4A54A

Structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MGMSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Edc3- and Scd6-Mediated Activation of the Dcp1:Dcp2 Mrna Decapping Complex.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein/hydrolase
molecule keywords EDC3
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2011-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a54A00
4J6YA 1BIBA 5GANd 3BY7A 3HFNA 5GAMd 3JB9I 4F7UB 1I5LA 3JB9H 4F7UE 5GMKm 2FB7A 1B34A 4C8QF 4EMHA 1H641 4M7AA 1WQ7A 1BIAA 1N9SA 4N0AC 4XTUA 4PJOB 1I81A 5LJ5e 4M7AG 2CGHA 4C8QC 3INZA 4M77D 5GANf 5GAOm 4C92F 4M7DD 2VC8A 4PJOF 3BW1A 5GMKh 4F7UA 5GAOq 4JLIA 3AHUA 4HT9A 4C8QE 5LJ3h 2EAYA 3EFSA 4C8QB 4QVCA 4M7DG 4M78G 4NL3A 3L2ZA 4F7UG 4JRIA 4XTZA 4M7AB 3JCMW 2FYKA 3QSUA 4M78C 4EMGA 2VXEA 3PGGA 2EJGA 2RM4A 4M77A 4XU1A 5GAN7 1KQ2A 4JUVA 2K57A 4XU0A 4PJOC 5CAIA 4C92C 3JB9G 2DKGA 4XTYA 5GAOr 1Y96A 4XTXA 4J5YA 5LJ5f 5GAN5 4J6WA 3FJPA 4NL2A 2I2LA 4DQ2A 3JCMV 2DTOA 4NOYA 3BFMA 4XTWA 3HSBA 4XU3A 4PJOE 2E65A 5GMKe 3V7CA 4HA8A 3JCMQ 2YHTA 3SWNB 3QO3A 4JRKA 1HK9A 3SWNC 5GMKi 1JRIA 3VU3C 3GIBA 2YLCA 5GAOp 3JCMh 2RD1A 3RUXA 3JCMe 5GAOn 1U1SA 4M77G 3V7SA 4RCBA 4XQ3A 1M5Q1 5I21A 4M7AD 4M7DE 4V2SA 4C92B 1U1TA 1WQWA 2EWNA 5GAMf 3JCMc 5GAN6 4M75B 3FB9A 3JB9D 4M7DC 3QUIA 4M77C 5LJ3f 2EJ9A 1HXDA 1D3BB 3EFRA 5GANg 5LJ5d 1B34B 5GMKj 4M77E 3JCMX 3JCMP 3JB9J 4M7AC 4X9CA 4PJOD 5LJ3d 4XTVA 4XU2A 5GANh 5GAOl 4MMKA 5GAMh 4M75F 3RKXA 1I4K1 1Y96B 2E1HA 3JCMb 4A54A 4C92G 3JCMd 4M7AF 2DZCA 2EJFA 3V8LA 5GAMj 2DTIA 4M78B 4RCCA 4M75G 5GAMg 2DEQA 4M78E 2VXFA 2Y90A 5GMKl 4EMKA 2DZ9A 2DXUA 2HNIA 4M77F 4M78F 3JCMg 4M7DB 3JB9F 1YCYA 4C92E 3SWNA 3M4GA 5GAMe 4EMKC 2ZGWA 4A53A 4QVDA 2QTXA 1TH7A 4M75E 3JCMf 4C8QD 1I8FA 4M78A 1WPYA 5GAN8 4MMLA 4J6XA 1N9RA 4EMKB 5GAN4 4M75C 1M8VA 4PJOG 4N0AA 4M77B 1KQ1A 2DXTA 3FIFA 1MGQA 3RIRA 4F7UF 4PJOA 1LNXA 4C92A 2DTHA 1D3BA 5GANe 2E41A 4M75A 2YLBA 4Y91A 4C8QG 3SB2A 2JN0A 2E64A 3RKWA 3JCMJ 1WNLA 1X01A 3HFOA 5GAN2 4WF2A 3V7RA 4C8QA 4M78D 3V8JA 5LJ3e 2RA2A 3RESA 5GANj 3RERA 3L1AA 4PNOA 5LJ5g 3RKYA 5DY9A 3V8KA 5LJ5j 1LOJA 5GAN3 4X9DA 2RB6A 4C92D 4M7DF 5LJ5h 3QHSA 5LJ3g 2E10A 4M75D 5LJ3j 4M7AE 4HT8A 2DVEA 4M7DA 3BDUA 4OP0A 2DJZA 1LJOA 1JBMA
chains in the Genus database with same CATH superfamily
5CVIA 3C0CA 2P84A 2K3XA 1E6HA 1ABQA 2O01E 4EMHA 3OW2A 4MZMA 4OMLA 4XTUA 4FU6A 2HQEA 4IURA 4PJLA 2CGHA 1KQSP 5GMKh 3OYNA 1YBYA 1Y07A 5LJ3h 1D0ZA 4FIBA 3OS0A 1RLQC 2HKQB 5CIUA 4DEYA 3JCMW 3PMTA 3HL8A 1Q82R 2VXEA 2ZAEA 4BUGA 1FWZA 2M51A 4XU1A 2CZ7B 2X4YA 2HKNA 1M3CA 1RI9A 4Q5WA 3PVQA 1M2OA 2YWWA 4M7AA 4ZN1A 4J6WA 1T0HA 3M0TA 1VQNA 5GMKe 3JCMQ 2YHTA 3CD6T 2CZ0B 3MHXA 2ED0A 5KYUA 4DOWA 3CD6Q 1M5Q1 3PTAA 3G7ZA 2EIFA 4C92B 1N6AA 4Y92A 1SHGA 3ER0A 2KBTA 1D3BB 4DEXA 5LJ3d 1OULA 2G6FX 3OS2A 2E70A 4L59A 2BUDA 2ED1A 2EYYA 1RL2A 3L42A 1JJ2S 3NFCA 1WPYA 3OYJA 1JEGA 2KI7A 1OPKA 1VQ7T 3VJPA 4PJOA 4QVZA 2M0YA 4WTOB 3SB2A 2BTTA 1SSFA 3PE0A 2LQWA 1FXXA 2RMOA 2CP2A 2HD0A 1NEBA 1C0MA 1VQ4A 1OEBA 3OS5A 2K79A 1ZUKA 3MEUA 4M75D 1MNDA 2KQWA 1BB9A 1C6VX 2VGMA 3JB9H 1VYTA 2EQIA 1I81A 1X2KA 2NLUA 2C0TA 1VQMA 5KYYB 3UWNA 3VRYA 3E9GA 3DB4A 3VUBA 2XDDA 1WGSA 2AKKA 2E6ZA 3NTHA 5A0DA 2L0AA 3VS5A 1IRXA 2K2MA 4BB7A 2LT4A 4DBHA 4Z88A 1X27A 4ZTFA 1KFZA 2P0PA 1Z9ZA 4IUUA 4ZGJB 3BDLA 4E7SA 1WX6A 2FL7A 1RAGB 4ME7A 4C92C 2OTJT 2QXFA 1VYUA 3QIIA 1CKBA 1T0JA 1JRIA 3NHNA 2LJ0A 2FZCB 3CCRQ 1U5SA 2CSQA 3CCRA 2JS2A 1HXDA 4QKUA 2QAZA 2FPFA 1B7TA 2RF0A 2ROLA 1VQOT 1YNZA 2JVVA 1I5OB 1EZZB 2XG8D 2XKOC 1OZ3A 2COZA 4BE2A 1R77A 1PNJA 3MP6A 4LDWA 2RPNA 4LUDA 4OMPA 1X69A 1H3ZA 4LXCA 2LP5A 2O88A 2MWOA 2D1XA 2YRVA 2ZPHB 1GL5A 2PVGB 2SRCA 3OYEA 1GCPA 2K4YA 4GBQA 3VS7A 4HCKA 4N0AA 1OPLA 4F7UF 2R5MA 4M75A 1AOJA 2CKKA 3J80E 1PRMC 1OZ2A 4OGCA 2LNVA 4M78D 1KD1U 2CH4A 1BYMA 4RKUE 2FPEA 4C92D 1FX7A 1RAHB 3OYBA 5LJ3j 2EQUA 3EHQA 1R0BG 4J83A 2O9VA 3CCVA 3FDRA 1QCFA 3J81E 4FCYA 4KULA 4C5IA 3OBWA 1JJ2P 1UJ0A 4C8QC 5GANf 2FRYA 2MMPA 1GFDA 3DLLA 2M16A 1VQ5T 3OYIA 4HXJA 3EHRA 4F7UG 3G1JA 3G71A 1D1AA 4BI4A 1VQ7Q 4EMGA 1S1NA 2IVWA 3OA6A 2JZ2A 2ZPBB 2I0NA 4XTWA 2ABLA 1VQPA 5IN1A 2XDPA 5FWBA 3HRUA 3O5ZA 3SWNC 2XD0A 1H92A 3V7SA 2K3BA 3G4SA 2JS0A 1YJNQ 1U1TA 2AZVA 4M75B 1M9SA 1KHIA 4LE9A 5GANg 2K5FA 3JB9J 3MCAB 2XIDA 1XOVA 4XU2A 3MKDA 5IH2A 2RQTA 3HRSA 2KVQG 4J9GA 1QKXA 1UJYA 2W0ZA 1YIJA 2DETA 4C92E 5GAMe 4Z8AA 2QTXA 1E7OA 1PCXA 4M78A 1KD1R 1ZBXA 3C95A 3LX7A 3A98A 4EMKB 2J6FA 2EGCA 1MGQA 3MJXA 1YJWQ 2YLBA 4PFOA 2DILA 2MOXA 4K11A 3CMET 2DVJA 4E7ZA 1M90U 1WJSA 5GAN3 6AT1B 5CR2A 1Y57A 3VS0A 2OJ2A 1N8RU 4IUTA 1BU1A 3S3MA 5CQXA 3UA7A 1NE8A 3CCEA 3CQTA 4F7UE 2FB7A 2EYZA 3IQLA 1UECA 5FU6B 1VQ6A 1OI1A 1ZSZB 2VVKA 1WXBA 2EQKA 1YJWA 2B86A 1VQ7A 4C5HA 3HKSA 1UGPB 2L3RA 5HK0A 2DL7A 3PGGA 4C0FA 1D09B 2RQVA 1X6OA 3P8DA 1MUZA 1MMDA 1G2BA 3LGLA 1RI0A 1K1ZA 2I2LA 3JCMV 4FYXB 2Z0WA 1JU5C 3NGPA 4BI8B 4BD3A 1X43A 4DBFA 1V29B 2LX9A 2DD4A 3JCMh 1M1GA 1K8AU 5CKEA 1MNEA 1WJQA 1ZUUA 3JCMc 1EFNA 1YP5A 4JS4A 1S72A 4M77C 1Z9QA 1I1JA 1AEYA 1W2BP 4PJOD 3G4ST 1SRMA 1YWPA 1J3TA 5GANh 3EFOA 2E6NA 4PLLA 2CUBA 3L2WA 5FLXE 4A54A 1YWOA 5GAMj 1BBZA 5GAMg 2SEMA 2BZYA 5GMKl 1W2BS 3LYIA 4JDSA 4J8OA 5I22A 1GBRA 2ZGWA 4A53A 3FJ5A 2DRMA 5A0LA 1YHQA 3G6ET 1QLYA 1V1CA 1M90R 1VQKQ 2KY9A 2F5KA 1Q86U 1YIJT 4J9IA 3QKJA 4AT1B 1N8RR 1PWTA 1IGQA 2DX1A 1HSQA 1X01A 1B07A 1KD1C 1TSFA 2RB6A 4M7DF 2DAQA 1WHMA 1MV0B 2O4XA 1OOTA 3QZ9B 3BY7A 1JB0E 2DIGA 4KGXB 3GP8A 3JAME 3H0HA 5A2QE 2GQIA 3INZA 2V1QA 3CCUQ 1NYFA 3EFSA 1U8RA 1U06A 2E5KA 4L6V5 4M78G 5CKFA 3TCJA 1QVGA 4GLKA 4KUIA 1RLPC 2ROTA 2OTLA 4M78C 3L2UA 1ZUYA 1VQ9Q 2EJGA 1QWEA 1VQ9T 3OMGA 1VQNQ 2DL3A 3BFMA 4XU3A 2EQMA 2OX7A 1MMNA 4LDYA 2HQHA 1I07A 1HK9A 2JUFA 2COYA 3CEYA 1JJ2A 1G5VA 4JZ3A 3M55A 1S72Q 5I21A 4B9WA 4P5NA 4MZPA 4FM4B 2EWNA 4F17A 2CP3A 5GAN6 1TUDA 3I55T 2KAFA 1RAIB 3JCMX 3M56A 1D1BA 1PSFA 1PRLC 1RAFB 3M5AA 2KSSA 2CSIA 3OSVA 2JTFA 1NJIR 1C1AA 4ZNXA 1D0YA 4OMFB 4RTYA 2VXFA 2ZPGB 2XDBA 1QMCA 4LDUA 3E2UA 4M78F 1YHQQ 2RN8A 2QQSA 1G3WA 4GLMA 1UHFA 2RNAA 2LCCA 4Y91A 5C0MA 5KYYA 4II1A 4AG2C 2RJDA 1VQPT 2QGGA 2YXYA 1T3LA 1FMVA 3U23A 5LJ5j 1KQSS 1TU0B 3MP8A 1Y71A 4OP0A 1RADB 1WHGA 1ZA1B 5J3BA 5GAMd 5LL6S 4RTVA 1GCQA 4CC7A 4M7AG 2LQ8A 5EG2A 4B9XA 3CCSQ 3A8GB 2A3LA 4E7IA 1VQ9A 3VRZA 1Q7YR 1VQKT 2FYKA 4E7KA 4OGEA 3LH5A 3I56T 1BCMA 2H3EB 2XMFA 1K9MC 4BY6C 2CP6A 2E65A 4HA8A 1UGQB 4HVVA 4JRQA 4IUPA 2MYSA 1H8KA 3SHWA 2DXCA 2RD1A 3RUXA 2LJ3A 3PMIA 3META 1NG2A 2JM8A 3R6NA 1ZA2B 2CZ1B 3CXCA 3M0UA 3PVLA 4M4ZA 4OVAA 2YSQA 1IO6A 2DE0X 2XI9A 4BACA 2VYTA 1G3SA 2K5IA 4M75F 5D6YA 1I4K1 3OW2S 3RBBB 4PFZA 1VQ6Q 4C92G 4M7AF 3HHTB 2MAMA 2DRKA 4IIMA 3P8HA 1W70A 3NTIA 4M78E 3CCQA 1IZ6A 2VB6A 2EPDA 3CMAQ 4JJBA 4M7DB 3TSZA 1M27C 3SWNA 2QG9B 4C8QD 4J9HA 2CZ6B 4M75C 2YDLA 3CBOA 1SKUB 3SEMA 2CYZB 5FU7B 4F04B 1W2BA 1TTHB 4ZN3A 3RKWA 2OTJQ 3V8KA 5J26A 1Q86R 3OYHA 1WZOA 3QHSA 3A8LB 2DFUA 2EGAA 2JNGA 1BIBA 1Q82U 3CMAA 2QDLA 2QQBA 3CCLQ 5CK9A 3FEOA 3LWHA 1Q7YU 1WQ7A 4XAXB 3EFOB 4OMMA 1M3BA 3EGXA 4C92F 1YHQT 4JLIA 4A63B 3CC7T 2LCSA 1Q81U 2EGEA 4RTWA 4KH0B 2CP5A 2DD5A 4JJDA 2MF2A 1VQPQ 1YI2Q 4NL2A 2QA4A 2HZYA 2M0OA 2KRMA 2JMAA 4MDWA 1ZSZC 3QO3A 3SWNB 1UGSB 4KH1B 4OMOA 3I5RA 3QBYA 2KT8A 1QVGS 4RG2A 3D7SB 4ORZA 1TUCA 5LJ5d 4IKFA 1OX8A 3RMQA 1G3YA 1NM7A 3UDCA 5M9OA 4O5VA 3OY9A 2KMTA 2ZCFB 3EG2A 4CC4B 4C0DB 2DK3A 2DZCA 2LQKA 2VASA 2KROA 5IHKA 3JCMg 1AWJA 1Q81C 4J7IA 1F1BB 1M8VA 4M77B 2RK1A 4L5GA 3SFMA 2FO0A 2QGFB 4KRTA 2BE7D 5KE2A 2BZ8A 2RHXA 4FSXA 4Z02A 5IXFA 2NUZA 1NPPA 3REBB 5L8RE 5GANj 2QQRA 3RERA 2JW4A 1PKSA 2VKNA 3CC4A 3EGDA 5LJ5h 2BKDN 1X75C 4FW2A 5IHIA 2DLPA 2FG0A 4J6YA 5GJVB 5GANd 3VS6A 1UEBA 4MZTA 1B3QA 3OBYA 1H641 1YFNA 1N9SA 2R57A 2DMOA 5LJ5e 4LN2A 1QW1A 4M77D 4OB1B 3REAB 3UF4A 1X6BA 1QKWA 4C8QE 2ECZA 2QEXQ 4M7DG 4NL3A 2HL3A 1Q82C 1KG1A 2C0IA 3CCJA 2K57A 4RTTA 5D6WA 3G71T 3JB9G 2LCLA 2DKGA 4PJOE 2M02A 1FMKA 3FJPA 3QYGB 2K5LA 3VV0A 3ULRB 1WXUA 1NPRA 2DYIA 2JJ9A 2QDYB 4HCZA 2COWA 1U3OA 4OMNA 1O75A 3X28B 2K6DA 2WSEE 5FRMA 2KYBA 1FMWA 3CCRT 1KK7A 2PVDB 2OAUA 3KXTA 1YI2A 1AHJB 4FT2A 5GAMh 1Y96B 2LX7A 1MHNA 2MPXC 3GNFB 2X51A 2EQJA 3VYHB 2Y90A 2DZ9A 2JT4A 1SHFA 5KCHA 2A0FB 2YUQA 2O4XB 1PM3A 4CI0C 1UG1A 3C4SA 1YI2T 1QP3A 2YRDA 1RABB 3CCVT 2HL5C 5FROA 4DBRA 1PG5B 4C8QA 3CCVQ 2LMJA 3L1AA 5LJ5g 4BE0A 3EAEA 1SPKA 1K73R 2XICA 1MMGA 2HBPA 2F5TX 1JBMA 1I8FA 2PTKA 1SG5A 1KC8C 2YUPA 3LH0A 4KT0E 3WVDB 1EX4A 2RJFA 3KBGA 1ACMB 2MWPA 4QT7A 4F16A 4JLGA 2VC8A 4KGZB 3L2ZA 4JRIA 2FVUA 4E7LA 2RHYA 3L2VA 1GRIA 4JZ4A 2FPDA 2KEAA 2EYXA 1N27A 2V8IA 1AD5A 4XTYA 3RNJA 1Q81R 2Y4YA 3UT1A 5CKBA 5KYWA 1YJ9Q 2IPOB 3SDZA 1M2VB 1HD3A 5GAOn 4RTUA 5GJWB 2EBPA 5GAMf 1Q86C 4M7DC 4CRIA 5LJ3f 3PIPA 3EFRA 1YJNT 5GMKj 1AWXA 2D6FA 1A0NB 4N4GA 4MMKA 3UATA 1OQKA 5IHNA 1QQJA 2E1HA 2QQ9A 2WSCE 2X4JA 1ZSZA 5I11A 3JCMb 4DOVA 4ATOA 2DEQA 1SF9A 1P92A 1FYNA 1M8MA 3LGFA 3DB3A 4EMKC 4ZTJA 2NUPB 1QVFA 1TH7A 4M75E 3JCMf 3G71Q 2YUNA 2D8HA 4QW2A 1N9RA 2BE9B 2DXTA 1H3HA 3OYKA 1WXTA 1KJWA 3CC2A 3Q1JA 3DKMA 2CP0A 1UGRB 1WIEA 3CC2Q 2QA4Q 3V7RA 2EW3A 5AT1B 1KC8U 3RESA 2QA4T 5DY9A 2KDSA 4X9DA 1BI2A 3CMEQ 1ARKA 4ELYC 4HT8A 3PIOA 4PJOG 5CQYA 3M0RA 2VUBA 3QDRB 3TQ7P 2H8HA 1LVKA 7AT1B 4FYVB 4FYYB 3CPWP 5GAOm 4J9DA 2LTOA 5GAOq 4E6RA 4EPCA 2RHUA 1ZHIA 3M58A 2OTLQ 3OYGA 1K0SA 4JPBW 2PVOB 2JOYA 3M53A 5GAN7 4M77A 2H3JA 1G83A 4C5EA 4ESRA 5CAIA 2K7AA 3CCMA 3CCMT 4DQ2A 4O6JA 4R0KA 4ZGDB 3C12A 4JRKA 2X3XD 2A7YA 3QYHB 4M77G 4V2SA 3A8OB 3CC4Q 4E2FB 1Q7YC 3QDFA 1IGUA 3M0PA 3CC4T 2NUTA 1I0CA 4BDYA 1RAEB 2GF7A 3OYCA 4R55A 4IUVA 3OYLA 1Y0MA 3V8LA 4QQ6A 3GLXA 4LUEA 3MP1A 1W6XA 2F2WA 2GBQA 1YITA 2KGTA 4QVDA 3CCST 2DIQA 3OMCA 1OU8A 3CCSA 4JJNK 1K9AA 1VQ8Q 1WLPB 1VQ4Q 3I35A 2KK4A 1E6GA 2GFUA 3RIRA 1LNXA 3G6EQ 4AFSC 2OTJA 1VQ8T 3M57A 1VQ4T 3L2RA 1OYXA 2E64A 5HKCA 1WHJA 3QJYA 4RG8A 4C0ZA 3RKYA 4UC4A 5LJ3g 4LNPA 2FZKB 4M7DA 2KXDA 3QWYA 1LJOA 2JM9A 2R58A 3AT1B 4E7HA 1AZGB 5I2MA 2RJCA 1WHKA 2PNIA 3LLRA 1K73U 1RAAB 1QCOA 1GBQA 3BW1A 4FW1A 4N4HA 2DYBA 1VOMA 3ZL7C 2O2OA 1VQ6T 3CMEA 4M7AB 1BKBA 2L3SA 1Y7XA 3GNGA 2ZZDA 4XU0A 5A0GA 3EH2A 4PJNA 4HVUA 3CC2T 4PJOC 4X34A 5IT9E 1AZEA 2DTOA 3X25B 4LDVA 1NYGA 2ENMA 2YUOA 1VQNT 1NJIU 5CO7A 1DJ7B 2E5QA 3GIBA 2KR3A 3M54A 3A5ZB 1G3TA 1WQWA 1UFFA 1OX9A 1ZSGA 1BI1A 2V26A 4J9EA 1N5ZA 2LT1A 3VUZA 4RMOA 3PT9A 1UE9A 5KE3A 1IB8A 3RR6A 1NBEB 4TVRA 4X9CA 4M7AC 4MDXA 8ATCB 2WSFE 4AFZC 1HYOA 3M0QA 3CCLT 4ANJA 3KUFA 2OTLT 4FT4A 2L8DA 2V1RA 2E3HA 1YCYA 2L3PA 5KH6A 2K9GA 4CC2A 3ZFJA 1D0XA 3I55A 4VUBA 3EGUA 1K9MR 3URGA 4MMLA 2YT6A 3M4YA 3HRTA 3UPUA 3E9FA 4OB0B 3X24B 3FC3A 2DTHA 2QTVA 2RQRA 2KE9A 2QYZA 2CREA 2HDAA 3H8ZA 1YCSB 2JXBA 3L2QA 2QQAA 1WNLA 2F1LA 4WF2A 5LJ3e 2BIVA 1PHTA 3I9QA 4KBMB 2RQUA 1EIFA 2P4RA 3OYFA 1YITQ 5D7UA 2DM1A 4E47A 5GAOr 1YITT 3QJ6A 2X9HA 1IXDA 5KYNA 1I5LA 1BIAA 3LW5E 1VQ5A 1GFCA 1V76A 5KYXB 2F2VA 1WHHA 2KNBB 1VQOA 3E1SA 4XTZA 2NUPA 2JMCA 2DPPB 3CC7A 1R8OB 2OAWA 1NLOC 4BY6B 1VQMQ 5HK3A 1TOVA 4XTXA 1Y96A 3I56Q 2CH4W 4Z89A 3X20B 4JRPA 2OI3A 2XK0A 2EKHA 3EH1A 2B8AA 3TEEA 1QCNA 5FWCA 5GMKi 2PU9B 2YLCA 2ESWA 1VIEA 3H41A 1BI3A 2RK2A 1WYXA 4RCBA 2A37A 2CP7A 2DXBA 3P8BB 4GY5A 1VQOQ 2D9TA 3CD6A 3GPLA 3OYMA 2EJ9A 3QG1A 3CPFA 2HBWA 2R5AA 5FW9A 4RTZA 4J9CA 3EG3A 1K9MU 5DM7R 2DTIA 3NPFA 2X35A 1M30A 2HQXA 4OB3B 1KC8R 1UUEA 2RO0A 2CS7A 4HVWA 1TUGB 4D6WA 1K73C 3JB9F 2RQWA 1PKTA 1QVPA 4J6XA 1TXQA 4PL6A 3EG0A 3H0IA 5KYXA 3ZEHA 5GANe 2E41A 3F70A 2GFAA 3N5BB 1IHVA 2EYWA 3HFOA 3M59A 1PC0A 5C6SA 2O9SA 3VS3A 3CCLA 3OW2P 3NMZC 4RTXA 4ZGEB 2AKLA 2A28A 1M1KC 3M9QA 2CT4A 4FSSA 4M7AE 2KRNA 3M0SA 2O31A 4WCIA 1AT1B 2GCXA 3OSSC 1B34A 2DERA 1JQQA 1YJ9A 2DBMA 4HCCA 3VS2A 2MI6A 1M1FA 2FHDA 2MK5A 1M2VA 4M7DD 4AFUC 3AHUA 3RMSA 4F7UA 3CCJQ 1O9SA 2CDTA 3CBMA 4C8QB 2WACA 3CCJT 4D8KA 3OYAA 4C0GA 3CC7Q 4B6MA 2HMAA 1M1KU 5AYFA 3TREA 1ZBJA 2VWFA 1GXIE 4N4IA 4J5YA 3G6EA 1ZLMA 3A8HB 4OF1A 2PUOB 5HY6A 5CCAA 1NLPC 3VU3C 1ZX6A 3FRNA 4XQ3A 2DA9A 3QXEB 2AZSA 2LJ1A 3EG9B 1WHLA 2AT1B 3FB9A 2X4XA 1UHCA 2LVMA 1WJRA 4M77E 5CKDA 3JCMP 2L2PA 2P0QA 1TS9A 4C0DC 1NZ9A 2F2XA 1WFWA 4M78B 4RCCA 1M4ZA 4Y28E 4EMKA 1PD1A 4M77F 3VS1A 5KYWB 2NWMA 4LD9K 5KCOA 4X1VA 1BCOA 4PJJA 1VUBA 1MV3A 4EIKA 1X6GA 3KFVA 2DO3A 1QVGP 1VQLQ 1M3AA 1D3BA 3MEWA 1W1FA 1VQLA 1VQLT 1R0CB 3PNWC 1BI0A 2E12A 1AVZC 2MIOA 2EKOA 1BK2A 1YJ9T 2DNUA 2LDMA 3BDUA 3X26B 3JB9I 2QEXA 2JTEA 3QPHA 5GMKm 4LD6A 1XQHA 3CCQT 1JXMA 4N0AC 3OB9A 2KRSA 4PJOB 4KGVB 2QK0A 5FU6C 4BI3A 4PK4A 4PJOF 2C0OA 2X3WD 2M1HA 2XHCA 4QVCA 1D1CA 1TWBA 4E7JA 1KQSA 1UTIA 2QEXT 2NUTB 1HJDA 3T9NA 1RACB 4AFQC 1OV3A 2ZPEB 2HEQA 8AT1B 5LJ5f 5GAN5 2LNHB 4R56A 2DF6A 3WVEB 2J06A 1UGVA 2A36A 1VQ8A 2LQNA 2EVRA 3EGXB 1YN8A 1LPLA 3VS4A 3A1PA 3G4SQ 2C06A 1PSEA 1UDLA 1IREB 2P4TA 5GAOl 2QI2A 1KHCA 2XU8A 3ME9A 4J7FA 1VQ5Q 3JCMd 3A8MB 2EFIA 4CC3A 4JJCA 2D0QB 1QVFS 1K8AR 1NEGA 2E3IA 2RI3A 5IAYA 3HPWA 3JSCA 2AIRB 2GGRA 1YIJQ 2HCKA 2HAXA 1TG0A 5GAN4 1QVFP 4A4KA 2GQVA 4EDUA 2GNCA 2L89A 1K76A 3OYDA 2W10A 3I56A 2JN0A 4FYWB 5GAN2 1JXOA 4HKEA 3CCMQ 3V8JA 4A4EA 3MEAA 3I5SA 5KYUB 3CCET 2DBKA 1LOJA 2FEIA 5EC7A 2M9UA 2DJZA 2KXCA 1G8XA 2CUDA 3HFNA 2D8JA 4NS5A 1SRLA 3VYGA 4F7UB 4PFPA 2X4WA 4C8QF 3THKA 1IHWA 2RHZA 3CCUT 1NJIC 3QZ5B 2ATCB 3DLMA 4KUDK 4HCBA 2D0NA 2EAYA 4XK8E 3GOXA 3UA6A 4J9BA 5IXBA 1QP2A 4LDXA 1XTDA 1N8RC 3E19A 1WA7A 1YJWT 2RM4A 1KQ2A 3CCUA 2K2VA 1QWFA 3H0FA 2L5QA 2E4HA 5CKHA 3GBQA 2RI5A 2RJEA 3OQ5A 9ATCB 1M1KR 3CPWA 2DL5A 1K8AC 1VYVA 2EYQA 2JTMA 3EG9A 1S72T 5J39A 4D8DA 3JCMe 1JO8A 1U1SA 2G3RA 3EG1A 3CXCS 2AHJB 3JB9D 2P0KA 2FRWA 3CCQQ 4IIOA 1B34B 3FLGA 1K4US 2KT1A 2RHIA 2HSEB 3R6OA 5ECAA 2FZGB 1X2QA 2IG0A 2J05A 4YTLA 3RKXA 4DA4A 3QWXX 2V8KA 2VGNA 2EJFA 4PJMA 2F69A 3C94A 4M75G 2PUKB 4AG1C 2DXUA 3TVTA 2RH2A 3M4GA 2YRCA 2RI2A 2J7IA 3HTRA 4A4GA 2LRQA 4FL6A 3FIFA 2ZPFB 2J6OA 4RUGA 3H6ZA 3MPUB 4PKCC 4C8QG 5DLQE 3TU4K 1LCKA 1ABOA 2PQWA 1KIKA 1M90C 2IIMA 5L23A 1AWOA 4OB2B 1K0XA 3SD4A 1ZQ1A 2E10A 2DVEA 3OS1A 1Q95G 2NYSA 4OMQA 3S3OA 3MO8A 2V8JA 1W4SA 3VKIA 4A4FA 2K3YA 4J9FA 5FRNA 1MMAA 3OYYA 5I2SA 4AMCA 1VA7A 4HT9A 1AWWA 2AK5A 3BE3A 2Y4XA 1VQKA 1T3SA 3WXMB 3QSUA 3S3NA 2ZPIB 3LWIA 1WI7A 2DL4A 1UB4A 4JS5A 4JUVA 4BE1A 3CBPA 1GCQC 2BZXA 3HSBA 3H9NA 2CT3A 4NOYA 3RDVA 1PD0A 3CCEQ 3V7CA 2L3QA 1SSHA 3CPWS 5GAOp 2DEUA 3S6WA 4M7AD 2A08A 3JRZA 4M7DE 3NTKA 4PLIA 1KSWA 1RUWA 2LC4A 3QUIA 3ASKA 4DBQA 4IUQA 2J6KA 3MEVA 4XTVA 2KYMA 5HCKA 4A4HA 3EGDB 3CMAT 1XJWB 3O8VA 3JV3A 1VIFA 2HNIA 1WDXA 2GTJA 3GF5A 1XNIA 1CSKA 5D6XA 2VV5A 2LZ6B 4ELZC 4QQGA 2MCNA 1OU9A 1CKAA 2DJQA 4QQDA 4C5GA 5GAN8 3J7AF 2GTOA 2QASA 1KQ1A 4C92A 1VQMT 3CXCP 3JCMJ 5DLOA 5FU7C 2HSPA 1SEMA 2RA2A 3HP9A 3TSWA 2DL8A 4PNOA 3ZBDA 3PFSA 1YJNA 3I55Q 2PZ1A 4F14A 4BDZA
chains in the Genus database with same CATH topology
5CVIA 3QZ9B 1KC8C 3BY7A 2K3XA 3LH0A 1JB0E 4KT0E 3WVDB 2DIGA 2GCXA 2O01E 3OSSC 3GP8A 3JAME 1B34A 4EMHA 2RJFA 5A2QE 3OW2A 3KBGA 1YJ9A 4MZMA 2MWPA 4XTUA 4HCCA 4FU6A 2HQEA 2MI6A 4IURA 1M1FA 2CGHA 2FHDA 3INZA 4JLGA 4M7DD 2VC8A 5GMKh 3OYNA 3RMSA 4F7UA 3AHUA 1YBYA 1O9SA 1Y07A 5LJ3h 3EFSA 1U8RA 4C8QB 3CBMA 4FIBA 4L6V5 2WACA 3L2ZA 4M78G 5CKFA 3TCJA 5CIUA 4JRIA 3OS0A 1QVGA 2FVUA 4GLKA 3CCJT 3OYAA 4C0GA 4E7LA 3JCMW 1M1KU 4KUIA 2RHYA 5AYFA 3PMTA 3L2VA 2OTLA 4M78C 3HL8A 3L2UA 2VXEA 4BUGA 1FWZA 2EJGA 4XU1A 3TREA 2CZ7B 1GXIE 2X4YA 1N27A 2V8IA 1VQ9T 4Q5WA 3OMGA 4XTYA 4M7AA 4N4IA 4J5YA 4ZN1A 4J6WA 3G6EA 3BFMA 4XU3A 2EQMA 2Y4YA 3UT1A 1VQNA 4LDYA 5GMKe 3A8HB 4OF1A 3JCMQ 2YHTA 3CD6T 2CZ0B 2PUOB 3MHXA 5CKBA 5HY6A 1HK9A 2JUFA 3CEYA 5CCAA 1JJ2A 1G5VA 3SDZA 3VU3C 4DOWA 5GAOn 3M55A 3FRNA 4XQ3A 1M5Q1 4B9WA 5I21A 3PTAA 4P5NA 3G7ZA 2EIFA 4MZPA 4C92B 3QXEB 4FM4B 1N6AA 2EWNA 5GAMf 4BDZA 5GAN6 1Q86C 3FB9A 4M7DC 4CRIA 5LJ3f 2X4XA 3ER0A 2LVMA 3PIPA 1D3BB 3EFRA 2KAFA 3I55T 1YJNT 1WJRA 5GMKj 4M77E 5CKDA 3JCMX 2P0QA 3JCMP 3M56A 4C0DC 1NZ9A 2D6FA 5LJ3d 1PSFA 4N4GA 4MMKA 3M5AA 2KSSA 3OS2A 3OSVA 2E1HA 2E70A 2JTFA 2X4JA 2QQ9A 2WSCE 4L59A 3JCMb 2BUDA 4DOVA 4M78B 4RCCA 4ATOA 1M4ZA 2DEQA 4OMFB 4Y28E 2ZPGB 2VXFA 2XDBA 4EMKA 1RL2A 4M77F 1P92A 3L42A 4LDUA 4M78F 4LD9K 5KCOA 3LGFA 3DB3A 4EMKC 4ZTJA 1JJ2S 3NFCA 1QVFA 1TH7A 2QQSA 4M75E 3JCMf 1G3WA 1VUBA 1WPYA 4QW2A 3OYJA 1N9RA 2DO3A 1VQ7T 2DXTA 3VJPA 4PJOA 3OYKA 2LCCA 4QVZA 1D3BA 3Q1JA 3CC2A 4Y91A 3SB2A 3MEWA 5C0MA 3DKMA 1VQLA 1SSFA 1UGRB 4II1A 1FXXA 1VQLT 2RJDA 2HD0A 3V7RA 1VQPT 1KC8U 3PNWC 1BI0A 2E12A 3RESA 1VQ4A 2QA4T 2EKOA 5DY9A 5LJ5j 1KQSS 2KDSA 3MP8A 3OS5A 4X9DA 1BI2A 1YJ9T 3MEUA 4M75D 4ELYC 2LDMA 4HT8A 1Y71A 3BDUA 4OP0A 2KQWA 3PIOA 4PJOG 5CQYA 3X26B 5J3BA 2VUBA 3JB9I 2VGMA 5GAMd 5LL6S 3QDRB 2QEXA 3JB9H 3QPHA 5GMKm 4LD6A 1XQHA 3CCQT 4N0AC 3OB9A 4PJOB 1I81A 2NLUA 4M7AG 5GAOm 5FU6C 1VQMA 4BI3A 2LTOA 4PJOF 5GAOq 2LQ8A 3UWNA 2M1HA 2XHCA 3E9GA 5EG2A 4EPCA 4B9XA 4QVCA 3DB4A 2RHUA 3VUBA 1ZHIA 1WGSA 3A8GB 3M58A 2A3LA 2XDDA 3OYGA 4E7JA 4E7IA 1VQ9A 2E6ZA 3NTHA 5A0DA 1VQKT 4BB7A 2FYKA 2LT4A 4E7KA 2QEXT 2PVOB 1KQSA 4OGEA 4ZTFA 2JOYA 2P0PA 3M53A 4IUUA 3T9NA 3BDLA 4M77A 2H3JA 4ZGJB 5GAN7 3I56T 4C5EA 2FL7A 5CAIA 2ZPEB 4ME7A 4C92C 1K9MC 2OTJT 3CCMA 2QXFA 4BY6C 5LJ5f 5GAN5 4DQ2A 3CCMT 4O6JA 4ZGDB 2E65A 3QIIA 4R56A 4HA8A 3C12A 4JRKA 1UGQB 4JRQA 4IUPA 3WVEB 1JRIA 2DXCA 2RD1A 3RUXA 1VQ8A 2A7YA 3QYHB 4M77G 3PMIA 3META 4V2SA 3A8OB 1Q7YC 2CZ1B 3CXCA 3CCRA 1HXDA 3CC4T 4OVAA 2C06A 1VQOT 4BDYA 2XI9A 4BACA 2VYTA 2GF7A 1G3SA 1PSEA 2JVVA 3OYCA 1IREB 2P4TA 4IUVA 2QI2A 1KHCA 2XU8A 2XG8D 2K5IA 2XKOC 3ME9A 4J7FA 4M75F 1I4K1 1OZ3A 5D6YA 3OW2S 3OYLA 4M7AF 4C92G 3JCMd 3A8MB 3HHTB 3V8LA 2MAMA 4QQ6A 4BE2A 2EFIA 3P8HA 3GLXA 3NTIA 4M78E 3CCQA 3MP6A 4LDWA 1IZ6A 2D0QB 1QVFS 1H3ZA 3MP1A 4M7DB 1YITA 3SWNA 2MWOA 2RI3A 2YRVA 2ZPHB 4QVDA 5IAYA 3HPWA 2PVGB 3JSCA 3OYEA 3CCST 2DIQA 3OMCA 4C8QD 3CCSA 2K4YA 2HAXA 4JJNK 5GAN4 2CZ6B 4M75C 2KK4A 4N0AA 2GFUA 4F7UF 3RIRA 3CBOA 4A4KA 2GQVA 4EDUA 1LNXA 2L89A 2CYZB 2R5MA 5FU7B 2OTJA 1VQ8T 3M57A 4M75A 1VQ4T 3OYDA 3L2RA 1OYXA 2CKKA 1W2BA 3J80E 3I56A 2JN0A 1OZ2A 2E64A 3RKWA 4ZN3A 4OGCA 5HKCA 2LNVA 5GAN2 4HKEA 4M78D 3V8JA 3QJYA 4A4EA 1KD1U 3MEAA 4RG8A 4C0ZA 1BYMA 3RKYA 3V8KA 3CCET 1LOJA 4UC4A 5J26A 4RKUE 4C92D 3OYHA 1FX7A 3QHSA 3A8LB 5LJ3g 3OYBA 5LJ3j 2EQUA 2M9UA 2JNGA 4M7DA 2DJZA 1LJOA 4J83A 1BIBA 1Q82U 3CMAA 2R58A 3HFNA 4NS5A 3VYGA 4F7UB 4E7HA 2QQBA 3CCVA 3FDRA 5CK9A 3J81E 2X4WA 4C8QF 3FEOA 5I2MA 2RHZA 2RJCA 3LWHA 1WQ7A 4XAXB 3CCUT 1Q7YU 3QZ5B 1NJIC 3DLMA 4KULA 4C5IA 4M7AC 3OBWA 4KUDK 3LLRA 4C8QC 1K73U 5GANf 4C92F 4HCBA 3BW1A 2MMPA 4N4HA 1YHQT 4JLIA 3CC7T 3DLLA 2M16A 2EAYA 4XK8E 3GOXA 1VQ5T 1VQ6T 3OYIA 4F7UG 3CMEA 1QP2A 1Q81U 4LDXA 4M7AB 3G71A 4BI4A 1BKBA 1XTDA 1N8RC 4EMGA 1Y7XA 3E19A 2ZZDA 3GNGA 2DD5A 2RM4A 1YJWT 1KQ2A 3CCUA 2K2VA 2IVWA 4XU0A 5A0GA 4PJOC 3OA6A 3CC2T 2MF2A 2L5QA 2JZ2A 5CKHA 4X34A 2ZPBB 2RI5A 5IT9E 4NL2A 2QA4A 2RJEA 2DTOA 4XTWA 2M0OA 3X25B 3OQ5A 4LDVA 3CPWA 1VQPA 1K8AC 1VQNT 5IN1A 2XDPA 4MDWA 3QO3A 3SWNB 1NJIU 1UGSB 2EYQA 2JTMA 3HRUA 1S72T 5CO7A 1DJ7B 2E5QA 3SWNC 3GIBA 5J39A 3QBYA 3JCMe 2XD0A 3M54A 1U1SA 3V7SA 2G3RA 3A5ZB 3CXCS 2AHJB 3G4SA 1G3TA 1U1TA 1WQWA 4M75B 1QVGS 3JB9D 1M9SA 1BI1A 4RG2A 2P0KA 1KHIA 2LT1A 3VUZA 4RMOA 5GANg 3PT9A 1B34B 3FLGA 5LJ5d 4IKFA 3RMQA 5KE3A 1G3YA 2K5FA 2RHIA 3MCAB 2XIDA 4TVRA 1XOVA 4X9CA 3R6OA 3UDCA 5M9OA 4MDXA 2WSFE 4O5VA 4XU2A 3OY9A 2ZCFB 2KMTA 2IG0A 3CCLT 4YTLA 3RKXA 4C0DB 4DA4A 2DK3A 2V8KA 2VGNA 2DZCA 2EJFA 3KUFA 2OTLT 3HRSA 2F69A 2KVQG 3C94A 4M75G 2LQKA 2PUKB 4FT4A 2DXUA 2L8DA 3JCMg 1YIJA 2RH2A 1YCYA 1Q81C 4C92E 5GAMe 3M4GA 5KH6A 3ZFJA 2RI2A 4J7IA 2QTXA 4R55A 3I55A 4VUBA 4M78A 4A4GA 1ZBXA 3C95A 3LX7A 4MMLA 3URGA 1M8VA 4EMKB 2LRQA 3M4YA 2RK1A 3HRTA 4FL6A 4M77B 3FIFA 1MGQA 2ZPFB 4L5GA 3E9FA 4OB0B 3SFMA 3X24B 3FC3A 3UPUA 2DTHA 3H6ZA 4PKCC 2YLBA 4C8QG 3H8ZA 5KE2A 3L2QA 2QQAA 5DLQE 5GAOl 1WNLA 3TU4K 2RHXA 4FSXA 4WF2A 4Z02A 1NPPA 2BIVA 2PQWA 5LJ3e 5L8RE 3CMET 2QQRA 5GANj 1M90C 1M90U 3RERA 1WJSA 5GAN3 4OB2B 4KBMB 1EIFA 3OYFA 3CC4A 5LJ5h 3SD4A 2BKDN 5CR2A 1ZQ1A 2E10A 1X75C 1N8RU 4IUTA 3S3MA 4E47A 2DVEA 3OS1A 5CQXA 5GAOr 1YITT 1NE8A 4J6YA 5GANd 3QJ6A 3CCEA 1I5LA 1UEBA 4F7UE 2FB7A 4MZTA 3S3OA 3OBYA 3MO8A 1H641 5FU6B 2R57A 1BIAA 1N9SA 3LW5E 2V8JA 1W4SA 5LJ5e 3VKIA 4A4FA 1VQ5A 1OI1A 2K3YA 1VQ6A 1QW1A 4M77D 5FRNA 4OB1B 3OYYA 5I2SA 2EQKA 1YJWA 4HT9A 4C8QE 1VQOA 4M7DG 1VQ7A 4C5HA 4NL3A 3E1SA 2Y4XA 3HKSA 1Q82C 1VQKA 1UGPB 3J7AF 4XTZA 1KG1A 2L3RA 3WXMB 3QSUA 5HK0A 2ZPIB 3LWIA 2DPPB 3S3NA 3PGGA 4C0FA 3CC7A 1R8OB 1UB4A 4JS5A 4BY6B 4JUVA 2K57A 1X6OA 5D6WA 3P8DA 5HK3A 3G71T 3CCJA 4BE1A 3CBPA 3JB9G 2LCLA 2DKGA 1Y96A 3LGLA 1RI0A 4XTXA 4PJOE 3QYGB 3FJPA 2I2LA 3X20B 3JCMV 2K5LA 4NOYA 3VV0A 4JRPA 3HSBA 2XK0A 1NPRA 3V7CA 2B8AA 2QDYB 3TEEA 4BI8B 4BD3A 4HCZA 3CPWS 5GMKi 1V29B 2PU9B 2LX9A 2DD4A 2YLCA 3JCMh 1VIEA 5GAOp 1BI3A 3S6WA 2RK2A 1M1GA 1K8AU 4RCBA 5CKEA 4M7AD 4M7DE 3JRZA 1WJQA 1O75A 3NTKA 3X28B 2WSEE 2DXBA 4PLIA 5FRMA 3P8BB 4GY5A 3JCMc 2D9TA 3CD6A 4JS4A 1S72A 3GPLA 2LC4A 3QUIA 4M77C 3OYMA 2EJ9A 3QG1A 3ASKA 3CPFA 3CCRT 2R5AA 2PVDB 2OAUA 3KXTA 3G4ST 1YI2A 4PJOD 1AHJB 4IUQA 3MEVA 4XTVA 5GANh 2E6NA 4FT2A 4PLLA 5GAMh 3L2WA 1Y96B 1K9MU 4A4HA 4A54A 5FLXE 5DM7R 3CMAT 1MHNA 3GNFB 5GAMj 2DTIA 5GAMg 2X35A 2EQJA 2HQXA 2Y90A 3O8VA 4OB3B 3VYHB 1VIFA 2DZ9A 2HNIA 3LYIA 5GMKl 1W2BS 2RO0A 5KCHA 3GF5A 4JDSA 1XNIA 2CS7A 2O4XB 4J8OA 5D6XA 4D6WA 2VV5A 1K73C 3JB9F 2ZGWA 4A53A 4ELZC 4QQGA 1JBMA 4C5GA 4QQDA 5A0LA 4CI0C 1QVPA 5GAN8 3C4SA 3G6ET 1YHQA 4J6XA 1YI2T 4PL6A 2KY9A 1KQ1A 1QP3A 2F5KA 4C92A 1YIJT 1Q86U 3ZEHA 5GANe 2E41A 3F70A 3QKJA 1VQMT 2GFAA 3CCVT 3JB9J 3JCMJ 3N5BB 5DLOA 5FU7C 1X01A 3HFOA 5FROA 3M59A 4C8QA 5C6SA 2RA2A 3HP9A 3CCLA 3L1AA 4PNOA 5LJ5g 4ZGEB 3ZBDA 1KD1C 2RB6A 1M1KC 4M7DF 3M9QA 2DAQA 3PFSA 4BE0A 1YJNA 3EAEA 4M7AE 2O4XA 2XICA 2HBPA 2F5TX 1I8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6Y A;  1BIB A;  5GAN d;  3BY7 A;  3HFN A;  5GAM d;  3JB9 I;  4F7U B;  1I5L A;  3JB9 H;  4F7U E;  5GMK m;  2FB7 A;  1B34 A;  4C8Q F;  4EMH A;  1H64 1;  4M7A A;  1WQ7 A;  1BIA A;  1N9S A;  4N0A C;  4XTU A;  4PJO B;  1I81 A;  5LJ5 e;  4M7A G;  2CGH A;  4C8Q C;  3INZ A;  4M77 D;  5GAN f;  5GAO m;  4C92 F;  4M7D D;  2VC8 A;  4PJO F;  3BW1 A;  5GMK h;  4F7U A;  5GAO q;  4JLI A;  3AHU A;  4HT9 A;  4C8Q E;  5LJ3 h;  2EAY A;  3EFS A;  4C8Q B;  4QVC A;  4M7D G;  4M78 G;  4NL3 A;  3L2Z A;  4F7U G;  4JRI A;  4XTZ A;  4M7A B;  3JCM W;  2FYK A;  3QSU A;  4M78 C;  4EMG A;  2VXE A;  3PGG A;  2EJG A;  2RM4 A;  4M77 A;  4XU1 A;  5GAN 7;  1KQ2 A;  4JUV A;  2K57 A;  4XU0 A;  4PJO C;  5CAI A;  4C92 C;  3JB9 G;  2DKG A;  4XTY A;  5GAO r;  1Y96 A;  4XTX A;  4J5Y A;  5LJ5 f;  5GAN 5;  4J6W A;  3FJP A;  4NL2 A;  2I2L A;  4DQ2 A;  3JCM V;  2DTO A;  4NOY A;  3BFM A;  4XTW A;  3HSB A;  4XU3 A;  4PJO E;  2E65 A;  5GMK e;  3V7C A;  4HA8 A;  3JCM Q;  2YHT A;  3SWN B;  3QO3 A;  4JRK A;  1HK9 A;  3SWN C;  5GMK i;  1JRI A;  3VU3 C;  3GIB A;  2YLC A;  5GAO p;  3JCM h;  2RD1 A;  3RUX A;  3JCM e;  5GAO n;  1U1S A;  4M77 G;  3V7S A;  4RCB A;  4XQ3 A;  1M5Q 1;  5I21 A;  4M7A D;  4M7D E;  4V2S A;  4C92 B;  1U1T A;  1WQW A;  2EWN A;  5GAM f;  3JCM c;  5GAN 6;  4M75 B;  3FB9 A;  3JB9 D;  4M7D C;  3QUI A;  4M77 C;  5LJ3 f;  2EJ9 A;  1HXD A;  1D3B B;  3EFR A;  5GAN g;  5LJ5 d;  1B34 B;  5GMK j;  4M77 E;  3JCM X;  3JCM P;  3JB9 J;  4M7A C;  4X9C A;  4PJO D;  5LJ3 d;  4XTV A;  4XU2 A;  5GAN h;  5GAO l;  4MMK A;  5GAM h;  4M75 F;  3RKX A;  1I4K 1;  1Y96 B;  2E1H A;  3JCM b;  4A54 A;  4C92 G;  3JCM d;  4M7A F;  2DZC A;  2EJF A;  3V8L A;  5GAM j;  2DTI A;  4M78 B;  4RCC A;  4M75 G;  5GAM g;  2DEQ A;  4M78 E;  2VXF A;  2Y90 A;  5GMK l;  4EMK A;  2DZ9 A;  2DXU A;  2HNI A;  4M77 F;  4M78 F;  3JCM g;  4M7D B;  3JB9 F;  1YCY A;  4C92 E;  3SWN A;  3M4G A;  5GAM e;  4EMK C;  2ZGW A;  4A53 A;  4QVD A;  2QTX A;  1TH7 A;  4M75 E;  3JCM f;  4C8Q D;  1I8F A;  4M78 A;  1WPY A;  5GAN 8;  4MML A;  4J6X A;  1N9R A;  4EMK B;  5GAN 4;  4M75 C;  1M8V A;  4PJO G;  4N0A A;  4M77 B;  1KQ1 A;  2DXT A;  3FIF A;  1MGQ A;  3RIR A;  4F7U F;  4PJO A;  1LNX A;  4C92 A;  2DTH A;  1D3B A;  5GAN e;  2E41 A;  4M75 A;  2YLB A;  4Y91 A;  4C8Q G;  3SB2 A;  2JN0 A;  2E64 A;  3RKW A;  3JCM J;  1WNL A;  1X01 A;  3HFO A;  5GAN 2;  4WF2 A;  3V7R A;  4C8Q A;  4M78 D;  3V8J A;  5LJ3 e;  2RA2 A;  3RES A;  5GAN j;  3RER A;  3L1A A;  4PNO A;  5LJ5 g;  3RKY A;  5DY9 A;  3V8K A;  5LJ5 j;  1LOJ A;  5GAN 3;  4X9D A;  2RB6 A;  4C92 D;  4M7D F;  5LJ5 h;  3QHS A;  5LJ3 g;  2E10 A;  4M75 D;  5LJ3 j;  4M7A E;  4HT8 A;  2DVE A;  4M7D A;  3BDU A;  4OP0 A;  2DJZ A;  1LJO A;  1JBM A; 
#chains in the Genus database with same CATH topology
 5CVI A;  3C0C A;  2P84 A;  2K3X A;  1E6H A;  1ABQ A;  2O01 E;  4EMH A;  3OW2 A;  4MZM A;  4OML A;  4XTU A;  4FU6 A;  2HQE A;  4IUR A;  4PJL A;  2CGH A;  1KQS P;  5GMK h;  3OYN A;  1YBY A;  1Y07 A;  5LJ3 h;  1D0Z A;  4FIB A;  3OS0 A;  1RLQ C;  2HKQ B;  5CIU A;  4DEY A;  3JCM W;  3PMT A;  3HL8 A;  1Q82 R;  2VXE A;  2ZAE A;  4BUG A;  1FWZ A;  2M51 A;  4XU1 A;  2CZ7 B;  2X4Y A;  2HKN A;  1M3C A;  1RI9 A;  4Q5W A;  3PVQ A;  1M2O A;  2YWW A;  4M7A A;  4ZN1 A;  4J6W A;  1T0H A;  3M0T A;  1VQN A;  5GMK e;  3JCM Q;  2YHT A;  3CD6 T;  2CZ0 B;  3MHX A;  2ED0 A;  5KYU A;  4DOW A;  3CD6 Q;  1M5Q 1;  3PTA A;  3G7Z A;  2EIF A;  4C92 B;  1N6A A;  4Y92 A;  1SHG A;  3ER0 A;  2KBT A;  1D3B B;  4DEX A;  5LJ3 d;  1OUL A;  2G6F X;  3OS2 A;  2E70 A;  4L59 A;  2BUD A;  2ED1 A;  2EYY A;  1RL2 A;  3L42 A;  1JJ2 S;  3NFC A;  1WPY A;  3OYJ A;  1JEG A;  2KI7 A;  1OPK A;  1VQ7 T;  3VJP A;  4PJO A;  4QVZ A;  2M0Y A;  4WTO B;  3SB2 A;  2BTT A;  1SSF A;  3PE0 A;  2LQW A;  1FXX A;  2RMO A;  2CP2 A;  2HD0 A;  1NEB A;  1C0M A;  1VQ4 A;  1OEB A;  3OS5 A;  2K79 A;  1ZUK A;  3MEU A;  4M75 D;  1MND A;  2KQW A;  1BB9 A;  1C6V X;  2VGM A;  3JB9 H;  1VYT A;  2EQI A;  1I81 A;  1X2K A;  2NLU A;  2C0T A;  1VQM A;  5KYY B;  3UWN A;  3VRY A;  3E9G A;  3DB4 A;  3VUB A;  2XDD A;  1WGS A;  2AKK A;  2E6Z A;  3NTH A;  5A0D A;  2L0A A;  3VS5 A;  1IRX A;  2K2M A;  4BB7 A;  2LT4 A;  4DBH A;  4Z88 A;  1X27 A;  4ZTF A;  1KFZ A;  2P0P A;  1Z9Z A;  4IUU A;  4ZGJ B;  3BDL A;  4E7S A;  1WX6 A;  2FL7 A;  1RAG B;  4ME7 A;  4C92 C;  2OTJ T;  2QXF A;  1VYU A;  3QII A;  1CKB A;  1T0J A;  1JRI A;  3NHN A;  2LJ0 A;  2FZC B;  3CCR Q;  1U5S A;  2CSQ A;  3CCR A;  2JS2 A;  1HXD A;  4QKU A;  2QAZ A;  2FPF A;  1B7T A;  2RF0 A;  2ROL A;  1VQO T;  1YNZ A;  2JVV A;  1I5O B;  1EZZ B;  2XG8 D;  2XKO C;  1OZ3 A;  2COZ A;  4BE2 A;  1R77 A;  1PNJ A;  3MP6 A;  4LDW A;  2RPN A;  4LUD A;  4OMP A;  1X69 A;  1H3Z A;  4LXC A;  2LP5 A;  2O88 A;  2MWO A;  2D1X A;  2YRV A;  2ZPH B;  1GL5 A;  2PVG B;  2SRC A;  3OYE A;  1GCP A;  2K4Y A;  4GBQ A;  3VS7 A;  4HCK A;  4N0A A;  1OPL A;  4F7U F;  2R5M A;  4M75 A;  1AOJ A;  2CKK A;  3J80 E;  1PRM C;  1OZ2 A;  4OGC A;  2LNV A;  4M78 D;  1KD1 U;  2CH4 A;  1BYM A;  4RKU E;  2FPE A;  4C92 D;  1FX7 A;  1RAH B;  3OYB A;  5LJ3 j;  2EQU A;  3EHQ A;  1R0B G;  4J83 A;  2O9V A;  3CCV A;  3FDR A;  1QCF A;  3J81 E;  4FCY A;  4KUL A;  4C5I A;  3OBW A;  1JJ2 P;  1UJ0 A;  4C8Q C;  5GAN f;  2FRY A;  2MMP A;  1GFD A;  3DLL A;  2M16 A;  1VQ5 T;  3OYI A;  4HXJ A;  3EHR A;  4F7U G;  3G1J A;  3G71 A;  1D1A A;  4BI4 A;  1VQ7 Q;  4EMG A;  1S1N A;  2IVW A;  3OA6 A;  2JZ2 A;  2ZPB B;  2I0N A;  4XTW A;  2ABL A;  1VQP A;  5IN1 A;  2XDP A;  5FWB A;  3HRU A;  3O5Z A;  3SWN C;  2XD0 A;  1H92 A;  3V7S A;  2K3B A;  3G4S A;  2JS0 A;  1YJN Q;  1U1T A;  2AZV A;  4M75 B;  1M9S A;  1KHI A;  4LE9 A;  5GAN g;  2K5F A;  3JB9 J;  3MCA B;  2XID A;  1XOV A;  4XU2 A;  3MKD A;  5IH2 A;  2RQT A;  3HRS A;  2KVQ G;  4J9G A;  1QKX A;  1UJY A;  2W0Z A;  1YIJ A;  2DET A;  4C92 E;  5GAM e;  4Z8A A;  2QTX A;  1E7O A;  1PCX A;  4M78 A;  1KD1 R;  1ZBX A;  3C95 A;  3LX7 A;  3A98 A;  4EMK B;  2J6F A;  2EGC A;  1MGQ A;  3MJX A;  1YJW Q;  2YLB A;  4PFO A;  2DIL A;  2MOX A;  4K11 A;  3CME T;  2DVJ A;  4E7Z A;  1M90 U;  1WJS A;  5GAN 3;  6AT1 B;  5CR2 A;  1Y57 A;  3VS0 A;  2OJ2 A;  1N8R U;  4IUT A;  1BU1 A;  3S3M A;  5CQX A;  3UA7 A;  1NE8 A;  3CCE A;  3CQT A;  4F7U E;  2FB7 A;  2EYZ A;  3IQL A;  1UEC A;  5FU6 B;  1VQ6 A;  1OI1 A;  1ZSZ B;  2VVK A;  1WXB A;  2EQK A;  1YJW A;  2B86 A;  1VQ7 A;  4C5H A;  3HKS A;  1UGP B;  2L3R A;  5HK0 A;  2DL7 A;  3PGG A;  4C0F A;  1D09 B;  2RQV A;  1X6O A;  3P8D A;  1MUZ A;  1MMD A;  1G2B A;  3LGL A;  1RI0 A;  1K1Z A;  2I2L A;  3JCM V;  4FYX B;  2Z0W A;  1JU5 C;  3NGP A;  4BI8 B;  4BD3 A;  1X43 A;  4DBF A;  1V29 B;  2LX9 A;  2DD4 A;  3JCM h;  1M1G A;  1K8A U;  5CKE A;  1MNE A;  1WJQ A;  1ZUU A;  3JCM c;  1EFN A;  1YP5 A;  4JS4 A;  1S72 A;  4M77 C;  1Z9Q A;  1I1J A;  1AEY A;  1W2B P;  4PJO D;  3G4S T;  1SRM A;  1YWP A;  1J3T A;  5GAN h;  3EFO A;  2E6N A;  4PLL A;  2CUB A;  3L2W A;  5FLX E;  4A54 A;  1YWO A;  5GAM j;  1BBZ A;  5GAM g;  2SEM A;  2BZY A;  5GMK l;  1W2B S;  3LYI A;  4JDS A;  4J8O A;  5I22 A;  1GBR A;  2ZGW A;  4A53 A;  3FJ5 A;  2DRM A;  5A0L A;  1YHQ A;  3G6E T;  1QLY A;  1V1C A;  1M90 R;  1VQK Q;  2KY9 A;  2F5K A;  1Q86 U;  1YIJ T;  4J9I A;  3QKJ A;  4AT1 B;  1N8R R;  1PWT A;  1IGQ A;  2DX1 A;  1HSQ A;  1X01 A;  1B07 A;  1KD1 C;  1TSF A;  2RB6 A;  4M7D F;  2DAQ A;  1WHM A;  1MV0 B;  2O4X A;  1OOT A;  3QZ9 B;  3BY7 A;  1JB0 E;  2DIG A;  4KGX B;  3GP8 A;  3JAM E;  3H0H A;  5A2Q E;  2GQI A;  3INZ A;  2V1Q A;  3CCU Q;  1NYF A;  3EFS A;  1U8R A;  1U06 A;  2E5K A;  4L6V 5;  4M78 G;  5CKF A;  3TCJ A;  1QVG A;  4GLK A;  4KUI A;  1RLP C;  2ROT A;  2OTL A;  4M78 C;  3L2U A;  1ZUY A;  1VQ9 Q;  2EJG A;  1QWE A;  1VQ9 T;  3OMG A;  1VQN Q;  2DL3 A;  3BFM A;  4XU3 A;  2EQM A;  2OX7 A;  1MMN A;  4LDY A;  2HQH A;  1I07 A;  1HK9 A;  2JUF A;  2COY A;  3CEY A;  1JJ2 A;  1G5V A;  4JZ3 A;  3M55 A;  1S72 Q;  5I21 A;  4B9W A;  4P5N A;  4MZP A;  4FM4 B;  2EWN A;  4F17 A;  2CP3 A;  5GAN 6;  1TUD A;  3I55 T;  2KAF A;  1RAI B;  3JCM X;  3M56 A;  1D1B A;  1PSF A;  1PRL C;  1RAF B;  3M5A A;  2KSS A;  2CSI A;  3OSV A;  2JTF A;  1NJI R;  1C1A A;  4ZNX A;  1D0Y A;  4OMF B;  4RTY A;  2VXF A;  2ZPG B;  2XDB A;  1QMC A;  4LDU A;  3E2U A;  4M78 F;  1YHQ Q;  2RN8 A;  2QQS A;  1G3W A;  4GLM A;  1UHF A;  2RNA A;  2LCC A;  4Y91 A;  5C0M A;  5KYY A;  4II1 A;  4AG2 C;  2RJD A;  1VQP T;  2QGG A;  2YXY A;  1T3L A;  1FMV A;  3U23 A;  5LJ5 j;  1KQS S;  1TU0 B;  3MP8 A;  1Y71 A;  4OP0 A;  1RAD B;  1WHG A;  1ZA1 B;  5J3B A;  5GAM d;  5LL6 S;  4RTV A;  1GCQ A;  4CC7 A;  4M7A G;  2LQ8 A;  5EG2 A;  4B9X A;  3CCS Q;  3A8G B;  2A3L A;  4E7I A;  1VQ9 A;  3VRZ A;  1Q7Y R;  1VQK T;  2FYK A;  4E7K A;  4OGE A;  3LH5 A;  3I56 T;  1BCM A;  2H3E B;  2XMF A;  1K9M C;  4BY6 C;  2CP6 A;  2E65 A;  4HA8 A;  1UGQ B;  4HVV A;  4JRQ A;  4IUP A;  2MYS A;  1H8K A;  3SHW A;  2DXC A;  2RD1 A;  3RUX A;  2LJ3 A;  3PMI A;  3MET A;  1NG2 A;  2JM8 A;  3R6N A;  1ZA2 B;  2CZ1 B;  3CXC A;  3M0U A;  3PVL A;  4M4Z A;  4OVA A;  2YSQ A;  1IO6 A;  2DE0 X;  2XI9 A;  4BAC A;  2VYT A;  1G3S A;  2K5I A;  4M75 F;  5D6Y A;  1I4K 1;  3OW2 S;  3RBB B;  4PFZ A;  1VQ6 Q;  4C92 G;  4M7A F;  3HHT B;  2MAM A;  2DRK A;  4IIM A;  3P8H A;  1W70 A;  3NTI A;  4M78 E;  3CCQ A;  1IZ6 A;  2VB6 A;  2EPD A;  3CMA Q;  4JJB A;  4M7D B;  3TSZ A;  1M27 C;  3SWN A;  2QG9 B;  4C8Q D;  4J9H A;  2CZ6 B;  4M75 C;  2YDL A;  3CBO A;  1SKU B;  3SEM A;  2CYZ B;  5FU7 B;  4F04 B;  1W2B A;  1TTH B;  4ZN3 A;  3RKW A;  2OTJ Q;  3V8K A;  5J26 A;  1Q86 R;  3OYH A;  1WZO A;  3QHS A;  3A8L B;  2DFU A;  2EGA A;  2JNG A;  1BIB A;  1Q82 U;  3CMA A;  2QDL A;  2QQB A;  3CCL Q;  5CK9 A;  3FEO A;  3LWH A;  1Q7Y U;  1WQ7 A;  4XAX B;  3EFO B;  4OMM A;  1M3B A;  3EGX A;  4C92 F;  1YHQ T;  4JLI A;  4A63 B;  3CC7 T;  2LCS A;  1Q81 U;  2EGE A;  4RTW A;  4KH0 B;  2CP5 A;  2DD5 A;  4JJD A;  2MF2 A;  1VQP Q;  1YI2 Q;  4NL2 A;  2QA4 A;  2HZY A;  2M0O A;  2KRM A;  2JMA A;  4MDW A;  1ZSZ C;  3QO3 A;  3SWN B;  1UGS B;  4KH1 B;  4OMO A;  3I5R A;  3QBY A;  2KT8 A;  1QVG S;  4RG2 A;  3D7S B;  4ORZ A;  1TUC A;  5LJ5 d;  4IKF A;  1OX8 A;  3RMQ A;  1G3Y A;  1NM7 A;  3UDC A;  5M9O A;  4O5V A;  3OY9 A;  2KMT A;  2ZCF B;  3EG2 A;  4CC4 B;  4C0D B;  2DK3 A;  2DZC A;  2LQK A;  2VAS A;  2KRO A;  5IHK A;  3JCM g;  1AWJ A;  1Q81 C;  4J7I A;  1F1B B;  1M8V A;  4M77 B;  2RK1 A;  4L5G A;  3SFM A;  2FO0 A;  2QGF B;  4KRT A;  2BE7 D;  5KE2 A;  2BZ8 A;  2RHX A;  4FSX A;  4Z02 A;  5IXF A;  2NUZ A;  1NPP A;  3REB B;  5L8R E;  5GAN j;  2QQR A;  3RER A;  2JW4 A;  1PKS A;  2VKN A;  3CC4 A;  3EGD A;  5LJ5 h;  2BKD N;  1X75 C;  4FW2 A;  5IHI A;  2DLP A;  2FG0 A;  4J6Y A;  5GJV B;  5GAN d;  3VS6 A;  1UEB A;  4MZT A;  1B3Q A;  3OBY A;  1H64 1;  1YFN A;  1N9S A;  2R57 A;  2DMO A;  5LJ5 e;  4LN2 A;  1QW1 A;  4M77 D;  4OB1 B;  3REA B;  3UF4 A;  1X6B A;  1QKW A;  4C8Q E;  2ECZ A;  2QEX Q;  4M7D G;  4NL3 A;  2HL3 A;  1Q82 C;  1KG1 A;  2C0I A;  3CCJ A;  2K57 A;  4RTT A;  5D6W A;  3G71 T;  3JB9 G;  2LCL A;  2DKG A;  4PJO E;  2M02 A;  1FMK A;  3FJP A;  3QYG B;  2K5L A;  3VV0 A;  3ULR B;  1WXU A;  1NPR A;  2DYI A;  2JJ9 A;  2QDY B;  4HCZ A;  2COW A;  1U3O A;  4OMN A;  1O75 A;  3X28 B;  2K6D A;  2WSE E;  5FRM A;  2KYB A;  1FMW A;  3CCR T;  1KK7 A;  2PVD B;  2OAU A;  3KXT A;  1YI2 A;  1AHJ B;  4FT2 A;  5GAM h;  1Y96 B;  2LX7 A;  1MHN A;  2MPX C;  3GNF B;  2X51 A;  2EQJ A;  3VYH B;  2Y90 A;  2DZ9 A;  2JT4 A;  1SHF A;  5KCH A;  2A0F B;  2YUQ A;  2O4X B;  1PM3 A;  4CI0 C;  1UG1 A;  3C4S A;  1YI2 T;  1QP3 A;  2YRD A;  1RAB B;  3CCV T;  2HL5 C;  5FRO A;  4DBR A;  1PG5 B;  4C8Q A;  3CCV Q;  2LMJ A;  3L1A A;  5LJ5 g;  4BE0 A;  3EAE A;  1SPK A;  1K73 R;  2XIC A;  1MMG A;  2HBP A;  2F5T X;  1JBM A;  1I8F A;  2PTK A;  1SG5 A;  1KC8 C;  2YUP A;  3LH0 A;  4KT0 E;  3WVD B;  1EX4 A;  2RJF A;  3KBG A;  1ACM B;  2MWP A;  4QT7 A;  4F16 A;  4JLG A;  2VC8 A;  4KGZ B;  3L2Z A;  4JRI A;  2FVU A;  4E7L A;  2RHY A;  3L2V A;  1GRI A;  4JZ4 A;  2FPD A;  2KEA A;  2EYX A;  1N27 A;  2V8I A;  1AD5 A;  4XTY A;  3RNJ A;  1Q81 R;  2Y4Y A;  3UT1 A;  5CKB A;  5KYW A;  1YJ9 Q;  2IPO B;  3SDZ A;  1M2V B;  1HD3 A;  5GAO n;  4RTU A;  5GJW B;  2EBP A;  5GAM f;  1Q86 C;  4M7D C;  4CRI A;  5LJ3 f;  3PIP A;  3EFR A;  1YJN T;  5GMK j;  1AWX A;  2D6F A;  1A0N B;  4N4G A;  4MMK A;  3UAT A;  1OQK A;  5IHN A;  1QQJ A;  2E1H A;  2QQ9 A;  2WSC E;  2X4J A;  1ZSZ A;  5I11 A;  3JCM b;  4DOV A;  4ATO A;  2DEQ A;  1SF9 A;  1P92 A;  1FYN A;  1M8M A;  3LGF A;  3DB3 A;  4EMK C;  4ZTJ A;  2NUP B;  1QVF A;  1TH7 A;  4M75 E;  3JCM f;  3G71 Q;  2YUN A;  2D8H A;  4QW2 A;  1N9R A;  2BE9 B;  2DXT A;  1H3H A;  3OYK A;  1WXT A;  1KJW A;  3CC2 A;  3Q1J A;  3DKM A;  2CP0 A;  1UGR B;  1WIE A;  3CC2 Q;  2QA4 Q;  3V7R A;  2EW3 A;  5AT1 B;  1KC8 U;  3RES A;  2QA4 T;  5DY9 A;  2KDS A;  4X9D A;  1BI2 A;  3CME Q;  1ARK A;  4ELY C;  4HT8 A;  3PIO A;  4PJO G;  5CQY A;  3M0R A;  2VUB A;  3QDR B;  3TQ7 P;  2H8H A;  1LVK A;  7AT1 B;  4FYV B;  4FYY B;  3CPW P;  5GAO m;  4J9D A;  2LTO A;  5GAO q;  4E6R A;  4EPC A;  2RHU A;  1ZHI A;  3M58 A;  2OTL Q;  3OYG A;  1K0S A;  4JPB W;  2PVO B;  2JOY A;  3M53 A;  5GAN 7;  4M77 A;  2H3J A;  1G83 A;  4C5E A;  4ESR A;  5CAI A;  2K7A A;  3CCM A;  3CCM T;  4DQ2 A;  4O6J A;  4R0K A;  4ZGD B;  3C12 A;  4JRK A;  2X3X D;  2A7Y A;  3QYH B;  4M77 G;  4V2S A;  3A8O B;  3CC4 Q;  4E2F B;  1Q7Y C;  3QDF A;  1IGU A;  3M0P A;  3CC4 T;  2NUT A;  1I0C A;  4BDY A;  1RAE B;  2GF7 A;  3OYC A;  4R55 A;  4IUV A;  3OYL A;  1Y0M A;  3V8L A;  4QQ6 A;  3GLX A;  4LUE A;  3MP1 A;  1W6X A;  2F2W A;  2GBQ A;  1YIT A;  2KGT A;  4QVD A;  3CCS T;  2DIQ A;  3OMC A;  1OU8 A;  3CCS A;  4JJN K;  1K9A A;  1VQ8 Q;  1WLP B;  1VQ4 Q;  3I35 A;  2KK4 A;  1E6G A;  2GFU A;  3RIR A;  1LNX A;  3G6E Q;  4AFS C;  2OTJ A;  1VQ8 T;  3M57 A;  1VQ4 T;  3L2R A;  1OYX A;  2E64 A;  5HKC A;  1WHJ A;  3QJY A;  4RG8 A;  4C0Z A;  3RKY A;  4UC4 A;  5LJ3 g;  4LNP A;  2FZK B;  4M7D A;  2KXD A;  3QWY A;  1LJO A;  2JM9 A;  2R58 A;  3AT1 B;  4E7H A;  1AZG B;  5I2M A;  2RJC A;  1WHK A;  2PNI A;  3LLR A;  1K73 U;  1RAA B;  1QCO A;  1GBQ A;  3BW1 A;  4FW1 A;  4N4H A;  2DYB A;  1VOM A;  3ZL7 C;  2O2O A;  1VQ6 T;  3CME A;  4M7A B;  1BKB A;  2L3S A;  1Y7X A;  3GNG A;  2ZZD A;  4XU0 A;  5A0G A;  3EH2 A;  4PJN A;  4HVU A;  3CC2 T;  4PJO C;  4X34 A;  5IT9 E;  1AZE A;  2DTO A;  3X25 B;  4LDV A;  1NYG A;  2ENM A;  2YUO A;  1VQN T;  1NJI U;  5CO7 A;  1DJ7 B;  2E5Q A;  3GIB A;  2KR3 A;  3M54 A;  3A5Z B;  1G3T A;  1WQW A;  1UFF A;  1OX9 A;  1ZSG A;  1BI1 A;  2V26 A;  4J9E A;  1N5Z A;  2LT1 A;  3VUZ A;  4RMO A;  3PT9 A;  1UE9 A;  5KE3 A;  1IB8 A;  3RR6 A;  1NBE B;  4TVR A;  4X9C A;  4M7A C;  4MDX A;  8ATC B;  2WSF E;  4AFZ C;  1HYO A;  3M0Q A;  3CCL T;  4ANJ A;  3KUF A;  2OTL T;  4FT4 A;  2L8D A;  2V1R A;  2E3H A;  1YCY A;  2L3P A;  5KH6 A;  2K9G A;  4CC2 A;  3ZFJ A;  1D0X A;  3I55 A;  4VUB A;  3EGU A;  1K9M R;  3URG A;  4MML A;  2YT6 A;  3M4Y A;  3HRT A;  3UPU A;  3E9F A;  4OB0 B;  3X24 B;  3FC3 A;  2DTH A;  2QTV A;  2RQR A;  2KE9 A;  2QYZ A;  2CRE A;  2HDA A;  3H8Z A;  1YCS B;  2JXB A;  3L2Q A;  2QQA A;  1WNL A;  2F1L A;  4WF2 A;  5LJ3 e;  2BIV A;  1PHT A;  3I9Q A;  4KBM B;  2RQU A;  1EIF A;  2P4R A;  3OYF A;  1YIT Q;  5D7U A;  2DM1 A;  4E47 A;  5GAO r;  1YIT T;  3QJ6 A;  2X9H A;  1IXD A;  5KYN A;  1I5L A;  1BIA A;  3LW5 E;  1VQ5 A;  1GFC A;  1V76 A;  5KYX B;  2F2V A;  1WHH A;  2KNB B;  1VQO A;  3E1S A;  4XTZ A;  2NUP A;  2JMC A;  2DPP B;  3CC7 A;  1R8O B;  2OAW A;  1NLO C;  4BY6 B;  1VQM Q;  5HK3 A;  1TOV A;  4XTX A;  1Y96 A;  3I56 Q;  2CH4 W;  4Z89 A;  3X20 B;  4JRP A;  2OI3 A;  2XK0 A;  2EKH A;  3EH1 A;  2B8A A;  3TEE A;  1QCN A;  5FWC A;  5GMK i;  2PU9 B;  2YLC A;  2ESW A;  1VIE A;  3H41 A;  1BI3 A;  2RK2 A;  1WYX A;  4RCB A;  2A37 A;  2CP7 A;  2DXB A;  3P8B B;  4GY5 A;  1VQO Q;  2D9T A;  3CD6 A;  3GPL A;  3OYM A;  2EJ9 A;  3QG1 A;  3CPF A;  2HBW A;  2R5A A;  5FW9 A;  4RTZ A;  4J9C A;  3EG3 A;  1K9M U;  5DM7 R;  2DTI A;  3NPF A;  2X35 A;  1M30 A;  2HQX A;  4OB3 B;  1KC8 R;  1UUE A;  2RO0 A;  2CS7 A;  4HVW A;  1TUG B;  4D6W A;  1K73 C;  3JB9 F;  2RQW A;  1PKT A;  1QVP A;  4J6X A;  1TXQ A;  4PL6 A;  3EG0 A;  3H0I A;  5KYX A;  3ZEH A;  5GAN e;  2E41 A;  3F70 A;  2GFA A;  3N5B B;  1IHV A;  2EYW A;  3HFO A;  3M59 A;  1PC0 A;  5C6S A;  2O9S A;  3VS3 A;  3CCL A;  3OW2 P;  3NMZ C;  4RTX A;  4ZGE B;  2AKL A;  2A28 A;  1M1K C;  3M9Q A;  2CT4 A;  4FSS A;  4M7A E;  2KRN A;  3M0S A;  2O31 A;  4WCI A;  1AT1 B;  2GCX A;  3OSS C;  1B34 A;  2DER A;  1JQQ A;  1YJ9 A;  2DBM A;  4HCC A;  3VS2 A;  2MI6 A;  1M1F A;  2FHD A;  2MK5 A;  1M2V A;  4M7D D;  4AFU C;  3AHU A;  3RMS A;  4F7U A;  3CCJ Q;  1O9S A;  2CDT A;  3CBM A;  4C8Q B;  2WAC A;  3CCJ T;  4D8K A;  3OYA A;  4C0G A;  3CC7 Q;  4B6M A;  2HMA A;  1M1K U;  5AYF A;  3TRE A;  1ZBJ A;  2VWF A;  1GXI E;  4N4I A;  4J5Y A;  3G6E A;  1ZLM A;  3A8H B;  4OF1 A;  2PUO B;  5HY6 A;  5CCA A;  1NLP C;  3VU3 C;  1ZX6 A;  3FRN A;  4XQ3 A;  2DA9 A;  3QXE B;  2AZS A;  2LJ1 A;  3EG9 B;  1WHL A;  2AT1 B;  3FB9 A;  2X4X A;  1UHC A;  2LVM A;  1WJR A;  4M77 E;  5CKD A;  3JCM P;  2L2P A;  2P0Q A;  1TS9 A;  4C0D C;  1NZ9 A;  2F2X A;  1WFW A;  4M78 B;  4RCC A;  1M4Z A;  4Y28 E;  4EMK A;  1PD1 A;  4M77 F;  3VS1 A;  5KYW B;  2NWM A;  4LD9 K;  5KCO A;  4X1V A;  1BCO A;  4PJJ A;  1VUB A;  1MV3 A;  4EIK A;  1X6G A;  3KFV A;  2DO3 A;  1QVG P;  1VQL Q;  1M3A A;  1D3B A;  3MEW A;  1W1F A;  1VQL A;  1VQL T;  1R0C B;  3PNW C;  1BI0 A;  2E12 A;  1AVZ C;  2MIO A;  2EKO A;  1BK2 A;  1YJ9 T;  2DNU A;  2LDM A;  3BDU A;  3X26 B;  3JB9 I;  2QEX A;  2JTE A;  3QPH A;  5GMK m;  4LD6 A;  1XQH A;  3CCQ T;  1JXM A;  4N0A C;  3OB9 A;  2KRS A;  4PJO B;  4KGV B;  2QK0 A;  5FU6 C;  4BI3 A;  4PK4 A;  4PJO F;  2C0O A;  2X3W D;  2M1H A;  2XHC A;  4QVC A;  1D1C A;  1TWB A;  4E7J A;  1KQS A;  1UTI A;  2QEX T;  2NUT B;  1HJD A;  3T9N A;  1RAC B;  4AFQ C;  1OV3 A;  2ZPE B;  2HEQ A;  8AT1 B;  5LJ5 f;  5GAN 5;  2LNH B;  4R56 A;  2DF6 A;  3WVE B;  2J06 A;  1UGV A;  2A36 A;  1VQ8 A;  2LQN A;  2EVR A;  3EGX B;  1YN8 A;  1LPL A;  3VS4 A;  3A1P A;  3G4S Q;  2C06 A;  1PSE A;  1UDL A;  1IRE B;  2P4T A;  5GAO l;  2QI2 A;  1KHC A;  2XU8 A;  3ME9 A;  4J7F A;  1VQ5 Q;  3JCM d;  3A8M B;  2EFI A;  4CC3 A;  4JJC A;  2D0Q B;  1QVF S;  1K8A R;  1NEG A;  2E3I A;  2RI3 A;  5IAY A;  3HPW A;  3JSC A;  2AIR B;  2GGR A;  1YIJ Q;  2HCK A;  2HAX A;  1TG0 A;  5GAN 4;  1QVF P;  4A4K A;  2GQV A;  4EDU A;  2GNC A;  2L89 A;  1K76 A;  3OYD A;  2W10 A;  3I56 A;  2JN0 A;  4FYW B;  5GAN 2;  1JXO A;  4HKE A;  3CCM Q;  3V8J A;  4A4E A;  3MEA A;  3I5S A;  5KYU B;  3CCE T;  2DBK A;  1LOJ A;  2FEI A;  5EC7 A;  2M9U A;  2DJZ A;  2KXC A;  1G8X A;  2CUD A;  3HFN A;  2D8J A;  4NS5 A;  1SRL A;  3VYG A;  4F7U B;  4PFP A;  2X4W A;  4C8Q F;  3THK A;  1IHW A;  2RHZ A;  3CCU T;  1NJI C;  3QZ5 B;  2ATC B;  3DLM A;  4KUD K;  4HCB A;  2D0N A;  2EAY A;  4XK8 E;  3GOX A;  3UA6 A;  4J9B A;  5IXB A;  1QP2 A;  4LDX A;  1XTD A;  1N8R C;  3E19 A;  1WA7 A;  1YJW T;  2RM4 A;  1KQ2 A;  3CCU A;  2K2V A;  1QWF A;  3H0F A;  2L5Q A;  2E4H A;  5CKH A;  3GBQ A;  2RI5 A;  2RJE A;  3OQ5 A;  9ATC B;  1M1K R;  3CPW A;  2DL5 A;  1K8A C;  1VYV A;  2EYQ A;  2JTM A;  3EG9 A;  1S72 T;  5J39 A;  4D8D A;  3JCM e;  1JO8 A;  1U1S A;  2G3R A;  3EG1 A;  3CXC S;  2AHJ B;  3JB9 D;  2P0K A;  2FRW A;  3CCQ Q;  4IIO A;  1B34 B;  3FLG A;  1K4U S;  2KT1 A;  2RHI A;  2HSE B;  3R6O A;  5ECA A;  2FZG B;  1X2Q A;  2IG0 A;  2J05 A;  4YTL A;  3RKX A;  4DA4 A;  3QWX X;  2V8K A;  2VGN A;  2EJF A;  4PJM A;  2F69 A;  3C94 A;  4M75 G;  2PUK B;  4AG1 C;  2DXU A;  3TVT A;  2RH2 A;  3M4G A;  2YRC A;  2RI2 A;  2J7I A;  3HTR A;  4A4G A;  2LRQ A;  4FL6 A;  3FIF A;  2ZPF B;  2J6O A;  4RUG A;  3H6Z A;  3MPU B;  4PKC C;  4C8Q G;  5DLQ E;  3TU4 K;  1LCK A;  1ABO A;  2PQW A;  1KIK A;  1M90 C;  2IIM A;  5L23 A;  1AWO A;  4OB2 B;  1K0X A;  3SD4 A;  1ZQ1 A;  2E10 A;  2DVE A;  3OS1 A;  1Q95 G;  2NYS A;  4OMQ A;  3S3O A;  3MO8 A;  2V8J A;  1W4S A;  3VKI A;  4A4F A;  2K3Y A;  4J9F A;  5FRN A;  1MMA A;  3OYY A;  5I2S A;  4AMC A;  1VA7 A;  4HT9 A;  1AWW A;  2AK5 A;  3BE3 A;  2Y4X A;  1VQK A;  1T3S A;  3WXM B;  3QSU A;  3S3N A;  2ZPI B;  3LWI A;  1WI7 A;  2DL4 A;  1UB4 A;  4JS5 A;  4JUV A;  4BE1 A;  3CBP A;  1GCQ C;  2BZX A;  3HSB A;  3H9N A;  2CT3 A;  4NOY A;  3RDV A;  1PD0 A;  3CCE Q;  3V7C A;  2L3Q A;  1SSH A;  3CPW S;  5GAO p;  2DEU A;  3S6W A;  4M7A D;  2A08 A;  3JRZ A;  4M7D E;  3NTK A;  4PLI A;  1KSW A;  1RUW A;  2LC4 A;  3QUI A;  3ASK A;  4DBQ A;  4IUQ A;  2J6K A;  3MEV A;  4XTV A;  2KYM A;  5HCK A;  4A4H A;  3EGD B;  3CMA T;  1XJW B;  3O8V A;  3JV3 A;  1VIF A;  2HNI A;  1WDX A;  2GTJ A;  3GF5 A;  1XNI A;  1CSK A;  5D6X A;  2VV5 A;  2LZ6 B;  4ELZ C;  4QQG A;  2MCN A;  1OU9 A;  1CKA A;  2DJQ A;  4QQD A;  4C5G A;  5GAN 8;  3J7A F;  2GTO A;  2QAS A;  1KQ1 A;  4C92 A;  1VQM T;  3CXC P;  3JCM J;  5DLO A;  5FU7 C;  2HSP A;  1SEM A;  2RA2 A;  3HP9 A;  3TSW A;  2DL8 A;  4PNO A;  3ZBD A;  3PFS A;  1YJN A;  3I55 Q;  2PZ1 A;  4F14 A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 5CVI A;  3QZ9 B;  1KC8 C;  3BY7 A;  2K3X A;  3LH0 A;  1JB0 E;  4KT0 E;  3WVD B;  2DIG A;  2GCX A;  2O01 E;  3OSS C;  3GP8 A;  3JAM E;  1B34 A;  4EMH A;  2RJF A;  5A2Q E;  3OW2 A;  3KBG A;  1YJ9 A;  4MZM A;  2MWP A;  4XTU A;  4HCC A;  4FU6 A;  2HQE A;  2MI6 A;  4IUR A;  1M1F A;  2CGH A;  2FHD A;  3INZ A;  4JLG A;  4M7D D;  2VC8 A;  5GMK h;  3OYN A;  3RMS A;  4F7U A;  3AHU A;  1YBY A;  1O9S A;  1Y07 A;  5LJ3 h;  3EFS A;  1U8R A;  4C8Q B;  3CBM A;  4FIB A;  4L6V 5;  2WAC A;  3L2Z A;  4M78 G;  5CKF A;  3TCJ A;  5CIU A;  4JRI A;  3OS0 A;  1QVG A;  2FVU A;  4GLK A;  3CCJ T;  3OYA A;  4C0G A;  4E7L A;  3JCM W;  1M1K U;  4KUI A;  2RHY A;  5AYF A;  3PMT A;  3L2V A;  2OTL A;  4M78 C;  3HL8 A;  3L2U A;  2VXE A;  4BUG A;  1FWZ A;  2EJG A;  4XU1 A;  3TRE A;  2CZ7 B;  1GXI E;  2X4Y A;  1N27 A;  2V8I A;  1VQ9 T;  4Q5W A;  3OMG A;  4XTY A;  4M7A A;  4N4I A;  4J5Y A;  4ZN1 A;  4J6W A;  3G6E A;  3BFM A;  4XU3 A;  2EQM A;  2Y4Y A;  3UT1 A;  1VQN A;  4LDY A;  5GMK e;  3A8H B;  4OF1 A;  3JCM Q;  2YHT A;  3CD6 T;  2CZ0 B;  2PUO B;  3MHX A;  5CKB A;  5HY6 A;  1HK9 A;  2JUF A;  3CEY A;  5CCA A;  1JJ2 A;  1G5V A;  3SDZ A;  3VU3 C;  4DOW A;  5GAO n;  3M55 A;  3FRN A;  4XQ3 A;  1M5Q 1;  4B9W A;  5I21 A;  3PTA A;  4P5N A;  3G7Z A;  2EIF A;  4MZP A;  4C92 B;  3QXE B;  4FM4 B;  1N6A A;  2EWN A;  5GAM f;  4BDZ A;  5GAN 6;  1Q86 C;  3FB9 A;  4M7D C;  4CRI A;  5LJ3 f;  2X4X A;  3ER0 A;  2LVM A;  3PIP A;  1D3B B;  3EFR A;  2KAF A;  3I55 T;  1YJN T;  1WJR A;  5GMK j;  4M77 E;  5CKD A;  3JCM X;  2P0Q A;  3JCM P;  3M56 A;  4C0D C;  1NZ9 A;  2D6F A;  5LJ3 d;  1PSF A;  4N4G A;  4MMK A;  3M5A A;  2KSS A;  3OS2 A;  3OSV A;  2E1H A;  2E70 A;  2JTF A;  2X4J A;  2QQ9 A;  2WSC E;  4L59 A;  3JCM b;  2BUD A;  4DOV A;  4M78 B;  4RCC A;  4ATO A;  1M4Z A;  2DEQ A;  4OMF B;  4Y28 E;  2ZPG B;  2VXF A;  2XDB A;  4EMK A;  1RL2 A;  4M77 F;  1P92 A;  3L42 A;  4LDU A;  4M78 F;  4LD9 K;  5KCO A;  3LGF A;  3DB3 A;  4EMK C;  4ZTJ A;  1JJ2 S;  3NFC A;  1QVF A;  1TH7 A;  2QQS A;  4M75 E;  3JCM f;  1G3W A;  1VUB A;  1WPY A;  4QW2 A;  3OYJ A;  1N9R A;  2DO3 A;  1VQ7 T;  2DXT A;  3VJP A;  4PJO A;  3OYK A;  2LCC A;  4QVZ A;  1D3B A;  3Q1J A;  3CC2 A;  4Y91 A;  3SB2 A;  3MEW A;  5C0M A;  3DKM A;  1VQL A;  1SSF A;  1UGR B;  4II1 A;  1FXX A;  1VQL T;  2RJD A;  2HD0 A;  3V7R A;  1VQP T;  1KC8 U;  3PNW C;  1BI0 A;  2E12 A;  3RES A;  1VQ4 A;  2QA4 T;  2EKO A;  5DY9 A;  5LJ5 j;  1KQS S;  2KDS A;  3MP8 A;  3OS5 A;  4X9D A;  1BI2 A;  1YJ9 T;  3MEU A;  4M75 D;  4ELY C;  2LDM A;  4HT8 A;  1Y71 A;  3BDU A;  4OP0 A;  2KQW A;  3PIO A;  4PJO G;  5CQY A;  3X26 B;  5J3B A;  2VUB A;  3JB9 I;  2VGM A;  5GAM d;  5LL6 S;  3QDR B;  2QEX A;  3JB9 H;  3QPH A;  5GMK m;  4LD6 A;  1XQH A;  3CCQ T;  4N0A C;  3OB9 A;  4PJO B;  1I81 A;  2NLU A;  4M7A G;  5GAO m;  5FU6 C;  1VQM A;  4BI3 A;  2LTO A;  4PJO F;  5GAO q;  2LQ8 A;  3UWN A;  2M1H A;  2XHC A;  3E9G A;  5EG2 A;  4EPC A;  4B9X A;  4QVC A;  3DB4 A;  2RHU A;  3VUB A;  1ZHI A;  1WGS A;  3A8G B;  3M58 A;  2A3L A;  2XDD A;  3OYG A;  4E7J A;  4E7I A;  1VQ9 A;  2E6Z A;  3NTH A;  5A0D A;  1VQK T;  4BB7 A;  2FYK A;  2LT4 A;  4E7K A;  2QEX T;  2PVO B;  1KQS A;  4OGE A;  4ZTF A;  2JOY A;  2P0P A;  3M53 A;  4IUU A;  3T9N A;  3BDL A;  4M77 A;  2H3J A;  4ZGJ B;  5GAN 7;  3I56 T;  4C5E A;  2FL7 A;  5CAI A;  2ZPE B;  4ME7 A;  4C92 C;  1K9M C;  2OTJ T;  3CCM A;  2QXF A;  4BY6 C;  5LJ5 f;  5GAN 5;  4DQ2 A;  3CCM T;  4O6J A;  4ZGD B;  2E65 A;  3QII A;  4R56 A;  4HA8 A;  3C12 A;  4JRK A;  1UGQ B;  4JRQ A;  4IUP A;  3WVE B;  1JRI A;  2DXC A;  2RD1 A;  3RUX A;  1VQ8 A;  2A7Y A;  3QYH B;  4M77 G;  3PMI A;  3MET A;  4V2S A;  3A8O B;  1Q7Y C;  2CZ1 B;  3CXC A;  3CCR A;  1HXD A;  3CC4 T;  4OVA A;  2C06 A;  1VQO T;  4BDY A;  2XI9 A;  4BAC A;  2VYT A;  2GF7 A;  1G3S A;  1PSE A;  2JVV A;  3OYC A;  1IRE B;  2P4T A;  4IUV A;  2QI2 A;  1KHC A;  2XU8 A;  2XG8 D;  2K5I A;  2XKO C;  3ME9 A;  4J7F A;  4M75 F;  1I4K 1;  1OZ3 A;  5D6Y A;  3OW2 S;  3OYL A;  4M7A F;  4C92 G;  3JCM d;  3A8M B;  3HHT B;  3V8L A;  2MAM A;  4QQ6 A;  4BE2 A;  2EFI A;  3P8H A;  3GLX A;  3NTI A;  4M78 E;  3CCQ A;  3MP6 A;  4LDW A;  1IZ6 A;  2D0Q B;  1QVF S;  1H3Z A;  3MP1 A;  4M7D B;  1YIT A;  3SWN A;  2MWO A;  2RI3 A;  2YRV A;  2ZPH B;  4QVD A;  5IAY A;  3HPW A;  2PVG B;  3JSC A;  3OYE A;  3CCS T;  2DIQ A;  3OMC A;  4C8Q D;  3CCS A;  2K4Y A;  2HAX A;  4JJN K;  5GAN 4;  2CZ6 B;  4M75 C;  2KK4 A;  4N0A A;  2GFU A;  4F7U F;  3RIR A;  3CBO A;  4A4K A;  2GQV A;  4EDU A;  1LNX A;  2L89 A;  2CYZ B;  2R5M A;  5FU7 B;  2OTJ A;  1VQ8 T;  3M57 A;  4M75 A;  1VQ4 T;  3OYD A;  3L2R A;  1OYX A;  2CKK A;  1W2B A;  3J80 E;  3I56 A;  2JN0 A;  1OZ2 A;  2E64 A;  3RKW A;  4ZN3 A;  4OGC A;  5HKC A;  2LNV A;  5GAN 2;  4HKE A;  4M78 D;  3V8J A;  3QJY A;  4A4E A;  1KD1 U;  3MEA A;  4RG8 A;  4C0Z A;  1BYM A;  3RKY A;  3V8K A;  3CCE T;  1LOJ A;  4UC4 A;  5J26 A;  4RKU E;  4C92 D;  3OYH A;  1FX7 A;  3QHS A;  3A8L B;  5LJ3 g;  3OYB A;  5LJ3 j;  2EQU A;  2M9U A;  2JNG A;  4M7D A;  2DJZ A;  1LJO A;  4J83 A;  1BIB A;  1Q82 U;  3CMA A;  2R58 A;  3HFN A;  4NS5 A;  3VYG A;  4F7U B;  4E7H A;  2QQB A;  3CCV A;  3FDR A;  5CK9 A;  3J81 E;  2X4W A;  4C8Q F;  3FEO A;  5I2M A;  2RHZ A;  2RJC A;  3LWH A;  1WQ7 A;  4XAX B;  3CCU T;  1Q7Y U;  3QZ5 B;  1NJI C;  3DLM A;  4KUL A;  4C5I A;  4M7A C;  3OBW A;  4KUD K;  3LLR A;  4C8Q C;  1K73 U;  5GAN f;  4C92 F;  4HCB A;  3BW1 A;  2MMP A;  4N4H A;  1YHQ T;  4JLI A;  3CC7 T;  3DLL A;  2M16 A;  2EAY A;  4XK8 E;  3GOX A;  1VQ5 T;  1VQ6 T;  3OYI A;  4F7U G;  3CME A;  1QP2 A;  1Q81 U;  4LDX A;  4M7A B;  3G71 A;  4BI4 A;  1BKB A;  1XTD A;  1N8R C;  4EMG A;  1Y7X A;  3E19 A;  2ZZD A;  3GNG A;  2DD5 A;  2RM4 A;  1YJW T;  1KQ2 A;  3CCU A;  2K2V A;  2IVW A;  4XU0 A;  5A0G A;  4PJO C;  3OA6 A;  3CC2 T;  2MF2 A;  2L5Q A;  2JZ2 A;  5CKH A;  4X34 A;  2ZPB B;  2RI5 A;  5IT9 E;  4NL2 A;  2QA4 A;  2RJE A;  2DTO A;  4XTW A;  2M0O A;  3X25 B;  3OQ5 A;  4LDV A;  3CPW A;  1VQP A;  1K8A C;  1VQN T;  5IN1 A;  2XDP A;  4MDW A;  3QO3 A;  3SWN B;  1NJI U;  1UGS B;  2EYQ A;  2JTM A;  3HRU A;  1S72 T;  5CO7 A;  1DJ7 B;  2E5Q A;  3SWN C;  3GIB A;  5J39 A;  3QBY A;  3JCM e;  2XD0 A;  3M54 A;  1U1S A;  3V7S A;  2G3R A;  3A5Z B;  3CXC S;  2AHJ B;  3G4S A;  1G3T A;  1U1T A;  1WQW A;  4M75 B;  1QVG S;  3JB9 D;  1M9S A;  1BI1 A;  4RG2 A;  2P0K A;  1KHI A;  2LT1 A;  3VUZ A;  4RMO A;  5GAN g;  3PT9 A;  1B34 B;  3FLG A;  5LJ5 d;  4IKF A;  3RMQ A;  5KE3 A;  1G3Y A;  2K5F A;  2RHI A;  3MCA B;  2XID A;  4TVR A;  1XOV A;  4X9C A;  3R6O A;  3UDC A;  5M9O A;  4MDX A;  2WSF E;  4O5V A;  4XU2 A;  3OY9 A;  2ZCF B;  2KMT A;  2IG0 A;  3CCL T;  4YTL A;  3RKX A;  4C0D B;  4DA4 A;  2DK3 A;  2V8K A;  2VGN A;  2DZC A;  2EJF A;  3KUF A;  2OTL T;  3HRS A;  2F69 A;  2KVQ G;  3C94 A;  4M75 G;  2LQK A;  2PUK B;  4FT4 A;  2DXU A;  2L8D A;  3JCM g;  1YIJ A;  2RH2 A;  1YCY A;  1Q81 C;  4C92 E;  5GAM e;  3M4G A;  5KH6 A;  3ZFJ A;  2RI2 A;  4J7I A;  2QTX A;  4R55 A;  3I55 A;  4VUB A;  4M78 A;  4A4G A;  1ZBX A;  3C95 A;  3LX7 A;  4MML A;  3URG A;  1M8V A;  4EMK B;  2LRQ A;  3M4Y A;  2RK1 A;  3HRT A;  4FL6 A;  4M77 B;  3FIF A;  1MGQ A;  2ZPF B;  4L5G A;  3E9F A;  4OB0 B;  3SFM A;  3X24 B;  3FC3 A;  3UPU A;  2DTH A;  3H6Z A;  4PKC C;  2YLB A;  4C8Q G;  3H8Z A;  5KE2 A;  3L2Q A;  2QQA A;  5DLQ E;  5GAO l;  1WNL A;  3TU4 K;  2RHX A;  4FSX A;  4WF2 A;  4Z02 A;  1NPP A;  2BIV A;  2PQW A;  5LJ3 e;  5L8R E;  3CME T;  2QQR A;  5GAN j;  1M90 C;  1M90 U;  3RER A;  1WJS A;  5GAN 3;  4OB2 B;  4KBM B;  1EIF A;  3OYF A;  3CC4 A;  5LJ5 h;  3SD4 A;  2BKD N;  5CR2 A;  1ZQ1 A;  2E10 A;  1X75 C;  1N8R U;  4IUT A;  3S3M A;  4E47 A;  2DVE A;  3OS1 A;  5CQX A;  5GAO r;  1YIT T;  1NE8 A;  4J6Y A;  5GAN d;  3QJ6 A;  3CCE A;  1I5L A;  1UEB A;  4F7U E;  2FB7 A;  4MZT A;  3S3O A;  3OBY A;  3MO8 A;  1H64 1;  5FU6 B;  2R57 A;  1BIA A;  1N9S A;  3LW5 E;  2V8J A;  1W4S A;  5LJ5 e;  3VKI A;  4A4F A;  1VQ5 A;  1OI1 A;  2K3Y A;  1VQ6 A;  1QW1 A;  4M77 D;  5FRN A;  4OB1 B;  3OYY A;  5I2S A;  2EQK A;  1YJW A;  4HT9 A;  4C8Q E;  1VQO A;  4M7D G;  1VQ7 A;  4C5H A;  4NL3 A;  3E1S A;  2Y4X A;  3HKS A;  1Q82 C;  1VQK A;  1UGP B;  3J7A F;  4XTZ A;  1KG1 A;  2L3R A;  3WXM B;  3QSU A;  5HK0 A;  2ZPI B;  3LWI A;  2DPP B;  3S3N A;  3PGG A;  4C0F A;  3CC7 A;  1R8O B;  1UB4 A;  4JS5 A;  4BY6 B;  4JUV A;  2K57 A;  1X6O A;  5D6W A;  3P8D A;  5HK3 A;  3G71 T;  3CCJ A;  4BE1 A;  3CBP A;  3JB9 G;  2LCL A;  2DKG A;  1Y96 A;  3LGL A;  1RI0 A;  4XTX A;  4PJO E;  3QYG B;  3FJP A;  2I2L A;  3X20 B;  3JCM V;  2K5L A;  4NOY A;  3VV0 A;  4JRP A;  3HSB A;  2XK0 A;  1NPR A;  3V7C A;  2B8A A;  2QDY B;  3TEE A;  4BI8 B;  4BD3 A;  4HCZ A;  3CPW S;  5GMK i;  1V29 B;  2PU9 B;  2LX9 A;  2DD4 A;  2YLC A;  3JCM h;  1VIE A;  5GAO p;  1BI3 A;  3S6W A;  2RK2 A;  1M1G A;  1K8A U;  4RCB A;  5CKE A;  4M7A D;  4M7D E;  3JRZ A;  1WJQ A;  1O75 A;  3NTK A;  3X28 B;  2WSE E;  2DXB A;  4PLI A;  5FRM A;  3P8B B;  4GY5 A;  3JCM c;  2D9T A;  3CD6 A;  4JS4 A;  1S72 A;  3GPL A;  2LC4 A;  3QUI A;  4M77 C;  3OYM A;  2EJ9 A;  3QG1 A;  3ASK A;  3CPF A;  3CCR T;  2R5A A;  2PVD B;  2OAU A;  3KXT A;  3G4S T;  1YI2 A;  4PJO D;  1AHJ B;  4IUQ A;  3MEV A;  4XTV A;  5GAN h;  2E6N A;  4FT2 A;  4PLL A;  5GAM h;  3L2W A;  1Y96 B;  1K9M U;  4A4H A;  4A54 A;  5FLX E;  5DM7 R;  3CMA T;  1MHN A;  3GNF B;  5GAM j;  2DTI A;  5GAM g;  2X35 A;  2EQJ A;  2HQX A;  2Y90 A;  3O8V A;  4OB3 B;  3VYH B;  1VIF A;  2DZ9 A;  2HNI A;  3LYI A;  5GMK l;  1W2B S;  2RO0 A;  5KCH A;  3GF5 A;  4JDS A;  1XNI A;  2CS7 A;  2O4X B;  4J8O A;  5D6X A;  4D6W A;  2VV5 A;  1K73 C;  3JB9 F;  2ZGW A;  4A53 A;  4ELZ C;  4QQG A;  1JBM A;  4C5G A;  4QQD A;  5A0L A;  4CI0 C;  1QVP A;  5GAN 8;  3C4S A;  3G6E T;  1YHQ A;  4J6X A;  1YI2 T;  4PL6 A;  2KY9 A;  1KQ1 A;  1QP3 A;  2F5K A;  4C92 A;  1YIJ T;  1Q86 U;  3ZEH A;  5GAN e;  2E41 A;  3F70 A;  3QKJ A;  1VQM T;  2GFA A;  3CCV T;  3JB9 J;  3JCM J;  3N5B B;  5DLO A;  5FU7 C;  1X01 A;  3HFO A;  5FRO A;  3M59 A;  4C8Q A;  5C6S A;  2RA2 A;  3HP9 A;  3CCL A;  3L1A A;  4PNO A;  5LJ5 g;  4ZGE B;  3ZBD A;  1KD1 C;  2RB6 A;  1M1K C;  4M7D F;  3M9Q A;  2DAQ A;  3PFS A;  4BE0 A;  1YJN A;  3EAE A;  4M7A E;  2O4X A;  2XIC A;  2HBP A;  2F5T X;  1I8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...