1XTDA

Structural analysis of leishmania mexicana eukaryotic initiation factor 5a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
149
structure length
149
Chain Sequence
NASKTYPMAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTHNVEVPFVKTFTYSVLDIQPNEDPSLPSHLSLMDDEGESREDLDMPPDAALATQIKEQFDSGKEVLVVVVSAMGTEQVLQTKNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eukaryotic initiation factor 5a
publication title Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
rcsb
source organism Leishmania mexicana
molecule tags Translation
total genus 26
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2004-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xtdA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xtdA02
3T1HQ 1J5EQ 2JUFA 2R6GA 5H1SE 5A2QE 1K3RA 2Q2HA 4DR3L 2B29A 4DK6C 4HJ9A 2VY3A 3GTPH 1O7IA 4B3TL 3PV0A 1VQ5A 4R4IA 1VQ7T 4OO1G 3F2BA 2NVYH 5M3MG 4EX5A 2F52A 2OTJT 1M1GA 1HR0W 4IFDJ 2IX0A 1HR0L 2PQAA 4DV2L 1VQ7A 4O0AA 5AJ3Q 1Q1EA 1VQ4T 4HIOA 3ZJYC 4A3GH 2KBNA 2KHJA 2OTJA 4BY7G 3H0GH 1IBLQ 3W1GA 4A3JH 3OW2S 1VQPT 3HOWG 3I56T 4P75A 3M7NA 1YIJA 1Q82U 4YWKA 1X3GA 2A8VA 1CUKA 1WI5A 1VQ4A 4NB3A 1VQLA 1W3SA 4GS3A 4LFBQ 2WB1G 4GLVB 1OXUA 1KIXA 2EIFA 2AKWB 1CSPA 2WB1E 4GOPB 1VQPA 4GNXB 1TWAH 1M90U 2V1CC 2R92H 4IFDI 4GLAC 2HQLA 2A1AA 4A3GG 1E24A 1L1OB 1E1TA 1K73U 5LL6S 1U0LA 3G6ET 1B70B 2K5NA 3KF6A 1UEBA 3H0GG 3G4SA 3M85A 4AQYQ 1PH9A 1V9PA 1J6QA 4B3MQ 1A62A 5JJKA 1X55A 4BBRH 3IRBA 3CAMA 1VQOT 1L0WA 4X64Q 3GDEA 3W5OA 4DV1L 1MJEA 1QVGS 2LQ8A 3G6EA 2I0QA 3GD7A 4DKAC 1GVPA 1VQMT 4FDBA 3AFPA 1S72T 4AH6A 2R92G 4BBSH 2KDSA 3A0JA 3K80C 2Z0SA 4LUVA 2VQEL 2UXBQ 2FXQA 2VS1A 3E9IA 3PGZA 5GAEC 4IJHA 4PZ8A 4ME3A 1HNZQ 2R93H 3LGLA 4K0KL 1YHQA 2JE6I 1VQMA 3AQQA 4L5QA 2L3RA 1KD1C 2YYZA 1I50H 1KD1U 4JBJA 4C3HH 1XNQQ 3CCEA 1GD7A 4MTNA 1NPRA 1E1OA 3KYHC 2JNGA 2IT1A 2ZM6Q 1TWHH 5LMUL 1JJCB 2C35B 2JVVA 3PF5A 3CCUT 5IAYA 1OXTA 3FP9A 3CPFA 3CPWS 4OONA 1XMQL 2ASBA 4IPCA 4KI0A 2A19A 5IYBH 4JI2L 2R93G 1VQDA 5IT9E 5IYCH 1WYDA 1VQFA 2ALYB 4DR1L 4JI1Q 1KAWA 3OTOQ 2IY5B 5DM7R 1SLJA 1X6OA 4HIDA 4LF4Q 2E6ZA 3CCRT 3J80E 3FHWA 3CCQT 5GAGC 5C44H 4DR7L 5BR8L 1G6PA 3CC4A 2Q2UA 3L7ZC 2JA7H 2PMZE 2R7DA 2K75A 4X66L 2E8GA 3CW2C 2KVQG 3CCRA 3K0XA 4A3MH 2JK8A 3EN2A 3CCQA 3ULJA 2RF4A 2PNHA 2K14A 4GN3B 2LCLA 4C3IH 2PI2A 4DPGA 4YHHL 4JCVE 5IYCG 1XPOA 2L15A 4GLXA 5DLQE 1N36L 1UE7A 1HNWQ 1JJGA 4B3SQ 5C0XG 4UP8A 1D8LA 5C44G 2CKZB 1N32Q 1IL2A 2R7ZH 1Z47A 3S15H 1Q12A 5ELNA 1D7QA 5FLXc 3T1HL 1J5EL 1N8RC 3RLNA 4LF6L 4OO1I 1PVOA 4A3MG 3JAME 1PH8A 2ZTCA 4WJ3M 2CCZA 3BJUA 3LH0A 3J7AF 1QVCA 2LXKA 2HHHQ 3HOYG 2VQFQ 4KHPQ 4PZ7A 4HJ8A 4A93H 3HOVH 3DB3A 2KCMA 4LNQA 1YBYA 4IJLA 4A3KH 4J15A 1VQGA 3I4MG 3KF8B 4DUZQ 4QJFA 2OCEA 2R7ZG 4GKJQ 2E2JH 5AJ3L 4L5SA 4JI5L 2F3IA 1S3OA 1KQSA 4A3DG 1Y1VH 1T9HA 2OQ0A 3GTMH 5C4JH 1NJIC 2NN6I 1IBLL 4ZN1A 1NJIU 4LFCQ 1K9MC 2N49A 4AYBG 4A93G 3I4OA 1EWIA 1VQHA 3LGFA 1CKNA 4AYBE 1IBKQ 4LF7Q 1FJGQ 4JBMA 4LWCA 1YNXA 2CWPA 1XNRQ 3AEVA 5C0XJ 4A3KG 1NY4A 2UUAQ 2OQKA 4DR5Q 4OXPA 2B63H 2Z6KA 3HFZB 1W2BA 3UE0A 1QVFA 3OTOL 3J81E 3H3VI 1I3QH 4AQYL 5HY6A 2AMCB 4DAMA 1X9NA 4B3ML 3CXCS 2UXCL 1L2FA 4X64L 5C3EH 3M4QA 4YCWA 1CKOA 2UUBQ 4UPAA 2LVMA 4A4IA 2ID0A 4DNIA 5IP9H 4OWXB 3J7A5 1HZ9A 4C2MH 2GVAA 4OX9L 1IYJB 4QY7A 2ZTEA 2B63G 2UXBL 3F2DA 3PO2G 1HNXQ 2JOYA 3BZKA 3CCLA 1HNZL 3RNUA 1PHJA 4GN5A 3CMAT 4P74A 3RZOH 1YIJT 4UP7A 4QQBX 2BH8A 4ZN3A 1BBWA 3AYHB 4YCVA 3STBC 1VQLT 5C3EG 3ER0A 4DR2Q 1YHAA 1XNQL 1SR3A 2ZM6L 3TEHB 2UU9Q 5IP9G 3KJOA 1P8LA 2YV5A 1EFWA 3I4NH 3CMAA 4LUZA 5IP7H 3S1RH 1QZHA 3S1QH 2KCTA 2JA6H 1HZBA 1JJ2A 3J81j 2PI2E 3A74A 4DV0Q 1KHIA 1OXXK 4DV4Q 3G4ST 4OWWB 3M4OH 1PH5A 3M4PA 3SGIA 4YTLA 1HJPA 1HZAA 2MO1A 4EQ5A 4JI1L 1HNWL 4LF4L 2EQSA 2PQAB 1SE8A 1PH6A 3HOVG 4TVRA 2MWOA 4KHZA 4JI6Q 3DLLA 4A3JG 4JOIA 4LFAL 1VS0A 5IP7G 1X54A 2JA6G 1IXRA 2K5HA 2YTVA 1YHQT 3GTJH 4HJAA 2UXDQ 1ASZA 2BA0A 1A63A 4PMWA 3E9HA 3I7FA 3UDFA 4JI3Q 1GM5A 5IE8A 1VQ9T 5IWAQ 2GN5A 3CCET 4RMFA 4B3SL 5K36G 3NENA 1QVGA 1K83H 4IPDA 3PUWA 4JBWA 1QUQA 1PYBA 1OTCA 2JEBI 1N32L 3KF6B 4JV5Q 1PH7A 4BBRG 3CF5A 1PH4A 1VQ9A 1VQJA 1SRUA 2NVXH 1FL0A 3NBHB 3T1YQ 3WWVA 3LGJA 4CRIA 1G51A 2AWNA 2ZJPA 1PH3A 3BZCA 3S2DH 3CC7A 2NZHA 4Y52H 4QL5A 1FGUA 3GO5A 5GROA 1TWFH 3FKIH 4BBSG 2UUCL 4DR6Q 2B3GA 2NZOA 4B3TQ 1EOVA 2MWPA 4DV7Q 1AE3A 1NTGA 2AHOB 1Y1WH 1SFOH 4JYAQ 1NMFA 5C4XH 1XMOQ 3CC4T 2F4VL 3KFUA 3HKZG 4DUZL 4DV3L 4GKJL 5FJ8H 2JQOA 3HKZE 4OWTB 2QA4T 4DUYL 2MQHA 3HOZH 3PUVA 1VQ8T 4JI7Q 2QEXA 1YVCA 4MNOA 1HR0Q 4JI0Q 4DK3C 4LFCL 1Y14B 2QA4A 2I5HA 3FKIG 3TQYA 1YJWA 1VQ8A 1YI2T 3KOJA 3G71A 3PUYA 4X65Q 5IYBG 1IBKL 4LF7L 1FJGL 1IBML 4WJ4A 1Y1WG 4GKKQ 1XNRL 3Q8DA 1LUZA 4A3CH 5C4XG 2UUAL 5FLXE 4HIKA 3MEFA 1Q86C 2Z6KC 5FJ8G 4DR5L 1P16A 1S40A 3HOZG 3CCSA 1EIFA 1YI2A 3F2CA 3I55A 2Y0SG 2MFIA 3B6YA 1GO3E 2Y0SE 4QGUA 4X62L 1WCMH 4JI4Q 3KDFA 3ULPA 2JEAI 3VDYA 4A3LH 3A5ZB 1SMXA 4A3EH 1Q81C 4P72A 3DB4A 2XHCA 1N8RU 4LF6Q 1VQIA 2UUBL 1N9WA 1KL9A 1K8AC 5IT9c 2XGTA 4A3CG 1XPUA 4AIMA 4DV1Q 1M1KC 3L0OA 4BY1H 1AH9A 1X3EA 1SN8A 5JJIA 3J80c 1VQKA 1I5FA 1HNXL 4Y7NH 4JG2A 4R4QA 5E7NA 1WCMG 2YTXA 1MIUA 4X6AH 1JMCA 4A3EG 3KDFB 1B7YB 4DR2L 1V43A 3A5UA 1JT8A 2K4KA 2UU9L 3D31A 1UE5A 2Q2IA 4TVAB 4O2DA 4NPSA 4L5RC 1K9MU 2VNUD 1CKMA 4R4CA 3K8AA 1EIYB 4DV4L 3K7AH 4LFBL 1SROA 5GAHC 1AE2A 1WFQA 2E5LQ 5ELOA 4DAYB 1VCIA 2WAQG 4DV5Q 2WAQE 3RLOA 5M5YH 2JJQA 1E22A 3RLFA 3JAMc 2KHIA 1UWVA 1BBUA 1GKHA 1Y1VG 3JC66 5M5XH 3K7UC 2LSSA 4JOIC 4JI6L 5IYDH 5J26A 3UDXA 2RHSB 2R7FA 4DV6Q 1XPRA 3CCJT 5FLMH 1CSQA 3RN2A 2VUMH 2K52A 3TRZA 1H95A 3ULLA 1QZGA 4P73A 5LMNQ 3CCLT 1NE3A 1CKNB 3EIVA 4UP9A 2NVTH 2UXDL 3CC2A 1W2BS 3GTGH 3CCJA 5M5WH 1Q7YC 3PF4A 2CWAA 4JI3L 5JEAG 3I2ZA 5IWAL 4NXNQ 4DR4Q 1NPPA 5JJLA 2HT1A 2RCNA 1N36Q 5IYDG 4LF8Q 1VQNT 3PUZA 3HOXH 2MI6A 1WJJA 2KENA 3W1BA 3UDIA 1BVSA 4RG2A 3CD6A 2D62A 3J80i 1Q46A 5FLMG 4YY3Q 1N34Q 1EUJA 2VUMG 1UE6A 3T1YL 2Q2TA 4JBKA 1VQNA 3PO3H 3NELA 1KRSA 4YWLA 4BY7H 2CFMA 4LF5Q 4DR6L 3F1ZA 2K50A 3EBEA 3CCVT 4DV7L 2WP8J 3S24A 3J81c 4ALPA 2IX1A 3HOWH 4JYAL 2EXDA 5EAYA 1XMOL 2G3RA 3OW2A 3M3YH 3HOXG 4A75A 4GOPA 2I5MX 3HOUH 2IG0A 4HJ5A 4GNXA 2E70A 2JA9A 2N78A 4XTCS 4JI7L 3CCVA 2ZTDA 3PIPA 1HZCA 1L1OA 4YWMA 1I94Q 4JI0L 3I4NG 1JJ2S 4JI5Q 2ZJQA 1A8VA 1K0RA 1E3PA 1UE1A 2CQOA 1OXSC 2LXJA 3K81C 3JAMi 1LTLA 5C0XI 1NMGA 3UDGA 4X65L 2HIXA 1IZ6A 1Q82C 3S16H 4PG3A 5JEAJ 4GKKL 1XJVA 2DGYA 1C7YA 1RIPA 4B3RQ 4NXMQ 2E2HH 3HOUG 4XIGS 3H3VH 2NN6G 1M90C 1C0AA 2DUDA 5IY0A 3I56A 2D0PA 3CC7T 4POFA 2GVBA 4JI4L 1SSFA 1VQCA 1K73C 1N33Q 3HKSA 4JI8Q 1MKHA 1RL2A 1OXVA 2JA7G 1TWGH 1PV4A 2UXCQ 3U50C 4DR3Q 1WOCA 2CKKA 2VZAA 3DM3A 2VQFL 2HHHL 4A3BH 4IOAA 4KHPL 1X65A 2E2IH 3AFQA 1EQQA 3RN5A 2QEXT 3CMET 1DGSA 2VW9A 1NZ9A 4QQDA 1VQBA 1YEZA 2JA5H 1I6HH 4OX9Q 4X34A 1FVIA 1JB7A 1VQOA 1QUQB 1V1QA 3U4ZA 3CPWA 1YJWT 3G71T 1XTDA 3J81i 3CMEA 2H5XA 4IOCA 3H15A 5LMNW 1Q1BA 4DV2Q 1S72A 1TXYA 2N3SA 2VL6A 3CP0A 4A3BG 4KLKA 3CCST 3PO3G 3I55T 3S2HH 4H02A 4APVA 1LM0A 4RG1A 3J7ZC 1TWCH 2OTLT 2AWOA 4IPGA 2IHEA 3U4VA 2ZJRA 4YCUA 2I5LX 2E5LL 2JA5G 4JC0A 2YU9H 2OWOA 3GTOH 3PSIA 1XNIA 1EQRA 4DV5L 1Q86U 3TS2A 1YJ9T 1NBWA 4R4TA 3ICEA 1KXLA 2BH2A 4P71A 3RR5A 1PYSB 2MNAA 2OTLA 3CCUA 2QGQA 4IO9A 2ES2A 4BA2I 3OYYA 4QIWE 4BXXH 4DV6L 3GTLH 1IBMQ 1G291 1EYGA 1YJNT 1YJ9A 1C9OA 1YITT 1VQKT 2YTYA 4GN4B 3D0FA 4LFAQ 1Q81U 2BA1A 3GTQH 4IFDG 3F8TA 4LW1A 1HH2P 3KBGA 5LMNL 3PCOB 2WFWA 2JA8H 1K8AU 1X3FA 1M1KU 2IHFA 1YJNA 1X56A 3KLWA 1YITA 3U58A 3G48A 4NXNL 3HOYH 4DR4L 4A3LG 2VQEQ 1VQ6T 4LF8L 4BXXG 3STBD 3S1NH 4L5TA 1B8AA 2XTIA 1N34L 4K0KQ 4YY3L 1KC8C 1VQAA 3I4MH 4A3FH 1YHBA 3TREA 1KC8U 1MJCA 1K8GA 4POGA 1VQ6A 2JA8G 1VQEA 3E0EA 1U5KA 3NEMA 4BY1G 3ERSX 3RZDH 4A3DH 4A3IH 4LF5L 1LYLA 4LUOA 4DV0L 5LMUQ 1A0IA 1ASYA 5J3BA 1XMQQ 2UUCQ 4GOPC 5M3FH 2N8NA 3UE1A 1KQSS 2HIVA 4GNXC 1YZ6A 2K5VA 4JI2Q 1PH2A 3CCMT 4BA1I 2F4VQ 4R4OA 4DV3Q 4DR1Q 1L1OC 4A3FG 4MZ9A 4DUYQ 1I94L 3CC2T 3CQZH 3S1MH 3PIOA 4IPHA 4TQUS 4LF9L 2D0OA 4DR7Q 5BR8Q 4A76A 3P8BB 3CCMA 1PFSA 4HJ7A 4A3IG 1E7ZA 1PH1A 4UY8C 4X66Q 5GADC 2ATWA 3GTKH 3S17H 1QVFS 5HGQA 5M3FG 1PA6A 4LF9Q 1JE5A 1KRTA 3CXCA 3CD6T 4NXML 4B3RL 2MO0A 1R9TH 1Q7YU 3TS0A 4YHHQ 3BU2A 2DO3A 3M9BA 1BKBA 4R1JA 3S14H 1Z9FA 3KJPA 4HIMA 2NVQH 5M3MH 4JV5L 1Q8KA 4JI8L 3L2PA 1N33L 3PO2H 3MXNB 5GQOA 3PUXA 4C3JH 2RHQB 4X62Q 1VQ5T 4PZ6A
chains in the Genus database with same CATH superfamily
3A56A 3EHRA 2DIGA 5CKEA 5GAMd 3I91A 4KY5A 1TWFB 3T1HQ 1B7TA 2VY3A 1O7IA 2LX7A 3P1HA 1SFOB 2HZYA 4E7LA 4QB4A 2ZPIB 1FX7A 3OYGA 4C1NK 1VQ7T 2F2XA 3X25B 3H0FA 2FB7A 3OS2A 2L3PA 2RI2A 1M1GA 2P0PA 2DJGC 2JN0A 5GMKj 3QIAA 3TDQA 2AKKA 4NOYA 2B2UA 2L1BA 5FOBB 5AJ3Q 1JXOA 5JJZA 1C4QA 1PZKD 4A3GH 4GY5A 1DZ1A 2CS7A 4BY7G 2AQ3B 2KT1A 1HRJA 3OW2S 1SYDA 1V76A 2RQUA 3HOWG 2MCNA 3RKXA 1Q82U 1OX8A 2O88A 1QCBD 1MGQA 1X27A 1VQ4A 3OIQA 1UDLA 2O5JC 4HTHA 3EGXB 2AKWB 4GOPB 1FYNA 3SXHA 4GNXB 3NWSA 4CI0C 4FW2A 4Y28E 1M90U 4IFDI 2HQHA 1H9SB 1CZWA 2SEMA 2HQLA 2H8HA 4OHJA 3OTOQ 2RHIA 1ENFA 2F0UA 1PH9A 2AQ1B 3PT9A 3OWFA 1Q90A 1J6QA 1A62A 3QWNA 5L23A 3SE0A 4BBRH 4IURA 1D5ZC 4KN7C 4FIBA 1QVGS 1KTKA 2BKDN 1SNOA 2HDMA 5A0DA 3G6EA 2VB3X 2PO4A 2R3ZA 3EVQA 3QOLA 3SFMA 2EY5A 4FDBA 1VQ9Q 2R92G 2WAQB 3FVQA 2JW4A 4JJBA 2VS1A 3VS6A 3A8IE 3SHLA 2DMOA 3LNNA 4CDEC 4F8MA 1HNZQ 4QKUA 1ENCA 1QMCA 2WINB 3AQQA 3H6MA 2L3RA 2FHTA 2CZ6B 2QDLA 1KD1U 1XNQQ 3CCEA 3RZDB 3OPOA 3GIBA 2ZM6Q 4OMFB 2IT1A 4L8JA 4NL3A 4M75A 1JJCB 2C35B 2KRMA 3WVDB 1WTVA 5IAYA 2QEXQ 3VR2A 2RJCA 4DBHA 5GAN4 5E1FA 4ZUIA 5GANe 5LHY1 2ZPBB 1U1SA 2ALYB 2ROTA 1QP2A 3ZEHA 4E7JA 1YJWQ 2HCCA 2KBTA 4X3UA 1SLJA 4LF4Q 2IY5B 2VUMB 3J80E 3H0IA 5GAGC 5C44H 4PJOE 5BR8L 1JORA 1G6PA 4HVVA 4CDFC 5J22A 1A3VA 4X66L 4VUBA 2E8GA 5IHNA 2JK8A 3J80L 3CCQA 3PNWC 1X3PA 2K14A 2PNHA 2LCLA 4C8QD 4FCYA 3V7SA 4GN3B 4QVZA 4C3IH 5G3LD 2JN4A 5IYCG 1XPOA 3M58A 3SR1A 1Y8OB 1UE7A 1YNJC 4RGMA 2RPNA 2EE1A 4UAIA 4AMCA 1N32Q 4J9IA 4EMGA 2M0OA 1G8ZD 4M75D 5ELNA 1D7QA 3Q0AA 1I81A 4OO1I 1AP0A 1PVOA 4BY7B 2FPFA 2O9SA 5LJ5j 2ZTCA 5BN5A 2DJZA 1AN8A 2F0IA 3TSWA 3BJUA 3HOYG 3HOWB 2VQFQ 1U5SA 2MAMA 2HD3A 1MMNA 2X4YA 2FRWA 4N9TA 1CKBA 4JZ4A 4O6JA 1QE6A 3DWQA 1MSHA 1SNPA 5KGUA 3TP5A 2RQVA 3I4MG 2DBKA 4E2FB 3KF8B 3K6OA 4GKJQ 2B2UC 2R7ZG 1P92A 1S4ZA 4M7AD 4CJ0B 2F3IA 1ZA1B 1S3OA 3PE0A 1BR9A 4OGQC 4BD3A 1WTOA 1F2YA 2EKHA 3S16B 1WLPB 1AHJB 2DIQA 4ZN1A 3WXMB 1UHFA 2EAYA 1EX4A 2N49A 3G7LA 3T13A 1VQHA 1G83A 1CKNA 3ZBDA 1K0XA 1PRTC 4JBMA 2MF2A 3Q24A 4LF7Q 1X6BA 2CWPA 3EH1A 3D4WA 1UGSB 5D7UA 5C0XJ 3MEUA 1G2BA 1ZHIA 4DR5Q 1MHNA 4C8QG 2ZPFB 2Z6KA 1UUEA 4A54A 4XDXA 2PNIA 4A63B 3LLRA 3CC2Q 1QW1A 3L2VA 1I6VC 3EA6A 3QKJA 5GJVB 4K5WA 2UXCL 2AHJB 3H09A 5AT1B 4YCWA 4X64L 2XD0A 4M75G 1GCQA 5FWBA 4MZMA 2I46A 1PXUA 4OF1A 4UPAA 1EYDA 1XQHA 4A4IA 4DNIA 4OWXB 4FXDA 4WORA 4C2MH 4OX9L 2B63G 4QY7A 4KUIA 4C8QC 2Z0WA 1ZX6A 2RHXA 3RNUA 3QWYA 3RZOH 3CMAT 4UP7A 2R5AA 4RG8A 2VVKA 3M59A 1VF5C 1I1JA 4M7AG 4M75C 3S1RH 4RUGA 2JTMA 2K5FA 5LJ3f 1TUDA 5GAMe 3A74A 4DV0Q 1BCPD 4OB2B 1OXXK 1Y7XA 3GP7A 5KYLA 3M56A 3MEAA 3SGIA 5LJ3j 1HJPA 4I7AA 4A4GA 1AWXA 2JXMB 1KLGD 3GTLB 1PH6A 4E47A 1B4OA 4E7ZA 2PW5A 1WD0A 1VQ4Q 4F7XA 4LFAL 3R2TA 4U68A 1IHVA 2K5WA 4FYVB 4J6XA 3TZUA 2NWMA 1OZ2A 1NR2A 3A7AB 2JS2A 1FGBD 1X54A 1WVLA 3KLSA 1GUTA 2YTVA 4HJAA 4EVOA 3HOYB 2UXDQ 3EAEA 4EPCA 1PRTB 2LT4A 3VJPA 1CM9A 4PMWA 3E9HA 3UDFA 3EROA 1ABOA 2QI2A 1BI1A 4WF2A 3S1NB 2GFUA 2RK2A 4JJNK 3CCET 2ZXPA 5AFWA 4M78E 3I4MB 4HCBA 4A3FB 2YDLA 1TWBA 1B1ZA 2P4TA 4KN4C 1SRUA 3G6JB 1DM0B 2KT8A 3WWVA 1DYQA 1U4LA 2F0GA 2ECZA 3BZCA 4Y52H 1FGUA 1PD1A 3EH2A 1TWFH 4BBSG 1OYXA 4LMQD 4WRDA 1RF2D 2YLCA 1Z9QA 2MWPA 4DV7Q 5CK9A 1AEXA 1UFFA 4C92F 1SFOH 1W70A 3KFUA 4DV3L 3NSWA 1AW7A 4DUYL 3I9QA 2QA4T 2MQHA 5LJ5d 1I0CA 3HOZH 4JI7Q 3A98A 3DM1A 2ZPGB 3WDNA 3EG1A 1D09B 1Y14B 2I5HA 3TQYA 1RAGB 3M5AA 2B86A 4M75B 2OI3A 5KH6A 5DNFA 1FJGL 4WJ4A 2VYTA 2QCPX 4JJDA 1Y1WG 4GKKQ 3PTAA 1RJTA 1X2QA 4PKCC 4XAXB 2Z6KC 3MP8A 1Q82R 1T0JA 5GAN8 1BCPC 2MPMA 2MFIA 3M0PA 5KYWB 1WCMH 4K6LA 3CCQQ 5C3WA 1YJNQ 3QO3A 2E76C 3M0TA 5J39A 1JO8A 1F1BB 1N8RU 1RKNA 1QCFA 4F7UA 1N9WA 4JRPA 3K59A 2DVJA 3RKYA 2XGTA 1TU2B 2XDBA 3JB9H 4ANJA 4DAPA 3A55A 2WSCE 3TP8A 1AH9A 2CUBA 2CREA 4M7DE 1KHCA 3J80c 5JJIA 1VQKA 1R0BG 2CZ0B 1LTTD 1TS3A 1VQ6Q 1BUVT 1TIID 1HNXL 4R4QA 4M78A 3GBQA 4HCSA 2TMPA 3KUPA 5EPKA 3JB9F 5CKHA 1FWZA 3KDFB 1B7YB 1QKXA 4PJJA 4DR2L 2JS0A 2DTIA 2K4KA 4N9PA 1LTBD 2FMCA 2LZ6B 1C1AA 4NPSA 1W1FA 4KH1B 4XU1A 3PMFA 1EIYB 1PRLC 1SROA 1SSHA 2AKLA 1AE2A 3OA6A 2E5LQ 5ELOA 4KGZB 4RCNA 4OL7A 3HZXA 5JEAH 2CSIA 3VYUA 5M5YH 2YRVA 2MJ8A 1GKHA 1LACA 5M5XH 1Q95G 4M77D 4JUVA 1Q86R 3H9NA 3HRSA 4R55A 1EIGA 4IZ8A 3UDXA 1G91A 1XPRA 5FLMH 2VUMH 1CSQA 2EYWA 2K52A 1RTOA 4BACA 2RI3A 1QZGA 1D1AA 3EFSA 1CKNB 2O5IC 2CZ7B 1F2MA 1PSEA 5KIXA 4BBSB 5GJWB 2CWAA 4IUPA 1G3YA 4JI3L 5IWAL 4NXNQ 4DR4Q 5JJLA 5I6YA 1SRMA 2BZ8A 1M1KR 5LL6X 4OP0A 4EMKA 4NP5A 4F16A 2KENA 1I50B 3W1BA 5DM73 1LPLA 3R93A 1N34Q 3J80i 4C3HB 1U4PA 4L5GA 3NWTA 3DEOA 1I8FA 2F0OA 2ENBA 3OYIA 2B2WA 2DNCA 2EYJA 3BY7A 4C5GA 1VQNA 2EGAA 1KC8R 3RBBB 4AFZC 1IW7C 4BY7H 4DR6L 4M7DA 3EBEA 1Y1WB 3HOWH 2KQ3A 1NEBA 2EXDA 2G3RA 2OTJQ 2XU8A 4M4ZA 1GUWA 2ZPHB 4QMGA 4BB7A 1ICFB 2JJ9A 3D8GA 3V7CA 4I65A 1I4RA 4K14A 1V1OA 3PIPA 3QSUA 1HZCA 2MIOA 4L6V5 3VR5A 3I4NG 4GN4B 4F7UG 1O7LA 4M77G 1UE1A 1OXSC 2LXJA 1VQPQ 2CVRA 1LTLA 5CV7A 1NMGA 3VYTA 4X65L 5C0XI 3UDGA 1Q82C 1K0SA 2IX3A 4PG3A 3S16H 5CV4A 1BCOA 3HOUG 3G4SQ 2BE7D 1SPKA 3H3VH 2L0CA 2JM8A 4XTYA 1M90C 1C0AA 4ZCKA 2DUDA 4PFZA 1D1IA 1UGPB 2BIVA 2D0PA 2EYFA 5KYXA 1A2UA 1LVKA 2J7IA 2L3SA 3JCMg 2V4DA 2DILA 5IXFA 1B50A 2F69A 3VS7A 4RTVA 1LO5D 1PV4A 2Y90A 2UXCQ 2C0OA 3U50C 1JOQA 1D5MC 2E1HA 1M5Q1 4NW2A 4QF4A 3CMET 1AFPA 4QQDA 3R3OA 2CYZB 1VQBA 4IUQA 2DERA 4M78C 3X26B 3L2QA 1FVIA 1X69A 2K5DA 2LMCB 4OX9Q 3V7RA 4K2LA 1YWOA 3HFNA 5EGTA 2HQEA 4QUCA 4IOCA 2NTSA 3H15A 3QG1A 2DA9A 4RTYA 3UPUA 2B8FA 3CP0A 4KLKA 1IGUA 3K7AB 2ICIA 4H02A 4PFOA 1LLRD 1KG1A 3PQIA 3J7ZC 1HA5A 3EG9A 5GANf 2AWOA 3FPPA 3U4VA 2I5LX 3GTOH 2OWOA 4XQQA 3PSIA 2QG9B 1XNIA 2DK3A 4DV5L 1YJ9T 1K3BC 1NBWA 4E7KA 5GANj 4R4TA 4EDUA 3SDZA 4A53A 1I3QB 4J9HA 1PYSB 4P71A 3RR5A 1ZEQX 5IGDA 3CCUA 4IO9A 3CCRQ 2LRQA 2XK0A 2KSSA 1JU5C 2F0KA 2RVLA 3GTLH 1IBMQ 5KNDA 4BXXH 1NE8A 1E0BA 4G7ZC 1EYGA 2Z6BA 1CSKA 5CR2A 1YITT 1VQKT 1OX9A 5LJ5e 2QAZA 1Q81U 1AZEA 2DM1A 1F2ZA 1F9PA 3D0FA 4V0BA 4LFAQ 1GBQA 3A1PA 5A0LA 2CT4A 3PCOB 2JA8H 2K5QA 5M5WB 2L9HA 2LX9A 3HOYH 3WVEB 4EMKC 2IW3A 3CQTA 2VQEQ 2HQXA 1RUWA 3S1NH 1KQ1A 3EG0A 1DJ7B 2N55A 2XTIA 5KCHA 1Y69U 1C0MA 4YY3L 4K0KQ 5C0MA 1KC8C 2K03A 3I4MH 2B2WC 4A3FH 3QUIA 1BO0A 1TKWB 1YHBA 3I4NB 4RTTA 4F7UB 1PRTF 1EY9A 1NUCA 1U5KA 2IJ0A 3ERSX 4BY1G 4C1NI 2L89A 4A3IH 4M7DC 2K3YA 1F77A 1LYLA 3I3CA 4XU3A 1ASYA 1SYFA 4GZYC 4FF4A 1PZID 5M3FH 1ILQA 4M78B 2F0MA 3CCMT 3A8OB 4DV3Q 2E65A 2O4XA 1CTMA 5CV8A 4NS5A 4DUYQ 1SJED 3PIOA 4TQUS 1BXTA 2B8GA 4DR7Q 1TS5A 1T3LA 4K11A 4A76A 1FXXA 1B3AA 2DL5A 3RIRA 1PFSA 3VU3C 1E7ZA 3VRYA 1A3UA 3MFGA 1WFWA 1DJRD 5FKAC 5GADC 4C0DC 3M54A 4B3RL 3REAB 2D5DA 4UDUC 1R8OB 1KRTA 4LF9Q 2E2HB 2EQIA 1R0CB 4OIJA 2RI5A 3M9BA 4MMLA 2J06A 3HRTA 4UHVA 2RSOA 1HQRD 2P84A 1Q8KA 2R61A 4JI8L 1N33L 1MHWC 2PZTA 3I90A 4C3JH 1NLPC 1GL5A 3RN2A 1VQ5T 1SMYD 2XRQD 3M4PA 4PZ6A 3TQ7P 1NR4A 4JDSA 2YSQA 3C46A 1J5EQ 4LF6Q 2EVBA 2IPOB 3C94A 5H1SE 3GTPH 1JCKB 2C5CA 4B3TL 1TH7A 4G7OC 2BH2A 5C4XB 2F0QA 1J8IA 1UGRB 2DF6A 2QQRA 4J83A 2L11A 3HS0C 3I70A 3PMIA 5M3MG 4EMKB 4FSXA 1VQNQ 1U1TA 2FG0A 1NSNS 1HR0L 2PQAA 1UECA 1VQ7A 1H9JA 2NBFA 3I73A 4O0AA 2EYLA 4FT2A 1Q1EA 4J9FA 4BWGB 3H0GH 5GAMf 1IBLQ 2BDNA 4DA4A 1TWCB 4P75A 4YWKA 2VXWA 4KJNA 4M7DB 3C0CA 4XT1B 2HKQB 1WI5A 5GAMj 1NJIR 4GS3A 4BUGA 5IGGA 4CC7A 2EIFA 3OYKA 4DBRA 3HL8A 4LK1C 1EEID 2KRNA 1QNUA 4GLAC 4OB3B 3EFXD 1K73U 5EAYA 1U0LA 3UA7A 3L42A 1UEBA 4AQYQ 4FF3A 1N9SA 2K32A 3THKA 1CZGA 5JJKA 2A6ED 1L0WA 1Y0MA 2ED0A 3CAMA 3W5OA 4BY1B 2LQKA 2JZ2A 5A0GA 3AB9A 3K5MA 5GAN3 3R6NA 4C0DB 2DE0X 2Y4YA 1VQMT 3DLMA 3ULRB 3AFPA 5D3DA 1B34A 1SNMA 2LQNA 3A0JA 3K80C 2Z0SA 2Q8IB 4BBSH 1SBBB 2UXBQ 3E9IA 5KYXB 2MGSA 5IHIA 2RNAA 5E4XA 3GPLA 2JE6I 1QILA 5FU6C 1K9AA 4J7IA 1I50H 1NLOC 4CJ2C 4C3HH 4XTUA 3DXJC 1YCYA 2EOTA 2R5MA 3MKDA 1BNZA 3I4LA 5I9OA 1SMYC 3I8ZA 5EPJA 5LMUL 3PF5A 2KOLA 3CCUT 4CDDC 1TY2A 1KNAA 4OONA 3QPHA 3BVGA 4II1A 4N4HA 2ASBA 2VASA 2GGRA 1RLPC 4IUNA 4JI2L 4PJOF 4KBMB 2R93G 1PLFA 4FU6A 1OPKA 2K6DA 1SYBA 1VQDA 3VYSA 5I9PA 3IQLA 2DL8A 3KBXA 1VQ8Q 4JI1Q 4D8DA 3CQZB 2W10A 4FYYB 3BG3A 3QZ9B 1PKSA 2KEAA 3CCSQ 2R7DA 1YI2Q 1IKMA 1EFID 3GTGB 4MDXA 2DNEA 3EG9B 3FB9A 1WHJA 4E7SA 4DPGA 4YHHL 4BI4A 4FF2A 2XG8D 4JCVE 1FR3A 2BDOA 1N36L 1HNWQ 3QDFA 1F9QA 1AD5A 4K8JA 5C0XG 4UP8A 1D8LA 1TS2A 3MEWA 2CKZB 1VYVA 3DWAA 2D9UA 1X43A 1Z47A 1PM3A 3PVQA 2CP6A 3PMTA 5CKDA 1N8RC 1AEYA 2F0TA 4A3MG 4WJ3M 2CP7A 3LH0A 1STYA 1QVCA 2SDFA 3A8JE 3NP8A 4X3TA 2A6EC 4IUTA 4HJ8A 1ZUUA 1Q3LA 3HOVH 2D6FA 3NTHA 1M1FA 2LNHB 2CDTA 2QEJC 1ONLA 1VQGA 1JRIA 4J15A 4DUZQ 1SXTA 2KR3A 4QJFA 3QJYA 2OCEA 2MYSA 2RK1A 3EGDA 1GUGA 1UAPA 4PJLA 1DOMA 3RMSA 3FC3A 4ESRA 1KQSA 2H4OA 4J8QA 4A3DG 2E10A 1NJIC 4Y91A 2NN6I 2XIWA 2J05A 1HA6A 2NYZD 4HXJA 4AYBG 1EZ6A 4A93G 4QVCA 3SVMA 2F0JA 1U06A 1TOVA 4Q0FA 4MTKA 1XNRQ 4A3KG 1AZQA 2DETA 2UUAQ 4OELB 2R57A 2PYKA 2PVOB 2X3WD 4OXPA 3HFZB 1YN8A 1EOTA 5JVG3 2L0AA 2AIRB 4C8QE 2O4XB 4CKEA 1Y8NB 1I3QH 2YXYA 3URGA 5CV5A 3CCJQ 3R6OA 1TWGB 1M3CA 2AMCB 3RD4A 4DAMA 1X9NA 4B3ML 4JRIA 1SEMA 3M4QA 1CKOA 2E2IB 1IHWA 1EY7A 4M75E 3H91A 4ABNA 2ID0A 2XWJB 2EY2A 2F1MA 2K4YA 1OQKA 3CD6Q 2B2YA 4XQJA 1Q81R 1HJDA 1WTQA 3J7A5 2GVAA 2ZTEA 1DXMA 3F2DA 1WXTA 2FO0A 4AG1C 2R93B 1G3SA 3CCLA 4P74A 4QQBX 3LWIA 1QWFA 4ZN3A 3AYHB 1I4QA 3E6ZX 3STBC 5C3EG 4ULLA 3V05A 1BK2A 1SR3A 1TWHB 5IP9G 4HVUA 2X4WA 2YV5A 4KH0B 3CMAA 4M7AE 5IP7H 2KYMA 3KJOA 3I4NH 2L12A 2HEQA 3UI2A 1X6GA 3CCVQ 1WHHA 1JJ2A 4DV4Q 1PRMC 5KE2A 3GV6A 3OWEB 3M4OH 4RA8A 1FMVA 3NTIA 1HZAA 2VGNA 2LFNA 1PMRA 1QB5D 1SE8A 2PQAB 3UF4A 1QNKA 1GXIE 2A69C 3DLLA 1KK7A 2EBPA 2DXBA 1QVFP 1PTOD 2XIDA 4A3JG 4KMUC 2EYMA 4DAVA 2PCFB 1QVPA 2JA6G 1QCOA 2DXUA 4M78F 2K5HA 2DN8A 1I4PA 4ZK9B 1ASZA 2BA0A 1STGA 1A63A 2DBMA 4FVMA 3I7FA 2CUDA 5CC4A 1VQ9T 1TUGB 5FRMA 4B3SL 4JBWA 1QVGA 1D0YA 4N4GA 4IPDA 1UB4A 4C8QA 1RACB 1PYBA 2GBQA 2F0EA 2BE5D 2Z4HA 2EKOA 1ZXTA 1YNND 3AU7A 5CV9A 1STHA 3CF5A 3E2UA 5I6WA 4B9WA 4HCCA 1GUSA 2FFKB 4A3DB 1WDXA 1FL0A 3NQIA 1KDCA 3PVLA 3LGJA 4BY6C 4CRIA 3S2DH 1X2KA 4ZGEB 3CC7A 4DFAA 2JT4A 4QL5A 4AYBB 3FKIH 1T5EA 4A93B 1TSFA 2B3GA 3BZDB 4B3TQ 1B34B 1AE3A 2EY1A 1LCKA 1D5XC 2NZ1D 1NMFA 2D2CC 2XN9C 4KY6A 1RI0A 2QTVA 4ZTFA 1ENAA 2CP2A 5HK3A 5C4XH 1ARKA 5ELEA 5C6SA 2JQOA 5FJ8H 5KYWA 4OWTB 4CDCC 3S1MB 1NBEB 1WTHA 1SHFA 1YVCA 4MNOA 1HR0Q 1TT2A 4JI0Q 3GTMB 3OMGA 5KEEA 3EFRA 5IN1A 1HPCA 3X3NA 4LFCL 4FL6A 3GTKB 4M7AA 4CC4B 2QA4A 4LNQA 1M8VA 3G71A 1IBKL 2OTLQ 2V1RA 5DY9A 5IYBG 4JK1C 4RCOA 4NL2A 3Q8DA 2ZGWA 5FLXE 3MEFA 3JSCA 4X3KA 3T1YQ 2D1XA 1S40A 1EIFA 1H3HA 4J9GA 3M3YH 4A4KA 3I55A 2Y0SG 2IIMA 1M3BA 2PVGB 3HFOA 2XWBB 5LJ5f 5GAN7 4X62L 3KDFA 4JI4Q 3VDYA 5FLXL 3A5ZB 2RM4A 4MHEA 2O01E 1W6XA 1SKUB 4FW1A 4M7DF 1JE4A 1SMXA 1Q81C 2XHCA 3P8DA 3N6RA 1H9MA 1VQIA 2UUBL 2V8JA 3UWNA 4TRDA 3QIIA 3QO2A 1EIHA 3VA7A 5CAIA 2B2YC 4A3CG 2KUMA 2F0FA 1LNXA 4BY1H 4LDVA 4LUDA 2NVYB 1I5FA 1AOJA 4DK1A 5IODA 5DLOA 1ZSGA 1WGSA 2ZAEA 5EKLA 3ERQA 1K1ZA 2YTXA 4AFUC 1ET6A 1D2BA 2F0VA 1XJWB 4A3EG 4ZGJB 1L0XB 1V43A 1OU8A 4A3JB 3G7ZA 2UU9L 2BE5C 3PFSA 3OYAA 4KULA 2XDDA 1EWCA 2Q2IA 4TVAB 3S1QB 1UGVA 2VNUD 1JBMA 1S5CD 3MFYA 4JRKA 3AMUA 4HN7A 3A54A 2DXCA 2FZKB 2R92B 4N0AC 2G9DA 4EQPA 2NUCA 2KAFA 8AT1B 2LJ0A 5KYUA 2A36A 3E9GA 3EGDB 4JI6L 1KLUD 2IL8A 2LSSA 5IYDH 2R7FA 4P5NA 3TRZA 2F0HA 2K7AA 1FNVA 3ULLA 1BI3A 1UEAB 4QT7A 3CCLT 1BI0A 4UP9A 1RAEB 5JOBA 2EZVA 2SRCA 5IGBA 3GTGH 4N4IA 2LCCA 2KXCA 3RUZA 3X28B 2WIIB 3I2ZA 2OJ2A 4YIJA 4RKUE 4E7HA 3VRZA 1N36Q 4LF8Q 2MI6A 2D62A 2EYOA 5EKKA 2NVXB 2GQVA 3JB9J 1EUJA 2FPEA 3T1YL 2EW3A 4JBKA 1AWWA 2DEQA 2F5TX 3E9FA 4OGEA 3VR6A 4Q5VA 1UJ0A 4JLGA 3M0QA 2LCSA 1S5DD 3WOFA 4LF5Q 2K79A 2XVSA 3F1ZA 4Z88A 2O2LD 3QR8A 1DD2A 4JYAL 4DGZA 1XMOL 2PUOB 3M4YA 1V1CA 2HCKA 4JS4A 3HOXG 1UG1A 3OYCA 5A2QL 2XMFA 2IG0A 2PUKB 4KGVB 4HJ5A 2JA9A 3C1EA 2N78A 2Y0SB 3CMAQ 1FNUA 2RQXA 1MGSA 1HHVA 2KY9A 1QOHA 1SYEA 4K5XA 2I2LA 3M55A 1EY0A 4YWMA 4DN4M 3MP1A 1I94Q 3QDRB 3CHBD 4M7AC 3PO3G 1E3PA 4F7UE 3SK6A 4M77E 1JOKA 4J5YA 4KKSA 2EQJA 4QW2A 5JEAJ 2EGEA 2RDGA 1STEA 1GJXA 3SWNA 4OIKA 2AUJD 1I07A 2NN6G 1QG7A 3A8HB 1XX8A 1H9RA 3V8KA 3I56A 2RMOA 3CC7T 4POFA 2R7ZB 3MO8A 1BDOA 3G6EQ 4BE0A 1K73C 2ZCFB 2YUPA 3HSBA 5CIUA 3BDLA 3H0HA 4ME7A 2FVUA 1TWGH 3M0UA 3NPPA 2LMJA 2HHHL 2CKKA 4KHPL 2K5LA 4IOAA 1X65A 2E2IH 3BDUA 4ZQ3A 2DXTA 3HTRA 1DGSA 2F0DA 1NG2A 5CGKA 4O5VA 1YEZA 2PZ1A 3MHXA 4Y7NB 3CCEQ 1JB7A 1HK9A 1VQOA 4C8QB 1QKWA 1V1QA 2CH4W 2E41A 1EWHA 3CPWA 2DZCA 1K28A 2DX1A 1JEGA 2A28A 3G71T 3NE5B 4G57A 3CMEA 3L9AX 3FMCA 3J7AV 2B8AA 5C4JB 1EQVA 4K8IA 1S72A 2N3SA 3OSVA 2XSCA 4HSPA 2KVMA 2RJEA 4A3BG 1X01A 4PLLA 3I55T 1F2LA 1BI2A 3GQBA 4H0LC 4X9CA 4RG1A 4APVA 4IPGA 4BDZA 2IHEA 2JA5G 1QCNA 5KE3A 1SAPA 1EZ8A 4YCUA 5FO8B 2B63B 2FMMA 1E6HA 1CHQD 1CQFA 4RWSC 2E5KA 2MNAA 3OIPA 4HMJA 3UDCA 4E7IA 3OYYA 2K9GA 4DV6L 1M90R 1WHGA 2EJ9A 1YJNT 3MTSA 1YJ9A 3I5RA 4M7AB 4IFDG 5IT9L 4M77A 1GFDA 5GAOn 3F8TA 4LW1A 2BOSA 2WV6D 5EC7A 4KY7A 5LMNL 2KE9A 3EJIA 1K8AU 1CA5A 2LJ3A 3KLWA 1YITA 3FDTA 2BE9B 1BIBA 1BIAA 1I4XA 3U58A 4A4HA 4A3LG 1G6ZA 1VQ6T 3CU7A 1G5VA 1B8AA 3D4RA 4HAEA 1KABA 2DJQA 3TREA 2LDMA 2O9VA 4RCBA 4DEYA 3E0EA 4ZNXA 1XOVA 3NEMA 1ZLMA 3EFOA 1ZUKA 3PIP3 3RZDH 4A3DH 1KD1R 2YHTA 3H8ZA 2LP5A 4KUDK 4LUOA 2VB2X 3RR6A 5J3BA 5I2YA 3L2UA 2HKNA 3OSOA 4IKFA 3M3YB 2MP1A 1YZ6A 1WJSA 1WHMA 3JAML 1PH2A 2M9VA 2GNCA 3RUXA 4RGNA 5CKFA 4MZ9A 5IIFA 4DOWA 1O75A 3S1MH 1OI1A 3GOXA 1N27A 4IPHA 1KFZA 4I7ZC 5EPLA 2D0OA 5BR8Q 2EJGA 4CGYB 5JAVA 3CCMA 4J6HA 4HJ7A 1PH1A 3GTJB 2DNUA 1EFNA 1H9KA 4KD3A 4X66Q 3GTKH 2DVEA 1QVFS 3OS0A 1PA6A 3JV3A 3SWNC 4NXML 3CXCA 4ZRZA 1PNJA 2YRDA 3TS0A 3JCMd 1NYFA 2E6NA 3RESA 5KYUB 1DOKA 1BCPB 2B39A 2FEIA 2K28A 4JV5L 3D7SB 2M16A 3L2PA 2C06A 3TP7A 4X62Q 2H3JA 2WSEE 2TSSA 2K2MA 3RERA 4DR3L 2R6GA 1K3RA 2Q2HA 4A3BB 4HT8A 4HJ9A 3JCMh 3K0YA 3QOJA 2FINB 3PV0A 1VQ5A 4R4IA 4JW0A 4OMMA 2JA5B 1RAFB 1EYAA 4OO1G 5IH2A 3F2BA 2NVYH 4EX5A 2OTJT 3KLSX 1RCVD 2HBPA 4GOPA 4LD6A 1JQYD 4WTOB 2IX0A 3BVMA 3FIFA 1MMGA 1LT5D 4DV2L 4FF1A 2L2PA 4HIOA 3ZJYC 5EBCA 3VKIA 2KBNA 5LJ3h 1X32A 2VWFA 3W1GA 4FYXB 4A3JH 1VQPT 1G2TA 1H92A 3I56T 1YIJA 2EWNA 2A8VA 2VUBA 1CUKA 4NB3A 3P7JA 3MCAB 1VQLA 2WB1G 5JPMC 4GLVB 1OXUA 1KIXA 1CSPA 3TU4K 2R92H 4A4EA 2DD5A 2A1AA 4A3GG 2K5NA 3KF6A 3M85A 1B70B 3F2UA 1V9PA 4M77C 2J6FA 2IWHA 4N8FA 3IRBA 3NBHA 1VQOT 3V96A 4X64Q 4ME5A 2EFIA 1JB3A 2CT3A 2LQ8A 5I2SA 1PYWD 5KYIA 3GD7A 1GVPA 3META 3SWNB 3V2TA 3R2IA 2PVDB 3X3MA 1S72T 1R4QB 4NMZA 2LT1A 3JB9I 2AZSA 2FXQA 5GAEC 2J6OA 3VUZA 3EHQA 5LJ3g 4F87A 1F9SA 4ME3A 2QTXA 1YHQA 4L5QA 1VQMA 3SB2A 3BDCA 5DAUA 1KD1C 1AVZC 5GAOq 4RHSA 4JBJA 2X35A 4GBQA 1E2VA 4MTNA 1NPRA 3KYHC 2JNGA 3URYA 5I2MA 2JVVA 1XMQL 2QW7A 4K2KA 4IPCA 4KI0A 5IYBH 5C5MA 1U9RA 5IOCA 1D3BA 1JJ2P 5IYCH 5CQXA 2NWGA 2QILA 4DR1L 4J6YA 2KI7A 2NUPA 5DM7R 2LC4A 1X6OA 4J6WA 4HIDA 4QUFA 3CCRT 3NHNA 1SSOA 1D0ZA 2EJGC 4K6DA 3CC4A 2Q2UA 2B2TC 3L7ZC 2JA7H 2HMAA 2K33A 1PCXA 2K75A 2M2LA 3VYGA 2H1EA 3K0XA 5K5PA 3OYLA 2DPPB 2DL3A 4V190 2BZXA 2PI2A 1R77A 1GHJA 1WJQA 2PTKA 2L15A 4GLXA 5M9OA 5DLQE 2SNMA 1SYCA 2Z8LA 4J7FA 1IGQA 3L1AA 4G7HC 2NVQB 1RAAB 5CVIA 1HUNA 3T56B 2Z1CA 5C44G 3DEPA 4Z89A 2MHVA 1IL2A 2R7ZH 1QVGP 3OW7A 1Q12A 2DFUA 4IALA 1YITQ 1VQKQ 2NTTA 3R8BA 3T1HL 3RLNA 2V1QA 4M77B 2VGMA 1HTLD 1V29B 4ZYSA 4C0GA 1VUBA 5KNBA 3J7AF 4RTWA 3NXWA 2HHHQ 4KHPQ 1LTGD 1DOLA 4PZ7A 1SRLA 1IB8A 3VS5A 3HOUB 3DB3A 3K57A 4DAYA 5AYFA 4JLIA 1YBYA 2HDAA 2RQTA 3I35A 2RJDA 4A3GB 1FYCA 5AJ3L 4L5SA 2KYBA 4Q5WA 1L0YB 4LNPA 4OB1B 1T9HA 2K6AA 1VDZA 2OQ0A 3ITPA 4ODGA 5C4JH 4KGXB 5CORA 3EFOB 4LDYA 1EWIA 1FJGQ 4AYBE 4C8QF 1YNXA 2DYBA 4PFPA 5G3LF 3AEVA 1NY4A 1IREB 1GFCA 2OQKA 2B63H 3CCMQ 2F5KA 4ZAIA 1W2BA 2RH2A 4ZTJA 3P8HA 1UGQB 1I5LA 3ZL7C 3OTOL 3J81E 3H3VI 4M75F 2BTTA 1M27C 2K05A 1VYTA 1B53A 4TKOB 3OY9A 4KHVA 3EG2A 2JXBA 2LVMA 3J81L 3Q6SA 4PJMA 5I11A 2JTFA 1N8RR 1HZ9A 1I6HB 7AT1B 5GAOm 3N52A 4BDYA 1HTPA 2NB0A 1K8AR 3PO2G 2PW7A 1HNXQ 4B6MA 1PZJD 1HNZL 1FMKA 3JCMb 1K4US 3JCMe 4M7AF 4GN5A 1YIJT 2I07B 3JCMc 1TY0A 1BBWA 1EY5A 2BH8A 2A5HA 1VQLT 4DR2Q 1XNQL 4C0FA 3MAQA 1KDAA 2ZM6L 2A74C 2OF1A 1B3QA 2PMZB 2CP5A 4RGOS 1P8LA 3S2HB 4MZTA 2YU9B 3INZA 1BBZA 4OVAA 3F70A 4ILWA 4FYDA 3BYYB 4BI3A 1EEFD 1KHIA 2LY7A 3CBMA 5C6AA 4OWWB 4C92D 1PH5A 1IRXA 4OGCA 1CA6A 1VOMA 4DOVA 2MO1A 4IQZA 4LF4L 2GA4B 1LOJA 2QYZA 5C44B 3MXUA 4TVRA 1SF9A 2FYKA 2MWOA 2M1HA 2QDYB 3DKMA 3MEHA 4KHZA 5E3FA 3VA5A 5I2XA 4HVWA 4QVDA 2EYHA 1N9RA 3A8LB 2CW0D 3NMZC 1WTWA 1ML0D 1EZZB 1IXRA 2X3XD 1YHQT 3GTJH 3OYEA 3NHHA 3W3AA 1G3TA 3LWEA 3VR4A 2F2WA 4JI3Q 2AZVA 3M0RA 4XQNA 5IWAQ 2GN5A 5K36G 3RDVA 3NENA 4AT1B 1QUQA 1N32L 1BCMA 2JEBI 3VS1A 3JCMQ 1SJHD 3IAYA 3KF6B 1TXQA 1RAHB 4JV5Q 1OEBA 1PH7A 5DEHA 1PH4A 1VQ9A 1LT6D 3NBHB 1ZYRD 2KECA 2NZHA 3CBPA 3D3RA 2CZ1B 1LABA 1R4PB 2NZOA 2UUCL 1BCPF 4DR6Q 2QDBA 2AHOB 4XXEA 1Y1WH 4KV6A 1M3AA 5C4HA 3CC4T 2F4VL 1WX6A 3NFCA 3QYGB 3HKZG 1NNXA 3NUCA 2VB6A 4GKJL 3D6WA 3FPUB 1IYVA 3G1JA 3PUVA 1VQ8T 2EYQA 1OULA 2QEXA 1MUZA 3JB9D 3OYFA 1V8QA 4DK3C 4RH6A 2A3LA 3S17B 2L8DA 2RDFA 1YJWA 3PUYA 1YI2T 4X65Q 5K36H 3CCUQ 4LF7L 4IFDH 3REBB 3JCMV 4XTVA 1LUZA 1ZKOA 3S14B 1C6VX 3NQTA 1WPYA 3IL8A 1D3BB 4D8KA 5M3MB 3H6ZA 4K5VA 4DR5L 3HOZG 2WACA 3PO2B 2F0LA 2YT6A 3M4GA 2NUPB 1PWTA 4DXFA 3QJ6A 2Y0SE 3IKJA 4RGTA 4QGUA 4A3LH 5IHKA 5HKCA 1Z9ZA 2L4NA 2ED1A 1A15A 5BN3A 3S3OA 2OX7A 3DB4A 4PJNA 4DEXA 4DNTB 1LT3D 4U673 1KL9A 1MI2A 4MZPA 1K8AC 4KRTA 2HAXA 1XPUA 4AIMA 4LUEA 4C2MB 3L0OA 2L55A 2CW0C 5CV6A 2J6KA 4ELYC 1NAPA 2NUZA 5TSSA 4JG2A 1WCMG 2GF7A 2Z9HA 2D0QB 1MIUA 4PV1C 4X6AH 1MV0B 5GANg 4DK0A 1JMCA 1I5OB 1A2TA 5IGCA 1XYIA 4RCCA 4C5IA 5FU6B 4LDWA 1Y57A 1HXYD 3CPWP 1S5BD 2K5IA 2VXFA 3S3NA 5JPNC 2EPBA 3JB9G 2XICA 1T3SA 3A8GB 4F88A 4L5RC 4C56C 1SG5A 3C4SA 1K9MU 4DA2A 4X3SA 4R4CA 3K7AH 4LFBL 5GAHC 1WTXA 1WFQA 2CH4A 4D6WA 5J1ZA 4LAAA 1TWAB 4LN2A 2A6HD 2DJFC 5EQ0A 4DAYB 3UT1A 1VCIA 2WAQG 4FO2A 4DV5Q 2GTJA 1CI3M 3RLOA 2JJQA 3RLFA 4XQ3A 5L8RE 1UWVA 2ATCB 3FJPA 1BBUA 1Y1VG 3QZ5B 2KHIA 3K7UC 4FT4A 1XXGA 3ND9A 5D6XA 4O42A 4ZKBB 2RHSB 3CCJT 1A3TA 4X9DA 1IL8A 1SE3A 4DF7A 4J9CA 2JM9A 2RA2A 1UUPA 2EGCA 4P73A 4FXGC 3EIVA 1WYXA 2UXDL 3CC2A 1YNZA 5KRUA 5M5WH 1YP5A 2EQMA 5KYNA 3PF4A 2EPDA 5JEAG 4PMBA 1PD0A 1NPPA 3DUZA 2HT1A 2ICEC 1VMCA 3HKZB 1SE2A 5ELCA 1WJJA 2QQ9A 1QJOA 3T4AC 1TTHB 1BVSA 1T5XD 5FLMG 2VUMG 4BS9A 5EBDA 1UJYA 4YY3Q 4MMKA 1II3A 5I22A 2DLPA 1M2OA 2N88A 2DTOA 4JVZA 3GP8A 1ZUYA 1JWUD 5FWCA 2OXPA 2HL5C 2D9TA 4IUUA 4L59A 2K50A 1VA7A 3CCVT 1VQ7Q 2WP8J 2X51A 3S24A 3J81c 4DV7L 4ALPA 1ESFA 3OW2A 2HBWA 3D4DA 4N0AA 1W6KA 2I5MX 1M2VA 3HOUH 3HOZB 1Z6HA 4LD9K 1GXDC 4F7UF 2IVWA 4XTCS 4M77F 4JI7L 5GAMh 1YCSB 1L1OA 3HPWA 3VYRA 2DKGA 3JCMJ 1JJ2S 4AH6A 1E7OA 3OS1A 2KCCA 3K81C 1VIFA 2QQAA 2M9UA 2NUTA 4A3MB 3RNJA 2HIXA 1IZ6A 5IGFA 4GKKL 2KQWA 1M30A 3Q22A 1LT4D 1YNJD 4B3RQ 3VV0A 2E2HH 2O2OA 4HCKA 4BI8B 1G2SA 1WXBA 3CXCP 1WIEA 4HR7B 1WCMB 2A6HC 2AUKA 3S15B 3MXPA 4LXCA 1N33Q 4JI8Q 1RL2A 1OXVA 2JA7G 1WQWA 1Q8IA 2G5DA 4FYWB 1JWMD 5C4ZA 5GMKl 4EQNA 1WOCA 1ZSZA 3DM3A 2XKOC 3MVVA 3U9OA 2QGGA 3AFQA 1EQQA 2HL3A 4NDXA 5I21A 3RN5A 2QEXT 2VW9A 3BS1A 1NCVA 5GAMg 1MBYA 2XDPA 3KUFA 1I6HH 4X34A 4E6RA 1ET9A 5C3XA 2E2JB 1QUQB 4OMNA 1YJWT 1XTDA 3M0SA 1KIKA 2DYIA 1Y1VB 3MA2B 3S3MA 4CJ1B 3J81i 1Q1BA 3OSSC 4HSVA 1TXYA 2X6GA 2C0IA 2CSQA 1QWEA 3LYIA 2VL6A 1PRTD 1JICA 1W6JA 1HCZA 3S2HH 3HEJA 5CMDA 3M53A 1AT1B 4RFBA 1TWCH 2OTLT 2ZJRA 2E5LL 2YU9H 3O13A 3H3VC 2K3XA 4KK7A 2DL4A 1FD7D 4HA8A 3CBOA 3TS2A 2EYYA 3QXEB 1Q86U 1K8MA 5M5YB 8ATCB 5M5XB 3QHSA 1PDQA 2F4IA 2RD1A 2J4XA 2ES2A 2LKVA 1C8CA 1MD2D 3SEMA 3BYTB 4QIWE 4XTWA 2LQWA 1G291 5C3EB 2RN8A 2EY6A 1C9OA 3O8VA 1UNSA 2HDLA 3NK9A 1J9OA 2BA1A 2Z4IA 1PTOC 1K73R 2L5QA 2JYOA 1LTSD 3KBGA 1M8MA 1SE4A 2WFWA 2ZZDA 2K2VA 1M1KU 2IHFA 1VF7A 1YJNA 4G4KA 1X56A 2Q8TA 5HGTA 3G48A 3JCMP 4NXNL 4DR4L 1GHKA 4J9BA 1MNEA 2ENMA 1GBRA 1WJRA 1WZOA 4BXXG 2RHUA 4L5TA 5T1GA 2EYPA 1B2TA 1N5ZA 1N34L 1RHPA 3NBIA 2FRYA 3M57A 2Q8RE 4IUVA 1KC8U 1K8GA 1VQ6A 1YNNC 2JA8G 1VQEA 4BY6B 4DNRB 2EJFA 2JA6B 3OMCA 3C3LA 2D8HA 5LMUQ 2KMTA 1RABB 3BVZA 2UUCQ 4XTZA 1EL0A 2G6FX 2N8NA 5NUCA 3UE1A 3T16A 2BUDA 2K5VA 4CKBA 4JI2Q 2ZXRA 2F4VQ 1BB9A 4R4OA 2E4HA 1EU3A 1M8AA 1L1OC 4A3FG 1LTAD 1CHPD 2P4RA 3CC2T 3CQZH 4Z8AA 1VYUA 2JA7B 3LW5E 1CT1D 2A68D 2KA7A 4A3IG 3NGPA 2RF0A 2RKSA 3ME9A 3DMUA 5CR3A 2ATWA 3S17H 3E1SA 4CC3A 1IKLA 5M3FG 1JE5A 2YTYA 3TZDA 3K58A 2MO0A 3OBWA 3OYBA 1Q7YU 4YHHQ 1K83B 3VYHB 3MJXA 1Y8PB 3S14H 1Z9FA 3KJPA 1AZGB 4NKLA 4B9XA 1LV9A 5M3MH 2EYZA 3NPFA 3PO2H 4XU2A 5GQOA 3PUXA 3GTPB 2RHQB 1BYMA 1SEBD 4XYOA 4PJOA 4QQGA 1XTCD 1CKAA 1ZSZC 2JUFA 3AT1B 3T9NA 5GMKh 5A2QE 1PTOB 2B29A 4DK6C 3CCLQ 1AWOA 1H641 2HSPA 2ZXOA 3C1FA 2E64A 3JCMf 5F2DA 3VR3A 4IN3A 2F0NA 2MOXA 2F52A 3LWHA 3AHUA 2WKCA 2A73B 1HR0W 4C3JG 1OOTA 1XWEA 2L3QA 1VQ4T 3U9SA 2KGTA 2KHJA 2OTJA 1UHCA 1ILPA 3RKWA 3SK8A 2JP1A 1O9SA 3M7NA 4GLKA 1X3GA 2KEDA 3GTOB 3A8MB 4KKUA 1H3ZA 4JPBW 4EIKA 2EYXA 4LE9A 1W3SA 2JSOA 4MN3A 2M51A 4LFBQ 3RMQA 5GAN2 1K9MR 2WB1E 1M2VB 4H7BA 4PJOD 1VQPA 1TWAH 2V1CC 3TP6A 1X3QA 4FM4B 2YUOA 1E24A 1L1OB 1E1TA 4A3EB 5LL6S 3VUBA 2E12A 3G6ET 1WQ7A 5D65A 1IBML 3FDRA 3U23A 3G4SA 1W2BP 3ASKA 5EG2A 4J8OA 3H0GG 3IFDA 4B3MQ 2NUTB 4B08A 2OAUA 2O31A 1X55A 2JA8B 1EYCA 1MJEA 3GDEA 4DV1L 2M00A 2RO0A 3I5SA 2A68C 4DKAC 5HCKA 2I0QA 4PLIA 1TU0B 1ACMB 3WOEA 2YUQA 1QQJA 2JTEA 2KDSA 2R58A 4HCZA 4R56A 1V1PA 2QF7A 4LUVA 4PMCA 3PGZA 2VQEL 5GAOl 4DBFA 4IJHA 3CC7Q 4PZ8A 5CBEE 1RADB 2R93H 3LGLA 4K0KL 3NTKA 1TQOA 2F3VA 1BF4A 1K76A 2YYZA 1H95A 1JXMA 1MMAA 2EJFC 1GD7A 2DY7A 4L6TB 2KXDA 1E1OA 4A3IB 1ZSZB 1TWHH 2PQEA 3SHWA 3FP9A 1OXTA 3CPFA 3CPWS 2G9HD 2K7VA 1SYGA 5M3FB 2A19A 2K3BA 3C95A 2X69A 4HKEA 2LS01 5IT9E 3SK4A 2RQRA 3FLGA 2QA4Q 1VQFA 1WYDA 5COYA 1WXUA 1KAWA 3G71Q 1HXDA 3TMEA 2E6ZA 5C0XH 1FMWA 2CGHA 4PJOG 3FHWA 3CCQT 2HD0A 3V8LA 2RB6A 1MSGA 2NLUA 4C3HG 2EVRA 5A35A 4DR7L 2COWA 4R8NA 3ZYYX 4OB0B 2NVTB 2PMZE 4JRQA 1HSQA 2QK0A 5FW9A 4F14A 3I55Q 3CW2C 2KVQG 3CCRA 4A3MH 2PU9B 3C12A 1VMPA 3EN2A 1OZ3A 2RF4A 3ULJA 4LF9L 3IFTA 3E3XA 4MIUA 1E6GA 1M9SA 3FEOA 5LJ5h 3HOXB 1JJGA 1W4SA 2V26A 4B3SQ 5FO9B 3GV3A 4FNFA 4C3JB 2E3IA 4PJOC 1F9RA 3QB3A 3SEBA 3S15H 1KDBA 4O1NA 2J7ZA 1ABQA 1PFNA 5FLXc 1OV3A 1J5EL 4LF6L 3OYJA 1IW7D 3X20B 1GCQC 4CHTB 1ZBXA 3JAME 3PO3B 1PH8A 1O7ZA 3FRPB 2CCZA 4LJZC 2XRSD 2LXKA 5CYUA 2DY8A 2C0TA 2J0TD 1YFNA 4A93H 2RJFA 2KCMA 1PKTA 1GOZA 2CQAA 3FRNA 4IJLA 2WKDA 4A3KH 4KJOA 3K5OA 1ZQ1A 1DCZA 4MDWA 2E2JH 1T0HA 2YLBA 4HEDA 3OYNA 4JI5L 1QP3A 4C5EA 2K1BA 4KTAA 2X6LA 1NM7A 1Y1VH 3H0GB 4OMOA 3GF5A 5D6YA 1WA7A 3OQ5A 1IBLL 3GTMH 2B2TA 1NJIU 4LFCQ 2JMAA 3LX7A 5CQYA 5LJ5g 1K9MC 3I4OA 3HOVG 3LGFA 4L63B 1IBKQ 1WTRA 4DXGA 1WI7A 3L3OC 4LWCA 3Q1JA 5CO7A 3MPUB 5ISRA 1VIEA 5ELFA 3EGUA 1M4VA 2DRKA 4V2SA 2FJ2A 3UE0A 1QVFA 2OEOA 1GCPA 5GMKm 4AQYL 4A3KB 5HY6A 3A8KE 2P5ZX 1BBXC 3CXCS 1L2FA 1SNDA 5C3EH 2KCNA 3S6WA 2UUBQ 3O5ZA 1WHKA 3LX0A 1EQTA 3TSSA 1YWPA 5IP9H 5LJ3d 2HCIA 4HMIA 4M78D 1ZBJA 3DHQA 4RTZA 1DONA 4IIOA 3EQLC 1IYJB 1STBA 2UXBL 3ZFJA 5IXBA 3VS3A 2JOYA 3BZKA 5GMKe 2F0PA 1PHJA 4QIWB 1NEGA 2A37A 4YCVA 1ZA2B 2ABLA 4PJOB 3TN2A 2M0YA 3ER0A 4ZUJA 1NYGA 1YHAA 5FU7C 1GRIA 2CP0A 3TEHB 1EFWA 2UU9Q 4M1UB 1KQSP 4LUZA 1QZHA 3S1QH 2EQKA 3MWYW 2KCTA 2JA6H 1HZBA 3J81j 2PI2E 1M4ZA 4RHRA 1FNWA 4FP5D 5FK9C 3G4ST 1MV3A 3LWUA 4OEMB 2KRSA 4YTLA 4EQ5A 3LH5A 3GLXA 5D6WA 1JC7A 4JI1L 1I4HA 2F0SA 1JR0D 2EQSA 2E3HA 4JI6Q 1D1CA 3GTQB 4JOIA 2BCOA 1VS0A 5IP7G 6AT1B 4BE2A 2F3WA 1IHZA 1A6XA 3QBYA 3I56Q 4R9WA 2VXEA 2H3EB 2SOBA 3Q23A 2E74C 1GM5A 1D0XA 5IE8A 1HNWL 2IPKD 4RMFA 4M78G 1K83H 3VS2A 3HG9A 2QQSA 1HFGA 2LTOA 1UTIA 2RBMA 3H94A 3MHBA 3PUWA 2YUNA 1Q7YR 1OTCA 1K8OA 2F03A 2F0WA 3D6CA 3MZ5A 4BBRG 1G8XA 1D1KA 1VQJA 2NVXH 5EKIA 1Y96A 3GNGA 4M7DD 1HUMA 1U3OA 1JOOA 2PZUA 1G51A 1VQOQ 4OMQA 5KYYA 5GMKi 2AWNA 2RDHA 3PIO3 2ZJPA 1PH3A 1E2WA 3GO5A 3KK7A 5GROA 3HP3A 5CCAA 2GCXA 1PTOH 1Y07A 3CMEQ 1D6EC 3HOVB 1EOVA 5KNCA 2I0NA 1JWSD 1S72Q 1NTGA 1S5ED 1EU4A 1V1PB 2CHBD 4JYAQ 1XMOQ 3ND8A 4DUZL 3HKZE 2QXFA 3OW2P 4JS5A 1PTOF 4C92E 3I72A 1KJWA 3M9QA 4FSSA 1S5FD 2VV5A 5FU7B 3FKIG 4J9EA 1VQ8A 1EY8A 3KOJA 4XU0A 5C5LA 2A7YA 2X4XA 2B2VA 2JMCA 1R9TB 4JJCA 3KFVA 2A08A 1JQQA 2DTHA 1BU1A 2AT1B 3C2PA 1XNRL 4A3CH 2UUAL 5C4XG 4HIKA 2GFAA 2FHDA 1YJ9Q 1Q86C 5FJ8G 5T1IA 1P16A 4DQ2A 3L2ZA 3CCSA 3T53B 1YI2A 3BE3A 3F2CA 3B6YA 1GO3E 2JEAI 3ULPA 4RAUC 1CQVA 1Y71A 1U4RA 4A3EH 4LDUA 1UE9A 4P72A 2KK4A 4J9DA 1B9MA 4PNYA 2OAWA 4C3IG 2GQIA 2FZCB 3CEYA 2COZA 2D8JA 1EY4A 3FJ5A 4EMHA 1Z7TA 2SNSA 4Z9CB 5IT9c 1M1KC 2HSEB 4RTXA 4M7DG 2PZWA 5DM63 4DV1Q 3CRKC 1X3EA 1IO6A 1SN8A 2WB1B 5FO7B 3J7YW 2E5QA 4TSSA 4DU9A 4Y7NH 5E7NA 1U8RA 4X1VA 4XT3B 1OU9A 3TSZA 5EJWA 3EG3A 2E75C 3A5UA 3TVTA 5CBAE 1JT8A 1N6AA 3OYMA 5ELBA 3D31A 9ATCB 1RLQC 1SNCA 1UE5A 4O2DA 4M8AA 1CKMA 1O7YA 2KHSA 3K8AA 3UA6A 4DV4L 4C5HA 1LTID 1KNEA 3M4OB 3DWPA 4UC4A 4PL6A 1O78A 3CKIB 4EGVA 1TS4A 1LJOA 4WJWA 1PC0A 2AK5A 2WAQE 2DL7A 1RAIB 4IIMA 1E22A 3JAMc 2LNVA 4AFQC 2EQUA 1STAA 3TBIB 3JC66 1TS9A 4JOIC 4C92A 3MXNA 1AWJA 5J26A 4J1MA 2K01A 2L5TA 4DV6Q 5ELDA 4BBRB 2P0KA 4IFDJ 3FEWX 2EXZA 4F04B 4ID6A 5LMNQ 4OMLA 2KROA 1NE3A 2NVTH 3QYHB 1W2BS 1HYOA 3UATA 3CCJA 1Q7YC 2LJ1A 2QASA 1QLYA 3TCJA 1PFMA 2RCNA 5IYDG 4Y92A 1VQNT 4ATOA 3PUZA 3HOXH 3M7GA 3UDIA 4RG2A 4JZ3A 1VQ5Q 3CD6A 1B44D 1Q46A 4C0ZA 2HNIA 1UE6A 2RQWA 2Q2TA 3S2DB 3VS4A 4RKLA 1AZPA 1GUOA 3OOCA 4FXKC 3OBYA 2CP3A 3FKIB 3NELA 1KRSA 3PO3H 1RD9D 4YWLA 2CFMA 3QWXX 2IX1A 2PQWA 1CK1A 1C48A 4WFN3 1TG0A 4H44C 3K5LA 1HD3A 3EGXA 5LJ3e 1RTNA 4N8X1 3JCMX 4A75A 1MNDA 1RODA 3MXGA 2E70A 4GNXA 5D3IB 2NN6H 1H9SA 3PGGA 3X24B 1YIJQ 3OYDA 3CCVA 2ZTDA 2A0FB 1PG5B 2XNAC 4JI0L 2DAQA 3JRZA 1VQLQ 1SDFA 3A7LA 4XYQA 4JI5Q 5E4WC 2ZJQA 1A8VA 1K0RA 2CQOA 3JAMi 4F17A 1S1NA 1TVXA 2B2VC 4C3IB 4RMOA 5KCOA 3KLRA 4RKBA 3L2WA 5FROA 3S9WA 2DGYA 1XJVA 1C7YA 1RIPA 4R8IA 2PPBC 4NXMQ 4XIGS 2BZYA 2GTOA 1ESRA 1PSFA 1J3TA 1G3WA 1I4K1 1RDPD 5IY0A 4PK4A 1E2ZA 2GVBA 4JI4L 1SSFA 1O80A 1VQCA 3HKSA 2ESWA 1MKHA 3ONAB 3V8JA 4ZLTF 2XI9A 4WCIA 3OYHA 2ZPEB 4P2CB 1WD1A 2COYA 4CBVA 2MMPA 2OT2A 4DR3Q 1OPLA 2VZAA 1OO9B 2VQFL 4A3BH 1WTPA 1YHQQ 3BFMA 5GANd 1VQMQ 2NYSA 1I4GA 3TEEA 2C9OA 4EQOA 3P75A 1NZ9A 2EDGA 1EY6A 1BQQT 2JA5H 4ZKCB 2ROLA 3U4ZA 4CC2A 2K04A 1B9NA 3E19A 1KQ2A 4C92G 4A4FA 2M02A 2H5XA 4PQXA 1CFMA 5L37A 2RHYA 1GUNA 2PNRC 1BOSA 4DV2Q 2MPXC 4R0KA 1Y96B 4KT0E 4QCLA 5GANh 2MK5A 3K5NA 2F2VA 1RI9A 2K57A 3HHTB 5KYYB 2QQBA 3CCST 2MUYA 2VKNA 2V8IA 1LM0A 4ELZC 1H8KA 2DZ9A 3HRUA 3E0JA 4Z02A 1PFBA 4JC0A 2RA4A 2DRMA 2RHZA 3OB9A 1HQMC 1EQRA 3H41A 3MEVA 3CC4Q 4KD4A 3SK5A 2X9HA 5GAOr 5BN4A 3ICEA 1KXLA 1IYUA 2AQ2B 4BE1A 2DD4A 1QWYA 4C92C 2OTLA 4OMPA 5GAN5 1LTRD 4ORZA 2QGQA 3OHXC 3KXTA 1TR5A 4BA2I 1IXDA 4E6IA 3MC0B 3VS0A 4CKCA 1WHLA 2D0NA 3HP9A 1STNA 5LMNW 3MP6A 1WNLA 3GTQH 1D1BA 4RTUA 2VC8A 4QQ6A 1HH2P 4KKTA 4XK8E 5D14A 1X3FA 2YRCA 3GNFB 3SD4A 4DBQA 2FL7A 2V8KA 1PHTA 1SHGA 1X75C 3W2DA 4XTXA 2HUGA 3RZOB 2RCFA 4LF8L 1TUCA 3STBD 4LDXA 3P20A 3KF8A 1U4MA 1A0NB 2F1LA 1VQAA 3E5SA 5GAOp 2DEUA 2KNBB 5FRNA 1MJCA 2X4JA 3S1RB 4POGA 4HT9A 2P0QA 1SNQA 3RMHA 2QKIC 4LF5L 4ZGDB 1ZYRC 3HRZC 1A0IA 2YWWA 5CKBA 3BW1A 4DV0L 4H13C 1XMQQ 4GOPC 5I4DA 3T51B 5IGEA 5HK0A 4AFSC 1KQSS 2HIVA 4GNXC 3HGBA 2A69D 4GLMA 4BA1I 1KSWA 4DR1Q 2EJMA 2SEBD 1I94L 2QGFB 2E2DC 3L2RA 3P8BB 4PNOA 4S3SA 5GAN6 2W0ZA 4UY8C 2Y4XA 3BDOA 1MMDA 3OS5A 5HURA 5HGQA 2FZGB 4AG2C 1B07A 3CD6T 1R9TH 2KEEA 1ICWA 3BU2A 3JCMW 2DO3A 1BKBA 3N5BB 2KJXA 4R1JA 5JVH3 3CRLC 4OO1H 1HFNA 4HIMA 2RSNA 2NVQH 4HCEA 1JB0E 4C92B 3MXNB 2FPDA 1KAAA 5ECAA 2ZT9C 2WSFE
chains in the Genus database with same CATH topology
2DIGA 5CKEA 5GAMd 3T1HQ 2VY3A 1O7IA 4E7LA 2ZPIB 1FX7A 3OYGA 1VQ7T 3X25B 2FB7A 3OS2A 2RI2A 1M1GA 2P0PA 2JN0A 5GMKj 4NOYA 5AJ3Q 4A3GH 4GY5A 2CS7A 4BY7G 3OW2S 3HOWG 3RKXA 1Q82U 1MGQA 1VQ4A 2AKWB 4GOPB 4GNXB 4IFDI 4CI0C 1M90U 4Y28E 2HQLA 3OTOQ 2RHIA 1PH9A 3PT9A 1J6QA 1A62A 4BBRH 4IURA 4FIBA 1QVGS 2BKDN 5A0DA 3G6EA 3SFMA 4FDBA 2R92G 2VS1A 1HNZQ 3AQQA 2L3RA 2CZ6B 1KD1U 1XNQQ 3CCEA 3GIBA 2ZM6Q 4OMFB 2IT1A 4NL3A 4M75A 1JJCB 2C35B 3WVDB 5IAYA 2RJCA 5GAN4 5GANe 2ZPBB 1U1SA 2ALYB 3ZEHA 1QP2A 4E7JA 2IY5B 1SLJA 4LF4Q 3J80E 5GAGC 5C44H 4PJOE 5BR8L 1G6PA 4X66L 4VUBA 2E8GA 2JK8A 3CCQA 3PNWC 2PNHA 2K14A 4GN3B 2LCLA 4C8QD 4C3IH 3V7SA 4QVZA 1XPOA 5IYCG 3M58A 1UE7A 1N32Q 4EMGA 2M0OA 4M75D 5ELNA 1D7QA 1I81A 4OO1I 1PVOA 5LJ5j 2ZTCA 2DJZA 3BJUA 3HOYG 2VQFQ 2MAMA 2X4YA 4O6JA 3I4MG 3KF8B 4GKJQ 2R7ZG 1P92A 4M7AD 2F3IA 1S3OA 4BD3A 1AHJB 2DIQA 4ZN1A 3WXMB 2EAYA 2N49A 1VQHA 1CKNA 3ZBDA 4LF7Q 4JBMA 2MF2A 2CWPA 1UGSB 5C0XJ 3MEUA 1ZHIA 4DR5Q 1MHNA 4C8QG 2ZPFB 2Z6KA 4A54A 3LLRA 1QW1A 3L2VA 3QKJA 2UXCL 2AHJB 4X64L 4YCWA 2XD0A 4M75G 4MZMA 4UPAA 4OF1A 1XQHA 4A4IA 4DNIA 4OWXB 4C2MH 4OX9L 2B63G 4QY7A 4KUIA 4C8QC 2RHXA 3RNUA 3RZOH 3CMAT 4UP7A 2R5AA 4RG8A 3M59A 4M7AG 4M75C 3S1RH 2JTMA 2K5FA 5LJ3f 5GAMe 3A74A 4DV0Q 4OB2B 1OXXK 1Y7XA 3M56A 3MEAA 3SGIA 5LJ3j 1HJPA 4A4GA 1PH6A 4E47A 4LFAL 4J6XA 1OZ2A 1X54A 2YTVA 4HJAA 2UXDQ 3EAEA 4EPCA 2LT4A 3VJPA 4PMWA 3E9HA 3UDFA 2QI2A 1BI1A 4WF2A 2GFUA 2RK2A 4JJNK 3CCET 4M78E 4HCBA 2P4TA 1SRUA 3WWVA 3BZCA 4Y52H 1FGUA 1TWFH 4BBSG 1OYXA 2YLCA 2MWPA 4DV7Q 5CK9A 1SFOH 4C92F 3KFUA 4DV3L 4DUYL 2QA4T 3HOZH 2MQHA 5LJ5d 4JI7Q 2ZPGB 1Y14B 2I5HA 3TQYA 3M5AA 4M75B 5KH6A 1FJGL 4WJ4A 2VYTA 1Y1WG 4GKKQ 3PTAA 4PKCC 4XAXB 2Z6KC 3MP8A 5GAN8 2MFIA 1WCMH 3QO3A 5J39A 1N8RU 4F7UA 1N9WA 4JRPA 3RKYA 2XGTA 2XDBA 3JB9H 2WSCE 1AH9A 4M7DE 1KHCA 3J80c 5JJIA 1VQKA 2CZ0B 1HNXL 4R4QA 4M78A 3JB9F 5CKHA 1FWZA 3KDFB 1B7YB 4DR2L 2DTIA 2K4KA 4NPSA 4XU1A 1EIYB 1SROA 1AE2A 2E5LQ 3OA6A 5ELOA 5M5YH 2YRVA 1GKHA 5M5XH 4M77D 4JUVA 3HRSA 4R55A 3UDXA 1XPRA 5FLMH 2VUMH 1CSQA 2K52A 4BACA 2RI3A 1QZGA 3EFSA 1CKNB 2CZ7B 1PSEA 2CWAA 4JI3L 4IUPA 1G3YA 5IWAL 4NXNQ 4DR4Q 5JJLA 4OP0A 4EMKA 2KENA 3W1BA 1N34Q 3J80i 4L5GA 1I8FA 3OYIA 3BY7A 4C5GA 1VQNA 4BY7H 4DR6L 4M7DA 3EBEA 3HOWH 2EXDA 2G3RA 2XU8A 2ZPHB 4BB7A 3V7CA 3PIPA 3QSUA 1HZCA 4L6V5 3I4NG 4F7UG 4M77G 1UE1A 1OXSC 2LXJA 2JA7H 1LTLA 5C0XI 1NMGA 3UDGA 4X65L 3S16H 1Q82C 4PG3A 3HOUG 3H3VH 4XTYA 1M90C 1C0AA 2DUDA 1UGPB 2BIVA 2D0PA 3JCMg 2F69A 1PV4A 2Y90A 2UXCQ 3U50C 2E1HA 1M5Q1 3CMET 4QQDA 2CYZB 1VQBA 4IUQA 4M78C 3X26B 3L2QA 1FVIA 4OX9Q 3V7RA 3HFNA 2HQEA 4IOCA 3H15A 3QG1A 3UPUA 3CP0A 4KLKA 4H02A 1KG1A 3J7ZC 2AWOA 5GANf 3U4VA 2I5LX 3GTOH 2OWOA 3PSIA 1XNIA 2DK3A 4DV5L 1YJ9T 1NBWA 4R4TA 4E7KA 5GANj 4EDUA 3SDZA 4A53A 4P71A 1PYSB 3RR5A 2BH2A 3CCUA 4IO9A 2LRQA 2XK0A 2KSSA 4BXXH 3GTLH 1IBMQ 1NE8A 1EYGA 5CR2A 1YITT 1VQKT 2YTYA 4GN4B 5LJ5e 3D0FA 1Q81U 4LFAQ 5A0LA 3PCOB 2JA8H 2LX9A 3HOYH 3WVEB 4EMKC 2VQEQ 2HQXA 3S1NH 1KQ1A 1DJ7B 2XTIA 5KCHA 4K0KQ 4YY3L 5C0MA 1KC8C 3I4MH 4A3FH 3QUIA 1YHBA 4F7UB 1U5KA 4BY1G 3ERSX 2L89A 4A3IH 1LYLA 4M7DC 2K3YA 4XU3A 1ASYA 5M3FH 4M78B 3CCMT 3A8OB 4DV3Q 2E65A 2O4XA 4NS5A 4DUYQ 3PIOA 4TQUS 4DR7Q 4A76A 1FXXA 3RIRA 1PFSA 3VU3C 1E7ZA 5GADC 4C0DC 3M54A 4B3RL 4LF9Q 1KRTA 1R8OB 2RI5A 3M9BA 4MMLA 3HRTA 1Q8KA 4JI8L 1N33L 4C3JH 3RN2A 1VQ5T 3M4PA 4PZ6A 4JDSA 1J5EQ 4LF6Q 3C94A 5H1SE 3GTPH 4B3TL 1TH7A 1UGRB 2QQRA 4J83A 3PMIA 5M3MG 4EMKB 4FSXA 1U1TA 1HR0L 2PQAA 1VQ7A 4O0AA 4FT2A 1Q1EA 3H0GH 5GAMf 1IBLQ 4DA4A 4P75A 4YWKA 4M7DB 1WI5A 5GAMj 4GS3A 4BUGA 2EIFA 3OYKA 3HL8A 4GLAC 4OB3B 1K73U 5EAYA 1U0LA 3L42A 1UEBA 4AQYQ 1N9SA 5JJKA 1L0WA 3CAMA 3W5OA 2LQKA 2JZ2A 5A0GA 5GAN3 4C0DB 1VQMT 2Y4YA 3DLMA 3AFPA 4AH6A 4BBSH 1B34A 3A0JA 3K80C 2Z0SA 2UXBQ 3E9IA 3GPLA 2JE6I 5FU6C 4J7IA 1I50H 4C3HH 4XTUA 1YCYA 2R5MA 5LMUL 3PF5A 3CCUT 4OONA 3QPHA 2ASBA 4II1A 4N4HA 4JI2L 4PJOF 4KBMB 2R93G 4FU6A 1VQDA 4JI1Q 3QZ9B 2R7DA 4MDXA 3FB9A 4DPGA 4YHHL 4BI4A 2XG8D 4JCVE 1N36L 1HNWQ 5C0XG 4UP8A 1D8LA 3MEWA 2CKZB 1Z47A 3PMTA 5CKDA 1N8RC 4A3MG 4WJ3M 3LH0A 1QVCA 4IUTA 4HJ8A 3HOVH 2D6FA 3NTHA 1M1FA 4J15A 1VQGA 1JRIA 4DUZQ 4QJFA 3QJYA 2OCEA 2RK1A 3RMSA 3FC3A 1KQSA 4A3DG 2E10A 1NJIC 4Y91A 2NN6I 4AYBG 4A93G 4QVCA 1XNRQ 4A3KG 2UUAQ 2R57A 2PVOB 4OXPA 3HFZB 4C8QE 2O4XB 1I3QH 3URGA 3R6OA 2AMCB 4DAMA 1X9NA 4B3ML 4JRIA 3M4QA 1CKOA 4M75E 2ID0A 2K4YA 3J7A5 2GVAA 2ZTEA 3F2DA 1G3SA 3CCLA 4P74A 4QQBX 3LWIA 4ZN3A 3AYHB 3STBC 5C3EG 1SR3A 5IP9G 3KJOA 2YV5A 2X4WA 3I4NH 4M7AE 3CMAA 5IP7H 1JJ2A 4DV4Q 5KE2A 3M4OH 3NTIA 1HZAA 2VGNA 2PQAB 1SE8A 1GXIE 3DLLA 2DXBA 4A3JG 2XIDA 1QVPA 2JA6G 2DXUA 4M78F 2K5HA 1ASZA 2BA0A 1A63A 3I7FA 5FRMA 1VQ9T 4B3SL 4JBWA 1QVGA 4N4GA 4IPDA 1UB4A 4C8QA 1PYBA 2EKOA 3CF5A 4B9WA 4HCCA 1FL0A 3LGJA 4BY6C 4CRIA 3S2DH 4ZGEB 3CC7A 4QL5A 3FKIH 2B3GA 4B3TQ 1B34B 1AE3A 1NMFA 5C4XH 1RI0A 4ZTFA 5HK3A 5FJ8H 5C6SA 2JQOA 4OWTB 1YVCA 4MNOA 1HR0Q 4JI0Q 3OMGA 3EFRA 5IN1A 4LFCL 4FL6A 4M7AA 2QA4A 4LNQA 1M8VA 3G71A 1IBKL 5IYBG 5DY9A 4NL2A 3Q8DA 2ZGWA 5FLXE 3MEFA 3JSCA 1S40A 1EIFA 4A4KA