5GANh

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ganh00
4XU2A 4N0AA 4M77E 4XTWA 3RUXA 5GMKh 4HA8A 3RIRA 3V8LA 3JCMb 1BIAA 3SWNC 1JBMA 5GAMd 4M7AA 4F7UB 1H641 2RM4A 4XTZA 4NL3A 2YLCA 5GAMj 2EAYA 4PJOA 4M7AB 3RKWA 4J6XA 3L1AA 1HXDA 4M7DC 3M4GA 1Y96B 1LOJA 4X9DA 3HSBA 3EFRA 4XU1A 2E64A 2EJFA 3RKXA 3JCMd 4M7AD 4WF2A 2YLBA 3QHSA 4C8QD 2DJZA 4XTVA 4V2SA 5LJ3h 3RKYA 3JCMc 4C92C 4M75C 1M8VA 3JB9H 4JLIA 4F7UF 1M5Q1 1U1SA 5LJ3d 5GAMf 2I2LA 4OP0A 5LJ5h 1BIBA 2VXFA 5GAMg 2E10A 3PGGA 3JCMe 4C92F 5GAMe 2YHTA 1HK9A 5LJ3f 5GAN3 4M7DE 1I81A 4C92D 3BY7A 5GANg 2RA2A 3JB9D 4EMKC 4C8QA 5LJ5j 4M78G 5GAN7 5GAOm 1YCYA 3BFMA 5GANj 1B34B 3FJPA 5GAN6 3FIFA 4N0AC 5GAN2 5GANe 5GMKe 1KQ1A 4JUVA 2DXTA 3JCMJ 4M75A 4F7UE 1MGQA 5GAOl 4PJOF 4M7DB 2CGHA 4C92A 4M7AG 5GMKj 4M77B 5I21A 3JCMX 5GAOq 3GIBA 4M77A 4JRKA 4QVDA 2DZ9A 3JCMW 3AHUA 4M7DA 4PNOA 2VXEA 4M75B 4C92G 5LJ5e 2DTIA 3QUIA 3SWNB 4J6YA 1LNXA 3JCMh 5LJ3g 5GMKm 4EMKB 2Y90A 4QVCA 4DQ2A 1KQ2A 4M78D 4M78F 5GMKi 5LJ3j 2FYKA 4PJOD 4XU0A 4RCBA 5LJ5d 3QSUA 4M77F 3FB9A 3JCMP 3V7CA 2K57A 1Y96A 5GAOp 1N9SA 3JCMV 3HFOA 4Y91A 4F7UG 5GANf 4RCCA 3BDUA 5GAMh 1D3BB 4EMHA 3INZA 5GAN8 2EWNA 4J6WA 3JCMg 2EJGA 4M78E 4C8QC 5GANh 3BW1A 4XTYA 5GAOn 4M7DG 2E41A 1JRIA 4EMGA 4PJOE 4J5YA 5LJ5f 2QTXA 4M7DF 4PJOB 4C8QF 5GAN5 3RERA 2RD1A 1U1TA 1D3BA 4XU3A 4M7AE 1I5LA 1WNLA 2RB6A 3HFNA 2DTHA 4M75E 3L2ZA 1X01A 4C92E 4F7UA 5LJ3e 2DKGA 3RESA 3V8KA 4A53A 4M75D 4M75F 4MMKA 5DY9A 3SB2A 3VU3C 4HT9A 5LJ5g 2DEQA 2DTOA 2ZGWA 4A54A 3JCMQ 5GAOr 3JB9J 3JB9F 4HT8A 4M78B 4M7AF 5GMKl 3V7RA 4PJOC 1WPYA 2JN0A 4X9CA 4M7DD 4EMKA 4XTXA 4C8QE 3SWNA 4M7AC 2E65A 4NL2A 1B34A 4M77G 1N9RA 4JRIA 3QO3A 4M77D 3JB9I 2DZCA 3JB9G 5CAIA 5GANd 1WQ7A 4M75G 4M78C 4C92B 4NOYA 1I4K1 2DXUA 4MMLA 4PJOG 1I8FA 2HNIA 5GAN4 4XTUA 3EFSA 4XQ3A 4M77C 2EJ9A 3V8JA 2E1HA 4M78A 3V7SA 2FB7A 1TH7A 4C8QG 1WQWA 4C8QB 1LJOA 3JCMf 2DVEA 2VC8A
chains in the Genus database with same CATH superfamily
2PQWA 1N6AA 4PFOA 3P8DA 2LCLA 2M0YA 1Q81C 3RKWA 2B86A 2RHYA 1WHGA 2X4YA 3HPWA 3CC7A 2CZ6B 2ZPEB 3JCMc 3G4SQ 4J7IA 5GJWB 2EPDA 3CMEQ 2CSQA 2I2LA 4OP0A 1K8AR 3VS0A 1HK9A 4ZTJA 2WSCE 3OYAA 4ZN1A 5KYWA 1D1CA 3G71T 1JJ2S 1OYXA 4PFZA 1VQMQ 1VQ5Q 2CGHA 4OMPA 4M7AG 2AIRB 5EG2A 5GMKj 3GIBA 4BY6C 2WACA 1WHHA 3EG0A 4HVVA 1X2QA 2O31A 2DLPA 4RCBA 3CPFA 2KVQG 4RTXA 1E6GA 1X75C 2QGFB 1LCKA 2YUNA 2DFUA 2FZKB 2DD5A 5C0MA 3JCMg 3M4YA 2AKKA 2A3LA 3J81E 4RTTA 2GF7A 1NE8A 3EG9B 3EGUA 4C8QF 5FRNA 2KBTA 4IUTA 1YIJA 3V8KA 1VQ5T 4M75D 1AOJA 1JB0E 3SB2A 2R5AA 3OW2P 2X35A 2QAZA 3A8GB 1PNJA 3HKSA 4XAXB 1WX6A 3L2VA 2RH2A 3EG2A 3FLGA 3JB9I 4KULA 4NOYA 2F2WA 2DEUA 4IIMA 4DBRA 4M78A 4OVAA 4IUUA 3VKIA 3VRZA 3OYLA 3L2UA 3CXCA 1W2BP 2KSSA 4LDWA 2PVDB 2XMFA 2HSPA 1WA7A 5AYFA 1JU5C 3A8MB 1UHCA 3L1AA 4Q5WA 4BE2A 1N27A 2VKNA 3QG1A 4C8QD 1M1FA 2GFUA 3QYHB 5GAMg 2LC4A 1EIFA 3JCMe 3VUZA 2O4XA 5DLOA 5GANg 4HCZA 4IKFA 3BFMA 1B34B 1OQKA 3FJPA 1UFFA 2B8AA 3HRUA 1UE9A 2RHUA 3OW2A 3M0SA 1Q7YR 1VQLQ 2O01E 5I21A 2A37A 4KT0E 4FW1A 2JM9A 2F2VA 1PCXA 4C5HA 4HXJA 2YDLA 4FYWB 4QQDA 3URGA 3A1PA 1VQPT 1QKWA 4M77F 4D6WA 1KK7A 1IRXA 2L3RA 5GAOp 2O9SA 1W1FA 2H8HA 2KYMA 1BI2A 2PVOB 2EWNA 2D0QB 1X43A 3QJYA 1BB9A 2COZA 2LQNA 2QTXA 1BU1A 5GJVB 1NLPC 1PSEA 2M9UA 3L2WA 3CCEA 4XU3A 4GLKA 5J26A 3MP8A 1VQ9T 4M75F 2LT1A 5LJ5g 4RG2A 2EQMA 4C8QE 2K9GA 4PFPA 3G4SA 4M7AC 2FG0A 1PG5B 1YJWQ 4A63B 2JS0A 1PRMC 2BUDA 2ZAEA 2LJ3A 2HEQA 1VQ6A 3VS2A 3MCAB 2V8JA 1RAAB 5KYXB 1ZLMA 3JCMb 1WGSA 1VQ6T 2PTKA 1R0BG 4J9GA 5KCHA 4RTUA 2EKHA 1R0CB 1WHJA 2J6OA 3JCMd 4A4FA 1IXDA 1SKUB 2YUOA 1XNIA 5D6WA 1K8AC 4C92F 1Y71A 1VQ9A 1I81A 4C92D 4AG2C 1M90U 4C8QA 5CQXA 5LJ5j 1X27A 2JNGA 1SHFA 3G7ZA 3CCRT 4N0AC 1NLOC 5GANe 4FYXB 2EQKA 1WDXA 3UWNA 1OU8A 1UJ0A 3CD6T 4LXCA 1UG1A 4M75B 2KDSA 2HBWA 4J9HA 1X6GA 1KFZA 2PU9B 3S3MA 1TOVA 2HSEB 1XQHA 4PJOD 2DYBA 4ZNXA 2RI3A 1FMWA 1B07A 2K5IA 1SG5A 2P0QA 3H9NA 4MDWA 1AVZC 5A0DA 3OYEA 1YI2T 2DA9A 2YT6A 2PNIA 4DOVA 4C8QC 4XTYA 3EFOB 2E41A 2P4RA 2QXFA 5LJ5f 1U5SA 3CCEQ 3C12A 3PMTA 1YIJQ 3L2ZA 2OTLQ 1RI0A 1VQMA 1KQSP 3FDRA 3QZ5B 5GAOr 1VQ8A 1BCMA 2JN0A 1VYTA 1GRIA 1TTHB 4O6JA 4E47A 3QXEB 3M0PA 1BI1A 4AFQC 5GANd 1Q7YU 5GAN4 2QQAA 3EFSA 4X34A 3L42A 1YI2Q 3LGFA 4JZ4A 2M0OA 1PD1A 2K2MA 2VWFA 3VS3A 3VS7A 1LJOA 2CUBA 3QBYA 1PKSA 4HA8A 3EGDB 4M7AA 2CS7A 4KH1B 4C0DC 1Q7YC 1YIJT 4A4EA 4M7AB 1D1BA 3EGDA 2OTLT 2LCSA 2CP6A 4R0KA 1VQKA 1I07A 2JTEA 2QYZA 4JLIA 3CEYA 3GP8A 4BD3A 1S1NA 4AFSC 5HK3A 5IN1A 2RK1A 2DBMA 2EGCA 1QCFA 5GAN6 2QQBA 4ZGJB 1W6XA 4C92A 4M4ZA 2PZ1A 1SRLA 2D0NA 1Q81R 3OMCA 5GAOq 4OGEA 2DZ9A 4BB7A 4JJBA 3QJ6A 4TVRA 4LNPA 4J6YA 3JCMh 3NPFA 2D9TA 4L5GA 2A0FB 3QZ9B 3QWYA 1XOVA 2IIMA 2A28A 1WJQA 1IZ6A 3CCQA 1QCNA 4F7UG 5FRMA 2JTFA 2E5KA 2QQRA 1SSFA 2GCXA 2BIVA 4O5VA 4F04B 5GAOn 2BZYA 3MEVA 4OGCA 2G3RA 2YUPA 3KUFA 1JQQA 5GAN5 5CKHA 1VQ4Q 4OMQA 2HQEA 2RB6A 1VQ4A 2PVGB 3RESA 3CCST 4LDXA 5I11A 1ZSGA 2LVMA 3M0RA 1S72T 3S3NA 4LDVA 2IVWA 4EMKA 1KD1R 2PUKB 1QCOA 2O88A 1OEBA 3DLMA 1EX4A 3RNJA 2BTTA 1ACMB 2HAXA 2QEXT 2DL5A 4M78C 2JS2A 1I4K1 2K3YA 4PJLA 2JOYA 1RLPC 5KYNA 5M9OA 3OMGA 1YHQQ 2H3EB 1NM7A 2LQKA 2NLUA 3MEUA 2KY9A 1T3SA 2HQHA 1YITQ 1ZUKA 2K5LA 3M4GA 3CCSQ 4X1VA 2C0TA 3ULRB 2KMTA 2E6ZA 1N8RR 1UGVA 2CP2A 3MEWA 1YJNT 2LX7A 2VXFA 2E10A 3PGGA 3REAB 4JS5A 4BE1A 2RN8A 4J9CA 2K5FA 1GCPA 1JJ2A 5GAN7 1VQ7A 2X4XA 2LJ1A 1K0SA 1YP5A 4JRQA 2DM1A 3VJPA 1YHQT 3EGXA 4QQ6A 2GGRA 4ELYC 1MHNA 3H8ZA 1Q95G 1G3SA 1VQ7T 4M7DA 4E7LA 4ESRA 3SWNB 1LNXA 1NPRA 2K6DA 2JM8A 3KFVA 2JMCA 1YJWA 5CKFA 1Y7XA 1BYMA 3MP1A 4FYVB 4QW2A 3L2QA 3EHRA 4RCCA 5DM7R 1I5OB 3E2UA 5GANh 3VS4A 3UA7A 2CP3A 1E7OA 7AT1B 3WVDB 1ZUYA 1AZEA 5CR2A 4M75E 1UHFA 1AT1B 1FYNA 1PKTA 5FU6B 3X26B 2V8KA 2X4WA 4A54A 4M7DD 3QWXX 3CMEA 2A7YA 1B34A 4M77G 1UGPB 1S72A 3I56T 2O4XB 1MNEA 4RTWA 3GOXA 2RHZA 2DAQA 3GNGA 1NJIU 1K0XA 4MDXA 2Z0WA 1GBRA 5C6SA 2QDLA 1MMAA 4XTWA 3OYMA 1KD1U 1H641 2HDAA 3CCMT 3QPHA 3VS1A 1VQPQ 3RBBB 1LOJA 3I55T 1QVGS 3META 3CCSA 1IGQA 2KEAA 1UUEA 2HL5C 2YLBA 3QHSA 4PJMA 4M75C 3CPWP 1V29B 2ATCB 3KBGA 4J9BA 2H3JA 1PSFA 3M54A 4XK8E 5LJ3f 4DBFA 2HL3A 4IIOA 4BY6B 4J8OA 5I2SA 2KNBB 1SF9A 3LWHA 1OZ3A 1CKBA 2L89A 3OS2A 5KYYA 2MCNA 3THKA 3VYHB 4OB2B 5AT1B 2CP0A 1GCQA 4C92G 4KGXB 1G2BA 1QVGA 3RMSA 5CIUA 1C1AA 1T3LA 1YITA 5LJ5d 4GBQA 4DEYA 1GFCA 1VQKT 3NTHA 4FT2A 2ENMA 2BE7D 1JXMA 1WFWA 1OI1A 3CC4T 4LD9K 3QIIA 2GQVA 3UA6A 3O8VA 3WVEB 1RI9A 1Q82R 5HY6A 1D09B 2KE9A 4Y92A 1U1TA 1M27C 4PKCC 4F7UA 1OU9A 3A8HB 1BI3A 5CQYA 2X3XD 2E3HA 5DY9A 4CI0C 3GPLA 4HT8A 4N4HA 5GMKl 4EIKA 4XTXA 3OYYA 3MP6A 5HCKA 5CK9A 2JUFA 3CBPA 2FPDA 2XHCA 4M75G 4OF1A 2O2OA 1G5VA 1VQMT 2EJ9A 3V7SA 2BKDN 2OI3A 1K73U 5L8RE 2KYBA 1KSWA 4ATOA 3R6NA 2RQTA 4E7JA 3CCVQ 1BIAA 5GAMd 1K9MU 5GAMj 1WXTA 4PLIA 1VQ8T 1H92A 2QA4Q 3CBMA 1XJWB 2GNCA 5I2MA 2AHJB 2MWOA 1ZBJA 4XTVA 2HMAA 2DPPB 3LYIA 1B3QA 3CCUQ 5GAMe 2IG0A 1F1BB 3EG3A 3EGXB 4J7FA 2RJDA 5HKCA 5GMKe 2DMOA 3JCMJ 2D8JA 4M7DB 2V1QA 1WHMA 3TREA 3I35A 2KAFA 2KXCA 3VRYA 3QDRB 5FWCA 2LP5A 1M2OA 2VUBA 4YTLA 4IUPA 2F69A 4PL6A 1W4SA 1M2VB 3OY9A 2JT4A 5GANf 1KIKA 3JV3A 4OMLA 4LD6A 4ANJA 4RTYA 3CMET 1R77A 3MPUB 3A98A 3LW5E 1Q82U 1C6VX 3IQLA 3G71Q 1WNLA 3TVTA 2DKGA 3REBB 2K79A 4PJOC 3CXCS 2EGAA 2DO3A 2LQ8A 2VVKA 4LUEA 2CT3A 1SPKA 5DLQE 1M1KR 2DZCA 2JTMA 5CO7A 1MMDA 1WQ7A 1YCSB 3M53A 2OTJQ 4MZPA 1DJ7B 2HD0A 4C8QG 2R5MA 1WQWA 2J6FA 3X24B 5LJ3e 4M77E 1RAFB 1G3WA 3RIRA 1OX9A 3E9GA 4ZGEB 4RTZA 2HBPA 1MV3A 3I9QA 4LDYA 4DEXA 2ZPBB 3VS5A 3EFRA 1HD3A 3VS6A 3I5SA 3CC2Q 3CMAT 4M7AD 4OMMA 5LJ3h 1Y57A 1TWBA 3LGLA 1NJIC 1BIBA 2CT4A 2KRMA 2F5KA 1A0NB 2PUOB 3ER0A 2ROLA 1OX8A 1M2VA 4PJNA 3DB3A 1BBZA 2GTJA 1PD0A 2GQIA 1IREB 1KQ1A 5KE3A 1Q82C 5CKBA 1VQ9Q 3NGPA 2DL3A 3AT1B 1GBQA 1S72Q 4BI8B 8ATCB 2EQUA 4FU6A 4A4GA 4F17A 4DQ2A 2FPEA 3M0TA 5IXFA 3OYNA 1G8XA 2D1XA 2DL4A 2LNVA 4XU0A 4L6V5 2DNUA 5CVIA 1OZ2A 3JCMV 3CC2T 4N4GA 4Y91A 4DBHA 3DB4A 3BDUA 4CC7A 1D3BB 4EMHA 5KCOA 1JRIA 1RAIB 1K4US 1M3BA 3CCRA 3MO8A 3CC7Q 3FEOA 1D3BA 2DK3A 5FLXE 2M16A 2QK0A 1X01A 4MZMA 3F70A 1XTDA 2CZ7B 2OJ2A 1TUGB 2YUQA 1WPYA 1BI0A 1YJNQ 3ME9A 3SWNA 1PHTA 3LWIA 4RKUE 4JS4A 4JRIA 4Z89A 1AD5A 2YRCA 4BACA 2DVJA 2CP5A 4MMLA 1VA7A 4XTUA 2X3WD 1UJYA 1ZBXA 1TSFA 2F5TX 2RQWA 1TH7A 5CKDA 5GAMf 2RMOA 2M1HA 2OAWA 1M3AA 3EFOA 4N0AA 1JBMA 4F7UB 2GFAA 2ECZA 3D7SB 2QA4A 1TUDA 1YJ9Q 1VQNA 1VIFA 4X9DA 1M4ZA 1T0JA 2NYSA 4OB0B 1FXXA 1QWFA 3PNWC 4QT7A 1AWJA 2JXBA 3JB9H 1PM3A 2CP7A 3DKMA 5LJ5h 4OB1B 2RA2A 1KQSS 2EVRA 1CKAA 3M57A 4M78G 2C0IA 2P0PA 3CCET 5GANj 3GLXA 3ZFJA 2X9HA 4IURA 1YJNA 4BE0A 3J7AF 1QVGP 3TEEA 1OPKA 4C0ZA 1UGQB 2WSEE 3JCMW 4ZGDB 2VGMA 1P92A 1KC8U 2JZ2A 1UEBA 2EQJA 1ZX6A 2P4TA 2DIQA 1VQPA 1NPPA 2MMPA 4JJDA 5LL6S 5FU7B 1YJ9T 3I56Q 1Q86U 3HTRA 3MKDA 1O75A 5FWBA 1PRLC 3HFOA 1VUBA 1KQSA 4QVZA 5J39A 4KRTA 2XKOC 2ZPHB 1QVPA 2ESWA 3ZL7C 3OYJA 3VUBA 5IHIA 4LDUA 2E3IA 2RD1A 3CCRQ 2ZPFB 1UGRB 3CCLA 4MMKA 2LT4A 3MJXA 3ZEHA 4RUGA 3PIOA 4HVUA 2DILA 3JB9G 4C92B 2KK4A 2Y4YA 2RQVA 4J83A 4B9WA 4UC4A 4LUDA 3L2RA 3WXMB 1NBEB 1ZA2B 1VQOQ 4AT1B 2A36A 3SFMA 3V8LA 1NEGA 2BZ8A 2EW3A 4M7DC 1HXDA 3HSBA 4XU1A 1NZ9A 1Q81U 3X20B 1VQKQ 1FMVA 2EGEA 3CCQT 2DL7A 3GF5A 4R56A 3CC4Q 2XG8D 5GAN3 3CCJQ 3OYKA 1VQ5A 2ZCFB 2A08A 2MPXC 2ZZDA 5A2QE 3A8OB 2F2XA 2NUPA 5GAN2 1VYUA 2DXTA 1C0MA 2DYIA 2JMAA 2YRDA 1M9SA 3JCMX 1QP2A 2CYZB 2ED0A 1HJDA 3M0QA 4A4KA 4AFUC 2EYZA 4Z8AA 3S6WA 3QUIA 2ZPIB 1K73C 5GMKm 1Y0MA 1KQ2A 2VB6A 4J9EA 2Y4XA 1B7TA 3OYDA 4ELZC 1VQNT 3G6EA 4GLMA 2FZGB 1SEMA 1QMCA 1JJ2P 2WSFE 3CCQQ 4E2FB 4NS5A 2C0OA 4F16A 1UB4A 1CSKA 4PJOE 4J9FA 2HQXA 3PFSA 3G71A 3SDZA 2RQUA 5FU7C 1D0YA 3SHWA 4M7AE 1WXBA 2HCKA 1FWZA 4CC2A 2W10A 3PVLA 5ECAA 3CXCP 1W2BA 2DTOA 3PMIA 3JB9J 4M7AF 4ME7A 1AWWA 4M78B 1FMKA 2KT1A 3PVQA 1K76A 4CC3A 4C5GA 2KXDA 1WLPB 1JXOA 3G6EQ 2YSQA 5KYYB 4PJOG 3QDFA 3NTIA 2LRQA 3I56A 1NYFA 4C8QB 2DVEA 3NHNA 1M90R 2RQRA 1ZQ1A 4AFZC 2IPOB 4JJCA 4C0GA 1VQ4T 4HCBA 2J05A 1O9SA 3HL8A 3CPWA 1H3ZA 2EJFA 4GY5A 4BDZA 4C92C 3H6ZA 2AK5A 1QVFS 1U1SA 3OB9A 1RUWA 3M56A 2MK5A 2R57A 2VGNA 4EMKC 3G6ET 5KYXA 1U06A 1M1GA 2ZPGB 1SRMA 2CH4W 1AWXA 4E7HA 1X6OA 2FZCB 1MGQA 2L3SA 2ED1A 3EHQA 2K4YA 2Y90A 3EH2A 4M78F 3TU4K 2FYKA 4FT4A 1RAGB 3OQ5A 2LZ6B 3JSCA 4LN2A 4E7IA 2HKQB 1VYVA 1VOMA 1M8MA 3GNFB 4HCKA 1IHWA 2YRVA 2MAMA 4B9XA 1X69A 1QVFP 3CCLQ 3CCMQ 2RJCA 1ARKA 1MNDA 4HT9A 3CMAQ 1VQLA 1HYOA 4JPBW 3JCMQ 2EIFA 4B6MA 2RO0A 1K9MR 3OS0A 3OYGA 2JVVA 2DD4A 3M55A 1MV0B 2QDYB 3HHTB 5KYUB 2DXUA 2KT8A 2KROA 2COWA 4PLLA 4M77C 2E1HA 2NWMA 2KI7A 2LDMA 1K1ZA 2EYXA 1UTIA 2FPFA 4X9CA 4JUVA 1EZZB 1K8AU 4E7SA 1WHLA 4DOWA 5IHKA 2RM4A 3CCLT 3OYHA 2O9VA 3OYIA 2EAYA 1M1KC 3M0UA 1GCQC 3NMZC 2HZYA 3VV0A 1Y96B 2XDDA 5CKEA 3G1JA 3OYCA 2FRWA 2LNHB 4V2SA 2JW4A 1UDLA 1LPLA 1AEYA 4F7UF 3E19A 4OMNA 1RLQC 2RHIA 1YWPA 2YHTA 1KG1A 5KYUA 3Q1JA 3CC7T 2NUZA 3BE3A 1D0XA 1YFNA 3HRSA 4FYYB 3H0HA 4M75A 4N4IA 1PWTA 3N5BB 2DRKA 4HCCA 4JRKA 4WCIA 2RJEA 2CZ1B 3CD6A 1QP3A 5IT9E 1IGUA 4EMKB 3JAME 2LMJA 1WHKA 5GMKi 3I55Q 3FB9A 4C5EA 1Y07A 2CDTA 2M02A 3FRNA 3UT1A 2E70A 1NYGA 2MWPA 2XDBA 4M7DG 4M78E 4HKEA 3OBYA 1ABQA 3H0IA 4JRPA 4J5YA 3CCVT 4A4HA 4FSXA 5D7UA 2E4HA 5IH2A 2ABLA 1VQ8Q 2D8HA 1W70A 2DTHA 2QA4T 3E1SA 2ROTA 4QKUA 4C0FA 2E5QA 3VU3C 1VQLT 3S3OA 5FROA 3FJ5A 3UDCA 2XI9A 3J80E 1RAHB 5IHNA 3UATA 1IB8A 1WZOA 3CQTA 4BUGA 5CAIA 1K9MC 2HNIA 4IUVA 5KYWB 1U3OA 1WJSA 2FB7A 2LX9A 1AHJB 4Y28E 3PTAA 4AG1C 2QQSA 1G3TA 2X4JA 1I0CA 2DL8A 2YLCA 1WJRA 3U23A 5FU6C 5A0GA 2E64A 2YXYA 5IAYA 1I1JA 3RKXA 4WF2A 4BDYA 2P84A 3VYGA 1N8RU 4D8DA 3QKJA 2JJ9A 2L3PA 3T9NA 2I0NA 3CC2A 2LCCA 4ZN3A 3JB9D 3ASKA 2XU8A 4OMOA 4K11A 2NUTA 1J3TA 3FIFA 3E9FA 2MOXA 4JLGA 2EYQA 3TCJA 4F7UE 5GAOl 3NFCA 1FX7A 4M77A 1D1AA 2QQ9A 4J9DA 1UECA 2RI5A 1RABB 4M78D 2SEMA 2L5QA 1YWOA 4CC4B 3JCMP 2EKOA 3V7CA 2AZVA 1N9SA 3C4SA 2OTJT 5GAMh 4JDSA 4QQGA 3CCUT 2RNAA 3CMAA 2DJQA 1ZSZB 2XDPA 2MF2A 4PJOB 2KRNA 1X2KA 1I5LA 4AMCA 4C92E 3OSVA 2CH4A 4A53A 2KRSA 2DRMA 1V1CA 3NTKA 5A0LA 4LE9A 2CKKA 2LJ0A 3M5AA 1W2BS 3OS1A 3CCJT 1KC8R 4FM4B 4WTOB 1TUCA 2YWWA 2J06A 2QTVA 2EFIA 1KD1C 4P5NA 3HP9A 1I8FA 4E7ZA 2DXBA 2DIGA 3JCMf 4XU2A 3UF4A 3CCVA 3RUXA 3X25B 3SWNC 4NL3A 2AT1B 3EG9A 2BZXA 2MI6A 3CC4A 2C06A 2K3BA 2COYA 3OS5A 3C0CA 4PJJA 5FW9A 1QKXA 5HK0A 1NJIR 5LJ3d 2BE9B 2VYTA 1RL2A 2GBQA 5EC7A 3OA6A 2SRCA 2FL7A 1AWOA 1YCYA 1JEGA 1PC0A 2RI2A 2XK0A 4PJOF 1QW1A 2AKLA 3AHUA 2OTJA 4PNOA 2VXEA 3MEAA 3MHXA 2L2PA 4QVCA 3CPWS 1Q86C 4RG8A 2M51A 3TQ7P 2DXCA 1GFDA 3C94A 2K57A 1VIEA 3SEMA 2OX7A 2L3QA 2DF6A 1KC8C 2QG9B 2RHXA 3OSSC 3I55A 3CCMA 2EJGA 3HRTA 4FW2A 4EMGA 1QVFA 2E6NA 3R6OA 1RAEB 4DBQA 2XIDA 3RERA 1SHGA 3LX7A 2DX1A 1U8RA 3HFNA 2EQIA 4EPCA 2CSIA 2RF0A 1RADB 2CUDA 2DEQA 3CBOA 3JB9F 4M7DE 1KHIA 3V7RA 2LQWA 2RJFA 1KJWA 2FRYA 2EYYA 1UGSB 3PIPA 4NL2A 1AZGB 3EH1A 1N9RA 2LTOA 3QO3A 2CREA 1ZSZC 4HVWA 2AZSA 2MIOA 1JO8A 4EDUA 1M3CA 3M58A 1G3YA 3RR6A 4L59A 1WI7A 2XD0A 2XICA 2P0KA 4KUDK 4PJOA 2L8DA 3EAEA 1MMNA 2D6FA 2EYWA 2FO0A 2V8IA 4R55A 2QI2A 4RTVA 5IXBA 1IO6A 1OV3A 3O5ZA 1ZHIA 3C95A 1M8VA 4FSSA 1X6BA 2CZ0B 1YJWT 1OULA 3RDVA 3BY7A 3OBWA 1BK2A 1Q86R 4OMFB 4II1A 5GAOm 2QEXQ 1QQJA 4RMOA 2OTLA 1WIEA 2NUPB 1QWEA 2FHDA 3H0FA 2KGTA 5J3BA 1YNZA 1YHQA 4M77B 1VQOA 2DBKA 4Z88A 8AT1B 5LJ5e 4FCYA 1VQ6Q 2K2VA 2NUTB 1T0HA 1YITT 5KH6A 3QSUA 3JRZA 5KE2A 2FVUA 2E12A 4D8KA 1K73R 1SSHA 3I5RA 4E6RA 4MZTA 3BDLA 1WYXA 3CCJA 4J6WA 1OPLA 1OOTA 4OB3B 9ATCB 1YBYA 1K9AA 5I22A 4BI3A 3SD4A 1E6HA 4F14A 5CCAA 3P8HA 3TSWA 3CD6Q 1VQ7Q 4KUIA 1EFNA 1M30A 1Z9QA 2QEXA 3CCUA 3GBQA 2E65A 3FC3A 2R58A 4ZTFA 3OYBA 1ABOA 2DERA 4JZ3A 1M1KU 4VUBA 4IUQA 2OAUA 2KR3A 4XQ3A 3OYFA 2X51A 3V8JA 6AT1B 1QLYA 3M59A 2GTOA 2VC8A 4E7KA 1TU0B 1D0ZA 3LH0A 2J6KA 5GMKh 4FL6A 2RPNA 2DETA 2K3XA 1YI2A 4XTZA 3RMQA 2KQWA 1H8KA 4FIBA 4J6XA 4BI4A 2K7AA 4KBMB 1YJ9A 1VQNQ 4DA4A 2DJZA 3RKYA 1YN8A 1TXQA 1RACB 4Z02A 1M5Q1 2EBPA 2QASA 1Z9ZA 3OW2S 1V76A 4KGVB 3DLLA 3H41A 3TSZA 1H3HA 3P8BB 1WXUA 1LVKA 4CRIA 1GXIE 3M9QA 2VASA 2MYSA 4QVDA 2F1LA 1VQOT 1N5ZA 2DTIA 5LJ3g 4KH0B 1BKBA 3QYGB 2FEIA 4PK4A 5LJ3j 2V26A 1G83A 1GL5A 1KHCA 1Y96A 2L0AA 1MMGA 5D6YA 1BCOA 3LLRA 3INZA 5GAN8 4ORZA 1ZA1B 3PE0A 1ZSZA 3BW1A 4J9IA 3LH5A 1NG2A 4C0DB 2HKNA 3KXTA 2DE0X 4M7DF 4KGZB 1M90C 3ZBDA 4C5IA 3EG1A 1IHVA 1MUZA 5L23A 2VV5A 2ZGWA 3UPUA 1ZUUA 3G4ST 3A8LB 1R8OB 3X28B 5D6XA 3A5ZB 1HSQA 2V1RA 1NEBA 2W0ZA 4M77D 2J7IA 3PT9A 4JJNK 2QGGA 1TS9A 1TG0A 2RK2A 2G6FX 1N8RC
chains in the Genus database with same CATH topology
2NLUA 2M1HA 1N6AA 2PQWA 4N0AA 3P8DA 3PTAA 3MEUA 2LCLA 2KY9A 2QQSA 1G3TA 2X4JA 1JBMA 4F7UB 2GFAA 2YLCA 2QA4A 1Q81C 1WJRA 3RKWA 1VQNA 2K5LA 3M4GA 1VIFA 4X9DA 5FU6C 1M4ZA 4OB0B 5A0GA 2E64A 2RHYA 3HPWA 2X4YA 1FXXA 3RKXA 5IAYA 2CZ6B 4WF2A 3CC7A 4BDYA 3PNWC 2KMTA 3VYGA 2ZPEB 3JCMc 1N8RU 4J7IA 3JB9H 2E6ZA 1YJNT 3MEWA 3DKMA 3QKJA 2I2LA 4OP0A 5LJ5h 4OB1B 2VXFA 2E10A 3PGGA 3T9NA 1HK9A 4M7DE 4ZTJA 2WSCE 4JS5A 3CC2A 2LCCA 2RA2A 4ZN3A 4BE1A 3JB9D 1KQSS 2K5FA 3M57A 1JJ2A 5GAN7 3ASKA 4M78G 2P0PA 2XU8A 3OYAA 5GANj 3GLXA 3ZFJA 4ZN1A 2X4XA 1VQ7A 3CCET 3G71T 1JJ2S 1OYXA 3FIFA 4IURA 3E9FA 4JLGA 3TCJA 2EYQA 4JRQA 1YJNA 4BE0A 4F7UE 3VJPA 5GAOl 2CGHA 1YHQT 3J7AF 4M7AG 5GAN3 5EG2A 5GMKj 3NFCA 4QQ6A 4ELYC 1FX7A 1MHNA 3H8ZA 4M77A 3TEEA 4BY6C 1G3SA 1UGQB 2WACA 2WSEE 4C0ZA 4ZGDB 3JCMW 2QQ9A 1VQ7T 2VGMA 4M7DA 1P92A 1KC8U 4E7LA 3SWNB 2JZ2A 1LNXA 1UEBA 2EQJA 1NPRA 2P4TA 2DIQA 2RI5A 4M78D 1VQPA 1NPPA 2MMPA 5LL6S 1YJWA 5FU7B 2L5QA 4RCBA 1YJ9T 5CKFA 1Y7XA 3CPFA 2KVQG 1Q86U 3MP1A 2EKOA 3JCMP 1BYMA 1O75A 3V7CA 1N9SA 4QW2A 3L2QA 1X75C 3HFOA 1VUBA 3C4SA 4RCCA 2OTJT 5DM7R 5GAMh 4QVZA 5J39A 1KQSA 2DD5A 4JDSA 5C0MA 3JCMg 5GANh 3M4YA 4QQGA 3CCUT 2XKOC 2A3LA 3CMAA 2ZPHB 1QVPA 3J81E 3OYJA 2XDPA 2GF7A 1NE8A 3WVDB 3VUBA 2MF2A 4PJOB 4C8QF 4LDUA 5FRNA 2RD1A 5CR2A 2ZPFB 1I5LA 4M75E 1UGRB 4C92E 3OSVA 4IUTA 1YIJA 3V8KA 3CCLA 4A53A 1VQ5T 4M75D 5FU6B 3X26B 1JB0E 2V8KA 3NTKA 4MMKA 3SB2A 2LT4A 2X4WA 4A54A 5A0LA 3ZEHA 2R5AA 2X35A 2CKKA 4M7DD 3M5AA 3PIOA 1W2BS 3A8GB 3OS1A 3CMEA 3CCJT 2A7YA 1B34A 3HKSA 4FM4B 4XAXB 4M77G 3L2VA 2RH2A 1UGPB 3JB9I 3FLGA 3JB9G 1S72A 3I56T 2EFIA 2O4XB 4KULA 4C92B 4NOYA 1KD1C 4P5NA 2KK4A 3HP9A 1I8FA 2Y4YA 3GOXA 2RHZA 2DAQA 4J83A 4B9WA 4UC4A 3GNGA 1NJIU 2DXBA 4M78A 3L2RA 4OVAA 3WXMB 2DIGA 4IUUA 3VKIA 3OYLA 4MDXA 3JCMf 5C6SA 4XU2A 3L2UA 3CXCA 4XTWA 2KSSA 3RUXA 4LDWA 3X25B 3CCVA 3SFMA 3V8LA 3SWNC 3OYMA 1KD1U 1H641 2PVDB 4NL3A 3CCMT 5AYFA 2MI6A 3QPHA 3A8MB 3L1AA 1HXDA 4M7DC 3I55T 1LOJA 4Q5WA 4BE2A 1QVGS 2C06A 1N27A 3META 3CC4A 3HSBA 4M7AF 4XU1A 3CCSA 1NZ9A 1Q81U 3QG1A 3X20B 2YLBA 3QHSA 4C8QD 1M1FA 3OS5A 3CCQT 2GFUA 3QYHB 4M75C 5HK0A 3GF5A 1V29B 5GAMg 2LC4A 5LJ3d 4R56A 2VYTA 1EIFA 2XG8D 3KBGA 1RL2A 3JCMe 2H3JA 1PSFA 3M54A 4XK8E 5LJ3f 2O4XA 3VUZA 5DLOA 3OYKA 1VQ5A 5GANg 2ZCFB 4HCZA 3OA6A 4IKFA 2FL7A 2ZZDA 1YCYA 3BFMA 5A2QE 3A8OB 1B34B 3FJPA 2RI2A 2XK0A 4J8OA 4BY6B 2B8AA 3HRUA 5I2SA 5GAN2 3LWHA 2DXTA 2RHUA 1OZ3A 4PJOF 1QW1A 3OW2A 2L89A 3OS2A 1M9SA 2O01E 3JCMX 1QP2A 2CYZB 5I21A 4KT0E 4A4KA 3VYHB 4OB2B 3AHUA 2OTJA 4PNOA 2VXEA 3S6WA 4C92G 3QUIA 3MEAA 3MHXA 2ZPIB 4C5HA 5GMKm 1K73C 4QVCA 3CPWS 1QVGA 1KQ2A 3RMSA 4RG8A 5CIUA 1Q86C 4QQDA 3URGA 2Y4XA 1YITA 2DXCA 5LJ5d 3OYDA 1VQPT 4M77F 4ELZC 3C94A 3G6EA 1VQNT 2K57A 4D6WA 1VIEA 2L3RA 5GAOp 1VQKT 3NTHA 4FT2A 1KC8C 2RHXA 2WSFE 1BI2A 2PVOB 4NS5A 2EWNA 3OSSC 1OI1A 2D0QB 3I55A 3CC4T 3CCMA 2EJGA 3QIIA 1UB4A 3HRTA 4LD9K 2GQVA 3WVEB 3O8VA 4EMGA 3QJYA 1QVFA 4PJOE 2HQXA 2E6NA 2QTXA 5HY6A 3PFSA 3R6OA 3G71A 3SDZA 2XIDA 3L2WA 1PSEA 3RERA 2M9UA 5FU7C 1U1TA 3LX7A 4XU3A 3CCEA 1U8RA 4GLKA 4PKCC 1FWZA 3HFNA 5J26A 4F7UA 4M7AE 3MP8A 3A8HB 4EPCA 1VQ9T 1BI3A 5CQYA 4M75F 2LT1A 5DY9A 1W2BA 5LJ5g 4CI0C 2DEQA 2DTOA 3CBOA 3PMIA 4ME7A 3JB9J 3JB9F 3GPLA 4HT8A 4M78B 1KHIA 4N4HA 3V7RA 5GMKl 2RJFA 2EQMA 4RG2A 4XTXA 4C8QE 3OYYA 4C5GA 1UGSB 3G4SA 4M7AC 3MP6A 5CK9A 3PIPA 4NL2A 1N9RA 2LTOA 2JUFA 3CBPA 3QO3A 2XHCA 2BUDA 4M75G 1VQ6A 4OF1A 4PJOG 1G5VA 1VQMT 3NTIA 3MCAB 2EJ9A 2V8JA 2LRQA 3V7SA 4EDUA 2BKDN 3I56A 1K73U 4C8QB 3M58A 5L8RE 2DVEA 1G3YA 4ATOA 4L59A 4E7JA 1ZQ1A 3JCMb 1BIAA 1WGSA 5GAMd 1VQ6T 4C0GA 2XD0A 1VQ4T 2XICA 2P0KA 1K9MU 4HCBA 5GAMj 4PLIA 1VQ8T 4KUDK 4PJOA 2L8DA 5KCHA 3CBMA 3EAEA 1O9SA 2D6FA 5I2MA 3HL8A 2AHJB 2V8IA 4R55A 2QI2A 3CPWA 1H3ZA 2MWOA 2EJFA 3JCMd 4GY5A 4XTVA 4A4FA 4C92C 1ZHIA 4BDZA 3H6ZA 3C95A 1M8VA 2DPPB 3LYIA 1QVFS 1U1SA 1XNIA 5D6WA 5GAMf 3OB9A 1K8AC 2CZ0B 4C92F 3M56A 1Y71A 5GAMe 1YJWT 2R57A 2VGNA 1VQ9A 1I81A 4C92D 3BY7A 3OBWA 2IG0A 4EMKC 3G6ET 1M90U 4C8QA 5CQXA 4OMFB 5LJ5j 1M1GA 2JNGA 4II1A 5GAOm 3G7ZA 4RMOA 3CCRT 2ZPGB 4N0AC 4E7HA 4J7FA 2RJDA 5GANe 5HKCA 1X6OA 5GMKe 2OTLA 3JCMJ 1MGQA 2EQKA 2FHDA 4M7DB 3UWNA 3TREA 5J3BA 1YHQA 4M77B 2KAFA 1VQOA 3CD6T 3QDRB 4M75B 5LJ5e 2K4YA 2KDSA 2VUBA 2Y90A 4YTLA 4IUPA 2K2VA 2F69A 2PU9B 4M78F 3TU4K 1YITT 3S3MA 4PL6A 1W4SA 2FYKA 4FT4A 4PJOD 1XQHA 5KH6A 3QSUA 3JRZA 3OY9A 2RI3A 5KE2A 2K5IA 2P0QA 2FVUA 3JSCA 3OQ5A 4MDWA 2E12A 4E7IA 5GANf 4MZTA 5A0DA 3OYEA 3BDLA 1YI2T 4LD6A 4DOVA 3CMET 3CCJA 4J6WA 3GNFB 4C8QC 4XTYA 2E41A 3LW5E 2YRVA 2MAMA 2QXFA 5LJ5f 1Q82U 4B9XA 4OB3B 3C12A 1YBYA 3PMTA 4BI3A 1WNLA 3SD4A 3L2ZA 2DKGA 2RJCA 5CCAA 1RI0A 1VQMA 3P8HA 4HT9A 3FDRA 1VQLA 3QZ5B 3JCMQ 5GAOr 2EIFA 4PJOC 1VQ8A 2JN0A 3CXCS 4KUIA 2QEXA 2DO3A 2XDBA 2RO0A 3CCUA 2LQ8A 3OS0A 2E65A 4O6JA 4E47A 3OYGA 2JVVA 2DD4A 2R58A 3QXEB 3FC3A 3OYBA 4ZTFA 3M55A 1BI1A 5DLQE 2QDYB 3HHTB 2DZCA 5GANd 2JTMA 5CO7A 1M1KU 1WQ7A 2DXUA 4VUBA 4IUQA 1Q7YU 2OAUA 3M53A 5GAN4 2QQAA 3EFSA 4X34A 4MZPA 4M77C 4PLLA 1DJ7B 3L42A 4XQ3A 3LGFA 3V8JA 3OYFA 2E1HA 2M0OA 2HD0A 2LDMA 2R5MA 4C8QG 1WQWA 1LJOA 3M59A 4X9CA 3X24B 2VC8A 4JUVA 5LJ3e 4E7KA 1K8AU 3QBYA 4M77E 3LH0A 4DOWA 5GMKh 1G3WA 4HA8A 3RIRA 4FL6A 3E9GA 4ZGEB 2K3XA 1YI2A 4M7AA 2CS7A 1Q7YC 4C0DC 4XTZA 2HBPA 2RM4A 3CCLT 1YIJT 4LDYA 4A4EA 3OYHA 3OYIA 2EAYA 1M1KC 4M7AB 3RMQA 2KQWA 4J6XA 4FIBA 3VV0A 4BI4A 2ZPBB 2OTLT 1Y96B 4KBMB 2XDDA 1YJ9A 3EFRA 1VQKA 5CKEA 3OYCA 3CMAT 4M7AD 4DA4A 4V2SA 2DJZA 5LJ3h 3RKYA 4JLIA 3CEYA 3LGLA 4Z02A 4F7UF 1M5Q1 3GP8A 4BD3A 3E19A 1NJIC 1BIBA 5HK3A 2RHIA 3OW2S 2YHTA 1KG1A 2F5KA 5IN1A 3DLLA 2PUOB 3ER0A 2RK1A 3P8BB 3Q1JA 3DB3A 3CC7T 5GAN6 4CRIA 2QQBA 3HRSA 5KE3A 1IREB 1KQ1A 4ZGJB 1Q82C 3M9QA 5CKBA 4M75A 1GXIE 4N4IA 4C92A 3N5BB 3OMCA 5GAOq 4HCCA 4OGEA 4JRKA 4QVDA 2DZ9A 4BB7A 2RJEA 2CZ1B 1VQOT 3CD6A 1QP3A 3QJ6A 4BI8B 4TVRA 5IT9E 2DTIA 4J6YA 3JCMh 5LJ3g 2EQUA 1BKBA 3QYGB 4FU6A 4A4GA 2D9TA 4DQ2A 4EMKB 3JAME 4L5GA 3QZ9B 3OYNA 5GMKi 5LJ3j 2LNVA 1XOVA 4XU0A 4L6V5 3FB9A 1WJQA 1KHCA 1IZ6A 1OZ2A 5CVIA 4C5EA 1Y07A 1Y96A 3JCMV 3CC2T 3CCQA 4N4GA 4Y91A 4F7UG 3DB4A 5D6YA 3BDUA 5FRMA 1D3BB 2JTFA 4EMHA 3FRNA 2QQRA 3LLRA 1SSFA 3INZA 5GAN8 2GCXA 3UT1A 2E70A 5KCOA 2BIVA 2MWPA 4O5VA 4M78E 4HKEA 3OBYA 3BW1A 5GAOn 4M7DG 1JRIA 3MEVA 4C0DB 4OGCA 2G3RA 4J5YA 4JRPA 3CCVT 3KUFA 4A4HA 3KXTA 4M7DF 3CCRA 3MO8A 4FSXA 5GAN5 5CKHA 3FEOA 1D3BA 2DK3A 2HQEA 2RB6A 5FLXE 2DTHA 2M16A 2QA4T 1X01A 1VQ4A 2PVGB 3E1SA 4MZMA 3RESA 3ZBDA 4C5IA 3F70A 1XTDA 1M90C 3CCST 4C0FA 2E5QA 2CZ7B 3VU3C 4LDXA 1VQLT 2VV5A 2LVMA 2ZGWA 3UPUA 3S3OA 5FROA 3UDCA 2XI9A 1S72T 1WPYA 3A8LB 3J80E 3G4ST 3S3NA 4LDVA 1BI0A 2IVWA 4EMKA 2PUKB 1R8OB 3ME9A 3SWNA 3X28B 3DLMA 3A5ZB 5D6XA 3LWIA 4RKUE 4JS4A 3GIBA 4JRIA 4M77D 3PT9A 2HAXA 4BUGA 5CAIA 4BACA 2QEXT 4JJNK 4M78C 1K9MC 1I4K1 2K3YA 2JOYA 4MMLA 2HNIA 4XTUA 5M9OA 3OMGA 4IUVA 1ZBXA 2RK2A 2F5TX 1WJSA 1TH7A 2FB7A 1AHJB 2LX9A 5CKDA 2LQKA 1N8RC 4Y28E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU2 A;  4N0A A;  4M77 E;  4XTW A;  3RUX A;  5GMK h;  4HA8 A;  3RIR A;  3V8L A;  3JCM b;  1BIA A;  3SWN C;  1JBM A;  5GAM d;  4M7A A;  4F7U B;  1H64 1;  2RM4 A;  4XTZ A;  4NL3 A;  2YLC A;  5GAM j;  2EAY A;  4PJO A;  4M7A B;  3RKW A;  4J6X A;  3L1A A;  1HXD A;  4M7D C;  3M4G A;  1Y96 B;  1LOJ A;  4X9D A;  3HSB A;  3EFR A;  4XU1 A;  2E64 A;  2EJF A;  3RKX A;  3JCM d;  4M7A D;  4WF2 A;  2YLB A;  3QHS A;  4C8Q D;  2DJZ A;  4XTV A;  4V2S A;  5LJ3 h;  3RKY A;  3JCM c;  4C92 C;  4M75 C;  1M8V A;  3JB9 H;  4JLI A;  4F7U F;  1M5Q 1;  1U1S A;  5LJ3 d;  5GAM f;  2I2L A;  4OP0 A;  5LJ5 h;  1BIB A;  2VXF A;  5GAM g;  2E10 A;  3PGG A;  3JCM e;  4C92 F;  5GAM e;  2YHT A;  1HK9 A;  5LJ3 f;  5GAN 3;  4M7D E;  1I81 A;  4C92 D;  3BY7 A;  5GAN g;  2RA2 A;  3JB9 D;  4EMK C;  4C8Q A;  5LJ5 j;  4M78 G;  5GAN 7;  5GAO m;  1YCY A;  3BFM A;  5GAN j;  1B34 B;  3FJP A;  5GAN 6;  3FIF A;  4N0A C;  5GAN 2;  5GAN e;  5GMK e;  1KQ1 A;  4JUV A;  2DXT A;  3JCM J;  4M75 A;  4F7U E;  1MGQ A;  5GAO l;  4PJO F;  4M7D B;  2CGH A;  4C92 A;  4M7A G;  5GMK j;  4M77 B;  5I21 A;  3JCM X;  5GAO q;  3GIB A;  4M77 A;  4JRK A;  4QVD A;  2DZ9 A;  3JCM W;  3AHU A;  4M7D A;  4PNO A;  2VXE A;  4M75 B;  4C92 G;  5LJ5 e;  2DTI A;  3QUI A;  3SWN B;  4J6Y A;  1LNX A;  3JCM h;  5LJ3 g;  5GMK m;  4EMK B;  2Y90 A;  4QVC A;  4DQ2 A;  1KQ2 A;  4M78 D;  4M78 F;  5GMK i;  5LJ3 j;  2FYK A;  4PJO D;  4XU0 A;  4RCB A;  5LJ5 d;  3QSU A;  4M77 F;  3FB9 A;  3JCM P;  3V7C A;  2K57 A;  1Y96 A;  5GAO p;  1N9S A;  3JCM V;  3HFO A;  4Y91 A;  4F7U G;  5GAN f;  4RCC A;  3BDU A;  5GAM h;  1D3B B;  4EMH A;  3INZ A;  5GAN 8;  2EWN A;  4J6W A;  3JCM g;  2EJG A;  4M78 E;  4C8Q C;  5GAN h;  3BW1 A;  4XTY A;  5GAO n;  4M7D G;  2E41 A;  1JRI A;  4EMG A;  4PJO E;  4J5Y A;  5LJ5 f;  2QTX A;  4M7D F;  4PJO B;  4C8Q F;  5GAN 5;  3RER A;  2RD1 A;  1U1T A;  1D3B A;  4XU3 A;  4M7A E;  1I5L A;  1WNL A;  2RB6 A;  3HFN A;  2DTH A;  4M75 E;  3L2Z A;  1X01 A;  4C92 E;  4F7U A;  5LJ3 e;  2DKG A;  3RES A;  3V8K A;  4A53 A;  4M75 D;  4M75 F;  4MMK A;  5DY9 A;  3SB2 A;  3VU3 C;  4HT9 A;  5LJ5 g;  2DEQ A;  2DTO A;  2ZGW A;  4A54 A;  3JCM Q;  5GAO r;  3JB9 J;  3JB9 F;  4HT8 A;  4M78 B;  4M7A F;  5GMK l;  3V7R A;  4PJO C;  1WPY A;  2JN0 A;  4X9C A;  4M7D D;  4EMK A;  4XTX A;  4C8Q E;  3SWN A;  4M7A C;  2E65 A;  4NL2 A;  1B34 A;  4M77 G;  1N9R A;  4JRI A;  3QO3 A;  4M77 D;  3JB9 I;  2DZC A;  3JB9 G;  5CAI A;  5GAN d;  1WQ7 A;  4M75 G;  4M78 C;  4C92 B;  4NOY A;  1I4K 1;  2DXU A;  4MML A;  4PJO G;  1I8F A;  2HNI A;  5GAN 4;  4XTU A;  3EFS A;  4XQ3 A;  4M77 C;  2EJ9 A;  3V8J A;  2E1H A;  4M78 A;  3V7S A;  2FB7 A;  1TH7 A;  4C8Q G;  1WQW A;  4C8Q B;  1LJO A;  3JCM f;  2DVE A;  2VC8 A; 
#chains in the Genus database with same CATH topology
 2PQW A;  1N6A A;  4PFO A;  3P8D A;  2LCL A;  2M0Y A;  1Q81 C;  3RKW A;  2B86 A;  2RHY A;  1WHG A;  2X4Y A;  3HPW A;  3CC7 A;  2CZ6 B;  2ZPE B;  3JCM c;  3G4S Q;  4J7I A;  5GJW B;  2EPD A;  3CME Q;  2CSQ A;  2I2L A;  4OP0 A;  1K8A R;  3VS0 A;  1HK9 A;  4ZTJ A;  2WSC E;  3OYA A;  4ZN1 A;  5KYW A;  1D1C A;  3G71 T;  1JJ2 S;  1OYX A;  4PFZ A;  1VQM Q;  1VQ5 Q;  2CGH A;  4OMP A;  4M7A G;  2AIR B;  5EG2 A;  5GMK j;  3GIB A;  4BY6 C;  2WAC A;  1WHH A;  3EG0 A;  4HVV A;  1X2Q A;  2O31 A;  2DLP A;  4RCB A;  3CPF A;  2KVQ G;  4RTX A;  1E6G A;  1X75 C;  2QGF B;  1LCK A;  2YUN A;  2DFU A;  2FZK B;  2DD5 A;  5C0M A;  3JCM g;  3M4Y A;  2AKK A;  2A3L A;  3J81 E;  4RTT A;  2GF7 A;  1NE8 A;  3EG9 B;  3EGU A;  4C8Q F;  5FRN A;  2KBT A;  4IUT A;  1YIJ A;  3V8K A;  1VQ5 T;  4M75 D;  1AOJ A;  1JB0 E;  3SB2 A;  2R5A A;  3OW2 P;  2X35 A;  2QAZ A;  3A8G B;  1PNJ A;  3HKS A;  4XAX B;  1WX6 A;  3L2V A;  2RH2 A;  3EG2 A;  3FLG A;  3JB9 I;  4KUL A;  4NOY A;  2F2W A;  2DEU A;  4IIM A;  4DBR A;  4M78 A;  4OVA A;  4IUU A;  3VKI A;  3VRZ A;  3OYL A;  3L2U A;  3CXC A;  1W2B P;  2KSS A;  4LDW A;  2PVD B;  2XMF A;  2HSP A;  1WA7 A;  5AYF A;  1JU5 C;  3A8M B;  1UHC A;  3L1A A;  4Q5W A;  4BE2 A;  1N27 A;  2VKN A;  3QG1 A;  4C8Q D;  1M1F A;  2GFU A;  3QYH B;  5GAM g;  2LC4 A;  1EIF A;  3JCM e;  3VUZ A;  2O4X A;  5DLO A;  5GAN g;  4HCZ A;  4IKF A;  3BFM A;  1B34 B;  1OQK A;  3FJP A;  1UFF A;  2B8A A;  3HRU A;  1UE9 A;  2RHU A;  3OW2 A;  3M0S A;  1Q7Y R;  1VQL Q;  2O01 E;  5I21 A;  2A37 A;  4KT0 E;  4FW1 A;  2JM9 A;  2F2V A;  1PCX A;  4C5H A;  4HXJ A;  2YDL A;  4FYW B;  4QQD A;  3URG A;  3A1P A;  1VQP T;  1QKW A;  4M77 F;  4D6W A;  1KK7 A;  1IRX A;  2L3R A;  5GAO p;  2O9S A;  1W1F A;  2H8H A;  2KYM A;  1BI2 A;  2PVO B;  2EWN A;  2D0Q B;  1X43 A;  3QJY A;  1BB9 A;  2COZ A;  2LQN A;  2QTX A;  1BU1 A;  5GJV B;  1NLP C;  1PSE A;  2M9U A;  3L2W A;  3CCE A;  4XU3 A;  4GLK A;  5J26 A;  3MP8 A;  1VQ9 T;  4M75 F;  2LT1 A;  5LJ5 g;  4RG2 A;  2EQM A;  4C8Q E;  2K9G A;  4PFP A;  3G4S A;  4M7A C;  2FG0 A;  1PG5 B;  1YJW Q;  4A63 B;  2JS0 A;  1PRM C;  2BUD A;  2ZAE A;  2LJ3 A;  2HEQ A;  1VQ6 A;  3VS2 A;  3MCA B;  2V8J A;  1RAA B;  5KYX B;  1ZLM A;  3JCM b;  1WGS A;  1VQ6 T;  2PTK A;  1R0B G;  4J9G A;  5KCH A;  4RTU A;  2EKH A;  1R0C B;  1WHJ A;  2J6O A;  3JCM d;  4A4F A;  1IXD A;  1SKU B;  2YUO A;  1XNI A;  5D6W A;  1K8A C;  4C92 F;  1Y71 A;  1VQ9 A;  1I81 A;  4C92 D;  4AG2 C;  1M90 U;  4C8Q A;  5CQX A;  5LJ5 j;  1X27 A;  2JNG A;  1SHF A;  3G7Z A;  3CCR T;  4N0A C;  1NLO C;  5GAN e;  4FYX B;  2EQK A;  1WDX A;  3UWN A;  1OU8 A;  1UJ0 A;  3CD6 T;  4LXC A;  1UG1 A;  4M75 B;  2KDS A;  2HBW A;  4J9H A;  1X6G A;  1KFZ A;  2PU9 B;  3S3M A;  1TOV A;  2HSE B;  1XQH A;  4PJO D;  2DYB A;  4ZNX A;  2RI3 A;  1FMW A;  1B07 A;  2K5I A;  1SG5 A;  2P0Q A;  3H9N A;  4MDW A;  1AVZ C;  5A0D A;  3OYE A;  1YI2 T;  2DA9 A;  2YT6 A;  2PNI A;  4DOV A;  4C8Q C;  4XTY A;  3EFO B;  2E41 A;  2P4R A;  2QXF A;  5LJ5 f;  1U5S A;  3CCE Q;  3C12 A;  3PMT A;  1YIJ Q;  3L2Z A;  2OTL Q;  1RI0 A;  1VQM A;  1KQS P;  3FDR A;  3QZ5 B;  5GAO r;  1VQ8 A;  1BCM A;  2JN0 A;  1VYT A;  1GRI A;  1TTH B;  4O6J A;  4E47 A;  3QXE B;  3M0P A;  1BI1 A;  4AFQ C;  5GAN d;  1Q7Y U;  5GAN 4;  2QQA A;  3EFS A;  4X34 A;  3L42 A;  1YI2 Q;  3LGF A;  4JZ4 A;  2M0O A;  1PD1 A;  2K2M A;  2VWF A;  3VS3 A;  3VS7 A;  1LJO A;  2CUB A;  3QBY A;  1PKS A;  4HA8 A;  3EGD B;  4M7A A;  2CS7 A;  4KH1 B;  4C0D C;  1Q7Y C;  1YIJ T;  4A4E A;  4M7A B;  1D1B A;  3EGD A;  2OTL T;  2LCS A;  2CP6 A;  4R0K A;  1VQK A;  1I07 A;  2JTE A;  2QYZ A;  4JLI A;  3CEY A;  3GP8 A;  4BD3 A;  1S1N A;  4AFS C;  5HK3 A;  5IN1 A;  2RK1 A;  2DBM A;  2EGC A;  1QCF A;  5GAN 6;  2QQB A;  4ZGJ B;  1W6X A;  4C92 A;  4M4Z A;  2PZ1 A;  1SRL A;  2D0N A;  1Q81 R;  3OMC A;  5GAO q;  4OGE A;  2DZ9 A;  4BB7 A;  4JJB A;  3QJ6 A;  4TVR A;  4LNP A;  4J6Y A;  3JCM h;  3NPF A;  2D9T A;  4L5G A;  2A0F B;  3QZ9 B;  3QWY A;  1XOV A;  2IIM A;  2A28 A;  1WJQ A;  1IZ6 A;  3CCQ A;  1QCN A;  4F7U G;  5FRM A;  2JTF A;  2E5K A;  2QQR A;  1SSF A;  2GCX A;  2BIV A;  4O5V A;  4F04 B;  5GAO n;  2BZY A;  3MEV A;  4OGC A;  2G3R A;  2YUP A;  3KUF A;  1JQQ A;  5GAN 5;  5CKH A;  1VQ4 Q;  4OMQ A;  2HQE A;  2RB6 A;  1VQ4 A;  2PVG B;  3RES A;  3CCS T;  4LDX A;  5I11 A;  1ZSG A;  2LVM A;  3M0R A;  1S72 T;  3S3N A;  4LDV A;  2IVW A;  4EMK A;  1KD1 R;  2PUK B;  1QCO A;  2O88 A;  1OEB A;  3DLM A;  1EX4 A;  3RNJ A;  2BTT A;  1ACM B;  2HAX A;  2QEX T;  2DL5 A;  4M78 C;  2JS2 A;  1I4K 1;  2K3Y A;  4PJL A;  2JOY A;  1RLP C;  5KYN A;  5M9O A;  3OMG A;  1YHQ Q;  2H3E B;  1NM7 A;  2LQK A;  2NLU A;  3MEU A;  2KY9 A;  1T3S A;  2HQH A;  1YIT Q;  1ZUK A;  2K5L A;  3M4G A;  3CCS Q;  4X1V A;  2C0T A;  3ULR B;  2KMT A;  2E6Z A;  1N8R R;  1UGV A;  2CP2 A;  3MEW A;  1YJN T;  2LX7 A;  2VXF A;  2E10 A;  3PGG A;  3REA B;  4JS5 A;  4BE1 A;  2RN8 A;  4J9C A;  2K5F A;  1GCP A;  1JJ2 A;  5GAN 7;  1VQ7 A;  2X4X A;  2LJ1 A;  1K0S A;  1YP5 A;  4JRQ A;  2DM1 A;  3VJP A;  1YHQ T;  3EGX A;  4QQ6 A;  2GGR A;  4ELY C;  1MHN A;  3H8Z A;  1Q95 G;  1G3S A;  1VQ7 T;  4M7D A;  4E7L A;  4ESR A;  3SWN B;  1LNX A;  1NPR A;  2K6D A;  2JM8 A;  3KFV A;  2JMC A;  1YJW A;  5CKF A;  1Y7X A;  1BYM A;  3MP1 A;  4FYV B;  4QW2 A;  3L2Q A;  3EHR A;  4RCC A;  5DM7 R;  1I5O B;  3E2U A;  5GAN h;  3VS4 A;  3UA7 A;  2CP3 A;  1E7O A;  7AT1 B;  3WVD B;  1ZUY A;  1AZE A;  5CR2 A;  4M75 E;  1UHF A;  1AT1 B;  1FYN A;  1PKT A;  5FU6 B;  3X26 B;  2V8K A;  2X4W A;  4A54 A;  4M7D D;  3QWX X;  3CME A;  2A7Y A;  1B34 A;  4M77 G;  1UGP B;  1S72 A;  3I56 T;  2O4X B;  1MNE A;  4RTW A;  3GOX A;  2RHZ A;  2DAQ A;  3GNG A;  1NJI U;  1K0X A;  4MDX A;  2Z0W A;  1GBR A;  5C6S A;  2QDL A;  1MMA A;  4XTW A;  3OYM A;  1KD1 U;  1H64 1;  2HDA A;  3CCM T;  3QPH A;  3VS1 A;  1VQP Q;  3RBB B;  1LOJ A;  3I55 T;  1QVG S;  3MET A;  3CCS A;  1IGQ A;  2KEA A;  1UUE A;  2HL5 C;  2YLB A;  3QHS A;  4PJM A;  4M75 C;  3CPW P;  1V29 B;  2ATC B;  3KBG A;  4J9B A;  2H3J A;  1PSF A;  3M54 A;  4XK8 E;  5LJ3 f;  4DBF A;  2HL3 A;  4IIO A;  4BY6 B;  4J8O A;  5I2S A;  2KNB B;  1SF9 A;  3LWH A;  1OZ3 A;  1CKB A;  2L89 A;  3OS2 A;  5KYY A;  2MCN A;  3THK A;  3VYH B;  4OB2 B;  5AT1 B;  2CP0 A;  1GCQ A;  4C92 G;  4KGX B;  1G2B A;  1QVG A;  3RMS A;  5CIU A;  1C1A A;  1T3L A;  1YIT A;  5LJ5 d;  4GBQ A;  4DEY A;  1GFC A;  1VQK T;  3NTH A;  4FT2 A;  2ENM A;  2BE7 D;  1JXM A;  1WFW A;  1OI1 A;  3CC4 T;  4LD9 K;  3QII A;  2GQV A;  3UA6 A;  3O8V A;  3WVE B;  1RI9 A;  1Q82 R;  5HY6 A;  1D09 B;  2KE9 A;  4Y92 A;  1U1T A;  1M27 C;  4PKC C;  4F7U A;  1OU9 A;  3A8H B;  1BI3 A;  5CQY A;  2X3X D;  2E3H A;  5DY9 A;  4CI0 C;  3GPL A;  4HT8 A;  4N4H A;  5GMK l;  4EIK A;  4XTX A;  3OYY A;  3MP6 A;  5HCK A;  5CK9 A;  2JUF A;  3CBP A;  2FPD A;  2XHC A;  4M75 G;  4OF1 A;  2O2O A;  1G5V A;  1VQM T;  2EJ9 A;  3V7S A;  2BKD N;  2OI3 A;  1K73 U;  5L8R E;  2KYB A;  1KSW A;  4ATO A;  3R6N A;  2RQT A;  4E7J A;  3CCV Q;  1BIA A;  5GAM d;  1K9M U;  5GAM j;  1WXT A;  4PLI A;  1VQ8 T;  1H92 A;  2QA4 Q;  3CBM A;  1XJW B;  2GNC A;  5I2M A;  2AHJ B;  2MWO A;  1ZBJ A;  4XTV A;  2HMA A;  2DPP B;  3LYI A;  1B3Q A;  3CCU Q;  5GAM e;  2IG0 A;  1F1B B;  3EG3 A;  3EGX B;  4J7F A;  2RJD A;  5HKC A;  5GMK e;  2DMO A;  3JCM J;  2D8J A;  4M7D B;  2V1Q A;  1WHM A;  3TRE A;  3I35 A;  2KAF A;  2KXC A;  3VRY A;  3QDR B;  5FWC A;  2LP5 A;  1M2O A;  2VUB A;  4YTL A;  4IUP A;  2F69 A;  4PL6 A;  1W4S A;  1M2V B;  3OY9 A;  2JT4 A;  5GAN f;  1KIK A;  3JV3 A;  4OML A;  4LD6 A;  4ANJ A;  4RTY A;  3CME T;  1R77 A;  3MPU B;  3A98 A;  3LW5 E;  1Q82 U;  1C6V X;  3IQL A;  3G71 Q;  1WNL A;  3TVT A;  2DKG A;  3REB B;  2K79 A;  4PJO C;  3CXC S;  2EGA A;  2DO3 A;  2LQ8 A;  2VVK A;  4LUE A;  2CT3 A;  1SPK A;  5DLQ E;  1M1K R;  2DZC A;  2JTM A;  5CO7 A;  1MMD A;  1WQ7 A;  1YCS B;  3M53 A;  2OTJ Q;  4MZP A;  1DJ7 B;  2HD0 A;  4C8Q G;  2R5M A;  1WQW A;  2J6F A;  3X24 B;  5LJ3 e;  4M77 E;  1RAF B;  1G3W A;  3RIR A;  1OX9 A;  3E9G A;  4ZGE B;  4RTZ A;  2HBP A;  1MV3 A;  3I9Q A;  4LDY A;  4DEX A;  2ZPB B;  3VS5 A;  3EFR A;  1HD3 A;  3VS6 A;  3I5S A;  3CC2 Q;  3CMA T;  4M7A D;  4OMM A;  5LJ3 h;  1Y57 A;  1TWB A;  3LGL A;  1NJI C;  1BIB A;  2CT4 A;  2KRM A;  2F5K A;  1A0N B;  2PUO B;  3ER0 A;  2ROL A;  1OX8 A;  1M2V A;  4PJN A;  3DB3 A;  1BBZ A;  2GTJ A;  1PD0 A;  2GQI A;  1IRE B;  1KQ1 A;  5KE3 A;  1Q82 C;  5CKB A;  1VQ9 Q;  3NGP A;  2DL3 A;  3AT1 B;  1GBQ A;  1S72 Q;  4BI8 B;  8ATC B;  2EQU A;  4FU6 A;  4A4G A;  4F17 A;  4DQ2 A;  2FPE A;  3M0T A;  5IXF A;  3OYN A;  1G8X A;  2D1X A;  2DL4 A;  2LNV A;  4XU0 A;  4L6V 5;  2DNU A;  5CVI A;  1OZ2 A;  3JCM V;  3CC2 T;  4N4G A;  4Y91 A;  4DBH A;  3DB4 A;  3BDU A;  4CC7 A;  1D3B B;  4EMH A;  5KCO A;  1JRI A;  1RAI B;  1K4U S;  1M3B A;  3CCR A;  3MO8 A;  3CC7 Q;  3FEO A;  1D3B A;  2DK3 A;  5FLX E;  2M16 A;  2QK0 A;  1X01 A;  4MZM A;  3F70 A;  1XTD A;  2CZ7 B;  2OJ2 A;  1TUG B;  2YUQ A;  1WPY A;  1BI0 A;  1YJN Q;  3ME9 A;  3SWN A;  1PHT A;  3LWI A;  4RKU E;  4JS4 A;  4JRI A;  4Z89 A;  1AD5 A;  2YRC A;  4BAC A;  2DVJ A;  2CP5 A;  4MML A;  1VA7 A;  4XTU A;  2X3W D;  1UJY A;  1ZBX A;  1TSF A;  2F5T X;  2RQW A;  1TH7 A;  5CKD A;  5GAM f;  2RMO A;  2M1H A;  2OAW A;  1M3A A;  3EFO A;  4N0A A;  1JBM A;  4F7U B;  2GFA A;  2ECZ A;  3D7S B;  2QA4 A;  1TUD A;  1YJ9 Q;  1VQN A;  1VIF A;  4X9D A;  1M4Z A;  1T0J A;  2NYS A;  4OB0 B;  1FXX A;  1QWF A;  3PNW C;  4QT7 A;  1AWJ A;  2JXB A;  3JB9 H;  1PM3 A;  2CP7 A;  3DKM A;  5LJ5 h;  4OB1 B;  2RA2 A;  1KQS S;  2EVR A;  1CKA A;  3M57 A;  4M78 G;  2C0I A;  2P0P A;  3CCE T;  5GAN j;  3GLX A;  3ZFJ A;  2X9H A;  4IUR A;  1YJN A;  4BE0 A;  3J7A F;  1QVG P;  3TEE A;  1OPK A;  4C0Z A;  1UGQ B;  2WSE E;  3JCM W;  4ZGD B;  2VGM A;  1P92 A;  1KC8 U;  2JZ2 A;  1UEB A;  2EQJ A;  1ZX6 A;  2P4T A;  2DIQ A;  1VQP A;  1NPP A;  2MMP A;  4JJD A;  5LL6 S;  5FU7 B;  1YJ9 T;  3I56 Q;  1Q86 U;  3HTR A;  3MKD A;  1O75 A;  5FWB A;  1PRL C;  3HFO A;  1VUB A;  1KQS A;  4QVZ A;  5J39 A;  4KRT A;  2XKO C;  2ZPH B;  1QVP A;  2ESW A;  3ZL7 C;  3OYJ A;  3VUB A;  5IHI A;  4LDU A;  2E3I A;  2RD1 A;  3CCR Q;  2ZPF B;  1UGR B;  3CCL A;  4MMK A;  2LT4 A;  3MJX A;  3ZEH A;  4RUG A;  3PIO A;  4HVU A;  2DIL A;  3JB9 G;  4C92 B;  2KK4 A;  2Y4Y A;  2RQV A;  4J83 A;  4B9W A;  4UC4 A;  4LUD A;  3L2R A;  3WXM B;  1NBE B;  1ZA2 B;  1VQO Q;  4AT1 B;  2A36 A;  3SFM A;  3V8L A;  1NEG A;  2BZ8 A;  2EW3 A;  4M7D C;  1HXD A;  3HSB A;  4XU1 A;  1NZ9 A;  1Q81 U;  3X20 B;  1VQK Q;  1FMV A;  2EGE A;  3CCQ T;  2DL7 A;  3GF5 A;  4R56 A;  3CC4 Q;  2XG8 D;  5GAN 3;  3CCJ Q;  3OYK A;  1VQ5 A;  2ZCF B;  2A08 A;  2MPX C;  2ZZD A;  5A2Q E;  3A8O B;  2F2X A;  2NUP A;  5GAN 2;  1VYU A;  2DXT A;  1C0M A;  2DYI A;  2JMA A;  2YRD A;  1M9S A;  3JCM X;  1QP2 A;  2CYZ B;  2ED0 A;  1HJD A;  3M0Q A;  4A4K A;  4AFU C;  2EYZ A;  4Z8A A;  3S6W A;  3QUI A;  2ZPI B;  1K73 C;  5GMK m;  1Y0M A;  1KQ2 A;  2VB6 A;  4J9E A;  2Y4X A;  1B7T A;  3OYD A;  4ELZ C;  1VQN T;  3G6E A;  4GLM A;  2FZG B;  1SEM A;  1QMC A;  1JJ2 P;  2WSF E;  3CCQ Q;  4E2F B;  4NS5 A;  2C0O A;  4F16 A;  1UB4 A;  1CSK A;  4PJO E;  4J9F A;  2HQX A;  3PFS A;  3G71 A;  3SDZ A;  2RQU A;  5FU7 C;  1D0Y A;  3SHW A;  4M7A E;  1WXB A;  2HCK A;  1FWZ A;  4CC2 A;  2W10 A;  3PVL A;  5ECA A;  3CXC P;  1W2B A;  2DTO A;  3PMI A;  3JB9 J;  4M7A F;  4ME7 A;  1AWW A;  4M78 B;  1FMK A;  2KT1 A;  3PVQ A;  1K76 A;  4CC3 A;  4C5G A;  2KXD A;  1WLP B;  1JXO A;  3G6E Q;  2YSQ A;  5KYY B;  4PJO G;  3QDF A;  3NTI A;  2LRQ A;  3I56 A;  1NYF A;  4C8Q B;  2DVE A;  3NHN A;  1M90 R;  2RQR A;  1ZQ1 A;  4AFZ C;  2IPO B;  4JJC A;  4C0G A;  1VQ4 T;  4HCB A;  2J05 A;  1O9S A;  3HL8 A;  3CPW A;  1H3Z A;  2EJF A;  4GY5 A;  4BDZ A;  4C92 C;  3H6Z A;  2AK5 A;  1QVF S;  1U1S A;  3OB9 A;  1RUW A;  3M56 A;  2MK5 A;  2R57 A;  2VGN A;  4EMK C;  3G6E T;  5KYX A;  1U06 A;  1M1G A;  2ZPG B;  1SRM A;  2CH4 W;  1AWX A;  4E7H A;  1X6O A;  2FZC B;  1MGQ A;  2L3S A;  2ED1 A;  3EHQ A;  2K4Y A;  2Y90 A;  3EH2 A;  4M78 F;  3TU4 K;  2FYK A;  4FT4 A;  1RAG B;  3OQ5 A;  2LZ6 B;  3JSC A;  4LN2 A;  4E7I A;  2HKQ B;  1VYV A;  1VOM A;  1M8M A;  3GNF B;  4HCK A;  1IHW A;  2YRV A;  2MAM A;  4B9X A;  1X69 A;  1QVF P;  3CCL Q;  3CCM Q;  2RJC A;  1ARK A;  1MND A;  4HT9 A;  3CMA Q;  1VQL A;  1HYO A;  4JPB W;  3JCM Q;  2EIF A;  4B6M A;  2RO0 A;  1K9M R;  3OS0 A;  3OYG A;  2JVV A;  2DD4 A;  3M55 A;  1MV0 B;  2QDY B;  3HHT B;  5KYU B;  2DXU A;  2KT8 A;  2KRO A;  2COW A;  4PLL A;  4M77 C;  2E1H A;  2NWM A;  2KI7 A;  2LDM A;  1K1Z A;  2EYX A;  1UTI A;  2FPF A;  4X9C A;  4JUV A;  1EZZ B;  1K8A U;  4E7S A;  1WHL A;  4DOW A;  5IHK A;  2RM4 A;  3CCL T;  3OYH A;  2O9V A;  3OYI A;  2EAY A;  1M1K C;  3M0U A;  1GCQ C;  3NMZ C;  2HZY A;  3VV0 A;  1Y96 B;  2XDD A;  5CKE A;  3G1J A;  3OYC A;  2FRW A;  2LNH B;  4V2S A;  2JW4 A;  1UDL A;  1LPL A;  1AEY A;  4F7U F;  3E19 A;  4OMN A;  1RLQ C;  2RHI A;  1YWP A;  2YHT A;  1KG1 A;  5KYU A;  3Q1J A;  3CC7 T;  2NUZ A;  3BE3 A;  1D0X A;  1YFN A;  3HRS A;  4FYY B;  3H0H A;  4M75 A;  4N4I A;  1PWT A;  3N5B B;  2DRK A;  4HCC A;  4JRK A;  4WCI A;  2RJE A;  2CZ1 B;  3CD6 A;  1QP3 A;  5IT9 E;  1IGU A;  4EMK B;  3JAM E;  2LMJ A;  1WHK A;  5GMK i;  3I55 Q;  3FB9 A;  4C5E A;  1Y07 A;  2CDT A;  2M02 A;  3FRN A;  3UT1 A;  2E70 A;  1NYG A;  2MWP A;  2XDB A;  4M7D G;  4M78 E;  4HKE A;  3OBY A;  1ABQ A;  3H0I A;  4JRP A;  4J5Y A;  3CCV T;  4A4H A;  4FSX A;  5D7U A;  2E4H A;  5IH2 A;  2ABL A;  1VQ8 Q;  2D8H A;  1W70 A;  2DTH A;  2QA4 T;  3E1S A;  2ROT A;  4QKU A;  4C0F A;  2E5Q A;  3VU3 C;  1VQL T;  3S3O A;  5FRO A;  3FJ5 A;  3UDC A;  2XI9 A;  3J80 E;  1RAH B;  5IHN A;  3UAT A;  1IB8 A;  1WZO A;  3CQT A;  4BUG A;  5CAI A;  1K9M C;  2HNI A;  4IUV A;  5KYW B;  1U3O A;  1WJS A;  2FB7 A;  2LX9 A;  1AHJ B;  4Y28 E;  3PTA A;  4AG1 C;  2QQS A;  1G3T A;  2X4J A;  1I0C A;  2DL8 A;  2YLC A;  1WJR A;  3U23 A;  5FU6 C;  5A0G A;  2E64 A;  2YXY A;  5IAY A;  1I1J A;  3RKX A;  4WF2 A;  4BDY A;  2P84 A;  3VYG A;  1N8R U;  4D8D A;  3QKJ A;  2JJ9 A;  2L3P A;  3T9N A;  2I0N A;  3CC2 A;  2LCC A;  4ZN3 A;  3JB9 D;  3ASK A;  2XU8 A;  4OMO A;  4K11 A;  2NUT A;  1J3T A;  3FIF A;  3E9F A;  2MOX A;  4JLG A;  2EYQ A;  3TCJ A;  4F7U E;  5GAO l;  3NFC A;  1FX7 A;  4M77 A;  1D1A A;  2QQ9 A;  4J9D A;  1UEC A;  2RI5 A;  1RAB B;  4M78 D;  2SEM A;  2L5Q A;  1YWO A;  4CC4 B;  3JCM P;  2EKO A;  3V7C A;  2AZV A;  1N9S A;  3C4S A;  2OTJ T;  5GAM h;  4JDS A;  4QQG A;  3CCU T;  2RNA A;  3CMA A;  2DJQ A;  1ZSZ B;  2XDP A;  2MF2 A;  4PJO B;  2KRN A;  1X2K A;  1I5L A;  4AMC A;  4C92 E;  3OSV A;  2CH4 A;  4A53 A;  2KRS A;  2DRM A;  1V1C A;  3NTK A;  5A0L A;  4LE9 A;  2CKK A;  2LJ0 A;  3M5A A;  1W2B S;  3OS1 A;  3CCJ T;  1KC8 R;  4FM4 B;  4WTO B;  1TUC A;  2YWW A;  2J06 A;  2QTV A;  2EFI A;  1KD1 C;  4P5N A;  3HP9 A;  1I8F A;  4E7Z A;  2DXB A;  2DIG A;  3JCM f;  4XU2 A;  3UF4 A;  3CCV A;  3RUX A;  3X25 B;  3SWN C;  4NL3 A;  2AT1 B;  3EG9 A;  2BZX A;  2MI6 A;  3CC4 A;  2C06 A;  2K3B A;  2COY A;  3OS5 A;  3C0C A;  4PJJ A;  5FW9 A;  1QKX A;  5HK0 A;  1NJI R;  5LJ3 d;  2BE9 B;  2VYT A;  1RL2 A;  2GBQ A;  5EC7 A;  3OA6 A;  2SRC A;  2FL7 A;  1AWO A;  1YCY A;  1JEG A;  1PC0 A;  2RI2 A;  2XK0 A;  4PJO F;  1QW1 A;  2AKL A;  3AHU A;  2OTJ A;  4PNO A;  2VXE A;  3MEA A;  3MHX A;  2L2P A;  4QVC A;  3CPW S;  1Q86 C;  4RG8 A;  2M51 A;  3TQ7 P;  2DXC A;  1GFD A;  3C94 A;  2K57 A;  1VIE A;  3SEM A;  2OX7 A;  2L3Q A;  2DF6 A;  1KC8 C;  2QG9 B;  2RHX A;  3OSS C;  3I55 A;  3CCM A;  2EJG A;  3HRT A;  4FW2 A;  4EMG A;  1QVF A;  2E6N A;  3R6O A;  1RAE B;  4DBQ A;  2XID A;  3RER A;  1SHG A;  3LX7 A;  2DX1 A;  1U8R A;  3HFN A;  2EQI A;  4EPC A;  2CSI A;  2RF0 A;  1RAD B;  2CUD A;  2DEQ A;  3CBO A;  3JB9 F;  4M7D E;  1KHI A;  3V7R A;  2LQW A;  2RJF A;  1KJW A;  2FRY A;  2EYY A;  1UGS B;  3PIP A;  4NL2 A;  1AZG B;  3EH1 A;  1N9R A;  2LTO A;  3QO3 A;  2CRE A;  1ZSZ C;  4HVW A;  2AZS A;  2MIO A;  1JO8 A;  4EDU A;  1M3C A;  3M58 A;  1G3Y A;  3RR6 A;  4L59 A;  1WI7 A;  2XD0 A;  2XIC A;  2P0K A;  4KUD K;  4PJO A;  2L8D A;  3EAE A;  1MMN A;  2D6F A;  2EYW A;  2FO0 A;  2V8I A;  4R55 A;  2QI2 A;  4RTV A;  5IXB A;  1IO6 A;  1OV3 A;  3O5Z A;  1ZHI A;  3C95 A;  1M8V A;  4FSS A;  1X6B A;  2CZ0 B;  1YJW T;  1OUL A;  3RDV A;  3BY7 A;  3OBW A;  1BK2 A;  1Q86 R;  4OMF B;  4II1 A;  5GAO m;  2QEX Q;  1QQJ A;  4RMO A;  2OTL A;  1WIE A;  2NUP B;  1QWE A;  2FHD A;  3H0F A;  2KGT A;  5J3B A;  1YNZ A;  1YHQ A;  4M77 B;  1VQO A;  2DBK A;  4Z88 A;  8AT1 B;  5LJ5 e;  4FCY A;  1VQ6 Q;  2K2V A;  2NUT B;  1T0H A;  1YIT T;  5KH6 A;  3QSU A;  3JRZ A;  5KE2 A;  2FVU A;  2E12 A;  4D8K A;  1K73 R;  1SSH A;  3I5R A;  4E6R A;  4MZT A;  3BDL A;  1WYX A;  3CCJ A;  4J6W A;  1OPL A;  1OOT A;  4OB3 B;  9ATC B;  1YBY A;  1K9A A;  5I22 A;  4BI3 A;  3SD4 A;  1E6H A;  4F14 A;  5CCA A;  3P8H A;  3TSW A;  3CD6 Q;  1VQ7 Q;  4KUI A;  1EFN A;  1M30 A;  1Z9Q A;  2QEX A;  3CCU A;  3GBQ A;  2E65 A;  3FC3 A;  2R58 A;  4ZTF A;  3OYB A;  1ABO A;  2DER A;  4JZ3 A;  1M1K U;  4VUB A;  4IUQ A;  2OAU A;  2KR3 A;  4XQ3 A;  3OYF A;  2X51 A;  3V8J A;  6AT1 B;  1QLY A;  3M59 A;  2GTO A;  2VC8 A;  4E7K A;  1TU0 B;  1D0Z A;  3LH0 A;  2J6K A;  5GMK h;  4FL6 A;  2RPN A;  2DET A;  2K3X A;  1YI2 A;  4XTZ A;  3RMQ A;  2KQW A;  1H8K A;  4FIB A;  4J6X A;  4BI4 A;  2K7A A;  4KBM B;  1YJ9 A;  1VQN Q;  4DA4 A;  2DJZ A;  3RKY A;  1YN8 A;  1TXQ A;  1RAC B;  4Z02 A;  1M5Q 1;  2EBP A;  2QAS A;  1Z9Z A;  3OW2 S;  1V76 A;  4KGV B;  3DLL A;  3H41 A;  3TSZ A;  1H3H A;  3P8B B;  1WXU A;  1LVK A;  4CRI A;  1GXI E;  3M9Q A;  2VAS A;  2MYS A;  4QVD A;  2F1L A;  1VQO T;  1N5Z A;  2DTI A;  5LJ3 g;  4KH0 B;  1BKB A;  3QYG B;  2FEI A;  4PK4 A;  5LJ3 j;  2V26 A;  1G83 A;  1GL5 A;  1KHC A;  1Y96 A;  2L0A A;  1MMG A;  5D6Y A;  1BCO A;  3LLR A;  3INZ A;  5GAN 8;  4ORZ A;  1ZA1 B;  3PE0 A;  1ZSZ A;  3BW1 A;  4J9I A;  3LH5 A;  1NG2 A;  4C0D B;  2HKN A;  3KXT A;  2DE0 X;  4M7D F;  4KGZ B;  1M90 C;  3ZBD A;  4C5I A;  3EG1 A;  1IHV A;  1MUZ A;  5L23 A;  2VV5 A;  2ZGW A;  3UPU A;  1ZUU A;  3G4S T;  3A8L B;  1R8O B;  3X28 B;  5D6X A;  3A5Z B;  1HSQ A;  2V1R A;  1NEB A;  2W0Z A;  4M77 D;  2J7I A;  3PT9 A;  4JJN K;  2QGG A;  1TS9 A;  1TG0 A;  2RK2 A;  2G6F X;  1N8R C; 
#chains in the Genus database with same CATH homology
 2NLU A;  2M1H A;  1N6A A;  2PQW A;  4N0A A;  3P8D A;  3PTA A;  3MEU A;  2LCL A;  2KY9 A;  2QQS A;  1G3T A;  2X4J A;  1JBM A;  4F7U B;  2GFA A;  2YLC A;  2QA4 A;  1Q81 C;  1WJR A;  3RKW A;  1VQN A;  2K5L A;  3M4G A;  1VIF A;  4X9D A;  5FU6 C;  1M4Z A;  4OB0 B;  5A0G A;  2E64 A;  2RHY A;  3HPW A;  2X4Y A;  1FXX A;  3RKX A;  5IAY A;  2CZ6 B;  4WF2 A;  3CC7 A;  4BDY A;  3PNW C;  2KMT A;  3VYG A;  2ZPE B;  3JCM c;  1N8R U;  4J7I A;  3JB9 H;  2E6Z A;  1YJN T;  3MEW A;  3DKM A;  3QKJ A;  2I2L A;  4OP0 A;  5LJ5 h;  4OB1 B;  2VXF A;  2E10 A;  3PGG A;  3T9N A;  1HK9 A;  4M7D E;  4ZTJ A;  2WSC E;  4JS5 A;  3CC2 A;  2LCC A;  2RA2 A;  4ZN3 A;  4BE1 A;  3JB9 D;  1KQS S;  2K5F A;  3M57 A;  1JJ2 A;  5GAN 7;  3ASK A;  4M78 G;  2P0P A;  2XU8 A;  3OYA A;  5GAN j;  3GLX A;  3ZFJ A;  4ZN1 A;  2X4X A;  1VQ7 A;  3CCE T;  3G71 T;  1JJ2 S;  1OYX A;  3FIF A;  4IUR A;  3E9F A;  4JLG A;  3TCJ A;  2EYQ A;  4JRQ A;  1YJN A;  4BE0 A;  4F7U E;  3VJP A;  5GAO l;  2CGH A;  1YHQ T;  3J7A F;  4M7A G;  5GAN 3;  5EG2 A;  5GMK j;  3NFC A;  4QQ6 A;  4ELY C;  1FX7 A;  1MHN A;  3H8Z A;  4M77 A;  3TEE A;  4BY6 C;  1G3S A;  1UGQ B;  2WAC A;  2WSE E;  4C0Z A;  4ZGD B;  3JCM W;  2QQ9 A;  1VQ7 T;  2VGM A;  4M7D A;  1P92 A;  1KC8 U;  4E7L A;  3SWN B;  2JZ2 A;  1LNX A;  1UEB A;  2EQJ A;  1NPR A;  2P4T A;  2DIQ A;  2RI5 A;  4M78 D;  1VQP A;  1NPP A;  2MMP A;  5LL6 S;  1YJW A;  5FU7 B;  2L5Q A;  4RCB A;  1YJ9 T;  5CKF A;  1Y7X A;  3CPF A;  2KVQ G;  1Q86 U;  3MP1 A;  2EKO A;  3JCM P;  1BYM A;  1O75 A;  3V7C A;  1N9S A;  4QW2 A;  3L2Q A;  1X75 C;  3HFO A;  1VUB A;  3C4S A;  4RCC A;  2OTJ T;  5DM7 R;  5GAM h;  4QVZ A;  5J39 A;  1KQS A;  2DD5 A;  4JDS A;  5C0M A;  3JCM g;  5GAN h;  3M4Y A;  4QQG A;  3CCU T;  2XKO C;  2A3L A;  3CMA A;  2ZPH B;  1QVP A;  3J81 E;  3OYJ A;  2XDP A;  2GF7 A;  1NE8 A;  3WVD B;  3VUB A;  2MF2 A;  4PJO B;  4C8Q F;  4LDU A;  5FRN A;  2RD1 A;  5CR2 A;  2ZPF B;  1I5L A;  4M75 E;  1UGR B;  4C92 E;  3OSV A;  4IUT A;  1YIJ A;  3V8K A;  3CCL A;  4A53 A;  1VQ5 T;  4M75 D;  5FU6 B;  3X26 B;  1JB0 E;  2V8K A;  3NTK A;  4MMK A;  3SB2 A;  2LT4 A;  2X4W A;  4A54 A;  5A0L A;  3ZEH A;  2R5A A;  2X35 A;  2CKK A;  4M7D D;  3M5A A;  3PIO A;  1W2B S;  3A8G B;  3OS1 A;  3CME A;  3CCJ T;  2A7Y A;  1B34 A;  3HKS A;  4FM4 B;  4XAX B;  4M77 G;  3L2V A;  2RH2 A;  1UGP B;  3JB9 I;  3FLG A;  3JB9 G;  1S72 A;  3I56 T;  2EFI A;  2O4X B;  4KUL A;  4C92 B;  4NOY A;  1KD1 C;  4P5N A;  2KK4 A;  3HP9 A;  1I8F A;  2Y4Y A;  3GOX A;  2RHZ A;  2DAQ A;  4J83 A;  4B9W A;  4UC4 A;  3GNG A;  1NJI U;  2DXB A;  4M78 A;  3L2R A;  4OVA A;  3WXM B;  2DIG A;  4IUU A;  3VKI A;  3OYL A;  4MDX A;  3JCM f;  5C6S A;  4XU2 A;  3L2U A;  3CXC A;  4XTW A;  2KSS A;  3RUX A;  4LDW A;  3X25 B;  3CCV A;  3SFM A;  3V8L A;  3SWN C;  3OYM A;  1KD1 U;  1H64 1;  2PVD B;  4NL3 A;  3CCM T;  5AYF A;  2MI6 A;  3QPH A;  3A8M B;  3L1A A;  1HXD A;  4M7D C;  3I55 T;  1LOJ A;  4Q5W A;  4BE2 A;  1QVG S;  2C06 A;  1N27 A;  3MET A;  3CC4 A;  3HSB A;  4M7A F;  4XU1 A;  3CCS A;  1NZ9 A;  1Q81 U;  3QG1 A;  3X20 B;  2YLB A;  3QHS A;  4C8Q D;  1M1F A;  3OS5 A;  3CCQ T;  2GFU A;  3QYH B;  4M75 C;  5HK0 A;  3GF5 A;  1V29 B;  5GAM g;  2LC4 A;  5LJ3 d;  4R56 A;  2VYT A;  1EIF A;  2XG8 D;  3KBG A;  1RL2 A;  3JCM e;  2H3J A;  1PSF A;  3M54 A;  4XK8 E;  5LJ3 f;  2O4X A;  3VUZ A;  5DLO A;  3OYK A;  1VQ5 A;  5GAN g;  2ZCF B;  4HCZ A;  3OA6 A;  4IKF A;  2FL7 A;  2ZZD A;  1YCY A;  3BFM A;  5A2Q E;  3A8O B;  1B34 B;  3FJP A;  2RI2 A;  2XK0 A;  4J8O A;  4BY6 B;  2B8A A;  3HRU A;  5I2S A;  5GAN 2;  3LWH A;  2DXT A;  2RHU A;  1OZ3 A;  4PJO F;  1QW1 A;  3OW2 A;  2L89 A;  3OS2 A;  1M9S A;  2O01 E;  3JCM X;  1QP2 A;  2CYZ B;  5I21 A;  4KT0 E;  4A4K A;  3VYH B;  4OB2 B;  3AHU A;  2OTJ A;  4PNO A;  2VXE A;  3S6W A;  4C92 G;  3QUI A;  3MEA A;  3MHX A;  2ZPI B;  4C5H A;  5GMK m;  1K73 C;  4QVC A;  3CPW S;  1QVG A;  1KQ2 A;  3RMS A;  4RG8 A;  5CIU A;  1Q86 C;  4QQD A;  3URG A;  2Y4X A;  1YIT A;  2DXC A;  5LJ5 d;  3OYD A;  1VQP T;  4M77 F;  4ELZ C;  3C94 A;  3G6E A;  1VQN T;  2K57 A;  4D6W A;  1VIE A;  2L3R A;  5GAO p;  1VQK T;  3NTH A;  4FT2 A;  1KC8 C;  2RHX A;  2WSF E;  1BI2 A;  2PVO B;  4NS5 A;  2EWN A;  3OSS C;  1OI1 A;  2D0Q B;  3I55 A;  3CC4 T;  3CCM A;  2EJG A;  3QII A;  1UB4 A;  3HRT A;  4LD9 K;  2GQV A;  3WVE B;  3O8V A;  4EMG A;  3QJY A;  1QVF A;  4PJO E;  2HQX A;  2E6N A;  2QTX A;  5HY6 A;  3PFS A;  3R6O A;  3G71 A;  3SDZ A;  2XID A;  3L2W A;  1PSE A;  3RER A;  2M9U A;  5FU7 C;  1U1T A;  3LX7 A;  4XU3 A;  3CCE A;  1U8R A;  4GLK A;  4PKC C;  1FWZ A;  3HFN A;  5J26 A;  4F7U A;  4M7A E;  3MP8 A;  3A8H B;  4EPC A;  1VQ9 T;  1BI3 A;  5CQY A;  4M75 F;  2LT1 A;  5DY9 A;  1W2B A;  5LJ5 g;  4CI0 C;  2DEQ A;  2DTO A;  3CBO A;  3PMI A;  4ME7 A;  3JB9 J;  3JB9 F;  3GPL A;  4HT8 A;  4M78 B;  1KHI A;  4N4H A;  3V7R A;  5GMK l;  2RJF A;  2EQM A;  4RG2 A;  4XTX A;  4C8Q E;  3OYY A;  4C5G A;  1UGS B;  3G4S A;  4M7A C;  3MP6 A;  5CK9 A;  3PIP A;  4NL2 A;  1N9R A;  2LTO A;  2JUF A;  3CBP A;  3QO3 A;  2XHC A;  2BUD A;  4M75 G;  1VQ6 A;  4OF1 A;  4PJO G;  1G5V A;  1VQM T;  3NTI A;  3MCA B;  2EJ9 A;  2V8J A;  2LRQ A;  3V7S A;  4EDU A;  2BKD N;  3I56 A;  1K73 U;  4C8Q B;  3M58 A;  5L8R E;  2DVE A;  1G3Y A;  4ATO A;  4L59 A;  4E7J A;  1ZQ1 A;  3JCM b;  1BIA A;  1WGS A;  5GAM d;  1VQ6 T;  4C0G A;  2XD0 A;  1VQ4 T;  2XIC A;  2P0K A;  1K9M U;  4HCB A;  5GAM j;  4PLI A;  1VQ8 T;  4KUD K;  4PJO A;  2L8D A;  5KCH A;  3CBM A;  3EAE A;  1O9S A;  2D6F A;  5I2M A;  3HL8 A;  2AHJ B;  2V8I A;  4R55 A;  2QI2 A;  3CPW A;  1H3Z A;  2MWO A;  2EJF A;  3JCM d;  4GY5 A;  4XTV A;  4A4F A;  4C92 C;  1ZHI A;  4BDZ A;  3H6Z A;  3C95 A;  1M8V A;  2DPP B;  3LYI A;  1QVF S;  1U1S A;  1XNI A;  5D6W A;  5GAM f;  3OB9 A;  1K8A C;  2CZ0 B;  4C92 F;  3M56 A;  1Y71 A;  5GAM e;  1YJW T;  2R57 A;  2VGN A;  1VQ9 A;  1I81 A;  4C92 D;  3BY7 A;  3OBW A;  2IG0 A;  4EMK C;  3G6E T;  1M90 U;  4C8Q A;  5CQX A;  4OMF B;  5LJ5 j;  1M1G A;  2JNG A;  4II1 A;  5GAO m;  3G7Z A;  4RMO A;  3CCR T;  2ZPG B;  4N0A C;  4E7H A;  4J7F A;  2RJD A;  5GAN e;  5HKC A;  1X6O A;  5GMK e;  2OTL A;  3JCM J;  1MGQ A;  2EQK A;  2FHD A;  4M7D B;  3UWN A;  3TRE A;  5J3B A;  1YHQ A;  4M77 B;  2KAF A;  1VQO A;  3CD6 T;  3QDR B;  4M75 B;  5LJ5 e;  2K4Y A;  2KDS A;  2VUB A;  2Y90 A;  4YTL A;  4IUP A;  2K2V A;  2F69 A;  2PU9 B;  4M78 F;  3TU4 K;  1YIT T;  3S3M A;  4PL6 A;  1W4S A;  2FYK A;  4FT4 A;  4PJO D;  1XQH A;  5KH6 A;  3QSU A;  3JRZ A;  3OY9 A;  2RI3 A;  5KE2 A;  2K5I A;  2P0Q A;  2FVU A;  3JSC A;  3OQ5 A;  4MDW A;  2E12 A;  4E7I A;  5GAN f;  4MZT A;  5A0D A;  3OYE A;  3BDL A;  1YI2 T;  4LD6 A;  4DOV A;  3CME T;  3CCJ A;  4J6W A;  3GNF B;  4C8Q C;  4XTY A;  2E41 A;  3LW5 E;  2YRV A;  2MAM A;  2QXF A;  5LJ5 f;  1Q82 U;  4B9X A;  4OB3 B;  3C12 A;  1YBY A;  3PMT A;  4BI3 A;  1WNL A;  3SD4 A;  3L2Z A;  2DKG A;  2RJC A;  5CCA A;  1RI0 A;  1VQM A;  3P8H A;  4HT9 A;  3FDR A;  1VQL A;  3QZ5 B;  3JCM Q;  5GAO r;  2EIF A;  4PJO C;  1VQ8 A;  2JN0 A;  3CXC S;  4KUI A;  2QEX A;  2DO3 A;  2XDB A;  2RO0 A;  3CCU A;  2LQ8 A;  3OS0 A;  2E65 A;  4O6J A;  4E47 A;  3OYG A;  2JVV A;  2DD4 A;  2R58 A;  3QXE B;  3FC3 A;  3OYB A;  4ZTF A;  3M55 A;  1BI1 A;  5DLQ E;  2QDY B;  3HHT B;  2DZC A;  5GAN d;  2JTM A;  5CO7 A;  1M1K U;  1WQ7 A;  2DXU A;  4VUB A;  4IUQ A;  1Q7Y U;  2OAU A;  3M53 A;  5GAN 4;  2QQA A;  3EFS A;  4X34 A;  4MZP A;  4M77 C;  4PLL A;  1DJ7 B;  3L42 A;  4XQ3 A;  3LGF A;  3V8J A;  3OYF A;  2E1H A;  2M0O A;  2HD0 A;  2LDM A;  2R5M A;  4C8Q G;  1WQW A;  1LJO A;  3M59 A;  4X9C A;  3X24 B;  2VC8 A;  4JUV A;  5LJ3 e;  4E7K A;  1K8A U;  3QBY A;  4M77 E;  3LH0 A;  4DOW A;  5GMK h;  1G3W A;  4HA8 A;  3RIR A;  4FL6 A;  3E9G A;  4ZGE B;  2K3X A;  1YI2 A;  4M7A A;  2CS7 A;  1Q7Y C;  4C0D C;  4XTZ A;  2HBP A;  2RM4 A;  3CCL T;  1YIJ T;  4LDY A;  4A4E A;  3OYH A;  3OYI A;  2EAY A;  1M1K C;  4M7A B;  3RMQ A;  2KQW A;  4J6X A;  4FIB A;  3VV0 A;  4BI4 A;  2ZPB B;  2OTL T;  1Y96 B;  4KBM B;  2XDD A;  1YJ9 A;  3EFR A;  1VQK A;  5CKE A;  3OYC A;  3CMA T;  4M7A D;  4DA4 A;  4V2S A;  2DJZ A;  5LJ3 h;  3RKY A;  4JLI A;  3CEY A;  3LGL A;  4Z02 A;  4F7U F;  1M5Q 1;  3GP8 A;  4BD3 A;  3E19 A;  1NJI C;  1BIB A;  5HK3 A;  2RHI A;  3OW2 S;  2YHT A;  1KG1 A;  2F5K A;  5IN1 A;  3DLL A;  2PUO B;  3ER0 A;  2RK1 A;  3P8B B;  3Q1J A;  3DB3 A;  3CC7 T;  5GAN 6;  4CRI A;  2QQB A;  3HRS A;  5KE3 A;  1IRE B;  1KQ1 A;  4ZGJ B;  1Q82 C;  3M9Q A;  5CKB A;  4M75 A;  1GXI E;  4N4I A;  4C92 A;  3N5B B;  3OMC A;  5GAO q;  4HCC A;  4OGE A;  4JRK A;  4QVD A;  2DZ9 A;  4BB7 A;  2RJE A;  2CZ1 B;  1VQO T;  3CD6 A;  1QP3 A;  3QJ6 A;  4BI8 B;  4TVR A;  5IT9 E;  2DTI A;  4J6Y A;  3JCM h;  5LJ3 g;  2EQU A;  1BKB A;  3QYG B;  4FU6 A;  4A4G A;  2D9T A;  4DQ2 A;  4EMK B;  3JAM E;  4L5G A;  3QZ9 B;  3OYN A;  5GMK i;  5LJ3 j;  2LNV A;  1XOV A;  4XU0 A;  4L6V 5;  3FB9 A;  1WJQ A;  1KHC A;  1IZ6 A;  1OZ2 A;  5CVI A;  4C5E A;  1Y07 A;  1Y96 A;  3JCM V;  3CC2 T;  3CCQ A;  4N4G A;  4Y91 A;  4F7U G;  3DB4 A;  5D6Y A;  3BDU A;  5FRM A;  1D3B B;  2JTF A;  4EMH A;  3FRN A;  2QQR A;  3LLR A;  1SSF A;  3INZ A;  5GAN 8;  2GCX A;  3UT1 A;  2E70 A;  5KCO A;  2BIV A;  2MWP A;  4O5V A;  4M78 E;  4HKE A;  3OBY A;  3BW1 A;  5GAO n;  4M7D G;  1JRI A;  3MEV A;  4C0D B;  4OGC A;  2G3R A;  4J5Y A;  4JRP A;  3CCV T;  3KUF A;  4A4H A;  3KXT A;  4M7D F;  3CCR A;  3MO8 A;  4FSX A;  5GAN 5;  5CKH A;  3FEO A;  1D3B A;  2DK3 A;  2HQE A;  2RB6 A;  5FLX E;  2DTH A;  2M16 A;  2QA4 T;  1X01 A;  1VQ4 A;  2PVG B;  3E1S A;  4MZM A;  3RES A;  3ZBD A;  4C5I A;  3F70 A;  1XTD A;  1M90 C;  3CCS T;  4C0F A;  2E5Q A;  2CZ7 B;  3VU3 C;  4LDX A;  1VQL T;  2VV5 A;  2LVM A;  2ZGW A;  3UPU A;  3S3O A;  5FRO A;  3UDC A;  2XI9 A;  1S72 T;  1WPY A;  3A8L B;  3J80 E;  3G4S T;  3S3N A;  4LDV A;  1BI0 A;  2IVW A;  4EMK A;  2PUK B;  1R8O B;  3ME9 A;  3SWN A;  3X28 B;  3DLM A;  3A5Z B;  5D6X A;  3LWI A;  4RKU E;  4JS4 A;  3GIB A;  4JRI A;  4M77 D;  3PT9 A;  2HAX A;  4BUG A;  5CAI A;  4BAC A;  2QEX T;  4JJN K;  4M78 C;  1K9M C;  1I4K 1;  2K3Y A;  2JOY A;  4MML A;  2HNI A;  4XTU A;  5M9O A;  3OMG A;  4IUV A;  1ZBX A;  2RK2 A;  2F5T X;  1WJS A;  1TH7 A;  2FB7 A;  1AHJ B;  2LX9 A;  5CKD A;  2LQK A;  1N8R C;  4Y28 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...