1F9RA 2RI2A 4C5GA 4V190 2AMCB 3QKJA 4PJOC 2A68D 3KLRA 3M85A 2A7YA 1GOZA 3DWQA 4F7UG 4IPHA 1PC0A 2FG0A 1VQ7T 3RUZA 2OTJA 1RL2A 4Z88A 5KYWA 4A3FH 5K36G 2NUPB 4CC2A 4ZN3A 1Q8KA 1KDAA 1BI3A 1WJSA 1M3CA 2O01E 1ENAA 1HQMC 1QVPA 5KEEA 1I5FA 3PF4A 3EGXB 3V8LA 1Q82U 5ELDA 1Y14B 2YYZA 2CWAA 2AKWB 1FMWA 1Y1WB 1K0SA 1T3LA 4C8QC 4GBQA 1B9MA 2FVUA 3GTMH 3UA7A 3NE5B 3M0SA 1YI2A 3GP8A 2JYOA 3CPWS 1A2UA 3AQQA 2DIQA 1AT1B 3NMZC 4XXEA 1KAAA 2EKOA 3AT1B 1H641 4MZTA 2F0FA 3GTPB 5GMKm 3CCEQ 1WA7A 2D8JA 1K3RA 3G7LA 3RZDB 4CKEA 1XJWB 4L5SA 3CCJQ 1RI9A 3ULRB 1ENFA 2WKCA 1EL0A 3EGDA 3KLSX 3TSSA 5GAOr 1Q95G 3HOXH 3VYGA 1K9MR 3N6RA 2ZJPA 3LH0A 1FNUA 1ZA1B 3OYFA 5GAOm 1Z6HA 1R8OB 3IFDA 4HCEA 1J5EQ 4CBVA 4EPCA 2KK4A 2O31A 1G2SA 4JBMA 2EYOA 2DXUA 3UATA 3H3VH 2IVWA 4JI3Q 1PWTA 1GCQC 1IXDA 3HRSA 1SNMA 1KQSA 2VWFA 2A08A 5LJ5j 2R7ZB 3D6CA 5CBAE 1Q81R 4C92C 2KQ3A 2PO4A 2KNBB 1X6BA 3RLOA 2YU9B 2RI5A 1GHKA 4HT8A 5M5WH 3HOWH 4FT4A 1C0AA 1SHFA 1I4HA 1VQJA 5C3XA 4F7UA 4DR2L 1VQCA 3U58A 1PCXA 2QEXA 2A5HA 4HEDA 4WJWA 4BI3A 3EIVA 4C5HA 5IXBA 5CKBA 2RHSB 3MXNA 1DCZA 3U50C 4ZKCB 1NJIC 2VKNA 1Q82C 4Q0FA 3M59A 2LJ3A 4YTLA 5HK0A 2PQEA 4F88A 5CGKA 1VQPA 1IL8A 4A76A 2J6OA 1VQMA 4TKOB 3U4ZA 5EC7A 1HZCA 2QW7A 1Y1VG 2BTTA 1V1CA 1SRMA 4ZGDB 4XTVA 2B2UA 2K03A 2WB1E 5C5MA 3OYGA 2NBFA 1PTOB 2ROLA 5IHNA 2ALYB 4XTCS 2I46A 2D0NA 4B9XA 5IOCA 2CW0C 4JI0Q 3TSWA 4C3HH 2PVGB 2MF2A 1YHQT 4F7UE 4LF8Q 4R4OA 2KY9A 1SE2A 4RG8A 3A8HB 2UUCL 3S9WA 2C0TA 2VXEA 2L12A 3HOUB 3HOZB 3OYDA 1KHIA 5D6XA 5C0XJ 3E9IA 4JZ4A 1A15A 1EX4A 1VQOQ 1PRTD 1VQNQ 1WXBA 1U0LA 3KLWA 3SWNB 2K05A 1QVGA 2Q8IB 4BACA 2MOXA 1SKUB 2C06A 3RMQA 1YNXA 5M5YH 1WHGA 1H92A 3OOCA 4JI4L 2EYWA 2ZPGB 3RESA 3Q6SA 3CCLA 3X26B 2KRMA 4HCSA 1HTLD 1F2MA 2VUMB 2RF4A 1UUEA 5KNBA 1ZKOA 3CCMQ 1JC7A 1JU5C 1WTWA 4LFBQ 5JAVA 1ASZA 3M55A 1L0XB 1H9SA 1WTXA 1IHVA 2YSQA 3LWIA 3QJYA 4DR7L 5LJ3j 4R55A 4PLLA 5GANd 2VXFA 4BWGB 3M3YB 2GBQA 2BDOA 3OHXC 1I0CA 4K6LA 1XMQQ 2E2IH 3PIPA 2E6NA 3F70A 2DBMA 1M1KU 1UUPA 2DRKA 4A3BH 1D8LA 2Q8TA 4CDDC 1UFFA 2K3XA 2HMAA 1JWUD 2PI2A 3DKMA 2MPMA 1PVOA 2DX1A 1YITT 4QMGA 3PVLA 4PLIA 2K28A 1FJGL 4QQBX 4XAXB 5I11A 2JJ9A 4L63B 2RDFA 2DN8A 1M90R 2W0ZA 2OT2A 4V0BA 4DA2A 1K76A 3N5BB 2OTLA 3PUWA 4WTOB 2DL3A 2ZM6L 1XYIA 2F4IA 3L2VA 1QKXA 1WTRA 2KYMA 4IQZA 4B6MA 1B3QA 1GCPA 1A62A 2L89A 2UXCQ 1W6XA 3G4SQ 3I72A 5GAN3 2EYXA 2JQOA 4KHPL 1M2OA 4N0AA 1JICA 4RGMA 4HIDA 1Y1WG 1EY9A 3CAMA 3PO2H 1FD7D 1LT6D 3REBB 4CDFC 1PDQA 2Y90A 4Z9CB 1O78A 2AZSA 2DLPA 2KE9A 4OMNA 1GFDA 1YNJC 3UPUA 2OQKA 2PI2E 3MA2B 1C1AA 3MEHA 1FMVA 2HCKA 3I55A 5ELEA 4FYXB 4E7KA 1N8RU 1XQHA 4NXNL 1WTPA 2NYSA 2V1CC 3BDLA 1Y07A 3LWEA 1SSOA 3OMGA 4EQ5A 4ILWA 3REAB 4M75D 1JE4A 4QT7A 1F2LA 1GD7A 2LQWA 5KYYB 4MMLA 1MI2A 1TSFA 4RCCA 3OYAA 4PJOB 1K8GA 4K0KL 1V29B 3W5OA 1YIJA 3EN2A 4M7DF 4N8X1 5E4XA 3E9GA 5FU7C 3QWNA 3TS0A 3RZOB 5H1SE 3TCJA 3CD6T 3SK5A 2CZ1B 5LJ3f 3RKXA 1I3QH 1SLJA 2A37A 5C4HA 2GNCA 2XI9A 5IYDG 1M1KC 3NWSA 4ALPA 1ZUYA 4WFN3 5KYXA 3I5SA 2A6ED 4DV4L 4IFDJ 2R7ZG 1QZHA 1HH2P 1A3UA 1VA7A 1IL2A 3NWTA 2OTJQ 4HJ8A 2FZKB 2O5IC 1G3TA 2J06A 5I6YA 1EFWA 3NBIA 1ONLA 1F2YA 4LFAL 1VQFA 1PH2A 3S1MH 3S1QH 2BE5D 2OAUA 2IW3A 2HL3A 4K2KA 4L5QA 4XIGS 5C4ZA 2M2LA 4JI2Q 2NVQB 2RJDA 1HSQA 3UE1A 2E2HH 4AQYQ 1T5XD 1BF4A 2ICIA 3KJOA 4A3MH 2RF0A 2NUPA 5C3EH 1BO0A 1A63A 1FWZA 4LK1C 1TH7A 1JEGA 2LTOA 1LV9A 4LFCL 5JPMC 3F2BA 1BB9A 1J8IA 1V1PB 2QXFA 1YI2Q 1JXMA 1PG5B 2O4XB 2RI3A 4OB1B 4DV2L 4P73A 1JXOA 1OPLA 1KFZA 3FLGA 1TKWB 1H9KA 3K5LA 1N8RC 3ITPA 3G71T 2P84A 1YWOA 1IW7D 3JSCA 4B3RL 5GAMh 1BCPC 2X3WD 3H0FA 2R57A 4HCBA 3GV3A 4JLGA 5FWCA 5CKHA 5ELBA 3FIFA 2JEAI 2JN4A 1Y71A 5EPKA 3MP8A 3CPWA 2PW5A 3S1NH 3BVGA 1QJOA 4FVMA 3HG9A 4OWXB 1PFSA 1RJTA 3A5ZB 1TY0A 4R9WA 3JCMg 1NY4A 3JB9F 1X65A 3PVQA 2JA5H 2AUKA 3S15B 2AHJB 3V7SA 3Q23A 3D31A 1WJQA 4BDYA 2N8NA 1VS0A 2B2UC 4QY7A 1LTSD 1VQLA 2AIRB 4F8MA 1TWHB 2AT1B 5C5LA 2Q2TA 1GL5A 3SHLA 3V8JA 2G9DA 3HP9A 3FDRA 2ZTEA 4P2CB 4A3LG 2VUMG 4IZ8A 2D1XA 1EY4A 1LLRD 2C0OA 3L2RA 1EOTA 4ME7A 1I1JA 2QEXQ 1K8MA 3VYTA 3KUFA 4F87A 2XRSD 4H13C 1W3SA 1AEXA 4C5IA 3PFSA 5KE2A 1EQRA 1LVKA 4ZUJA 4FSSA 2QF7A 1D1BA 3JB9G 4DR5Q 2CFMA 2L5TA 4FP5D 1YFNA 3KBGA 2L1BA 2PZUA 1VQPQ 4NKLA 2RKSA 5AFWA 1YJWT 1CA6A 1VQMQ 3DB3A 2L0CA 2LSSA 4YWKA 2JEBI 1K83H 4XK8E 2F0NA 4FM4B 3RR5A 5IODA 1STHA 1O7YA 3OIQA 4MMKA 1C6VX 4C5EA 2EXDA 4BBRG 3MEVA 4RTWA 4IOCA 4JYAQ 1TS3A 3FJ5A 4E6RA 2ED0A 3S14B 4AFUC 2CH4A 2B2VA 2CZ7B 1QVFP 2ZXPA 5BN5A 2VW9A 1QNUA 2LFNA 1BKBA 2FFKB 4OMQA 1WDXA 4ME5A 2XICA 4JBKA 3ND8A 1SBBB 4BS9A 2C35B 4OEMB 2BOSA 1ABOA 2KA7A 2AZVA 3OWEB 2KCNA 2CP2A 4QW2A 3PGGA 2R92G 2H1EA 1JJGA 2DKGA 4K5XA 5IYCG 5M3FB 1JB7A 4WF2A 3E0JA 4VUBA 3T1HQ 1PKSA 2LT1A 1NNXA 3TN2A 3I35A 3A8OB 1FGBD 2CGHA 2W10A 1XWEA 2MAMA 4HCZA 1RAEB 2YWWA 1P8LA 5D65A 4MDWA 3GNFB 2RBMA 4NW2A 2TMPA 4WORA 1SRUA 1SEMA 3CCLQ 1PSFA 4IO9A 4C3IB 4FNFA 1Q86R 3SWNA 1TWAB 2FPFA 3HOYH 2MCNA 5I2YA 4P71A 4C0DC 4FU6A 1NM7A 1VQ4A 4GN3B 2EJFA 2WSEE 2FXQA 9ATCB 2X4XA 3LX7A 1E1TA 1UGSB 1M8MA 1AWWA 5F2DA 2DERA 2F0LA 1SE8A 1BDOA 2PUOB 2JM9A 2FPEA 1E0BA 2OAWA 4GN4B 1N9RA 5BN3A 1LTTD 4N0AC 3VJPA 1IBKQ 2BH8A 2E76C 2BE9B 3O8VA 4A3JH 1I4RA 2LMCB 3L2WA 3EA6A 2XRQD 1YVCA 2JA9A 3CQZH 2DM1A 4LNPA 4NMZA 3VA7A 3FP9A 2JE6I 1STEA 1B7YB 2OTLQ 4ATOA 5GAOp 1DOMA 2HZYA 2DPPB 3KUPA 4EQNA 3PMFA 1NEGA 3MP1A 1SHGA 2HL5C 2V8JA 1CKOA 3V05A 4AG2C 4JRQA 5EKLA 4EDUA 4WCIA 4X3TA 3HOVB 1UGVA 3VUBA 4RTTA 1NG2A 4DR3Q 1HHVA 1PM3A 2D0QB 4ZGJB 5C0XI 4LFBL 2VUBA 3ULLA 1UJYA 3IAYA 5T1IA 1CHQD 3C46A 1D1CA 1GM5A 3K5OA 4D8KA 5A0LA 4XYQA 3C3LA 4HA8A 3T56B 3T1YQ 2NVTB 1XMQL 4XT3B 4HIOA 4DR4L 1GBQA 2RHUA 2NUTA 2CVRA 1EOVA 4NL2A 4BD3A 1G5VA 4LUZA 2OX7A 3S16B 2L3SA 2L5QA 2A6HC 1YIJQ 3WOEA 3X3NA 3HRTA 4A3KB 3DWAA 4J6HA 1KIXA 1MHWC 4IUQA 4G7ZC 2CQOA 5KYYA 1WHMA 3NEMA 2BA0A 2NB0A 3ERSX 5CKDA 3EGDB 4NXMQ 1L0YB 3QDFA 1WGSA 1B8AA 4DK3C 4OF1A 5GANh 3S3OA 4KY7A 2PQWA 3EHQA 4JI7L 2NVYB 5IYBH 2KECA 3QHSA 3R6NA 1MMNA 4X62Q 2M16A 3PIP3 5I4DA 3MXGA 5IIFA 3MC0B 1VQ5A 3WXMB 3NTIA 2ABLA 2R3ZA 4RKLA 4FF3A 1ZBJA 3T4AC 1JOQA 2COYA 1JJ2P 1I4K1 2KRNA 5JPNC 1WFQA 2YHTA 5M3MH 3OTOL 3PO3H 4OB0B 3HFZB 2EYHA 5CO7A 2MHVA 2I2LA 2QQ9A 4FSXA 3SGIA 4POGA 1JB3A 1SJHD 1W70A 3JCMe 3FHWA 2QQAA 2DEUA 4OXPA 2P0KA 3GF5A 4LNQA 5CKFA 1AZQA 4E7IA 2DNCA 4KN7C 1IKMA 3EH1A 1BCPB 2HD3A 1BCMA 2D62A 4RCOA 1BBZA 3CPFA 4EQPA 2A0FB 3J80c 4UP7A 3JCMQ 1UHFA 5GQOA 2DL8A 2DVJA 1K9MU 2ZPBB 3MXNB 2EJ9A 2YU9H 5GAMj 3UE0A 5CK9A 1V1PA 4KH0B 2YRCA 1AWOA 2QTXA 2ZTDA 3Q24A 1KRTA 2O4XA 2B63G 4K11A 4BY1H 3QZ5B 3OYLA 2F0QA 1VQ8T 2KXCA 4J9HA 1O7LA 2HSEB 2QGQA 3FKIB 4DGZA 3MEAA 1WD1A 2QAZA 4ZLTF 3VS3A 2ASBA 1FVIA 5E4WC 4YCUA 2YUNA 1Z9QA 3SE0A 1Z7TA 4HSVA 1GVPA 4DF7A 4JI6L 2IL8A 1D09B 1LNXA 3CCUT 2K5HA 3U4VA 1Q81U 3CHBD 2COWA 5M3FG 2NWMA 2SOBA 2RM4A 1VQKT 5I22A 1PLFA 5HK3A 1X54A 3LX0A 2K7AA 3FPUB 5L23A 1VQLQ 1ARKA 2JA6H 1SNQA 3CCQT 1B34A 1I4GA 3M7GA 3F2CA 1IO6A 1WX6A 2EOTA 1BBXC 4E7SA 1X27A 5IP9G 4NP5A 3M4OH 3TS2A 1C4QA 3A8JE 3H0HA 4DV1L 3QOJA 1RADB 2A36A 3BS1A 3HRUA 5D7UA 4G4KA 3Q0AA 4X3UA 1PTOC 2EYLA 5EAYA 5C0XH 1AN8A 1VQ7A 4E7JA 1IB8A 4C1NK 1LOJA 3HOUH 3HOZH 1XOVA 1W6JA 3PSIA 1QWYA 2L2PA 4GLMA 5A0DA 1EZZB 1AP0A 1TVXA 1V8QA 2NWGA 1Q1EA 3QJ6A 4NS5A 4OMLA 4B3ML 1XNQQ 1KNEA 2F52A 4L5GA 3VS4A 3BZCA 4M1UB 4B3SL 1LJOA 2QA4T 4LF6Q 2PZ1A 4ZKBB 2MI6A 4A4EA 1VF7A 1ZEQX 2A19A 2VGNA 3I5RA 2M00A 1LCKA 3K80C 4EX5A 3CMAQ 1VYTA 1MIUA 3J80E 1N36L 4BXXG 4KUDK 3CP0A 2CQAA 2PQAA 3SWNC 5I21A 3CU7A 5JEAG 4OO1I 4KKSA 2DFUA 2EJFC 3DWPA 2CCZA 3U9SA 4KT0E 1U3OA 4J9GA 5GAMf 2KHJA 3OSSC 3E19A 2YDLA 5IHIA 2J4XA 4GLKA 4AFSC 4E2FB 3DUZA 3K7UC 1M30A 1YNZA 3KFVA 4M7AF 3EVQA 3HOVG 5JJZA 5BN4A 4QGUA 1ESRA 3NQTA 2NZHA 4GKKQ 5CCAA 1NLPC 2K5FA 2I07B 2GVBA 4C0DB 1QOHA 1Q81C 1Y1VB 1K73R 4RA8A 4A3DB 2MQHA 2F3VA 4KKTA 4A54A 1X9NA 4QIWE 4ORZA 4M77D 3GTKB 3E6ZX 3QG1A 4JJCA 4Q5WA 3L1AA 3OBYA 1WHKA 1EY0A 1RHPA 4DAYA 1VQ4Q 2FO0A 1AE3A 4O2DA 1MNEA 5IY0A 4DR5L 1W2BS 2EGAA 1GHJA 4O0AA 2K32A 4PG3A 3HPWA 3E5SA 1EWHA 3VR5A 4BY7B 2MFIA 2L3RA 5HGQA 4A3KG 3BYTB 4M7AG 1OX9A 2O88A 5IGFA 1AW7A 4JI5Q 1XNRQ 4JYAL 1WIEA 3QYGB 1D5XC 1QNKA 1XMOL 1D0XA 1STNA 1QWFA 1M90U 2XD0A 1K8AU 3MZ5A 3VR2A 3INZA 3S2DB 3J7A5 1PKTA 4FYVB 2AWOA 3H09A 3P7JA 4A4KA 4YCWA 3HHTB 3M0QA 4GOPB 4A3IH 2JW4A 2MIOA 2RJFA 2EPBA 4Y52H 1CZWA 3PE0A 1PH9A 3I4MB 4J15A 3KBXA 2XKOC 4N8FA 4PMBA 1EQQA 2ID0A 1LTGD 4PNYA 1B4OA 2H8HA 1EQVA 3MO8A 5JVG3 1N9SA 3OWFA 3CXCA 4ELZC 3CKIB 4R8IA 1BUVT 1O7IA 2F0HA 3N52A 4II1A 1VQIA 5A2QE 1PZJD 5EGTA 1UEAB 2Q8RE 1CT1D 1EFID 3RZOH 2GF7A 3VU3C 5GMKj 2N3SA 1E1OA 5GJWB 4IFDH 4Z89A 1YHQA 4L8JA 2WAQG 1ZUKA 4TSSA 2UU9Q 4KGZB 1X3GA 4F16A 3K8AA 4HVWA 2MMPA 1CK1A 4UPAA 4HSPA 5BR8Q 3RNUA 1I6HH 2F0TA 2QI2A 1R4PB 4P5NA 1KLGD 1OXSC 3I56Q 4R4IA 4JG2A 1ET6A 1YZ6A 3GTQB 4B08A 3CF5A 5A0GA 3TREA 5C4XB 2BCOA 3CC4T 1RD9D 5IGCA 4LF4Q 2DA9A 2A28A 5JOBA 4F17A 2HEQA 4JRIA 4IALA 1WTVA 2NVQH 3S3NA 3FKIG 1TWFB 4GNXB 2DY8A 2O9SA 4RGOS 2C5CA 5KYNA 2L15A 4MN3A 4U673 3M4GA 2AKLA 4A4HA 4GZYC 2DZCA 3PCOB 2L11A 4LF5Q 4Y28E 2DY7A 1HNWQ 4BBSB 1LUZA 2ZTCA 3JCMJ 4OO1H 1N27A 2XK0A 5GANj 2F0PA 1HYOA 3PUXA 4YWLA 2NUZA 2GN5A 4M7AA 3PGZA 3I70A 2GFAA 1M90C 1EFNA 2DGYA 2B39A 3AFPA 3H91A 3JCMd 4QQGA 1VOMA 2DJQA 1YCYA 5GAHC 1ZSGA 1TS2A 3VYHB 5AT1B 2BA1A 2R7FA 4GKJQ 3RN2A 1HR0L 5HKCA 1ABQA 5D6YA 1TOVA 2DYBA 4J9IA 1VQ5Q 1UWVA 1PD0A 3I4LA 3GO5A 1TWCB 3KF8A 1UDLA 1HZBA 4DR3L 3CC7T 1QP3A 4RH6A 2ZJRA 2ENBA 2VQEQ 1RLQC 1SFOB 1FMKA 1PNJA 4FT2A 2LP5A 1Q7YR 2J7ZA 3TZDA 3JRZA 1RF2D 4MZ9A 5GAOn 4C3JG 4J9CA 4FCYA 5KYIA 3EGUA 3T1YL 1Y8OB 1MUZA 1JB0E 1TU2B 3NGPA 1KD1R 1KC8R 1KDCA 4M7AE 3SK6A 1IGUA 5EPLA 4HCCA 4JDSA 3HP3A 4OHJA 5IT9c 2JMAA 4DV0Q 4CHTB 4KMUC 4CJ0B 4DV5Q 3MXUA 2NZOA 2Z4IA 3IKJA 1QP2A 4DQ2A 1LYLA 5G3LD 1D7QA 1TWGH 4L6V5 4M7DB 2JTFA 1Y7XA 3K7AH 3X25B 3GTOH 2Y0SB 2DETA 4QQDA 1RCVD 3FPPA 1HD3A 5GMKi 4PZ7A 2CZ6B 4X65Q 5JJIA 4L5RC 1XXGA 5FJ8H 4DV6Q 3BY7A 4L59A 2KMTA 3JAME 2AK5A 3R2IA 2HHHQ 3A8IE 2JM8A 1NYFA 3KDFB 1AZPA 3G6ET 1SNPA 2N88A 3LGJA 4A3DG 3M0TA 1HR0W 1A0NB 1CQVA 4QB4A 4HIKA 1F9QA 3OS1A 4RTUA 4JI8L 1WXUA 2CP0A 5GANf 3MEUA 1M1GA 1UGRB 3CD6A 1XNIA 4KH1B 2FHTA 1NPRA 4ZK9B 2WAQE 5COYA 1BBWA 2YXYA 3HS0C 2BIVA 1UE7A 4A3CH 1PRLC 1WTQA 3GD7A 2EGCA 3OBWA 1TU0B 3D0FA 5KGUA 1PH8A 4G7OC 3S17B 1VQ7Q 4BY7G 1DD2A 4OX9Q 3QIIA 4D8DA 1GBRA 2H3JA 2RSNA 4A53A 3TMEA 4BA1I 3CW2C 2PTKA 3AFQA 1YNNC 3UDGA 3J81c 4DFAA 2OWOA 1QWEA 2DVEA 4DBQA 2Z6BA 1NMFA 2K5IA 4DR1L 1BNZA 4FF1A 3L9AX 4MNOA 1D3BB 1YHBA 4X3KA 3S15H 2M0YA 3MP6A 3BVZA 4Y91A 1VMPA 3M54A 5ELFA 3THKA 4EMHA 5FROA 1ACMB 4PJOD 2WV6D 3I4MG 2YUOA 2WKDA 4CC4B 5IT9E 4C3IH 3C94A 1TWAH 3T51B 1IBLL 3CC2T 2F5TX 5CAIA 1PD1A 1U4MA 4HMJA 4OIJA 3EG1A 2SNSA 3KF6B 1ML0D 1OZ3A 5IH2A 1W6KA 3OS5A 3RR6A 1WHJA 4DN4M 1GXDC 3Q8DA 3G71A 1CKAA 2K79A 3CPWP 1NBWA 2LJ0A 1STYA 1SXTA 1E3PA 3G48A 4IUPA 2YT6A 2KOLA 2MWPA 1S5FD 1Y8NB 4E7ZA 4PMWA 4DK0A 4DEXA 3JB9J 3R6OA 1I4QA 5J22A 4X9CA 3EHRA 4FXGC 1Q86U 3KLSA 2OF1A 3MFYA 4X64Q 3CCRT 2F4VQ 4BBRB 1B3AA 1F1BB 4C8QD 2PCFB 3OW2S 3R2TA 1K8AR 2E2DC 4AMCA 4ULLA 5C4XG 4DBRA 3ZL7C 5DLOA 1B07A 5LMNQ 1WXTA 1SRLA 5CIUA 4I7AA 1QKWA 4JRKA 4V2SA 2LC4A 4CGYB 1I94Q 1M1FA 1XNQL 4QUFA 4QVDA 5FU6B 2LKVA 1LABA 4A93B 2QEJC 1RDPD 4J9BA 1RAAB 1YWPA 1X01A 2R92B 3QYHB 1OI1A 2QDYB 2KEAA 3J81E 4BBSG 2K5LA 1X56A 2K5QA 3QR8A 2NUTB 1X2QA 5LMUL 1LPLA 2RJCA 2XG8D 1W2BA 2RPNA 2J6FA 2FL7A 1OXTA 3KXTA 2YTVA 3MXPA 3NQIA 2GCXA 3URGA 4HJAA 1WCMH 1IBMQ 4M78F 3GTJB 2JA8G 4ZNXA 1IRXA 2NVTH 5LJ5d 4MDXA 3AMUA 4HJ5A 1YJWA 1D6EC 1NMGA 4M8AA 4C92D 2QK0A 4PJLA 3D8GA 5IWAL 2WSFE 4GOPA 3CCST 3I4NB 2VXWA 3S16H 2F5KA 4AT1B 4POFA 2EYQA 1E22A 4A3EH 5GAOq 1JO8A 2FEIA 3BDOA 1PRTB 1DOLA 3H0GB 2PVOB 1UGQB 2A3LA 1YJNT 1E2WA 2K7VA 3R3OA 3BW1A 3BZKA 4A3GH 5I2XA 1YHQQ 1RTNA 2FRYA 1X6OA 3JCMc 2KVQG 1UNSA 4M7AC 3ERQA 4B3MQ 2ATCB 4KHZA 4CDEC 1U1TA 2R93G 1Q86C 2DE0X 5DM7R 1STAA 2EPDA 2KRSA 2NVYH 5FRNA 3A54A 3MAQA 1V1QA 3JCMV 4OGEA 3MHBA 5FLMH 1TUDA 2QQBA 1O80A 5CV6A 4DA4A 1X69A 3NTKA 1XNRL 2K52A 3UDXA 4M7DG 1NJIR 1KLUD 2FZCB 1UAPA 2Y0SG 3BYYB 2DXCA 1QILA 4QKUA 4LF9Q 1HZAA 2CW0D 2UUAL 5LHY1 1MV0B 2CWPA 4IPDA 5IP7H 3D3RA 1S5ED 2JP1A 3CQTA 4A4GA 4O1NA 3G1JA 2E12A 5ISRA 4A3FB 2RA2A 1SMXA 1PFNA 3JC66 4GNXA 1Y69U 2QGFB 2F0JA 3H6MA 2UXBQ 4Y7NB 2K3BA 1TS4A 1M27C 5CQXA 1FNWA 1G91A 5IAYA 4R4QA 4PJMA 1JOOA 1RODA 5K36H 2NUCA 2F1MA 3TP5A 3SD4A 1PXUA 4F14A 2LQKA 5AJ3Q 1BQQT 3R93A 3ASKA 1ZXTA 4ZYSA 2A69C 4PJNA 4KULA 1RAGB 3FB9A 1VQ9T 3OPOA 3J80i 1FL0A 1AZEA 1AWJA 1E6GA 5C44G 1O9SA 1YITQ 2BZYA 1BI0A 2E1HA 2UU9L 3GTMB 3JV3A 4X1VA 4CKCA 1HXDA 2K2VA 2QTVA 1OQKA 2UXDQ 4PFPA 1U1SA 2X4WA 5BR8L 1KTKA 1JRIA 2EXZA 1KQ1A 4JJDA 2KCMA 3VRYA 1B34B 4P74A 1UEBA 4EGVA 3L2UA 3NPPA 2KUMA 4N9TA 4TQUS 4HR7B 3S24A 1M4ZA 4DR6Q 3M4QA 3HOXB 2B2YA 1IGQA 1F77A 3HKZG 4KV6A 1D2BA 2GQVA 3UA6A 2XDDA 2D2CC 3PUYA 4FO2A 5L8RE 3P75A 4AYBB 2R58A 3T53B 3GTLB 1HK9A 4E7LA 1AOJA 1F2ZA 1P16A 3X20B 2LXJA 2Q2UA 1N33Q 4QIWB 4CC3A 2DBKA 3ZFJA 2JSOA 4Q5VA 1SMYC 2YV5A 1BIBA 4BE0A 1WYXA 2J0TD 1R4QB 1EY5A 4C1NI 3W1BA 4M7DA 4YWMA 3PMTA 2JN0A 3Q1JA 2PQAB 5I9PA 4OIKA 4GKJL 1NE3A 3P20A 3CMET 4APVA 2PVDB 4KD4A 3CMAA 5KNCA 2PUKB 1U5SA 1JWSD 1J5EL 1ZHIA 2ZPFB 4XQ3A 1MMAA 2BZXA 1V9PA 3CD6Q 3EROA 4JJBA 3KDFA 2VQFQ 3QZ9B 3I55T 3C1FA 1YNJD 1OXVA 3URYA 1CI3M 1RAHB 2B63B 2E2JB 5J39A 1N34Q 2RCNA 1U4PA 4BA2I 4PJJA 3K0YA 4RCNA 2K1BA 4JI3L 2DXBA 3JCMh 4ELYC 4M78E 1NSNS 1Q12A 4A93G 5I2MA 4J6WA 5FW9A 2AHOB 2A8VA 2EQUA 4R0KA 1AWXA 4O42A 2V1QA 4M7DE 1PRTF 5FO7B 3HGBA 2Y0SE 4DAYB 2QYZA 1KABA 1S1NA 2DYIA 1Y1VH 2EDGA 3F2UA 4C3HB 2FZGB 3STBC 2QASA 2HAXA 3VS2A 2HDMA 3M4PA 3V96A 2HNIA 4ZQ3A 3OQ5A 3M58A 5D6WA 4DBHA 3QSUA 2Y4XA 4X65L 3E9FA 4KLKA 1D3BA 3PV0A 3T9NA 5CR2A 1ILPA 4PFZA 1VQ6T 4C2MH 5IHKA 3NSWA 2CKKA 1AFPA 2F03A 2HHHL 3PNWC 5ELCA 3IQLA 1ESFA 2RB6A 1BCOA 1M8VA 2HCIA 2MO0A 3BDCA 3ZYYX 3I4NG 3I9QA 4RKUE 5C6AA 1PA6A 2MK5A 3P8BB 2IHEA 1B9NA 1JJCB 2F0GA 1AD5A 1K73U 3G71Q 1WI7A 2EVBA 1Q46A 5GAN5 2NN6G 3H0GG 1SF9A 3TEHB 3J80L 2YRDA 3IL8A 4JI0L 2VVKA 1VQ8A 3KF6A 1RKNA 3TBIB 1U9RA 1MV3A 2EIFA 3M9BA 3QIAA 2HUGA 4LF8L 2B8AA 2JMCA 4OELB 2KEEA 1ICWA 3CCVT 4EMKB 1DJRD 2RQWA 2D9TA 3AHUA 1D1KA 1U8RA 1W4SA 3LWUA 3CRKC 2PNRC 3QB3A 5M5XH 4DAVA 1WTOA 3L7ZC 3CCUA 4OX9L 3I4OA 1MMGA 4XTXA 1ZLMA 1NEBA 1QE6A 3SK8A 2E2IB 1VQKA 1TY2A 4GOPC 3OMCA 2Z6KA 5JEAJ 1DGSA 4A3BB 5IGBA 1VMCA 3VUZA 3ULJA 1X3EA 3HKZE 2F0VA 5I9OA 1BCPD 4J8QA 3CCQA 2EAYA 1PYSB 4AIMA 1WJRA 3W3AA 4IIMA 3OW2A 1IYUA 1IXRA 1J9OA 2IX1A 4Z02A 4A3FG 1XPOA 4ESRA 2ESWA 2KT8A 2RN8A 3E1SA 3KJPA 1M5Q1 2LS01 4JRPA 2NZ1D 3OYIA 4G7HC 4ZUIA 3I56A 4OL7A 5FLXc 2KBTA 4KJOA 3GTGB 2DJFC 2KQWA 4HTHA 1HRJA 1I8FA 3M9QA 4RTYA 2WSCE 1KAWA 2MYSA 4OMMA 2DJZA 1ZX6A 3S3MA 1YJWQ 2E41A 4M75F 1J3TA 4F04B 1PV4A 2I5LX 3QOLA 3K81C 4JOIA 1WOCA 2M1HA 1VF5C 1TWFH 3I7FA 4M7AB 2R6GA 3HOWB 4XTWA 2H4OA 2JXBA 1Y1WH 3DLMA 4HT9A 1VDZA 1LTAD 1STBA 3FEWX 4U68A 4UC4A 4N4GA 1EY7A 1TS5A 1K73C 2ZZDA 3X3MA 4BBSH 4GNXC 4JI1Q 1H9MA 1KK7A 3UDFA 5LJ5g 3KF8B 5LMNL 1CA5A 5KYLA 3A55A 4DAPA 1I94L 1TUGB 5KIXA 3HOXG 4UAIA 2F0MA 3GTPH 1I07A 1RAIB 1BI1A 2KDSA 3RZDH 2UXCL 4LMQD 1QCOA 3JB9I 3M53A 4K5WA 2YLCA 1AEYA 1CSQA 4FYYB 1B70B 1NCVA 3BZDB 1PHJA 4GLVB 1X3QA 4M75G 4JBJA 2ZT9C 2LMJA 4IUUA 1QUQB 1HNXQ 2AQ1B 4FXKC 3FDTA 1I3QB 4X3SA 3JCMb 4AYBG 1N5ZA 1SYCA 1DONA 1PH1A 4IN3A 1ZSZB 1G3WA 1Q3LA 5CV8A 1I5OB 2LX7A 5FK9C 2GTJA 5EBCA 2P4RA 3RLNA 2QILA 1TIID 3EG2A 4RWSC 3K58A 4UP8A 2WAQB 3RN5A 3C2PA 1XJVA 4S3SA 3I3CA 5IYDH 1IBML 3S1MB 3M7NA 2LVMA 1A0IA 4HN7A 1TWBA 3S1QB 1H8KA 1G3YA 1ZYRC 4K2LA 4OMPA 2NTTA 4OWWB 2H3EB 2R7ZH 1T0JA 4PL6A 1EIYB 2B2YC 1WQWA 2B8GA 4A3MB 2E64A 5GAN8 3PIOA 4KRTA 1ENCA 4ME3A 4KJNA 5FLXE 1KSWA 1TR5A 2R5MA 3A56A 5HY6A 4DV2Q 1TUCA 1KQ2A 4DXFA 2DZ9A 1WHLA 2O9VA 1Q7YU 2L4NA 3STBD 4RFBA 1S40A 4M78C 4UY8C 2UUCQ 1UG1A 1SNOA 5D14A 5I2SA 2RQUA 1PSEA 5EKIA 4D6WA 2AUJD 2PZWA 2JZ2A 2DO3A 3BE3A 3CXCP 1L1OC 1S5BD 1VIEA 5LJ5h 4M7DC 1KD1U 1M2VB 1UE9A 1KC8U 2X69A 3I2ZA 1PH4A 3H41A 4A4FA 3D4RA 2FRWA 2FB7A 4JI2L 4C3HG 4HXJA 3GPLA 4AQYL 4OWTB 3F2DA 2YUQA 5T1GA 3V8KA 1PTOH 4LDWA 2K50A 3S1NB 5CV5A 4LF9L 1CUKA 2DRMA 3DM1A 2KCTA 2A68C 3S2HB 4XTUA 4IFDI 2KVMA 3DEOA 4BY6C 4LWCA 1WFWA 2LZ6B 3AYHB 4LDXA 1HPCA 4TVAB 4UHVA 8ATCB 2HQLA 5LJ3g 1QLYA 2JK8A 1G6ZA 4RUGA 1EY8A 2F69A 2UXBL 1KJWA 3OY9A 2K5DA 4K8JA 4XT1B 3EFOB 1YJ9T 1EYGA 2EGEA 4M75A 2DEQA 2XHCA 4HKEA 5IN1A 1EEID 3VKIA 3HFNA 2K5WA 4HAEA 3KK7A 3VR6A 4C3JB 4X34A 2C0IA 1V1OA 4JK1C 1GUNA 2M51A 2TSSA 5CBEE 5AJ3L 1K9AA 2B3GA 2ICEC 2B29A 3G7ZA 1HJPA 3J81i 3U9OA 1ZA2B 4ZTJA 3BDUA 4FW1A 1BIAA 2LY7A 4MIUA 2DILA 2RHIA 2B2WA 4IPGA 3SXHA 5GAGC 2UXDL 1K9MC 4DNTB 1EWIA 3ZJYC 4A3LH 2VUMH 2JVVA 3P8DA 2ZM6Q 1S5CD 5GMKl 1UE6A 3LH5A 5EG2A 1OXUA 3BG3A 4HMIA 3QUIA 3ER0A 3M57A 4A3BG 2EYFA 3D4DA 1PH7A 1G83A 1Q7YC 3M3YH 2IHFA 3K6OA 4CC7A 1K83B 2PMZB 2CUBA 3GNGA 3DM3A 3JB9H 4M75E 4TVRA 3TQ7P 3HL8A 1IHWA 4KHPQ 4RKBA 5GAOl 1XTCD 3SR1A 3UDCA 4ZN1A 1DYQA 3QO2A 2A6HD 4AYBE 1KD1C 2EJGA 4JJNK 1T0HA 1KC8C 1CQFA 1Y57A 1I50B 2BKDN 1PYBA 5E7NA 2L0AA 1JMCA 3CC7A 2KBNA 4DUYQ 3S1RB 1B2TA 3EG9B 3MPUB 1WZOA 4JZ3A 1KQSP 5FRMA 1S5DD 4BBRH 2KEDA 1CSKA 1YN8A 2ZPIB 3QO3A 3CCET 2PU9B 5CQYA 1QCBD 3VS5A 4CKBA 2ROTA 3CCJT 1EZ8A 2QCPX 2OJ2A 1IHZA 4G57A 2MO1A 2Z6KC 3Q22A 3PO2G 4LUEA 2VGMA 4WRDA 2M0OA 2JTMA 4CRIA 5GAN7 1I81A 1CHPD 1AHJB 2R5AA 4OB3B 2XDBA 3ZEHA 4RAUC 3HOWG 2SEBD 3VDYA 1SYFA 1CKMA 4JV5Q 3VS7A 1HXYD 4PQXA 2V4DA 1CZGA 2HKNA 2I0NA 2V1RA 3FMCA 4CDCC 2R92H 1EEFD 5IYCH 2ZXOA 4XYOA 1C7YA 1BK2A 1O75A 2DK3A 5FU6C 3FRPB 5IT9L 1VQ8Q 1G2TA 4AFZC 2ZJQA 1N34L 3C4SA 3UF4A 4OP0A 3RMHA 5DY9A 4DV4Q 2DTHA 3HTRA 1BI2A 4FYWB 2EQKA 3EBEA 3LLRA 1VYVA 3CCUQ 4KTAA 1U4RA 2JA7B 3MCAB 4AFQC 2EJMA 3GTJH 4ZAIA 4LF7Q 1KNAA 3G6EA 1T9HA 1VQKQ 3VRZA 1TXYA 4GN5A 4JOIC 3T1HL 1FYNA 1M3AA 2QQSA 4EMKA 4HVUA 4A3JB 4LE9A 3E9HA 1DZ1A 3UI2A 1KRSA 3BU2A 3CCQQ 3PMIA 1HA5A 1G8XA 3JCMf 1CFMA 1CM9A 4CI0C 4C0ZA 3PTAA 3GLXA 2JXMB 4DXGA 3FEOA 4LFCQ 3X24B 5KRUA 5LJ5e 1LACA 1XTDA 1JR0D 4Z8AA 2DL4A 2RMOA 1OU8A 2L55A 5DLQE 1QVGP 5GAN2 2J7IA 1PRTC 5TSSA 3LW5E 3A8KE 4A3MG 4M7DD 1MJEA 3OS0A 1H9RA 1CKNB 1SSFA 2HDAA 1SNCA 2RCFA 5C3EG 2V26A 4K5VA 3FVQA 4B3RQ 1IBKL 1MSHA 3ULPA 2QDLA 2QA4Q 3TVTA 3J81L 2X51A 2D5DA 3FRNA 1SE4A 4R56A 4IJLA 3RBBB 2HCCA 3JAMc 2F1LA 2HDLA 2LDMA 1C8CA 2RD1A 4JCVE 3QXEB 1PTOD 3T16A 4UDUC 1VQOT 1G51A 1HFGA 5E1FA 4YHHQ 2CREA 2H5XA 3CC2A 1A6XA 1VQNT 1RUWA 2CZ0B 1FYCA 2HQXA 1K8AC 1K1ZA 1E6HA 4Y7NH 2RQRA 4M77B 2EWNA 3H9NA 2MP1A 1R77A 2KHIA 1D5MC 1WD0A 2A73B 1NJIU 1UECA 2JA8B 3GOXA 4LUOA 3A98A 2RJEA 4DOWA 1NR2A 1RIPA 2LNHB 3PQIA 1NZ9A 1YITA 1RTOA 2I0QA 1OXXK 3CCMT 2LT4A 2F2WA 3CCRA 4KY5A 2MUYA 1U5KA 2JA5G 2Z0SA 3C0CA 3DEPA 2KSSA 1VQAA 3FJPA 2D0OA 2IX3A 5GAEC 1JQYD 3UT1A 1EY6A 5CORA 1C9OA 1F9SA 1QUQA 1C0MA 5EPJA 3VA5A 4A75A 1N32Q 5C4JB 2FYKA 1O7ZA 1FXXA 3TP8A 2F2XA 3GBQA 2WACA 1SPKA 2V8IA 4PZ8A 1ZSZA 3CBMA 1T3SA 1Q90A 2L8DA 2MPXC 2RO0A 3V7RA 2ENMA 5GAN6 2RHQB 2PNIA 4XU3A 2MGSA 4DV3Q 4IJHA 4Y92A 4R4TA 2MJ8A 3WWVA 2R93B 1LT5D 4M78B 2RDHA 1TWHH 3OIPA 5M3MB 3RUXA 1K0RA 3A1PA 3K5NA 3PO3B 2CT3A 3RLFA 4N4IA 2K04A 1W2BP 1WQ7A 1Y8PB 4CJ1B 1L1OB 5LJ3e 2X4YA 3RMSA 2N78A 2A1AA 3JB9D 5LL6X 1HNZQ 4NXML 4EVOA 1PHTA 3GTLH 4JI1L 2XDPA 4LJZC 3CBPA 5GJVB 1LT3D 1JT8A 3OYJA 3V2TA 5CVIA 4M75C 2BUDA 2EQMA 3OYNA 5KE3A 4X62L 1Z9ZA 2RK2A 3H3VC 3G4ST 2GA4B 2C9OA 3O5ZA 3IRBA 1FX7A 4BY6B 3DLLA 3P1HA 1BYMA 1P92A 4N9PA 3CCSA 1LM0A 2Z1CA 1HNXL 5AYFA 4BY1B 1VQHA 2B86A 3SFMA 2B2WC 2WIIB 1M2VA 4NOYA 4RGTA 3EAEA 1YJNA 3OSVA 4BUGA 7AT1B 1MD2D 3NXWA 3S14H 2A6EC 2B63H 2E2JH 5C44B 1S72T 4DK6C 1GKHA 4ABNA 2K3YA 2SRCA 1GUOA 4UP9A 1EZ6A 2O5JC 2M02A 1STGA 2BE5C 5DNFA 3SK4A 4AH6A 2XTIA 2E74C 1H3ZA 2DNEA 4ZGEB 1W1FA 2JA6B 3CC4Q 2DIGA 4MZPA 2EY6A 1NTGA 3NK9A 5M3FH 4DUZQ 2HT1A 1OO9B 6AT1B 4O5VA 2F2VA 1X3FA 3HOYG 2EJGC 4LW1A 2D9UA 4NB3A 4OONA 3M4OB 1XX8A 3EFOA 1SYDA 1YHAA 1A8VA 3HKZB 1RLPC 1NAPA 1Y0MA 3H94A 2BZ8A 2RHZA 3QWXX 2E75C 1H9JA 4DU9A 3JCMP 5IP9H 4X9DA 2L3QA 2OTJT 4GLAC 4DOVA 3CBOA 4JVZA 2JA7G 2K75A 3DB4A 4N4HA 1D1IA 1X6GA 1JOKA 4L5TA 2E5LQ 5CV9A 1U06A 4FXDA 5E3FA 2P0PA 5J3BA 4A4IA 4IURA 1IW7C 4A3JG 4RG2A 4FF2A 4NDXA 3OYCA 2DMOA 3C95A 4P72A 5K5PA 2CS7A 1T5EA 4IUTA 4KBMB 1M8AA 2ZAEA 1WNLA 1VQ9A 1MBYA 1GUGA 2YTXA 3MEWA 3S6WA 4JS4A 4XTYA 2EYMA 2N49A 1ZUUA 1Z47A 5LJ5f 2YLBA 3WVDB 1KDBA 1N9WA 3CC7Q 1YI2T 3JCMX 2EYZA 4RTVA 4BXXH 2P0QA 1KIKA 5GAN4 4M77F 4PZ6A 1PMRA 3RIRA 4YY3Q 4DPGA 5JEAH 8AT1B 1QB5D 2EW3A 3JCMW 2LCLA 3A7LA 4DR4Q 5IGGA 4NPSA 1I6HB 4ZTFA 2RHYA 3EG9A 4EMKC 4LF6L 2KROA 3SDZA 3A0JA 1B7TA 3OSOA 1NPPA 3DHQA 2EZVA 2YTYA 4HIMA 1M4VA 2COZA 4J7IA 1ICFB 4LDYA 2E5KA 1ET9A 3HOVH 3A74A 3M0UA 3HRZC 3M4YA 4NL3A 2NVXB 2VASA 2HQHA 1MHNA 4PV1C 3E3XA 3WDNA 5HGTA 1E24A 1ZQ1A 2CP7A 4M77G 1EIFA 1A2TA 2PMZE 1GRIA 1I6VC 4JI7Q 2VY3A 2PYKA 3A8LB 1TG0A 3LGFA 1EQTA 1PFMA 4J9DA 3I8ZA 3H0IA 3GTGH 1LTBD 3KFUA 5EJWA 1JWMD 1MKHA 3NBHB 4GKKL 1UJ0A 2YRVA 3G6EQ 3EQLC 3W2DA 3UWNA 3HKSA 4XU0A 3VYRA 1S4ZA 3QBYA 3CMEA 2IPKD 2Q2IA 2AWNA 3VS6A 3OTOQ 2VZAA 3NFCA 2QEXT 4A3KH 1K3BC 4DUYL 5CKEA 1F9PA 1NUCA 3DXJC 4OB2B 1SE3A 2RSOA 4XQNA 4A3IB 1PH3A 5IYBG 3RKWA 1OYXA 3MEFA 4FDBA 1WHHA 5ECAA 3MWYW 2GGRA 2GVAA 1V43A 1S72Q 4JBWA 2ED1A 2NYZD 1VQPT 2G5DA 3R8BA 1R0CB 1GUWA 3ZBDA 4MTNA 2CP5A 1VQMT 2WP8J 4M78G 3E0EA 5GAMg 1FR3A 3H6ZA 1BXTA 1C48A 4BE2A 3F1ZA 4KD3A 5M3MG 3PO3G 2RK1A 1QVFS 1VQEA 4JI5L 1G291 1VUBA 3B6YA 4JV5L 1VQGA 3EFXD 4PMCA 4IPCA 1R9TB 2ES2A 4KK7A 3L42A 4BI4A 1MJCA 5FKAC 1GXIE 1SAPA 1II3A 2IT1A 1Q82R 1UB4A 2IPOB 2XN9C 3HZXA 4YCVA 3M0PA 4JI6Q 3W1GA 1CKNA 2P4TA 2E6ZA 2XIDA 2CH4W 1CTMA 1G2BA 1RABB 1HZ9A 2EQSA 4DV7Q 2HIXA 4DNRB 2NLUA 1L2FA 2EQIA 5FO9B 3RDVA 1MSGA 4FL6A 3PUZA 5DM63 4JC0A 2IY5B 2UUBQ 1VQ6A 1HTPA 1ZSZC 1NYGA 4X6AH 3CC2Q 1PTOF 3FC3A 5JJLA 2KAFA 2ZCFB 5HURA 1YNND 4C8QB 4BY1G 4KUIA 2DF6A 1WPYA 1L0WA 5JVH3 2O2LD 4MTKA 3ME9A 3PUVA 2HD0A 3AU7A 1G6PA 3NENA 3CRLC 1TS9A 1MMDA 3CCLT 4EIKA 4KGXB 5IXFA 2AKKA 3SHWA 4LD6A 4M77A 4DV1Q 2XMFA 1DXMA 3FKIH 3MHXA 4RTZA 3CCRQ 2KXDA 3META 3CCVA 1GUTA 2DXTA 2RQXA 4JUVA 4J1MA 3EGXA 1Y96B 2XU8A 1GJXA 5ELOA 1YBYA 1JORA 3F8TA 4IOAA 3L2PA 2JA6G 5LJ3d 1CSPA 2CSQA 5CV4A 2OEOA 4LF4L 4IUVA 3G6JB 4J5YA 3OW2P 2DNUA 2V8KA 4H44C 3BJUA 4B3SQ 2WINB 4FIBA 3NUCA 2E5QA 4MHEA 2A74C 5C6SA 5C0XG 2D8HA 3TDQA 1SSHA 1N36Q 1E7OA 4M75B 1WYDA 3HOUG 3K57A 1K28A 3PIO3 3HOZG 4LF5L 3S2HH 5IGEA 2KR3A 4QJFA 4LUDA 2N55A 1HNWL 4C92B 2LQNA 2CHBD 1H95A 3QWYA 2OTLT 2M9UA 5G3LF 4M78A 2LQ8A 2DUDA 4M77E 4YHHL 4K8IA 1I4XA 3GV6A 1B44D 1L1OA 4BE1A 3A8MB 1WLPB 1TXQA 5FLXL 5M5WB 4C3JH 2DD5A 2ECZA 2CYZB 2YUPA 1EU3A 5KYUB 2F0KA 3K59A 4XU2A 3GQBA 5NUCA 1VYUA 3L2ZA 3CCSQ 1UGPB 1TWGB 3VV0A 2K9GA 2OXPA 4KKUA 4LD9K 2F0DA 5GADC 3K7AB 3GTOB 3MJXA 3MKDA 2K6AA 2KI7A 4QUCA 3RKYA 2M9VA 3TZUA 2VQEL 1TQOA 4X66Q 5C3WA 1YJNQ 3M56A 5J26A 1N32L 1J6QA 3UDIA 3RERA 1Q8IA 2G3RA 5EQ0A 1MGSA 3RNJA 1JBMA 2KGTA 4ANJA 2DTOA 2QG9B 2ZPEB 3X28B 3ND9A 4DV3L 3SB2A 1VCIA 1YIJT 4DAMA 2EVRA 4DV0L 4DV5L 2LJ1A 1NBEB 3TSZA 1S3OA 2B8FA 2X6LA 1XMOQ 3NTHA 3TQYA 4A3DH 1AH9A 2JNGA 3M0RA 4RGNA 1I50H 1WI5A 3H15A 3OYEA 1YP5A 1HNZL 4QF4A 1M9SA 3S1RH 1IYJB 4XDXA 3PT9A 1H3HA 2RA4A 5DM73 2KHSA 3GTKH 4DV6L 1X43A 1UHCA 3IFTA 1JJ2S 4PJOF 4J7FA 4M7AD 4P75A 5D3IB 1XPUA 2ATWA 2B2TA 2KT1A 1QCFA 3MTSA 1IYVA 2DTIA 1DJ7B 4B3TQ 4BY7H 1OX8A 1LTLA 1PYWD 4I65A 4ODGA 2K2MA 2K5VA 5M5YB 1M1KR 2FMMA 2F0SA 3L3OC 1D0YA 4A3IG 3E2UA 4L6TB 1EIGA 1YCSB 2Z0WA 2I5HA 1VQ9Q 4FYDA 1QZGA 5CR3A 2Z9HA 1EU4A 3A8GB 2F3WA 5FOBB 3S2DH 2EE1A 1U4LA 2CKZB 2VB3X 5IGDA 2GFUA 2KYBA 5DEHA 1HUMA 4C8QF 4PJOG 3I4MH 2RHXA 2Z8LA 3LGLA 1DM0B 3MVVA 1SYEA 3H8ZA 4O6JA 1VQBA 4ZRZA 2ZPHB 2JA7H 2R7DA 3DMUA 2X6GA 1SG5A 1TTHB 3OYMA 2E70A 2LX9A 1X2KA 2HBWA 2GQIA 4C56C 4DUZL 2EKHA 1B1ZA 5CMDA 2FPDA 4OMOA 4IFDG 1EWCA 2XIWA 4KN4C 2FMCA 2FHDA 2L3PA 2BE7D 2RH2A 4C0FA 3CXCS 1LO5D 2XVSA 4K6DA 4DKAC 5FO8B 4H0LC 3RD4A 2A69D 3AEVA 1R0BG 2EQJA 4HJ9A 2KENA 5GANg 1JCKB 1WTHA 1IKLA 3KOJA 4KHVA 1I4PA 2CP6A 4XTZA 3WVEB 4XQQA 1N8RR 1KXLA 2F3IA 1NE8A 4XQJA 2EYPA 4C8QG 5GAMe 1RAFB 2E5LL 1OZ2A 1YJ9A 4GS3A 1SEBD 3K5MA 2HKQB 2MWOA 3LNNA 3GTQH 3QDRB 2KCCA 1VQLT 5DAUA 2K57A 3D7SB 5KCHA 5C4XH 1PH5A 2QA4A 1D1AA 2QQRA 1HR0Q 3ONAB 3PO2B 2F0WA 4RCBA 5FWBA 1M3BA 5KYWB 1BOSA 2JS2A 5JJKA 4C92F 4F7XA 4RTXA 3CMEQ 1ASYA 1EYAA 4DEYA 5GMKh 4IKFA 4OO1G 3EFRA 1NLOC 4X64L 2XSCA 1ILQA 4M4ZA 3TP6A 5KNDA 3SVMA 2F4VL 1X55A 1Q1BA 2K33A 3TU4K 4LDUA 3NBHA 3I55Q 5GROA 3OA6A 3OS2A 4YY3L 1X75C 2EYJA 1PH6A 3HFOA 1WCMB 3I73A 3JAMi 5FU7B 3PF5A 2K4KA 1SMYD 3GDEA 2XWJB 4JW0A 2E3HA 4RHRA 3A7AB 1SYBA 4HJ7A 4LN2A 2E10A 3TEEA 1JE5A 3J81j 2P5ZX 5A2QL 2RVLA 2JA8H 2O2OA 4LAAA 4E6IA 3CMAT 4A3EB 1B50A 2LNVA 4DR2Q 1EYCA 3EG0A 4C92G 1TWCH 3I90A 4M77C 2HIVA 4A3GB 2EY5A 3L2QA 3NP8A 4PJOA 1LTRD 5IE8A 1KG1A 4QVCA 4LDVA 1SFOH 2EY2A 4XU1A 3CCEA 1NR4A 1WJJA 2X3XD 4A63B 2K4YA 1X32A 3CCJA 1QVFA 3D4WA 5C4JH 2J6KA 1VQ6Q 1GO3E 1WVLA 4J6XA 3VS1A 1MGQA 1KQSS 2LRQA 4OGCA 1KL9A 3VR3A 2E2HB 1A3VA 2R93H 2PW7A 4J9FA 2CSIA 4WJ4A 4JI8Q 5C3EB 4DBFA 1X3PA 3NPFA 1UTIA 2HSPA 2OCEA 2WB1B 1LTID 5FJ8G 2K14A 1B53A 2CT4A 4J8OA 2Y4YA 1QG7A 4K14A 1HA6A 4C8QA 4IUNA 2QGGA 3TRZA 1VQ4T 5LMNW 3CCVQ 4PJOE 4F7UB 2EY1A 2WFWA 2EBPA 2RQVA 1BU1A 2SNMA 1ZBXA 2K6DA 3OB9A 2I5MX 2JUFA 5J1ZA 2DL7A 4QCLA 3OYYA 1VQDA 4DR1Q 2VB6A 2CP3A 1K8OA 2XNAC 1Y96A 4ZCKA 2RQTA 2DJGC 4A3CG 3J7AF 4B9WA 2D6FA 2F0EA 4JI4Q 1AVZC 3HSBA 2NN6I 3TP7A 2J05A 1OU9A 4QVZA 4DV7L 2BH2A 1G8ZD 1E2VA 2VS1A 3M5AA 4GLXA 1HQRD 1G3SA 2OI3A 1SR3A 5C44H 2RDGA 3MFGA 1PRMC 1IBLQ 4C8QE 2UUBL 2OQ0A 4DR7Q 4DK1A 2JA5B 1GCQA 1RI0A 3S17H 3EFSA 3O13A 2D0PA 4JPBW 4HCKA 2JS0A 1SROA 2X4JA 4OVAA 3CC4A 1IREB 4C92A 4KI0A 1JQQA 3OYBA 4RHSA 2VV5A 3NHHA 2VL6A 5EKKA 4H7BA 4FW2A 5L37A 1QVGS 3NELA 4C3IG 4KY6A 1SNDA 1UE5A 2B2VC 4JLIA 1FJGQ 2X35A 2E3IA 4RMFA 3J7ZC 3VYUA 5M9OA 4TRDA 2LCSA 4KGVB 5KYUA 1OOTA 4E47A 3I56T 3JAML 2IJ0A 1HFNA 1VQOA 1HJDA 4ID6A 2Q2HA 4I7ZC 3T13A 1VQNA 1SJED 5CC4A 2QKIC 3L0OA 1HUNA 1HCZA 2B2TC 2NTSA 3QPHA 1SDFA 5D3DA 4DR6L 5CV7A 3NHNA 1FGUA 3VS0A 4R4CA 5GMKe 2PNHA 2DL5A 5EBDA 1H9SB 2ZGWA 2IG0A 1OV3A 2VC8A 2IIMA 3GP7A 2PPBC 4C92E 2JT4A 2EYYA 1CKBA 2AQ2B 4J6YA 3ICEA 1EUJA 4WJ3M 5KCOA 3CCMA 1OPKA 4QL5A 3HEJA 5KH6A 1QMCA 2RNAA 2XGTA 5LMUQ 4NXNQ 4DNIA 4LF7L 1QW1A 1N33L 2DD4A 3BFMA 2VB2X 2FJ2A 5LJ3h 3GIBA 4LUVA 1E7ZA 2FINB 4RG1A 3LYIA 4PNOA 1PFBA 2KJXA 3WOFA 4CJ2C 4PKCC 4C0GA 3K0XA 1VQ5T 5I6WA 5IWAQ 5LL6S 1GFCA 1PZKD 1BBUA 5CYUA 4YIJA 3J7AV 4A93H 4K0KQ 2ZXRA 1VIFA 3D6WA 1QVCA 1AZGB 1D5ZC 2G6FX 1LT4D 3VR4A 5GANe 2VNUD 2IX0A 2GTOA 4GY5A 1E2ZA 3AB9A 4J83A 4AG1C 2VQFL 4X66L 3HOYB 2NVXH 3H3VI 1N6AA 1JJ2A 3SEMA 1WCMG 1KHCA 1AE2A 4EMGA 1XPRA 4RMOA 1UE1A 3J7YW 4C2MB 2E4HA 1BVSA 1MNDA 4PFOA 2E8GA 2CUDA 1DOKA 1FNVA 1GUSA 3BVMA 2AQ3B 4J9EA 2JJQA 4R1JA 2CDTA 1SYGA 3OW7A 4BDZA 3A5UA 2LXKA 3C12A 3G4SA 3P8HA 1ZYRD 2PZTA 3EG3A 4LFAQ 2DAQA 4A3EG 2SDFA 4EQOA 1QQJA 1QCNA 4A3GG 4HVVA 5GAMd 5ELNA 2Z4HA 3I4NH 1K0XA 1EIHA 2X9HA 3OYHA 4BI8B 1SN8A 4QQ6A 5HCKA 2BDNA 3CQZB 1RACB 4OMFB 1BR9A 1PZID 4OGQC 4IIOA 2HBPA 2UUAQ 4FF4A 2F0IA 1BCPF 1IZ6A 4F7UF 2NN6H 3U23A 4E7HA 3H0GH 3I91A 3VYSA 1Z9FA 3EH2A 1EYDA 2F0UA 3V7CA 4M78D 2K01A 3SEBA 1S72A 5M5XB 1A3TA 2E65A 2JTEA 3C1EA 4H02A 3LWHA 2XWBB 2IWHA 5FLMG 5C0MA
chains in the Genus database with same CATH topology
1OTCA 2JOYA 3OYKA 1I5LA 4JS5A 4MZMA 4B3TL 2VYTA 1YEZA 2K5NA 2EFIA 2LCCA 4BB7A 2WB1G 5IP7G 3CEYA 3KYHC 2MNAA 1R9TH 2HQEA 2RI2A 4C5GA 2AMCB 3QKJA 4PJOC 3M85A 2A7YA 4F7UG 4IPHA 1VQ7T 2OTJA 1RL2A 4A3FH 5K36G 4ZN3A 1Q8KA 1BI3A 1WJSA 2O01E 1QVPA 1I5FA 3PF4A 3V8LA 1Q82U 1Y14B 2YYZA 2CWAA 2AKWB 4C8QC 2FVUA 3GTMH 4WJ3M 1YI2A 3GP8A 3AQQA 3CPWS 2DIQA 2EKOA 4MZTA 1H641 5GMKm 1K3RA 4L5SA 5GAOr 3HOXH 3VYGA 2ZJPA 3LH0A 3OYFA 5GAOm 1R8OB 1J5EQ 4EPCA 2KK4A 4JBMA 2DXUA 3H3VH 2IVWA 4JI3Q 3HRSA 1KQSA 5LJ5j 4C92C 3RLOA 2RI5A 4HT8A 5M5WH 4FT4A 1C0AA 1VQJA 4F7UA 4DR2L 1VQCA 3U58A 2QEXA 4BI3A 3EIVA 4C5HA 2RHSB 5CKBA 3U50C 1NJIC 1Q82C 3M59A 4YTLA 5HK0A 1VQPA 4A76A 1VQMA 3U4ZA 1HZCA 1Y1VG 4ZGDB 4XTVA 2WB1E 3OYGA 2ALYB 4XTCS 4B9XA 4JI0Q 4C3HH 2PVGB 2MF2A 1YHQT 4F7UE 4LF8Q 4R4OA 2KY9A 4RG8A 3A8HB 2UUCL 2VXEA 3OYDA 1KHIA 5D6XA 5C0XJ 3E9IA 1U0LA 3KLWA 3SWNB 1QVGA 4BACA 2C06A 3RMQA 1YNXA 5M5YH 4JI4L 2ZPGB 3RESA 3CCLA 3X26B 2RF4A 4LFBQ 1ASZA 3M55A 3LWIA 4DR7L 3QJYA 5LJ3j 4R55A 4PLLA 5GANd 2VXFA 1XMQQ 2E2IH 3PIPA 2E6NA 3F70A 1M1KU 4A3BH 1D8LA 2K3XA 2PI2A 3DKMA 1PVOA 1YITT 4QQBX 4PLIA 1FJGL 4XAXB 3N5BB 2OTLA 3PUWA 2ZM6L 3L2VA 1A62A 2L89A 2UXCQ 5GAN3 2JQOA 4KHPL 4HIDA 4N0AA 1Y1WG 3CAMA 3PO2H 2Y90A 4HIMA 2PI2E 3HOWH 2OQKA 3UPUA 3I55A 4NXNL 4E7KA 1N8RU 1XQHA 2V1CC 3BDLA 1Y07A 3OMGA 4EQ5A 4M75D 1GD7A 4MMLA 4RCCA 3OYAA 4PJOB 1K8GA 4K0KL 1V29B 3W5OA 1YIJA 3EN2A 4M7DF 3E9GA 5FU7C 3TS0A 5H1SE 3TCJA 3CD6T 2CZ1B 5LJ3f 3RKXA 1I3QH 1SLJA 2XI9A 5IYDG 1M1KC 4ALPA 4IFDJ 4DV4L 2R7ZG 1QZHA 1HH2P 1IL2A 4HJ8A 1G3TA 1EFWA 4LFAL 3S1MH 1VQFA 1PH2A 3S1QH 4L5QA 2OAUA 4XIGS 4LF7L 4JI2Q 2RJDA 3UE1A 2E2HH 4AQYQ 4A3MH 3KJOA 5C3EH 1FWZA 1TH7A 2LTOA 4LFCL 3F2BA 2QXFA 2O4XB 2RI3A 4OB1B 4DV2L 4P73A 3FLGA 1N8RC 3G71T 4B3RL 3JSCA 5GAMh 2R57A 4HCBA 4JLGA 5CKHA 3FIFA 2JEAI 1Y71A 3MP8A 3CPWA 3S1NH 4OWXB 1PFSA 3A5ZB 3JCMg 1NY4A 3JB9F 1X65A 2JA5H 2AHJB 3V7SA 3D31A 1WJQA 4BDYA 2N8NA 1VS0A 4QY7A 1VQLA 2Q2TA 3V8JA 3HP9A 3FDRA 2ZTEA 4A3LG 2VUMG 3L2RA 4ME7A 3KUFA 1W3SA 4C5IA 3PFSA 5KE2A 1EQRA 3JB9G 4DR5Q 2CFMA 3KBGA 1YJWT 3DB3A 2LSSA 4YWKA 2JEBI 1K83H 4XK8E 4FM4B 3RR5A 4MMKA 4C5EA 2EXDA 4BBRG 4IOCA 3MEVA 4JYAQ 2CZ7B 2VW9A 1BKBA 2XICA 4JBKA 2C35B 1JJGA 4QW2A 3PGGA 2R92G 2DKGA 5IYCG 1JB7A 4WF2A 4VUBA 3T1HQ 2LT1A 3A8OB 2CGHA 2MAMA 4HCZA 1P8LA 4MDWA 3GNFB 1SRUA 4IO9A 3HOYH 1PSFA 3SWNA 4P71A 4C0DC 4FU6A 1VQ4A 4GN3B 2EJFA 2WSEE 2FXQA 2X4XA 3LX7A 1E1TA 1UGSB 1SE8A 2PUOB 4GN4B 1N9RA 4N0AC 3VJPA 1IBKQ 2BH8A 3O8VA 4A3JH 3L2WA 1YVCA 2JA9A 3CQZH 3FP9A 2JE6I 1B7YB 4ATOA 5GAOp 2DPPB 3MP1A 2V8JA 1CKOA 4JRQA 4EDUA 3VUBA 4DR3Q 2D0QB 4ZGJB 5C0XI 4LFBL 2VUBA 3ULLA 1GM5A 5A0LA 4HA8A 3T1YQ 1XMQL 4DR4L 4HIOA 2RHUA 1EOVA 4NL2A 4BD3A 1G5VA 4LUZA 2L5QA 3HRTA 1KIXA 4IUQA 2CQOA 3NEMA 2BA0A 3ERSX 5CKDA 4NXMQ 1B8AA 1WGSA 4DK3C 4OF1A 5GANh 3S3OA 2PQWA 4JI7L 5IYBH 3QHSA 4X62Q 2M16A 1VQ5A 3WXMB 3NTIA 1I4K1 5M3MH 1WFQA 2YHTA 3OTOL 3PO3H 4OB0B 3HFZB 5CO7A 2I2LA 2QQ9A 4FSXA 3SGIA 4POGA 3JCMe 4OXPA 3FHWA 2QQAA 2P0KA 3GF5A 4LNQA 5CKFA 4E7IA 2D62A 3CPFA 3J80c 4UP7A 3JCMQ 5GQOA 3MXNB 2YU9H 1K9MU 2ZPBB 2EJ9A 5GAMj 3UE0A 5CK9A 2QTXA 2ZTDA 1KRTA 2O4XA 2B63G 4BY1H 3QZ5B 3OYLA 1VQ8T 4JI6L 2QGQA 3MEAA 2ASBA 1FVIA 4YCUA 1GVPA 3CCUT 1LNXA 3U4VA 2K5HA 1Q81U 5M3FG 2RM4A 1VQKT 5HK3A 1X54A 2JA6H 3CCQT 1B34A 3F2CA 3M4OH 3TS2A 5IP9G 4DV1L 3HRUA 5EAYA 1VQ7A 4E7JA 1LOJA 3HOUH 3HOZH 1XOVA 3PSIA 5A0DA 1Q1EA 3QJ6A 4NS5A 1XNQQ 2F52A 4L5GA 3BZCA 4B3SL 1LJOA 2QA4T 4LF6Q 2MI6A 4A4EA 2A19A 3K80C 2VGNA 4EX5A 1N36L 1MIUA 3J80E 4BXXG 4KUDK 3CP0A 2PQAA 3SWNC 5I21A 5JEAG 4OO1I 2CCZA 4KT0E 5GAMf 2KHJA 3OSSC 3E19A 4GLKA 3K7UC 3HOVG 4M7AF 4GKKQ 4QGUA 2NZHA 5CCAA 2K5FA 2GVBA 4C0DB 1Q81C 2MQHA 4A54A 1X9NA 4QIWE 4M77D 3QG1A 4Q5WA 3L1AA 3OBYA 1AE3A 4O2DA 4DR5L 5IY0A 1W2BS 4O0AA 4PG3A 3HPWA 2MFIA 2L3RA 5HGQA 4A3KG 4M7AG 4JI5Q 1XNRQ 4JYAL 3QYGB 1XMOL 1M90U 2XD0A 1K8AU 3INZA 3J7A5 2AWOA 4A4KA 4YCWA 3HHTB 4GOPB 4A3IH 2RJFA 4Y52H 4J15A 2XKOC 1EQQA 2ID0A 3MO8A 1N9SA 3CXCA 4ELZC 1O7IA 4II1A 1VQIA 5A2QE 3RZOH 2GF7A 3VU3C 5GMKj 2N3SA 1E1OA 1YHQA 2UU9Q 2WAQG 1X3GA 3K8AA 2MMPA 4UPAA 5BR8Q 3RNUA 2QI2A 4P5NA 1OXSC 4R4IA 4JG2A 1YZ6A 3CF5A 5A0GA 3TREA 3CC4T 4LF4Q 4JRIA 2NVQH 3S3NA 3FKIG 4GNXB 2L15A 3M4GA 4A4HA 2DZCA 3PCOB 4LF5Q 4Y28E 1HNWQ 1LUZA 2ZTCA 3JCMJ 1N27A 2XK0A 5GANj 4YWLA 3PUXA 2GN5A 4M7AA 3PGZA 2GFAA 1M90C 2DGYA 3AFPA 3JCMd 4QQGA 1YCYA 5GAHC 3VYHB 2R7FA 2BA1A 4GKJQ 3RN2A 1HR0L 5HKCA 5D6YA 1UWVA 3GO5A 1HZBA 4DR3L 3CC7T 1QP3A 2ZJRA 2VQEQ 4FT2A 3JRZA 4MZ9A 5GAOn 3T1YL 1JB0E 4M7AE 4HCCA 4JDSA 5IT9c 4DV0Q 4DV5Q 2NZOA 1D7QA 1QP2A 4DQ2A 1LYLA 1TWGH 4L6V5 4M7DB 2JTFA 1Y7XA 3K7AH 3X25B 3GTOH 4QQDA 4PZ7A 5GMKi 2CZ6B 4X65Q 5JJIA 4L5RC 5FJ8H 4DV6Q 3BY7A 4L59A 2KMTA 3JAME 2HHHQ 3KDFB 3G6ET 3LGJA 4A3DG 1HR0W 4HIKA 3OS1A 4JI8L 5GANf 3MEUA 1M1GA 1UGRB 3CD6A 1XNIA 1NPRA 2WAQE 1BBWA 2BIVA 1UE7A 4A3CH 3GD7A 3OBWA 3D0FA 1PH8A 4BY7G 4OX9Q 3QIIA 1A63A 2H3JA 4BA1I 4A53A 3UDGA 3CW2C 3AFQA 3J81c 2OWOA 2DVEA 1NMFA 2K5IA 4DR1L 4MNOA 1D3BB 1YHBA 3MP6A 4Y91A 3M54A 4EMHA 5FROA 4PJOD 3I4MG 5IT9E 4C3IH 3C94A