4A54A

Structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EDC3
publication title The Structural Basis of Edc3- and Scd6-Mediated Activation of the Dcp1:Dcp2 Mrna Decapping Complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein/hydrolase
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a54A00
1I8FA 5LJ3d 3V7RA 1N9RA 2I2LA 4F7UG 4M7AC 5GMKm 4XTUA 3PGGA 4N0AC 5DY9A 5GAOr 2YHTA 3V7CA 5GANe 3JCMQ 1N9SA 1YCYA 3L2ZA 2EJ9A 2DTHA 2YLBA 4C92B 3RKXA 3RIRA 1HK9A 4M78D 5GAMh 5GAN2 4M7DF 1D3BA 4Y91A 4M77E 4EMGA 2K57A 4M75E 3V8KA 3QUIA 5LJ5e 3JCMc 4M78G 2DZ9A 4EMKB 5LJ3e 2VC8A 3L1AA 1U1TA 4JUVA 4EMHA 3RESA 2CGHA 4C8QB 5GAN5 3QSUA 3BY7A 2E1HA 4OP0A 1M5Q1 3GIBA 2DJZA 4M75B 4EMKA 1MGQA 4J6WA 4M7AD 1Y96A 2QTXA 3M4GA 4C92E 4PJOB 2E41A 5GAOn 4C8QA 4J6YA 2EJFA 4M7DD 5GAMf 2RB6A 3JCMh 2E64A 3FIFA 4M78C 4M75A 1WQWA 3JCMV 3V7SA 3JCMJ 3SWNA 5GMKh 4X9DA 5GMKl 1U1SA 2EJGA 4M7DG 2RA2A 3JCMW 4HT9A 4M77G 2JN0A 3JB9J 4C8QE 4M77F 4XTZA 4M7AE 4MMLA 5GAOm 3RERA 3HFOA 1WPYA 5GAMj 5GAN7 3JCMb 4M75F 4XU2A 5GAN6 3RKYA 5GAMd 1I5LA 2EWNA 1I81A 1WQ7A 2YLCA 3VU3C 4C92A 4PJOE 3RKWA 4HT8A 2DXUA 3BW1A 4QVDA 4M7AB 4J5YA 3HSBA 4A54A 2DTIA 4M78B 4XU0A 4HA8A 3JCMf 5GAN8 4XU1A 4M7DC 4QVCA 4M77C 3JCMP 1JRIA 4C92F 4F7UE 3JCMX 3V8JA 2E10A 3JCMg 3HFNA 3QO3A 4WF2A 4M7AA 1TH7A 5GANf 2ZGWA 4M77D 4N0AA 3JB9H 2VXFA 1B34B 1LJOA 4MMKA 5I21A 5GAMg 4PJOA 3V8LA 3JCMd 5GMKj 4F7UB 4JRIA 4C8QG 3RUXA 5GANh 4XTYA 4C8QF 4M7AF 4XTXA 4NOYA 2Y90A 4JRKA 5LJ5f 4M78E 2DEQA 5GANj 2DTOA 4M75G 4V2SA 1B34A 5GANd 5GAOl 3FJPA 2DKGA 4F7UA 1BIAA 4PJOF 1WNLA 3FB9A 2VXEA 3JB9I 1HXDA 5LJ5h 2E65A 4C92D 5GAOp 5LJ3h 1LNXA 4EMKC 5GAN3 3JB9G 1KQ2A 5LJ5j 3JB9F 2RM4A 3JCMe 5GMKe 4C8QC 4XTVA 1D3BB 4C92G 4F7UF 4JLIA 1H641 4XTWA 1I4K1 4PJOC 3QHSA 4M75C 5GAMe 3SWNC 1M8VA 4M78A 1BIBA 2FB7A 2FYKA 1KQ1A 4PNOA 3EFRA 2EAYA 4C8QD 3SB2A 5CAIA 2DXTA 3AHUA 5GAOq 4M7DE 4RCCA 2RD1A 5GANg 3BDUA 4M75D 4XU3A 5GMKi 1JBMA 3BFMA 4DQ2A 4NL3A 4PJOD 2DVEA 4XQ3A 4M7AG 1LOJA 4M78F 4RCBA 5LJ3f 1Y96B 2HNIA 4C92C 4NL2A 4X9CA 4M7DB 4A53A 3JB9D 5LJ5g 4M77B 4J6XA 4PJOG 2DZCA 5LJ3g 3INZA 1X01A 5GAN4 3SWNB 3EFSA 4M7DA 5LJ3j 5LJ5d 4M77A
chains in the Genus database with same CATH superfamily
2DIQA 1GCQA 1TG0A 3C0CA 2R5AA 2OI3A 3CCRA 2EQJA 2XD0A 4HXJA 1TUGB 5GAMh 1WHLA 4JRPA 3CC2T 1G8XA 4BE1A 1MMDA 3PT9A 1ZBXA 5LJ5e 2KMTA 1R77A 2F69A 2AKKA 4PL6A 2DRKA 2DEUA 1MNDA 3CCSQ 3CCET 4C8QB 3CC2A 3OMCA 2C06A 4PFOA 4YTLA 2VGNA 3GIBA 2EW3A 1N8RR 3CCQT 2PUOB 4KGZB 4M7DD 5KE3A 2RHYA 3V7SA 3VRYA 3SWNA 3CCQA 4FCYA 4R55A 1RADB 4OMLA 4E7LA 1WIEA 4F14A 4C0DC 3O5ZA 3DB3A 3QG1A 3MPUB 2C0OA 2DXUA 2DTIA 2ATCB 4HA8A 3JCMf 5GAN8 4M7DC 4J8OA 4FSSA 3LGLA 2RJEA 3QZ9B 1VQOT 3EGXB 5CKDA 3HHTB 4FW2A 2CZ6B 4C5GA 3VV0A 1VQOA 4M7AF 4XTXA 1TS9A 3GP8A 1YI2T 4QVZA 3JB9I 1HXDA 2EBPA 4C92D 1KC8R 1FYNA 3HKSA 2RM4A 2HZYA 2QDLA 1UGQB 1YI2A 3MKDA 3PMIA 4F7UF 2L5QA 3QBYA 2KRSA 3TEEA 3G4SQ 3EFRA 2AK5A 4PFPA 3TREA 1JXOA 4RG2A 1RAIB 4FIBA 1FMKA 2EGEA 1TOVA 1SSFA 1HD3A 1QQJA 2LQ8A 4O5VA 2FL7A 4C92C 3OW2P 1VQPT 4X9CA 3OYHA 2RHZA 2JMAA 2HD0A 3OYCA 1FMVA 1QWEA 1M27C 3PNWC 1VQPA 3MEAA 1U06A 3PIPA 2RN8A 1N8RC 3CCUT 4RTTA 1K0SA 1CKBA 2GNCA 2YWWA 3RIRA 3RKXA 5GAN2 2EYZA 2JW4A 4IUTA 4RKUE 1PRMC 1OZ2A 3CCUA 2RJFA 3MEVA 1VQ4Q 2EPDA 2PZ1A 1G3SA 4ANJA 1I07A 4WTOB 1VQMT 3ZEHA 2RI5A 5GAOn 2MI6A 2QI2A 1OULA 1Q81R 2A3LA 3JCMh 4E2FB 1NYGA 2J6OA 2K5LA 2MPXC 2YRDA 2JN0A 2OTLT 1HYOA 1XOVA 3CCVT 1N5ZA 3VS4A 3OS1A 3OY9A 2CS7A 4OMPA 3CCVA 1KC8C 3C12A 1GCQC 1RAFB 3PVLA 3UWNA 2E4HA 3A8GB 3CMAQ 4HKEA 1D0YA 1OPKA 3MHXA 4LD9K 2D6FA 1WDXA 2LRQA 3PMTA 3CXCP 1AZGB 2DILA 5L23A 1PCXA 1VYVA 4L6V5 5J39A 1M1KU 3SHWA 2E5KA 3CPWS 2A7YA 1T3SA 3SWNC 3REBB 4PJLA 4C8QD 2CP2A 1Q95G 2SEMA 1YITT 1OX8A 4RCCA 3T9NA 2KBTA 3UATA 2QDYB 4ZGDB 3M4YA 3OBYA 4BY6C 3GF5A 1YITA 2ZPGB 1BI2A 2RJDA 2HSEB 4M77B 3A8HB 1NJIR 1X01A 1SF9A 3QJYA 3S6WA 4ZN3A 1M8MA 2KYMA 1GL5A 1VQ8T 3S3OA 1QVFS 3G1JA 5KYYA 5DLQE 4OB3B 2RNAA 3O8VA 2ROLA 3D7SB 5FLXE 1N9SA 2OTJQ 1Y7XA 2YLBA 1VQ8A 3EG2A 1Q81C 4J9IA 7AT1B 3I56A 2MWOA 1C6VX 1Q7YU 3QIIA 3LW5E 3QSUA 1Q82U 2DD5A 2DJZA 4M75B 2YUQA 4J6WA 2B86A 3FEOA 2GFAA 1A0NB 5AT1B 1N27A 2JXBA 3EAEA 9ATCB 2MWPA 2K5FA 2KRMA 2HBWA 2QXFA 2BIVA 2LCSA 1OZ3A 2PNIA 2EQIA 1UGSB 2LC4A 3G6ET 2LJ0A 2X3XD 3QKJA 2EQUA 3L2WA 2K5IA 3UDCA 2CP7A 3G6EA 1G5VA 1TH7A 2AT1B 5CKBA 2HCKA 3X28B 1K0XA 5KYXB 1WXUA 2SRCA 3V8LA 4FYVB 1QCOA 4C8QG 1M30A 1AWOA 3A5ZB 5GAOl 2MOXA 4B9WA 2FZKB 1RACB 3JB9F 1NJIC 2GTOA 1KJWA 4XTVA 4OF1A 2QYZA 2O9SA 3VYHB 2FB7A 4J9GA 2F2XA 2IG0A 1H3HA 4RUGA 2BTTA 3DKMA 3H6ZA 4ORZA 5CCAA 2EYXA 4LDXA 2ECZA 2AZVA 4NL2A 2ZAEA 2DZCA 1K8AC 4LUDA 3A8LB 4KH1B 5D6YA 3AT1B 2VASA 2XIDA 2I2LA 4B9XA 4EIKA 4OMOA 4Z8AA 2DA9A 5DY9A 5I2SA 1C1AA 3V7CA 3BE3A 5M9OA 2Y4XA 2NUPB 3SEMA 4HCZA 4QQDA 4DEXA 2XMFA 2CSQA 3CD6T 1E6GA 2JZ2A 3E1SA 4C0FA 1K1ZA 3VUBA 3CCVQ 1QW1A 3LYIA 1BI1A 1QWFA 4QKUA 2B8AA 4HCKA 3OMGA 2CUBA 4CC7A 4PFZA 3SDZA 5GAOm 4Q5WA 2JTFA 5GAN6 4OGCA 2KT1A 3VRZA 4F04B 4PJOE 2AZSA 3EG9B 3KXTA 3MEWA 4J5YA 1Q86R 4QVCA 2LX9A 4BDZA 3JCMP 1PNJA 5KCOA 3ZFJA 1T0JA 4M77D 4ESRA 4MMKA 3CC7Q 1YFNA 1M4ZA 2RO0A 4NOYA 3CCST 1QVGA 5C6SA 4PLLA 3FB9A 2VXEA 3CCSA 4DBRA 5GAN3 2QGFB 2HMAA 3JCMe 4J83A 1D3BB 1H641 1ZSZB 3CPFA 4Z89A 3EG9A 2PVDB 3OYNA 2YUPA 4MZTA 2QK0A 4BI4A 5CAIA 3CPWP 4FYYB 2RD1A 4M75D 3I56Q 1VIFA 1ARKA 2JUFA 4XQ3A 1PG5B 4DEYA 4KUIA 4M7DB 1B7TA 5LJ5g 4PJOG 2EKOA 4IKFA 2W0ZA 4JS5A 2VWFA 3UF4A 4E47A 2R57A 4HVVA 1VQ7Q 1NEBA 2DYBA 3PGGA 3QPHA 1QVFP 2RQVA 4FL6A 2M51A 2X4YA 1D3BA 1ZSZA 4OMFB 3OSSC 1YBYA 4M75E 5CQXA 3P8HA 1Y0MA 1VQNQ 4JUVA 4LDVA 1YIJQ 4CC4B 1TUCA 1G3WA 1N6AA 1E6HA 1MGQA 2X35A 1PHTA 3M53A 4BACA 3G4ST 4KGXB 4J6YA 1Q86C 3GLXA 1WQWA 2K3YA 1IB8A 2L8DA 1K4US 4R56A 3G4SA 4LNPA 1QP3A 4M77G 3JB9J 3MP8A 4MMLA 2ED0A 3HFOA 3ME9A 2LQWA 4CC3A 1I81A 2RI2A 4RMOA 2MYSA 4CC2A 1WXBA 2M16A 4A4KA 5D6WA 5J3BA 2EFIA 3GOXA 3MCAB 1IREB 2J05A 2J7IA 2AIRB 3OS2A 1G83A 2E3HA 1VQ4T 3RUXA 5GANh 1WJRA 3H0FA 4M78E 1Q86U 2MCNA 4BI8B 4M75G 1JEGA 1O75A 3JV3A 3QYHB 4AMCA 1LCKA 1VQ4A 4XK8E 2KAFA 1D1AA 3QYGB 3L42A 2H3JA 2LDMA 4OMMA 1UUEA 1QLYA 2YUNA 2KI7A 3UA7A 5L8RE 2PQWA 3OYYA 3BFMA 1WHGA 4JZ3A 3H9NA 1Y96B 2BZXA 5IHIA 4FYXB 3J80E 2QQ9A 5LJ3j 3C94A 1I8FA 3Q1JA 3M0QA 5LJ3d 4ELZC 2DERA 3CMAT 3QXEB 2FO0A 1BU1A 1I1JA 2FRWA 1IO6A 3UA6A 3ZBDA 1C0MA 4EMGA 2I0NA 3CMAA 3I35A 3JCMc 4M78G 2XI9A 1UTIA 2F2WA 3RESA 2C0TA 4DBQA 1ZSGA 4EMKA 1Y96A 3RMQA 5KYWA 1H3ZA 1M3BA 2K2VA 1MUZA 4E6RA 3M0UA 4BY6B 2KNBB 2NUZA 4HT9A 5I2MA 1I5LA 4D8KA 3CC4Q 5AYFA 2X9HA 1VYTA 3BW1A 1AHJB 3NTKA 3NPFA 1OU8A 2DIGA 5C0MA 3EG1A 2OTJT 4M7AA 1W2BA 1GRIA 1MMAA 1UJ0A 4QW2A 1SHFA 2CP5A 1ZSZC 4MZPA 2OTJA 3OBWA 1PC0A 1B34A 2PVGB 4F7UA 2JM8A 1I0CA 2X4JA 4RTVA 3FC3A 5LJ5j 4J9BA 4QQ6A 2E5QA 2BE9B 3E9FA 1YCSB 3M0PA 2QGGA 2GFUA 1M8VA 2RPNA 4JRQA 4M7DE 1M1KR 1QCNA 4C0GA 2MMPA 2RQTA 2XG8D 1JJ2S 1GFCA 2L3QA 2RJCA 1XQHA 3META 4A4FA 4JZ4A 2JMCA 3I9QA 2ZPIB 2CDTA 3OYDA 1BCOA 2R58A 2RHXA 2BZ8A 5A2QE 5CKFA 2O4XB 2EJ9A 2LCLA 3J81E 1SRMA 2A37A 1VQLQ 1PRLC 4QQGA 4BE0A 3HP9A 2VC8A 3GNGA 2RI3A 4HCCA 2FPFA 1NBEB 2COWA 5FRMA 1X2QA 4MZMA 1R0BG 4C92E 5A0LA 1WJSA 2CZ1B 2E41A 1Q7YR 5IAYA 1UE9A 3I5SA 1OQKA 4C5HA 3WVDB 1RAGB 4DOVA 1Q82R 1U1SA 1RUWA 2LTOA 1YP5A 4KT0E 1JO8A 1UB4A 4M7DG 2RA2A 3JCMW 1TSFA 1QKWA 3OYJA 1NZ9A 5FU7B 2VYTA 3R6NA 5GAN7 1M2VA 2O4XA 1WXTA 1T0HA 4Y28E 1FWZA 4F16A 2K6DA 4Z02A 3V8JA 3RDVA 2WSFE 2MK5A 2E3IA 2D8HA 2H8HA 3R6OA 4XAXB 1DJ7B 4HCBA 4L59A 1M1KC 2OX7A 2WSCE 2P84A 4LDWA 2X4XA 1Y07A 4BI3A 2DKGA 2LNVA 5GAOp 5FU6B 4EMKC 2AHJB 2ROTA 1XJWB 3MEUA 2OJ2A 4C92G 3VS5A 2F2VA 2XK0A 1MV0B 2QAZA 1BIBA 3CMEQ 2JNGA 5GAOq 2CT4A 2PTKA 4DQ2A 1M3CA 1KHCA 5LJ3f 1NEGA 2XDPA 2VKNA 4FSXA 1CKAA 5KYYB 2XICA 3EH1A 4FT4A 2RF0A 4M7AC 1W70A 5IN1A 3CC7T 1MHNA 1B07A 4XTUA 5GANe 2A0FB 1Q7YC 2E6ZA 2HEQA 1HK9A 1ZX6A 2V8KA 2O88A 3CC7A 4A4HA 1Q82C 5HY6A 1NM7A 4FM4B 2M02A 1PD1A 4ZTJA 1UHFA 4PLIA 4ZGEB 1KQSS 4OP0A 3HL8A 2YXYA 3CCJA 2DXBA 1SRLA 4JJDA 1AVZC 1XTDA 3QWYA 3I56T 2ESWA 3E2UA 1M3AA 4Y92A 4C8QE 2Z0WA 1UEBA 3RKYA 1RL2A 2EWNA 3RKWA 3VS2A 2DFUA 4JJCA 1VQ7T 3CXCA 3GBQA 1VQ6Q 3EFOA 3JCMg 1QVPA 3QO3A 4WF2A 2DE0X 3QJ6A 4N0AA 1AWJA 2V8IA 1VQ7A 4HVUA 2FRYA 1VQNT 3OYKA 2DLPA 5LJ5f 4IURA 4FW1A 1YIJT 3VKIA 1VIEA 1M2OA 4PJOF 4DBHA 2K79A 2J06A 1VQNA 3PIOA 5LJ3h 1LNXA 1YIJA 1KD1U 2JVVA 2GGRA 2KROA 2MF2A 2NUTA 1SHGA 4JLIA 3I55Q 3OSVA 2ZZDA 5GAMe 1AOJA 2RK1A 1ZHIA 4R0KA 1TUDA 1VUBA 1YNZA 3DLMA 3LWHA 4LE9A 2HL3A 3I5RA 3IQLA 2LP5A 4RCBA 1GFDA 1W6XA 4A53A 1U3OA 2JM9A 4LN2A 1PSFA 5I11A 1JJ2P 5KYUB 2LZ6B 2FG0A 3FJ5A 4BUGA 3L2QA 3VS3A 1JQQA 2CP3A 4J7IA 3V7RA 1PSEA 5CKEA 5GAOr 3L2ZA 1SPKA 1YHQA 1TTHB 2DVJA 3UPUA 2QQAA 3FLGA 2DMOA 2DZ9A 1YN8A 5GJWB 2NWMA 3MO8A 3KBGA 2CGHA 5IXBA 5FU7C 4OB1B 2QEXQ 2EQKA 2ENMA 1QMCA 2QG9B 4GY5A 2H3EB 2E64A 1PWTA 5KYUA 2KGTA 1ZUUA 3LLRA 4OB0B 3M0TA 4FYWB 4XTZA 3RERA 4ZNXA 1VOMA 3NTIA 4M75F 1W2BS 2JOYA 3JSCA 3X26B 3LWIA 2D0QB 4XU1A 2XHCA 4HVWA 4JPBW 1KSWA 1GBQA 5FU6C 5CQYA 2GCXA 2E12A 1LJOA 3A8MB 5HK3A 1IRXA 5GMKj 2K3BA 1UDLA 1RLQC 3OYFA 1WYXA 1I5OB 2BKDN 2FVUA 5IH2A 3G71T 4OMNA 4BB7A 5FW9A 2DM1A 2HQXA 3G71A 5FROA 3SB2A 1QKXA 1OOTA 3L2VA 3CC4T 3GNFB 2P4RA 3HPWA 4M78F 1BB9A 1M1GA 3JB9D 2PVOB 3CC4A 2G6FX 1X6BA 2CP0A 3EGDA 4A4GA 3CCJQ 1D0ZA 3FRNA 3RBBB 1FMWA 2CKKA 1YJWT 8ATCB 1G2BA 1UJYA 2V8JA 1U8RA 2BZYA 3QDRB 4N0AC 1ZUYA 1UG1A 5ECAA 2MIOA 3REAB 1YJWA 4KRTA 4M77E 4BE2A 2D9TA 2O9VA 2VV5A 4PJMA 3CBMA 4J9HA 1X69A 2M9UA 4E7KA 2DRMA 4OMQA 1R0CB 4QT7A 4DOWA 1V76A 2KK4A 1KQSP 4GLMA 1Y57A 1Z9QA 4N4IA 3CCLT 2CH4W 2J6FA 5IHKA 1Z9ZA 2COZA 2F5KA 1S72Q 3CCLA 2LQNA 3EHRA 3QDFA 3RNJA 4J9EA 3PE0A 3WXMB 4XU0A 1JRIA 1YJ9A 1SG5A 3CCMQ 4IUUA 5HKCA 2EQMA 8AT1B 1VQLT 2VXFA 1EFNA 2VVKA 2EGAA 2WSEE 5A0GA 1EIFA 3VS1A 4EDUA 2GQVA 2Y90A 3CPWA 1VQLA 4V2SA 3OA6A 2E65A 2M1HA 3JB9G 1WHKA 2GF7A 2D8JA 2ZPFB 2Y4YA 1XNIA 4RTXA 2FHDA 1ZUKA 1YHQQ 4AG2C 1YWPA 1CSKA 2DXTA 1OEBA 2L3PA 2L0AA 2HSPA 2DVEA 2IIMA 1QVFA 4AFUC 4FT2A 3UT1A 4JS4A 3QZ5B 4WCIA 3NTHA 4E7ZA 1W1FA 1YJNA 4TVRA 1UFFA 5CO7A 1EZZB 2QA4A 3E9GA 1VQ9A 2YRCA 4MDWA 2C0IA 4M7DF 4LDUA 2QASA 1MMNA 1M90U 4UC4A 4EMKB 5LJ3e 1U1TA 2P4TA 5KYWB 3BY7A 2ZPBB 5FWBA 1HSQA 2WACA 3CMET 2EJFA 1BBZA 1NG2A 2EJGA 3CMEA 2DX1A 5CKHA 1J3TA 3PTAA 1WJQA 4C0ZA 4XU2A 3TCJA 4KULA 4II1A 1W2BP 2HKQB 4JJBA 4C5IA 4M7AB 2R5MA 2CUDA 4A54A 1VQ5A 2EGCA 2IVWA 2YT6A 3M55A 2BUDA 2FZGB 1FXXA 1RAEB 3M57A 4C92F 2JTMA 2E10A 4PJJA 2O31A 3G71Q 1B34B 3SD4A 1RI0A 3TSWA 4F7UB 4IIMA 1GXIE 5HCKA 3LH0A 2DO3A 2QTVA 3VJPA 2O2OA 5KYNA 5FRNA 3OB9A 3FDRA 2ABLA 1YJWQ 4ME7A 5GANg 1PKSA 2HQHA 2OAUA 1KFZA 2YDLA 1LOJA 3VS0A 2ED1A 4PJNA 4J6XA 3ZL7C 1NE8A 1VQ6T 2DAQA 3NHNA 4OVAA 2HBPA 3CCEA 4ATOA 5LJ5d 1OX9A 2L2PA 1TU0B 3G7ZA 2LX7A 1VQ6A 4BDYA 3JCMQ 4KGVB 2K2MA 4RTZA 2QQRA 3P8BB 3CCLQ 2FEIA 1LVKA 2FZCB 2L3RA 1MV3A 3OS5A 4Z88A 2QQBA 3P8DA 2XU8A 5DM7R 1IZ6A 3I55T 3X20B 2QTXA 1YJ9Q 3CQTA 4C8QA 3JCMJ 5GMKh 3I55A 1M2VB 1NPPA 3OYLA 2W10A 3L2UA 4E7HA 5D7UA 4RTUA 1M1FA 1WQ7A 2YLCA 3M0RA 1NYFA 3N5BB 4QVDA 4B6MA 1TWBA 1Y71A 2YSQA 1NLPC 2KVQG 5CVIA 4FU6A 3URGA 3MP6A 4E7JA 2HL5C 5GAMg 1AEYA 2DPPB 1RLPC 2K9GA 4OB2B 4C8QF 3EGXA 4J7FA 4CRIA 3PVQA 5EC7A 2DBKA 2QEXT 1BIAA 2LJ3A 1WNLA 1TXQA 2EVRA 3GPLA 1YJNQ 1KQ2A 3KFVA 3H0IA 3OYBA 2QEXA 2LQKA 4X1VA 1D1BA 4JDSA 2L3SA 1BI0A 3VS6A 1QVGS 1KG1A 2D1XA 2QA4Q 1VQ9Q 2EIFA 1K9MR 3M59A 2EKHA 2EAYA 3ASKA 1KD1R 3M58A 3EGUA 5GMKi 3CBPA 2KR3A 3TU4K 2DJQA 3DLLA 4ZTFA 3OW2A 4C5EA 1PM3A 1JXMA 1W4SA 1VQMA 2KSSA 4AT1B 4M7AD 1WGSA 2YRVA 2VUBA 2K57A 1N8RU 3OYEA 2HKNA 2RMOA 2OTLA 2DL3A 2V1RA 1K76A 5GAN5 1VQ5Q 1M5Q1 5HK0A 3JAME 1H8KA 4PJOB 2PUKB 3NGPA 2DBMA 2KY9A 2DF6A 3PFSA 5GMKl 2CH4A 1VQKT 2GTJA 1MMGA 1UGPB 2DL8A 2JT4A 4M7AE 1MNEA 1VQKA 2KXCA 1ZA1B 3CCJT 3EG3A 3EFOB 2A36A 4CI0C 3NFCA 2X51A 2RQRA 1WHHA 3H0HA 2ZPEB 1ZA2B 4F7UE 3A8OB 3CCRQ 2EYYA 1H92A 2D0NA 1OI1A 4PJOA 1KC8U 1K9MC 3H8ZA 1GBRA 4JRKA 1OV3A 1KD1C 5GANj 2KYBA 5GANd 3CC2Q 4L5GA 2NUTB 1O9SA 1WFWA 2RH2A 5IT9E 3CCEQ 1SKUB 4IUQA 4C8QC 1OYXA 1G3TA 5I22A 1YWOA 3CCQQ 3QHSA 3EH2A 2CZ0B 3OYGA 1KQ1A 4PKCC 1S72T 2DXCA 3BDUA 2K7AA 1PD0A 1K8AR 4M7AG 1UECA 2HNIA 1S72A 4J9CA 1OU9A 5GAN4 2PU9B 1K9MU 3CCMT 2MAMA 4E7SA 2P0PA 1ZBJA 2F1LA 4M77A 3LX7A 1N9RA 3F70A 4F7UG 5GMKm 2DD4A 1BCMA 3CCMA 5KCHA 1YCYA 1UHCA 4PK4A 2LJ1A 1VQOQ 3RR6A 1GCPA 1WLPB 3QUIA 2KRNA 4IUPA 3A1PA 4GLKA 1Q81U 5EG2A 2RK2A 3LGFA 1YI2Q 1B3QA 3M4GA 1YHQT 1BYMA 1X75C 2RB6A 1AD5A 2IPOB 1X6GA 4M75A 2LT1A 3HRSA 4M4ZA 2RHUA 1IHWA 1VYUA 4M77F 4AFZC 5GAMj 5GAMd 4AFQC 2QQSA 3VU3C 1UGRB 5IXFA 4ZGJB 3M54A 2LMJA 1VQPQ 3HSBA 4M78B 2ZCFB 2CSIA 3VUZA 3C4SA 2O01E 1JB0E 2GBQA 2EYWA 1SSHA 3VYGA 5I21A 3ER0A 4LD6A 3CCUQ 2K3XA 3TVTA 2KE9A 2KT8A 3WVEB 3LH5A 5KYXA 2KEAA 3SFMA 5LJ5h 4P5NA 3X25B 3A98A 1U5SA 2DNUA 2HDAA 5GMKe 4XTWA 1I4K1 4RTYA 1JJ2A 1VQMQ 2KXDA 4M78A 1EX4A 3AHUA 1QVGP 4KBMB 1M9SA 5A0DA 1NJIU 1PKTA 1KHIA 1JBMA 4PJOD 3OYAA 3U23A 4AFSC 1WX6A 3EGDB 4E7IA 1G3YA 1BKBA 2LVMA 2OTLQ 1D09B 5LJ3g 2DK3A 3CD6A 2HQEA 1S1NA 2JTEA 5CIUA 3EFSA 4JLGA 3CEYA 1RABB 2LT4A 3HRTA 1F1BB 1K8AU 2YHTA 2DL5A 4PJOC 2FPDA 1KIKA 1D1CA 1NPRA 4NS5A 5FWCA 3V8KA 1VQKQ 3C95A 1AT1B 2X4WA 2CYZB 3M9QA 2LCCA 2NUPA 3E19A 1X43A 4RG8A 5CR2A 3BDLA 1ZQ1A 2V26A 4MDXA 6AT1B 1K73R 2BE7D 1M90R 3FIFA 3JCMV 3OS0A 4X9DA 4A63B 3TSZA 2J6KA 5D6XA 1WPYA 1YITQ 1D0XA 4AG1C 1JU5C 4HT8A 2G3RA 3M56A 1WHJA 4M77C 2XDBA 3HFNA 2DETA 5GANf 5KE2A 2ZGWA 1VQ8Q 4C0DB 4N4GA 4ZN1A 2HAXA 4X34A 4O6JA 5LL6S 3JCMd 3S3MA 1R8OB 4JRIA 4JJNK 4XTYA 2JS0A 2DEQA 3HTRA 1OPLA 1QCFA 3KUFA 3FJPA 1FX7A 4KH0B 5J26A 4N4HA 1AWWA 1YJ9T 3MJXA 2VB6A 2CZ7B 4VUBA 3S3NA 4BD3A 2ZPHB 4M75C 3VS7A 1IHVA 2VGMA 3DB4A 2KDSA 1IXDA 2NYSA 4EPCA 3OQ5A 5DLOA 4XU3A 3EG0A 1K9AA 1X27A 5KH6A 3OW2S 4NL3A 2DL4A 1X6OA 1V29B 2X3WD 3J7AF 1BK2A 3M0SA 1X2KA 5CK9A 4M7DA 3G6EQ 1NLOC 2DYIA 4LUEA 2JS2A 2COYA 2DL7A 1RAAB 1M90C 1K73C 4DA4A 2DTHA 4C92B 4F17A 1KQSA 2XKOC 4M78D 4Y91A 3HRUA 1LPLA 5IHNA 4J9FA 1ZLMA 4A4EA 1T3LA 4KUDK 2P0KA 3L1AA 1YJNT 3NMZC 4EMHA 3M5AA 2RQUA 3X24B 1ABOA 2M0YA 2E1HA 1E7OA 2OAWA 2CREA 2L89A 2XDDA 2QA4T 1VQ9T 3CBOA 5GAMf 4M78C 4LDYA 2LNHB 3TQ7P 2K4YA 1QP2A 3JRZA 2KQWA 4OGEA 4LXCA 3QWXX 3RMSA 3THKA 1WI7A 3JCMb 1V1CA 2CT3A 1K73U 4C92A 1WA7A 2JJ9A 4DBFA 1HJDA 2A08A 3MP1A 3OYIA 1IGQA 2E6NA 3JCMX 2E70A 3H41A 2AKLA 1KK7A 2M0OA 4D6WA 3JB9H 1ACMB 3OYMA 2FPEA 2F5TX 1UGVA 5GJVB 3CXCS 2RHIA 2DTOA 1VQ5T 1AWXA 3EHQA 4J9DA 1RAHB 3CD6Q 2V1QA 2CP6A 4IIOA 4ELYC 1BI3A 2A28A 4D8DA 1SEMA 2EYQA 1WZOA 2RQWA 4PNOA 2FYKA 4IUVA 1AZEA 4GBQA 1IGUA 2P0QA 4RTWA 4K11A 1RI9A 2YUOA 1VA7A 3L2RA 2NLUA 3INZA 1ABQA 3ULRB 3SWNB 2GQIA 1P92A 3CCRT 1WHMA
chains in the Genus database with same CATH topology
3V7RA 4E47A 1PSEA 4C5EA 2DIQA 2R57A 5CKEA 3PGGA 5GAOr 3QPHA 1W4SA 2R5AA 3L2ZA 2KSSA 3CCRA 2EQJA 1VQMA 4FL6A 1YHQA 2XD0A 4M7AD 1WGSA 2X4YA 2QQAA 5GAMh 3UPUA 1D3BA 4JRPA 3CC2T 4BE1A 2YRVA 2VUBA 4OMFB 2K57A 3OSSC 1YBYA 3FLGA 3PT9A 4M75E 5CQXA 1ZBXA 3OYEA 5LJ5e 2KMTA 2F69A 4PL6A 2DZ9A 3P8HA 4JUVA 3MO8A 3KBGA 4LDVA 2OTLA 3CCET 2CGHA 4C8QB 3OMCA 3CC2A 5GAN5 2C06A 5FU7C 4OB1B 4YTLA 1M5Q1 1G3WA 1N6AA 2VGNA 3GIBA 2EQKA 1MGQA 5HK0A 3CCQT 2PUOB 2X35A 3M53A 3JAME 4BACA 4PJOB 2PUKB 3G4ST 2KY9A 4GY5A 4J6YA 4M7DD 5KE3A 1Q86C 2RHYA 3V7SA 2E64A 3GLXA 1WQWA 2K3YA 3SWNA 3PFSA 2L8DA 5GMKl 3CCQA 3LLRA 1VQKT 4R56A 4OB0B 3G4SA 1UGPB 4R55A 1QP3A 4M77G 3JB9J 4XTZA 4E7LA 3MP8A 4M7AE 4MMLA 3RERA 3HFOA 3ME9A 3NTIA 4C0DC 3DB3A 3QG1A 4M75F 1W2BS 1VQKA 2JOYA 1I81A 3CCJT 2RI2A 2DXUA 4RMOA 4CI0C 3JSCA 3NFCA 3X26B 2DTIA 4HA8A 3LWIA 3JCMf 5GAN8 2D0QB 4XU1A 4M7DC 2M16A 2XHCA 2ZPEB 4J8OA 4F7UE 3LGLA 4A4KA 2RJEA 3QZ9B 3A8OB 2EFIA 5D6WA 5FU6C 5J3BA 3GOXA 5CQYA 2GCXA 3MCAB 1VQOT 1IREB 5CKDA 2E12A 3HHTB 1LJOA 3A8MB 5HK3A 1OI1A 2CZ6B 4PJOA 4C5GA 3VV0A 3OS2A 5GMKj 1KC8U 1VQ4T 1K9MC 3RUXA 5GANh 3H8ZA 1VQOA 4M7AF 4XTXA 1WJRA 4JRKA 1KD1C 4M78E 5GANj 4BI8B 1Q86U 4M75G 5GANd 3GP8A 4L5GA 1O75A 1YI2T 3OYFA 3QYHB 4QVZA 1VQ4A 3JB9I 1HXDA 1O9SA 4C92D 4XK8E 2KAFA 2BKDN 2FVUA 3L42A 3HKSA 2H3JA 2RH2A 2RM4A 3QYGB 3G71T 5IT9E 2LDMA 1UGQB 4BB7A 4IUQA 4C8QC 1OYXA 1YI2A 3PMIA 1G3TA 4F7UF 2L5QA 3QBYA 3QHSA 2CZ0B 2HQXA 3TEEA 3G71A 3OYGA 1KQ1A 4PKCC 3EFRA 5FROA 3SB2A 1S72T 2DXCA 3TREA 3BDUA 4RG2A 5L8RE 4FIBA 2PQWA 3OYYA 3L2VA 3GNFB 3CC4T 3BFMA 1SSFA 4M7AG 2LQ8A 4O5VA 3HPWA 2FL7A 4M78F 1Y96B 2HNIA 1M1GA 4C92C 1VQPT 4X9CA 1S72A 3OYHA 3JB9D 2RHZA 2PVOB 3CC4A 2HD0A 3OYCA 5GAN4 2PU9B 1K9MU 3PNWC 4A4GA 3CCMT 3J80E 2MAMA 2QQ9A 2P0PA 3FRNA 3MEAA 2CKKA 5LJ3j 1VQPA 1YJWT 3C94A 4M77A 1I8FA 3LX7A 3Q1JA 1N9RA 2V8JA 3F70A 5LJ3d 4ELZC 4F7UG 5GMKm 3PIPA 1U8RA 2DD4A 3CMAT 1N8RC 3QDRB 3QXEB 3CCUT 4N0AC 3CCMA 5KCHA 1YCYA 1YJWA 3RKXA 3RIRA 5GAN2 4IUTA 4RKUE 4M77E 3ZBDA 4BE2A 4EMGA 3CMAA 1OZ2A 2D9TA 3CCUA 2RJFA 3MEVA 3QUIA 3JCMc 4IUPA 4M78G 2XI9A 2VV5A 3CBMA 4GLKA 1G3SA 1Q81U 5EG2A 3RESA 2M9UA 2RK2A 3LGFA 4E7KA 4EMKA 4DOWA 2KK4A 1Y96A 3M4GA 1VQMT 1YHQT 3RMQA 2RI5A 3ZEHA 5GAOn 1BYMA 2MI6A 4A4FA 1X75C 1H3ZA 2QI2A 2RB6A 2A3LA 2K2VA 3JCMh 4M75A 2LT1A 3HRSA 2K5LA 2RHUA 4N4IA 3CCLT 4BY6B 4HT9A 2JN0A 4M77F 2OTLT 2F5KA 5GAMj 5I2MA 1I5LA 5GAMd 3CCLA 1XOVA 3CCVT 2QQSA 5AYFA 1UGRB 3VU3C 4ZGJB 3M54A 3BW1A 1AHJB 3NTKA 3OS1A 3OY9A 3HSBA 4M78B 2CS7A 4XU0A 3WXMB 2ZCFB 2DIGA 3VUZA 3C4SA 3CCVA 1JRIA 2O01E 1JB0E 5C0MA 3C12A 1KC8C 1YJ9A 2OTJT 3UWNA 4M7AA 1W2BA 4IUUA 3A8GB 4QW2A 3VYGA 5HKCA 2EQMA 1VQLT 2VXFA 5I21A 3ER0A 4LD6A 2K3XA 4HKEA 4MZPA 2OTJA 3WVEB 4LD9K 2WSEE 3MHXA 1EIFA 4EDUA 5A0GA 2GQVA 2D6FA 2Y90A 3CPWA 3OBWA 1VQLA 2LRQA 1B34A 3PMTA 2PVGB 4V2SA 3OA6A 4F7UA 2X4JA 3SFMA 2E65A 2M1HA 4L6V5 4P5NA 5LJ5h 3X25B 3FC3A 5J39A 3JB9G 5LJ5j 4QQ6A 1M1KU 2GF7A 2ZPFB 5GMKe 3CPWS 2Y4YA 1XNIA 2E5QA 2A7YA 2FHDA 3E9FA 1I4K1 4XTWA 1JJ2A 3SWNC 2GFUA 4M78A 1M8VA 4C8QD 4JRQA 3AHUA 4M7DE 2DXTA 4KBMB 1M9SA 5A0DA 4RCCA 3T9NA 1YITT 1KHIA 1NJIU 1JBMA 2QDYB 4C0GA 4PJOD 2DVEA 2MMPA 4ZGDB 3OYAA 2XG8D 3M4YA 1QVFA 3OBYA 4E7IA 1G3YA 4BY6C 3GF5A 1BKBA 2LVMA 4JS4A 1YITA 1JJ2S 2RJCA 1XQHA 1BI2A 2RJDA 2ZPGB 3A8HB 3META 3QZ5B 4FT2A 4M77B 2DK3A 1X01A 3UT1A 5LJ3g 3CD6A 2ZPIB 2HQEA 3NTHA 3QJYA 3S6WA 4ZN3A 1N8RU 1YJNA 5CIUA 3EFSA 4JLGA 3OYDA 1VQ8T 3CEYA 2LT4A 3HRTA 3S3OA 2R58A 4TVRA 2RHXA 1QVFS 5A2QE 5CO7A 1K8AU 5CKFA 5DLQE 4OB3B 2YHTA 3E9GA 3O8VA 5FLXE 4MDWA 2QA4A 1N9SA 1VQ9A 2O4XB 2EJ9A 1Y7XA 2YLBA 1VQ8A 4M7DF 4PJOC 2LCLA 1Q81C 3J81E 4LDUA 4QQGA 3I56A 1NPRA 4NS5A 2MWOA 3V8KA 4BE0A 3C95A 3HP9A 2X4WA 1M90U 4UC4A 4EMKB 5LJ3e 2CYZB 2VC8A 3M9QA 1U1TA 3GNGA 1Q7YU 2LCCA 2RI3A 2P4TA 3E19A 3QIIA 4HCCA 3LW5E 4RG8A 5CR2A 3BDLA 3QSUA 1ZQ1A 3BY7A 1Q82U 5FRMA 2DD5A 2DJZA 2ZPBB 4M75B 4MZMA 4J6WA 3FEOA 4MDXA 2GFAA 2WACA 4C92E 5A0LA 1WJSA 2CZ1B 2E41A 3CMET 2EJFA 5IAYA 3FIFA 4C5HA 3WVDB 1N27A 3JCMV 3OS0A 4DOVA 4X9DA 3EAEA 1U1SA 2LTOA 2MWPA 4KT0E 1UB4A 2EJGA 2RA2A 3JCMW 3CMEA 4M7DG 2K5FA 2QXFA 3OYJA 2BIVA 5CKHA 1NZ9A 5D6XA 1WPYA 1WJQA 1OZ3A 2VYTA 5FU7B 4C0ZA 4XU2A 5GAN7 3PTAA 3TCJA 2O4XA 4II1A 4KULA 1UGSB 4HT8A 4Y28E 2LC4A 3G6ET 4C5IA 3QKJA 4M7AB 2EQUA 3L2WA 2R5MA 4A54A 1VQ5A 2K5IA 2IVWA 3UDCA 1FWZA 2G3RA 2BUDA 3M55A 3M56A 4M77C 1FXXA 3M57A 2XDBA 4C92F 2JTMA 4Z02A 2E10A 3V8JA 3HFNA 3G6EA 1G5VA 1TH7A 2WSFE 5KE2A 2ZGWA 5GANf 5CKBA 4C0DB 4N4GA 3X28B 4ZN1A 1B34B 3R6OA 4XAXB 1DJ7B 1RI0A 3SD4A 2HAXA 4X34A 4HCBA 4O6JA 5LL6S 3V8LA 3JCMd 1R8OB 4F7UB 3S3MA 4L59A 4JRIA 4C8QG 4JJNK 4XTYA 3A5ZB 1M1KC 2DEQA 1GXIE 2WSCE 3KUFA 5GAOl 3LH0A 2X4XA 1FX7A 1Y07A 3FJPA 4LDWA 4B9WA 2DKGA 4BI3A 2LNVA 5J26A 2DO3A 4N4HA 5GAOp 5FU6B 3VJPA 1YJ9T 5FRNA 4EMKC 2CZ7B 4VUBA 3S3NA 2AHJB 3MEUA 3JB9F 4BD3A 1NJIC 3OB9A 3FDRA 4XTVA 4C92G 2ZPHB 4OF1A 4M75C 2VGMA 2XK0A 3DB4A 3VYHB 1BIBA 2FB7A 2KDSA 2IG0A 2JNGA 4EPCA 4ME7A 3OQ5A 5GAOq 5DLOA 3DKMA 3H6ZA 5GANg 4XU3A 5CCAA 3OW2S 2OAUA 5KH6A 4DQ2A 4NL3A 1X6OA 1LOJA 1V29B 1KHCA 5LJ3f 4LDXA 4NL2A 4J6XA 2XDPA 2DZCA 3J7AF 1K8AC 4FSXA 3A8LB 1NE8A 1VQ6T 2DAQA 5D6YA 2XICA 4OVAA 4FT4A 2HBPA 5CK9A 4M7DA 3CCEA 4ATOA 5LJ5d 2XIDA 2I2LA 4M7AC 4B9XA 3G7ZA 5IN1A 1MHNA 3CC7T 4XTUA 1VQ6A 5DY9A 5I2SA 4BDYA 5GANe 3V7CA 3JCMQ 1K73C 1M90C 5M9OA 4DA4A 1Q7YC 2DTHA 2E6ZA 4C92B 1KQSA 2XKOC 1HK9A 2V8KA 4M78D 2Y4XA 4Y91A 3HRUA 4HCZA 2QQRA 3CC7A 4QQDA 4A4HA 1Q82C 5HY6A 3P8BB 4FM4B 3CD6T 2JZ2A 4A4EA 3E1SA 4KUDK 2P0KA 3L1AA 1YJNT 4EMHA 4ZTJA 4C0FA 4PLIA 3M5AA 2L3RA 4ZGEB 3VUBA 3X24B 3OS5A 1KQSS 2QQBA 2E1HA 4OP0A 3HL8A 2XU8A 3P8DA 5DM7R 1IZ6A 2L89A 2XDDA 3I55T 3X20B 1QW1A 2DXBA 3CCJA 2QTXA 3LYIA 2QA4T 1VQ9T 3CBOA 1BI1A 4C8QA 5GAMf 2B8AA 1XTDA 4M78C 4LDYA 3I56T 3OMGA 2K4YA 5GMKh 1QP2A 3I55A 3JCMJ 1NPPA 3JRZA 2KQWA 3OYLA 4OGEA 4E7HA 3SDZA 3L2UA 4C8QE 5GAOm 3RMSA 4Q5WA 2JTFA 3JCMb 5GAN6 1UEBA 1M1FA 3RKYA 4OGCA 1RL2A 2EWNA 1K73U 1WQ7A 2YLCA 4C92A 4PJOE 3RKWA 3N5BB 4QVDA 3KXTA 3MEWA 4J5YA 1VQ7T 3MP1A 2LX9A 4QVCA 4BDZA 3OYIA 1Y71A 2E6NA 3CXCA 5KCOA 3JCMX 2E70A 3JCMP 3JCMg 2KVQG 1QVPA 3ZFJA 5CVIA 3QO3A 4WF2A 2M0OA 4FU6A 3URGA 4D6WA 3MP6A 3QJ6A 4M77D 4N0AA 4E7JA 2V8IA 1VQ7A 3JB9H 4MMKA 3OYMA 5GAMg 2DPPB 2F5TX 1VQNT 4OB2B 3OYKA 1M4ZA 4C8QF 3CXCS 2RO0A 4J7FA 4IURA 4NOYA 4CRIA 5LJ5f 2RHIA 3CCST 1YIJT 2DTOA 3VKIA 1VIEA 1QVGA 1VQ5T 5C6SA 2QEXT 1BIAA 4PJOF 1WNLA 4PLLA 3FB9A 1VQNA 2VXEA 3PIOA 3GPLA 5LJ3h 1LNXA 3CCSA 5GAN3 1KQ2A 1YIJA 1KD1U 2JVVA 3JCMe 4ELYC 3OYBA 2MF2A 2QEXA 1BI3A 2LQKA 4J83A 1D3BB 4JDSA 4JLIA 1H641 1BI0A 3CPFA 1QVGS 1KG1A 3OSVA 2ZZDA 2PVDB 3OYNA 2EIFA 2EYQA 5GAMe 3M59A 2RK1A 4MZTA 4PNOA 4BI4A 2FYKA 1ZHIA 4IUVA 5CAIA 2EAYA 3ASKA 3M58A 2RD1A 4M75D 5GMKi 1VUBA 1VIFA 3DLMA 2P0QA 3LWHA 3CBPA 2JUFA 4XQ3A 4RCBA 4KUIA 3L2RA 4M7DB 2NLUA 4A53A 5LJ5g 1PSFA 4PJOG 2EKOA 3INZA 4IKFA 3TU4K 4ZTFA 3L2QA 4BUGA 3DLLA 3SWNB 1P92A 3CCRT 4JS5A 3OW2A 4J7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8F A;  5LJ3 d;  3V7R A;  1N9R A;  2I2L A;  4F7U G;  4M7A C;  5GMK m;  4XTU A;  3PGG A;  4N0A C;  5DY9 A;  5GAO r;  2YHT A;  3V7C A;  5GAN e;  3JCM Q;  1N9S A;  1YCY A;  3L2Z A;  2EJ9 A;  2DTH A;  2YLB A;  4C92 B;  3RKX A;  3RIR A;  1HK9 A;  4M78 D;  5GAM h;  5GAN 2;  4M7D F;  1D3B A;  4Y91 A;  4M77 E;  4EMG A;  2K57 A;  4M75 E;  3V8K A;  3QUI A;  5LJ5 e;  3JCM c;  4M78 G;  2DZ9 A;  4EMK B;  5LJ3 e;  2VC8 A;  3L1A A;  1U1T A;  4JUV A;  4EMH A;  3RES A;  2CGH A;  4C8Q B;  5GAN 5;  3QSU A;  3BY7 A;  2E1H A;  4OP0 A;  1M5Q 1;  3GIB A;  2DJZ A;  4M75 B;  4EMK A;  1MGQ A;  4J6W A;  4M7A D;  1Y96 A;  2QTX A;  3M4G A;  4C92 E;  4PJO B;  2E41 A;  5GAO n;  4C8Q A;  4J6Y A;  2EJF A;  4M7D D;  5GAM f;  2RB6 A;  3JCM h;  2E64 A;  3FIF A;  4M78 C;  4M75 A;  1WQW A;  3JCM V;  3V7S A;  3JCM J;  3SWN A;  5GMK h;  4X9D A;  5GMK l;  1U1S A;  2EJG A;  4M7D G;  2RA2 A;  3JCM W;  4HT9 A;  4M77 G;  2JN0 A;  3JB9 J;  4C8Q E;  4M77 F;  4XTZ A;  4M7A E;  4MML A;  5GAO m;  3RER A;  3HFO A;  1WPY A;  5GAM j;  5GAN 7;  3JCM b;  4M75 F;  4XU2 A;  5GAN 6;  3RKY A;  5GAM d;  1I5L A;  2EWN A;  1I81 A;  1WQ7 A;  2YLC A;  3VU3 C;  4C92 A;  4PJO E;  3RKW A;  4HT8 A;  2DXU A;  3BW1 A;  4QVD A;  4M7A B;  4J5Y A;  3HSB A;  4A54 A;  2DTI A;  4M78 B;  4XU0 A;  4HA8 A;  3JCM f;  5GAN 8;  4XU1 A;  4M7D C;  4QVC A;  4M77 C;  3JCM P;  1JRI A;  4C92 F;  4F7U E;  3JCM X;  3V8J A;  2E10 A;  3JCM g;  3HFN A;  3QO3 A;  4WF2 A;  4M7A A;  1TH7 A;  5GAN f;  2ZGW A;  4M77 D;  4N0A A;  3JB9 H;  2VXF A;  1B34 B;  1LJO A;  4MMK A;  5I21 A;  5GAM g;  4PJO A;  3V8L A;  3JCM d;  5GMK j;  4F7U B;  4JRI A;  4C8Q G;  3RUX A;  5GAN h;  4XTY A;  4C8Q F;  4M7A F;  4XTX A;  4NOY A;  2Y90 A;  4JRK A;  5LJ5 f;  4M78 E;  2DEQ A;  5GAN j;  2DTO A;  4M75 G;  4V2S A;  1B34 A;  5GAN d;  5GAO l;  3FJP A;  2DKG A;  4F7U A;  1BIA A;  4PJO F;  1WNL A;  3FB9 A;  2VXE A;  3JB9 I;  1HXD A;  5LJ5 h;  2E65 A;  4C92 D;  5GAO p;  5LJ3 h;  1LNX A;  4EMK C;  5GAN 3;  3JB9 G;  1KQ2 A;  5LJ5 j;  3JB9 F;  2RM4 A;  3JCM e;  5GMK e;  4C8Q C;  4XTV A;  1D3B B;  4C92 G;  4F7U F;  4JLI A;  1H64 1;  4XTW A;  1I4K 1;  4PJO C;  3QHS A;  4M75 C;  5GAM e;  3SWN C;  1M8V A;  4M78 A;  1BIB A;  2FB7 A;  2FYK A;  1KQ1 A;  4PNO A;  3EFR A;  2EAY A;  4C8Q D;  3SB2 A;  5CAI A;  2DXT A;  3AHU A;  5GAO q;  4M7D E;  4RCC A;  2RD1 A;  5GAN g;  3BDU A;  4M75 D;  4XU3 A;  5GMK i;  1JBM A;  3BFM A;  4DQ2 A;  4NL3 A;  4PJO D;  2DVE A;  4XQ3 A;  4M7A G;  1LOJ A;  4M78 F;  4RCB A;  5LJ3 f;  1Y96 B;  2HNI A;  4C92 C;  4NL2 A;  4X9C A;  4M7D B;  4A53 A;  3JB9 D;  5LJ5 g;  4M77 B;  4J6X A;  4PJO G;  2DZC A;  5LJ3 g;  3INZ A;  1X01 A;  5GAN 4;  3SWN B;  3EFS A;  4M7D A;  5LJ3 j;  5LJ5 d;  4M77 A; 
#chains in the Genus database with same CATH topology
 2DIQ A;  1GCQ A;  1TG0 A;  3C0C A;  2R5A A;  2OI3 A;  3CCR A;  2EQJ A;  2XD0 A;  4HXJ A;  1TUG B;  5GAM h;  1WHL A;  4JRP A;  3CC2 T;  1G8X A;  4BE1 A;  1MMD A;  3PT9 A;  1ZBX A;  5LJ5 e;  2KMT A;  1R77 A;  2F69 A;  2AKK A;  4PL6 A;  2DRK A;  2DEU A;  1MND A;  3CCS Q;  3CCE T;  4C8Q B;  3CC2 A;  3OMC A;  2C06 A;  4PFO A;  4YTL A;  2VGN A;  3GIB A;  2EW3 A;  1N8R R;  3CCQ T;  2PUO B;  4KGZ B;  4M7D D;  5KE3 A;  2RHY A;  3V7S A;  3VRY A;  3SWN A;  3CCQ A;  4FCY A;  4R55 A;  1RAD B;  4OML A;  4E7L A;  1WIE A;  4F14 A;  4C0D C;  3O5Z A;  3DB3 A;  3QG1 A;  3MPU B;  2C0O A;  2DXU A;  2DTI A;  2ATC B;  4HA8 A;  3JCM f;  5GAN 8;  4M7D C;  4J8O A;  4FSS A;  3LGL A;  2RJE A;  3QZ9 B;  1VQO T;  3EGX B;  5CKD A;  3HHT B;  4FW2 A;  2CZ6 B;  4C5G A;  3VV0 A;  1VQO A;  4M7A F;  4XTX A;  1TS9 A;  3GP8 A;  1YI2 T;  4QVZ A;  3JB9 I;  1HXD A;  2EBP A;  4C92 D;  1KC8 R;  1FYN A;  3HKS A;  2RM4 A;  2HZY A;  2QDL A;  1UGQ B;  1YI2 A;  3MKD A;  3PMI A;  4F7U F;  2L5Q A;  3QBY A;  2KRS A;  3TEE A;  3G4S Q;  3EFR A;  2AK5 A;  4PFP A;  3TRE A;  1JXO A;  4RG2 A;  1RAI B;  4FIB A;  1FMK A;  2EGE A;  1TOV A;  1SSF A;  1HD3 A;  1QQJ A;  2LQ8 A;  4O5V A;  2FL7 A;  4C92 C;  3OW2 P;  1VQP T;  4X9C A;  3OYH A;  2RHZ A;  2JMA A;  2HD0 A;  3OYC A;  1FMV A;  1QWE A;  1M27 C;  3PNW C;  1VQP A;  3MEA A;  1U06 A;  3PIP A;  2RN8 A;  1N8R C;  3CCU T;  4RTT A;  1K0S A;  1CKB A;  2GNC A;  2YWW A;  3RIR A;  3RKX A;  5GAN 2;  2EYZ A;  2JW4 A;  4IUT A;  4RKU E;  1PRM C;  1OZ2 A;  3CCU A;  2RJF A;  3MEV A;  1VQ4 Q;  2EPD A;  2PZ1 A;  1G3S A;  4ANJ A;  1I07 A;  4WTO B;  1VQM T;  3ZEH A;  2RI5 A;  5GAO n;  2MI6 A;  2QI2 A;  1OUL A;  1Q81 R;  2A3L A;  3JCM h;  4E2F B;  1NYG A;  2J6O A;  2K5L A;  2MPX C;  2YRD A;  2JN0 A;  2OTL T;  1HYO A;  1XOV A;  3CCV T;  1N5Z A;  3VS4 A;  3OS1 A;  3OY9 A;  2CS7 A;  4OMP A;  3CCV A;  1KC8 C;  3C12 A;  1GCQ C;  1RAF B;  3PVL A;  3UWN A;  2E4H A;  3A8G B;  3CMA Q;  4HKE A;  1D0Y A;  1OPK A;  3MHX A;  4LD9 K;  2D6F A;  1WDX A;  2LRQ A;  3PMT A;  3CXC P;  1AZG B;  2DIL A;  5L23 A;  1PCX A;  1VYV A;  4L6V 5;  5J39 A;  1M1K U;  3SHW A;  2E5K A;  3CPW S;  2A7Y A;  1T3S A;  3SWN C;  3REB B;  4PJL A;  4C8Q D;  2CP2 A;  1Q95 G;  2SEM A;  1YIT T;  1OX8 A;  4RCC A;  3T9N A;  2KBT A;  3UAT A;  2QDY B;  4ZGD B;  3M4Y A;  3OBY A;  4BY6 C;  3GF5 A;  1YIT A;  2ZPG B;  1BI2 A;  2RJD A;  2HSE B;  4M77 B;  3A8H B;  1NJI R;  1X01 A;  1SF9 A;  3QJY A;  3S6W A;  4ZN3 A;  1M8M A;  2KYM A;  1GL5 A;  1VQ8 T;  3S3O A;  1QVF S;  3G1J A;  5KYY A;  5DLQ E;  4OB3 B;  2RNA A;  3O8V A;  2ROL A;  3D7S B;  5FLX E;  1N9S A;  2OTJ Q;  1Y7X A;  2YLB A;  1VQ8 A;  3EG2 A;  1Q81 C;  4J9I A;  7AT1 B;  3I56 A;  2MWO A;  1C6V X;  1Q7Y U;  3QII A;  3LW5 E;  3QSU A;  1Q82 U;  2DD5 A;  2DJZ A;  4M75 B;  2YUQ A;  4J6W A;  2B86 A;  3FEO A;  2GFA A;  1A0N B;  5AT1 B;  1N27 A;  2JXB A;  3EAE A;  9ATC B;  2MWP A;  2K5F A;  2KRM A;  2HBW A;  2QXF A;  2BIV A;  2LCS A;  1OZ3 A;  2PNI A;  2EQI A;  1UGS B;  2LC4 A;  3G6E T;  2LJ0 A;  2X3X D;  3QKJ A;  2EQU A;  3L2W A;  2K5I A;  3UDC A;  2CP7 A;  3G6E A;  1G5V A;  1TH7 A;  2AT1 B;  5CKB A;  2HCK A;  3X28 B;  1K0X A;  5KYX B;  1WXU A;  2SRC A;  3V8L A;  4FYV B;  1QCO A;  4C8Q G;  1M30 A;  1AWO A;  3A5Z B;  5GAO l;  2MOX A;  4B9W A;  2FZK B;  1RAC B;  3JB9 F;  1NJI C;  2GTO A;  1KJW A;  4XTV A;  4OF1 A;  2QYZ A;  2O9S A;  3VYH B;  2FB7 A;  4J9G A;  2F2X A;  2IG0 A;  1H3H A;  4RUG A;  2BTT A;  3DKM A;  3H6Z A;  4ORZ A;  5CCA A;  2EYX A;  4LDX A;  2ECZ A;  2AZV A;  4NL2 A;  2ZAE A;  2DZC A;  1K8A C;  4LUD A;  3A8L B;  4KH1 B;  5D6Y A;  3AT1 B;  2VAS A;  2XID A;  2I2L A;  4B9X A;  4EIK A;  4OMO A;  4Z8A A;  2DA9 A;  5DY9 A;  5I2S A;  1C1A A;  3V7C A;  3BE3 A;  5M9O A;  2Y4X A;  2NUP B;  3SEM A;  4HCZ A;  4QQD A;  4DEX A;  2XMF A;  2CSQ A;  3CD6 T;  1E6G A;  2JZ2 A;  3E1S A;  4C0F A;  1K1Z A;  3VUB A;  3CCV Q;  1QW1 A;  3LYI A;  1BI1 A;  1QWF A;  4QKU A;  2B8A A;  4HCK A;  3OMG A;  2CUB A;  4CC7 A;  4PFZ A;  3SDZ A;  5GAO m;  4Q5W A;  2JTF A;  5GAN 6;  4OGC A;  2KT1 A;  3VRZ A;  4F04 B;  4PJO E;  2AZS A;  3EG9 B;  3KXT A;  3MEW A;  4J5Y A;  1Q86 R;  4QVC A;  2LX9 A;  4BDZ A;  3JCM P;  1PNJ A;  5KCO A;  3ZFJ A;  1T0J A;  4M77 D;  4ESR A;  4MMK A;  3CC7 Q;  1YFN A;  1M4Z A;  2RO0 A;  4NOY A;  3CCS T;  1QVG A;  5C6S A;  4PLL A;  3FB9 A;  2VXE A;  3CCS A;  4DBR A;  5GAN 3;  2QGF B;  2HMA A;  3JCM e;  4J83 A;  1D3B B;  1H64 1;  1ZSZ B;  3CPF A;  4Z89 A;  3EG9 A;  2PVD B;  3OYN A;  2YUP A;  4MZT A;  2QK0 A;  4BI4 A;  5CAI A;  3CPW P;  4FYY B;  2RD1 A;  4M75 D;  3I56 Q;  1VIF A;  1ARK A;  2JUF A;  4XQ3 A;  1PG5 B;  4DEY A;  4KUI A;  4M7D B;  1B7T A;  5LJ5 g;  4PJO G;  2EKO A;  4IKF A;  2W0Z A;  4JS5 A;  2VWF A;  3UF4 A;  4E47 A;  2R57 A;  4HVV A;  1VQ7 Q;  1NEB A;  2DYB A;  3PGG A;  3QPH A;  1QVF P;  2RQV A;  4FL6 A;  2M51 A;  2X4Y A;  1D3B A;  1ZSZ A;  4OMF B;  3OSS C;  1YBY A;  4M75 E;  5CQX A;  3P8H A;  1Y0M A;  1VQN Q;  4JUV A;  4LDV A;  1YIJ Q;  4CC4 B;  1TUC A;  1G3W A;  1N6A A;  1E6H A;  1MGQ A;  2X35 A;  1PHT A;  3M53 A;  4BAC A;  3G4S T;  4KGX B;  4J6Y A;  1Q86 C;  3GLX A;  1WQW A;  2K3Y A;  1IB8 A;  2L8D A;  1K4U S;  4R56 A;  3G4S A;  4LNP A;  1QP3 A;  4M77 G;  3JB9 J;  3MP8 A;  4MML A;  2ED0 A;  3HFO A;  3ME9 A;  2LQW A;  4CC3 A;  1I81 A;  2RI2 A;  4RMO A;  2MYS A;  4CC2 A;  1WXB A;  2M16 A;  4A4K A;  5D6W A;  5J3B A;  2EFI A;  3GOX A;  3MCA B;  1IRE B;  2J05 A;  2J7I A;  2AIR B;  3OS2 A;  1G83 A;  2E3H A;  1VQ4 T;  3RUX A;  5GAN h;  1WJR A;  3H0F A;  4M78 E;  1Q86 U;  2MCN A;  4BI8 B;  4M75 G;  1JEG A;  1O75 A;  3JV3 A;  3QYH B;  4AMC A;  1LCK A;  1VQ4 A;  4XK8 E;  2KAF A;  1D1A A;  3QYG B;  3L42 A;  2H3J A;  2LDM A;  4OMM A;  1UUE A;  1QLY A;  2YUN A;  2KI7 A;  3UA7 A;  5L8R E;  2PQW A;  3OYY A;  3BFM A;  1WHG A;  4JZ3 A;  3H9N A;  1Y96 B;  2BZX A;  5IHI A;  4FYX B;  3J80 E;  2QQ9 A;  5LJ3 j;  3C94 A;  1I8F A;  3Q1J A;  3M0Q A;  5LJ3 d;  4ELZ C;  2DER A;  3CMA T;  3QXE B;  2FO0 A;  1BU1 A;  1I1J A;  2FRW A;  1IO6 A;  3UA6 A;  3ZBD A;  1C0M A;  4EMG A;  2I0N A;  3CMA A;  3I35 A;  3JCM c;  4M78 G;  2XI9 A;  1UTI A;  2F2W A;  3RES A;  2C0T A;  4DBQ A;  1ZSG A;  4EMK A;  1Y96 A;  3RMQ A;  5KYW A;  1H3Z A;  1M3B A;  2K2V A;  1MUZ A;  4E6R A;  3M0U A;  4BY6 B;  2KNB B;  2NUZ A;  4HT9 A;  5I2M A;  1I5L A;  4D8K A;  3CC4 Q;  5AYF A;  2X9H A;  1VYT A;  3BW1 A;  1AHJ B;  3NTK A;  3NPF A;  1OU8 A;  2DIG A;  5C0M A;  3EG1 A;  2OTJ T;  4M7A A;  1W2B A;  1GRI A;  1MMA A;  1UJ0 A;  4QW2 A;  1SHF A;  2CP5 A;  1ZSZ C;  4MZP A;  2OTJ A;  3OBW A;  1PC0 A;  1B34 A;  2PVG B;  4F7U A;  2JM8 A;  1I0C A;  2X4J A;  4RTV A;  3FC3 A;  5LJ5 j;  4J9B A;  4QQ6 A;  2E5Q A;  2BE9 B;  3E9F A;  1YCS B;  3M0P A;  2QGG A;  2GFU A;  1M8V A;  2RPN A;  4JRQ A;  4M7D E;  1M1K R;  1QCN A;  4C0G A;  2MMP A;  2RQT A;  2XG8 D;  1JJ2 S;  1GFC A;  2L3Q A;  2RJC A;  1XQH A;  3MET A;  4A4F A;  4JZ4 A;  2JMC A;  3I9Q A;  2ZPI B;  2CDT A;  3OYD A;  1BCO A;  2R58 A;  2RHX A;  2BZ8 A;  5A2Q E;  5CKF A;  2O4X B;  2EJ9 A;  2LCL A;  3J81 E;  1SRM A;  2A37 A;  1VQL Q;  1PRL C;  4QQG A;  4BE0 A;  3HP9 A;  2VC8 A;  3GNG A;  2RI3 A;  4HCC A;  2FPF A;  1NBE B;  2COW A;  5FRM A;  1X2Q A;  4MZM A;  1R0B G;  4C92 E;  5A0L A;  1WJS A;  2CZ1 B;  2E41 A;  1Q7Y R;  5IAY A;  1UE9 A;  3I5S A;  1OQK A;  4C5H A;  3WVD B;  1RAG B;  4DOV A;  1Q82 R;  1U1S A;  1RUW A;  2LTO A;  1YP5 A;  4KT0 E;  1JO8 A;  1UB4 A;  4M7D G;  2RA2 A;  3JCM W;  1TSF A;  1QKW A;  3OYJ A;  1NZ9 A;  5FU7 B;  2VYT A;  3R6N A;  5GAN 7;  1M2V A;  2O4X A;  1WXT A;  1T0H A;  4Y28 E;  1FWZ A;  4F16 A;  2K6D A;  4Z02 A;  3V8J A;  3RDV A;  2WSF E;  2MK5 A;  2E3I A;  2D8H A;  2H8H A;  3R6O A;  4XAX B;  1DJ7 B;  4HCB A;  4L59 A;  1M1K C;  2OX7 A;  2WSC E;  2P84 A;  4LDW A;  2X4X A;  1Y07 A;  4BI3 A;  2DKG A;  2LNV A;  5GAO p;  5FU6 B;  4EMK C;  2AHJ B;  2ROT A;  1XJW B;  3MEU A;  2OJ2 A;  4C92 G;  3VS5 A;  2F2V A;  2XK0 A;  1MV0 B;  2QAZ A;  1BIB A;  3CME Q;  2JNG A;  5GAO q;  2CT4 A;  2PTK A;  4DQ2 A;  1M3C A;  1KHC A;  5LJ3 f;  1NEG A;  2XDP A;  2VKN A;  4FSX A;  1CKA A;  5KYY B;  2XIC A;  3EH1 A;  4FT4 A;  2RF0 A;  4M7A C;  1W70 A;  5IN1 A;  3CC7 T;  1MHN A;  1B07 A;  4XTU A;  5GAN e;  2A0F B;  1Q7Y C;  2E6Z A;  2HEQ A;  1HK9 A;  1ZX6 A;  2V8K A;  2O88 A;  3CC7 A;  4A4H A;  1Q82 C;  5HY6 A;  1NM7 A;  4FM4 B;  2M02 A;  1PD1 A;  4ZTJ A;  1UHF A;  4PLI A;  4ZGE B;  1KQS S;  4OP0 A;  3HL8 A;  2YXY A;  3CCJ A;  2DXB A;  1SRL A;  4JJD A;  1AVZ C;  1XTD A;  3QWY A;  3I56 T;  2ESW A;  3E2U A;  1M3A A;  4Y92 A;  4C8Q E;  2Z0W A;  1UEB A;  3RKY A;  1RL2 A;  2EWN A;  3RKW A;  3VS2 A;  2DFU A;  4JJC A;  1VQ7 T;  3CXC A;  3GBQ A;  1VQ6 Q;  3EFO A;  3JCM g;  1QVP A;  3QO3 A;  4WF2 A;  2DE0 X;  3QJ6 A;  4N0A A;  1AWJ A;  2V8I A;  1VQ7 A;  4HVU A;  2FRY A;  1VQN T;  3OYK A;  2DLP A;  5LJ5 f;  4IUR A;  4FW1 A;  1YIJ T;  3VKI A;  1VIE A;  1M2O A;  4PJO F;  4DBH A;  2K79 A;  2J06 A;  1VQN A;  3PIO A;  5LJ3 h;  1LNX A;  1YIJ A;  1KD1 U;  2JVV A;  2GGR A;  2KRO A;  2MF2 A;  2NUT A;  1SHG A;  4JLI A;  3I55 Q;  3OSV A;  2ZZD A;  5GAM e;  1AOJ A;  2RK1 A;  1ZHI A;  4R0K A;  1TUD A;  1VUB A;  1YNZ A;  3DLM A;  3LWH A;  4LE9 A;  2HL3 A;  3I5R A;  3IQL A;  2LP5 A;  4RCB A;  1GFD A;  1W6X A;  4A53 A;  1U3O A;  2JM9 A;  4LN2 A;  1PSF A;  5I11 A;  1JJ2 P;  5KYU B;  2LZ6 B;  2FG0 A;  3FJ5 A;  4BUG A;  3L2Q A;  3VS3 A;  1JQQ A;  2CP3 A;  4J7I A;  3V7R A;  1PSE A;  5CKE A;  5GAO r;  3L2Z A;  1SPK A;  1YHQ A;  1TTH B;  2DVJ A;  3UPU A;  2QQA A;  3FLG A;  2DMO A;  2DZ9 A;  1YN8 A;  5GJW B;  2NWM A;  3MO8 A;  3KBG A;  2CGH A;  5IXB A;  5FU7 C;  4OB1 B;  2QEX Q;  2EQK A;  2ENM A;  1QMC A;  2QG9 B;  4GY5 A;  2H3E B;  2E64 A;  1PWT A;  5KYU A;  2KGT A;  1ZUU A;  3LLR A;  4OB0 B;  3M0T A;  4FYW B;  4XTZ A;  3RER A;  4ZNX A;  1VOM A;  3NTI A;  4M75 F;  1W2B S;  2JOY A;  3JSC A;  3X26 B;  3LWI A;  2D0Q B;  4XU1 A;  2XHC A;  4HVW A;  4JPB W;  1KSW A;  1GBQ A;  5FU6 C;  5CQY A;  2GCX A;  2E12 A;  1LJO A;  3A8M B;  5HK3 A;  1IRX A;  5GMK j;  2K3B A;  1UDL A;  1RLQ C;  3OYF A;  1WYX A;  1I5O B;  2BKD N;  2FVU A;  5IH2 A;  3G71 T;  4OMN A;  4BB7 A;  5FW9 A;  2DM1 A;  2HQX A;  3G71 A;  5FRO A;  3SB2 A;  1QKX A;  1OOT A;  3L2V A;  3CC4 T;  3GNF B;  2P4R A;  3HPW A;  4M78 F;  1BB9 A;  1M1G A;  3JB9 D;  2PVO B;  3CC4 A;  2G6F X;  1X6B A;  2CP0 A;  3EGD A;  4A4G A;  3CCJ Q;  1D0Z A;  3FRN A;  3RBB B;  1FMW A;  2CKK A;  1YJW T;  8ATC B;  1G2B A;  1UJY A;  2V8J A;  1U8R A;  2BZY A;  3QDR B;  4N0A C;  1ZUY A;  1UG1 A;  5ECA A;  2MIO A;  3REA B;  1YJW A;  4KRT A;  4M77 E;  4BE2 A;  2D9T A;  2O9V A;  2VV5 A;  4PJM A;  3CBM A;  4J9H A;  1X69 A;  2M9U A;  4E7K A;  2DRM A;  4OMQ A;  1R0C B;  4QT7 A;  4DOW A;  1V76 A;  2KK4 A;  1KQS P;  4GLM A;  1Y57 A;  1Z9Q A;  4N4I A;  3CCL T;  2CH4 W;  2J6F A;  5IHK A;  1Z9Z A;  2COZ A;  2F5K A;  1S72 Q;  3CCL A;  2LQN A;  3EHR A;  3QDF A;  3RNJ A;  4J9E A;  3PE0 A;  3WXM B;  4XU0 A;  1JRI A;  1YJ9 A;  1SG5 A;  3CCM Q;  4IUU A;  5HKC A;  2EQM A;  8AT1 B;  1VQL T;  2VXF A;  1EFN A;  2VVK A;  2EGA A;  2WSE E;  5A0G A;  1EIF A;  3VS1 A;  4EDU A;  2GQV A;  2Y90 A;  3CPW A;  1VQL A;  4V2S A;  3OA6 A;  2E65 A;  2M1H A;  3JB9 G;  1WHK A;  2GF7 A;  2D8J A;  2ZPF B;  2Y4Y A;  1XNI A;  4RTX A;  2FHD A;  1ZUK A;  1YHQ Q;  4AG2 C;  1YWP A;  1CSK A;  2DXT A;  1OEB A;  2L3P A;  2L0A A;  2HSP A;  2DVE A;  2IIM A;  1QVF A;  4AFU C;  4FT2 A;  3UT1 A;  4JS4 A;  3QZ5 B;  4WCI A;  3NTH A;  4E7Z A;  1W1F A;  1YJN A;  4TVR A;  1UFF A;  5CO7 A;  1EZZ B;  2QA4 A;  3E9G A;  1VQ9 A;  2YRC A;  4MDW A;  2C0I A;  4M7D F;  4LDU A;  2QAS A;  1MMN A;  1M90 U;  4UC4 A;  4EMK B;  5LJ3 e;  1U1T A;  2P4T A;  5KYW B;  3BY7 A;  2ZPB B;  5FWB A;  1HSQ A;  2WAC A;  3CME T;  2EJF A;  1BBZ A;  1NG2 A;  2EJG A;  3CME A;  2DX1 A;  5CKH A;  1J3T A;  3PTA A;  1WJQ A;  4C0Z A;  4XU2 A;  3TCJ A;  4KUL A;  4II1 A;  1W2B P;  2HKQ B;  4JJB A;  4C5I A;  4M7A B;  2R5M A;  2CUD A;  4A54 A;  1VQ5 A;  2EGC A;  2IVW A;  2YT6 A;  3M55 A;  2BUD A;  2FZG B;  1FXX A;  1RAE B;  3M57 A;  4C92 F;  2JTM A;  2E10 A;  4PJJ A;  2O31 A;  3G71 Q;  1B34 B;  3SD4 A;  1RI0 A;  3TSW A;  4F7U B;  4IIM A;  1GXI E;  5HCK A;  3LH0 A;  2DO3 A;  2QTV A;  3VJP A;  2O2O A;  5KYN A;  5FRN A;  3OB9 A;  3FDR A;  2ABL A;  1YJW Q;  4ME7 A;  5GAN g;  1PKS A;  2HQH A;  2OAU A;  1KFZ A;  2YDL A;  1LOJ A;  3VS0 A;  2ED1 A;  4PJN A;  4J6X A;  3ZL7 C;  1NE8 A;  1VQ6 T;  2DAQ A;  3NHN A;  4OVA A;  2HBP A;  3CCE A;  4ATO A;  5LJ5 d;  1OX9 A;  2L2P A;  1TU0 B;  3G7Z A;  2LX7 A;  1VQ6 A;  4BDY A;  3JCM Q;  4KGV B;  2K2M A;  4RTZ A;  2QQR A;  3P8B B;  3CCL Q;  2FEI A;  1LVK A;  2FZC B;  2L3R A;  1MV3 A;  3OS5 A;  4Z88 A;  2QQB A;  3P8D A;  2XU8 A;  5DM7 R;  1IZ6 A;  3I55 T;  3X20 B;  2QTX A;  1YJ9 Q;  3CQT A;  4C8Q A;  3JCM J;  5GMK h;  3I55 A;  1M2V B;  1NPP A;  3OYL A;  2W10 A;  3L2U A;  4E7H A;  5D7U A;  4RTU A;  1M1F A;  1WQ7 A;  2YLC A;  3M0R A;  1NYF A;  3N5B B;  4QVD A;  4B6M A;  1TWB A;  1Y71 A;  2YSQ A;  1NLP C;  2KVQ G;  5CVI A;  4FU6 A;  3URG A;  3MP6 A;  4E7J A;  2HL5 C;  5GAM g;  1AEY A;  2DPP B;  1RLP C;  2K9G A;  4OB2 B;  4C8Q F;  3EGX A;  4J7F A;  4CRI A;  3PVQ A;  5EC7 A;  2DBK A;  2QEX T;  1BIA A;  2LJ3 A;  1WNL A;  1TXQ A;  2EVR A;  3GPL A;  1YJN Q;  1KQ2 A;  3KFV A;  3H0I A;  3OYB A;  2QEX A;  2LQK A;  4X1V A;  1D1B A;  4JDS A;  2L3S A;  1BI0 A;  3VS6 A;  1QVG S;  1KG1 A;  2D1X A;  2QA4 Q;  1VQ9 Q;  2EIF A;  1K9M R;  3M59 A;  2EKH A;  2EAY A;  3ASK A;  1KD1 R;  3M58 A;  3EGU A;  5GMK i;  3CBP A;  2KR3 A;  3TU4 K;  2DJQ A;  3DLL A;  4ZTF A;  3OW2 A;  4C5E A;  1PM3 A;  1JXM A;  1W4S A;  1VQM A;  2KSS A;  4AT1 B;  4M7A D;  1WGS A;  2YRV A;  2VUB A;  2K57 A;  1N8R U;  3OYE A;  2HKN A;  2RMO A;  2OTL A;  2DL3 A;  2V1R A;  1K76 A;  5GAN 5;  1VQ5 Q;  1M5Q 1;  5HK0 A;  3JAM E;  1H8K A;  4PJO B;  2PUK B;  3NGP A;  2DBM A;  2KY9 A;  2DF6 A;  3PFS A;  5GMK l;  2CH4 A;  1VQK T;  2GTJ A;  1MMG A;  1UGP B;  2DL8 A;  2JT4 A;  4M7A E;  1MNE A;  1VQK A;  2KXC A;  1ZA1 B;  3CCJ T;  3EG3 A;  3EFO B;  2A36 A;  4CI0 C;  3NFC A;  2X51 A;  2RQR A;  1WHH A;  3H0H A;  2ZPE B;  1ZA2 B;  4F7U E;  3A8O B;  3CCR Q;  2EYY A;  1H92 A;  2D0N A;  1OI1 A;  4PJO A;  1KC8 U;  1K9M C;  3H8Z A;  1GBR A;  4JRK A;  1OV3 A;  1KD1 C;  5GAN j;  2KYB A;  5GAN d;  3CC2 Q;  4L5G A;  2NUT B;  1O9S A;  1WFW A;  2RH2 A;  5IT9 E;  3CCE Q;  1SKU B;  4IUQ A;  4C8Q C;  1OYX A;  1G3T A;  5I22 A;  1YWO A;  3CCQ Q;  3QHS A;  3EH2 A;  2CZ0 B;  3OYG A;  1KQ1 A;  4PKC C;  1S72 T;  2DXC A;  3BDU A;  2K7A A;  1PD0 A;  1K8A R;  4M7A G;  1UEC A;  2HNI A;  1S72 A;  4J9C A;  1OU9 A;  5GAN 4;  2PU9 B;  1K9M U;  3CCM T;  2MAM A;  4E7S A;  2P0P A;  1ZBJ A;  2F1L A;  4M77 A;  3LX7 A;  1N9R A;  3F70 A;  4F7U G;  5GMK m;  2DD4 A;  1BCM A;  3CCM A;  5KCH A;  1YCY A;  1UHC A;  4PK4 A;  2LJ1 A;  1VQO Q;  3RR6 A;  1GCP A;  1WLP B;  3QUI A;  2KRN A;  4IUP A;  3A1P A;  4GLK A;  1Q81 U;  5EG2 A;  2RK2 A;  3LGF A;  1YI2 Q;  1B3Q A;  3M4G A;  1YHQ T;  1BYM A;  1X75 C;  2RB6 A;  1AD5 A;  2IPO B;  1X6G A;  4M75 A;  2LT1 A;  3HRS A;  4M4Z A;  2RHU A;  1IHW A;  1VYU A;  4M77 F;  4AFZ C;  5GAM j;  5GAM d;  4AFQ C;  2QQS A;  3VU3 C;  1UGR B;  5IXF A;  4ZGJ B;  3M54 A;  2LMJ A;  1VQP Q;  3HSB A;  4M78 B;  2ZCF B;  2CSI A;  3VUZ A;  3C4S A;  2O01 E;  1JB0 E;  2GBQ A;  2EYW A;  1SSH A;  3VYG A;  5I21 A;  3ER0 A;  4LD6 A;  3CCU Q;  2K3X A;  3TVT A;  2KE9 A;  2KT8 A;  3WVE B;  3LH5 A;  5KYX A;  2KEA A;  3SFM A;  5LJ5 h;  4P5N A;  3X25 B;  3A98 A;  1U5S A;  2DNU A;  2HDA A;  5GMK e;  4XTW A;  1I4K 1;  4RTY A;  1JJ2 A;  1VQM Q;  2KXD A;  4M78 A;  1EX4 A;  3AHU A;  1QVG P;  4KBM B;  1M9S A;  5A0D A;  1NJI U;  1PKT A;  1KHI A;  1JBM A;  4PJO D;  3OYA A;  3U23 A;  4AFS C;  1WX6 A;  3EGD B;  4E7I A;  1G3Y A;  1BKB A;  2LVM A;  2OTL Q;  1D09 B;  5LJ3 g;  2DK3 A;  3CD6 A;  2HQE A;  1S1N A;  2JTE A;  5CIU A;  3EFS A;  4JLG A;  3CEY A;  1RAB B;  2LT4 A;  3HRT A;  1F1B B;  1K8A U;  2YHT A;  2DL5 A;  4PJO C;  2FPD A;  1KIK A;  1D1C A;  1NPR A;  4NS5 A;  5FWC A;  3V8K A;  1VQK Q;  3C95 A;  1AT1 B;  2X4W A;  2CYZ B;  3M9Q A;  2LCC A;  2NUP A;  3E19 A;  1X43 A;  4RG8 A;  5CR2 A;  3BDL A;  1ZQ1 A;  2V26 A;  4MDX A;  6AT1 B;  1K73 R;  2BE7 D;  1M90 R;  3FIF A;  3JCM V;  3OS0 A;  4X9D A;  4A63 B;  3TSZ A;  2J6K A;  5D6X A;  1WPY A;  1YIT Q;  1D0X A;  4AG1 C;  1JU5 C;  4HT8 A;  2G3R A;  3M56 A;  1WHJ A;  4M77 C;  2XDB A;  3HFN A;  2DET A;  5GAN f;  5KE2 A;  2ZGW A;  1VQ8 Q;  4C0D B;  4N4G A;  4ZN1 A;  2HAX A;  4X34 A;  4O6J A;  5LL6 S;  3JCM d;  3S3M A;  1R8O B;  4JRI A;  4JJN K;  4XTY A;  2JS0 A;  2DEQ A;  3HTR A;  1OPL A;  1QCF A;  3KUF A;  3FJP A;  1FX7 A;  4KH0 B;  5J26 A;  4N4H A;  1AWW A;  1YJ9 T;  3MJX A;  2VB6 A;  2CZ7 B;  4VUB A;  3S3N A;  4BD3 A;  2ZPH B;  4M75 C;  3VS7 A;  1IHV A;  2VGM A;  3DB4 A;  2KDS A;  1IXD A;  2NYS A;  4EPC A;  3OQ5 A;  5DLO A;  4XU3 A;  3EG0 A;  1K9A A;  1X27 A;  5KH6 A;  3OW2 S;  4NL3 A;  2DL4 A;  1X6O A;  1V29 B;  2X3W D;  3J7A F;  1BK2 A;  3M0S A;  1X2K A;  5CK9 A;  4M7D A;  3G6E Q;  1NLO C;  2DYI A;  4LUE A;  2JS2 A;  2COY A;  2DL7 A;  1RAA B;  1M90 C;  1K73 C;  4DA4 A;  2DTH A;  4C92 B;  4F17 A;  1KQS A;  2XKO C;  4M78 D;  4Y91 A;  3HRU A;  1LPL A;  5IHN A;  4J9F A;  1ZLM A;  4A4E A;  1T3L A;  4KUD K;  2P0K A;  3L1A A;  1YJN T;  3NMZ C;  4EMH A;  3M5A A;  2RQU A;  3X24 B;  1ABO A;  2M0Y A;  2E1H A;  1E7O A;  2OAW A;  2CRE A;  2L89 A;  2XDD A;  2QA4 T;  1VQ9 T;  3CBO A;  5GAM f;  4M78 C;  4LDY A;  2LNH B;  3TQ7 P;  2K4Y A;  1QP2 A;  3JRZ A;  2KQW A;  4OGE A;  4LXC A;  3QWX X;  3RMS A;  3THK A;  1WI7 A;  3JCM b;  1V1C A;  2CT3 A;  1K73 U;  4C92 A;  1WA7 A;  2JJ9 A;  4DBF A;  1HJD A;  2A08 A;  3MP1 A;  3OYI A;  1IGQ A;  2E6N A;  3JCM X;  2E70 A;  3H41 A;  2AKL A;  1KK7 A;  2M0O A;  4D6W A;  3JB9 H;  1ACM B;  3OYM A;  2FPE A;  2F5T X;  1UGV A;  5GJV B;  3CXC S;  2RHI A;  2DTO A;  1VQ5 T;  1AWX A;  3EHQ A;  4J9D A;  1RAH B;  3CD6 Q;  2V1Q A;  2CP6 A;  4IIO A;  4ELY C;  1BI3 A;  2A28 A;  4D8D A;  1SEM A;  2EYQ A;  1WZO A;  2RQW A;  4PNO A;  2FYK A;  4IUV A;  1AZE A;  4GBQ A;  1IGU A;  2P0Q A;  4RTW A;  4K11 A;  1RI9 A;  2YUO A;  1VA7 A;  3L2R A;  2NLU A;  3INZ A;  1ABQ A;  3ULR B;  3SWN B;  2GQI A;  1P92 A;  3CCR T;  1WHM A; 
#chains in the Genus database with same CATH homology
 3V7R A;  4E47 A;  1PSE A;  4C5E A;  2DIQ A;  2R57 A;  5CKE A;  3PGG A;  5GAO r;  3QPH A;  1W4S A;  2R5A A;  3L2Z A;  2KSS A;  3CCR A;  2EQJ A;  1VQM A;  4FL6 A;  1YHQ A;  2XD0 A;  4M7A D;  1WGS A;  2X4Y A;  2QQA A;  5GAM h;  3UPU A;  1D3B A;  4JRP A;  3CC2 T;  4BE1 A;  2YRV A;  2VUB A;  4OMF B;  2K57 A;  3OSS C;  1YBY A;  3FLG A;  3PT9 A;  4M75 E;  5CQX A;  1ZBX A;  3OYE A;  5LJ5 e;  2KMT A;  2F69 A;  4PL6 A;  2DZ9 A;  3P8H A;  4JUV A;  3MO8 A;  3KBG A;  4LDV A;  2OTL A;  3CCE T;  2CGH A;  4C8Q B;  3OMC A;  3CC2 A;  5GAN 5;  2C06 A;  5FU7 C;  4OB1 B;  4YTL A;  1M5Q 1;  1G3W A;  1N6A A;  2VGN A;  3GIB A;  2EQK A;  1MGQ A;  5HK0 A;  3CCQ T;  2PUO B;  2X35 A;  3M53 A;  3JAM E;  4BAC A;  4PJO B;  2PUK B;  3G4S T;  2KY9 A;  4GY5 A;  4J6Y A;  4M7D D;  5KE3 A;  1Q86 C;  2RHY A;  3V7S A;  2E64 A;  3GLX A;  1WQW A;  2K3Y A;  3SWN A;  3PFS A;  2L8D A;  5GMK l;  3CCQ A;  3LLR A;  1VQK T;  4R56 A;  4OB0 B;  3G4S A;  1UGP B;  4R55 A;  1QP3 A;  4M77 G;  3JB9 J;  4XTZ A;  4E7L A;  3MP8 A;  4M7A E;  4MML A;  3RER A;  3HFO A;  3ME9 A;  3NTI A;  4C0D C;  3DB3 A;  3QG1 A;  4M75 F;  1W2B S;  1VQK A;  2JOY A;  1I81 A;  3CCJ T;  2RI2 A;  2DXU A;  4RMO A;  4CI0 C;  3JSC A;  3NFC A;  3X26 B;  2DTI A;  4HA8 A;  3LWI A;  3JCM f;  5GAN 8;  2D0Q B;  4XU1 A;  4M7D C;  2M16 A;  2XHC A;  2ZPE B;  4J8O A;  4F7U E;  3LGL A;  4A4K A;  2RJE A;  3QZ9 B;  3A8O B;  2EFI A;  5D6W A;  5FU6 C;  5J3B A;  3GOX A;  5CQY A;  2GCX A;  3MCA B;  1VQO T;  1IRE B;  5CKD A;  2E12 A;  3HHT B;  1LJO A;  3A8M B;  5HK3 A;  1OI1 A;  2CZ6 B;  4PJO A;  4C5G A;  3VV0 A;  3OS2 A;  5GMK j;  1KC8 U;  1VQ4 T;  1K9M C;  3RUX A;  5GAN h;  3H8Z A;  1VQO A;  4M7A F;  4XTX A;  1WJR A;  4JRK A;  1KD1 C;  4M78 E;  5GAN j;  4BI8 B;  1Q86 U;  4M75 G;  5GAN d;  3GP8 A;  4L5G A;  1O75 A;  1YI2 T;  3OYF A;  3QYH B;  4QVZ A;  1VQ4 A;  3JB9 I;  1HXD A;  1O9S A;  4C92 D;  4XK8 E;  2KAF A;  2BKD N;  2FVU A;  3L42 A;  3HKS A;  2H3J A;  2RH2 A;  2RM4 A;  3QYG B;  3G71 T;  5IT9 E;  2LDM A;  1UGQ B;  4BB7 A;  4IUQ A;  4C8Q C;  1OYX A;  1YI2 A;  3PMI A;  1G3T A;  4F7U F;  2L5Q A;  3QBY A;  3QHS A;  2CZ0 B;  2HQX A;  3TEE A;  3G71 A;  3OYG A;  1KQ1 A;  4PKC C;  3EFR A;  5FRO A;  3SB2 A;  1S72 T;  2DXC A;  3TRE A;  3BDU A;  4RG2 A;  5L8R E;  4FIB A;  2PQW A;  3OYY A;  3L2V A;  3GNF B;  3CC4 T;  3BFM A;  1SSF A;  4M7A G;  2LQ8 A;  4O5V A;  3HPW A;  2FL7 A;  4M78 F;  1Y96 B;  2HNI A;  1M1G A;  4C92 C;  1VQP T;  4X9C A;  1S72 A;  3OYH A;  3JB9 D;  2RHZ A;  2PVO B;  3CC4 A;  2HD0 A;  3OYC A;  5GAN 4;  2PU9 B;  1K9M U;  3PNW C;  4A4G A;  3CCM T;  3J80 E;  2MAM A;  2QQ9 A;  2P0P A;  3FRN A;  3MEA A;  2CKK A;  5LJ3 j;  1VQP A;  1YJW T;  3C94 A;  4M77 A;  1I8F A;  3LX7 A;  3Q1J A;  1N9R A;  2V8J A;  3F70 A;  5LJ3 d;  4ELZ C;  4F7U G;  5GMK m;  3PIP A;  1U8R A;  2DD4 A;  3CMA T;  1N8R C;  3QDR B;  3QXE B;  3CCU T;  4N0A C;  3CCM A;  5KCH A;  1YCY A;  1YJW A;  3RKX A;  3RIR A;  5GAN 2;  4IUT A;  4RKU E;  4M77 E;  3ZBD A;  4BE2 A;  4EMG A;  3CMA A;  1OZ2 A;  2D9T A;  3CCU A;  2RJF A;  3MEV A;  3QUI A;  3JCM c;  4IUP A;  4M78 G;  2XI9 A;  2VV5 A;  3CBM A;  4GLK A;  1G3S A;  1Q81 U;  5EG2 A;  3RES A;  2M9U A;  2RK2 A;  3LGF A;  4E7K A;  4EMK A;  4DOW A;  2KK4 A;  1Y96 A;  3M4G A;  1VQM T;  1YHQ T;  3RMQ A;  2RI5 A;  3ZEH A;  5GAO n;  1BYM A;  2MI6 A;  4A4F A;  1X75 C;  1H3Z A;  2QI2 A;  2RB6 A;  2A3L A;  2K2V A;  3JCM h;  4M75 A;  2LT1 A;  3HRS A;  2K5L A;  2RHU A;  4N4I A;  3CCL T;  4BY6 B;  4HT9 A;  2JN0 A;  4M77 F;  2OTL T;  2F5K A;  5GAM j;  5I2M A;  1I5L A;  5GAM d;  3CCL A;  1XOV A;  3CCV T;  2QQS A;  5AYF A;  1UGR B;  3VU3 C;  4ZGJ B;  3M54 A;  3BW1 A;  1AHJ B;  3NTK A;  3OS1 A;  3OY9 A;  3HSB A;  4M78 B;  2CS7 A;  4XU0 A;  3WXM B;  2ZCF B;  2DIG A;  3VUZ A;  3C4S A;  3CCV A;  1JRI A;  2O01 E;  1JB0 E;  5C0M A;  3C12 A;  1KC8 C;  1YJ9 A;  2OTJ T;  3UWN A;  4M7A A;  1W2B A;  4IUU A;  3A8G B;  4QW2 A;  3VYG A;  5HKC A;  2EQM A;  1VQL T;  2VXF A;  5I21 A;  3ER0 A;  4LD6 A;  2K3X A;  4HKE A;  4MZP A;  2OTJ A;  3WVE B;  4LD9 K;  2WSE E;  3MHX A;  1EIF A;  4EDU A;  5A0G A;  2GQV A;  2D6F A;  2Y90 A;  3CPW A;  3OBW A;  1VQL A;  2LRQ A;  1B34 A;  3PMT A;  2PVG B;  4V2S A;  3OA6 A;  4F7U A;  2X4J A;  3SFM A;  2E65 A;  2M1H A;  4L6V 5;  4P5N A;  5LJ5 h;  3X25 B;  3FC3 A;  5J39 A;  3JB9 G;  5LJ5 j;  4QQ6 A;  1M1K U;  2GF7 A;  2ZPF B;  5GMK e;  3CPW S;  2Y4Y A;  1XNI A;  2E5Q A;  2A7Y A;  2FHD A;  3E9F A;  1I4K 1;  4XTW A;  1JJ2 A;  3SWN C;  2GFU A;  4M78 A;  1M8V A;  4C8Q D;  4JRQ A;  3AHU A;  4M7D E;  2DXT A;  4KBM B;  1M9S A;  5A0D A;  4RCC A;  3T9N A;  1YIT T;  1KHI A;  1NJI U;  1JBM A;  2QDY B;  4C0G A;  4PJO D;  2DVE A;  2MMP A;  4ZGD B;  3OYA A;  2XG8 D;  3M4Y A;  1QVF A;  3OBY A;  4E7I A;  1G3Y A;  4BY6 C;  3GF5 A;  1BKB A;  2LVM A;  4JS4 A;  1YIT A;  1JJ2 S;  2RJC A;  1XQH A;  1BI2 A;  2RJD A;  2ZPG B;  3A8H B;  3MET A;  3QZ5 B;  4FT2 A;  4M77 B;  2DK3 A;  1X01 A;  3UT1 A;  5LJ3 g;  3CD6 A;  2ZPI B;  2HQE A;  3NTH A;  3QJY A;  3S6W A;  4ZN3 A;  1N8R U;  1YJN A;  5CIU A;  3EFS A;  4JLG A;  3OYD A;  1VQ8 T;  3CEY A;  2LT4 A;  3HRT A;  3S3O A;  2R58 A;  4TVR A;  2RHX A;  1QVF S;  5A2Q E;  5CO7 A;  1K8A U;  5CKF A;  5DLQ E;  4OB3 B;  2YHT A;  3E9G A;  3O8V A;  5FLX E;  4MDW A;  2QA4 A;  1N9S A;  1VQ9 A;  2O4X B;  2EJ9 A;  1Y7X A;  2YLB A;  1VQ8 A;  4M7D F;  4PJO C;  2LCL A;  1Q81 C;  3J81 E;  4LDU A;  4QQG A;  3I56 A;  1NPR A;  4NS5 A;  2MWO A;  3V8K A;  4BE0 A;  3C95 A;  3HP9 A;  2X4W A;  1M90 U;  4UC4 A;  4EMK B;  5LJ3 e;  2CYZ B;  2VC8 A;  3M9Q A;  1U1T A;  3GNG A;  1Q7Y U;  2LCC A;  2RI3 A;  2P4T A;  3E19 A;  3QII A;  4HCC A;  3LW5 E;  4RG8 A;  5CR2 A;  3BDL A;  3QSU A;  1ZQ1 A;  3BY7 A;  1Q82 U;  5FRM A;  2DD5 A;  2DJZ A;  2ZPB B;  4M75 B;  4MZM A;  4J6W A;  3FEO A;  4MDX A;  2GFA A;  2WAC A;  4C92 E;  5A0L A;  1WJS A;  2CZ1 B;  2E41 A;  3CME T;  2EJF A;  5IAY A;  3FIF A;  4C5H A;  3WVD B;  1N27 A;  3JCM V;  3OS0 A;  4DOV A;  4X9D A;  3EAE A;  1U1S A;  2LTO A;  2MWP A;  4KT0 E;  1UB4 A;  2EJG A;  2RA2 A;  3JCM W;  3CME A;  4M7D G;  2K5F A;  2QXF A;  3OYJ A;  2BIV A;  5CKH A;  1NZ9 A;  5D6X A;  1WPY A;  1WJQ A;  1OZ3 A;  2VYT A;  5FU7 B;  4C0Z A;  4XU2 A;  5GAN 7;  3PTA A;  3TCJ A;  2O4X A;  4II1 A;  4KUL A;  1UGS B;  4HT8 A;  4Y28 E;  2LC4 A;  3G6E T;  4C5I A;  3QKJ A;  4M7A B;  2EQU A;  3L2W A;  2R5M A;  4A54 A;  1VQ5 A;  2K5I A;  2IVW A;  3UDC A;  1FWZ A;  2G3R A;  2BUD A;  3M55 A;  3M56 A;  4M77 C;  1FXX A;  3M57 A;  2XDB A;  4C92 F;  2JTM A;  4Z02 A;  2E10 A;  3V8J A;  3HFN A;  3G6E A;  1G5V A;  1TH7 A;  2WSF E;  5KE2 A;  2ZGW A;  5GAN f;  5CKB A;  4C0D B;  4N4G A;  3X28 B;  4ZN1 A;  1B34 B;  3R6O A;  4XAX B;  1DJ7 B;  1RI0 A;  3SD4 A;  2HAX A;  4X34 A;  4HCB A;  4O6J A;  5LL6 S;  3V8L A;  3JCM d;  1R8O B;  4F7U B;  3S3M A;  4L59 A;  4JRI A;  4C8Q G;  4JJN K;  4XTY A;  3A5Z B;  1M1K C;  2DEQ A;  1GXI E;  2WSC E;  3KUF A;  5GAO l;  3LH0 A;  2X4X A;  1FX7 A;  1Y07 A;  3FJP A;  4LDW A;  4B9W A;  2DKG A;  4BI3 A;  2LNV A;  5J26 A;  2DO3 A;  4N4H A;  5GAO p;  5FU6 B;  3VJP A;  1YJ9 T;  5FRN A;  4EMK C;  2CZ7 B;  4VUB A;  3S3N A;  2AHJ B;  3MEU A;  3JB9 F;  4BD3 A;  1NJI C;  3OB9 A;  3FDR A;  4XTV A;  4C92 G;  2ZPH B;  4OF1 A;  4M75 C;  2VGM A;  2XK0 A;  3DB4 A;  3VYH B;  1BIB A;  2FB7 A;  2KDS A;  2IG0 A;  2JNG A;  4EPC A;  4ME7 A;  3OQ5 A;  5GAO q;  5DLO A;  3DKM A;  3H6Z A;  5GAN g;  4XU3 A;  5CCA A;  3OW2 S;  2OAU A;  5KH6 A;  4DQ2 A;  4NL3 A;  1X6O A;  1LOJ A;  1V29 B;  1KHC A;  5LJ3 f;  4LDX A;  4NL2 A;  4J6X A;  2XDP A;  2DZC A;  3J7A F;  1K8A C;  4FSX A;  3A8L B;  1NE8 A;  1VQ6 T;  2DAQ A;  5D6Y A;  2XIC A;  4OVA A;  4FT4 A;  2HBP A;  5CK9 A;  4M7D A;  3CCE A;  4ATO A;  5LJ5 d;  2XID A;  2I2L A;  4M7A C;  4B9X A;  3G7Z A;  5IN1 A;  1MHN A;  3CC7 T;  4XTU A;  1VQ6 A;  5DY9 A;  5I2S A;  4BDY A;  5GAN e;  3V7C A;  3JCM Q;  1K73 C;  1M90 C;  5M9O A;  4DA4 A;  1Q7Y C;  2DTH A;  2E6Z A;  4C92 B;  1KQS A;  2XKO C;  1HK9 A;  2V8K A;  4M78 D;  2Y4X A;  4Y91 A;  3HRU A;  4HCZ A;  2QQR A;  3CC7 A;  4QQD A;  4A4H A;  1Q82 C;  5HY6 A;  3P8B B;  4FM4 B;  3CD6 T;  2JZ2 A;  4A4E A;  3E1S A;  4KUD K;  2P0K A;  3L1A A;  1YJN T;  4EMH A;  4ZTJ A;  4C0F A;  4PLI A;  3M5A A;  2L3R A;  4ZGE B;  3VUB A;  3X24 B;  3OS5 A;  1KQS S;  2QQB A;  2E1H A;  4OP0 A;  3HL8 A;  2XU8 A;  3P8D A;  5DM7 R;  1IZ6 A;  2L89 A;  2XDD A;  3I55 T;  3X20 B;  1QW1 A;  2DXB A;  3CCJ A;  2QTX A;  3LYI A;  2QA4 T;  1VQ9 T;  3CBO A;  1BI1 A;  4C8Q A;  5GAM f;  2B8A A;  1XTD A;  4M78 C;  4LDY A;  3I56 T;  3OMG A;  2K4Y A;  5GMK h;  1QP2 A;  3I55 A;  3JCM J;  1NPP A;  3JRZ A;  2KQW A;  3OYL A;  4OGE A;  4E7H A;  3SDZ A;  3L2U A;  4C8Q E;  5GAO m;  3RMS A;  4Q5W A;  2JTF A;  3JCM b;  5GAN 6;  1UEB A;  1M1F A;  3RKY A;  4OGC A;  1RL2 A;  2EWN A;  1K73 U;  1WQ7 A;  2YLC A;  4C92 A;  4PJO E;  3RKW A;  3N5B B;  4QVD A;  3KXT A;  3MEW A;  4J5Y A;  1VQ7 T;  3MP1 A;  2LX9 A;  4QVC A;  4BDZ A;  3OYI A;  1Y71 A;  2E6N A;  3CXC A;  5KCO A;  3JCM X;  2E70 A;  3JCM P;  3JCM g;  2KVQ G;  1QVP A;  3ZFJ A;  5CVI A;  3QO3 A;  4WF2 A;  2M0O A;  4FU6 A;  3URG A;  4D6W A;  3MP6 A;  3QJ6 A;  4M77 D;  4N0A A;  4E7J A;  2V8I A;  1VQ7 A;  3JB9 H;  4MMK A;  3OYM A;  5GAM g;  2DPP B;  2F5T X;  1VQN T;  4OB2 B;  3OYK A;  1M4Z A;  4C8Q F;  3CXC S;  2RO0 A;  4J7F A;  4IUR A;  4NOY A;  4CRI A;  5LJ5 f;  2RHI A;  3CCS T;  1YIJ T;  2DTO A;  3VKI A;  1VIE A;  1QVG A;  1VQ5 T;  5C6S A;  2QEX T;  1BIA A;  4PJO F;  1WNL A;  4PLL A;  3FB9 A;  1VQN A;  2VXE A;  3PIO A;  3GPL A;  5LJ3 h;  1LNX A;  3CCS A;  5GAN 3;  1KQ2 A;  1YIJ A;  1KD1 U;  2JVV A;  3JCM e;  4ELY C;  3OYB A;  2MF2 A;  2QEX A;  1BI3 A;  2LQK A;  4J83 A;  1D3B B;  4JDS A;  4JLI A;  1H64 1;  1BI0 A;  3CPF A;  1QVG S;  1KG1 A;  3OSV A;  2ZZD A;  2PVD B;  3OYN A;  2EIF A;  2EYQ A;  5GAM e;  3M59 A;  2RK1 A;  4MZT A;  4PNO A;  4BI4 A;  2FYK A;  1ZHI A;  4IUV A;  5CAI A;  2EAY A;  3ASK A;  3M58 A;  2RD1 A;  4M75 D;  5GMK i;  1VUB A;  1VIF A;  3DLM A;  2P0Q A;  3LWH A;  3CBP A;  2JUF A;  4XQ3 A;  4RCB A;  4KUI A;  3L2R A;  4M7D B;  2NLU A;  4A53 A;  5LJ5 g;  1PSF A;  4PJO G;  2EKO A;  3INZ A;  4IKF A;  3TU4 K;  4ZTF A;  3L2Q A;  4BUG A;  3DLL A;  3SWN B;  1P92 A;  3CCR T;  4JS5 A;  3OW2 A;  4J7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...