4A54A

Structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/hydrolase
molecule keywords EDC3
publication title The Structural Basis of Edc3- and Scd6-Mediated Activation of the Dcp1:Dcp2 Mrna Decapping Complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a54A00
1I81A 1Y96A 2RB6A 4M75E 5LJ3d 4A54A 3V7CA 1D3BB 4M7AF 4DQ2A 4EMKB 3JCMX 5LJ5d 2RA2A 4M77F 4HT8A 5GANd 3HSBA 3JCMJ 2JN0A 2I2LA 1HXDA 2E1HA 4N0AA 3JB9F 2HNIA 4NL3A 4F7UG 5GAOr 4X9DA 4M78G 2RM4A 3RKYA 3RKXA 2DXUA 4XTZA 3HFOA 4X9CA 5GAN4 3JB9D 3RERA 4C92C 4EMGA 4N0AC 2DEQA 4F7UF 4F7UA 3GIBA 4C8QF 3JCMf 1TH7A 4M78A 4M77G 2DVEA 5GAN7 3PGGA 4NL2A 1I5LA 3JCMh 4M7AG 2K57A 1I8FA 4F7UE 1JRIA 4M78E 3JCMW 5LJ5j 2FB7A 4PJOG 3JB9G 1N9RA 3QUIA 4F7UB 5GANj 4MMKA 4V2SA 3JCMP 4M78B 4C8QD 3V8KA 4M78D 5GAMj 4M77A 3RESA 2YLCA 4PNOA 4WF2A 5GAMf 5GMKl 4EMKC 3JCMQ 5GAN5 4M75C 2VC8A 4M7DF 5GAN6 5GAMh 4RCBA 3JCMc 5GAN3 4M77E 4PJOF 1N9SA 2EWNA 2QTXA 4XU1A 3FIFA 4M77B 4JUVA 4NOYA 4C8QG 4M77D 4XU0A 1U1TA 4XQ3A 2ZGWA 4M7AB 4QVCA 3JB9J 1WNLA 4M7DB 4M7AD 2E41A 4M7DD 1YCYA 3SB2A 4XU2A 4XTXA 5GAOm 4PJOB 4PJOD 1BIAA 1I4K1 3M4GA 4RCCA 3JCMV 3VU3C 4J6XA 2E65A 4C8QA 5LJ3j 4J6YA 5LJ3f 2VXFA 4MMLA 4M7DG 2EJ9A 4C8QE 2DKGA 5LJ3h 3SWNB 3V8LA 5LJ5f 3JCMb 4C92F 4JLIA 3RIRA 4C8QB 5GANf 2FYKA 3AHUA 5LJ5h 3L2ZA 5GANh 4XTVA 4Y91A 3QSUA 4M78C 4M7AA 3HFNA 5GAN8 1M5Q1 2DTHA 3FJPA 5GMKj 4HT9A 4M7DA 5GMKi 1WQWA 5GAOq 4PJOA 2CGHA 3RUXA 3JCMg 5GAOp 4M7AE 4M7DE 3V7RA 5GMKh 1JBMA 3EFRA 1MGQA 3BW1A 4PJOE 1X01A 5GAMe 2EJGA 4M77C 1KQ1A 1LOJA 4M75F 3RKWA 1WPYA 3BY7A 3V8JA 4M7AC 2DTIA 5DY9A 5GAN2 2E64A 1WQ7A 4C92G 3SWNA 4PJOC 5GAMg 2YLBA 2DTOA 1BIBA 4JRKA 1M8VA 3BFMA 3L1AA 2EJFA 4M75B 4M75D 4J6WA 5CAIA 3FB9A 4J5YA 5GAOl 1B34A 3BDUA 1Y96B 3EFSA 3QHSA 4A53A 4C92A 5I21A 1LJOA 5GAMd 4EMHA 3JB9H 2DZ9A 2DJZA 3SWNC 3JCMe 2DXTA 1H641 4OP0A 4C8QC 4C92E 2Y90A 5LJ3e 4XU3A 1LNXA 1B34B 1U1SA 4JRIA 4M75G 4XTYA 4C92B 2DZCA 4C92D 3QO3A 5GAOn 5LJ5e 4XTWA 1HK9A 5GANe 2YHTA 5LJ3g 3INZA 2EAYA 3JB9I 4XTUA 2E10A 1D3BA 4M78F 2VXEA 4EMKA 3V7SA 4M75A 4HA8A 4QVDA 5GMKm 5LJ5g 5GANg 3JCMd 4M7DC 5GMKe 2RD1A 1KQ2A
chains in the Genus database with same CATH superfamily
1SG5A 4OMLA 1ABOA 4AFUC 3PTAA 2PUOB 2RI3A 4MZTA 5GANd 1KC8U 2QA4A 3LW5E 2DA9A 4BE0A 2CDTA 2E5KA 4J9GA 2KYBA 2DXUA 3L2UA 2D9TA 5IT9E 1W6XA 5I2SA 1R77A 4B9XA 2DEQA 1ZSZC 1X2QA 1WHMA 2DILA 2KQWA 3E9GA 3OYEA 1BI2A 2R5AA 4M77A 4FU6A 3CCLT 2EQIA 2MF2A 5KYNA 2VC8A 1OI1A 1WX6A 2CP2A 1KD1C 1I1JA 3LX7A 5C6SA 2JMCA 3JB9J 2DD5A 4XTXA 1K9MC 1H3HA 4RCCA 4DOWA 4GLMA 5LJ3j 1GBQA 3CC4Q 2YT6A 1YJ9A 3A8GB 1VQOT 3G6ET 2MWPA 3QSUA 1AWXA 1GCQA 2GQVA 2J6KA 2LC4A 1N8RR 3CCEQ 1AZEA 1QKXA 1GRIA 2WSCE 3CPWS 2KT8A 4E7LA 1AWJA 1KQ1A 1GXIE 4KRTA 1YN8A 5IAYA 1Y71A 4KGZB 1F1BB 2G6FX 2X4WA 2EKHA 2DEUA 4HCBA 1CKAA 3BFMA 4J6WA 4LXCA 2GGRA 3QHSA 3A8OB 2EYXA 3KBGA 4EMHA 1MNDA 2OTJT 4OP0A 4AG1C 4NS5A 1PNJA 5J3BA 4BE2A 4E7HA 4C92D 4BY6B 1ZUYA 2L8DA 2O31A 1Q82C 1WHHA 5CO7A 5IXFA 4C0DB 1ZUKA 1W2BA 1N5ZA 2KI7A 3NMZC 2D0NA 2OAUA 2CSQA 4BUGA 2YRCA 1WFWA 1VQMA 2OTLA 2AKLA 4EPCA 3OMCA 3L2VA 5A0LA 1VQPQ 2ABLA 1YWPA 5GAN4 4J9EA 3NTIA 5IN1A 1BCMA 2LNVA 4ESRA 4OB0B 4F7UE 1K8AC 1JO8A 3EHRA 1AWWA 3E19A 4M78D 1YI2T 1FYNA 1BB9A 2G3RA 1WJRA 2RK1A 3RMSA 4XU0A 4M7AB 2RHXA 4A4KA 4KH1B 1K73C 1Y7XA 2J6OA 2F2WA 5CKDA 4IUQA 1QKWA 3OS1A 4Z89A 1IHWA 2OTJQ 4OMOA 4C8QB 2QDLA 4O6JA 1QVGS 5GANh 4XTVA 4RTXA 3HRUA 1X75C 2GNCA 1RLPC 2K79A 3JCMg 2E70A 5FRMA 3BW1A 2XDBA 5L23A 2OX7A 4M75F 2XDDA 1M30A 5DY9A 3CD6T 3X24B 4JJDA 3SWNA 1Y0MA 4JRKA 4LNPA 1M3BA 2D1XA 2E12A 2BE7D 3T9NA 1KD1R 4ATOA 2C0IA 3JAME 3CBMA 1JJ2P 3P8BB 4FT4A 1GFCA 1NM7A 2EAYA 1MMNA 2ZPIB 2QDYB 4EMKA 3GF5A 3V7SA 1JU5C 4PL6A 5CR2A 2PVOB 2NUZA 5DLQE 4IIMA 2FEIA 3PVLA 5A0DA 1VQ5T 1KQSS 1VQNT 2EYYA 1YI2Q 1PSEA 3LLRA 4Z8AA 2QG9B 1IZ6A 1WDXA 3QZ9B 1IGQA 2JN0A 5FRNA 1FWZA 4MDXA 2E5QA 3MP8A 4PK4A 3EH1A 2JNGA 2PVDB 4LD6A 2L2PA 1EIFA 3O8VA 3CC7A 4XTZA 3CCSA 1VQ8A 1YCSB 5KCOA 3CMAA 1B3QA 2KDSA 3PFSA 4F7UA 1UHFA 4BACA 4AMCA 5CCAA 1SKUB 4PNOA 1D1BA 2NUTA 5HK0A 3JCMQ 3GNFB 3VS5A 3URGA 1IGUA 3OSSC 3JCMc 3F70A 3OYBA 4XU1A 4M77B 1H3ZA 1X43A 2QA4T 4EDUA 1XTDA 1Q82R 3CD6Q 4PJOB 2D8JA 2RNAA 3WVDB 4J6XA 5CKFA 1T3LA 3HRSA 4RTYA 3CCJA 2DBMA 4X1VA 5LJ5f 4ME7A 1NYFA 2K2VA 4KGVB 4R55A 2PTKA 5KYUB 1M5Q1 1RABB 2VWFA 4O5VA 2J05A 3DB4A 1UB4A 4JLGA 1MV0B 2X4YA 2FRWA 1VQKQ 2K3BA 1KC8C 3C0CA 3FRNA 1VQNQ 3D7SB 1YJWA 1W1FA 2K6DA 3LYIA 3X28B 1PCXA 5FROA 1HD3A 2X51A 1Y96B 2ZPFB 2AT1B 1KQSA 5I22A 4JZ4A 1BI3A 2COZA 2CZ6B 2EYZA 2K5FA 1YJ9T 1LNXA 3JRZA 3KXTA 1K73R 5IHNA 3H9NA 2E10A 3MO8A 1MMGA 2CS7A 2VXEA 3CXCS 2FL7A 2NYSA 3ER0A 1WA7A 2QQ9A 1VQ9Q 1M3CA 3MHXA 6AT1B 3PNWC 4OF1A 2E1HA 4PJMA 2QA4Q 2NUPB 3M0TA 3O5ZA 2FZCB 2XIDA 1UJYA 2IVWA 2LMJA 3QYHB 2KR3A 3OYNA 4CC7A 3LH0A 1I8FA 3JV3A 1YITQ 3JCMP 4C8QD 4JS5A 1V1CA 4A63B 5GAMf 3CCUA 1TTHB 3MJXA 5D6XA 4AG2C 1D1CA 3G1JA 3OYAA 1KHCA 2YUQA 4L6V5 3RNJA 2ZGWA 1VQMT 3H8ZA 4OMNA 2VXFA 4A4GA 1ZBXA 4HCKA 1M1KR 2IG0A 2HKQB 1E6GA 3CQTA 3QZ5B 4JLIA 4LE9A 3HHTB 1W4SA 4J9BA 2EIFA 5IHKA 3VS4A 4M7AE 3V7RA 2XK0A 1QMCA 4CI0C 4FL6A 3RDVA 3G71A 1HYOA 1NPPA 3C12A 1RAGB 1VA7A 5DM7R 1PKSA 3DLMA 3FB9A 3CXCA 1EX4A 1B34A 1PHTA 1VYTA 2DXTA 1FX7A 2YWWA 4L5GA 5D6YA 1KG1A 4XTYA 1WHKA 3VS6A 5GAOn 5IH2A 5FW9A 1E6HA 2Z0WA 3VS7A 4HVWA 1M1FA 2RD1A 3EGXB 2ZAEA 2RJFA 4A54A 1UGRB 1EFNA 1VQLA 2LQ8A 4EMKB 2M9UA 4HVUA 3HSBA 5CQYA 3OYFA 2M0OA 1VQMQ 2J7IA 4GLKA 4WCIA 2LCSA 2K3XA 2AIRB 2OTLQ 4KUDK 2GCXA 4FIBA 4QKUA 1KC8R 2F1LA 2M02A 1TWBA 3CPFA 3UDCA 2CP5A 4LDXA 1PWTA 3OYLA 4OMMA 5D7UA 2RHZA 4F7UB 4PFZA 2DPPB 1OQKA 4ZTJA 3C95A 4PFPA 3EG2A 5GMKl 2DJQA 2V26A 4E7SA 3CMEA 2BKDN 2CSIA 4NOYA 1U1TA 2ROTA 4M7DB 1N8RC 3HPWA 4XU2A 1MMDA 1BIAA 4JJNK 1VQ8T 3CC7T 3CCST 1RAEB 4BI3A 2XI9A 5LJ3f 3CMAT 3OSVA 4RG8A 5ECAA 1OULA 3I5RA 1GFDA 1FMWA 4TVRA 1TUGB 2BE9B 2PVGB 2FHDA 2L3RA 3L2ZA 3J7AF 4Y91A 4M7AA 3M57A 2ED1A 2RQUA 2QEXQ 4UC4A 1VQ7A 4PJOE 1M1KU 1AOJA 4IUUA 3OQ5A 3GOXA 2HKNA 2D8HA 3CCRQ 2L3QA 2RMOA 2A28A 5I21A 1SHGA 2L3SA 3CCJT 3JSCA 2L3PA 1LCKA 1ZSZB 4XTWA 2KE9A 5HCKA 3INZA 1G3TA 2YSQA 4B9WA 1EZZB 3MKDA 4HA8A 5GMKm 1W2BP 4M7DC 5GMKe 2HZYA 2DETA 3GP8A 2DIGA 4LUDA 1YJWT 3QPHA 3JCMJ 2JZ2A 2MK5A 2X4XA 1CSKA 3EG9B 5I2MA 2CUBA 4ZGJB 5KH6A 3J80E 3QIIA 1RAHB 3RKXA 1X6GA 3META 3EG3A 3SD4A 1VQ8Q 4C92C 5AYFA 3CC7Q 2ATCB 4N0AC 4CC3A 3CMAQ 4M7AG 1J3TA 1QCFA 2CP7A 3CC2A 4FSXA 2QGGA 1VOMA 1RL2A 1ARKA 3VS2A 4QW2A 1RAIB 2CP6A 2DYBA 3OW2S 4C8QG 4XQ3A 2AHJB 2JTFA 1SRLA 1I4K1 1HJDA 1I07A 2QAZA 3NTHA 3CCQQ 2DL3A 2O4XB 4ANJA 3SFMA 1UGQB 3V8LA 2KMTA 3ULRB 2P84A 3NGPA 2ZPBB 4M78C 4QQDA 4N4HA 1UGPB 3M58A 4A4HA 4PJOA 2QK0A 3AT1B 3CCUT 4BI4A 4LDVA 2FG0A 2KNBB 4RTWA 3M4YA 1KIKA 3E1SA 2ZPEB 1BYMA 2JW4A 3VS1A 2HQEA 1YJWQ 5CAIA 1YIJA 5KYUA 2D6FA 3EFSA 1VQ6A 3VRZA 3A8LB 4HVVA 4IUTA 4AFQC 1DJ7B 1B34B 1UECA 3I55Q 1OPLA 2KRSA 3M56A 2AK5A 1Y96A 3G71T 3EHQA 2CUDA 1D0XA 5FWBA 4A4FA 2DRKA 3HRTA 1Y07A 2AKKA 2XKOC 2A7YA 4RTVA 4RG2A 1WHLA 1G2BA 5GJWB 3EH2A 1TXQA 4M77G 2ESWA 4NL2A 1I5LA 2A0FB 5FU7C 2R5MA 1D1AA 2FB7A 4PJOG 4V2SA 3CCLQ 3SEMA 1LPLA 3ASKA 2NUPA 1ZA1B 4C5HA 1M2OA 1M90U 2KK4A 5GAN6 1JXMA 1VQLT 3CCUQ 1LVKA 2EWNA 2B86A 2DL7A 1QLYA 3UATA 2E3IA 3S3OA 1M3AA 3UT1A 4JRQA 1H8KA 2ZPHB 1VQOQ 2JT4A 5GANf 3G6EQ 2RQTA 3A8MB 5GMKi 2QQSA 2AZSA 1BI1A 1UGSB 1G8XA 4M7DE 5GMKh 3EFRA 3M5AA 3M9QA 4CC2A 2XMFA 3CMET 2YUNA 1SEMA 2A36A 3QDFA 1OEBA 2KGTA 3QWYA 3G71Q 3OBYA 3QG1A 3FDRA 3CPWA 5I11A 4Q5WA 4M75B 4YTLA 2KXCA 1KFZA 1KQSP 2KXDA 2W0ZA 2JS0A 4C92E 1ZA2B 2FO0A 1SHFA 3IQLA 4HCCA 1YJNA 1HK9A 3M0QA 4KUIA 4XTUA 4BDYA 2GBQA 3R6NA 2FRYA 1VQ7T 1I81A 2RB6A 3NFCA 3VV0A 5CVIA 2JVVA 3UA6A 4E7IA 1VQLQ 3VKIA 1QP3A 1AVZC 4E7KA 3LH5A 1SPKA 3GPLA 1B07A 2CP0A 4ZN3A 2EYQA 2LQNA 1PC0A 3SHWA 1Q81U 2MCNA 3EGXA 2RJEA 2DX1A 4C8QF 1U06A 3OYYA 3JCMh 1N27A 4M78E 2EGEA 4AT1B 1NJIU 1M1KC 3OMGA 4M75C 3TCJA 2DO3A 1N9SA 2O01E 3UF4A 3LGFA 3CMEQ 1WHJA 1XOVA 1YHQA 2P4TA 3EFOB 1MUZA 4OB1B 1PD0A 4J7FA 2C0TA 4PLLA 3QDRB 1MV3A 2CH4W 3NPFA 4M7DA 3FJPA 5GMKj 3CC2T 2EQMA 2B8AA 1MNEA 2CGHA 2PQWA 1QVGA 3PT9A 3G4SA 3MP1A 3X26B 2Y4YA 1WXUA 1VQ7Q 3RMQA 2KVQG 2HBPA 3P8HA 5GAN2 1V29B 2MOXA 4RMOA 1U5SA 2F5TX 4PJLA 5GAOl 2MMPA 1QWEA 4C92A 1JJ2S 1VIFA 4OMQA 2ROLA 5LL6S 4PFOA 2QYZA 4JJCA 4JZ3A 1NZ9A 1VQ5Q 2V8KA 5LJ5g 2JS2A 4II1A 2HQHA 3H6ZA 1OPKA 4M77F 2P0KA 4IIOA 4N4IA 1ZSZA 5A0GA 2EBPA 4F7UG 1YIJT 3RKYA 4RTZA 1VQ6T 2L0AA 2RO0A 3MEUA 2QQAA 2COYA 1TG0A 4M78A 1YWOA 3HTRA 1NE8A 2P0QA 2K57A 2FZGB 3PIOA 3EG9A 3GLXA 5D6WA 2DIQA 2CH4A 4L59A 4RCBA 5GAN3 1WHGA 2QTXA 2LVMA 1YBYA 1RI9A 2E6ZA 2DL4A 2LTOA 4DEXA 1QVFP 1FXXA 4M7AD 4ZNXA 2QASA 5GAOm 4J9FA 1PSFA 1IHVA 4J6YA 2H8HA 4J7IA 2YXYA 1QW1A 1RLQC 1K9MU 2QXFA 2VV5A 1Z9ZA 3AHUA 2LQKA 4XAXB 2AZVA 3EGDA 4ZTFA 3OY9A 2DK3A 4KGXB 1UFFA 1XJWB 2LP5A 2KAFA 3M0SA 2O4XA 1GCQC 3C94A 2EPDA 5CKBA 4OGEA 5GAMg 2Y4XA 1B7TA 1K76A 4FM4B 1PRMC 1C1AA 2XDPA 1JEGA 1NEBA 1T0HA 2QI2A 3M0UA 5IXBA 1YIJQ 3CCVA 1CKBA 1ABQA 1YJ9Q 1BU1A 5FU6C 2DNUA 1VQ6Q 1QVPA 1VQPA 1NLPC 3SDZA 4FYXB 2HEQA 3CBPA 3MP6A 3QYGB 2DYIA 2BZ8A 3H41A 3FJ5A 2LCLA 4FW1A 2J6FA 2D0QB 3H0HA 2GF7A 4X34A 4M75E 3V7CA 4Y92A 4E47A 2RA2A 2PU9B 1QWFA 3M55A 2FVUA 1UEBA 4JPBW 2HNIA 3M0RA 2KRMA 2LDMA 3NHNA 4J9DA 2CYZB 2K5IA 3JB9D 3P8DA 4Z02A 1WJSA 5KYWB 4EMGA 5KE3A 1JXOA 3PGGA 1YJNT 4QT7A 3VS0A 1TUCA 2ZPGB 4BE1A 5LJ5j 3JCMW 2DD4A 2RN8A 4FW2A 2LCCA 5AT1B 1OOTA 2DAQA 1JQQA 4WF2A 1WIEA 1W70A 5HK3A 1Q86U 3QJYA 3CBOA 5C0MA 1M27C 3UA7A 1K8AU 3I9QA 4M77D 2CZ1B 3PMIA 2CT3A 1RACB 2E41A 3VRYA 1M2VA 2EKOA 1U3OA 3U23A 4PJOD 2SRCA 3A98A 3TU4K 2HL5C 3EGUA 1VUBA 2RI2A 1I0CA 5IHIA 1VQ4A 1M1GA 5CK9A 5GAOp 2RHYA 1JBMA 1SSFA 3OBWA 2A3LA 4DBRA 3TREA 3L42A 4E6RA 3V8JA 3MEVA 1WPYA 2HSPA 2F2VA 1ACMB 2DTOA 2LX9A 1YHQT 3L1AA 2F69A 2L89A 1Q81C 2DZ9A 2DJZA 3SWNC 4PKCC 4C92B 3PVQA 1OV3A 1NJIC 1UTIA 2YHTA 5LJ3g 2JM9A 1D3BA 4M75A 3G4ST 2COWA 1K1ZA 4R56A 3R6OA 3OYHA 4DQ2A 2JTEA 3LWIA 1R0BG 4GBQA 3S3NA 2LRQA 1Q95G 1ZSGA 1UUEA 4RUGA 1P92A 3DB3A 3FEOA 3VYGA 2MYSA 2GFAA 3OS5A 4LDWA 5HY6A 1WXTA 3GIBA 3CCMA 1ZUUA 1QCNA 2JJ9A 4DBHA 1PG5B 3PIPA 2OJ2A 1MHNA 1ZLMA 4MMKA 1UE9A 4M78B 4BD3A 2BZYA 2LJ1A 1VQKA 1SRMA 2KEAA 1O75A 3THKA 3WVEB 3A5ZB 3QBYA 2F2XA 2RJDA 2WSEE 2V8JA 4RKUE 1WGSA 1M90R 3CCSQ 3JCMV 3VU3C 2MWOA 2RQVA 2JM8A 4MMLA 4C0ZA 4WTOB 2QGFB 4R0KA 5KE2A 4EIKA 3OYKA 2LJ3A 3HFNA 2DTHA 3TEEA 1WQWA 1FMVA 4ELYC 4MDWA 3L2RA 3EFOA 2YRDA 3EGDB 3H0IA 3G4SQ 2NWMA 3RKWA 4J9CA 1VQ9A 2QQBA 3MEAA 3I56A 3CPWP 4KH0B 1WZOA 5J26A 2VGMA 1AHJB 4A53A 2X3WD 3CCJQ 2DXCA 3UPUA 4LDYA 3REBB 2ENMA 3JCMe 4K11A 2C06A 3RBBB 2X9HA 1W2BS 3VJPA 4BB7A 2VASA 1QP2A 2DM1A 5FU7B 4HXJA 2F5KA 1YITA 3JCMd 2KRNA 2EQUA 3OYIA 1KQ2A 2PZ1A 3MCAB 4IUPA 1PRLC 3M59A 5FLXE 3FC3A 2FZKB 2H3EB 3OYDA 4ZGDB 3LGLA 1S72A 2MAMA 1UDLA 4HCZA 3E9FA 1FMKA 3M54A 3CCVT 2MIOA 2CREA 4GY5A 1VQPT 3RERA 1X2KA 4JS4A 5GJVB 2DF6A 3QUIA 3JB9G 1M4ZA 1Q81R 2LT4A 3BE3A 5GAN5 2HQXA 3ZL7C 2P0PA 2RHIA 2C0OA 4FT2A 1WLPB 2HBWA 1RADB 4F04B 2RJCA 1OU9A 1AEYA 1NJIR 1WNLA 1X27A 4M7DD 2ZCFB 1YCYA 4KULA 3SB2A 8AT1B 5EG2A 3OW2A 1KK7A 2VUBA 1HSQA 1M2VB 2DKGA 1Q7YU 3JCMb 1G3WA 3ZEHA 4DBQA 3PE0A 1OYXA 5KYYB 3RUXA 1QVGP 5KYXB 1MGQA 2K4YA 2YDLA 1IXDA 1BCOA 5CIUA 1WJQA 2HSEB 3S3MA 3Q1JA 2YLBA 4IKFA 1NLOC 2R58A 1BIBA 3G7ZA 1G83A 1YNZA 3X20B 2RHUA 1E7OA 4PJNA 1IREB 2VB6A 3VYHB 1WI7A 3CCVQ 4KT0E 4F14A 3QWXX 3OYJA 5LJ5e 2ZZDA 4KBMB 1OU8A 4PJJA 3L2QA 3A1PA 9ATCB 1NYGA 1R8OB 4AFSC 1VQ4T 1Q86C 1XNIA 4FSSA 3DKMA 5GANg 4XK8E 2DFUA 4IUVA 3REAB 2K3YA 1D3BB 1AZGB 5LJ5d 2O9VA 4E2FB 4FYYB 2LZ6B 3NTKA 4OMPA 4NL3A 1C6VX 2WSFE 4X9DA 2RM4A 2CKKA 2M0YA 1QCOA 1VIEA 1IRXA 2DXBA 4F17A 4BY6C 1NG2A 1SSHA 3JCMf 4C5IA 2DVEA 2X4JA 4C0DC 1TOVA 1RAAB 1N9RA 3QKJA 4D8KA 2HCKA 3V8KA 1PD1A 3OA6A 3OS0A 4P5NA 2BUDA 4M7AF 2QEXA 5KYWA 2OI3A 4E7JA 5L8RE 4IURA 1A0NB 1N6AA 1U8RA 2RPNA 2O9SA 2K9GA 2PUKB 2R57A 3M4GA 4OB3B 2DL5A 2JXBA 2QQRA 2KBTA 2DRMA 2DLPA 3PMTA 3OYGA 5KCHA 3CCRA 2XICA 2YRVA 1UGVA 1N8RU 1S1NA 3CCMT 4ELZC 2BTTA 2M51A 5GAN8 2DBKA 2FPDA 5GAOq 1V76A 5CKEA 3MEWA 1K9MR 1VQ4Q 1TSFA 4JRPA 2YUOA 3ZBDA 2DMOA 5GAMe 2EJGA 1LOJA 1X6OA 1OX9A 3BY7A 1VQKT 4M7AC 4BI8B 2WACA 1M9SA 4LUEA 2DL8A 2EGAA 2JOYA 2EJFA 1G5VA 1WXBA 3ME9A 5GAMd 1LJOA 1XQHA 2DE0X 1IO6A 2RQWA 1H641 4C8QC 4OGCA 1C0MA 2LX7A 2EW3A 5EC7A 2LT1A 3UWNA 3QO3A 4C5GA 2LJ0A 3WXMB 3JB9I 2JMAA 1ZBJA 2SEMA 1M8MA 2VVKA 4HT8A 2HMAA 3CXCP 1IB8A 2A37A 3I56T 1VQ9T 2I2LA 2MI6A 1HXDA 2JUFA 4N0AA 3JB9F 3LWHA 1RI0A 4FCYA 3HFOA 1R0CB 1VYVA 1I5OB 4OVAA 2O2OA 3CCQA 2LQWA 1TH7A 2K5LA 4OMFB 3CCMQ 5GANj 4D6WA 2RQRA 4C0GA 1YITT 3RESA 2DVJA 2VKNA 3VS3A 4QQGA 2BZXA 2EGCA 4PJOF 2K7AA 1PKTA 4QQ6A 4QVCA 4MZPA 2MPXC 1S72T 1SF9A 3EG1A 1Q86R 3CC4A 1K8AR 2X35A 4Z88A 1BI0A 4J83A 4M7DG 4B6MA 2JTMA 1D0ZA 3TVTA 5FU6B 3RIRA 2FYKA 5LJ5h 4RTUA 3CC2Q 1X69A 3I55A 3CCEA 2GQIA 2E6NA 1BKBA 3OYCA 1YFNA 4M77C 2V8IA 4C92G 1KD1U 4PJOC 1OZ2A 2FPFA 2V1QA 3I56Q 4M75D 3CEYA 3C4SA 3VUZA 4DA4A 2HAXA 4FYVB 3H0FA 4OB2B 3TQ7P 1Y57A 2Y90A 5LJ3e 1JB0E 1U1SA 4QVZA 2DZCA 4N4GA 1JJ2A 2XG8D 4QVDA 2GFUA 3CCLA 2ED0A 2CP3A 1TU0B 5LJ3d 2EQJA 2FPEA 2K2MA 2GTJA 4JJBA 3JCMX 3OS2A 2QTVA 4ZN1A 1O9SA 2CZ7B 3N5BB 5GAOr 3HL8A 4M78G 1S72Q 1PM3A 2NLUA 1ZQ1A 1Q7YC 3EAEA 2OTLT 1OZ3A 2XU8A 4X9CA 1WYXA 3GNGA 1M90C 5GAN7 1VQOA 3DLLA 3G6EA 3KUFA 8ATCB 2XHCA 1Q82U 7AT1B 1GCPA 2YLCA 1QVFS 1K4US 2O88A 1GBRA 1GL5A 2E3HA 5GAMh 3I35A 4MZMA 4ZGEB 3FIFA 2YUPA 4JUVA 4DBFA 2KYMA 2XD0A 4JDSA 1T3SA 4C0FA 2RF0A 3FLGA 2E65A 1X6BA 2OTJA 1K9AA 2EJ9A 4C8QE 3SWNB 1ZX6A 2IIMA 5M9OA 3ZFJA 1T0JA 2RK2A 3TSZA 2OAWA 4HT9A 4FYWB 5FWCA 2VYTA 1AT1B 2QEXT 5J39A 2J06A 3I5SA 4ORZA 2DTIA 2E64A 1K0SA 3E2UA 3HKSA 1M8VA 3J81E 1NPRA 3TSWA 5KYYA 1K73U 4C5EA 3VUBA 3CCRT 5A2QE 1NBEB 2A08A 2GTOA 3RR6A 5DLOA 3JB9H 2PNIA 4Y28E 5KYXA 1AWOA 4E7ZA 1UJ0A 4XU3A 2KT1A 4JRIA 1NEGA 1VYUA 4J8OA 1KHIA 4F16A 3A8HB 5CQXA 4CRIA 2M16A 4J9HA 2V1RA 2HL3A 2H3JA 4PLIA 4BDZA 1YI2A 3EG0A 2HD0A 2RI5A 3X25B 4LN2A 2IPOB 2VGNA 2HDAA 3QJ6A 4D8DA 3L2WA 2I0NA 1D09B 1ZHIA 4M4ZA 2NUTB 1KJWA 1G3SA 2CT4A 1QVFA 1D0YA 1UG1A 3OYMA 1KSWA 4AFZC 1MMAA 4F7UF 1YJNQ 2EQKA 1H92A 1JRIA 1G3YA 5GAMj 4DEYA 3BDLA 5CKHA 5HKCA 4EMKC 3M0PA 4M7DF 2EFIA 2E4HA 4M77E 4RTTA 3CD6A 2LNHB 3M53A 1BBZA 3OB9A 2KROA 3OW2P 4C8QA 2EVRA 2KSSA 2RH2A 1RUWA 3GBQA 4VUBA 2KY9A 5LJ3h 3CCQT 4C92F 4A4EA 1YP5A 2L5QA 2CZ0B 3KFVA 1BK2A 1Z9QA 1Q7YR 1UHCA 2W10A 1VQ5A 2P4RA 1X01A 1VQNA 1AD5A 4HKEA 2BIVA 1WQ7A 2M1HA 1YHQQ 2DERA 1TUDA 1OX8A 4J5YA 1RAFB 3CC4T 3S6WA 1K0XA 3BDUA 2X3XD 3MPUB 4LDUA 4DOVA 1TS9A 4M75G 1QQJA 4J9IA 2EYWA 4CC4B 5GANe 3I55T 3CCET 4M78F 2ECZA 4LD9K 3QXEB 3HP9A
chains in the Genus database with same CATH topology
2K3YA 3H6ZA 2RJFA 4A54A 1UGRB 1VQLA 2LQ8A 1D3BB 3PTAA 4EMKB 2PUOB 2M9UA 5LJ5d 4M77F 2RI3A 2P0KA 4MZTA 5GANd 3HSBA 1KC8U 5CQYA 2QA4A 3LW5E 3OYFA 4N4IA 2M0OA 3NTKA 5A0GA 4NL3A 4BE0A 2WSFE 4F7UG 1YIJT 4X9DA 3RKYA 2RM4A 4GLKA 1VQ6T 2K3XA 2CKKA 2RO0A 4KUDK 2DXUA 2GCXA 4FIBA 1VIEA 3L2UA 2D9TA 3MEUA 5IT9E 2DXBA 2QQAA 5I2SA 3CPFA 4B9XA 3UDCA 2DEQA 4BY6C 4LDXA 3JCMf 4C5IA 4M78A 3OYLA 2DVEA 1NE8A 2P0QA 2K57A 2X4JA 4C0DC 2RHZA 1N9RA 4F7UB 3QKJA 2KQWA 3GLXA 3PIOA 2DPPB 3E9GA 3OYEA 3V8KA 3OA6A 1BI2A 5D6WA 4P5NA 2R5AA 4M77A 3C95A 2BUDA 2DIQA 2MF2A 4FU6A 5GMKl 3CCLT 4ZTJA 4M7AF 4IUVA 2VC8A 1OI1A 4L59A 2QEXA 4RCBA 5GAN3 1KD1C 3CMEA 3LX7A 2BKDN 2QTXA 2LVMA 5C6SA 4NOYA 1YBYA 1U1TA 2E6ZA 4E7JA 2LTOA 5L8RE 3JB9J 4M7DB 1N8RC 1FXXA 3HPWA 4IURA 4M7AD 1N6AA 4XU2A 2DD5A 4XTXA 5GAOm 2PUKB 2R57A 1U8RA 1K9MC 1BIAA 3M4GA 4RCCA 4DOWA 4JJNK 4OB3B 1PSFA 2QQRA 3PMTA 1VQ8T 3CC7T 3CCST 3OYGA 5KCHA 4BI3A 2XICA 5LJ3j 2XI9A 2YRVA 3CCRA 4J6YA 5LJ3f 4J7IA 3CMAT 3OSVA 1QW1A 4RG8A 1N8RU 1YJ9A 3A8GB 3CCMT 2QXFA 1K9MU 2VV5A 4TVRA 3AHUA 1VQOT 2PVGB 4ELZC 2FHDA 2L3RA 2LQKA 3L2ZA 3J7AF 4XAXB 4Y91A 2MWPA 3G6ET 3QSUA 4M7AA 5GAN8 2GQVA 4ZTFA 3M57A 5GAOq 2LC4A 5CKEA 4UC4A 3OY9A 3MEWA 2DK3A 1VQ7A 2WSCE 3CPWS 4JRPA 4PJOE 3ZBDA 4E7LA 5GAMe 2EJGA 1M1KU 1KQ1A 1LOJA 1X6OA 1GXIE 4M7AC 3BY7A 2KAFA 4IUUA 2O4XA 1VQKT 3C94A 3OQ5A 5CKBA 4OGEA 1Y71A 2WACA 4BI8B 5IAYA 3GOXA 1M9SA 5GAMg 2Y4XA 2X4WA 4HCBA 4FM4B 3BFMA 2JOYA 2EJFA 4J6WA 2XDPA 1G5VA 3QHSA 5I21A 3A8OB 2QI2A 5GAMd 3ME9A 3KBGA 1LJOA 3CCVA 4EMHA 2OTJT 3CCJT 5FU6C 1XQHA 1QVPA 1H641 4OP0A 4C8QC 4OGCA 3JSCA 1VQPA 4NS5A 3SDZA 2LT1A 5J3BA 4BE2A 3UWNA 4E7HA 3CBPA 4C92D 3QO3A 4BY6B 3MP6A 3QYGB 4XTWA 4C5GA 2L8DA 1Q82C 3INZA 1G3TA 5CO7A 3WXMB 4B9WA 3JB9I 4C0DB 2LCLA 4HA8A 5GMKm 4M7DC 1W2BA 5GMKe 2D0QB 2GF7A 4X34A 4M75E 3V7CA 4E47A 2OAUA 3GP8A 2RA2A 4HT8A 2DIGA 1YJWT 3QPHA 4BUGA 3JCMJ 1VQ9T 2JZ2A 3I56T 2I2LA 2PU9B 2MI6A 2X4XA 1HXDA 1VQMA 2JUFA 4N0AA 3M55A 2FVUA 1UEBA 5I2MA 3LWHA 2OTLA 1RI0A 2HNIA 4ZGJB 3JB9F 4EPCA 5KH6A 2LDMA 3J80E 3QIIA 3OMCA 3RKXA 5A0LA 3L2VA 3HFOA 3META 2CYZB 4OVAA 2K5IA 5GAN4 3P8DA 3SD4A 4Z02A 5AYFA 1WJSA 3NTIA 4C92C 4EMGA 4N0AC 5KE3A 3CCQA 5IN1A 1TH7A 2LNVA 4OB0B 2K5LA 3PGGA 1YJNT 4M7AG 4F7UE 4OMFB 1K8AC 4BE1A 2ZPGB 3JCMW 5LJ5j 5GANj 3CC2A 4D6WA 2DD4A 4C0GA 4FSXA 3E19A 4M78D 1YITT 1YI2T 2LCCA 2DAQA 3RESA 4WF2A 2G3RA 1RL2A 1WJRA 5HK3A 3QJYA 1Q86U 4QQGA 3CBOA 4PJOF 5C0MA 4QW2A 1K8AU 3OW2S 2RK1A 3RMSA 4QQ6A 4C8QG 4M77D 4XU0A 4XQ3A 4QVCA 2CZ1B 3PMIA 2RHXA 4M7AB 4A4KA 4MZPA 2E41A 2AHJB 2JTFA 1S72T 1K73C 2EKOA 4PJOD 1I4K1 3TU4K 3CC4A 1Y7XA 2X35A 1BI0A 3NTHA 5CKDA 4J83A 4IUQA 3OS1A 4M7DG 2O4XB 2JTMA 3SFMA 1UGQB 5FU6B 3V8LA 1VUBA 2KMTA 4C8QB 2RI2A 3RIRA 4O6JA 2FYKA 1QVGS 5LJ5h 2ZPBB 5GANh 4XTVA 3HRUA 4M78C 4QQDA 3I55A 3CCEA 1X75C 4N4HA 1UGPB 3M58A 2E6NA 1VQ4A 1M1GA 4A4HA 1BKBA 4PJOA 3JCMg 5CK9A 5GAOp 2RHYA 2E70A 5FRMA 1JBMA 3CCUT 3OYCA 4BI4A 1SSFA 3BW1A 3OBWA 2A3LA 2XDBA 4LDVA 4M77C 3JB9D 3TREA 3L42A 4M75F 3V8JA 3MEVA 1WPYA 2XDDA 5DY9A 3CD6T 3X24B 2V8IA 4C92G 3M4YA 1KD1U 3SWNA 4PJOC 3E1SA 2ZPEB 1BYMA 2DTOA 1OZ2A 2LX9A 4JRKA 2HQEA 1YHQT 3L1AA 2E12A 4M75D 5CAIA 1YIJA 2D6FA 2F69A 2L89A 3C4SA 3CEYA 3T9NA 3EFSA 1Q81C 1VQ6A 3A8LB 3VUZA 4DA4A 2HAXA 4IUTA 2DZ9A 2DJZA 4OB2B 3SWNC 4ATOA 1DJ7B 2Y90A 5LJ3e 1JB0E 3JAME 3CBMA 1B34B 1U1SA 4PKCC 4QVZA 4C92B 2DZCA 4N4GA 1JJ2A 2XG8D 1NJIC 2YHTA 3P8BB 4FT4A 5LJ3g 2EAYA 3M56A 2ZPIB 1D3BA 2QDYB 4EMKA 3GF5A 3V7SA 4M75A 4QVDA 4PL6A 5CR2A 2PVOB 2GFUA 3CCLA 5A0DA 5DLQE 3G4ST 1VQ5T 1Y96A 5LJ3d 4R56A 2EQJA 1KQSS 1VQNT 1PSEA 3LLRA 3R6OA 3OYHA 4DQ2A 3JCMX 3LWIA 3G71T 1IZ6A 3QZ9B 4A4FA 3OS2A 3S3NA 2JN0A 5FRNA 2LRQA 1FWZA 4MDXA 2E5QA 1Y07A 3HRTA 3MP8A 4ZN1A 1O9SA 2CZ7B 3N5BB 1P92A 2JNGA 2PVDB 3DB3A 3HL8A 4LD6A 4M78G 5GAOr 2XKOC 3FEOA 3VYGA 2NLUA 1EIFA 2A7YA 3O8VA 4XTZA 3CC7A 3CCSA 1ZQ1A 1Q7YC 1VQ8A 3EAEA 4RG2A 2OTLT 1OZ3A 2XU8A 4X9CA 2GFAA 3OS5A 4LDWA 5KCOA 3CMAA 3PFSA 2KDSA 5HY6A 3GIBA 4F7UA 3CCMA 3GNGA 4M77G 1M90C 5GAN7 4NL2A 1VQOA 1I5LA 5FU7C 2R5MA 3DLLA 3G6EA 3PIPA 2FB7A 1MHNA 3KUFA 4PJOG 4BACA 4V2SA 4MMKA 2XHCA 4M78B 4BD3A 5CCAA 1Q82U 3ASKA 2YLCA 4PNOA 4C5HA 5HK0A 3JCMQ 1QVFS 3GNFB 1M90U 2KK4A 3URGA 5GAN6 5GAMh 3OSSC 3JCMc 3F70A 1VQLT 4MZMA 2EWNA 3OYBA 4XU1A 4ZGEB 1VQKA 3FIFA 4M77B 4JUVA 1H3ZA 1O75A 3WVEB 2QA4T 2XD0A 4EDUA 1XTDA 3A5ZB 3QBYA 4JDSA 2RJDA 2WSEE 4PJOB 4C0FA 2V8JA 3S3OA 4RKUE 1WGSA 3JCMV 3FLGA 3WVDB 3VU3C 4J6XA 2E65A 2MWOA 3UT1A 4JRQA 5CKFA 3HRSA 2OTJA 4C0ZA 4MMLA 3CCJA 2EJ9A 4C8QE 2ZPHB 3SWNB 5LJ5f 5GANf 4ME7A 5M9OA 2K2VA 5KE2A 3ZFJA 4R55A 3OYKA 2RK2A 3HFNA 1M5Q1 2DTHA 4HT9A 3A8MB 3TEEA 5GMKi 1WQWA 2QQSA 4ELYC 4O5VA 1BI1A 1UGSB 4M7DE 5GMKh 3DB4A 1UB4A 3EFRA 4JLGA 2VYTA 3M5AA 2X4YA 3M9QA 4MDWA 5J39A 3L2RA 2QEXT 3CMET 1KC8C 3RKWA 3FRNA 2DTIA 2E64A 1YJWA 1VQ9A 2QQBA 3MEAA 3I56A 3HKSA 3OBYA 3QG1A 3FDRA 3LYIA 3CPWA 1M8VA 4Q5WA 3J81E 3X28B 4M75B 1NPRA 5FROA 5J26A 4YTLA 2VGMA 1K73U 1AHJB 1Y96B 2ZPFB 3VUBA 4A53A 2DXCA 4C5EA 3CCRT 5A2QE 3UPUA 4LDYA 1KQSA 5DLOA 3JB9H 4Y28E 3JCMe 1BI3A 2C06A 2CZ6B 4C92E 2K5FA 1YJ9T 4XU3A 1LNXA 3JRZA 4JRIA 1W2BS 4HCCA 3VJPA 4BB7A 4J8OA 1KHIA 3KXTA 1YJNA 1HK9A 1QP2A 3A8HB 4KUIA 5CQXA 4CRIA 2M16A 4XTUA 5FU7B 2E10A 3MO8A 4BDYA 2CS7A 2VXEA 2H3JA 4PLIA 2F5KA 4BDZA 3CXCS 1YITA 1YI2A 3JCMd 2HD0A 2FL7A 2RI5A 1VQ7T 2EQUA 3ER0A 1I81A 3OYIA 2RB6A 3X25B 3NFCA 1KQ2A 3VV0A 2QQ9A 3MCAB 5CVIA 4IUPA 2JVVA 2VGNA 3MHXA 3M59A 3QJ6A 4E7IA 5FLXE 3PNWC 4OF1A 3L2WA 3FC3A 3VKIA 3OYDA 1QP3A 2E1HA 4ZGDB 3LGLA 1S72A 4E7KA 2MAMA 4HCZA 1ZHIA 3E9FA 3M54A 3GPLA 1G3SA 4ZN3A 2EYQA 1QVFA 3CCVT 3OYMA 1Q81U 4GY5A 2XIDA 1VQPT 3RERA 2IVWA 2RJEA 4F7UF 3QYHB 4C8QF 2EQKA 4JS4A 3OYNA 3LH0A 3OYYA 3JCMh 1N27A 1I8FA 1JRIA 4M78E 1G3YA 3JB9G 3QUIA 1M4ZA 3JCMP 1NJIU 4C8QD 2LT4A 5GAMj 4JS5A 1M1KC 5GAMf 3BDLA 5GAN5 5CKHA 5HKCA 4EMKC 3OMGA 3CCUA 4M75C 2HQXA 3TCJA 2EFIA 4M7DF 2DO3A 4M77E 2P0PA 2RHIA 1N9SA 2O01E 5D6XA 4FT2A 3OYAA 1KHCA 3CD6A 2RJCA 3LGFA 4L6V5 2ZGWA 3M53A 1WNLA 1VQMT 1XOVA 4M7DD 2ZCFB 1YCYA 4KULA 3SB2A 1YHQA 3OB9A 3H8ZA 5EG2A 3OW2A 4C8QA 2P4TA 2KSSA 2RH2A 2VUBA 4OB1B 2VXFA 4A4GA 4VUBA 1ZBXA 2DKGA 4J7FA 2IG0A 2KY9A 5LJ3h 3CCQT 1Q7YU 4PLLA 3JCMb 3QZ5B 4JLIA 4A4EA 4C92F 3QDRB 1G3WA 3HHTB 3ZEHA 1OYXA 4M7DA 2L5QA 1W4SA 2EIFA 2CZ0B 3FJPA 5GMKj 3CC2T 2EQMA 2B8AA 2CGHA 3RUXA 4M7AE 2PQWA 3V7RA 1QVGA 3PT9A 1MGQA 3G4SA 2K4YA 3MP1A 1VQ5A 2XK0A 4CI0C 1X01A 3X26B 2Y4YA 1VQNA 4FL6A 4HKEA 5CIUA 3G71A 1NPPA 3RMQA 2KVQG 2HBPA 1WJQA 2BIVA 3P8HA 1WQ7A 3C12A 2M1HA 3Q1JA 5GAN2 3S3MA 1V29B 2YLBA 4IKFA 2R58A 1BIBA 3G7ZA 4RMOA 5DM7R 2F5TX 3DLMA 3FB9A 4J5YA 3CXCA 5GAOl 3CC4T 3S6WA 2MMPA 1B34A 3BDUA 3X20B 2RHUA 4C92A 1JJ2S 1VIFA 1IREB 2DXTA 1FX7A 4L5GA 5D6YA 3VYHB 4LDUA 1KG1A 4DOVA 4M75G 4KT0E 4XTYA 3OYJA 5GAOn 5LJ5e 2ZZDA 4KBMB 5GANe 5LL6S 3L2QA 3OS0A 3I55T 3CCET 1R8OB 1NZ9A 1VQ4T 4M78F 1Q86C 1XNIA 2V8KA 3DKMA 5LJ5g 4LD9K 5GANg 4II1A 1M1FA 4XK8E 2RD1A 3QXEB 3HP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I81 A;  1Y96 A;  2RB6 A;  4M75 E;  5LJ3 d;  4A54 A;  3V7C A;  1D3B B;  4M7A F;  4DQ2 A;  4EMK B;  3JCM X;  5LJ5 d;  2RA2 A;  4M77 F;  4HT8 A;  5GAN d;  3HSB A;  3JCM J;  2JN0 A;  2I2L A;  1HXD A;  2E1H A;  4N0A A;  3JB9 F;  2HNI A;  4NL3 A;  4F7U G;  5GAO r;  4X9D A;  4M78 G;  2RM4 A;  3RKY A;  3RKX A;  2DXU A;  4XTZ A;  3HFO A;  4X9C A;  5GAN 4;  3JB9 D;  3RER A;  4C92 C;  4EMG A;  4N0A C;  2DEQ A;  4F7U F;  4F7U A;  3GIB A;  4C8Q F;  3JCM f;  1TH7 A;  4M78 A;  4M77 G;  2DVE A;  5GAN 7;  3PGG A;  4NL2 A;  1I5L A;  3JCM h;  4M7A G;  2K57 A;  1I8F A;  4F7U E;  1JRI A;  4M78 E;  3JCM W;  5LJ5 j;  2FB7 A;  4PJO G;  3JB9 G;  1N9R A;  3QUI A;  4F7U B;  5GAN j;  4MMK A;  4V2S A;  3JCM P;  4M78 B;  4C8Q D;  3V8K A;  4M78 D;  5GAM j;  4M77 A;  3RES A;  2YLC A;  4PNO A;  4WF2 A;  5GAM f;  5GMK l;  4EMK C;  3JCM Q;  5GAN 5;  4M75 C;  2VC8 A;  4M7D F;  5GAN 6;  5GAM h;  4RCB A;  3JCM c;  5GAN 3;  4M77 E;  4PJO F;  1N9S A;  2EWN A;  2QTX A;  4XU1 A;  3FIF A;  4M77 B;  4JUV A;  4NOY A;  4C8Q G;  4M77 D;  4XU0 A;  1U1T A;  4XQ3 A;  2ZGW A;  4M7A B;  4QVC A;  3JB9 J;  1WNL A;  4M7D B;  4M7A D;  2E41 A;  4M7D D;  1YCY A;  3SB2 A;  4XU2 A;  4XTX A;  5GAO m;  4PJO B;  4PJO D;  1BIA A;  1I4K 1;  3M4G A;  4RCC A;  3JCM V;  3VU3 C;  4J6X A;  2E65 A;  4C8Q A;  5LJ3 j;  4J6Y A;  5LJ3 f;  2VXF A;  4MML A;  4M7D G;  2EJ9 A;  4C8Q E;  2DKG A;  5LJ3 h;  3SWN B;  3V8L A;  5LJ5 f;  3JCM b;  4C92 F;  4JLI A;  3RIR A;  4C8Q B;  5GAN f;  2FYK A;  3AHU A;  5LJ5 h;  3L2Z A;  5GAN h;  4XTV A;  4Y91 A;  3QSU A;  4M78 C;  4M7A A;  3HFN A;  5GAN 8;  1M5Q 1;  2DTH A;  3FJP A;  5GMK j;  4HT9 A;  4M7D A;  5GMK i;  1WQW A;  5GAO q;  4PJO A;  2CGH A;  3RUX A;  3JCM g;  5GAO p;  4M7A E;  4M7D E;  3V7R A;  5GMK h;  1JBM A;  3EFR A;  1MGQ A;  3BW1 A;  4PJO E;  1X01 A;  5GAM e;  2EJG A;  4M77 C;  1KQ1 A;  1LOJ A;  4M75 F;  3RKW A;  1WPY A;  3BY7 A;  3V8J A;  4M7A C;  2DTI A;  5DY9 A;  5GAN 2;  2E64 A;  1WQ7 A;  4C92 G;  3SWN A;  4PJO C;  5GAM g;  2YLB A;  2DTO A;  1BIB A;  4JRK A;  1M8V A;  3BFM A;  3L1A A;  2EJF A;  4M75 B;  4M75 D;  4J6W A;  5CAI A;  3FB9 A;  4J5Y A;  5GAO l;  1B34 A;  3BDU A;  1Y96 B;  3EFS A;  3QHS A;  4A53 A;  4C92 A;  5I21 A;  1LJO A;  5GAM d;  4EMH A;  3JB9 H;  2DZ9 A;  2DJZ A;  3SWN C;  3JCM e;  2DXT A;  1H64 1;  4OP0 A;  4C8Q C;  4C92 E;  2Y90 A;  5LJ3 e;  4XU3 A;  1LNX A;  1B34 B;  1U1S A;  4JRI A;  4M75 G;  4XTY A;  4C92 B;  2DZC A;  4C92 D;  3QO3 A;  5GAO n;  5LJ5 e;  4XTW A;  1HK9 A;  5GAN e;  2YHT A;  5LJ3 g;  3INZ A;  2EAY A;  3JB9 I;  4XTU A;  2E10 A;  1D3B A;  4M78 F;  2VXE A;  4EMK A;  3V7S A;  4M75 A;  4HA8 A;  4QVD A;  5GMK m;  5LJ5 g;  5GAN g;  3JCM d;  4M7D C;  5GMK e;  2RD1 A;  1KQ2 A; 
#chains in the Genus database with same CATH topology
 1SG5 A;  4OML A;  1ABO A;  4AFU C;  3PTA A;  2PUO B;  2RI3 A;  4MZT A;  5GAN d;  1KC8 U;  2QA4 A;  3LW5 E;  2DA9 A;  4BE0 A;  2CDT A;  2E5K A;  4J9G A;  2KYB A;  2DXU A;  3L2U A;  2D9T A;  5IT9 E;  1W6X A;  5I2S A;  1R77 A;  4B9X A;  2DEQ A;  1ZSZ C;  1X2Q A;  1WHM A;  2DIL A;  2KQW A;  3E9G A;  3OYE A;  1BI2 A;  2R5A A;  4M77 A;  4FU6 A;  3CCL T;  2EQI A;  2MF2 A;  5KYN A;  2VC8 A;  1OI1 A;  1WX6 A;  2CP2 A;  1KD1 C;  1I1J A;  3LX7 A;  5C6S A;  2JMC A;  3JB9 J;  2DD5 A;  4XTX A;  1K9M C;  1H3H A;  4RCC A;  4DOW A;  4GLM A;  5LJ3 j;  1GBQ A;  3CC4 Q;  2YT6 A;  1YJ9 A;  3A8G B;  1VQO T;  3G6E T;  2MWP A;  3QSU A;  1AWX A;  1GCQ A;  2GQV A;  2J6K A;  2LC4 A;  1N8R R;  3CCE Q;  1AZE A;  1QKX A;  1GRI A;  2WSC E;  3CPW S;  2KT8 A;  4E7L A;  1AWJ A;  1KQ1 A;  1GXI E;  4KRT A;  1YN8 A;  5IAY A;  1Y71 A;  4KGZ B;  1F1B B;  2G6F X;  2X4W A;  2EKH A;  2DEU A;  4HCB A;  1CKA A;  3BFM A;  4J6W A;  4LXC A;  2GGR A;  3QHS A;  3A8O B;  2EYX A;  3KBG A;  4EMH A;  1MND A;  2OTJ T;  4OP0 A;  4AG1 C;  4NS5 A;  1PNJ A;  5J3B A;  4BE2 A;  4E7H A;  4C92 D;  4BY6 B;  1ZUY A;  2L8D A;  2O31 A;  1Q82 C;  1WHH A;  5CO7 A;  5IXF A;  4C0D B;  1ZUK A;  1W2B A;  1N5Z A;  2KI7 A;  3NMZ C;  2D0N A;  2OAU A;  2CSQ A;  4BUG A;  2YRC A;  1WFW A;  1VQM A;  2OTL A;  2AKL A;  4EPC A;  3OMC A;  3L2V A;  5A0L A;  1VQP Q;  2ABL A;  1YWP A;  5GAN 4;  4J9E A;  3NTI A;  5IN1 A;  1BCM A;  2LNV A;  4ESR A;  4OB0 B;  4F7U E;  1K8A C;  1JO8 A;  3EHR A;  1AWW A;  3E19 A;  4M78 D;  1YI2 T;  1FYN A;  1BB9 A;  2G3R A;  1WJR A;  2RK1 A;  3RMS A;  4XU0 A;  4M7A B;  2RHX A;  4A4K A;  4KH1 B;  1K73 C;  1Y7X A;  2J6O A;  2F2W A;  5CKD A;  4IUQ A;  1QKW A;  3OS1 A;  4Z89 A;  1IHW A;  2OTJ Q;  4OMO A;  4C8Q B;  2QDL A;  4O6J A;  1QVG S;  5GAN h;  4XTV A;  4RTX A;  3HRU A;  1X75 C;  2GNC A;  1RLP C;  2K79 A;  3JCM g;  2E70 A;  5FRM A;  3BW1 A;  2XDB A;  5L23 A;  2OX7 A;  4M75 F;  2XDD A;  1M30 A;  5DY9 A;  3CD6 T;  3X24 B;  4JJD A;  3SWN A;  1Y0M A;  4JRK A;  4LNP A;  1M3B A;  2D1X A;  2E12 A;  2BE7 D;  3T9N A;  1KD1 R;  4ATO A;  2C0I A;  3JAM E;  3CBM A;  1JJ2 P;  3P8B B;  4FT4 A;  1GFC A;  1NM7 A;  2EAY A;  1MMN A;  2ZPI B;  2QDY B;  4EMK A;  3GF5 A;  3V7S A;  1JU5 C;  4PL6 A;  5CR2 A;  2PVO B;  2NUZ A;  5DLQ E;  4IIM A;  2FEI A;  3PVL A;  5A0D A;  1VQ5 T;  1KQS S;  1VQN T;  2EYY A;  1YI2 Q;  1PSE A;  3LLR A;  4Z8A A;  2QG9 B;  1IZ6 A;  1WDX A;  3QZ9 B;  1IGQ A;  2JN0 A;  5FRN A;  1FWZ A;  4MDX A;  2E5Q A;  3MP8 A;  4PK4 A;  3EH1 A;  2JNG A;  2PVD B;  4LD6 A;  2L2P A;  1EIF A;  3O8V A;  3CC7 A;  4XTZ A;  3CCS A;  1VQ8 A;  1YCS B;  5KCO A;  3CMA A;  1B3Q A;  2KDS A;  3PFS A;  4F7U A;  1UHF A;  4BAC A;  4AMC A;  5CCA A;  1SKU B;  4PNO A;  1D1B A;  2NUT A;  5HK0 A;  3JCM Q;  3GNF B;  3VS5 A;  3URG A;  1IGU A;  3OSS C;  3JCM c;  3F70 A;  3OYB A;  4XU1 A;  4M77 B;  1H3Z A;  1X43 A;  2QA4 T;  4EDU A;  1XTD A;  1Q82 R;  3CD6 Q;  4PJO B;  2D8J A;  2RNA A;  3WVD B;  4J6X A;  5CKF A;  1T3L A;  3HRS A;  4RTY A;  3CCJ A;  2DBM A;  4X1V A;  5LJ5 f;  4ME7 A;  1NYF A;  2K2V A;  4KGV B;  4R55 A;  2PTK A;  5KYU B;  1M5Q 1;  1RAB B;  2VWF A;  4O5V A;  2J05 A;  3DB4 A;  1UB4 A;  4JLG A;  1MV0 B;  2X4Y A;  2FRW A;  1VQK Q;  2K3B A;  1KC8 C;  3C0C A;  3FRN A;  1VQN Q;  3D7S B;  1YJW A;  1W1F A;  2K6D A;  3LYI A;  3X28 B;  1PCX A;  5FRO A;  1HD3 A;  2X51 A;  1Y96 B;  2ZPF B;  2AT1 B;  1KQS A;  5I22 A;  4JZ4 A;  1BI3 A;  2COZ A;  2CZ6 B;  2EYZ A;  2K5F A;  1YJ9 T;  1LNX A;  3JRZ A;  3KXT A;  1K73 R;  5IHN A;  3H9N A;  2E10 A;  3MO8 A;  1MMG A;  2CS7 A;  2VXE A;  3CXC S;  2FL7 A;  2NYS A;  3ER0 A;  1WA7 A;  2QQ9 A;  1VQ9 Q;  1M3C A;  3MHX A;  6AT1 B;  3PNW C;  4OF1 A;  2E1H A;  4PJM A;  2QA4 Q;  2NUP B;  3M0T A;  3O5Z A;  2FZC B;  2XID A;  1UJY A;  2IVW A;  2LMJ A;  3QYH B;  2KR3 A;  3OYN A;  4CC7 A;  3LH0 A;  1I8F A;  3JV3 A;  1YIT Q;  3JCM P;  4C8Q D;  4JS5 A;  1V1C A;  4A63 B;  5GAM f;  3CCU A;  1TTH B;  3MJX A;  5D6X A;  4AG2 C;  1D1C A;  3G1J A;  3OYA A;  1KHC A;  2YUQ A;  4L6V 5;  3RNJ A;  2ZGW A;  1VQM T;  3H8Z A;  4OMN A;  2VXF A;  4A4G A;  1ZBX A;  4HCK A;  1M1K R;  2IG0 A;  2HKQ B;  1E6G A;  3CQT A;  3QZ5 B;  4JLI A;  4LE9 A;  3HHT B;  1W4S A;  4J9B A;  2EIF A;  5IHK A;  3VS4 A;  4M7A E;  3V7R A;  2XK0 A;  1QMC A;  4CI0 C;  4FL6 A;  3RDV A;  3G71 A;  1HYO A;  1NPP A;  3C12 A;  1RAG B;  1VA7 A;  5DM7 R;  1PKS A;  3DLM A;  3FB9 A;  3CXC A;  1EX4 A;  1B34 A;  1PHT A;  1VYT A;  2DXT A;  1FX7 A;  2YWW A;  4L5G A;  5D6Y A;  1KG1 A;  4XTY A;  1WHK A;  3VS6 A;  5GAO n;  5IH2 A;  5FW9 A;  1E6H A;  2Z0W A;  3VS7 A;  4HVW A;  1M1F A;  2RD1 A;  3EGX B;  2ZAE A;  2RJF A;  4A54 A;  1UGR B;  1EFN A;  1VQL A;  2LQ8 A;  4EMK B;  2M9U A;  4HVU A;  3HSB A;  5CQY A;  3OYF A;  2M0O A;  1VQM Q;  2J7I A;  4GLK A;  4WCI A;  2LCS A;  2K3X A;  2AIR B;  2OTL Q;  4KUD K;  2GCX A;  4FIB A;  4QKU A;  1KC8 R;  2F1L A;  2M02 A;  1TWB A;  3CPF A;  3UDC A;  2CP5 A;  4LDX A;  1PWT A;  3OYL A;  4OMM A;  5D7U A;  2RHZ A;  4F7U B;  4PFZ A;  2DPP B;  1OQK A;  4ZTJ A;  3C95 A;  4PFP A;  3EG2 A;  5GMK l;  2DJQ A;  2V26 A;  4E7S A;  3CME A;  2BKD N;  2CSI A;  4NOY A;  1U1T A;  2ROT A;  4M7D B;  1N8R C;  3HPW A;  4XU2 A;  1MMD A;  1BIA A;  4JJN K;  1VQ8 T;  3CC7 T;  3CCS T;  1RAE B;  4BI3 A;  2XI9 A;  5LJ3 f;  3CMA T;  3OSV A;  4RG8 A;  5ECA A;  1OUL A;  3I5R A;  1GFD A;  1FMW A;  4TVR A;  1TUG B;  2BE9 B;  2PVG B;  2FHD A;  2L3R A;  3L2Z A;  3J7A F;  4Y91 A;  4M7A A;  3M57 A;  2ED1 A;  2RQU A;  2QEX Q;  4UC4 A;  1VQ7 A;  4PJO E;  1M1K U;  1AOJ A;  4IUU A;  3OQ5 A;  3GOX A;  2HKN A;  2D8H A;  3CCR Q;  2L3Q A;  2RMO A;  2A28 A;  5I21 A;  1SHG A;  2L3S A;  3CCJ T;  3JSC A;  2L3P A;  1LCK A;  1ZSZ B;  4XTW A;  2KE9 A;  5HCK A;  3INZ A;  1G3T A;  2YSQ A;  4B9W A;  1EZZ B;  3MKD A;  4HA8 A;  5GMK m;  1W2B P;  4M7D C;  5GMK e;  2HZY A;  2DET A;  3GP8 A;  2DIG A;  4LUD A;  1YJW T;  3QPH A;  3JCM J;  2JZ2 A;  2MK5 A;  2X4X A;  1CSK A;  3EG9 B;  5I2M A;  2CUB A;  4ZGJ B;  5KH6 A;  3J80 E;  3QII A;  1RAH B;  3RKX A;  1X6G A;  3MET A;  3EG3 A;  3SD4 A;  1VQ8 Q;  4C92 C;  5AYF A;  3CC7 Q;  2ATC B;  4N0A C;  4CC3 A;  3CMA Q;  4M7A G;  1J3T A;  1QCF A;  2CP7 A;  3CC2 A;  4FSX A;  2QGG A;  1VOM A;  1RL2 A;  1ARK A;  3VS2 A;  4QW2 A;  1RAI B;  2CP6 A;  2DYB A;  3OW2 S;  4C8Q G;  4XQ3 A;  2AHJ B;  2JTF A;  1SRL A;  1I4K 1;  1HJD A;  1I07 A;  2QAZ A;  3NTH A;  3CCQ Q;  2DL3 A;  2O4X B;  4ANJ A;  3SFM A;  1UGQ B;  3V8L A;  2KMT A;  3ULR B;  2P84 A;  3NGP A;  2ZPB B;  4M78 C;  4QQD A;  4N4H A;  1UGP B;  3M58 A;  4A4H A;  4PJO A;  2QK0 A;  3AT1 B;  3CCU T;  4BI4 A;  4LDV A;  2FG0 A;  2KNB B;  4RTW A;  3M4Y A;  1KIK A;  3E1S A;  2ZPE B;  1BYM A;  2JW4 A;  3VS1 A;  2HQE A;  1YJW Q;  5CAI A;  1YIJ A;  5KYU A;  2D6F A;  3EFS A;  1VQ6 A;  3VRZ A;  3A8L B;  4HVV A;  4IUT A;  4AFQ C;  1DJ7 B;  1B34 B;  1UEC A;  3I55 Q;  1OPL A;  2KRS A;  3M56 A;  2AK5 A;  1Y96 A;  3G71 T;  3EHQ A;  2CUD A;  1D0X A;  5FWB A;  4A4F A;  2DRK A;  3HRT A;  1Y07 A;  2AKK A;  2XKO C;  2A7Y A;  4RTV A;  4RG2 A;  1WHL A;  1G2B A;  5GJW B;  3EH2 A;  1TXQ A;  4M77 G;  2ESW A;  4NL2 A;  1I5L A;  2A0F B;  5FU7 C;  2R5M A;  1D1A A;  2FB7 A;  4PJO G;  4V2S A;  3CCL Q;  3SEM A;  1LPL A;  3ASK A;  2NUP A;  1ZA1 B;  4C5H A;  1M2O A;  1M90 U;  2KK4 A;  5GAN 6;  1JXM A;  1VQL T;  3CCU Q;  1LVK A;  2EWN A;  2B86 A;  2DL7 A;  1QLY A;  3UAT A;  2E3I A;  3S3O A;  1M3A A;  3UT1 A;  4JRQ A;  1H8K A;  2ZPH B;  1VQO Q;  2JT4 A;  5GAN f;  3G6E Q;  2RQT A;  3A8M B;  5GMK i;  2QQS A;  2AZS A;  1BI1 A;  1UGS B;  1G8X A;  4M7D E;  5GMK h;  3EFR A;  3M5A A;  3M9Q A;  4CC2 A;  2XMF A;  3CME T;  2YUN A;  1SEM A;  2A36 A;  3QDF A;  1OEB A;  2KGT A;  3QWY A;  3G71 Q;  3OBY A;  3QG1 A;  3FDR A;  3CPW A;  5I11 A;  4Q5W A;  4M75 B;  4YTL A;  2KXC A;  1KFZ A;  1KQS P;  2KXD A;  2W0Z A;  2JS0 A;  4C92 E;  1ZA2 B;  2FO0 A;  1SHF A;  3IQL A;  4HCC A;  1YJN A;  1HK9 A;  3M0Q A;  4KUI A;  4XTU A;  4BDY A;  2GBQ A;  3R6N A;  2FRY A;  1VQ7 T;  1I81 A;  2RB6 A;  3NFC A;  3VV0 A;  5CVI A;  2JVV A;  3UA6 A;  4E7I A;  1VQL Q;  3VKI A;  1QP3 A;  1AVZ C;  4E7K A;  3LH5 A;  1SPK A;  3GPL A;  1B07 A;  2CP0 A;  4ZN3 A;  2EYQ A;  2LQN A;  1PC0 A;  3SHW A;  1Q81 U;  2MCN A;  3EGX A;  2RJE A;  2DX1 A;  4C8Q F;  1U06 A;  3OYY A;  3JCM h;  1N27 A;  4M78 E;  2EGE A;  4AT1 B;  1NJI U;  1M1K C;  3OMG A;  4M75 C;  3TCJ A;  2DO3 A;  1N9S A;  2O01 E;  3UF4 A;  3LGF A;  3CME Q;  1WHJ A;  1XOV A;  1YHQ A;  2P4T A;  3EFO B;  1MUZ A;  4OB1 B;  1PD0 A;  4J7F A;  2C0T A;  4PLL A;  3QDR B;  1MV3 A;  2CH4 W;  3NPF A;  4M7D A;  3FJP A;  5GMK j;  3CC2 T;  2EQM A;  2B8A A;  1MNE A;  2CGH A;  2PQW A;  1QVG A;  3PT9 A;  3G4S A;  3MP1 A;  3X26 B;  2Y4Y A;  1WXU A;  1VQ7 Q;  3RMQ A;  2KVQ G;  2HBP A;  3P8H A;  5GAN 2;  1V29 B;  2MOX A;  4RMO A;  1U5S A;  2F5T X;  4PJL A;  5GAO l;  2MMP A;  1QWE A;  4C92 A;  1JJ2 S;  1VIF A;  4OMQ A;  2ROL A;  5LL6 S;  4PFO A;  2QYZ A;  4JJC A;  4JZ3 A;  1NZ9 A;  1VQ5 Q;  2V8K A;  5LJ5 g;  2JS2 A;  4II1 A;  2HQH A;  3H6Z A;  1OPK A;  4M77 F;  2P0K A;  4IIO A;  4N4I A;  1ZSZ A;  5A0G A;  2EBP A;  4F7U G;  1YIJ T;  3RKY A;  4RTZ A;  1VQ6 T;  2L0A A;  2RO0 A;  3MEU A;  2QQA A;  2COY A;  1TG0 A;  4M78 A;  1YWO A;  3HTR A;  1NE8 A;  2P0Q A;  2K57 A;  2FZG B;  3PIO A;  3EG9 A;  3GLX A;  5D6W A;  2DIQ A;  2CH4 A;  4L59 A;  4RCB A;  5GAN 3;  1WHG A;  2QTX A;  2LVM A;  1YBY A;  1RI9 A;  2E6Z A;  2DL4 A;  2LTO A;  4DEX A;  1QVF P;  1FXX A;  4M7A D;  4ZNX A;  2QAS A;  5GAO m;  4J9F A;  1PSF A;  1IHV A;  4J6Y A;  2H8H A;  4J7I A;  2YXY A;  1QW1 A;  1RLQ C;  1K9M U;  2QXF A;  2VV5 A;  1Z9Z A;  3AHU A;  2LQK A;  4XAX B;  2AZV A;  3EGD A;  4ZTF A;  3OY9 A;  2DK3 A;  4KGX B;  1UFF A;  1XJW B;  2LP5 A;  2KAF A;  3M0S A;  2O4X A;  1GCQ C;  3C94 A;  2EPD A;  5CKB A;  4OGE A;  5GAM g;  2Y4X A;  1B7T A;  1K76 A;  4FM4 B;  1PRM C;  1C1A A;  2XDP A;  1JEG A;  1NEB A;  1T0H A;  2QI2 A;  3M0U A;  5IXB A;  1YIJ Q;  3CCV A;  1CKB A;  1ABQ A;  1YJ9 Q;  1BU1 A;  5FU6 C;  2DNU A;  1VQ6 Q;  1QVP A;  1VQP A;  1NLP C;  3SDZ A;  4FYX B;  2HEQ A;  3CBP A;  3MP6 A;  3QYG B;  2DYI A;  2BZ8 A;  3H41 A;  3FJ5 A;  2LCL A;  4FW1 A;  2J6F A;  2D0Q B;  3H0H A;  2GF7 A;  4X34 A;  4M75 E;  3V7C A;  4Y92 A;  4E47 A;  2RA2 A;  2PU9 B;  1QWF A;  3M55 A;  2FVU A;  1UEB A;  4JPB W;  2HNI A;  3M0R A;  2KRM A;  2LDM A;  3NHN A;  4J9D A;  2CYZ B;  2K5I A;  3JB9 D;  3P8D A;  4Z02 A;  1WJS A;  5KYW B;  4EMG A;  5KE3 A;  1JXO A;  3PGG A;  1YJN T;  4QT7 A;  3VS0 A;  1TUC A;  2ZPG B;  4BE1 A;  5LJ5 j;  3JCM W;  2DD4 A;  2RN8 A;  4FW2 A;  2LCC A;  5AT1 B;  1OOT A;  2DAQ A;  1JQQ A;  4WF2 A;  1WIE A;  1W70 A;  5HK3 A;  1Q86 U;  3QJY A;  3CBO A;  5C0M A;  1M27 C;  3UA7 A;  1K8A U;  3I9Q A;  4M77 D;  2CZ1 B;  3PMI A;  2CT3 A;  1RAC B;  2E41 A;  3VRY A;  1M2V A;  2EKO A;  1U3O A;  3U23 A;  4PJO D;  2SRC A;  3A98 A;  3TU4 K;  2HL5 C;  3EGU A;  1VUB A;  2RI2 A;  1I0C A;  5IHI A;  1VQ4 A;  1M1G A;  5CK9 A;  5GAO p;  2RHY A;  1JBM A;  1SSF A;  3OBW A;  2A3L A;  4DBR A;  3TRE A;  3L42 A;  4E6R A;  3V8J A;  3MEV A;  1WPY A;  2HSP A;  2F2V A;  1ACM B;  2DTO A;  2LX9 A;  1YHQ T;  3L1A A;  2F69 A;  2L89 A;  1Q81 C;  2DZ9 A;  2DJZ A;  3SWN C;  4PKC C;  4C92 B;  3PVQ A;  1OV3 A;  1NJI C;  1UTI A;  2YHT A;  5LJ3 g;  2JM9 A;  1D3B A;  4M75 A;  3G4S T;  2COW A;  1K1Z A;  4R56 A;  3R6O A;  3OYH A;  4DQ2 A;  2JTE A;  3LWI A;  1R0B G;  4GBQ A;  3S3N A;  2LRQ A;  1Q95 G;  1ZSG A;  1UUE A;  4RUG A;  1P92 A;  3DB3 A;  3FEO A;  3VYG A;  2MYS A;  2GFA A;  3OS5 A;  4LDW A;  5HY6 A;  1WXT A;  3GIB A;  3CCM A;  1ZUU A;  1QCN A;  2JJ9 A;  4DBH A;  1PG5 B;  3PIP A;  2OJ2 A;  1MHN A;  1ZLM A;  4MMK A;  1UE9 A;  4M78 B;  4BD3 A;  2BZY A;  2LJ1 A;  1VQK A;  1SRM A;  2KEA A;  1O75 A;  3THK A;  3WVE B;  3A5Z B;  3QBY A;  2F2X A;  2RJD A;  2WSE E;  2V8J A;  4RKU E;  1WGS A;  1M90 R;  3CCS Q;  3JCM V;  3VU3 C;  2MWO A;  2RQV A;  2JM8 A;  4MML A;  4C0Z A;  4WTO B;  2QGF B;  4R0K A;  5KE2 A;  4EIK A;  3OYK A;  2LJ3 A;  3HFN A;  2DTH A;  3TEE A;  1WQW A;  1FMV A;  4ELY C;  4MDW A;  3L2R A;  3EFO A;  2YRD A;  3EGD B;  3H0I A;  3G4S Q;  2NWM A;  3RKW A;  4J9C A;  1VQ9 A;  2QQB A;  3MEA A;  3I56 A;  3CPW P;  4KH0 B;  1WZO A;  5J26 A;  2VGM A;  1AHJ B;  4A53 A;  2X3W D;  3CCJ Q;  2DXC A;  3UPU A;  4LDY A;  3REB B;  2ENM A;  3JCM e;  4K11 A;  2C06 A;  3RBB B;  2X9H A;  1W2B S;  3VJP A;  4BB7 A;  2VAS A;  1QP2 A;  2DM1 A;  5FU7 B;  4HXJ A;  2F5K A;  1YIT A;  3JCM d;  2KRN A;  2EQU A;  3OYI A;  1KQ2 A;  2PZ1 A;  3MCA B;  4IUP A;  1PRL C;  3M59 A;  5FLX E;  3FC3 A;  2FZK B;  2H3E B;  3OYD A;  4ZGD B;  3LGL A;  1S72 A;  2MAM A;  1UDL A;  4HCZ A;  3E9F A;  1FMK A;  3M54 A;  3CCV T;  2MIO A;  2CRE A;  4GY5 A;  1VQP T;  3RER A;  1X2K A;  4JS4 A;  5GJV B;  2DF6 A;  3QUI A;  3JB9 G;  1M4Z A;  1Q81 R;  2LT4 A;  3BE3 A;  5GAN 5;  2HQX A;  3ZL7 C;  2P0P A;  2RHI A;  2C0O A;  4FT2 A;  1WLP B;  2HBW A;  1RAD B;  4F04 B;  2RJC A;  1OU9 A;  1AEY A;  1NJI R;  1WNL A;  1X27 A;  4M7D D;  2ZCF B;  1YCY A;  4KUL A;  3SB2 A;  8AT1 B;  5EG2 A;  3OW2 A;  1KK7 A;  2VUB A;  1HSQ A;  1M2V B;  2DKG A;  1Q7Y U;  3JCM b;  1G3W A;  3ZEH A;  4DBQ A;  3PE0 A;  1OYX A;  5KYY B;  3RUX A;  1QVG P;  5KYX B;  1MGQ A;  2K4Y A;  2YDL A;  1IXD A;  1BCO A;  5CIU A;  1WJQ A;  2HSE B;  3S3M A;  3Q1J A;  2YLB A;  4IKF A;  1NLO C;  2R58 A;  1BIB A;  3G7Z A;  1G83 A;  1YNZ A;  3X20 B;  2RHU A;  1E7O A;  4PJN A;  1IRE B;  2VB6 A;  3VYH B;  1WI7 A;  3CCV Q;  4KT0 E;  4F14 A;  3QWX X;  3OYJ A;  5LJ5 e;  2ZZD A;  4KBM B;  1OU8 A;  4PJJ A;  3L2Q A;  3A1P A;  9ATC B;  1NYG A;  1R8O B;  4AFS C;  1VQ4 T;  1Q86 C;  1XNI A;  4FSS A;  3DKM A;  5GAN g;  4XK8 E;  2DFU A;  4IUV A;  3REA B;  2K3Y A;  1D3B B;  1AZG B;  5LJ5 d;  2O9V A;  4E2F B;  4FYY B;  2LZ6 B;  3NTK A;  4OMP A;  4NL3 A;  1C6V X;  2WSF E;  4X9D A;  2RM4 A;  2CKK A;  2M0Y A;  1QCO A;  1VIE A;  1IRX A;  2DXB A;  4F17 A;  4BY6 C;  1NG2 A;  1SSH A;  3JCM f;  4C5I A;  2DVE A;  2X4J A;  4C0D C;  1TOV A;  1RAA B;  1N9R A;  3QKJ A;  4D8K A;  2HCK A;  3V8K A;  1PD1 A;  3OA6 A;  3OS0 A;  4P5N A;  2BUD A;  4M7A F;  2QEX A;  5KYW A;  2OI3 A;  4E7J A;  5L8R E;  4IUR A;  1A0N B;  1N6A A;  1U8R A;  2RPN A;  2O9S A;  2K9G A;  2PUK B;  2R57 A;  3M4G A;  4OB3 B;  2DL5 A;  2JXB A;  2QQR A;  2KBT A;  2DRM A;  2DLP A;  3PMT A;  3OYG A;  5KCH A;  3CCR A;  2XIC A;  2YRV A;  1UGV A;  1N8R U;  1S1N A;  3CCM T;  4ELZ C;  2BTT A;  2M51 A;  5GAN 8;  2DBK A;  2FPD A;  5GAO q;  1V76 A;  5CKE A;  3MEW A;  1K9M R;  1VQ4 Q;  1TSF A;  4JRP A;  2YUO A;  3ZBD A;  2DMO A;  5GAM e;  2EJG A;  1LOJ A;  1X6O A;  1OX9 A;  3BY7 A;  1VQK T;  4M7A C;  4BI8 B;  2WAC A;  1M9S A;  4LUE A;  2DL8 A;  2EGA A;  2JOY A;  2EJF A;  1G5V A;  1WXB A;  3ME9 A;  5GAM d;  1LJO A;  1XQH A;  2DE0 X;  1IO6 A;  2RQW A;  1H64 1;  4C8Q C;  4OGC A;  1C0M A;  2LX7 A;  2EW3 A;  5EC7 A;  2LT1 A;  3UWN A;  3QO3 A;  4C5G A;  2LJ0 A;  3WXM B;  3JB9 I;  2JMA A;  1ZBJ A;  2SEM A;  1M8M A;  2VVK A;  4HT8 A;  2HMA A;  3CXC P;  1IB8 A;  2A37 A;  3I56 T;  1VQ9 T;  2I2L A;  2MI6 A;  1HXD A;  2JUF A;  4N0A A;  3JB9 F;  3LWH A;  1RI0 A;  4FCY A;  3HFO A;  1R0C B;  1VYV A;  1I5O B;  4OVA A;  2O2O A;  3CCQ A;  2LQW A;  1TH7 A;  2K5L A;  4OMF B;  3CCM Q;  5GAN j;  4D6W A;  2RQR A;  4C0G A;  1YIT T;  3RES A;  2DVJ A;  2VKN A;  3VS3 A;  4QQG A;  2BZX A;  2EGC A;  4PJO F;  2K7A A;  1PKT A;  4QQ6 A;  4QVC A;  4MZP A;  2MPX C;  1S72 T;  1SF9 A;  3EG1 A;  1Q86 R;  3CC4 A;  1K8A R;  2X35 A;  4Z88 A;  1BI0 A;  4J83 A;  4M7D G;  4B6M A;  2JTM A;  1D0Z A;  3TVT A;  5FU6 B;  3RIR A;  2FYK A;  5LJ5 h;  4RTU A;  3CC2 Q;  1X69 A;  3I55 A;  3CCE A;  2GQI A;  2E6N A;  1BKB A;  3OYC A;  1YFN A;  4M77 C;  2V8I A;  4C92 G;  1KD1 U;  4PJO C;  1OZ2 A;  2FPF A;  2V1Q A;  3I56 Q;  4M75 D;  3CEY A;  3C4S A;  3VUZ A;  4DA4 A;  2HAX A;  4FYV B;  3H0F A;  4OB2 B;  3TQ7 P;  1Y57 A;  2Y90 A;  5LJ3 e;  1JB0 E;  1U1S A;  4QVZ A;  2DZC A;  4N4G A;  1JJ2 A;  2XG8 D;  4QVD A;  2GFU A;  3CCL A;  2ED0 A;  2CP3 A;  1TU0 B;  5LJ3 d;  2EQJ A;  2FPE A;  2K2M A;  2GTJ A;  4JJB A;  3JCM X;  3OS2 A;  2QTV A;  4ZN1 A;  1O9S A;  2CZ7 B;  3N5B B;  5GAO r;  3HL8 A;  4M78 G;  1S72 Q;  1PM3 A;  2NLU A;  1ZQ1 A;  1Q7Y C;  3EAE A;  2OTL T;  1OZ3 A;  2XU8 A;  4X9C A;  1WYX A;  3GNG A;  1M90 C;  5GAN 7;  1VQO A;  3DLL A;  3G6E A;  3KUF A;  8ATC B;  2XHC A;  1Q82 U;  7AT1 B;  1GCP A;  2YLC A;  1QVF S;  1K4U S;  2O88 A;  1GBR A;  1GL5 A;  2E3H A;  5GAM h;  3I35 A;  4MZM A;  4ZGE B;  3FIF A;  2YUP A;  4JUV A;  4DBF A;  2KYM A;  2XD0 A;  4JDS A;  1T3S A;  4C0F A;  2RF0 A;  3FLG A;  2E65 A;  1X6B A;  2OTJ A;  1K9A A;  2EJ9 A;  4C8Q E;  3SWN B;  1ZX6 A;  2IIM A;  5M9O A;  3ZFJ A;  1T0J A;  2RK2 A;  3TSZ A;  2OAW A;  4HT9 A;  4FYW B;  5FWC A;  2VYT A;  1AT1 B;  2QEX T;  5J39 A;  2J06 A;  3I5S A;  4ORZ A;  2DTI A;  2E64 A;  1K0S A;  3E2U A;  3HKS A;  1M8V A;  3J81 E;  1NPR A;  3TSW A;  5KYY A;  1K73 U;  4C5E A;  3VUB A;  3CCR T;  5A2Q E;  1NBE B;  2A08 A;  2GTO A;  3RR6 A;  5DLO A;  3JB9 H;  2PNI A;  4Y28 E;  5KYX A;  1AWO A;  4E7Z A;  1UJ0 A;  4XU3 A;  2KT1 A;  4JRI A;  1NEG A;  1VYU A;  4J8O A;  1KHI A;  4F16 A;  3A8H B;  5CQX A;  4CRI A;  2M16 A;  4J9H A;  2V1R A;  2HL3 A;  2H3J A;  4PLI A;  4BDZ A;  1YI2 A;  3EG0 A;  2HD0 A;  2RI5 A;  3X25 B;  4LN2 A;  2IPO B;  2VGN A;  2HDA A;  3QJ6 A;  4D8D A;  3L2W A;  2I0N A;  1D09 B;  1ZHI A;  4M4Z A;  2NUT B;  1KJW A;  1G3S A;  2CT4 A;  1QVF A;  1D0Y A;  1UG1 A;  3OYM A;  1KSW A;  4AFZ C;  1MMA A;  4F7U F;  1YJN Q;  2EQK A;  1H92 A;  1JRI A;  1G3Y A;  5GAM j;  4DEY A;  3BDL A;  5CKH A;  5HKC A;  4EMK C;  3M0P A;  4M7D F;  2EFI A;  2E4H A;  4M77 E;  4RTT A;  3CD6 A;  2LNH B;  3M53 A;  1BBZ A;  3OB9 A;  2KRO A;  3OW2 P;  4C8Q A;  2EVR A;  2KSS A;  2RH2 A;  1RUW A;  3GBQ A;  4VUB A;  2KY9 A;  5LJ3 h;  3CCQ T;  4C92 F;  4A4E A;  1YP5 A;  2L5Q A;  2CZ0 B;  3KFV A;  1BK2 A;  1Z9Q A;  1Q7Y R;  1UHC A;  2W10 A;  1VQ5 A;  2P4R A;  1X01 A;  1VQN A;  1AD5 A;  4HKE A;  2BIV A;  1WQ7 A;  2M1H A;  1YHQ Q;  2DER A;  1TUD A;  1OX8 A;  4J5Y A;  1RAF B;  3CC4 T;  3S6W A;  1K0X A;  3BDU A;  2X3X D;  3MPU B;  4LDU A;  4DOV A;  1TS9 A;  4M75 G;  1QQJ A;  4J9I A;  2EYW A;  4CC4 B;  5GAN e;  3I55 T;  3CCE T;  4M78 F;  2ECZ A;  4LD9 K;  3QXE B;  3HP9 A; 
#chains in the Genus database with same CATH homology
 2K3Y A;  3H6Z A;  2RJF A;  4A54 A;  1UGR B;  1VQL A;  2LQ8 A;  1D3B B;  3PTA A;  4EMK B;  2PUO B;  2M9U A;  5LJ5 d;  4M77 F;  2RI3 A;  2P0K A;  4MZT A;  5GAN d;  3HSB A;  1KC8 U;  5CQY A;  2QA4 A;  3LW5 E;  3OYF A;  4N4I A;  2M0O A;  3NTK A;  5A0G A;  4NL3 A;  4BE0 A;  2WSF E;  4F7U G;  1YIJ T;  4X9D A;  3RKY A;  2RM4 A;  4GLK A;  1VQ6 T;  2K3X A;  2CKK A;  2RO0 A;  4KUD K;  2DXU A;  2GCX A;  4FIB A;  1VIE A;  3L2U A;  2D9T A;  3MEU A;  5IT9 E;  2DXB A;  2QQA A;  5I2S A;  3CPF A;  4B9X A;  3UDC A;  2DEQ A;  4BY6 C;  4LDX A;  3JCM f;  4C5I A;  4M78 A;  3OYL A;  2DVE A;  1NE8 A;  2P0Q A;  2K57 A;  2X4J A;  4C0D C;  2RHZ A;  1N9R A;  4F7U B;  3QKJ A;  2KQW A;  3GLX A;  3PIO A;  2DPP B;  3E9G A;  3OYE A;  3V8K A;  3OA6 A;  1BI2 A;  5D6W A;  4P5N A;  2R5A A;  4M77 A;  3C95 A;  2BUD A;  2DIQ A;  2MF2 A;  4FU6 A;  5GMK l;  3CCL T;  4ZTJ A;  4M7A F;  4IUV A;  2VC8 A;  1OI1 A;  4L59 A;  2QEX A;  4RCB A;  5GAN 3;  1KD1 C;  3CME A;  3LX7 A;  2BKD N;  2QTX A;  2LVM A;  5C6S A;  4NOY A;  1YBY A;  1U1T A;  2E6Z A;  4E7J A;  2LTO A;  5L8R E;  3JB9 J;  4M7D B;  1N8R C;  1FXX A;  3HPW A;  4IUR A;  4M7A D;  1N6A A;  4XU2 A;  2DD5 A;  4XTX A;  5GAO m;  2PUK B;  2R57 A;  1U8R A;  1K9M C;  1BIA A;  3M4G A;  4RCC A;  4DOW A;  4JJN K;  4OB3 B;  1PSF A;  2QQR A;  3PMT A;  1VQ8 T;  3CC7 T;  3CCS T;  3OYG A;  5KCH A;  4BI3 A;  2XIC A;  5LJ3 j;  2XI9 A;  2YRV A;  3CCR A;  4J6Y A;  5LJ3 f;  4J7I A;  3CMA T;  3OSV A;  1QW1 A;  4RG8 A;  1N8R U;  1YJ9 A;  3A8G B;  3CCM T;  2QXF A;  1K9M U;  2VV5 A;  4TVR A;  3AHU A;  1VQO T;  2PVG B;  4ELZ C;  2FHD A;  2L3R A;  2LQK A;  3L2Z A;  3J7A F;  4XAX B;  4Y91 A;  2MWP A;  3G6E T;  3QSU A;  4M7A A;  5GAN 8;  2GQV A;  4ZTF A;  3M57 A;  5GAO q;  2LC4 A;  5CKE A;  4UC4 A;  3OY9 A;  3MEW A;  2DK3 A;  1VQ7 A;  2WSC E;  3CPW S;  4JRP A;  4PJO E;  3ZBD A;  4E7L A;  5GAM e;  2EJG A;  1M1K U;  1KQ1 A;  1LOJ A;  1X6O A;  1GXI E;  4M7A C;  3BY7 A;  2KAF A;  4IUU A;  2O4X A;  1VQK T;  3C94 A;  3OQ5 A;  5CKB A;  4OGE A;  1Y71 A;  2WAC A;  4BI8 B;  5IAY A;  3GOX A;  1M9S A;  5GAM g;  2Y4X A;  2X4W A;  4HCB A;  4FM4 B;  3BFM A;  2JOY A;  2EJF A;  4J6W A;  2XDP A;  1G5V A;  3QHS A;  5I21 A;  3A8O B;  2QI2 A;  5GAM d;  3ME9 A;  3KBG A;  1LJO A;  3CCV A;  4EMH A;  2OTJ T;  3CCJ T;  5FU6 C;  1XQH A;  1QVP A;  1H64 1;  4OP0 A;  4C8Q C;  4OGC A;  3JSC A;  1VQP A;  4NS5 A;  3SDZ A;  2LT1 A;  5J3B A;  4BE2 A;  3UWN A;  4E7H A;  3CBP A;  4C92 D;  3QO3 A;  4BY6 B;  3MP6 A;  3QYG B;  4XTW A;  4C5G A;  2L8D A;  1Q82 C;  3INZ A;  1G3T A;  5CO7 A;  3WXM B;  4B9W A;  3JB9 I;  4C0D B;  2LCL A;  4HA8 A;  5GMK m;  4M7D C;  1W2B A;  5GMK e;  2D0Q B;  2GF7 A;  4X34 A;  4M75 E;  3V7C A;  4E47 A;  2OAU A;  3GP8 A;  2RA2 A;  4HT8 A;  2DIG A;  1YJW T;  3QPH A;  4BUG A;  3JCM J;  1VQ9 T;  2JZ2 A;  3I56 T;  2I2L A;  2PU9 B;  2MI6 A;  2X4X A;  1HXD A;  1VQM A;  2JUF A;  4N0A A;  3M55 A;  2FVU A;  1UEB A;  5I2M A;  3LWH A;  2OTL A;  1RI0 A;  2HNI A;  4ZGJ B;  3JB9 F;  4EPC A;  5KH6 A;  2LDM A;  3J80 E;  3QII A;  3OMC A;  3RKX A;  5A0L A;  3L2V A;  3HFO A;  3MET A;  2CYZ B;  4OVA A;  2K5I A;  5GAN 4;  3P8D A;  3SD4 A;  4Z02 A;  5AYF A;  1WJS A;  3NTI A;  4C92 C;  4EMG A;  4N0A C;  5KE3 A;  3CCQ A;  5IN1 A;  1TH7 A;  2LNV A;  4OB0 B;  2K5L A;  3PGG A;  1YJN T;  4M7A G;  4F7U E;  4OMF B;  1K8A C;  4BE1 A;  2ZPG B;  3JCM W;  5LJ5 j;  5GAN j;  3CC2 A;  4D6W A;  2DD4 A;  4C0G A;  4FSX A;  3E19 A;  4M78 D;  1YIT T;  1YI2 T;  2LCC A;  2DAQ A;  3RES A;  4WF2 A;  2G3R A;  1RL2 A;  1WJR A;  5HK3 A;  3QJY A;  1Q86 U;  4QQG A;  3CBO A;  4PJO F;  5C0M A;  4QW2 A;  1K8A U;  3OW2 S;  2RK1 A;  3RMS A;  4QQ6 A;  4C8Q G;  4M77 D;  4XU0 A;  4XQ3 A;  4QVC A;  2CZ1 B;  3PMI A;  2RHX A;  4M7A B;  4A4K A;  4MZP A;  2E41 A;  2AHJ B;  2JTF A;  1S72 T;  1K73 C;  2EKO A;  4PJO D;  1I4K 1;  3TU4 K;  3CC4 A;  1Y7X A;  2X35 A;  1BI0 A;  3NTH A;  5CKD A;  4J83 A;  4IUQ A;  3OS1 A;  4M7D G;  2O4X B;  2JTM A;  3SFM A;  1UGQ B;  5FU6 B;  3V8L A;  1VUB A;  2KMT A;  4C8Q B;  2RI2 A;  3RIR A;  4O6J A;  2FYK A;  1QVG S;  5LJ5 h;  2ZPB B;  5GAN h;  4XTV A;  3HRU A;  4M78 C;  4QQD A;  3I55 A;  3CCE A;  1X75 C;  4N4H A;  1UGP B;  3M58 A;  2E6N A;  1VQ4 A;  1M1G A;  4A4H A;  1BKB A;  4PJO A;  3JCM g;  5CK9 A;  5GAO p;  2RHY A;  2E70 A;  5FRM A;  1JBM A;  3CCU T;  3OYC A;  4BI4 A;  1SSF A;  3BW1 A;  3OBW A;  2A3L A;  2XDB A;  4LDV A;  4M77 C;  3JB9 D;  3TRE A;  3L42 A;  4M75 F;  3V8J A;  3MEV A;  1WPY A;  2XDD A;  5DY9 A;  3CD6 T;  3X24 B;  2V8I A;  4C92 G;  3M4Y A;  1KD1 U;  3SWN A;  4PJO C;  3E1S A;  2ZPE B;  1BYM A;  2DTO A;  1OZ2 A;  2LX9 A;  4JRK A;  2HQE A;  1YHQ T;  3L1A A;  2E12 A;  4M75 D;  5CAI A;  1YIJ A;  2D6F A;  2F69 A;  2L89 A;  3C4S A;  3CEY A;  3T9N A;  3EFS A;  1Q81 C;  1VQ6 A;  3A8L B;  3VUZ A;  4DA4 A;  2HAX A;  4IUT A;  2DZ9 A;  2DJZ A;  4OB2 B;  3SWN C;  4ATO A;  1DJ7 B;  2Y90 A;  5LJ3 e;  1JB0 E;  3JAM E;  3CBM A;  1B34 B;  1U1S A;  4PKC C;  4QVZ A;  4C92 B;  2DZC A;  4N4G A;  1JJ2 A;  2XG8 D;  1NJI C;  2YHT A;  3P8B B;  4FT4 A;  5LJ3 g;  2EAY A;  3M56 A;  2ZPI B;  1D3B A;  2QDY B;  4EMK A;  3GF5 A;  3V7S A;  4M75 A;  4QVD A;  4PL6 A;  5CR2 A;  2PVO B;  2GFU A;  3CCL A;  5A0D A;  5DLQ E;  3G4S T;  1VQ5 T;  1Y96 A;  5LJ3 d;  4R56 A;  2EQJ A;  1KQS S;  1VQN T;  1PSE A;  3LLR A;  3R6O A;  3OYH A;  4DQ2 A;  3JCM X;  3LWI A;  3G71 T;  1IZ6 A;  3QZ9 B;  4A4F A;  3OS2 A;  3S3N A;  2JN0 A;  5FRN A;  2LRQ A;  1FWZ A;  4MDX A;  2E5Q A;  1Y07 A;  3HRT A;  3MP8 A;  4ZN1 A;  1O9S A;  2CZ7 B;  3N5B B;  1P92 A;  2JNG A;  2PVD B;  3DB3 A;  3HL8 A;  4LD6 A;  4M78 G;  5GAO r;  2XKO C;  3FEO A;  3VYG A;  2NLU A;  1EIF A;  2A7Y A;  3O8V A;  4XTZ A;  3CC7 A;  3CCS A;  1ZQ1 A;  1Q7Y C;  1VQ8 A;  3EAE A;  4RG2 A;  2OTL T;  1OZ3 A;  2XU8 A;  4X9C A;  2GFA A;  3OS5 A;  4LDW A;  5KCO A;  3CMA A;  3PFS A;  2KDS A;  5HY6 A;  3GIB A;  4F7U A;  3CCM A;  3GNG A;  4M77 G;  1M90 C;  5GAN 7;  4NL2 A;  1VQO A;  1I5L A;  5FU7 C;  2R5M A;  3DLL A;  3G6E A;  3PIP A;  2FB7 A;  1MHN A;  3KUF A;  4PJO G;  4BAC A;  4V2S A;  4MMK A;  2XHC A;  4M78 B;  4BD3 A;  5CCA A;  1Q82 U;  3ASK A;  2YLC A;  4PNO A;  4C5H A;  5HK0 A;  3JCM Q;  1QVF S;  3GNF B;  1M90 U;  2KK4 A;  3URG A;  5GAN 6;  5GAM h;  3OSS C;  3JCM c;  3F70 A;  1VQL T;  4MZM A;  2EWN A;  3OYB A;  4XU1 A;  4ZGE B;  1VQK A;  3FIF A;  4M77 B;  4JUV A;  1H3Z A;  1O75 A;  3WVE B;  2QA4 T;  2XD0 A;  4EDU A;  1XTD A;  3A5Z B;  3QBY A;  4JDS A;  2RJD A;  2WSE E;  4PJO B;  4C0F A;  2V8J A;  3S3O A;  4RKU E;  1WGS A;  3JCM V;  3FLG A;  3WVD B;  3VU3 C;  4J6X A;  2E65 A;  2MWO A;  3UT1 A;  4JRQ A;  5CKF A;  3HRS A;  2OTJ A;  4C0Z A;  4MML A;  3CCJ A;  2EJ9 A;  4C8Q E;  2ZPH B;  3SWN B;  5LJ5 f;  5GAN f;  4ME7 A;  5M9O A;  2K2V A;  5KE2 A;  3ZFJ A;  4R55 A;  3OYK A;  2RK2 A;  3HFN A;  1M5Q 1;  2DTH A;  4HT9 A;  3A8M B;  3TEE A;  5GMK i;  1WQW A;  2QQS A;  4ELY C;  4O5V A;  1BI1 A;  1UGS B;  4M7D E;  5GMK h;  3DB4 A;  1UB4 A;  3EFR A;  4JLG A;  2VYT A;  3M5A A;  2X4Y A;  3M9Q A;  4MDW A;  5J39 A;  3L2R A;  2QEX T;  3CME T;  1KC8 C;  3RKW A;  3FRN A;  2DTI A;  2E64 A;  1YJW A;  1VQ9 A;  2QQB A;  3MEA A;  3I56 A;  3HKS A;  3OBY A;  3QG1 A;  3FDR A;  3LYI A;  3CPW A;  1M8V A;  4Q5W A;  3J81 E;  3X28 B;  4M75 B;  1NPR A;  5FRO A;  5J26 A;  4YTL A;  2VGM A;  1K73 U;  1AHJ B;  1Y96 B;  2ZPF B;  3VUB A;  4A53 A;  2DXC A;  4C5E A;  3CCR T;  5A2Q E;  3UPU A;  4LDY A;  1KQS A;  5DLO A;  3JB9 H;  4Y28 E;  3JCM e;  1BI3 A;  2C06 A;  2CZ6 B;  4C92 E;  2K5F A;  1YJ9 T;  4XU3 A;  1LNX A;  3JRZ A;  4JRI A;  1W2B S;  4HCC A;  3VJP A;  4BB7 A;  4J8O A;  1KHI A;  3KXT A;  1YJN A;  1HK9 A;  1QP2 A;  3A8H B;  4KUI A;  5CQX A;  4CRI A;  2M16 A;  4XTU A;  5FU7 B;  2E10 A;  3MO8 A;  4BDY A;  2CS7 A;  2VXE A;  2H3J A;  4PLI A;  2F5K A;  4BDZ A;  3CXC S;  1YIT A;  1YI2 A;  3JCM d;  2HD0 A;  2FL7 A;  2RI5 A;  1VQ7 T;  2EQU A;  3ER0 A;  1I81 A;  3OYI A;  2RB6 A;  3X25 B;  3NFC A;  1KQ2 A;  3VV0 A;  2QQ9 A;  3MCA B;  5CVI A;  4IUP A;  2JVV A;  2VGN A;  3MHX A;  3M59 A;  3QJ6 A;  4E7I A;  5FLX E;  3PNW C;  4OF1 A;  3L2W A;  3FC3 A;  3VKI A;  3OYD A;  1QP3 A;  2E1H A;  4ZGD B;  3LGL A;  1S72 A;  4E7K A;  2MAM A;  4HCZ A;  1ZHI A;  3E9F A;  3M54 A;  3GPL A;  1G3S A;  4ZN3 A;  2EYQ A;  1QVF A;  3CCV T;  3OYM A;  1Q81 U;  4GY5 A;  2XID A;  1VQP T;  3RER A;  2IVW A;  2RJE A;  4F7U F;  3QYH B;  4C8Q F;  2EQK A;  4JS4 A;  3OYN A;  3LH0 A;  3OYY A;  3JCM h;  1N27 A;  1I8F A;  1JRI A;  4M78 E;  1G3Y A;  3JB9 G;  3QUI A;  1M4Z A;  3JCM P;  1NJI U;  4C8Q D;  2LT4 A;  5GAM j;  4JS5 A;  1M1K C;  5GAM f;  3BDL A;  5GAN 5;  5CKH A;  5HKC A;  4EMK C;  3OMG A;  3CCU A;  4M75 C;  2HQX A;  3TCJ A;  2EFI A;  4M7D F;  2DO3 A;  4M77 E;  2P0P A;  2RHI A;  1N9S A;  2O01 E;  5D6X A;  4FT2 A;  3OYA A;  1KHC A;  3CD6 A;  2RJC A;  3LGF A;  4L6V 5;  2ZGW A;  3M53 A;  1WNL A;  1VQM T;  1XOV A;  4M7D D;  2ZCF B;  1YCY A;  4KUL A;  3SB2 A;  1YHQ A;  3OB9 A;  3H8Z A;  5EG2 A;  3OW2 A;  4C8Q A;  2P4T A;  2KSS A;  2RH2 A;  2VUB A;  4OB1 B;  2VXF A;  4A4G A;  4VUB A;  1ZBX A;  2DKG A;  4J7F A;  2IG0 A;  2KY9 A;  5LJ3 h;  3CCQ T;  1Q7Y U;  4PLL A;  3JCM b;  3QZ5 B;  4JLI A;  4A4E A;  4C92 F;  3QDR B;  1G3W A;  3HHT B;  3ZEH A;  1OYX A;  4M7D A;  2L5Q A;  1W4S A;  2EIF A;  2CZ0 B;  3FJP A;  5GMK j;  3CC2 T;  2EQM A;  2B8A A;  2CGH A;  3RUX A;  4M7A E;  2PQW A;  3V7R A;  1QVG A;  3PT9 A;  1MGQ A;  3G4S A;  2K4Y A;  3MP1 A;  1VQ5 A;  2XK0 A;  4CI0 C;  1X01 A;  3X26 B;  2Y4Y A;  1VQN A;  4FL6 A;  4HKE A;  5CIU A;  3G71 A;  1NPP A;  3RMQ A;  2KVQ G;  2HBP A;  1WJQ A;  2BIV A;  3P8H A;  1WQ7 A;  3C12 A;  2M1H A;  3Q1J A;  5GAN 2;  3S3M A;  1V29 B;  2YLB A;  4IKF A;  2R58 A;  1BIB A;  3G7Z A;  4RMO A;  5DM7 R;  2F5T X;  3DLM A;  3FB9 A;  4J5Y A;  3CXC A;  5GAO l;  3CC4 T;  3S6W A;  2MMP A;  1B34 A;  3BDU A;  3X20 B;  2RHU A;  4C92 A;  1JJ2 S;  1VIF A;  1IRE B;  2DXT A;  1FX7 A;  4L5G A;  5D6Y A;  3VYH B;  4LDU A;  1KG1 A;  4DOV A;  4M75 G;  4KT0 E;  4XTY A;  3OYJ A;  5GAO n;  5LJ5 e;  2ZZD A;  4KBM B;  5GAN e;  5LL6 S;  3L2Q A;  3OS0 A;  3I55 T;  3CCE T;  1R8O B;  1NZ9 A;  1VQ4 T;  4M78 F;  1Q86 C;  1XNI A;  2V8K A;  3DKM A;  5LJ5 g;  4LD9 K;  5GAN g;  4II1 A;  1M1F A;  4XK8 E;  2RD1 A;  3QXE B;  3HP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...