1I0CA

Eps8 sh3 closed monomer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8
publication title Effect of pH and salt bridges on structural assembly: molecular structures of the monomer and intertwined dimer of the Eps8 SH3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone/growth factor
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i0cA00
1SSHA 2GTOA 3VRZA 3NMZC 2V1RA 2KR3A 4F14A 1GCPA 3M0TA 4JZ4A 1T0HA 4CC4B 4AFQC 2GNCA 2JM9A 2JS2A 1PRLC 4KRTA 3EG0A 5GJVB 2PNIA 1QWEA 2K2MA 3H41A 1BK2A 2BZYA 1AEYA 2K6DA 2EYZA 1WXUA 4RTZA 1U5SA 4RTTA 3H0HA 1VYVA 4Z89A 2RQVA 3PVLA 3RBBB 3UF4A 2DL8A 2VVKA 3I9QA 1X6GA 4JPBW 2ECZA 2RQRA 3QWYA 1QKWA 2GGRA 1GCQA 2LQWA 3H0IA 2RQTA 2LJ1A 4K11A 1NLPC 1UGVA 4LE9A 4R0KA 1YWOA 2L2PA 2A36A 1ABQA 1H8KA 1PKTA 2K3BA 4JJDA 1V1CA 2EBPA 2CDTA 1QWFA 4X1VA 2DA9A 1KJWA 4ESRA 3R6NA 3UATA 2D8JA 2J6OA 4RTWA 2C0TA 3A98A 4OMLA 2ESWA 2JS0A 1AWWA 2KE9A 2M0YA 1NEGA 4JZ3A 3GBQA 2O9VA 4CC7A 2D0NA 2PZ1A 1QKXA 1PWTA 1X6BA 4DEYA 1K76A 4JJBA 2KYBA 4LUDA 2CSQA 3I5SA 1K0SA 2K9GA 1MV3A 2LNHB 1Z9ZA 1BBZA 2KROA 2HEQA 4J9EA 4EIKA 1AWXA 4LUEA 3VS2A 2JMCA 2YSQA 4AG1C 2AKLA 1TUCA 2LQNA 4D8DA 2G6FX 1YNZA 2RQWA 2FRWA 2EGEA 1IO6A 1PRMC 1UUEA 1WI7A 2GTJA 4D8KA 2O31A 3NGPA 1CKBA 1VYUA 1E7OA 1WXTA 2YDLA 3THKA 5L23A 4J9HA 2FO0A 2JM8A 4Z8AA 1FYNA 1ZUYA 2LZ6B 2M51A 1G2BA 1PNJA 2IIMA 3REBB 3VRYA 1SHFA 2GBQA 2HSPA 2LP5A 5I22A 1WYXA 3H0FA 4AFUC 1AZGB 5EC7A 1UE9A 2ENMA 3I5RA 3KFVA 1Z9QA 1ZUKA 4J9FA 2VKNA 1I0CA 1JXOA 2EYXA 1TUDA 1UHCA 3I35A 2DNUA 1X2KA 1H92A 3VS1A 2RN8A 1UJ0A 1B07A 2DILA 1PHTA 2DL5A 2EW3A 3M0QA 4JJCA 5HCKA 1NEBA 4ORZA 2RQUA 2RNAA 2HDAA 1JO8A 1K9AA 1AVZC 1YCSB 2FPFA 2X3WD 1AWOA 4J9DA 1ZUUA 5IXFA 2DL4A 1NLOC 1Y57A 4M4ZA 1NM7A 1CSKA 1X69A 2DF6A 2D1XA 2KXCA 4HVWA 4OMPA 1ARKA 1K4US 1X2QA 2YT6A 2RMOA 1K0XA 3UA6A 1AOJA 1J3TA 2ROLA 1OEBA 1I07A 1WDXA 2F2WA 3EHRA 1WXBA 1HD3A 3NPFA 2DBKA 2KRMA 2DVJA 5IXBA 1UJYA 2C0OA 3M0UA 2DRKA 1RI9A 2LJ0A 3VS7A 2C0IA 2SRCA 1PKSA 1OV3A 2KRNA 1S1NA 1M30A 5I11A 3PE0A 2FRYA 2HBWA 2J05A 1M3AA 2ROTA 4J9IA 3VS6A 1GFCA 2EKHA 2EYWA 4Z88A 1JXMA 1B3QA 2OI3A 4E6RA 2KYMA 2YUOA 2BZ8A 2F2VA 2XMFA 4A63B 3EGUA 3REAB 1LCKA 5IHIA 5IHKA 1M27C 3PVQA 2KBTA 2MCNA 2KT8A 3VS5A 2K7AA 4HVVA 4RTVA 2CH4W 2I0NA 4ZNXA 2AK5A 2AKKA 1M3CA 2DRMA 3M0PA 1KIKA 1MUZA 1JEGA 2ABLA 2KGTA 3M0SA 2CH4A 1T0JA 2KXDA 2ED0A 2KEAA 2J6KA 2O9SA 3C0CA 5IHNA 1YP5A 1UHFA 1Y0MA 4FSSA 4Y92A 1UG1A 2B86A 4WCIA 2RPNA 1GCQC 1SEMA 1T3SA 4HCKA 1N5ZA 1SPKA 3VS4A 1AD5A 1YN8A 1OOTA 2L3PA 4AG2C 2K79A 4AFSC 1T3LA 1SRLA 4OMMA 2JTEA 3U23A 1UTIA 2L3SA 4RTUA 1U3OA 4AFZC 3LH5A 2OAWA 2X3XD 1VYTA 3VS3A 2CUDA 4OMQA 2LMJA 3EG3A 4J9CA 3O5ZA 4LN2A 1RLQC 2DLPA 1ZLMA 2CT3A 1ZBJA 2PTKA 2EGCA 2FPDA 1JQQA 1WA7A 2EQIA 3EG1A 1GRIA 1SHGA 1HJDA 1ZSGA 2CSIA 2J06A 4J9GA 1MV0B 1BB9A 1UECA 1QCFA 2A08A 3NHNA 2HCKA 2LCSA 2DL7A 4LNPA 1RUWA 1X27A 2NUZA 2BZXA 1UDLA 2EVRA 1K1ZA 2EPDA 2NWMA 2AZSA 3JV3A 3TSWA 5FWBA 2YUNA 1GBQA 4CC2A 1RLPC 1KFZA 1G83A 3QWXX 1WLPB 2GQIA 3ULRB 4OMNA 4RUGA 3IQLA 3CQTA 1XOVA 2JT4A 5ECAA 2EGAA 1GL5A 2EYYA 1FMKA 2O2OA 1M3BA 5GJWB 1WX6A 1NYFA 4F17A 2CREA 2A37A 3TVTA 4IIOA 1CKAA 1WIEA 1W1FA 1BU1A 1E6HA 3TSZA 2DX1A 2MOXA 2F2XA 1WFWA 2FEIA 2LJ3A 1NYGA 2H8HA 3VS0A 4HXJA 1AZEA 2W0ZA 2CUBA 1KSWA 3FJ5A 3SHWA 1NG2A 2DJQA 2V1QA 1JU5C 1ABOA 2DYBA 3UA7A 1X43A 1HSQA 2SEMA 2J6FA 2OJ2A 1AWJA 2DE0X 2QDLA 3RNJA 4RTYA 1OPKA 2RF0A 2L0AA 2P4RA 2DM1A 4F16A 3SEMA 2YUPA 2DBMA 2FG0A 1GFDA 1YWPA 3ZL7C 1UFFA 3EHQA 2D8HA 2KNBB 1ZX6A 2ED1A 2J7IA 1I1JA 2E5KA 2JMAA 2YUQA 2BTTA 2DL3A 5FW9A 2LX7A 2JW4A 1A0NB 1W6XA 2KT1A 5IH2A 2MIOA 2CT4A 2JXBA 4GBQA 2VWFA 4RTXA 2AZVA 1TG0A 4IIMA 4DEXA 2KRSA 1W70A 2A28A 1EFNA 1E6GA 1VA7A 4QT7A 2FPEA 4HVUA 1M8MA 1OPLA 1SRMA 5FWCA 1GBRA 4OMOA 2L3QA 2DMOA 1H3HA 3M0RA 4J9BA 4CC3A 2O88A 1QLYA 3EG2A 4GLMA 1U06A 2W10A
chains in the Genus database with same CATH superfamily
1VQ4A 1YHQT 3M4GA 2GTOA 5KYWA 3VRZA 2AIRB 2FYKA 4F14A 3PNWC 1GCPA 2P0QA 3M4YA 1VQKA 4CC4B 2GNCA 1QVGS 1U1TA 2DVEA 3G4SQ 3EG0A 3CBOA 2Z0WA 3A8GB 2K2MA 3CCVT 5GMKl 2K6DA 2EYZA 1ZSZC 2RD1A 4J8OA 3RBBB 3UF4A 4M75D 4J7IA 4DBRA 1X6GA 4JPBW 2R5AA 1V76A 2ECZA 1QVGA 2LNVA 2XKOC 1R0BG 1MMDA 3CC4A 4LE9A 1QCOA 4R0KA 4QQDA 3PT9A 1BKBA 1QP3A 1UGPB 2QA4T 2K3BA 4J6WA 3OYNA 4DA4A 2EQUA 1VQPA 2XU8A 2DXBA 1VQ6A 2WSEE 3R6NA 3OSVA 2DYIA 3A98A 1F1BB 4OB3B 4OMLA 2ESWA 4FIBA 4NS5A 2LDMA 2KE9A 1YBYA 4MMLA 4KGZB 4JZ3A 2O9VA 2EQKA 4J7FA 3CMAT 3OMCA 3FDRA 3VJPA 4M78B 4Y91A 4M7AC 2FZKB 3M5AA 5KCOA 2E4HA 4LUDA 1C1AA 8AT1B 1K0SA 4N0AC 1JB0E 4JRQA 1LOJA 3QJ6A 4L5GA 3BW1A 2RK1A 1U8RA 3CCRT 3VS2A 1K8AC 1X01A 4ELYC 2YSQA 1TUCA 2DD4A 1OX9A 3J7AF 1XNIA 2RQWA 3CC2A 2FRWA 1KQ1A 3MO8A 4QVDA 5KE2A 1TH7A 2GTJA 3M55A 1YIJQ 3GIBA 1PM3A 4RCCA 5DLQE 2DTOA 2FL7A 1D1CA 2JZ2A 4PJOC 3X28B 2JM8A 1BI1A 4Z8AA 2QQSA 1ZUYA 5I21A 4HT9A 2YRVA 4XQ3A 2M02A 2GBQA 1WHMA 4E7SA 5KYXA 1M2OA 1PSEA 1AZGB 5CKBA 5EC7A 1UE9A 3I5RA 1Z9QA 3JB9D 4J9FA 2VKNA 2DPPB 2EYXA 1VQ7A 3I35A 5GAOn 3JCMW 1Q82R 1UJ0A 2X4WA 1B07A 4KUIA 2EIFA 2NYSA 2EW3A 1NEBA 2V8KA 3EG9B 2HDAA 2DEQA 1JO8A 2KI7A 2X51A 1VQ8A 3VYGA 2O4XA 1W2BS 4MDWA 3META 1NLOC 2P0PA 1WHLA 4M77G 1KD1C 4OMPA 4Y28E 1X2QA 4OF1A 1K73R 1K0XA 2HBPA 1YJWQ 1I07A 1WDXA 2F2WA 3EHRA 1WXBA 1HD3A 3EH1A 2DVJA 1ZSZB 3OS1A 3OS5A 2OTJA 1D0YA 2GFAA 3VS7A 4C5HA 3LLRA 3QZ5B 3CCLQ 1OV3A 2KRNA 4RG8A 2OTLA 4E7KA 5GAOr 1VQ5A 2MF2A 1GFCA 2EYWA 1IREB 2BE9B 1G5VA 5GMKh 3QJYA 1VQ4T 3RUXA 5FLXE 2K5FA 2QI2A 3EG9A 1VQKT 1M27C 3VV0A 2KBTA 1EZZB 4HVVA 5KH6A 2DXTA 3CCMQ 3PFSA 1W2BP 1D1AA 1K9MR 4C0DB 4ZNXA 4M7AE 4CI0C 1UGQB 3KUFA 4IURA 2LC4A 1I81A 3CBPA 5IHNA 1RACB 1ZSZA 4FSSA 4FL6A 2B86A 2QEXQ 5GAOm 2RPNA 5CKDA 4HCKA 5GAMj 4LD9K 5KCHA 4AFSC 4RKUE 1SG5A 2V26A 2JTEA 2L3SA 4FW2A 4RTUA 1VQPT 4AFZC 4PJOE 1VQ6T 3A5ZB 2OAWA 2X3XD 4PJNA 4OMQA 3OW2S 4M78F 3EG3A 4J9CA 3O5ZA 2MMPA 3SB2A 3CXCS 3E9FA 2DLPA 2F5KA 2HMAA 3E1SA 3RDVA 1ZLMA 2CT3A 4WF2A 1YITT 2LT1A 5CKFA 2FPDA 5GANe 1JQQA 1OI1A 1WA7A 2DIGA 3GLXA 1HJDA 3OW2A 4N4IA 5IT9E 2R5MA 4BDYA 4J9GA 3CXCA 4M7AA 5GAOl 3I56Q 1HYOA 4FYYB 4KUDK 2AT1B 2K57A 4A4HA 4DOVA 4N0AA 3SWNC 1YJNT 1RI0A 4XTZA 3KXTA 4LNPA 1RUWA 1FWZA 2NUZA 2LCCA 5LJ5j 3N5BB 4M75B 1K1ZA 4RG2A 2GF7A 5CCAA 4BACA 5FWBA 3V8JA 3QIIA 4J6YA 1RLPC 3DKMA 1KFZA 3HRTA 3QWXX 2GQIA 4PJOA 2R57A 3X26B 3IQLA 4XTVA 3V7SA 1XOVA 5ECAA 2EGAA 1GL5A 3EFSA 4Q5WA 4OP0A 3R6OA 1NYFA 2RA2A 4C8QG 1SSFA 2C06A 2A37A 1CKAA 2NUPB 5KYYB 1W1FA 1VQ9Q 1E6HA 1RADB 2F2XA 3WVDB 5LJ3f 2E3IA 1VQOA 2LJ3A 3I55A 4DQ2A 2CKKA 1NBEB 3VS0A 2BIVA 1NPRA 4M78D 2E65A 3JCMP 4XU0A 2HNIA 5LJ5d 2ZCFB 2CUBA 1KSWA 1NG2A 4C92G 3ER0A 1U1SA 4BY6B 1IGQA 4M77C 4KULA 2DYBA 2ZPHB 1V29B 3GP8A 1SKUB 2CP5A 3OMGA 1Q86U 1VQ8T 5M9OA 4EMKB 4RTYA 3OYMA 7AT1B 1P92A 1R8OB 3SEMA 2YUPA 2L5QA 1VQLT 2DETA 1JBMA 3EGXA 1M2VA 2EWNA 2RB6A 3OYEA 4MZTA 1Q81C 3SD4A 2OTJT 1D1BA 1W6XA 2DXUA 4GBQA 1QMCA 4QW2A 2QA4A 4PFOA 1LPLA 1TG0A 4DEXA 2OTLT 2KRSA 3S3MA 1W70A 2A28A 3CBMA 1VQ5T 4QT7A 3J81E 1SRMA 4KGXB 4X34A 4OMOA 2MAMA 2L3QA 4KH1B 3OYHA 2B8AA 2E1HA 1Q95G 4LDWA 4CC3A 5CR2A 2HZYA 1X6OA 1U06A 4OVAA 5FROA 1PCXA 4C5GA 5I2SA 2KR3A 4J6XA 5KYUB 4JZ4A 5DY9A 4J5YA 4GY5A 2YRDA 2COZA 3Q1JA 3P8HA 2JM9A 1PRLC 1G3TA 3CCRA 4KRTA 3CCLA 4PNOA 3ASKA 1BK2A 1K8AR 3CEYA 1KK7A 3UPUA 4E7HA 1U5SA 2WACA 3VUBA 4F7UF 2DTHA 2VVKA 4XTWA 5CVIA 2ZPGB 2QGGA 1QKWA 2G3RA 1IHVA 2LQWA 3H0IA 5GMKi 2RQTA 4BI8B 4AMCA 4XAXB 1UGVA 4M7DG 1NJIR 4YTLA 5GAMg 3CCJA 1MNDA 1IZ6A 1TWBA 1WJRA 1ABQA 1H8KA 1PKTA 4JJDA 4JRKA 1V1CA 2CDTA 1QWFA 2YLCA 1KJWA 1BI0A 2J6OA 3X20B 2C0TA 2NUTB 2JS0A 1NEGA 3CC7A 3GBQA 4XTXA 2QEXA 5DLOA 3OYBA 3LH0A 1X6BA 4JJBA 4M75F 3I5SA 4DBHA 2MWPA 2LNHB 1BBZA 4M77E 2PUOB 4J9EA 2CYZB 3MEWA 4IUVA 1OULA 3SWNA 3C4SA 4MDXA 4M77B 4CRIA 2EAYA 2XDBA 4D8DA 3BDLA 2EGEA 1KC8R 4C5IA 5LJ5g 5GAN6 1RABB 5GMKe 4KGVB 1WI7A 4D8KA 1KD1R 4C8QC 2HSEB 1VYUA 3FLGA 3PMTA 1TXQA 2YDLA 3THKA 1XQHA 5L23A 3QDFA 4R56A 5CKEA 1FYNA 2CP3A 2IIMA 3JCMg 2IPOB 5CQXA 4E7JA 4C92C 3CD6Q 1WYXA 1TTHB 4A54A 3H0FA 2ENMA 1I0CA 4IKFA 2E41A 2RI2A 5FRNA 1UHCA 1ZQ1A 3A8OB 4ZGJB 4WTOB 1YI2Q 2KDSA 2XICA 2QTXA 2DILA 1PHTA 2LX9A 3HSBA 4M77A 4JJCA 2DK3A 3JB9J 2RQUA 1RAIB 3MHXA 4OB0B 1AVZC 5C0MA 1Q7YU 2FPFA 3NTIA 1Y7XA 3CMEQ 2VC8A 1ZUUA 2DL4A 1Y71A 1O9SA 1NM7A 1M90U 4QVCA 2ZPEB 4IUQA 3X24B 1K4US 1N9RA 3FC3A 2RMOA 1HK9A 1AHJB 4DBFA 1BI3A 3NPFA 5IXBA 1UJYA 3JB9F 3URGA 2DRKA 3JCMc 3EFOA 3JAME 2CZ0B 2MK5A 3BDUA 5LJ3h 4V2SA 1I8FA 4Z02A 3JCMQ 1M30A 5I11A 4ZTFA 1M3AA 5KYXB 5D6WA 1IHWA 1YITA 4Z88A 2E64A 3G71Q 1N8RU 4BE2A 1WHGA 2RHUA 4E6RA 2YUOA 2BZ8A 2F2VA 2XMFA 4A63B 4EMGA 3REAB 5IHIA 4BD3A 3PVQA 5AYFA 1RAGB 2KT8A 3VS5A 1M1KR 3CCQQ 4RTVA 4JDSA 3P8DA 2JNGA 2I0NA 3E2UA 1YJNA 3CCLT 1M3CA 4ZTJA 3M0PA 1WZOA 4M7DC 2ABLA 1D0XA 4FU6A 2QQAA 2O4XB 1NE8A 1QP2A 3M0SA 3M54A 2CH4A 4PJJA 2IVWA 2Y4YA 1Y0MA 1O75A 4Y92A 1S72Q 2DAQA 2PQWA 3RMQA 1N5ZA 1SPKA 1YN8A 3CCJT 3CCSA 1OOTA 3JRZA 2M1HA 4C8QE 1T3LA 3FEOA 1R77A 3U23A 1UTIA 4DOWA 3FIFA 4A53A 1KQ2A 1YHQQ 3LH5A 4N4GA 2RO0A 3M53A 2XDDA 3T9NA 4TVRA 1VQMQ 2LQ8A 3OB9A 3V7CA 4C92E 3CC7T 5LJ5h 3RMSA 3HFNA 3JB9H 4JLGA 5GAN2 2QEXT 2PTKA 3CCVQ 2EGCA 1PC0A 4IUPA 2CS7A 1GRIA 4MZMA 2CSIA 5GANj 1KQSP 4E7ZA 1IRXA 1TUGB 1UECA 2K4YA 1B34A 3ZEHA 5A0LA 2RI3A 2E6ZA 2XDPA 2LCSA 2ZZDA 2K2VA 2RHYA 1X27A 1VQLA 3CCUA 1MMAA 2EVRA 3LX7A 2KAFA 4BB7A 2EPDA 2O01E 2AZSA 4KBMB 1W2BA 1RAFB 2HL5C 3GNGA 4CC2A 4C8QA 1G83A 1KG1A 3G6EQ 4HT8A 1WLPB 1MGQA 3ULRB 3M58A 4RUGA 3G1JA 3LGFA 3CMAQ 2O2OA 2RK2A 5GANd 4C92A 1WX6A 4F17A 2EQMA 3TVTA 4JS5A 4IIOA 4MMKA 3TU4K 3A8LB 2F5TX 2FEIA 4BE1A 2MI6A 3MEAA 1HXDA 4EPCA 4HXJA 1AZEA 2W0ZA 2DZ9A 3FJ5A 2FB7A 4LD6A 2DJQA 4ZN1A 1ABOA 2HD0A 2E5QA 4FYWB 1HSQA 2SEMA 3INZA 2OX7A 4M7AB 2DE0X 2QDLA 3M56A 4M77D 1OPKA 2QQRA 2L0AA 2P4RA 3QKJA 2DM1A 3RESA 2FG0A 2LRQA 2KNBB 1ZX6A 4M7DE 2KY9A 4ME7A 1N6AA 2E5KA 3VUZA 2YUQA 2DL3A 3OYAA 4B9XA 4BDZA 4JRIA 2KT1A 5IH2A 2MIOA 2VWFA 5CAIA 4PJOB 3G4SA 4QVZA 3D7SB 3LGLA 3NTHA 1NZ9A 4LXCA 1E6GA 4PFZA 3LWHA 4BI3A 1M8MA 3V7RA 1QQJA 4PJLA 2R58A 2WSFE 1Y07A 2EFIA 2CP7A 2DMOA 1Y96B 3OBYA 1H3HA 3M0RA 5CKHA 3EG2A 1SSHA 2RJCA 4B9WA 3V8KA 2K3YA 5GAMd 2PVOB 3MPUB 3M0TA 4NL2A 1T0HA 4LDVA 3PTAA 3HL8A 3A8HB 3JSCA 2X4JA 4M78G 5GJVB 2PNIA 3OYGA 3HHTB 1R0CB 3L2QA 2YLBA 3CCEQ 3HP9A 4M7DA 2BZYA 1AEYA 3HKSA 4PKCC 4RTZA 4VUBA 4RTTA 3WXMB 3H0HA 4Z89A 5FRMA 2RI5A 4O5VA 3UDCA 1Q86C 2DL8A 3I9QA 3EGXB 3J80E 2A0FB 1VQNQ 2VGNA 1M2VB 3CCST 2GGRA 4HCZA 2XD0A 1VQ4Q 1YWOA 2E12A 5D7UA 5GAN4 1VQKQ 2ZGWA 2RJEA 1LJOA 1Y96A 2XIDA 4X1VA 4B6MA 1YJ9Q 4FM4B 4ESRA 4RTWA 3V8LA 1YIJA 3DB4A 1AWWA 1VIFA 1JJ2P 3S6WA 4EMHA 4KH0B 2PZ1A 2X4YA 3HFOA 1QKXA 3QZ9B 1Q82C 5GAMf 2WSCE 3QYGB 2QQBA 2X4XA 3CC4Q 2CSQA 5GANg 1JRIA 3JCMd 1Z9ZA 2L3RA 2KROA 3P8BB 2HEQA 4RMOA 2COWA 5LJ3e 3CCUT 2AKLA 2LQNA 1VQPQ 1FXXA 2VASA 3OYFA 1C0MA 1ZBXA 4IUTA 1IO6A 1PRMC 4XK8E 2V8IA 3TCJA 1CKBA 5GMKj 2RHXA 4J9HA 4ANJA 2FO0A 4FW1A 1WQ7A 4C8QD 2LZ6B 1PNJA 4PLLA 1Q82U 2DZCA 2BUDA 5CIUA 1SHFA 2LP5A 2HSPA 9ATCB 5I22A 2EKOA 5GAOq 3HRSA 2HKQB 2X9HA 3C95A 4AFUC 1XJWB 3FJPA 4C92D 3LYIA 1MMNA 5LJ5f 1JXOA 1WJQA 1UGSB 3CC2Q 4M7AF 4D6WA 1TUDA 1YJWA 2DNUA 3DLLA 2CZ7B 3VS1A 1K73U 3G7ZA 2DL5A 3ME9A 3JCMf 2CP6A 3QBYA 2RNAA 1K9MC 2DFUA 5D6XA 5CQYA 1K9AA 3RKYA 2AHJB 4J9DA 4ZN3A 2EJGA 3SWNB 3EFRA 4A4KA 5LJ5e 2D1XA 2KXCA 4PJOF 3BE3A 3TEEA 1M4ZA 2YT6A 3UA6A 1AOJA 2LTOA 1J3TA 2XHCA 1N9SA 1VQ7Q 2MYSA 3CCMA 2DBKA 2C0OA 3G4ST 3RIRA 5KYNA 2P0KA 2QK0A 2LJ0A 4A4EA 4RCBA 5GAN7 3CPWS 5DM7R 2C0IA 4OGCA 4MZPA 3CMET 2HAXA 1K9MU 1VQ8Q 2E3HA 2HBWA 2ROTA 4ZGEB 3VS6A 4XU2A 2EKHA 2VXEA 4F7UG 3ZFJA 2RHZA 3QDRB 2KYMA 4M78C 2RJDA 1IB8A 1IGUA 4UC4A 2YRCA 3FRNA 1LCKA 2PU9B 3CPFA 3ZBDA 2GCXA 4M7AD 2JOYA 2CH4W 2HKNA 1UB4A 2AK5A 2OTJQ 2DRMA 1WQWA 3UWNA 2GFUA 3RR6A 2KGTA 4HKEA 3QUIA 5HY6A 2OTLQ 2KMTA 1UHFA 4M7DD 5FU6C 1VQ5Q 5D6YA 1GXIE 1GCQC 1SEMA 2VXFA 4BE0A 2E10A 1Q7YC 1T3SA 3CPWP 2NLUA 1AD5A 2P4TA 4PJOD 2L3PA 4AG2C 3I56A 4JLIA 4M75G 1SRLA 1M90C 1RAEB 3EFOB 3VS3A 2CUDA 2RH2A 5AT1B 1BCMA 3OYYA 1OYXA 1YIJT 4LN2A 1RL2A 1FMWA 2D0QB 2JTMA 2IG0A 4FYVB 4QQ6A 2JN0A 4OB1B 3JCMX 1VQNA 2EQIA 3M57A 3EG1A 1M1GA 2VYTA 1ZSGA 3LWIA 1MV0B 1BB9A 2EJ9A 2A08A 5GAN3 1N8RC 2HCKA 1VQMT 2DL7A 2K5IA 5CO7A 3E19A 1VQ9A 1I5OB 1YCYA 1YJ9A 3EGDA 1PD0A 1TSFA 3JB9I 1MNEA 1SF9A 5A0DA 2NWMA 1IXDA 4E7IA 4NOYA 1FMVA 4FYXB 1M8VA 2QGFB 1B7TA 2HQEA 4FCYA 5GAN5 3OS0A 1BCOA 1WHKA 2JT4A 5I2MA 3OBWA 1BI2A 3OY9A 2EYYA 2QASA 1M3BA 5GJWB 3PGGA 3AT1B 1YJWT 1OQKA 5GAMh 3G6ET 3SHWA 4JRPA 2VUBA 3JB9G 4M78E 1OZ2A 2DO3A 2V1QA 4C0DC 1JU5C 4LDYA 1X43A 5FU7C 5HK0A 3OYLA 1QVGP 1KQSS 4DBQA 2J6FA 3RERA 1B34B 2X35A 2H3EB 4F16A 2H3JA 4XTUA 1GFDA 4C0GA 1YWPA 3ZL7C 2D8HA 2F1LA 2E70A 4BUGA 5J3BA 1KQSA 1VQOQ 2J7IA 3CCMT 1I1JA 2JMAA 3I55Q 2K3XA 4C0ZA 1TS9A 2LX7A 1Q86R 4PFPA 3PIPA 2JW4A 5LL6S 2EYQA 4C8QB 5HK3A 2JXBA 3GPLA 5FU6B 1NJIC 3MCAB 2AZVA 1BYMA 4IIMA 3L2UA 4AT1B 3OSSC 2VGMA 2LVMA 2BKDN 2FPEA 4HVUA 4C92B 1OPLA 3TQ7P 2DTIA 2QXFA 5FWCA 1UGRB 2I2LA 4M77F 4E7LA 4R55A 1EX4A 4J9BA 1K8AU 2O88A 2PUKB 1QLYA 4M78A 1FX7A 2W10A 3JCMh 3NMZC 2V1RA 4AFQC 3GF5A 2JS2A 3QG1A 1G8XA 2HL3A 2QA4Q 1G3YA 3KBGA 3HPWA 4OMFB 1NJIU 3OQ5A 1QWEA 4M75C 3H41A 3OYKA 3QHSA 2OAUA 1WXUA 4A4GA 1VYVA 1KC8C 2RQVA 1M5Q1 3PVLA 3EAEA 1C6VX 1M9SA 2DD5A 2RQRA 3QWYA 1Q81R 3I56T 1GCQA 2LJ1A 4K11A 1NLPC 2QYZA 4KT0E 2K5LA 2L2PA 2DEUA 2D9TA 1ACMB 1UEBA 2A36A 3DLMA 4N4HA 2JVVA 2ZPIB 2EBPA 1H3ZA 1PD1A 2CP2A 2DA9A 3CCET 4XU1A 3CCRQ 3UATA 3C94A 2D8JA 3MP6A 4X9CA 5EG2A 1WPYA 1VQNT 2M0YA 4BY6C 1YFNA 8ATCB 3MEUA 4CC7A 2D0NA 1KC8U 2CZ1B 1PWTA 2COYA 3SFMA 5A2QE 4QKUA 4DEYA 4EMKC 1I4K1 1K76A 4NL3A 3OYIA 1KD1U 3OS2A 2KYBA 3H8ZA 1TOVA 2K9GA 3CD6A 1MV3A 1D0ZA 1VQ9T 1YJ9T 4P5NA 4QQGA 2XK0A 4EIKA 3CCJQ 1AWXA 4HA8A 4LUEA 2JMCA 4AG1C 4E2FB 4JJNK 5LJ3j 2G6FX 1YNZA 5J39A 5FU7B 4C5EA 4M7DB 4IUUA 1UUEA 1PSFA 1M1FA 3VYHB 2O31A 2VV5A 3NGPA 3RKWA 3UT1A 2GQVA 1BIBA 1PG5B 1YI2A 1E7OA 3CC7Q 1WXTA 2KVQG 4EDUA 3CC4T 5GANf 2M51A 1G2BA 2F69A 3GOXA 1WNLA 3REBB 3CMEA 3VRYA 4F7UE 3MEVA 1TU0B 1QCNA 5CK9A 1ZHIA 4L59A 2XG8D 4F7UB 2ZPFB 3KFVA 1ZUKA 3GNFB 1DJ7B 3BY7A 4GLKA 1QVFS 3MP8A 5LJ3d 1X2KA 3L1AA 1H92A 1JJ2S 2RN8A 2JJ9A 3VKIA 1VIEA 1M1KC 2LCLA 3M0QA 5HCKA 4ORZA 2RJFA 3EH2A 1X75C 5KE3A 1YCSB 5HKCA 2M16A 1MHNA 2X3WD 1AWOA 2QQ9A 1QVFA 5IXFA 1Y57A 4LDXA 4PJMA 4C8QF 1JJ2A 4A4FA 4M4ZA 3G71A 1CSKA 1X69A 2DF6A 1XTDA 3OYDA 3CC2T 2QAZA 4HVWA 2L89A 1ARKA 4M75E 3A8MB 2RHIA 1OU8A 3VU3C 4PK4A 2ROLA 1OEBA 2FZCB 3H6ZA 3OYJA 2M0OA 3S3NA 2FHDA 3CCQA 2KRMA 4C92F 3M0UA 1Q7YR 3QYHB 1RI9A 4F7UA 2V8JA 5GAOp 2SRCA 3OW2P 1PKSA 1M90R 1M1KU 3CXCP 2L8DA 3FB9A 1S1NA 3PE0A 1OX8A 2FRYA 1QVFP 2J05A 2DERA 4J9IA 3H9NA 1S72A 1JXMA 1G3SA 1B3QA 2HQHA 4ATOA 1AT1B 2OI3A 5L8RE 4HCBA 4II1A 3MJXA 3EGUA 1VQ7T 1QVPA 2YHTA 3M9QA 5IHKA 2MCNA 3OYCA 2CZ6B 2K7AA 2EQJA 4BI4A 1YHQA 1RAAB 2A3LA 2AKKA 1VQMA 1BIAA 2M9UA 1VQ6Q 4XTYA 4E47A 3MP1A 2MWOA 1KIKA 1N8RR 2ATCB 1MUZA 1JEGA 3LW5E 1D3BB 4M75A 1WGSA 1T0JA 2KXDA 1K73C 2ED0A 2J6KA 2KEAA 2O9SA 3C0CA 3CCVA 1YP5A 3AHUA 4L6V5 1YITQ 1UG1A 5GAMe 4WCIA 2PVGB 1QW1A 3VS4A 1WHHA 2K79A 4FSXA 3JCMb 4OMMA 2VB6A 1I5LA 1U3OA 2KSSA 1WJSA 3JCMJ 2E6NA 1VYTA 2RM4A 1WHJA 2LMJA 1YJNQ 5KYYA 2NUPA 5IN1A 3S3OA 1RLQC 2XI9A 1NPPA 4O6JA 3PIOA 1VUBA 4J83A 3OA6A 1ZBJA 3L2ZA 1EIFA 4ZGDB 2KK4A 1KHIA 2LT4A 3G6EA 2CP0A 3NFCA 1SHGA 3CD6T 2J06A 5J26A 1D09B 3CMAA 4M7DF 3CCSQ 1QCFA 4EMKA 2LQKA 1D3BA 3RKXA 3NHNA 3TREA 4PLIA 2DKGA 2BE7D 1Q81U 2MPXC 4LDUA 3DB3A 1KHCA 2JUFA 3C12A 2BZXA 3WVEB 1UDLA 3E9GA 1OZ3A 1MMGA 5C6SA 4M7AG 5LJ3g 3L2VA 1YI2T 3JV3A 3TSWA 4F04B 2DXCA 2YUNA 1GBQA 3JCMe 2EJFA 3L2WA 1ZA1B 3SDZA 2FZGB 4OMNA 2QTVA 2KQWA 1OU9A 3CQTA 2HQXA 2DJZA 1FMKA 3QO3A 5IAYA 1VOMA 5GAN8 1H641 3F70A 2CREA 1WIEA 1BU1A 3TSZA 3CPWA 4PJOG 2DX1A 1LVKA 2MOXA 1WFWA 1NYGA 1VQLQ 3O8VA 3CCUQ 3PMIA 2H8HA 4XU3A 2PVDB 3MKDA 2FVUA 3HTRA 5KYUA 1RAHB 3NTKA 3QPHA 3UA7A 2OJ2A 1AWJA 3RNJA 5KYWB 1G3WA 2RF0A 3G71T 4JS4A 2QDYB 3BFMA 6AT1B 4PL6A 2DBMA 1UFFA 3M59A 4OB2B 2YWWA 3EHQA 3EGDB 2QG9B 4FT4A 2ED1A 5A0GA 3QXEB 3CCQT 2BTTA 5FW9A 5GANh 2DIQA 1W4SA 3L2RA 3X25B 4C0FA 2YXYA 4ELZC 1A0NB 2Y90A 2D6FA 2CT4A 2ZPBB 1N27A 2P84A 2CGHA 4OGEA 2Y4XA 5GMKm 4RTXA 2A7YA 1EFNA 3CCEA 4JUVA 1S72T 1VA7A 2NUTA 3L42A 3A1PA 2JTFA 1GBRA 3HRUA 1VQOT 4X9DA 3JCMV 3I55T 4HCCA 4FT2A 1ZA2B 1LNXA 2ZAEA 4GLMA 3QSUA
chains in the Genus database with same CATH topology
1SSHA 2GTOA 3VRZA 3NMZC 2V1RA 2KR3A 4F14A 1GCPA 3M0TA 4JZ4A 1T0HA 4CC4B 4AFQC 2GNCA 2JM9A 2JS2A 1PRLC 4KRTA 3EG0A 5GJVB 2PNIA 1QWEA 2K2MA 3H41A 1BK2A 2BZYA 1AEYA 2K6DA 2EYZA 1WXUA 4RTZA 1U5SA 4RTTA 3H0HA 1VYVA 4Z89A 2RQVA 3PVLA 3RBBB 3UF4A 2DL8A 2VVKA 3I9QA 1X6GA 4JPBW 2ECZA 2RQRA 3QWYA 1QKWA 2GGRA 1GCQA 2LQWA 3H0IA 2RQTA 2LJ1A 4K11A 1NLPC 1UGVA 4LE9A 4R0KA 1YWOA 2L2PA 2A36A 1ABQA 1H8KA 1PKTA 2K3BA 4JJDA 1V1CA 2EBPA 2CDTA 1QWFA 4X1VA 2DA9A 1KJWA 4ESRA 3R6NA 3UATA 2D8JA 2J6OA 4RTWA 2C0TA 3A98A 4OMLA 2ESWA 2JS0A 1AWWA 2KE9A 2M0YA 1NEGA 4JZ3A 3GBQA 2O9VA 4CC7A 2D0NA 2PZ1A 1QKXA 1PWTA 1X6BA 4DEYA 1K76A 4JJBA 2KYBA 4LUDA 2CSQA 3I5SA 1K0SA 2K9GA 1MV3A 2LNHB 1Z9ZA 1BBZA 2KROA 2HEQA 4J9EA 4EIKA 1AWXA 4LUEA 3VS2A 2JMCA 2YSQA 4AG1C 2AKLA 1TUCA 2LQNA 4D8DA 2G6FX 1YNZA 2RQWA 2FRWA 2EGEA 1IO6A 1PRMC 1UUEA 1WI7A 2GTJA 4D8KA 2O31A 3NGPA 1CKBA 1VYUA 1E7OA 1WXTA 2YDLA 3THKA 5L23A 4J9HA 2FO0A 2JM8A 4Z8AA 1FYNA 1ZUYA 2LZ6B 2M51A 1G2BA 1PNJA 2IIMA 3REBB 3VRYA 1SHFA 2GBQA 2HSPA 2LP5A 5I22A 1WYXA 3H0FA 4AFUC 1AZGB 5EC7A 1UE9A 2ENMA 3I5RA 3KFVA 1Z9QA 1ZUKA 4J9FA 2VKNA 1I0CA 1JXOA 2EYXA 1TUDA 1UHCA 3I35A 2DNUA 1X2KA 1H92A 3VS1A 2RN8A 1UJ0A 1B07A 2DILA 1PHTA 2DL5A 2EW3A 3M0QA 4JJCA 5HCKA 1NEBA 4ORZA 2RQUA 2RNAA 2HDAA 1JO8A 1K9AA 1AVZC 1YCSB 2FPFA 2X3WD 1AWOA 4J9DA 1ZUUA 5IXFA 2DL4A 1NLOC 1Y57A 4M4ZA 1NM7A 1CSKA 1X69A 2DF6A 2D1XA 2KXCA 4HVWA 4OMPA 1ARKA 1K4US 1X2QA 2YT6A 2RMOA 1K0XA 3UA6A 1AOJA 1J3TA 2ROLA 1OEBA 1I07A 1WDXA 2F2WA 3EHRA 1WXBA 1HD3A 3NPFA 2DBKA 2KRMA 2DVJA 5IXBA 1UJYA 2C0OA 3M0UA 2DRKA 1RI9A 2LJ0A 3VS7A 2C0IA 2SRCA 1PKSA 1OV3A 2KRNA 1S1NA 1M30A 5I11A 3PE0A 2FRYA 2HBWA 2J05A 1M3AA 2ROTA 4J9IA 3VS6A 1GFCA 2EKHA 2EYWA 4Z88A 1JXMA 1B3QA 2OI3A 4E6RA 2KYMA 2YUOA 2BZ8A 2F2VA 2XMFA 4A63B 3EGUA 3REAB 1LCKA 5IHIA 5IHKA 1M27C 3PVQA 2KBTA 2MCNA 2KT8A 3VS5A 2K7AA 4HVVA 4RTVA 2CH4W 2I0NA 4ZNXA 2AK5A 2AKKA 1M3CA 2DRMA 3M0PA 1KIKA 1MUZA 1JEGA 2ABLA 2KGTA 3M0SA 2CH4A 1T0JA 2KXDA 2ED0A 2KEAA 2J6KA 2O9SA 3C0CA 5IHNA 1YP5A 1UHFA 1Y0MA 4FSSA 4Y92A 1UG1A 2B86A 4WCIA 2RPNA 1GCQC 1SEMA 1T3SA 4HCKA 1N5ZA 1SPKA 3VS4A 1AD5A 1YN8A 1OOTA 2L3PA 4AG2C 2K79A 4AFSC 1T3LA 1SRLA 4OMMA 2JTEA 3U23A 1UTIA 2L3SA 4RTUA 1U3OA 4AFZC 3LH5A 2OAWA 2X3XD 1VYTA 3VS3A 2CUDA 4OMQA 2LMJA 3EG3A 4J9CA 3O5ZA 4LN2A 1RLQC 2DLPA 1ZLMA 2CT3A 1ZBJA 2PTKA 2EGCA 2FPDA 1JQQA 1WA7A 2EQIA 3EG1A 1GRIA 1SHGA 1HJDA 1ZSGA 2CSIA 2J06A 4J9GA 1MV0B 1BB9A 1UECA 1QCFA 2A08A 3NHNA 2HCKA 2LCSA 2DL7A 4LNPA 1RUWA 1X27A 2NUZA 2BZXA 1UDLA 2EVRA 1K1ZA 2EPDA 2NWMA 2AZSA 3JV3A 3TSWA 5FWBA 2YUNA 1GBQA 4CC2A 1RLPC 1KFZA 1G83A 3QWXX 1WLPB 2GQIA 3ULRB 4OMNA 4RUGA 3IQLA 3CQTA 1XOVA 2JT4A 5ECAA 2EGAA 1GL5A 2EYYA 1FMKA 2O2OA 1M3BA 5GJWB 1WX6A 1NYFA 4F17A 2CREA 2A37A 3TVTA 4IIOA 1CKAA 1WIEA 1W1FA 1BU1A 1E6HA 3TSZA 2DX1A 2MOXA 2F2XA 1WFWA 2FEIA 2LJ3A 1NYGA 2H8HA 3VS0A 4HXJA 1AZEA 2W0ZA 2CUBA 1KSWA 3FJ5A 3SHWA 1NG2A 2DJQA 2V1QA 1JU5C 1ABOA 2DYBA 3UA7A 1X43A 1HSQA 2SEMA 2J6FA 2OJ2A 1AWJA 2DE0X 2QDLA 3RNJA 4RTYA 1OPKA 2RF0A 2L0AA 2P4RA 2DM1A 4F16A 3SEMA 2YUPA 2DBMA 2FG0A 1GFDA 1YWPA 3ZL7C 1UFFA 3EHQA 2D8HA 2KNBB 1ZX6A 2ED1A 2J7IA 1I1JA 2E5KA 2JMAA 2YUQA 2BTTA 2DL3A 5FW9A 2LX7A 2JW4A 1A0NB 1W6XA 2KT1A 5IH2A 2MIOA 2CT4A 2JXBA 4GBQA 2VWFA 4RTXA 2AZVA 1TG0A 4IIMA 4DEXA 2KRSA 1W70A 2A28A 1EFNA 1E6GA 1VA7A 4QT7A 2FPEA 4HVUA 1M8MA 1OPLA 1SRMA 5FWCA 1GBRA 4OMOA 2L3QA 2DMOA 1H3HA 3M0RA 4J9BA 4CC3A 2O88A 1QLYA 3EG2A 4GLMA 1U06A 2W10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSH A;  2GTO A;  3VRZ A;  3NMZ C;  2V1R A;  2KR3 A;  4F14 A;  1GCP A;  3M0T A;  4JZ4 A;  1T0H A;  4CC4 B;  4AFQ C;  2GNC A;  2JM9 A;  2JS2 A;  1PRL C;  4KRT A;  3EG0 A;  5GJV B;  2PNI A;  1QWE A;  2K2M A;  3H41 A;  1BK2 A;  2BZY A;  1AEY A;  2K6D A;  2EYZ A;  1WXU A;  4RTZ A;  1U5S A;  4RTT A;  3H0H A;  1VYV A;  4Z89 A;  2RQV A;  3PVL A;  3RBB B;  3UF4 A;  2DL8 A;  2VVK A;  3I9Q A;  1X6G A;  4JPB W;  2ECZ A;  2RQR A;  3QWY A;  1QKW A;  2GGR A;  1GCQ A;  2LQW A;  3H0I A;  2RQT A;  2LJ1 A;  4K11 A;  1NLP C;  1UGV A;  4LE9 A;  4R0K A;  1YWO A;  2L2P A;  2A36 A;  1ABQ A;  1H8K A;  1PKT A;  2K3B A;  4JJD A;  1V1C A;  2EBP A;  2CDT A;  1QWF A;  4X1V A;  2DA9 A;  1KJW A;  4ESR A;  3R6N A;  3UAT A;  2D8J A;  2J6O A;  4RTW A;  2C0T A;  3A98 A;  4OML A;  2ESW A;  2JS0 A;  1AWW A;  2KE9 A;  2M0Y A;  1NEG A;  4JZ3 A;  3GBQ A;  2O9V A;  4CC7 A;  2D0N A;  2PZ1 A;  1QKX A;  1PWT A;  1X6B A;  4DEY A;  1K76 A;  4JJB A;  2KYB A;  4LUD A;  2CSQ A;  3I5S A;  1K0S A;  2K9G A;  1MV3 A;  2LNH B;  1Z9Z A;  1BBZ A;  2KRO A;  2HEQ A;  4J9E A;  4EIK A;  1AWX A;  4LUE A;  3VS2 A;  2JMC A;  2YSQ A;  4AG1 C;  2AKL A;  1TUC A;  2LQN A;  4D8D A;  2G6F X;  1YNZ A;  2RQW A;  2FRW A;  2EGE A;  1IO6 A;  1PRM C;  1UUE A;  1WI7 A;  2GTJ A;  4D8K A;  2O31 A;  3NGP A;  1CKB A;  1VYU A;  1E7O A;  1WXT A;  2YDL A;  3THK A;  5L23 A;  4J9H A;  2FO0 A;  2JM8 A;  4Z8A A;  1FYN A;  1ZUY A;  2LZ6 B;  2M51 A;  1G2B A;  1PNJ A;  2IIM A;  3REB B;  3VRY A;  1SHF A;  2GBQ A;  2HSP A;  2LP5 A;  5I22 A;  1WYX A;  3H0F A;  4AFU C;  1AZG B;  5EC7 A;  1UE9 A;  2ENM A;  3I5R A;  3KFV A;  1Z9Q A;  1ZUK A;  4J9F A;  2VKN A;  1I0C A;  1JXO A;  2EYX A;  1TUD A;  1UHC A;  3I35 A;  2DNU A;  1X2K A;  1H92 A;  3VS1 A;  2RN8 A;  1UJ0 A;  1B07 A;  2DIL A;  1PHT A;  2DL5 A;  2EW3 A;  3M0Q A;  4JJC A;  5HCK A;  1NEB A;  4ORZ A;  2RQU A;  2RNA A;  2HDA A;  1JO8 A;  1K9A A;  1AVZ C;  1YCS B;  2FPF A;  2X3W D;  1AWO A;  4J9D A;  1ZUU A;  5IXF A;  2DL4 A;  1NLO C;  1Y57 A;  4M4Z A;  1NM7 A;  1CSK A;  1X69 A;  2DF6 A;  2D1X A;  2KXC A;  4HVW A;  4OMP A;  1ARK A;  1K4U S;  1X2Q A;  2YT6 A;  2RMO A;  1K0X A;  3UA6 A;  1AOJ A;  1J3T A;  2ROL A;  1OEB A;  1I07 A;  1WDX A;  2F2W A;  3EHR A;  1WXB A;  1HD3 A;  3NPF A;  2DBK A;  2KRM A;  2DVJ A;  5IXB A;  1UJY A;  2C0O A;  3M0U A;  2DRK A;  1RI9 A;  2LJ0 A;  3VS7 A;  2C0I A;  2SRC A;  1PKS A;  1OV3 A;  2KRN A;  1S1N A;  1M30 A;  5I11 A;  3PE0 A;  2FRY A;  2HBW A;  2J05 A;  1M3A A;  2ROT A;  4J9I A;  3VS6 A;  1GFC A;  2EKH A;  2EYW A;  4Z88 A;  1JXM A;  1B3Q A;  2OI3 A;  4E6R A;  2KYM A;  2YUO A;  2BZ8 A;  2F2V A;  2XMF A;  4A63 B;  3EGU A;  3REA B;  1LCK A;  5IHI A;  5IHK A;  1M27 C;  3PVQ A;  2KBT A;  2MCN A;  2KT8 A;  3VS5 A;  2K7A A;  4HVV A;  4RTV A;  2CH4 W;  2I0N A;  4ZNX A;  2AK5 A;  2AKK A;  1M3C A;  2DRM A;  3M0P A;  1KIK A;  1MUZ A;  1JEG A;  2ABL A;  2KGT A;  3M0S A;  2CH4 A;  1T0J A;  2KXD A;  2ED0 A;  2KEA A;  2J6K A;  2O9S A;  3C0C A;  5IHN A;  1YP5 A;  1UHF A;  1Y0M A;  4FSS A;  4Y92 A;  1UG1 A;  2B86 A;  4WCI A;  2RPN A;  1GCQ C;  1SEM A;  1T3S A;  4HCK A;  1N5Z A;  1SPK A;  3VS4 A;  1AD5 A;  1YN8 A;  1OOT A;  2L3P A;  4AG2 C;  2K79 A;  4AFS C;  1T3L A;  1SRL A;  4OMM A;  2JTE A;  3U23 A;  1UTI A;  2L3S A;  4RTU A;  1U3O A;  4AFZ C;  3LH5 A;  2OAW A;  2X3X D;  1VYT A;  3VS3 A;  2CUD A;  4OMQ A;  2LMJ A;  3EG3 A;  4J9C A;  3O5Z A;  4LN2 A;  1RLQ C;  2DLP A;  1ZLM A;  2CT3 A;  1ZBJ A;  2PTK A;  2EGC A;  2FPD A;  1JQQ A;  1WA7 A;  2EQI A;  3EG1 A;  1GRI A;  1SHG A;  1HJD A;  1ZSG A;  2CSI A;  2J06 A;  4J9G A;  1MV0 B;  1BB9 A;  1UEC A;  1QCF A;  2A08 A;  3NHN A;  2HCK A;  2LCS A;  2DL7 A;  4LNP A;  1RUW A;  1X27 A;  2NUZ A;  2BZX A;  1UDL A;  2EVR A;  1K1Z A;  2EPD A;  2NWM A;  2AZS A;  3JV3 A;  3TSW A;  5FWB A;  2YUN A;  1GBQ A;  4CC2 A;  1RLP C;  1KFZ A;  1G83 A;  3QWX X;  1WLP B;  2GQI A;  3ULR B;  4OMN A;  4RUG A;  3IQL A;  3CQT A;  1XOV A;  2JT4 A;  5ECA A;  2EGA A;  1GL5 A;  2EYY A;  1FMK A;  2O2O A;  1M3B A;  5GJW B;  1WX6 A;  1NYF A;  4F17 A;  2CRE A;  2A37 A;  3TVT A;  4IIO A;  1CKA A;  1WIE A;  1W1F A;  1BU1 A;  1E6H A;  3TSZ A;  2DX1 A;  2MOX A;  2F2X A;  1WFW A;  2FEI A;  2LJ3 A;  1NYG A;  2H8H A;  3VS0 A;  4HXJ A;  1AZE A;  2W0Z A;  2CUB A;  1KSW A;  3FJ5 A;  3SHW A;  1NG2 A;  2DJQ A;  2V1Q A;  1JU5 C;  1ABO A;  2DYB A;  3UA7 A;  1X43 A;  1HSQ A;  2SEM A;  2J6F A;  2OJ2 A;  1AWJ A;  2DE0 X;  2QDL A;  3RNJ A;  4RTY A;  1OPK A;  2RF0 A;  2L0A A;  2P4R A;  2DM1 A;  4F16 A;  3SEM A;  2YUP A;  2DBM A;  2FG0 A;  1GFD A;  1YWP A;  3ZL7 C;  1UFF A;  3EHQ A;  2D8H A;  2KNB B;  1ZX6 A;  2ED1 A;  2J7I A;  1I1J A;  2E5K A;  2JMA A;  2YUQ A;  2BTT A;  2DL3 A;  5FW9 A;  2LX7 A;  2JW4 A;  1A0N B;  1W6X A;  2KT1 A;  5IH2 A;  2MIO A;  2CT4 A;  2JXB A;  4GBQ A;  2VWF A;  4RTX A;  2AZV A;  1TG0 A;  4IIM A;  4DEX A;  2KRS A;  1W70 A;  2A28 A;  1EFN A;  1E6G A;  1VA7 A;  4QT7 A;  2FPE A;  4HVU A;  1M8M A;  1OPL A;  1SRM A;  5FWC A;  1GBR A;  4OMO A;  2L3Q A;  2DMO A;  1H3H A;  3M0R A;  4J9B A;  4CC3 A;  2O88 A;  1QLY A;  3EG2 A;  4GLM A;  1U06 A;  2W10 A; 
#chains in the Genus database with same CATH topology
 1VQ4 A;  1YHQ T;  3M4G A;  2GTO A;  5KYW A;  3VRZ A;  2AIR B;  2FYK A;  4F14 A;  3PNW C;  1GCP A;  2P0Q A;  3M4Y A;  1VQK A;  4CC4 B;  2GNC A;  1QVG S;  1U1T A;  2DVE A;  3G4S Q;  3EG0 A;  3CBO A;  2Z0W A;  3A8G B;  2K2M A;  3CCV T;  5GMK l;  2K6D A;  2EYZ A;  1ZSZ C;  2RD1 A;  4J8O A;  3RBB B;  3UF4 A;  4M75 D;  4J7I A;  4DBR A;  1X6G A;  4JPB W;  2R5A A;  1V76 A;  2ECZ A;  1QVG A;  2LNV A;  2XKO C;  1R0B G;  1MMD A;  3CC4 A;  4LE9 A;  1QCO A;  4R0K A;  4QQD A;  3PT9 A;  1BKB A;  1QP3 A;  1UGP B;  2QA4 T;  2K3B A;  4J6W A;  3OYN A;  4DA4 A;  2EQU A;  1VQP A;  2XU8 A;  2DXB A;  1VQ6 A;  2WSE E;  3R6N A;  3OSV A;  2DYI A;  3A98 A;  1F1B B;  4OB3 B;  4OML A;  2ESW A;  4FIB A;  4NS5 A;  2LDM A;  2KE9 A;  1YBY A;  4MML A;  4KGZ B;  4JZ3 A;  2O9V A;  2EQK A;  4J7F A;  3CMA T;  3OMC A;  3FDR A;  3VJP A;  4M78 B;  4Y91 A;  4M7A C;  2FZK B;  3M5A A;  5KCO A;  2E4H A;  4LUD A;  1C1A A;  8AT1 B;  1K0S A;  4N0A C;  1JB0 E;  4JRQ A;  1LOJ A;  3QJ6 A;  4L5G A;  3BW1 A;  2RK1 A;  1U8R A;  3CCR T;  3VS2 A;  1K8A C;  1X01 A;  4ELY C;  2YSQ A;  1TUC A;  2DD4 A;  1OX9 A;  3J7A F;  1XNI A;  2RQW A;  3CC2 A;  2FRW A;  1KQ1 A;  3MO8 A;  4QVD A;  5KE2 A;  1TH7 A;  2GTJ A;  3M55 A;  1YIJ Q;  3GIB A;  1PM3 A;  4RCC A;  5DLQ E;  2DTO A;  2FL7 A;  1D1C A;  2JZ2 A;  4PJO C;  3X28 B;  2JM8 A;  1BI1 A;  4Z8A A;  2QQS A;  1ZUY A;  5I21 A;  4HT9 A;  2YRV A;  4XQ3 A;  2M02 A;  2GBQ A;  1WHM A;  4E7S A;  5KYX A;  1M2O A;  1PSE A;  1AZG B;  5CKB A;  5EC7 A;  1UE9 A;  3I5R A;  1Z9Q A;  3JB9 D;  4J9F A;  2VKN A;  2DPP B;  2EYX A;  1VQ7 A;  3I35 A;  5GAO n;  3JCM W;  1Q82 R;  1UJ0 A;  2X4W A;  1B07 A;  4KUI A;  2EIF A;  2NYS A;  2EW3 A;  1NEB A;  2V8K A;  3EG9 B;  2HDA A;  2DEQ A;  1JO8 A;  2KI7 A;  2X51 A;  1VQ8 A;  3VYG A;  2O4X A;  1W2B S;  4MDW A;  3MET A;  1NLO C;  2P0P A;  1WHL A;  4M77 G;  1KD1 C;  4OMP A;  4Y28 E;  1X2Q A;  4OF1 A;  1K73 R;  1K0X A;  2HBP A;  1YJW Q;  1I07 A;  1WDX A;  2F2W A;  3EHR A;  1WXB A;  1HD3 A;  3EH1 A;  2DVJ A;  1ZSZ B;  3OS1 A;  3OS5 A;  2OTJ A;  1D0Y A;  2GFA A;  3VS7 A;  4C5H A;  3LLR A;  3QZ5 B;  3CCL Q;  1OV3 A;  2KRN A;  4RG8 A;  2OTL A;  4E7K A;  5GAO r;  1VQ5 A;  2MF2 A;  1GFC A;  2EYW A;  1IRE B;  2BE9 B;  1G5V A;  5GMK h;  3QJY A;  1VQ4 T;  3RUX A;  5FLX E;  2K5F A;  2QI2 A;  3EG9 A;  1VQK T;  1M27 C;  3VV0 A;  2KBT A;  1EZZ B;  4HVV A;  5KH6 A;  2DXT A;  3CCM Q;  3PFS A;  1W2B P;  1D1A A;  1K9M R;  4C0D B;  4ZNX A;  4M7A E;  4CI0 C;  1UGQ B;  3KUF A;  4IUR A;  2LC4 A;  1I81 A;  3CBP A;  5IHN A;  1RAC B;  1ZSZ A;  4FSS A;  4FL6 A;  2B86 A;  2QEX Q;  5GAO m;  2RPN A;  5CKD A;  4HCK A;  5GAM j;  4LD9 K;  5KCH A;  4AFS C;  4RKU E;  1SG5 A;  2V26 A;  2JTE A;  2L3S A;  4FW2 A;  4RTU A;  1VQP T;  4AFZ C;  4PJO E;  1VQ6 T;  3A5Z B;  2OAW A;  2X3X D;  4PJN A;  4OMQ A;  3OW2 S;  4M78 F;  3EG3 A;  4J9C A;  3O5Z A;  2MMP A;  3SB2 A;  3CXC S;  3E9F A;  2DLP A;  2F5K A;  2HMA A;  3E1S A;  3RDV A;  1ZLM A;  2CT3 A;  4WF2 A;  1YIT T;  2LT1 A;  5CKF A;  2FPD A;  5GAN e;  1JQQ A;  1OI1 A;  1WA7 A;  2DIG A;  3GLX A;  1HJD A;  3OW2 A;  4N4I A;  5IT9 E;  2R5M A;  4BDY A;  4J9G A;  3CXC A;  4M7A A;  5GAO l;  3I56 Q;  1HYO A;  4FYY B;  4KUD K;  2AT1 B;  2K57 A;  4A4H A;  4DOV A;  4N0A A;  3SWN C;  1YJN T;  1RI0 A;  4XTZ A;  3KXT A;  4LNP A;  1RUW A;  1FWZ A;  2NUZ A;  2LCC A;  5LJ5 j;  3N5B B;  4M75 B;  1K1Z A;  4RG2 A;  2GF7 A;  5CCA A;  4BAC A;  5FWB A;  3V8J A;  3QII A;  4J6Y A;  1RLP C;  3DKM A;  1KFZ A;  3HRT A;  3QWX X;  2GQI A;  4PJO A;  2R57 A;  3X26 B;  3IQL A;  4XTV A;  3V7S A;  1XOV A;  5ECA A;  2EGA A;  1GL5 A;  3EFS A;  4Q5W A;  4OP0 A;  3R6O A;  1NYF A;  2RA2 A;  4C8Q G;  1SSF A;  2C06 A;  2A37 A;  1CKA A;  2NUP B;  5KYY B;  1W1F A;  1VQ9 Q;  1E6H A;  1RAD B;  2F2X A;  3WVD B;  5LJ3 f;  2E3I A;  1VQO A;  2LJ3 A;  3I55 A;  4DQ2 A;  2CKK A;  1NBE B;  3VS0 A;  2BIV A;  1NPR A;  4M78 D;  2E65 A;  3JCM P;  4XU0 A;  2HNI A;  5LJ5 d;  2ZCF B;  2CUB A;  1KSW A;  1NG2 A;  4C92 G;  3ER0 A;  1U1S A;  4BY6 B;  1IGQ A;  4M77 C;  4KUL A;  2DYB A;  2ZPH B;  1V29 B;  3GP8 A;  1SKU B;  2CP5 A;  3OMG A;  1Q86 U;  1VQ8 T;  5M9O A;  4EMK B;  4RTY A;  3OYM A;  7AT1 B;  1P92 A;  1R8O B;  3SEM A;  2YUP A;  2L5Q A;  1VQL T;  2DET A;  1JBM A;  3EGX A;  1M2V A;  2EWN A;  2RB6 A;  3OYE A;  4MZT A;  1Q81 C;  3SD4 A;  2OTJ T;  1D1B A;  1W6X A;  2DXU A;  4GBQ A;  1QMC A;  4QW2 A;  2QA4 A;  4PFO A;  1LPL A;  1TG0 A;  4DEX A;  2OTL T;  2KRS A;  3S3M A;  1W70 A;  2A28 A;  3CBM A;  1VQ5 T;  4QT7 A;  3J81 E;  1SRM A;  4KGX B;  4X34 A;  4OMO A;  2MAM A;  2L3Q A;  4KH1 B;  3OYH A;  2B8A A;  2E1H A;  1Q95 G;  4LDW A;  4CC3 A;  5CR2 A;  2HZY A;  1X6O A;  1U06 A;  4OVA A;  5FRO A;  1PCX A;  4C5G A;  5I2S A;  2KR3 A;  4J6X A;  5KYU B;  4JZ4 A;  5DY9 A;  4J5Y A;  4GY5 A;  2YRD A;  2COZ A;  3Q1J A;  3P8H A;  2JM9 A;  1PRL C;  1G3T A;  3CCR A;  4KRT A;  3CCL A;  4PNO A;  3ASK A;  1BK2 A;  1K8A R;  3CEY A;  1KK7 A;  3UPU A;  4E7H A;  1U5S A;  2WAC A;  3VUB A;  4F7U F;  2DTH A;  2VVK A;  4XTW A;  5CVI A;  2ZPG B;  2QGG A;  1QKW A;  2G3R A;  1IHV A;  2LQW A;  3H0I A;  5GMK i;  2RQT A;  4BI8 B;  4AMC A;  4XAX B;  1UGV A;  4M7D G;  1NJI R;  4YTL A;  5GAM g;  3CCJ A;  1MND A;  1IZ6 A;  1TWB A;  1WJR A;  1ABQ A;  1H8K A;  1PKT A;  4JJD A;  4JRK A;  1V1C A;  2CDT A;  1QWF A;  2YLC A;  1KJW A;  1BI0 A;  2J6O A;  3X20 B;  2C0T A;  2NUT B;  2JS0 A;  1NEG A;  3CC7 A;  3GBQ A;  4XTX A;  2QEX A;  5DLO A;  3OYB A;  3LH0 A;  1X6B A;  4JJB A;  4M75 F;  3I5S A;  4DBH A;  2MWP A;  2LNH B;  1BBZ A;  4M77 E;  2PUO B;  4J9E A;  2CYZ B;  3MEW A;  4IUV A;  1OUL A;  3SWN A;  3C4S A;  4MDX A;  4M77 B;  4CRI A;  2EAY A;  2XDB A;  4D8D A;  3BDL A;  2EGE A;  1KC8 R;  4C5I A;  5LJ5 g;  5GAN 6;  1RAB B;  5GMK e;  4KGV B;  1WI7 A;  4D8K A;  1KD1 R;  4C8Q C;  2HSE B;  1VYU A;  3FLG A;  3PMT A;  1TXQ A;  2YDL A;  3THK A;  1XQH A;  5L23 A;  3QDF A;  4R56 A;  5CKE A;  1FYN A;  2CP3 A;  2IIM A;  3JCM g;  2IPO B;  5CQX A;  4E7J A;  4C92 C;  3CD6 Q;  1WYX A;  1TTH B;  4A54 A;  3H0F A;  2ENM A;  1I0C A;  4IKF A;  2E41 A;  2RI2 A;  5FRN A;  1UHC A;  1ZQ1 A;  3A8O B;  4ZGJ B;  4WTO B;  1YI2 Q;  2KDS A;  2XIC A;  2QTX A;  2DIL A;  1PHT A;  2LX9 A;  3HSB A;  4M77 A;  4JJC A;  2DK3 A;  3JB9 J;  2RQU A;  1RAI B;  3MHX A;  4OB0 B;  1AVZ C;  5C0M A;  1Q7Y U;  2FPF A;  3NTI A;  1Y7X A;  3CME Q;  2VC8 A;  1ZUU A;  2DL4 A;  1Y71 A;  1O9S A;  1NM7 A;  1M90 U;  4QVC A;  2ZPE B;  4IUQ A;  3X24 B;  1K4U S;  1N9R A;  3FC3 A;  2RMO A;  1HK9 A;  1AHJ B;  4DBF A;  1BI3 A;  3NPF A;  5IXB A;  1UJY A;  3JB9 F;  3URG A;  2DRK A;  3JCM c;  3EFO A;  3JAM E;  2CZ0 B;  2MK5 A;  3BDU A;  5LJ3 h;  4V2S A;  1I8F A;  4Z02 A;  3JCM Q;  1M30 A;  5I11 A;  4ZTF A;  1M3A A;  5KYX B;  5D6W A;  1IHW A;  1YIT A;  4Z88 A;  2E64 A;  3G71 Q;  1N8R U;  4BE2 A;  1WHG A;  2RHU A;  4E6R A;  2YUO A;  2BZ8 A;  2F2V A;  2XMF A;  4A63 B;  4EMG A;  3REA B;  5IHI A;  4BD3 A;  3PVQ A;  5AYF A;  1RAG B;  2KT8 A;  3VS5 A;  1M1K R;  3CCQ Q;  4RTV A;  4JDS A;  3P8D A;  2JNG A;  2I0N A;  3E2U A;  1YJN A;  3CCL T;  1M3C A;  4ZTJ A;  3M0P A;  1WZO A;  4M7D C;  2ABL A;  1D0X A;  4FU6 A;  2QQA A;  2O4X B;  1NE8 A;  1QP2 A;  3M0S A;  3M54 A;  2CH4 A;  4PJJ A;  2IVW A;  2Y4Y A;  1Y0M A;  1O75 A;  4Y92 A;  1S72 Q;  2DAQ A;  2PQW A;  3RMQ A;  1N5Z A;  1SPK A;  1YN8 A;  3CCJ T;  3CCS A;  1OOT A;  3JRZ A;  2M1H A;  4C8Q E;  1T3L A;  3FEO A;  1R77 A;  3U23 A;  1UTI A;  4DOW A;  3FIF A;  4A53 A;  1KQ2 A;  1YHQ Q;  3LH5 A;  4N4G A;  2RO0 A;  3M53 A;  2XDD A;  3T9N A;  4TVR A;  1VQM Q;  2LQ8 A;  3OB9 A;  3V7C A;  4C92 E;  3CC7 T;  5LJ5 h;  3RMS A;  3HFN A;  3JB9 H;  4JLG A;  5GAN 2;  2QEX T;  2PTK A;  3CCV Q;  2EGC A;  1PC0 A;  4IUP A;  2CS7 A;  1GRI A;  4MZM A;  2CSI A;  5GAN j;  1KQS P;  4E7Z A;  1IRX A;  1TUG B;  1UEC A;  2K4Y A;  1B34 A;  3ZEH A;  5A0L A;  2RI3 A;  2E6Z A;  2XDP A;  2LCS A;  2ZZD A;  2K2V A;  2RHY A;  1X27 A;  1VQL A;  3CCU A;  1MMA A;  2EVR A;  3LX7 A;  2KAF A;  4BB7 A;  2EPD A;  2O01 E;  2AZS A;  4KBM B;  1W2B A;  1RAF B;  2HL5 C;  3GNG A;  4CC2 A;  4C8Q A;  1G83 A;  1KG1 A;  3G6E Q;  4HT8 A;  1WLP B;  1MGQ A;  3ULR B;  3M58 A;  4RUG A;  3G1J A;  3LGF A;  3CMA Q;  2O2O A;  2RK2 A;  5GAN d;  4C92 A;  1WX6 A;  4F17 A;  2EQM A;  3TVT A;  4JS5 A;  4IIO A;  4MMK A;  3TU4 K;  3A8L B;  2F5T X;  2FEI A;  4BE1 A;  2MI6 A;  3MEA A;  1HXD A;  4EPC A;  4HXJ A;  1AZE A;  2W0Z A;  2DZ9 A;  3FJ5 A;  2FB7 A;  4LD6 A;  2DJQ A;  4ZN1 A;  1ABO A;  2HD0 A;  2E5Q A;  4FYW B;  1HSQ A;  2SEM A;  3INZ A;  2OX7 A;  4M7A B;  2DE0 X;  2QDL A;  3M56 A;  4M77 D;  1OPK A;  2QQR A;  2L0A A;  2P4R A;  3QKJ A;  2DM1 A;  3RES A;  2FG0 A;  2LRQ A;  2KNB B;  1ZX6 A;  4M7D E;  2KY9 A;  4ME7 A;  1N6A A;  2E5K A;  3VUZ A;  2YUQ A;  2DL3 A;  3OYA A;  4B9X A;  4BDZ A;  4JRI A;  2KT1 A;  5IH2 A;  2MIO A;  2VWF A;  5CAI A;  4PJO B;  3G4S A;  4QVZ A;  3D7S B;  3LGL A;  3NTH A;  1NZ9 A;  4LXC A;  1E6G A;  4PFZ A;  3LWH A;  4BI3 A;  1M8M A;  3V7R A;  1QQJ A;  4PJL A;  2R58 A;  2WSF E;  1Y07 A;  2EFI A;  2CP7 A;  2DMO A;  1Y96 B;  3OBY A;  1H3H A;  3M0R A;  5CKH A;  3EG2 A;  1SSH A;  2RJC A;  4B9W A;  3V8K A;  2K3Y A;  5GAM d;  2PVO B;  3MPU B;  3M0T A;  4NL2 A;  1T0H A;  4LDV A;  3PTA A;  3HL8 A;  3A8H B;  3JSC A;  2X4J A;  4M78 G;  5GJV B;  2PNI A;  3OYG A;  3HHT B;  1R0C B;  3L2Q A;  2YLB A;  3CCE Q;  3HP9 A;  4M7D A;  2BZY A;  1AEY A;  3HKS A;  4PKC C;  4RTZ A;  4VUB A;  4RTT A;  3WXM B;  3H0H A;  4Z89 A;  5FRM A;  2RI5 A;  4O5V A;  3UDC A;  1Q86 C;  2DL8 A;  3I9Q A;  3EGX B;  3J80 E;  2A0F B;  1VQN Q;  2VGN A;  1M2V B;  3CCS T;  2GGR A;  4HCZ A;  2XD0 A;  1VQ4 Q;  1YWO A;  2E12 A;  5D7U A;  5GAN 4;  1VQK Q;  2ZGW A;  2RJE A;  1LJO A;  1Y96 A;  2XID A;  4X1V A;  4B6M A;  1YJ9 Q;  4FM4 B;  4ESR A;  4RTW A;  3V8L A;  1YIJ A;  3DB4 A;  1AWW A;  1VIF A;  1JJ2 P;  3S6W A;  4EMH A;  4KH0 B;  2PZ1 A;  2X4Y A;  3HFO A;  1QKX A;  3QZ9 B;  1Q82 C;  5GAM f;  2WSC E;  3QYG B;  2QQB A;  2X4X A;  3CC4 Q;  2CSQ A;  5GAN g;  1JRI A;  3JCM d;  1Z9Z A;  2L3R A;  2KRO A;  3P8B B;  2HEQ A;  4RMO A;  2COW A;  5LJ3 e;  3CCU T;  2AKL A;  2LQN A;  1VQP Q;  1FXX A;  2VAS A;  3OYF A;  1C0M A;  1ZBX A;  4IUT A;  1IO6 A;  1PRM C;  4XK8 E;  2V8I A;  3TCJ A;  1CKB A;  5GMK j;  2RHX A;  4J9H A;  4ANJ A;  2FO0 A;  4FW1 A;  1WQ7 A;  4C8Q D;  2LZ6 B;  1PNJ A;  4PLL A;  1Q82 U;  2DZC A;  2BUD A;  5CIU A;  1SHF A;  2LP5 A;  2HSP A;  9ATC B;  5I22 A;  2EKO A;  5GAO q;  3HRS A;  2HKQ B;  2X9H A;  3C95 A;  4AFU C;  1XJW B;  3FJP A;  4C92 D;  3LYI A;  1MMN A;  5LJ5 f;  1JXO A;  1WJQ A;  1UGS B;  3CC2 Q;  4M7A F;  4D6W A;  1TUD A;  1YJW A;  2DNU A;  3DLL A;  2CZ7 B;  3VS1 A;  1K73 U;  3G7Z A;  2DL5 A;  3ME9 A;  3JCM f;  2CP6 A;  3QBY A;  2RNA A;  1K9M C;  2DFU A;  5D6X A;  5CQY A;  1K9A A;  3RKY A;  2AHJ B;  4J9D A;  4ZN3 A;  2EJG A;  3SWN B;  3EFR A;  4A4K A;  5LJ5 e;  2D1X A;  2KXC A;  4PJO F;  3BE3 A;  3TEE A;  1M4Z A;  2YT6 A;  3UA6 A;  1AOJ A;  2LTO A;  1J3T A;  2XHC A;  1N9S A;  1VQ7 Q;  2MYS A;  3CCM A;  2DBK A;  2C0O A;  3G4S T;  3RIR A;  5KYN A;  2P0K A;  2QK0 A;  2LJ0 A;  4A4E A;  4RCB A;  5GAN 7;  3CPW S;  5DM7 R;  2C0I A;  4OGC A;  4MZP A;  3CME T;  2HAX A;  1K9M U;  1VQ8 Q;  2E3H A;  2HBW A;  2ROT A;  4ZGE B;  3VS6 A;  4XU2 A;  2EKH A;  2VXE A;  4F7U G;  3ZFJ A;  2RHZ A;  3QDR B;  2KYM A;  4M78 C;  2RJD A;  1IB8 A;  1IGU A;  4UC4 A;  2YRC A;  3FRN A;  1LCK A;  2PU9 B;  3CPF A;  3ZBD A;  2GCX A;  4M7A D;  2JOY A;  2CH4 W;  2HKN A;  1UB4 A;  2AK5 A;  2OTJ Q;  2DRM A;  1WQW A;  3UWN A;  2GFU A;  3RR6 A;  2KGT A;  4HKE A;  3QUI A;  5HY6 A;  2OTL Q;  2KMT A;  1UHF A;  4M7D D;  5FU6 C;  1VQ5 Q;  5D6Y A;  1GXI E;  1GCQ C;  1SEM A;  2VXF A;  4BE0 A;  2E10 A;  1Q7Y C;  1T3S A;  3CPW P;  2NLU A;  1AD5 A;  2P4T A;  4PJO D;  2L3P A;  4AG2 C;  3I56 A;  4JLI A;  4M75 G;  1SRL A;  1M90 C;  1RAE B;  3EFO B;  3VS3 A;  2CUD A;  2RH2 A;  5AT1 B;  1BCM A;  3OYY A;  1OYX A;  1YIJ T;  4LN2 A;  1RL2 A;  1FMW A;  2D0Q B;  2JTM A;  2IG0 A;  4FYV B;  4QQ6 A;  2JN0 A;  4OB1 B;  3JCM X;  1VQN A;  2EQI A;  3M57 A;  3EG1 A;  1M1G A;  2VYT A;  1ZSG A;  3LWI A;  1MV0 B;  1BB9 A;  2EJ9 A;  2A08 A;  5GAN 3;  1N8R C;  2HCK A;  1VQM T;  2DL7 A;  2K5I A;  5CO7 A;  3E19 A;  1VQ9 A;  1I5O B;  1YCY A;  1YJ9 A;  3EGD A;  1PD0 A;  1TSF A;  3JB9 I;  1MNE A;  1SF9 A;  5A0D A;  2NWM A;  1IXD A;  4E7I A;  4NOY A;  1FMV A;  4FYX B;  1M8V A;  2QGF B;  1B7T A;  2HQE A;  4FCY A;  5GAN 5;  3OS0 A;  1BCO A;  1WHK A;  2JT4 A;  5I2M A;  3OBW A;  1BI2 A;  3OY9 A;  2EYY A;  2QAS A;  1M3B A;  5GJW B;  3PGG A;  3AT1 B;  1YJW T;  1OQK A;  5GAM h;  3G6E T;  3SHW A;  4JRP A;  2VUB A;  3JB9 G;  4M78 E;  1OZ2 A;  2DO3 A;  2V1Q A;  4C0D C;  1JU5 C;  4LDY A;  1X43 A;  5FU7 C;  5HK0 A;  3OYL A;  1QVG P;  1KQS S;  4DBQ A;  2J6F A;  3RER A;  1B34 B;  2X35 A;  2H3E B;  4F16 A;  2H3J A;  4XTU A;  1GFD A;  4C0G A;  1YWP A;  3ZL7 C;  2D8H A;  2F1L A;  2E70 A;  4BUG A;  5J3B A;  1KQS A;  1VQO Q;  2J7I A;  3CCM T;  1I1J A;  2JMA A;  3I55 Q;  2K3X A;  4C0Z A;  1TS9 A;  2LX7 A;  1Q86 R;  4PFP A;  3PIP A;  2JW4 A;  5LL6 S;  2EYQ A;  4C8Q B;  5HK3 A;  2JXB A;  3GPL A;  5FU6 B;  1NJI C;  3MCA B;  2AZV A;  1BYM A;  4IIM A;  3L2U A;  4AT1 B;  3OSS C;  2VGM A;  2LVM A;  2BKD N;  2FPE A;  4HVU A;  4C92 B;  1OPL A;  3TQ7 P;  2DTI A;  2QXF A;  5FWC A;  1UGR B;  2I2L A;  4M77 F;  4E7L A;  4R55 A;  1EX4 A;  4J9B A;  1K8A U;  2O88 A;  2PUK B;  1QLY A;  4M78 A;  1FX7 A;  2W10 A;  3JCM h;  3NMZ C;  2V1R A;  4AFQ C;  3GF5 A;  2JS2 A;  3QG1 A;  1G8X A;  2HL3 A;  2QA4 Q;  1G3Y A;  3KBG A;  3HPW A;  4OMF B;  1NJI U;  3OQ5 A;  1QWE A;  4M75 C;  3H41 A;  3OYK A;  3QHS A;  2OAU A;  1WXU A;  4A4G A;  1VYV A;  1KC8 C;  2RQV A;  1M5Q 1;  3PVL A;  3EAE A;  1C6V X;  1M9S A;  2DD5 A;  2RQR A;  3QWY A;  1Q81 R;  3I56 T;  1GCQ A;  2LJ1 A;  4K11 A;  1NLP C;  2QYZ A;  4KT0 E;  2K5L A;  2L2P A;  2DEU A;  2D9T A;  1ACM B;  1UEB A;  2A36 A;  3DLM A;  4N4H A;  2JVV A;  2ZPI B;  2EBP A;  1H3Z A;  1PD1 A;  2CP2 A;  2DA9 A;  3CCE T;  4XU1 A;  3CCR Q;  3UAT A;  3C94 A;  2D8J A;  3MP6 A;  4X9C A;  5EG2 A;  1WPY A;  1VQN T;  2M0Y A;  4BY6 C;  1YFN A;  8ATC B;  3MEU A;  4CC7 A;  2D0N A;  1KC8 U;  2CZ1 B;  1PWT A;  2COY A;  3SFM A;  5A2Q E;  4QKU A;  4DEY A;  4EMK C;  1I4K 1;  1K76 A;  4NL3 A;  3OYI A;  1KD1 U;  3OS2 A;  2KYB A;  3H8Z A;  1TOV A;  2K9G A;  3CD6 A;  1MV3 A;  1D0Z A;  1VQ9 T;  1YJ9 T;  4P5N A;  4QQG A;  2XK0 A;  4EIK A;  3CCJ Q;  1AWX A;  4HA8 A;  4LUE A;  2JMC A;  4AG1 C;  4E2F B;  4JJN K;  5LJ3 j;  2G6F X;  1YNZ A;  5J39 A;  5FU7 B;  4C5E A;  4M7D B;  4IUU A;  1UUE A;  1PSF A;  1M1F A;  3VYH B;  2O31 A;  2VV5 A;  3NGP A;  3RKW A;  3UT1 A;  2GQV A;  1BIB A;  1PG5 B;  1YI2 A;  1E7O A;  3CC7 Q;  1WXT A;  2KVQ G;  4EDU A;  3CC4 T;  5GAN f;  2M51 A;  1G2B A;  2F69 A;  3GOX A;  1WNL A;  3REB B;  3CME A;  3VRY A;  4F7U E;  3MEV A;  1TU0 B;  1QCN A;  5CK9 A;  1ZHI A;  4L59 A;  2XG8 D;  4F7U B;  2ZPF B;  3KFV A;  1ZUK A;  3GNF B;  1DJ7 B;  3BY7 A;  4GLK A;  1QVF S;  3MP8 A;  5LJ3 d;  1X2K A;  3L1A A;  1H92 A;  1JJ2 S;  2RN8 A;  2JJ9 A;  3VKI A;  1VIE A;  1M1K C;  2LCL A;  3M0Q A;  5HCK A;  4ORZ A;  2RJF A;  3EH2 A;  1X75 C;  5KE3 A;  1YCS B;  5HKC A;  2M16 A;  1MHN A;  2X3W D;  1AWO A;  2QQ9 A;  1QVF A;  5IXF A;  1Y57 A;  4LDX A;  4PJM A;  4C8Q F;  1JJ2 A;  4A4F A;  4M4Z A;  3G71 A;  1CSK A;  1X69 A;  2DF6 A;  1XTD A;  3OYD A;  3CC2 T;  2QAZ A;  4HVW A;  2L89 A;  1ARK A;  4M75 E;  3A8M B;  2RHI A;  1OU8 A;  3VU3 C;  4PK4 A;  2ROL A;  1OEB A;  2FZC B;  3H6Z A;  3OYJ A;  2M0O A;  3S3N A;  2FHD A;  3CCQ A;  2KRM A;  4C92 F;  3M0U A;  1Q7Y R;  3QYH B;  1RI9 A;  4F7U A;  2V8J A;  5GAO p;  2SRC A;  3OW2 P;  1PKS A;  1M90 R;  1M1K U;  3CXC P;  2L8D A;  3FB9 A;  1S1N A;  3PE0 A;  1OX8 A;  2FRY A;  1QVF P;  2J05 A;  2DER A;  4J9I A;  3H9N A;  1S72 A;  1JXM A;  1G3S A;  1B3Q A;  2HQH A;  4ATO A;  1AT1 B;  2OI3 A;  5L8R E;  4HCB A;  4II1 A;  3MJX A;  3EGU A;  1VQ7 T;  1QVP A;  2YHT A;  3M9Q A;  5IHK A;  2MCN A;  3OYC A;  2CZ6 B;  2K7A A;  2EQJ A;  4BI4 A;  1YHQ A;  1RAA B;  2A3L A;  2AKK A;  1VQM A;  1BIA A;  2M9U A;  1VQ6 Q;  4XTY A;  4E47 A;  3MP1 A;  2MWO A;  1KIK A;  1N8R R;  2ATC B;  1MUZ A;  1JEG A;  3LW5 E;  1D3B B;  4M75 A;  1WGS A;  1T0J A;  2KXD A;  1K73 C;  2ED0 A;  2J6K A;  2KEA A;  2O9S A;  3C0C A;  3CCV A;  1YP5 A;  3AHU A;  4L6V 5;  1YIT Q;  1UG1 A;  5GAM e;  4WCI A;  2PVG B;  1QW1 A;  3VS4 A;  1WHH A;  2K79 A;  4FSX A;  3JCM b;  4OMM A;  2VB6 A;  1I5L A;  1U3O A;  2KSS A;  1WJS A;  3JCM J;  2E6N A;  1VYT A;  2RM4 A;  1WHJ A;  2LMJ A;  1YJN Q;  5KYY A;  2NUP A;  5IN1 A;  3S3O A;  1RLQ C;  2XI9 A;  1NPP A;  4O6J A;  3PIO A;  1VUB A;  4J83 A;  3OA6 A;  1ZBJ A;  3L2Z A;  1EIF A;  4ZGD B;  2KK4 A;  1KHI A;  2LT4 A;  3G6E A;  2CP0 A;  3NFC A;  1SHG A;  3CD6 T;  2J06 A;  5J26 A;  1D09 B;  3CMA A;  4M7D F;  3CCS Q;  1QCF A;  4EMK A;  2LQK A;  1D3B A;  3RKX A;  3NHN A;  3TRE A;  4PLI A;  2DKG A;  2BE7 D;  1Q81 U;  2MPX C;  4LDU A;  3DB3 A;  1KHC A;  2JUF A;  3C12 A;  2BZX A;  3WVE B;  1UDL A;  3E9G A;  1OZ3 A;  1MMG A;  5C6S A;  4M7A G;  5LJ3 g;  3L2V A;  1YI2 T;  3JV3 A;  3TSW A;  4F04 B;  2DXC A;  2YUN A;  1GBQ A;  3JCM e;  2EJF A;  3L2W A;  1ZA1 B;  3SDZ A;  2FZG B;  4OMN A;  2QTV A;  2KQW A;  1OU9 A;  3CQT A;  2HQX A;  2DJZ A;  1FMK A;  3QO3 A;  5IAY A;  1VOM A;  5GAN 8;  1H64 1;  3F70 A;  2CRE A;  1WIE A;  1BU1 A;  3TSZ A;  3CPW A;  4PJO G;  2DX1 A;  1LVK A;  2MOX A;  1WFW A;  1NYG A;  1VQL Q;  3O8V A;  3CCU Q;  3PMI A;  2H8H A;  4XU3 A;  2PVD B;  3MKD A;  2FVU A;  3HTR A;  5KYU A;  1RAH B;  3NTK A;  3QPH A;  3UA7 A;  2OJ2 A;  1AWJ A;  3RNJ A;  5KYW B;  1G3W A;  2RF0 A;  3G71 T;  4JS4 A;  2QDY B;  3BFM A;  6AT1 B;  4PL6 A;  2DBM A;  1UFF A;  3M59 A;  4OB2 B;  2YWW A;  3EHQ A;  3EGD B;  2QG9 B;  4FT4 A;  2ED1 A;  5A0G A;  3QXE B;  3CCQ T;  2BTT A;  5FW9 A;  5GAN h;  2DIQ A;  1W4S A;  3L2R A;  3X25 B;  4C0F A;  2YXY A;  4ELZ C;  1A0N B;  2Y90 A;  2D6F A;  2CT4 A;  2ZPB B;  1N27 A;  2P84 A;  2CGH A;  4OGE A;  2Y4X A;  5GMK m;  4RTX A;  2A7Y A;  1EFN A;  3CCE A;  4JUV A;  1S72 T;  1VA7 A;  2NUT A;  3L42 A;  3A1P A;  2JTF A;  1GBR A;  3HRU A;  1VQO T;  4X9D A;  3JCM V;  3I55 T;  4HCC A;  4FT2 A;  1ZA2 B;  1LNX A;  2ZAE A;  4GLM A;  3QSU A; 
#chains in the Genus database with same CATH homology
 1SSH A;  2GTO A;  3VRZ A;  3NMZ C;  2V1R A;  2KR3 A;  4F14 A;  1GCP A;  3M0T A;  4JZ4 A;  1T0H A;  4CC4 B;  4AFQ C;  2GNC A;  2JM9 A;  2JS2 A;  1PRL C;  4KRT A;  3EG0 A;  5GJV B;  2PNI A;  1QWE A;  2K2M A;  3H41 A;  1BK2 A;  2BZY A;  1AEY A;  2K6D A;  2EYZ A;  1WXU A;  4RTZ A;  1U5S A;  4RTT A;  3H0H A;  1VYV A;  4Z89 A;  2RQV A;  3PVL A;  3RBB B;  3UF4 A;  2DL8 A;  2VVK A;  3I9Q A;  1X6G A;  4JPB W;  2ECZ A;  2RQR A;  3QWY A;  1QKW A;  2GGR A;  1GCQ A;  2LQW A;  3H0I A;  2RQT A;  2LJ1 A;  4K11 A;  1NLP C;  1UGV A;  4LE9 A;  4R0K A;  1YWO A;  2L2P A;  2A36 A;  1ABQ A;  1H8K A;  1PKT A;  2K3B A;  4JJD A;  1V1C A;  2EBP A;  2CDT A;  1QWF A;  4X1V A;  2DA9 A;  1KJW A;  4ESR A;  3R6N A;  3UAT A;  2D8J A;  2J6O A;  4RTW A;  2C0T A;  3A98 A;  4OML A;  2ESW A;  2JS0 A;  1AWW A;  2KE9 A;  2M0Y A;  1NEG A;  4JZ3 A;  3GBQ A;  2O9V A;  4CC7 A;  2D0N A;  2PZ1 A;  1QKX A;  1PWT A;  1X6B A;  4DEY A;  1K76 A;  4JJB A;  2KYB A;  4LUD A;  2CSQ A;  3I5S A;  1K0S A;  2K9G A;  1MV3 A;  2LNH B;  1Z9Z A;  1BBZ A;  2KRO A;  2HEQ A;  4J9E A;  4EIK A;  1AWX A;  4LUE A;  3VS2 A;  2JMC A;  2YSQ A;  4AG1 C;  2AKL A;  1TUC A;  2LQN A;  4D8D A;  2G6F X;  1YNZ A;  2RQW A;  2FRW A;  2EGE A;  1IO6 A;  1PRM C;  1UUE A;  1WI7 A;  2GTJ A;  4D8K A;  2O31 A;  3NGP A;  1CKB A;  1VYU A;  1E7O A;  1WXT A;  2YDL A;  3THK A;  5L23 A;  4J9H A;  2FO0 A;  2JM8 A;  4Z8A A;  1FYN A;  1ZUY A;  2LZ6 B;  2M51 A;  1G2B A;  1PNJ A;  2IIM A;  3REB B;  3VRY A;  1SHF A;  2GBQ A;  2HSP A;  2LP5 A;  5I22 A;  1WYX A;  3H0F A;  4AFU C;  1AZG B;  5EC7 A;  1UE9 A;  2ENM A;  3I5R A;  3KFV A;  1Z9Q A;  1ZUK A;  4J9F A;  2VKN A;  1I0C A;  1JXO A;  2EYX A;  1TUD A;  1UHC A;  3I35 A;  2DNU A;  1X2K A;  1H92 A;  3VS1 A;  2RN8 A;  1UJ0 A;  1B07 A;  2DIL A;  1PHT A;  2DL5 A;  2EW3 A;  3M0Q A;  4JJC A;  5HCK A;  1NEB A;  4ORZ A;  2RQU A;  2RNA A;  2HDA A;  1JO8 A;  1K9A A;  1AVZ C;  1YCS B;  2FPF A;  2X3W D;  1AWO A;  4J9D A;  1ZUU A;  5IXF A;  2DL4 A;  1NLO C;  1Y57 A;  4M4Z A;  1NM7 A;  1CSK A;  1X69 A;  2DF6 A;  2D1X A;  2KXC A;  4HVW A;  4OMP A;  1ARK A;  1K4U S;  1X2Q A;  2YT6 A;  2RMO A;  1K0X A;  3UA6 A;  1AOJ A;  1J3T A;  2ROL A;  1OEB A;  1I07 A;  1WDX A;  2F2W A;  3EHR A;  1WXB A;  1HD3 A;  3NPF A;  2DBK A;  2KRM A;  2DVJ A;  5IXB A;  1UJY A;  2C0O A;  3M0U A;  2DRK A;  1RI9 A;  2LJ0 A;  3VS7 A;  2C0I A;  2SRC A;  1PKS A;  1OV3 A;  2KRN A;  1S1N A;  1M30 A;  5I11 A;  3PE0 A;  2FRY A;  2HBW A;  2J05 A;  1M3A A;  2ROT A;  4J9I A;  3VS6 A;  1GFC A;  2EKH A;  2EYW A;  4Z88 A;  1JXM A;  1B3Q A;  2OI3 A;  4E6R A;  2KYM A;  2YUO A;  2BZ8 A;  2F2V A;  2XMF A;  4A63 B;  3EGU A;  3REA B;  1LCK A;  5IHI A;  5IHK A;  1M27 C;  3PVQ A;  2KBT A;  2MCN A;  2KT8 A;  3VS5 A;  2K7A A;  4HVV A;  4RTV A;  2CH4 W;  2I0N A;  4ZNX A;  2AK5 A;  2AKK A;  1M3C A;  2DRM A;  3M0P A;  1KIK A;  1MUZ A;  1JEG A;  2ABL A;  2KGT A;  3M0S A;  2CH4 A;  1T0J A;  2KXD A;  2ED0 A;  2KEA A;  2J6K A;  2O9S A;  3C0C A;  5IHN A;  1YP5 A;  1UHF A;  1Y0M A;  4FSS A;  4Y92 A;  1UG1 A;  2B86 A;  4WCI A;  2RPN A;  1GCQ C;  1SEM A;  1T3S A;  4HCK A;  1N5Z A;  1SPK A;  3VS4 A;  1AD5 A;  1YN8 A;  1OOT A;  2L3P A;  4AG2 C;  2K79 A;  4AFS C;  1T3L A;  1SRL A;  4OMM A;  2JTE A;  3U23 A;  1UTI A;  2L3S A;  4RTU A;  1U3O A;  4AFZ C;  3LH5 A;  2OAW A;  2X3X D;  1VYT A;  3VS3 A;  2CUD A;  4OMQ A;  2LMJ A;  3EG3 A;  4J9C A;  3O5Z A;  4LN2 A;  1RLQ C;  2DLP A;  1ZLM A;  2CT3 A;  1ZBJ A;  2PTK A;  2EGC A;  2FPD A;  1JQQ A;  1WA7 A;  2EQI A;  3EG1 A;  1GRI A;  1SHG A;  1HJD A;  1ZSG A;  2CSI A;  2J06 A;  4J9G A;  1MV0 B;  1BB9 A;  1UEC A;  1QCF A;  2A08 A;  3NHN A;  2HCK A;  2LCS A;  2DL7 A;  4LNP A;  1RUW A;  1X27 A;  2NUZ A;  2BZX A;  1UDL A;  2EVR A;  1K1Z A;  2EPD A;  2NWM A;  2AZS A;  3JV3 A;  3TSW A;  5FWB A;  2YUN A;  1GBQ A;  4CC2 A;  1RLP C;  1KFZ A;  1G83 A;  3QWX X;  1WLP B;  2GQI A;  3ULR B;  4OMN A;  4RUG A;  3IQL A;  3CQT A;  1XOV A;  2JT4 A;  5ECA A;  2EGA A;  1GL5 A;  2EYY A;  1FMK A;  2O2O A;  1M3B A;  5GJW B;  1WX6 A;  1NYF A;  4F17 A;  2CRE A;  2A37 A;  3TVT A;  4IIO A;  1CKA A;  1WIE A;  1W1F A;  1BU1 A;  1E6H A;  3TSZ A;  2DX1 A;  2MOX A;  2F2X A;  1WFW A;  2FEI A;  2LJ3 A;  1NYG A;  2H8H A;  3VS0 A;  4HXJ A;  1AZE A;  2W0Z A;  2CUB A;  1KSW A;  3FJ5 A;  3SHW A;  1NG2 A;  2DJQ A;  2V1Q A;  1JU5 C;  1ABO A;  2DYB A;  3UA7 A;  1X43 A;  1HSQ A;  2SEM A;  2J6F A;  2OJ2 A;  1AWJ A;  2DE0 X;  2QDL A;  3RNJ A;  4RTY A;  1OPK A;  2RF0 A;  2L0A A;  2P4R A;  2DM1 A;  4F16 A;  3SEM A;  2YUP A;  2DBM A;  2FG0 A;  1GFD A;  1YWP A;  3ZL7 C;  1UFF A;  3EHQ A;  2D8H A;  2KNB B;  1ZX6 A;  2ED1 A;  2J7I A;  1I1J A;  2E5K A;  2JMA A;  2YUQ A;  2BTT A;  2DL3 A;  5FW9 A;  2LX7 A;  2JW4 A;  1A0N B;  1W6X A;  2KT1 A;  5IH2 A;  2MIO A;  2CT4 A;  2JXB A;  4GBQ A;  2VWF A;  4RTX A;  2AZV A;  1TG0 A;  4IIM A;  4DEX A;  2KRS A;  1W70 A;  2A28 A;  1EFN A;  1E6G A;  1VA7 A;  4QT7 A;  2FPE A;  4HVU A;  1M8M A;  1OPL A;  1SRM A;  5FWC A;  1GBR A;  4OMO A;  2L3Q A;  2DMO A;  1H3H A;  3M0R A;  4J9B A;  4CC3 A;  2O88 A;  1QLY A;  3EG2 A;  4GLM A;  1U06 A;  2W10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...