3CEYA

Crystal structure of l3mbtl2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
433
structure length
390
Chain Sequence
QDALVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSDRVYWIASVIQTAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILVPPRTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDDDDFWCHMWSPLIHPVGWSRRVGHGIKMCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICVDDWFCYHASSHAIFPATFCQKNDIELTPPKTFNWENYLEKTKSKAAPSRLFNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Lethal(3)malignant brain tumor-like 2 protein
publication title Methylation-state-specific recognition of histones by the MBT repeat protein L3MBTL2.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 390
sequence length 433
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ceyA04
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ceyA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ceyA03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ceyA01
4N4GA 3OYLA 2EQUA 2R58A 3OMGA 2GFUA 1MHNA 3O8VA 4QVZA 2XK0A 4N4IA 3OY9A 2LCCA 4GY5A 2X4XA 3LGLA 3MP8A 3S3NA 2O4XA 3EAEA 4IUQA 3ZEHA 4EDUA 4ZTFA 4L59A 2RHIA 2WACA 2RHYA 4E7IA 2MWOA 2R5AA 2DIGA 2QQSA 3META 4CRIA 2BIVA 4PLLA 1RI0A 5D6WA 2NLUA 2DAQA 3OYGA 3S3OA 2HQEA 4B9WA 3OA6A 1KHCA 2L8DA 3UWNA 2YRVA 2DIQA 2CKKA 2K3YA 3LLRA 4PLIA 1OI1A 3FLGA 5D6XA 1WJSA 4E7JA 3OYBA 4BACA 4FL6A 4FU6A 3OS2A 4A4FA 2LRQA 3L2UA 3GOXA 3OYJA 4NS5A 4IUVA 3P8HA 1WJQA 3NTIA 4IUTA 4B9XA 4A4HA 2EQJA 2MWPA 2RJCA 3OS0A 3NTHA 2B8AA 3DLMA 3DB4A 3L2RA 4Q5WA 1XNIA 3OYEA 3QBYA 3QKJA 3FEOA 5IN1A 5C6SA 4IKFA 5KE3A 3P8DA 4QQDA 1H3ZA 1OZ2A 2PQWA 2R57A 5M9OA 3L2VA 4A4GA 1SSFA 2LDMA 2RHXA 3Q1JA 3FC3A 4A4EA 3MEWA 1OZ3A 3OQ5A 2BUDA 3MEUA 2RHUA 2BKDN 4E7KA 4BD3A 3OYIA 2E5QA 4E7LA 3QIIA 2X4WA 2LTOA 1OYXA 3OYKA 3OS1A 4X34A 3MP1A 3MP6A 4BDYA 4BE1A 2L3RA 3MO8A 2EQMA 4RG2A 4C5HA 5J39A 2O4XB 2P0KA 4II1A 1G5VA 3OYNA 4QQGA 4C5IA 5C0MA 2HQXA 2EKOA 2E6NA 2K3XA 2IG0A 3PMIA 4C5EA 3ASKA 3S3MA 4BE2A 4QQ6A 3E9FA 2F5KA 3PNWC 3H8ZA 2RI3A 4C5GA 3OYFA 2RJFA 3UT1A 2RI5A 4QW2A 5KH6A 3OMCA 2X35A 4BE0A 3SD4A 4IURA 1N27A 5J26A 3OYHA 2GFAA 3OYCA 4PL6A 3OB9A 3PMTA 2RHZA 3LH0A 3C4SA 5KCHA 5CIUA 3L2QA 2R5MA 4LD6A 2X4YA 3ME9A 3S6WA 2QQRA 3QJ6A 5KE2A 2L89A 4N4HA 3MEAA 3OYMA 3M9QA 3KUFA 2LVMA 3LGFA 2M1HA 3L42A 5D6YA 4HCZA 4UC4A 2JTFA 2VYTA 3E9GA 3H6ZA 3LYIA 3MEVA 4Z02A 2D9TA 3L2WA 2M16A 2RJEA 4ZTJA 5FROA 2RO0A 1WJRA 2FHDA 2GF7A 3F70A 3OYAA 3LX7A 4IUPA 2RI2A 3BDLA 4OVAA 5KCOA 1WGSA 5FRMA 5IAYA 3DB3A 5FRNA 4E7HA 4BDZA 3NTKA 3OYDA 4IUUA 3PFSA 3FDRA 2M0OA 2G3RA 2EFIA 2EQKA 2XDPA 2RJDA 2JZ2A 3CEYA
chains in the Genus database with same CATH superfamily
4J7IA 4QVZA 3EH1A 3VRYA 1M1KU 2LMJA 3VS5A 2EAYA 2O4XA 1XQHA 4LXCA 4Y91A 2RHIA 2LJ0A 2DIGA 4DBFA 4JRIA 1UEBA 1QVFP 3VJPA 2RA2A 2DAQA 1WFWA 2CZ0B 4DBHA 4RCCA 4JRQA 4JJDA 2K4YA 2C0OA 3VYHB 1X69A 1M1KC 2K6DA 2COYA 3HRUA 1WXTA 4XTZA 2CUBA 5L8RE 2X3WD 1KQSP 2BZYA 2P84A 1VQLT 1ZUUA 2LJ1A 3SWNB 2L2PA 1MNDA 1BBZA 1HSQA 4X9DA 4MZMA 2FEIA 4X34A 1OU8A 2L5QA 1NEGA 2F2WA 3R6OA 2IG0A 1T0HA 1YNZA 1LOJA 2FO0A 1BK2A 2KI7A 4XK8E 1AHJB 3M58A 3RUXA 2HL5C 1TU0B 3CCQA 1D0YA 3QJYA 1CSKA 3JRZA 5DLQE 2L3QA 3M5AA 3JCMe 2F2XA 2DPPB 4Z89A 4M7DA 1Q82U 5KYUB 5KCHA 2KR3A 1GBQA 1NYFA 4JZ3A 1LJOA 2FL7A 5KE2A 3C12A 2QXFA 3TEEA 1Y7XA 1QCOA 1N8RR 3J80E 2LT4A 2J6OA 2RI2A 2XIDA 4BY6B 1AWWA 4RTUA 4M75F 3N5BB 3I56A 1Q82C 2YUOA 2BE9B 1X27A 1I8FA 1HXDA 1BI3A 2QI2A 4J5YA 3CC7T 1MUZA 3QWXX 2KYMA 4NL2A 1UJYA 2EQUA 2GCXA 3TSWA 1E7OA 1TG0A 1I5OB 1U1TA 1VQLQ 1ZSZA 5HCKA 4EMKB 2LT1A 5CKDA 4FW2A 2LQ8A 4OGEA 1H92A 3FIFA 4OMPA 1VA7A 2FG0A 3GOXA 2DYBA 3DLLA 2EWNA 3M4GA 4PFPA 1Y07A 1IXDA 3CCST 2BE7D 1YI2T 1SKUB 2E3HA 4VUBA 2EYQA 3P8DA 5I22A 2FZGB 1ACMB 1SSFA 3TSZA 1OZ3A 4QKUA 2K2VA 1VQPT 2QA4A 2QEXQ 4AFQC 2HMAA 3OSSC 4F16A 5I2SA 1ZBJA 2MK5A 3OYNA 3M0PA 3S3MA 2LX7A 1VQ7A 3HRSA 2EGAA 2CREA 4M77C 3AHUA 2DXUA 1IHVA 5A0GA 1Q7YU 4M7DG 1RAHB 1YCYA 2OTJA 2MF2A 3CC7Q 4HT9A 1ZUKA 9ATCB 1GCPA 5GAN7 3M9QA 3M54A 2DE0X 5D6YA 3CCET 1MV0B 3GNGA 1M4ZA 2CYZB 2J7IA 1F1BB 1Q7YC 3CD6Q 4OB3B 2V8KA 3BDLA 1D0ZA 3HTRA 5KCOA 4BDZA 2DL5A 4M78A 2JVVA 3CCJT 2R58A 1OQKA 1UGVA 3EFOB 1VQNT 1T3SA 2VWFA 2Y90A 2R5AA 1R8OB 4FYXB 4PJNA 3HFNA 4OB0B 3GF5A 1VQPQ 4RKUE 3X25B 2Z0WA 4KBMB 1C0MA 1X01A 3NPFA 2D1XA 3UA7A 2RD1A 2CP5A 3CCUT 2H8HA 5GAOn 2EVRA 4JZ4A 1M2VA 5GMKl 1QCFA 1OZ2A 4C0DB 1NJIR 3A8LB 4J9CA 1RADB 2RHXA 1LVKA 1K8AU 5CQYA 2OTLQ 4PFOA 2CP3A 5LJ3d 4E2FB 4ELZC 3OYIA 4F17A 2DRMA 2LP5A 2L3RA 3CCEQ 2LQWA 2O4XB 3GPLA 2E6ZA 1UHCA 3NMZC 2MYSA 3E9FA 2CSQA 3V7RA 1RAFB 1K8AC 3JV3A 4KUDK 4A63B 1SF9A 5HY6A 3UDCA 3EG1A 3CCJQ 1OULA 3OB9A 4JLGA 3PMTA 1AT1B 5GMKj 1VQMQ 1VQLA 1C6VX 1JO8A 1FMVA 1VQNQ 1N9RA 1QP2A 4AFZC 4J9GA 1IGUA 2MMPA 4CC4B 3LGFA 3GP8A 5GAOr 4KGVB 4ZTJA 2DXBA 2GF7A 5CCAA 1QKXA 4M78G 4M7AC 4HCCA 1K0XA 4J7FA 3CBOA 3EFRA 3CCVQ 3P8BB 1RAGB 2JZ2A 2XU8A 1MHNA 3CCUQ 4BUGA 4N4IA 1VQ5Q 4XTXA 1QVFA 1WX6A 1TUGB 5GAN3 1U06A 3V8LA 2EJ9A 2RHYA 2V8JA 4XAXB 5LJ5d 2NYSA 4JJCA 4PLLA 1VYUA 3WVEB 3OYGA 2PNIA 3FJ5A 2QEXA 3MHXA 5LJ3e 2PVOB 4M7DB 2QGFB 2C0TA 4X1VA 1JJ2A 1KQSA 1W1FA 4A4FA 8AT1B 1KD1C 2JM9A 4HVVA 2DL4A 4LDWA 1RAAB 3NTHA 2DXCA 3CC7A 3QKJA 2QTXA 5GAMd 2AIRB 2VC8A 2ZPFB 2QASA 2DF6A 3G4ST 1UTIA 4MDWA 2COZA 2ZPBB 2RK2A 1TXQA 1FMWA 4JUVA 4XU2A 5CKFA 3LW5E 3OS1A 2D6FA 1GXIE 2DX1A 1VQ9Q 2OAWA 2EGCA 2P0KA 2ED1A 1ZSZB 3UF4A 5CK9A 3X20B 1NLPC 3M53A 3JCMg 3DKMA 3OW2S 2E70A 5FU7B 2RI3A 3VS2A 1B3QA 3L1AA 5KH6A 5CKHA 3OMCA 2YXYA 3JCMJ 4M75A 5LJ5f 2V8IA 2XDDA 4IIMA 5FLXE 4ME7A 3CCSA 1UDLA 1V76A 3HSBA 3L2QA 2VUBA 3QJ6A 4KT0E 1VQPA 4TVRA 4MZTA 1HJDA 1W2BS 1S72T 3U23A 1XOVA 1IGQA 4ANJA 1PWTA 4XU0A 5FU6B 1M90U 4MMLA 4FT2A 4IUUA 2AZSA 4OMQA 2KK4A 2K9GA 3QHSA 3O8VA 2XK0A 5HKCA 2J06A 1QVGS 2EYWA 2CT4A 4ZTFA 4Z8AA 5GAN8 4ZGDB 3META 2QK0A 2OTLA 1RUWA 5GAMe 3CBMA 3M55A 4OMOA 1M90C 4M7DD 4DEYA 1WA7A 1D1BA 2JJ9A 3CCEA 1TUDA 2CKKA 1K73R 3EG9B 5GANg 3BE3A 1K9MC 2QYZA 2PU9B 2X3XD 3E1SA 4FW1A 3P8HA 5LJ5j 1WJQA 1QQJA 4XTUA 2EIFA 3HL8A 2D0QB 4DEXA 2ZAEA 2DLPA 3CCJA 3QSUA 4AG2C 1EX4A 4C8QE 1M3BA 3VUBA 1I4K1 1VQNA 4M78B 4KUIA 1YJNQ 3CXCS 1J3TA 1EZZB 3HPWA 5GAN2 5GAN5 3TU4K 3X24B 8ATCB 2K3XA 1XTDA 5GAMj 1YIJT 2CUDA 3HRTA 4M75G 3H8ZA 2VASA 4F14A 2RJFA 1N8RU 1YHQT 4N0AC 3CCUA 1VQ5A 1I5LA 3RDVA 3OYCA 1D3BA 3VYGA 2X4YA 1VIFA 1GCQC 1NE8A 3EGXA 2ZZDA 1AZEA 1UUEA 1M2VB 2ENMA 2M1HA 3L42A 5L23A 4FSXA 2CZ1B 2RJEA 1M1GA 2FRYA 2O9SA 4A53A 1JRIA 2XD0A 2VXFA 4C0GA 2B86A 4C92C 2XI9A 3PFSA 2DMOA 2JW4A 1KC8R 4BE2A 1WHMA 4M77F 2CP2A 1WNLA 2GFUA 4ORZA 1KJWA 3OY9A 2F1LA 3S3NA 2ABLA 3ZEHA 2MPXC 1NPRA 2HZYA 2QQSA 1AWOA 3A1PA 1N9SA 1KQ2A 1RLPC 1OPKA 3ULRB 3VU3C 3PVQA 4F7UF 1FYNA 1VQ9A 2C06A 4E7JA 1SEMA 2JOYA 4PJOC 4D8KA 3CBPA 2AK5A 2JNGA 4E7SA 3IQLA 4XU3A 2OTJQ 3RIRA 4IUTA 4C8QC 2RMOA 1VQOT 1NM7A 2ZPGB 3UATA 2CP7A 4M78D 4V2SA 3OQ5A 3JB9I 2JN0A 2X4WA 4OB1B 4XTWA 3MO8A 2BZ8A 1IRXA 3NHNA 1VQ4T 2PVDB 4JRKA 1D0XA 1GRIA 2YHTA 1GCQA 4LDVA 2I0NA 3LH5A 3M57A 1PNJA 2EJGA 3SD4A 5EC7A 4EMHA 4JS4A 2L3SA 3JB9D 1D09B 3BY7A 1TUCA 5D7UA 3CC2T 1RAIB 2E41A 4J6XA 1P92A 4LD6A 1YITQ 1I0CA 2J6FA 1MMGA 1X6BA 3VS7A 3VRZA 1YWOA 2J05A 3LYIA 3CPWS 1X6GA 2FHDA 2KY9A 2HKQB 2A08A 2G6FX 4B6MA 1OEBA 3CMEQ 2DVEA 3MCAB 3HFOA 1VQ6Q 2EGEA 4OMLA 2EQKA 2RJDA 4ELYC 1NBEB 3TREA 3V8JA 3VS4A 3LGLA 1VQOQ 5KYNA 3GNFB 1B34A 2VVKA 3E2UA 1YJWT 1YJNA 4LUDA 4M75B 2HQEA 1KHCA 2CZ6B 1H3HA 4KULA 3JCMX 2P0QA 1W4SA 4PKCC 2M02A 4J8OA 4BACA 1S72A 4LUEA 2ATCB 4ZNXA 4M7AF 3FJPA 2K7AA 3RKYA 2DTHA 3DB4A 3SFMA 1PSFA 3RMQA 5LJ3h 1Z9QA 3EFSA 4L6V5 3OYEA 3CPFA 2QQ9A 2PQWA 4A4GA 1FXXA 1VQ8T 2BUDA 2NUTA 5CR2A 2RHUA 1V1CA 2E5QA 1UGPB 4JRPA 3JCMP 2FPFA 3JCMc 1U5SA 4BI8B 1TTHB 2DJQA 2ZPEB 2HBPA 3EGDA 3HKSA 1EFNA 2GNCA 1SSHA 1OU9A 2W0ZA 1NPPA 2KROA 4ZGJB 1FWZA 5GANf 2GTOA 2QQAA 4DOWA 4PJJA 4J6WA 3OYHA 2BZXA 1K1ZA 1IB8A 1BIBA 1SRLA 3EG3A 1VYTA 3M0TA 1WYXA 1WHKA 4CC7A 1KSWA 3M0SA 3ME9A 7AT1B 2HCKA 3AT1B 3OYMA 5IHIA 2LVMA 3QPHA 5GMKm 2GQIA 2YDLA 2EPDA 2SRCA 4D6WA 1YJWQ 2AKKA 1M8MA 1R0BG 2MCNA 1FMKA 3F70A 4OP0A 3I55T 4D8DA 2E4HA 1UECA 4PFZA 1YIJA 3S3OA 4DQ2A 1G8XA 3OYLA 3EG9A 5LJ5h 2H3EB 3OW2P 2LZ6B 3QXEB 5CKBA 3G71T 1RL2A 1MMNA 1G3YA 3CCMT 3GBQA 4M75D 5GJVB 5I11A 3TVTA 2DD4A 1VQ8Q 2BIVA 1KK7A 5KYXA 4DBRA 3RNJA 1D3BB 2EYZA 1I1JA 4RTTA 5GANj 1ZBXA 2HKNA 3SHWA 3OYBA 3GLXA 3EGXB 3JB9J 4R55A 3OYJA 1OX8A 1W2BP 5GAMh 5KYYB 3CCSQ 1YI2Q 3O5ZA 2HQHA 2HDAA 4M75E 3QDFA 1QW1A 3CC4T 1YITA 2GGRA 2BKDN 2Y4XA 1BCOA 2IIMA 2LTOA 4MDXA 1NYGA 1QVGP 2XICA 5IHNA 3MP1A 4ZN1A 2RQVA 4II1A 3X26B 5GMKe 3PIOA 1G5VA 3RR6A 2EKOA 2ROLA 3UA6A 1UJ0A 1W6XA 4PNOA 3PNWC 5HK3A 3I55Q 3CMEA 1WZOA 1JJ2S 1KQSS 1VQ6A 1BYMA 4LDXA 3TQ7P 2X35A 3CCRT 4FYYB 1Q95G 2MOXA 1VQOA 3LH0A 3JCMQ 4M77A 4KGXB 2QQRA 3SWNC 4R0KA 2VXEA 4A4KA 1G3WA 3LWIA 2FPDA 3A8OB 2YT6A 3G1JA 1FX7A 2KSSA 2YLBA 1Y0MA 3CXCP 2DL3A 4F7UA 5CKEA 4P5NA 4RG8A 3NTKA 2M0OA 2G3RA 3CCLT 2NUPA 3A8HB 2OX7A 2CH4A 1Y57A 2FYKA 1K9AA 2WSFE 1K76A 2MWOA 4OMNA 2NLUA 3M0QA 2KDSA 2HBWA 1WDXA 2YRVA 2KVQG 1HD3A 1NZ9A 2DBKA 5D6XA 3BFMA 4KH0B 1KG1A 2DVJA 4L5GA 2DL8A 4C92F 3G6ET 4A4HA 3FRNA 1PCXA 2DTIA 2H3JA 1WHJA 5IN1A 3FEOA 3NGPA 1JEGA 3V8KA 2AT1B 2FPEA 1UG1A 5A0DA 1IREB 1MMAA 2XKOC 3THKA 1WHGA 4Y92A 2A7YA 4AFSC 2OI3A 1OYXA 1XJWB 1YJWA 4ZGEB 4EMKC 3EHQA 5CAIA 1B34B 4C5EA 3PMIA 4ESRA 4BB7A 2DZCA 2KAFA 4PJOF 4OGCA 4O5VA 4BI3A 2K5IA 4PJMA 3VV0A 4BE0A 4M77G 5A2QE 1N27A 5J26A 2AKLA 4C8QF 1KFZA 1AOJA 1U8RA 3PVLA 1X75C 3H0HA 3C4SA 1OOTA 5ECAA 3OBYA 2E1HA 2YLCA 1M8VA 2M9UA 1KC8U 1UFFA 1VQ8A 2JTFA 3E9GA 4JLIA 1ZHIA 4F7UG 1VQKT 2RO0A 2KT8A 3OYAA 3M0RA 2QAZA 2NUTB 4RTWA 5LL6S 1SPKA 2O9VA 2JTEA 5I21A 4QVCA 5FRNA 4AT1B 2XHCA 5GAOq 2KRSA 1YI2A 3EGDB 4EPCA 3G6EQ 4M7AA 5J3BA 2LCCA 1Q81R 4E6RA 5KYWA 2LCLA 4EDUA 1BB9A 4PJLA 5LJ5e 2DTOA 3G7ZA 1RI0A 2E10A 1Q86R 1AZGB 2O88A 3VS0A 2Y4YA 3J81E 3A8GB 3LLRA 1WXBA 2ECZA 3FLGA 4HA8A 2RB6A 3HHTB 4FL6A 4EMGA 2LRQA 2DEUA 3CPWP 1X6OA 4X9CA 1BI2A 3VS3A 3QZ9B 4NS5A 4AG1C 3I55A 5AYFA 3I56T 3EG2A 5GAOl 1U1SA 1SRMA 2QDLA 2KEAA 2MAMA 3L2RA 2ROTA 3OS5A 1K8AR 4HVWA 4C0ZA 1WHLA 2K3BA 3FC3A 3G4SQ 3SDZA 4JDSA 1YCSB 4C0FA 2NUZA 5GJWB 3OYKA 2JMCA 3QYHB 5FW9A 4RUGA 2E5KA 2F5KA 1AD5A 2PUOB 5FWBA 3OYFA 2KQWA 1O75A 4XTYA 2RI5A 2VV5A 5KYXB 2DL7A 1PKSA 5DM7R 2LC4A 2VB6A 2ZCFB 1JXOA 2FZKB 1PHTA 4M7DE 1YN8A 3GIBA 2KYBA 4C0DC 3MEVA 1S72Q 1VIEA 4OVAA 5GAOp 5IAYA 1RAEB 1BI0A 4M7AG 4F04B 3OW2A 4WTOB 3R6NA 3CEYA 1KD1R 1SG5A 2AHJB 1ZA1B 3MP8A 2GBQA 3EAEA 3WXMB 5KYYA 4LDYA 1N8RC 2YUPA 2X51A 2A37A 1M27C 2LNHB 2LQKA 1WHHA 1GBRA 2GTJA 2ED0A 2YRCA 1QWEA 2YRDA 4M77B 1A0NB 1OI1A 1W2BA 1WJSA 2HSPA 4LN2A 1RABB 4FU6A 1WIEA 1WI7A 3I5SA 4A54A 1UE9A 2KBTA 2EW3A 4F7UB 1B7TA 3UPUA 2LDMA 1QVGA 3MEWA 1U3OA 1JBMA 2IVWA 5IXBA 2NUPB 1ZX6A 2XMFA 3BW1A 2L3PA 1YP5A 2E12A 2K2MA 3MP6A 2J6KA 4GLKA 4CC3A 2KXCA 1Y71A 5C0MA 1YIJQ 4K11A 3ASKA 4RTXA 3X28B 2HNIA 3H0FA 4M7DC 3OYYA 2PTKA 3UT1A 1YHQQ 1T0JA 2AZVA 2MI6A 4FYVB 2K5LA 4IURA 4XQ3A 3M4YA 3G6EA 3JCMd 1S1NA 3FB9A 5DY9A 5GMKh 2HD0A 3S6WA 4N0AA 1YJ9T 3KUFA 4UC4A 3H6ZA 3CXCA 2D9TA 2JS2A 1M90R 1WPYA 4FM4B 4IUPA 3ER0A 1E6GA 3I9QA 4CI0C 3QO3A 3EH2A 1WGSA 1RLQC 1WXUA 4FIBA 4E7HA 3OYDA 1O9SA 4M78E 4NL3A 1K9MR 1ZSZC 2P0PA 2XDPA 1GL5A 1M2OA 1PKTA 4PK4A 3PTAA 2CGHA 5FU7C 4C92A 2X4XA 4IUQA 4GLMA 4DA4A 1JJ2P 2A28A 2PVGB 2DYIA 3G4SA 2FRWA 4RTZA 2DEQA 4J9IA 3NFCA 4E7IA 1D1CA 2KXDA 1MNEA 3PIPA 1KIKA 4M77D 1G3TA 3UWNA 4LNPA 2D0NA 3JCMf 1VQKA 2K57A 4QVDA 2JT4A 3PT9A 1EIFA 1X2QA 2OAUA 3QDRB 2F69A 5GAN4 2LNVA 3JCMb 2RJCA 3OS0A 5GANd 1AWXA 2D8HA 5FU6C 2JUFA 5LJ3g 4PJOA 1I07A 2QQBA 3QBYA 3C95A 1VOMA 3C0CA 4C8QA 2HSEB 1K0SA 4HCKA 1PC0A 1UGQB 2O31A 1NJIU 2LX9A 3QIIA 4M77E 2W10A 4E47A 1RACB 4M7AB 2A3LA 1YJ9Q 1PSEA 2QEXT 2COWA 4C5HA 5KYWB 1VQ4Q 3EHRA 4C5IA 2HQXA 2RPNA 1C1AA 2EJFA 2JMAA 1M3AA 2DRKA 3INZA 4J9EA 4F7UE 3RKXA 1NJIC 4OMMA 2GQVA 1CKBA 1M3CA 3CC2Q 3VUZA 2VGNA 1QP3A 2RF0A 2DJZA 5GMKi 1ABQA 2KRNA 2EYXA 2JXBA 5IT9E 2DBMA 4Z02A 4M78C 4LE9A 2FB7A 1TSFA 4KGZB 3VS6A 3CD6T 3CMAT 1PRLC 3DB3A 1MGQA 1R0CB 4C92G 3FDRA 3VKIA 2WSEE 4J6YA 1Y96A 3OMGA 1D1AA 5LJ5g 3H41A 5GANe 3BDUA 4Y28E 2V1RA 3V7CA 5HK0A 2CZ7B 1OX9A 5D6WA 1YBYA 3SB2A 3PGGA 5I2MA 1IZ6A 2ZPHB 3CPWA 2K3YA 3I35A 3I5RA 2XDBA 4KH1B 1QLYA 3H9NA 2D8JA 1M1KR 3REAB 1N6AA 4PJOG 5GAMg 1ZQ1A 1YHQA 3NTIA 4B9XA 2EQJA 3A5ZB 3DLMA 1SHFA 4C8QG 2HL3A 4ZN3A 1H3ZA 4QQDA 2V1QA 2FVUA 1JB0E 4NOYA 4M7AD 2DILA 2YUNA 2DKGA 4RMOA 4E7LA 2OTLT 4HKEA 1ZSGA 2EQMA 2RQWA 2V26A 2CT3A 1M1FA 2E6NA 1OPLA 1WLPB 3ZL7C 1ZA2B 2ZPIB 4O6JA 3CMAQ 2MIOA 4HCBA 2EYYA 2EBPA 4J9DA 1QVFS 1TH7A 2A36A 3D7SB 4JJNK 5CO7A 1VQMT 4M7AE 1QMCA 3JB9H 2L89A 4YTLA 4HCZA 2VYTA 3T9NA 1WQWA 2M16A 1Q81U 1WQ7A 1WJRA 2DXTA 2CH4W 2CDTA 1Q82R 1Q86U 2L0AA 1AWJA 4M4ZA 3JCMV 1KHIA 3CCVT 4N4GA 3G71Q 1QCNA 2QGGA 1ABOA 4GY5A 3CCMQ 1VQ5T 1Q81C 2DZ9A 2DO3A 1QVPA 5GAN6 4CC2A 4CRIA 1HK9A 2JS0A 3ZBDA 2HEQA 3QYGB 3RBBB 1Q86C 1VUBA 1UB4A 1YJ9A 4JS5A 4RCBA 2KMTA 2DIQA 3MPUB 3EGUA 4PLIA 3LWHA 1VQ4A 1JXMA 3QZ5B 2HAXA 1JU5C 5A0LA 1UHFA 4FSSA 2DERA 1K73U 3MKDA 1PRMC 1ZUYA 2P4TA 3EG0A 3RMSA 4J9BA 4Q5WA 1XNIA 2YUQA 3CC2A 4IKFA 2F5TX 5C6SA 1M9SA 4MMKA 3CC4Q 5IXFA 2ZGWA 4IIOA 4A4EA 1G83A 1NEBA 2WSCE 3C94A 1K73C 2EQIA 4R56A 1PD1A 1TWBA 2CS7A 2DA9A 4C92B 4BDYA 4BE1A 1LCKA 2K5FA 5J39A 1KQ1A 3CQTA 3PE0A 1VQ9T 4M75C 4BY6C 3KXTA 4C5GA 3V7SA 4GBQA 3CCRQ 4OF1A 2YSQA 2GFAA 1YFNA 4WCIA 5LJ3f 5CIUA 3SEMA 1SHGA 2O2OA 2DETA 4OMFB 5GAOm 4DOVA 3QUIA 1KD1U 4PJOB 1BCMA 4ATOA 5AT1B 2LJ3A 1TS9A 1Q7YR 5FROA 2KGTA 1W70A 3OBWA 3MJXA 4C8QB 1E6HA 3SWNA 3OSVA 1V29B 3JB9G 2CSIA 3CCLQ 2I2LA 3KBGA 1T3LA 3M56A 1TOVA 4FT4A 2O01E 1LPLA 4M7DF 2EKHA 4E7ZA 1BKBA 3M59A 4L59A 2WACA 4MZPA 4AFUC 2DK3A 1HYOA 3OA6A 4JJBA 2JTMA 5DLOA 1BIAA 4HT8A 2CP0A 2YWWA 3CCQT 1H641 3QG1A 5KYUA 3OS2A 3L2UA 1KC8C 3CD6A 4IUVA 1ZLMA 3JCMW 3CMAA 2MWPA 2DD5A 2KE9A 1LNXA 1ARKA 5LJ3j 2P4RA 2X9HA 2RH2A 2ESWA 2R57A 3RESA 2PZ1A 2RNAA 2RK1A 3MEUA 4E7KA 2FZCB 4BD3A 4C92D 1Y96B 1YJNT 4RG2A 4XTVA 4EIKA 1R77A 1H8KA 4Z88A 3VS1A 4QQ6A 3JCMh 1N5ZA 4EMKA 2BTTA 4AMCA 2QG9B 5GAMf 2X4JA 5IH2A 3G71A 2M0YA 2QTVA 1PG5B 3CCMA 4LDUA 3JAME 2R5MA 4C92E 1K9MU 6AT1B 4PJOD 3RKWA 4N4HA 4QT7A 1GFDA 3A8MB 4HXJA 1VQKQ 5CQXA 3L2WA 1YWPA 2RQRA 4C8QD 2NWMA 3LX7A 2CP6A 2RQUA 4OB2B 1M30A 3CCQQ 1PD0A 1UGRB 2KT1A 2EFIA 4RTVA 2KNBB 4J9FA 1JQQA 1RI9A 2VKNA 4FCYA 1PM3A 3CC4A 4PJOE 3REBB 2QA4T 2A0FB 4DBQA 1VQMA 1DJ7B 5IHKA 2C0IA 2E65A 4B9WA 2L8DA 1VQ7T 3E19A 1MMDA 2E64A 2DM1A 1B07A 4M78F 5GANh 2DNUA 4XU1A 1BU1A 3TCJA 1X2KA 3I56Q 2M51A 1Z9ZA 1IHWA 1AVZC 2OTJT 3CCRA 5EG2A 2B8AA 2K79A 2OJ2A 1G3SA 1AEYA 2XG8D 3CCVA 4RTYA 5KE3A 5M9OA 4J9HA 3L2VA 3Q1JA 3URGA 1BI1A 5CVIA 2F2VA 3JSCA 1G2BA 1X43A 3JB9F 2LQNA 1NLOC 3QWYA 4QQGA 2E3IA 3EFOA 2RQTA 3L2ZA 3HP9A 1QKWA 3ZFJA 5FWCA 1OV3A 3CCLA 2QDYB 4HVUA 1IO6A 2KRMA 4BI4A 1NG2A 4QW2A 4LD9K 2LCSA 1MV3A 3KFVA 4JPBW 4PL6A 4KRTA 2RHZA 3H0IA 4WF2A 3A98A 1VYVA 4FYWB 2VGMA 1GFCA 3MEAA 2IPOB 1YITT 1K4US 1UGSB 3WVDB 2QA4Q 1I81A 2JM8A 4J83A 1VQ7Q 1CKAA 5FRMA 2DFUA 2PUKB 3M0UA 3RERA 2SEMA 3CMET 2RM4A 1M5Q1 1QWFA 1VQ6T 3J7AF 2RN8A
chains in the Genus database with same CATH topology
2FYKA 4J6YA 1Y96A 3OMGA 4J7IA 3O8VA 4QVZA 2XK0A 5LJ5g 5HKCA 1M1KU 5GANe 3BDUA 1QVGS 2EAYA 2O4XA 2WSFE 4Y28E 1XQHA 4ZTFA 4Y91A 2RHIA 3V7CA 5GAN8 4ZGDB 5HK0A 2MWOA 3META 2DIGA 2OTLA 2CZ7B 4JRIA 5GAMe 1UEBA 3CBMA 3M55A 3VJPA 5D6WA 2NLUA 1YBYA 2DAQA 2RA2A 3PGGA 3SB2A 2KDSA 1M90C 4M7DD 5I2MA 2CZ0B 1IZ6A 4RCCA 2YRVA 2ZPHB 4JRQA 2KVQG 3CCEA 2CKKA 2K3YA 3CPWA 1NZ9A 2K4YA 5D6XA 2XDBA 5GANg 3VYHB 3BFMA 1K9MC 1N6AA 1M1KC 1KG1A 2PU9B 4L5GA 3HRUA 3E1SA 4PJOG 3P8HA 4XTZA 5LJ5j 4C92F 1ZQ1A 5GAMg 1YHQA 1WJQA 3NTIA 5L8RE 4B9XA 3G6ET 4A4HA 2EQJA 4XTUA 3A5ZB 3DLMA 3FRNA 2EIFA 3HL8A 2D0QB 2DTIA 4C8QG 2H3JA 1VQLT 4ZN3A 5IN1A 3FEOA 3SWNB 3CCJA 3QSUA 1H3ZA 4QQDA 3V8KA 2FVUA 1JB0E 4C8QE 3VUBA 1I4K1 1VQNA 5A0DA 4NOYA 1IREB 4M78B 4M7AD 4KUIA 2DKGA 4RMOA 4E7LA 2OTLT 2XKOC 4X9DA 3CXCS 2A7YA 4MZMA 1OYXA 1YJWA 4HKEA 4X34A 4ZGEB 2L5QA 2EQMA 5GAN2 3HPWA 4EMKC 5GAN5 3TU4K 3X24B 5CAIA 1B34B 1M1FA 1XTDA 2E6NA 2IG0A 2K3XA 3PMIA 3R6OA 4C5EA 4BB7A 5GAMj 1LOJA 1YIJT 3HRTA 4M75G 4XK8E 1AHJB 2DZCA 2KAFA 3M58A 3H8ZA 3RUXA 4PJOF 2ZPIB 4O6JA 4OGCA 3CCQA 2RJFA 4O5VA 1N8RU 4BI3A 3QJYA 2K5IA 4HCBA 3JRZA 5DLQE 1YHQT 4N0AC 3M5AA 4M77G 3VV0A 5A2QE 1N27A 5J26A 3JCMe 4BE0A 3CCUA 1QVFS 4C8QF 2DPPB 1VQ5A 1TH7A 1I5LA 3OYCA 1U8RA 1D3BA 3VYGA 4M7DA 1X75C 4JJNK 1Q82U 3C4SA 5CO7A 5KCHA 1VQMT 3OBYA 4M7AE 1LJOA 2E1HA 2X4YA 2YLCA 3JB9H 2M9UA 1VIFA 2FL7A 1M8VA 5KE2A 1NE8A 2L89A 3C12A 1KC8U 2ZZDA 2QXFA 3TEEA 1VQ8A 1Y7XA 2M1HA 3L42A 4YTLA 4HCZA 4FSXA 2JTFA 2VYTA 3E9GA 4JLIA 3T9NA 2CZ1B 1ZHIA 4F7UG 1WQWA 2M16A 2RJEA 1Q81U 1M1GA 2XD0A 4A53A 1VQKT 1JRIA 2RO0A 1WQ7A 2VXFA 1WJRA 3OYAA 4C0GA 2DXTA 3J80E 2LT4A 2RI2A 2XIDA 5LL6S 4BY6B 4C92C 4M75F 3N5BB 5I21A 1Q86U 3I56A 4QVCA 1Q82C 5FRNA 2XHCA 2XI9A 3PFSA 5GAOq 1I8FA 1HXDA 1BI3A 2QI2A 4J5YA 3JCMV 4BE2A 1YI2A 3CC7T 1KHIA 4EPCA 4M77F 4N4GA 4NL2A 2EQUA 1WNLA 2GCXA 2GFUA 3CCVT 4M7AA 3OY9A 5J3BA 2LCCA 4GY5A 1U1TA 3S3NA 2LCLA 3ZEHA 1VQ5T 1Q81C 4EDUA 2DZ9A 2DO3A 1QVPA 5GAN6 4CRIA 1NPRA 2QQSA 1HK9A 5LJ5e 4EMKB 2DTOA 3ZBDA 1N9SA 3G7ZA 1RI0A 2E10A 3QYGB 1KQ2A 2LT1A 5CKDA 1Q86C 1VUBA 1UB4A 1YJ9A 4JS5A 4RCBA 2KMTA 3VU3C 2DIQA 2LQ8A 4OGEA 4F7UF 1VQ9A 2Y4YA 3J81E 3A8GB 3LLRA 4PLIA 3LWHA 1VQ4A 2C06A 3FLGA 4E7JA 3QZ5B 4HA8A 3FIFA 2HAXA 2JOYA 2RB6A 3HHTB 4PJOC 5A0LA 4FL6A 3CBPA 4EMGA 2LRQA 3GOXA 1K73U 1X6OA 2JNGA 1BI2A 4X9CA 3QZ9B 4NS5A 2EWNA 4XU3A 3M4GA 3I55A 2P4TA 5AYFA 3I56T 3RIRA 5GAOl 1Y07A 1U1SA 4IUTA 4C8QC 3RMSA 2MAMA 3CCST 3L2RA 1VQOT 1YI2T 4Q5WA 1XNIA 3OS5A 2ZPGB 3CC2A 4IKFA 2F5TX 4C0ZA 4VUBA 5C6SA 2EYQA 3P8DA 1M9SA 4MMKA 3FC3A 4M78D 2ZGWA 1SSFA 4V2SA 4A4EA 3OQ5A 1OZ3A 3JB9I 3SDZA 4JDSA 2K2VA 2JN0A 4C0FA 1VQPT 2WSCE 2X4WA 3C94A 1K73C 2QA4A 4R56A 4OB1B 3OYKA 2CS7A 4XTWA 4C92B 3OSSC 4BDYA 4BE1A 3MO8A 5I2SA 2K5FA 3QYHB 5J39A 1KQ1A 3OYNA 1VQ9T 4M75C 3S3MA 1VQ4T 1VQ7A 3HRSA 2PVDB 4JRKA 4BY6C 3KXTA 2F5KA 2PUOB 2YHTA 4LDVA 2KQWA 1O75A 4M77C 4XTYA 3V7SA 2DXUA 2RI5A 2VV5A 4C5GA 3AHUA 3M57A 5A0GA 2EJGA 4OF1A 1Q7YU 4M7DG 3SD4A 1YCYA 4EMHA 5DM7R 2GFAA 2LC4A 4JS4A 2MF2A 2OTJA 2ZCFB 3JB9D 4HT9A 3BY7A 3CC2T 4M7DE 5LJ3f 2E41A 5CIUA 3GIBA 4J6XA 5GAN7 1P92A 4LD6A 4OMFB 5GAOm 3M9QA 4DOVA 3QUIA 1KD1U 3M54A 4C0DC 5D6YA 3CCET 3GNGA 4PJOB 1M4ZA 2CYZB 4ATOA 3MEVA 3LYIA 3CPWS 1VIEA 5FROA 1Q7YC 3OBWA 2FHDA 2KY9A 4OB3B 4C8QB 2V8KA 3SWNA 3BDLA 3OSVA 1V29B 4OVAA 3DLLA 5GAOp 5KCOA 5IAYA 3JB9G 1BI0A 2I2LA 2DVEA 3KBGA 4BDZA 4M7AG 3MCAB 3HFOA 3OW2A 4M78A 3M56A 4FT4A 2EQKA 2O01E 2RJDA 3CEYA 4M7DF 2JVVA 4ELYC 2R58A 3TREA 3V8JA 3CCJT 1BKBA 3M59A 2AHJB 3LGLA 3MP8A 1VQNT 3EAEA 3GNFB 1B34A 2Y90A 4L59A 2WACA 2R5AA 4MZPA 3WXMB 4LDYA 1N8RC 1R8OB 1YJWT 2DK3A 3HFNA 1YJNA 2LQKA 4M75B 4OB0B 2HQEA 3OA6A 3GF5A 1KHCA 2CZ6B 4KULA 3JCMX 4RKUE 3X25B 2JTMA 2P0QA 4KBMB 1OI1A 4M77B 5DLOA 1W2BA 1W4SA 1BIAA 1WJSA 4PKCC 4HT8A 4J8OA 1X01A 3CCQT 4BACA 1S72A 1H641 3QG1A 4FU6A 3OS2A 3L2UA 1KC8C 2RD1A 3CD6A 4IUVA 4M7AF 3JCMW 3CMAA 3CCUT 3FJPA 3RKYA 5GAOn 2MWPA 2DD5A 2DTHA 5GMKl 3DB4A 3SFMA 1LNXA 4A54A 1PSFA 3RMQA 5LJ3h 5LJ3j 3EFSA 4L6V5 3OYEA 3CPFA 2QQ9A 2RH2A 4F7UB 1OZ2A 4C0DB 2PQWA 2R57A 3RESA 3UPUA 3A8LB 4A4GA 1FXXA 2LDMA 2RHXA 3OYFA 1QVGA 1VQ8T 3MEWA 1K8AU 2BUDA 2RK1A 5CQYA 3MEUA 2RHUA 5CR2A 4E7KA 4ELZC 1JBMA 2IVWA 5LJ3d 4BD3A 3OYIA 4C92D 2E5QA 1UGPB 4JRPA 3BW1A 3JCMP 3JCMc 1Y96B 4BI8B 2E12A 1YJNT 3MP6A 2L3RA 2HBPA 2ZPEB 3HKSA 4RG2A 2O4XB 4GLKA 4XTVA 3GPLA 1Y71A 2E6ZA 5C0MA 3ASKA 3X28B 1NPPA 4QQ6A 2HNIA 3E9FA 3JCMh 3V7RA 1FWZA 4ZGJB 5GANf 4M7DC 2QQAA 3OYYA 3UT1A 4EMKA 1K8AC 4DOWA 2MI6A 4KUDK 2K5LA 4IURA 4J6WA 4XQ3A 5GAMf 2X4JA 3OYHA 3M4YA 3G6EA 3JCMd 3G71A 5HY6A 3UDCA 1BIBA 3FB9A 3OB9A 3PMTA 4JLGA 4LDUA 5DY9A 5GMKh 5GMKj 3JAME 3CCMA 1VQLA 2HD0A 2R5MA 4C92E 1N9RA 1QP2A 3ME9A 3S6WA 4N0AA 1K9MU 4PJOD 3RKWA 4N4HA 3OYMA 1YJ9T 2MMPA 2LVMA 3A8MB 3KUFA 3LGFA 3QPHA 5GMKm 3GP8A 5GAOr 4UC4A 4D6WA 3H6ZA 3CXCA 5CQXA 2D9TA 3L2WA 4C8QD 4ZTJA 2DXBA 3F70A 2GF7A 1WPYA 3LX7A 4FM4B 4IUPA 5CCAA 4M78G 3ER0A 4OP0A 4CI0C 3I55T 3QO3A 4M7AC 1WGSA 4HCCA 4OB2B 4FIBA 4E7HA 4J7FA 3OYDA 3CBOA 1O9SA 1UGRB 4M78E 4NL3A 1YIJA 3EFRA 3P8BB 2EFIA 2P0PA 2XDPA 2JZ2A 2XU8A 4DQ2A 3S3OA 3OYLA 3PTAA 1MHNA 2CGHA 4BUGA 5FU7C 4N4IA 4C92A 5LJ5h 4XTXA 3QXEB 2X4XA 5CKBA 3G71T 1QVFA 4IUQA 5GAN3 4DA4A 3CC4A 1RL2A 1G3YA 2PVGB 3V8LA 3G4SA 3CCMT 2EJ9A 4PJOE 2RHYA 2DEQA 4E7IA 3NFCA 4M75D 2V8JA 2QA4T 4XAXB 2DD4A 5LJ5d 1VQMA 3PIPA 2BIVA 4PLLA 1DJ7B 3WVEB 3OYGA 2QEXA 3MHXA 4M77D 2E65A 4B9WA 1G3TA 2PVOB 2L8DA 5LJ3e 3UWNA 1D3BB 1VQ7T 3E19A 4M7DB 2E64A 5GANj 4M78F 1ZBXA 3JCMf 5GANh 2K57A 3OYBA 1JJ2A 1VQKA 1KQSA 3GLXA 4XU1A 4QVDA 3TCJA 4A4FA 3JB9J 3PT9A 1EIFA 1KD1C 4R55A 3OYJA 2OAUA 3QDRB 2F69A 5GAN4 2LNVA 3RERA 5GAMh 2OTJT 3JCMb 3CCRA 2RJCA 4LDWA 5EG2A 5GANd 3NTHA 3OS0A 2DXCA 2B8AA 5FU6C 2JUFA 5LJ3g 4PJOA 3CC7A 1G3SA 2QQBA 3QBYA 3QKJA 2XG8D 3CCVA 5KE3A 3C95A 2QTXA 5GAMd 4M75E 5M9OA 3L2VA 2VC8A 3Q1JA 2ZPFB 1QW1A 3URGA 4C8QA 3CC4T 1YITA 3G4ST 2BKDN 2Y4XA 4MDWA 1BI1A 2ZPBB 1UGQB 5CVIA 2RK2A 1NJIU 2LX9A 3QIIA 4M77E 2LTOA 4MDXA 4E47A 4M7AB 4JUVA 4XU2A 2A3LA 2XICA 3JSCA 1PSEA 3LW5E 3MP1A 5CKFA 4ZN1A 3OS1A 2QEXT 2D6FA 1GXIE 4C5HA 3JB9F 2P0KA 4II1A 3X26B 5GMKe 3PIOA 1G5VA 4QQGA 4C5IA 2HQXA 2EKOA 5CK9A 3L2ZA 3X20B 2EJFA 3HP9A 3M53A 3ZFJA 3JCMg 4PNOA 3DKMA 3PNWC 3OW2S 2E70A 2QDYB 5FU7B 5HK3A 3CMEA 1JJ2S 3CCLA 2RI3A 1KQSS 1VQ6A 4BI4A 1BYMA 3INZA 4LDXA 3L1AA 4QW2A 5CKHA 4F7UE 5KH6A 3OMCA 4LD9K 2X35A 3RKXA 4M75A 3JCMJ 1NJIC 5LJ5f 2V8IA 2XDDA 3CCRT 2GQVA 5FLXE 4ME7A 3VUZA 2VGNA 4PL6A 3CCSA 1QP3A 2RHZA 3LH0A 2DJZA 3JCMQ 4M77A 1VQOA 3HSBA 3L2QA 4WF2A 5GMKi 2VUBA 2QQRA 3QJ6A 2VGMA 3MEAA 1YITT 5IT9E 1UGSB 3SWNC 4KT0E 3WVDB 1I81A 1VQPA 4TVRA 2VXEA 4MZTA 4Z02A 4A4KA 1W2BS 1G3WA 3LWIA 4M78C 1S72T 3A8OB 2FB7A 1FX7A 1XOVA 2KSSA 4J83A 2YLBA 3CD6T 4F7UA 3CMAT 4XU0A 5CKEA 5FU6B 2PUKB 4P5NA 4RG8A 3DB3A 1M90U 5FRMA 3NTKA 4MMLA 1MGQA 4FT2A 4IUUA 3FDRA 3VKIA 2M0OA 2G3RA 2WSEE 2RM4A 1M5Q1 3A8HB 4C92G 3CMET 3CCLT 1VQ6T 3J7AF 2KK4A 3QHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4G A;  3OYL A;  2EQU A;  2R58 A;  3OMG A;  2GFU A;  1MHN A;  3O8V A;  4QVZ A;  2XK0 A;  4N4I A;  3OY9 A;  2LCC A;  4GY5 A;  2X4X A;  3LGL A;  3MP8 A;  3S3N A;  2O4X A;  3EAE A;  4IUQ A;  3ZEH A;  4EDU A;  4ZTF A;  4L59 A;  2RHI A;  2WAC A;  2RHY A;  4E7I A;  2MWO A;  2R5A A;  2DIG A;  2QQS A;  3MET A;  4CRI A;  2BIV A;  4PLL A;  1RI0 A;  5D6W A;  2NLU A;  2DAQ A;  3OYG A;  3S3O A;  2HQE A;  4B9W A;  3OA6 A;  1KHC A;  2L8D A;  3UWN A;  2YRV A;  2DIQ A;  2CKK A;  2K3Y A;  3LLR A;  4PLI A;  1OI1 A;  3FLG A;  5D6X A;  1WJS A;  4E7J A;  3OYB A;  4BAC A;  4FL6 A;  4FU6 A;  3OS2 A;  4A4F A;  2LRQ A;  3L2U A;  3GOX A;  3OYJ A;  4NS5 A;  4IUV A;  3P8H A;  1WJQ A;  3NTI A;  4IUT A;  4B9X A;  4A4H A;  2EQJ A;  2MWP A;  2RJC A;  3OS0 A;  3NTH A;  2B8A A;  3DLM A;  3DB4 A;  3L2R A;  4Q5W A;  1XNI A;  3OYE A;  3QBY A;  3QKJ A;  3FEO A;  5IN1 A;  5C6S A;  4IKF A;  5KE3 A;  3P8D A;  4QQD A;  1H3Z A;  1OZ2 A;  2PQW A;  2R57 A;  5M9O A;  3L2V A;  4A4G A;  1SSF A;  2LDM A;  2RHX A;  3Q1J A;  3FC3 A;  4A4E A;  3MEW A;  1OZ3 A;  3OQ5 A;  2BUD A;  3MEU A;  2RHU A;  2BKD N;  4E7K A;  4BD3 A;  3OYI A;  2E5Q A;  4E7L A;  3QII A;  2X4W A;  2LTO A;  1OYX A;  3OYK A;  3OS1 A;  4X34 A;  3MP1 A;  3MP6 A;  4BDY A;  4BE1 A;  2L3R A;  3MO8 A;  2EQM A;  4RG2 A;  4C5H A;  5J39 A;  2O4X B;  2P0K A;  4II1 A;  1G5V A;  3OYN A;  4QQG A;  4C5I A;  5C0M A;  2HQX A;  2EKO A;  2E6N A;  2K3X A;  2IG0 A;  3PMI A;  4C5E A;  3ASK A;  3S3M A;  4BE2 A;  4QQ6 A;  3E9F A;  2F5K A;  3PNW C;  3H8Z A;  2RI3 A;  4C5G A;  3OYF A;  2RJF A;  3UT1 A;  2RI5 A;  4QW2 A;  5KH6 A;  3OMC A;  2X35 A;  4BE0 A;  3SD4 A;  4IUR A;  1N27 A;  5J26 A;  3OYH A;  2GFA A;  3OYC A;  4PL6 A;  3OB9 A;  3PMT A;  2RHZ A;  3LH0 A;  3C4S A;  5KCH A;  5CIU A;  3L2Q A;  2R5M A;  4LD6 A;  2X4Y A;  3ME9 A;  3S6W A;  2QQR A;  3QJ6 A;  5KE2 A;  2L89 A;  4N4H A;  3MEA A;  3OYM A;  3M9Q A;  3KUF A;  2LVM A;  3LGF A;  2M1H A;  3L42 A;  5D6Y A;  4HCZ A;  4UC4 A;  2JTF A;  2VYT A;  3E9G A;  3H6Z A;  3LYI A;  3MEV A;  4Z02 A;  2D9T A;  3L2W A;  2M16 A;  2RJE A;  4ZTJ A;  5FRO A;  2RO0 A;  1WJR A;  2FHD A;  2GF7 A;  3F70 A;  3OYA A;  3LX7 A;  4IUP A;  2RI2 A;  3BDL A;  4OVA A;  5KCO A;  1WGS A;  5FRM A;  5IAY A;  3DB3 A;  5FRN A;  4E7H A;  4BDZ A;  3NTK A;  3OYD A;  4IUU A;  3PFS A;  3FDR A;  2M0O A;  2G3R A;  2EFI A;  2EQK A;  2XDP A;  2RJD A;  2JZ2 A;  3CEY A; 
#chains in the Genus database with same CATH topology
 4J7I A;  4QVZ A;  3EH1 A;  3VRY A;  1M1K U;  2LMJ A;  3VS5 A;  2EAY A;  2O4X A;  1XQH A;  4LXC A;  4Y91 A;  2RHI A;  2LJ0 A;  2DIG A;  4DBF A;  4JRI A;  1UEB A;  1QVF P;  3VJP A;  2RA2 A;  2DAQ A;  1WFW A;  2CZ0 B;  4DBH A;  4RCC A;  4JRQ A;  4JJD A;  2K4Y A;  2C0O A;  3VYH B;  1X69 A;  1M1K C;  2K6D A;  2COY A;  3HRU A;  1WXT A;  4XTZ A;  2CUB A;  5L8R E;  2X3W D;  1KQS P;  2BZY A;  2P84 A;  1VQL T;  1ZUU A;  2LJ1 A;  3SWN B;  2L2P A;  1MND A;  1BBZ A;  1HSQ A;  4X9D A;  4MZM A;  2FEI A;  4X34 A;  1OU8 A;  2L5Q A;  1NEG A;  2F2W A;  3R6O A;  2IG0 A;  1T0H A;  1YNZ A;  1LOJ A;  2FO0 A;  1BK2 A;  2KI7 A;  4XK8 E;  1AHJ B;  3M58 A;  3RUX A;  2HL5 C;  1TU0 B;  3CCQ A;  1D0Y A;  3QJY A;  1CSK A;  3JRZ A;  5DLQ E;  2L3Q A;  3M5A A;  3JCM e;  2F2X A;  2DPP B;  4Z89 A;  4M7D A;  1Q82 U;  5KYU B;  5KCH A;  2KR3 A;  1GBQ A;  1NYF A;  4JZ3 A;  1LJO A;  2FL7 A;  5KE2 A;  3C12 A;  2QXF A;  3TEE A;  1Y7X A;  1QCO A;  1N8R R;  3J80 E;  2LT4 A;  2J6O A;  2RI2 A;  2XID A;  4BY6 B;  1AWW A;  4RTU A;  4M75 F;  3N5B B;  3I56 A;  1Q82 C;  2YUO A;  2BE9 B;  1X27 A;  1I8F A;  1HXD A;  1BI3 A;  2QI2 A;  4J5Y A;  3CC7 T;  1MUZ A;  3QWX X;  2KYM A;  4NL2 A;  1UJY A;  2EQU A;  2GCX A;  3TSW A;  1E7O A;  1TG0 A;  1I5O B;  1U1T A;  1VQL Q;  1ZSZ A;  5HCK A;  4EMK B;  2LT1 A;  5CKD A;  4FW2 A;  2LQ8 A;  4OGE A;  1H92 A;  3FIF A;  4OMP A;  1VA7 A;  2FG0 A;  3GOX A;  2DYB A;  3DLL A;  2EWN A;  3M4G A;  4PFP A;  1Y07 A;  1IXD A;  3CCS T;  2BE7 D;  1YI2 T;  1SKU B;  2E3H A;  4VUB A;  2EYQ A;  3P8D A;  5I22 A;  2FZG B;  1ACM B;  1SSF A;  3TSZ A;  1OZ3 A;  4QKU A;  2K2V A;  1VQP T;  2QA4 A;  2QEX Q;  4AFQ C;  2HMA A;  3OSS C;  4F16 A;  5I2S A;  1ZBJ A;  2MK5 A;  3OYN A;  3M0P A;  3S3M A;  2LX7 A;  1VQ7 A;  3HRS A;  2EGA A;  2CRE A;  4M77 C;  3AHU A;  2DXU A;  1IHV A;  5A0G A;  1Q7Y U;  4M7D G;  1RAH B;  1YCY A;  2OTJ A;  2MF2 A;  3CC7 Q;  4HT9 A;  1ZUK A;  9ATC B;  1GCP A;  5GAN 7;  3M9Q A;  3M54 A;  2DE0 X;  5D6Y A;  3CCE T;  1MV0 B;  3GNG A;  1M4Z A;  2CYZ B;  2J7I A;  1F1B B;  1Q7Y C;  3CD6 Q;  4OB3 B;  2V8K A;  3BDL A;  1D0Z A;  3HTR A;  5KCO A;  4BDZ A;  2DL5 A;  4M78 A;  2JVV A;  3CCJ T;  2R58 A;  1OQK A;  1UGV A;  3EFO B;  1VQN T;  1T3S A;  2VWF A;  2Y90 A;  2R5A A;  1R8O B;  4FYX B;  4PJN A;  3HFN A;  4OB0 B;  3GF5 A;  1VQP Q;  4RKU E;  3X25 B;  2Z0W A;  4KBM B;  1C0M A;  1X01 A;  3NPF A;  2D1X A;  3UA7 A;  2RD1 A;  2CP5 A;  3CCU T;  2H8H A;  5GAO n;  2EVR A;  4JZ4 A;  1M2V A;  5GMK l;  1QCF A;  1OZ2 A;  4C0D B;  1NJI R;  3A8L B;  4J9C A;  1RAD B;  2RHX A;  1LVK A;  1K8A U;  5CQY A;  2OTL Q;  4PFO A;  2CP3 A;  5LJ3 d;  4E2F B;  4ELZ C;  3OYI A;  4F17 A;  2DRM A;  2LP5 A;  2L3R A;  3CCE Q;  2LQW A;  2O4X B;  3GPL A;  2E6Z A;  1UHC A;  3NMZ C;  2MYS A;  3E9F A;  2CSQ A;  3V7R A;  1RAF B;  1K8A C;  3JV3 A;  4KUD K;  4A63 B;  1SF9 A;  5HY6 A;  3UDC A;  3EG1 A;  3CCJ Q;  1OUL A;  3OB9 A;  4JLG A;  3PMT A;  1AT1 B;  5GMK j;  1VQM Q;  1VQL A;  1C6V X;  1JO8 A;  1FMV A;  1VQN Q;  1N9R A;  1QP2 A;  4AFZ C;  4J9G A;  1IGU A;  2MMP A;  4CC4 B;  3LGF A;  3GP8 A;  5GAO r;  4KGV B;  4ZTJ A;  2DXB A;  2GF7 A;  5CCA A;  1QKX A;  4M78 G;  4M7A C;  4HCC A;  1K0X A;  4J7F A;  3CBO A;  3EFR A;  3CCV Q;  3P8B B;  1RAG B;  2JZ2 A;  2XU8 A;  1MHN A;  3CCU Q;  4BUG A;  4N4I A;  1VQ5 Q;  4XTX A;  1QVF A;  1WX6 A;  1TUG B;  5GAN 3;  1U06 A;  3V8L A;  2EJ9 A;  2RHY A;  2V8J A;  4XAX B;  5LJ5 d;  2NYS A;  4JJC A;  4PLL A;  1VYU A;  3WVE B;  3OYG A;  2PNI A;  3FJ5 A;  2QEX A;  3MHX A;  5LJ3 e;  2PVO B;  4M7D B;  2QGF B;  2C0T A;  4X1V A;  1JJ2 A;  1KQS A;  1W1F A;  4A4F A;  8AT1 B;  1KD1 C;  2JM9 A;  4HVV A;  2DL4 A;  4LDW A;  1RAA B;  3NTH A;  2DXC A;  3CC7 A;  3QKJ A;  2QTX A;  5GAM d;  2AIR B;  2VC8 A;  2ZPF B;  2QAS A;  2DF6 A;  3G4S T;  1UTI A;  4MDW A;  2COZ A;  2ZPB B;  2RK2 A;  1TXQ A;  1FMW A;  4JUV A;  4XU2 A;  5CKF A;  3LW5 E;  3OS1 A;  2D6F A;  1GXI E;  2DX1 A;  1VQ9 Q;  2OAW A;  2EGC A;  2P0K A;  2ED1 A;  1ZSZ B;  3UF4 A;  5CK9 A;  3X20 B;  1NLP C;  3M53 A;  3JCM g;  3DKM A;  3OW2 S;  2E70 A;  5FU7 B;  2RI3 A;  3VS2 A;  1B3Q A;  3L1A A;  5KH6 A;  5CKH A;  3OMC A;  2YXY A;  3JCM J;  4M75 A;  5LJ5 f;  2V8I A;  2XDD A;  4IIM A;  5FLX E;  4ME7 A;  3CCS A;  1UDL A;  1V76 A;  3HSB A;  3L2Q A;  2VUB A;  3QJ6 A;  4KT0 E;  1VQP A;  4TVR A;  4MZT A;  1HJD A;  1W2B S;  1S72 T;  3U23 A;  1XOV A;  1IGQ A;  4ANJ A;  1PWT A;  4XU0 A;  5FU6 B;  1M90 U;  4MML A;  4FT2 A;  4IUU A;  2AZS A;  4OMQ A;  2KK4 A;  2K9G A;  3QHS A;  3O8V A;  2XK0 A;  5HKC A;  2J06 A;  1QVG S;  2EYW A;  2CT4 A;  4ZTF A;  4Z8A A;  5GAN 8;  4ZGD B;  3MET A;  2QK0 A;  2OTL A;  1RUW A;  5GAM e;  3CBM A;  3M55 A;  4OMO A;  1M90 C;  4M7D D;  4DEY A;  1WA7 A;  1D1B A;  2JJ9 A;  3CCE A;  1TUD A;  2CKK A;  1K73 R;  3EG9 B;  5GAN g;  3BE3 A;  1K9M C;  2QYZ A;  2PU9 B;  2X3X D;  3E1S A;  4FW1 A;  3P8H A;  5LJ5 j;  1WJQ A;  1QQJ A;  4XTU A;  2EIF A;  3HL8 A;  2D0Q B;  4DEX A;  2ZAE A;  2DLP A;  3CCJ A;  3QSU A;  4AG2 C;  1EX4 A;  4C8Q E;  1M3B A;  3VUB A;  1I4K 1;  1VQN A;  4M78 B;  4KUI A;  1YJN Q;  3CXC S;  1J3T A;  1EZZ B;  3HPW A;  5GAN 2;  5GAN 5;  3TU4 K;  3X24 B;  8ATC B;  2K3X A;  1XTD A;  5GAM j;  1YIJ T;  2CUD A;  3HRT A;  4M75 G;  3H8Z A;  2VAS A;  4F14 A;  2RJF A;  1N8R U;  1YHQ T;  4N0A C;  3CCU A;  1VQ5 A;  1I5L A;  3RDV A;  3OYC A;  1D3B A;  3VYG A;  2X4Y A;  1VIF A;  1GCQ C;  1NE8 A;  3EGX A;  2ZZD A;  1AZE A;  1UUE A;  1M2V B;  2ENM A;  2M1H A;  3L42 A;  5L23 A;  4FSX A;  2CZ1 B;  2RJE A;  1M1G A;  2FRY A;  2O9S A;  4A53 A;  1JRI A;  2XD0 A;  2VXF A;  4C0G A;  2B86 A;  4C92 C;  2XI9 A;  3PFS A;  2DMO A;  2JW4 A;  1KC8 R;  4BE2 A;  1WHM A;  4M77 F;  2CP2 A;  1WNL A;  2GFU A;  4ORZ A;  1KJW A;  3OY9 A;  2F1L A;  3S3N A;  2ABL A;  3ZEH A;  2MPX C;  1NPR A;  2HZY A;  2QQS A;  1AWO A;  3A1P A;  1N9S A;  1KQ2 A;  1RLP C;  1OPK A;  3ULR B;  3VU3 C;  3PVQ A;  4F7U F;  1FYN A;  1VQ9 A;  2C06 A;  4E7J A;  1SEM A;  2JOY A;  4PJO C;  4D8K A;  3CBP A;  2AK5 A;  2JNG A;  4E7S A;  3IQL A;  4XU3 A;  2OTJ Q;  3RIR A;  4IUT A;  4C8Q C;  2RMO A;  1VQO T;  1NM7 A;  2ZPG B;  3UAT A;  2CP7 A;  4M78 D;  4V2S A;  3OQ5 A;  3JB9 I;  2JN0 A;  2X4W A;  4OB1 B;  4XTW A;  3MO8 A;  2BZ8 A;  1IRX A;  3NHN A;  1VQ4 T;  2PVD B;  4JRK A;  1D0X A;  1GRI A;  2YHT A;  1GCQ A;  4LDV A;  2I0N A;  3LH5 A;  3M57 A;  1PNJ A;  2EJG A;  3SD4 A;  5EC7 A;  4EMH A;  4JS4 A;  2L3S A;  3JB9 D;  1D09 B;  3BY7 A;  1TUC A;  5D7U A;  3CC2 T;  1RAI B;  2E41 A;  4J6X A;  1P92 A;  4LD6 A;  1YIT Q;  1I0C A;  2J6F A;  1MMG A;  1X6B A;  3VS7 A;  3VRZ A;  1YWO A;  2J05 A;  3LYI A;  3CPW S;  1X6G A;  2FHD A;  2KY9 A;  2HKQ B;  2A08 A;  2G6F X;  4B6M A;  1OEB A;  3CME Q;  2DVE A;  3MCA B;  3HFO A;  1VQ6 Q;  2EGE A;  4OML A;  2EQK A;  2RJD A;  4ELY C;  1NBE B;  3TRE A;  3V8J A;  3VS4 A;  3LGL A;  1VQO Q;  5KYN A;  3GNF B;  1B34 A;  2VVK A;  3E2U A;  1YJW T;  1YJN A;  4LUD A;  4M75 B;  2HQE A;  1KHC A;  2CZ6 B;  1H3H A;  4KUL A;  3JCM X;  2P0Q A;  1W4S A;  4PKC C;  2M02 A;  4J8O A;  4BAC A;  1S72 A;  4LUE A;  2ATC B;  4ZNX A;  4M7A F;  3FJP A;  2K7A A;  3RKY A;  2DTH A;  3DB4 A;  3SFM A;  1PSF A;  3RMQ A;  5LJ3 h;  1Z9Q A;  3EFS A;  4L6V 5;  3OYE A;  3CPF A;  2QQ9 A;  2PQW A;  4A4G A;  1FXX A;  1VQ8 T;  2BUD A;  2NUT A;  5CR2 A;  2RHU A;  1V1C A;  2E5Q A;  1UGP B;  4JRP A;  3JCM P;  2FPF A;  3JCM c;  1U5S A;  4BI8 B;  1TTH B;  2DJQ A;  2ZPE B;  2HBP A;  3EGD A;  3HKS A;  1EFN A;  2GNC A;  1SSH A;  1OU9 A;  2W0Z A;  1NPP A;  2KRO A;  4ZGJ B;  1FWZ A;  5GAN f;  2GTO A;  2QQA A;  4DOW A;  4PJJ A;  4J6W A;  3OYH A;  2BZX A;  1K1Z A;  1IB8 A;  1BIB A;  1SRL A;  3EG3 A;  1VYT A;  3M0T A;  1WYX A;  1WHK A;  4CC7 A;  1KSW A;  3M0S A;  3ME9 A;  7AT1 B;  2HCK A;  3AT1 B;  3OYM A;  5IHI A;  2LVM A;  3QPH A;  5GMK m;  2GQI A;  2YDL A;  2EPD A;  2SRC A;  4D6W A;  1YJW Q;  2AKK A;  1M8M A;  1R0B G;  2MCN A;  1FMK A;  3F70 A;  4OP0 A;  3I55 T;  4D8D A;  2E4H A;  1UEC A;  4PFZ A;  1YIJ A;  3S3O A;  4DQ2 A;  1G8X A;  3OYL A;  3EG9 A;  5LJ5 h;  2H3E B;  3OW2 P;  2LZ6 B;  3QXE B;  5CKB A;  3G71 T;  1RL2 A;  1MMN A;  1G3Y A;  3CCM T;  3GBQ A;  4M75 D;  5GJV B;  5I11 A;  3TVT A;  2DD4 A;  1VQ8 Q;  2BIV A;  1KK7 A;  5KYX A;  4DBR A;  3RNJ A;  1D3B B;  2EYZ A;  1I1J A;  4RTT A;  5GAN j;  1ZBX A;  2HKN A;  3SHW A;  3OYB A;  3GLX A;  3EGX B;  3JB9 J;  4R55 A;  3OYJ A;  1OX8 A;  1W2B P;  5GAM h;  5KYY B;  3CCS Q;  1YI2 Q;  3O5Z A;  2HQH A;  2HDA A;  4M75 E;  3QDF A;  1QW1 A;  3CC4 T;  1YIT A;  2GGR A;  2BKD N;  2Y4X A;  1BCO A;  2IIM A;  2LTO A;  4MDX A;  1NYG A;  1QVG P;  2XIC A;  5IHN A;  3MP1 A;  4ZN1 A;  2RQV A;  4II1 A;  3X26 B;  5GMK e;  3PIO A;  1G5V A;  3RR6 A;  2EKO A;  2ROL A;  3UA6 A;  1UJ0 A;  1W6X A;  4PNO A;  3PNW C;  5HK3 A;  3I55 Q;  3CME A;  1WZO A;  1JJ2 S;  1KQS S;  1VQ6 A;  1BYM A;  4LDX A;  3TQ7 P;  2X35 A;  3CCR T;  4FYY B;  1Q95 G;  2MOX A;  1VQO A;  3LH0 A;  3JCM Q;  4M77 A;  4KGX B;  2QQR A;  3SWN C;  4R0K A;  2VXE A;  4A4K A;  1G3W A;  3LWI A;  2FPD A;  3A8O B;  2YT6 A;  3G1J A;  1FX7 A;  2KSS A;  2YLB A;  1Y0M A;  3CXC P;  2DL3 A;  4F7U A;  5CKE A;  4P5N A;  4RG8 A;  3NTK A;  2M0O A;  2G3R A;  3CCL T;  2NUP A;  3A8H B;  2OX7 A;  2CH4 A;  1Y57 A;  2FYK A;  1K9A A;  2WSF E;  1K76 A;  2MWO A;  4OMN A;  2NLU A;  3M0Q A;  2KDS A;  2HBW A;  1WDX A;  2YRV A;  2KVQ G;  1HD3 A;  1NZ9 A;  2DBK A;  5D6X A;  3BFM A;  4KH0 B;  1KG1 A;  2DVJ A;  4L5G A;  2DL8 A;  4C92 F;  3G6E T;  4A4H A;  3FRN A;  1PCX A;  2DTI A;  2H3J A;  1WHJ A;  5IN1 A;  3FEO A;  3NGP A;  1JEG A;  3V8K A;  2AT1 B;  2FPE A;  1UG1 A;  5A0D A;  1IRE B;  1MMA A;  2XKO C;  3THK A;  1WHG A;  4Y92 A;  2A7Y A;  4AFS C;  2OI3 A;  1OYX A;  1XJW B;  1YJW A;  4ZGE B;  4EMK C;  3EHQ A;  5CAI A;  1B34 B;  4C5E A;  3PMI A;  4ESR A;  4BB7 A;  2DZC A;  2KAF A;  4PJO F;  4OGC A;  4O5V A;  4BI3 A;  2K5I A;  4PJM A;  3VV0 A;  4BE0 A;  4M77 G;  5A2Q E;  1N27 A;  5J26 A;  2AKL A;  4C8Q F;  1KFZ A;  1AOJ A;  1U8R A;  3PVL A;  1X75 C;  3H0H A;  3C4S A;  1OOT A;  5ECA A;  3OBY A;  2E1H A;  2YLC A;  1M8V A;  2M9U A;  1KC8 U;  1UFF A;  1VQ8 A;  2JTF A;  3E9G A;  4JLI A;  1ZHI A;  4F7U G;  1VQK T;  2RO0 A;  2KT8 A;  3OYA A;  3M0R A;  2QAZ A;  2NUT B;  4RTW A;  5LL6 S;  1SPK A;  2O9V A;  2JTE A;  5I21 A;  4QVC A;  5FRN A;  4AT1 B;  2XHC A;  5GAO q;  2KRS A;  1YI2 A;  3EGD B;  4EPC A;  3G6E Q;  4M7A A;  5J3B A;  2LCC A;  1Q81 R;  4E6R A;  5KYW A;  2LCL A;  4EDU A;  1BB9 A;  4PJL A;  5LJ5 e;  2DTO A;  3G7Z A;  1RI0 A;  2E10 A;  1Q86 R;  1AZG B;  2O88 A;  3VS0 A;  2Y4Y A;  3J81 E;  3A8G B;  3LLR A;  1WXB A;  2ECZ A;  3FLG A;  4HA8 A;  2RB6 A;  3HHT B;  4FL6 A;  4EMG A;  2LRQ A;  2DEU A;  3CPW P;  1X6O A;  4X9C A;  1BI2 A;  3VS3 A;  3QZ9 B;  4NS5 A;  4AG1 C;  3I55 A;  5AYF A;  3I56 T;  3EG2 A;  5GAO l;  1U1S A;  1SRM A;  2QDL A;  2KEA A;  2MAM A;  3L2R A;  2ROT A;  3OS5 A;  1K8A R;  4HVW A;  4C0Z A;  1WHL A;  2K3B A;  3FC3 A;  3G4S Q;  3SDZ A;  4JDS A;  1YCS B;  4C0F A;  2NUZ A;  5GJW B;  3OYK A;  2JMC A;  3QYH B;  5FW9 A;  4RUG A;  2E5K A;  2F5K A;  1AD5 A;  2PUO B;  5FWB A;  3OYF A;  2KQW A;  1O75 A;  4XTY A;  2RI5 A;  2VV5 A;  5KYX B;  2DL7 A;  1PKS A;  5DM7 R;  2LC4 A;  2VB6 A;  2ZCF B;  1JXO A;  2FZK B;  1PHT A;  4M7D E;  1YN8 A;  3GIB A;  2KYB A;  4C0D C;  3MEV A;  1S72 Q;  1VIE A;  4OVA A;  5GAO p;  5IAY A;  1RAE B;  1BI0 A;  4M7A G;  4F04 B;  3OW2 A;  4WTO B;  3R6N A;  3CEY A;  1KD1 R;  1SG5 A;  2AHJ B;  1ZA1 B;  3MP8 A;  2GBQ A;  3EAE A;  3WXM B;  5KYY A;  4LDY A;  1N8R C;  2YUP A;  2X51 A;  2A37 A;  1M27 C;  2LNH B;  2LQK A;  1WHH A;  1GBR A;  2GTJ A;  2ED0 A;  2YRC A;  1QWE A;  2YRD A;  4M77 B;  1A0N B;  1OI1 A;  1W2B A;  1WJS A;  2HSP A;  4LN2 A;  1RAB B;  4FU6 A;  1WIE A;  1WI7 A;  3I5S A;  4A54 A;  1UE9 A;  2KBT A;  2EW3 A;  4F7U B;  1B7T A;  3UPU A;  2LDM A;  1QVG A;  3MEW A;  1U3O A;  1JBM A;  2IVW A;  5IXB A;  2NUP B;  1ZX6 A;  2XMF A;  3BW1 A;  2L3P A;  1YP5 A;  2E12 A;  2K2M A;  3MP6 A;  2J6K A;  4GLK A;  4CC3 A;  2KXC A;  1Y71 A;  5C0M A;  1YIJ Q;  4K11 A;  3ASK A;  4RTX A;  3X28 B;  2HNI A;  3H0F A;  4M7D C;  3OYY A;  2PTK A;  3UT1 A;  1YHQ Q;  1T0J A;  2AZV A;  2MI6 A;  4FYV B;  2K5L A;  4IUR A;  4XQ3 A;  3M4Y A;  3G6E A;  3JCM d;  1S1N A;  3FB9 A;  5DY9 A;  5GMK h;  2HD0 A;  3S6W A;  4N0A A;  1YJ9 T;  3KUF A;  4UC4 A;  3H6Z A;  3CXC A;  2D9T A;  2JS2 A;  1M90 R;  1WPY A;  4FM4 B;  4IUP A;  3ER0 A;  1E6G A;  3I9Q A;  4CI0 C;  3QO3 A;  3EH2 A;  1WGS A;  1RLQ C;  1WXU A;  4FIB A;  4E7H A;  3OYD A;  1O9S A;  4M78 E;  4NL3 A;  1K9M R;  1ZSZ C;  2P0P A;  2XDP A;  1GL5 A;  1M2O A;  1PKT A;  4PK4 A;  3PTA A;  2CGH A;  5FU7 C;  4C92 A;  2X4X A;  4IUQ A;  4GLM A;  4DA4 A;  1JJ2 P;  2A28 A;  2PVG B;  2DYI A;  3G4S A;  2FRW A;  4RTZ A;  2DEQ A;  4J9I A;  3NFC A;  4E7I A;  1D1C A;  2KXD A;  1MNE A;  3PIP A;  1KIK A;  4M77 D;  1G3T A;  3UWN A;  4LNP A;  2D0N A;  3JCM f;  1VQK A;  2K57 A;  4QVD A;  2JT4 A;  3PT9 A;  1EIF A;  1X2Q A;  2OAU A;  3QDR B;  2F69 A;  5GAN 4;  2LNV A;  3JCM b;  2RJC A;  3OS0 A;  5GAN d;  1AWX A;  2D8H A;  5FU6 C;  2JUF A;  5LJ3 g;  4PJO A;  1I07 A;  2QQB A;  3QBY A;  3C95 A;  1VOM A;  3C0C A;  4C8Q A;  2HSE B;  1K0S A;  4HCK A;  1PC0 A;  1UGQ B;  2O31 A;  1NJI U;  2LX9 A;  3QII A;  4M77 E;  2W10 A;  4E47 A;  1RAC B;  4M7A B;  2A3L A;  1YJ9 Q;  1PSE A;  2QEX T;  2COW A;  4C5H A;  5KYW B;  1VQ4 Q;  3EHR A;  4C5I A;  2HQX A;  2RPN A;  1C1A A;  2EJF A;  2JMA A;  1M3A A;  2DRK A;  3INZ A;  4J9E A;  4F7U E;  3RKX A;  1NJI C;  4OMM A;  2GQV A;  1CKB A;  1M3C A;  3CC2 Q;  3VUZ A;  2VGN A;  1QP3 A;  2RF0 A;  2DJZ A;  5GMK i;  1ABQ A;  2KRN A;  2EYX A;  2JXB A;  5IT9 E;  2DBM A;  4Z02 A;  4M78 C;  4LE9 A;  2FB7 A;  1TSF A;  4KGZ B;  3VS6 A;  3CD6 T;  3CMA T;  1PRL C;  3DB3 A;  1MGQ A;  1R0C B;  4C92 G;  3FDR A;  3VKI A;  2WSE E;  4J6Y A;  1Y96 A;  3OMG A;  1D1A A;  5LJ5 g;  3H41 A;  5GAN e;  3BDU A;  4Y28 E;  2V1R A;  3V7C A;  5HK0 A;  2CZ7 B;  1OX9 A;  5D6W A;  1YBY A;  3SB2 A;  3PGG A;  5I2M A;  1IZ6 A;  2ZPH B;  3CPW A;  2K3Y A;  3I35 A;  3I5R A;  2XDB A;  4KH1 B;  1QLY A;  3H9N A;  2D8J A;  1M1K R;  3REA B;  1N6A A;  4PJO G;  5GAM g;  1ZQ1 A;  1YHQ A;  3NTI A;  4B9X A;  2EQJ A;  3A5Z B;  3DLM A;  1SHF A;  4C8Q G;  2HL3 A;  4ZN3 A;  1H3Z A;  4QQD A;  2V1Q A;  2FVU A;  1JB0 E;  4NOY A;  4M7A D;  2DIL A;  2YUN A;  2DKG A;  4RMO A;  4E7L A;  2OTL T;  4HKE A;  1ZSG A;  2EQM A;  2RQW A;  2V26 A;  2CT3 A;  1M1F A;  2E6N A;  1OPL A;  1WLP B;  3ZL7 C;  1ZA2 B;  2ZPI B;  4O6J A;  3CMA Q;  2MIO A;  4HCB A;  2EYY A;  2EBP A;  4J9D A;  1QVF S;  1TH7 A;  2A36 A;  3D7S B;  4JJN K;  5CO7 A;  1VQM T;  4M7A E;  1QMC A;  3JB9 H;  2L89 A;  4YTL A;  4HCZ A;  2VYT A;  3T9N A;  1WQW A;  2M16 A;  1Q81 U;  1WQ7 A;  1WJR A;  2DXT A;  2CH4 W;  2CDT A;  1Q82 R;  1Q86 U;  2L0A A;  1AWJ A;  4M4Z A;  3JCM V;  1KHI A;  3CCV T;  4N4G A;  3G71 Q;  1QCN A;  2QGG A;  1ABO A;  4GY5 A;  3CCM Q;  1VQ5 T;  1Q81 C;  2DZ9 A;  2DO3 A;  1QVP A;  5GAN 6;  4CC2 A;  4CRI A;  1HK9 A;  2JS0 A;  3ZBD A;  2HEQ A;  3QYG B;  3RBB B;  1Q86 C;  1VUB A;  1UB4 A;  1YJ9 A;  4JS5 A;  4RCB A;  2KMT A;  2DIQ A;  3MPU B;  3EGU A;  4PLI A;  3LWH A;  1VQ4 A;  1JXM A;  3QZ5 B;  2HAX A;  1JU5 C;  5A0L A;  1UHF A;  4FSS A;  2DER A;  1K73 U;  3MKD A;  1PRM C;  1ZUY A;  2P4T A;  3EG0 A;  3RMS A;  4J9B A;  4Q5W A;  1XNI A;  2YUQ A;  3CC2 A;  4IKF A;  2F5T X;  5C6S A;  1M9S A;  4MMK A;  3CC4 Q;  5IXF A;  2ZGW A;  4IIO A;  4A4E A;  1G83 A;  1NEB A;  2WSC E;  3C94 A;  1K73 C;  2EQI A;  4R56 A;  1PD1 A;  1TWB A;  2CS7 A;  2DA9 A;  4C92 B;  4BDY A;  4BE1 A;  1LCK A;  2K5F A;  5J39 A;  1KQ1 A;  3CQT A;  3PE0 A;  1VQ9 T;  4M75 C;  4BY6 C;  3KXT A;  4C5G A;  3V7S A;  4GBQ A;  3CCR Q;  4OF1 A;  2YSQ A;  2GFA A;  1YFN A;  4WCI A;  5LJ3 f;  5CIU A;  3SEM A;  1SHG A;  2O2O A;  2DET A;  4OMF B;  5GAO m;  4DOV A;  3QUI A;  1KD1 U;  4PJO B;  1BCM A;  4ATO A;  5AT1 B;  2LJ3 A;  1TS9 A;  1Q7Y R;  5FRO A;  2KGT A;  1W70 A;  3OBW A;  3MJX A;  4C8Q B;  1E6H A;  3SWN A;  3OSV A;  1V29 B;  3JB9 G;  2CSI A;  3CCL Q;  2I2L A;  3KBG A;  1T3L A;  3M56 A;  1TOV A;  4FT4 A;  2O01 E;  1LPL A;  4M7D F;  2EKH A;  4E7Z A;  1BKB A;  3M59 A;  4L59 A;  2WAC A;  4MZP A;  4AFU C;  2DK3 A;  1HYO A;  3OA6 A;  4JJB A;  2JTM A;  5DLO A;  1BIA A;  4HT8 A;  2CP0 A;  2YWW A;  3CCQ T;  1H64 1;  3QG1 A;  5KYU A;  3OS2 A;  3L2U A;  1KC8 C;  3CD6 A;  4IUV A;  1ZLM A;  3JCM W;  3CMA A;  2MWP A;  2DD5 A;  2KE9 A;  1LNX A;  1ARK A;  5LJ3 j;  2P4R A;  2X9H A;  2RH2 A;  2ESW A;  2R57 A;  3RES A;  2PZ1 A;  2RNA A;  2RK1 A;  3MEU A;  4E7K A;  2FZC B;  4BD3 A;  4C92 D;  1Y96 B;  1YJN T;  4RG2 A;  4XTV A;  4EIK A;  1R77 A;  1H8K A;  4Z88 A;  3VS1 A;  4QQ6 A;  3JCM h;  1N5Z A;  4EMK A;  2BTT A;  4AMC A;  2QG9 B;  5GAM f;  2X4J A;  5IH2 A;  3G71 A;  2M0Y A;  2QTV A;  1PG5 B;  3CCM A;  4LDU A;  3JAM E;  2R5M A;  4C92 E;  1K9M U;  6AT1 B;  4PJO D;  3RKW A;  4N4H A;  4QT7 A;  1GFD A;  3A8M B;  4HXJ A;  1VQK Q;  5CQX A;  3L2W A;  1YWP A;  2RQR A;  4C8Q D;  2NWM A;  3LX7 A;  2CP6 A;  2RQU A;  4OB2 B;  1M30 A;  3CCQ Q;  1PD0 A;  1UGR B;  2KT1 A;  2EFI A;  4RTV A;  2KNB B;  4J9F A;  1JQQ A;  1RI9 A;  2VKN A;  4FCY A;  1PM3 A;  3CC4 A;  4PJO E;  3REB B;  2QA4 T;  2A0F B;  4DBQ A;  1VQM A;  1DJ7 B;  5IHK A;  2C0I A;  2E65 A;  4B9W A;  2L8D A;  1VQ7 T;  3E19 A;  1MMD A;  2E64 A;  2DM1 A;  1B07 A;  4M78 F;  5GAN h;  2DNU A;  4XU1 A;  1BU1 A;  3TCJ A;  1X2K A;  3I56 Q;  2M51 A;  1Z9Z A;  1IHW A;  1AVZ C;  2OTJ T;  3CCR A;  5EG2 A;  2B8A A;  2K79 A;  2OJ2 A;  1G3S A;  1AEY A;  2XG8 D;  3CCV A;  4RTY A;  5KE3 A;  5M9O A;  4J9H A;  3L2V A;  3Q1J A;  3URG A;  1BI1 A;  5CVI A;  2F2V A;  3JSC A;  1G2B A;  1X43 A;  3JB9 F;  2LQN A;  1NLO C;  3QWY A;  4QQG A;  2E3I A;  3EFO A;  2RQT A;  3L2Z A;  3HP9 A;  1QKW A;  3ZFJ A;  5FWC A;  1OV3 A;  3CCL A;  2QDY B;  4HVU A;  1IO6 A;  2KRM A;  4BI4 A;  1NG2 A;  4QW2 A;  4LD9 K;  2LCS A;  1MV3 A;  3KFV A;  4JPB W;  4PL6 A;  4KRT A;  2RHZ A;  3H0I A;  4WF2 A;  3A98 A;  1VYV A;  4FYW B;  2VGM A;  1GFC A;  3MEA A;  2IPO B;  1YIT T;  1K4U S;  1UGS B;  3WVD B;  2QA4 Q;  1I81 A;  2JM8 A;  4J83 A;  1VQ7 Q;  1CKA A;  5FRM A;  2DFU A;  2PUK B;  3M0U A;  3RER A;  2SEM A;  3CME T;  2RM4 A;  1M5Q 1;  1QWF A;  1VQ6 T;  3J7A F;  2RN8 A; 
#chains in the Genus database with same CATH homology
 2FYK A;  4J6Y A;  1Y96 A;  3OMG A;  4J7I A;  3O8V A;  4QVZ A;  2XK0 A;  5LJ5 g;  5HKC A;  1M1K U;  5GAN e;  3BDU A;  1QVG S;  2EAY A;  2O4X A;  2WSF E;  4Y28 E;  1XQH A;  4ZTF A;  4Y91 A;  2RHI A;  3V7C A;  5GAN 8;  4ZGD B;  5HK0 A;  2MWO A;  3MET A;  2DIG A;  2OTL A;  2CZ7 B;  4JRI A;  5GAM e;  1UEB A;  3CBM A;  3M55 A;  3VJP A;  5D6W A;  2NLU A;  1YBY A;  2DAQ A;  2RA2 A;  3PGG A;  3SB2 A;  2KDS A;  1M90 C;  4M7D D;  5I2M A;  2CZ0 B;  1IZ6 A;  4RCC A;  2YRV A;  2ZPH B;  4JRQ A;  2KVQ G;  3CCE A;  2CKK A;  2K3Y A;  3CPW A;  1NZ9 A;  2K4Y A;  5D6X A;  2XDB A;  5GAN g;  3VYH B;  3BFM A;  1K9M C;  1N6A A;  1M1K C;  1KG1 A;  2PU9 B;  4L5G A;  3HRU A;  3E1S A;  4PJO G;  3P8H A;  4XTZ A;  5LJ5 j;  4C92 F;  1ZQ1 A;  5GAM g;  1YHQ A;  1WJQ A;  3NTI A;  5L8R E;  4B9X A;  3G6E T;  4A4H A;  2EQJ A;  4XTU A;  3A5Z B;  3DLM A;  3FRN A;  2EIF A;  3HL8 A;  2D0Q B;  2DTI A;  4C8Q G;  2H3J A;  1VQL T;  4ZN3 A;  5IN1 A;  3FEO A;  3SWN B;  3CCJ A;  3QSU A;  1H3Z A;  4QQD A;  3V8K A;  2FVU A;  1JB0 E;  4C8Q E;  3VUB A;  1I4K 1;  1VQN A;  5A0D A;  4NOY A;  1IRE B;  4M78 B;  4M7A D;  4KUI A;  2DKG A;  4RMO A;  4E7L A;  2OTL T;  2XKO C;  4X9D A;  3CXC S;  2A7Y A;  4MZM A;  1OYX A;  1YJW A;  4HKE A;  4X34 A;  4ZGE B;  2L5Q A;  2EQM A;  5GAN 2;  3HPW A;  4EMK C;  5GAN 5;  3TU4 K;  3X24 B;  5CAI A;  1B34 B;  1M1F A;  1XTD A;  2E6N A;  2IG0 A;  2K3X A;  3PMI A;  3R6O A;  4C5E A;  4BB7 A;  5GAM j;  1LOJ A;  1YIJ T;  3HRT A;  4M75 G;  4XK8 E;  1AHJ B;  2DZC A;  2KAF A;  3M58 A;  3H8Z A;  3RUX A;  4PJO F;  2ZPI B;  4O6J A;  4OGC A;  3CCQ A;  2RJF A;  4O5V A;  1N8R U;  4BI3 A;  3QJY A;  2K5I A;  4HCB A;  3JRZ A;  5DLQ E;  1YHQ T;  4N0A C;  3M5A A;  4M77 G;  3VV0 A;  5A2Q E;  1N27 A;  5J26 A;  3JCM e;  4BE0 A;  3CCU A;  1QVF S;  4C8Q F;  2DPP B;  1VQ5 A;  1TH7 A;  1I5L A;  3OYC A;  1U8R A;  1D3B A;  3VYG A;  4M7D A;  1X75 C;  4JJN K;  1Q82 U;  3C4S A;  5CO7 A;  5KCH A;  1VQM T;  3OBY A;  4M7A E;  1LJO A;  2E1H A;  2X4Y A;  2YLC A;  3JB9 H;  2M9U A;  1VIF A;  2FL7 A;  1M8V A;  5KE2 A;  1NE8 A;  2L89 A;  3C12 A;  1KC8 U;  2ZZD A;  2QXF A;  3TEE A;  1VQ8 A;  1Y7X A;  2M1H A;  3L42 A;  4YTL A;  4HCZ A;  4FSX A;  2JTF A;  2VYT A;  3E9G A;  4JLI A;  3T9N A;  2CZ1 B;  1ZHI A;  4F7U G;  1WQW A;  2M16 A;  2RJE A;  1Q81 U;  1M1G A;  2XD0 A;  4A53 A;  1VQK T;  1JRI A;  2RO0 A;  1WQ7 A;  2VXF A;  1WJR A;  3OYA A;  4C0G A;  2DXT A;  3J80 E;  2LT4 A;  2RI2 A;  2XID A;  5LL6 S;  4BY6 B;  4C92 C;  4M75 F;  3N5B B;  5I21 A;  1Q86 U;  3I56 A;  4QVC A;  1Q82 C;  5FRN A;  2XHC A;  2XI9 A;  3PFS A;  5GAO q;  1I8F A;  1HXD A;  1BI3 A;  2QI2 A;  4J5Y A;  3JCM V;  4BE2 A;  1YI2 A;  3CC7 T;  1KHI A;  4EPC A;  4M77 F;  4N4G A;  4NL2 A;  2EQU A;  1WNL A;  2GCX A;  2GFU A;  3CCV T;  4M7A A;  3OY9 A;  5J3B A;  2LCC A;  4GY5 A;  1U1T A;  3S3N A;  2LCL A;  3ZEH A;  1VQ5 T;  1Q81 C;  4EDU A;  2DZ9 A;  2DO3 A;  1QVP A;  5GAN 6;  4CRI A;  1NPR A;  2QQS A;  1HK9 A;  5LJ5 e;  4EMK B;  2DTO A;  3ZBD A;  1N9S A;  3G7Z A;  1RI0 A;  2E10 A;  3QYG B;  1KQ2 A;  2LT1 A;  5CKD A;  1Q86 C;  1VUB A;  1UB4 A;  1YJ9 A;  4JS5 A;  4RCB A;  2KMT A;  3VU3 C;  2DIQ A;  2LQ8 A;  4OGE A;  4F7U F;  1VQ9 A;  2Y4Y A;  3J81 E;  3A8G B;  3LLR A;  4PLI A;  3LWH A;  1VQ4 A;  2C06 A;  3FLG A;  4E7J A;  3QZ5 B;  4HA8 A;  3FIF A;  2HAX A;  2JOY A;  2RB6 A;  3HHT B;  4PJO C;  5A0L A;  4FL6 A;  3CBP A;  4EMG A;  2LRQ A;  3GOX A;  1K73 U;  1X6O A;  2JNG A;  1BI2 A;  4X9C A;  3QZ9 B;  4NS5 A;  2EWN A;  4XU3 A;  3M4G A;  3I55 A;  2P4T A;  5AYF A;  3I56 T;  3RIR A;  5GAO l;  1Y07 A;  1U1S A;  4IUT A;  4C8Q C;  3RMS A;  2MAM A;  3CCS T;  3L2R A;  1VQO T;  1YI2 T;  4Q5W A;  1XNI A;  3OS5 A;  2ZPG B;  3CC2 A;  4IKF A;  2F5T X;  4C0Z A;  4VUB A;  5C6S A;  2EYQ A;  3P8D A;  1M9S A;  4MMK A;  3FC3 A;  4M78 D;  2ZGW A;  1SSF A;  4V2S A;  4A4E A;  3OQ5 A;  1OZ3 A;  3JB9 I;  3SDZ A;  4JDS A;  2K2V A;  2JN0 A;  4C0F A;  1VQP T;  2WSC E;  2X4W A;  3C94 A;  1K73 C;  2QA4 A;  4R56 A;  4OB1 B;  3OYK A;  2CS7 A;  4XTW A;  4C92 B;  3OSS C;  4BDY A;  4BE1 A;  3MO8 A;  5I2S A;  2K5F A;  3QYH B;  5J39 A;  1KQ1 A;  3OYN A;  1VQ9 T;  4M75 C;  3S3M A;  1VQ4 T;  1VQ7 A;  3HRS A;  2PVD B;  4JRK A;  4BY6 C;  3KXT A;  2F5K A;  2PUO B;  2YHT A;  4LDV A;  2KQW A;  1O75 A;  4M77 C;  4XTY A;  3V7S A;  2DXU A;  2RI5 A;  2VV5 A;  4C5G A;  3AHU A;  3M57 A;  5A0G A;  2EJG A;  4OF1 A;  1Q7Y U;  4M7D G;  3SD4 A;  1YCY A;  4EMH A;  5DM7 R;  2GFA A;  2LC4 A;  4JS4 A;  2MF2 A;  2OTJ A;  2ZCF B;  3JB9 D;  4HT9 A;  3BY7 A;  3CC2 T;  4M7D E;  5LJ3 f;  2E41 A;  5CIU A;  3GIB A;  4J6X A;  5GAN 7;  1P92 A;  4LD6 A;  4OMF B;  5GAO m;  3M9Q A;  4DOV A;  3QUI A;  1KD1 U;  3M54 A;  4C0D C;  5D6Y A;  3CCE T;  3GNG A;  4PJO B;  1M4Z A;  2CYZ B;  4ATO A;  3MEV A;  3LYI A;  3CPW S;  1VIE A;  5FRO A;  1Q7Y C;  3OBW A;  2FHD A;  2KY9 A;  4OB3 B;  4C8Q B;  2V8K A;  3SWN A;  3BDL A;  3OSV A;  1V29 B;  4OVA A;  3DLL A;  5GAO p;  5KCO A;  5IAY A;  3JB9 G;  1BI0 A;  2I2L A;  2DVE A;  3KBG A;  4BDZ A;  4M7A G;  3MCA B;  3HFO A;  3OW2 A;  4M78 A;  3M56 A;  4FT4 A;  2EQK A;  2O01 E;  2RJD A;  3CEY A;  4M7D F;  2JVV A;  4ELY C;  2R58 A;  3TRE A;  3V8J A;  3CCJ T;  1BKB A;  3M59 A;  2AHJ B;  3LGL A;  3MP8 A;  1VQN T;  3EAE A;  3GNF B;  1B34 A;  2Y90 A;  4L59 A;  2WAC A;  2R5A A;  4MZP A;  3WXM B;  4LDY A;  1N8R C;  1R8O B;  1YJW T;  2DK3 A;  3HFN A;  1YJN A;  2LQK A;  4M75 B;  4OB0 B;  2HQE A;  3OA6 A;  3GF5 A;  1KHC A;  2CZ6 B;  4KUL A;  3JCM X;  4RKU E;  3X25 B;  2JTM A;  2P0Q A;  4KBM B;  1OI1 A;  4M77 B;  5DLO A;  1W2B A;  1W4S A;  1BIA A;  1WJS A;  4PKC C;  4HT8 A;  4J8O A;  1X01 A;  3CCQ T;  4BAC A;  1S72 A;  1H64 1;  3QG1 A;  4FU6 A;  3OS2 A;  3L2U A;  1KC8 C;  2RD1 A;  3CD6 A;  4IUV A;  4M7A F;  3JCM W;  3CMA A;  3CCU T;  3FJP A;  3RKY A;  5GAO n;  2MWP A;  2DD5 A;  2DTH A;  5GMK l;  3DB4 A;  3SFM A;  1LNX A;  4A54 A;  1PSF A;  3RMQ A;  5LJ3 h;  5LJ3 j;  3EFS A;  4L6V 5;  3OYE A;  3CPF A;  2QQ9 A;  2RH2 A;  4F7U B;  1OZ2 A;  4C0D B;  2PQW A;  2R57 A;  3RES A;  3UPU A;  3A8L B;  4A4G A;  1FXX A;  2LDM A;  2RHX A;  3OYF A;  1QVG A;  1VQ8 T;  3MEW A;  1K8A U;  2BUD A;  2RK1 A;  5CQY A;  3MEU A;  2RHU A;  5CR2 A;  4E7K A;  4ELZ C;  1JBM A;  2IVW A;  5LJ3 d;  4BD3 A;  3OYI A;  4C92 D;  2E5Q A;  1UGP B;  4JRP A;  3BW1 A;  3JCM P;  3JCM c;  1Y96 B;  4BI8 B;  2E12 A;  1YJN T;  3MP6 A;  2L3R A;  2HBP A;  2ZPE B;  3HKS A;  4RG2 A;  2O4X B;  4GLK A;  4XTV A;  3GPL A;  1Y71 A;  2E6Z A;  5C0M A;  3ASK A;  3X28 B;  1NPP A;  4QQ6 A;  2HNI A;  3E9F A;  3JCM h;  3V7R A;  1FWZ A;  4ZGJ B;  5GAN f;  4M7D C;  2QQA A;  3OYY A;  3UT1 A;  4EMK A;  1K8A C;  4DOW A;  2MI6 A;  4KUD K;  2K5L A;  4IUR A;  4J6W A;  4XQ3 A;  5GAM f;  2X4J A;  3OYH A;  3M4Y A;  3G6E A;  3JCM d;  3G71 A;  5HY6 A;  3UDC A;  1BIB A;  3FB9 A;  3OB9 A;  3PMT A;  4JLG A;  4LDU A;  5DY9 A;  5GMK h;  5GMK j;  3JAM E;  3CCM A;  1VQL A;  2HD0 A;  2R5M A;  4C92 E;  1N9R A;  1QP2 A;  3ME9 A;  3S6W A;  4N0A A;  1K9M U;  4PJO D;  3RKW A;  4N4H A;  3OYM A;  1YJ9 T;  2MMP A;  2LVM A;  3A8M B;  3KUF A;  3LGF A;  3QPH A;  5GMK m;  3GP8 A;  5GAO r;  4UC4 A;  4D6W A;  3H6Z A;  3CXC A;  5CQX A;  2D9T A;  3L2W A;  4C8Q D;  4ZTJ A;  2DXB A;  3F70 A;  2GF7 A;  1WPY A;  3LX7 A;  4FM4 B;  4IUP A;  5CCA A;  4M78 G;  3ER0 A;  4OP0 A;  4CI0 C;  3I55 T;  3QO3 A;  4M7A C;  1WGS A;  4HCC A;  4OB2 B;  4FIB A;  4E7H A;  4J7F A;  3OYD A;  3CBO A;  1O9S A;  1UGR B;  4M78 E;  4NL3 A;  1YIJ A;  3EFR A;  3P8B B;  2EFI A;  2P0P A;  2XDP A;  2JZ2 A;  2XU8 A;  4DQ2 A;  3S3O A;  3OYL A;  3PTA A;  1MHN A;  2CGH A;  4BUG A;  5FU7 C;  4N4I A;  4C92 A;  5LJ5 h;  4XTX A;  3QXE B;  2X4X A;  5CKB A;  3G71 T;  1QVF A;  4IUQ A;  5GAN 3;  4DA4 A;  3CC4 A;  1RL2 A;  1G3Y A;  2PVG B;  3V8L A;  3G4S A;  3CCM T;  2EJ9 A;  4PJO E;  2RHY A;  2DEQ A;  4E7I A;  3NFC A;  4M75 D;  2V8J A;  2QA4 T;  4XAX B;  2DD4 A;  5LJ5 d;  1VQM A;  3PIP A;  2BIV A;  4PLL A;  1DJ7 B;  3WVE B;  3OYG A;  2QEX A;  3MHX A;  4M77 D;  2E65 A;  4B9W A;  1G3T A;  2PVO B;  2L8D A;  5LJ3 e;  3UWN A;  1D3B B;  1VQ7 T;  3E19 A;  4M7D B;  2E64 A;  5GAN j;  4M78 F;  1ZBX A;  3JCM f;  5GAN h;  2K57 A;  3OYB A;  1JJ2 A;  1VQK A;  1KQS A;  3GLX A;  4XU1 A;  4QVD A;  3TCJ A;  4A4F A;  3JB9 J;  3PT9 A;  1EIF A;  1KD1 C;  4R55 A;  3OYJ A;  2OAU A;  3QDR B;  2F69 A;  5GAN 4;  2LNV A;  3RER A;  5GAM h;  2OTJ T;  3JCM b;  3CCR A;  2RJC A;  4LDW A;  5EG2 A;  5GAN d;  3NTH A;  3OS0 A;  2DXC A;  2B8A A;  5FU6 C;  2JUF A;  5LJ3 g;  4PJO A;  3CC7 A;  1G3S A;  2QQB A;  3QBY A;  3QKJ A;  2XG8 D;  3CCV A;  5KE3 A;  3C95 A;  2QTX A;  5GAM d;  4M75 E;  5M9O A;  3L2V A;  2VC8 A;  3Q1J A;  2ZPF B;  1QW1 A;  3URG A;  4C8Q A;  3CC4 T;  1YIT A;  3G4S T;  2BKD N;  2Y4X A;  4MDW A;  1BI1 A;  2ZPB B;  1UGQ B;  5CVI A;  2RK2 A;  1NJI U;  2LX9 A;  3QII A;  4M77 E;  2LTO A;  4MDX A;  4E47 A;  4M7A B;  4JUV A;  4XU2 A;  2A3L A;  2XIC A;  3JSC A;  1PSE A;  3LW5 E;  3MP1 A;  5CKF A;  4ZN1 A;  3OS1 A;  2QEX T;  2D6F A;  1GXI E;  4C5H A;  3JB9 F;  2P0K A;  4II1 A;  3X26 B;  5GMK e;  3PIO A;  1G5V A;  4QQG A;  4C5I A;  2HQX A;  2EKO A;  5CK9 A;  3L2Z A;  3X20 B;  2EJF A;  3HP9 A;  3M53 A;  3ZFJ A;  3JCM g;  4PNO A;  3DKM A;  3PNW C;  3OW2 S;  2E70 A;  2QDY B;  5FU7 B;  5HK3 A;  3CME A;  1JJ2 S;  3CCL A;  2RI3 A;  1KQS S;  1VQ6 A;  4BI4 A;  1BYM A;  3INZ A;  4LDX A;  3L1A A;  4QW2 A;  5CKH A;  4F7U E;  5KH6 A;  3OMC A;  4LD9 K;  2X35 A;  3RKX A;  4M75 A;  3JCM J;  1NJI C;  5LJ5 f;  2V8I A;  2XDD A;  3CCR T;  2GQV A;  5FLX E;  4ME7 A;  3VUZ A;  2VGN A;  4PL6 A;  3CCS A;  1QP3 A;  2RHZ A;  3LH0 A;  2DJZ A;  3JCM Q;  4M77 A;  1VQO A;  3HSB A;  3L2Q A;  4WF2 A;  5GMK i;  2VUB A;  2QQR A;  3QJ6 A;  2VGM A;  3MEA A;  1YIT T;  5IT9 E;  1UGS B;  3SWN C;  4KT0 E;  3WVD B;  1I81 A;  1VQP A;  4TVR A;  2VXE A;  4MZT A;  4Z02 A;  4A4K A;  1W2B S;  1G3W A;  3LWI A;  4M78 C;  1S72 T;  3A8O B;  2FB7 A;  1FX7 A;  1XOV A;  2KSS A;  4J83 A;  2YLB A;  3CD6 T;  4F7U A;  3CMA T;  4XU0 A;  5CKE A;  5FU6 B;  2PUK B;  4P5N A;  4RG8 A;  3DB3 A;  1M90 U;  5FRM A;  3NTK A;  4MML A;  1MGQ A;  4FT2 A;  4IUU A;  3FDR A;  3VKI A;  2M0O A;  2G3R A;  2WSE E;  2RM4 A;  1M5Q 1;  3A8H B;  4C92 G;  3CME T;  3CCL T;  1VQ6 T;  3J7A F;  2KK4 A;  3QHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...