1I0CA

Eps8 sh3 closed monomer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8
publication title Effect of pH and salt bridges on structural assembly: molecular structures of the monomer and intertwined dimer of the Eps8 SH3 domain.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i0cA00
2D8HA 1OPKA 3M0UA 1BK2A 1M3CA 2O88A 1VYVA 3CQTA 4ORZA 4RTVA 5I22A 1X27A 2CUDA 1PKSA 2GGRA 4FSSA 4J9DA 2DRKA 2RMOA 4CC7A 2BTTA 2H8HA 2DF6A 2DM1A 2YT6A 4AFSC 1AEYA 2JS0A 2RQVA 2DBMA 2KT1A 3I5RA 1GCQC 1Y0MA 4JZ4A 1JO8A 2K6DA 2K79A 3VS5A 2JM8A 1K0SA 1ARKA 1W1FA 2L3QA 3UA6A 2J6KA 2JM9A 1QLYA 2O31A 2OJ2A 3FJ5A 4IIMA 4JJDA 2RQRA 3PVLA 3NMZC 2JTEA 2DL5A 2EYZA 1YN8A 1AZGB 1MUZA 4RTXA 1U5SA 1ZX6A 2GTJA 1ZBJA 2YSQA 1UTIA 2BZYA 5FW9A 3M0SA 2DL4A 4J9BA 3GBQA 4RTYA 1UDLA 1H8KA 1WLPB 4JJCA 2JMCA 2EGEA 2M0YA 1G83A 1YWOA 4A63B 2LQWA 3VS1A 1ZUKA 2AZVA 3EHQA 4EIKA 2MIOA 2DL3A 4J9GA 3NPFA 2LMJA 3H41A 2KNBB 1S1NA 1VYTA 3A98A 5IHNA 2KYBA 5EC7A 1UECA 1B07A 3VS2A 4Z89A 2DLPA 1JU5C 2RQTA 1AWXA 1NYFA 3EHRA 4RTZA 1WA7A 4JZ3A 2JT4A 5IXFA 2LNHB 1ABQA 1M27C 3VS4A 2AKLA 1AD5A 3H0IA 2FG0A 2W10A 1KSWA 2FO0A 1FMKA 1UHFA 1NYGA 2D0NA 4JPBW 2D1XA 1X43A 4ESRA 2J7IA 5IHIA 1TUCA 4J9EA 4F17A 1YP5A 3O5ZA 1M30A 1M3BA 1XOVA 4CC2A 2C0TA 1A0NB 2RNAA 2LJ1A 1SRLA 4Y92A 2L0AA 3VRYA 1AWJA 1NLOC 1X6BA 1YNZA 2AKKA 2DJQA 2EBPA 2PTKA 4CC4B 3VS6A 5IHKA 1E6HA 2J6FA 1WI7A 1WX6A 1SHFA 2LJ3A 3NHNA 1SRMA 1I07A 2CT4A 1J3TA 4GLMA 1NLPC 2JW4A 2P4RA 2L3PA 1GBQA 1CKAA 1QCFA 3M0PA 2V1QA 1T0HA 2A37A 2GQIA 3EG1A 4RTUA 4RUGA 2OAWA 4DEYA 2DBKA 2RN8A 4ZNXA 1UUEA 2C0IA 2IIMA 1WXBA 1K9AA 2EYWA 1WFWA 3ZL7C 2CUBA 1GCQA 2EKHA 3TSWA 1UGVA 1AZEA 1OV3A 1W6XA 4WCIA 2FRYA 3THKA 2CREA 4J9IA 1ZLMA 2KR3A 3REAB 1SEMA 1CKBA 2J05A 2KT8A 4HVVA 2ESWA 1X2QA 2JXBA 2KEAA 2LQNA 3NGPA 4K11A 1MV3A 3VS3A 1FYNA 1B3QA 2SRCA 4J9FA 1SSHA 2EVRA 2BZXA 1BBZA 2HDAA 3KFVA 5L23A 2HEQA 2ROLA 2HBWA 2EYXA 2BZ8A 1H92A 3PVQA 3SHWA 1UFFA 1WYXA 2D8JA 2PZ1A 4OMPA 4AG2C 1NG2A 3U23A 2DNUA 2JS2A 4QT7A 1WDXA 2KE9A 3EG2A 1ABOA 1AVZC 2MCNA 3TSZA 2ABLA 2DILA 2KRMA 1TUDA 2NWMA 4DEXA 1RLPC 1KFZA 2JMAA 3QWXX 2DVJA 1H3HA 2VVKA 3ULRB 2FPFA 1GRIA 2A28A 2EGAA 3VS0A 2L2PA 5I11A 1NM7A 1W70A 1KJWA 4Z8AA 2O9VA 2RF0A 3EGUA 1JXOA 3UATA 2W0ZA 1TG0A 1Y57A 4J9HA 1ZUUA 5IXBA 2LCSA 1I1JA 3JV3A 3UF4A 2GTOA 2VWFA 1UJYA 1X69A 1PHTA 1N5ZA 2MOXA 4KRTA 2EYYA 4CC3A 4OMMA 3M0RA 4LNPA 2CH4W 1V1CA 2A08A 4HVWA 4F16A 2J6OA 1CSKA 4LE9A 1JXMA 1ZUYA 1UG1A 1ZSGA 4E6RA 1K1ZA 1E6GA 5FWBA 1HSQA 1G2BA 5GJWB 3RBBB 1OOTA 3PE0A 2PNIA 2ECZA 3LH5A 2B86A 2YUQA 2ED0A 3TVTA 1AWOA 2K7AA 2YUOA 2KXDA 2AK5A 2F2VA 2YDLA 3EG3A 4LUDA 4AG1C 1T3SA 1IO6A 3I9QA 1JEGA 2ROTA 4M4ZA 1RI9A 1T3LA 3IQLA 4OMLA 4OMNA 1AOJA 2SEMA 2A36A 1Z9QA 2DL7A 1OPLA 2VKNA 2KBTA 4GBQA 1QWEA 2CDTA 2RQUA 5HCKA 3REBB 1AWWA 1X2KA 1M8MA 2YUPA 2ENMA 4R0KA 1GBRA 1JQQA 2AZSA 2EGCA 1BB9A 4RTTA 5IH2A 1EFNA 1PNJA 2XMFA 2FEIA 2DA9A 1RLQC 2KROA 3UA7A 1GCPA 2FRWA 1M3AA 2E5KA 1HJDA 3C0CA 3R6NA 2GBQA 2NUZA 2I0NA 1KIKA 5FWCA 2EQIA 1OEBA 4IIOA 4Z88A 4LN2A 4HVUA 2CSQA 1U06A 2KRNA 1WXTA 1QKXA 1YWPA 2LZ6B 2KRSA 2QDLA 2O2OA 1HD3A 1K4US 1MV0B 1U3OA 2FPEA 1VA7A 2KGTA 2HSPA 2O9SA 1PWTA 1QKWA 1NEGA 2GNCA 1UHCA 3SEMA 1GFCA 1VYUA 3M0QA 1NEBA 2C0OA 2DRMA 2CT3A 1Z9ZA 3VRZA 2DMOA 2HCKA 1SHGA 1BU1A 5GJVB 2LX7A 3EG0A 1T0JA 2CSIA 4OMQA 1QWFA 3M0TA 4HCKA 2M51A 2DX1A 1PKTA 2DL8A 3RNJA 2LJ0A 1YCSB 1E7OA 2K9GA 1GL5A 4RTWA 4X1VA 5ECAA 2EPDA 1X6GA 2RQWA 4LUEA 2LP5A 2G6FX 1SPKA 1RUWA 1GFDA 2DYBA 2ED1A 1K76A 3QWYA 1WXUA 2K3BA 2X3XD 2EW3A 1LCKA 2F2XA 2KYMA 2X3WD 2FPDA 3VS7A 1PRLC 1WIEA 2YUNA 2RPNA 2DE0X 2KXCA 1UE9A 1UJ0A 2F2WA 4D8DA 2CH4A 1PRMC 1I0CA 4AFZC 2V1RA 3H0HA 3I35A 2L3SA 4JJBA 4D8KA 4F14A 3I5SA 4AFQC 1K0XA 2OI3A 4AFUC 4HXJA 4OMOA 3H0FA 4J9CA 2K2MA 2J06A
chains in the Genus database with same CATH superfamily
1VQNQ 4M78A 3M0UA 5D6YA 3CC7A 2IPOB 2CZ7B 1IB8A 2QTVA 5CKEA 2GGRA 3CCJT 1YIJA 4CC7A 4F7UE 2K4YA 2H8HA 1IHVA 2YT6A 2JS0A 2XG8D 2DBMA 2KT1A 1VQNT 4ELYC 3I5RA 5LJ5h 1GCQC 3M4GA 5KYNA 3G7ZA 2K79A 1K0SA 3CBMA 1ARKA 3CC4A 3CCRA 3UA6A 2L3QA 1U1TA 3P8HA 1QLYA 4PKCC 3BY7A 4J7IA 3RKWA 1BI3A 5KYUB 2VASA 4BY6B 3PVLA 3EGXB 4A4GA 3OYAA 2JTEA 1VQOQ 1VQ8A 1YN8A 1QMCA 5KYUA 3C4SA 4C8QE 1O9SA 1ZBJA 5CKFA 1MMNA 3M0SA 1NPRA 1VQ4A 2VV5A 4PLLA 4EPCA 3M9QA 5GAN3 1X75C 4Y91A 4B9WA 4IUTA 2BUDA 4R55A 1ZA1B 2DERA 2COYA 4XU3A 2FL7A 3UDCA 4LDXA 4A53A 3VS1A 1VQMQ 1QVGA 2EQJA 1VQOT 2MWOA 2E3IA 1RL2A 2MIOA 2DL3A 3JCMJ 2XDPA 2EIFA 4II1A 5D6XA 3E9GA 4AMCA 4B9XA 3E1SA 4HCCA 4PJOF 4M77D 5KCHA 3A8MB 3GLXA 4IUVA 1Q86C 4ZTFA 1VQMT 1JU5C 1AWXA 1NYFA 4JLIA 4DBHA 5GMKl 4JZ3A 4EMKC 3BDLA 2BKDN 4E7SA 4PJNA 2FG0A 2JN0A 1KSWA 3DB3A 4BACA 2FO0A 2RK1A 3OYDA 4JRKA 1X43A 1VQPA 1TUCA 3MEVA 3SD4A 4CC2A 2RNAA 5A0GA 1BI0A 1SRLA 4Y92A 4HKEA 4KGVB 1QVGS 3VRYA 2ZAEA 1NLOC 1X6BA 2PTKA 1NJIC 4JRQA 2YLBA 5IHKA 1E6HA 2OX7A 1WI7A 1WX6A 3NHNA 1OX8A 1SRMA 2CT4A 4GLMA 1NLPC 2P4RA 5D7UA 4ATOA 5FLXE 1CKAA 1N8RC 3MEUA 2CP3A 2A37A 3VUZA 5LL6S 4RTUA 2OAWA 4D6WA 3TU4K 2IIMA 2K5FA 2ZZDA 3PFSA 3DB4A 2KY9A 3CCEA 1RADB 2O4XA 1KQ2A 3HP9A 4XTVA 3A8LB 2CUBA 2DXBA 3LWHA 1YITA 2RHXA 3LX7A 3M58A 2KR3A 1TTHB 3REAB 3V7RA 3DLMA 1WGSA 1CKBA 4M78F 3VYHB 5LJ3d 1XQHA 4KULA 1D1AA 2DJZA 4K11A 2XU8A 4NL3A 1B3QA 2RB6A 3EH2A 3OS5A 2M16A 4C0GA 4IKFA 5GAMg 1BBZA 3KFVA 3GF5A 3JCMb 3JCMe 2HEQA 5GAN6 1K8AU 2XIDA 4FYVB 5LJ5f 1D0XA 4FCYA 1VQ9Q 1YJNA 3PVQA 1OULA 1UFFA 2RM4A 1R77A 1NG2A 1IXDA 2GQVA 2L5QA 2PUOB 2DZ9A 2QASA 3X24B 3EG2A 1ABOA 4KH1B 2ABLA 2DXTA 2LC4A 2KSSA 4LD6A 1ZHIA 1KQSP 1TUDA 1AHJB 1VQ9T 2K57A 3OSVA 1RLPC 1K73R 1YCYA 3QWXX 2FPFA 3VS0A 1RAAB 3L2RA 4MZPA 1VQNA 3JCMW 4Z8AA 2CZ1B 3CPWA 2RF0A 3FRNA 3EGUA 3X20B 1JXOA 5IAYA 1TG0A 1Y57A 1ZUUA 4RG8A 1PSFA 1B34A 3JV3A 3UF4A 3HFNA 4XK8E 1KHCA 2MOXA 4KRTA 2EYYA 4OMMA 4HVWA 4F16A 3SWNB 2J6OA 1WZOA 2DTHA 4ZGJB 4M77B 3HPWA 1UG1A 1K1ZA 3SWNA 4C0DB 1E6GA 1HSQA 3RBBB 5GANd 3L2QA 4M77A 2KI7A 2QG9B 4KUIA 4C92D 2PNIA 3MEAA 2ECZA 2KDSA 4L59A 1VQOA 2ED0A 3TVTA 1PC0A 3E9FA 4M75D 4BUGA 2ZPEB 3JCMQ 1D0YA 3OYFA 3CPWS 1FMWA 4M7DC 1RI9A 1OU9A 5GANj 4J6XA 1PCXA 1VQMA 4OMLA 4PK4A 4BDYA 2DO3A 2DL7A 1W2BA 1OX9A 2CDTA 2RQUA 1AWWA 1X2KA 3NTIA 1FXXA 1M1GA 5FRMA 4XAXB 4BE1A 2NYSA 1GBRA 1VQLQ 1VQ6Q 4XU2A 2XMFA 2FEIA 3UPUA 3ZEHA 1GCPA 3X28B 1HJDA 3CXCP 3VUBA 1G3TA 1NBEB 4AT1B 4J6YA 3MP6A 2CYZB 3A8GB 3G4SQ 5IT9E 1I8FA 4UC4A 4R56A 2HQXA 1OEBA 1PG5B 4IUUA 1VQLT 1VQ6T 2LZ6B 1UGRB 3FJPA 1UGQB 2O2OA 1K4US 1MV0B 1OZ2A 4LDWA 2DYIA 2HSPA 2RK2A 1Q81C 2O9SA 4LDUA 3G4ST 3CC4Q 4IUPA 3CCRQ 4FW1A 2D0QB 3OYIA 1FMVA 3SEMA 2Y90A 1GFCA 2HL3A 2QYZA 3MO8A 2WSEE 2D9TA 1NEBA 1Z9ZA 2CP2A 5CQYA 3PIOA 5GMKe 1QWFA 4DBRA 2Z0WA 1M90C 5GAN8 2DL8A 1KK7A 1YCSB 3RNJA 1RAIB 3MCAB 4E7ZA 1D1BA 3RUXA 3CC4T 5GAOn 3CCRT 1RI0A 1WQ7A 3V8JA 2RJCA 2LX9A 3LGFA 1RUWA 1GFDA 4XTYA 2DYBA 4P5NA 1K76A 3OYNA 4PJOE 1WXUA 1Q7YU 2F2XA 1D0ZA 2X3WD 2EQKA 3VS7A 1S72Q 4WF2A 2JTFA 3CCUA 4TVRA 4HCBA 2RPNA 1M4ZA 1UJ0A 1X01A 1LPLA 2V1RA 3H0HA 2L89A 4F14A 5FU7C 1LJOA 1M1KR 1Y7XA 1K9MU 1P92A 2EQUA 3MHXA 1S72T 1M3CA 3RIRA 1VQ9A 3CQTA 4ORZA 5I22A 1KD1R 3VYGA 1X27A 3OBYA 4N0AA 4DOWA 1TWBA 4J9DA 2RMOA 1N27A 2BTTA 4M77F 2DEQA 2KQWA 1RAFB 1AEYA 2PQWA 2RQVA 1M2OA 2LVMA 3URGA 1JB0E 3AT1B 5DM7R 3EFSA 2JM9A 3G1JA 4C92B 3G71A 3FJ5A 4IIMA 4JS5A 1Y96B 4M75B 4O6JA 4C92A 1MMGA 4QKUA 3OW2A 2COWA 5DLQE 3JB9G 3OYJA 4RTXA 3CCEQ 1U5SA 2QQRA 5I2MA 1Y96A 1XNIA 1UTIA 4M75A 3GNFB 5CKHA 4RTYA 5CKBA 4JJCA 7AT1B 3QZ9B 2EGEA 1I5OB 3OA6A 1YHQQ 5GAN7 2XI9A 4GLKA 4O5VA 5C6SA 3HL8A 4EIKA 1LVKA 3CCET 2VYTA 1Q82C 2ZPIB 2XKOC 3EGDB 4FYXB 5GAOl 5CCAA 1ZSZC 4BI3A 1UB4A 2V8KA 4BDZA 2QEXQ 3KUFA 1OQKA 1ZQ1A 1TSFA 3WVDB 1YHQT 4F7UG 4EDUA 1ACMB 2B8AA 4MZTA 3EHRA 2R5AA 1WA7A 5IXFA 4M7AC 3QG1A 3MP8A 1M27C 2HKNA 3VS4A 1WPYA 1YJNQ 3H0IA 3J81E 3V8LA 3KBGA 1Q7YR 3OW2S 2X4YA 2QEXT 3OS1A 3CCLA 5HKCA 1UHFA 3CPFA 2RHIA 4ESRA 4FL6A 4F17A 4BB7A 1IZ6A 1Y07A 2JVVA 1M30A 1M3BA 1A0NB 2LJ1A 1X6OA 1YJNT 4C8QG 1AWJA 2AKKA 2EBPA 2DJQA 2EAYA 3RMQA 3EFRA 2XICA 3JCMd 1K9MR 4JDSA 3VS6A 1VQ6A 4F04B 1J3TA 1I07A 2CP6A 2JW4A 2L3PA 1N9SA 5GMKm 1JRIA 3QYGB 3T9NA 1T0HA 2GQIA 2RO0A 4MDWA 2RJFA 3G4SA 4DEYA 2DBKA 3OYCA 1UUEA 1HYOA 1KC8R 4HA8A 1HK9A 2EYWA 4Z02A 3ZL7C 3QIIA 1GCQA 2EKHA 1M9SA 2G3RA 1W6XA 4WCIA 2FRYA 4EMHA 3F70A 4M78C 1OYXA 2MWPA 1VQ5A 4QQ6A 2OTLA 4HVVA 1TOVA 1UGPB 2GCXA 2EQMA 2JXBA 2KEAA 2QGGA 3L1AA 4C5EA 2LQNA 3EG9B 4J9FA 3QXEB 3EG9A 3EGXA 1D1CA 5L23A 2ROLA 4BD3A 1QCNA 4OGCA 4PJJA 3OMGA 2EYXA 2RD1A 4JS4A 4FT4A 4OMPA 4AG2C 2JS2A 2HL5C 3P8BB 2YLCA 1VIEA 4C5GA 1S72A 2F5KA 3JB9H 1WDXA 3RKXA 4C92F 2KE9A 1C1AA 3J80E 5KYYB 4DOVA 1G3WA 2V8IA 4EMKB 3S3OA 4M75F 2DILA 2NWMA 4XU0A 5IN1A 5KYYA 2MK5A 3PT9A 2CP0A 4EMKA 2DVJA 1K73U 2LQ8A 2NUPB 2A28A 4PJMA 4E2FB 3BE3A 2MI6A 5GAMe 4HT8A 2R57A 1KJWA 3M53A 2E4HA 3LW5E 2NUPA 2O9VA 2BIVA 5FROA 3RESA 2W0ZA 1PD1A 1QVFP 2ATCB 3QJYA 3VV0A 2DTOA 2HZYA 1I1JA 4ANJA 3JCMc 2M02A 1NJIU 3HHTB 3JCMV 4N4HA 4V2SA 3OQ5A 3V7CA 4CC3A 2PU9B 5GANh 1V1CA 4ZGEB 4IURA 4LE9A 1PD0A 5FRNA 4M7DG 1JXMA 4XU1A 1ZUYA 3JB9I 1ZSGA 5FWBA 1G2BA 1OOTA 2LCLA 1WJQA 1RACB 4CRIA 2B86A 2YUQA 4J83A 8AT1B 1AWOA 2AHJB 2YUOA 3HTRA 4QQDA 4OMFB 1H641 2F2VA 3EG3A 4RKUE 4LUDA 3FIFA 3DKMA 5CIUA 4C8QC 3TREA 1IO6A 2E41A 2HMAA 2VUBA 2V8JA 4M4ZA 1PM3A 4BI4A 1YHQA 4OMNA 5KH6A 3CCUQ 3GNGA 2QTXA 3L2ZA 2VKNA 2LTOA 1QWEA 2DK3A 2X35A 4XTUA 1WHLA 1BKBA 2QEXA 2ENMA 2Y4YA 1UGSB 1EX4A 3QDFA 3M56A 1ZBXA 5D6WA 2D6FA 1PNJA 3CCMA 2KROA 3MEWA 3CCUT 3M5AA 4M77E 3C0CA 2GBQA 5GMKj 4ZN3A 5LJ3j 1KIKA 5FWCA 4IIOA 2QQBA 2KRNA 1Q86R 1WXTA 2V26A 1QKXA 2LNVA 2KRSA 4KT0E 1U3OA 4E7IA 2PUKB 2CS7A 3PNWC 1PWTA 2X51A 1NEGA 1WNLA 1K8AC 2M9UA 3L2WA 2E12A 2OTJQ 5CO7A 2RI3A 3G71Q 2E65A 2CT3A 3FEOA 1FX7A 2DMOA 1SHGA 2ZPBB 5KYXB 2LX7A 1G8XA 4OMQA 4HCKA 1WJSA 2ZGWA 1NJIR 5KYXA 1E7OA 4RTWA 2QI2A 1MGQA 4FSXA 2OTJT 1N8RR 3MKDA 2KK4A 3G71T 2JOYA 3META 3HSBA 2ED1A 2E70A 2A7YA 2VB6A 3QWYA 2EW3A 1LCKA 1KG1A 3M54A 5A2QE 5L8RE 1KQSA 2CH4A 1I0CA 3CBOA 4AFQC 1K0XA 4HXJA 4M7DB 2RHZA 5CAIA 2RI5A 2XK0A 2K2MA 1M1KU 5GANf 3J7AF 4A4KA 1BK2A 5GAOp 1WQWA 2DD4A 4ME7A 4RTVA 3CCLQ 2K3XA 1NPPA 3CCSQ 1KD1U 2DRKA 3C12A 1UEBA 4PFZA 4LD9K 2DM1A 4AFSC 3GIBA 2DXCA 1YJ9A 3SB2A 4N4GA 5HK0A 2Y4XA 2K6DA 2PVGB 4M7AD 2JM8A 3CCLT 2FVUA 3PGGA 4OB0B 3CCST 1SSFA 4E7HA 4A4HA 2OJ2A 1KQSS 3QUIA 4JJDA 2RQRA 4PJOG 1QCOA 3SDZA 2ZPHB 3NMZC 4E7KA 3QZ5B 2CZ6B 2GTJA 3H6ZA 5FW9A 2BZYA 4DBQA 2DL4A 2EJGA 4J9BA 3GBQA 1C0MA 3OBWA 1LOJA 1JJ2P 3JRZA 3M4YA 1UDLA 1H8KA 1WLPB 2RA2A 2JMCA 4BI8B 2M0YA 1M1FA 4M7AG 1YWOA 4A63B 2LQWA 3HFOA 3DLLA 1VQ5Q 2A0FB 3I55A 1ZUKA 2OTLQ 4MDXA 2AT1B 1W2BS 1RABB 4J9GA 3NPFA 2QK0A 2E3HA 2FHDA 2LMJA 4C5IA 2X4XA 4BE0A 4DQ2A 5IHNA 3CCVA 1IREB 2KYBA 2R58A 2LT1A 1UECA 2EJFA 3NTHA 2H3JA 4L5GA 3RR6A 1WHJA 1IHWA 4KUDK 4NS5A 2DLPA 1VQ5T 2RQTA 4IUQA 3CXCA 2OTLT 3GP8A 2M1HA 4JUVA 4PLIA 4C92E 2W10A 5A0DA 5LJ5e 2DZCA 1VQKA 1MMAA 1FMKA 4M75E 4JPBW 3QKJA 3JCMh 5FU7B 2KMTA 2HAXA 1WJRA 5IHIA 4J9EA 1YP5A 1R0CB 3O5ZA 1QVPA 2P0KA 2HNIA 1BCMA 2L0AA 1YNZA 1D3BB 3V7SA 1VUBA 2J6FA 4C5HA 2LJ3A 4M78G 2RJEA 3EFOB 1D3BA 2HSEB 1QCFA 5EG2A 1KQ1A 3EG1A 3EFOA 3CCQA 1Q7YC 4BE2A 4RUGA 2RN8A 4ZNXA 4QW2A 2C0IA 1I81A 2HBPA 3JB9D 3CXCS 1K9AA 4QQGA 1WFWA 1KC8U 3TSWA 5GAN2 1M5Q1 1UGVA 3INZA 1AZEA 3THKA 1F1BB 1ZLMA 5CQXA 5GAMd 2OTJA 2VXEA 2E1HA 2DAQA 2ESWA 2F69A 4PJLA 3V8KA 3NGPA 1MV3A 3VS3A 1Q81R 3S3NA 1SSHA 4JRPA 1H3ZA 2EFIA 2BZXA 2HDAA 1WHGA 5J3BA 3OYMA 5LJ5g 2YHTA 4FYWB 4X34A 5GAN4 3S3MA 2HBWA 4OB3B 5GAMj 3JCMP 1H92A 4OB1B 3RKYA 2NLUA 1QQJA 1ZSZB 3C95A 3SHWA 1WYXA 2D8JA 4FT2A 5CK9A 1M90R 3U23A 1IGQA 2DNUA 3A8HB 4QT7A 5HY6A 1ZSZA 2WACA 4PJOC 3RDVA 3MP1A 3R6OA 4M7AB 3O8VA 5CVIA 3EGDA 2JUFA 1U1SA 2DFUA 4PNOA 3CCMQ 3QBYA 3OYGA 4DBFA 4C8QD 1H3HA 4EMGA 3ULRB 2L2PA 5I11A 2FZCB 2JNGA 5FU6C 3HRUA 3OS2A 3CBPA 4YTLA 1WHMA 1QW1A 3UATA 2PVOB 5KE2A 3CCSA 4J5YA 2LCSA 2GTOA 3CCMT 2MMPA 2VWFA 2K3YA 1X69A 4OP0A 1N5ZA 2DEUA 2JTMA 2P0QA 4FU6A 2QGFB 3M0RA 4LNPA 2CH4W 5J39A 2BE7D 3QJ6A 2QAZA 1CSKA 2RHUA 5GJWB 3PE0A 2QQAA 3I56Q 2X4JA 3CC2Q 3LH5A 3JCMf 1MHNA 3OYHA 2QXFA 3WVEB 3LH0A 2F1LA 2KXDA 2AK5A 2YDLA 5GAN5 2VC8A 2QDYB 5GANg 3CD6A 5HK3A 5GMKh 1BIAA 1T3SA 5LJ3h 3I9QA 1JEGA 2ROTA 1T3LA 3I56T 3CC2T 1QVGP 3JCMX 2A36A 1Z9QA 5GAOq 2KBTA 5HCKA 3REBB 3E2UA 2YUPA 1B7TA 4Y28E 2E6ZA 2GFAA 2XD0A 2EGCA 1G3YA 1BB9A 1EFNA 1N6AA 4XTXA 2DA9A 1Q82R 3UA7A 3VKIA 1YJWA 2FRWA 1OI1A 1XTDA 1AT1B 2NUZA 1MNDA 2DKGA 2EQIA 4Z88A 2C06A 4RMOA 4LN2A 2CSQA 1U06A 4QVZA 1Q86U 1EZZB 5M9OA 2QDLA 1HD3A 4BY6C 2QA4A 1YJ9Q 3QDRB 2FPEA 5J26A 3H9NA 1QKWA 1UHCA 1TXQA 1I5LA 2LRQA 2C0OA 3MPUB 2DD5A 4M7DD 3VRZA 3EG0A 1YJ9T 3PMIA 3ZBDA 3M0TA 2VGNA 5AYFA 4OGEA 4HT9A 4F7UB 3GOXA 5I21A 4X1VA 5ECAA 3WXMB 1X6GA 2RQWA 2JZ2A 4F7UA 2K2VA 3OYKA 2HQEA 2RHYA 4J8OA 4M7AF 1GXIE 2E10A 1N8RU 3I55Q 2X3XD 1K73C 2KYMA 2FPDA 1PRLC 2RI2A 3OMCA 1RAHB 2YUNA 4M77G 1SG5A 3CMAQ 4FIBA 3CCVQ 2KXCA 1UE9A 2F2WA 4D8DA 1PRMC 4AFZC 4C8QB 3I35A 2L3SA 4JJBA 5DY9A 4D8KA 3M55A 3I5SA 2QQSA 3I55T 4OMOA 3H0FA 4J9CA 4C8QA 3HKSA 1VQ7Q 2D8HA 1OPKA 2KAFA 3CMAT 1M2VB 2O88A 1VYVA 3CCVT 2O4XB 1VQKQ 2IG0A 1QVFA 4QVDA 3OS0A 2CUDA 1PKSA 2DETA 3CEYA 1M2VA 4FSSA 2DIQA 4MMLA 1BIBA 2COZA 2DF6A 3X26B 8ATCB 2XDBA 1HXDA 2MPXC 1VQ7T 1R0BG 2DTIA 1OZ3A 1Y0MA 4JZ4A 2IVWA 3L2VA 1JO8A 3FC3A 4ELZC 2L8DA 1VQKT 3VS5A 3JB9J 3CMEQ 2XHCA 2FZGB 1W1FA 1V76A 2J6KA 3Q1JA 5LJ3f 4PL6A 4DA4A 2O31A 4JJNK 2JJ9A 3RMSA 5LJ5d 3G6EQ 1YFNA 3CCQQ 2O01E 3L42A 4KH0B 2MYSA 3CPWP 2DL5A 2EYZA 3VU3C 1BI2A 4Q5WA 1AZGB 1MUZA 1ZX6A 2YSQA 2YWWA 1JBMA 3CMET 4M7DE 4FW2A 1QP2A 2CZ0B 1G83A 5LJ5j 3G6ET 4C0ZA 1QVFS 3CCQT 4ZTJA 3MJXA 1BCOA 2AZVA 3EHQA 1N9RA 3TEEA 1YI2Q 3EAEA 4WTOB 3H41A 2KNBB 1S1NA 1VYTA 5KYWB 3A98A 3C94A 3QSUA 4HCZA 1LNXA 4GY5A 2F5TX 5EC7A 3I56A 1B07A 1W4SA 3BFMA 3JB9F 3A5ZB 3CC2A 5KYWA 3CCJA 1FWZA 3VS2A 4Z89A 4RTZA 2JT4A 2LNHB 1ABQA 1YI2T 1RAGB 3BDUA 2AKLA 3OYBA 1AD5A 2E5QA 1B34B 3M57A 3QYHB 2X9HA 3JAME 3LLRA 1NYGA 5I2SA 2D0NA 4OB2B 2D1XA 5KCOA 2J7IA 4A4EA 1O75A 1W2BP 4FYYB 1XOVA 2C0TA 3E19A 2XDDA 4X9CA 4FM4B 2LCCA 1TU0B 4CC4B 4F7UF 1NZ9A 2ZPFB 4OF1A 3ME9A 4KGXB 4XTZA 1SHFA 2DPPB 1DJ7B 2OAUA 1GBQA 4M7DA 3M0PA 2V1QA 2RH2A 3JCMg 3SWNC 4PJOD 2CKKA 4M77C 1WXBA 4NL2A 5KE3A 2AIRB 4C0DC 2HD0A 1D09B 5GAMh 1ZA2B 1OV3A 2CGHA 2CREA 4J9IA 4C8QF 1NE8A 4N4IA 1SEMA 2KVQG 1M1KC 2J05A 1IGUA 2KT8A 2QQ9A 3UWNA 1X2QA 1VIFA 4C92G 4CI0C 2M0OA 5AT1B 1FYNA 2SRCA 1KD1C 4M75G 2EVRA 1Q81U 1K8AR 3L2UA 1EIFA 3AHUA 3CD6Q 1V29B 4J7FA 2DVEA 3CC7Q 2DXUA 2BZ8A 4RG2A 1IRXA 3VJPA 4B6MA 4ZN1A 2EYQA 2PZ1A 3HRSA 4LXCA 1M8VA 4A4FA 1YIJQ 1M90U 6AT1B 3QO3A 2EJ9A 3LWIA 4J6WA 3CMAA 1AVZC 2MCNA 4JRIA 3TSZA 1TH7A 3CD6T 4PFPA 4VUBA 4E7JA 4KGZB 3X25B 3CC7T 2P0PA 2KRMA 4DEXA 4LDVA 3RERA 2P4TA 1KFZA 2JMAA 1YJWQ 2VVKA 3M59A 1GRIA 2EGAA 2NUTB 1SF9A 1YIJT 4M78D 1XJWB 1NM7A 1W70A 3FDRA 1VQ7A 2GFUA 2NUTA 5LJ3e 1VQ8Q 3HRTA 2CP5A 4XTWA 3OB9A 2A3LA 3LYIA 4J9HA 3S6WA 5IXBA 5GMKi 1YBYA 2DIGA 1VQ4Q 2H3EB 2QA4Q 1JJ2A 1UJYA 1PHTA 1TS9A 1YJWT 4NOYA 5GAOm 5DLOA 2WSFE 4MMKA 3TQ7P 3GPLA 4LDYA 4OVAA 2A08A 1VQ8T 2LQKA 3FB9A 3CMEA 3D7SB 1WHKA 4E6RA 1VQ4T 4JLGA 2QA4T 2VXFA 3PTAA 3G6EA 1MMDA 1C6VX 9ATCB 4M7AE 3OW2P 2YRDA 2K7AA 5C0MA 4A54A 3EH1A 2K5LA 2FYKA 4AG1C 2ZPGB 2L3RA 1K9MC 1MNEA 1RAEB 3IQLA 4M7DF 4MZMA 1AOJA 2SEMA 3A1PA 1JJ2S 3QPHA 2HQHA 1VQPQ 1YI2A 4N0AC 3BW1A 1OPLA 3OYEA 4GBQA 1M8MA 2X4WA 4R0KA 2MF2A 1G5VA 2P84A 1JQQA 2AZSA 4RTTA 1KC8C 3QHSA 2E6NA 5GAMf 5IH2A 5LJ3g 1RLQC 3PIPA 1M3AA 2E5KA 3ASKA 1U8RA 1Q82U 1VQPT 4ZGDB 2HKQB 3R6NA 4PJOB 2EKOA 2I0NA 3NFCA 3OSSC 2FB7A 5GANe 4PJOA 4HVUA 1I4K1 3OYYA 1WHHA 4C92C 1YWPA 1QP3A 2VGMA 4M78E 2LT4A 3UT1A 4XQ3A 4M75C 1Y71A 1YITQ 4RCBA 2GF7A 2ZCFB 1VA7A 2KGTA 3ZFJA 5FU6B 5CR2A 2YRVA 2PVDB 5A0LA 3PMTA 2GNCA 4M7AA 1SKUB 1BYMA 1BI1A 1VYUA 3M0QA 3KXTA 2DRMA 2K5IA 4C0FA 1R8OB 4X9DA 2HCKA 5GJVB 1BU1A 2FZKB 1T0JA 2CSIA 4PFOA 1YITT 2M51A 2DX1A 1PKTA 3LGLA 3N5BB 5CKDA 1Q95G 2LJ0A 2K9GA 2MAMA 1GL5A 4L6V5 4QVCA 2EPDA 2YRCA 3TCJA 4LUEA 2LP5A 1OU8A 4E7LA 2G6FX 2I2LA 3JSCA 3OY9A 1SPKA 1VOMA 4RCCA 5GAOr 2R5MA 3NTKA 2K3BA 3ER0A 3OYLA 3H8ZA 1TUGB 3A8OB 1WIEA 4KBMB 2WSCE 4E47A 2DE0X 1KHIA 2LDMA 3CCJQ 3FLGA 2E64A 1G3SA 2YXYA 2OI3A 4AFUC 2BE9B 2RJDA 4M78B 1VQLA 3P8DA 2CP7A 2EWNA 1PSEA 3SFMA 2J06A
chains in the Genus database with same CATH topology
2D8HA 1OPKA 3M0UA 1BK2A 1M3CA 2O88A 1VYVA 3CQTA 4ORZA 4RTVA 5I22A 1X27A 2CUDA 1PKSA 2GGRA 4FSSA 4J9DA 2DRKA 2RMOA 4CC7A 2BTTA 2H8HA 2DF6A 2DM1A 2YT6A 4AFSC 1AEYA 2JS0A 2RQVA 2DBMA 2KT1A 3I5RA 1GCQC 1Y0MA 4JZ4A 1JO8A 2K6DA 2K79A 3VS5A 2JM8A 1K0SA 1ARKA 1W1FA 2L3QA 3UA6A 2J6KA 2JM9A 1QLYA 2O31A 2OJ2A 3FJ5A 4IIMA 4JJDA 2RQRA 3PVLA 3NMZC 2JTEA 2DL5A 2EYZA 1YN8A 1AZGB 1MUZA 4RTXA 1U5SA 1ZX6A 2GTJA 1ZBJA 2YSQA 1UTIA 2BZYA 5FW9A 3M0SA 2DL4A 4J9BA 3GBQA 4RTYA 1UDLA 1H8KA 1WLPB 4JJCA 2JMCA 2EGEA 2M0YA 1G83A 1YWOA 4A63B 2LQWA 3VS1A 1ZUKA 2AZVA 3EHQA 4EIKA 2MIOA 2DL3A 4J9GA 3NPFA 2LMJA 3H41A 2KNBB 1S1NA 1VYTA 3A98A 5IHNA 2KYBA 5EC7A 1UECA 1B07A 3VS2A 4Z89A 2DLPA 1JU5C 2RQTA 1AWXA 1NYFA 3EHRA 4RTZA 1WA7A 4JZ3A 2JT4A 5IXFA 2LNHB 1ABQA 1M27C 3VS4A 2AKLA 1AD5A 3H0IA 2FG0A 2W10A 1KSWA 2FO0A 1FMKA 1UHFA 1NYGA 2D0NA 4JPBW 2D1XA 1X43A 4ESRA 2J7IA 5IHIA 1TUCA 4J9EA 4F17A 1YP5A 3O5ZA 1M30A 1M3BA 1XOVA 4CC2A 2C0TA 1A0NB 2RNAA 2LJ1A 1SRLA 4Y92A 2L0AA 3VRYA 1AWJA 1NLOC 1X6BA 1YNZA 2AKKA 2DJQA 2EBPA 2PTKA 4CC4B 3VS6A 5IHKA 1E6HA 2J6FA 1WI7A 1WX6A 1SHFA 2LJ3A 3NHNA 1SRMA 1I07A 2CT4A 1J3TA 4GLMA 1NLPC 2JW4A 2P4RA 2L3PA 1GBQA 1CKAA 1QCFA 3M0PA 2V1QA 1T0HA 2A37A 2GQIA 3EG1A 4RTUA 4RUGA 2OAWA 4DEYA 2DBKA 2RN8A 4ZNXA 1UUEA 2C0IA 2IIMA 1WXBA 1K9AA 2EYWA 1WFWA 3ZL7C 2CUBA 1GCQA 2EKHA 3TSWA 1UGVA 1AZEA 1OV3A 1W6XA 4WCIA 2FRYA 3THKA 2CREA 4J9IA 1ZLMA 2KR3A 3REAB 1SEMA 1CKBA 2J05A 2KT8A 4HVVA 2ESWA 1X2QA 2JXBA 2KEAA 2LQNA 3NGPA 4K11A 1MV3A 3VS3A 1FYNA 1B3QA 2SRCA 4J9FA 1SSHA 2EVRA 2BZXA 1BBZA 2HDAA 3KFVA 5L23A 2HEQA 2ROLA 2HBWA 2EYXA 2BZ8A 1H92A 3PVQA 3SHWA 1UFFA 1WYXA 2D8JA 2PZ1A 4OMPA 4AG2C 1NG2A 3U23A 2DNUA 2JS2A 4QT7A 1WDXA 2KE9A 3EG2A 1ABOA 1AVZC 2MCNA 3TSZA 2ABLA 2DILA 2KRMA 1TUDA 2NWMA 4DEXA 1RLPC 1KFZA 2JMAA 3QWXX 2DVJA 1H3HA 2VVKA 3ULRB 2FPFA 1GRIA 2A28A 2EGAA 3VS0A 2L2PA 5I11A 1NM7A 1W70A 1KJWA 4Z8AA 2O9VA 2RF0A 3EGUA 1JXOA 3UATA 2W0ZA 1TG0A 1Y57A 4J9HA 1ZUUA 5IXBA 2LCSA 1I1JA 3JV3A 3UF4A 2GTOA 2VWFA 1UJYA 1X69A 1PHTA 1N5ZA 2MOXA 4KRTA 2EYYA 4CC3A 4OMMA 3M0RA 4LNPA 2CH4W 1V1CA 2A08A 4HVWA 4F16A 2J6OA 1CSKA 4LE9A 1JXMA 1ZUYA 1UG1A 1ZSGA 4E6RA 1K1ZA 1E6GA 5FWBA 1HSQA 1G2BA 5GJWB 3RBBB 1OOTA 3PE0A 2PNIA 2ECZA 3LH5A 2B86A 2YUQA 2ED0A 3TVTA 1AWOA 2K7AA 2YUOA 2KXDA 2AK5A 2F2VA 2YDLA 3EG3A 4LUDA 4AG1C 1T3SA 1IO6A 3I9QA 1JEGA 2ROTA 4M4ZA 1RI9A 1T3LA 3IQLA 4OMLA 4OMNA 1AOJA 2SEMA 2A36A 1Z9QA 2DL7A 1OPLA 2VKNA 2KBTA 4GBQA 1QWEA 2CDTA 2RQUA 5HCKA 3REBB 1AWWA 1X2KA 1M8MA 2YUPA 2ENMA 4R0KA 1GBRA 1JQQA 2AZSA 2EGCA 1BB9A 4RTTA 5IH2A 1EFNA 1PNJA 2XMFA 2FEIA 2DA9A 1RLQC 2KROA 3UA7A 1GCPA 2FRWA 1M3AA 2E5KA 1HJDA 3C0CA 3R6NA 2GBQA 2NUZA 2I0NA 1KIKA 5FWCA 2EQIA 1OEBA 4IIOA 4Z88A 4LN2A 4HVUA 2CSQA 1U06A 2KRNA 1WXTA 1QKXA 1YWPA 2LZ6B 2KRSA 2QDLA 2O2OA 1HD3A 1K4US 1MV0B 1U3OA 2FPEA 1VA7A 2KGTA 2HSPA 2O9SA 1PWTA 1QKWA 1NEGA 2GNCA 1UHCA 3SEMA 1GFCA 1VYUA 3M0QA 1NEBA 2C0OA 2DRMA 2CT3A 1Z9ZA 3VRZA 2DMOA 2HCKA 1SHGA 1BU1A 5GJVB 2LX7A 3EG0A 1T0JA 2CSIA 4OMQA 1QWFA 3M0TA 4HCKA 2M51A 2DX1A 1PKTA 2DL8A 3RNJA 2LJ0A 1YCSB 1E7OA 2K9GA 1GL5A 4RTWA 4X1VA 5ECAA 2EPDA 1X6GA 2RQWA 4LUEA 2LP5A 2G6FX 1SPKA 1RUWA 1GFDA 2DYBA 2ED1A 1K76A 3QWYA 1WXUA 2K3BA 2X3XD 2EW3A 1LCKA 2F2XA 2KYMA 2X3WD 2FPDA 3VS7A 1PRLC 1WIEA 2YUNA 2RPNA 2DE0X 2KXCA 1UE9A 1UJ0A 2F2WA 4D8DA 2CH4A 1PRMC 1I0CA 4AFZC 2V1RA 3H0HA 3I35A 2L3SA 4JJBA 4D8KA 4F14A 3I5SA 4AFQC 1K0XA 2OI3A 4AFUC 4HXJA 4OMOA 3H0FA 4J9CA 2K2MA 2J06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8H A;  1OPK A;  3M0U A;  1BK2 A;  1M3C A;  2O88 A;  1VYV A;  3CQT A;  4ORZ A;  4RTV A;  5I22 A;  1X27 A;  2CUD A;  1PKS A;  2GGR A;  4FSS A;  4J9D A;  2DRK A;  2RMO A;  4CC7 A;  2BTT A;  2H8H A;  2DF6 A;  2DM1 A;  2YT6 A;  4AFS C;  1AEY A;  2JS0 A;  2RQV A;  2DBM A;  2KT1 A;  3I5R A;  1GCQ C;  1Y0M A;  4JZ4 A;  1JO8 A;  2K6D A;  2K79 A;  3VS5 A;  2JM8 A;  1K0S A;  1ARK A;  1W1F A;  2L3Q A;  3UA6 A;  2J6K A;  2JM9 A;  1QLY A;  2O31 A;  2OJ2 A;  3FJ5 A;  4IIM A;  4JJD A;  2RQR A;  3PVL A;  3NMZ C;  2JTE A;  2DL5 A;  2EYZ A;  1YN8 A;  1AZG B;  1MUZ A;  4RTX A;  1U5S A;  1ZX6 A;  2GTJ A;  1ZBJ A;  2YSQ A;  1UTI A;  2BZY A;  5FW9 A;  3M0S A;  2DL4 A;  4J9B A;  3GBQ A;  4RTY A;  1UDL A;  1H8K A;  1WLP B;  4JJC A;  2JMC A;  2EGE A;  2M0Y A;  1G83 A;  1YWO A;  4A63 B;  2LQW A;  3VS1 A;  1ZUK A;  2AZV A;  3EHQ A;  4EIK A;  2MIO A;  2DL3 A;  4J9G A;  3NPF A;  2LMJ A;  3H41 A;  2KNB B;  1S1N A;  1VYT A;  3A98 A;  5IHN A;  2KYB A;  5EC7 A;  1UEC A;  1B07 A;  3VS2 A;  4Z89 A;  2DLP A;  1JU5 C;  2RQT A;  1AWX A;  1NYF A;  3EHR A;  4RTZ A;  1WA7 A;  4JZ3 A;  2JT4 A;  5IXF A;  2LNH B;  1ABQ A;  1M27 C;  3VS4 A;  2AKL A;  1AD5 A;  3H0I A;  2FG0 A;  2W10 A;  1KSW A;  2FO0 A;  1FMK A;  1UHF A;  1NYG A;  2D0N A;  4JPB W;  2D1X A;  1X43 A;  4ESR A;  2J7I A;  5IHI A;  1TUC A;  4J9E A;  4F17 A;  1YP5 A;  3O5Z A;  1M30 A;  1M3B A;  1XOV A;  4CC2 A;  2C0T A;  1A0N B;  2RNA A;  2LJ1 A;  1SRL A;  4Y92 A;  2L0A A;  3VRY A;  1AWJ A;  1NLO C;  1X6B A;  1YNZ A;  2AKK A;  2DJQ A;  2EBP A;  2PTK A;  4CC4 B;  3VS6 A;  5IHK A;  1E6H A;  2J6F A;  1WI7 A;  1WX6 A;  1SHF A;  2LJ3 A;  3NHN A;  1SRM A;  1I07 A;  2CT4 A;  1J3T A;  4GLM A;  1NLP C;  2JW4 A;  2P4R A;  2L3P A;  1GBQ A;  1CKA A;  1QCF A;  3M0P A;  2V1Q A;  1T0H A;  2A37 A;  2GQI A;  3EG1 A;  4RTU A;  4RUG A;  2OAW A;  4DEY A;  2DBK A;  2RN8 A;  4ZNX A;  1UUE A;  2C0I A;  2IIM A;  1WXB A;  1K9A A;  2EYW A;  1WFW A;  3ZL7 C;  2CUB A;  1GCQ A;  2EKH A;  3TSW A;  1UGV A;  1AZE A;  1OV3 A;  1W6X A;  4WCI A;  2FRY A;  3THK A;  2CRE A;  4J9I A;  1ZLM A;  2KR3 A;  3REA B;  1SEM A;  1CKB A;  2J05 A;  2KT8 A;  4HVV A;  2ESW A;  1X2Q A;  2JXB A;  2KEA A;  2LQN A;  3NGP A;  4K11 A;  1MV3 A;  3VS3 A;  1FYN A;  1B3Q A;  2SRC A;  4J9F A;  1SSH A;  2EVR A;  2BZX A;  1BBZ A;  2HDA A;  3KFV A;  5L23 A;  2HEQ A;  2ROL A;  2HBW A;  2EYX A;  2BZ8 A;  1H92 A;  3PVQ A;  3SHW A;  1UFF A;  1WYX A;  2D8J A;  2PZ1 A;  4OMP A;  4AG2 C;  1NG2 A;  3U23 A;  2DNU A;  2JS2 A;  4QT7 A;  1WDX A;  2KE9 A;  3EG2 A;  1ABO A;  1AVZ C;  2MCN A;  3TSZ A;  2ABL A;  2DIL A;  2KRM A;  1TUD A;  2NWM A;  4DEX A;  1RLP C;  1KFZ A;  2JMA A;  3QWX X;  2DVJ A;  1H3H A;  2VVK A;  3ULR B;  2FPF A;  1GRI A;  2A28 A;  2EGA A;  3VS0 A;  2L2P A;  5I11 A;  1NM7 A;  1W70 A;  1KJW A;  4Z8A A;  2O9V A;  2RF0 A;  3EGU A;  1JXO A;  3UAT A;  2W0Z A;  1TG0 A;  1Y57 A;  4J9H A;  1ZUU A;  5IXB A;  2LCS A;  1I1J A;  3JV3 A;  3UF4 A;  2GTO A;  2VWF A;  1UJY A;  1X69 A;  1PHT A;  1N5Z A;  2MOX A;  4KRT A;  2EYY A;  4CC3 A;  4OMM A;  3M0R A;  4LNP A;  2CH4 W;  1V1C A;  2A08 A;  4HVW A;  4F16 A;  2J6O A;  1CSK A;  4LE9 A;  1JXM A;  1ZUY A;  1UG1 A;  1ZSG A;  4E6R A;  1K1Z A;  1E6G A;  5FWB A;  1HSQ A;  1G2B A;  5GJW B;  3RBB B;  1OOT A;  3PE0 A;  2PNI A;  2ECZ A;  3LH5 A;  2B86 A;  2YUQ A;  2ED0 A;  3TVT A;  1AWO A;  2K7A A;  2YUO A;  2KXD A;  2AK5 A;  2F2V A;  2YDL A;  3EG3 A;  4LUD A;  4AG1 C;  1T3S A;  1IO6 A;  3I9Q A;  1JEG A;  2ROT A;  4M4Z A;  1RI9 A;  1T3L A;  3IQL A;  4OML A;  4OMN A;  1AOJ A;  2SEM A;  2A36 A;  1Z9Q A;  2DL7 A;  1OPL A;  2VKN A;  2KBT A;  4GBQ A;  1QWE A;  2CDT A;  2RQU A;  5HCK A;  3REB B;  1AWW A;  1X2K A;  1M8M A;  2YUP A;  2ENM A;  4R0K A;  1GBR A;  1JQQ A;  2AZS A;  2EGC A;  1BB9 A;  4RTT A;  5IH2 A;  1EFN A;  1PNJ A;  2XMF A;  2FEI A;  2DA9 A;  1RLQ C;  2KRO A;  3UA7 A;  1GCP A;  2FRW A;  1M3A A;  2E5K A;  1HJD A;  3C0C A;  3R6N A;  2GBQ A;  2NUZ A;  2I0N A;  1KIK A;  5FWC A;  2EQI A;  1OEB A;  4IIO A;  4Z88 A;  4LN2 A;  4HVU A;  2CSQ A;  1U06 A;  2KRN A;  1WXT A;  1QKX A;  1YWP A;  2LZ6 B;  2KRS A;  2QDL A;  2O2O A;  1HD3 A;  1K4U S;  1MV0 B;  1U3O A;  2FPE A;  1VA7 A;  2KGT A;  2HSP A;  2O9S A;  1PWT A;  1QKW A;  1NEG A;  2GNC A;  1UHC A;  3SEM A;  1GFC A;  1VYU A;  3M0Q A;  1NEB A;  2C0O A;  2DRM A;  2CT3 A;  1Z9Z A;  3VRZ A;  2DMO A;  2HCK A;  1SHG A;  1BU1 A;  5GJV B;  2LX7 A;  3EG0 A;  1T0J A;  2CSI A;  4OMQ A;  1QWF A;  3M0T A;  4HCK A;  2M51 A;  2DX1 A;  1PKT A;  2DL8 A;  3RNJ A;  2LJ0 A;  1YCS B;  1E7O A;  2K9G A;  1GL5 A;  4RTW A;  4X1V A;  5ECA A;  2EPD A;  1X6G A;  2RQW A;  4LUE A;  2LP5 A;  2G6F X;  1SPK A;  1RUW A;  1GFD A;  2DYB A;  2ED1 A;  1K76 A;  3QWY A;  1WXU A;  2K3B A;  2X3X D;  2EW3 A;  1LCK A;  2F2X A;  2KYM A;  2X3W D;  2FPD A;  3VS7 A;  1PRL C;  1WIE A;  2YUN A;  2RPN A;  2DE0 X;  2KXC A;  1UE9 A;  1UJ0 A;  2F2W A;  4D8D A;  2CH4 A;  1PRM C;  1I0C A;  4AFZ C;  2V1R A;  3H0H A;  3I35 A;  2L3S A;  4JJB A;  4D8K A;  4F14 A;  3I5S A;  4AFQ C;  1K0X A;  2OI3 A;  4AFU C;  4HXJ A;  4OMO A;  3H0F A;  4J9C A;  2K2M A;  2J06 A; 
#chains in the Genus database with same CATH topology
 1VQN Q;  4M78 A;  3M0U A;  5D6Y A;  3CC7 A;  2IPO B;  2CZ7 B;  1IB8 A;  2QTV A;  5CKE A;  2GGR A;  3CCJ T;  1YIJ A;  4CC7 A;  4F7U E;  2K4Y A;  2H8H A;  1IHV A;  2YT6 A;  2JS0 A;  2XG8 D;  2DBM A;  2KT1 A;  1VQN T;  4ELY C;  3I5R A;  5LJ5 h;  1GCQ C;  3M4G A;  5KYN A;  3G7Z A;  2K79 A;  1K0S A;  3CBM A;  1ARK A;  3CC4 A;  3CCR A;  3UA6 A;  2L3Q A;  1U1T A;  3P8H A;  1QLY A;  4PKC C;  3BY7 A;  4J7I A;  3RKW A;  1BI3 A;  5KYU B;  2VAS A;  4BY6 B;  3PVL A;  3EGX B;  4A4G A;  3OYA A;  2JTE A;  1VQO Q;  1VQ8 A;  1YN8 A;  1QMC A;  5KYU A;  3C4S A;  4C8Q E;  1O9S A;  1ZBJ A;  5CKF A;  1MMN A;  3M0S A;  1NPR A;  1VQ4 A;  2VV5 A;  4PLL A;  4EPC A;  3M9Q A;  5GAN 3;  1X75 C;  4Y91 A;  4B9W A;  4IUT A;  2BUD A;  4R55 A;  1ZA1 B;  2DER A;  2COY A;  4XU3 A;  2FL7 A;  3UDC A;  4LDX A;  4A53 A;  3VS1 A;  1VQM Q;  1QVG A;  2EQJ A;  1VQO T;  2MWO A;  2E3I A;  1RL2 A;  2MIO A;  2DL3 A;  3JCM J;  2XDP A;  2EIF A;  4II1 A;  5D6X A;  3E9G A;  4AMC A;  4B9X A;  3E1S A;  4HCC A;  4PJO F;  4M77 D;  5KCH A;  3A8M B;  3GLX A;  4IUV A;  1Q86 C;  4ZTF A;  1VQM T;  1JU5 C;  1AWX A;  1NYF A;  4JLI A;  4DBH A;  5GMK l;  4JZ3 A;  4EMK C;  3BDL A;  2BKD N;  4E7S A;  4PJN A;  2FG0 A;  2JN0 A;  1KSW A;  3DB3 A;  4BAC A;  2FO0 A;  2RK1 A;  3OYD A;  4JRK A;  1X43 A;  1VQP A;  1TUC A;  3MEV A;  3SD4 A;  4CC2 A;  2RNA A;  5A0G A;  1BI0 A;  1SRL A;  4Y92 A;  4HKE A;  4KGV B;  1QVG S;  3VRY A;  2ZAE A;  1NLO C;  1X6B A;  2PTK A;  1NJI C;  4JRQ A;  2YLB A;  5IHK A;  1E6H A;  2OX7 A;  1WI7 A;  1WX6 A;  3NHN A;  1OX8 A;  1SRM A;  2CT4 A;  4GLM A;  1NLP C;  2P4R A;  5D7U A;  4ATO A;  5FLX E;  1CKA A;  1N8R C;  3MEU A;  2CP3 A;  2A37 A;  3VUZ A;  5LL6 S;  4RTU A;  2OAW A;  4D6W A;  3TU4 K;  2IIM A;  2K5F A;  2ZZD A;  3PFS A;  3DB4 A;  2KY9 A;  3CCE A;  1RAD B;  2O4X A;  1KQ2 A;  3HP9 A;  4XTV A;  3A8L B;  2CUB A;  2DXB A;  3LWH A;  1YIT A;  2RHX A;  3LX7 A;  3M58 A;  2KR3 A;  1TTH B;  3REA B;  3V7R A;  3DLM A;  1WGS A;  1CKB A;  4M78 F;  3VYH B;  5LJ3 d;  1XQH A;  4KUL A;  1D1A A;  2DJZ A;  4K11 A;  2XU8 A;  4NL3 A;  1B3Q A;  2RB6 A;  3EH2 A;  3OS5 A;  2M16 A;  4C0G A;  4IKF A;  5GAM g;  1BBZ A;  3KFV A;  3GF5 A;  3JCM b;  3JCM e;  2HEQ A;  5GAN 6;  1K8A U;  2XID A;  4FYV B;  5LJ5 f;  1D0X A;  4FCY A;  1VQ9 Q;  1YJN A;  3PVQ A;  1OUL A;  1UFF A;  2RM4 A;  1R77 A;  1NG2 A;  1IXD A;  2GQV A;  2L5Q A;  2PUO B;  2DZ9 A;  2QAS A;  3X24 B;  3EG2 A;  1ABO A;  4KH1 B;  2ABL A;  2DXT A;  2LC4 A;  2KSS A;  4LD6 A;  1ZHI A;  1KQS P;  1TUD A;  1AHJ B;  1VQ9 T;  2K57 A;  3OSV A;  1RLP C;  1K73 R;  1YCY A;  3QWX X;  2FPF A;  3VS0 A;  1RAA B;  3L2R A;  4MZP A;  1VQN A;  3JCM W;  4Z8A A;  2CZ1 B;  3CPW A;  2RF0 A;  3FRN A;  3EGU A;  3X20 B;  1JXO A;  5IAY A;  1TG0 A;  1Y57 A;  1ZUU A;  4RG8 A;  1PSF A;  1B34 A;  3JV3 A;  3UF4 A;  3HFN A;  4XK8 E;  1KHC A;  2MOX A;  4KRT A;  2EYY A;  4OMM A;  4HVW A;  4F16 A;  3SWN B;  2J6O A;  1WZO A;  2DTH A;  4ZGJ B;  4M77 B;  3HPW A;  1UG1 A;  1K1Z A;  3SWN A;  4C0D B;  1E6G A;  1HSQ A;  3RBB B;  5GAN d;  3L2Q A;  4M77 A;  2KI7 A;  2QG9 B;  4KUI A;  4C92 D;  2PNI A;  3MEA A;  2ECZ A;  2KDS A;  4L59 A;  1VQO A;  2ED0 A;  3TVT A;  1PC0 A;  3E9F A;  4M75 D;  4BUG A;  2ZPE B;  3JCM Q;  1D0Y A;  3OYF A;  3CPW S;  1FMW A;  4M7D C;  1RI9 A;  1OU9 A;  5GAN j;  4J6X A;  1PCX A;  1VQM A;  4OML A;  4PK4 A;  4BDY A;  2DO3 A;  2DL7 A;  1W2B A;  1OX9 A;  2CDT A;  2RQU A;  1AWW A;  1X2K A;  3NTI A;  1FXX A;  1M1G A;  5FRM A;  4XAX B;  4BE1 A;  2NYS A;  1GBR A;  1VQL Q;  1VQ6 Q;  4XU2 A;  2XMF A;  2FEI A;  3UPU A;  3ZEH A;  1GCP A;  3X28 B;  1HJD A;  3CXC P;  3VUB A;  1G3T A;  1NBE B;  4AT1 B;  4J6Y A;  3MP6 A;  2CYZ B;  3A8G B;  3G4S Q;  5IT9 E;  1I8F A;  4UC4 A;  4R56 A;  2HQX A;  1OEB A;  1PG5 B;  4IUU A;  1VQL T;  1VQ6 T;  2LZ6 B;  1UGR B;  3FJP A;  1UGQ B;  2O2O A;  1K4U S;  1MV0 B;  1OZ2 A;  4LDW A;  2DYI A;  2HSP A;  2RK2 A;  1Q81 C;  2O9S A;  4LDU A;  3G4S T;  3CC4 Q;  4IUP A;  3CCR Q;  4FW1 A;  2D0Q B;  3OYI A;  1FMV A;  3SEM A;  2Y90 A;  1GFC A;  2HL3 A;  2QYZ A;  3MO8 A;  2WSE E;  2D9T A;  1NEB A;  1Z9Z A;  2CP2 A;  5CQY A;  3PIO A;  5GMK e;  1QWF A;  4DBR A;  2Z0W A;  1M90 C;  5GAN 8;  2DL8 A;  1KK7 A;  1YCS B;  3RNJ A;  1RAI B;  3MCA B;  4E7Z A;  1D1B A;  3RUX A;  3CC4 T;  5GAO n;  3CCR T;  1RI0 A;  1WQ7 A;  3V8J A;  2RJC A;  2LX9 A;  3LGF A;  1RUW A;  1GFD A;  4XTY A;  2DYB A;  4P5N A;  1K76 A;  3OYN A;  4PJO E;  1WXU A;  1Q7Y U;  2F2X A;  1D0Z A;  2X3W D;  2EQK A;  3VS7 A;  1S72 Q;  4WF2 A;  2JTF A;  3CCU A;  4TVR A;  4HCB A;  2RPN A;  1M4Z A;  1UJ0 A;  1X01 A;  1LPL A;  2V1R A;  3H0H A;  2L89 A;  4F14 A;  5FU7 C;  1LJO A;  1M1K R;  1Y7X A;  1K9M U;  1P92 A;  2EQU A;  3MHX A;  1S72 T;  1M3C A;  3RIR A;  1VQ9 A;  3CQT A;  4ORZ A;  5I22 A;  1KD1 R;  3VYG A;  1X27 A;  3OBY A;  4N0A A;  4DOW A;  1TWB A;  4J9D A;  2RMO A;  1N27 A;  2BTT A;  4M77 F;  2DEQ A;  2KQW A;  1RAF B;  1AEY A;  2PQW A;  2RQV A;  1M2O A;  2LVM A;  3URG A;  1JB0 E;  3AT1 B;  5DM7 R;  3EFS A;  2JM9 A;  3G1J A;  4C92 B;  3G71 A;  3FJ5 A;  4IIM A;  4JS5 A;  1Y96 B;  4M75 B;  4O6J A;  4C92 A;  1MMG A;  4QKU A;  3OW2 A;  2COW A;  5DLQ E;  3JB9 G;  3OYJ A;  4RTX A;  3CCE Q;  1U5S A;  2QQR A;  5I2M A;  1Y96 A;  1XNI A;  1UTI A;  4M75 A;  3GNF B;  5CKH A;  4RTY A;  5CKB A;  4JJC A;  7AT1 B;  3QZ9 B;  2EGE A;  1I5O B;  3OA6 A;  1YHQ Q;  5GAN 7;  2XI9 A;  4GLK A;  4O5V A;  5C6S A;  3HL8 A;  4EIK A;  1LVK A;  3CCE T;  2VYT A;  1Q82 C;  2ZPI B;  2XKO C;  3EGD B;  4FYX B;  5GAO l;  5CCA A;  1ZSZ C;  4BI3 A;  1UB4 A;  2V8K A;  4BDZ A;  2QEX Q;  3KUF A;  1OQK A;  1ZQ1 A;  1TSF A;  3WVD B;  1YHQ T;  4F7U G;  4EDU A;  1ACM B;  2B8A A;  4MZT A;  3EHR A;  2R5A A;  1WA7 A;  5IXF A;  4M7A C;  3QG1 A;  3MP8 A;  1M27 C;  2HKN A;  3VS4 A;  1WPY A;  1YJN Q;  3H0I A;  3J81 E;  3V8L A;  3KBG A;  1Q7Y R;  3OW2 S;  2X4Y A;  2QEX T;  3OS1 A;  3CCL A;  5HKC A;  1UHF A;  3CPF A;  2RHI A;  4ESR A;  4FL6 A;  4F17 A;  4BB7 A;  1IZ6 A;  1Y07 A;  2JVV A;  1M30 A;  1M3B A;  1A0N B;  2LJ1 A;  1X6O A;  1YJN T;  4C8Q G;  1AWJ A;  2AKK A;  2EBP A;  2DJQ A;  2EAY A;  3RMQ A;  3EFR A;  2XIC A;  3JCM d;  1K9M R;  4JDS A;  3VS6 A;  1VQ6 A;  4F04 B;  1J3T A;  1I07 A;  2CP6 A;  2JW4 A;  2L3P A;  1N9S A;  5GMK m;  1JRI A;  3QYG B;  3T9N A;  1T0H A;  2GQI A;  2RO0 A;  4MDW A;  2RJF A;  3G4S A;  4DEY A;  2DBK A;  3OYC A;  1UUE A;  1HYO A;  1KC8 R;  4HA8 A;  1HK9 A;  2EYW A;  4Z02 A;  3ZL7 C;  3QII A;  1GCQ A;  2EKH A;  1M9S A;  2G3R A;  1W6X A;  4WCI A;  2FRY A;  4EMH A;  3F70 A;  4M78 C;  1OYX A;  2MWP A;  1VQ5 A;  4QQ6 A;  2OTL A;  4HVV A;  1TOV A;  1UGP B;  2GCX A;  2EQM A;  2JXB A;  2KEA A;  2QGG A;  3L1A A;  4C5E A;  2LQN A;  3EG9 B;  4J9F A;  3QXE B;  3EG9 A;  3EGX A;  1D1C A;  5L23 A;  2ROL A;  4BD3 A;  1QCN A;  4OGC A;  4PJJ A;  3OMG A;  2EYX A;  2RD1 A;  4JS4 A;  4FT4 A;  4OMP A;  4AG2 C;  2JS2 A;  2HL5 C;  3P8B B;  2YLC A;  1VIE A;  4C5G A;  1S72 A;  2F5K A;  3JB9 H;  1WDX A;  3RKX A;  4C92 F;  2KE9 A;  1C1A A;  3J80 E;  5KYY B;  4DOV A;  1G3W A;  2V8I A;  4EMK B;  3S3O A;  4M75 F;  2DIL A;  2NWM A;  4XU0 A;  5IN1 A;  5KYY A;  2MK5 A;  3PT9 A;  2CP0 A;  4EMK A;  2DVJ A;  1K73 U;  2LQ8 A;  2NUP B;  2A28 A;  4PJM A;  4E2F B;  3BE3 A;  2MI6 A;  5GAM e;  4HT8 A;  2R57 A;  1KJW A;  3M53 A;  2E4H A;  3LW5 E;  2NUP A;  2O9V A;  2BIV A;  5FRO A;  3RES A;  2W0Z A;  1PD1 A;  1QVF P;  2ATC B;  3QJY A;  3VV0 A;  2DTO A;  2HZY A;  1I1J A;  4ANJ A;  3JCM c;  2M02 A;  1NJI U;  3HHT B;  3JCM V;  4N4H A;  4V2S A;  3OQ5 A;  3V7C A;  4CC3 A;  2PU9 B;  5GAN h;  1V1C A;  4ZGE B;  4IUR A;  4LE9 A;  1PD0 A;  5FRN A;  4M7D G;  1JXM A;  4XU1 A;  1ZUY A;  3JB9 I;  1ZSG A;  5FWB A;  1G2B A;  1OOT A;  2LCL A;  1WJQ A;  1RAC B;  4CRI A;  2B86 A;  2YUQ A;  4J83 A;  8AT1 B;  1AWO A;  2AHJ B;  2YUO A;  3HTR A;  4QQD A;  4OMF B;  1H64 1;  2F2V A;  3EG3 A;  4RKU E;  4LUD A;  3FIF A;  3DKM A;  5CIU A;  4C8Q C;  3TRE A;  1IO6 A;  2E41 A;  2HMA A;  2VUB A;  2V8J A;  4M4Z A;  1PM3 A;  4BI4 A;  1YHQ A;  4OMN A;  5KH6 A;  3CCU Q;  3GNG A;  2QTX A;  3L2Z A;  2VKN A;  2LTO A;  1QWE A;  2DK3 A;  2X35 A;  4XTU A;  1WHL A;  1BKB A;  2QEX A;  2ENM A;  2Y4Y A;  1UGS B;  1EX4 A;  3QDF A;  3M56 A;  1ZBX A;  5D6W A;  2D6F A;  1PNJ A;  3CCM A;  2KRO A;  3MEW A;  3CCU T;  3M5A A;  4M77 E;  3C0C A;  2GBQ A;  5GMK j;  4ZN3 A;  5LJ3 j;  1KIK A;  5FWC A;  4IIO A;  2QQB A;  2KRN A;  1Q86 R;  1WXT A;  2V26 A;  1QKX A;  2LNV A;  2KRS A;  4KT0 E;  1U3O A;  4E7I A;  2PUK B;  2CS7 A;  3PNW C;  1PWT A;  2X51 A;  1NEG A;  1WNL A;  1K8A C;  2M9U A;  3L2W A;  2E12 A;  2OTJ Q;  5CO7 A;  2RI3 A;  3G71 Q;  2E65 A;  2CT3 A;  3FEO A;  1FX7 A;  2DMO A;  1SHG A;  2ZPB B;  5KYX B;  2LX7 A;  1G8X A;  4OMQ A;  4HCK A;  1WJS A;  2ZGW A;  1NJI R;  5KYX A;  1E7O A;  4RTW A;  2QI2 A;  1MGQ A;  4FSX A;  2OTJ T;  1N8R R;  3MKD A;  2KK4 A;  3G71 T;  2JOY A;  3MET A;  3HSB A;  2ED1 A;  2E70 A;  2A7Y A;  2VB6 A;  3QWY A;  2EW3 A;  1LCK A;  1KG1 A;  3M54 A;  5A2Q E;  5L8R E;  1KQS A;  2CH4 A;  1I0C A;  3CBO A;  4AFQ C;  1K0X A;  4HXJ A;  4M7D B;  2RHZ A;  5CAI A;  2RI5 A;  2XK0 A;  2K2M A;  1M1K U;  5GAN f;  3J7A F;  4A4K A;  1BK2 A;  5GAO p;  1WQW A;  2DD4 A;  4ME7 A;  4RTV A;  3CCL Q;  2K3X A;  1NPP A;  3CCS Q;  1KD1 U;  2DRK A;  3C12 A;  1UEB A;  4PFZ A;  4LD9 K;  2DM1 A;  4AFS C;  3GIB A;  2DXC A;  1YJ9 A;  3SB2 A;  4N4G A;  5HK0 A;  2Y4X A;  2K6D A;  2PVG B;  4M7A D;  2JM8 A;  3CCL T;  2FVU A;  3PGG A;  4OB0 B;  3CCS T;  1SSF A;  4E7H A;  4A4H A;  2OJ2 A;  1KQS S;  3QUI A;  4JJD A;  2RQR A;  4PJO G;  1QCO A;  3SDZ A;  2ZPH B;  3NMZ C;  4E7K A;  3QZ5 B;  2CZ6 B;  2GTJ A;  3H6Z A;  5FW9 A;  2BZY A;  4DBQ A;  2DL4 A;  2EJG A;  4J9B A;  3GBQ A;  1C0M A;  3OBW A;  1LOJ A;  1JJ2 P;  3JRZ A;  3M4Y A;  1UDL A;  1H8K A;  1WLP B;  2RA2 A;  2JMC A;  4BI8 B;  2M0Y A;  1M1F A;  4M7A G;  1YWO A;  4A63 B;  2LQW A;  3HFO A;  3DLL A;  1VQ5 Q;  2A0F B;  3I55 A;  1ZUK A;  2OTL Q;  4MDX A;  2AT1 B;  1W2B S;  1RAB B;  4J9G A;  3NPF A;  2QK0 A;  2E3H A;  2FHD A;  2LMJ A;  4C5I A;  2X4X A;  4BE0 A;  4DQ2 A;  5IHN A;  3CCV A;  1IRE B;  2KYB A;  2R58 A;  2LT1 A;  1UEC A;  2EJF A;  3NTH A;  2H3J A;  4L5G A;  3RR6 A;  1WHJ A;  1IHW A;  4KUD K;  4NS5 A;  2DLP A;  1VQ5 T;  2RQT A;  4IUQ A;  3CXC A;  2OTL T;  3GP8 A;  2M1H A;  4JUV A;  4PLI A;  4C92 E;  2W10 A;  5A0D A;  5LJ5 e;  2DZC A;  1VQK A;  1MMA A;  1FMK A;  4M75 E;  4JPB W;  3QKJ A;  3JCM h;  5FU7 B;  2KMT A;  2HAX A;  1WJR A;  5IHI A;  4J9E A;  1YP5 A;  1R0C B;  3O5Z A;  1QVP A;  2P0K A;  2HNI A;  1BCM A;  2L0A A;  1YNZ A;  1D3B B;  3V7S A;  1VUB A;  2J6F A;  4C5H A;  2LJ3 A;  4M78 G;  2RJE A;  3EFO B;  1D3B A;  2HSE B;  1QCF A;  5EG2 A;  1KQ1 A;  3EG1 A;  3EFO A;  3CCQ A;  1Q7Y C;  4BE2 A;  4RUG A;  2RN8 A;  4ZNX A;  4QW2 A;  2C0I A;  1I81 A;  2HBP A;  3JB9 D;  3CXC S;  1K9A A;  4QQG A;  1WFW A;  1KC8 U;  3TSW A;  5GAN 2;  1M5Q 1;  1UGV A;  3INZ A;  1AZE A;  3THK A;  1F1B B;  1ZLM A;  5CQX A;  5GAM d;  2OTJ A;  2VXE A;  2E1H A;  2DAQ A;  2ESW A;  2F69 A;  4PJL A;  3V8K A;  3NGP A;  1MV3 A;  3VS3 A;  1Q81 R;  3S3N A;  1SSH A;  4JRP A;  1H3Z A;  2EFI A;  2BZX A;  2HDA A;  1WHG A;  5J3B A;  3OYM A;  5LJ5 g;  2YHT A;  4FYW B;  4X34 A;  5GAN 4;  3S3M A;  2HBW A;  4OB3 B;  5GAM j;  3JCM P;  1H92 A;  4OB1 B;  3RKY A;  2NLU A;  1QQJ A;  1ZSZ B;  3C95 A;  3SHW A;  1WYX A;  2D8J A;  4FT2 A;  5CK9 A;  1M90 R;  3U23 A;  1IGQ A;  2DNU A;  3A8H B;  4QT7 A;  5HY6 A;  1ZSZ A;  2WAC A;  4PJO C;  3RDV A;  3MP1 A;  3R6O A;  4M7A B;  3O8V A;  5CVI A;  3EGD A;  2JUF A;  1U1S A;  2DFU A;  4PNO A;  3CCM Q;  3QBY A;  3OYG A;  4DBF A;  4C8Q D;  1H3H A;  4EMG A;  3ULR B;  2L2P A;  5I11 A;  2FZC B;  2JNG A;  5FU6 C;  3HRU A;  3OS2 A;  3CBP A;  4YTL A;  1WHM A;  1QW1 A;  3UAT A;  2PVO B;  5KE2 A;  3CCS A;  4J5Y A;  2LCS A;  2GTO A;  3CCM T;  2MMP A;  2VWF A;  2K3Y A;  1X69 A;  4OP0 A;  1N5Z A;  2DEU A;  2JTM A;  2P0Q A;  4FU6 A;  2QGF B;  3M0R A;  4LNP A;  2CH4 W;  5J39 A;  2BE7 D;  3QJ6 A;  2QAZ A;  1CSK A;  2RHU A;  5GJW B;  3PE0 A;  2QQA A;  3I56 Q;  2X4J A;  3CC2 Q;  3LH5 A;  3JCM f;  1MHN A;  3OYH A;  2QXF A;  3WVE B;  3LH0 A;  2F1L A;  2KXD A;  2AK5 A;  2YDL A;  5GAN 5;  2VC8 A;  2QDY B;  5GAN g;  3CD6 A;  5HK3 A;  5GMK h;  1BIA A;  1T3S A;  5LJ3 h;  3I9Q A;  1JEG A;  2ROT A;  1T3L A;  3I56 T;  3CC2 T;  1QVG P;  3JCM X;  2A36 A;  1Z9Q A;  5GAO q;  2KBT A;  5HCK A;  3REB B;  3E2U A;  2YUP A;  1B7T A;  4Y28 E;  2E6Z A;  2GFA A;  2XD0 A;  2EGC A;  1G3Y A;  1BB9 A;  1EFN A;  1N6A A;  4XTX A;  2DA9 A;  1Q82 R;  3UA7 A;  3VKI A;  1YJW A;  2FRW A;  1OI1 A;  1XTD A;  1AT1 B;  2NUZ A;  1MND A;  2DKG A;  2EQI A;  4Z88 A;  2C06 A;  4RMO A;  4LN2 A;  2CSQ A;  1U06 A;  4QVZ A;  1Q86 U;  1EZZ B;  5M9O A;  2QDL A;  1HD3 A;  4BY6 C;  2QA4 A;  1YJ9 Q;  3QDR B;  2FPE A;  5J26 A;  3H9N A;  1QKW A;  1UHC A;  1TXQ A;  1I5L A;  2LRQ A;  2C0O A;  3MPU B;  2DD5 A;  4M7D D;  3VRZ A;  3EG0 A;  1YJ9 T;  3PMI A;  3ZBD A;  3M0T A;  2VGN A;  5AYF A;  4OGE A;  4HT9 A;  4F7U B;  3GOX A;  5I21 A;  4X1V A;  5ECA A;  3WXM B;  1X6G A;  2RQW A;  2JZ2 A;  4F7U A;  2K2V A;  3OYK A;  2HQE A;  2RHY A;  4J8O A;  4M7A F;  1GXI E;  2E10 A;  1N8R U;  3I55 Q;  2X3X D;  1K73 C;  2KYM A;  2FPD A;  1PRL C;  2RI2 A;  3OMC A;  1RAH B;  2YUN A;  4M77 G;  1SG5 A;  3CMA Q;  4FIB A;  3CCV Q;  2KXC A;  1UE9 A;  2F2W A;  4D8D A;  1PRM C;  4AFZ C;  4C8Q B;  3I35 A;  2L3S A;  4JJB A;  5DY9 A;  4D8K A;  3M55 A;  3I5S A;  2QQS A;  3I55 T;  4OMO A;  3H0F A;  4J9C A;  4C8Q A;  3HKS A;  1VQ7 Q;  2D8H A;  1OPK A;  2KAF A;  3CMA T;  1M2V B;  2O88 A;  1VYV A;  3CCV T;  2O4X B;  1VQK Q;  2IG0 A;  1QVF A;  4QVD A;  3OS0 A;  2CUD A;  1PKS A;  2DET A;  3CEY A;  1M2V A;  4FSS A;  2DIQ A;  4MML A;  1BIB A;  2COZ A;  2DF6 A;  3X26 B;  8ATC B;  2XDB A;  1HXD A;  2MPX C;  1VQ7 T;  1R0B G;  2DTI A;  1OZ3 A;  1Y0M A;  4JZ4 A;  2IVW A;  3L2V A;  1JO8 A;  3FC3 A;  4ELZ C;  2L8D A;  1VQK T;  3VS5 A;  3JB9 J;  3CME Q;  2XHC A;  2FZG B;  1W1F A;  1V76 A;  2J6K A;  3Q1J A;  5LJ3 f;  4PL6 A;  4DA4 A;  2O31 A;  4JJN K;  2JJ9 A;  3RMS A;  5LJ5 d;  3G6E Q;  1YFN A;  3CCQ Q;  2O01 E;  3L42 A;  4KH0 B;  2MYS A;  3CPW P;  2DL5 A;  2EYZ A;  3VU3 C;  1BI2 A;  4Q5W A;  1AZG B;  1MUZ A;  1ZX6 A;  2YSQ A;  2YWW A;  1JBM A;  3CME T;  4M7D E;  4FW2 A;  1QP2 A;  2CZ0 B;  1G83 A;  5LJ5 j;  3G6E T;  4C0Z A;  1QVF S;  3CCQ T;  4ZTJ A;  3MJX A;  1BCO A;  2AZV A;  3EHQ A;  1N9R A;  3TEE A;  1YI2 Q;  3EAE A;  4WTO B;  3H41 A;  2KNB B;  1S1N A;  1VYT A;  5KYW B;  3A98 A;  3C94 A;  3QSU A;  4HCZ A;  1LNX A;  4GY5 A;  2F5T X;  5EC7 A;  3I56 A;  1B07 A;  1W4S A;  3BFM A;  3JB9 F;  3A5Z B;  3CC2 A;  5KYW A;  3CCJ A;  1FWZ A;  3VS2 A;  4Z89 A;  4RTZ A;  2JT4 A;  2LNH B;  1ABQ A;  1YI2 T;  1RAG B;  3BDU A;  2AKL A;  3OYB A;  1AD5 A;  2E5Q A;  1B34 B;  3M57 A;  3QYH B;  2X9H A;  3JAM E;  3LLR A;  1NYG A;  5I2S A;  2D0N A;  4OB2 B;  2D1X A;  5KCO A;  2J7I A;  4A4E A;  1O75 A;  1W2B P;  4FYY B;  1XOV A;  2C0T A;  3E19 A;  2XDD A;  4X9C A;  4FM4 B;  2LCC A;  1TU0 B;  4CC4 B;  4F7U F;  1NZ9 A;  2ZPF B;  4OF1 A;  3ME9 A;  4KGX B;  4XTZ A;  1SHF A;  2DPP B;  1DJ7 B;  2OAU A;  1GBQ A;  4M7D A;  3M0P A;  2V1Q A;  2RH2 A;  3JCM g;  3SWN C;  4PJO D;  2CKK A;  4M77 C;  1WXB A;  4NL2 A;  5KE3 A;  2AIR B;  4C0D C;  2HD0 A;  1D09 B;  5GAM h;  1ZA2 B;  1OV3 A;  2CGH A;  2CRE A;  4J9I A;  4C8Q F;  1NE8 A;  4N4I A;  1SEM A;  2KVQ G;  1M1K C;  2J05 A;  1IGU A;  2KT8 A;  2QQ9 A;  3UWN A;  1X2Q A;  1VIF A;  4C92 G;  4CI0 C;  2M0O A;  5AT1 B;  1FYN A;  2SRC A;  1KD1 C;  4M75 G;  2EVR A;  1Q81 U;  1K8A R;  3L2U A;  1EIF A;  3AHU A;  3CD6 Q;  1V29 B;  4J7F A;  2DVE A;  3CC7 Q;  2DXU A;  2BZ8 A;  4RG2 A;  1IRX A;  3VJP A;  4B6M A;  4ZN1 A;  2EYQ A;  2PZ1 A;  3HRS A;  4LXC A;  1M8V A;  4A4F A;  1YIJ Q;  1M90 U;  6AT1 B;  3QO3 A;  2EJ9 A;  3LWI A;  4J6W A;  3CMA A;  1AVZ C;  2MCN A;  4JRI A;  3TSZ A;  1TH7 A;  3CD6 T;  4PFP A;  4VUB A;  4E7J A;  4KGZ B;  3X25 B;  3CC7 T;  2P0P A;  2KRM A;  4DEX A;  4LDV A;  3RER A;  2P4T A;  1KFZ A;  2JMA A;  1YJW Q;  2VVK A;  3M59 A;  1GRI A;  2EGA A;  2NUT B;  1SF9 A;  1YIJ T;  4M78 D;  1XJW B;  1NM7 A;  1W70 A;  3FDR A;  1VQ7 A;  2GFU A;  2NUT A;  5LJ3 e;  1VQ8 Q;  3HRT A;  2CP5 A;  4XTW A;  3OB9 A;  2A3L A;  3LYI A;  4J9H A;  3S6W A;  5IXB A;  5GMK i;  1YBY A;  2DIG A;  1VQ4 Q;  2H3E B;  2QA4 Q;  1JJ2 A;  1UJY A;  1PHT A;  1TS9 A;  1YJW T;  4NOY A;  5GAO m;  5DLO A;  2WSF E;  4MMK A;  3TQ7 P;  3GPL A;  4LDY A;  4OVA A;  2A08 A;  1VQ8 T;  2LQK A;  3FB9 A;  3CME A;  3D7S B;  1WHK A;  4E6R A;  1VQ4 T;  4JLG A;  2QA4 T;  2VXF A;  3PTA A;  3G6E A;  1MMD A;  1C6V X;  9ATC B;  4M7A E;  3OW2 P;  2YRD A;  2K7A A;  5C0M A;  4A54 A;  3EH1 A;  2K5L A;  2FYK A;  4AG1 C;  2ZPG B;  2L3R A;  1K9M C;  1MNE A;  1RAE B;  3IQL A;  4M7D F;  4MZM A;  1AOJ A;  2SEM A;  3A1P A;  1JJ2 S;  3QPH A;  2HQH A;  1VQP Q;  1YI2 A;  4N0A C;  3BW1 A;  1OPL A;  3OYE A;  4GBQ A;  1M8M A;  2X4W A;  4R0K A;  2MF2 A;  1G5V A;  2P84 A;  1JQQ A;  2AZS A;  4RTT A;  1KC8 C;  3QHS A;  2E6N A;  5GAM f;  5IH2 A;  5LJ3 g;  1RLQ C;  3PIP A;  1M3A A;  2E5K A;  3ASK A;  1U8R A;  1Q82 U;  1VQP T;  4ZGD B;  2HKQ B;  3R6N A;  4PJO B;  2EKO A;  2I0N A;  3NFC A;  3OSS C;  2FB7 A;  5GAN e;  4PJO A;  4HVU A;  1I4K 1;  3OYY A;  1WHH A;  4C92 C;  1YWP A;  1QP3 A;  2VGM A;  4M78 E;  2LT4 A;  3UT1 A;  4XQ3 A;  4M75 C;  1Y71 A;  1YIT Q;  4RCB A;  2GF7 A;  2ZCF B;  1VA7 A;  2KGT A;  3ZFJ A;  5FU6 B;  5CR2 A;  2YRV A;  2PVD B;  5A0L A;  3PMT A;  2GNC A;  4M7A A;  1SKU B;  1BYM A;  1BI1 A;  1VYU A;  3M0Q A;  3KXT A;  2DRM A;  2K5I A;  4C0F A;  1R8O B;  4X9D A;  2HCK A;  5GJV B;  1BU1 A;  2FZK B;  1T0J A;  2CSI A;  4PFO A;  1YIT T;  2M51 A;  2DX1 A;  1PKT A;  3LGL A;  3N5B B;  5CKD A;  1Q95 G;  2LJ0 A;  2K9G A;  2MAM A;  1GL5 A;  4L6V 5;  4QVC A;  2EPD A;  2YRC A;  3TCJ A;  4LUE A;  2LP5 A;  1OU8 A;  4E7L A;  2G6F X;  2I2L A;  3JSC A;  3OY9 A;  1SPK A;  1VOM A;  4RCC A;  5GAO r;  2R5M A;  3NTK A;  2K3B A;  3ER0 A;  3OYL A;  3H8Z A;  1TUG B;  3A8O B;  1WIE A;  4KBM B;  2WSC E;  4E47 A;  2DE0 X;  1KHI A;  2LDM A;  3CCJ Q;  3FLG A;  2E64 A;  1G3S A;  2YXY A;  2OI3 A;  4AFU C;  2BE9 B;  2RJD A;  4M78 B;  1VQL A;  3P8D A;  2CP7 A;  2EWN A;  1PSE A;  3SFM A;  2J06 A; 
#chains in the Genus database with same CATH homology
 2D8H A;  1OPK A;  3M0U A;  1BK2 A;  1M3C A;  2O88 A;  1VYV A;  3CQT A;  4ORZ A;  4RTV A;  5I22 A;  1X27 A;  2CUD A;  1PKS A;  2GGR A;  4FSS A;  4J9D A;  2DRK A;  2RMO A;  4CC7 A;  2BTT A;  2H8H A;  2DF6 A;  2DM1 A;  2YT6 A;  4AFS C;  1AEY A;  2JS0 A;  2RQV A;  2DBM A;  2KT1 A;  3I5R A;  1GCQ C;  1Y0M A;  4JZ4 A;  1JO8 A;  2K6D A;  2K79 A;  3VS5 A;  2JM8 A;  1K0S A;  1ARK A;  1W1F A;  2L3Q A;  3UA6 A;  2J6K A;  2JM9 A;  1QLY A;  2O31 A;  2OJ2 A;  3FJ5 A;  4IIM A;  4JJD A;  2RQR A;  3PVL A;  3NMZ C;  2JTE A;  2DL5 A;  2EYZ A;  1YN8 A;  1AZG B;  1MUZ A;  4RTX A;  1U5S A;  1ZX6 A;  2GTJ A;  1ZBJ A;  2YSQ A;  1UTI A;  2BZY A;  5FW9 A;  3M0S A;  2DL4 A;  4J9B A;  3GBQ A;  4RTY A;  1UDL A;  1H8K A;  1WLP B;  4JJC A;  2JMC A;  2EGE A;  2M0Y A;  1G83 A;  1YWO A;  4A63 B;  2LQW A;  3VS1 A;  1ZUK A;  2AZV A;  3EHQ A;  4EIK A;  2MIO A;  2DL3 A;  4J9G A;  3NPF A;  2LMJ A;  3H41 A;  2KNB B;  1S1N A;  1VYT A;  3A98 A;  5IHN A;  2KYB A;  5EC7 A;  1UEC A;  1B07 A;  3VS2 A;  4Z89 A;  2DLP A;  1JU5 C;  2RQT A;  1AWX A;  1NYF A;  3EHR A;  4RTZ A;  1WA7 A;  4JZ3 A;  2JT4 A;  5IXF A;  2LNH B;  1ABQ A;  1M27 C;  3VS4 A;  2AKL A;  1AD5 A;  3H0I A;  2FG0 A;  2W10 A;  1KSW A;  2FO0 A;  1FMK A;  1UHF A;  1NYG A;  2D0N A;  4JPB W;  2D1X A;  1X43 A;  4ESR A;  2J7I A;  5IHI A;  1TUC A;  4J9E A;  4F17 A;  1YP5 A;  3O5Z A;  1M30 A;  1M3B A;  1XOV A;  4CC2 A;  2C0T A;  1A0N B;  2RNA A;  2LJ1 A;  1SRL A;  4Y92 A;  2L0A A;  3VRY A;  1AWJ A;  1NLO C;  1X6B A;  1YNZ A;  2AKK A;  2DJQ A;  2EBP A;  2PTK A;  4CC4 B;  3VS6 A;  5IHK A;  1E6H A;  2J6F A;  1WI7 A;  1WX6 A;  1SHF A;  2LJ3 A;  3NHN A;  1SRM A;  1I07 A;  2CT4 A;  1J3T A;  4GLM A;  1NLP C;  2JW4 A;  2P4R A;  2L3P A;  1GBQ A;  1CKA A;  1QCF A;  3M0P A;  2V1Q A;  1T0H A;  2A37 A;  2GQI A;  3EG1 A;  4RTU A;  4RUG A;  2OAW A;  4DEY A;  2DBK A;  2RN8 A;  4ZNX A;  1UUE A;  2C0I A;  2IIM A;  1WXB A;  1K9A A;  2EYW A;  1WFW A;  3ZL7 C;  2CUB A;  1GCQ A;  2EKH A;  3TSW A;  1UGV A;  1AZE A;  1OV3 A;  1W6X A;  4WCI A;  2FRY A;  3THK A;  2CRE A;  4J9I A;  1ZLM A;  2KR3 A;  3REA B;  1SEM A;  1CKB A;  2J05 A;  2KT8 A;  4HVV A;  2ESW A;  1X2Q A;  2JXB A;  2KEA A;  2LQN A;  3NGP A;  4K11 A;  1MV3 A;  3VS3 A;  1FYN A;  1B3Q A;  2SRC A;  4J9F A;  1SSH A;  2EVR A;  2BZX A;  1BBZ A;  2HDA A;  3KFV A;  5L23 A;  2HEQ A;  2ROL A;  2HBW A;  2EYX A;  2BZ8 A;  1H92 A;  3PVQ A;  3SHW A;  1UFF A;  1WYX A;  2D8J A;  2PZ1 A;  4OMP A;  4AG2 C;  1NG2 A;  3U23 A;  2DNU A;  2JS2 A;  4QT7 A;  1WDX A;  2KE9 A;  3EG2 A;  1ABO A;  1AVZ C;  2MCN A;  3TSZ A;  2ABL A;  2DIL A;  2KRM A;  1TUD A;  2NWM A;  4DEX A;  1RLP C;  1KFZ A;  2JMA A;  3QWX X;  2DVJ A;  1H3H A;  2VVK A;  3ULR B;  2FPF A;  1GRI A;  2A28 A;  2EGA A;  3VS0 A;  2L2P A;  5I11 A;  1NM7 A;  1W70 A;  1KJW A;  4Z8A A;  2O9V A;  2RF0 A;  3EGU A;  1JXO A;  3UAT A;  2W0Z A;  1TG0 A;  1Y57 A;  4J9H A;  1ZUU A;  5IXB A;  2LCS A;  1I1J A;  3JV3 A;  3UF4 A;  2GTO A;  2VWF A;  1UJY A;  1X69 A;  1PHT A;  1N5Z A;  2MOX A;  4KRT A;  2EYY A;  4CC3 A;  4OMM A;  3M0R A;  4LNP A;  2CH4 W;  1V1C A;  2A08 A;  4HVW A;  4F16 A;  2J6O A;  1CSK A;  4LE9 A;  1JXM A;  1ZUY A;  1UG1 A;  1ZSG A;  4E6R A;  1K1Z A;  1E6G A;  5FWB A;  1HSQ A;  1G2B A;  5GJW B;  3RBB B;  1OOT A;  3PE0 A;  2PNI A;  2ECZ A;  3LH5 A;  2B86 A;  2YUQ A;  2ED0 A;  3TVT A;  1AWO A;  2K7A A;  2YUO A;  2KXD A;  2AK5 A;  2F2V A;  2YDL A;  3EG3 A;  4LUD A;  4AG1 C;  1T3S A;  1IO6 A;  3I9Q A;  1JEG A;  2ROT A;  4M4Z A;  1RI9 A;  1T3L A;  3IQL A;  4OML A;  4OMN A;  1AOJ A;  2SEM A;  2A36 A;  1Z9Q A;  2DL7 A;  1OPL A;  2VKN A;  2KBT A;  4GBQ A;  1QWE A;  2CDT A;  2RQU A;  5HCK A;  3REB B;  1AWW A;  1X2K A;  1M8M A;  2YUP A;  2ENM A;  4R0K A;  1GBR A;  1JQQ A;  2AZS A;  2EGC A;  1BB9 A;  4RTT A;  5IH2 A;  1EFN A;  1PNJ A;  2XMF A;  2FEI A;  2DA9 A;  1RLQ C;  2KRO A;  3UA7 A;  1GCP A;  2FRW A;  1M3A A;  2E5K A;  1HJD A;  3C0C A;  3R6N A;  2GBQ A;  2NUZ A;  2I0N A;  1KIK A;  5FWC A;  2EQI A;  1OEB A;  4IIO A;  4Z88 A;  4LN2 A;  4HVU A;  2CSQ A;  1U06 A;  2KRN A;  1WXT A;  1QKX A;  1YWP A;  2LZ6 B;  2KRS A;  2QDL A;  2O2O A;  1HD3 A;  1K4U S;  1MV0 B;  1U3O A;  2FPE A;  1VA7 A;  2KGT A;  2HSP A;  2O9S A;  1PWT A;  1QKW A;  1NEG A;  2GNC A;  1UHC A;  3SEM A;  1GFC A;  1VYU A;  3M0Q A;  1NEB A;  2C0O A;  2DRM A;  2CT3 A;  1Z9Z A;  3VRZ A;  2DMO A;  2HCK A;  1SHG A;  1BU1 A;  5GJV B;  2LX7 A;  3EG0 A;  1T0J A;  2CSI A;  4OMQ A;  1QWF A;  3M0T A;  4HCK A;  2M51 A;  2DX1 A;  1PKT A;  2DL8 A;  3RNJ A;  2LJ0 A;  1YCS B;  1E7O A;  2K9G A;  1GL5 A;  4RTW A;  4X1V A;  5ECA A;  2EPD A;  1X6G A;  2RQW A;  4LUE A;  2LP5 A;  2G6F X;  1SPK A;  1RUW A;  1GFD A;  2DYB A;  2ED1 A;  1K76 A;  3QWY A;  1WXU A;  2K3B A;  2X3X D;  2EW3 A;  1LCK A;  2F2X A;  2KYM A;  2X3W D;  2FPD A;  3VS7 A;  1PRL C;  1WIE A;  2YUN A;  2RPN A;  2DE0 X;  2KXC A;  1UE9 A;  1UJ0 A;  2F2W A;  4D8D A;  2CH4 A;  1PRM C;  1I0C A;  4AFZ C;  2V1R A;  3H0H A;  3I35 A;  2L3S A;  4JJB A;  4D8K A;  4F14 A;  3I5S A;  4AFQ C;  1K0X A;  2OI3 A;  4AFU C;  4HXJ A;  4OMO A;  3H0F A;  4J9C A;  2K2M A;  2J06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...