3LH0A

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k372me2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A01
1XTDA 1YJ9T 2G3RA 2QEXT 2RJDA 2NLUA 3OY9A 1VQ7T 2LQ8A 5FLXE 1VQ5A 5FRNA 2MI6A 4X34A 1W2BS 3CEYA 2M1HA 3G71T 1VQ6T 3CD6T 3O8VA 3CCST 1YJWT 3HKSA 1NPPA 5CIUA 3J7AF 3OYCA 1YI2T 5KE2A 2JTFA 3G4SA 4IUUA 2R5AA 2JUFA 1K8AC 2JOYA 2GFAA 1KD1U 1VQNA 3I56A 3JAME 4E7LA 1YITT 5J26A 5KE3A 2RHYA 5KCOA 5IT9E 4YTLA 3MEWA 3OYLA 2EFIA 3OMGA 3ER0A 3CMEA 2EQMA 3EAEA 1M1GA 3CPWS 2JVVA 1VQ4A 3LX7A 2DIGA 3OYFA 1VQMA 1KHIA 1S72T 3CCJA 3NTHA 2FHDA 4A4FA 1G5VA 3MP8A 1KD1C 3J80E 3G6ET 1OYXA 3SD4A 1VQ9T 5IAYA 3CCVA 1Q81U 1QVGA 3OB9A 1K9MU 4ZTJA 2JZ2A 3CCUT 2BUDA 2LTOA 4PLLA 3UWNA 1OZ2A 5A2QE 1EIFA 2RHZA 3I55T 2IG0A 4BACA 3E9FA 4RG2A 1N8RU 5D6XA 2OTJT 3ZEHA 5FRMA 4BD3A 1VQ8A 1RI0A 1JJ2S 3L42A 3H8ZA 3LYIA 2XDPA 3KUFA 1XNIA 2XK0A 1X6OA 3CC2T 1YBYA 1KQSS 1YHQT 3FLGA 3OYNA 4L59A 1Q81C 5D6WA 3QBYA 1KC8U 1WGSA 3OYBA 3OYAA 1UEBA 3CMAA 4ZN1A 2E6NA 2QA4T 1WJQA 3CCQT 1M1KU 3F70A 4NS5A 1N8RC 3S3OA 1M90U 3CCMT 3FEOA 1YJ9A 1Q7YC 2QEXA 3PMTA 5C6SA 4C5GA 1NJIU 4N4IA 1VQKT 3DB4A 4IKFA 5FROA 3E9GA 2L3RA 5DLQE 3CXCA 2RJFA 3GOXA 1VQ7A 3FC3A 1Q82C 2RI5A 4HCZA 1VQOT 1KHCA 1YJNT 1KC8C 3G71A 1VQ6A 2CKKA 2KVQG 3CD6A 2EQJA 3CCSA 1YJWA 3LLRA 3META 1YI2A 4BDYA 3OW2A 5D6YA 4A4EA 3L2UA 3S3NA 1M1KC 1Q86U 4OVAA 2OTLT 4IUTA 4QQ6A 4E7HA 3L2VA 1YITA 2DO3A 1M90C 3OQ5A 1YIJT 1NJIC 3DLMA 3OYJA 2R58A 4ZTFA 3OMCA 2R5MA 4C5IA 2LCLA 5HY6A 3S6WA 2O4XB 1S72A 3OYIA 1QVFA 3M9QA 2RHUA 3CCRT 4IURA 3PFSA 1VQPT 2LVMA 1QVFS 3OYGA 1QVGS 2R57A 3G6EA 1VQ9A 2K3YA 5C0MA 4BE1A 3CCUA 4Z02A 3CCET 2EQKA 2E6ZA 2EQUA 3CC7T 3CCLT 4Q5WA 4N4HA 1VQLT 3I55A 1K73U 2OTJA 3OS1A 3DB3A 2X4WA 3LGFA 2K3XA 3ME9A 2X4YA 5J39A 1K9MC 2L8DA 3CC2A 1YHQA 2RHXA 3H6ZA 1OI1A 2EIFA 2O4XA 2RHIA 4A4GA 2X4XA 2M16A 3CC4T 2LRQA 4UC4A 2M0OA 4N4GA 2MWOA 2QA4A 3OYEA 2D9TA 3QJ6A 3CCQA 3ASKA 4E7IA 3A5ZB 1SSFA 3DLLA 4PLIA 1K73C 3S3MA 3PIPA 4EDUA 3MO8A 3QKJA 3J81E 2B8AA 3NTIA 3CCMA 1VQ5T 2RI2A 5DM7R 3PMIA 1RL2A 3MEAA 2DAQA 3LGLA 1VQKA 3CXCS 1NPRA 3MP1A 3KBGA 1W2BA 2F5KA 5KH6A 4CRIA 1VQOA 3MEVA 5LL6S 3G4ST 1N27A 1BKBA 4IUVA 2RI3A 1YJNA 3OW2S 1OZ3A 2GF7A 2LDMA 3LH0A 4IUQA 3OS0A 1H3ZA 1VQNT 3I56T 3OYYA 3P8BB 1WJRA 2E5QA 2OTLA 2YRVA 2WACA 3L2WA 2QQRA 3CMET 1YIJA 3OYHA 1MHNA 3UT1A 1VQ4T 3CPWA 3L2RA 1VQMT 2KDSA 2XHCA 2BKDN 3CCJT 5J3BA 3FDRA 5KCHA 4PL6A 4B9XA 3OYDA 2QQSA 3L2QA 1Q86C 4A4HA 3TREA 2HQEA 2HQXA 4BE0A 3OYKA 3CCVT 4ZN3A 2E70A 3CCRA 3PNWC 1VQPA 3P8HA 2BIVA 3QIIA 3Q1JA 4IUPA 4TVRA 2VYTA 2EKOA 3CCEA 5M9OA 3BDLA 2JNGA 3PIOA 4E7JA 4BE2A 2P0KA 3CC7A 3CCLA 4C5EA 4QQDA 1VQ8T 4C5HA 2X35A 1VQLA 1JJ2A 4QQGA 4QVZA 4FL6A 2LCCA 4BDZA 3MP6A 1Q7YU 3NTKA 4GY5A 4LD6A 2MWPA 4QW2A 1KQSA 2GFUA 3OS2A 2RJCA 3MEUA 4B9WA 3C4SA 3CMAT 1Q82U 4E7KA 2RJEA 4FU6A 1NZ9A 3CC4A 1WJSA 1K8AU 1IZ6A 3P8DA 2L89A 3OYMA 5IN1A 3CPFA 2DIQA 4II1A 2RO0A 3OA6A 2PQWA
chains in the Genus database with same CATH superfamily
2HKNA 1RUWA 2F2XA 2Y4YA 2QEXT 1KFZA 2DRMA 1QP3A 2JM9A 1SRMA 2LQ8A 4KUIA 3QPHA 2DFUA 2B86A 1W2BS 1AWJA 2EVRA 2DVJA 2RPNA 3G71T 2E65A 1YJWT 2QXFA 3J7AF 2ZPHB 1YI2T 5KE2A 2JTFA 3L2ZA 3JCMQ 1O75A 2ZGWA 2KSSA 1I8FA 3I56A 1K9MR 2PTKA 4XK8E 1YITT 1PD1A 2P0QA 3I5SA 1EZZB 1JEGA 5DLOA 4RUGA 5IT9E 4PK4A 2ZPGB 4YTLA 3MEWA 2EFIA 1BI2A 5GAN3 2DL5A 1K0SA 2L2PA 2EQMA 2RM4A 1M1GA 4PJOE 1PKTA 2X3WD 1MMAA 2MOXA 1VQMA 1KHIA 1S72T 2F2VA 2ROLA 1VQ7Q 2FHDA 2GGRA 1V76A 4A4FA 1BK2A 1G5VA 1Y96B 2IPOB 1ZA1B 5GAMh 1VQ9T 1C6VX 3CCVA 1VQ6Q 1KK7A 2CP2A 3L1AA 2F69A 3JSCA 1QVGA 1M8VA 2JZ2A 4PFOA 5IH2A 2EBPA 2QAZA 1CSKA 2EYZA 2LTOA 4AMCA 2ESWA 3JB9F 2JTMA 3FB9A 2CP5A 1UDLA 2DA9A 2LT4A 4X1VA 2KI7A 3M59A 2RHZA 1BU1A 4PJNA 1UGPB 4BACA 4RG2A 5D6XA 3BW1A 2H3JA 4KUDK 1G3YA 1JJ2S 5CCAA 1M2VB 1SRLA 2LMJA 5I11A 1UGRB 3RMQA 1YBYA 1KQSS 2ATCB 2MYSA 4L59A 4C92A 2CZ0B 5D6WA 5GAOq 2AK5A 2DD4A 1NG2A 3OYAA 1NEGA 3CMAA 5D7UA 3RUXA 3MHXA 1W4SA 2A37A 4JLGA 2QDLA 2A36A 3M0RA 1W70A 1N8RC 1MMGA 3JCMX 5LJ3e 4ESRA 2XICA 2CT4A 1NJIU 2CT3A 4VUBA 1MV0B 4RTVA 4AG1C 4F14A 3CXCA 1ABQA 2CZ6B 2RI5A 1CKAA 1VQOT 4C8QA 1GFDA 1M30A 1RI9A 4XTXA 3MJXA 1KHCA 5KYXA 3VS2A 4M7AA 1KC8C 2KVQG 3CD6A 3CCSA 1D1AA 1WQ7A 3NPFA 4BDYA 5D6YA 4Y92A 3CC2Q 3M56A 2CREA 2QQBA 1M1KC 1NE8A 3GBQA 3VS4A 4J5YA 1NYGA 4OVAA 2O9SA 4LD9K 3A8LB 2DO3A 2SRCA 2KGTA 1U1SA 3PVQA 1FYNA 3OYJA 2D1XA 1N9RA 2QEXQ 1JBMA 3EG9A 1QQJA 3IQLA 1I0CA 3OMCA 2C06A 1R0BG 2ED1A 2R5MA 3UDCA 4J9BA 1AWWA 4HVUA 1M27C 4C92G 2KYBA 4DBHA 1VQKQ 4J9DA 4FT4A 1WXUA 2PZ1A 3NGPA 2YLCA 2RHUA 1PCXA 1Y57A 4IURA 3PFSA 1YI2Q 2EKHA 1YP5A 3EGUA 1BBZA 2HL5C 5CK9A 4BE1A 2E10A 3EFRA 1QVFP 3CCET 1UUEA 3G7ZA 3UA6A 2EQKA 3QZ5B 1PHTA 1N9SA 1K8AR 3JB9H 3QG1A 2OTLQ 1YWOA 1NLOC 1VQLT 8ATCB 2CP0A 2DYBA 3I55A 1K73U 3QSUA 1IHVA 1X2QA 1WX6A 2OTJA 5I22A 2O01E 3OS1A 1D1BA 4C8QG 1FMWA 2X4WA 2MF2A 1EX4A 2XIDA 4M7AG 2DXCA 4KGXB 2L8DA 4OMQA 4LDVA 5CKEA 4OF1A 3UATA 4OMPA 5LJ5h 3JB9D 1K0XA 2IIMA 2BZYA 2YHTA 3AT1B 2LRQA 1QW1A 2CSQA 2I0NA 1GL5A 2MWOA 3CCRQ 1M3AA 2FPDA 1TWBA 3QJ6A 1LCKA 4HXJA 2Z0WA 5GAMg 4M75G 5GMKh 2LQNA 4EDUA 3JCMV 2LQWA 2DILA 4L6V5 5HK0A 1VQ5T 2WSCE 1JQQA 3CCLQ 1RL2A 2DAQA 3A1PA 1Y0MA 1X2KA 5IHIA 3I5RA 3NMZC 5KYNA 1AOJA 1OU8A 2M9UA 3REBB 4OGEA 5LL6S 3JB9I 1N27A 3G4ST 2RI3A 1YJNA 2CP6A 2HDAA 1J3TA 2CSIA 4M7DG 2J7IA 2AKKA 3C95A 3OS0A 1H3ZA 2DNUA 1VQNT 2KE9A 3GPLA 2YWWA 2JTEA 4M78G 4OMOA 2NUPB 1WHLA 2YRVA 4M4ZA 4D6WA 3CC4Q 1Q81R 3L2WA 2QQRA 1D3BB 4LDYA 4PNOA 3CMET 1YIJA 1MHNA 2K7AA 4FYXB 2EYWA 2QQ9A 1UGQB 5CAIA 3L2RA 2GQVA 3EGXA 1BI1A 3D7SB 4PL6A 4OB2B 1WHHA 3OYDA 3L2QA 5KYYB 2J05A 1QVPA 2FG0A 3QUIA 2VV5A 4HVVA 2VC8A 1PG5B 1RADB 2DBKA 1A0NB 2KROA 1X69A 3JCMJ 3HRUA 2A0FB 5GANh 2VVKA 1ZLMA 2RQWA 3I56Q 2EKOA 1RAFB 5M9OA 3BDLA 1I5OB 3M0QA 3TQ7P 4QQDA 4C5HA 4CC4B 2VGMA 2X35A 2MK5A 4J9CA 3QDFA 4J9IA 5A0LA 4A63B 1M90R 5CQYA 1M8MA 2X51A 1UHFA 4J9HA 4JS5A 4GY5A 4LD6A 2I2LA 4QW2A 4MZMA 2DBMA 3URGA 1I81A 4C0DB 4AFQC 2VXEA 1D0ZA 2L3SA 2KEAA 5GAOp 1GCQC 1U3OA 5CKDA 1KG1A 4QT7A 1K8AU 4J6YA 3P8DA 1E6HA 1AT1B 2L89A 2LNHB 2DIQA 2FB7A 1T3SA 1Y96A 2PQWA 2EYYA 1XTDA 2G3RA 2W10A 2FO0A 2FVUA 5AYFA 2RJDA 3A98A 1VQ7T 3EGDA 5FLXE 2HAXA 1PSEA 4X34A 1FWZA 1AD5A 4Y28E 3VU3C 1VQ6T 1PNJA 3CBMA 3ZBDA 4HT8A 2K5LA 1XJWB 4IUUA 2JUFA 4AG2C 3BDUA 1NM7A 2GFAA 1WXBA 5I2MA 3JAME 4E7LA 3REAB 5LJ5g 3DKMA 3CMAQ 2PNIA 2C0TA 4LN2A 1V1CA 5KE3A 2O2OA 1WA7A 4ZGEB 1CKBA 1R77A 3EFOB 4IIOA 3M57A 5LJ3h 4JJCA 3ER0A 2CP3A 2MAMA 5EG2A 1C0MA 2JVVA 1VQ4A 3JV3A 2L0AA 1QP2A 4RTXA 1PWTA 3CCJA 2AZVA 2E4HA 4DBFA 2ROTA 1OEBA 3NTHA 2KXCA 2CGHA 3KXTA 1U5SA 1KD1C 3J80E 1OQKA 5KYUB 3SD4A 5IAYA 5HCKA 1Q81U 3OB9A 3CCSQ 1WHMA 3CCUT 3X28B 1VQNQ 1PSFA 1K9AA 3RERA 2KRMA 2VWFA 2BUDA 4Z88A 4J9EA 3UWNA 4DQ2A 1OZ2A 4M75E 5A2QE 5GAN6 1X6GA 4CC3A 1YCSB 4EMHA 3E9FA 1QCFA 2OI3A 3ZEHA 4PJOB 2D0NA 3CBPA 1OX8A 2RK1A 4Z89A 4LDUA 1LVKA 2LX9A 2RQTA 3CC2T 1YHQT 3FLGA 3C12A 1QKWA 4M7DE 4OGCA 3QBYA 2J6KA 4C0DC 2KT8A 3OYBA 1UEBA 4J7FA 2ZPEB 4RKUE 3FJ5A 3JCMP 2YUOA 3PGGA 1JO8A 4M78E 1IRXA 3SWNB 1HYOA 2VUBA 3F70A 3QYGB 2JN0A 4NS5A 1UHCA 2NYSA 1BYMA 1M90U 1H92A 4ZGDB 5HK3A 5GANg 1YJ9A 2DKGA 4IIMA 2WSFE 5C6SA 2HNIA 4N4IA 1VQKT 2V1RA 4PJOD 5FROA 5DLQE 2RJFA 3GOXA 3FC3A 1Q82C 4HCZA 4CC2A 3QDRB 5FW9A 3FRNA 5L8RE 1UGVA 1TUGB 2GNCA 2RA2A 2CKKA 2QTVA 3M58A 3OW2A 3CBOA 3WVDB 3VS0A 3V7CA 2OTLT 4E7HA 1LJOA 3HL8A 4BY6C 3L2VA 2MIOA 2FL7A 3X26B 1GCQA 1N6AA 3OQ5A 4OMFB 2K3BA 3RKXA 2YRCA 3DLMA 2R58A 2LNVA 1K73R 1P92A 2DD5A 3M54A 4GBQA 4FW2A 2JW4A 3S6WA 2O4XB 1MNDA 3HSBA 3OYIA 3M9QA 4RTUA 5GAOn 3CCRT 1ZBJA 2FZKB 2K2VA 5IHKA 4FSSA 3UA7A 4R0KA 3G6EA 3JB9G 1YJNQ 1HD3A 1IHWA 3PE0A 2RH2A 2K3YA 2YUPA 4WTOB 3A8GB 1NEBA 1TUDA 2PUKB 4J8OA 2DZCA 4FYWB 2CDTA 4J83A 3CCLT 2LZ6B 1M4ZA 4FCYA 5IXFA 2VKNA 4M77B 3RIRA 1PKSA 2HZYA 1YIJQ 1ZSZB 4PJOC 1LNXA 2K3XA 1D3BA 3TEEA 5LJ3g 2DE0X 4HA8A 2K57A 3TVTA 1K4US 2GTOA 4QKUA 2RHXA 4E7ZA 1OI1A 2P84A 2EJ9A 2FEIA 1AVZC 2X4XA 3CC4T 1U06A 3GNFB 2DPPB 2QA4A 3CCUQ 2RK2A 2JMAA 4F7UA 1WZOA 3CCQA 3SWNC 1V29B 3A5ZB 4JJNK 4EPCA 1SSFA 3DLLA 3A8HB 3S3MA 1RAIB 3QKJA 1XOVA 3J81E 2FPFA 4JZ4A 7AT1B 3CCMA 1JXMA 5GAOm 1WYXA 1VYVA 1MGQA 4FW1A 4ELZC 4X9CA 2VGNA 1W2BA 2DX1A 2K5IA 2F5KA 3VUBA 1PM3A 3LH5A 1AWOA 1YHQQ 3H0FA 2QASA 3JCMg 2RNAA 1IREB 2LDMA 3LH0A 3I56T 2KXDA 2F1LA 1OX9A 3WVEB 3P8BB 1WQWA 5L23A 2OAUA 3NHNA 3LWHA 3TSWA 2V26A 5A0DA 2EAYA 4M77E 1AZGB 2HD0A 3UT1A 4QVCA 1D0YA 3V7SA 2XD0A 1SPKA 1ZA2B 2LJ3A 1VQMT 2XHCA 4HCKA 3X20B 2BKDN 5J3BA 4JPBW 1KQ1A 3FDRA 5KCHA 4EIKA 1KJWA 1N8RR 2VXFA 1RAHB 1Q86C 4DBQA 2KRSA 2HQEA 3JCMW 3CPWP 5KYWB 4BE0A 3CCVT 2LCSA 3V7RA 4DA4A 1MV3A 2YT6A 1B34A 3PNWC 1VQPA 4JJBA 3BE3A 2COWA 2VB6A 4F7UF 3OBWA 3X25B 1YN8A 4TVRA 1H3HA 1KC8R 2JXBA 2V1QA 4JDSA 4JRIA 2F2WA 4E7JA 5GAN5 3RESA 3CC7A 3EH1A 4XTUA 1M1KR 1M3CA 2JT4A 2AIRB 1JJ2A 4QQGA 1K1ZA 3JRZA 1SHFA 1BIAA 4ATOA 2LCCA 1ZSZC 3MP6A 5I2SA 1VQ4Q 3NTKA 3QO3A 3EFOA 1HSQA 2MWPA 2DF6A 1KQSA 2GFUA 2JMCA 2J6FA 1YNZA 4XAXB 2RJCA 3MEUA 1IB8A 1ZQ1A 3QZ9B 2DRKA 4C0FA 3CCJQ 3CMAT 1Q82U 2COZA 2HBWA 1T3LA 4FU6A 4F17A 1NZ9A 1W1FA 3BY7A 2L3PA 2L5QA 2CUDA 3ZL7C 1TS9A 6AT1B 4A54A 3C94A 1I5LA 4HCCA 3FJPA 4XTWA 2NLUA 3SHWA 3OY9A 4QVDA 4KULA 4PKCC 5GMKm 4XU3A 4FYVB 2M1HA 2QDYB 3O8VA 3CD6T 2ABLA 3CCST 4P5NA 3HKSA 5CIUA 2LT1A 2F5TX 4PJOA 5CO7A 2HSEB 2AHJB 1TG0A 3EFSA 2CP7A 3VS6A 2O88A 3HP9A 3RKWA 5GAN2 3VS5A 3HFOA 2O9VA 3RR6A 2C0IA 2V8IA 1S1NA 1WPYA 2RHYA 3G1JA 3A8OB 3GIBA 2DL8A 3ZFJA 2RMOA 4FYYB 1GBQA 2KQWA 3OMGA 3C0CA 1G83A 4LXCA 3EAEA 3SWNA 3CPWS 3LWIA 2E12A 2EJGA 2ENMA 4DEYA 1PC0A 1YJ9Q 2DIGA 4C92B 1WHKA 2JJ9A 2YDLA 4XU1A 1SF9A 4LUEA 2XDBA 3RBBB 2NUZA 1NYFA 3MP8A 4R56A 3BFMA 1Q95G 1GCPA 4DOWA 2H8HA 1OYXA 3VYHB 4ZTJA 2YSQA 1HXDA 1M3BA 4X9DA 4KH0B 3V8LA 2DEQA 3EH2A 1EIFA 2MMPA 2DERA 4OMNA 1QVGP 5GAMj 3I55T 2IG0A 1OPLA 1N8RU 1MMNA 2OTJT 5FRMA 4C8QB 4BD3A 1VQ8A 1RI0A 3LW5E 5KYXB 4M7AB 4EMKB 1D09B 1O9SA 4PFPA 3LYIA 1T0HA 2A7YA 1VYTA 1VQMQ 4XTYA 3KUFA 1XNIA 3QWYA 1X6OA 4PJOF 1X43A 2CS7A 4BI4A 3OYNA 1AWXA 3JCMf 1Y07A 3M55A 1X27A 1KC8U 1WGSA 2A28A 4XTZA 3SFMA 3CCVQ 2E6NA 4ZN1A 2DJZA 3M5AA 3GF5A 1YCYA 2LX7A 1WJQA 1IXDA 4LDWA 4M75B 1M1KU 9ATCB 3G6EQ 3EG9B 1R0CB 5GAMd 3M0PA 2PU9B 3S3OA 1E7OA 2GBQA 3TU4K 3FEOA 1Q7YC 4RCBA 2QEXA 5FWCA 1SEMA 4KGZB 3ULRB 4Z8AA 3DB4A 4E2FB 1OV3A 4C92E 1WFWA 3GLXA 1B07A 4MDWA 4ZGJB 2RB6A 4F16A 1KIKA 1LOJA 1G3WA 1YJNT 1UB4A 1M2VA 3HPWA 4M7DB 4PJJA 3G71A 2EQJA 3M0UA 1YJWA 3LLRA 4A4KA 4XU0A 3QJYA 1YI2A 3CXCP 1ZSZA 1WHJA 1WHGA 4A4EA 3L2UA 3S3NA 4M78B 1TU0B 3GP8A 3MKDA 1Q86U 1FMKA 1VYUA 2HSPA 3RKYA 2V8KA 4IUTA 2FYKA 1MUZA 1SKUB 1TXQA 1YITA 4M75D 3SDZA 1ZBXA 1ZHIA 4LNPA 2QA4Q 1JU5C 1YIJT 1NJIC 3CCQQ 4C8QE 1B7TA 1TSFA 3I9QA 4MMLA 4M7AE 4DEXA 1SSHA 1VA7A 3VRYA 3CCMQ 3M0SA 3HFNA 4WF2A 4BI8B 2JM8A 2PUOB 1S72A 2HCKA 2P0PA 1QVFA 3CD6Q 2YLBA 1GFCA 3UPUA 1WI7A 2LVMA 2X3XD 1VIFA 1QVGS 4CC7A 4MMKA 5GAMf 2K2MA 2HKQB 1VQ9A 5FU7B 5LJ5e 2AKLA 1UECA 2EGEA 2DXTA 2XI9A 4FM4B 1M5Q1 2O31A 2BE9B 1RLQC 2D0QB 2DTHA 1Z9QA 3U23A 4JRPA 3E2UA 3H9NA 4Q5WA 4N4HA 1WLPB 4RTTA 2E1HA 1AEYA 3VS1A 4M77F 2DZ9A 4FSXA 1UGSB 4EMKC 5J39A 1K9MC 2ECZA 4PJMA 1VOMA 3TSZA 3H6ZA 2XKOC 4J7IA 2D8JA 2EIFA 5IXBA 1NLPC 4A4GA 2M16A 2CH4W 1VIEA 4UC4A 1IO6A 2M0OA 4N4GA 3X24B 2DTIA 1VQPQ 2D9TA 2WSEE 4M75C 5LJ5j 1KD1R 3OSSC 1GBRA 3JCMb 1BI0A 1K73C 3PIPA 4RG8A 2EGAA 1BCMA 3MO8A 2B8AA 3NTIA 4NOYA 4B6MA 3I55Q 2RI2A 5AT1B 3CC7Q 2OTJQ 3PMIA 3MEAA 2KYMA 3CXCS 1NPRA 4BB7A 2FPEA 4JS4A 3KBGA 1PRMC 5GMKj 3QXEB 1MMDA 3PT9A 2K6DA 1VQOA 3MEVA 1NBEB 4XU2A 1VUBA 1G8XA 2EW3A 4M7DC 1OZ3A 4IUQA 2OX7A 2KRNA 4HCBA 4ME7A 1QWFA 1WIEA 2CH4A 2CYZB 3OYYA 5CKHA 4M78C 2CUBA 4JRQA 1WJRA 2PVDB 1F1BB 2PVGB 2OJ2A 4PFZA 5LJ5d 5GANe 2BTTA 2IVWA 2E3HA 2FRWA 2ZPIB 2NUTB 1VQ4T 5CVIA 1W6XA 1N5ZA 1RAAB 1U8RA 4OP0A 2KDSA 1RLPC 2BZXA 3CCJT 4B9XA 4MDXA 4CI0C 2QQSA 4AFSC 3TREA 2GCXA 5GMKi 2DL7A 3OYKA 3TCJA 4ZN3A 4RTZA 2E3IA 2ZCFB 2E70A 2FZGB 4ELYC 1Q82R 3N5BB 4E7SA 1WDXA 2RQVA 4O6JA 3QIIA 3Q1JA 4OMMA 1K76A 5FU7C 4IUPA 1GRIA 2VYTA 3FIFA 4OMLA 3CCEA 1UJ0A 4BI3A 2BZ8A 2QGFB 4BE2A 3EGDB 1RAEB 3T9NA 4C5EA 2NUPA 1QKXA 1GXIE 3JB9J 4RMOA 1VQLA 5GANj 2P4TA 2QQAA 5EC7A 4QVZA 2P4RA 4BDZA 2FRYA 3OS5A 1Q7YU 2QTXA 3RMSA 1HJDA 1XQHA 4D8DA 5GAN7 1YWPA 1QMCA 3C4SA 4LE9A 5LJ5f 4E7KA 1FMVA 5KYYA 3MPUB 4FIBA 1M2OA 3AHUA 2NWMA 2K4YA 2K5FA 1QCNA 4R55A 1QWEA 3VUZA 3OA6A 2ZPFB 4M77D 3EHRA 4L5GA 1YJ9T 1D1CA 2E41A 2BE7D 3VS3A 2DEUA 2RQRA 2DL4A 5GANd 1Z9ZA 4LUDA 2DXBA 2YXYA 1ZUYA 1VQ5A 5FRNA 2GTJA 2MI6A 1ZUKA 4WCIA 2SEMA 1VQ8Q 3CEYA 1X01A 4LDXA 2Y4XA 4KBMB 3JCMc 1NPPA 3OYCA 4ORZA 3EG0A 2J06A 3G4SA 3V8JA 2DTOA 3PVLA 2R5AA 1K8AC 4EMKA 2JOYA 4F04B 1M1FA 1KD1U 3M53A 1VQNA 1ZUUA 4XTVA 1G2BA 1JXOA 4EMGA 4DOVA 1ABOA 5J26A 3H0IA 4KGVB 2K79A 5KCOA 3HRSA 2RF0A 4N0AC 3OYLA 4C0GA 4BUGA 3CMEA 4JZ3A 1LPLA 4M75A 2CZ1B 3LX7A 4DBRA 2M51A 3OYFA 4RTYA 1UE9A 3EG1A 4FT2A 3JCMe 1SHGA 5LJ3j 2DK3A 2XDDA 3V8KA 1ZX6A 2L3QA 4C92F 3PTAA 4HVWA 3G6ET 4F7UG 3G71Q 1K9MU 1YJWQ 2Y90A 1SG5A 3H0HA 4M7DA 4PLLA 5CQXA 2QYZA 5GANf 3M4GA 4M77C 3H41A 3QWXX 3R6NA 4M78A 1YITQ 1JRIA 2H3EB 1TUCA 3UF4A 8AT1B 1QLYA 3EG2A 4RTWA 3L42A 5ECAA 3H8ZA 1AHJB 3VJPA 2XDPA 2C0OA 2DXUA 2XK0A 3SB2A 2EWNA 4AFZC 4C8QF 5CKBA 4J9FA 5LJ3d 1IGQA 3QHSA 4M7AF 1M9SA 3THKA 1Q81C 4ANJA 1S72Q 1I07A 1Y71A 1X6BA 4OB0B 1WNLA 2QA4T 2ZPBB 2EJFA 2PVOB 1EFNA 1Q86R 3CCQT 2OAWA 5KYUA 1G3TA 2X9HA 1OU9A 2W0ZA 1VQ9Q 5GAOr 1TTHB 4KT0E 2YRDA 3INZA 5GAOl 3CCMT 4M75F 1PRLC 2V8JA 3PMTA 1BIBA 4C5GA 4IKFA 1ARKA 1I4K1 2EYQA 3E9GA 2L3RA 4D8KA 1VQ7A 3E19A 3SEMA 3RDVA 1VQ6A 5GJWB 3META 3NFCA 1IGUA 3I35A 3JCMd 2COYA 5GAMe 4RCCA 3VYGA 1BI3A 2DJQA 4M7DF 4HKEA 5GAN8 2QG9B 4QQ6A 2HEQA 1E6GA 4Y91A 5FWBA 1M90C 2M02A 3OW2P 4M78F 2EGCA 4KH1B 4PJLA 4HT9A 2A3LA 3O5ZA 2DYIA 4ZTFA 5LJ3f 4ZNXA 2VASA 2JS0A 1KSWA 2J6OA 5GAN4 4C5IA 1RACB 2LCLA 5HY6A 2XG8D 3EHQA 3OSVA 2QK0A 4NL3A 2HBPA 1MNEA 1T0JA 1ACMB 1VQPT 3M4YA 1VQOQ 2AZSA 3HTRA 2XU8A 1QVFS 3OYGA 4F7UB 2R57A 2LJ1A 5CR2A 5GJVB 4JLIA 4J9GA 5C0MA 3CCUA 4Z02A 2E6ZA 4E6RA 2EQUA 2DM1A 3CC7T 1D0XA 3KFVA 2E5KA 4AT1B 1C1AA 3QYHB 2LJ0A 3GNGA 4C92D 2E64A 4PJOG 3DB3A 4N0AA 3LGFA 2KR3A 3ME9A 2G6FX 1UG1A 2X4YA 2KY9A 2D6FA 1G3SA 2LP5A 1KQ2A 2HMAA 4C0ZA 1OULA 3CC2A 2NUTA 4J6WA 1YHQA 2DMOA 2ZZDA 2O4XA 1TOVA 2RHIA 2KAFA 3R6OA 1WXTA 5I21A 5FU6B 3OYEA 2A08A 1BB9A 4XQ3A 3ASKA 4E7IA 4PLIA 2MPXC 4MZTA 4O5VA 2X4JA 2ED0A 3CQTA 3CCEQ 4C8QD 3E1SA 5GMKl 3VRZA 5DM7R 1UJYA 4M7AD 4J6XA 5HKCA 3LGLA 1VQKA 4E47A 4M77A 2QI2A 3MP1A 1RAGB 1VQLQ 1YFNA 2YUQA 1HK9A 1B34B 4CRIA 5KH6A 1U1TA 4OB1B 2RN8A 2DLPA 2GQIA 3OBYA 1BKBA 1H641 4IUVA 2EQIA 2EYXA 3OW2S 3M0TA 1R8OB 2GF7A 4F7UE 1B3QA 1W2BP 2ZAEA 2HL3A 4NL2A 2E5QA 3RNJA 4V2SA 5A0GA 2OTLA 4BY6B 2WACA 2RD1A 1ZSGA 4JUVA 2HQHA 1DJ7B 3OYHA 1QCOA 2KK4A 3A8MB 4KRTA 2D8HA 3CPWA 1H8KA 4C92C 4K11A 2JS2A 3HHTB 5CKFA 2XMFA 2EPDA 1VQ5Q 4M7DD 3WXMB 4A4HA 1Q7YR 1OOTA 2CZ7B 2FZCB 2LC4A 1TH7A 1OPKA 2HQXA 2KT1A 4JRKA 1FXXA 4M78D 3CCRA 3P8HA 1FX7A 1RABB 2BIVA 3VKIA 3G4SQ 1I1JA 5IHNA 3VV0A 1PD0A 2YUNA 2JNGA 4GLKA 3PIOA 1X75C 1AZEA 4AFUC 2P0KA 5GMKe 2KNBB 4JJDA 3CCLA 2KMTA 2M0YA 2DETA 1BCOA 2K9GA 4C8QC 1VQ8T 5DY9A 4OB3B 4M77G 2DVEA 2MCNA 4M7AC 1Y7XA 4FL6A 2DL3A 3CMEQ 1JB0E 3MCAB 3HRTA 3JCMh 1NJIR 3VS7A 2KBTA 4A53A 3OS2A 4B9WA 1JJ2P 4MZPA 3EG3A 2AT1B 2RQUA 2RJEA 1UFFA 2QGGA 3CC4A 1WJSA 1IZ6A 5KYWA 1KQSP 4GLMA 3OYMA 5IN1A 1UTIA 3EGXB 3CPFA 4II1A 2RO0A 5FU6C 2LQKA
chains in the Genus database with same CATH topology
1XTDA 4M77D 4A54A 3C94A 4L5GA 1YJ9T 1I5LA 2G3RA 2Y4YA 4HCCA 2QEXT 2FVUA 3FJPA 2E41A 4XTWA 2RJDA 5AYFA 2NLUA 5GANd 3OY9A 4QVDA 4KULA 3J7AF 2DXBA 1QP3A 1VQ7T 2LQ8A 4KUIA 5FLXE 3QPHA 1VQ5A 2HAXA 5FRNA 2MI6A 4PKCC 5GMKm 1PSEA 4X34A 4XU3A 1W2BS 1FWZA 3CEYA 1X01A 4Y28E 3VU3C 4LDXA 2Y4XA 2M1HA 2QDYB 3G71T 4KBMB 1VQ6T 3O8VA 3CD6T 2E65A 3CCST 4P5NA 3HKSA 1NPPA 2QXFA 3CBMA 5CIUA 2ZPHB 3JCMc 3OYCA 2LT1A 1YI2T 3ZBDA 5KE2A 2F5TX 4PJOA 5CO7A 2JTFA 3L2ZA 2AHJB 1O75A 2K5LA 3JCMQ 4HT8A 2ZGWA 3EFSA 4IUUA 3G4SA 3V8JA 2DTOA 2KSSA 2R5AA 2JUFA 1K8AC 4EMKA 2JOYA 3BDUA 1M1FA 2GFAA 1KD1U 3M53A 3HP9A 3RKWA 1I8FA 5GAN2 5I2MA 3HFOA 3I56A 1VQNA 4XTVA 3JAME 4E7LA 4EMGA 4XK8E 4DOVA 5LJ5g 1YITT 3DKMA 2V8IA 2P0QA 5J26A 5KE3A 1WPYA 2RHYA 5DLOA 3A8OB 3GIBA 5KCOA 3ZFJA 3HRSA 4ZGEB 4N0AC 5IT9E 2ZPGB 4YTLA 3MEWA 3OYLA 2EFIA 2KQWA 1BI2A 3M57A 3OMGA 5LJ3h 4C0GA 5GAN3 4BUGA 3ER0A 3CMEA 2EQMA 2MAMA 2RM4A 3EAEA 1M1GA 3SWNA 4M75A 5EG2A 2E12A 2EJGA 2CZ1B 3LWIA 2JVVA 3LX7A 3CPWS 1VQ4A 4PJOE 2DIGA 1QP2A 3OYFA 4C92B 1VQMA 1KHIA 4XU1A 1S72T 3CCJA 4FT2A 2XDBA 3JCMe 3NTHA 2FHDA 2CGHA 3KXTA 5LJ3j 4A4FA 2DK3A 2XDDA 1G5VA 1Y96B 3MP8A 3V8KA 3BFMA 4C92F 4R56A 3PTAA 1KD1C 4DOWA 3J80E 5GAMh 1OYXA 3G6ET 3SD4A 4F7UG 1VQ9T 5IAYA 3CCVA 1Q81U 1QVGA 3L1AA 3OB9A 2F69A 3JSCA 3VYHB 4ZTJA 1K9MU 1M8VA 1HXDA 2JZ2A 3CCUT 2Y90A 3X28B 1PSFA 3RERA 4X9DA 3V8LA 2BUDA 2LTOA 3JB9F 4M7DA 4PLLA 2JTMA 5CQXA 2DEQA 3UWNA 4DQ2A 1OZ2A 5GANf 3FB9A 2LT4A 4M75E 5A2QE 3M4GA 3M59A 1EIFA 2MMPA 5GAN6 2RHZA 4M77C 5GAMj 3I55T 4EMHA 1UGPB 2IG0A 1JRIA 4M78A 4BACA 3E9FA 4RG2A 5D6XA 3BW1A 1N8RU 2OTJT 4PJOB 2H3JA 3ZEHA 4C8QB 4BD3A 5FRMA 3CBPA 1VQ8A 4KUDK 1G3YA 1RI0A 1JJ2S 3LW5E 2RK1A 4M7AB 5CCAA 4EMKB 4LDUA 3L42A 1O9SA 3H8ZA 3LYIA 2LX9A 2A7YA 1AHJB 3VJPA 2XDPA 3KUFA 1UGRB 1XNIA 4XTYA 2DXUA 2XK0A 1X6OA 3SB2A 2EWNA 4PJOF 4C8QF 3RMQA 1YBYA 2CS7A 5CKBA 1YHQT 4BI4A 1KQSS 3CC2T 3FLGA 5LJ3d 3OYNA 3QHSA 3JCMf 4L59A 4M7AF 1M9SA 4C92A 1Y07A 2CZ0B 1Q81C 3C12A 4M7DE 5D6WA 3M55A 4OGCA 5GAOq 3QBYA 1KC8U 1WGSA 4C0DC 2DD4A 3OYBA 3OYAA 1UEBA 1Y71A 2ZPEB 4J7FA 4RKUE 4XTZA 4OB0B 2E6NA 3SFMA 1WNLA 3RUXA 4ZN1A 3CMAA 2DJZA 2QA4T 3M5AA 3MHXA 2ZPBB 3GF5A 3PGGA 1YCYA 4M78E 1WJQA 2EJFA 2PVOB 3SWNB 1W4SA 4LDWA 4M75B 3CCQT 1M1KU 2VUBA 3F70A 1G3TA 4JLGA 3QYGB 5GAOr 2JN0A 4NS5A 4KT0E 3INZA 1N8RC 5GAMd 2PU9B 3S3OA 1BYMA 5GAOl 1M90U 4ZGDB 3JCMX 3FEOA 4M75F 5HK3A 5GANg 3CCMT 3TU4K 1YJ9A 2DKGA 4RCBA 1Q7YC 2V8JA 3PMTA 2QEXA 1BIBA 5LJ3e 2WSFE 2XICA 5C6SA 4C5GA 2HNIA 4N4IA 1NJIU 1VQKT 3DB4A 4IKFA 4VUBA 1I4K1 4C92E 4PJOD 2EYQA 5FROA 3E9GA 2L3RA 5DLQE 3CXCA 2RJFA 3GOXA 1VQ7A 3E19A 3GLXA 3FC3A 2CZ6B 2RI5A 1Q82C 4HCZA 3QDRB 4MDWA 4ZGJB 4C8QA 1VQOT 4XTXA 2RB6A 3FRNA 5L8RE 1KHCA 1LOJA 1G3WA 1YJNT 1UB4A 3HPWA 4M7AA 1KC8C 2RA2A 4M7DB 3G71A 2EQJA 2CKKA 2KVQG 1VQ6A 3CD6A 3CCSA 1YJWA 1WQ7A 3LLRA 4A4KA 4XU0A 3META 3NFCA 3QJYA 3M58A 4BDYA 1YI2A 3OW2A 5D6YA 4A4EA 3JCMd 3L2UA 3S3NA 5GAMe 4RCCA 3CBOA 3M56A 4M78B 2QQBA 1BI3A 1NE8A 3VYGA 3WVDB 3GP8A 1Q86U 1M1KC 4M7DF 3V7CA 4J5YA 4OVAA 4HKEA 5GAN8 3RKYA 2OTLT 2V8KA 4IUTA 4QQ6A 4E7HA 1LJOA 3HL8A 4BY6C 3L2VA 2FYKA 2FL7A 4LD9K 4Y91A 1YITA 3A8LB 2DO3A 3X26B 1M90C 4M75D 3SDZA 1ZBXA 1ZHIA 4M78F 1N6AA 3OQ5A 4OMFB 1YIJT 4HT9A 3RKXA 1U1SA 1NJIC 2A3LA 4C8QE 3DLMA 3OYJA 1N9RA 1JBMA 2R58A 4ZTFA 2LNVA 4MMLA 5LJ3f 4M7AE 1P92A 2C06A 3OMCA 5GAN4 2R5MA 3UDCA 4C5IA 2DD5A 3M54A 2LCLA 3HFNA 2XG8D 3OSVA 5HY6A 3S6WA 2O4XB 4WF2A 4BI8B 4C92G 2PUOB 3HSBA 4NL3A 4FT4A 1S72A 2P0PA 3OYIA 1QVFA 2YLCA 2YLBA 2HBPA 3M9QA 3UPUA 2RHUA 5GAOn 3CCRT 4IURA 3PFSA 1VQPT 2K2VA 2LVMA 3M4YA 1YJWT 1VIFA 2XU8A 1QVFS 3OYGA 1QVGS 4F7UB 4MMKA 2R57A 3G6EA 5GAMf 3JB9G 1VQ9A 5FU7B 5LJ5e 5CR2A 2RH2A 2K3YA 2DXTA 2XI9A 4FM4B 4JLIA 5C0MA 3A8GB 5CK9A 2E10A 3CCUA 3EFRA 4Z02A 1M5Q1 4BE1A 2PUKB 3CCET 3G7ZA 2EQKA 3QZ5B 2E6ZA 4J8OA 2DZCA 2D0QB 3JCMP 2EQUA 1N9SA 3CC7T 2DTHA 4J83A 3CCLT 4JRPA 3JB9H 1M4ZA 3QG1A 4M77B 4Q5WA 4N4HA 3RIRA 3QYHB 1VQLT 3I55A 1K73U 3QSUA 3GNGA 2OTJA 2E1HA 2O01E 4C92D 3OS1A 4PJOC 2E64A 1LNXA 3DB3A 4PJOG 4C8QG 2X4WA 2MF2A 4N0AA 3LGFA 4M77F 2DZ9A 2K3XA 4FSXA 3ME9A 1D3BA 2XIDA 1UGSB 4M7AG 3TEEA 4EMKC 2DXCA 2KY9A 2X4YA 5J39A 1G3SA 5LJ3g 1K9MC 2D6FA 2L8DA 1KQ2A 4LDVA 4HA8A 5CKEA 4OF1A 2K57A 4C0ZA 3CC2A 5LJ5h 2RHXA 4J6WA 3H6ZA 3JB9D 1OI1A 1YHQA 2XKOC 4J7IA 2ZZDA 2EIFA 2EJ9A 2O4XA 2RHIA 4A4GA 2KAFA 2YHTA 2X4XA 2M16A 3CC4T 2LRQA 1QW1A 3R6OA 1VIEA 4UC4A 2M0OA 4N4GA 3X24B 3GNFB 5I21A 2MWOA 2DPPB 2QA4A 2DTIA 5FU6B 2RK2A 3OYEA 2D9TA 3QJ6A 2WSEE 4XQ3A 4F7UA 3ASKA 5GAMg 3SWNC 3CCQA 4E7IA 4M75C 5LJ5j 4M75G 1V29B 3A5ZB 3OSSC 4JJNK 5GMKh 4EPCA 1SSFA 3JCMb 4PLIA 1BI0A 3DLLA 1K73C 3A8HB 3PIPA 3S3MA 4RG8A 4EDUA 4MZTA 4O5VA 3MO8A 2X4JA 3QKJA 3JCMV 1XOVA 4C8QD 3E1SA 3J81E 2B8AA 3NTIA 4L6V5 4NOYA 5HK0A 5GMKl 3CCMA 2RI2A 1VQ5T 5DM7R 2WSCE 4J6XA 5GAOm 4M7AD 3PMIA 1RL2A 3MEAA 1MGQA 2DAQA 3LGLA 5HKCA 1VQKA 4ELZC 4E47A 4M77A 1NPRA 3CXCS 4BB7A 4X9CA 4JS4A 2QI2A 2VGNA 3MP1A 3KBGA 1W2BA 5GMKj 2K5IA 3QXEB 1HK9A 2F5KA 3VUBA 3PT9A 1B34B 4CRIA 3MEVA 5KH6A 1VQOA 1U1TA 2M9UA 4OB1B 4OGEA 4XU2A 1VUBA 5LL6S 3JB9I 1N27A 1BKBA 1H641 3OBYA 2RI3A 4IUVA 3JCMg 3G4ST 1YJNA 3OW2S 1IREB 4M7DC 1OZ3A 4M7DG 1R8OB 2GF7A 4F7UE 2LDMA 3LH0A 4IUQA 3C95A 3OS0A 1H3ZA 4HCBA 3I56T 1VQNT 4ME7A 3GPLA 2CYZB 3OYYA 3WVEB 5CKHA 3P8BB 4M78C 4M78G 4JRQA 1WQWA 4NL2A 1WJRA 2E5QA 2OAUA 2PVDB 4V2SA 5A0GA 2PVGB 2OTLA 4BY6B 3LWHA 4D6WA 2YRVA 5LJ5d 5A0DA 2EAYA 2WACA 2QQRA 3L2WA 1D3BB 2RD1A 4LDYA 4M77E 5GANe 4PNOA 4JUVA 2HD0A 2IVWA 1DJ7B 3CMET 1YIJA 3OYHA 1MHNA 3UT1A 2KK4A 2ZPIB 3A8MB 4QVCA 1VQ4T 5CVIA 3V7SA 2QQ9A 1UGQB 5CAIA 2XD0A 3CPWA 3L2RA 1U8RA 2GQVA 4C92C 4OP0A 1VQMT 2KDSA 2XHCA 3X20B 1BI1A 2BKDN 3HHTB 3CCJT 5J3BA 1KQ1A 3FDRA 5KCHA 5CKFA 2VXFA 4PL6A 4OB2B 4B9XA 3OYDA 4MDXA 4CI0C 4M7DD 2QQSA 3WXMB 3L2QA 1Q86C 4A4HA 1QVPA 2CZ7B 2LC4A 3TREA 1TH7A 2HQEA 3QUIA 3JCMW 2VV5A 2VC8A 2HQXA 4BE0A 2GCXA 5GMKi 3OYKA 3CCVT 4JRKA 1FXXA 3TCJA 4ZN3A 4M78D 3V7RA 2ZCFB 4DA4A 2E70A 3CCRA 1B34A 3PNWC 1VQPA 3P8HA 4ELYC 1FX7A 2BIVA 3N5BB 3JCMJ 3VKIA 3HRUA 3QIIA 4O6JA 4F7UF 3Q1JA 5GANh 3OBWA 3X25B 5FU7C 4IUPA 4TVRA 2VYTA 3FIFA 4JDSA 3VV0A 2EKOA 3CCEA 4JRIA 4BI3A 5M9OA 3BDLA 2JNGA 4GLKA 3PIOA 1X75C 4E7JA 4BE2A 5GAN5 2P0KA 5GMKe 3RESA 3CC7A 3T9NA 3CCLA 4XTUA 2KMTA 4C5EA 4QQDA 4C5HA 1VQ8T 4C8QC 1GXIE 2VGMA 5DY9A 2X35A 4OB3B 3JB9J 4M77G 4RMOA 1VQLA 2DVEA 5GANj 2P4TA 4M7AC 1Y7XA 2QQAA 1JJ2A 4QQGA 4QVZA 5A0LA 3JRZA 4FL6A 5CQYA 1JB0E 1BIAA 3MCAB 4ATOA 2LCCA 4BDZA 3MP6A 3OS5A 5I2SA 3HRTA 1Q7YU 4JS5A 2QTXA 3RMSA 3JCMh 3NTKA 3QO3A 4GY5A 4LD6A 2MWPA 2I2LA 4QW2A 4MZMA 1KQSA 2GFUA 1XQHA 3URGA 1I81A 4C0DB 4XAXB 2RJCA 4A53A 3MEUA 4B9WA 5GAN7 3OS2A 1ZQ1A 3QZ9B 4C0FA 2VXEA 3C4SA 4MZPA 3CMAT 1Q82U 5LJ5f 4E7KA 5GAOp 2RJEA 4FU6A 4FIBA 5CKDA 1KG1A 3AHUA 1NZ9A 3CC4A 1WJSA 2K4YA 2K5FA 1K8AU 1IZ6A 4J6YA 3P8DA 4R55A 2L89A 3OYMA 5IN1A 3BY7A 2DIQA 2FB7A 3CPFA 4II1A 2RO0A 1Y96A 3VUZA 5FU6C 2L5QA 2LQKA 2PQWA 2ZPFB 3OA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTD A;  1YJ9 T;  2G3R A;  2QEX T;  2RJD A;  2NLU A;  3OY9 A;  1VQ7 T;  2LQ8 A;  5FLX E;  1VQ5 A;  5FRN A;  2MI6 A;  4X34 A;  1W2B S;  3CEY A;  2M1H A;  3G71 T;  1VQ6 T;  3CD6 T;  3O8V A;  3CCS T;  1YJW T;  3HKS A;  1NPP A;  5CIU A;  3J7A F;  3OYC A;  1YI2 T;  5KE2 A;  2JTF A;  3G4S A;  4IUU A;  2R5A A;  2JUF A;  1K8A C;  2JOY A;  2GFA A;  1KD1 U;  1VQN A;  3I56 A;  3JAM E;  4E7L A;  1YIT T;  5J26 A;  5KE3 A;  2RHY A;  5KCO A;  5IT9 E;  4YTL A;  3MEW A;  3OYL A;  2EFI A;  3OMG A;  3ER0 A;  3CME A;  2EQM A;  3EAE A;  1M1G A;  3CPW S;  2JVV A;  1VQ4 A;  3LX7 A;  2DIG A;  3OYF A;  1VQM A;  1KHI A;  1S72 T;  3CCJ A;  3NTH A;  2FHD A;  4A4F A;  1G5V A;  3MP8 A;  1KD1 C;  3J80 E;  3G6E T;  1OYX A;  3SD4 A;  1VQ9 T;  5IAY A;  3CCV A;  1Q81 U;  1QVG A;  3OB9 A;  1K9M U;  4ZTJ A;  2JZ2 A;  3CCU T;  2BUD A;  2LTO A;  4PLL A;  3UWN A;  1OZ2 A;  5A2Q E;  1EIF A;  2RHZ A;  3I55 T;  2IG0 A;  4BAC A;  3E9F A;  4RG2 A;  1N8R U;  5D6X A;  2OTJ T;  3ZEH A;  5FRM A;  4BD3 A;  1VQ8 A;  1RI0 A;  1JJ2 S;  3L42 A;  3H8Z A;  3LYI A;  2XDP A;  3KUF A;  1XNI A;  2XK0 A;  1X6O A;  3CC2 T;  1YBY A;  1KQS S;  1YHQ T;  3FLG A;  3OYN A;  4L59 A;  1Q81 C;  5D6W A;  3QBY A;  1KC8 U;  1WGS A;  3OYB A;  3OYA A;  1UEB A;  3CMA A;  4ZN1 A;  2E6N A;  2QA4 T;  1WJQ A;  3CCQ T;  1M1K U;  3F70 A;  4NS5 A;  1N8R C;  3S3O A;  1M90 U;  3CCM T;  3FEO A;  1YJ9 A;  1Q7Y C;  2QEX A;  3PMT A;  5C6S A;  4C5G A;  1NJI U;  4N4I A;  1VQK T;  3DB4 A;  4IKF A;  5FRO A;  3E9G A;  2L3R A;  5DLQ E;  3CXC A;  2RJF A;  3GOX A;  1VQ7 A;  3FC3 A;  1Q82 C;  2RI5 A;  4HCZ A;  1VQO T;  1KHC A;  1YJN T;  1KC8 C;  3G71 A;  1VQ6 A;  2CKK A;  2KVQ G;  3CD6 A;  2EQJ A;  3CCS A;  1YJW A;  3LLR A;  3MET A;  1YI2 A;  4BDY A;  3OW2 A;  5D6Y A;  4A4E A;  3L2U A;  3S3N A;  1M1K C;  1Q86 U;  4OVA A;  2OTL T;  4IUT A;  4QQ6 A;  4E7H A;  3L2V A;  1YIT A;  2DO3 A;  1M90 C;  3OQ5 A;  1YIJ T;  1NJI C;  3DLM A;  3OYJ A;  2R58 A;  4ZTF A;  3OMC A;  2R5M A;  4C5I A;  2LCL A;  5HY6 A;  3S6W A;  2O4X B;  1S72 A;  3OYI A;  1QVF A;  3M9Q A;  2RHU A;  3CCR T;  4IUR A;  3PFS A;  1VQP T;  2LVM A;  1QVF S;  3OYG A;  1QVG S;  2R57 A;  3G6E A;  1VQ9 A;  2K3Y A;  5C0M A;  4BE1 A;  3CCU A;  4Z02 A;  3CCE T;  2EQK A;  2E6Z A;  2EQU A;  3CC7 T;  3CCL T;  4Q5W A;  4N4H A;  1VQL T;  3I55 A;  1K73 U;  2OTJ A;  3OS1 A;  3DB3 A;  2X4W A;  3LGF A;  2K3X A;  3ME9 A;  2X4Y A;  5J39 A;  1K9M C;  2L8D A;  3CC2 A;  1YHQ A;  2RHX A;  3H6Z A;  1OI1 A;  2EIF A;  2O4X A;  2RHI A;  4A4G A;  2X4X A;  2M16 A;  3CC4 T;  2LRQ A;  4UC4 A;  2M0O A;  4N4G A;  2MWO A;  2QA4 A;  3OYE A;  2D9T A;  3QJ6 A;  3CCQ A;  3ASK A;  4E7I A;  3A5Z B;  1SSF A;  3DLL A;  4PLI A;  1K73 C;  3S3M A;  3PIP A;  4EDU A;  3MO8 A;  3QKJ A;  3J81 E;  2B8A A;  3NTI A;  3CCM A;  1VQ5 T;  2RI2 A;  5DM7 R;  3PMI A;  1RL2 A;  3MEA A;  2DAQ A;  3LGL A;  1VQK A;  3CXC S;  1NPR A;  3MP1 A;  3KBG A;  1W2B A;  2F5K A;  5KH6 A;  4CRI A;  1VQO A;  3MEV A;  5LL6 S;  3G4S T;  1N27 A;  1BKB A;  4IUV A;  2RI3 A;  1YJN A;  3OW2 S;  1OZ3 A;  2GF7 A;  2LDM A;  3LH0 A;  4IUQ A;  3OS0 A;  1H3Z A;  1VQN T;  3I56 T;  3OYY A;  3P8B B;  1WJR A;  2E5Q A;  2OTL A;  2YRV A;  2WAC A;  3L2W A;  2QQR A;  3CME T;  1YIJ A;  3OYH A;  1MHN A;  3UT1 A;  1VQ4 T;  3CPW A;  3L2R A;  1VQM T;  2KDS A;  2XHC A;  2BKD N;  3CCJ T;  5J3B A;  3FDR A;  5KCH A;  4PL6 A;  4B9X A;  3OYD A;  2QQS A;  3L2Q A;  1Q86 C;  4A4H A;  3TRE A;  2HQE A;  2HQX A;  4BE0 A;  3OYK A;  3CCV T;  4ZN3 A;  2E70 A;  3CCR A;  3PNW C;  1VQP A;  3P8H A;  2BIV A;  3QII A;  3Q1J A;  4IUP A;  4TVR A;  2VYT A;  2EKO A;  3CCE A;  5M9O A;  3BDL A;  2JNG A;  3PIO A;  4E7J A;  4BE2 A;  2P0K A;  3CC7 A;  3CCL A;  4C5E A;  4QQD A;  1VQ8 T;  4C5H A;  2X35 A;  1VQL A;  1JJ2 A;  4QQG A;  4QVZ A;  4FL6 A;  2LCC A;  4BDZ A;  3MP6 A;  1Q7Y U;  3NTK A;  4GY5 A;  4LD6 A;  2MWP A;  4QW2 A;  1KQS A;  2GFU A;  3OS2 A;  2RJC A;  3MEU A;  4B9W A;  3C4S A;  3CMA T;  1Q82 U;  4E7K A;  2RJE A;  4FU6 A;  1NZ9 A;  3CC4 A;  1WJS A;  1K8A U;  1IZ6 A;  3P8D A;  2L89 A;  3OYM A;  5IN1 A;  3CPF A;  2DIQ A;  4II1 A;  2RO0 A;  3OA6 A;  2PQW A; 
#chains in the Genus database with same CATH topology
 2HKN A;  1RUW A;  2F2X A;  2Y4Y A;  2QEX T;  1KFZ A;  2DRM A;  1QP3 A;  2JM9 A;  1SRM A;  2LQ8 A;  4KUI A;  3QPH A;  2DFU A;  2B86 A;  1W2B S;  1AWJ A;  2EVR A;  2DVJ A;  2RPN A;  3G71 T;  2E65 A;  1YJW T;  2QXF A;  3J7A F;  2ZPH B;  1YI2 T;  5KE2 A;  2JTF A;  3L2Z A;  3JCM Q;  1O75 A;  2ZGW A;  2KSS A;  1I8F A;  3I56 A;  1K9M R;  2PTK A;  4XK8 E;  1YIT T;  1PD1 A;  2P0Q A;  3I5S A;  1EZZ B;  1JEG A;  5DLO A;  4RUG A;  5IT9 E;  4PK4 A;  2ZPG B;  4YTL A;  3MEW A;  2EFI A;  1BI2 A;  5GAN 3;  2DL5 A;  1K0S A;  2L2P A;  2EQM A;  2RM4 A;  1M1G A;  4PJO E;  1PKT A;  2X3W D;  1MMA A;  2MOX A;  1VQM A;  1KHI A;  1S72 T;  2F2V A;  2ROL A;  1VQ7 Q;  2FHD A;  2GGR A;  1V76 A;  4A4F A;  1BK2 A;  1G5V A;  1Y96 B;  2IPO B;  1ZA1 B;  5GAM h;  1VQ9 T;  1C6V X;  3CCV A;  1VQ6 Q;  1KK7 A;  2CP2 A;  3L1A A;  2F69 A;  3JSC A;  1QVG A;  1M8V A;  2JZ2 A;  4PFO A;  5IH2 A;  2EBP A;  2QAZ A;  1CSK A;  2EYZ A;  2LTO A;  4AMC A;  2ESW A;  3JB9 F;  2JTM A;  3FB9 A;  2CP5 A;  1UDL A;  2DA9 A;  2LT4 A;  4X1V A;  2KI7 A;  3M59 A;  2RHZ A;  1BU1 A;  4PJN A;  1UGP B;  4BAC A;  4RG2 A;  5D6X A;  3BW1 A;  2H3J A;  4KUD K;  1G3Y A;  1JJ2 S;  5CCA A;  1M2V B;  1SRL A;  2LMJ A;  5I11 A;  1UGR B;  3RMQ A;  1YBY A;  1KQS S;  2ATC B;  2MYS A;  4L59 A;  4C92 A;  2CZ0 B;  5D6W A;  5GAO q;  2AK5 A;  2DD4 A;  1NG2 A;  3OYA A;  1NEG A;  3CMA A;  5D7U A;  3RUX A;  3MHX A;  1W4S A;  2A37 A;  4JLG A;  2QDL A;  2A36 A;  3M0R A;  1W70 A;  1N8R C;  1MMG A;  3JCM X;  5LJ3 e;  4ESR A;  2XIC A;  2CT4 A;  1NJI U;  2CT3 A;  4VUB A;  1MV0 B;  4RTV A;  4AG1 C;  4F14 A;  3CXC A;  1ABQ A;  2CZ6 B;  2RI5 A;  1CKA A;  1VQO T;  4C8Q A;  1GFD A;  1M30 A;  1RI9 A;  4XTX A;  3MJX A;  1KHC A;  5KYX A;  3VS2 A;  4M7A A;  1KC8 C;  2KVQ G;  3CD6 A;  3CCS A;  1D1A A;  1WQ7 A;  3NPF A;  4BDY A;  5D6Y A;  4Y92 A;  3CC2 Q;  3M56 A;  2CRE A;  2QQB A;  1M1K C;  1NE8 A;  3GBQ A;  3VS4 A;  4J5Y A;  1NYG A;  4OVA A;  2O9S A;  4LD9 K;  3A8L B;  2DO3 A;  2SRC A;  2KGT A;  1U1S A;  3PVQ A;  1FYN A;  3OYJ A;  2D1X A;  1N9R A;  2QEX Q;  1JBM A;  3EG9 A;  1QQJ A;  3IQL A;  1I0C A;  3OMC A;  2C06 A;  1R0B G;  2ED1 A;  2R5M A;  3UDC A;  4J9B A;  1AWW A;  4HVU A;  1M27 C;  4C92 G;  2KYB A;  4DBH A;  1VQK Q;  4J9D A;  4FT4 A;  1WXU A;  2PZ1 A;  3NGP A;  2YLC A;  2RHU A;  1PCX A;  1Y57 A;  4IUR A;  3PFS A;  1YI2 Q;  2EKH A;  1YP5 A;  3EGU A;  1BBZ A;  2HL5 C;  5CK9 A;  4BE1 A;  2E10 A;  3EFR A;  1QVF P;  3CCE T;  1UUE A;  3G7Z A;  3UA6 A;  2EQK A;  3QZ5 B;  1PHT A;  1N9S A;  1K8A R;  3JB9 H;  3QG1 A;  2OTL Q;  1YWO A;  1NLO C;  1VQL T;  8ATC B;  2CP0 A;  2DYB A;  3I55 A;  1K73 U;  3QSU A;  1IHV A;  1X2Q A;  1WX6 A;  2OTJ A;  5I22 A;  2O01 E;  3OS1 A;  1D1B A;  4C8Q G;  1FMW A;  2X4W A;  2MF2 A;  1EX4 A;  2XID A;  4M7A G;  2DXC A;  4KGX B;  2L8D A;  4OMQ A;  4LDV A;  5CKE A;  4OF1 A;  3UAT A;  4OMP A;  5LJ5 h;  3JB9 D;  1K0X A;  2IIM A;  2BZY A;  2YHT A;  3AT1 B;  2LRQ A;  1QW1 A;  2CSQ A;  2I0N A;  1GL5 A;  2MWO A;  3CCR Q;  1M3A A;  2FPD A;  1TWB A;  3QJ6 A;  1LCK A;  4HXJ A;  2Z0W A;  5GAM g;  4M75 G;  5GMK h;  2LQN A;  4EDU A;  3JCM V;  2LQW A;  2DIL A;  4L6V 5;  5HK0 A;  1VQ5 T;  2WSC E;  1JQQ A;  3CCL Q;  1RL2 A;  2DAQ A;  3A1P A;  1Y0M A;  1X2K A;  5IHI A;  3I5R A;  3NMZ C;  5KYN A;  1AOJ A;  1OU8 A;  2M9U A;  3REB B;  4OGE A;  5LL6 S;  3JB9 I;  1N27 A;  3G4S T;  2RI3 A;  1YJN A;  2CP6 A;  2HDA A;  1J3T A;  2CSI A;  4M7D G;  2J7I A;  2AKK A;  3C95 A;  3OS0 A;  1H3Z A;  2DNU A;  1VQN T;  2KE9 A;  3GPL A;  2YWW A;  2JTE A;  4M78 G;  4OMO A;  2NUP B;  1WHL A;  2YRV A;  4M4Z A;  4D6W A;  3CC4 Q;  1Q81 R;  3L2W A;  2QQR A;  1D3B B;  4LDY A;  4PNO A;  3CME T;  1YIJ A;  1MHN A;  2K7A A;  4FYX B;  2EYW A;  2QQ9 A;  1UGQ B;  5CAI A;  3L2R A;  2GQV A;  3EGX A;  1BI1 A;  3D7S B;  4PL6 A;  4OB2 B;  1WHH A;  3OYD A;  3L2Q A;  5KYY B;  2J05 A;  1QVP A;  2FG0 A;  3QUI A;  2VV5 A;  4HVV A;  2VC8 A;  1PG5 B;  1RAD B;  2DBK A;  1A0N B;  2KRO A;  1X69 A;  3JCM J;  3HRU A;  2A0F B;  5GAN h;  2VVK A;  1ZLM A;  2RQW A;  3I56 Q;  2EKO A;  1RAF B;  5M9O A;  3BDL A;  1I5O B;  3M0Q A;  3TQ7 P;  4QQD A;  4C5H A;  4CC4 B;  2VGM A;  2X35 A;  2MK5 A;  4J9C A;  3QDF A;  4J9I A;  5A0L A;  4A63 B;  1M90 R;  5CQY A;  1M8M A;  2X51 A;  1UHF A;  4J9H A;  4JS5 A;  4GY5 A;  4LD6 A;  2I2L A;  4QW2 A;  4MZM A;  2DBM A;  3URG A;  1I81 A;  4C0D B;  4AFQ C;  2VXE A;  1D0Z A;  2L3S A;  2KEA A;  5GAO p;  1GCQ C;  1U3O A;  5CKD A;  1KG1 A;  4QT7 A;  1K8A U;  4J6Y A;  3P8D A;  1E6H A;  1AT1 B;  2L89 A;  2LNH B;  2DIQ A;  2FB7 A;  1T3S A;  1Y96 A;  2PQW A;  2EYY A;  1XTD A;  2G3R A;  2W10 A;  2FO0 A;  2FVU A;  5AYF A;  2RJD A;  3A98 A;  1VQ7 T;  3EGD A;  5FLX E;  2HAX A;  1PSE A;  4X34 A;  1FWZ A;  1AD5 A;  4Y28 E;  3VU3 C;  1VQ6 T;  1PNJ A;  3CBM A;  3ZBD A;  4HT8 A;  2K5L A;  1XJW B;  4IUU A;  2JUF A;  4AG2 C;  3BDU A;  1NM7 A;  2GFA A;  1WXB A;  5I2M A;  3JAM E;  4E7L A;  3REA B;  5LJ5 g;  3DKM A;  3CMA Q;  2PNI A;  2C0T A;  4LN2 A;  1V1C A;  5KE3 A;  2O2O A;  1WA7 A;  4ZGE B;  1CKB A;  1R77 A;  3EFO B;  4IIO A;  3M57 A;  5LJ3 h;  4JJC A;  3ER0 A;  2CP3 A;  2MAM A;  5EG2 A;  1C0M A;  2JVV A;  1VQ4 A;  3JV3 A;  2L0A A;  1QP2 A;  4RTX A;  1PWT A;  3CCJ A;  2AZV A;  2E4H A;  4DBF A;  2ROT A;  1OEB A;  3NTH A;  2KXC A;  2CGH A;  3KXT A;  1U5S A;  1KD1 C;  3J80 E;  1OQK A;  5KYU B;  3SD4 A;  5IAY A;  5HCK A;  1Q81 U;  3OB9 A;  3CCS Q;  1WHM A;  3CCU T;  3X28 B;  1VQN Q;  1PSF A;  1K9A A;  3RER A;  2KRM A;  2VWF A;  2BUD A;  4Z88 A;  4J9E A;  3UWN A;  4DQ2 A;  1OZ2 A;  4M75 E;  5A2Q E;  5GAN 6;  1X6G A;  4CC3 A;  1YCS B;  4EMH A;  3E9F A;  1QCF A;  2OI3 A;  3ZEH A;  4PJO B;  2D0N A;  3CBP A;  1OX8 A;  2RK1 A;  4Z89 A;  4LDU A;  1LVK A;  2LX9 A;  2RQT A;  3CC2 T;  1YHQ T;  3FLG A;  3C12 A;  1QKW A;  4M7D E;  4OGC A;  3QBY A;  2J6K A;  4C0D C;  2KT8 A;  3OYB A;  1UEB A;  4J7F A;  2ZPE B;  4RKU E;  3FJ5 A;  3JCM P;  2YUO A;  3PGG A;  1JO8 A;  4M78 E;  1IRX A;  3SWN B;  1HYO A;  2VUB A;  3F70 A;  3QYG B;  2JN0 A;  4NS5 A;  1UHC A;  2NYS A;  1BYM A;  1M90 U;  1H92 A;  4ZGD B;  5HK3 A;  5GAN g;  1YJ9 A;  2DKG A;  4IIM A;  2WSF E;  5C6S A;  2HNI A;  4N4I A;  1VQK T;  2V1R A;  4PJO D;  5FRO A;  5DLQ E;  2RJF A;  3GOX A;  3FC3 A;  1Q82 C;  4HCZ A;  4CC2 A;  3QDR B;  5FW9 A;  3FRN A;  5L8R E;  1UGV A;  1TUG B;  2GNC A;  2RA2 A;  2CKK A;  2QTV A;  3M58 A;  3OW2 A;  3CBO A;  3WVD B;  3VS0 A;  3V7C A;  2OTL T;  4E7H A;  1LJO A;  3HL8 A;  4BY6 C;  3L2V A;  2MIO A;  2FL7 A;  3X26 B;  1GCQ A;  1N6A A;  3OQ5 A;  4OMF B;  2K3B A;  3RKX A;  2YRC A;  3DLM A;  2R58 A;  2LNV A;  1K73 R;  1P92 A;  2DD5 A;  3M54 A;  4GBQ A;  4FW2 A;  2JW4 A;  3S6W A;  2O4X B;  1MND A;  3HSB A;  3OYI A;  3M9Q A;  4RTU A;  5GAO n;  3CCR T;  1ZBJ A;  2FZK B;  2K2V A;  5IHK A;  4FSS A;  3UA7 A;  4R0K A;  3G6E A;  3JB9 G;  1YJN Q;  1HD3 A;  1IHW A;  3PE0 A;  2RH2 A;  2K3Y A;  2YUP A;  4WTO B;  3A8G B;  1NEB A;  1TUD A;  2PUK B;  4J8O A;  2DZC A;  4FYW B;  2CDT A;  4J83 A;  3CCL T;  2LZ6 B;  1M4Z A;  4FCY A;  5IXF A;  2VKN A;  4M77 B;  3RIR A;  1PKS A;  2HZY A;  1YIJ Q;  1ZSZ B;  4PJO C;  1LNX A;  2K3X A;  1D3B A;  3TEE A;  5LJ3 g;  2DE0 X;  4HA8 A;  2K57 A;  3TVT A;  1K4U S;  2GTO A;  4QKU A;  2RHX A;  4E7Z A;  1OI1 A;  2P84 A;  2EJ9 A;  2FEI A;  1AVZ C;  2X4X A;  3CC4 T;  1U06 A;  3GNF B;  2DPP B;  2QA4 A;  3CCU Q;  2RK2 A;  2JMA A;  4F7U A;  1WZO A;  3CCQ A;  3SWN C;  1V29 B;  3A5Z B;  4JJN K;  4EPC A;  1SSF A;  3DLL A;  3A8H B;  3S3M A;  1RAI B;  3QKJ A;  1XOV A;  3J81 E;  2FPF A;  4JZ4 A;  7AT1 B;  3CCM A;  1JXM A;  5GAO m;  1WYX A;  1VYV A;  1MGQ A;  4FW1 A;  4ELZ C;  4X9C A;  2VGN A;  1W2B A;  2DX1 A;  2K5I A;  2F5K A;  3VUB A;  1PM3 A;  3LH5 A;  1AWO A;  1YHQ Q;  3H0F A;  2QAS A;  3JCM g;  2RNA A;  1IRE B;  2LDM A;  3LH0 A;  3I56 T;  2KXD A;  2F1L A;  1OX9 A;  3WVE B;  3P8B B;  1WQW A;  5L23 A;  2OAU A;  3NHN A;  3LWH A;  3TSW A;  2V26 A;  5A0D A;  2EAY A;  4M77 E;  1AZG B;  2HD0 A;  3UT1 A;  4QVC A;  1D0Y A;  3V7S A;  2XD0 A;  1SPK A;  1ZA2 B;  2LJ3 A;  1VQM T;  2XHC A;  4HCK A;  3X20 B;  2BKD N;  5J3B A;  4JPB W;  1KQ1 A;  3FDR A;  5KCH A;  4EIK A;  1KJW A;  1N8R R;  2VXF A;  1RAH B;  1Q86 C;  4DBQ A;  2KRS A;  2HQE A;  3JCM W;  3CPW P;  5KYW B;  4BE0 A;  3CCV T;  2LCS A;  3V7R A;  4DA4 A;  1MV3 A;  2YT6 A;  1B34 A;  3PNW C;  1VQP A;  4JJB A;  3BE3 A;  2COW A;  2VB6 A;  4F7U F;  3OBW A;  3X25 B;  1YN8 A;  4TVR A;  1H3H A;  1KC8 R;  2JXB A;  2V1Q A;  4JDS A;  4JRI A;  2F2W A;  4E7J A;  5GAN 5;  3RES A;  3CC7 A;  3EH1 A;  4XTU A;  1M1K R;  1M3C A;  2JT4 A;  2AIR B;  1JJ2 A;  4QQG A;  1K1Z A;  3JRZ A;  1SHF A;  1BIA A;  4ATO A;  2LCC A;  1ZSZ C;  3MP6 A;  5I2S A;  1VQ4 Q;  3NTK A;  3QO3 A;  3EFO A;  1HSQ A;  2MWP A;  2DF6 A;  1KQS A;  2GFU A;  2JMC A;  2J6F A;  1YNZ A;  4XAX B;  2RJC A;  3MEU A;  1IB8 A;  1ZQ1 A;  3QZ9 B;  2DRK A;  4C0F A;  3CCJ Q;  3CMA T;  1Q82 U;  2COZ A;  2HBW A;  1T3L A;  4FU6 A;  4F17 A;  1NZ9 A;  1W1F A;  3BY7 A;  2L3P A;  2L5Q A;  2CUD A;  3ZL7 C;  1TS9 A;  6AT1 B;  4A54 A;  3C94 A;  1I5L A;  4HCC A;  3FJP A;  4XTW A;  2NLU A;  3SHW A;  3OY9 A;  4QVD A;  4KUL A;  4PKC C;  5GMK m;  4XU3 A;  4FYV B;  2M1H A;  2QDY B;  3O8V A;  3CD6 T;  2ABL A;  3CCS T;  4P5N A;  3HKS A;  5CIU A;  2LT1 A;  2F5T X;  4PJO A;  5CO7 A;  2HSE B;  2AHJ B;  1TG0 A;  3EFS A;  2CP7 A;  3VS6 A;  2O88 A;  3HP9 A;  3RKW A;  5GAN 2;  3VS5 A;  3HFO A;  2O9V A;  3RR6 A;  2C0I A;  2V8I A;  1S1N A;  1WPY A;  2RHY A;  3G1J A;  3A8O B;  3GIB A;  2DL8 A;  3ZFJ A;  2RMO A;  4FYY B;  1GBQ A;  2KQW A;  3OMG A;  3C0C A;  1G83 A;  4LXC A;  3EAE A;  3SWN A;  3CPW S;  3LWI A;  2E12 A;  2EJG A;  2ENM A;  4DEY A;  1PC0 A;  1YJ9 Q;  2DIG A;  4C92 B;  1WHK A;  2JJ9 A;  2YDL A;  4XU1 A;  1SF9 A;  4LUE A;  2XDB A;  3RBB B;  2NUZ A;  1NYF A;  3MP8 A;  4R56 A;  3BFM A;  1Q95 G;  1GCP A;  4DOW A;  2H8H A;  1OYX A;  3VYH B;  4ZTJ A;  2YSQ A;  1HXD A;  1M3B A;  4X9D A;  4KH0 B;  3V8L A;  2DEQ A;  3EH2 A;  1EIF A;  2MMP A;  2DER A;  4OMN A;  1QVG P;  5GAM j;  3I55 T;  2IG0 A;  1OPL A;  1N8R U;  1MMN A;  2OTJ T;  5FRM A;  4C8Q B;  4BD3 A;  1VQ8 A;  1RI0 A;  3LW5 E;  5KYX B;  4M7A B;  4EMK B;  1D09 B;  1O9S A;  4PFP A;  3LYI A;  1T0H A;  2A7Y A;  1VYT A;  1VQM Q;  4XTY A;  3KUF A;  1XNI A;  3QWY A;  1X6O A;  4PJO F;  1X43 A;  2CS7 A;  4BI4 A;  3OYN A;  1AWX A;  3JCM f;  1Y07 A;  3M55 A;  1X27 A;  1KC8 U;  1WGS A;  2A28 A;  4XTZ A;  3SFM A;  3CCV Q;  2E6N A;  4ZN1 A;  2DJZ A;  3M5A A;  3GF5 A;  1YCY A;  2LX7 A;  1WJQ A;  1IXD A;  4LDW A;  4M75 B;  1M1K U;  9ATC B;  3G6E Q;  3EG9 B;  1R0C B;  5GAM d;  3M0P A;  2PU9 B;  3S3O A;  1E7O A;  2GBQ A;  3TU4 K;  3FEO A;  1Q7Y C;  4RCB A;  2QEX A;  5FWC A;  1SEM A;  4KGZ B;  3ULR B;  4Z8A A;  3DB4 A;  4E2F B;  1OV3 A;  4C92 E;  1WFW A;  3GLX A;  1B07 A;  4MDW A;  4ZGJ B;  2RB6 A;  4F16 A;  1KIK A;  1LOJ A;  1G3W A;  1YJN T;  1UB4 A;  1M2V A;  3HPW A;  4M7D B;  4PJJ A;  3G71 A;  2EQJ A;  3M0U A;  1YJW A;  3LLR A;  4A4K A;  4XU0 A;  3QJY A;  1YI2 A;  3CXC P;  1ZSZ A;  1WHJ A;  1WHG A;  4A4E A;  3L2U A;  3S3N A;  4M78 B;  1TU0 B;  3GP8 A;  3MKD A;  1Q86 U;  1FMK A;  1VYU A;  2HSP A;  3RKY A;  2V8K A;  4IUT A;  2FYK A;  1MUZ A;  1SKU B;  1TXQ A;  1YIT A;  4M75 D;  3SDZ A;  1ZBX A;  1ZHI A;  4LNP A;  2QA4 Q;  1JU5 C;  1YIJ T;  1NJI C;  3CCQ Q;  4C8Q E;  1B7T A;  1TSF A;  3I9Q A;  4MML A;  4M7A E;  4DEX A;  1SSH A;  1VA7 A;  3VRY A;  3CCM Q;  3M0S A;  3HFN A;  4WF2 A;  4BI8 B;  2JM8 A;  2PUO B;  1S72 A;  2HCK A;  2P0P A;  1QVF A;  3CD6 Q;  2YLB A;  1GFC A;  3UPU A;  1WI7 A;  2LVM A;  2X3X D;  1VIF A;  1QVG S;  4CC7 A;  4MMK A;  5GAM f;  2K2M A;  2HKQ B;  1VQ9 A;  5FU7 B;  5LJ5 e;  2AKL A;  1UEC A;  2EGE A;  2DXT A;  2XI9 A;  4FM4 B;  1M5Q 1;  2O31 A;  2BE9 B;  1RLQ C;  2D0Q B;  2DTH A;  1Z9Q A;  3U23 A;  4JRP A;  3E2U A;  3H9N A;  4Q5W A;  4N4H A;  1WLP B;  4RTT A;  2E1H A;  1AEY A;  3VS1 A;  4M77 F;  2DZ9 A;  4FSX A;  1UGS B;  4EMK C;  5J39 A;  1K9M C;  2ECZ A;  4PJM A;  1VOM A;  3TSZ A;  3H6Z A;  2XKO C;  4J7I A;  2D8J A;  2EIF A;  5IXB A;  1NLP C;  4A4G A;  2M16 A;  2CH4 W;  1VIE A;  4UC4 A;  1IO6 A;  2M0O A;  4N4G A;  3X24 B;  2DTI A;  1VQP Q;  2D9T A;  2WSE E;  4M75 C;  5LJ5 j;  1KD1 R;  3OSS C;  1GBR A;  3JCM b;  1BI0 A;  1K73 C;  3PIP A;  4RG8 A;  2EGA A;  1BCM A;  3MO8 A;  2B8A A;  3NTI A;  4NOY A;  4B6M A;  3I55 Q;  2RI2 A;  5AT1 B;  3CC7 Q;  2OTJ Q;  3PMI A;  3MEA A;  2KYM A;  3CXC S;  1NPR A;  4BB7 A;  2FPE A;  4JS4 A;  3KBG A;  1PRM C;  5GMK j;  3QXE B;  1MMD A;  3PT9 A;  2K6D A;  1VQO A;  3MEV A;  1NBE B;  4XU2 A;  1VUB A;  1G8X A;  2EW3 A;  4M7D C;  1OZ3 A;  4IUQ A;  2OX7 A;  2KRN A;  4HCB A;  4ME7 A;  1QWF A;  1WIE A;  2CH4 A;  2CYZ B;  3OYY A;  5CKH A;  4M78 C;  2CUB A;  4JRQ A;  1WJR A;  2PVD B;  1F1B B;  2PVG B;  2OJ2 A;  4PFZ A;  5LJ5 d;  5GAN e;  2BTT A;  2IVW A;  2E3H A;  2FRW A;  2ZPI B;  2NUT B;  1VQ4 T;  5CVI A;  1W6X A;  1N5Z A;  1RAA B;  1U8R A;  4OP0 A;  2KDS A;  1RLP C;  2BZX A;  3CCJ T;  4B9X A;  4MDX A;  4CI0 C;  2QQS A;  4AFS C;  3TRE A;  2GCX A;  5GMK i;  2DL7 A;  3OYK A;  3TCJ A;  4ZN3 A;  4RTZ A;  2E3I A;  2ZCF B;  2E70 A;  2FZG B;  4ELY C;  1Q82 R;  3N5B B;  4E7S A;  1WDX A;  2RQV A;  4O6J A;  3QII A;  3Q1J A;  4OMM A;  1K76 A;  5FU7 C;  4IUP A;  1GRI A;  2VYT A;  3FIF A;  4OML A;  3CCE A;  1UJ0 A;  4BI3 A;  2BZ8 A;  2QGF B;  4BE2 A;  3EGD B;  1RAE B;  3T9N A;  4C5E A;  2NUP A;  1QKX A;  1GXI E;  3JB9 J;  4RMO A;  1VQL A;  5GAN j;  2P4T A;  2QQA A;  5EC7 A;  4QVZ A;  2P4R A;  4BDZ A;  2FRY A;  3OS5 A;  1Q7Y U;  2QTX A;  3RMS A;  1HJD A;  1XQH A;  4D8D A;  5GAN 7;  1YWP A;  1QMC A;  3C4S A;  4LE9 A;  5LJ5 f;  4E7K A;  1FMV A;  5KYY A;  3MPU B;  4FIB A;  1M2O A;  3AHU A;  2NWM A;  2K4Y A;  2K5F A;  1QCN A;  4R55 A;  1QWE A;  3VUZ A;  3OA6 A;  2ZPF B;  4M77 D;  3EHR A;  4L5G A;  1YJ9 T;  1D1C A;  2E41 A;  2BE7 D;  3VS3 A;  2DEU A;  2RQR A;  2DL4 A;  5GAN d;  1Z9Z A;  4LUD A;  2DXB A;  2YXY A;  1ZUY A;  1VQ5 A;  5FRN A;  2GTJ A;  2MI6 A;  1ZUK A;  4WCI A;  2SEM A;  1VQ8 Q;  3CEY A;  1X01 A;  4LDX A;  2Y4X A;  4KBM B;  3JCM c;  1NPP A;  3OYC A;  4ORZ A;  3EG0 A;  2J06 A;  3G4S A;  3V8J A;  2DTO A;  3PVL A;  2R5A A;  1K8A C;  4EMK A;  2JOY A;  4F04 B;  1M1F A;  1KD1 U;  3M53 A;  1VQN A;  1ZUU A;  4XTV A;  1G2B A;  1JXO A;  4EMG A;  4DOV A;  1ABO A;  5J26 A;  3H0I A;  4KGV B;  2K79 A;  5KCO A;  3HRS A;  2RF0 A;  4N0A C;  3OYL A;  4C0G A;  4BUG A;  3CME A;  4JZ3 A;  1LPL A;  4M75 A;  2CZ1 B;  3LX7 A;  4DBR A;  2M51 A;  3OYF A;  4RTY A;  1UE9 A;  3EG1 A;  4FT2 A;  3JCM e;  1SHG A;  5LJ3 j;  2DK3 A;  2XDD A;  3V8K A;  1ZX6 A;  2L3Q A;  4C92 F;  3PTA A;  4HVW A;  3G6E T;  4F7U G;  3G71 Q;  1K9M U;  1YJW Q;  2Y90 A;  1SG5 A;  3H0H A;  4M7D A;  4PLL A;  5CQX A;  2QYZ A;  5GAN f;  3M4G A;  4M77 C;  3H41 A;  3QWX X;  3R6N A;  4M78 A;  1YIT Q;  1JRI A;  2H3E B;  1TUC A;  3UF4 A;  8AT1 B;  1QLY A;  3EG2 A;  4RTW A;  3L42 A;  5ECA A;  3H8Z A;  1AHJ B;  3VJP A;  2XDP A;  2C0O A;  2DXU A;  2XK0 A;  3SB2 A;  2EWN A;  4AFZ C;  4C8Q F;  5CKB A;  4J9F A;  5LJ3 d;  1IGQ A;  3QHS A;  4M7A F;  1M9S A;  3THK A;  1Q81 C;  4ANJ A;  1S72 Q;  1I07 A;  1Y71 A;  1X6B A;  4OB0 B;  1WNL A;  2QA4 T;  2ZPB B;  2EJF A;  2PVO B;  1EFN A;  1Q86 R;  3CCQ T;  2OAW A;  5KYU A;  1G3T A;  2X9H A;  1OU9 A;  2W0Z A;  1VQ9 Q;  5GAO r;  1TTH B;  4KT0 E;  2YRD A;  3INZ A;  5GAO l;  3CCM T;  4M75 F;  1PRL C;  2V8J A;  3PMT A;  1BIB A;  4C5G A;  4IKF A;  1ARK A;  1I4K 1;  2EYQ A;  3E9G A;  2L3R A;  4D8K A;  1VQ7 A;  3E19 A;  3SEM A;  3RDV A;  1VQ6 A;  5GJW B;  3MET A;  3NFC A;  1IGU A;  3I35 A;  3JCM d;  2COY A;  5GAM e;  4RCC A;  3VYG A;  1BI3 A;  2DJQ A;  4M7D F;  4HKE A;  5GAN 8;  2QG9 B;  4QQ6 A;  2HEQ A;  1E6G A;  4Y91 A;  5FWB A;  1M90 C;  2M02 A;  3OW2 P;  4M78 F;  2EGC A;  4KH1 B;  4PJL A;  4HT9 A;  2A3L A;  3O5Z A;  2DYI A;  4ZTF A;  5LJ3 f;  4ZNX A;  2VAS A;  2JS0 A;  1KSW A;  2J6O A;  5GAN 4;  4C5I A;  1RAC B;  2LCL A;  5HY6 A;  2XG8 D;  3EHQ A;  3OSV A;  2QK0 A;  4NL3 A;  2HBP A;  1MNE A;  1T0J A;  1ACM B;  1VQP T;  3M4Y A;  1VQO Q;  2AZS A;  3HTR A;  2XU8 A;  1QVF S;  3OYG A;  4F7U B;  2R57 A;  2LJ1 A;  5CR2 A;  5GJV B;  4JLI A;  4J9G A;  5C0M A;  3CCU A;  4Z02 A;  2E6Z A;  4E6R A;  2EQU A;  2DM1 A;  3CC7 T;  1D0X A;  3KFV A;  2E5K A;  4AT1 B;  1C1A A;  3QYH B;  2LJ0 A;  3GNG A;  4C92 D;  2E64 A;  4PJO G;  3DB3 A;  4N0A A;  3LGF A;  2KR3 A;  3ME9 A;  2G6F X;  1UG1 A;  2X4Y A;  2KY9 A;  2D6F A;  1G3S A;  2LP5 A;  1KQ2 A;  2HMA A;  4C0Z A;  1OUL A;  3CC2 A;  2NUT A;  4J6W A;  1YHQ A;  2DMO A;  2ZZD A;  2O4X A;  1TOV A;  2RHI A;  2KAF A;  3R6O A;  1WXT A;  5I21 A;  5FU6 B;  3OYE A;  2A08 A;  1BB9 A;  4XQ3 A;  3ASK A;  4E7I A;  4PLI A;  2MPX C;  4MZT A;  4O5V A;  2X4J A;  2ED0 A;  3CQT A;  3CCE Q;  4C8Q D;  3E1S A;  5GMK l;  3VRZ A;  5DM7 R;  1UJY A;  4M7A D;  4J6X A;  5HKC A;  3LGL A;  1VQK A;  4E47 A;  4M77 A;  2QI2 A;  3MP1 A;  1RAG B;  1VQL Q;  1YFN A;  2YUQ A;  1HK9 A;  1B34 B;  4CRI A;  5KH6 A;  1U1T A;  4OB1 B;  2RN8 A;  2DLP A;  2GQI A;  3OBY A;  1BKB A;  1H64 1;  4IUV A;  2EQI A;  2EYX A;  3OW2 S;  3M0T A;  1R8O B;  2GF7 A;  4F7U E;  1B3Q A;  1W2B P;  2ZAE A;  2HL3 A;  4NL2 A;  2E5Q A;  3RNJ A;  4V2S A;  5A0G A;  2OTL A;  4BY6 B;  2WAC A;  2RD1 A;  1ZSG A;  4JUV A;  2HQH A;  1DJ7 B;  3OYH A;  1QCO A;  2KK4 A;  3A8M B;  4KRT A;  2D8H A;  3CPW A;  1H8K A;  4C92 C;  4K11 A;  2JS2 A;  3HHT B;  5CKF A;  2XMF A;  2EPD A;  1VQ5 Q;  4M7D D;  3WXM B;  4A4H A;  1Q7Y R;  1OOT A;  2CZ7 B;  2FZC B;  2LC4 A;  1TH7 A;  1OPK A;  2HQX A;  2KT1 A;  4JRK A;  1FXX A;  4M78 D;  3CCR A;  3P8H A;  1FX7 A;  1RAB B;  2BIV A;  3VKI A;  3G4S Q;  1I1J A;  5IHN A;  3VV0 A;  1PD0 A;  2YUN A;  2JNG A;  4GLK A;  3PIO A;  1X75 C;  1AZE A;  4AFU C;  2P0K A;  5GMK e;  2KNB B;  4JJD A;  3CCL A;  2KMT A;  2M0Y A;  2DET A;  1BCO A;  2K9G A;  4C8Q C;  1VQ8 T;  5DY9 A;  4OB3 B;  4M77 G;  2DVE A;  2MCN A;  4M7A C;  1Y7X A;  4FL6 A;  2DL3 A;  3CME Q;  1JB0 E;  3MCA B;  3HRT A;  3JCM h;  1NJI R;  3VS7 A;  2KBT A;  4A53 A;  3OS2 A;  4B9W A;  1JJ2 P;  4MZP A;  3EG3 A;  2AT1 B;  2RQU A;  2RJE A;  1UFF A;  2QGG A;  3CC4 A;  1WJS A;  1IZ6 A;  5KYW A;  1KQS P;  4GLM A;  3OYM A;  5IN1 A;  1UTI A;  3EGX B;  3CPF A;  4II1 A;  2RO0 A;  5FU6 C;  2LQK A; 
#chains in the Genus database with same CATH homology
 1XTD A;  4M77 D;  4A54 A;  3C94 A;  4L5G A;  1YJ9 T;  1I5L A;  2G3R A;  2Y4Y A;  4HCC A;  2QEX T;  2FVU A;  3FJP A;  2E41 A;  4XTW A;  2RJD A;  5AYF A;  2NLU A;  5GAN d;  3OY9 A;  4QVD A;  4KUL A;  3J7A F;  2DXB A;  1QP3 A;  1VQ7 T;  2LQ8 A;  4KUI A;  5FLX E;  3QPH A;  1VQ5 A;  2HAX A;  5FRN A;  2MI6 A;  4PKC C;  5GMK m;  1PSE A;  4X34 A;  4XU3 A;  1W2B S;  1FWZ A;  3CEY A;  1X01 A;  4Y28 E;  3VU3 C;  4LDX A;  2Y4X A;  2M1H A;  2QDY B;  3G71 T;  4KBM B;  1VQ6 T;  3O8V A;  3CD6 T;  2E65 A;  3CCS T;  4P5N A;  3HKS A;  1NPP A;  2QXF A;  3CBM A;  5CIU A;  2ZPH B;  3JCM c;  3OYC A;  2LT1 A;  1YI2 T;  3ZBD A;  5KE2 A;  2F5T X;  4PJO A;  5CO7 A;  2JTF A;  3L2Z A;  2AHJ B;  1O75 A;  2K5L A;  3JCM Q;  4HT8 A;  2ZGW A;  3EFS A;  4IUU A;  3G4S A;  3V8J A;  2DTO A;  2KSS A;  2R5A A;  2JUF A;  1K8A C;  4EMK A;  2JOY A;  3BDU A;  1M1F A;  2GFA A;  1KD1 U;  3M53 A;  3HP9 A;  3RKW A;  1I8F A;  5GAN 2;  5I2M A;  3HFO A;  3I56 A;  1VQN A;  4XTV A;  3JAM E;  4E7L A;  4EMG A;  4XK8 E;  4DOV A;  5LJ5 g;  1YIT T;  3DKM A;  2V8I A;  2P0Q A;  5J26 A;  5KE3 A;  1WPY A;  2RHY A;  5DLO A;  3A8O B;  3GIB A;  5KCO A;  3ZFJ A;  3HRS A;  4ZGE B;  4N0A C;  5IT9 E;  2ZPG B;  4YTL A;  3MEW A;  3OYL A;  2EFI A;  2KQW A;  1BI2 A;  3M57 A;  3OMG A;  5LJ3 h;  4C0G A;  5GAN 3;  4BUG A;  3ER0 A;  3CME A;  2EQM A;  2MAM A;  2RM4 A;  3EAE A;  1M1G A;  3SWN A;  4M75 A;  5EG2 A;  2E12 A;  2EJG A;  2CZ1 B;  3LWI A;  2JVV A;  3LX7 A;  3CPW S;  1VQ4 A;  4PJO E;  2DIG A;  1QP2 A;  3OYF A;  4C92 B;  1VQM A;  1KHI A;  4XU1 A;  1S72 T;  3CCJ A;  4FT2 A;  2XDB A;  3JCM e;  3NTH A;  2FHD A;  2CGH A;  3KXT A;  5LJ3 j;  4A4F A;  2DK3 A;  2XDD A;  1G5V A;  1Y96 B;  3MP8 A;  3V8K A;  3BFM A;  4C92 F;  4R56 A;  3PTA A;  1KD1 C;  4DOW A;  3J80 E;  5GAM h;  1OYX A;  3G6E T;  3SD4 A;  4F7U G;  1VQ9 T;  5IAY A;  3CCV A;  1Q81 U;  1QVG A;  3L1A A;  3OB9 A;  2F69 A;  3JSC A;  3VYH B;  4ZTJ A;  1K9M U;  1M8V A;  1HXD A;  2JZ2 A;  3CCU T;  2Y90 A;  3X28 B;  1PSF A;  3RER A;  4X9D A;  3V8L A;  2BUD A;  2LTO A;  3JB9 F;  4M7D A;  4PLL A;  2JTM A;  5CQX A;  2DEQ A;  3UWN A;  4DQ2 A;  1OZ2 A;  5GAN f;  3FB9 A;  2LT4 A;  4M75 E;  5A2Q E;  3M4G A;  3M59 A;  1EIF A;  2MMP A;  5GAN 6;  2RHZ A;  4M77 C;  5GAM j;  3I55 T;  4EMH A;  1UGP B;  2IG0 A;  1JRI A;  4M78 A;  4BAC A;  3E9F A;  4RG2 A;  5D6X A;  3BW1 A;  1N8R U;  2OTJ T;  4PJO B;  2H3J A;  3ZEH A;  4C8Q B;  4BD3 A;  5FRM A;  3CBP A;  1VQ8 A;  4KUD K;  1G3Y A;  1RI0 A;  1JJ2 S;  3LW5 E;  2RK1 A;  4M7A B;  5CCA A;  4EMK B;  4LDU A;  3L42 A;  1O9S A;  3H8Z A;  3LYI A;  2LX9 A;  2A7Y A;  1AHJ B;  3VJP A;  2XDP A;  3KUF A;  1UGR B;  1XNI A;  4XTY A;  2DXU A;  2XK0 A;  1X6O A;  3SB2 A;  2EWN A;  4PJO F;  4C8Q F;  3RMQ A;  1YBY A;  2CS7 A;  5CKB A;  1YHQ T;  4BI4 A;  1KQS S;  3CC2 T;  3FLG A;  5LJ3 d;  3OYN A;  3QHS A;  3JCM f;  4L59 A;  4M7A F;  1M9S A;  4C92 A;  1Y07 A;  2CZ0 B;  1Q81 C;  3C12 A;  4M7D E;  5D6W A;  3M55 A;  4OGC A;  5GAO q;  3QBY A;  1KC8 U;  1WGS A;  4C0D C;  2DD4 A;  3OYB A;  3OYA A;  1UEB A;  1Y71 A;  2ZPE B;  4J7F A;  4RKU E;  4XTZ A;  4OB0 B;  2E6N A;  3SFM A;  1WNL A;  3RUX A;  4ZN1 A;  3CMA A;  2DJZ A;  2QA4 T;  3M5A A;  3MHX A;  2ZPB B;  3GF5 A;  3PGG A;  1YCY A;  4M78 E;  1WJQ A;  2EJF A;  2PVO B;  3SWN B;  1W4S A;  4LDW A;  4M75 B;  3CCQ T;  1M1K U;  2VUB A;  3F70 A;  1G3T A;  4JLG A;  3QYG B;  5GAO r;  2JN0 A;  4NS5 A;  4KT0 E;  3INZ A;  1N8R C;  5GAM d;  2PU9 B;  3S3O A;  1BYM A;  5GAO l;  1M90 U;  4ZGD B;  3JCM X;  3FEO A;  4M75 F;  5HK3 A;  5GAN g;  3CCM T;  3TU4 K;  1YJ9 A;  2DKG A;  4RCB A;  1Q7Y C;  2V8J A;  3PMT A;  2QEX A;  1BIB A;  5LJ3 e;  2WSF E;  2XIC A;  5C6S A;  4C5G A;  2HNI A;  4N4I A;  1NJI U;  1VQK T;  3DB4 A;  4IKF A;  4VUB A;  1I4K 1;  4C92 E;  4PJO D;  2EYQ A;  5FRO A;  3E9G A;  2L3R A;  5DLQ E;  3CXC A;  2RJF A;  3GOX A;  1VQ7 A;  3E19 A;  3GLX A;  3FC3 A;  2CZ6 B;  2RI5 A;  1Q82 C;  4HCZ A;  3QDR B;  4MDW A;  4ZGJ B;  4C8Q A;  1VQO T;  4XTX A;  2RB6 A;  3FRN A;  5L8R E;  1KHC A;  1LOJ A;  1G3W A;  1YJN T;  1UB4 A;  3HPW A;  4M7A A;  1KC8 C;  2RA2 A;  4M7D B;  3G71 A;  2EQJ A;  2CKK A;  2KVQ G;  1VQ6 A;  3CD6 A;  3CCS A;  1YJW A;  1WQ7 A;  3LLR A;  4A4K A;  4XU0 A;  3MET A;  3NFC A;  3QJY A;  3M58 A;  4BDY A;  1YI2 A;  3OW2 A;  5D6Y A;  4A4E A;  3JCM d;  3L2U A;  3S3N A;  5GAM e;  4RCC A;  3CBO A;  3M56 A;  4M78 B;  2QQB A;  1BI3 A;  1NE8 A;  3VYG A;  3WVD B;  3GP8 A;  1Q86 U;  1M1K C;  4M7D F;  3V7C A;  4J5Y A;  4OVA A;  4HKE A;  5GAN 8;  3RKY A;  2OTL T;  2V8K A;  4IUT A;  4QQ6 A;  4E7H A;  1LJO A;  3HL8 A;  4BY6 C;  3L2V A;  2FYK A;  2FL7 A;  4LD9 K;  4Y91 A;  1YIT A;  3A8L B;  2DO3 A;  3X26 B;  1M90 C;  4M75 D;  3SDZ A;  1ZBX A;  1ZHI A;  4M78 F;  1N6A A;  3OQ5 A;  4OMF B;  1YIJ T;  4HT9 A;  3RKX A;  1U1S A;  1NJI C;  2A3L A;  4C8Q E;  3DLM A;  3OYJ A;  1N9R A;  1JBM A;  2R58 A;  4ZTF A;  2LNV A;  4MML A;  5LJ3 f;  4M7A E;  1P92 A;  2C06 A;  3OMC A;  5GAN 4;  2R5M A;  3UDC A;  4C5I A;  2DD5 A;  3M54 A;  2LCL A;  3HFN A;  2XG8 D;  3OSV A;  5HY6 A;  3S6W A;  2O4X B;  4WF2 A;  4BI8 B;  4C92 G;  2PUO B;  3HSB A;  4NL3 A;  4FT4 A;  1S72 A;  2P0P A;  3OYI A;  1QVF A;  2YLC A;  2YLB A;  2HBP A;  3M9Q A;  3UPU A;  2RHU A;  5GAO n;  3CCR T;  4IUR A;  3PFS A;  1VQP T;  2K2V A;  2LVM A;  3M4Y A;  1YJW T;  1VIF A;  2XU8 A;  1QVF S;  3OYG A;  1QVG S;  4F7U B;  4MMK A;  2R57 A;  3G6E A;  5GAM f;  3JB9 G;  1VQ9 A;  5FU7 B;  5LJ5 e;  5CR2 A;  2RH2 A;  2K3Y A;  2DXT A;  2XI9 A;  4FM4 B;  4JLI A;  5C0M A;  3A8G B;  5CK9 A;  2E10 A;  3CCU A;  3EFR A;  4Z02 A;  1M5Q 1;  4BE1 A;  2PUK B;  3CCE T;  3G7Z A;  2EQK A;  3QZ5 B;  2E6Z A;  4J8O A;  2DZC A;  2D0Q B;  3JCM P;  2EQU A;  1N9S A;  3CC7 T;  2DTH A;  4J83 A;  3CCL T;  4JRP A;  3JB9 H;  1M4Z A;  3QG1 A;  4M77 B;  4Q5W A;  4N4H A;  3RIR A;  3QYH B;  1VQL T;  3I55 A;  1K73 U;  3QSU A;  3GNG A;  2OTJ A;  2E1H A;  2O01 E;  4C92 D;  3OS1 A;  4PJO C;  2E64 A;  1LNX A;  3DB3 A;  4PJO G;  4C8Q G;  2X4W A;  2MF2 A;  4N0A A;  3LGF A;  4M77 F;  2DZ9 A;  2K3X A;  4FSX A;  3ME9 A;  1D3B A;  2XID A;  1UGS B;  4M7A G;  3TEE A;  4EMK C;  2DXC A;  2KY9 A;  2X4Y A;  5J39 A;  1G3S A;  5LJ3 g;  1K9M C;  2D6F A;  2L8D A;  1KQ2 A;  4LDV A;  4HA8 A;  5CKE A;  4OF1 A;  2K57 A;  4C0Z A;  3CC2 A;  5LJ5 h;  2RHX A;  4J6W A;  3H6Z A;  3JB9 D;  1OI1 A;  1YHQ A;  2XKO C;  4J7I A;  2ZZD A;  2EIF A;  2EJ9 A;  2O4X A;  2RHI A;  4A4G A;  2KAF A;  2YHT A;  2X4X A;  2M16 A;  3CC4 T;  2LRQ A;  1QW1 A;  3R6O A;  1VIE A;  4UC4 A;  2M0O A;  4N4G A;  3X24 B;  3GNF B;  5I21 A;  2MWO A;  2DPP B;  2QA4 A;  2DTI A;  5FU6 B;  2RK2 A;  3OYE A;  2D9T A;  3QJ6 A;  2WSE E;  4XQ3 A;  4F7U A;  3ASK A;  5GAM g;  3SWN C;  3CCQ A;  4E7I A;  4M75 C;  5LJ5 j;  4M75 G;  1V29 B;  3A5Z B;  3OSS C;  4JJN K;  5GMK h;  4EPC A;  1SSF A;  3JCM b;  4PLI A;  1BI0 A;  3DLL A;  1K73 C;  3A8H B;  3PIP A;  3S3M A;  4RG8 A;  4EDU A;  4MZT A;  4O5V A;  3MO8 A;  2X4J A;  3QKJ A;  3JCM V;  1XOV A;  4C8Q D;  3E1S A;  3J81 E;  2B8A A;  3NTI A;  4L6V 5;  4NOY A;  5HK0 A;  5GMK l;  3CCM A;  2RI2 A;  1VQ5 T;  5DM7 R;  2WSC E;  4J6X A;  5GAO m;  4M7A D;  3PMI A;  1RL2 A;  3MEA A;  1MGQ A;  2DAQ A;  3LGL A;  5HKC A;  1VQK A;  4ELZ C;  4E47 A;  4M77 A;  1NPR A;  3CXC S;  4BB7 A;  4X9C A;  4JS4 A;  2QI2 A;  2VGN A;  3MP1 A;  3KBG A;  1W2B A;  5GMK j;  2K5I A;  3QXE B;  1HK9 A;  2F5K A;  3VUB A;  3PT9 A;  1B34 B;  4CRI A;  3MEV A;  5KH6 A;  1VQO A;  1U1T A;  2M9U A;  4OB1 B;  4OGE A;  4XU2 A;  1VUB A;  5LL6 S;  3JB9 I;  1N27 A;  1BKB A;  1H64 1;  3OBY A;  2RI3 A;  4IUV A;  3JCM g;  3G4S T;  1YJN A;  3OW2 S;  1IRE B;  4M7D C;  1OZ3 A;  4M7D G;  1R8O B;  2GF7 A;  4F7U E;  2LDM A;  3LH0 A;  4IUQ A;  3C95 A;  3OS0 A;  1H3Z A;  4HCB A;  3I56 T;  1VQN T;  4ME7 A;  3GPL A;  2CYZ B;  3OYY A;  3WVE B;  5CKH A;  3P8B B;  4M78 C;  4M78 G;  4JRQ A;  1WQW A;  4NL2 A;  1WJR A;  2E5Q A;  2OAU A;  2PVD B;  4V2S A;  5A0G A;  2PVG B;  2OTL A;  4BY6 B;  3LWH A;  4D6W A;  2YRV A;  5LJ5 d;  5A0D A;  2EAY A;  2WAC A;  2QQR A;  3L2W A;  1D3B B;  2RD1 A;  4LDY A;  4M77 E;  5GAN e;  4PNO A;  4JUV A;  2HD0 A;  2IVW A;  1DJ7 B;  3CME T;  1YIJ A;  3OYH A;  1MHN A;  3UT1 A;  2KK4 A;  2ZPI B;  3A8M B;  4QVC A;  1VQ4 T;  5CVI A;  3V7S A;  2QQ9 A;  1UGQ B;  5CAI A;  2XD0 A;  3CPW A;  3L2R A;  1U8R A;  2GQV A;  4C92 C;  4OP0 A;  1VQM T;  2KDS A;  2XHC A;  3X20 B;  1BI1 A;  2BKD N;  3HHT B;  3CCJ T;  5J3B A;  1KQ1 A;  3FDR A;  5KCH A;  5CKF A;  2VXF A;  4PL6 A;  4OB2 B;  4B9X A;  3OYD A;  4MDX A;  4CI0 C;  4M7D D;  2QQS A;  3WXM B;  3L2Q A;  1Q86 C;  4A4H A;  1QVP A;  2CZ7 B;  2LC4 A;  3TRE A;  1TH7 A;  2HQE A;  3QUI A;  3JCM W;  2VV5 A;  2VC8 A;  2HQX A;  4BE0 A;  2GCX A;  5GMK i;  3OYK A;  3CCV T;  4JRK A;  1FXX A;  3TCJ A;  4ZN3 A;  4M78 D;  3V7R A;  2ZCF B;  4DA4 A;  2E70 A;  3CCR A;  1B34 A;  3PNW C;  1VQP A;  3P8H A;  4ELY C;  1FX7 A;  2BIV A;  3N5B B;  3JCM J;  3VKI A;  3HRU A;  3QII A;  4O6J A;  4F7U F;  3Q1J A;  5GAN h;  3OBW A;  3X25 B;  5FU7 C;  4IUP A;  4TVR A;  2VYT A;  3FIF A;  4JDS A;  3VV0 A;  2EKO A;  3CCE A;  4JRI A;  4BI3 A;  5M9O A;  3BDL A;  2JNG A;  4GLK A;  3PIO A;  1X75 C;  4E7J A;  4BE2 A;  5GAN 5;  2P0K A;  5GMK e;  3RES A;  3CC7 A;  3T9N A;  3CCL A;  4XTU A;  2KMT A;  4C5E A;  4QQD A;  4C5H A;  1VQ8 T;  4C8Q C;  1GXI E;  2VGM A;  5DY9 A;  2X35 A;  4OB3 B;  3JB9 J;  4M77 G;  4RMO A;  1VQL A;  2DVE A;  5GAN j;  2P4T A;  4M7A C;  1Y7X A;  2QQA A;  1JJ2 A;  4QQG A;  4QVZ A;  5A0L A;  3JRZ A;  4FL6 A;  5CQY A;  1JB0 E;  1BIA A;  3MCA B;  4ATO A;  2LCC A;  4BDZ A;  3MP6 A;  3OS5 A;  5I2S A;  3HRT A;  1Q7Y U;  4JS5 A;  2QTX A;  3RMS A;  3JCM h;  3NTK A;  3QO3 A;  4GY5 A;  4LD6 A;  2MWP A;  2I2L A;  4QW2 A;  4MZM A;  1KQS A;  2GFU A;  1XQH A;  3URG A;  1I81 A;  4C0D B;  4XAX B;  2RJC A;  4A53 A;  3MEU A;  4B9W A;  5GAN 7;  3OS2 A;  1ZQ1 A;  3QZ9 B;  4C0F A;  2VXE A;  3C4S A;  4MZP A;  3CMA T;  1Q82 U;  5LJ5 f;  4E7K A;  5GAO p;  2RJE A;  4FU6 A;  4FIB A;  5CKD A;  1KG1 A;  3AHU A;  1NZ9 A;  3CC4 A;  1WJS A;  2K4Y A;  2K5F A;  1K8A U;  1IZ6 A;  4J6Y A;  3P8D A;  4R55 A;  2L89 A;  3OYM A;  5IN1 A;  3BY7 A;  2DIQ A;  2FB7 A;  3CPF A;  4II1 A;  2RO0 A;  1Y96 A;  3VUZ A;  5FU6 C;  2L5Q A;  2LQK A;  2PQW A;  2ZPF B;  3OA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...