5GANh

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ganh00
2FB7A 4C92F 4XU1A 4Y91A 4EMHA 4RCBA 2E41A 5GMKj 3JCMd 1H641 3RKXA 4C8QB 4C8QF 4N0AA 4NL3A 3GIBA 4JUVA 4A53A 1HK9A 4J6XA 1U1TA 1YCYA 4NOYA 3JCMW 4M78C 2DVEA 4J6WA 3INZA 3JB9H 2EJGA 3RESA 3QUIA 4PNOA 1BIAA 1HXDA 1D3BB 2DTOA 2DXTA 2YLBA 3BY7A 3RUXA 4C92C 5GAN6 4M7AA 5LJ3d 4X9CA 3JB9I 2YHTA 4WF2A 1JBMA 4M78B 4M77B 1N9SA 4M77F 4M78G 4X9DA 5DY9A 4XQ3A 4XU0A 4M78A 4A54A 4C92B 5LJ5j 1JRIA 4M78D 5CAIA 5GAOp 3RERA 2YLCA 3V7CA 4C92G 5GAN7 4M78E 4HT9A 3FB9A 3SB2A 4JRKA 2VXFA 4C92A 2E10A 2RB6A 4C8QG 4C92D 4PJOC 4JLIA 3JCMX 5GAMh 1N9RA 5LJ3j 4C8QA 4C92E 4EMGA 4XTZA 4QVDA 4OP0A 1X01A 3V7SA 4C8QD 2RM4A 5I21A 4C8QE 4M77C 1I8FA 5GMKh 2FYKA 3JCMb 2E1HA 2VXEA 3HFNA 4EMKC 5GAOl 4XTUA 2DZ9A 5GAMe 5GAMf 3JCMQ 4PJOB 4PJOF 2DJZA 1M8VA 4PJOG 4M7DC 5GMKi 2EJFA 3QO3A 1D3BA 2Y90A 4M75C 5GAMg 4EMKB 3JB9F 2JN0A 3HSBA 3BDUA 4M77G 4PJOE 3VU3C 3JB9J 2EAYA 4M77A 5GAMd 2DZCA 1BIBA 4MMLA 4M77D 3JCMh 1MGQA 4EMKA 3QSUA 2DXUA 2ZGWA 1B34B 4F7UB 4M7DF 4F7UF 4M7DB 4M77E 5GANh 5GAOq 4M75B 3JCMV 4M75F 4XTWA 4F7UG 4XTXA 4M75G 3RIRA 4J5YA 3SWNB 1B34A 1M5Q1 4N0AC 5LJ5h 2QTXA 3BW1A 1WNLA 4M75D 4XTVA 1I81A 5GANe 4F7UE 4HA8A 5GANf 1WQWA 1WQ7A 2HNIA 4XTYA 3RKWA 4M75E 4QVCA 4XU2A 1I5LA 2DTIA 5GMKm 2VC8A 3PGGA 5GAMj 5LJ5e 5LJ3h 5LJ5f 4XU3A 1I4K1 2EWNA 5GAN5 5GMKe 3L2ZA 5GANg 2RD1A 2EJ9A 4PJOA 4M7AC 2DEQA 3FJPA 3FIFA 5GAN4 2DTHA 4PJOD 3JCMc 3SWNC 1WPYA 1U1SA 4JRIA 5GANd 5GAOn 3JB9G 1LNXA 4NL2A 5LJ3e 5LJ5g 4J6YA 5LJ3f 3RKYA 5GAN3 3M4GA 4MMKA 5GAOr 4HT8A 3JCMJ 3JB9D 4V2SA 5LJ5d 2RA2A 3V7RA 3EFSA 3EFRA 3L1AA 3V8KA 4M7AB 1KQ1A 3V8LA 2E64A 5GAN8 4M7AF 4M7DG 3AHUA 2I2LA 5LJ3g 5GAOm 4M7AG 1Y96B 1LJOA 4F7UA 4M7DA 4M7DD 1LOJA 4M75A 3JCMe 3JCMf 4RCCA 2CGHA 4M7DE 2E65A 3BFMA 3SWNA 4M7AD 2DKGA 4C8QC 1Y96A 1TH7A 4M78F 5GANj 4M7AE 5GAN2 1KQ2A 3HFOA 3QHSA 5GMKl 3JCMP 2K57A 3JCMg 3V8JA 4DQ2A
chains in the Genus database with same CATH superfamily
1XQHA 3HTRA 3MP1A 5KYYB 1MMGA 3DLMA 2ROLA 1ABOA 2CP3A 1R77A 3ER0A 2EJGA 1VQ7A 2MOXA 1D1AA 2YLBA 3UA6A 3PE0A 4IUPA 1C1AA 4OMLA 1ZSZA 1G3SA 5IN1A 1SHFA 2OI3A 1ARKA 3CBPA 4M4ZA 4OMNA 2LQNA 1WA7A 4XAXB 3GF5A 4RTVA 1TXQA 2XICA 2KROA 1G3WA 4E7HA 1PD0A 4C8QA 3HRTA 4D8DA 2Y4XA 4EMKC 1AWWA 2DAQA 2BE9B 4ZGDB 3CCJA 4FT4A 5LL6S 5I11A 1B34B 1G8XA 4M75B 5EG2A 1HJDA 2FZKB 4HVWA 2L8DA 3VRYA 2HNIA 3S3MA 4M75E 3OMCA 2X4YA 4HKEA 5FU6C 3I5RA 1UJYA 3QDFA 2GFAA 2KMTA 4M7AC 2DL8A 2JS0A 1QVFP 3MEAA 1ZUKA 1VQ8Q 1Y0MA 3HL8A 1SPKA 1JXOA 1P92A 2RA2A 5GAN8 1KQ1A 3H0FA 1UHFA 1LOJA 4BE1A 5IH2A 1O9SA 3TQ7P 3MEVA 3TREA 3FJ5A 5GJVB 4Y92A 1KG1A 2FEIA 2J05A 2E41A 5GMKj 1H641 2RPNA 2BE7D 3A8MB 2LT4A 7AT1B 1IREB 1JJ2A 1HXDA 2YSQA 1WHHA 5FRMA 4ORZA 2F5KA 2WSEE 3GOXA 1SRMA 3VRZA 4HCKA 3VUBA 2OTJT 2HQEA 3LGLA 1SSHA 1UB4A 1MMDA 3L2WA 2DERA 3KUFA 1I0CA 1GCQC 1NLPC 2Y4YA 4EMGA 2CSIA 4Z02A 2RHUA 4J83A 5KYYA 1ZA1B 3PT9A 3JCMb 3H6ZA 1IB8A 2LDMA 1RAGB 3P8HA 3OW2S 4A4FA 2DL7A 3DB3A 5GAMg 1YJ9Q 1V1CA 5GAMd 4EMKA 4M77D 1N8RC 1MGQA 2K6DA 3EH1A 1X27A 2NUTB 2J6KA 1KQSS 2ATCB 4ZNXA 3OYFA 3SD4A 1M5Q1 4KUDK 2ED0A 2BKDN 1WQWA 1T3LA 3VS4A 1VOMA 3PVLA 2YUNA 2HL5C 2ZAEA 1LCKA 2RH2A 4RG2A 1E7OA 2DO3A 1WPYA 2AZVA 1OX8A 2FRYA 3CCET 3M53A 1QP3A 3VJPA 2DILA 4AFUC 2EYZA 4M7DG 2CSQA 3AHUA 1NPRA 2A7YA 3KFVA 4KGVB 2QQSA 4M75A 2LP5A 5IAYA 3C95A 4P5NA 4M78F 2DL5A 2IIMA 2HMAA 3MP8A 4DQ2A 2FB7A 2RK2A 3M0QA 3RKXA 2FZGB 3CCEA 2PU9B 2EQUA 2KYMA 2EQIA 2EPDA 2XD0A 3DKMA 2DLPA 4NOYA 2CDTA 2V1QA 3QYGB 3X26B 1AOJA 1E6HA 1G3TA 1CKAA 1M3CA 3A98A 4B9WA 4M78B 1NYGA 4M77B 1AWOA 2GNCA 2CZ0B 1OU8A 2R57A 5CAIA 2LCLA 5GAOp 1S72Q 1M8MA 4M78E 3QIIA 4JJCA 3CC2T 2RI5A 1WHMA 1N9RA 1O75A 3ZEHA 4C0GA 4M77C 4F16A 4D8KA 2AHJB 4XTUA 1M3AA 1VQ4Q 3JAME 3CCRQ 1RI0A 3L42A 4M7DC 2KYBA 1GCQA 3H8ZA 3CBOA 3E2UA 2LCCA 2GQIA 4AMCA 1Z9QA 2M02A 3VYHB 4DEXA 1D1CA 1NEBA 1MMAA 2FPDA 4II1A 1KQSP 4XTXA 2L2PA 2CS7A 2YRVA 5EC7A 4J8OA 4RTUA 1VQ9T 4XTVA 2B86A 4MDXA 1MNEA 4AT1B 2VKNA 2DF6A 3SDZA 2EQJA 3OMGA 1KSWA 2V8KA 2MF2A 2QA4T 1QCOA 2M0YA 4CC3A 2H3JA 1PM3A 3JB9D 2O4XB 1ZBXA 3L1AA 3PIPA 1MNDA 5LJ3g 1VQ9A 3FRNA 4RG8A 2NUTA 3NGPA 2CGHA 5J26A 3WXMB 4BI4A 4HVUA 3VS7A 3EHRA 1M30A 3VKIA 3CCUA 2CZ1B 2HAXA 4C92F 2QA4A 3EAEA 1OZ2A 1IGUA 1W70A 3GIBA 4JUVA 4A53A 1OQKA 3CQTA 3G6ET 3CC2Q 4C0DB 3QUIA 2C0OA 2DMOA 3X28B 4LDUA 3JSCA 1Q81C 1D0ZA 4XQ3A 2JNGA 4C92B 2RQTA 1PKTA 1UGSB 4PFZA 4C0ZA 3QDRB 1HD3A 3MHXA 4GLKA 2DFUA 4C92E 1WJQA 1TTHB 5CKHA 2L89A 1KC8R 2DXBA 2RM4A 1X69A 3I55Q 2EKHA 2RN8A 2CREA 2LJ0A 2ABLA 2JTFA 3G71T 2HQHA 2WACA 1V29B 1WGSA 1RAIB 2NUZA 5GMKi 2HKNA 2JS2A 4NS5A 2FL7A 3E9GA 4LDVA 2VUBA 3VU3C 4KT0E 3OYEA 4M77A 1QWEA 2X4JA 1YIJQ 4QKUA 1AWXA 2XIDA 1M1FA 2QEXT 2B8AA 2QTXA 2ESWA 1WNLA 4FCYA 2DTIA 1VQ6A 2DE0X 5GAMj 2ZCFB 2DEUA 4BDZA 2LCSA 3RMQA 2M1HA 3EFOB 3CEYA 4JZ4A 3CD6A 5LJ5g 2SEMA 3H9NA 3CXCA 5LJ5d 1RAAB 1SF9A 2X35A 2HD0A 2PUOB 2YXYA 3JCMf 2K5FA 2XG8D 3CCLQ 2DKGA 1GL5A 4OGEA 1GBQA 2HZYA 2J06A 1YJNA 4E6RA 2XHCA 1NJIR 2JM8A 1ZUUA 4C5IA 4RCBA 1T0HA 2RQVA 2NYSA 2O9VA 4C8QF 3J81E 2MAMA 3OYCA 4A4HA 1U1TA 2ZZDA 2KI7A 2KT8A 3CXCS 2RJEA 1Y57A 1F1BB 3VYGA 4ZN3A 1NYFA 2VV5A 1QCNA 2MPXC 1M90R 1UFFA 1RABB 4KH0B 1ZQ1A 3CC4Q 1Q95G 2QG9B 4HCCA 4FYWB 3FB9A 3DB4A 1J3TA 3M0TA 4PJOC 3OYYA 4C0FA 2L0AA 2P4RA 2K3XA 1CKBA 3N5BB 1PSFA 1SSFA 4C8QE 3H0IA 5GMKh 4TVRA 3JV3A 3CCQQ 3JCMQ 2QEXQ 3OSVA 4IUUA 3ASKA 2FG0A 2L3SA 3BDUA 3JCMh 1QCFA 3I56A 4KGXB 4J9DA 1R0CB 4PJJA 3BW1A 3A8LB 1Q7YC 1VQKA 3EHQA 1M1KU 1D09B 2EWNA 1FMVA 5GANg 4BE2A 3PTAA 3FIFA 1OU9A 2FHDA 2DL4A 5GANd 2M16A 3M54A 4FYVB 1VQ5A 2LTOA 4JJDA 3L2UA 1QVFA 2F2VA 5IXBA 5GAN2 4BY6C 3JCMP 5GMKl 4JJBA 5FW9A 3CCSQ 1X6GA 3PVQA 1EZZB 4MZTA 1M1KC 1N27A 3E9FA 1YCYA 2DVEA 4BB7A 1Z9ZA 4K11A 2K2MA 1BIAA 1KC8U 1BCMA 1OPKA 3EGXB 2ED1A 1QVGA 1XTDA 1DJ7B 3ZFJA 2VYTA 4DOVA 1K73R 1VQ8T 4LN2A 2CUBA 5KYXA 1KD1U 2RB6A 2KK4A 4XK8E 4JLIA 3OYKA 2KQWA 1T0JA 4E7SA 1W2BA 2NWMA 4ME7A 2GCXA 2XK0A 2COYA 2O01E 1JB0E 5IHNA 3JRZA 4OMPA 1BI3A 4RTZA 3BDLA 4EMKB 1Q82R 1K8AR 2C06A 2LRQA 3JB9J 5KCHA 1BI0A 1WHJA 1U06A 5A2QE 4JS5A 1SRLA 2ZPGB 4M75F 2RMOA 3MCAB 1BCOA 3META 4M75G 4E2FB 2CUDA 5HK3A 2KVQG 1ABQA 5CKBA 2KSSA 1I5LA 2LVMA 1KD1C 1N5ZA 1K1ZA 4B9XA 2HDAA 1PCXA 1JEGA 5GAN4 2AKKA 3CPWA 1U1SA 1NJIU 1LNXA 1FYNA 2QDYB 4OB3B 3G4SQ 1NZ9A 5FU6B 2DX1A 3S3OA 3CC7Q 4M7AB 1LPLA 1PD1A 2XU8A 2RI2A 2I2LA 3CCVQ 4ATOA 1JQQA 2OTLQ 1Y96A 2FVUA 3URGA 4M7AE 4YTLA 3CMEQ 2P0PA 1YJ9T 2K5LA 1TSFA 1T3SA 2RHYA 3CBMA 4O5VA 2KR3A 3UPUA 3LW5E 2LMJA 2K9GA 2D9TA 2O2OA 2KBTA 4CI0C 3LH5A 4ANJA 1UJ0A 3BY7A 1VQNQ 2EYWA 1VQ7Q 1YJ9A 4CC2A 2J7IA 1TOVA 1N9SA 2R5MA 2F5TX 2LT1A 4BI3A 2K5IA 2A28A 3H0HA 3NMZC 4HT9A 2X4XA 1D0YA 4OP0A 1Q86R 2F2WA 2DA9A 3OYMA 5GAMf 4OVAA 1VQLQ 1YITQ 1TG0A 2KT1A 2F2XA 3PMIA 1QKXA 3EGXA 3QBYA 3PFSA 2FRWA 3X20B 3MO8A 3CCJQ 4FW1A 2DXUA 2QASA 1C0MA 1OYXA 3NPFA 2YRCA 2EYYA 3C94A 2YUPA 4Z88A 1K76A 1PG5B 4HCZA 1OOTA 4JDSA 1QVPA 3J80E 1JJ2S 2OTJA 1UUEA 1WXUA 1S72T 5A0GA 3VS0A 2DK3A 2P84A 6AT1B 5D6XA 1JXMA 4GY5A 2LQ8A 3WVDB 2ZPEB 4RTTA 2MMPA 3RKYA 4AG2C 3CPFA 1K4US 3M0RA 5GAOr 3S6WA 3GNFB 4D6WA 3THKA 4BI8B 1VQ4T 5KCOA 1G3YA 5AYFA 4M7DD 3CCRT 4OB1B 3M55A 3EG2A 3ZL7C 1NE8A 1UEBA 5GANj 2EQKA 3OYHA 1S72A 2I0NA 1YHQQ 2K7AA 1VQMQ 3G7ZA 2DD4A 4FW2A 1K73U 1OZ3A 5FWBA 1RAEB 3DLLA 2DD5A 4ZGEB 1VQ4A 3CCRA 5HY6A 1UTIA 1D3BB 2DXTA 4M7AA 2MWPA 1TWBA 4FL6A 4M77F 4M78G 2CKKA 3EG3A 3LYIA 4A54A 2WSCE 5KE3A 4EPCA 2DYIA 2JW4A 4BD3A 2FZCB 1WZOA 4JRKA 2FO0A 3UATA 1B3QA 4OF1A 1FWZA 3OYGA 1SHGA 2M51A 1ZBJA 5HK0A 2RHIA 2LX7A 3QYHB 4C5GA 5IHKA 2RQRA 4ZTJA 2EKOA 2OJ2A 3EGDB 3UF4A 5A0DA 3R6NA 1QQJA 1D1BA 1H92A 1NBEB 2JTMA 4A4KA 4L6V5 4M7DB 4M77E 2HEQA 3C12A 1V76A 2D8JA 4HA8A 1M27C 5C6SA 4XU2A 2P0QA 3M57A 2NUPB 1PSEA 4IIMA 1JJ2P 1S1NA 3OW2P 2H3EB 4CC7A 1IHWA 5GAOn 5A0LA 3CC2A 5LJ3f 4BUGA 4FSXA 2OAUA 4E7LA 1CSKA 4V2SA 3NTKA 3P8DA 3TU4K 3I55T 3V7RA 1SEMA 1Y71A 4A4GA 4FU6A 5I22A 4LE9A 1FXXA 1NPPA 4E7IA 2EW3A 2LZ6B 3A8OB 1WI7A 2RJCA 2QXFA 4Y91A 5CKFA 8ATCB 2E5QA 3LGFA 3G1JA 3OS5A 1YIJT 4MZMA 3I55A 2MYSA 2XMFA 4JRQA 2HL3A 1Q86U 1WJSA 4PJMA 2DVJA 5LJ3d 4VUBA 4X9CA 3OYBA 4IUTA 1AVZC 4FSSA 1W6XA 2YT6A 1JRIA 1WJRA 4C92G 1UGRB 5GAN7 3LLRA 1EFNA 1K9AA 3QXEB 2QGGA 4J7IA 1TUDA 3E1SA 1X01A 3HRUA 4LDXA 3X24B 3CCLT 4J7FA 5I21A 2KRMA 1I8FA 2D1XA 4LNPA 1M9SA 1K9MR 2KNBB 2AT1B 3LX7A 3SEMA 1D3BA 2HSEB 1OEBA 3UT1A 4E7KA 3JB9F 2LX9A 1QP2A 2QYZA 3UDCA 4MMLA 4F7UB 4PLLA 1RLQC 4ELYC 2LJ1A 3G6EA 3CCLA 2AZSA 3QZ9B 2LNVA 4N0AC 1BI2A 1X75C 3QJ6A 2L3PA 4F7UE 4EIKA 2E12A 2L3QA 3KBGA 5CIUA 2J6FA 1M3BA 4XU3A 2L3RA 5LJ5f 3CC4T 5GMKe 4PLIA 4PJOD 3EGDA 1YJWQ 2EYXA 4N4HA 1BYMA 4DBHA 5KE2A 2KEAA 3VUZA 1U5SA 5GAN3 1LVKA 2GBQA 3NTIA 2DPPB 3EFSA 3CMAQ 1YN8A 2E64A 1W4SA 5I2SA 1WXBA 3CCQT 4M7DA 5J3BA 3JCMe 2HBWA 4E47A 2E65A 4N4GA 2X9HA 4ZN1A 1WHGA 3G71A 3CC4A 3HFOA 4BACA 3CCUQ 1VUBA 2CP6A 1JO8A 2NUPA 2GTJA 5CKDA 3NFCA 2QGFB 2QEXA 4R55A 1WYXA 1SKUB 3ZBDA 2BTTA 3PMTA 1RUWA 5GAN6 5AT1B 3A1PA 3JB9I 2VASA 3GLXA 3OY9A 4JS4A 1GFCA 9ATCB 2QK0A 4J9BA 2E6NA 5KYXB 2D8HA 1B7TA 1UGPB 2VXFA 4C8QG 1AZEA 3TSZA 4LD6A 4OB2B 1MHNA 2E1HA 2JMCA 5GAOl 4PJOB 1EIFA 1HYOA 3CCST 4RUGA 2MIOA 2SRCA 2XDPA 3QWXX 2YUOA 3EH2A 4PJOE 2E70A 5L23A 1PRLC 1IZ6A 2BZYA 2AIRB 3OBWA 1G5VA 4GLMA 2GQVA 4J5YA 4X1VA 4OMMA 1YI2Q 1TUCA 2XI9A 2DJQA 1M1GA 5GANf 5IT9E 1YWPA 3O5ZA 3CCSA 4PFPA 2H8HA 3PNWC 1VQ6Q 4HVVA 4QVZA 3QWYA 3OYJA 2A36A 1ZSZC 2EGEA 4R56A 3HKSA 4LDYA 2DIGA 1YBYA 3CD6Q 4OMQA 3JCMJ 2K3YA 2XDBA 2IG0A 5GAOm 4GBQA 1Y96B 1LJOA 4F7UA 2ZPIB 4RMOA 2VGMA 1X6OA 4FM4B 2KGTA 1GBRA 3VS1A 2RJFA 4C8QC 1TH7A 3KXTA 3QG1A 1D0XA 4C5EA 4Z89A 5IHIA 3EG0A 4IUVA 2M0OA 1YJNQ 2QAZA 2YDLA 3CCMQ 4NL3A 4BY6B 4QQ6A 1VYVA 4OB0B 3JB9H 3M0UA 1N8RR 3EG9B 3QPHA 2NLUA 2PNIA 1MMNA 2YHTA 3M4YA 1K9MU 3OS1A 1R0BG 3FC3A 2RHZA 3HP9A 4CC4B 3G4ST 4BE0A 3FEOA 4J9EA 2BIVA 3CC7T 5FROA 1YWOA 1VQPT 5LJ3j 4XTZA 3CCVT 2DL3A 2OTLT 1H3ZA 2LQWA 3M5AA 5L8RE 5CO7A 2A3LA 4JZ3A 3CXCP 3CMET 2V1RA 2OAWA 2A37A 2ECZA 4EDUA 4ZTFA 5KH6A 2LC4A 3G4SA 1ZUYA 1QVFS 3CC7A 2EAYA 2JM9A 3L2RA 2BZ8A 1PC0A 2ZGWA 3JCMV 4C5HA 4HCBA 4RTYA 2OTLA 2X4WA 1VQNT 3I56Q 2J6OA 4JRPA 4PL6A 1VQ7T 4IUQA 4M75D 2CH4A 1OI1A 3OA6A 5KYNA 1M4ZA 5FLXE 2ZPFB 5GMKm 2CT3A 2DNUA 1VQKQ 3EGUA 3GPLA 4PJOA 2MCNA 1VQ8A 3JCMc 1KC8C 1QVGS 4NL2A 4J6YA 2RNAA 4DOWA 3I5SA 3S3NA 3V8LA 1VQNA 4M7AF 5FU7C 4A4EA 4F14A 1MUZA 4M7AG 1VQLT 2Z0WA 3SFMA 2R5AA 1YITT 1FMWA 3X25B 2RO0A 3FLGA 1OV3A 3QHSA 1W2BS 1VQ5Q 1NLOC 3OYIA 2C0TA 3BE3A 3TSWA 3L2QA 3REBB 3CCJT 2E4HA 3GBQA 2XDDA 4J6XA 5GJWB 1RL2A 4J6WA 1VQLA 4J9GA 1UDLA 1YITA 1PWTA 4PNOA 1VQPQ 1VQOQ 5FWCA 1KHCA 2F69A 3M56A 4JJNK 4X9DA 5DM7R 3PIOA 4AFZC 2JT4A 5LJ5j 3TCJA 1RLPC 2X3XD 1M90U 1PNJA 1UE9A 3RMSA 2C0IA 5ECAA 3JCMX 2JXBA 1AT1B 3CPWS 4IIOA 2PQWA 1G83A 2KAFA 2ROTA 2CH4W 3A8HB 3HFNA 5GAMe 1NJIC 1YHQT 2L5QA 3EG9A 4KH1B 1YP5A 4L5GA 2HQXA 5I2MA 1PHTA 4DEYA 4M75C 1VQMT 3O8VA 4DBQA 3REAB 1YFNA 2FPEA 1AHJB 3U23A 1VYUA 2PVGB 1IGQA 1TUGB 4OMFB 4F17A 3GNGA 2K4YA 2JVVA 3LWIA 1I81A 1M90C 1YHQA 3HHTB 4AFSC 5D7UA 1X6BA 2MWOA 3RDVA 1B07A 1VQMA 1I5OB 5GAN5 1UGQB 3P8BB 4JRIA 5HCKA 2QI2A 2CP5A 1QVGP 1Q81R 5J39A 2JZ2A 1X2QA 5CQXA 1I1JA 4KGZB 1GFDA 3M0PA 1BB9A 3OW2A 1UECA 1NM7A 3H41A 3MEWA 4N4IA 1TU0B 1N8RU 2QQBA 1NEGA 1QKWA 4BDYA 2JJ9A 2HSPA 1W2BP 4OMOA 4B6MA 2VGNA 1KQSA 4Q5WA 3RBBB 4RTWA 4ELZC 4Y28E 2AKLA 4MZPA 4LUEA 3SHWA 3HPWA 3J7AF 1WHKA 1HK9A 1G2BA 3F70A 4L59A 3FDRA 4PJLA 1KFZA 2D6FA 2DTOA 1M2OA 1ZSGA 4WF2A 4LDWA 1YCSB 1ZX6A 4LUDA 4M78D 3SB2A 4E7JA 3MPUB 5GAMh 1WHLA 3CPWP 4J9IA 2HCKA 2QQ9A 1X43A 2VXEA 2ENMA 1AEYA 2DJZA 3VS6A 3NHNA 1SG5A 4KULA 2LQKA 4DA4A 2KE9A 3QO3A 2CZ6B 1KIKA 1Y07A 4MDWA 1BU1A 2JN0A 2PZ1A 4M77G 5CCAA 1PRMC 1Q82U 1K8AU 3C4SA 3QSUA 3RNJA 4M7DF 1RACB 1FX7A 4CRIA 5GAOq 4XTWA 2QTVA 4KBMB 2JUFA 3L2VA 5M9OA 1B34A 1GRIA 4IURA 1VYTA 4JLGA 5DLOA 1WQ7A 3RKWA 2KRSA 2RHXA 1K73C 2RF0A 2RQWA 4PKCC 1VIFA 3QKJA 5KYWB 3OBYA 2DRMA 2DEQA 2OTJQ 2DIQA 2EFIA 5LJ3e 2GFUA 1MV0B 1TS9A 3NTHA 4MMKA 2G3RA 4HT8A 4ESRA 3V8KA 4J9FA 4ZGJB 3MP6A 5C0MA 4M7DE 1Q82C 1K8AC 2V8JA 3MEUA 3V8JA 3OS2A 3VV0A 4XU1A 4J9HA 4WCIA 4QT7A 2BZXA 2A0FB 3A5ZB 1IRXA 4IKFA 3C0CA 2KXCA 4R0KA 2X3WD 4M78C 4A63B 2GGRA 2EVRA 4HXJA 3RESA 1QWFA 1Y7XA 2E3IA 2KRNA 3OYAA 1Q7YR 1YNZA 1YJWT 4XU0A 1AZGB 2YLCA 3IQLA 3V7CA 2CP2A 3CMAT 2E10A 4C92D 1AWJA 4OGCA 3CCEQ 3M9QA 2GF7A 4QVDA 1XNIA 2GTOA 3QJYA 1GCPA 1K0XA 1K0SA 2D0NA 1KK7A 3LH0A 5HKCA 1YJWA 3CCUT 2Y90A 2CYZB 3OS0A 2WSFE 2R58A 3CMAA 1YIJA 1BIBA 4J9CA 1X2KA 5KYUB 4F7UF 2RQUA 1Q81U 4F7UG 3SWNB 1C6VX 2RJDA 3VS2A 1M1KR 1E6GA 4QVCA 1OULA 2HBPA 2VC8A 2V26A 3PGGA 3TVTA 8AT1B 5LJ3h 5LJ5e 2CP7A 1H8KA 4JPBW 2E3HA 1VA7A 1FMKA 2EJ9A 2W0ZA 2CT4A 3FJPA 2DTHA 1WFWA 3SWNC 2LJ3A 1Q86C 3JB9G 2COWA 1M2VB 3OYNA 2KXDA 2M9UA 2DYBA 3UWNA 3R6OA 2PVOB 3QZ5B 4FT2A 4UC4A 3BFMA 1XOVA 1JU5C 1W1FA 4AG1C 2HKQB 5D6WA 2OX7A 2P0KA 1AD5A 2DRKA 1RI9A 4C0DC 4PFOA 2EBPA 3I9QA 5KYWA 4DBRA 4QQGA 2KDSA 4KUIA 2K2VA 1YI2T 3INZA 3OQ5A 2RI3A 3OYLA 1A0NB 1VIEA 4C92C 2EYQA 2XKOC 5D6YA 1VQ9Q 1XJWB 1ZLMA 2O31A 1VQ6T 1JBMA 2E6ZA 2MI6A 2A08A 5DY9A 2MK5A 3ME9A 2CP0A 1WXTA 4M78A 1KD1R 3CD6T 4DBFA 4PJNA 1ACMB 2QA4Q 1BI1A 3Q1JA 1YI2A 1WLPB 1QMCA 3LWHA 2DETA 4AFQC 4C8QD 3M0SA 3CCQA 4X34A 2K3BA 5FRNA 2FYKA 3M59A 2VB6A 4Z8AA 1NG2A 2DZ9A 3EG1A 4LXCA 4PJOF 1BBZA 2KY9A 1M8VA 4QQDA 4FYXB 4PJOG 4RTXA 2EQMA 1YJNT 2VWFA 1QLYA 3CCMT 1HSQA 3HSBA 2P4TA 4WTOB 5CVIA 3I35A 2QDLA 3MJXA 5LJ5h 3G6EQ 5GANe 1N6AA 2IVWA 2VVKA 2YRDA 2YUQA 1OX9A 2LNHB 1I07A 1I4K1 3MKDA 3CCMA 2PUKB 3L2ZA 4O6JA 1RAHB 2O88A 3E19A 2COZA 4RKUE 2JMAA 3OSSC 3M58A 1BKBA 2G6FX 3OYDA 1ZSZB 2O4XA 5KYUA 4RCCA 1KJWA 2PVDB 3SWNA 1UHCA 2QQAA 1H3HA 3OB9A 2BUDA 3JCMg 3G71Q 4EMHA 2F1LA 3UA7A 3JCMd 1Q7YU 5IXFA 4C8QB 4N0AA 2ZPBB 1WX6A 2ZPHB 4PK4A 3I56T 2JTEA 3JCMW 2EGCA 2FPFA 2V8IA 2W10A 3GP8A 1M2VA 2X51A 2RK1A 3RUXA 1PKSA 4F04B 4KRTA 1VQKT 1EX4A 2D0QB 3VS5A 2AK5A 1ZHIA 3TEEA 2EIFA 3RERA 3HRSA 2DXCA 1U3OA 2O9SA 1WDXA 4C92A 2CZ7B 1BK2A 4E7ZA 2JOYA 3WVEB 3V7SA 3D7SB 5CKEA 5DLQE 1RADB 2EGAA 1U8RA 1VQ5T 1QW1A 1OPLA 5CK9A 2EJFA 2YWWA 1GXIE 2DM1A 4FIBA 2DZCA 1ZA2B 5GANh 4FYYB 3VS3A 2PTKA 3RIRA 5CR2A 3AT1B 1VQOT 2QQRA 1MV3A 2DBMA 4XTYA 1R8OB 2DBKA 1UGVA 2RD1A 1IO6A 4LD9K 1RAFB 3EFOA 5CQYA 1IHVA 3M4GA 1VQPA 1VQOA 3CCVA 3EFRA 1K9MC 4QW2A 1UG1A 1KHIA 2E5KA 3RR6A 3T9NA 3ULRB 3CMEA 4M7AD 3A8GB 1WIEA 1IXDA 2K79A 1KQ2A 2IPOB 5FU7B 2K57A
chains in the Genus database with same CATH topology
2VGNA 4Y91A 5CKFA 1XQHA 4C5IA 1KQSA 2E5QA 4Q5WA 3LGFA 4RCBA 4ELZC 3MP1A 4Y28E 4C8QF 3J81E 3OS5A 1YIJT 2MAMA 4MZPA 4MZMA 3OYCA 4A4HA 3HPWA 3I55A 3J7AF 3DLMA 1HK9A 1U1TA 2ZZDA 3F70A 4JRQA 4L59A 3ER0A 2EJGA 1VQ7A 3FDRA 3CXCS 1Q86U 2RJEA 1WJSA 2D6FA 2YLBA 2DTOA 4ZN3A 3VYGA 5LJ3d 4IUPA 4VUBA 4X9CA 3OYBA 4IUTA 4WF2A 1G3SA 2VV5A 5IN1A 4LDWA 3CBPA 1ZQ1A 1JRIA 4XAXB 4M78D 4HCCA 3GF5A 1WJRA 4C92G 1UGRB 5GAN7 2XICA 3FB9A 3DB4A 3LLRA 3SB2A 4E7JA 1G3WA 4E7HA 4PJOC 3QXEB 3OYYA 5GAMh 4J7IA 4C0FA 4C8QA 3HRTA 3E1SA 1X01A 2K3XA 3HRUA 4LDXA 3X24B 3N5BB 2Y4XA 1PSFA 1SSFA 3CCLT 4J7FA 4C8QE 5I21A 1I8FA 2QQ9A 5GMKh 4TVRA 4EMKC 2VXEA 3JCMQ 1M9SA 2DJZA 2DAQA 3OSVA 4IUUA 4KULA 2LQKA 4DA4A 3ASKA 3LX7A 3QO3A 1D3BA 2CZ6B 1Y07A 4MDWA 3UT1A 4ZGDB 3CCJA 4E7KA 2JN0A 4FT4A 3BDUA 4M77G 3JB9F 2LX9A 1QP2A 5LL6S 5CCAA 3UDCA 4MMLA 1Q82U 3JCMh 1K8AU 3C4SA 3QSUA 1B34B 4F7UB 4M7DF 4PLLA 3I56A 4ELYC 4CRIA 1FX7A 4M75B 5GAOq 5EG2A 4XTWA 3G6EA 3CCLA 4KBMB 2JUFA 3QZ9B 2LNVA 5M9OA 1B34A 3L2VA 4N0AC 1BI2A 1X75C 3QJ6A 3BW1A 3A8LB 4IURA 4JLGA 2L8DA 4F7UE 1Q7YC 5DLOA 1WQ7A 3RKWA 2HNIA 2RHXA 3S3MA 4M75E 1VQKA 2E12A 1K73C 3KBGA 5CIUA 1M1KU 3OMCA 2X4YA 5LJ5f 4HKEA 2L3RA 1VIFA 4PKCC 4XU3A 2EWNA 5FU6C 3CC4T 3QKJA 5GMKe 5GANg 3OBYA 4BE2A 3PTAA 2GFAA 4PLIA 2KMTA 2DEQA 4M7AC 3FIFA 4PJOD 2FHDA 2DIQA 2EFIA 2M16A 5GANd 3M54A 5LJ3e 2GFUA 3MEAA 3NTHA 4N4HA 1BYMA 5KE2A 5GAN3 3VUZA 4MMKA 2G3RA 3HL8A 4HT8A 3NTIA 1P92A 2RA2A 2DPPB 3EFSA 3V8KA 5GAN8 1KQ1A 4ZGJB 2E64A 1W4SA 5I2SA 3MP6A 3CCQT 4M7DA 5J3BA 1LOJA 3JCMe 4E47A 5C0MA 1VQ5A 2E65A 2LTOA 4N4GA 1Q82C 4BE1A 2V8JA 3L2UA 1K8AC 1QVFA 4ZN1A 3G71A 3CC4A 3MEUA 5GAN2 1O9SA 4BY6C 3HFOA 3MEVA 3JCMP 5GMKl 3TREA 4BACA 3V8JA 3OS2A 3VV0A 4XU1A 1KG1A 2E41A 5GMKj 1VUBA 1H641 4MZTA 3A5ZB 5CKDA 3A8MB 4IKFA 1M1KC 2LT4A 1N27A 3NFCA 3E9FA 1YCYA 4M78C 2DVEA 1IREB 2QEXA 4BB7A 4R55A 3RESA 1BIAA 3ZBDA 1KC8U 1HXDA 1Y7XA 3PMTA 1JJ2A 5GAN6 5FRMA 3JB9I 2F5KA 2WSEE 3GLXA 3OY9A 4JS4A 1QVGA 3GOXA 1XTDA 1DJ7B 3OYAA 3VUBA 3ZFJA 2OTJT 2HQEA 3LGLA 1YJWT 1UB4A 2VYTA 4XU0A 4DOVA 2E6NA 1VQ8T 2YLCA 3V7CA 3L2WA 3KUFA 1UGPB 2VXFA 1KD1U 2E10A 3CMAT 2RB6A 2KK4A 4XK8E 4C8QG 4C92D 4JLIA 3OYKA 4OGCA 2Y4YA 4EMGA 3M9QA 2GF7A 4QVDA 4Z02A 2RHUA 1XNIA 4J83A 3QJYA 2KQWA 1W2BA 4LD6A 4OB2B 1MHNA 2E1HA 3H6ZA 3PT9A 4ME7A 3JCMb 5GAOl 2GCXA 2XK0A 4PJOB 1EIFA 2LDMA 3LH0A 2O01E 3CCST 3P8HA 1JB0E 4A4FA 3DB3A 5HKCA 3CCUT 3OW2S 2Y90A 1YJWA 3JRZA 2CYZB 1BI3A 3OS0A 3BDLA 2XDPA 5GAMg 4EMKB 2WSFE 2C06A 4PJOE 2E70A 2LRQA 2R58A 4M7DE 3JB9J 1IZ6A 5KCHA 5GAMd 3CMAA 1YIJA 1BI0A 1BIBA 4EMKA 4M77D 1N8RC 1MGQA 5A2QE 4JS5A 3OBWA 4F7UF 1G5VA 2ZPGB 1KQSS 4M75F 1Q81U 3MCAB 4F7UG 3META 3OYFA 3SWNB 4M75G 2GQVA 4J5YA 3SD4A 1M5Q1 5HK3A 2KVQG 4KUDK 2RJDA 5CKBA 2KSSA 2BKDN 2XI9A 1M1GA 5GANf 1WQWA 5IT9E 1I5LA 2LVMA 4QVCA 3CCSA 1KD1C 2HBPA 4B9XA 2VC8A 3PGGA 5LJ5e 5LJ3h 3PNWC 2RH2A 4RG2A 2EJ9A 4QVZA 3FJPA 5GAN4 2DTHA 2DO3A 3SWNC 3OYJA 3CPWA 1WPYA 1U1SA 1Q86C 1NJIU 4R56A 3JB9G 1LNXA 2QDYB 4OB3B 3HKSA 4LDYA 1NZ9A 2DIGA 3CCET 1YBYA 3M53A 1QP3A 3VJPA 3JCMJ 5FU6B 2K3YA 3S3OA 2XDBA 3OYNA 2M9UA 4M7AB 4M7DG 3UWNA 2XU8A 2IG0A 2RI2A 3AHUA 1NPRA 2A7YA 2I2LA 5GAOm 1Y96B 1LJOA 4F7UA 2QQSA 4ATOA 2ZPIB 3R6OA 4M75A 2VGMA 1X6OA 2PVOB 3C95A 3QZ5B 4FM4B 4FT2A 4P5NA 4UC4A 3BFMA 5IAYA 2RJFA 1XOVA 4C8QC 1Y96A 2FVUA 3URGA 1TH7A 4M78F 4M7AE 3KXTA 3QG1A 4YTLA 4C5EA 2P0PA 5D6WA 1YJ9T 3MP8A 4DQ2A 2K5LA 2FB7A 2P0KA 2RK2A 4IUVA 2M0OA 4C0DC 3RKXA 2RHYA 3CCEA 3CBMA 4O5VA 4NL3A 2PU9B 2EQUA 4QQGA 4QQ6A 4BY6B 3UPUA 2KDSA 3LW5E 4KUIA 2XD0A 2K2VA 3DKMA 2D9TA 4NOYA 1YI2T 4OB0B 3INZA 3JB9H 3OQ5A 2RI3A 3OYLA 3QPHA 4CI0C 3QYGB 3X26B 2NLUA 1VIEA 3BY7A 2EYQA 4C92C 2XKOC 1G3TA 5D6YA 2YHTA 4B9WA 3M4YA 1VQ6T 1JBMA 4M78B 1YJ9A 1K9MU 2E6ZA 2MI6A 3OS1A 4M77B 1N9SA 5DY9A 3ME9A 2R5MA 3FC3A 2F5TX 2RHZA 2LT1A 2CZ0B 4BI3A 2K5IA 3HP9A 4M78A 3G4ST 4BE0A 2R57A 5CAIA 2LCLA 3FEOA 5GAOp 3CD6T 2BIVA 3QIIA 4M78E 3CC7T 4HT9A 3CC2T 2RI5A 1BI1A 2X4XA 3Q1JA 1YI2A 5FROA 1VQPT 1N9RA 5LJ3j 3LWHA 4XTZA 3CCVT 4OP0A 4C8QD 1O75A 3ZEHA 3CCQA 2OTLT 3M5AA 4X34A 4C0GA 1H3ZA 5L8RE 4M77C 5FRNA 5CO7A 2FYKA 2AHJB 3M59A 2A3LA 4XTUA 2DZ9A 3OYMA 5GAMf 3CMET 4OVAA 2KY9A 4PJOF 1M8VA 3JAME 4QQDA 4PJOG 1RI0A 4EDUA 4ZTFA 3L42A 2EQMA 5KH6A 1YJNT 2LC4A 3PMIA 3G4SA 4M7DC 3CCMT 3H8ZA 3CBOA 2LCCA 1QVFS 3HSBA 3QBYA 3PFSA 2P4TA 3CC7A 3X20B 2EAYA 3MO8A 3VYHB 3L2RA 5CVIA 2DXUA 2ZGWA 3JCMV 4C5HA 1OYXA 4HCBA 4II1A 2OTLA 4XTXA 3C94A 2X4WA 2CS7A 1VQNT 2YRVA 4JRPA 4J8OA 4PL6A 5LJ5h 4HCZA 1VQ7T 4IUQA 1VQ9T 4M75D 4XTVA 5GANe 1OI1A 3OA6A 1N6AA 4JDSA 1M4ZA 2IVWA 4MDXA 1QVPA 5FLXE 2ZPFB 5GMKm 3J80E 3SDZA 3CCMA 1JJ2S 2OTJA 1I4K1 2PUKB 3GPLA 1S72T 3L2ZA 5A0GA 4O6JA 4PJOA 2DK3A 1VQ8A 2EQJA 3OMGA 2V8KA 5D6XA 3JCMc 2MF2A 4GY5A 2QA4T 2LQ8A 1KC8C 3WVDB 1QVGS 4NL2A 3E19A 2ZPEB 4J6YA 4RKUE 2MMPA 3RKYA 3OSSC 3CPFA 2H3JA 3M58A 5GAOr 3JB9D 1BKBA 3S6WA 2O4XB 4DOWA 1ZBXA 3GNFB 3S3NA 3V8LA 3L1AA 1VQNA 3OYDA 4D6WA 3PIPA 4M7AF 5FU7C 4A4EA 5LJ3g 1VQ9A 4M7AG 2O4XA 4BI8B 1VQ4T 3FRNA 1G3YA 4RG8A 5AYFA 3SFMA 2R5AA 5KCOA 1YITT 1VQLT 4RCCA 2CGHA 3CCRT 4M7DD 4OB1B 2PVDB 3M55A 3SWNA 3X25B 2RO0A 2QQAA 1NE8A 1UEBA 3FLGA 5J26A 3WXMB 5GANj 3OB9A 4BI4A 2EQKA 3QHSA 2BUDA 3VKIA 2CZ1B 3OYHA 3CCUA 1S72A 1W2BS 2HAXA 3JCMg 3OYIA 3L2QA 4C92F 2QA4A 4EMHA 3CCJT 3EAEA 1OZ2A 3JCMd 1Q7YU 4C8QB 4N0AA 3G7ZA 2DD4A 2ZPBB 1K73U 3GIBA 4JUVA 1OZ3A 4A53A 2XDDA 2ZPHB 4J6XA 3I56T 1RL2A 3JCMW 3DLLA 3G6ET 4J6WA 2DD5A 4ZGEB 4C0DB 1VQ4A 1VQLA 1YITA 3QUIA 3CCRA 4PNOA 2V8IA 3GP8A 5HY6A 1D3BB 2DXTA 2RK1A 3RUXA 3X28B 4M7AA 2MWPA 1KHCA 1VQKT 4LDUA 4FL6A 2D0QB 2F69A 3JSCA 3M56A 4JJNK 4M77F 4M78G 4X9DA 2CKKA 5DM7R 1ZHIA 3PIOA 4XQ3A 1Q81C 2JNGA 3TEEA 3LYIA 4A54A 4C92B 5LJ5j 2EIFA 2WSCE 3TCJA 1UGSB 4EPCA 3HRSA 5KE3A 1M90U 3RERA 2DXCA 4BD3A 4C0ZA 4JRKA 4C92A 3QDRB 3RMSA 2CZ7B 3MHXA 3JCMX 4GLKA 4C92E 1WJQA 2JOYA 4OF1A 2L89A 2PQWA 5CKHA 1FWZA 3V7SA 3WVEB 3OYGA 2KAFA 2DXBA 2RM4A 5CKEA 5DLQE 3A8HB 5HK0A 3HFNA 2RHIA 5GAMe 3QYHB 1NJIC 1U8RA 1VQ5T 4C5GA 1YHQT 2L5QA 2JTFA 1QW1A 4L5GA 3G71T 2WACA 1V29B 1WGSA 4ZTJA 2HQXA 2EKOA 2EJFA 5I2MA 5CK9A 5GMKi 5A0DA 1GXIE 4M75C 4NS5A 1VQMT 2FL7A 3E9GA 4LDVA 3O8VA 2JTMA 2VUBA 4FIBA 4KT0E 3VU3C 4A4KA 3OYEA 4M77A 4L6V5 2DZCA 1AHJB 2X4JA 4M7DB 4M77E 5GANh 2PVGB 4OMFB 3C12A 2XIDA 5CR2A 3RIRA 1VQOT 1M1FA 2QEXT 2B8AA 3GNGA 2K4YA 3CPWS 2JVVA 2QTXA 1WNLA 3LWIA 2QQRA 1I81A 1M90C 1YHQA 4HA8A 3HHTB 4XTYA 5C6SA 4XU2A 2P0QA 2DTIA 3M57A 1VQ6A 2MWOA 1R8OB 5GAMj 2ZCFB 4BDZA 1PSEA 3RMQA 5GAN5 1VQMA 2RD1A 2M1HA 1UGQB 3CEYA 3P8BB 3CD6A 4LD9K 4JRIA 5GAOn 2QI2A 5A0LA 5LJ5g 3CC2A 5CQYA 5LJ3f 4BUGA 4FSXA 2OAUA 3M4GA 5J39A 4E7LA 4RMOA 3CXCA 3NTKA 3P8DA 5LJ5d 1VQPA 3TU4K 4V2SA 3I55T 3V7RA 3CCVA 3EFRA 2JZ2A 1VQOA 1K9MC 1Y71A 5CQXA 4QW2A 2X35A 2HD0A 1KHIA 2PUOB 4FU6A 4A4GA 3OW2A 3T9NA 3JCMf 3MEWA 2K5FA 4N4IA 2XG8D 3CMEA 1N8RU 4M7AD 2QQBA 1FXXA 1NPPA 2DKGA 4BDYA 3A8GB 4E7IA 4OGEA 1KQ2A 1YJNA 3A8OB 5FU7B 2K57A 2RJCA 2QXFA 2XHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB7 A;  4C92 F;  4XU1 A;  4Y91 A;  4EMH A;  4RCB A;  2E41 A;  5GMK j;  3JCM d;  1H64 1;  3RKX A;  4C8Q B;  4C8Q F;  4N0A A;  4NL3 A;  3GIB A;  4JUV A;  4A53 A;  1HK9 A;  4J6X A;  1U1T A;  1YCY A;  4NOY A;  3JCM W;  4M78 C;  2DVE A;  4J6W A;  3INZ A;  3JB9 H;  2EJG A;  3RES A;  3QUI A;  4PNO A;  1BIA A;  1HXD A;  1D3B B;  2DTO A;  2DXT A;  2YLB A;  3BY7 A;  3RUX A;  4C92 C;  5GAN 6;  4M7A A;  5LJ3 d;  4X9C A;  3JB9 I;  2YHT A;  4WF2 A;  1JBM A;  4M78 B;  4M77 B;  1N9S A;  4M77 F;  4M78 G;  4X9D A;  5DY9 A;  4XQ3 A;  4XU0 A;  4M78 A;  4A54 A;  4C92 B;  5LJ5 j;  1JRI A;  4M78 D;  5CAI A;  5GAO p;  3RER A;  2YLC A;  3V7C A;  4C92 G;  5GAN 7;  4M78 E;  4HT9 A;  3FB9 A;  3SB2 A;  4JRK A;  2VXF A;  4C92 A;  2E10 A;  2RB6 A;  4C8Q G;  4C92 D;  4PJO C;  4JLI A;  3JCM X;  5GAM h;  1N9R A;  5LJ3 j;  4C8Q A;  4C92 E;  4EMG A;  4XTZ A;  4QVD A;  4OP0 A;  1X01 A;  3V7S A;  4C8Q D;  2RM4 A;  5I21 A;  4C8Q E;  4M77 C;  1I8F A;  5GMK h;  2FYK A;  3JCM b;  2E1H A;  2VXE A;  3HFN A;  4EMK C;  5GAO l;  4XTU A;  2DZ9 A;  5GAM e;  5GAM f;  3JCM Q;  4PJO B;  4PJO F;  2DJZ A;  1M8V A;  4PJO G;  4M7D C;  5GMK i;  2EJF A;  3QO3 A;  1D3B A;  2Y90 A;  4M75 C;  5GAM g;  4EMK B;  3JB9 F;  2JN0 A;  3HSB A;  3BDU A;  4M77 G;  4PJO E;  3VU3 C;  3JB9 J;  2EAY A;  4M77 A;  5GAM d;  2DZC A;  1BIB A;  4MML A;  4M77 D;  3JCM h;  1MGQ A;  4EMK A;  3QSU A;  2DXU A;  2ZGW A;  1B34 B;  4F7U B;  4M7D F;  4F7U F;  4M7D B;  4M77 E;  5GAN h;  5GAO q;  4M75 B;  3JCM V;  4M75 F;  4XTW A;  4F7U G;  4XTX A;  4M75 G;  3RIR A;  4J5Y A;  3SWN B;  1B34 A;  1M5Q 1;  4N0A C;  5LJ5 h;  2QTX A;  3BW1 A;  1WNL A;  4M75 D;  4XTV A;  1I81 A;  5GAN e;  4F7U E;  4HA8 A;  5GAN f;  1WQW A;  1WQ7 A;  2HNI A;  4XTY A;  3RKW A;  4M75 E;  4QVC A;  4XU2 A;  1I5L A;  2DTI A;  5GMK m;  2VC8 A;  3PGG A;  5GAM j;  5LJ5 e;  5LJ3 h;  5LJ5 f;  4XU3 A;  1I4K 1;  2EWN A;  5GAN 5;  5GMK e;  3L2Z A;  5GAN g;  2RD1 A;  2EJ9 A;  4PJO A;  4M7A C;  2DEQ A;  3FJP A;  3FIF A;  5GAN 4;  2DTH A;  4PJO D;  3JCM c;  3SWN C;  1WPY A;  1U1S A;  4JRI A;  5GAN d;  5GAO n;  3JB9 G;  1LNX A;  4NL2 A;  5LJ3 e;  5LJ5 g;  4J6Y A;  5LJ3 f;  3RKY A;  5GAN 3;  3M4G A;  4MMK A;  5GAO r;  4HT8 A;  3JCM J;  3JB9 D;  4V2S A;  5LJ5 d;  2RA2 A;  3V7R A;  3EFS A;  3EFR A;  3L1A A;  3V8K A;  4M7A B;  1KQ1 A;  3V8L A;  2E64 A;  5GAN 8;  4M7A F;  4M7D G;  3AHU A;  2I2L A;  5LJ3 g;  5GAO m;  4M7A G;  1Y96 B;  1LJO A;  4F7U A;  4M7D A;  4M7D D;  1LOJ A;  4M75 A;  3JCM e;  3JCM f;  4RCC A;  2CGH A;  4M7D E;  2E65 A;  3BFM A;  3SWN A;  4M7A D;  2DKG A;  4C8Q C;  1Y96 A;  1TH7 A;  4M78 F;  5GAN j;  4M7A E;  5GAN 2;  1KQ2 A;  3HFO A;  3QHS A;  5GMK l;  3JCM P;  2K57 A;  3JCM g;  3V8J A;  4DQ2 A; 
#chains in the Genus database with same CATH topology
 1XQH A;  3HTR A;  3MP1 A;  5KYY B;  1MMG A;  3DLM A;  2ROL A;  1ABO A;  2CP3 A;  1R77 A;  3ER0 A;  2EJG A;  1VQ7 A;  2MOX A;  1D1A A;  2YLB A;  3UA6 A;  3PE0 A;  4IUP A;  1C1A A;  4OML A;  1ZSZ A;  1G3S A;  5IN1 A;  1SHF A;  2OI3 A;  1ARK A;  3CBP A;  4M4Z A;  4OMN A;  2LQN A;  1WA7 A;  4XAX B;  3GF5 A;  4RTV A;  1TXQ A;  2XIC A;  2KRO A;  1G3W A;  4E7H A;  1PD0 A;  4C8Q A;  3HRT A;  4D8D A;  2Y4X A;  4EMK C;  1AWW A;  2DAQ A;  2BE9 B;  4ZGD B;  3CCJ A;  4FT4 A;  5LL6 S;  5I11 A;  1B34 B;  1G8X A;  4M75 B;  5EG2 A;  1HJD A;  2FZK B;  4HVW A;  2L8D A;  3VRY A;  2HNI A;  3S3M A;  4M75 E;  3OMC A;  2X4Y A;  4HKE A;  5FU6 C;  3I5R A;  1UJY A;  3QDF A;  2GFA A;  2KMT A;  4M7A C;  2DL8 A;  2JS0 A;  1QVF P;  3MEA A;  1ZUK A;  1VQ8 Q;  1Y0M A;  3HL8 A;  1SPK A;  1JXO A;  1P92 A;  2RA2 A;  5GAN 8;  1KQ1 A;  3H0F A;  1UHF A;  1LOJ A;  4BE1 A;  5IH2 A;  1O9S A;  3TQ7 P;  3MEV A;  3TRE A;  3FJ5 A;  5GJV B;  4Y92 A;  1KG1 A;  2FEI A;  2J05 A;  2E41 A;  5GMK j;  1H64 1;  2RPN A;  2BE7 D;  3A8M B;  2LT4 A;  7AT1 B;  1IRE B;  1JJ2 A;  1HXD A;  2YSQ A;  1WHH A;  5FRM A;  4ORZ A;  2F5K A;  2WSE E;  3GOX A;  1SRM A;  3VRZ A;  4HCK A;  3VUB A;  2OTJ T;  2HQE A;  3LGL A;  1SSH A;  1UB4 A;  1MMD A;  3L2W A;  2DER A;  3KUF A;  1I0C A;  1GCQ C;  1NLP C;  2Y4Y A;  4EMG A;  2CSI A;  4Z02 A;  2RHU A;  4J83 A;  5KYY A;  1ZA1 B;  3PT9 A;  3JCM b;  3H6Z A;  1IB8 A;  2LDM A;  1RAG B;  3P8H A;  3OW2 S;  4A4F A;  2DL7 A;  3DB3 A;  5GAM g;  1YJ9 Q;  1V1C A;  5GAM d;  4EMK A;  4M77 D;  1N8R C;  1MGQ A;  2K6D A;  3EH1 A;  1X27 A;  2NUT B;  2J6K A;  1KQS S;  2ATC B;  4ZNX A;  3OYF A;  3SD4 A;  1M5Q 1;  4KUD K;  2ED0 A;  2BKD N;  1WQW A;  1T3L A;  3VS4 A;  1VOM A;  3PVL A;  2YUN A;  2HL5 C;  2ZAE A;  1LCK A;  2RH2 A;  4RG2 A;  1E7O A;  2DO3 A;  1WPY A;  2AZV A;  1OX8 A;  2FRY A;  3CCE T;  3M53 A;  1QP3 A;  3VJP A;  2DIL A;  4AFU C;  2EYZ A;  4M7D G;  2CSQ A;  3AHU A;  1NPR A;  2A7Y A;  3KFV A;  4KGV B;  2QQS A;  4M75 A;  2LP5 A;  5IAY A;  3C95 A;  4P5N A;  4M78 F;  2DL5 A;  2IIM A;  2HMA A;  3MP8 A;  4DQ2 A;  2FB7 A;  2RK2 A;  3M0Q A;  3RKX A;  2FZG B;  3CCE A;  2PU9 B;  2EQU A;  2KYM A;  2EQI A;  2EPD A;  2XD0 A;  3DKM A;  2DLP A;  4NOY A;  2CDT A;  2V1Q A;  3QYG B;  3X26 B;  1AOJ A;  1E6H A;  1G3T A;  1CKA A;  1M3C A;  3A98 A;  4B9W A;  4M78 B;  1NYG A;  4M77 B;  1AWO A;  2GNC A;  2CZ0 B;  1OU8 A;  2R57 A;  5CAI A;  2LCL A;  5GAO p;  1S72 Q;  1M8M A;  4M78 E;  3QII A;  4JJC A;  3CC2 T;  2RI5 A;  1WHM A;  1N9R A;  1O75 A;  3ZEH A;  4C0G A;  4M77 C;  4F16 A;  4D8K A;  2AHJ B;  4XTU A;  1M3A A;  1VQ4 Q;  3JAM E;  3CCR Q;  1RI0 A;  3L42 A;  4M7D C;  2KYB A;  1GCQ A;  3H8Z A;  3CBO A;  3E2U A;  2LCC A;  2GQI A;  4AMC A;  1Z9Q A;  2M02 A;  3VYH B;  4DEX A;  1D1C A;  1NEB A;  1MMA A;  2FPD A;  4II1 A;  1KQS P;  4XTX A;  2L2P A;  2CS7 A;  2YRV A;  5EC7 A;  4J8O A;  4RTU A;  1VQ9 T;  4XTV A;  2B86 A;  4MDX A;  1MNE A;  4AT1 B;  2VKN A;  2DF6 A;  3SDZ A;  2EQJ A;  3OMG A;  1KSW A;  2V8K A;  2MF2 A;  2QA4 T;  1QCO A;  2M0Y A;  4CC3 A;  2H3J A;  1PM3 A;  3JB9 D;  2O4X B;  1ZBX A;  3L1A A;  3PIP A;  1MND A;  5LJ3 g;  1VQ9 A;  3FRN A;  4RG8 A;  2NUT A;  3NGP A;  2CGH A;  5J26 A;  3WXM B;  4BI4 A;  4HVU A;  3VS7 A;  3EHR A;  1M30 A;  3VKI A;  3CCU A;  2CZ1 B;  2HAX A;  4C92 F;  2QA4 A;  3EAE A;  1OZ2 A;  1IGU A;  1W70 A;  3GIB A;  4JUV A;  4A53 A;  1OQK A;  3CQT A;  3G6E T;  3CC2 Q;  4C0D B;  3QUI A;  2C0O A;  2DMO A;  3X28 B;  4LDU A;  3JSC A;  1Q81 C;  1D0Z A;  4XQ3 A;  2JNG A;  4C92 B;  2RQT A;  1PKT A;  1UGS B;  4PFZ A;  4C0Z A;  3QDR B;  1HD3 A;  3MHX A;  4GLK A;  2DFU A;  4C92 E;  1WJQ A;  1TTH B;  5CKH A;  2L89 A;  1KC8 R;  2DXB A;  2RM4 A;  1X69 A;  3I55 Q;  2EKH A;  2RN8 A;  2CRE A;  2LJ0 A;  2ABL A;  2JTF A;  3G71 T;  2HQH A;  2WAC A;  1V29 B;  1WGS A;  1RAI B;  2NUZ A;  5GMK i;  2HKN A;  2JS2 A;  4NS5 A;  2FL7 A;  3E9G A;  4LDV A;  2VUB A;  3VU3 C;  4KT0 E;  3OYE A;  4M77 A;  1QWE A;  2X4J A;  1YIJ Q;  4QKU A;  1AWX A;  2XID A;  1M1F A;  2QEX T;  2B8A A;  2QTX A;  2ESW A;  1WNL A;  4FCY A;  2DTI A;  1VQ6 A;  2DE0 X;  5GAM j;  2ZCF B;  2DEU A;  4BDZ A;  2LCS A;  3RMQ A;  2M1H A;  3EFO B;  3CEY A;  4JZ4 A;  3CD6 A;  5LJ5 g;  2SEM A;  3H9N A;  3CXC A;  5LJ5 d;  1RAA B;  1SF9 A;  2X35 A;  2HD0 A;  2PUO B;  2YXY A;  3JCM f;  2K5F A;  2XG8 D;  3CCL Q;  2DKG A;  1GL5 A;  4OGE A;  1GBQ A;  2HZY A;  2J06 A;  1YJN A;  4E6R A;  2XHC A;  1NJI R;  2JM8 A;  1ZUU A;  4C5I A;  4RCB A;  1T0H A;  2RQV A;  2NYS A;  2O9V A;  4C8Q F;  3J81 E;  2MAM A;  3OYC A;  4A4H A;  1U1T A;  2ZZD A;  2KI7 A;  2KT8 A;  3CXC S;  2RJE A;  1Y57 A;  1F1B B;  3VYG A;  4ZN3 A;  1NYF A;  2VV5 A;  1QCN A;  2MPX C;  1M90 R;  1UFF A;  1RAB B;  4KH0 B;  1ZQ1 A;  3CC4 Q;  1Q95 G;  2QG9 B;  4HCC A;  4FYW B;  3FB9 A;  3DB4 A;  1J3T A;  3M0T A;  4PJO C;  3OYY A;  4C0F A;  2L0A A;  2P4R A;  2K3X A;  1CKB A;  3N5B B;  1PSF A;  1SSF A;  4C8Q E;  3H0I A;  5GMK h;  4TVR A;  3JV3 A;  3CCQ Q;  3JCM Q;  2QEX Q;  3OSV A;  4IUU A;  3ASK A;  2FG0 A;  2L3S A;  3BDU A;  3JCM h;  1QCF A;  3I56 A;  4KGX B;  4J9D A;  1R0C B;  4PJJ A;  3BW1 A;  3A8L B;  1Q7Y C;  1VQK A;  3EHQ A;  1M1K U;  1D09 B;  2EWN A;  1FMV A;  5GAN g;  4BE2 A;  3PTA A;  3FIF A;  1OU9 A;  2FHD A;  2DL4 A;  5GAN d;  2M16 A;  3M54 A;  4FYV B;  1VQ5 A;  2LTO A;  4JJD A;  3L2U A;  1QVF A;  2F2V A;  5IXB A;  5GAN 2;  4BY6 C;  3JCM P;  5GMK l;  4JJB A;  5FW9 A;  3CCS Q;  1X6G A;  3PVQ A;  1EZZ B;  4MZT A;  1M1K C;  1N27 A;  3E9F A;  1YCY A;  2DVE A;  4BB7 A;  1Z9Z A;  4K11 A;  2K2M A;  1BIA A;  1KC8 U;  1BCM A;  1OPK A;  3EGX B;  2ED1 A;  1QVG A;  1XTD A;  1DJ7 B;  3ZFJ A;  2VYT A;  4DOV A;  1K73 R;  1VQ8 T;  4LN2 A;  2CUB A;  5KYX A;  1KD1 U;  2RB6 A;  2KK4 A;  4XK8 E;  4JLI A;  3OYK A;  2KQW A;  1T0J A;  4E7S A;  1W2B A;  2NWM A;  4ME7 A;  2GCX A;  2XK0 A;  2COY A;  2O01 E;  1JB0 E;  5IHN A;  3JRZ A;  4OMP A;  1BI3 A;  4RTZ A;  3BDL A;  4EMK B;  1Q82 R;  1K8A R;  2C06 A;  2LRQ A;  3JB9 J;  5KCH A;  1BI0 A;  1WHJ A;  1U06 A;  5A2Q E;  4JS5 A;  1SRL A;  2ZPG B;  4M75 F;  2RMO A;  3MCA B;  1BCO A;  3MET A;  4M75 G;  4E2F B;  2CUD A;  5HK3 A;  2KVQ G;  1ABQ A;  5CKB A;  2KSS A;  1I5L A;  2LVM A;  1KD1 C;  1N5Z A;  1K1Z A;  4B9X A;  2HDA A;  1PCX A;  1JEG A;  5GAN 4;  2AKK A;  3CPW A;  1U1S A;  1NJI U;  1LNX A;  1FYN A;  2QDY B;  4OB3 B;  3G4S Q;  1NZ9 A;  5FU6 B;  2DX1 A;  3S3O A;  3CC7 Q;  4M7A B;  1LPL A;  1PD1 A;  2XU8 A;  2RI2 A;  2I2L A;  3CCV Q;  4ATO A;  1JQQ A;  2OTL Q;  1Y96 A;  2FVU A;  3URG A;  4M7A E;  4YTL A;  3CME Q;  2P0P A;  1YJ9 T;  2K5L A;  1TSF A;  1T3S A;  2RHY A;  3CBM A;  4O5V A;  2KR3 A;  3UPU A;  3LW5 E;  2LMJ A;  2K9G A;  2D9T A;  2O2O A;  2KBT A;  4CI0 C;  3LH5 A;  4ANJ A;  1UJ0 A;  3BY7 A;  1VQN Q;  2EYW A;  1VQ7 Q;  1YJ9 A;  4CC2 A;  2J7I A;  1TOV A;  1N9S A;  2R5M A;  2F5T X;  2LT1 A;  4BI3 A;  2K5I A;  2A28 A;  3H0H A;  3NMZ C;  4HT9 A;  2X4X A;  1D0Y A;  4OP0 A;  1Q86 R;  2F2W A;  2DA9 A;  3OYM A;  5GAM f;  4OVA A;  1VQL Q;  1YIT Q;  1TG0 A;  2KT1 A;  2F2X A;  3PMI A;  1QKX A;  3EGX A;  3QBY A;  3PFS A;  2FRW A;  3X20 B;  3MO8 A;  3CCJ Q;  4FW1 A;  2DXU A;  2QAS A;  1C0M A;  1OYX A;  3NPF A;  2YRC A;  2EYY A;  3C94 A;  2YUP A;  4Z88 A;  1K76 A;  1PG5 B;  4HCZ A;  1OOT A;  4JDS A;  1QVP A;  3J80 E;  1JJ2 S;  2OTJ A;  1UUE A;  1WXU A;  1S72 T;  5A0G A;  3VS0 A;  2DK3 A;  2P84 A;  6AT1 B;  5D6X A;  1JXM A;  4GY5 A;  2LQ8 A;  3WVD B;  2ZPE B;  4RTT A;  2MMP A;  3RKY A;  4AG2 C;  3CPF A;  1K4U S;  3M0R A;  5GAO r;  3S6W A;  3GNF B;  4D6W A;  3THK A;  4BI8 B;  1VQ4 T;  5KCO A;  1G3Y A;  5AYF A;  4M7D D;  3CCR T;  4OB1 B;  3M55 A;  3EG2 A;  3ZL7 C;  1NE8 A;  1UEB A;  5GAN j;  2EQK A;  3OYH A;  1S72 A;  2I0N A;  1YHQ Q;  2K7A A;  1VQM Q;  3G7Z A;  2DD4 A;  4FW2 A;  1K73 U;  1OZ3 A;  5FWB A;  1RAE B;  3DLL A;  2DD5 A;  4ZGE B;  1VQ4 A;  3CCR A;  5HY6 A;  1UTI A;  1D3B B;  2DXT A;  4M7A A;  2MWP A;  1TWB A;  4FL6 A;  4M77 F;  4M78 G;  2CKK A;  3EG3 A;  3LYI A;  4A54 A;  2WSC E;  5KE3 A;  4EPC A;  2DYI A;  2JW4 A;  4BD3 A;  2FZC B;  1WZO A;  4JRK A;  2FO0 A;  3UAT A;  1B3Q A;  4OF1 A;  1FWZ A;  3OYG A;  1SHG A;  2M51 A;  1ZBJ A;  5HK0 A;  2RHI A;  2LX7 A;  3QYH B;  4C5G A;  5IHK A;  2RQR A;  4ZTJ A;  2EKO A;  2OJ2 A;  3EGD B;  3UF4 A;  5A0D A;  3R6N A;  1QQJ A;  1D1B A;  1H92 A;  1NBE B;  2JTM A;  4A4K A;  4L6V 5;  4M7D B;  4M77 E;  2HEQ A;  3C12 A;  1V76 A;  2D8J A;  4HA8 A;  1M27 C;  5C6S A;  4XU2 A;  2P0Q A;  3M57 A;  2NUP B;  1PSE A;  4IIM A;  1JJ2 P;  1S1N A;  3OW2 P;  2H3E B;  4CC7 A;  1IHW A;  5GAO n;  5A0L A;  3CC2 A;  5LJ3 f;  4BUG A;  4FSX A;  2OAU A;  4E7L A;  1CSK A;  4V2S A;  3NTK A;  3P8D A;  3TU4 K;  3I55 T;  3V7R A;  1SEM A;  1Y71 A;  4A4G A;  4FU6 A;  5I22 A;  4LE9 A;  1FXX A;  1NPP A;  4E7I A;  2EW3 A;  2LZ6 B;  3A8O B;  1WI7 A;  2RJC A;  2QXF A;  4Y91 A;  5CKF A;  8ATC B;  2E5Q A;  3LGF A;  3G1J A;  3OS5 A;  1YIJ T;  4MZM A;  3I55 A;  2MYS A;  2XMF A;  4JRQ A;  2HL3 A;  1Q86 U;  1WJS A;  4PJM A;  2DVJ A;  5LJ3 d;  4VUB A;  4X9C A;  3OYB A;  4IUT A;  1AVZ C;  4FSS A;  1W6X A;  2YT6 A;  1JRI A;  1WJR A;  4C92 G;  1UGR B;  5GAN 7;  3LLR A;  1EFN A;  1K9A A;  3QXE B;  2QGG A;  4J7I A;  1TUD A;  3E1S A;  1X01 A;  3HRU A;  4LDX A;  3X24 B;  3CCL T;  4J7F A;  5I21 A;  2KRM A;  1I8F A;  2D1X A;  4LNP A;  1M9S A;  1K9M R;  2KNB B;  2AT1 B;  3LX7 A;  3SEM A;  1D3B A;  2HSE B;  1OEB A;  3UT1 A;  4E7K A;  3JB9 F;  2LX9 A;  1QP2 A;  2QYZ A;  3UDC A;  4MML A;  4F7U B;  4PLL A;  1RLQ C;  4ELY C;  2LJ1 A;  3G6E A;  3CCL A;  2AZS A;  3QZ9 B;  2LNV A;  4N0A C;  1BI2 A;  1X75 C;  3QJ6 A;  2L3P A;  4F7U E;  4EIK A;  2E12 A;  2L3Q A;  3KBG A;  5CIU A;  2J6F A;  1M3B A;  4XU3 A;  2L3R A;  5LJ5 f;  3CC4 T;  5GMK e;  4PLI A;  4PJO D;  3EGD A;  1YJW Q;  2EYX A;  4N4H A;  1BYM A;  4DBH A;  5KE2 A;  2KEA A;  3VUZ A;  1U5S A;  5GAN 3;  1LVK A;  2GBQ A;  3NTI A;  2DPP B;  3EFS A;  3CMA Q;  1YN8 A;  2E64 A;  1W4S A;  5I2S A;  1WXB A;  3CCQ T;  4M7D A;  5J3B A;  3JCM e;  2HBW A;  4E47 A;  2E65 A;  4N4G A;  2X9H A;  4ZN1 A;  1WHG A;  3G71 A;  3CC4 A;  3HFO A;  4BAC A;  3CCU Q;  1VUB A;  2CP6 A;  1JO8 A;  2NUP A;  2GTJ A;  5CKD A;  3NFC A;  2QGF B;  2QEX A;  4R55 A;  1WYX A;  1SKU B;  3ZBD A;  2BTT A;  3PMT A;  1RUW A;  5GAN 6;  5AT1 B;  3A1P A;  3JB9 I;  2VAS A;  3GLX A;  3OY9 A;  4JS4 A;  1GFC A;  9ATC B;  2QK0 A;  4J9B A;  2E6N A;  5KYX B;  2D8H A;  1B7T A;  1UGP B;  2VXF A;  4C8Q G;  1AZE A;  3TSZ A;  4LD6 A;  4OB2 B;  1MHN A;  2E1H A;  2JMC A;  5GAO l;  4PJO B;  1EIF A;  1HYO A;  3CCS T;  4RUG A;  2MIO A;  2SRC A;  2XDP A;  3QWX X;  2YUO A;  3EH2 A;  4PJO E;  2E70 A;  5L23 A;  1PRL C;  1IZ6 A;  2BZY A;  2AIR B;  3OBW A;  1G5V A;  4GLM A;  2GQV A;  4J5Y A;  4X1V A;  4OMM A;  1YI2 Q;  1TUC A;  2XI9 A;  2DJQ A;  1M1G A;  5GAN f;  5IT9 E;  1YWP A;  3O5Z A;  3CCS A;  4PFP A;  2H8H A;  3PNW C;  1VQ6 Q;  4HVV A;  4QVZ A;  3QWY A;  3OYJ A;  2A36 A;  1ZSZ C;  2EGE A;  4R56 A;  3HKS A;  4LDY A;  2DIG A;  1YBY A;  3CD6 Q;  4OMQ A;  3JCM J;  2K3Y A;  2XDB A;  2IG0 A;  5GAO m;  4GBQ A;  1Y96 B;  1LJO A;  4F7U A;  2ZPI B;  4RMO A;  2VGM A;  1X6O A;  4FM4 B;  2KGT A;  1GBR A;  3VS1 A;  2RJF A;  4C8Q C;  1TH7 A;  3KXT A;  3QG1 A;  1D0X A;  4C5E A;  4Z89 A;  5IHI A;  3EG0 A;  4IUV A;  2M0O A;  1YJN Q;  2QAZ A;  2YDL A;  3CCM Q;  4NL3 A;  4BY6 B;  4QQ6 A;  1VYV A;  4OB0 B;  3JB9 H;  3M0U A;  1N8R R;  3EG9 B;  3QPH A;  2NLU A;  2PNI A;  1MMN A;  2YHT A;  3M4Y A;  1K9M U;  3OS1 A;  1R0B G;  3FC3 A;  2RHZ A;  3HP9 A;  4CC4 B;  3G4S T;  4BE0 A;  3FEO A;  4J9E A;  2BIV A;  3CC7 T;  5FRO A;  1YWO A;  1VQP T;  5LJ3 j;  4XTZ A;  3CCV T;  2DL3 A;  2OTL T;  1H3Z A;  2LQW A;  3M5A A;  5L8R E;  5CO7 A;  2A3L A;  4JZ3 A;  3CXC P;  3CME T;  2V1R A;  2OAW A;  2A37 A;  2ECZ A;  4EDU A;  4ZTF A;  5KH6 A;  2LC4 A;  3G4S A;  1ZUY A;  1QVF S;  3CC7 A;  2EAY A;  2JM9 A;  3L2R A;  2BZ8 A;  1PC0 A;  2ZGW A;  3JCM V;  4C5H A;  4HCB A;  4RTY A;  2OTL A;  2X4W A;  1VQN T;  3I56 Q;  2J6O A;  4JRP A;  4PL6 A;  1VQ7 T;  4IUQ A;  4M75 D;  2CH4 A;  1OI1 A;  3OA6 A;  5KYN A;  1M4Z A;  5FLX E;  2ZPF B;  5GMK m;  2CT3 A;  2DNU A;  1VQK Q;  3EGU A;  3GPL A;  4PJO A;  2MCN A;  1VQ8 A;  3JCM c;  1KC8 C;  1QVG S;  4NL2 A;  4J6Y A;  2RNA A;  4DOW A;  3I5S A;  3S3N A;  3V8L A;  1VQN A;  4M7A F;  5FU7 C;  4A4E A;  4F14 A;  1MUZ A;  4M7A G;  1VQL T;  2Z0W A;  3SFM A;  2R5A A;  1YIT T;  1FMW A;  3X25 B;  2RO0 A;  3FLG A;  1OV3 A;  3QHS A;  1W2B S;  1VQ5 Q;  1NLO C;  3OYI A;  2C0T A;  3BE3 A;  3TSW A;  3L2Q A;  3REB B;  3CCJ T;  2E4H A;  3GBQ A;  2XDD A;  4J6X A;  5GJW B;  1RL2 A;  4J6W A;  1VQL A;  4J9G A;  1UDL A;  1YIT A;  1PWT A;  4PNO A;  1VQP Q;  1VQO Q;  5FWC A;  1KHC A;  2F69 A;  3M56 A;  4JJN K;  4X9D A;  5DM7 R;  3PIO A;  4AFZ C;  2JT4 A;  5LJ5 j;  3TCJ A;  1RLP C;  2X3X D;  1M90 U;  1PNJ A;  1UE9 A;  3RMS A;  2C0I A;  5ECA A;  3JCM X;  2JXB A;  1AT1 B;  3CPW S;  4IIO A;  2PQW A;  1G83 A;  2KAF A;  2ROT A;  2CH4 W;  3A8H B;  3HFN A;  5GAM e;  1NJI C;  1YHQ T;  2L5Q A;  3EG9 A;  4KH1 B;  1YP5 A;  4L5G A;  2HQX A;  5I2M A;  1PHT A;  4DEY A;  4M75 C;  1VQM T;  3O8V A;  4DBQ A;  3REA B;  1YFN A;  2FPE A;  1AHJ B;  3U23 A;  1VYU A;  2PVG B;  1IGQ A;  1TUG B;  4OMF B;  4F17 A;  3GNG A;  2K4Y A;  2JVV A;  3LWI A;  1I81 A;  1M90 C;  1YHQ A;  3HHT B;  4AFS C;  5D7U A;  1X6B A;  2MWO A;  3RDV A;  1B07 A;  1VQM A;  1I5O B;  5GAN 5;  1UGQ B;  3P8B B;  4JRI A;  5HCK A;  2QI2 A;  2CP5 A;  1QVG P;  1Q81 R;  5J39 A;  2JZ2 A;  1X2Q A;  5CQX A;  1I1J A;  4KGZ B;  1GFD A;  3M0P A;  1BB9 A;  3OW2 A;  1UEC A;  1NM7 A;  3H41 A;  3MEW A;  4N4I A;  1TU0 B;  1N8R U;  2QQB A;  1NEG A;  1QKW A;  4BDY A;  2JJ9 A;  2HSP A;  1W2B P;  4OMO A;  4B6M A;  2VGN A;  1KQS A;  4Q5W A;  3RBB B;  4RTW A;  4ELZ C;  4Y28 E;  2AKL A;  4MZP A;  4LUE A;  3SHW A;  3HPW A;  3J7A F;  1WHK A;  1HK9 A;  1G2B A;  3F70 A;  4L59 A;  3FDR A;  4PJL A;  1KFZ A;  2D6F A;  2DTO A;  1M2O A;  1ZSG A;  4WF2 A;  4LDW A;  1YCS B;  1ZX6 A;  4LUD A;  4M78 D;  3SB2 A;  4E7J A;  3MPU B;  5GAM h;  1WHL A;  3CPW P;  4J9I A;  2HCK A;  2QQ9 A;  1X43 A;  2VXE A;  2ENM A;  1AEY A;  2DJZ A;  3VS6 A;  3NHN A;  1SG5 A;  4KUL A;  2LQK A;  4DA4 A;  2KE9 A;  3QO3 A;  2CZ6 B;  1KIK A;  1Y07 A;  4MDW A;  1BU1 A;  2JN0 A;  2PZ1 A;  4M77 G;  5CCA A;  1PRM C;  1Q82 U;  1K8A U;  3C4S A;  3QSU A;  3RNJ A;  4M7D F;  1RAC B;  1FX7 A;  4CRI A;  5GAO q;  4XTW A;  2QTV A;  4KBM B;  2JUF A;  3L2V A;  5M9O A;  1B34 A;  1GRI A;  4IUR A;  1VYT A;  4JLG A;  5DLO A;  1WQ7 A;  3RKW A;  2KRS A;  2RHX A;  1K73 C;  2RF0 A;  2RQW A;  4PKC C;  1VIF A;  3QKJ A;  5KYW B;  3OBY A;  2DRM A;  2DEQ A;  2OTJ Q;  2DIQ A;  2EFI A;  5LJ3 e;  2GFU A;  1MV0 B;  1TS9 A;  3NTH A;  4MMK A;  2G3R A;  4HT8 A;  4ESR A;  3V8K A;  4J9F A;  4ZGJ B;  3MP6 A;  5C0M A;  4M7D E;  1Q82 C;  1K8A C;  2V8J A;  3MEU A;  3V8J A;  3OS2 A;  3VV0 A;  4XU1 A;  4J9H A;  4WCI A;  4QT7 A;  2BZX A;  2A0F B;  3A5Z B;  1IRX A;  4IKF A;  3C0C A;  2KXC A;  4R0K A;  2X3W D;  4M78 C;  4A63 B;  2GGR A;  2EVR A;  4HXJ A;  3RES A;  1QWF A;  1Y7X A;  2E3I A;  2KRN A;  3OYA A;  1Q7Y R;  1YNZ A;  1YJW T;  4XU0 A;  1AZG B;  2YLC A;  3IQL A;  3V7C A;  2CP2 A;  3CMA T;  2E10 A;  4C92 D;  1AWJ A;  4OGC A;  3CCE Q;  3M9Q A;  2GF7 A;  4QVD A;  1XNI A;  2GTO A;  3QJY A;  1GCP A;  1K0X A;  1K0S A;  2D0N A;  1KK7 A;  3LH0 A;  5HKC A;  1YJW A;  3CCU T;  2Y90 A;  2CYZ B;  3OS0 A;  2WSF E;  2R58 A;  3CMA A;  1YIJ A;  1BIB A;  4J9C A;  1X2K A;  5KYU B;  4F7U F;  2RQU A;  1Q81 U;  4F7U G;  3SWN B;  1C6V X;  2RJD A;  3VS2 A;  1M1K R;  1E6G A;  4QVC A;  1OUL A;  2HBP A;  2VC8 A;  2V26 A;  3PGG A;  3TVT A;  8AT1 B;  5LJ3 h;  5LJ5 e;  2CP7 A;  1H8K A;  4JPB W;  2E3H A;  1VA7 A;  1FMK A;  2EJ9 A;  2W0Z A;  2CT4 A;  3FJP A;  2DTH A;  1WFW A;  3SWN C;  2LJ3 A;  1Q86 C;  3JB9 G;  2COW A;  1M2V B;  3OYN A;  2KXD A;  2M9U A;  2DYB A;  3UWN A;  3R6O A;  2PVO B;  3QZ5 B;  4FT2 A;  4UC4 A;  3BFM A;  1XOV A;  1JU5 C;  1W1F A;  4AG1 C;  2HKQ B;  5D6W A;  2OX7 A;  2P0K A;  1AD5 A;  2DRK A;  1RI9 A;  4C0D C;  4PFO A;  2EBP A;  3I9Q A;  5KYW A;  4DBR A;  4QQG A;  2KDS A;  4KUI A;  2K2V A;  1YI2 T;  3INZ A;  3OQ5 A;  2RI3 A;  3OYL A;  1A0N B;  1VIE A;  4C92 C;  2EYQ A;  2XKO C;  5D6Y A;  1VQ9 Q;  1XJW B;  1ZLM A;  2O31 A;  1VQ6 T;  1JBM A;  2E6Z A;  2MI6 A;  2A08 A;  5DY9 A;  2MK5 A;  3ME9 A;  2CP0 A;  1WXT A;  4M78 A;  1KD1 R;  3CD6 T;  4DBF A;  4PJN A;  1ACM B;  2QA4 Q;  1BI1 A;  3Q1J A;  1YI2 A;  1WLP B;  1QMC A;  3LWH A;  2DET A;  4AFQ C;  4C8Q D;  3M0S A;  3CCQ A;  4X34 A;  2K3B A;  5FRN A;  2FYK A;  3M59 A;  2VB6 A;  4Z8A A;  1NG2 A;  2DZ9 A;  3EG1 A;  4LXC A;  4PJO F;  1BBZ A;  2KY9 A;  1M8V A;  4QQD A;  4FYX B;  4PJO G;  4RTX A;  2EQM A;  1YJN T;  2VWF A;  1QLY A;  3CCM T;  1HSQ A;  3HSB A;  2P4T A;  4WTO B;  5CVI A;  3I35 A;  2QDL A;  3MJX A;  5LJ5 h;  3G6E Q;  5GAN e;  1N6A A;  2IVW A;  2VVK A;  2YRD A;  2YUQ A;  1OX9 A;  2LNH B;  1I07 A;  1I4K 1;  3MKD A;  3CCM A;  2PUK B;  3L2Z A;  4O6J A;  1RAH B;  2O88 A;  3E19 A;  2COZ A;  4RKU E;  2JMA A;  3OSS C;  3M58 A;  1BKB A;  2G6F X;  3OYD A;  1ZSZ B;  2O4X A;  5KYU A;  4RCC A;  1KJW A;  2PVD B;  3SWN A;  1UHC A;  2QQA A;  1H3H A;  3OB9 A;  2BUD A;  3JCM g;  3G71 Q;  4EMH A;  2F1L A;  3UA7 A;  3JCM d;  1Q7Y U;  5IXF A;  4C8Q B;  4N0A A;  2ZPB B;  1WX6 A;  2ZPH B;  4PK4 A;  3I56 T;  2JTE A;  3JCM W;  2EGC A;  2FPF A;  2V8I A;  2W10 A;  3GP8 A;  1M2V A;  2X51 A;  2RK1 A;  3RUX A;  1PKS A;  4F04 B;  4KRT A;  1VQK T;  1EX4 A;  2D0Q B;  3VS5 A;  2AK5 A;  1ZHI A;  3TEE A;  2EIF A;  3RER A;  3HRS A;  2DXC A;  1U3O A;  2O9S A;  1WDX A;  4C92 A;  2CZ7 B;  1BK2 A;  4E7Z A;  2JOY A;  3WVE B;  3V7S A;  3D7S B;  5CKE A;  5DLQ E;  1RAD B;  2EGA A;  1U8R A;  1VQ5 T;  1QW1 A;  1OPL A;  5CK9 A;  2EJF A;  2YWW A;  1GXI E;  2DM1 A;  4FIB A;  2DZC A;  1ZA2 B;  5GAN h;  4FYY B;  3VS3 A;  2PTK A;  3RIR A;  5CR2 A;  3AT1 B;  1VQO T;  2QQR A;  1MV3 A;  2DBM A;  4XTY A;  1R8O B;  2DBK A;  1UGV A;  2RD1 A;  1IO6 A;  4LD9 K;  1RAF B;  3EFO A;  5CQY A;  1IHV A;  3M4G A;  1VQP A;  1VQO A;  3CCV A;  3EFR A;  1K9M C;  4QW2 A;  1UG1 A;  1KHI A;  2E5K A;  3RR6 A;  3T9N A;  3ULR B;  3CME A;  4M7A D;  3A8G B;  1WIE A;  1IXD A;  2K79 A;  1KQ2 A;  2IPO B;  5FU7 B;  2K57 A; 
#chains in the Genus database with same CATH homology
 2VGN A;  4Y91 A;  5CKF A;  1XQH A;  4C5I A;  1KQS A;  2E5Q A;  4Q5W A;  3LGF A;  4RCB A;  4ELZ C;  3MP1 A;  4Y28 E;  4C8Q F;  3J81 E;  3OS5 A;  1YIJ T;  2MAM A;  4MZP A;  4MZM A;  3OYC A;  4A4H A;  3HPW A;  3I55 A;  3J7A F;  3DLM A;  1HK9 A;  1U1T A;  2ZZD A;  3F70 A;  4JRQ A;  4L59 A;  3ER0 A;  2EJG A;  1VQ7 A;  3FDR A;  3CXC S;  1Q86 U;  2RJE A;  1WJS A;  2D6F A;  2YLB A;  2DTO A;  4ZN3 A;  3VYG A;  5LJ3 d;  4IUP A;  4VUB A;  4X9C A;  3OYB A;  4IUT A;  4WF2 A;  1G3S A;  2VV5 A;  5IN1 A;  4LDW A;  3CBP A;  1ZQ1 A;  1JRI A;  4XAX B;  4M78 D;  4HCC A;  3GF5 A;  1WJR A;  4C92 G;  1UGR B;  5GAN 7;  2XIC A;  3FB9 A;  3DB4 A;  3LLR A;  3SB2 A;  4E7J A;  1G3W A;  4E7H A;  4PJO C;  3QXE B;  3OYY A;  5GAM h;  4J7I A;  4C0F A;  4C8Q A;  3HRT A;  3E1S A;  1X01 A;  2K3X A;  3HRU A;  4LDX A;  3X24 B;  3N5B B;  2Y4X A;  1PSF A;  1SSF A;  3CCL T;  4J7F A;  4C8Q E;  5I21 A;  1I8F A;  2QQ9 A;  5GMK h;  4TVR A;  4EMK C;  2VXE A;  3JCM Q;  1M9S A;  2DJZ A;  2DAQ A;  3OSV A;  4IUU A;  4KUL A;  2LQK A;  4DA4 A;  3ASK A;  3LX7 A;  3QO3 A;  1D3B A;  2CZ6 B;  1Y07 A;  4MDW A;  3UT1 A;  4ZGD B;  3CCJ A;  4E7K A;  2JN0 A;  4FT4 A;  3BDU A;  4M77 G;  3JB9 F;  2LX9 A;  1QP2 A;  5LL6 S;  5CCA A;  3UDC A;  4MML A;  1Q82 U;  3JCM h;  1K8A U;  3C4S A;  3QSU A;  1B34 B;  4F7U B;  4M7D F;  4PLL A;  3I56 A;  4ELY C;  4CRI A;  1FX7 A;  4M75 B;  5GAO q;  5EG2 A;  4XTW A;  3G6E A;  3CCL A;  4KBM B;  2JUF A;  3QZ9 B;  2LNV A;  5M9O A;  1B34 A;  3L2V A;  4N0A C;  1BI2 A;  1X75 C;  3QJ6 A;  3BW1 A;  3A8L B;  4IUR A;  4JLG A;  2L8D A;  4F7U E;  1Q7Y C;  5DLO A;  1WQ7 A;  3RKW A;  2HNI A;  2RHX A;  3S3M A;  4M75 E;  1VQK A;  2E12 A;  1K73 C;  3KBG A;  5CIU A;  1M1K U;  3OMC A;  2X4Y A;  5LJ5 f;  4HKE A;  2L3R A;  1VIF A;  4PKC C;  4XU3 A;  2EWN A;  5FU6 C;  3CC4 T;  3QKJ A;  5GMK e;  5GAN g;  3OBY A;  4BE2 A;  3PTA A;  2GFA A;  4PLI A;  2KMT A;  2DEQ A;  4M7A C;  3FIF A;  4PJO D;  2FHD A;  2DIQ A;  2EFI A;  2M16 A;  5GAN d;  3M54 A;  5LJ3 e;  2GFU A;  3MEA A;  3NTH A;  4N4H A;  1BYM A;  5KE2 A;  5GAN 3;  3VUZ A;  4MMK A;  2G3R A;  3HL8 A;  4HT8 A;  3NTI A;  1P92 A;  2RA2 A;  2DPP B;  3EFS A;  3V8K A;  5GAN 8;  1KQ1 A;  4ZGJ B;  2E64 A;  1W4S A;  5I2S A;  3MP6 A;  3CCQ T;  4M7D A;  5J3B A;  1LOJ A;  3JCM e;  4E47 A;  5C0M A;  1VQ5 A;  2E65 A;  2LTO A;  4N4G A;  1Q82 C;  4BE1 A;  2V8J A;  3L2U A;  1K8A C;  1QVF A;  4ZN1 A;  3G71 A;  3CC4 A;  3MEU A;  5GAN 2;  1O9S A;  4BY6 C;  3HFO A;  3MEV A;  3JCM P;  5GMK l;  3TRE A;  4BAC A;  3V8J A;  3OS2 A;  3VV0 A;  4XU1 A;  1KG1 A;  2E41 A;  5GMK j;  1VUB A;  1H64 1;  4MZT A;  3A5Z B;  5CKD A;  3A8M B;  4IKF A;  1M1K C;  2LT4 A;  1N27 A;  3NFC A;  3E9F A;  1YCY A;  4M78 C;  2DVE A;  1IRE B;  2QEX A;  4BB7 A;  4R55 A;  3RES A;  1BIA A;  3ZBD A;  1KC8 U;  1HXD A;  1Y7X A;  3PMT A;  1JJ2 A;  5GAN 6;  5FRM A;  3JB9 I;  2F5K A;  2WSE E;  3GLX A;  3OY9 A;  4JS4 A;  1QVG A;  3GOX A;  1XTD A;  1DJ7 B;  3OYA A;  3VUB A;  3ZFJ A;  2OTJ T;  2HQE A;  3LGL A;  1YJW T;  1UB4 A;  2VYT A;  4XU0 A;  4DOV A;  2E6N A;  1VQ8 T;  2YLC A;  3V7C A;  3L2W A;  3KUF A;  1UGP B;  2VXF A;  1KD1 U;  2E10 A;  3CMA T;  2RB6 A;  2KK4 A;  4XK8 E;  4C8Q G;  4C92 D;  4JLI A;  3OYK A;  4OGC A;  2Y4Y A;  4EMG A;  3M9Q A;  2GF7 A;  4QVD A;  4Z02 A;  2RHU A;  1XNI A;  4J83 A;  3QJY A;  2KQW A;  1W2B A;  4LD6 A;  4OB2 B;  1MHN A;  2E1H A;  3H6Z A;  3PT9 A;  4ME7 A;  3JCM b;  5GAO l;  2GCX A;  2XK0 A;  4PJO B;  1EIF A;  2LDM A;  3LH0 A;  2O01 E;  3CCS T;  3P8H A;  1JB0 E;  4A4F A;  3DB3 A;  5HKC A;  3CCU T;  3OW2 S;  2Y90 A;  1YJW A;  3JRZ A;  2CYZ B;  1BI3 A;  3OS0 A;  3BDL A;  2XDP A;  5GAM g;  4EMK B;  2WSF E;  2C06 A;  4PJO E;  2E70 A;  2LRQ A;  2R58 A;  4M7D E;  3JB9 J;  1IZ6 A;  5KCH A;  5GAM d;  3CMA A;  1YIJ A;  1BI0 A;  1BIB A;  4EMK A;  4M77 D;  1N8R C;  1MGQ A;  5A2Q E;  4JS5 A;  3OBW A;  4F7U F;  1G5V A;  2ZPG B;  1KQS S;  4M75 F;  1Q81 U;  3MCA B;  4F7U G;  3MET A;  3OYF A;  3SWN B;  4M75 G;  2GQV A;  4J5Y A;  3SD4 A;  1M5Q 1;  5HK3 A;  2KVQ G;  4KUD K;  2RJD A;  5CKB A;  2KSS A;  2BKD N;  2XI9 A;  1M1G A;  5GAN f;  1WQW A;  5IT9 E;  1I5L A;  2LVM A;  4QVC A;  3CCS A;  1KD1 C;  2HBP A;  4B9X A;  2VC8 A;  3PGG A;  5LJ5 e;  5LJ3 h;  3PNW C;  2RH2 A;  4RG2 A;  2EJ9 A;  4QVZ A;  3FJP A;  5GAN 4;  2DTH A;  2DO3 A;  3SWN C;  3OYJ A;  3CPW A;  1WPY A;  1U1S A;  1Q86 C;  1NJI U;  4R56 A;  3JB9 G;  1LNX A;  2QDY B;  4OB3 B;  3HKS A;  4LDY A;  1NZ9 A;  2DIG A;  3CCE T;  1YBY A;  3M53 A;  1QP3 A;  3VJP A;  3JCM J;  5FU6 B;  2K3Y A;  3S3O A;  2XDB A;  3OYN A;  2M9U A;  4M7A B;  4M7D G;  3UWN A;  2XU8 A;  2IG0 A;  2RI2 A;  3AHU A;  1NPR A;  2A7Y A;  2I2L A;  5GAO m;  1Y96 B;  1LJO A;  4F7U A;  2QQS A;  4ATO A;  2ZPI B;  3R6O A;  4M75 A;  2VGM A;  1X6O A;  2PVO B;  3C95 A;  3QZ5 B;  4FM4 B;  4FT2 A;  4P5N A;  4UC4 A;  3BFM A;  5IAY A;  2RJF A;  1XOV A;  4C8Q C;  1Y96 A;  2FVU A;  3URG A;  1TH7 A;  4M78 F;  4M7A E;  3KXT A;  3QG1 A;  4YTL A;  4C5E A;  2P0P A;  5D6W A;  1YJ9 T;  3MP8 A;  4DQ2 A;  2K5L A;  2FB7 A;  2P0K A;  2RK2 A;  4IUV A;  2M0O A;  4C0D C;  3RKX A;  2RHY A;  3CCE A;  3CBM A;  4O5V A;  4NL3 A;  2PU9 B;  2EQU A;  4QQG A;  4QQ6 A;  4BY6 B;  3UPU A;  2KDS A;  3LW5 E;  4KUI A;  2XD0 A;  2K2V A;  3DKM A;  2D9T A;  4NOY A;  1YI2 T;  4OB0 B;  3INZ A;  3JB9 H;  3OQ5 A;  2RI3 A;  3OYL A;  3QPH A;  4CI0 C;  3QYG B;  3X26 B;  2NLU A;  1VIE A;  3BY7 A;  2EYQ A;  4C92 C;  2XKO C;  1G3T A;  5D6Y A;  2YHT A;  4B9W A;  3M4Y A;  1VQ6 T;  1JBM A;  4M78 B;  1YJ9 A;  1K9M U;  2E6Z A;  2MI6 A;  3OS1 A;  4M77 B;  1N9S A;  5DY9 A;  3ME9 A;  2R5M A;  3FC3 A;  2F5T X;  2RHZ A;  2LT1 A;  2CZ0 B;  4BI3 A;  2K5I A;  3HP9 A;  4M78 A;  3G4S T;  4BE0 A;  2R57 A;  5CAI A;  2LCL A;  3FEO A;  5GAO p;  3CD6 T;  2BIV A;  3QII A;  4M78 E;  3CC7 T;  4HT9 A;  3CC2 T;  2RI5 A;  1BI1 A;  2X4X A;  3Q1J A;  1YI2 A;  5FRO A;  1VQP T;  1N9R A;  5LJ3 j;  3LWH A;  4XTZ A;  3CCV T;  4OP0 A;  4C8Q D;  1O75 A;  3ZEH A;  3CCQ A;  2OTL T;  3M5A A;  4X34 A;  4C0G A;  1H3Z A;  5L8R E;  4M77 C;  5FRN A;  5CO7 A;  2FYK A;  2AHJ B;  3M59 A;  2A3L A;  4XTU A;  2DZ9 A;  3OYM A;  5GAM f;  3CME T;  4OVA A;  2KY9 A;  4PJO F;  1M8V A;  3JAM E;  4QQD A;  4PJO G;  1RI0 A;  4EDU A;  4ZTF A;  3L42 A;  2EQM A;  5KH6 A;  1YJN T;  2LC4 A;  3PMI A;  3G4S A;  4M7D C;  3CCM T;  3H8Z A;  3CBO A;  2LCC A;  1QVF S;  3HSB A;  3QBY A;  3PFS A;  2P4T A;  3CC7 A;  3X20 B;  2EAY A;  3MO8 A;  3VYH B;  3L2R A;  5CVI A;  2DXU A;  2ZGW A;  3JCM V;  4C5H A;  1OYX A;  4HCB A;  4II1 A;  2OTL A;  4XTX A;  3C94 A;  2X4W A;  2CS7 A;  1VQN T;  2YRV A;  4JRP A;  4J8O A;  4PL6 A;  5LJ5 h;  4HCZ A;  1VQ7 T;  4IUQ A;  1VQ9 T;  4M75 D;  4XTV A;  5GAN e;  1OI1 A;  3OA6 A;  1N6A A;  4JDS A;  1M4Z A;  2IVW A;  4MDX A;  1QVP A;  5FLX E;  2ZPF B;  5GMK m;  3J80 E;  3SDZ A;  3CCM A;  1JJ2 S;  2OTJ A;  1I4K 1;  2PUK B;  3GPL A;  1S72 T;  3L2Z A;  5A0G A;  4O6J A;  4PJO A;  2DK3 A;  1VQ8 A;  2EQJ A;  3OMG A;  2V8K A;  5D6X A;  3JCM c;  2MF2 A;  4GY5 A;  2QA4 T;  2LQ8 A;  1KC8 C;  3WVD B;  1QVG S;  4NL2 A;  3E19 A;  2ZPE B;  4J6Y A;  4RKU E;  2MMP A;  3RKY A;  3OSS C;  3CPF A;  2H3J A;  3M58 A;  5GAO r;  3JB9 D;  1BKB A;  3S6W A;  2O4X B;  4DOW A;  1ZBX A;  3GNF B;  3S3N A;  3V8L A;  3L1A A;  1VQN A;  3OYD A;  4D6W A;  3PIP A;  4M7A F;  5FU7 C;  4A4E A;  5LJ3 g;  1VQ9 A;  4M7A G;  2O4X A;  4BI8 B;  1VQ4 T;  3FRN A;  1G3Y A;  4RG8 A;  5AYF A;  3SFM A;  2R5A A;  5KCO A;  1YIT T;  1VQL T;  4RCC A;  2CGH A;  3CCR T;  4M7D D;  4OB1 B;  2PVD B;  3M55 A;  3SWN A;  3X25 B;  2RO0 A;  2QQA A;  1NE8 A;  1UEB A;  3FLG A;  5J26 A;  3WXM B;  5GAN j;  3OB9 A;  4BI4 A;  2EQK A;  3QHS A;  2BUD A;  3VKI A;  2CZ1 B;  3OYH A;  3CCU A;  1S72 A;  1W2B S;  2HAX A;  3JCM g;  3OYI A;  3L2Q A;  4C92 F;  2QA4 A;  4EMH A;  3CCJ T;  3EAE A;  1OZ2 A;  3JCM d;  1Q7Y U;  4C8Q B;  4N0A A;  3G7Z A;  2DD4 A;  2ZPB B;  1K73 U;  3GIB A;  4JUV A;  1OZ3 A;  4A53 A;  2XDD A;  2ZPH B;  4J6X A;  3I56 T;  1RL2 A;  3JCM W;  3DLL A;  3G6E T;  4J6W A;  2DD5 A;  4ZGE B;  4C0D B;  1VQ4 A;  1VQL A;  1YIT A;  3QUI A;  3CCR A;  4PNO A;  2V8I A;  3GP8 A;  5HY6 A;  1D3B B;  2DXT A;  2RK1 A;  3RUX A;  3X28 B;  4M7A A;  2MWP A;  1KHC A;  1VQK T;  4LDU A;  4FL6 A;  2D0Q B;  2F69 A;  3JSC A;  3M56 A;  4JJN K;  4M77 F;  4M78 G;  4X9D A;  2CKK A;  5DM7 R;  1ZHI A;  3PIO A;  4XQ3 A;  1Q81 C;  2JNG A;  3TEE A;  3LYI A;  4A54 A;  4C92 B;  5LJ5 j;  2EIF A;  2WSC E;  3TCJ A;  1UGS B;  4EPC A;  3HRS A;  5KE3 A;  1M90 U;  3RER A;  2DXC A;  4BD3 A;  4C0Z A;  4JRK A;  4C92 A;  3QDR B;  3RMS A;  2CZ7 B;  3MHX A;  3JCM X;  4GLK A;  4C92 E;  1WJQ A;  2JOY A;  4OF1 A;  2L89 A;  2PQW A;  5CKH A;  1FWZ A;  3V7S A;  3WVE B;  3OYG A;  2KAF A;  2DXB A;  2RM4 A;  5CKE A;  5DLQ E;  3A8H B;  5HK0 A;  3HFN A;  2RHI A;  5GAM e;  3QYH B;  1NJI C;  1U8R A;  1VQ5 T;  4C5G A;  1YHQ T;  2L5Q A;  2JTF A;  1QW1 A;  4L5G A;  3G71 T;  2WAC A;  1V29 B;  1WGS A;  4ZTJ A;  2HQX A;  2EKO A;  2EJF A;  5I2M A;  5CK9 A;  5GMK i;  5A0D A;  1GXI E;  4M75 C;  4NS5 A;  1VQM T;  2FL7 A;  3E9G A;  4LDV A;  3O8V A;  2JTM A;  2VUB A;  4FIB A;  4KT0 E;  3VU3 C;  4A4K A;  3OYE A;  4M77 A;  4L6V 5;  2DZC A;  1AHJ B;  2X4J A;  4M7D B;  4M77 E;  5GAN h;  2PVG B;  4OMF B;  3C12 A;  2XID A;  5CR2 A;  3RIR A;  1VQO T;  1M1F A;  2QEX T;  2B8A A;  3GNG A;  2K4Y A;  3CPW S;  2JVV A;  2QTX A;  1WNL A;  3LWI A;  2QQR A;  1I81 A;  1M90 C;  1YHQ A;  4HA8 A;  3HHT B;  4XTY A;  5C6S A;  4XU2 A;  2P0Q A;  2DTI A;  3M57 A;  1VQ6 A;  2MWO A;  1R8O B;  5GAM j;  2ZCF B;  4BDZ A;  1PSE A;  3RMQ A;  5GAN 5;  1VQM A;  2RD1 A;  2M1H A;  1UGQ B;  3CEY A;  3P8B B;  3CD6 A;  4LD9 K;  4JRI A;  5GAO n;  2QI2 A;  5A0L A;  5LJ5 g;  3CC2 A;  5CQY A;  5LJ3 f;  4BUG A;  4FSX A;  2OAU A;  3M4G A;  5J39 A;  4E7L A;  4RMO A;  3CXC A;  3NTK A;  3P8D A;  5LJ5 d;  1VQP A;  3TU4 K;  4V2S A;  3I55 T;  3V7R A;  3CCV A;  3EFR A;  2JZ2 A;  1VQO A;  1K9M C;  1Y71 A;  5CQX A;  4QW2 A;  2X35 A;  2HD0 A;  1KHI A;  2PUO B;  4FU6 A;  4A4G A;  3OW2 A;  3T9N A;  3JCM f;  3MEW A;  2K5F A;  4N4I A;  2XG8 D;  3CME A;  1N8R U;  4M7A D;  2QQB A;  1FXX A;  1NPP A;  2DKG A;  4BDY A;  3A8G B;  4E7I A;  4OGE A;  1KQ2 A;  1YJN A;  3A8O B;  5FU7 B;  2K57 A;  2RJC A;  2QXF A;  2XHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...