3LH0A

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k372me2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A01
3I56A 3ER0A 2PQWA 4N4GA 2E70A 3LYIA 3OYYA 3G6ET 4BE1A 3CCVT 5LL6S 3OYHA 2X35A 3ZEHA 2RHZA 2WACA 1S72T 3KBGA 3S3NA 1NJIU 4E7KA 4A4HA 3S6WA 1YHQT 1K9MC 1QVFA 1MHNA 1WJQA 5IN1A 2LTOA 1WGSA 3L2QA 2RHUA 3CCET 3DLLA 1W2BS 4IKFA 5J3BA 3DB4A 3UT1A 3OMCA 3JAME 2OTLA 4BDZA 3PMIA 3CD6A 3OYBA 4HCZA 3HKSA 1M90C 5KCHA 1VQ7A 1YJNA 2R5MA 2OTJT 2LQ8A 3OY9A 2R5AA 2RJEA 1K73C 2LCLA 3L2VA 1OI1A 3P8DA 4ZN3A 1VQ5A 1WJSA 4QQGA 2RJFA 3OYFA 1S72A 3QIIA 3QBYA 2JVVA 4QQ6A 1N8RU 4NS5A 4RG2A 3CCQA 3S3MA 3I55A 2LRQA 4FU6A 4PLIA 2E6ZA 2EIFA 2BUDA 3CC2A 3O8VA 5D6WA 4X34A 2O4XB 3P8HA 4QVZA 3CMAA 1Q81U 1VQPT 1QVGS 2X4YA 3SD4A 5IAYA 3QJ6A 4Z02A 3J7AF 3FLGA 4A4FA 4BE2A 2EQUA 4ZTJA 5IT9E 4YTLA 3L2WA 3NTHA 1VQ9T 2HQXA 3PIOA 3OYIA 1JJ2S 3KUFA 1YITT 2HQEA 2RHIA 2EFIA 1VQKA 2JOYA 3CXCS 3MEVA 4EDUA 1VQMA 4C5EA 2CKKA 3MEUA 3CCJA 2JNGA 2XHCA 1YIJT 3OS1A 2M0OA 2XDPA 3OS0A 2LDMA 3CC4A 3PIPA 5FRNA 1OYXA 2JTFA 1WJRA 4IUTA 5KE2A 1KQSS 4PLLA 3OS2A 3FDRA 3CCMA 2RI3A 1EIFA 3TREA 3CMAT 1X6OA 1JJ2A 4PL6A 3CCLT 3DB3A 3CC7A 1OZ2A 5D6YA 4E7JA 1RL2A 1QVGA 4GY5A 2EQMA 2GF7A 4II1A 2M16A 1KHCA 4IURA 1VQLA 3H6ZA 1Q82U 3CD6T 3MP1A 1M1KC 1YI2T 3M9QA 3CCUA 5A2QE 3CMET 4E7LA 3OYCA 1VQLT 4IUPA 1VQMT 2VYTA 3G4ST 3META 2E5QA 3CCJT 3I56T 2GFUA 3L2UA 3CCUT 2LCCA 2RI5A 1IZ6A 1W2BA 5D6XA 4N4HA 3NTIA 5FLXE 1VQ7T 5KE3A 4QQDA 1K8AU 1VQNT 3LGFA 3CCMT 2RHXA 4BACA 3OW2S 3CPFA 2RO0A 3CCLA 3Q1JA 3PMTA 1VQPA 1NPPA 2L3RA 2DIGA 2DO3A 3P8BB 3LGLA 1BKBA 5FRMA 4ZTFA 2QA4T 4BE0A 1VQ4A 1UEBA 1VQOT 1K8AC 1YI2A 1K9MU 3G6EA 3CPWA 3NTKA 2QEXA 2MWPA 3C4SA 3G4SA 2QA4A 3QKJA 4IUUA 1VQKT 3PNWC 2BIVA 2IG0A 3CEYA 4ZN1A 5HY6A 1G5VA 2KDSA 1XTDA 3LX7A 3FC3A 3OMGA 3F70A 2EKOA 1M1GA 2B8AA 2RHYA 5FROA 3MEWA 2JZ2A 4E7IA 2QQSA 4LD6A 2RJDA 2LVMA 3CPWS 3ME9A 2NLUA 2XK0A 1YIJA 1YJNT 3CXCA 4CRIA 1YJ9A 1VQ6A 1QVFS 3ASKA 4C5HA 4A4EA 3CCST 1Q81C 5J39A 2L8DA 3PFSA 5KCOA 2QEXT 3MO8A 1YJ9T 3CCRA 1YJWA 4B9XA 1NJIC 4BDYA 2X4WA 3DLMA 5CIUA 1N27A 1KD1C 3E9GA 3H8ZA 2KVQG 3FEOA 3E9FA 1NPRA 3CC7T 4L59A 2RJCA 3CCRT 1YJWT 2QQRA 1KD1U 1XNIA 1N8RC 3OYEA 3OYLA 2MI6A 1K73U 3OYAA 1VQ8A 3A5ZB 2BKDN 2RI2A 2MWOA 3OYDA 1Q86C 3CC2T 3EAEA 1YBYA 1M90U 3CMEA 1OZ3A 1VQNA 2JUFA 5C6SA 2R57A 3CCEA 1YITA 5M9OA 2EQJA 3G71A 3J80E 2X4XA 5DLQE 1YHQA 3CCSA 4IUQA 2E6NA 3J81E 4UC4A 2F5KA 3BDLA 2O4XA 1VQOA 3OYGA 3OQ5A 1SSFA 4C5IA 3MEAA 1KC8U 3CC4T 3LLRA 3S3OA 1VQ8T 2M1HA 3OYKA 1VQ4T 1Q7YU 1RI0A 4QW2A 1Q82C 1KHIA 2D9TA 1M1KU 2DAQA 1KQSA 5J26A 4FL6A 3GOXA 2G3RA 3G71T 4TVRA 3OW2A 3OB9A 4C5GA 4N4IA 5DM7R 1VQ5T 3CCVA 1KC8C 3L2RA 2R58A 5KH6A 2YRVA 3OYMA 1VQ6T 2EQKA 4Q5WA 5C0MA 1Q7YC 3CCQT 3I55T 3MP6A 2K3YA 4IUVA 2K3XA 2DIQA 4A4GA 2P0KA 3OYJA 2FHDA 3OYNA 2OTLT 3UWNA 4OVAA 4BD3A 3OA6A 3MP8A 3LH0A 1VQ9A 1Q86U 4B9WA 2GFAA 2L89A 1NZ9A 2OTJA 3L42A 4E7HA 1H3ZA
chains in the Genus database with same CATH superfamily
3I56A 4LDYA 3OYYA 3G6ET 4BE1A 1WI7A 2LQWA 8AT1B 4LNPA 2RHZA 2WSFE 4F7UF 1AEYA 1C0MA 4LN2A 1ZQ1A 2QYZA 4E7KA 1YHQT 1K9MC 2BZYA 1IB8A 2EJFA 2M51A 5FW9A 3CCUQ 2HKNA 2XU8A 3DLLA 1UDLA 5J3BA 1ZSZC 3SFMA 1WLPB 4WF2A 2KSSA 3OMCA 4JLIA 1AT1B 2CREA 1Q86R 2MK5A 1O75A 1ZBXA 3BW1A 2E3IA 2DEUA 2CP7A 4BY6C 1D0ZA 1WQ7A 4HCZA 2O9SA 2DILA 5I2SA 2E10A 1VQ4Q 1VQ7A 1YJNA 5LJ5g 1ZA2B 2OTJT 2LQ8A 3HFNA 5GANh 2XDBA 4JZ3A 4J9BA 4M7DE 4ZN3A 5L8RE 4M78D 2VB6A 3V8LA 2J7IA 4FU6A 1UTIA 2K3BA 5LJ3h 4QT7A 4JJBA 5KYXA 2EIFA 4ZGJB 1RABB 4HXJA 3G7ZA 3CC2A 1SEMA 4JRKA 5D6WA 2O4XB 1Q81U 4Y91A 3SD4A 5GMKj 2KGTA 2DERA 3M4YA 1H92A 4Z02A 5CO7A 4A4FA 4F14A 1VQPQ 4ZTJA 4C8QE 2ZPIB 3V8KA 1UGSB 4WCIA 4BI3A 3NTHA 1WQWA 1W4SA 1ZSGA 1F1BB 5GANj 1K0SA 1YITT 2HQEA 4ZNXA 3HRUA 3NMZC 4OP0A 3MEVA 4Y92A 4C0GA 3CXCS 1N8RR 2DRKA 4RTYA 4FIBA 4M7AD 2ZAEA 3MEUA 2JNGA 1MMAA 1YIJT 3OS1A 4LUDA 2ZPBB 2O9VA 5GANd 2M0OA 1LPLA 1WHHA 2DL3A 1QP2A 3VS6A 4OB0B 1VYTA 3OS0A 3HSBA 1OYXA 2C0IA 1WJRA 3A8GB 2QQ9A 1D1BA 1WXBA 5GAN8 2SEMA 3CMAT 4PL6A 4EMKB 4MDXA 1G2BA 3DB3A 2YXYA 1YWOA 1KFZA 3CC7A 1OZ2A 4M75G 3BE3A 1UUEA 3EGXA 1OOTA 3JCMh 1VQLA 4JRIA 4FM4B 1VQNQ 2LJ1A 1SF9A 5IHIA 5GAOl 2F69A 2AK5A 2D0QB 4E7LA 2KXDA 3OYCA 3WVDB 3EGXB 1XOVA 3GF5A 4LDXA 1YN8A 2CZ7B 3CCUT 2RPNA 1E7OA 3M0SA 4Z8AA 2V8KA 4E7ZA 2E1HA 5KE3A 1WHMA 2BE9B 1ARKA 4MZMA 4QQDA 4E6RA 1M8VA 2J06A 1Y07A 1M2VA 2COYA 2KT1A 3HP9A 1B3QA 3M55A 2DMOA 1C1AA 2L3PA 2L3RA 2DIGA 4M7AE 2JM8A 2L3SA 5GMKe 2DJQA 4HT9A 3CMAQ 3I5RA 2QA4T 2JTEA 1VQ4A 4PJOF 3GNGA 2E41A 4A4KA 2EJGA 3M0RA 1X75C 2X3WD 1QVGP 3I55Q 4OGCA 1KC8R 2E5KA 3OW2P 5A0GA 3UA7A 2ATCB 1N9SA 3SEMA 2J05A 4AG2C 4RCCA 2DZ9A 2YRCA 3WVEB 1K8AR 2LT1A 1VYVA 1VQKT 3NPFA 3PNWC 5AT1B 2EPDA 5IH2A 4ZN1A 3TEEA 3M58A 3FC3A 4RTUA 4HVWA 4JRQA 2EKOA 1M1GA 1VQ6Q 2RHYA 2RNAA 2QQSA 2YSQA 4PJNA 1BB9A 3BFMA 1M3AA 2QQBA 2RD1A 4A63B 3VU3C 4HCBA 3SDZA 2XK0A 3E1SA 4OMLA 1K9MR 3OBYA 1NEGA 5CCAA 1PC0A 4PJOD 2LNVA 1YJ9A 1JU5C 1QVFS 3ZFJA 3EG3A 1ZX6A 1RAIB 3A8LB 1QVPA 2W10A 3M56A 4B9XA 1PD1A 4PJOE 5I2MA 3OBWA 2HMAA 3H8ZA 3FEOA 2M02A 1MMGA 2HCKA 2PNIA 1X6GA 2YLCA 3REBB 1KD1U 1N8RC 3OYLA 4CI0C 5EC7A 4M77B 2BKDN 1K9AA 1QMCA 3OYDA 3VS0A 3LWIA 2HD0A 3QYHB 2V8IA 2KR3A 1SKUB 1K1ZA 1OZ3A 3CMEA 1VQNA 2JUFA 2NYSA 5C6SA 2R57A 3EFOA 2K6DA 1YITA 3RNJA 2EQIA 4J9EA 4F04B 3MKDA 2KAFA 4PJLA 2FRWA 4ATOA 2YT6A 1PG5B 3QZ5B 4JS4A 4MMKA 3BDLA 4M78F 1KD1R 4J7FA 1YJWQ 4JJDA 2FZCB 3RDVA 1X2KA 2ED1A 4BY6B 1A0NB 1KC8U 3REAB 2CGHA 2EAYA 2QI2A 2M1HA 3OYKA 3X25B 2YDLA 1IHVA 2ED0A 1Q82C 1H3HA 1U06A 3SWNB 5GMKl 5GANe 4J83A 1ZBJA 2DAQA 5GAN5 5J26A 2M0YA 4J9CA 4C5GA 2A36A 2EVRA 2X3XD 2YHTA 3IQLA 1KC8C 1MUZA 1OX8A 3A8HB 4J9GA 4D8DA 5KH6A 5GMKi 5GANg 2RF0A 1VQ6T 3EGDB 4M75D 3HPWA 4PFPA 3OSSC 1LCKA 4HCKA 1QWFA 3I55T 2QDYB 3HL8A 1B34A 5DLOA 4M7DA 2DETA 2DIQA 4A4GA 4BI8B 2HSPA 2KBTA 4M7DD 1YI2Q 1JXOA 5ECAA 1VQKQ 1NJIR 1OU8A 3A1PA 4QKUA 4ZGEB 2DPPB 2JTMA 1VA7A 3LH0A 3CXCP 1VQ9A 4DEXA 1PD0A 4KULA 3L42A 2CUBA 2EYQA 3CBOA 2RK2A 4K11A 2COZA 3LYIA 2COWA 3RKYA 5GAMf 5GAOr 2DL4A 3GBQA 5LL6S 1LJOA 3ZEHA 5IXFA 2CH4A 2AZSA 5GAN7 3S3NA 2F2XA 2ECZA 1NJIU 4A4HA 2DBKA 3S6WA 5LJ5j 1QVFA 4KGZB 1WJQA 5IN1A 3QDRB 1UJ0A 1WGSA 2LTOA 1Y0MA 2JS0A 4RTTA 1W2BS 3DB4A 2A28A 1G3TA 5GJVB 7AT1B 3G1JA 4AFZC 2DEQA 3CD6A 4JJNK 2XIDA 3HKSA 1M90C 2DYBA 2RQTA 3RKXA 1AOJA 1B34B 4HKEA 4PJMA 3V7SA 1BI1A 4CC2A 1K73C 2PUOB 1OI1A 3P8DA 4F7UE 1B07A 1D3BB 1WJSA 2ABLA 4J9DA 4QQGA 3L2ZA 3OYFA 3QIIA 3JB9H 1WX6A 2K5IA 4OMFB 3L1AA 1IRXA 2XKOC 4RKUE 3I55A 3R6OA 4PLIA 1M30A 1BI2A 1PHTA 2DLPA 4LD9K 4O6JA 1UFFA 4M78C 3CMAA 2QDLA 3HTRA 1VQPT 2QASA 2NUPA 4XQ3A 3VYHB 1QVGS 2DL7A 5IAYA 2B86A 1QLYA 8ATCB 2FPEA 3RMQA 3A8OB 1M2OA 2QXFA 2KEAA 1E6GA 1ZSZB 3L2WA 2RM4A 4J9HA 3UATA 4RMOA 4B6MA 3KUFA 1IREB 1GCPA 2RHIA 4M77G 1QP3A 4KGXB 1NE8A 1RAFB 4M7DB 1RAGB 1VQMA 2CKKA 4C92G 1B7TA 2Y90A 4PJJA 1BK2A 3O5ZA 4M75B 4QVCA 1D1AA 2PUKB 1VIEA 1WHGA 2K9GA 4IUTA 3EFSA 5GAMh 1KQSS 2RI3A 3GP8A 1MNEA 1XQHA 3TREA 1ABQA 3UA6A 3JB9D 3EGDA 1GRIA 1I8FA 1VOMA 2GQIA 1J3TA 2ZPEB 1K4US 4E7JA 1RL2A 4ANJA 1QVGA 3URGA 2GF7A 1JO8A 3R6NA 4IURA 5KYXB 1BBZA 3H6ZA 4M78E 4FYVB 2DL8A 3MP1A 4AFUC 4DQ2A 1V76A 5A2QE 3D7SB 3CMET 4IIOA 3KFVA 4KRTA 1VQMT 1RLPC 3QWXX 1AVZC 3META 1AHJB 1T3LA 2A3LA 2CP3A 2CZ0B 2E5QA 2GFUA 3I56T 4M7AG 3G4SQ 1C6VX 1IZ6A 4LDWA 1W2BA 2Y4YA 1QCFA 1M90R 2KK4A 2QK0A 4ME7A 2XICA 4O5VA 1BCOA 4CC3A 3C95A 1M27C 2K5LA 4E47A 4BACA 1QKWA 3I35A 4PK4A 1Y7XA 2DXTA 2L3QA 4LXCA 3M0QA 1VQPA 1HJDA 2JW4A 1YCYA 1AZGB 1E6HA 5LJ5f 1Y96A 2NUZA 1BKBA 5FRMA 1VQ8Q 2K4YA 2QGFB 2MAMA 3HRSA 4BE0A 4DA4A 2DKGA 2EYZA 1RLQC 1K9MU 1QQJA 4PJOG 2I2LA 3NTKA 2KQWA 2ZPFB 2HL3A 3EH1A 4DBQA 2A0FB 5GAOq 2CUDA 1YP5A 4IUUA 4C92F 4R56A 2IG0A 3CEYA 1XTDA 1I0CA 1I4K1 3M54A 4RTZA 3GIBA 1W1FA 2YLBA 5FROA 3MEWA 1WXTA 2JZ2A 2EW3A 4J8OA 1U1SA 2RJDA 2RQWA 1ZUKA 3ME9A 5CKBA 2BZXA 4C8QC 5DY9A 3JRZA 1H641 4N0AA 2CP2A 2PTKA 1GCQA 1NG2A 2ZPGB 2DFUA 2KYBA 1YJWA 4P5NA 4M77A 3JCMP 3DLMA 5CIUA 5HK3A 1ZUUA 2HL5C 1KD1C 4OMPA 1FMWA 2DRMA 3E9GA 2K57A 3V8JA 4C92A 4M7AF 1NYGA 1BIBA 2DJZA 3CCRT 5LJ3f 2LJ0A 2YUNA 1K73U 3OYAA 1Y71A 4OB1B 4F7UB 1H8KA 2MWOA 1Q86C 4DBFA 4C0ZA 1YBYA 1TS9A 2OJ2A 4PNOA 2X51A 1PKTA 5M9OA 2EQJA 3PTAA 4JRPA 2M9UA 1O9SA 3AT1B 2A7YA 2K2MA 1Q95G 3CC7Q 1WA7A 2X4XA 2YUQA 1BI3A 4E7SA 1V1CA 2GCXA 2OI3A 1TG0A 4KUIA 2IIMA 1PSEA 4M77D 2JJ9A 5GAMe 1RAEB 1D1CA 1OV3A 3OQ5A 5I11A 5CAIA 3MEAA 3H0FA 2RB6A 2CSQA 3JV3A 3CC4T 3LLRA 2QA4Q 1I5OB 3JCMX 3RIRA 1VQ8T 2IVWA 4M4ZA 1YJ9Q 4ESRA 1RI0A 2QQAA 4C92E 2DE0X 4C8QA 4RTWA 3FIFA 2E12A 2ROLA 2D9TA 4M75E 5CQXA 3GOXA 2G3RA 3GNFB 2D0NA 2DX1A 4PFZA 2OTLQ 3OW2A 3OB9A 3CQTA 1RAAB 4J6XA 3NGPA 5DM7R 1I07A 2D1XA 5LJ5h 3L2RA 2R58A 2EGCA 3DKMA 3MCAB 2KXCA 2EQKA 2ZZDA 4EMKA 3CCQT 4HVVA 1TUDA 2KNBB 2K3YA 1AD5A 2MMPA 2W0ZA 2CT3A 4FW1A 3C12A 4M7AB 2P0KA 2HAXA 2J6FA 2PU9B 4GLMA 2FHDA 2DBMA 1AWWA 2QTXA 3JCMW 4F7UG 3UWNA 2DVEA 1GFCA 1YWPA 4OMMA 4BD3A 5GAOm 3ZL7C 1X27A 3MP8A 2FO0A 4L5GA 1JRIA 1M3CA 2EKHA 3QZ9B 1R0CB 3JSCA 4HT8A 3GPLA 1I5LA 3VS4A 1LVKA 1S1NA 2PQWA 2E70A 1VQ7Q 5LJ5e 1UE9A 1N9RA 3OYHA 2CS7A 3CCQQ 2WACA 2KRSA 4FT4A 1NYFA 3ULRB 4M78B 1CSKA 2FYKA 1FXXA 2O88A 2AHJB 2EJ9A 5GAMj 2RHUA 3UT1A 3CCJQ 4M7DG 1FMVA 1WXUA 3M57A 5FU7C 4BDZA 3PMIA 6AT1B 3EG1A 3I5SA 2LQKA 1WFWA 3HFOA 4OMOA 5KCHA 4NL3A 2KI7A 2GBQA 3LW5E 2J6OA 2FVUA 3RERA 3CD6Q 3VUBA 3UPUA 3G71Q 2ENMA 2DXCA 3M53A 5KYWA 2JXBA 2DXBA 1IXDA 3JB9G 3L2VA 3QUIA 1IGUA 4X9DA 5L23A 2HDAA 3TQ7P 4CC7A 4WTOB 1XJWB 2RJFA 2EBPA 1HSQA 1W2BP 2FZGB 3EGUA 3FRNA 2DVJA 1N8RU 2DL5A 2VWFA 4AG1C 5CKEA 4RG2A 1ABOA 2WSCE 4KH0B 3CCQA 4C92D 1W6XA 2LRQA 2E6ZA 1X6BA 2MF2A 3C0CA 4X34A 3BDUA 4QVZA 1HD3A 5LJ3e 2CP5A 4E2FB 2X4YA 4JPBW 3H41A 3QJ6A 1T0HA 3FLGA 3QO3A 3CPWP 3EG9A 2EQUA 4BI4A 3RBBB 3VJPA 5IT9E 3PVQA 1VQ9Q 3JCMe 2KT8A 4YTLA 2AZVA 1VQ9T 3OYIA 1JJ2S 4RG8A 4FSXA 1KJWA 4EPCA 1N6AA 1RADB 4F17A 4D8KA 1VYUA 2EFIA 1BU1A 4EDUA 3VS1A 1Q82R 4M75F 2EYWA 4A54A 3CCJA 4ORZA 2FEIA 3CBPA 2XDDA 2DXUA 2CZ1B 5IHNA 1RUWA 2XDPA 1OPKA 1RAHB 4Z88A 3CC4A 3PIPA 5FRNA 3GLXA 3JCMQ 2JTFA 1VQOQ 4C92C 1JXMA 1RACB 1T0JA 5KE2A 4A53A 3I9QA 4ZGDB 4PLLA 3OS2A 3FDRA 2AKLA 1EIFA 1X6OA 2JMCA 3CCSQ 3AHUA 1GXIE 5HKCA 5D6YA 4JZ4A 2F5TX 1I1JA 5GAOn 4GY5A 1WHJA 3BY7A 4II1A 2M16A 5GJWB 4XU3A 1HK9A 3CCEQ 1IHWA 3CD6T 3V7RA 1MNDA 2OAUA 5EG2A 1M1KC 2FPFA 1YI2T 3NFCA 5CVIA 3CCUA 3JB9F 1WYXA 1BYMA 3RESA 4DEYA 4KH1B 1VQLT 5LJ3g 2VYTA 3JCMb 5AYFA 3CCJT 3L2UA 2P4RA 1TTHB 2KMTA 5GAMd 2C0OA 1FWZA 2RI5A 4VUBA 1WHLA 4N4HA 2P0PA 4FCYA 4ELYC 5I21A 5GMKm 2E4HA 1K8AU 4M77E 3C94A 3LGFA 1G83A 1NLPC 2RHXA 4MZPA 2Y4XA 2F1LA 4M78A 3Q1JA 1OULA 5CK9A 1ZHIA 1NPPA 1AWXA 3JB9I 2DTHA 1X43A 4XU1A 1MMDA 1N5ZA 2D8HA 2ZCFB 4MDWA 1PSFA 2DD4A 5IXBA 2ROTA 5CKFA 4MMLA 1GCQC 1UEBA 1VQOT 3SHWA 1K8AC 1YI2A 4J6YA 1Y96B 2JN0A 3CPWA 2E3HA 2MWPA 3M0PA 3CCMQ 4BUGA 1TXQA 3EH2A 2QA4A 3QXEB 3VS2A 1M1FA 1P92A 2LQNA 1T3SA 2BIVA 1Q7YR 3RR6A 4C0FA 1VQ5Q 1UGPB 1BI0A 1JB0E 1EFNA 2QTVA 1TSFA 5HY6A 1G5VA 3LX7A 1X69A 4XTYA 2LCSA 1M1KR 2B8AA 3LH5A 2EYXA 2E64A 2FRYA 3EHQA 5KYNA 1EZZB 2LP5A 2HEQA 2LVMA 2VGNA 1NM7A 2NLUA 4LDVA 2L2PA 5GMKh 1Y57A 3TSWA 3OS5A 3CXCA 2MIOA 3RKWA 1QCOA 2O31A 4J6WA 2NUPB 5J39A 5KCOA 1R0BG 3MO8A 1YJ9T 2K79A 3QHSA 1NJIC 3CC2Q 4BDYA 1X2QA 1V29B 1N27A 2KVQG 3E9FA 2QGGA 4L59A 3JCMg 1VIFA 2RJCA 1GL5A 2QQRA 1XNIA 2K7AA 3OYEA 4XTVA 1QVFP 4DOVA 1VQ8A 3A5ZB 2RI2A 1G3YA 3EAEA 1D3BA 2DF6A 1M90U 3UDCA 2KRNA 2HSEB 2HNIA 4LDUA 1KSWA 2MPXC 1K76A 2A08A 1PRLC 3JCMV 5LJ3j 1UGVA 4OGEA 3J80E 1YJNQ 2X9HA 2L0AA 4OB3B 4RUGA 5DLQE 3CCSA 1YHQA 1NBEB 1UHFA 3FJ5A 1PM3A 2EYYA 1NLOC 1ZUYA 2VXEA 2F5KA 2JS2A 2O4XA 1M8MA 3H0IA 2JM9A 3CCRQ 1SHFA 2EGAA 3OYGA 2DA9A 1PKSA 1GBQA 1ZSZA 4EMHA 2VASA 2PZ1A 4C8QD 4PJOA 2RK1A 4XTXA 4QW2A 2FL7A 4FYWB 1KHIA 1Z9QA 2MCNA 1ACMB 4FL6A 4X9CA 1M5Q1 4C92B 2OTJQ 9ATCB 4RCBA 2E65A 4AMCA 4N4IA 1VQ5T 3OSVA 2G6FX 3CCVA 2LX7A 4Z89A 4ELZC 3U23A 2HKQB 3MHXA 2V1RA 4CC4B 3OYMA 4JLGA 5GAN3 3ZBDA 4Q5WA 3JCMf 1SHGA 2H8HA 2KROA 5FU7B 1UHCA 1HXDA 1U5SA 4M77C 2ZPHB 1Q81R 4X1VA 4JUVA 4XAXB 1KK7A 2LMJA 3G6EQ 2D6FA 1AWOA 2VC8A 2H3EB 1YHQQ 1CKBA 2RQUA 2OTLT 1TH7A 2BE7D 5I22A 2Z0WA 3OA6A 2LT4A 1KQ1A 1FX7A 3MPUB 3QG1A 4B9WA 2GFAA 2VGMA 2L89A 3X26B 1TUGB 2D8JA 4E7HA 3X28B 2RMOA 3ER0A 4N4GA 2KY9A 5LJ5d 1GBRA 2VUBA 5KYYA 2L5QA 3CCVT 2RQVA 2GTJA 1JQQA 1JJ2P 2X35A 1M4ZA 1S72T 4QVDA 3KBGA 1MHNA 4V2SA 3SWNA 3M0TA 5GAOp 2LNHB 4R55A 3L2QA 3CCET 2RQRA 4KBMB 4IKFA 3UF4A 4XK8E 3JAME 2OTLA 1WPYA 4XU0A 1VQMQ 1VQLQ 5GAMg 4OMQA 2VVKA 3E19A 3OYBA 2YWWA 4M7AC 2C06A 1UB4A 2R5MA 2QAZA 1AZEA 1UG1A 3OY9A 1M3BA 2VV5A 1MV3A 2R5AA 2RJEA 4JS5A 2DD5A 3A8MB 2MOXA 2LCLA 2OX7A 4OF1A 1R77A 1UGRB 4KGVB 1VQ5A 1MV0B 3VS3A 1TU0B 3FJPA 4DBRA 3M59A 5FWCA 1S72A 3QBYA 2JVVA 3EFOB 4EMKC 4QQ6A 4NS5A 1PRMC 3QPHA 3S3MA 3EG9B 3RUXA 2BUDA 5KYUB 5GANf 2KYMA 2MYSA 5KYYB 3O8VA 4J5YA 3THKA 1SG5A 3P8HA 3VS5A 1WIEA 2DYIA 1R8OB 4J9IA 1QKXA 4NL2A 3J7AF 4GLKA 4BE2A 4FT2A 2LC4A 1LOJA 1LNXA 2F2WA 2HQXA 4M7DF 2BTTA 2A37A 2EGEA 3PIOA 4EIKA 2F2VA 2AIRB 1M2VB 4XTWA 1NEBA 1FMKA 1W70A 1VQKA 1AWJA 2JOYA 1U1TA 1KQ2A 4C5EA 4KUDK 1UECA 2XHCA 3PE0A 1QWEA 2CH4W 5GAN4 3HRTA 2GNCA 1S72Q 1QW1A 2LDMA 5IHKA 2DM1A 2K5FA 3VRZA 2DTIA 3N5BB 1G3SA 3CCMA 2O2OA 3TCJA 3VUZA 1EX4A 2QEXQ 1JJ2A 3T9NA 4XTUA 1UJYA 1OQKA 4M77F 4FYXB 3CCLT 2FZKB 3JCMJ 1M9SA 1YCSB 2JMAA 1TOVA 1KIKA 4HCCA 1WHKA 4M7AA 3EG0A 2VXFA 2EQMA 2CSIA 1KHCA 2CP6A 2RH2A 2XI9A 1D0YA 1JBMA 1ZA1B 1Q82U 2V8JA 3X24B 1FYNA 1K0XA 2OAWA 3VYGA 2NWMA 2KE9A 3M9QA 1WNLA 2LJ3A 2P0QA 4IUPA 1MMNA 3G4ST 1BCMA 1G3WA 2EWNA 2LCCA 4N0AC 3M0UA 1OPLA 5D6XA 1CKAA 3NTIA 5FLXE 1VQ7T 2PVGB 4C0DC 3QDFA 3INZA 2AKKA 2VKNA 4KT0E 3VKIA 3HHTB 2JT4A 1VQNT 3JCMc 3CCMT 4OB2B 2DTOA 3OW2S 2HZYA 3M4GA 2GTOA 2P4TA 3CPFA 4Y28E 5CKHA 2RO0A 3CCLA 3PMTA 2XD0A 3WXMB 2X4JA 2DO3A 5A0LA 3P8BB 3LGLA 1BIAA 5CQYA 2C0TA 3MJXA 4ZTFA 5A0DA 2ZGWA 3JCMd 1UGQB 3G6EA 2DZCA 2DNUA 2QEXA 1U3OA 3C4SA 4J9FA 4C8QF 3G4SA 2RA2A 3QKJA 1IO6A 4AFSC 1PCXA 4JJCA 5LJ3d 2XMFA 3CC4Q 4J7IA 5GAN6 3PGGA 2KDSA 1KQSP 3V7CA 1HYOA 3F70A 3OMGA 2CZ6B 2QG9B 3JB9J 4BB7A 1YIJQ 4E7IA 3CBMA 3VRYA 1OEBA 4LD6A 4FW2A 4L6V5 2YRDA 1Z9ZA 3CPWS 1G8XA 5KYUA 1YITQ 4M78G 2CT4A 4HA8A 1YIJA 1YJNT 3X20B 4CRIA 1VQ6A 3ASKA 2I0NA 5D7UA 4LUEA 5HCKA 1YNZA 4PJOB 1I81A 1TWBA 4C5HA 4A4EA 2K2VA 3CCST 1Q81C 2FB7A 2L8DA 2XG8D 3PFSA 2ESWA 4C0DB 3PVLA 1SPKA 2PVOB 1YFNA 2QEXT 4NOYA 3CCRA 4LE9A 2HBWA 2X4WA 4D6WA 1OU9A 4RTVA 4M7DC 4C8QB 4AFQC 4DBHA 2HBPA 4XU2A 1NPRA 3CC7T 3SWNC 1YJWT 2CYZB 3E2UA 4M75C 1X01A 2MI6A 2DK3A 4EMGA 3QSUA 1TUCA 2KRMA 2AT1B 3CC2T 4HVUA 3TU4K 2SRCA 1VUBA 4RTXA 1IGQA 3CCEA 4GBQA 4PJOC 2V26A 2IPOB 3QYGB 2HQHA 3G71A 2FG0A 1QCNA 5GAN2 4MZTA 4IUQA 1MGQA 1PWTA 2E6NA 4PFOA 3A98A 1SRLA 2PVDB 3J81E 4UC4A 3VS7A 1D09B 1VQOA 3VV0A 4C8QG 3RMSA 2GQVA 3NHNA 3QWYA 5FU6B 1K73R 1SRMA 1U8RA 4R0KA 1SSFA 4AT1B 4C5IA 5CR2A 2H3JA 1WZOA 2GGRA 2CP0A 3H9NA 3EHRA 1DJ7B 4OMNA 4JDSA 3S3OA 1KG1A 5FWBA 2O01E 2CDTA 3LWHA 2WSEE 1VQ4T 1Q7YU 2LZ6B 3SB2A 2LX9A 1SSHA 3TSZA 2YUPA 2BZ8A 3EG2A 5FU6C 4DOWA 1M1KU 1KQSA 2FPDA 3PT9A 3KXTA 3G71T 4TVRA 3EFRA 4XTZA 3FB9A 4FSSA 4PKCC 1WDXA 2J6KA 5HK0A 2RN8A 5CKDA 1JEGA 4F7UA 1RI9A 2YRVA 5C0MA 2P84A 1Q7YC 3TVTA 3MP6A 4IUVA 2K3XA 2V1QA 5KYWB 2NUTB 3OYJA 3M5AA 4FYYB 4IIMA 4F16A 1ZLMA 3OYNA 1GFDA 4OVAA 4M75A 1OX9A 3I56Q 1D0XA 2YUOA 3CCVQ 1Q86U 3CMEQ 2NUTA 3QJYA 1NZ9A 3CCLQ 2OTJA 1PNJA 3H0HA 1H3ZA
chains in the Genus database with same CATH topology
3I56A 3ER0A 2PQWA 4N4GA 2KY9A 2E70A 5LJ5d 3LYIA 4LDYA 2VUBA 3RKYA 3OYYA 5LJ5e 3G6ET 4BE1A 5GAMf 2L5QA 5GAOr 1N9RA 3CCVT 5LL6S 3OYHA 2X35A 1LJOA 2CS7A 3ZEHA 2RHZA 2WACA 1M4ZA 2WSFE 1S72T 4FT4A 4F7UF 5GAN7 4QVDA 3KBGA 3S3NA 1ZQ1A 4M78B 1NJIU 4E7KA 4A4HA 3S6WA 1YHQT 5LJ5j 1MHNA 2FYKA 1K9MC 1QVFA 4V2SA 3SWNA 1FXXA 1WJQA 5IN1A 2EJFA 3QDRB 2AHJB 2LTOA 1WGSA 2EJ9A 5GAOp 4R55A 3L2QA 5GAMj 2RHUA 3CCET 3DLLA 2XU8A 4KBMB 1W2BS 4IKFA 5J3BA 3DB4A 4XK8E 3SFMA 3UT1A 2KSSA 3OMCA 4JLIA 1G3TA 4WF2A 4M7DG 3JAME 2OTLA 1WPYA 1O75A 3M57A 1ZBXA 3BW1A 4XU0A 5FU7C 5GAMg 4BDZA 3PMIA 2DEQA 4BY6C 3CD6A 3E19A 3OYBA 4JJNK 2XIDA 1WQ7A 4HCZA 2LQKA 3HKSA 3HFOA 5I2SA 2E10A 1M90C 2C06A 5KCHA 4NL3A 1VQ7A 4M7AC 3LW5E 1YJNA 5LJ5g 2FVUA 3RKXA 1UB4A 2R5MA 3RERA 3VUBA 3UPUA 2OTJT 1B34B 2LQ8A 3HFNA 2DXCA 3OY9A 3M53A 4HKEA 3V7SA 2VV5A 2DXBA 1BI1A 2R5AA 3JB9G 2RJEA 4JS5A 5GANh 2XDBA 2DD5A 3A8MB 1K73C 2LCLA 3L2VA 3QUIA 2PUOB 4X9DA 4M7DE 1OI1A 3P8DA 1UGRB 4OF1A 4F7UE 4ZN3A 1D3BB 1WJSA 1VQ5A 5L8RE 3FJPA 4QQGA 2RJFA 3L2ZA 3M59A 3OYFA 1S72A 3GPLA 3QIIA 3QBYA 2JVVA 3FRNA 3JB9H 4EMKC 4QQ6A 1N8RU 2K5IA 4M78D 4OMFB 4NS5A 5CKEA 4RG2A 3L1AA 3QPHA 3V8LA 2XKOC 2WSCE 4RKUE 3CCQA 3S3MA 4C92D 3I55A 2LRQA 4FU6A 5LJ3h 3R6OA 4PLIA 3RUXA 2E6ZA 2EIFA 2BUDA 4ZGJB 3G7ZA 5GANf 3CC2A 1BI2A 2MF2A 4JRKA 3O8VA 4J5YA 5D6WA 4LD9K 4X34A 3BDUA 2O4XB 3P8HA 4O6JA 4M78C 4QVZA 3CMAA 5LJ3e 4Y91A 1VQPT 1Q81U 3VYHB 4XQ3A 1QVGS 2X4YA 3SD4A 1R8OB 5GMKj 5IAYA 3M4YA 3QJ6A 4NL2A 4Z02A 3J7AF 5CO7A 3FLGA 3QO3A 4GLKA 4A4FA 1H3ZA 4BE2A 2EQUA 4FT2A 4BI4A 4ZTJA 4C8QE 3RMQA 3A8OB 2LC4A 3VJPA 5IT9E 2QXFA 1LOJA 2ZPIB 3V8KA 1LNXA 1UGSB 3JCMe 4YTLA 3L2WA 4BI3A 3NTHA 1WQWA 1VQ9T 2HQXA 2RM4A 3PIOA 3OYIA 4M7DF 1JJ2S 4RG8A 1W4SA 4FSXA 4RMOA 5GANj 3KUFA 4EPCA 1IREB 4XTWA 1N6AA 1YITT 2HQEA 2RHIA 4M77G 2EFIA 1QP3A 1VQKA 3HRUA 2JOYA 4OP0A 1NE8A 3MEVA 4C0GA 3CXCS 4EDUA 4M7DB 1U1TA 1KQ2A 4FIBA 4M75F 1VQMA 4C5EA 4M7AD 4KUDK 2CKKA 3MEUA 4C92G 4A54A 3CCJA 2JNGA 2XHCA 2Y90A 1YIJT 3OS1A 2ZPBB 3CBPA 2XDDA 5GANd 2DXUA 3HRTA 5GAN4 2CZ1B 2M0OA 1QP2A 4M75B 4QVCA 4OB0B 1QW1A 2XDPA 3OS0A 2LDMA 3CC4A 3PIPA 3HSBA 5FRNA 3GLXA 2PUKB 1OYXA 1VIEA 2JTFA 3JCMQ 2K5FA 1WJRA 3A8GB 4IUTA 3EFSA 4C92C 5KE2A 2DTIA 5GAMh 4A53A 2QQ9A 4ZGDB 4PLLA 1KQSS 3N5BB 1G3SA 3FDRA 5GAN8 2RI3A 3OS2A 1EIFA 3GP8A 3CCMA 1XQHA 3TCJA 3TREA 3VUZA 3CMAT 1X6OA 1JJ2A 4PL6A 3T9NA 4XTUA 4EMKB 3JB9D 4MDXA 4M77F 1I8FA 3CCLT 3JCMJ 3DB3A 2ZPEB 1M9SA 3AHUA 1GXIE 5HKCA 3CC7A 1OZ2A 5D6YA 4M75G 2F5TX 4E7JA 1RL2A 4HCCA 4M7AA 5GAOn 1QVGA 4GY5A 2VXFA 2EQMA 3URGA 2GF7A 3BY7A 4II1A 2M16A 1KHCA 4XU3A 1HK9A 4IURA 2RH2A 2XI9A 1JBMA 4JRIA 3JCMh 1VQLA 3H6ZA 4FM4B 2V8JA 4M78E 1Q82U 3CD6T 3X24B 3V7RA 3VYGA 5GAOl 2OAUA 3MP1A 5EG2A 1M1KC 3M9QA 1YI2T 3NFCA 5CVIA 3CCUA 1WNLA 2F69A 4DQ2A 3JB9F 5A2QE 3CMET 2D0QB 4E7LA 1BYMA 3RESA 3OYCA 2P0QA 3WVDB 1VQLT 4IUPA 5LJ3g 2VYTA 3G4ST 3JCMb 1VQMT 3META 1XOVA 1AHJB 2A3LA 2CZ0B 2E5QA 3GF5A 5AYFA 2GFUA 3I56T 3CCJT 1I5LA 3L2UA 4LDXA 4M7AG 2EWNA 1G3WA 2KMTA 5GAMd 2CZ7B 2LCCA 3CCUT 1FWZA 2RI5A 4N0AC 4VUBA 1IZ6A 4LDWA 5D6XA 2Y4YA 1W2BA 4N4HA 3NTIA 2P0PA 5FLXE 1VQ7T 2PVGB 2V8KA 4C0DC 2KK4A 2E1HA 3INZA 4ME7A 4ELYC 2XICA 5I21A 5KE3A 4KT0E 4O5VA 4MZMA 4QQDA 5GMKm 1K8AU 3VKIA 1M8VA 4M77E 3HHTB 3C94A 1VQNT 3C95A 1Y07A 3LGFA 3JCMc 2RHXA 3CCMT 2K5LA 4MZPA 4OB2B 2DTOA 3HP9A 4E47A 4BACA 3M4GA 2Y4XA 3OW2S 3M55A 1Y7XA 2P4TA 3CPFA 4Y28E 2DXTA 2RO0A 4M78A 5CKHA 3CCLA 3Q1JA 5CK9A 1ZHIA 3PMTA 1VQPA 1NPPA 2XD0A 2L3RA 3WXMB 2DIGA 1YCYA 2X4JA 2DO3A 2DTHA 3JB9I 5A0LA 4XU1A 4M7AE 3P8BB 5LJ5f 5GMKe 1Y96A 3LGLA 4HT9A 1BKBA 1BIAA 5CQYA 5FRMA 2ZCFB 4ZTFA 2K4YA 4MDWA 1PSFA 2DD4A 2QA4T 5CKFA 2MAMA 3HRSA 5A0DA 4BE0A 4PJOF 1VQ4A 2ZGWA 3GNGA 4MMLA 4DA4A 1UEBA 2DKGA 2E41A 2EJGA 4A4KA 1VQOT 3JCMd 1K8AC 1YI2A 4J6YA 1X75C 1K9MU 1UGQB 1Y96B 2JN0A 4PJOG 3G6EA 2I2LA 4OGCA 3NTKA 2DZCA 2QEXA 2MWPA 3CPWA 2KQWA 3C4SA 5A0GA 2ZPFB 4C8QF 1N9SA 4BUGA 3G4SA 2RA2A 2QA4A 3QKJA 4RCCA 3QXEB 2DZ9A 5GAOq 1M1FA 1P92A 3WVEB 2LT1A 4IUUA 4C92F 4R56A 1VQKT 5LJ3d 3PNWC 2BIVA 2IG0A 4C0FA 3CEYA 1UGPB 1BI0A 4J7IA 1JB0E 4ZN1A 5HY6A 3TEEA 3PGGA 5GAN6 2KDSA 1G5VA 1XTDA 3LX7A 3M58A 3FC3A 3V7CA 3OMGA 3F70A 4XTYA 1I4K1 4JRQA 2EKOA 1M1GA 2CZ6B 3M54A 3GIBA 2B8AA 2YLBA 3JB9J 4BB7A 2RHYA 5FROA 3MEWA 2E64A 2JZ2A 3CBMA 4E7IA 2QQSA 4J8OA 3BFMA 4LD6A 1U1SA 2RJDA 4L6V5 2LVMA 2QQBA 2VGNA 2RD1A 3CPWS 3ME9A 3VU3C 4HCBA 3SDZA 2NLUA 4LDVA 5CKBA 2XK0A 4C8QC 4M78G 5GMKh 3E1SA 4HA8A 3OBYA 3OS5A 5CCAA 1YIJA 1YJNT 4PJOD 2LNVA 3X20B 4CRIA 3CXCA 3RKWA 1YJ9A 5DY9A 3ASKA 1QVFS 1VQ6A 3ZFJA 3JRZA 1H641 4PJOB 4N0AA 1I81A 4C5HA 4J6WA 4A4EA 2K2VA 3CCST 1Q81C 5J39A 3A8LB 2FB7A 2L8DA 2XG8D 3PFSA 5KCOA 2ZPGB 4C0DB 2QEXT 1QVPA 2PVOB 3MO8A 3CCRA 4NOYA 1YJ9T 1YJWA 3M56A 3QHSA 4P5NA 4B9XA 4M77A 4BDYA 1NJIC 3JCMP 2X4WA 3DLMA 5CIUA 4D6WA 5HK3A 1V29B 4PJOE 1N27A 4C8QB 4M7DC 5I2MA 1KD1C 3E9GA 3OBWA 3H8ZA 2KVQG 3FEOA 2K57A 2HBPA 3E9FA 4XU2A 1NPRA 3V8JA 4C92A 4M7AF 3CC7T 3SWNC 4L59A 3JCMg 1BIBA 1VIFA 2RJCA 2YLCA 2DJZA 3CCRT 5LJ3f 2CYZB 1YJWT 2QQRA 1KD1U 1XNIA 1N8RC 4M75C 1X01A 3OYEA 2MI6A 4CI0C 3OYLA 2DK3A 1K73U 4EMGA 4XTVA 4M77B 3OYAA 3QSUA 1Y71A 4DOVA 4OB1B 3A5ZB 4F7UB 2BKDN 1VQ8A 2RI2A 1G3YA 2MWOA 3OYDA 1Q86C 3LWIA 3CC2T 3EAEA 1D3BA 2HD0A 4C0ZA 1YBYA 1M90U 3UDCA 3QYHB 2V8IA 3CMEA 1OZ3A 3TU4K 2HNIA 4LDUA 1VQNA 2JUFA 1VUBA 5C6SA 2R57A 3CCEA 4PNOA 4PJOC 3QYGB 5M9OA 1YITA 2EQJA 3PTAA 3G71A 3JCMV 5LJ3j 4JRPA 2M9UA 4OGEA 3J80E 5GAN2 1O9SA 2A7YA 4ATOA 2KAFA 2X4XA 5DLQE 4OB3B 1YHQA 3CCSA 4MZTA 4IUQA 1MGQA 2E6NA 3QZ5B 1BI3A 2GCXA 2PVDB 3J81E 4KUIA 4UC4A 4JS4A 4MMKA 2VXEA 2F5KA 3BDLA 4M78F 1PSEA 2O4XA 4M77D 5GAMe 4J7FA 3VV0A 4C8QG 3RMSA 2GQVA 1VQOA 5FU6B 1U8RA 3OYGA 3OQ5A 1SSFA 4BY6B 5CAIA 4C5IA 3MEAA 5CR2A 1KC8U 2H3JA 2RB6A 4EMHA 2CGHA 2EAYA 3CC4T 1DJ7B 2QI2A 3LLRA 4C8QD 3JCMX 4JDSA 3RIRA 3S3OA 1VQ8T 4PJOA 2M1HA 1KG1A 2IVWA 2O01E 3OYKA 3LWHA 2RK1A 2WSEE 1VQ4T 1Q7YU 3X25B 1RI0A 2QQAA 4XTXA 3SB2A 2LX9A 4QW2A 4C92E 2FL7A 1Q82C 1KHIA 4C8QA 3SWNB 5FU6C 3FIFA 2E12A 4DOWA 5GANe 2D9TA 4J83A 5GMKl 4M75E 1M1KU 2DAQA 5GAN5 1KQSA 4FL6A 4X9CA 5J26A 5CQXA 3GOXA 2G3RA 1M5Q1 3GNFB 3PT9A 4C92B 3KXTA 3G71T 4TVRA 4RCBA 3OB9A 4C5GA 2E65A 3OW2A 3EFRA 4J6XA 4XTZA 4N4IA 3FB9A 2YHTA 5DM7R 3OSVA 1VQ5T 5LJ5h 4PKCC 3L2RA 3CCVA 5HK0A 1KC8C 2R58A 5CKDA 3A8HB 4ELZC 3DKMA 4F7UA 3MCAB 3MHXA 5KH6A 5GMKi 2YRVA 5GANg 3OYMA 4JLGA 5GAN3 2EQKA 1VQ6T 2ZZDA 4M75D 3HPWA 4Q5WA 3JCMf 3ZBDA 4EMKA 5C0MA 1Q7YC 3OSSC 5FU7B 3CCQT 1HXDA 3I55T 3MP6A 2K3YA 4M77C 2MMPA 2QDYB 2ZPHB 3HL8A 2K3XA 4IUVA 1B34A 5DLOA 4JUVA 4M7DA 4XAXB 2DIQA 4A4GA 3C12A 4M7AB 4BI8B 2D6FA 2P0KA 2HAXA 4M7DD 3OYJA 3M5AA 2PU9B 2VC8A 2FHDA 3OYNA 2QTXA 3JCMW 2OTLT 1TH7A 3UWNA 4F7UG 2DVEA 4OVAA 4M75A 4ZGEB 2DPPB 2JTMA 4BD3A 5GAOm 3OA6A 2LT4A 3MP8A 3LH0A 4L5GA 1KQ1A 1FX7A 1JRIA 1VQ9A 3QZ9B 1Q86U 3QG1A 4B9WA 2GFAA 2VGMA 2L89A 3QJYA 1NZ9A 3JSCA 3X26B 4HT8A 4KULA 2OTJA 3L42A 4E7HA 2EYQA 3X28B 3CBOA 2RK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 A;  3ER0 A;  2PQW A;  4N4G A;  2E70 A;  3LYI A;  3OYY A;  3G6E T;  4BE1 A;  3CCV T;  5LL6 S;  3OYH A;  2X35 A;  3ZEH A;  2RHZ A;  2WAC A;  1S72 T;  3KBG A;  3S3N A;  1NJI U;  4E7K A;  4A4H A;  3S6W A;  1YHQ T;  1K9M C;  1QVF A;  1MHN A;  1WJQ A;  5IN1 A;  2LTO A;  1WGS A;  3L2Q A;  2RHU A;  3CCE T;  3DLL A;  1W2B S;  4IKF A;  5J3B A;  3DB4 A;  3UT1 A;  3OMC A;  3JAM E;  2OTL A;  4BDZ A;  3PMI A;  3CD6 A;  3OYB A;  4HCZ A;  3HKS A;  1M90 C;  5KCH A;  1VQ7 A;  1YJN A;  2R5M A;  2OTJ T;  2LQ8 A;  3OY9 A;  2R5A A;  2RJE A;  1K73 C;  2LCL A;  3L2V A;  1OI1 A;  3P8D A;  4ZN3 A;  1VQ5 A;  1WJS A;  4QQG A;  2RJF A;  3OYF A;  1S72 A;  3QII A;  3QBY A;  2JVV A;  4QQ6 A;  1N8R U;  4NS5 A;  4RG2 A;  3CCQ A;  3S3M A;  3I55 A;  2LRQ A;  4FU6 A;  4PLI A;  2E6Z A;  2EIF A;  2BUD A;  3CC2 A;  3O8V A;  5D6W A;  4X34 A;  2O4X B;  3P8H A;  4QVZ A;  3CMA A;  1Q81 U;  1VQP T;  1QVG S;  2X4Y A;  3SD4 A;  5IAY A;  3QJ6 A;  4Z02 A;  3J7A F;  3FLG A;  4A4F A;  4BE2 A;  2EQU A;  4ZTJ A;  5IT9 E;  4YTL A;  3L2W A;  3NTH A;  1VQ9 T;  2HQX A;  3PIO A;  3OYI A;  1JJ2 S;  3KUF A;  1YIT T;  2HQE A;  2RHI A;  2EFI A;  1VQK A;  2JOY A;  3CXC S;  3MEV A;  4EDU A;  1VQM A;  4C5E A;  2CKK A;  3MEU A;  3CCJ A;  2JNG A;  2XHC A;  1YIJ T;  3OS1 A;  2M0O A;  2XDP A;  3OS0 A;  2LDM A;  3CC4 A;  3PIP A;  5FRN A;  1OYX A;  2JTF A;  1WJR A;  4IUT A;  5KE2 A;  1KQS S;  4PLL A;  3OS2 A;  3FDR A;  3CCM A;  2RI3 A;  1EIF A;  3TRE A;  3CMA T;  1X6O A;  1JJ2 A;  4PL6 A;  3CCL T;  3DB3 A;  3CC7 A;  1OZ2 A;  5D6Y A;  4E7J A;  1RL2 A;  1QVG A;  4GY5 A;  2EQM A;  2GF7 A;  4II1 A;  2M16 A;  1KHC A;  4IUR A;  1VQL A;  3H6Z A;  1Q82 U;  3CD6 T;  3MP1 A;  1M1K C;  1YI2 T;  3M9Q A;  3CCU A;  5A2Q E;  3CME T;  4E7L A;  3OYC A;  1VQL T;  4IUP A;  1VQM T;  2VYT A;  3G4S T;  3MET A;  2E5Q A;  3CCJ T;  3I56 T;  2GFU A;  3L2U A;  3CCU T;  2LCC A;  2RI5 A;  1IZ6 A;  1W2B A;  5D6X A;  4N4H A;  3NTI A;  5FLX E;  1VQ7 T;  5KE3 A;  4QQD A;  1K8A U;  1VQN T;  3LGF A;  3CCM T;  2RHX A;  4BAC A;  3OW2 S;  3CPF A;  2RO0 A;  3CCL A;  3Q1J A;  3PMT A;  1VQP A;  1NPP A;  2L3R A;  2DIG A;  2DO3 A;  3P8B B;  3LGL A;  1BKB A;  5FRM A;  4ZTF A;  2QA4 T;  4BE0 A;  1VQ4 A;  1UEB A;  1VQO T;  1K8A C;  1YI2 A;  1K9M U;  3G6E A;  3CPW A;  3NTK A;  2QEX A;  2MWP A;  3C4S A;  3G4S A;  2QA4 A;  3QKJ A;  4IUU A;  1VQK T;  3PNW C;  2BIV A;  2IG0 A;  3CEY A;  4ZN1 A;  5HY6 A;  1G5V A;  2KDS A;  1XTD A;  3LX7 A;  3FC3 A;  3OMG A;  3F70 A;  2EKO A;  1M1G A;  2B8A A;  2RHY A;  5FRO A;  3MEW A;  2JZ2 A;  4E7I A;  2QQS A;  4LD6 A;  2RJD A;  2LVM A;  3CPW S;  3ME9 A;  2NLU A;  2XK0 A;  1YIJ A;  1YJN T;  3CXC A;  4CRI A;  1YJ9 A;  1VQ6 A;  1QVF S;  3ASK A;  4C5H A;  4A4E A;  3CCS T;  1Q81 C;  5J39 A;  2L8D A;  3PFS A;  5KCO A;  2QEX T;  3MO8 A;  1YJ9 T;  3CCR A;  1YJW A;  4B9X A;  1NJI C;  4BDY A;  2X4W A;  3DLM A;  5CIU A;  1N27 A;  1KD1 C;  3E9G A;  3H8Z A;  2KVQ G;  3FEO A;  3E9F A;  1NPR A;  3CC7 T;  4L59 A;  2RJC A;  3CCR T;  1YJW T;  2QQR A;  1KD1 U;  1XNI A;  1N8R C;  3OYE A;  3OYL A;  2MI6 A;  1K73 U;  3OYA A;  1VQ8 A;  3A5Z B;  2BKD N;  2RI2 A;  2MWO A;  3OYD A;  1Q86 C;  3CC2 T;  3EAE A;  1YBY A;  1M90 U;  3CME A;  1OZ3 A;  1VQN A;  2JUF A;  5C6S A;  2R57 A;  3CCE A;  1YIT A;  5M9O A;  2EQJ A;  3G71 A;  3J80 E;  2X4X A;  5DLQ E;  1YHQ A;  3CCS A;  4IUQ A;  2E6N A;  3J81 E;  4UC4 A;  2F5K A;  3BDL A;  2O4X A;  1VQO A;  3OYG A;  3OQ5 A;  1SSF A;  4C5I A;  3MEA A;  1KC8 U;  3CC4 T;  3LLR A;  3S3O A;  1VQ8 T;  2M1H A;  3OYK A;  1VQ4 T;  1Q7Y U;  1RI0 A;  4QW2 A;  1Q82 C;  1KHI A;  2D9T A;  1M1K U;  2DAQ A;  1KQS A;  5J26 A;  4FL6 A;  3GOX A;  2G3R A;  3G71 T;  4TVR A;  3OW2 A;  3OB9 A;  4C5G A;  4N4I A;  5DM7 R;  1VQ5 T;  3CCV A;  1KC8 C;  3L2R A;  2R58 A;  5KH6 A;  2YRV A;  3OYM A;  1VQ6 T;  2EQK A;  4Q5W A;  5C0M A;  1Q7Y C;  3CCQ T;  3I55 T;  3MP6 A;  2K3Y A;  4IUV A;  2K3X A;  2DIQ A;  4A4G A;  2P0K A;  3OYJ A;  2FHD A;  3OYN A;  2OTL T;  3UWN A;  4OVA A;  4BD3 A;  3OA6 A;  3MP8 A;  3LH0 A;  1VQ9 A;  1Q86 U;  4B9W A;  2GFA A;  2L89 A;  1NZ9 A;  2OTJ A;  3L42 A;  4E7H A;  1H3Z A; 
#chains in the Genus database with same CATH topology
 3I56 A;  4LDY A;  3OYY A;  3G6E T;  4BE1 A;  1WI7 A;  2LQW A;  8AT1 B;  4LNP A;  2RHZ A;  2WSF E;  4F7U F;  1AEY A;  1C0M A;  4LN2 A;  1ZQ1 A;  2QYZ A;  4E7K A;  1YHQ T;  1K9M C;  2BZY A;  1IB8 A;  2EJF A;  2M51 A;  5FW9 A;  3CCU Q;  2HKN A;  2XU8 A;  3DLL A;  1UDL A;  5J3B A;  1ZSZ C;  3SFM A;  1WLP B;  4WF2 A;  2KSS A;  3OMC A;  4JLI A;  1AT1 B;  2CRE A;  1Q86 R;  2MK5 A;  1O75 A;  1ZBX A;  3BW1 A;  2E3I A;  2DEU A;  2CP7 A;  4BY6 C;  1D0Z A;  1WQ7 A;  4HCZ A;  2O9S A;  2DIL A;  5I2S A;  2E10 A;  1VQ4 Q;  1VQ7 A;  1YJN A;  5LJ5 g;  1ZA2 B;  2OTJ T;  2LQ8 A;  3HFN A;  5GAN h;  2XDB A;  4JZ3 A;  4J9B A;  4M7D E;  4ZN3 A;  5L8R E;  4M78 D;  2VB6 A;  3V8L A;  2J7I A;  4FU6 A;  1UTI A;  2K3B A;  5LJ3 h;  4QT7 A;  4JJB A;  5KYX A;  2EIF A;  4ZGJ B;  1RAB B;  4HXJ A;  3G7Z A;  3CC2 A;  1SEM A;  4JRK A;  5D6W A;  2O4X B;  1Q81 U;  4Y91 A;  3SD4 A;  5GMK j;  2KGT A;  2DER A;  3M4Y A;  1H92 A;  4Z02 A;  5CO7 A;  4A4F A;  4F14 A;  1VQP Q;  4ZTJ A;  4C8Q E;  2ZPI B;  3V8K A;  1UGS B;  4WCI A;  4BI3 A;  3NTH A;  1WQW A;  1W4S A;  1ZSG A;  1F1B B;  5GAN j;  1K0S A;  1YIT T;  2HQE A;  4ZNX A;  3HRU A;  3NMZ C;  4OP0 A;  3MEV A;  4Y92 A;  4C0G A;  3CXC S;  1N8R R;  2DRK A;  4RTY A;  4FIB A;  4M7A D;  2ZAE A;  3MEU A;  2JNG A;  1MMA A;  1YIJ T;  3OS1 A;  4LUD A;  2ZPB B;  2O9V A;  5GAN d;  2M0O A;  1LPL A;  1WHH A;  2DL3 A;  1QP2 A;  3VS6 A;  4OB0 B;  1VYT A;  3OS0 A;  3HSB A;  1OYX A;  2C0I A;  1WJR A;  3A8G B;  2QQ9 A;  1D1B A;  1WXB A;  5GAN 8;  2SEM A;  3CMA T;  4PL6 A;  4EMK B;  4MDX A;  1G2B A;  3DB3 A;  2YXY A;  1YWO A;  1KFZ A;  3CC7 A;  1OZ2 A;  4M75 G;  3BE3 A;  1UUE A;  3EGX A;  1OOT A;  3JCM h;  1VQL A;  4JRI A;  4FM4 B;  1VQN Q;  2LJ1 A;  1SF9 A;  5IHI A;  5GAO l;  2F69 A;  2AK5 A;  2D0Q B;  4E7L A;  2KXD A;  3OYC A;  3WVD B;  3EGX B;  1XOV A;  3GF5 A;  4LDX A;  1YN8 A;  2CZ7 B;  3CCU T;  2RPN A;  1E7O A;  3M0S A;  4Z8A A;  2V8K A;  4E7Z A;  2E1H A;  5KE3 A;  1WHM A;  2BE9 B;  1ARK A;  4MZM A;  4QQD A;  4E6R A;  1M8V A;  2J06 A;  1Y07 A;  1M2V A;  2COY A;  2KT1 A;  3HP9 A;  1B3Q A;  3M55 A;  2DMO A;  1C1A A;  2L3P A;  2L3R A;  2DIG A;  4M7A E;  2JM8 A;  2L3S A;  5GMK e;  2DJQ A;  4HT9 A;  3CMA Q;  3I5R A;  2QA4 T;  2JTE A;  1VQ4 A;  4PJO F;  3GNG A;  2E41 A;  4A4K A;  2EJG A;  3M0R A;  1X75 C;  2X3W D;  1QVG P;  3I55 Q;  4OGC A;  1KC8 R;  2E5K A;  3OW2 P;  5A0G A;  3UA7 A;  2ATC B;  1N9S A;  3SEM A;  2J05 A;  4AG2 C;  4RCC A;  2DZ9 A;  2YRC A;  3WVE B;  1K8A R;  2LT1 A;  1VYV A;  1VQK T;  3NPF A;  3PNW C;  5AT1 B;  2EPD A;  5IH2 A;  4ZN1 A;  3TEE A;  3M58 A;  3FC3 A;  4RTU A;  4HVW A;  4JRQ A;  2EKO A;  1M1G A;  1VQ6 Q;  2RHY A;  2RNA A;  2QQS A;  2YSQ A;  4PJN A;  1BB9 A;  3BFM A;  1M3A A;  2QQB A;  2RD1 A;  4A63 B;  3VU3 C;  4HCB A;  3SDZ A;  2XK0 A;  3E1S A;  4OML A;  1K9M R;  3OBY A;  1NEG A;  5CCA A;  1PC0 A;  4PJO D;  2LNV A;  1YJ9 A;  1JU5 C;  1QVF S;  3ZFJ A;  3EG3 A;  1ZX6 A;  1RAI B;  3A8L B;  1QVP A;  2W10 A;  3M56 A;  4B9X A;  1PD1 A;  4PJO E;  5I2M A;  3OBW A;  2HMA A;  3H8Z A;  3FEO A;  2M02 A;  1MMG A;  2HCK A;  2PNI A;  1X6G A;  2YLC A;  3REB B;  1KD1 U;  1N8R C;  3OYL A;  4CI0 C;  5EC7 A;  4M77 B;  2BKD N;  1K9A A;  1QMC A;  3OYD A;  3VS0 A;  3LWI A;  2HD0 A;  3QYH B;  2V8I A;  2KR3 A;  1SKU B;  1K1Z A;  1OZ3 A;  3CME A;  1VQN A;  2JUF A;  2NYS A;  5C6S A;  2R57 A;  3EFO A;  2K6D A;  1YIT A;  3RNJ A;  2EQI A;  4J9E A;  4F04 B;  3MKD A;  2KAF A;  4PJL A;  2FRW A;  4ATO A;  2YT6 A;  1PG5 B;  3QZ5 B;  4JS4 A;  4MMK A;  3BDL A;  4M78 F;  1KD1 R;  4J7F A;  1YJW Q;  4JJD A;  2FZC B;  3RDV A;  1X2K A;  2ED1 A;  4BY6 B;  1A0N B;  1KC8 U;  3REA B;  2CGH A;  2EAY A;  2QI2 A;  2M1H A;  3OYK A;  3X25 B;  2YDL A;  1IHV A;  2ED0 A;  1Q82 C;  1H3H A;  1U06 A;  3SWN B;  5GMK l;  5GAN e;  4J83 A;  1ZBJ A;  2DAQ A;  5GAN 5;  5J26 A;  2M0Y A;  4J9C A;  4C5G A;  2A36 A;  2EVR A;  2X3X D;  2YHT A;  3IQL A;  1KC8 C;  1MUZ A;  1OX8 A;  3A8H B;  4J9G A;  4D8D A;  5KH6 A;  5GMK i;  5GAN g;  2RF0 A;  1VQ6 T;  3EGD B;  4M75 D;  3HPW A;  4PFP A;  3OSS C;  1LCK A;  4HCK A;  1QWF A;  3I55 T;  2QDY B;  3HL8 A;  1B34 A;  5DLO A;  4M7D A;  2DET A;  2DIQ A;  4A4G A;  4BI8 B;  2HSP A;  2KBT A;  4M7D D;  1YI2 Q;  1JXO A;  5ECA A;  1VQK Q;  1NJI R;  1OU8 A;  3A1P A;  4QKU A;  4ZGE B;  2DPP B;  2JTM A;  1VA7 A;  3LH0 A;  3CXC P;  1VQ9 A;  4DEX A;  1PD0 A;  4KUL A;  3L42 A;  2CUB A;  2EYQ A;  3CBO A;  2RK2 A;  4K11 A;  2COZ A;  3LYI A;  2COW A;  3RKY A;  5GAM f;  5GAO r;  2DL4 A;  3GBQ A;  5LL6 S;  1LJO A;  3ZEH A;  5IXF A;  2CH4 A;  2AZS A;  5GAN 7;  3S3N A;  2F2X A;  2ECZ A;  1NJI U;  4A4H A;  2DBK A;  3S6W A;  5LJ5 j;  1QVF A;  4KGZ B;  1WJQ A;  5IN1 A;  3QDR B;  1UJ0 A;  1WGS A;  2LTO A;  1Y0M A;  2JS0 A;  4RTT A;  1W2B S;  3DB4 A;  2A28 A;  1G3T A;  5GJV B;  7AT1 B;  3G1J A;  4AFZ C;  2DEQ A;  3CD6 A;  4JJN K;  2XID A;  3HKS A;  1M90 C;  2DYB A;  2RQT A;  3RKX A;  1AOJ A;  1B34 B;  4HKE A;  4PJM A;  3V7S A;  1BI1 A;  4CC2 A;  1K73 C;  2PUO B;  1OI1 A;  3P8D A;  4F7U E;  1B07 A;  1D3B B;  1WJS A;  2ABL A;  4J9D A;  4QQG A;  3L2Z A;  3OYF A;  3QII A;  3JB9 H;  1WX6 A;  2K5I A;  4OMF B;  3L1A A;  1IRX A;  2XKO C;  4RKU E;  3I55 A;  3R6O A;  4PLI A;  1M30 A;  1BI2 A;  1PHT A;  2DLP A;  4LD9 K;  4O6J A;  1UFF A;  4M78 C;  3CMA A;  2QDL A;  3HTR A;  1VQP T;  2QAS A;  2NUP A;  4XQ3 A;  3VYH B;  1QVG S;  2DL7 A;  5IAY A;  2B86 A;  1QLY A;  8ATC B;  2FPE A;  3RMQ A;  3A8O B;  1M2O A;  2QXF A;  2KEA A;  1E6G A;  1ZSZ B;  3L2W A;  2RM4 A;  4J9H A;  3UAT A;  4RMO A;  4B6M A;  3KUF A;  1IRE B;  1GCP A;  2RHI A;  4M77 G;  1QP3 A;  4KGX B;  1NE8 A;  1RAF B;  4M7D B;  1RAG B;  1VQM A;  2CKK A;  4C92 G;  1B7T A;  2Y90 A;  4PJJ A;  1BK2 A;  3O5Z A;  4M75 B;  4QVC A;  1D1A A;  2PUK B;  1VIE A;  1WHG A;  2K9G A;  4IUT A;  3EFS A;  5GAM h;  1KQS S;  2RI3 A;  3GP8 A;  1MNE A;  1XQH A;  3TRE A;  1ABQ A;  3UA6 A;  3JB9 D;  3EGD A;  1GRI A;  1I8F A;  1VOM A;  2GQI A;  1J3T A;  2ZPE B;  1K4U S;  4E7J A;  1RL2 A;  4ANJ A;  1QVG A;  3URG A;  2GF7 A;  1JO8 A;  3R6N A;  4IUR A;  5KYX B;  1BBZ A;  3H6Z A;  4M78 E;  4FYV B;  2DL8 A;  3MP1 A;  4AFU C;  4DQ2 A;  1V76 A;  5A2Q E;  3D7S B;  3CME T;  4IIO A;  3KFV A;  4KRT A;  1VQM T;  1RLP C;  3QWX X;  1AVZ C;  3MET A;  1AHJ B;  1T3L A;  2A3L A;  2CP3 A;  2CZ0 B;  2E5Q A;  2GFU A;  3I56 T;  4M7A G;  3G4S Q;  1C6V X;  1IZ6 A;  4LDW A;  1W2B A;  2Y4Y A;  1QCF A;  1M90 R;  2KK4 A;  2QK0 A;  4ME7 A;  2XIC A;  4O5V A;  1BCO A;  4CC3 A;  3C95 A;  1M27 C;  2K5L A;  4E47 A;  4BAC A;  1QKW A;  3I35 A;  4PK4 A;  1Y7X A;  2DXT A;  2L3Q A;  4LXC A;  3M0Q A;  1VQP A;  1HJD A;  2JW4 A;  1YCY A;  1AZG B;  1E6H A;  5LJ5 f;  1Y96 A;  2NUZ A;  1BKB A;  5FRM A;  1VQ8 Q;  2K4Y A;  2QGF B;  2MAM A;  3HRS A;  4BE0 A;  4DA4 A;  2DKG A;  2EYZ A;  1RLQ C;  1K9M U;  1QQJ A;  4PJO G;  2I2L A;  3NTK A;  2KQW A;  2ZPF B;  2HL3 A;  3EH1 A;  4DBQ A;  2A0F B;  5GAO q;  2CUD A;  1YP5 A;  4IUU A;  4C92 F;  4R56 A;  2IG0 A;  3CEY A;  1XTD A;  1I0C A;  1I4K 1;  3M54 A;  4RTZ A;  3GIB A;  1W1F A;  2YLB A;  5FRO A;  3MEW A;  1WXT A;  2JZ2 A;  2EW3 A;  4J8O A;  1U1S A;  2RJD A;  2RQW A;  1ZUK A;  3ME9 A;  5CKB A;  2BZX A;  4C8Q C;  5DY9 A;  3JRZ A;  1H64 1;  4N0A A;  2CP2 A;  2PTK A;  1GCQ A;  1NG2 A;  2ZPG B;  2DFU A;  2KYB A;  1YJW A;  4P5N A;  4M77 A;  3JCM P;  3DLM A;  5CIU A;  5HK3 A;  1ZUU A;  2HL5 C;  1KD1 C;  4OMP A;  1FMW A;  2DRM A;  3E9G A;  2K57 A;  3V8J A;  4C92 A;  4M7A F;  1NYG A;  1BIB A;  2DJZ A;  3CCR T;  5LJ3 f;  2LJ0 A;  2YUN A;  1K73 U;  3OYA A;  1Y71 A;  4OB1 B;  4F7U B;  1H8K A;  2MWO A;  1Q86 C;  4DBF A;  4C0Z A;  1YBY A;  1TS9 A;  2OJ2 A;  4PNO A;  2X51 A;  1PKT A;  5M9O A;  2EQJ A;  3PTA A;  4JRP A;  2M9U A;  1O9S A;  3AT1 B;  2A7Y A;  2K2M A;  1Q95 G;  3CC7 Q;  1WA7 A;  2X4X A;  2YUQ A;  1BI3 A;  4E7S A;  1V1C A;  2GCX A;  2OI3 A;  1TG0 A;  4KUI A;  2IIM A;  1PSE A;  4M77 D;  2JJ9 A;  5GAM e;  1RAE B;  1D1C A;  1OV3 A;  3OQ5 A;  5I11 A;  5CAI A;  3MEA A;  3H0F A;  2RB6 A;  2CSQ A;  3JV3 A;  3CC4 T;  3LLR A;  2QA4 Q;  1I5O B;  3JCM X;  3RIR A;  1VQ8 T;  2IVW A;  4M4Z A;  1YJ9 Q;  4ESR A;  1RI0 A;  2QQA A;  4C92 E;  2DE0 X;  4C8Q A;  4RTW A;  3FIF A;  2E12 A;  2ROL A;  2D9T A;  4M75 E;  5CQX A;  3GOX A;  2G3R A;  3GNF B;  2D0N A;  2DX1 A;  4PFZ A;  2OTL Q;  3OW2 A;  3OB9 A;  3CQT A;  1RAA B;  4J6X A;  3NGP A;  5DM7 R;  1I07 A;  2D1X A;  5LJ5 h;  3L2R A;  2R58 A;  2EGC A;  3DKM A;  3MCA B;  2KXC A;  2EQK A;  2ZZD A;  4EMK A;  3CCQ T;  4HVV A;  1TUD A;  2KNB B;  2K3Y A;  1AD5 A;  2MMP A;  2W0Z A;  2CT3 A;  4FW1 A;  3C12 A;  4M7A B;  2P0K A;  2HAX A;  2J6F A;  2PU9 B;  4GLM A;  2FHD A;  2DBM A;  1AWW A;  2QTX A;  3JCM W;  4F7U G;  3UWN A;  2DVE A;  1GFC A;  1YWP A;  4OMM A;  4BD3 A;  5GAO m;  3ZL7 C;  1X27 A;  3MP8 A;  2FO0 A;  4L5G A;  1JRI A;  1M3C A;  2EKH A;  3QZ9 B;  1R0C B;  3JSC A;  4HT8 A;  3GPL A;  1I5L A;  3VS4 A;  1LVK A;  1S1N A;  2PQW A;  2E70 A;  1VQ7 Q;  5LJ5 e;  1UE9 A;  1N9R A;  3OYH A;  2CS7 A;  3CCQ Q;  2WAC A;  2KRS A;  4FT4 A;  1NYF A;  3ULR B;  4M78 B;  1CSK A;  2FYK A;  1FXX A;  2O88 A;  2AHJ B;  2EJ9 A;  5GAM j;  2RHU A;  3UT1 A;  3CCJ Q;  4M7D G;  1FMV A;  1WXU A;  3M57 A;  5FU7 C;  4BDZ A;  3PMI A;  6AT1 B;  3EG1 A;  3I5S A;  2LQK A;  1WFW A;  3HFO A;  4OMO A;  5KCH A;  4NL3 A;  2KI7 A;  2GBQ A;  3LW5 E;  2J6O A;  2FVU A;  3RER A;  3CD6 Q;  3VUB A;  3UPU A;  3G71 Q;  2ENM A;  2DXC A;  3M53 A;  5KYW A;  2JXB A;  2DXB A;  1IXD A;  3JB9 G;  3L2V A;  3QUI A;  1IGU A;  4X9D A;  5L23 A;  2HDA A;  3TQ7 P;  4CC7 A;  4WTO B;  1XJW B;  2RJF A;  2EBP A;  1HSQ A;  1W2B P;  2FZG B;  3EGU A;  3FRN A;  2DVJ A;  1N8R U;  2DL5 A;  2VWF A;  4AG1 C;  5CKE A;  4RG2 A;  1ABO A;  2WSC E;  4KH0 B;  3CCQ A;  4C92 D;  1W6X A;  2LRQ A;  2E6Z A;  1X6B A;  2MF2 A;  3C0C A;  4X34 A;  3BDU A;  4QVZ A;  1HD3 A;  5LJ3 e;  2CP5 A;  4E2F B;  2X4Y A;  4JPB W;  3H41 A;  3QJ6 A;  1T0H A;  3FLG A;  3QO3 A;  3CPW P;  3EG9 A;  2EQU A;  4BI4 A;  3RBB B;  3VJP A;  5IT9 E;  3PVQ A;  1VQ9 Q;  3JCM e;  2KT8 A;  4YTL A;  2AZV A;  1VQ9 T;  3OYI A;  1JJ2 S;  4RG8 A;  4FSX A;  1KJW A;  4EPC A;  1N6A A;  1RAD B;  4F17 A;  4D8K A;  1VYU A;  2EFI A;  1BU1 A;  4EDU A;  3VS1 A;  1Q82 R;  4M75 F;  2EYW A;  4A54 A;  3CCJ A;  4ORZ A;  2FEI A;  3CBP A;  2XDD A;  2DXU A;  2CZ1 B;  5IHN A;  1RUW A;  2XDP A;  1OPK A;  1RAH B;  4Z88 A;  3CC4 A;  3PIP A;  5FRN A;  3GLX A;  3JCM Q;  2JTF A;  1VQO Q;  4C92 C;  1JXM A;  1RAC B;  1T0J A;  5KE2 A;  4A53 A;  3I9Q A;  4ZGD B;  4PLL A;  3OS2 A;  3FDR A;  2AKL A;  1EIF A;  1X6O A;  2JMC A;  3CCS Q;  3AHU A;  1GXI E;  5HKC A;  5D6Y A;  4JZ4 A;  2F5T X;  1I1J A;  5GAO n;  4GY5 A;  1WHJ A;  3BY7 A;  4II1 A;  2M16 A;  5GJW B;  4XU3 A;  1HK9 A;  3CCE Q;  1IHW A;  3CD6 T;  3V7R A;  1MND A;  2OAU A;  5EG2 A;  1M1K C;  2FPF A;  1YI2 T;  3NFC A;  5CVI A;  3CCU A;  3JB9 F;  1WYX A;  1BYM A;  3RES A;  4DEY A;  4KH1 B;  1VQL T;  5LJ3 g;  2VYT A;  3JCM b;  5AYF A;  3CCJ T;  3L2U A;  2P4R A;  1TTH B;  2KMT A;  5GAM d;  2C0O A;  1FWZ A;  2RI5 A;  4VUB A;  1WHL A;  4N4H A;  2P0P A;  4FCY A;  4ELY C;  5I21 A;  5GMK m;  2E4H A;  1K8A U;  4M77 E;  3C94 A;  3LGF A;  1G83 A;  1NLP C;  2RHX A;  4MZP A;  2Y4X A;  2F1L A;  4M78 A;  3Q1J A;  1OUL A;  5CK9 A;  1ZHI A;  1NPP A;  1AWX A;  3JB9 I;  2DTH A;  1X43 A;  4XU1 A;  1MMD A;  1N5Z A;  2D8H A;  2ZCF B;  4MDW A;  1PSF A;  2DD4 A;  5IXB A;  2ROT A;  5CKF A;  4MML A;  1GCQ C;  1UEB A;  1VQO T;  3SHW A;  1K8A C;  1YI2 A;  4J6Y A;  1Y96 B;  2JN0 A;  3CPW A;  2E3H A;  2MWP A;  3M0P A;  3CCM Q;  4BUG A;  1TXQ A;  3EH2 A;  2QA4 A;  3QXE B;  3VS2 A;  1M1F A;  1P92 A;  2LQN A;  1T3S A;  2BIV A;  1Q7Y R;  3RR6 A;  4C0F A;  1VQ5 Q;  1UGP B;  1BI0 A;  1JB0 E;  1EFN A;  2QTV A;  1TSF A;  5HY6 A;  1G5V A;  3LX7 A;  1X69 A;  4XTY A;  2LCS A;  1M1K R;  2B8A A;  3LH5 A;  2EYX A;  2E64 A;  2FRY A;  3EHQ A;  5KYN A;  1EZZ B;  2LP5 A;  2HEQ A;  2LVM A;  2VGN A;  1NM7 A;  2NLU A;  4LDV A;  2L2P A;  5GMK h;  1Y57 A;  3TSW A;  3OS5 A;  3CXC A;  2MIO A;  3RKW A;  1QCO A;  2O31 A;  4J6W A;  2NUP B;  5J39 A;  5KCO A;  1R0B G;  3MO8 A;  1YJ9 T;  2K79 A;  3QHS A;  1NJI C;  3CC2 Q;  4BDY A;  1X2Q A;  1V29 B;  1N27 A;  2KVQ G;  3E9F A;  2QGG A;  4L59 A;  3JCM g;  1VIF A;  2RJC A;  1GL5 A;  2QQR A;  1XNI A;  2K7A A;  3OYE A;  4XTV A;  1QVF P;  4DOV A;  1VQ8 A;  3A5Z B;  2RI2 A;  1G3Y A;  3EAE A;  1D3B A;  2DF6 A;  1M90 U;  3UDC A;  2KRN A;  2HSE B;  2HNI A;  4LDU A;  1KSW A;  2MPX C;  1K76 A;  2A08 A;  1PRL C;  3JCM V;  5LJ3 j;  1UGV A;  4OGE A;  3J80 E;  1YJN Q;  2X9H A;  2L0A A;  4OB3 B;  4RUG A;  5DLQ E;  3CCS A;  1YHQ A;  1NBE B;  1UHF A;  3FJ5 A;  1PM3 A;  2EYY A;  1NLO C;  1ZUY A;  2VXE A;  2F5K A;  2JS2 A;  2O4X A;  1M8M A;  3H0I A;  2JM9 A;  3CCR Q;  1SHF A;  2EGA A;  3OYG A;  2DA9 A;  1PKS A;  1GBQ A;  1ZSZ A;  4EMH A;  2VAS A;  2PZ1 A;  4C8Q D;  4PJO A;  2RK1 A;  4XTX A;  4QW2 A;  2FL7 A;  4FYW B;  1KHI A;  1Z9Q A;  2MCN A;  1ACM B;  4FL6 A;  4X9C A;  1M5Q 1;  4C92 B;  2OTJ Q;  9ATC B;  4RCB A;  2E65 A;  4AMC A;  4N4I A;  1VQ5 T;  3OSV A;  2G6F X;  3CCV A;  2LX7 A;  4Z89 A;  4ELZ C;  3U23 A;  2HKQ B;  3MHX A;  2V1R A;  4CC4 B;  3OYM A;  4JLG A;  5GAN 3;  3ZBD A;  4Q5W A;  3JCM f;  1SHG A;  2H8H A;  2KRO A;  5FU7 B;  1UHC A;  1HXD A;  1U5S A;  4M77 C;  2ZPH B;  1Q81 R;  4X1V A;  4JUV A;  4XAX B;  1KK7 A;  2LMJ A;  3G6E Q;  2D6F A;  1AWO A;  2VC8 A;  2H3E B;  1YHQ Q;  1CKB A;  2RQU A;  2OTL T;  1TH7 A;  2BE7 D;  5I22 A;  2Z0W A;  3OA6 A;  2LT4 A;  1KQ1 A;  1FX7 A;  3MPU B;  3QG1 A;  4B9W A;  2GFA A;  2VGM A;  2L89 A;  3X26 B;  1TUG B;  2D8J A;  4E7H A;  3X28 B;  2RMO A;  3ER0 A;  4N4G A;  2KY9 A;  5LJ5 d;  1GBR A;  2VUB A;  5KYY A;  2L5Q A;  3CCV T;  2RQV A;  2GTJ A;  1JQQ A;  1JJ2 P;  2X35 A;  1M4Z A;  1S72 T;  4QVD A;  3KBG A;  1MHN A;  4V2S A;  3SWN A;  3M0T A;  5GAO p;  2LNH B;  4R55 A;  3L2Q A;  3CCE T;  2RQR A;  4KBM B;  4IKF A;  3UF4 A;  4XK8 E;  3JAM E;  2OTL A;  1WPY A;  4XU0 A;  1VQM Q;  1VQL Q;  5GAM g;  4OMQ A;  2VVK A;  3E19 A;  3OYB A;  2YWW A;  4M7A C;  2C06 A;  1UB4 A;  2R5M A;  2QAZ A;  1AZE A;  1UG1 A;  3OY9 A;  1M3B A;  2VV5 A;  1MV3 A;  2R5A A;  2RJE A;  4JS5 A;  2DD5 A;  3A8M B;  2MOX A;  2LCL A;  2OX7 A;  4OF1 A;  1R77 A;  1UGR B;  4KGV B;  1VQ5 A;  1MV0 B;  3VS3 A;  1TU0 B;  3FJP A;  4DBR A;  3M59 A;  5FWC A;  1S72 A;  3QBY A;  2JVV A;  3EFO B;  4EMK C;  4QQ6 A;  4NS5 A;  1PRM C;  3QPH A;  3S3M A;  3EG9 B;  3RUX A;  2BUD A;  5KYU B;  5GAN f;  2KYM A;  2MYS A;  5KYY B;  3O8V A;  4J5Y A;  3THK A;  1SG5 A;  3P8H A;  3VS5 A;  1WIE A;  2DYI A;  1R8O B;  4J9I A;  1QKX A;  4NL2 A;  3J7A F;  4GLK A;  4BE2 A;  4FT2 A;  2LC4 A;  1LOJ A;  1LNX A;  2F2W A;  2HQX A;  4M7D F;  2BTT A;  2A37 A;  2EGE A;  3PIO A;  4EIK A;  2F2V A;  2AIR B;  1M2V B;  4XTW A;  1NEB A;  1FMK A;  1W70 A;  1VQK A;  1AWJ A;  2JOY A;  1U1T A;  1KQ2 A;  4C5E A;  4KUD K;  1UEC A;  2XHC A;  3PE0 A;  1QWE A;  2CH4 W;  5GAN 4;  3HRT A;  2GNC A;  1S72 Q;  1QW1 A;  2LDM A;  5IHK A;  2DM1 A;  2K5F A;  3VRZ A;  2DTI A;  3N5B B;  1G3S A;  3CCM A;  2O2O A;  3TCJ A;  3VUZ A;  1EX4 A;  2QEX Q;  1JJ2 A;  3T9N A;  4XTU A;  1UJY A;  1OQK A;  4M77 F;  4FYX B;  3CCL T;  2FZK B;  3JCM J;  1M9S A;  1YCS B;  2JMA A;  1TOV A;  1KIK A;  4HCC A;  1WHK A;  4M7A A;  3EG0 A;  2VXF A;  2EQM A;  2CSI A;  1KHC A;  2CP6 A;  2RH2 A;  2XI9 A;  1D0Y A;  1JBM A;  1ZA1 B;  1Q82 U;  2V8J A;  3X24 B;  1FYN A;  1K0X A;  2OAW A;  3VYG A;  2NWM A;  2KE9 A;  3M9Q A;  1WNL A;  2LJ3 A;  2P0Q A;  4IUP A;  1MMN A;  3G4S T;  1BCM A;  1G3W A;  2EWN A;  2LCC A;  4N0A C;  3M0U A;  1OPL A;  5D6X A;  1CKA A;  3NTI A;  5FLX E;  1VQ7 T;  2PVG B;  4C0D C;  3QDF A;  3INZ A;  2AKK A;  2VKN A;  4KT0 E;  3VKI A;  3HHT B;  2JT4 A;  1VQN T;  3JCM c;  3CCM T;  4OB2 B;  2DTO A;  3OW2 S;  2HZY A;  3M4G A;  2GTO A;  2P4T A;  3CPF A;  4Y28 E;  5CKH A;  2RO0 A;  3CCL A;  3PMT A;  2XD0 A;  3WXM B;  2X4J A;  2DO3 A;  5A0L A;  3P8B B;  3LGL A;  1BIA A;  5CQY A;  2C0T A;  3MJX A;  4ZTF A;  5A0D A;  2ZGW A;  3JCM d;  1UGQ B;  3G6E A;  2DZC A;  2DNU A;  2QEX A;  1U3O A;  3C4S A;  4J9F A;  4C8Q F;  3G4S A;  2RA2 A;  3QKJ A;  1IO6 A;  4AFS C;  1PCX A;  4JJC A;  5LJ3 d;  2XMF A;  3CC4 Q;  4J7I A;  5GAN 6;  3PGG A;  2KDS A;  1KQS P;  3V7C A;  1HYO A;  3F70 A;  3OMG A;  2CZ6 B;  2QG9 B;  3JB9 J;  4BB7 A;  1YIJ Q;  4E7I A;  3CBM A;  3VRY A;  1OEB A;  4LD6 A;  4FW2 A;  4L6V 5;  2YRD A;  1Z9Z A;  3CPW S;  1G8X A;  5KYU A;  1YIT Q;  4M78 G;  2CT4 A;  4HA8 A;  1YIJ A;  1YJN T;  3X20 B;  4CRI A;  1VQ6 A;  3ASK A;  2I0N A;  5D7U A;  4LUE A;  5HCK A;  1YNZ A;  4PJO B;  1I81 A;  1TWB A;  4C5H A;  4A4E A;  2K2V A;  3CCS T;  1Q81 C;  2FB7 A;  2L8D A;  2XG8 D;  3PFS A;  2ESW A;  4C0D B;  3PVL A;  1SPK A;  2PVO B;  1YFN A;  2QEX T;  4NOY A;  3CCR A;  4LE9 A;  2HBW A;  2X4W A;  4D6W A;  1OU9 A;  4RTV A;  4M7D C;  4C8Q B;  4AFQ C;  4DBH A;  2HBP A;  4XU2 A;  1NPR A;  3CC7 T;  3SWN C;  1YJW T;  2CYZ B;  3E2U A;  4M75 C;  1X01 A;  2MI6 A;  2DK3 A;  4EMG A;  3QSU A;  1TUC A;  2KRM A;  2AT1 B;  3CC2 T;  4HVU A;  3TU4 K;  2SRC A;  1VUB A;  4RTX A;  1IGQ A;  3CCE A;  4GBQ A;  4PJO C;  2V26 A;  2IPO B;  3QYG B;  2HQH A;  3G71 A;  2FG0 A;  1QCN A;  5GAN 2;  4MZT A;  4IUQ A;  1MGQ A;  1PWT A;  2E6N A;  4PFO A;  3A98 A;  1SRL A;  2PVD B;  3J81 E;  4UC4 A;  3VS7 A;  1D09 B;  1VQO A;  3VV0 A;  4C8Q G;  3RMS A;  2GQV A;  3NHN A;  3QWY A;  5FU6 B;  1K73 R;  1SRM A;  1U8R A;  4R0K A;  1SSF A;  4AT1 B;  4C5I A;  5CR2 A;  2H3J A;  1WZO A;  2GGR A;  2CP0 A;  3H9N A;  3EHR A;  1DJ7 B;  4OMN A;  4JDS A;  3S3O A;  1KG1 A;  5FWB A;  2O01 E;  2CDT A;  3LWH A;  2WSE E;  1VQ4 T;  1Q7Y U;  2LZ6 B;  3SB2 A;  2LX9 A;  1SSH A;  3TSZ A;  2YUP A;  2BZ8 A;  3EG2 A;  5FU6 C;  4DOW A;  1M1K U;  1KQS A;  2FPD A;  3PT9 A;  3KXT A;  3G71 T;  4TVR A;  3EFR A;  4XTZ A;  3FB9 A;  4FSS A;  4PKC C;  1WDX A;  2J6K A;  5HK0 A;  2RN8 A;  5CKD A;  1JEG A;  4F7U A;  1RI9 A;  2YRV A;  5C0M A;  2P84 A;  1Q7Y C;  3TVT A;  3MP6 A;  4IUV A;  2K3X A;  2V1Q A;  5KYW B;  2NUT B;  3OYJ A;  3M5A A;  4FYY B;  4IIM A;  4F16 A;  1ZLM A;  3OYN A;  1GFD A;  4OVA A;  4M75 A;  1OX9 A;  3I56 Q;  1D0X A;  2YUO A;  3CCV Q;  1Q86 U;  3CME Q;  2NUT A;  3QJY A;  1NZ9 A;  3CCL Q;  2OTJ A;  1PNJ A;  3H0H A;  1H3Z A; 
#chains in the Genus database with same CATH homology
 3I56 A;  3ER0 A;  2PQW A;  4N4G A;  2KY9 A;  2E70 A;  5LJ5 d;  3LYI A;  4LDY A;  2VUB A;  3RKY A;  3OYY A;  5LJ5 e;  3G6E T;  4BE1 A;  5GAM f;  2L5Q A;  5GAO r;  1N9R A;  3CCV T;  5LL6 S;  3OYH A;  2X35 A;  1LJO A;  2CS7 A;  3ZEH A;  2RHZ A;  2WAC A;  1M4Z A;  2WSF E;  1S72 T;  4FT4 A;  4F7U F;  5GAN 7;  4QVD A;  3KBG A;  3S3N A;  1ZQ1 A;  4M78 B;  1NJI U;  4E7K A;  4A4H A;  3S6W A;  1YHQ T;  5LJ5 j;  1MHN A;  2FYK A;  1K9M C;  1QVF A;  4V2S A;  3SWN A;  1FXX A;  1WJQ A;  5IN1 A;  2EJF A;  3QDR B;  2AHJ B;  2LTO A;  1WGS A;  2EJ9 A;  5GAO p;  4R55 A;  3L2Q A;  5GAM j;  2RHU A;  3CCE T;  3DLL A;  2XU8 A;  4KBM B;  1W2B S;  4IKF A;  5J3B A;  3DB4 A;  4XK8 E;  3SFM A;  3UT1 A;  2KSS A;  3OMC A;  4JLI A;  1G3T A;  4WF2 A;  4M7D G;  3JAM E;  2OTL A;  1WPY A;  1O75 A;  3M57 A;  1ZBX A;  3BW1 A;  4XU0 A;  5FU7 C;  5GAM g;  4BDZ A;  3PMI A;  2DEQ A;  4BY6 C;  3CD6 A;  3E19 A;  3OYB A;  4JJN K;  2XID A;  1WQ7 A;  4HCZ A;  2LQK A;  3HKS A;  3HFO A;  5I2S A;  2E10 A;  1M90 C;  2C06 A;  5KCH A;  4NL3 A;  1VQ7 A;  4M7A C;  3LW5 E;  1YJN A;  5LJ5 g;  2FVU A;  3RKX A;  1UB4 A;  2R5M A;  3RER A;  3VUB A;  3UPU A;  2OTJ T;  1B34 B;  2LQ8 A;  3HFN A;  2DXC A;  3OY9 A;  3M53 A;  4HKE A;  3V7S A;  2VV5 A;  2DXB A;  1BI1 A;  2R5A A;  3JB9 G;  2RJE A;  4JS5 A;  5GAN h;  2XDB A;  2DD5 A;  3A8M B;  1K73 C;  2LCL A;  3L2V A;  3QUI A;  2PUO B;  4X9D A;  4M7D E;  1OI1 A;  3P8D A;  1UGR B;  4OF1 A;  4F7U E;  4ZN3 A;  1D3B B;  1WJS A;  1VQ5 A;  5L8R E;  3FJP A;  4QQG A;  2RJF A;  3L2Z A;  3M59 A;  3OYF A;  1S72 A;  3GPL A;  3QII A;  3QBY A;  2JVV A;  3FRN A;  3JB9 H;  4EMK C;  4QQ6 A;  1N8R U;  2K5I A;  4M78 D;  4OMF B;  4NS5 A;  5CKE A;  4RG2 A;  3L1A A;  3QPH A;  3V8L A;  2XKO C;  2WSC E;  4RKU E;  3CCQ A;  3S3M A;  4C92 D;  3I55 A;  2LRQ A;  4FU6 A;  5LJ3 h;  3R6O A;  4PLI A;  3RUX A;  2E6Z A;  2EIF A;  2BUD A;  4ZGJ B;  3G7Z A;  5GAN f;  3CC2 A;  1BI2 A;  2MF2 A;  4JRK A;  3O8V A;  4J5Y A;  5D6W A;  4LD9 K;  4X34 A;  3BDU A;  2O4X B;  3P8H A;  4O6J A;  4M78 C;  4QVZ A;  3CMA A;  5LJ3 e;  4Y91 A;  1VQP T;  1Q81 U;  3VYH B;  4XQ3 A;  1QVG S;  2X4Y A;  3SD4 A;  1R8O B;  5GMK j;  5IAY A;  3M4Y A;  3QJ6 A;  4NL2 A;  4Z02 A;  3J7A F;  5CO7 A;  3FLG A;  3QO3 A;  4GLK A;  4A4F A;  1H3Z A;  4BE2 A;  2EQU A;  4FT2 A;  4BI4 A;  4ZTJ A;  4C8Q E;  3RMQ A;  3A8O B;  2LC4 A;  3VJP A;  5IT9 E;  2QXF A;  1LOJ A;  2ZPI B;  3V8K A;  1LNX A;  1UGS B;  3JCM e;  4YTL A;  3L2W A;  4BI3 A;  3NTH A;  1WQW A;  1VQ9 T;  2HQX A;  2RM4 A;  3PIO A;  3OYI A;  4M7D F;  1JJ2 S;  4RG8 A;  1W4S A;  4FSX A;  4RMO A;  5GAN j;  3KUF A;  4EPC A;  1IRE B;  4XTW A;  1N6A A;  1YIT T;  2HQE A;  2RHI A;  4M77 G;  2EFI A;  1QP3 A;  1VQK A;  3HRU A;  2JOY A;  4OP0 A;  1NE8 A;  3MEV A;  4C0G A;  3CXC S;  4EDU A;  4M7D B;  1U1T A;  1KQ2 A;  4FIB A;  4M75 F;  1VQM A;  4C5E A;  4M7A D;  4KUD K;  2CKK A;  3MEU A;  4C92 G;  4A54 A;  3CCJ A;  2JNG A;  2XHC A;  2Y90 A;  1YIJ T;  3OS1 A;  2ZPB B;  3CBP A;  2XDD A;  5GAN d;  2DXU A;  3HRT A;  5GAN 4;  2CZ1 B;  2M0O A;  1QP2 A;  4M75 B;  4QVC A;  4OB0 B;  1QW1 A;  2XDP A;  3OS0 A;  2LDM A;  3CC4 A;  3PIP A;  3HSB A;  5FRN A;  3GLX A;  2PUK B;  1OYX A;  1VIE A;  2JTF A;  3JCM Q;  2K5F A;  1WJR A;  3A8G B;  4IUT A;  3EFS A;  4C92 C;  5KE2 A;  2DTI A;  5GAM h;  4A53 A;  2QQ9 A;  4ZGD B;  4PLL A;  1KQS S;  3N5B B;  1G3S A;  3FDR A;  5GAN 8;  2RI3 A;  3OS2 A;  1EIF A;  3GP8 A;  3CCM A;  1XQH A;  3TCJ A;  3TRE A;  3VUZ A;  3CMA T;  1X6O A;  1JJ2 A;  4PL6 A;  3T9N A;  4XTU A;  4EMK B;  3JB9 D;  4MDX A;  4M77 F;  1I8F A;  3CCL T;  3JCM J;  3DB3 A;  2ZPE B;  1M9S A;  3AHU A;  1GXI E;  5HKC A;  3CC7 A;  1OZ2 A;  5D6Y A;  4M75 G;  2F5T X;  4E7J A;  1RL2 A;  4HCC A;  4M7A A;  5GAO n;  1QVG A;  4GY5 A;  2VXF A;  2EQM A;  3URG A;  2GF7 A;  3BY7 A;  4II1 A;  2M16 A;  1KHC A;  4XU3 A;  1HK9 A;  4IUR A;  2RH2 A;  2XI9 A;  1JBM A;  4JRI A;  3JCM h;  1VQL A;  3H6Z A;  4FM4 B;  2V8J A;  4M78 E;  1Q82 U;  3CD6 T;  3X24 B;  3V7R A;  3VYG A;  5GAO l;  2OAU A;  3MP1 A;  5EG2 A;  1M1K C;  3M9Q A;  1YI2 T;  3NFC A;  5CVI A;  3CCU A;  1WNL A;  2F69 A;  4DQ2 A;  3JB9 F;  5A2Q E;  3CME T;  2D0Q B;  4E7L A;  1BYM A;  3RES A;  3OYC A;  2P0Q A;  3WVD B;  1VQL T;  4IUP A;  5LJ3 g;  2VYT A;  3G4S T;  3JCM b;  1VQM T;  3MET A;  1XOV A;  1AHJ B;  2A3L A;  2CZ0 B;  2E5Q A;  3GF5 A;  5AYF A;  2GFU A;  3I56 T;  3CCJ T;  1I5L A;  3L2U A;  4LDX A;  4M7A G;  2EWN A;  1G3W A;  2KMT A;  5GAM d;  2CZ7 B;  2LCC A;  3CCU T;  1FWZ A;  2RI5 A;  4N0A C;  4VUB A;  1IZ6 A;  4LDW A;  5D6X A;  2Y4Y A;  1W2B A;  4N4H A;  3NTI A;  2P0P A;  5FLX E;  1VQ7 T;  2PVG B;  2V8K A;  4C0D C;  2KK4 A;  2E1H A;  3INZ A;  4ME7 A;  4ELY C;  2XIC A;  5I21 A;  5KE3 A;  4KT0 E;  4O5V A;  4MZM A;  4QQD A;  5GMK m;  1K8A U;  3VKI A;  1M8V A;  4M77 E;  3HHT B;  3C94 A;  1VQN T;  3C95 A;  1Y07 A;  3LGF A;  3JCM c;  2RHX A;  3CCM T;  2K5L A;  4MZP A;  4OB2 B;  2DTO A;  3HP9 A;  4E47 A;  4BAC A;  3M4G A;  2Y4X A;  3OW2 S;  3M55 A;  1Y7X A;  2P4T A;  3CPF A;  4Y28 E;  2DXT A;  2RO0 A;  4M78 A;  5CKH A;  3CCL A;  3Q1J A;  5CK9 A;  1ZHI A;  3PMT A;  1VQP A;  1NPP A;  2XD0 A;  2L3R A;  3WXM B;  2DIG A;  1YCY A;  2X4J A;  2DO3 A;  2DTH A;  3JB9 I;  5A0L A;  4XU1 A;  4M7A E;  3P8B B;  5LJ5 f;  5GMK e;  1Y96 A;  3LGL A;  4HT9 A;  1BKB A;  1BIA A;  5CQY A;  5FRM A;  2ZCF B;  4ZTF A;  2K4Y A;  4MDW A;  1PSF A;  2DD4 A;  2QA4 T;  5CKF A;  2MAM A;  3HRS A;  5A0D A;  4BE0 A;  4PJO F;  1VQ4 A;  2ZGW A;  3GNG A;  4MML A;  4DA4 A;  1UEB A;  2DKG A;  2E41 A;  2EJG A;  4A4K A;  1VQO T;  3JCM d;  1K8A C;  1YI2 A;  4J6Y A;  1X75 C;  1K9M U;  1UGQ B;  1Y96 B;  2JN0 A;  4PJO G;  3G6E A;  2I2L A;  4OGC A;  3NTK A;  2DZC A;  2QEX A;  2MWP A;  3CPW A;  2KQW A;  3C4S A;  5A0G A;  2ZPF B;  4C8Q F;  1N9S A;  4BUG A;  3G4S A;  2RA2 A;  2QA4 A;  3QKJ A;  4RCC A;  3QXE B;  2DZ9 A;  5GAO q;  1M1F A;  1P92 A;  3WVE B;  2LT1 A;  4IUU A;  4C92 F;  4R56 A;  1VQK T;  5LJ3 d;  3PNW C;  2BIV A;  2IG0 A;  4C0F A;  3CEY A;  1UGP B;  1BI0 A;  4J7I A;  1JB0 E;  4ZN1 A;  5HY6 A;  3TEE A;  3PGG A;  5GAN 6;  2KDS A;  1G5V A;  1XTD A;  3LX7 A;  3M58 A;  3FC3 A;  3V7C A;  3OMG A;  3F70 A;  4XTY A;  1I4K 1;  4JRQ A;  2EKO A;  1M1G A;  2CZ6 B;  3M54 A;  3GIB A;  2B8A A;  2YLB A;  3JB9 J;  4BB7 A;  2RHY A;  5FRO A;  3MEW A;  2E64 A;  2JZ2 A;  3CBM A;  4E7I A;  2QQS A;  4J8O A;  3BFM A;  4LD6 A;  1U1S A;  2RJD A;  4L6V 5;  2LVM A;  2QQB A;  2VGN A;  2RD1 A;  3CPW S;  3ME9 A;  3VU3 C;  4HCB A;  3SDZ A;  2NLU A;  4LDV A;  5CKB A;  2XK0 A;  4C8Q C;  4M78 G;  5GMK h;  3E1S A;  4HA8 A;  3OBY A;  3OS5 A;  5CCA A;  1YIJ A;  1YJN T;  4PJO D;  2LNV A;  3X20 B;  4CRI A;  3CXC A;  3RKW A;  1YJ9 A;  5DY9 A;  3ASK A;  1QVF S;  1VQ6 A;  3ZFJ A;  3JRZ A;  1H64 1;  4PJO B;  4N0A A;  1I81 A;  4C5H A;  4J6W A;  4A4E A;  2K2V A;  3CCS T;  1Q81 C;  5J39 A;  3A8L B;  2FB7 A;  2L8D A;  2XG8 D;  3PFS A;  5KCO A;  2ZPG B;  4C0D B;  2QEX T;  1QVP A;  2PVO B;  3MO8 A;  3CCR A;  4NOY A;  1YJ9 T;  1YJW A;  3M56 A;  3QHS A;  4P5N A;  4B9X A;  4M77 A;  4BDY A;  1NJI C;  3JCM P;  2X4W A;  3DLM A;  5CIU A;  4D6W A;  5HK3 A;  1V29 B;  4PJO E;  1N27 A;  4C8Q B;  4M7D C;  5I2M A;  1KD1 C;  3E9G A;  3OBW A;  3H8Z A;  2KVQ G;  3FEO A;  2K57 A;  2HBP A;  3E9F A;  4XU2 A;  1NPR A;  3V8J A;  4C92 A;  4M7A F;  3CC7 T;  3SWN C;  4L59 A;  3JCM g;  1BIB A;  1VIF A;  2RJC A;  2YLC A;  2DJZ A;  3CCR T;  5LJ3 f;  2CYZ B;  1YJW T;  2QQR A;  1KD1 U;  1XNI A;  1N8R C;  4M75 C;  1X01 A;  3OYE A;  2MI6 A;  4CI0 C;  3OYL A;  2DK3 A;  1K73 U;  4EMG A;  4XTV A;  4M77 B;  3OYA A;  3QSU A;  1Y71 A;  4DOV A;  4OB1 B;  3A5Z B;  4F7U B;  2BKD N;  1VQ8 A;  2RI2 A;  1G3Y A;  2MWO A;  3OYD A;  1Q86 C;  3LWI A;  3CC2 T;  3EAE A;  1D3B A;  2HD0 A;  4C0Z A;  1YBY A;  1M90 U;  3UDC A;  3QYH B;  2V8I A;  3CME A;  1OZ3 A;  3TU4 K;  2HNI A;  4LDU A;  1VQN A;  2JUF A;  1VUB A;  5C6S A;  2R57 A;  3CCE A;  4PNO A;  4PJO C;  3QYG B;  5M9O A;  1YIT A;  2EQJ A;  3PTA A;  3G71 A;  3JCM V;  5LJ3 j;  4JRP A;  2M9U A;  4OGE A;  3J80 E;  5GAN 2;  1O9S A;  2A7Y A;  4ATO A;  2KAF A;  2X4X A;  5DLQ E;  4OB3 B;  1YHQ A;  3CCS A;  4MZT A;  4IUQ A;  1MGQ A;  2E6N A;  3QZ5 B;  1BI3 A;  2GCX A;  2PVD B;  3J81 E;  4KUI A;  4UC4 A;  4JS4 A;  4MMK A;  2VXE A;  2F5K A;  3BDL A;  4M78 F;  1PSE A;  2O4X A;  4M77 D;  5GAM e;  4J7F A;  3VV0 A;  4C8Q G;  3RMS A;  2GQV A;  1VQO A;  5FU6 B;  1U8R A;  3OYG A;  3OQ5 A;  1SSF A;  4BY6 B;  5CAI A;  4C5I A;  3MEA A;  5CR2 A;  1KC8 U;  2H3J A;  2RB6 A;  4EMH A;  2CGH A;  2EAY A;  3CC4 T;  1DJ7 B;  2QI2 A;  3LLR A;  4C8Q D;  3JCM X;  4JDS A;  3RIR A;  3S3O A;  1VQ8 T;  4PJO A;  2M1H A;  1KG1 A;  2IVW A;  2O01 E;  3OYK A;  3LWH A;  2RK1 A;  2WSE E;  1VQ4 T;  1Q7Y U;  3X25 B;  1RI0 A;  2QQA A;  4XTX A;  3SB2 A;  2LX9 A;  4QW2 A;  4C92 E;  2FL7 A;  1Q82 C;  1KHI A;  4C8Q A;  3SWN B;  5FU6 C;  3FIF A;  2E12 A;  4DOW A;  5GAN e;  2D9T A;  4J83 A;  5GMK l;  4M75 E;  1M1K U;  2DAQ A;  5GAN 5;  1KQS A;  4FL6 A;  4X9C A;  5J26 A;  5CQX A;  3GOX A;  2G3R A;  1M5Q 1;  3GNF B;  3PT9 A;  4C92 B;  3KXT A;  3G71 T;  4TVR A;  4RCB A;  3OB9 A;  4C5G A;  2E65 A;  3OW2 A;  3EFR A;  4J6X A;  4XTZ A;  4N4I A;  3FB9 A;  2YHT A;  5DM7 R;  3OSV A;  1VQ5 T;  5LJ5 h;  4PKC C;  3L2R A;  3CCV A;  5HK0 A;  1KC8 C;  2R58 A;  5CKD A;  3A8H B;  4ELZ C;  3DKM A;  4F7U A;  3MCA B;  3MHX A;  5KH6 A;  5GMK i;  2YRV A;  5GAN g;  3OYM A;  4JLG A;  5GAN 3;  2EQK A;  1VQ6 T;  2ZZD A;  4M75 D;  3HPW A;  4Q5W A;  3JCM f;  3ZBD A;  4EMK A;  5C0M A;  1Q7Y C;  3OSS C;  5FU7 B;  3CCQ T;  1HXD A;  3I55 T;  3MP6 A;  2K3Y A;  4M77 C;  2MMP A;  2QDY B;  2ZPH B;  3HL8 A;  2K3X A;  4IUV A;  1B34 A;  5DLO A;  4JUV A;  4M7D A;  4XAX B;  2DIQ A;  4A4G A;  3C12 A;  4M7A B;  4BI8 B;  2D6F A;  2P0K A;  2HAX A;  4M7D D;  3OYJ A;  3M5A A;  2PU9 B;  2VC8 A;  2FHD A;  3OYN A;  2QTX A;  3JCM W;  2OTL T;  1TH7 A;  3UWN A;  4F7U G;  2DVE A;  4OVA A;  4M75 A;  4ZGE B;  2DPP B;  2JTM A;  4BD3 A;  5GAO m;  3OA6 A;  2LT4 A;  3MP8 A;  3LH0 A;  4L5G A;  1KQ1 A;  1FX7 A;  1JRI A;  1VQ9 A;  3QZ9 B;  1Q86 U;  3QG1 A;  4B9W A;  2GFA A;  2VGM A;  2L89 A;  3QJY A;  1NZ9 A;  3JSC A;  3X26 B;  4HT8 A;  4KUL A;  2OTJ A;  3L42 A;  4E7H A;  2EYQ A;  3X28 B;  3CBO A;  2RK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...