1I0CA

Eps8 sh3 closed monomer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL GROWTH FACTOR RECEPTOR KINASE SUBSTRATE EPS8
publication title Effect of pH and salt bridges on structural assembly: molecular structures of the monomer and intertwined dimer of the Eps8 SH3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone/growth factor
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1i0cA00
4RTXA 1SEMA 1HJDA 2KXDA 2YUOA 2KRNA 2ECZA 2X3WD 1Z9ZA 3LH5A 3NMZC 1UHFA 2DL8A 1MV3A 3VS1A 1GL5A 4LUEA 2H8HA 4WCIA 2RQVA 1GBRA 1A0NB 3RBBB 1QCFA 1T0HA 1NEBA 1CKAA 1MUZA 5I11A 2KXCA 4J9GA 2DX1A 2J06A 1X2KA 2FPFA 2D8HA 2LJ3A 4FSSA 4J9EA 1SRMA 1QKWA 4OMMA 3M0QA 1W6XA 1ABQA 4IIOA 4QT7A 1X43A 4AG2C 2FPEA 2L3QA 5IXBA 4Y92A 2HDAA 2EW3A 1KJWA 2DRMA 1BK2A 2QDLA 1HSQA 2LP5A 3I5SA 2EKHA 2C0IA 2AZSA 2KRMA 1SSHA 4GLMA 2D1XA 4JZ3A 3H0HA 2FRYA 2GTJA 3TVTA 2MOXA 1WYXA 2HSPA 2KBTA 1PRLC 3VS2A 1S1NA 2J05A 2K6DA 3IQLA 2DL3A 1OOTA 1QLYA 3REBB 2LQNA 1T0JA 2JXBA 2K2MA 2PNIA 1UUEA 4AFSC 1T3SA 3UA6A 2HCKA 2MCNA 4LE9A 2YT6A 4J9IA 1NM7A 1GCQA 3PVQA 2J7IA 3EG1A 1VYVA 2EVRA 2KR3A 2K79A 5IHKA 4Z89A 1ZX6A 2PZ1A 1K0XA 2DILA 1M27C 5EC7A 2RQTA 1OEBA 2DBKA 2DL7A 3KFVA 2KE9A 4RTUA 3ZL7C 3CQTA 4F16A 1AZGB 3NPFA 4D8KA 1X69A 2K7AA 1SPKA 2L0AA 2RQRA 1RI9A 2YSQA 1KFZA 1BBZA 2V1RA 1TUDA 2GQIA 2EYZA 1M3BA 2KRSA 1M3CA 1NLOC 4E6RA 1OV3A 2E5KA 1HD3A 2KGTA 1U3OA 2EGEA 1UGVA 1SRLA 1Y57A 1AVZC 2ED1A 2M0YA 2A36A 4JJBA 3UA7A 4HVUA 1X6GA 1TG0A 3C0CA 2DRKA 3PVLA 1AOJA 2KT8A 3PE0A 4CC4B 2RF0A 1LCKA 4X1VA 1WLPB 2GTOA 3NGPA 1PHTA 4R0KA 2FEIA 4KRTA 2F2VA 3R6NA 1U5SA 1X6BA 2CSQA 2EBPA 5HCKA 2JM9A 2GGRA 1K9AA 2FG0A 2GBQA 2ROTA 1AD5A 2O31A 4HCKA 3VS4A 1ZBJA 3QWXX 1GCQC 2FO0A 2RQWA 1ZUYA 1AEYA 2L3SA 1VA7A 4IIMA 1NLPC 2A37A 2DJQA 2VVKA 2K3BA 1BU1A 1JU5C 1E7OA 2EYYA 2KYBA 2HBWA 5FW9A 4AFZC 1PRMC 1WDXA 1K0SA 2RPNA 2AKLA 1E6HA 2I0NA 3M0TA 4J9HA 1E6GA 4D8DA 3EHQA 4GBQA 5FWBA 3EG3A 2M51A 1WFWA 2DLPA 2EGCA 1QKXA 1NEGA 2JS2A 4LUDA 3ULRB 2LJ1A 4OMPA 1PKSA 1Y0MA 1CKBA 1RLPC 1PWTA 1NYGA 2IIMA 2F2WA 4DEXA 1NG2A 4RTWA 1W1FA 2AZVA 2O9VA 1UDLA 4HVWA 1KSWA 1NYFA 1YNZA 3M0PA 5IXFA 2A28A 3I5RA 2BZYA 2FPDA 2J6OA 3H0IA 2AK5A 2ESWA 2LCSA 2D8JA 1QWEA 2BTTA 3EGUA 1V1CA 2ENMA 2BZXA 3H41A 1VYUA 1G2BA 1VYTA 2KROA 3RNJA 4K11A 1UJYA 1XOVA 3TSZA 1RUWA 2J6KA 2F2XA 2LJ0A 1H3HA 3JV3A 1M3AA 4F17A 3M0UA 1ZSGA 3GBQA 4JPBW 2MIOA 1K1ZA 2DYBA 2EYXA 2K9GA 2BZ8A 3VRZA 1B07A 1M30A 1GFCA 4OMOA 4RUGA 1YP5A 1AWJA 2CH4W 2O9SA 2ROLA 4JJDA 3SHWA 2HEQA 3UATA 2KEAA 1ABOA 3THKA 1UHCA 2L3PA 4A63B 4HXJA 4LNPA 1GBQA 1OPKA 2O2OA 3FJ5A 4OMLA 1UE9A 1GCPA 4JZ4A 1WX6A 1WXTA 4RTZA 1UTIA 1AWWA 1J3TA 4J9BA 1BB9A 2L2PA 5L23A 2KNBB 1UJ0A 3REAB 1RLQC 5FWCA 4OMQA 1K4US 2CT3A 2RN8A 1W70A 2JMAA 2CUBA 2OJ2A 3I35A 2EGAA 3I9QA 1ZLMA 2DNUA 1CSKA 4M4ZA 1WA7A 2DL5A 2DE0X 3H0FA 4Z88A 2NWMA 1GRIA 3SEMA 4AFQC 2DBMA 2DM1A 1FMKA 4OMNA 4DEYA 2EPDA 1UFFA 3EHRA 1YWPA 2D0NA 2ED0A 3VS6A 1ZUUA 4RTTA 2FRWA 5IHIA 4CC7A 1UECA 5I22A 2CDTA 2OAWA 3A98A 3M0RA 5GJVB 4CC3A 2NUZA 3EG2A 2OI3A 1YN8A 3VS0A 2SRCA 1SHFA 3M0SA 2GNCA 2YDLA 2LMJA 2DMOA 1YWOA 4RTYA 4LN2A 1YCSB 2X3XD 1ARKA 1TUCA 3QWYA 3NHNA 1WIEA 2A08A 1AWXA 1UG1A 2V1QA 4JJCA 1JQQA 2JMCA 1H8KA 2CUDA 3VS5A 1PKTA 4EIKA 1M8MA 1AWOA 2CT4A 2B86A 1KIKA 2RNAA 1G83A 2AKKA 2DVJA 2O88A 4ESRA 1SHGA 1AZEA 2C0OA 2CSIA 2EYWA 1I1JA 2C0TA 1WXUA 1JEGA 2DF6A 1GFDA 1I0CA 1MV0B 2YUQA 4J9FA 2P4RA 2EQIA 4AG1C 1K76A 2RQUA 1H92A 2DL4A 2W10A 5IHNA 2DA9A 1QWFA 2LNHB 1B3QA 2KYMA 2XMFA 2YUPA 3EG0A 3VRYA 2RMOA 1FYNA 2JM8A 1X2QA 1ZUKA 3TSWA 4RTVA 2CH4A 2LX7A 3UF4A 2VKNA 4J9DA 4J9CA 4F14A 5IH2A 2VWFA 3VS3A 1WXBA 1X27A 1OPLA 2SEMA 2PTKA 2KT1A 5GJWB 2JS0A 4AFUC 1I07A 1Z9QA 4HVVA 1JXMA 4CC2A 4ZNXA 3VS7A 1PNJA 1N5ZA 2CREA 4Z8AA 2JW4A 1JO8A 1U06A 1EFNA 2LZ6B 2ABLA 2W0ZA 2LQWA 2JTEA 2G6FX 2J6FA 1WI7A 5ECAA 4ORZA 1JXOA 2YUNA 3U23A 1IO6A 1T3LA 2JT4A 3O5ZA
chains in the Genus database with same CATH superfamily
2EQUA 4R56A 1SEMA 3L1AA 2RHYA 2KRNA 2X3WD 2CP3A 2LT4A 1Z9ZA 3LX7A 3CMEQ 3LH5A 1UHFA 5J39A 1D0ZA 2DETA 5LJ3e 1EZZB 2OAUA 4WCIA 2FZKB 3MEVA 5GAN7 2RHUA 3WXMB 4JLGA 3M4YA 3LWIA 3M56A 2D8HA 5FU6B 4C0FA 3CCSQ 4OMMA 3OYMA 1W6XA 4C92E 2G3RA 1ABQA 1XNIA 4XTVA 4AG2C 3FEOA 3UDCA 1I81A 4EMKC 2EW3A 2B8AA 2DRMA 3JCMg 1Y96B 1VIFA 5FU7B 5LJ5h 3M57A 1O9SA 4LDVA 5KYXB 2XDDA 4A54A 3KXTA 2CZ6B 2HSPA 2KBTA 1W2BP 1TWBA 2ZPEB 5CO7A 2J05A 4B9WA 3REBB 2EWNA 2EJFA 3OSVA 4DBRA 1Q86R 1T3SA 4A4HA 1OX9A 3DLLA 4LE9A 4PK4A 1XTDA 4E2FB 1D1CA 1K9MU 2HL5C 5KH6A 1GCQA 3PVQA 2J7IA 1ZSZC 1ZX6A 2PZ1A 2CYZB 3EFOB 3CD6A 1K0XA 2DILA 2HKQB 3JSCA 2RQTA 1OEBA 5DLQE 2MI6A 2P0KA 4F7UG 3RR6A 3DLMA 4RTUA 1KQSS 1Q82U 3CQTA 3CPWA 3NPFA 3QZ9B 1VQLA 1M1KR 2LRQA 2PU9B 1KC8U 1M3BA 5L8RE 2HZYA 4KUDK 2E5KA 1HD3A 4X34A 1SG5A 2KGTA 1WQWA 2NUPA 1UGVA 3HSBA 1PM3A 1YI2T 2JUFA 3QG1A 3PVLA 1AOJA 5M9OA 2Y90A 3PE0A 4VUBA 2IVWA 4ZGDB 2EYQA 3QO3A 2DVEA 2L89A 1PHTA 1KQ2A 1ZBXA 2DTHA 3G6EQ 2YLCA 1M90C 1KHIA 2GGRA 4J6XA 3OQ5A 3G4ST 1AD5A 1LVKA 2H3JA 2C06A 4QQGA 4XU3A 1VQ7Q 1ZUYA 1AEYA 4IIMA 4J7IA 4DOWA 2RHZA 4M7DB 3I55Q 4R55A 4PJOD 2K3BA 5KYWA 4ZN1A 1D0YA 4C5GA 1NJIU 3SWNA 1X75C 1WDXA 5CIUA 2AKLA 1E6HA 2DPPB 3EGXB 5I21A 3JCMc 4X9CA 1U1SA 1E6GA 4D8DA 2E70A 5FWBA 2E65A 3QIIA 2M51A 3S3NA 1DJ7B 2VUBA 3PNWC 4KH1B 2EGCA 4XQ3A 1NEGA 4N0AA 3ME9A 4LUDA 2LJ1A 3I55A 1D1BA 1RAIB 1PKSA 4BDYA 1OYXA 1NYGA 1VQNT 2F2WA 1VQ4A 3OS5A 3C94A 5D6YA 4KUIA 4M78D 1TOVA 4FIBA 1UDLA 4HVWA 1WJSA 3BE3A 2MWOA 5IXFA 2BZYA 4JUVA 2JOYA 2BTTA 3BDLA 3CBMA 2A0FB 3ER0A 3BFMA 1VYUA 3P8BB 4Y28E 3RNJA 3JCMQ 3RIRA 3OY9A 2RI2A 4C92A 1H3HA 3JV3A 1M3AA 4EPCA 2K3YA 4WF2A 1BI3A 3GBQA 3PGGA 5GMKj 4JPBW 3CCMQ 2YXYA 4EMKA 4UC4A 5GMKe 1YP5A 2CH4W 2O9SA 2ROLA 1EIFA 1WGSA 4M77D 3UATA 1FXXA 4C0DB 3THKA 3PMTA 5GAMe 4LNPA 4PJMA 1OPKA 2RM4A 2YRDA 4ME7A 2DO3A 1UE9A 1EX4A 1VQ5A 4JZ4A 3CCMA 4LDUA 2QEXQ 2VGMA 1AWWA 2HL3A 1X6OA 2LVMA 2JTMA 3E19A 2KNBB 5GANg 3REAB 5FWCA 4ELYC 4OMQA 1K4US 2E6NA 2CT3A 3OMCA 4OMFB 2CUBA 2OJ2A 1Q7YU 5KYYB 2KAFA 4IUPA 4C8QF 1WHGA 2HD0A 3JB9D 4M7DC 4KH0B 3I9QA 1VQ6Q 2HBPA 1OX8A 2DE0X 2PUKB 3OYEA 5LJ3d 3HP9A 4OMNA 2DM1A 3CCLQ 1UFFA 3EHRA 1YWPA 2GFAA 2D0NA 4ZN3A 3HFNA 3VS6A 3CXCP 2BE7D 3FRNA 4RTTA 3PIOA 1TSFA 4CC7A 1UECA 5CK9A 2OAWA 3CCEQ 3P8HA 2CZ1B 2R58A 1WHMA 3VS0A 2SRCA 2YDLA 4ELZC 1SKUB 1YWOA 4LN2A 4RTYA 3OBYA 1TUCA 1NJIR 2A08A 4Q5WA 2WSEE 1VQLT 4OB2B 1W2BS 4MDXA 4GLKA 2XG8D 1WJRA 1FMVA 2DVJA 1KQSP 5LJ3h 3CC2Q 2C0OA 2H3EB 5A0LA 5GAN4 1I1JA 3HTRA 1WXUA 1JEGA 2DF6A 4DQ2A 1JJ2A 1I0CA 2YUQA 1YIJT 2O4XB 2KK4A 5IHNA 2DA9A 4BY6B 3WVDB 1QWFA 1G3SA 2RMOA 4XK8E 1M90R 3TSWA 5CAIA 4C5IA 3JCMP 4F14A 2QDYB 2GFUA 1Y96A 2COZA 2V8JA 2PTKA 2QQ9A 2QQBA 2X4WA 2MYSA 5GJWB 2JS0A 5LL6S 4HVVA 4CC2A 2QA4Q 5KYXA 3VS7A 3CCQQ 1VQMT 1PNJA 1MHNA 3GLXA 4MZMA 2QTVA 4Z8AA 2JW4A 2ZPIB 4M75B 4QVCA 4PJJA 1OI1A 2LQWA 4OP0A 2J6FA 1JXOA 2QGFB 3U23A 4PNOA 1IO6A 1V29B 4PKCC 1AT1B 5CKDA 4BE1A 4II1A 2YUOA 2YLBA 2COYA 2HKNA 2ECZA 3G4SQ 2D6FA 5GMKm 4BACA 3SFMA 3NMZC 5HKCA 4RG8A 2RB6A 4JLIA 2DL8A 1MV3A 1YI2A 3FDRA 2EAYA 1PSEA 1BKBA 1W4SA 2A7YA 1QCFA 2XIDA 3EFOA 6AT1B 1KK7A 2KXCA 4J9GA 4FM4B 2DX1A 2EFIA 1X2KA 2LJ3A 1Q86U 3AT1B 2LQ8A 1SRMA 4LDXA 3RMSA 4C8QG 4IIOA 3G4SA 4AMCA 2L3QA 4C8QC 4E7IA 3HRTA 2IPOB 1BK2A 3VV0A 2LP5A 2EKHA 1UEBA 3CCJT 1IXDA 5CKFA 3LYIA 3A8MB 1SSHA 2D1XA 1IB8A 1RAHB 3H0HA 3JCMf 3URGA 4LDWA 1PRLC 2X35A 5GAOq 1B7TA 2HQHA 2K6DA 1RAEB 2DL3A 1VQNQ 2ZPGB 3E2UA 4HT8A 1OZ3A 2LQNA 1M1KU 2JXBA 3C12A 1UUEA 3E9FA 1K8AC 3CC4T 3OW2S 2YT6A 1QVGS 1KQ1A 1NM7A 2RI5A 1ZSZB 2E3IA 3MO8A 2E12A 1G3YA 8AT1B 2E10A 3V7RA 2DAQA 5IHKA 3KBGA 4M7AE 5GAOl 3QPHA 3C95A 5EC7A 5GAN6 1ACMB 1FX7A 4BY6C 1P92A 1H641 2M0OA 1YCYA 3A1PA 2EJ9A 3KFVA 4F7UB 4M7DA 3CBOA 2K5IA 1AZGB 1VQ5T 4D8KA 3CPWS 1SPKA 2K4YA 5I2SA 1BIBA 2YSQA 3OS0A 1BBZA 1TUDA 2EYZA 2KRSA 3EGXA 4E6RA 4HCCA 1QP3A 2X4YA 1Y57A 1AVZC 2ED1A 4FU6A 2M0YA 2A36A 4JJBA 1X6GA 1ZHIA 3C0CA 2Y4YA 3EH1A 4PJOF 2KT8A 3BY7A 3TREA 2P0QA 2RF0A 1LCKA 3NGPA 1IHVA 2DK3A 3R6NA 1U5SA 3RUXA 1AHJB 2OTLT 1TU0B 1X6BA 4M75E 2EBPA 1KD1C 1M2VB 5D7UA 5FLXE 5GAN3 2ROTA 4DBQA 5GAMd 4HCKA 3QWXX 3L2WA 2WSFE 4QVDA 1QVFP 2A37A 4M78F 3MJXA 4HA8A 4V2SA 2NLUA 2EQMA 1K73C 4OB3B 2HBWA 2KYBA 5FW9A 1K0SA 2DD4A 2EJGA 4A4KA 5GMKh 1FWZA 3S6WA 5KCHA 4F04B 3EG3A 3OYNA 1QKXA 3GNFB 3CD6Q 4C92D 3ULRB 2FYKA 3CXCS 3M9QA 1U8RA 1CKBA 4D6WA 1LJOA 5GAMh 4ZTFA 1RLPC 1N8RC 4BE0A 2CP2A 4FCYA 4FW2A 4BUGA 1W1FA 4L5GA 1R0BG 2FZGB 1VQLQ 4QVZA 3OYBA 4YTLA 1YNZA 3VYHB 4A4EA 2DTIA 2JZ2A 3M0PA 3I5RA 1Y07A 2AK5A 5CKHA 3V8KA 2LCSA 2D8JA 1IREB 4M77F 1V1CA 3QJYA 2RJCA 3MP8A 1NPPA 5KYYA 2O01E 3JB9H 2RHIA 2KROA 3PT9A 1D1AA 5C6SA 2ZAEA 2IG0A 2F2XA 2LJ0A 3MEWA 4C5HA 2JVVA 3JAME 2MPXC 3EH2A 5GMKi 2F5TX 4A4GA 1B07A 3A8LB 4EDUA 4L6V5 4AT1B 4FYYB 3S3OA 1YIJA 3JB9F 3I56T 3H9NA 4A53A 2HEQA 3VKIA 1VQMQ 2L3PA 2LCLA 1IZ6A 1SF9A 2RK2A 1KG1A 4FL6A 2QAZA 3FJ5A 4OMLA 2FL7A 1GCPA 1UGPB 3AHUA 4PJOG 4EMGA 1J3TA 4MMLA 4BB7A 1BB9A 4PJOC 5L23A 3BW1A 1MNEA 2RN8A 4HCZA 4ZGJB 2D9TA 2JMAA 4M7AA 4FW1A 3OYAA 1VQMA 1D0XA 4QQ6A 1XQHA 2EGAA 5GANf 1TTHB 4JDSA 4L59A 3SDZA 2QGGA 2O4XA 5IN1A 1D09B 2XHCA 1VQ4Q 1JBMA 3DKMA 1CSKA 4M4ZA 1WA7A 2NUTB 5A2QE 1K8AR 1VQOT 3QSUA 1ZQ1A 4AFQC 2L5QA 1FMKA 1VQ8T 2EPDA 2KDSA 4M78G 2ED0A 5D6XA 3LGLA 1Q81C 3NTHA 4M78C 5I22A 1YITT 2NUZA 3OW2P 2QTXA 1QVGP 2OI3A 1YN8A 4KT0E 1SHFA 4XU2A 4IKFA 1M90U 2GCXA 1VQ9T 2HQEA 4HCBA 3QWYA 3EG9B 3BDUA 4M75A 1AWXA 1D3BB 1VUBA 3RKYA 2JMCA 1H8KA 3MP6A 3CCJA 3GPLA 3Q1JA 2HAXA 1MMNA 1KIKA 2RNAA 1G83A 3E9GA 3G71T 2O88A 3X28B 2VB6A 1SHGA 1AZEA 1FMWA 3CPWP 5LJ3g 2K2VA 4J9FA 3HRSA 2PVOB 2EQIA 2RQUA 1H92A 2DL4A 4PJLA 2W10A 5KYNA 3M54A 2K5LA 4M77G 1B3QA 3CC7T 3EG0A 1FYNA 3CC4A 1X2QA 1ZUKA 4M77C 4E7SA 1VQ5Q 5KCOA 2XKOC 3L2QA 3CMAT 4PLLA 3UF4A 5DM7R 4OGEA 2KSSA 2CGHA 3V8JA 2SEMA 4XTYA 2KT1A 1QCNA 1VQKT 1M5Q1 2QQAA 2DXTA 2R57A 5LJ5j 1BYMA 4AFUC 1YJ9T 4DA4A 1JXMA 1R77A 2XDPA 1K73R 2ZPFB 3KUFA 1EFNA 3JB9G 3OB9A 1MNDA 1WI7A 2BKDN 2CZ0B 4ORZA 5ECAA 2JT4A 3FC3A 4E7JA 3GOXA 1Y7XA 2WACA 2QQRA 1ZSZA 1GXIE 4GY5A 1NBEB 3CMET 1GL5A 4LUEA 2H8HA 2HMAA 1GBRA 2M16A 1N8RR 3L2RA 3JCMV 2K57A 1NEBA 4FSXA 1MUZA 4M7DE 2QK0A 3OYGA 2J06A 8ATCB 2OTLA 1M2OA 3QBYA 4J9EA 4F7UA 1WNLA 2R5MA 2E3HA 3M0QA 1N9RA 2E41A 3E1SA 4J7FA 1IHWA 4QT7A 4C8QB 1QVFS 3PMIA 4RG2A 3CCST 2M1HA 2RJDA 4Y92A 2HDAA 1KJWA 2R5AA 2QDLA 2ZPBB 3I5SA 1LOJA 1WZOA 2C0IA 1QCOA 2AZSA 3RESA 3TQ7P 2KRMA 2EQKA 3OS2A 3QUIA 4GLMA 2KI7A 4JRIA 4JZ3A 1HK9A 2FRYA 2GTJA 3TVTA 2MOXA 3LLRA 2XD0A 1Q95G 3VS2A 1S1NA 3QHSA 2XDBA 2CS7A 5J3BA 1OOTA 3L2ZA 1QLYA 3OYCA 2DD5A 3PTAA 1T0JA 5LJ5f 3OYIA 3UPUA 2X9HA 2HCKA 2KY9A 2MCNA 2AHJB 5D6WA 4NS5A 2RO0A 1M2VA 4J9IA 3V7CA 5FRNA 1WQ7A 3NTKA 3OSSC 2JNGA 2X51A 3QXEB 4FT4A 2MWPA 2EVRA 2KR3A 3MEUA 2DXUA 4Z89A 3EFSA 5GAN5 1M27C 3TCJA 4QKUA 1WHJA 1UGQB 4IUUA 2OTJT 4FT2A 3ZL7C 2JTFA 4F16A 4E7KA 4LD6A 5GMKl 2L0AA 5DY9A 1RI9A 2LDMA 3ASKA 3JB9I 1KFZA 3JCMe 4C0ZA 1M3CA 2HNIA 1OV3A 2FZCB 2HQXA 1WJQA 4XTUA 1YI2Q 4LD9K 2YWWA 5HY6A 1YHQA 1TG0A 2FHDA 1N27A 1RACB 5A0DA 5IAYA 2BE9B 2GTOA 2CP7A 2DEUA 4FYVB 2FEIA 4KRTA 4R0KA 1TS9A 2X4JA 2F2VA 3JCMW 2CSQA 1OQKA 4JJNK 1Q81R 1QW1A 2DTOA 1K9AA 2K5FA 3G6ET 2O31A 3I56A 2DZ9A 3QDFA 3VS4A 4C92F 2GQVA 1GCQC 3GP8A 3V8LA 2FO0A 2RQWA 1OU9A 1NLPC 4J6WA 1VQ7T 2DJQA 3X24B 2RJEA 4KBMB 2VVKA 1U1TA 2Y4XA 1BU1A 1SSFA 1C6VX 1VQOQ 1E7OA 2EYYA 1PRMC 4Z02A 2I0NA 4O5VA 1ZA1B 4C8QE 3M0TA 3UT1A 2Z0WA 3RERA 3VJPA 1YJWT 5CKBA 1JRIA 1WFWA 4HT9A 2DLPA 2JS2A 3EGDB 1Y0MA 5J26A 1VQOA 2IIMA 2E64A 1VQ9Q 1VQ8A 2AZVA 3VYGA 2O9VA 5GAMg 3META 1F1BB 3DB3A 1JJ2P 1KSWA 5GAOp 1UGSB 1W2BA 2DXBA 2A3LA 3LWHA 2FPDA 2J6OA 1YITA 1VQPT 2ESWA 2KQWA 3G71Q 1QWEA 2F69A 4B6MA 5KYUB 1TUGB 1VQ9A 1Y71A 1G2BA 4JS5A 1VYTA 3OYKA 3G7ZA 4K11A 3CPFA 1UJYA 3TSZA 2J6KA 2NUTA 3OBWA 4RCBA 3J7AF 3UWNA 1G5VA 2D0QB 2VGNA 1M1FA 3JCMX 4M7AD 4E47A 2DYBA 3G71A 3JCMJ 3CMAQ 4OB0B 5GAOn 2EYXA 2K9GA 2BZ8A 2E6ZA 5KE2A 1AWJA 1RI0A 3SHWA 4N0AC 2MK5A 2KEAA 3CC7A 1ABOA 1G3TA 1I5OB 1K8AU 3CCRT 2M9UA 4RKUE 1OZ2A 3CCUT 1R8OB 5GAN2 1GBQA 3VU3C 2O2OA 3EG9A 3PIPA 3CMAA 1D3BA 1WX6A 5GAOm 4Y91A 3CBPA 1UTIA 4PJOB 3RKWA 3H6ZA 4ZGEB 1YJNT 4BD3A 2L2PA 2VXFA 5LJ5d 2QEXT 1UJ0A 4P5NA 1VQKA 1BIAA 1RLQC 3A8HB 4RMOA 5CQXA 1YJ9A 4ATOA 1W70A 2DFUA 5LJ3j 5GAOr 5HK3A 4M75D 4A4FA 3I35A 1K9MC 3RMQA 3T9NA 4DBHA 2DNUA 4C92G 2DL5A 3H0FA 1VQ6T 2F1LA 3SD4A 4C92C 1UB4A 1QMCA 1G3WA 2RK1A 3DB4A 2EKOA 3V7SA 3OYFA 2QXFA 4M78B 1Q82C 1ZUUA 2VC8A 3CMEA 1HXDA 3CCLT 5IHIA 3A5ZB 1KC8C 2CDTA 3A98A 4CC3A 3EG2A 1PSFA 5CKEA 3HRUA 3CCET 3M0SA 1KD1U 2GNCA 2DJZA 4XAXB 4IUVA 2DMOA 2LCCA 3OMGA 1ARKA 1WIEA 3ZEHA 4CRIA 3CCSA 5GANj 4HKEA 4JJCA 1JQQA 2COWA 2CUDA 3VS5A 1M9SA 1PKTA 1WHKA 2XU8A 1M8MA 5GANe 2CT4A 3MKDA 2VYTA 3QZ5B 5KE3A 1I8FA 1PCXA 3OW2A 2AKKA 1BCMA 4PJNA 1QVGA 1WPYA 4MZPA 2CZ7B 2EYWA 2FVUA 1YIJQ 3GF5A 1YHQT 1GFDA 5FRMA 3CC2T 1MV0B 1K73U 2FB7A 2P4RA 3S3MA 4AG1C 1K76A 2MMPA 3A8GB 4F7UE 1S72T 3P8DA 2LNHB 2OTJQ 4M77B 2P4TA 2XMFA 2YUPA 2OX7A 5LJ3f 2JM8A 3N5BB 4OB1B 5FROA 5CR2A 3WVEB 3OA6A 1BI1A 4C8QA 2CH4A 1VOMA 2VKNA 4J9DA 1NJIC 2VWFA 3VS3A 2VV5A 1WXBA 3OYYA 1RAAB 1O75A 2GF7A 2DKGA 1N8RU 1OU8A 1NE8A 3JCMd 2OTJA 3G1JA 2X4XA 1N5ZA 2V8KA 1B34B 2CREA 4MDWA 2QA4T 1JO8A 1U06A 3CCQT 2ABLA 1N9SA 2YUNA 2PVGB 3MP1A 3O5ZA 4RTXA 3CCVT 2KXDA 1HJDA 2LC4A 4PJOE 4M7DF 3HHTB 2QI2A 2K3XA 3VS1A 2P0PA 4XU1A 1TXQA 2RQVA 1PD1A 2QASA 1RAFB 1A0NB 3RBBB 1T0HA 1CKAA 5I11A 3M55A 4E7HA 1I5LA 4C0GA 4BI3A 3EAEA 1C0MA 2FPFA 4FSSA 2CKKA 2DYIA 4E7ZA 1QKWA 3HKSA 3JCMh 5FU6C 1X43A 4J8OA 3G6EA 2FPEA 3CEYA 5AT1B 5IXBA 3CCJQ 1HSQA 4MMKA 3VUZA 3QKJA 3LGFA 4M78E 3JB9J 2PVDB 1YJWQ 4IUTA 5FU7C 1WHHA 3X25B 3X26B 1VQ7A 2HSEB 1WYXA 3ZBDA 3IQLA 3CXCA 3GIBA 4N4GA 3CC4Q 2K2MA 2PNIA 4AFSC 3UA6A 2E1HA 3QYHB 3QDRB 3HPWA 1YJWA 4BE2A 1VQPQ 1JJ2S 3EG1A 1VYVA 2K79A 1LPLA 4FYWB 4MZTA 1N6AA 1KD1R 5GAN8 2ZPHB 3LH0A 2DBKA 2LT1A 1Q7YC 2DL7A 1KQSA 2KE9A 1MMAA 4LDYA 1Q81U 1X69A 5CVIA 2K7AA 1BCOA 2RQRA 4M77E 2ZZDA 5HK0A 4NOYA 2V1RA 3TEEA 2GQIA 1VQPA 4C5EA 1NLOC 3QYGB 4PLIA 1U3OA 2EGEA 1SRLA 4ANJA 3UA7A 1V76A 3NFCA 4HVUA 3J81E 5LJ5e 1K9MR 4J83A 1YBYA 1M4ZA 2DRKA 3EGDA 2BUDA 3PFSA 2LQKA 4CC4B 2XK0A 2YHTA 4X1VA 1WLPB 3CCRQ 2OTLQ 2PUOB 5GAMj 3CCUQ 2XICA 1MMGA 4KGVB 4B9XA 2E4HA 4TVRA 3M59A 2DIQA 2EQJA 1Q82R 5HCKA 2JM9A 4NL2A 5DLOA 1YJNQ 3M53A 2FG0A 5C0MA 4XTXA 1WHLA 2GBQA 4KGZB 4WTOB 1KC8R 2KMTA 1ZBJA 1HYOA 4IUQA 3VUBA 1RL2A 2E5QA 2QG9B 5KYUA 4JRKA 1PG5B 4LXCA 2EIFA 3CCRA 4OF1A 2L3SA 1VA7A 3CCUA 2BIVA 4M7DG 1RABB 2M02A 1JU5C 5I2MA 1RADB 3QJ6A 4AFZC 1IRXA 1YJNA 2V26A 2RPNA 2QEXA 3M5AA 2AIRB 4ZTJA 3FIFA 4J9HA 2XI9A 4M7DD 3EHQA 4GBQA 2NUPB 1IGUA 2KVQG 3M58A 2MF2A 3NTIA 3FLGA 1MMDA 3RKXA 4OMPA 5CQYA 4BI8B 4N4IA 3CD6T 4J6YA 1PWTA 2RI3A 1VQ6A 4XTWA 4DEXA 1NG2A 2YRVA 2JJ9A 4PL6A 7AT1B 4RTWA 3OYLA 4M7AF 2JN0A 3MPUB 1PD0A 4KULA 1NYFA 1VIEA 3X20B 3CCLA 1QQJA 4PJOA 4DOVA 2LX9A 2ZGWA 4BI4A 2A28A 2ATCB 2DZCA 2CP5A 3H0IA 5GAMf 3J80E 3JCMb 2VASA 3EGUA 2L8DA 3CCEA 1YHQQ 2ENMA 2BZXA 1TH7A 3H41A 1LNXA 4M7AB 3O8VA 5GANd 1M1GA 3M4GA 4CI0C 2CP0A 4EMHA 5KYWB 1XOVA 1S72Q 1ZA2B 1RUWA 3SWNB 1NZ9A 4F17A 3M0UA 1ZSGA 3HL8A 1H3ZA 3OYHA 4QQDA 1M8VA 2MIOA 1K1ZA 2NYSA 1Q86C 9ATCB 4M78A 1QVPA 3VRZA 1M30A 4RUGA 1GFCA 4OMOA 3I56Q 3FJPA 2MAMA 3H8ZA 1BI2A 3CC2A 4M75F 4OGCA 3C4SA 4PFZA 1UGRB 4JJDA 3OYJA 1S72A 5CCAA 5IT9E 3R6OA 3INZA 1UHCA 4C0DC 4A63B 4HXJA 4O6JA 4DBFA 3A8OB 3SB2A 3L2UA 5GANh 4NL3A 1WXTA 4RTZA 4J9BA 3CCVQ 4IURA 3FB9A 1M1KC 3D7SB 2RA2A 4XTZA 1XJWB 2RD1A 3L42A 2QA4A 3GNGA 3CCQA 1ZLMA 3I55T 4C92B 1MGQA 2CP6A 2DXCA 4Z88A 2NWMA 1VQ8Q 1GRIA 4M77A 2DERA 1VQ4T 3CCVA 3SEMA 2QQSA 1PC0A 2DBMA 4DEYA 3MEAA 1QVFA 4EMKB 1QP2A 4PFOA 2PQWA 1YITQ 4BDZA 2FRWA 4N4HA 5EG2A 1KHCA 3M0RA 5GJVB 5AYFA 4JRQA 2QYZA 1Q7YR 3OYDA 3L2VA 4C8QD 2LMJA 1YCSB 2WSCE 2YRCA 1B34A 2X3XD 5LJ5g 1OULA 3NHNA 4RCCA 1UG1A 2LTOA 4E7LA 2V1QA 3JRZA 3EFRA 4EIKA 1X01A 1AWOA 2B86A 2DIGA 4ESRA 4F7UF 4M7AG 2CSIA 1I4K1 5A0GA 2C0TA 2DEQA 2RHXA 4JRPA 4M7AC 1BI0A 2P84A 3CC7Q 4XU0A 1G8XA 2I2LA 3SWNC 1VQNA 2KYMA 3VRYA 2L3RA 1YFNA 1IGQA 4RTVA 2LX7A 3HFOA 3TU4K 1JB0E 4X9DA 3CCMT 4J9CA 3ZFJA 1VQKQ 5IH2A 4FYXB 1YJ9Q 1X27A 1OPLA 2LNVA 1RAGB 1NPRA 2F5KA 1I07A 1Z9QA 3F70A 2ZCFB 3MHXA 4PFPA 2RJFA 4ZNXA 3RDVA 1C1AA 2V8IA 3MCAB 4OVAA 3OS1A 2AT1B 4JS4A 2VXEA 4M75G 4KGXB 4QW2A 2LZ6B 3LW5E 2W0ZA 2JTEA 2G6FX 4M75C 1R0CB 1T3LA 4J5YA 2RH2A
chains in the Genus database with same CATH topology
4RTXA 1SEMA 1HJDA 2KXDA 2YUOA 2KRNA 2ECZA 2X3WD 1Z9ZA 3LH5A 3NMZC 1UHFA 2DL8A 1MV3A 3VS1A 1GL5A 4LUEA 2H8HA 4WCIA 2RQVA 1GBRA 1A0NB 3RBBB 1QCFA 1T0HA 1NEBA 1CKAA 1MUZA 5I11A 2KXCA 4J9GA 2DX1A 2J06A 1X2KA 2FPFA 2D8HA 2LJ3A 4FSSA 4J9EA 1SRMA 1QKWA 4OMMA 3M0QA 1W6XA 1ABQA 4IIOA 4QT7A 1X43A 4AG2C 2FPEA 2L3QA 5IXBA 4Y92A 2HDAA 2EW3A 1KJWA 2DRMA 1BK2A 2QDLA 1HSQA 2LP5A 3I5SA 2EKHA 2C0IA 2AZSA 2KRMA 1SSHA 4GLMA 2D1XA 4JZ3A 3H0HA 2FRYA 2GTJA 3TVTA 2MOXA 1WYXA 2HSPA 2KBTA 1PRLC 3VS2A 1S1NA 2J05A 2K6DA 3IQLA 2DL3A 1OOTA 1QLYA 3REBB 2LQNA 1T0JA 2JXBA 2K2MA 2PNIA 1UUEA 4AFSC 1T3SA 3UA6A 2HCKA 2MCNA 4LE9A 2YT6A 4J9IA 1NM7A 1GCQA 3PVQA 2J7IA 3EG1A 1VYVA 2EVRA 2KR3A 2K79A 5IHKA 4Z89A 1ZX6A 2PZ1A 1K0XA 2DILA 1M27C 5EC7A 2RQTA 1OEBA 2DBKA 2DL7A 3KFVA 2KE9A 4RTUA 3ZL7C 3CQTA 4F16A 1AZGB 3NPFA 4D8KA 1X69A 2K7AA 1SPKA 2L0AA 2RQRA 1RI9A 2YSQA 1KFZA 1BBZA 2V1RA 1TUDA 2GQIA 2EYZA 1M3BA 2KRSA 1M3CA 1NLOC 4E6RA 1OV3A 2E5KA 1HD3A 2KGTA 1U3OA 2EGEA 1UGVA 1SRLA 1Y57A 1AVZC 2ED1A 2M0YA 2A36A 4JJBA 3UA7A 4HVUA 1X6GA 1TG0A 3C0CA 2DRKA 3PVLA 1AOJA 2KT8A 3PE0A 4CC4B 2RF0A 1LCKA 4X1VA 1WLPB 2GTOA 3NGPA 1PHTA 4R0KA 2FEIA 4KRTA 2F2VA 3R6NA 1U5SA 1X6BA 2CSQA 2EBPA 5HCKA 2JM9A 2GGRA 1K9AA 2FG0A 2GBQA 2ROTA 1AD5A 2O31A 4HCKA 3VS4A 1ZBJA 3QWXX 1GCQC 2FO0A 2RQWA 1ZUYA 1AEYA 2L3SA 1VA7A 4IIMA 1NLPC 2A37A 2DJQA 2VVKA 2K3BA 1BU1A 1JU5C 1E7OA 2EYYA 2KYBA 2HBWA 5FW9A 4AFZC 1PRMC 1WDXA 1K0SA 2RPNA 2AKLA 1E6HA 2I0NA 3M0TA 4J9HA 1E6GA 4D8DA 3EHQA 4GBQA 5FWBA 3EG3A 2M51A 1WFWA 2DLPA 2EGCA 1QKXA 1NEGA 2JS2A 4LUDA 3ULRB 2LJ1A 4OMPA 1PKSA 1Y0MA 1CKBA 1RLPC 1PWTA 1NYGA 2IIMA 2F2WA 4DEXA 1NG2A 4RTWA 1W1FA 2AZVA 2O9VA 1UDLA 4HVWA 1KSWA 1NYFA 1YNZA 3M0PA 5IXFA 2A28A 3I5RA 2BZYA 2FPDA 2J6OA 3H0IA 2AK5A 2ESWA 2LCSA 2D8JA 1QWEA 2BTTA 3EGUA 1V1CA 2ENMA 2BZXA 3H41A 1VYUA 1G2BA 1VYTA 2KROA 3RNJA 4K11A 1UJYA 1XOVA 3TSZA 1RUWA 2J6KA 2F2XA 2LJ0A 1H3HA 3JV3A 1M3AA 4F17A 3M0UA 1ZSGA 3GBQA 4JPBW 2MIOA 1K1ZA 2DYBA 2EYXA 2K9GA 2BZ8A 3VRZA 1B07A 1M30A 1GFCA 4OMOA 4RUGA 1YP5A 1AWJA 2CH4W 2O9SA 2ROLA 4JJDA 3SHWA 2HEQA 3UATA 2KEAA 1ABOA 3THKA 1UHCA 2L3PA 4A63B 4HXJA 4LNPA 1GBQA 1OPKA 2O2OA 3FJ5A 4OMLA 1UE9A 1GCPA 4JZ4A 1WX6A 1WXTA 4RTZA 1UTIA 1AWWA 1J3TA 4J9BA 1BB9A 2L2PA 5L23A 2KNBB 1UJ0A 3REAB 1RLQC 5FWCA 4OMQA 1K4US 2CT3A 2RN8A 1W70A 2JMAA 2CUBA 2OJ2A 3I35A 2EGAA 3I9QA 1ZLMA 2DNUA 1CSKA 4M4ZA 1WA7A 2DL5A 2DE0X 3H0FA 4Z88A 2NWMA 1GRIA 3SEMA 4AFQC 2DBMA 2DM1A 1FMKA 4OMNA 4DEYA 2EPDA 1UFFA 3EHRA 1YWPA 2D0NA 2ED0A 3VS6A 1ZUUA 4RTTA 2FRWA 5IHIA 4CC7A 1UECA 5I22A 2CDTA 2OAWA 3A98A 3M0RA 5GJVB 4CC3A 2NUZA 3EG2A 2OI3A 1YN8A 3VS0A 2SRCA 1SHFA 3M0SA 2GNCA 2YDLA 2LMJA 2DMOA 1YWOA 4RTYA 4LN2A 1YCSB 2X3XD 1ARKA 1TUCA 3QWYA 3NHNA 1WIEA 2A08A 1AWXA 1UG1A 2V1QA 4JJCA 1JQQA 2JMCA 1H8KA 2CUDA 3VS5A 1PKTA 4EIKA 1M8MA 1AWOA 2CT4A 2B86A 1KIKA 2RNAA 1G83A 2AKKA 2DVJA 2O88A 4ESRA 1SHGA 1AZEA 2C0OA 2CSIA 2EYWA 1I1JA 2C0TA 1WXUA 1JEGA 2DF6A 1GFDA 1I0CA 1MV0B 2YUQA 4J9FA 2P4RA 2EQIA 4AG1C 1K76A 2RQUA 1H92A 2DL4A 2W10A 5IHNA 2DA9A 1QWFA 2LNHB 1B3QA 2KYMA 2XMFA 2YUPA 3EG0A 3VRYA 2RMOA 1FYNA 2JM8A 1X2QA 1ZUKA 3TSWA 4RTVA 2CH4A 2LX7A 3UF4A 2VKNA 4J9DA 4J9CA 4F14A 5IH2A 2VWFA 3VS3A 1WXBA 1X27A 1OPLA 2SEMA 2PTKA 2KT1A 5GJWB 2JS0A 4AFUC 1I07A 1Z9QA 4HVVA 1JXMA 4CC2A 4ZNXA 3VS7A 1PNJA 1N5ZA 2CREA 4Z8AA 2JW4A 1JO8A 1U06A 1EFNA 2LZ6B 2ABLA 2W0ZA 2LQWA 2JTEA 2G6FX 2J6FA 1WI7A 5ECAA 4ORZA 1JXOA 2YUNA 3U23A 1IO6A 1T3LA 2JT4A 3O5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTX A;  1SEM A;  1HJD A;  2KXD A;  2YUO A;  2KRN A;  2ECZ A;  2X3W D;  1Z9Z A;  3LH5 A;  3NMZ C;  1UHF A;  2DL8 A;  1MV3 A;  3VS1 A;  1GL5 A;  4LUE A;  2H8H A;  4WCI A;  2RQV A;  1GBR A;  1A0N B;  3RBB B;  1QCF A;  1T0H A;  1NEB A;  1CKA A;  1MUZ A;  5I11 A;  2KXC A;  4J9G A;  2DX1 A;  2J06 A;  1X2K A;  2FPF A;  2D8H A;  2LJ3 A;  4FSS A;  4J9E A;  1SRM A;  1QKW A;  4OMM A;  3M0Q A;  1W6X A;  1ABQ A;  4IIO A;  4QT7 A;  1X43 A;  4AG2 C;  2FPE A;  2L3Q A;  5IXB A;  4Y92 A;  2HDA A;  2EW3 A;  1KJW A;  2DRM A;  1BK2 A;  2QDL A;  1HSQ A;  2LP5 A;  3I5S A;  2EKH A;  2C0I A;  2AZS A;  2KRM A;  1SSH A;  4GLM A;  2D1X A;  4JZ3 A;  3H0H A;  2FRY A;  2GTJ A;  3TVT A;  2MOX A;  1WYX A;  2HSP A;  2KBT A;  1PRL C;  3VS2 A;  1S1N A;  2J05 A;  2K6D A;  3IQL A;  2DL3 A;  1OOT A;  1QLY A;  3REB B;  2LQN A;  1T0J A;  2JXB A;  2K2M A;  2PNI A;  1UUE A;  4AFS C;  1T3S A;  3UA6 A;  2HCK A;  2MCN A;  4LE9 A;  2YT6 A;  4J9I A;  1NM7 A;  1GCQ A;  3PVQ A;  2J7I A;  3EG1 A;  1VYV A;  2EVR A;  2KR3 A;  2K79 A;  5IHK A;  4Z89 A;  1ZX6 A;  2PZ1 A;  1K0X A;  2DIL A;  1M27 C;  5EC7 A;  2RQT A;  1OEB A;  2DBK A;  2DL7 A;  3KFV A;  2KE9 A;  4RTU A;  3ZL7 C;  3CQT A;  4F16 A;  1AZG B;  3NPF A;  4D8K A;  1X69 A;  2K7A A;  1SPK A;  2L0A A;  2RQR A;  1RI9 A;  2YSQ A;  1KFZ A;  1BBZ A;  2V1R A;  1TUD A;  2GQI A;  2EYZ A;  1M3B A;  2KRS A;  1M3C A;  1NLO C;  4E6R A;  1OV3 A;  2E5K A;  1HD3 A;  2KGT A;  1U3O A;  2EGE A;  1UGV A;  1SRL A;  1Y57 A;  1AVZ C;  2ED1 A;  2M0Y A;  2A36 A;  4JJB A;  3UA7 A;  4HVU A;  1X6G A;  1TG0 A;  3C0C A;  2DRK A;  3PVL A;  1AOJ A;  2KT8 A;  3PE0 A;  4CC4 B;  2RF0 A;  1LCK A;  4X1V A;  1WLP B;  2GTO A;  3NGP A;  1PHT A;  4R0K A;  2FEI A;  4KRT A;  2F2V A;  3R6N A;  1U5S A;  1X6B A;  2CSQ A;  2EBP A;  5HCK A;  2JM9 A;  2GGR A;  1K9A A;  2FG0 A;  2GBQ A;  2ROT A;  1AD5 A;  2O31 A;  4HCK A;  3VS4 A;  1ZBJ A;  3QWX X;  1GCQ C;  2FO0 A;  2RQW A;  1ZUY A;  1AEY A;  2L3S A;  1VA7 A;  4IIM A;  1NLP C;  2A37 A;  2DJQ A;  2VVK A;  2K3B A;  1BU1 A;  1JU5 C;  1E7O A;  2EYY A;  2KYB A;  2HBW A;  5FW9 A;  4AFZ C;  1PRM C;  1WDX A;  1K0S A;  2RPN A;  2AKL A;  1E6H A;  2I0N A;  3M0T A;  4J9H A;  1E6G A;  4D8D A;  3EHQ A;  4GBQ A;  5FWB A;  3EG3 A;  2M51 A;  1WFW A;  2DLP A;  2EGC A;  1QKX A;  1NEG A;  2JS2 A;  4LUD A;  3ULR B;  2LJ1 A;  4OMP A;  1PKS A;  1Y0M A;  1CKB A;  1RLP C;  1PWT A;  1NYG A;  2IIM A;  2F2W A;  4DEX A;  1NG2 A;  4RTW A;  1W1F A;  2AZV A;  2O9V A;  1UDL A;  4HVW A;  1KSW A;  1NYF A;  1YNZ A;  3M0P A;  5IXF A;  2A28 A;  3I5R A;  2BZY A;  2FPD A;  2J6O A;  3H0I A;  2AK5 A;  2ESW A;  2LCS A;  2D8J A;  1QWE A;  2BTT A;  3EGU A;  1V1C A;  2ENM A;  2BZX A;  3H41 A;  1VYU A;  1G2B A;  1VYT A;  2KRO A;  3RNJ A;  4K11 A;  1UJY A;  1XOV A;  3TSZ A;  1RUW A;  2J6K A;  2F2X A;  2LJ0 A;  1H3H A;  3JV3 A;  1M3A A;  4F17 A;  3M0U A;  1ZSG A;  3GBQ A;  4JPB W;  2MIO A;  1K1Z A;  2DYB A;  2EYX A;  2K9G A;  2BZ8 A;  3VRZ A;  1B07 A;  1M30 A;  1GFC A;  4OMO A;  4RUG A;  1YP5 A;  1AWJ A;  2CH4 W;  2O9S A;  2ROL A;  4JJD A;  3SHW A;  2HEQ A;  3UAT A;  2KEA A;  1ABO A;  3THK A;  1UHC A;  2L3P A;  4A63 B;  4HXJ A;  4LNP A;  1GBQ A;  1OPK A;  2O2O A;  3FJ5 A;  4OML A;  1UE9 A;  1GCP A;  4JZ4 A;  1WX6 A;  1WXT A;  4RTZ A;  1UTI A;  1AWW A;  1J3T A;  4J9B A;  1BB9 A;  2L2P A;  5L23 A;  2KNB B;  1UJ0 A;  3REA B;  1RLQ C;  5FWC A;  4OMQ A;  1K4U S;  2CT3 A;  2RN8 A;  1W70 A;  2JMA A;  2CUB A;  2OJ2 A;  3I35 A;  2EGA A;  3I9Q A;  1ZLM A;  2DNU A;  1CSK A;  4M4Z A;  1WA7 A;  2DL5 A;  2DE0 X;  3H0F A;  4Z88 A;  2NWM A;  1GRI A;  3SEM A;  4AFQ C;  2DBM A;  2DM1 A;  1FMK A;  4OMN A;  4DEY A;  2EPD A;  1UFF A;  3EHR A;  1YWP A;  2D0N A;  2ED0 A;  3VS6 A;  1ZUU A;  4RTT A;  2FRW A;  5IHI A;  4CC7 A;  1UEC A;  5I22 A;  2CDT A;  2OAW A;  3A98 A;  3M0R A;  5GJV B;  4CC3 A;  2NUZ A;  3EG2 A;  2OI3 A;  1YN8 A;  3VS0 A;  2SRC A;  1SHF A;  3M0S A;  2GNC A;  2YDL A;  2LMJ A;  2DMO A;  1YWO A;  4RTY A;  4LN2 A;  1YCS B;  2X3X D;  1ARK A;  1TUC A;  3QWY A;  3NHN A;  1WIE A;  2A08 A;  1AWX A;  1UG1 A;  2V1Q A;  4JJC A;  1JQQ A;  2JMC A;  1H8K A;  2CUD A;  3VS5 A;  1PKT A;  4EIK A;  1M8M A;  1AWO A;  2CT4 A;  2B86 A;  1KIK A;  2RNA A;  1G83 A;  2AKK A;  2DVJ A;  2O88 A;  4ESR A;  1SHG A;  1AZE A;  2C0O A;  2CSI A;  2EYW A;  1I1J A;  2C0T A;  1WXU A;  1JEG A;  2DF6 A;  1GFD A;  1I0C A;  1MV0 B;  2YUQ A;  4J9F A;  2P4R A;  2EQI A;  4AG1 C;  1K76 A;  2RQU A;  1H92 A;  2DL4 A;  2W10 A;  5IHN A;  2DA9 A;  1QWF A;  2LNH B;  1B3Q A;  2KYM A;  2XMF A;  2YUP A;  3EG0 A;  3VRY A;  2RMO A;  1FYN A;  2JM8 A;  1X2Q A;  1ZUK A;  3TSW A;  4RTV A;  2CH4 A;  2LX7 A;  3UF4 A;  2VKN A;  4J9D A;  4J9C A;  4F14 A;  5IH2 A;  2VWF A;  3VS3 A;  1WXB A;  1X27 A;  1OPL A;  2SEM A;  2PTK A;  2KT1 A;  5GJW B;  2JS0 A;  4AFU C;  1I07 A;  1Z9Q A;  4HVV A;  1JXM A;  4CC2 A;  4ZNX A;  3VS7 A;  1PNJ A;  1N5Z A;  2CRE A;  4Z8A A;  2JW4 A;  1JO8 A;  1U06 A;  1EFN A;  2LZ6 B;  2ABL A;  2W0Z A;  2LQW A;  2JTE A;  2G6F X;  2J6F A;  1WI7 A;  5ECA A;  4ORZ A;  1JXO A;  2YUN A;  3U23 A;  1IO6 A;  1T3L A;  2JT4 A;  3O5Z A; 
#chains in the Genus database with same CATH topology
 2EQU A;  4R56 A;  1SEM A;  3L1A A;  2RHY A;  2KRN A;  2X3W D;  2CP3 A;  2LT4 A;  1Z9Z A;  3LX7 A;  3CME Q;  3LH5 A;  1UHF A;  5J39 A;  1D0Z A;  2DET A;  5LJ3 e;  1EZZ B;  2OAU A;  4WCI A;  2FZK B;  3MEV A;  5GAN 7;  2RHU A;  3WXM B;  4JLG A;  3M4Y A;  3LWI A;  3M56 A;  2D8H A;  5FU6 B;  4C0F A;  3CCS Q;  4OMM A;  3OYM A;  1W6X A;  4C92 E;  2G3R A;  1ABQ A;  1XNI A;  4XTV A;  4AG2 C;  3FEO A;  3UDC A;  1I81 A;  4EMK C;  2EW3 A;  2B8A A;  2DRM A;  3JCM g;  1Y96 B;  1VIF A;  5FU7 B;  5LJ5 h;  3M57 A;  1O9S A;  4LDV A;  5KYX B;  2XDD A;  4A54 A;  3KXT A;  2CZ6 B;  2HSP A;  2KBT A;  1W2B P;  1TWB A;  2ZPE B;  5CO7 A;  2J05 A;  4B9W A;  3REB B;  2EWN A;  2EJF A;  3OSV A;  4DBR A;  1Q86 R;  1T3S A;  4A4H A;  1OX9 A;  3DLL A;  4LE9 A;  4PK4 A;  1XTD A;  4E2F B;  1D1C A;  1K9M U;  2HL5 C;  5KH6 A;  1GCQ A;  3PVQ A;  2J7I A;  1ZSZ C;  1ZX6 A;  2PZ1 A;  2CYZ B;  3EFO B;  3CD6 A;  1K0X A;  2DIL A;  2HKQ B;  3JSC A;  2RQT A;  1OEB A;  5DLQ E;  2MI6 A;  2P0K A;  4F7U G;  3RR6 A;  3DLM A;  4RTU A;  1KQS S;  1Q82 U;  3CQT A;  3CPW A;  3NPF A;  3QZ9 B;  1VQL A;  1M1K R;  2LRQ A;  2PU9 B;  1KC8 U;  1M3B A;  5L8R E;  2HZY A;  4KUD K;  2E5K A;  1HD3 A;  4X34 A;  1SG5 A;  2KGT A;  1WQW A;  2NUP A;  1UGV A;  3HSB A;  1PM3 A;  1YI2 T;  2JUF A;  3QG1 A;  3PVL A;  1AOJ A;  5M9O A;  2Y90 A;  3PE0 A;  4VUB A;  2IVW A;  4ZGD B;  2EYQ A;  3QO3 A;  2DVE A;  2L89 A;  1PHT A;  1KQ2 A;  1ZBX A;  2DTH A;  3G6E Q;  2YLC A;  1M90 C;  1KHI A;  2GGR A;  4J6X A;  3OQ5 A;  3G4S T;  1AD5 A;  1LVK A;  2H3J A;  2C06 A;  4QQG A;  4XU3 A;  1VQ7 Q;  1ZUY A;  1AEY A;  4IIM A;  4J7I A;  4DOW A;  2RHZ A;  4M7D B;  3I55 Q;  4R55 A;  4PJO D;  2K3B A;  5KYW A;  4ZN1 A;  1D0Y A;  4C5G A;  1NJI U;  3SWN A;  1X75 C;  1WDX A;  5CIU A;  2AKL A;  1E6H A;  2DPP B;  3EGX B;  5I21 A;  3JCM c;  4X9C A;  1U1S A;  1E6G A;  4D8D A;  2E70 A;  5FWB A;  2E65 A;  3QII A;  2M51 A;  3S3N A;  1DJ7 B;  2VUB A;  3PNW C;  4KH1 B;  2EGC A;  4XQ3 A;  1NEG A;  4N0A A;  3ME9 A;  4LUD A;  2LJ1 A;  3I55 A;  1D1B A;  1RAI B;  1PKS A;  4BDY A;  1OYX A;  1NYG A;  1VQN T;  2F2W A;  1VQ4 A;  3OS5 A;  3C94 A;  5D6Y A;  4KUI A;  4M78 D;  1TOV A;  4FIB A;  1UDL A;  4HVW A;  1WJS A;  3BE3 A;  2MWO A;  5IXF A;  2BZY A;  4JUV A;  2JOY A;  2BTT A;  3BDL A;  3CBM A;  2A0F B;  3ER0 A;  3BFM A;  1VYU A;  3P8B B;  4Y28 E;  3RNJ A;  3JCM Q;  3RIR A;  3OY9 A;  2RI2 A;  4C92 A;  1H3H A;  3JV3 A;  1M3A A;  4EPC A;  2K3Y A;  4WF2 A;  1BI3 A;  3GBQ A;  3PGG A;  5GMK j;  4JPB W;  3CCM Q;  2YXY A;  4EMK A;  4UC4 A;  5GMK e;  1YP5 A;  2CH4 W;  2O9S A;  2ROL A;  1EIF A;  1WGS A;  4M77 D;  3UAT A;  1FXX A;  4C0D B;  3THK A;  3PMT A;  5GAM e;  4LNP A;  4PJM A;  1OPK A;  2RM4 A;  2YRD A;  4ME7 A;  2DO3 A;  1UE9 A;  1EX4 A;  1VQ5 A;  4JZ4 A;  3CCM A;  4LDU A;  2QEX Q;  2VGM A;  1AWW A;  2HL3 A;  1X6O A;  2LVM A;  2JTM A;  3E19 A;  2KNB B;  5GAN g;  3REA B;  5FWC A;  4ELY C;  4OMQ A;  1K4U S;  2E6N A;  2CT3 A;  3OMC A;  4OMF B;  2CUB A;  2OJ2 A;  1Q7Y U;  5KYY B;  2KAF A;  4IUP A;  4C8Q F;  1WHG A;  2HD0 A;  3JB9 D;  4M7D C;  4KH0 B;  3I9Q A;  1VQ6 Q;  2HBP A;  1OX8 A;  2DE0 X;  2PUK B;  3OYE A;  5LJ3 d;  3HP9 A;  4OMN A;  2DM1 A;  3CCL Q;  1UFF A;  3EHR A;  1YWP A;  2GFA A;  2D0N A;  4ZN3 A;  3HFN A;  3VS6 A;  3CXC P;  2BE7 D;  3FRN A;  4RTT A;  3PIO A;  1TSF A;  4CC7 A;  1UEC A;  5CK9 A;  2OAW A;  3CCE Q;  3P8H A;  2CZ1 B;  2R58 A;  1WHM A;  3VS0 A;  2SRC A;  2YDL A;  4ELZ C;  1SKU B;  1YWO A;  4LN2 A;  4RTY A;  3OBY A;  1TUC A;  1NJI R;  2A08 A;  4Q5W A;  2WSE E;  1VQL T;  4OB2 B;  1W2B S;  4MDX A;  4GLK A;  2XG8 D;  1WJR A;  1FMV A;  2DVJ A;  1KQS P;  5LJ3 h;  3CC2 Q;  2C0O A;  2H3E B;  5A0L A;  5GAN 4;  1I1J A;  3HTR A;  1WXU A;  1JEG A;  2DF6 A;  4DQ2 A;  1JJ2 A;  1I0C A;  2YUQ A;  1YIJ T;  2O4X B;  2KK4 A;  5IHN A;  2DA9 A;  4BY6 B;  3WVD B;  1QWF A;  1G3S A;  2RMO A;  4XK8 E;  1M90 R;  3TSW A;  5CAI A;  4C5I A;  3JCM P;  4F14 A;  2QDY B;  2GFU A;  1Y96 A;  2COZ A;  2V8J A;  2PTK A;  2QQ9 A;  2QQB A;  2X4W A;  2MYS A;  5GJW B;  2JS0 A;  5LL6 S;  4HVV A;  4CC2 A;  2QA4 Q;  5KYX A;  3VS7 A;  3CCQ Q;  1VQM T;  1PNJ A;  1MHN A;  3GLX A;  4MZM A;  2QTV A;  4Z8A A;  2JW4 A;  2ZPI B;  4M75 B;  4QVC A;  4PJJ A;  1OI1 A;  2LQW A;  4OP0 A;  2J6F A;  1JXO A;  2QGF B;  3U23 A;  4PNO A;  1IO6 A;  1V29 B;  4PKC C;  1AT1 B;  5CKD A;  4BE1 A;  4II1 A;  2YUO A;  2YLB A;  2COY A;  2HKN A;  2ECZ A;  3G4S Q;  2D6F A;  5GMK m;  4BAC A;  3SFM A;  3NMZ C;  5HKC A;  4RG8 A;  2RB6 A;  4JLI A;  2DL8 A;  1MV3 A;  1YI2 A;  3FDR A;  2EAY A;  1PSE A;  1BKB A;  1W4S A;  2A7Y A;  1QCF A;  2XID A;  3EFO A;  6AT1 B;  1KK7 A;  2KXC A;  4J9G A;  4FM4 B;  2DX1 A;  2EFI A;  1X2K A;  2LJ3 A;  1Q86 U;  3AT1 B;  2LQ8 A;  1SRM A;  4LDX A;  3RMS A;  4C8Q G;  4IIO A;  3G4S A;  4AMC A;  2L3Q A;  4C8Q C;  4E7I A;  3HRT A;  2IPO B;  1BK2 A;  3VV0 A;  2LP5 A;  2EKH A;  1UEB A;  3CCJ T;  1IXD A;  5CKF A;  3LYI A;  3A8M B;  1SSH A;  2D1X A;  1IB8 A;  1RAH B;  3H0H A;  3JCM f;  3URG A;  4LDW A;  1PRL C;  2X35 A;  5GAO q;  1B7T A;  2HQH A;  2K6D A;  1RAE B;  2DL3 A;  1VQN Q;  2ZPG B;  3E2U A;  4HT8 A;  1OZ3 A;  2LQN A;  1M1K U;  2JXB A;  3C12 A;  1UUE A;  3E9F A;  1K8A C;  3CC4 T;  3OW2 S;  2YT6 A;  1QVG S;  1KQ1 A;  1NM7 A;  2RI5 A;  1ZSZ B;  2E3I A;  3MO8 A;  2E12 A;  1G3Y A;  8AT1 B;  2E10 A;  3V7R A;  2DAQ A;  5IHK A;  3KBG A;  4M7A E;  5GAO l;  3QPH A;  3C95 A;  5EC7 A;  5GAN 6;  1ACM B;  1FX7 A;  4BY6 C;  1P92 A;  1H64 1;  2M0O A;  1YCY A;  3A1P A;  2EJ9 A;  3KFV A;  4F7U B;  4M7D A;  3CBO A;  2K5I A;  1AZG B;  1VQ5 T;  4D8K A;  3CPW S;  1SPK A;  2K4Y A;  5I2S A;  1BIB A;  2YSQ A;  3OS0 A;  1BBZ A;  1TUD A;  2EYZ A;  2KRS A;  3EGX A;  4E6R A;  4HCC A;  1QP3 A;  2X4Y A;  1Y57 A;  1AVZ C;  2ED1 A;  4FU6 A;  2M0Y A;  2A36 A;  4JJB A;  1X6G A;  1ZHI A;  3C0C A;  2Y4Y A;  3EH1 A;  4PJO F;  2KT8 A;  3BY7 A;  3TRE A;  2P0Q A;  2RF0 A;  1LCK A;  3NGP A;  1IHV A;  2DK3 A;  3R6N A;  1U5S A;  3RUX A;  1AHJ B;  2OTL T;  1TU0 B;  1X6B A;  4M75 E;  2EBP A;  1KD1 C;  1M2V B;  5D7U A;  5FLX E;  5GAN 3;  2ROT A;  4DBQ A;  5GAM d;  4HCK A;  3QWX X;  3L2W A;  2WSF E;  4QVD A;  1QVF P;  2A37 A;  4M78 F;  3MJX A;  4HA8 A;  4V2S A;  2NLU A;  2EQM A;  1K73 C;  4OB3 B;  2HBW A;  2KYB A;  5FW9 A;  1K0S A;  2DD4 A;  2EJG A;  4A4K A;  5GMK h;  1FWZ A;  3S6W A;  5KCH A;  4F04 B;  3EG3 A;  3OYN A;  1QKX A;  3GNF B;  3CD6 Q;  4C92 D;  3ULR B;  2FYK A;  3CXC S;  3M9Q A;  1U8R A;  1CKB A;  4D6W A;  1LJO A;  5GAM h;  4ZTF A;  1RLP C;  1N8R C;  4BE0 A;  2CP2 A;  4FCY A;  4FW2 A;  4BUG A;  1W1F A;  4L5G A;  1R0B G;  2FZG B;  1VQL Q;  4QVZ A;  3OYB A;  4YTL A;  1YNZ A;  3VYH B;  4A4E A;  2DTI A;  2JZ2 A;  3M0P A;  3I5R A;  1Y07 A;  2AK5 A;  5CKH A;  3V8K A;  2LCS A;  2D8J A;  1IRE B;  4M77 F;  1V1C A;  3QJY A;  2RJC A;  3MP8 A;  1NPP A;  5KYY A;  2O01 E;  3JB9 H;  2RHI A;  2KRO A;  3PT9 A;  1D1A A;  5C6S A;  2ZAE A;  2IG0 A;  2F2X A;  2LJ0 A;  3MEW A;  4C5H A;  2JVV A;  3JAM E;  2MPX C;  3EH2 A;  5GMK i;  2F5T X;  4A4G A;  1B07 A;  3A8L B;  4EDU A;  4L6V 5;  4AT1 B;  4FYY B;  3S3O A;  1YIJ A;  3JB9 F;  3I56 T;  3H9N A;  4A53 A;  2HEQ A;  3VKI A;  1VQM Q;  2L3P A;  2LCL A;  1IZ6 A;  1SF9 A;  2RK2 A;  1KG1 A;  4FL6 A;  2QAZ A;  3FJ5 A;  4OML A;  2FL7 A;  1GCP A;  1UGP B;  3AHU A;  4PJO G;  4EMG A;  1J3T A;  4MML A;  4BB7 A;  1BB9 A;  4PJO C;  5L23 A;  3BW1 A;  1MNE A;  2RN8 A;  4HCZ A;  4ZGJ B;  2D9T A;  2JMA A;  4M7A A;  4FW1 A;  3OYA A;  1VQM A;  1D0X A;  4QQ6 A;  1XQH A;  2EGA A;  5GAN f;  1TTH B;  4JDS A;  4L59 A;  3SDZ A;  2QGG A;  2O4X A;  5IN1 A;  1D09 B;  2XHC A;  1VQ4 Q;  1JBM A;  3DKM A;  1CSK A;  4M4Z A;  1WA7 A;  2NUT B;  5A2Q E;  1K8A R;  1VQO T;  3QSU A;  1ZQ1 A;  4AFQ C;  2L5Q A;  1FMK A;  1VQ8 T;  2EPD A;  2KDS A;  4M78 G;  2ED0 A;  5D6X A;  3LGL A;  1Q81 C;  3NTH A;  4M78 C;  5I22 A;  1YIT T;  2NUZ A;  3OW2 P;  2QTX A;  1QVG P;  2OI3 A;  1YN8 A;  4KT0 E;  1SHF A;  4XU2 A;  4IKF A;  1M90 U;  2GCX A;  1VQ9 T;  2HQE A;  4HCB A;  3QWY A;  3EG9 B;  3BDU A;  4M75 A;  1AWX A;  1D3B B;  1VUB A;  3RKY A;  2JMC A;  1H8K A;  3MP6 A;  3CCJ A;  3GPL A;  3Q1J A;  2HAX A;  1MMN A;  1KIK A;  2RNA A;  1G83 A;  3E9G A;  3G71 T;  2O88 A;  3X28 B;  2VB6 A;  1SHG A;  1AZE A;  1FMW A;  3CPW P;  5LJ3 g;  2K2V A;  4J9F A;  3HRS A;  2PVO B;  2EQI A;  2RQU A;  1H92 A;  2DL4 A;  4PJL A;  2W10 A;  5KYN A;  3M54 A;  2K5L A;  4M77 G;  1B3Q A;  3CC7 T;  3EG0 A;  1FYN A;  3CC4 A;  1X2Q A;  1ZUK A;  4M77 C;  4E7S A;  1VQ5 Q;  5KCO A;  2XKO C;  3L2Q A;  3CMA T;  4PLL A;  3UF4 A;  5DM7 R;  4OGE A;  2KSS A;  2CGH A;  3V8J A;  2SEM A;  4XTY A;  2KT1 A;  1QCN A;  1VQK T;  1M5Q 1;  2QQA A;  2DXT A;  2R57 A;  5LJ5 j;  1BYM A;  4AFU C;  1YJ9 T;  4DA4 A;  1JXM A;  1R77 A;  2XDP A;  1K73 R;  2ZPF B;  3KUF A;  1EFN A;  3JB9 G;  3OB9 A;  1MND A;  1WI7 A;  2BKD N;  2CZ0 B;  4ORZ A;  5ECA A;  2JT4 A;  3FC3 A;  4E7J A;  3GOX A;  1Y7X A;  2WAC A;  2QQR A;  1ZSZ A;  1GXI E;  4GY5 A;  1NBE B;  3CME T;  1GL5 A;  4LUE A;  2H8H A;  2HMA A;  1GBR A;  2M16 A;  1N8R R;  3L2R A;  3JCM V;  2K57 A;  1NEB A;  4FSX A;  1MUZ A;  4M7D E;  2QK0 A;  3OYG A;  2J06 A;  8ATC B;  2OTL A;  1M2O A;  3QBY A;  4J9E A;  4F7U A;  1WNL A;  2R5M A;  2E3H A;  3M0Q A;  1N9R A;  2E41 A;  3E1S A;  4J7F A;  1IHW A;  4QT7 A;  4C8Q B;  1QVF S;  3PMI A;  4RG2 A;  3CCS T;  2M1H A;  2RJD A;  4Y92 A;  2HDA A;  1KJW A;  2R5A A;  2QDL A;  2ZPB B;  3I5S A;  1LOJ A;  1WZO A;  2C0I A;  1QCO A;  2AZS A;  3RES A;  3TQ7 P;  2KRM A;  2EQK A;  3OS2 A;  3QUI A;  4GLM A;  2KI7 A;  4JRI A;  4JZ3 A;  1HK9 A;  2FRY A;  2GTJ A;  3TVT A;  2MOX A;  3LLR A;  2XD0 A;  1Q95 G;  3VS2 A;  1S1N A;  3QHS A;  2XDB A;  2CS7 A;  5J3B A;  1OOT A;  3L2Z A;  1QLY A;  3OYC A;  2DD5 A;  3PTA A;  1T0J A;  5LJ5 f;  3OYI A;  3UPU A;  2X9H A;  2HCK A;  2KY9 A;  2MCN A;  2AHJ B;  5D6W A;  4NS5 A;  2RO0 A;  1M2V A;  4J9I A;  3V7C A;  5FRN A;  1WQ7 A;  3NTK A;  3OSS C;  2JNG A;  2X51 A;  3QXE B;  4FT4 A;  2MWP A;  2EVR A;  2KR3 A;  3MEU A;  2DXU A;  4Z89 A;  3EFS A;  5GAN 5;  1M27 C;  3TCJ A;  4QKU A;  1WHJ A;  1UGQ B;  4IUU A;  2OTJ T;  4FT2 A;  3ZL7 C;  2JTF A;  4F16 A;  4E7K A;  4LD6 A;  5GMK l;  2L0A A;  5DY9 A;  1RI9 A;  2LDM A;  3ASK A;  3JB9 I;  1KFZ A;  3JCM e;  4C0Z A;  1M3C A;  2HNI A;  1OV3 A;  2FZC B;  2HQX A;  1WJQ A;  4XTU A;  1YI2 Q;  4LD9 K;  2YWW A;  5HY6 A;  1YHQ A;  1TG0 A;  2FHD A;  1N27 A;  1RAC B;  5A0D A;  5IAY A;  2BE9 B;  2GTO A;  2CP7 A;  2DEU A;  4FYV B;  2FEI A;  4KRT A;  4R0K A;  1TS9 A;  2X4J A;  2F2V A;  3JCM W;  2CSQ A;  1OQK A;  4JJN K;  1Q81 R;  1QW1 A;  2DTO A;  1K9A A;  2K5F A;  3G6E T;  2O31 A;  3I56 A;  2DZ9 A;  3QDF A;  3VS4 A;  4C92 F;  2GQV A;  1GCQ C;  3GP8 A;  3V8L A;  2FO0 A;  2RQW A;  1OU9 A;  1NLP C;  4J6W A;  1VQ7 T;  2DJQ A;  3X24 B;  2RJE A;  4KBM B;  2VVK A;  1U1T A;  2Y4X A;  1BU1 A;  1SSF A;  1C6V X;  1VQO Q;  1E7O A;  2EYY A;  1PRM C;  4Z02 A;  2I0N A;  4O5V A;  1ZA1 B;  4C8Q E;  3M0T A;  3UT1 A;  2Z0W A;  3RER A;  3VJP A;  1YJW T;  5CKB A;  1JRI A;  1WFW A;  4HT9 A;  2DLP A;  2JS2 A;  3EGD B;  1Y0M A;  5J26 A;  1VQO A;  2IIM A;  2E64 A;  1VQ9 Q;  1VQ8 A;  2AZV A;  3VYG A;  2O9V A;  5GAM g;  3MET A;  1F1B B;  3DB3 A;  1JJ2 P;  1KSW A;  5GAO p;  1UGS B;  1W2B A;  2DXB A;  2A3L A;  3LWH A;  2FPD A;  2J6O A;  1YIT A;  1VQP T;  2ESW A;  2KQW A;  3G71 Q;  1QWE A;  2F69 A;  4B6M A;  5KYU B;  1TUG B;  1VQ9 A;  1Y71 A;  1G2B A;  4JS5 A;  1VYT A;  3OYK A;  3G7Z A;  4K11 A;  3CPF A;  1UJY A;  3TSZ A;  2J6K A;  2NUT A;  3OBW A;  4RCB A;  3J7A F;  3UWN A;  1G5V A;  2D0Q B;  2VGN A;  1M1F A;  3JCM X;  4M7A D;  4E47 A;  2DYB A;  3G71 A;  3JCM J;  3CMA Q;  4OB0 B;  5GAO n;  2EYX A;  2K9G A;  2BZ8 A;  2E6Z A;  5KE2 A;  1AWJ A;  1RI0 A;  3SHW A;  4N0A C;  2MK5 A;  2KEA A;  3CC7 A;  1ABO A;  1G3T A;  1I5O B;  1K8A U;  3CCR T;  2M9U A;  4RKU E;  1OZ2 A;  3CCU T;  1R8O B;  5GAN 2;  1GBQ A;  3VU3 C;  2O2O A;  3EG9 A;  3PIP A;  3CMA A;  1D3B A;  1WX6 A;  5GAO m;  4Y91 A;  3CBP A;  1UTI A;  4PJO B;  3RKW A;  3H6Z A;  4ZGE B;  1YJN T;  4BD3 A;  2L2P A;  2VXF A;  5LJ5 d;  2QEX T;  1UJ0 A;  4P5N A;  1VQK A;  1BIA A;  1RLQ C;  3A8H B;  4RMO A;  5CQX A;  1YJ9 A;  4ATO A;  1W70 A;  2DFU A;  5LJ3 j;  5GAO r;  5HK3 A;  4M75 D;  4A4F A;  3I35 A;  1K9M C;  3RMQ A;  3T9N A;  4DBH A;  2DNU A;  4C92 G;  2DL5 A;  3H0F A;  1VQ6 T;  2F1L A;  3SD4 A;  4C92 C;  1UB4 A;  1QMC A;  1G3W A;  2RK1 A;  3DB4 A;  2EKO A;  3V7S A;  3OYF A;  2QXF A;  4M78 B;  1Q82 C;  1ZUU A;  2VC8 A;  3CME A;  1HXD A;  3CCL T;  5IHI A;  3A5Z B;  1KC8 C;  2CDT A;  3A98 A;  4CC3 A;  3EG2 A;  1PSF A;  5CKE A;  3HRU A;  3CCE T;  3M0S A;  1KD1 U;  2GNC A;  2DJZ A;  4XAX B;  4IUV A;  2DMO A;  2LCC A;  3OMG A;  1ARK A;  1WIE A;  3ZEH A;  4CRI A;  3CCS A;  5GAN j;  4HKE A;  4JJC A;  1JQQ A;  2COW A;  2CUD A;  3VS5 A;  1M9S A;  1PKT A;  1WHK A;  2XU8 A;  1M8M A;  5GAN e;  2CT4 A;  3MKD A;  2VYT A;  3QZ5 B;  5KE3 A;  1I8F A;  1PCX A;  3OW2 A;  2AKK A;  1BCM A;  4PJN A;  1QVG A;  1WPY A;  4MZP A;  2CZ7 B;  2EYW A;  2FVU A;  1YIJ Q;  3GF5 A;  1YHQ T;  1GFD A;  5FRM A;  3CC2 T;  1MV0 B;  1K73 U;  2FB7 A;  2P4R A;  3S3M A;  4AG1 C;  1K76 A;  2MMP A;  3A8G B;  4F7U E;  1S72 T;  3P8D A;  2LNH B;  2OTJ Q;  4M77 B;  2P4T A;  2XMF A;  2YUP A;  2OX7 A;  5LJ3 f;  2JM8 A;  3N5B B;  4OB1 B;  5FRO A;  5CR2 A;  3WVE B;  3OA6 A;  1BI1 A;  4C8Q A;  2CH4 A;  1VOM A;  2VKN A;  4J9D A;  1NJI C;  2VWF A;  3VS3 A;  2VV5 A;  1WXB A;  3OYY A;  1RAA B;  1O75 A;  2GF7 A;  2DKG A;  1N8R U;  1OU8 A;  1NE8 A;  3JCM d;  2OTJ A;  3G1J A;  2X4X A;  1N5Z A;  2V8K A;  1B34 B;  2CRE A;  4MDW A;  2QA4 T;  1JO8 A;  1U06 A;  3CCQ T;  2ABL A;  1N9S A;  2YUN A;  2PVG B;  3MP1 A;  3O5Z A;  4RTX A;  3CCV T;  2KXD A;  1HJD A;  2LC4 A;  4PJO E;  4M7D F;  3HHT B;  2QI2 A;  2K3X A;  3VS1 A;  2P0P A;  4XU1 A;  1TXQ A;  2RQV A;  1PD1 A;  2QAS A;  1RAF B;  1A0N B;  3RBB B;  1T0H A;  1CKA A;  5I11 A;  3M55 A;  4E7H A;  1I5L A;  4C0G A;  4BI3 A;  3EAE A;  1C0M A;  2FPF A;  4FSS A;  2CKK A;  2DYI A;  4E7Z A;  1QKW A;  3HKS A;  3JCM h;  5FU6 C;  1X43 A;  4J8O A;  3G6E A;  2FPE A;  3CEY A;  5AT1 B;  5IXB A;  3CCJ Q;  1HSQ A;  4MMK A;  3VUZ A;  3QKJ A;  3LGF A;  4M78 E;  3JB9 J;  2PVD B;  1YJW Q;  4IUT A;  5FU7 C;  1WHH A;  3X25 B;  3X26 B;  1VQ7 A;  2HSE B;  1WYX A;  3ZBD A;  3IQL A;  3CXC A;  3GIB A;  4N4G A;  3CC4 Q;  2K2M A;  2PNI A;  4AFS C;  3UA6 A;  2E1H A;  3QYH B;  3QDR B;  3HPW A;  1YJW A;  4BE2 A;  1VQP Q;  1JJ2 S;  3EG1 A;  1VYV A;  2K79 A;  1LPL A;  4FYW B;  4MZT A;  1N6A A;  1KD1 R;  5GAN 8;  2ZPH B;  3LH0 A;  2DBK A;  2LT1 A;  1Q7Y C;  2DL7 A;  1KQS A;  2KE9 A;  1MMA A;  4LDY A;  1Q81 U;  1X69 A;  5CVI A;  2K7A A;  1BCO A;  2RQR A;  4M77 E;  2ZZD A;  5HK0 A;  4NOY A;  2V1R A;  3TEE A;  2GQI A;  1VQP A;  4C5E A;  1NLO C;  3QYG B;  4PLI A;  1U3O A;  2EGE A;  1SRL A;  4ANJ A;  3UA7 A;  1V76 A;  3NFC A;  4HVU A;  3J81 E;  5LJ5 e;  1K9M R;  4J83 A;  1YBY A;  1M4Z A;  2DRK A;  3EGD A;  2BUD A;  3PFS A;  2LQK A;  4CC4 B;  2XK0 A;  2YHT A;  4X1V A;  1WLP B;  3CCR Q;  2OTL Q;  2PUO B;  5GAM j;  3CCU Q;  2XIC A;  1MMG A;  4KGV B;  4B9X A;  2E4H A;  4TVR A;  3M59 A;  2DIQ A;  2EQJ A;  1Q82 R;  5HCK A;  2JM9 A;  4NL2 A;  5DLO A;  1YJN Q;  3M53 A;  2FG0 A;  5C0M A;  4XTX A;  1WHL A;  2GBQ A;  4KGZ B;  4WTO B;  1KC8 R;  2KMT A;  1ZBJ A;  1HYO A;  4IUQ A;  3VUB A;  1RL2 A;  2E5Q A;  2QG9 B;  5KYU A;  4JRK A;  1PG5 B;  4LXC A;  2EIF A;  3CCR A;  4OF1 A;  2L3S A;  1VA7 A;  3CCU A;  2BIV A;  4M7D G;  1RAB B;  2M02 A;  1JU5 C;  5I2M A;  1RAD B;  3QJ6 A;  4AFZ C;  1IRX A;  1YJN A;  2V26 A;  2RPN A;  2QEX A;  3M5A A;  2AIR B;  4ZTJ A;  3FIF A;  4J9H A;  2XI9 A;  4M7D D;  3EHQ A;  4GBQ A;  2NUP B;  1IGU A;  2KVQ G;  3M58 A;  2MF2 A;  3NTI A;  3FLG A;  1MMD A;  3RKX A;  4OMP A;  5CQY A;  4BI8 B;  4N4I A;  3CD6 T;  4J6Y A;  1PWT A;  2RI3 A;  1VQ6 A;  4XTW A;  4DEX A;  1NG2 A;  2YRV A;  2JJ9 A;  4PL6 A;  7AT1 B;  4RTW A;  3OYL A;  4M7A F;  2JN0 A;  3MPU B;  1PD0 A;  4KUL A;  1NYF A;  1VIE A;  3X20 B;  3CCL A;  1QQJ A;  4PJO A;  4DOV A;  2LX9 A;  2ZGW A;  4BI4 A;  2A28 A;  2ATC B;  2DZC A;  2CP5 A;  3H0I A;  5GAM f;  3J80 E;  3JCM b;  2VAS A;  3EGU A;  2L8D A;  3CCE A;  1YHQ Q;  2ENM A;  2BZX A;  1TH7 A;  3H41 A;  1LNX A;  4M7A B;  3O8V A;  5GAN d;  1M1G A;  3M4G A;  4CI0 C;  2CP0 A;  4EMH A;  5KYW B;  1XOV A;  1S72 Q;  1ZA2 B;  1RUW A;  3SWN B;  1NZ9 A;  4F17 A;  3M0U A;  1ZSG A;  3HL8 A;  1H3Z A;  3OYH A;  4QQD A;  1M8V A;  2MIO A;  1K1Z A;  2NYS A;  1Q86 C;  9ATC B;  4M78 A;  1QVP A;  3VRZ A;  1M30 A;  4RUG A;  1GFC A;  4OMO A;  3I56 Q;  3FJP A;  2MAM A;  3H8Z A;  1BI2 A;  3CC2 A;  4M75 F;  4OGC A;  3C4S A;  4PFZ A;  1UGR B;  4JJD A;  3OYJ A;  1S72 A;  5CCA A;  5IT9 E;  3R6O A;  3INZ A;  1UHC A;  4C0D C;  4A63 B;  4HXJ A;  4O6J A;  4DBF A;  3A8O B;  3SB2 A;  3L2U A;  5GAN h;  4NL3 A;  1WXT A;  4RTZ A;  4J9B A;  3CCV Q;  4IUR A;  3FB9 A;  1M1K C;  3D7S B;  2RA2 A;  4XTZ A;  1XJW B;  2RD1 A;  3L42 A;  2QA4 A;  3GNG A;  3CCQ A;  1ZLM A;  3I55 T;  4C92 B;  1MGQ A;  2CP6 A;  2DXC A;  4Z88 A;  2NWM A;  1VQ8 Q;  1GRI A;  4M77 A;  2DER A;  1VQ4 T;  3CCV A;  3SEM A;  2QQS A;  1PC0 A;  2DBM A;  4DEY A;  3MEA A;  1QVF A;  4EMK B;  1QP2 A;  4PFO A;  2PQW A;  1YIT Q;  4BDZ A;  2FRW A;  4N4H A;  5EG2 A;  1KHC A;  3M0R A;  5GJV B;  5AYF A;  4JRQ A;  2QYZ A;  1Q7Y R;  3OYD A;  3L2V A;  4C8Q D;  2LMJ A;  1YCS B;  2WSC E;  2YRC A;  1B34 A;  2X3X D;  5LJ5 g;  1OUL A;  3NHN A;  4RCC A;  1UG1 A;  2LTO A;  4E7L A;  2V1Q A;  3JRZ A;  3EFR A;  4EIK A;  1X01 A;  1AWO A;  2B86 A;  2DIG A;  4ESR A;  4F7U F;  4M7A G;  2CSI A;  1I4K 1;  5A0G A;  2C0T A;  2DEQ A;  2RHX A;  4JRP A;  4M7A C;  1BI0 A;  2P84 A;  3CC7 Q;  4XU0 A;  1G8X A;  2I2L A;  3SWN C;  1VQN A;  2KYM A;  3VRY A;  2L3R A;  1YFN A;  1IGQ A;  4RTV A;  2LX7 A;  3HFO A;  3TU4 K;  1JB0 E;  4X9D A;  3CCM T;  4J9C A;  3ZFJ A;  1VQK Q;  5IH2 A;  4FYX B;  1YJ9 Q;  1X27 A;  1OPL A;  2LNV A;  1RAG B;  1NPR A;  2F5K A;  1I07 A;  1Z9Q A;  3F70 A;  2ZCF B;  3MHX A;  4PFP A;  2RJF A;  4ZNX A;  3RDV A;  1C1A A;  2V8I A;  3MCA B;  4OVA A;  3OS1 A;  2AT1 B;  4JS4 A;  2VXE A;  4M75 G;  4KGX B;  4QW2 A;  2LZ6 B;  3LW5 E;  2W0Z A;  2JTE A;  2G6F X;  4M75 C;  1R0C B;  1T3L A;  4J5Y A;  2RH2 A; 
#chains in the Genus database with same CATH homology
 4RTX A;  1SEM A;  1HJD A;  2KXD A;  2YUO A;  2KRN A;  2ECZ A;  2X3W D;  1Z9Z A;  3LH5 A;  3NMZ C;  1UHF A;  2DL8 A;  1MV3 A;  3VS1 A;  1GL5 A;  4LUE A;  2H8H A;  4WCI A;  2RQV A;  1GBR A;  1A0N B;  3RBB B;  1QCF A;  1T0H A;  1NEB A;  1CKA A;  1MUZ A;  5I11 A;  2KXC A;  4J9G A;  2DX1 A;  2J06 A;  1X2K A;  2FPF A;  2D8H A;  2LJ3 A;  4FSS A;  4J9E A;  1SRM A;  1QKW A;  4OMM A;  3M0Q A;  1W6X A;  1ABQ A;  4IIO A;  4QT7 A;  1X43 A;  4AG2 C;  2FPE A;  2L3Q A;  5IXB A;  4Y92 A;  2HDA A;  2EW3 A;  1KJW A;  2DRM A;  1BK2 A;  2QDL A;  1HSQ A;  2LP5 A;  3I5S A;  2EKH A;  2C0I A;  2AZS A;  2KRM A;  1SSH A;  4GLM A;  2D1X A;  4JZ3 A;  3H0H A;  2FRY A;  2GTJ A;  3TVT A;  2MOX A;  1WYX A;  2HSP A;  2KBT A;  1PRL C;  3VS2 A;  1S1N A;  2J05 A;  2K6D A;  3IQL A;  2DL3 A;  1OOT A;  1QLY A;  3REB B;  2LQN A;  1T0J A;  2JXB A;  2K2M A;  2PNI A;  1UUE A;  4AFS C;  1T3S A;  3UA6 A;  2HCK A;  2MCN A;  4LE9 A;  2YT6 A;  4J9I A;  1NM7 A;  1GCQ A;  3PVQ A;  2J7I A;  3EG1 A;  1VYV A;  2EVR A;  2KR3 A;  2K79 A;  5IHK A;  4Z89 A;  1ZX6 A;  2PZ1 A;  1K0X A;  2DIL A;  1M27 C;  5EC7 A;  2RQT A;  1OEB A;  2DBK A;  2DL7 A;  3KFV A;  2KE9 A;  4RTU A;  3ZL7 C;  3CQT A;  4F16 A;  1AZG B;  3NPF A;  4D8K A;  1X69 A;  2K7A A;  1SPK A;  2L0A A;  2RQR A;  1RI9 A;  2YSQ A;  1KFZ A;  1BBZ A;  2V1R A;  1TUD A;  2GQI A;  2EYZ A;  1M3B A;  2KRS A;  1M3C A;  1NLO C;  4E6R A;  1OV3 A;  2E5K A;  1HD3 A;  2KGT A;  1U3O A;  2EGE A;  1UGV A;  1SRL A;  1Y57 A;  1AVZ C;  2ED1 A;  2M0Y A;  2A36 A;  4JJB A;  3UA7 A;  4HVU A;  1X6G A;  1TG0 A;  3C0C A;  2DRK A;  3PVL A;  1AOJ A;  2KT8 A;  3PE0 A;  4CC4 B;  2RF0 A;  1LCK A;  4X1V A;  1WLP B;  2GTO A;  3NGP A;  1PHT A;  4R0K A;  2FEI A;  4KRT A;  2F2V A;  3R6N A;  1U5S A;  1X6B A;  2CSQ A;  2EBP A;  5HCK A;  2JM9 A;  2GGR A;  1K9A A;  2FG0 A;  2GBQ A;  2ROT A;  1AD5 A;  2O31 A;  4HCK A;  3VS4 A;  1ZBJ A;  3QWX X;  1GCQ C;  2FO0 A;  2RQW A;  1ZUY A;  1AEY A;  2L3S A;  1VA7 A;  4IIM A;  1NLP C;  2A37 A;  2DJQ A;  2VVK A;  2K3B A;  1BU1 A;  1JU5 C;  1E7O A;  2EYY A;  2KYB A;  2HBW A;  5FW9 A;  4AFZ C;  1PRM C;  1WDX A;  1K0S A;  2RPN A;  2AKL A;  1E6H A;  2I0N A;  3M0T A;  4J9H A;  1E6G A;  4D8D A;  3EHQ A;  4GBQ A;  5FWB A;  3EG3 A;  2M51 A;  1WFW A;  2DLP A;  2EGC A;  1QKX A;  1NEG A;  2JS2 A;  4LUD A;  3ULR B;  2LJ1 A;  4OMP A;  1PKS A;  1Y0M A;  1CKB A;  1RLP C;  1PWT A;  1NYG A;  2IIM A;  2F2W A;  4DEX A;  1NG2 A;  4RTW A;  1W1F A;  2AZV A;  2O9V A;  1UDL A;  4HVW A;  1KSW A;  1NYF A;  1YNZ A;  3M0P A;  5IXF A;  2A28 A;  3I5R A;  2BZY A;  2FPD A;  2J6O A;  3H0I A;  2AK5 A;  2ESW A;  2LCS A;  2D8J A;  1QWE A;  2BTT A;  3EGU A;  1V1C A;  2ENM A;  2BZX A;  3H41 A;  1VYU A;  1G2B A;  1VYT A;  2KRO A;  3RNJ A;  4K11 A;  1UJY A;  1XOV A;  3TSZ A;  1RUW A;  2J6K A;  2F2X A;  2LJ0 A;  1H3H A;  3JV3 A;  1M3A A;  4F17 A;  3M0U A;  1ZSG A;  3GBQ A;  4JPB W;  2MIO A;  1K1Z A;  2DYB A;  2EYX A;  2K9G A;  2BZ8 A;  3VRZ A;  1B07 A;  1M30 A;  1GFC A;  4OMO A;  4RUG A;  1YP5 A;  1AWJ A;  2CH4 W;  2O9S A;  2ROL A;  4JJD A;  3SHW A;  2HEQ A;  3UAT A;  2KEA A;  1ABO A;  3THK A;  1UHC A;  2L3P A;  4A63 B;  4HXJ A;  4LNP A;  1GBQ A;  1OPK A;  2O2O A;  3FJ5 A;  4OML A;  1UE9 A;  1GCP A;  4JZ4 A;  1WX6 A;  1WXT A;  4RTZ A;  1UTI A;  1AWW A;  1J3T A;  4J9B A;  1BB9 A;  2L2P A;  5L23 A;  2KNB B;  1UJ0 A;  3REA B;  1RLQ C;  5FWC A;  4OMQ A;  1K4U S;  2CT3 A;  2RN8 A;  1W70 A;  2JMA A;  2CUB A;  2OJ2 A;  3I35 A;  2EGA A;  3I9Q A;  1ZLM A;  2DNU A;  1CSK A;  4M4Z A;  1WA7 A;  2DL5 A;  2DE0 X;  3H0F A;  4Z88 A;  2NWM A;  1GRI A;  3SEM A;  4AFQ C;  2DBM A;  2DM1 A;  1FMK A;  4OMN A;  4DEY A;  2EPD A;  1UFF A;  3EHR A;  1YWP A;  2D0N A;  2ED0 A;  3VS6 A;  1ZUU A;  4RTT A;  2FRW A;  5IHI A;  4CC7 A;  1UEC A;  5I22 A;  2CDT A;  2OAW A;  3A98 A;  3M0R A;  5GJV B;  4CC3 A;  2NUZ A;  3EG2 A;  2OI3 A;  1YN8 A;  3VS0 A;  2SRC A;  1SHF A;  3M0S A;  2GNC A;  2YDL A;  2LMJ A;  2DMO A;  1YWO A;  4RTY A;  4LN2 A;  1YCS B;  2X3X D;  1ARK A;  1TUC A;  3QWY A;  3NHN A;  1WIE A;  2A08 A;  1AWX A;  1UG1 A;  2V1Q A;  4JJC A;  1JQQ A;  2JMC A;  1H8K A;  2CUD A;  3VS5 A;  1PKT A;  4EIK A;  1M8M A;  1AWO A;  2CT4 A;  2B86 A;  1KIK A;  2RNA A;  1G83 A;  2AKK A;  2DVJ A;  2O88 A;  4ESR A;  1SHG A;  1AZE A;  2C0O A;  2CSI A;  2EYW A;  1I1J A;  2C0T A;  1WXU A;  1JEG A;  2DF6 A;  1GFD A;  1I0C A;  1MV0 B;  2YUQ A;  4J9F A;  2P4R A;  2EQI A;  4AG1 C;  1K76 A;  2RQU A;  1H92 A;  2DL4 A;  2W10 A;  5IHN A;  2DA9 A;  1QWF A;  2LNH B;  1B3Q A;  2KYM A;  2XMF A;  2YUP A;  3EG0 A;  3VRY A;  2RMO A;  1FYN A;  2JM8 A;  1X2Q A;  1ZUK A;  3TSW A;  4RTV A;  2CH4 A;  2LX7 A;  3UF4 A;  2VKN A;  4J9D A;  4J9C A;  4F14 A;  5IH2 A;  2VWF A;  3VS3 A;  1WXB A;  1X27 A;  1OPL A;  2SEM A;  2PTK A;  2KT1 A;  5GJW B;  2JS0 A;  4AFU C;  1I07 A;  1Z9Q A;  4HVV A;  1JXM A;  4CC2 A;  4ZNX A;  3VS7 A;  1PNJ A;  1N5Z A;  2CRE A;  4Z8A A;  2JW4 A;  1JO8 A;  1U06 A;  1EFN A;  2LZ6 B;  2ABL A;  2W0Z A;  2LQW A;  2JTE A;  2G6F X;  2J6F A;  1WI7 A;  5ECA A;  4ORZ A;  1JXO A;  2YUN A;  3U23 A;  1IO6 A;  1T3L A;  2JT4 A;  3O5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...