3LH0A

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k372me2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A01
5DLQE 1WJQA 3P8BB 1VQ5A 3MEUA 3DLMA 1W2BS 1KD1U 1K8AC 3CPWS 2JNGA 1VQ8A 5D6XA 3HKSA 4C5HA 4FU6A 1NJIU 3MEWA 2HQEA 2P0KA 3LLRA 3M9QA 4L59A 1JJ2S 3BDLA 4QQDA 5CIUA 4ZTFA 4E7HA 3FEOA 3CCEA 3G6ET 1KQSS 4Q5WA 1VQPA 1UEBA 3QBYA 2RI2A 3CCUA 3CCRA 1VQLT 2RI3A 1Q82C 1OZ2A 5KCHA 3OYHA 2E6NA 1RL2A 2QA4A 3OW2A 1N8RU 1YBYA 3CC2A 1VQ6T 3CC4A 3CCJA 1XTDA 1Q86C 4Z02A 3F70A 2LCLA 4N4IA 3I55T 3CMEA 4LD6A 2X4YA 1Q81C 1G5VA 5A2QE 1YJNA 3L2RA 3E9FA 1EIFA 2M16A 3CCST 4ZN1A 5FRMA 3FDRA 3OQ5A 5KE2A 2EQJA 5IAYA 2X4WA 1QVGS 3LH0A 3PIPA 4BDZA 5KE3A 3PIOA 2RHXA 3FC3A 1KD1C 1OYXA 5C6SA 1S72A 2QQRA 2MI6A 2K3YA 4QVZA 1NJIC 3OB9A 1BKBA 1VQOA 1YIJT 4C5EA 2X35A 3G4ST 4E7KA 3A5ZB 4NS5A 3PNWC 2XK0A 2R5MA 3GOXA 2GFAA 1VQ7T 3G71T 4BE0A 3OYAA 1WJSA 3PMTA 2QEXA 1VQMT 3CMAA 2JZ2A 2XDPA 5J39A 3OS2A 2R5AA 2PQWA 5LL6S 4ZN3A 1N8RC 3LYIA 2XHCA 5J3BA 3MP6A 4N4HA 3ME9A 2HQXA 3NTKA 4BACA 1NPPA 2DIGA 4CRIA 3CCVT 2E70A 2KDSA 3S6WA 2F5KA 2EQKA 4X34A 1YI2T 3O8VA 3ASKA 5M9OA 5IN1A 4QQGA 3PMIA 4A4EA 4C5IA 2EFIA 4E7JA 2NLUA 3OYYA 3QJ6A 2O4XA 3JAME 3OYLA 5KH6A 3S3OA 2E5QA 5FLXE 2LTOA 1VQ8T 3CCMA 1VQ6A 4GY5A 2RHZA 3MEAA 3EAEA 2JTFA 5IT9E 3E9GA 4EDUA 2RO0A 3L42A 2R58A 4IURA 3OYNA 4E7IA 5D6WA 1YITT 2YRVA 4OVAA 3CCET 1IZ6A 1VQPT 1OZ3A 4HCZA 1QVFS 3OYDA 1VQNT 5J26A 1W2BA 3CCUT 4N4GA 2RJEA 1K73U 3CPWA 3CCSA 4II1A 2RHIA 2JOYA 2E6ZA 1YJ9A 4IUQA 3CXCS 1M90U 3UT1A 5FROA 3I56T 2LCCA 1JJ2A 3CD6A 3CC2T 3CCQA 3CCLA 1M1KU 1KQSA 4A4FA 2RHYA 1VQKA 3OYBA 3KUFA 3S3NA 5HY6A 3J80E 3UWNA 3G4SA 2EIFA 3LGLA 3MP8A 1VQ9T 3P8DA 1VQ7A 3G71A 1YHQA 4PL6A 2M0OA 1KC8U 5DM7R 2GFUA 1VQ4A 3NTHA 3PFSA 5C0MA 2OTJT 3NTIA 3CC7T 2KVQG 3H8ZA 2BKDN 3OYJA 1M1GA 3L2UA 3L2WA 4TVRA 1YJWT 1K9MU 1XNIA 4QW2A 3CCVA 4BD3A 4BE1A 1QVGA 2MWOA 2BIVA 3L2QA 4ZTJA 3FLGA 3META 1K73C 4C5GA 2QEXT 2LQ8A 3ER0A 2R57A 2GF7A 2X4XA 4E7LA 4PLLA 2RJDA 1KHCA 2K3XA 2LRQA 1M90C 3QIIA 2OTLT 2JUFA 3G6EA 4FL6A 2FHDA 3CEYA 1VQLA 4A4GA 1M1KC 3H6ZA 3LX7A 4B9WA 1VQ5T 3ZEHA 1WJRA 4B9XA 2JVVA 3OMCA 2RJCA 2EQUA 3OS1A 3SD4A 3S3MA 3C4SA 1H3ZA 1YITA 2DO3A 2L89A 3I55A 2RI5A 2CKKA 1VQNA 2IG0A 3OYMA 5D6YA 1Q7YU 1KC8C 2L8DA 4IUTA 2G3RA 1NPRA 3CCRT 4UC4A 3I56A 2B8AA 1X6OA 3OYGA 3CCMT 3OYCA 4IUUA 1K9MC 2O4XB 3DB3A 2QA4T 1NZ9A 2BUDA 3CC4T 3CCJT 4IKFA 1RI0A 4QQ6A 4IUVA 2VYTA 3CPFA 1K8AU 3CMET 3P8HA 2EQMA 3MO8A 2RHUA 1YIJA 1VQ9A 2QQSA 3QKJA 1YJNT 3OS0A 1YJ9T 1WGSA 3OYEA 5FRNA 4RG2A 3OA6A 2DAQA 2L3RA 3J7AF 5KCOA 4PLIA 3CD6T 3CCQT 3CCLT 3J81E 4BDYA 2OTJA 1VQMA 1OI1A 3CC7A 2M1HA 1Q82U 2WACA 3OYFA 1VQKT 1QVFA 3OYKA 1MHNA 1S72T 1SSFA 2DIQA 3TREA 1YJWA 2LDMA 3L2VA 1N27A 4A4HA 1VQOT 4IUPA 3CXCA 4BE2A 3Q1JA 1Q86U 1YHQT 1Q7YC 3DLLA 2D9TA 3KBGA 2EKOA 2MWPA 3MP1A 3OY9A 1Q81U 1VQ4T 3OMGA 1YI2A 2OTLA 3DB4A 3LGFA 3OW2S 3CMAT 1KHIA 3OYIA 2LVMA 2RJFA 4YTLA 3MEVA
chains in the Genus database with same CATH superfamily
5I22A 2DFUA 1Y57A 2VGMA 3JCMX 1VQ9Q 1OPLA 3P8BB 1VQ5A 3M0RA 2QASA 3DLMA 2JW4A 5IHKA 1W2BS 1PSEA 1KD1U 3TU4K 1PHTA 2X4JA 1KK7A 3HKSA 1U3OA 1EFNA 2DEQA 3SEMA 2P0KA 5CKDA 2F2XA 3M9QA 3M59A 1M1FA 2GQVA 3QZ5B 1GBQA 2HL3A 3FEOA 3EGXA 4OMMA 2OI3A 4Q5WA 1VQPA 2RK2A 4M7AG 3CCUA 3CCRA 2RI3A 1Q82C 1GXIE 2QTVA 5GAN8 1UHCA 2RB6A 4OMNA 1X69A 1WQWA 5LJ5g 2QEXQ 1JBMA 3CC2A 1VQ6T 1U1SA 1XTDA 4F7UB 2PNIA 1PD1A 3RKWA 3JB9I 1EZZB 2D1XA 3PTAA 2RM4A 1WA7A 5A2QE 1U06A 1YJNA 4J9HA 2RQUA 1TUCA 4JJCA 5FRMA 2ZCFB 2YLBA 2EQJA 1SHFA 3VS3A 4DOVA 5IAYA 3LH0A 1WHLA 2EBPA 2FPEA 2K7AA 4LD9K 2VXEA 1JXOA 3FC3A 3HFOA 3EH1A 2H8HA 3WVDB 5GANf 1LJOA 3I35A 4QVZA 1MUZA 2WSEE 4M75E 3EG2A 1BKBA 1O75A 1LOJA 2YWWA 4DBQA 1YWOA 2XK0A 4M7AF 3GOXA 1OU8A 1M27C 3MCAB 3OYAA 2YUOA 1B34A 2DXBA 3CPWP 2DETA 3CC4Q 1K73R 2JZ2A 3OS2A 4PJOC 2R5AA 2QAZA 3CMEQ 1AD5A 1JJ2P 3FRNA 5DLOA 1QP2A 4NL2A 3JB9D 1KQSP 1WFWA 1BI0A 1ZHIA 2DNUA 2HZYA 4BACA 3OBYA 2EVRA 2GCXA 1WDXA 2WSFE 3GNFB 3X28B 2E70A 5FU6C 3CD6Q 4E2FB 3S6WA 1V1CA 1BYMA 1IHVA 3JCMQ 2KRSA 2F5KA 2LC4A 1X75C 1ABQA 3M54A 4AMCA 5CVIA 1T3LA 4C92D 4AG2C 1VQOQ 3OYYA 4EMKA 4J83A 3C12A 1TG0A 3JAME 3VU3C 5LJ3f 1G3SA 5KYXA 1KJWA 2KR3A 1UDLA 3HFNA 2LTOA 4EMGA 1VQ8T 2DXUA 3CCMA 1VQ6A 2QTXA 4GY5A 4BI8B 1WXUA 2SEMA 1H8KA 1M2OA 2YLCA 4EDUA 2DL8A 2R58A 3OYNA 4E7IA 1YITT 4HCZA 2F2WA 1W2BA 4N4GA 2K5LA 2RJEA 1K73U 1G3WA 5I21A 1M3AA 4PNOA 4D8KA 4WF2A 4OMLA 4LN2A 2DXTA 4KBMB 3CCQA 3CCLA 4HVWA 1ZX6A 2RHYA 4DBFA 4EMKC 5GAMj 2A08A 2ATCB 2E4HA 3VKIA 1HXDA 3KUFA 1NBEB 2IPOB 3S3NA 3A1PA 2MIOA 1ZUYA 4OMPA 4PJOF 3UA6A 2DTIA 4Z89A 3SWNC 5FWCA 1B3QA 4XU0A 2KT1A 4C92A 4J8OA 2P0PA 3TSWA 4M7DD 4F17A 4PL6A 3M57A 5A0DA 1OV3A 1GBRA 3NTHA 3I55Q 3NTIA 4DA4A 5GAOn 2RQVA 2K4YA 5A0LA 2NWMA 4M75C 3L2WA 4PJNA 4TVRA 2EJGA 3EGUA 1QCNA 2QQ9A 4FYVB 4M77A 4PJJA 4FYYB 3INZA 1M1KR 1SSHA 3L2QA 2KMTA 1FX7A 2LNVA 3OS5A 2HBWA 2LQ8A 2GF7A 2X4XA 4OB3B 2RJDA 1M90C 1NLPC 2OTLT 1H641 2JUFA 4R0KA 2DE0X 3G6EA 5GMKi 1B34B 2LNHB 4HCBA 2O9VA 1VQLA 3LX7A 3QDRB 2CT3A 1VQ7Q 5GMKj 1ZSZC 4N0AA 2L0AA 4RTVA 4MZTA 2HDAA 4MMKA 2RJCA 1VQMQ 2K5IA 2HCKA 2E12A 5GANh 1OOTA 3HRSA 4M7DA 2ENMA 1YITA 4RUGA 3I9QA 3EGDA 2IG0A 5FU7C 3V7RA 3OYMA 5D6YA 4IUTA 4F7UE 4C92G 2M02A 1D1BA 2P4RA 2YDLA 1K9AA 2AT1B 3M53A 2ZPBB 4X9CA 2X3WD 3OYCA 3T9NA 1SRLA 4EMKB 3PE0A 2QA4T 2KRMA 1NZ9A 2EYWA 2BUDA 3BFMA 5KYXB 4IKFA 3RMQA 5HK0A 1D3BB 2HAXA 1K8AU 4OMQA 2MOXA 3SWNB 5I2MA 1U8RA 4LUEA 1SPKA 4M77G 3MO8A 1ZA1B 3OSVA 4J7IA 5GAOr 3JCMd 2EKHA 2FB7A 1MMNA 3EG1A 4M75F 4A63B 3PGGA 1ZUKA 2L3RA 3J7AF 2CP2A 1J3TA 3RNJA 4FW2A 3J81E 3QDFA 2F69A 5LJ5j 2DX1A 2AHJB 2WACA 2I0NA 4JDSA 3BY7A 2KE9A 3JCMW 3CCUQ 4M7AE 4C0ZA 1PM3A 3C0CA 5GAOl 3GLXA 2PTKA 5GAMh 3JCMe 2CS7A 3I56Q 1IGUA 3JRZA 2KYBA 3KBGA 3CC2Q 3SDZA 3U23A 3MP1A 3QG1A 1YI2A 3CBOA 4QVCA 2OTLA 5HCKA 3LGFA 4C92B 3HP9A 3CMAT 3RDVA 3OYIA 3FB9A 2LVMA 1MMDA 2A7YA 2XIDA 1JO8A 4A54A 2QI2A 2E1HA 2E64A 3C94A 1ZSZB 3REAB 4RCBA 2E10A 3PT9A 2RN8A 3UATA 4AFSC 4KUIA 1MNDA 3X20B 4AFQC 5D6XA 9ATCB 4OB0B 2PU9B 2E65A 4FU6A 1NJIU 3V8KA 2QXFA 2RMOA 5AYFA 2OTJQ 3A8OB 2K2VA 4M77B 4L59A 1OQKA 1T3SA 7AT1B 1GCPA 3TSZA 1BI1A 4E7HA 3CCEA 2CP7A 1JU5C 3A8LB 3HTRA 3A8GB 2DK3A 1Q86R 1XOVA 3CBPA 4PFOA 2PVDB 5GAN5 5LJ3g 2E3IA 1Q81R 2OJ2A 4CC3A 5KCHA 3OYHA 4CC7A 3UA7A 1LVKA 5GMKm 1YCYA 1D0XA 3QSUA 2QA4A 4ZGJB 3EFOA 1N8RU 2ROTA 1Y07A 3WVEB 3QHSA 1UGQB 2X4YA 4QT7A 1WZOA 2EYZA 1KD1R 1X2KA 3L2RA 2QQBA 1TUDA 2VB6A 4M7DB 2M16A 5GMKe 4RTUA 1K0XA 2MCNA 4ZN1A 1UGRB 2MK5A 1TTHB 2X4WA 1QVGS 4BDZA 1RAHB 2BZXA 1Y7XA 3PIOA 2DVJA 5KYUA 4JRPA 1OYXA 2QQRA 3A8MB 5GAN3 4MZMA 1F1BB 2X9HA 2O9SA 3PVLA 2M0YA 2ZZDA 2HNIA 3OB9A 1YIJT 3G4ST 1HSQA 4NS5A 4JRIA 5LJ5d 2XICA 3CCMQ 4V2SA 1MMGA 2RPNA 3R6OA 4L6V5 2DD4A 4BE0A 2KBTA 3HL8A 2HMAA 1KFZA 4KT0E 2CYZB 1QW1A 1RI9A 3CCJQ 1XQHA 3CMAA 5HK3A 1Y96A 4KGVB 1X2QA 2J6FA 2PQWA 5CQYA 1UG1A 4X1VA 2KNBB 4ZN3A 3VYGA 3LYIA 4N4HA 4M78D 1I5LA 4FCYA 2JM8A 4GLKA 2L5QA 4HCKA 3THKA 4PJMA 2DJZA 4CRIA 1WPYA 4PJOD 2DL4A 4A4KA 2KDSA 3I5RA 2JXBA 2JS0A 3CCQQ 5LJ5e 4PKCC 4Z8AA 2EQKA 4RTYA 5M9OA 4C8QA 1S72Q 5IN1A 4J9GA 1M2VA 4C5IA 1ZLMA 5FW9A 2NLUA 4JPBW 2EJ9A 3OYLA 2XMFA 3S3OA 4CI0C 2FYKA 2V8IA 2KT8A 5FLXE 3QWXX 4F7UF 4EPCA 4QKUA 1I4K1 2KEAA 2O88A 2AZVA 1IB8A 2JTFA 5IT9E 3E9GA 2EWNA 1BBZA 3M4GA 2RO0A 3L42A 2AK5A 2QDYB 2XG8D 2CP5A 2MPXC 4X9DA 3BE3A 1HYOA 3OYDA 1QVFS 2DBMA 5J26A 2KROA 4JZ3A 3NMZC 2HSEB 1S1NA 4II1A 2RHIA 8ATCB 2E6ZA 1YJ9A 3VS5A 4HA8A 1W70A 3TVTA 3UT1A 1LCKA 4RG8A 4M78A 1WIEA 4C8QC 2BZ8A 3QXEB 1FXXA 2SRCA 4HCCA 3URGA 2EAYA 1RLPC 1TS9A 1RADB 4DQ2A 3QUIA 1QLYA 5GAOp 1FMVA 1IRXA 4A4FA 4J9EA 1VQKA 3G6EQ 2QG9B 1N5ZA 2BTTA 4FYWB 2HSPA 5HY6A 3J80E 1CKBA 3UWNA 2GNCA 2EQIA 3EFSA 3VRZA 3HHTB 3VS6A 5CAIA 3G4SA 1VQLQ 3LGLA 3MP8A 4Z88A 2ZPFB 1VQ9T 3P8DA 4JJDA 3M5AA 1LPLA 4AT1B 1YHQA 4BUGA 2D8HA 1Q7YR 4C8QG 1KC8U 2LX7A 2GFUA 2RQWA 4C0DB 3PFSA 2GTOA 3ZL7C 2DA9A 3G1JA 2K79A 2EGAA 2FO0A 3NHNA 3GF5A 2KVQG 3H8ZA 4CC4B 5KYNA 1MGQA 1RAEB 2FEIA 1G83A 2ECZA 1K9MU 3CCSQ 3GBQA 2LJ1A 2CSIA 2QGFB 4BE1A 1QVGA 1X43A 1YN8A 2A36A 5GJWB 3META 4C5GA 4KGXB 1QWEA 1AWJA 2CP6A 4XU2A 2QEXT 1QKWA 4M75D 1KHCA 1AT1B 2K3XA 1OX8A 2LRQA 4DBRA 2KK4A 4ESRA 5L8RE 3JCMJ 1MNEA 2L3PA 2QK0A 1ABOA 3V8LA 1E7OA 4M77E 2IIMA 1M1KC 3H6ZA 3H0FA 3JCMf 1XJWB 1X27A 3EG9A 3G71Q 4NOYA 3MPUB 1WJRA 4IIMA 4B9XA 2RA2A 1CKAA 2DRKA 2JVVA 2EQUA 1M3BA 2HKQB 5GAMf 3QZ9B 3CXCP 3S3MA 2CZ6B 1VQ4Q 2P0QA 4XTWA 2F2VA 1PKSA 4C8QF 2JMCA 2GGRA 1Q7YU 2L8DA 3JSCA 3H0HA 2NUZA 2XI9A 1NPRA 4C8QB 2ED0A 3CCVQ 1M2VB 4XU3A 1X6OA 2FVUA 2XU8A 3OYGA 4OF1A 1X6BA 3EGXB 4IUUA 1ZQ1A 3N5BB 2M9UA 1YI2Q 2DILA 3DB3A 4IIOA 1D09B 4Y91A 3CC4T 1KSWA 4IUVA 2VYTA 5IXFA 3CPFA 2JN0A 3CMET 1PKTA 2EQMA 2ROLA 2F1LA 4LNPA 1VQ9A 2QQSA 1RAAB 5CCAA 5GJVB 3X26B 3EFRA 3TQ7P 2CREA 4RG2A 2YSQA 2P4TA 2KY9A 1I07A 1FWZA 2A0FB 4KUDK 3CD6T 1OI1A 4FT2A 1HD3A 1PSFA 1CSKA 1Q82U 4E6RA 2FL7A 2KAFA 3OYFA 2C0TA 3CCEQ 1QVFA 2QYZA 2DYBA 1VQNQ 3HRTA 2DIQA 2E41A 2YRDA 4JLIA 2LDMA 4E7ZA 2NYSA 1VQOT 4IUPA 4OGEA 4XU1A 2ABLA 3OSSC 3DLLA 4WTOB 3VUZA 2KSSA 2E3HA 2LJ0A 1K8AR 2EKOA 2L2PA 4RMOA 2K57A 3H0IA 3EG3A 1VQ4T 1KG1A 1X01A 2F5TX 3RIRA 3QJYA 4WCIA 1BI2A 2RJFA 1YCSB 1OX9A 4XAXB 4MMLA 5DLQE 1WJQA 4C92C 2ESWA 3MEUA 3M58A 3CPWS 1UTIA 3JB9G 4J6YA 2W10A 4BI3A 2JNGA 3RUXA 1VQ8A 1UGVA 2RQRA 4FW1A 3MEWA 4D6WA 3MKDA 2HQEA 3LLRA 2V8JA 3CC7Q 4ANJA 1JJ2S 3VS2A 1VOMA 1KQSS 2K3BA 4FYXB 2PZ1A 1UEBA 1YJWQ 3QBYA 1UUEA 1PC0A 1YFNA 4M77C 2CGHA 1OZ2A 2XD0A 4Y28E 4HKEA 2E6NA 5LJ5f 1RL2A 4OB1B 2MAMA 3RESA 3OW2A 4GBQA 1G3YA 4R55A 1YBYA 1ZUUA 3CC4A 1KQ2A 2CUDA 3SHWA 1Q86C 2LCLA 2CZ1B 4N4IA 4F16A 1C0MA 3I55T 3CMEA 1QMCA 2OX7A 2HBPA 2L3QA 1Q81C 3ZFJA 3E9FA 1I1JA 1UJ0A 1M4ZA 1VQ5Q 1NJIR 2LT1A 4GLMA 4N0AC 3ZBDA 3OQ5A 5KE2A 2VC8A 3SFMA 2O31A 2O2OA 2LX9A 4AFZC 5KE3A 5KYWA 4M7DC 2DVEA 5GAN7 2EYXA 1NM7A 1KD1C 1UECA 2CSQA 2K5FA 5GANg 2RQTA 2K3YA 1VQPQ 5A0GA 2PVGB 5LJ3d 1VQOA 4JRQA 3CCRQ 4L5GA 3WXMB 4E7KA 3JCMh 1N8RR 1JB0E 2R5MA 2DJQA 1Y71A 1VQ7T 1W2BP 4C92F 2DYIA 1MV0B 4M7DG 1VQMT 1I81A 1GFCA 1UFFA 2XDPA 5J39A 1D0YA 1GRIA 5LL6S 2PVOB 4VUBA 1ZSGA 2FPDA 2XHCA 5J3BA 4DEYA 3MP6A 3AT1B 1YJNQ 3ME9A 1NG2A 2HQXA 1PWTA 2EGCA 2GBQA 1NPPA 2QDLA 2FZCB 3I5SA 2DIGA 4FSSA 2B86A 3VRYA 3OBWA 5KYYA 4M77F 4KGZB 3M0PA 3G7ZA 1FMWA 2JMAA 1AVZC 3O8VA 4X34A 3ASKA 2D0QB 2KYMA 4M7AD 1YNZA 4QQGA 3PMIA 2VKNA 1QP3A 4J9FA 1V76A 3C95A 4B6MA 1BCMA 4LE9A 4F04B 3NGPA 4LDUA 2O4XA 1M8VA 4LDYA 2DXCA 5KH6A 4DOWA 2E5QA 1C6VX 1UGSB 2D0NA 2GTJA 1WNLA 2LQKA 1WHHA 1WX6A 4XTXA 5GAMg 3EAEA 4C8QE 2J6KA 3X24B 2O01E 1WXTA 3GIBA 1WYXA 5D6WA 2VUBA 4OVAA 1H3HA 4P5NA 4M7DF 1AEYA 1IZ6A 1R0CB 1VQPT 5CK9A 5GMKh 3CCUT 4NL3A 3QWYA 3CPWA 3RBBB 2JOYA 1V29B 1AZEA 4IUQA 1M90U 4A53A 3EHRA 2CH4A 1PRMC 3EGDB 5FROA 2V1RA 3I56T 1AWXA 1JJ2A 3E1SA 3CC2T 2VASA 4O5VA 2ZGWA 4JUVA 1KQSA 3HSBA 1HK9A 3VS7A 4OP0A 3OYBA 1WQ7A 2J7IA 2DM1A 5CQXA 2YUPA 2EIFA 4Y92A 1E6HA 4M7AA 1IGQA 5GAOm 2WSCE 1Q95G 4HXJA 2G6FX 1VQ7A 2YHTA 1SKUB 4AFUC 3AHUA 4ZGDB 1VQ6Q 2HKNA 2JTEA 2ZAEA 2PUOB 1YWPA 2RH2A 2OTJT 3FJ5A 3V7CA 2LQWA 5CKFA 2J06A 2BKDN 1OPKA 1M1GA 3JB9H 2DZCA 3L2UA 1DJ7B 4C0DC 5KYWB 2QGGA 1RAIB 2CDTA 5EG2A 1PNJA 2E5KA 2JM9A 1SG5A 2RD1A 4QW2A 1X6GA 4BD3A 4LDXA 2MWOA 2BIVA 5LJ5h 3ULRB 3VJPA 1T0HA 1BK2A 1SHGA 1I5OB 3VV0A 1K73C 5GAOq 2VXFA 2AKLA 3RKXA 3CCLQ 3QPHA 2R57A 2V8KA 4E7LA 2VVKA 3QYGB 1AOJA 2PUKB 2FHDA 3CEYA 4XK8E 5FWBA 2COZA 4A4GA 1JQQA 4JJNK 2HEQA 1KC8R 3QO3A 2YRCA 3ZEHA 2KQWA 4PFZA 1QCFA 1UB4A 2MMPA 2Y4XA 3REBB 3OMCA 1MV3A 5CO7A 1T0JA 3SD4A 5I2SA 3C4SA 2YXYA 3M0SA 2DO3A 4J9DA 1K9MR 4MDWA 2CKKA 2DLPA 2YUQA 3SB2A 3GPLA 5KYYB 1K1ZA 2ZPIB 2JTMA 3M0UA 4PFPA 2CP3A 1TU0B 3UF4A 2DRMA 3I56A 4XTYA 3CCMT 1WI7A 2K6DA 2O4XB 2NUTA 3CCJT 1RI0A 1AZGB 2X3XD 1I8FA 4PJOA 1N9RA 3A8HB 2RHUA 1YIJA 3QKJA 3EFOB 4FIBA 1K0SA 1NEBA 1Z9ZA 3OS0A 3JCMc 2FZKB 5CR2A 1WGSA 1VQ8Q 4KH1B 2DAQA 4XTUA 1U1TA 1BCOA 4OMFB 1BU1A 1GCQA 3CCQT 3CCLT 1AWWA 1D1AA 4BDYA 4LDWA 2OTJA 5AT1B 2EPDA 2M1HA 1H92A 1YITQ 1MMAA 3RMSA 2H3JA 2XKOC 1S72T 1TWBA 2DD5A 4R56A 3L2VA 2AIRB 1N27A 4A4HA 1M5Q1 4BY6B 3M0TA 1K76A 1VA7A 4BE2A 1BIAA 5KYUB 4C92E 3Q1JA 1NE8A 1M9SA 2A3LA 2L3SA 4M78C 4KRTA 3DKMA 2NUPA 1PG5B 1R77A 1RACB 3O5ZA 4M7AB 4EIKA 2KGTA 3CBMA 3DB4A 1UE9A 3OW2S 3M4YA 1KHIA 4C0GA 3X25B 4BB7A 1HJDA 5GAN4 2YUNA 4YTLA 4RTXA 1NYFA 3MEVA 3H41A 5GANj 2QQAA 1Z9QA 2W0ZA 4JJBA 3V7SA 1IO6A 4J9CA 1GCQC 1K8AC 4M78G 1Y96B 1Q82R 4XQ3A 3KFVA 1Y0MA 1ARKA 4C5HA 4PJOG 3KXTA 3M56A 3VS1A 3BDLA 2CZ7B 4QQDA 5CIUA 1U5SA 4ZTFA 2EYYA 3UDCA 3G6ET 4LXCA 4MZPA 1WHKA 5GAN2 1N9SA 5EC7A 4XTVA 2RI2A 1BIBA 1VQLT 3JCMV 2XDDA 1D3BA 4M4ZA 1VUBA 3SWNA 3NFCA 1RAGB 4JZ4A 2ED1A 4KH0B 2DEUA 2FZGB 4MDXA 3CCJA 4M7DE 4J5YA 4DBHA 2OTLQ 2YT6A 4Z02A 3F70A 4M77D 2CP0A 4LD6A 5CKBA 4E7SA 4JS5A 2A28A 1G5VA 1M30A 2CZ0B 2VGNA 2OAWA 3GNGA 4ZNXA 1QQJA 4M75A 1EIFA 5CKEA 4JRKA 3CCST 2HL5C 2KI7A 3FDRA 1PD0A 5L23A 2ZPEB 1N6AA 2BE9B 4PK4A 5LJ3j 3PIPA 4ELZC 3A98A 1G8XA 2K2MA 1ZBXA 2DL3A 2RHXA 4ATOA 4M78F 3VS0A 5C6SA 1S72A 3L2ZA 2ZPGB 2MI6A 4J9BA 4C0FA 1WHGA 1NJIC 2JT4A 3LWHA 4M78B 3MHXA 4C5EA 2X35A 2NUTB 1RABB 3A5ZB 3E2UA 3PNWC 1AHJB 4O6JA 1JEGA 1VYTA 1WLPB 2GFAA 4PJOB 3G71T 1ZA2B 2Z0WA 2QA4Q 1WJSA 2OAUA 1ZSZA 4K11A 1OEBA 2J6OA 3PMTA 4QVDA 2QEXA 2CT4A 2FRYA 2RK1A 1N8RC 4LUDA 2D8JA 2JJ9A 5IHIA 2P84A 5FU6B 2AKKA 3QYHB 4FT4A 3NTKA 1SRMA 3HPWA 4ZGEB 2M51A 1KQ1A 2HD0A 4E47A 3CCVT 2IVWA 2DZ9A 4HT8A 3TCJA 1VIFA 5IH2A 3JCMb 3IQLA 2COWA 3VYHB 5GANd 1YI2T 2CUBA 1BI3A 4A4EA 3TEEA 1FMKA 4M75G 2NUPB 2H3EB 2EFIA 4E7JA 3QJ6A 1D0ZA 1QVPA 2KXCA 2DF6A 5CKHA 2EYQA 1M3CA 4AG1C 3R6NA 3E19A 4CC2A 1PCXA 3L1AA 2RHZA 5GAN6 3MEAA 2LMJA 2EJFA 1QVGP 3M55A 1W6XA 3V8JA 2LZ6B 3LWIA 3CMAQ 4IURA 5GANe 1IXDA 1AWOA 2YRVA 3EG9B 2DPPB 3CCET 3PVQA 5I11A 1IREB 1OZ3A 1VQNT 3CCSA 2DBKA 3BDUA 1K4US 3CXCS 1OULA 1I0CA 1TSFA 3NPFA 2XDBA 5GMKl 2LCCA 1O9SA 2BE7D 3CD6A 5ECAA 1RLQC 3FJPA 1C1AA 3CQTA 1M1KU 2RF0A 1PRLC 5IHNA 3JB9F 2LJ3A 3JV3A 2GQIA 4RTZA 1TOVA 3MJXA 1G3TA 2HQHA 1EX4A 3G71A 1A0NB 5GAMd 2M0OA 2DERA 4J6XA 2MF2A 4EMHA 5DM7R 1NLOC 2BZYA 4HVUA 4M75B 1VQ4A 4ELYC 5C0MA 3UPUA 2LCSA 2J05A 3CC7T 4F14A 1FYNA 3OYJA 4XTZA 3VUBA 8AT1B 5LJ3h 3RR6A 1M90R 4RTWA 4JS4A 5D7UA 1YJWT 2V26A 1XNIA 1UGPB 2RNAA 3CCVA 1YJ9Q 2C0OA 5LJ3e 4J9IA 1OU9A 4ZTJA 1BB9A 1D1CA 2FG0A 4J6WA 2V1QA 3FLGA 1KIKA 5GAMe 2KRNA 2D6FA 4LDVA 1NYGA 4OMOA 3ER0A 1ZBJA 2LQNA 4PLLA 2DTOA 1GFDA 3QIIA 1W1FA 1VQKQ 3HRUA 1QCOA 1YP5A 1SEMA 2DMOA 5IXBA 3LW5E 4FL6A 4ME7A 1YIJQ 1VYUA 1JRIA 3G4SQ 4KULA 3D7SB 6AT1B 3M0QA 4JLGA 4B9WA 1QVFP 4F7UA 1VQ5T 4DEXA 2Y90A 2MYSA 1YHQQ 1VYVA 3JCMg 4OB2B 1P92A 4HT9A 1E6GA 2FPFA 1UJYA 3EH2A 5FU7B 3OS1A 1QKXA 2EW3A 1H3ZA 2FRWA 1IHWA 4OGCA 2L89A 3I55A 1LNXA 2RI5A 2JS2A 1VQNA 4J7FA 3BW1A 1KC8C 1TXQA 2G3RA 1ACMB 2ZPHB 4FM4B 1B7TA 3CCRT 1TH7A 4UC4A 2DL5A 4HVVA 1RUWA 2VWFA 2B8AA 2DKGA 1K9MC 2LT4A 4PJLA 3GP8A 2DL7A 3EHQA 1G2BA 1WHJA 1RAFB 1WHMA 2C0IA 4QQ6A 4BI4A 3H9NA 1R0BG 1JXMA 3P8HA 1VIEA 2KXDA 1TUGB 4ORZA 1YJNT 1W4SA 4RCCA 1YJ9T 4C8QD 2AZSA 3VS4A 2LP5A 3OYEA 2A37A 5FRNA 3OA6A 4M78E 5HKCA 3FIFA 5KCOA 4PLIA 2Y4YA 1VQMA 2K9GA 3CC7A 2CH4W 3RERA 4PJOE 2VV5A 1VQKT 3OYKA 1M8MA 1MHNA 3OW2P 5DY9A 1SSFA 2C06A 4F7UG 1B07A 3TREA 1GL5A 1YJWA 1NEGA 1WXBA 3CXCA 4FSXA 3EG0A 1QWFA 1Q86U 1YHQT 4D8DA 1Q7YC 4RKUE 3RKYA 2D9TA 1UHFA 2COYA 4BY6C 2MWPA 2X51A 3OY9A 1Q81U 1SF9A 1R8OB 3OMGA 4RTTA 3JB9J 2EGEA 3LH5A 2I2LA 3JCMP 2DTHA 4M7AC
chains in the Genus database with same CATH topology
5GANj 4XAXB 2QQAA 4MMLA 2QI2A 5DLQE 1WJQA 2VGMA 3JCMX 2E1HA 2E64A 3C94A 3P8BB 3V7SA 3MEUA 4C92C 1VQ5A 4RCBA 3M58A 3DLMA 1W2BS 2E10A 1PSEA 1KD1U 1K8AC 3CPWS 3TU4K 3PT9A 4M78G 1Y96B 4J6YA 3JB9G 4KUIA 4XQ3A 3X20B 2JNGA 2X4JA 5D6XA 3RUXA 4BI3A 1VQ8A 4OB0B 2PU9B 3HKSA 4C5HA 2E65A 4FU6A 1NJIU 3V8KA 2DEQA 2QXFA 3MEWA 4D6WA 2HQEA 2P0KA 3LLRA 5CKDA 5AYFA 2V8JA 4PJOG 3KXTA 3A8OB 2K2VA 3M9QA 4M77B 4L59A 3M56A 1JJ2S 3BDLA 1M1FA 2GQVA 3M59A 2CZ7B 3QZ5B 4QQDA 5CIUA 1BI1A 4ZTFA 4E7HA 3FEOA 3UDCA 3CCEA 3G6ET 1KQSS 3A8LB 4MZPA 3A8GB 4Q5WA 1VQPA 2DK3A 1UEBA 2RK2A 4M7AG 5GAN2 1N9SA 1XOVA 3QBYA 4XTVA 3CBPA 2RI2A 3CCUA 1BIBA 4M77C 3CCRA 1VQLT 2PVDB 2RI3A 3JCMV 1Q82C 5GAN5 5LJ3g 2XDDA 1GXIE 2CGHA 1D3BA 1OZ2A 1VUBA 3SWNA 2XD0A 5GAN8 4Y28E 4HKEA 5KCHA 3OYHA 3NFCA 2E6NA 5LJ5f 5GMKm 2RB6A 1RL2A 1YCYA 3QSUA 4OB1B 2QA4A 2MAMA 3RESA 1WQWA 4ZGJB 5LJ5g 3OW2A 1N8RU 1G3YA 1JBMA 4R55A 1YBYA 3CC2A 1VQ6T 1U1SA 3CC4A 1KQ2A 3CCJA 1XTDA 4MDXA 4J5YA 4M7DE 4F7UB 1Y07A 1Q86C 3WVEB 4Z02A 3F70A 4M77D 2LCLA 2CZ1B 4N4IA 3I55T 3QHSA 1UGQB 3RKWA 3CMEA 3JB9I 4LD6A 5CKBA 4JS5A 3PTAA 2X4YA 2HBPA 2RM4A 1Q81C 1G5VA 5A2QE 2CZ0B 2VGNA 3GNGA 1YJNA 3L2RA 2QQBA 3ZFJA 3E9FA 1M4ZA 4M75A 1EIFA 5CKEA 4M7DB 2M16A 4JRKA 5GMKe 3CCST 2LT1A 4ZN1A 5FRMA 2ZCFB 2YLBA 1UGRB 4N0AC 3FDRA 3OQ5A 3ZBDA 5KE2A 2VC8A 2EQJA 3SFMA 4DOVA 5IAYA 2ZPEB 1N6AA 2X4WA 1QVGS 2LX9A 3LH0A 5LJ3j 3PIPA 4ELZC 4BDZA 5KE3A 4M7DC 1ZBXA 4LD9K 1Y7XA 2RHXA 3PIOA 2VXEA 2DVEA 4ATOA 5GAN7 3FC3A 3HFOA 4M78F 4JRPA 1OYXA 5C6SA 1KD1C 3WVDB 2K5FA 2QQRA 3A8MB 5GANf 5GAN3 1S72A 3L2ZA 4MZMA 1LJOA 2ZPGB 2MI6A 4C0FA 5GANg 2K3YA 4QVZA 2ZZDA 2HNIA 1NJIC 2WSEE 4M75E 3OB9A 2PVGB 5A0GA 1BKBA 3LWHA 5LJ3d 1VQOA 1O75A 4JRQA 4M78B 1YIJT 1LOJA 3MHXA 4C5EA 2X35A 3G4ST 4L5GA 3WXMB 4E7KA 3JCMh 3A5ZB 4NS5A 4JRIA 3PNWC 2XK0A 1AHJB 4O6JA 5LJ5d 2XICA 1JB0E 2R5MA 3GOXA 4M7AF 4V2SA 3R6OA 1Y71A 2GFAA 1VQ7T 3G71T 4L6V5 4PJOB 2DD4A 4BE0A 3MCAB 3OYAA 1B34A 3HL8A 2DXBA 4A54A 4C92F 1WJSA 4KT0E 2OAUA 4M7DG 2CYZB 3PMTA 4QVDA 1QW1A 2QEXA 1VQMT 1XQHA 1I81A 2XDPA 2JZ2A 5J39A 5HK3A 3OS2A 3CMAA 1Y96A 4PJOC 2R5AA 2RK1A 2PQWA 5CQYA 5LL6S 2PVOB 4ZN3A 3FRNA 4VUBA 1QP2A 3VYGA 3LYIA 5DLOA 4NL2A 2XHCA 1N8RC 5J3BA 3MP6A 4N4HA 5FU6B 3ME9A 3QYHB 2HQXA 4FT4A 4M78D 3JB9D 1I5LA 1BI0A 1ZHIA 3NTKA 4GLKA 4BACA 1NPPA 2L5QA 3OBYA 3HPWA 2GCXA 4ZGEB 2DIGA 1KQ1A 2DJZA 2WSFE 4CRIA 1WPYA 2HD0A 4E47A 3GNFB 3CCVT 3X28B 2IVWA 4PJOD 2E70A 3OBWA 4M77F 5FU6C 2DZ9A 2KDSA 4A4KA 4HT8A 3S6WA 3G7ZA 3TCJA 5LJ5e 4PKCC 1BYMA 3JCMQ 1VIFA 3JCMb 1QVFA 2F5KA 3VYHB 2EQKA 3O8VA 4X34A 5GANd 1YI2T 3ASKA 2LC4A 2D0QB 1X75C 5M9OA 4C8QA 4M7AD 3M54A 5IN1A 4QQGA 5CVIA 3PMIA 1BI3A 4A4EA 1QP3A 3TEEA 4M75G 4C5IA 4C92D 3C95A 2EFIA 4E7JA 2NLUA 3OYYA 3QJ6A 4EMKA 4J83A 4LDUA 2O4XA 3C12A 3JAME 1M8VA 2EJ9A 4LDYA 3OYLA 1QVPA 2DXCA 5LJ3f 3VU3C 1G3SA 4DOWA 2E5QA 1UGSB 2FYKA 2V8IA 4CI0C 5CKHA 2EYQA 5FLXE 3HFNA 1WNLA 2LTOA 4F7UF 4EPCA 4EMGA 3E19A 2DXUA 1VQ8T 3CCMA 1I4K1 1VQ6A 2LQKA 3L1AA 4XTXA 2QTXA 4GY5A 2RHZA 5GAN6 3MEAA 3EAEA 4C8QE 5GAMg 3X24B 4BI8B 2EJFA 2JTFA 5IT9E 3E9GA 2EWNA 2O01E 3M55A 3V8JA 3M4GA 2YLCA 4EDUA 3LWIA 3GIBA 2RO0A 3L42A 2R58A 2QDYB 2XG8D 4IURA 3OYNA 4E7IA 5GANe 5D6WA 5KH6A 4X9DA 2VUBA 2YRVA 1YITT 4OVAA 2DPPB 4P5NA 3CCET 4M7DF 1IZ6A 1VQPT 1IREB 1OZ3A 4HCZA 3OYDA 1QVFS 5CK9A 1VQNT 5GMKh 5J26A 1W2BA 3CCUT 4N4GA 2K5LA 2RJEA 4NL3A 1K73U 1G3WA 3CPWA 3CCSA 4II1A 2RHIA 2JOYA 5I21A 2E6ZA 1V29B 1YJ9A 4PNOA 4HA8A 3BDUA 4IUQA 3CXCS 1M90U 3UT1A 4A53A 4WF2A 5FROA 2XDBA 4RG8A 4M78A 3I56T 5GMKl 2LCCA 4C8QC 1O9SA 2DXTA 3QXEB 4KBMB 1FXXA 3E1SA 1JJ2A 3CC2T 3CCQA 3URGA 2EAYA 3CCLA 3FJPA 4O5VA 4HCCA 3CD6A 2ZGWA 4DQ2A 3QUIA 4JUVA 5GAOp 1M1KU 1KQSA 3HSBA 4A4FA 2RHYA 1HK9A 1VQKA 3JB9F 4EMKC 4OP0A 5GAMj 3OYBA 3VKIA 1WQ7A 1HXDA 3KUFA 3S3NA 5HY6A 3J80E 3UWNA 3G4SA 3EFSA 5CQXA 3HHTB 5CAIA 3S3OA 2EIFA 3LGLA 4M7AA 3MP8A 4PJOF 2DTIA 3SWNC 5GAOm 2ZPFB 1VQ9T 2WSCE 3P8DA 4XU0A 3M5AA 1G3TA 4C92A 3G71A 4J8OA 1VQ7A 2P0PA 1YHQA 4BUGA 4M7DD 2YHTA 5GAMd 4PL6A 2M0OA 3M57A 5A0DA 3AHUA 4ZGDB 4J6XA 4C8QG 1KC8U 2MF2A 4EMHA 5DM7R 2GFUA 4M75B 1VQ4A 4C0DB 2PUOB 3NTHA 3PFSA 4ELYC 5C0MA 2RH2A 2OTJT 3NTIA 3UPUA 3CC7T 3V7CA 4DA4A 3GF5A 2KVQG 5GAOn 5CKFA 3H8ZA 2BKDN 3OYJA 1M1GA 4XTZA 3JB9H 1MGQA 3VUBA 2DZCA 2K4YA 5A0LA 4M75C 1DJ7B 4C0DC 5LJ3h 3L2UA 4JS4A 3L2WA 4TVRA 5EG2A 2EJGA 1YJWT 1K9MU 2QQ9A 1XNIA 2RD1A 4QW2A 1UGPB 4M77A 3CCVA 4BD3A 4BE1A 4LDXA 1QVGA 5LJ3e 2MWOA 2BIVA 5LJ5h 3INZA 3L2QA 3VJPA 4ZTJA 2KMTA 1FX7A 4J6WA 3FLGA 3META 2LNVA 3VV0A 4C5GA 1K73C 5GAOq 2VXFA 3OS5A 5GAMe 2D6FA 4LDVA 4XU2A 3RKXA 2QEXT 3QPHA 4M75D 2LQ8A 3ER0A 2R57A 2GF7A 2X4XA 2V8KA 4E7LA 4PLLA 2RJDA 1KHCA 2DTOA 2K3XA 2LRQA 3QIIA 3QYGB 4OB3B 1M90C 2OTLT 2KK4A 3HRUA 1H641 2PUKB 2JUFA 5L8RE 3G6EA 3JCMJ 3LW5E 4FL6A 4ME7A 5GMKi 2FHDA 1B34B 3CEYA 4XK8E 1JRIA 4HCBA 3V8LA 4M77E 4KULA 1VQLA 4JLGA 4A4GA 1M1KC 3H6ZA 4JJNK 3LX7A 4B9WA 4F7UA 3QO3A 1VQ5T 3JCMf 2Y90A 3QDRB 3ZEHA 2KQWA 3JCMg 5GMKj 4NOYA 1WJRA 4N0AA 4B9XA 2RA2A 2MMPA 1UB4A 2JVVA 2Y4XA 1P92A 4MMKA 4MZTA 4OB2B 3OMCA 4HT9A 2RJCA 5FU7B 5CO7A 2EQUA 5GAMf 3OS1A 3QZ9B 5I2SA 2K5IA 3SD4A 3S3MA 2CZ6B 2E12A 3C4SA 5GANh 3HRSA 4M7DA 1H3ZA 2P0QA 2DO3A 1YITA 4OGCA 2L89A 3I55A 1LNXA 4XTWA 4MDWA 2RI5A 4C8QF 2CKKA 1VQNA 2IG0A 5FU7C 3SB2A 4J7FA 3V7RA 3OYMA 5D6YA 3BW1A 3GPLA 2L8DA 1Q7YU 1KC8C 2ZPIB 4IUTA 3JSCA 4F7UE 4C92G 2XI9A 2JTMA 2G3RA 2ZPHB 1NPRA 4FM4B 3CCRT 1TH7A 4C8QB 4UC4A 3I56A 3M53A 2B8AA 1X6OA 4XU3A 2FVUA 2ZPBB 4X9CA 2XU8A 4XTYA 4OF1A 3OYGA 3CCMT 3OYCA 4IUUA 3T9NA 2DKGA 1ZQ1A 3N5BB 4EMKB 2M9UA 1K9MC 2LT4A 2O4XB 3DB3A 2QA4T 3GP8A 1NZ9A 4Y91A 2BUDA 3BFMA 3CC4T 3CCJT 4IKFA 1RI0A 4QQ6A 4BI4A 4IUVA 2VYTA 1D3BB 3RMQA 5HK0A 3CPFA 2HAXA 1K8AU 2JN0A 3SWNB 1I8FA 4PJOA 3CMET 3P8HA 5I2MA 1U8RA 1N9RA 3A8HB 2EQMA 1VIEA 4M77G 3MO8A 2RHUA 3OSVA 1YIJA 1VQ9A 4J7IA 2QQSA 3QKJA 5GAOr 5CCAA 4FIBA 1YJNT 3JCMd 3X26B 1W4SA 3EFRA 4RCCA 3JCMc 3OS0A 1YJ9T 4C8QD 5CR2A 1WGSA 2FB7A 3OYEA 4M75F 5FRNA 4RG2A 3OA6A 3PGGA 2DAQA 4M78E 4XTUA 2L3RA 1U1TA 3J7AF 5HKCA 4OMFB 3FIFA 2P4TA 5KCOA 4PLIA 2KY9A 1FWZA 4KUDK 2Y4YA 3CD6T 3CCQT 3CCLT 3J81E 4BDYA 4LDWA 1VQMA 2OTJA 1OI1A 4FT2A 2F69A 3CC7A 5LJ5j 1PSFA 2AHJB 2M1HA 3RERA 1Q82U 4PJOE 2VV5A 2FL7A 2KAFA 2WACA 2H3JA 3RMSA 3OYFA 3OYKA 1VQKT 1MHNA 2XKOC 4JDSA 3BY7A 1S72T 5DY9A 1SSFA 2C06A 3HRTA 2DIQA 4F7UG 2E41A 3TREA 3JCMW 1YJWA 2DD5A 4JLIA 2LDMA 4M7AE 4R56A 3L2VA 4C0ZA 1N27A 4A4HA 1M5Q1 1VQOT 4BY6B 4IUPA 4OGEA 3CXCA 4BE2A 1BIAA 4FSXA 4C92E 5GAOl 4XU1A 3GLXA 3Q1JA 1NE8A 1Q86U 1M9SA 2A3LA 1YHQT 4M78C 1Q7YC 5GAMh 3JCMe 2CS7A 3OSSC 3DKMA 4RKUE 3RKYA 2D9TA 3DLLA 3VUZA 3JRZA 2KSSA 3KBGA 3SDZA 2EKOA 4BY6C 4RMOA 2K57A 2MWPA 3MP1A 3QG1A 3OY9A 1Q81U 4M7AB 1VQ4T 1R8OB 3CBMA 3CBOA 3OMGA 1YI2A 1KG1A 4QVCA 1X01A 2F5TX 3DB4A 3LGFA 3RIRA 2OTLA 4C92B 3QJYA 3OW2S 3HP9A 3M4YA 3JB9J 3CMAT 1KHIA 4C0GA 3OYIA 3FB9A 3X25B 4BB7A 2LVMA 2A7YA 2I2LA 1BI2A 2RJFA 2XIDA 4YTLA 5GAN4 3JCMP 2DTHA 3MEVA 4M7AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLQ E;  1WJQ A;  3P8B B;  1VQ5 A;  3MEU A;  3DLM A;  1W2B S;  1KD1 U;  1K8A C;  3CPW S;  2JNG A;  1VQ8 A;  5D6X A;  3HKS A;  4C5H A;  4FU6 A;  1NJI U;  3MEW A;  2HQE A;  2P0K A;  3LLR A;  3M9Q A;  4L59 A;  1JJ2 S;  3BDL A;  4QQD A;  5CIU A;  4ZTF A;  4E7H A;  3FEO A;  3CCE A;  3G6E T;  1KQS S;  4Q5W A;  1VQP A;  1UEB A;  3QBY A;  2RI2 A;  3CCU A;  3CCR A;  1VQL T;  2RI3 A;  1Q82 C;  1OZ2 A;  5KCH A;  3OYH A;  2E6N A;  1RL2 A;  2QA4 A;  3OW2 A;  1N8R U;  1YBY A;  3CC2 A;  1VQ6 T;  3CC4 A;  3CCJ A;  1XTD A;  1Q86 C;  4Z02 A;  3F70 A;  2LCL A;  4N4I A;  3I55 T;  3CME A;  4LD6 A;  2X4Y A;  1Q81 C;  1G5V A;  5A2Q E;  1YJN A;  3L2R A;  3E9F A;  1EIF A;  2M16 A;  3CCS T;  4ZN1 A;  5FRM A;  3FDR A;  3OQ5 A;  5KE2 A;  2EQJ A;  5IAY A;  2X4W A;  1QVG S;  3LH0 A;  3PIP A;  4BDZ A;  5KE3 A;  3PIO A;  2RHX A;  3FC3 A;  1KD1 C;  1OYX A;  5C6S A;  1S72 A;  2QQR A;  2MI6 A;  2K3Y A;  4QVZ A;  1NJI C;  3OB9 A;  1BKB A;  1VQO A;  1YIJ T;  4C5E A;  2X35 A;  3G4S T;  4E7K A;  3A5Z B;  4NS5 A;  3PNW C;  2XK0 A;  2R5M A;  3GOX A;  2GFA A;  1VQ7 T;  3G71 T;  4BE0 A;  3OYA A;  1WJS A;  3PMT A;  2QEX A;  1VQM T;  3CMA A;  2JZ2 A;  2XDP A;  5J39 A;  3OS2 A;  2R5A A;  2PQW A;  5LL6 S;  4ZN3 A;  1N8R C;  3LYI A;  2XHC A;  5J3B A;  3MP6 A;  4N4H A;  3ME9 A;  2HQX A;  3NTK A;  4BAC A;  1NPP A;  2DIG A;  4CRI A;  3CCV T;  2E70 A;  2KDS A;  3S6W A;  2F5K A;  2EQK A;  4X34 A;  1YI2 T;  3O8V A;  3ASK A;  5M9O A;  5IN1 A;  4QQG A;  3PMI A;  4A4E A;  4C5I A;  2EFI A;  4E7J A;  2NLU A;  3OYY A;  3QJ6 A;  2O4X A;  3JAM E;  3OYL A;  5KH6 A;  3S3O A;  2E5Q A;  5FLX E;  2LTO A;  1VQ8 T;  3CCM A;  1VQ6 A;  4GY5 A;  2RHZ A;  3MEA A;  3EAE A;  2JTF A;  5IT9 E;  3E9G A;  4EDU A;  2RO0 A;  3L42 A;  2R58 A;  4IUR A;  3OYN A;  4E7I A;  5D6W A;  1YIT T;  2YRV A;  4OVA A;  3CCE T;  1IZ6 A;  1VQP T;  1OZ3 A;  4HCZ A;  1QVF S;  3OYD A;  1VQN T;  5J26 A;  1W2B A;  3CCU T;  4N4G A;  2RJE A;  1K73 U;  3CPW A;  3CCS A;  4II1 A;  2RHI A;  2JOY A;  2E6Z A;  1YJ9 A;  4IUQ A;  3CXC S;  1M90 U;  3UT1 A;  5FRO A;  3I56 T;  2LCC A;  1JJ2 A;  3CD6 A;  3CC2 T;  3CCQ A;  3CCL A;  1M1K U;  1KQS A;  4A4F A;  2RHY A;  1VQK A;  3OYB A;  3KUF A;  3S3N A;  5HY6 A;  3J80 E;  3UWN A;  3G4S A;  2EIF A;  3LGL A;  3MP8 A;  1VQ9 T;  3P8D A;  1VQ7 A;  3G71 A;  1YHQ A;  4PL6 A;  2M0O A;  1KC8 U;  5DM7 R;  2GFU A;  1VQ4 A;  3NTH A;  3PFS A;  5C0M A;  2OTJ T;  3NTI A;  3CC7 T;  2KVQ G;  3H8Z A;  2BKD N;  3OYJ A;  1M1G A;  3L2U A;  3L2W A;  4TVR A;  1YJW T;  1K9M U;  1XNI A;  4QW2 A;  3CCV A;  4BD3 A;  4BE1 A;  1QVG A;  2MWO A;  2BIV A;  3L2Q A;  4ZTJ A;  3FLG A;  3MET A;  1K73 C;  4C5G A;  2QEX T;  2LQ8 A;  3ER0 A;  2R57 A;  2GF7 A;  2X4X A;  4E7L A;  4PLL A;  2RJD A;  1KHC A;  2K3X A;  2LRQ A;  1M90 C;  3QII A;  2OTL T;  2JUF A;  3G6E A;  4FL6 A;  2FHD A;  3CEY A;  1VQL A;  4A4G A;  1M1K C;  3H6Z A;  3LX7 A;  4B9W A;  1VQ5 T;  3ZEH A;  1WJR A;  4B9X A;  2JVV A;  3OMC A;  2RJC A;  2EQU A;  3OS1 A;  3SD4 A;  3S3M A;  3C4S A;  1H3Z A;  1YIT A;  2DO3 A;  2L89 A;  3I55 A;  2RI5 A;  2CKK A;  1VQN A;  2IG0 A;  3OYM A;  5D6Y A;  1Q7Y U;  1KC8 C;  2L8D A;  4IUT A;  2G3R A;  1NPR A;  3CCR T;  4UC4 A;  3I56 A;  2B8A A;  1X6O A;  3OYG A;  3CCM T;  3OYC A;  4IUU A;  1K9M C;  2O4X B;  3DB3 A;  2QA4 T;  1NZ9 A;  2BUD A;  3CC4 T;  3CCJ T;  4IKF A;  1RI0 A;  4QQ6 A;  4IUV A;  2VYT A;  3CPF A;  1K8A U;  3CME T;  3P8H A;  2EQM A;  3MO8 A;  2RHU A;  1YIJ A;  1VQ9 A;  2QQS A;  3QKJ A;  1YJN T;  3OS0 A;  1YJ9 T;  1WGS A;  3OYE A;  5FRN A;  4RG2 A;  3OA6 A;  2DAQ A;  2L3R A;  3J7A F;  5KCO A;  4PLI A;  3CD6 T;  3CCQ T;  3CCL T;  3J81 E;  4BDY A;  2OTJ A;  1VQM A;  1OI1 A;  3CC7 A;  2M1H A;  1Q82 U;  2WAC A;  3OYF A;  1VQK T;  1QVF A;  3OYK A;  1MHN A;  1S72 T;  1SSF A;  2DIQ A;  3TRE A;  1YJW A;  2LDM A;  3L2V A;  1N27 A;  4A4H A;  1VQO T;  4IUP A;  3CXC A;  4BE2 A;  3Q1J A;  1Q86 U;  1YHQ T;  1Q7Y C;  3DLL A;  2D9T A;  3KBG A;  2EKO A;  2MWP A;  3MP1 A;  3OY9 A;  1Q81 U;  1VQ4 T;  3OMG A;  1YI2 A;  2OTL A;  3DB4 A;  3LGF A;  3OW2 S;  3CMA T;  1KHI A;  3OYI A;  2LVM A;  2RJF A;  4YTL A;  3MEV A; 
#chains in the Genus database with same CATH topology
 5I22 A;  2DFU A;  1Y57 A;  2VGM A;  3JCM X;  1VQ9 Q;  1OPL A;  3P8B B;  1VQ5 A;  3M0R A;  2QAS A;  3DLM A;  2JW4 A;  5IHK A;  1W2B S;  1PSE A;  1KD1 U;  3TU4 K;  1PHT A;  2X4J A;  1KK7 A;  3HKS A;  1U3O A;  1EFN A;  2DEQ A;  3SEM A;  2P0K A;  5CKD A;  2F2X A;  3M9Q A;  3M59 A;  1M1F A;  2GQV A;  3QZ5 B;  1GBQ A;  2HL3 A;  3FEO A;  3EGX A;  4OMM A;  2OI3 A;  4Q5W A;  1VQP A;  2RK2 A;  4M7A G;  3CCU A;  3CCR A;  2RI3 A;  1Q82 C;  1GXI E;  2QTV A;  5GAN 8;  1UHC A;  2RB6 A;  4OMN A;  1X69 A;  1WQW A;  5LJ5 g;  2QEX Q;  1JBM A;  3CC2 A;  1VQ6 T;  1U1S A;  1XTD A;  4F7U B;  2PNI A;  1PD1 A;  3RKW A;  3JB9 I;  1EZZ B;  2D1X A;  3PTA A;  2RM4 A;  1WA7 A;  5A2Q E;  1U06 A;  1YJN A;  4J9H A;  2RQU A;  1TUC A;  4JJC A;  5FRM A;  2ZCF B;  2YLB A;  2EQJ A;  1SHF A;  3VS3 A;  4DOV A;  5IAY A;  3LH0 A;  1WHL A;  2EBP A;  2FPE A;  2K7A A;  4LD9 K;  2VXE A;  1JXO A;  3FC3 A;  3HFO A;  3EH1 A;  2H8H A;  3WVD B;  5GAN f;  1LJO A;  3I35 A;  4QVZ A;  1MUZ A;  2WSE E;  4M75 E;  3EG2 A;  1BKB A;  1O75 A;  1LOJ A;  2YWW A;  4DBQ A;  1YWO A;  2XK0 A;  4M7A F;  3GOX A;  1OU8 A;  1M27 C;  3MCA B;  3OYA A;  2YUO A;  1B34 A;  2DXB A;  3CPW P;  2DET A;  3CC4 Q;  1K73 R;  2JZ2 A;  3OS2 A;  4PJO C;  2R5A A;  2QAZ A;  3CME Q;  1AD5 A;  1JJ2 P;  3FRN A;  5DLO A;  1QP2 A;  4NL2 A;  3JB9 D;  1KQS P;  1WFW A;  1BI0 A;  1ZHI A;  2DNU A;  2HZY A;  4BAC A;  3OBY A;  2EVR A;  2GCX A;  1WDX A;  2WSF E;  3GNF B;  3X28 B;  2E70 A;  5FU6 C;  3CD6 Q;  4E2F B;  3S6W A;  1V1C A;  1BYM A;  1IHV A;  3JCM Q;  2KRS A;  2F5K A;  2LC4 A;  1X75 C;  1ABQ A;  3M54 A;  4AMC A;  5CVI A;  1T3L A;  4C92 D;  4AG2 C;  1VQO Q;  3OYY A;  4EMK A;  4J83 A;  3C12 A;  1TG0 A;  3JAM E;  3VU3 C;  5LJ3 f;  1G3S A;  5KYX A;  1KJW A;  2KR3 A;  1UDL A;  3HFN A;  2LTO A;  4EMG A;  1VQ8 T;  2DXU A;  3CCM A;  1VQ6 A;  2QTX A;  4GY5 A;  4BI8 B;  1WXU A;  2SEM A;  1H8K A;  1M2O A;  2YLC A;  4EDU A;  2DL8 A;  2R58 A;  3OYN A;  4E7I A;  1YIT T;  4HCZ A;  2F2W A;  1W2B A;  4N4G A;  2K5L A;  2RJE A;  1K73 U;  1G3W A;  5I21 A;  1M3A A;  4PNO A;  4D8K A;  4WF2 A;  4OML A;  4LN2 A;  2DXT A;  4KBM B;  3CCQ A;  3CCL A;  4HVW A;  1ZX6 A;  2RHY A;  4DBF A;  4EMK C;  5GAM j;  2A08 A;  2ATC B;  2E4H A;  3VKI A;  1HXD A;  3KUF A;  1NBE B;  2IPO B;  3S3N A;  3A1P A;  2MIO A;  1ZUY A;  4OMP A;  4PJO F;  3UA6 A;  2DTI A;  4Z89 A;  3SWN C;  5FWC A;  1B3Q A;  4XU0 A;  2KT1 A;  4C92 A;  4J8O A;  2P0P A;  3TSW A;  4M7D D;  4F17 A;  4PL6 A;  3M57 A;  5A0D A;  1OV3 A;  1GBR A;  3NTH A;  3I55 Q;  3NTI A;  4DA4 A;  5GAO n;  2RQV A;  2K4Y A;  5A0L A;  2NWM A;  4M75 C;  3L2W A;  4PJN A;  4TVR A;  2EJG A;  3EGU A;  1QCN A;  2QQ9 A;  4FYV B;  4M77 A;  4PJJ A;  4FYY B;  3INZ A;  1M1K R;  1SSH A;  3L2Q A;  2KMT A;  1FX7 A;  2LNV A;  3OS5 A;  2HBW A;  2LQ8 A;  2GF7 A;  2X4X A;  4OB3 B;  2RJD A;  1M90 C;  1NLP C;  2OTL T;  1H64 1;  2JUF A;  4R0K A;  2DE0 X;  3G6E A;  5GMK i;  1B34 B;  2LNH B;  4HCB A;  2O9V A;  1VQL A;  3LX7 A;  3QDR B;  2CT3 A;  1VQ7 Q;  5GMK j;  1ZSZ C;  4N0A A;  2L0A A;  4RTV A;  4MZT A;  2HDA A;  4MMK A;  2RJC A;  1VQM Q;  2K5I A;  2HCK A;  2E12 A;  5GAN h;  1OOT A;  3HRS A;  4M7D A;  2ENM A;  1YIT A;  4RUG A;  3I9Q A;  3EGD A;  2IG0 A;  5FU7 C;  3V7R A;  3OYM A;  5D6Y A;  4IUT A;  4F7U E;  4C92 G;  2M02 A;  1D1B A;  2P4R A;  2YDL A;  1K9A A;  2AT1 B;  3M53 A;  2ZPB B;  4X9C A;  2X3W D;  3OYC A;  3T9N A;  1SRL A;  4EMK B;  3PE0 A;  2QA4 T;  2KRM A;  1NZ9 A;  2EYW A;  2BUD A;  3BFM A;  5KYX B;  4IKF A;  3RMQ A;  5HK0 A;  1D3B B;  2HAX A;  1K8A U;  4OMQ A;  2MOX A;  3SWN B;  5I2M A;  1U8R A;  4LUE A;  1SPK A;  4M77 G;  3MO8 A;  1ZA1 B;  3OSV A;  4J7I A;  5GAO r;  3JCM d;  2EKH A;  2FB7 A;  1MMN A;  3EG1 A;  4M75 F;  4A63 B;  3PGG A;  1ZUK A;  2L3R A;  3J7A F;  2CP2 A;  1J3T A;  3RNJ A;  4FW2 A;  3J81 E;  3QDF A;  2F69 A;  5LJ5 j;  2DX1 A;  2AHJ B;  2WAC A;  2I0N A;  4JDS A;  3BY7 A;  2KE9 A;  3JCM W;  3CCU Q;  4M7A E;  4C0Z A;  1PM3 A;  3C0C A;  5GAO l;  3GLX A;  2PTK A;  5GAM h;  3JCM e;  2CS7 A;  3I56 Q;  1IGU A;  3JRZ A;  2KYB A;  3KBG A;  3CC2 Q;  3SDZ A;  3U23 A;  3MP1 A;  3QG1 A;  1YI2 A;  3CBO A;  4QVC A;  2OTL A;  5HCK A;  3LGF A;  4C92 B;  3HP9 A;  3CMA T;  3RDV A;  3OYI A;  3FB9 A;  2LVM A;  1MMD A;  2A7Y A;  2XID A;  1JO8 A;  4A54 A;  2QI2 A;  2E1H A;  2E64 A;  3C94 A;  1ZSZ B;  3REA B;  4RCB A;  2E10 A;  3PT9 A;  2RN8 A;  3UAT A;  4AFS C;  4KUI A;  1MND A;  3X20 B;  4AFQ C;  5D6X A;  9ATC B;  4OB0 B;  2PU9 B;  2E65 A;  4FU6 A;  1NJI U;  3V8K A;  2QXF A;  2RMO A;  5AYF A;  2OTJ Q;  3A8O B;  2K2V A;  4M77 B;  4L59 A;  1OQK A;  1T3S A;  7AT1 B;  1GCP A;  3TSZ A;  1BI1 A;  4E7H A;  3CCE A;  2CP7 A;  1JU5 C;  3A8L B;  3HTR A;  3A8G B;  2DK3 A;  1Q86 R;  1XOV A;  3CBP A;  4PFO A;  2PVD B;  5GAN 5;  5LJ3 g;  2E3I A;  1Q81 R;  2OJ2 A;  4CC3 A;  5KCH A;  3OYH A;  4CC7 A;  3UA7 A;  1LVK A;  5GMK m;  1YCY A;  1D0X A;  3QSU A;  2QA4 A;  4ZGJ B;  3EFO A;  1N8R U;  2ROT A;  1Y07 A;  3WVE B;  3QHS A;  1UGQ B;  2X4Y A;  4QT7 A;  1WZO A;  2EYZ A;  1KD1 R;  1X2K A;  3L2R A;  2QQB A;  1TUD A;  2VB6 A;  4M7D B;  2M16 A;  5GMK e;  4RTU A;  1K0X A;  2MCN A;  4ZN1 A;  1UGR B;  2MK5 A;  1TTH B;  2X4W A;  1QVG S;  4BDZ A;  1RAH B;  2BZX A;  1Y7X A;  3PIO A;  2DVJ A;  5KYU A;  4JRP A;  1OYX A;  2QQR A;  3A8M B;  5GAN 3;  4MZM A;  1F1B B;  2X9H A;  2O9S A;  3PVL A;  2M0Y A;  2ZZD A;  2HNI A;  3OB9 A;  1YIJ T;  3G4S T;  1HSQ A;  4NS5 A;  4JRI A;  5LJ5 d;  2XIC A;  3CCM Q;  4V2S A;  1MMG A;  2RPN A;  3R6O A;  4L6V 5;  2DD4 A;  4BE0 A;  2KBT A;  3HL8 A;  2HMA A;  1KFZ A;  4KT0 E;  2CYZ B;  1QW1 A;  1RI9 A;  3CCJ Q;  1XQH A;  3CMA A;  5HK3 A;  1Y96 A;  4KGV B;  1X2Q A;  2J6F A;  2PQW A;  5CQY A;  1UG1 A;  4X1V A;  2KNB B;  4ZN3 A;  3VYG A;  3LYI A;  4N4H A;  4M78 D;  1I5L A;  4FCY A;  2JM8 A;  4GLK A;  2L5Q A;  4HCK A;  3THK A;  4PJM A;  2DJZ A;  4CRI A;  1WPY A;  4PJO D;  2DL4 A;  4A4K A;  2KDS A;  3I5R A;  2JXB A;  2JS0 A;  3CCQ Q;  5LJ5 e;  4PKC C;  4Z8A A;  2EQK A;  4RTY A;  5M9O A;  4C8Q A;  1S72 Q;  5IN1 A;  4J9G A;  1M2V A;  4C5I A;  1ZLM A;  5FW9 A;  2NLU A;  4JPB W;  2EJ9 A;  3OYL A;  2XMF A;  3S3O A;  4CI0 C;  2FYK A;  2V8I A;  2KT8 A;  5FLX E;  3QWX X;  4F7U F;  4EPC A;  4QKU A;  1I4K 1;  2KEA A;  2O88 A;  2AZV A;  1IB8 A;  2JTF A;  5IT9 E;  3E9G A;  2EWN A;  1BBZ A;  3M4G A;  2RO0 A;  3L42 A;  2AK5 A;  2QDY B;  2XG8 D;  2CP5 A;  2MPX C;  4X9D A;  3BE3 A;  1HYO A;  3OYD A;  1QVF S;  2DBM A;  5J26 A;  2KRO A;  4JZ3 A;  3NMZ C;  2HSE B;  1S1N A;  4II1 A;  2RHI A;  8ATC B;  2E6Z A;  1YJ9 A;  3VS5 A;  4HA8 A;  1W70 A;  3TVT A;  3UT1 A;  1LCK A;  4RG8 A;  4M78 A;  1WIE A;  4C8Q C;  2BZ8 A;  3QXE B;  1FXX A;  2SRC A;  4HCC A;  3URG A;  2EAY A;  1RLP C;  1TS9 A;  1RAD B;  4DQ2 A;  3QUI A;  1QLY A;  5GAO p;  1FMV A;  1IRX A;  4A4F A;  4J9E A;  1VQK A;  3G6E Q;  2QG9 B;  1N5Z A;  2BTT A;  4FYW B;  2HSP A;  5HY6 A;  3J80 E;  1CKB A;  3UWN A;  2GNC A;  2EQI A;  3EFS A;  3VRZ A;  3HHT B;  3VS6 A;  5CAI A;  3G4S A;  1VQL Q;  3LGL A;  3MP8 A;  4Z88 A;  2ZPF B;  1VQ9 T;  3P8D A;  4JJD A;  3M5A A;  1LPL A;  4AT1 B;  1YHQ A;  4BUG A;  2D8H A;  1Q7Y R;  4C8Q G;  1KC8 U;  2LX7 A;  2GFU A;  2RQW A;  4C0D B;  3PFS A;  2GTO A;  3ZL7 C;  2DA9 A;  3G1J A;  2K79 A;  2EGA A;  2FO0 A;  3NHN A;  3GF5 A;  2KVQ G;  3H8Z A;  4CC4 B;  5KYN A;  1MGQ A;  1RAE B;  2FEI A;  1G83 A;  2ECZ A;  1K9M U;  3CCS Q;  3GBQ A;  2LJ1 A;  2CSI A;  2QGF B;  4BE1 A;  1QVG A;  1X43 A;  1YN8 A;  2A36 A;  5GJW B;  3MET A;  4C5G A;  4KGX B;  1QWE A;  1AWJ A;  2CP6 A;  4XU2 A;  2QEX T;  1QKW A;  4M75 D;  1KHC A;  1AT1 B;  2K3X A;  1OX8 A;  2LRQ A;  4DBR A;  2KK4 A;  4ESR A;  5L8R E;  3JCM J;  1MNE A;  2L3P A;  2QK0 A;  1ABO A;  3V8L A;  1E7O A;  4M77 E;  2IIM A;  1M1K C;  3H6Z A;  3H0F A;  3JCM f;  1XJW B;  1X27 A;  3EG9 A;  3G71 Q;  4NOY A;  3MPU B;  1WJR A;  4IIM A;  4B9X A;  2RA2 A;  1CKA A;  2DRK A;  2JVV A;  2EQU A;  1M3B A;  2HKQ B;  5GAM f;  3QZ9 B;  3CXC P;  3S3M A;  2CZ6 B;  1VQ4 Q;  2P0Q A;  4XTW A;  2F2V A;  1PKS A;  4C8Q F;  2JMC A;  2GGR A;  1Q7Y U;  2L8D A;  3JSC A;  3H0H A;  2NUZ A;  2XI9 A;  1NPR A;  4C8Q B;  2ED0 A;  3CCV Q;  1M2V B;  4XU3 A;  1X6O A;  2FVU A;  2XU8 A;  3OYG A;  4OF1 A;  1X6B A;  3EGX B;  4IUU A;  1ZQ1 A;  3N5B B;  2M9U A;  1YI2 Q;  2DIL A;  3DB3 A;  4IIO A;  1D09 B;  4Y91 A;  3CC4 T;  1KSW A;  4IUV A;  2VYT A;  5IXF A;  3CPF A;  2JN0 A;  3CME T;  1PKT A;  2EQM A;  2ROL A;  2F1L A;  4LNP A;  1VQ9 A;  2QQS A;  1RAA B;  5CCA A;  5GJV B;  3X26 B;  3EFR A;  3TQ7 P;  2CRE A;  4RG2 A;  2YSQ A;  2P4T A;  2KY9 A;  1I07 A;  1FWZ A;  2A0F B;  4KUD K;  3CD6 T;  1OI1 A;  4FT2 A;  1HD3 A;  1PSF A;  1CSK A;  1Q82 U;  4E6R A;  2FL7 A;  2KAF A;  3OYF A;  2C0T A;  3CCE Q;  1QVF A;  2QYZ A;  2DYB A;  1VQN Q;  3HRT A;  2DIQ A;  2E41 A;  2YRD A;  4JLI A;  2LDM A;  4E7Z A;  2NYS A;  1VQO T;  4IUP A;  4OGE A;  4XU1 A;  2ABL A;  3OSS C;  3DLL A;  4WTO B;  3VUZ A;  2KSS A;  2E3H A;  2LJ0 A;  1K8A R;  2EKO A;  2L2P A;  4RMO A;  2K57 A;  3H0I A;  3EG3 A;  1VQ4 T;  1KG1 A;  1X01 A;  2F5T X;  3RIR A;  3QJY A;  4WCI A;  1BI2 A;  2RJF A;  1YCS B;  1OX9 A;  4XAX B;  4MML A;  5DLQ E;  1WJQ A;  4C92 C;  2ESW A;  3MEU A;  3M58 A;  3CPW S;  1UTI A;  3JB9 G;  4J6Y A;  2W10 A;  4BI3 A;  2JNG A;  3RUX A;  1VQ8 A;  1UGV A;  2RQR A;  4FW1 A;  3MEW A;  4D6W A;  3MKD A;  2HQE A;  3LLR A;  2V8J A;  3CC7 Q;  4ANJ A;  1JJ2 S;  3VS2 A;  1VOM A;  1KQS S;  2K3B A;  4FYX B;  2PZ1 A;  1UEB A;  1YJW Q;  3QBY A;  1UUE A;  1PC0 A;  1YFN A;  4M77 C;  2CGH A;  1OZ2 A;  2XD0 A;  4Y28 E;  4HKE A;  2E6N A;  5LJ5 f;  1RL2 A;  4OB1 B;  2MAM A;  3RES A;  3OW2 A;  4GBQ A;  1G3Y A;  4R55 A;  1YBY A;  1ZUU A;  3CC4 A;  1KQ2 A;  2CUD A;  3SHW A;  1Q86 C;  2LCL A;  2CZ1 B;  4N4I A;  4F16 A;  1C0M A;  3I55 T;  3CME A;  1QMC A;  2OX7 A;  2HBP A;  2L3Q A;  1Q81 C;  3ZFJ A;  3E9F A;  1I1J A;  1UJ0 A;  1M4Z A;  1VQ5 Q;  1NJI R;  2LT1 A;  4GLM A;  4N0A C;  3ZBD A;  3OQ5 A;  5KE2 A;  2VC8 A;  3SFM A;  2O31 A;  2O2O A;  2LX9 A;  4AFZ C;  5KE3 A;  5KYW A;  4M7D C;  2DVE A;  5GAN 7;  2EYX A;  1NM7 A;  1KD1 C;  1UEC A;  2CSQ A;  2K5F A;  5GAN g;  2RQT A;  2K3Y A;  1VQP Q;  5A0G A;  2PVG B;  5LJ3 d;  1VQO A;  4JRQ A;  3CCR Q;  4L5G A;  3WXM B;  4E7K A;  3JCM h;  1N8R R;  1JB0 E;  2R5M A;  2DJQ A;  1Y71 A;  1VQ7 T;  1W2B P;  4C92 F;  2DYI A;  1MV0 B;  4M7D G;  1VQM T;  1I81 A;  1GFC A;  1UFF A;  2XDP A;  5J39 A;  1D0Y A;  1GRI A;  5LL6 S;  2PVO B;  4VUB A;  1ZSG A;  2FPD A;  2XHC A;  5J3B A;  4DEY A;  3MP6 A;  3AT1 B;  1YJN Q;  3ME9 A;  1NG2 A;  2HQX A;  1PWT A;  2EGC A;  2GBQ A;  1NPP A;  2QDL A;  2FZC B;  3I5S A;  2DIG A;  4FSS A;  2B86 A;  3VRY A;  3OBW A;  5KYY A;  4M77 F;  4KGZ B;  3M0P A;  3G7Z A;  1FMW A;  2JMA A;  1AVZ C;  3O8V A;  4X34 A;  3ASK A;  2D0Q B;  2KYM A;  4M7A D;  1YNZ A;  4QQG A;  3PMI A;  2VKN A;  1QP3 A;  4J9F A;  1V76 A;  3C95 A;  4B6M A;  1BCM A;  4LE9 A;  4F04 B;  3NGP A;  4LDU A;  2O4X A;  1M8V A;  4LDY A;  2DXC A;  5KH6 A;  4DOW A;  2E5Q A;  1C6V X;  1UGS B;  2D0N A;  2GTJ A;  1WNL A;  2LQK A;  1WHH A;  1WX6 A;  4XTX A;  5GAM g;  3EAE A;  4C8Q E;  2J6K A;  3X24 B;  2O01 E;  1WXT A;  3GIB A;  1WYX A;  5D6W A;  2VUB A;  4OVA A;  1H3H A;  4P5N A;  4M7D F;  1AEY A;  1IZ6 A;  1R0C B;  1VQP T;  5CK9 A;  5GMK h;  3CCU T;  4NL3 A;  3QWY A;  3CPW A;  3RBB B;  2JOY A;  1V29 B;  1AZE A;  4IUQ A;  1M90 U;  4A53 A;  3EHR A;  2CH4 A;  1PRM C;  3EGD B;  5FRO A;  2V1R A;  3I56 T;  1AWX A;  1JJ2 A;  3E1S A;  3CC2 T;  2VAS A;  4O5V A;  2ZGW A;  4JUV A;  1KQS A;  3HSB A;  1HK9 A;  3VS7 A;  4OP0 A;  3OYB A;  1WQ7 A;  2J7I A;  2DM1 A;  5CQX A;  2YUP A;  2EIF A;  4Y92 A;  1E6H A;  4M7A A;  1IGQ A;  5GAO m;  2WSC E;  1Q95 G;  4HXJ A;  2G6F X;  1VQ7 A;  2YHT A;  1SKU B;  4AFU C;  3AHU A;  4ZGD B;  1VQ6 Q;  2HKN A;  2JTE A;  2ZAE A;  2PUO B;  1YWP A;  2RH2 A;  2OTJ T;  3FJ5 A;  3V7C A;  2LQW A;  5CKF A;  2J06 A;  2BKD N;  1OPK A;  1M1G A;  3JB9 H;  2DZC A;  3L2U A;  1DJ7 B;  4C0D C;  5KYW B;  2QGG A;  1RAI B;  2CDT A;  5EG2 A;  1PNJ A;  2E5K A;  2JM9 A;  1SG5 A;  2RD1 A;  4QW2 A;  1X6G A;  4BD3 A;  4LDX A;  2MWO A;  2BIV A;  5LJ5 h;  3ULR B;  3VJP A;  1T0H A;  1BK2 A;  1SHG A;  1I5O B;  3VV0 A;  1K73 C;  5GAO q;  2VXF A;  2AKL A;  3RKX A;  3CCL Q;  3QPH A;  2R57 A;  2V8K A;  4E7L A;  2VVK A;  3QYG B;  1AOJ A;  2PUK B;  2FHD A;  3CEY A;  4XK8 E;  5FWB A;  2COZ A;  4A4G A;  1JQQ A;  4JJN K;  2HEQ A;  1KC8 R;  3QO3 A;  2YRC A;  3ZEH A;  2KQW A;  4PFZ A;  1QCF A;  1UB4 A;  2MMP A;  2Y4X A;  3REB B;  3OMC A;  1MV3 A;  5CO7 A;  1T0J A;  3SD4 A;  5I2S A;  3C4S A;  2YXY A;  3M0S A;  2DO3 A;  4J9D A;  1K9M R;  4MDW A;  2CKK A;  2DLP A;  2YUQ A;  3SB2 A;  3GPL A;  5KYY B;  1K1Z A;  2ZPI B;  2JTM A;  3M0U A;  4PFP A;  2CP3 A;  1TU0 B;  3UF4 A;  2DRM A;  3I56 A;  4XTY A;  3CCM T;  1WI7 A;  2K6D A;  2O4X B;  2NUT A;  3CCJ T;  1RI0 A;  1AZG B;  2X3X D;  1I8F A;  4PJO A;  1N9R A;  3A8H B;  2RHU A;  1YIJ A;  3QKJ A;  3EFO B;  4FIB A;  1K0S A;  1NEB A;  1Z9Z A;  3OS0 A;  3JCM c;  2FZK B;  5CR2 A;  1WGS A;  1VQ8 Q;  4KH1 B;  2DAQ A;  4XTU A;  1U1T A;  1BCO A;  4OMF B;  1BU1 A;  1GCQ A;  3CCQ T;  3CCL T;  1AWW A;  1D1A A;  4BDY A;  4LDW A;  2OTJ A;  5AT1 B;  2EPD A;  2M1H A;  1H92 A;  1YIT Q;  1MMA A;  3RMS A;  2H3J A;  2XKO C;  1S72 T;  1TWB A;  2DD5 A;  4R56 A;  3L2V A;  2AIR B;  1N27 A;  4A4H A;  1M5Q 1;  4BY6 B;  3M0T A;  1K76 A;  1VA7 A;  4BE2 A;  1BIA A;  5KYU B;  4C92 E;  3Q1J A;  1NE8 A;  1M9S A;  2A3L A;  2L3S A;  4M78 C;  4KRT A;  3DKM A;  2NUP A;  1PG5 B;  1R77 A;  1RAC B;  3O5Z A;  4M7A B;  4EIK A;  2KGT A;  3CBM A;  3DB4 A;  1UE9 A;  3OW2 S;  3M4Y A;  1KHI A;  4C0G A;  3X25 B;  4BB7 A;  1HJD A;  5GAN 4;  2YUN A;  4YTL A;  4RTX A;  1NYF A;  3MEV A;  3H41 A;  5GAN j;  2QQA A;  1Z9Q A;  2W0Z A;  4JJB A;  3V7S A;  1IO6 A;  4J9C A;  1GCQ C;  1K8A C;  4M78 G;  1Y96 B;  1Q82 R;  4XQ3 A;  3KFV A;  1Y0M A;  1ARK A;  4C5H A;  4PJO G;  3KXT A;  3M56 A;  3VS1 A;  3BDL A;  2CZ7 B;  4QQD A;  5CIU A;  1U5S A;  4ZTF A;  2EYY A;  3UDC A;  3G6E T;  4LXC A;  4MZP A;  1WHK A;  5GAN 2;  1N9S A;  5EC7 A;  4XTV A;  2RI2 A;  1BIB A;  1VQL T;  3JCM V;  2XDD A;  1D3B A;  4M4Z A;  1VUB A;  3SWN A;  3NFC A;  1RAG B;  4JZ4 A;  2ED1 A;  4KH0 B;  2DEU A;  2FZG B;  4MDX A;  3CCJ A;  4M7D E;  4J5Y A;  4DBH A;  2OTL Q;  2YT6 A;  4Z02 A;  3F70 A;  4M77 D;  2CP0 A;  4LD6 A;  5CKB A;  4E7S A;  4JS5 A;  2A28 A;  1G5V A;  1M30 A;  2CZ0 B;  2VGN A;  2OAW A;  3GNG A;  4ZNX A;  1QQJ A;  4M75 A;  1EIF A;  5CKE A;  4JRK A;  3CCS T;  2HL5 C;  2KI7 A;  3FDR A;  1PD0 A;  5L23 A;  2ZPE B;  1N6A A;  2BE9 B;  4PK4 A;  5LJ3 j;  3PIP A;  4ELZ C;  3A98 A;  1G8X A;  2K2M A;  1ZBX A;  2DL3 A;  2RHX A;  4ATO A;  4M78 F;  3VS0 A;  5C6S A;  1S72 A;  3L2Z A;  2ZPG B;  2MI6 A;  4J9B A;  4C0F A;  1WHG A;  1NJI C;  2JT4 A;  3LWH A;  4M78 B;  3MHX A;  4C5E A;  2X35 A;  2NUT B;  1RAB B;  3A5Z B;  3E2U A;  3PNW C;  1AHJ B;  4O6J A;  1JEG A;  1VYT A;  1WLP B;  2GFA A;  4PJO B;  3G71 T;  1ZA2 B;  2Z0W A;  2QA4 Q;  1WJS A;  2OAU A;  1ZSZ A;  4K11 A;  1OEB A;  2J6O A;  3PMT A;  4QVD A;  2QEX A;  2CT4 A;  2FRY A;  2RK1 A;  1N8R C;  4LUD A;  2D8J A;  2JJ9 A;  5IHI A;  2P84 A;  5FU6 B;  2AKK A;  3QYH B;  4FT4 A;  3NTK A;  1SRM A;  3HPW A;  4ZGE B;  2M51 A;  1KQ1 A;  2HD0 A;  4E47 A;  3CCV T;  2IVW A;  2DZ9 A;  4HT8 A;  3TCJ A;  1VIF A;  5IH2 A;  3JCM b;  3IQL A;  2COW A;  3VYH B;  5GAN d;  1YI2 T;  2CUB A;  1BI3 A;  4A4E A;  3TEE A;  1FMK A;  4M75 G;  2NUP B;  2H3E B;  2EFI A;  4E7J A;  3QJ6 A;  1D0Z A;  1QVP A;  2KXC A;  2DF6 A;  5CKH A;  2EYQ A;  1M3C A;  4AG1 C;  3R6N A;  3E19 A;  4CC2 A;  1PCX A;  3L1A A;  2RHZ A;  5GAN 6;  3MEA A;  2LMJ A;  2EJF A;  1QVG P;  3M55 A;  1W6X A;  3V8J A;  2LZ6 B;  3LWI A;  3CMA Q;  4IUR A;  5GAN e;  1IXD A;  1AWO A;  2YRV A;  3EG9 B;  2DPP B;  3CCE T;  3PVQ A;  5I11 A;  1IRE B;  1OZ3 A;  1VQN T;  3CCS A;  2DBK A;  3BDU A;  1K4U S;  3CXC S;  1OUL A;  1I0C A;  1TSF A;  3NPF A;  2XDB A;  5GMK l;  2LCC A;  1O9S A;  2BE7 D;  3CD6 A;  5ECA A;  1RLQ C;  3FJP A;  1C1A A;  3CQT A;  1M1K U;  2RF0 A;  1PRL C;  5IHN A;  3JB9 F;  2LJ3 A;  3JV3 A;  2GQI A;  4RTZ A;  1TOV A;  3MJX A;  1G3T A;  2HQH A;  1EX4 A;  3G71 A;  1A0N B;  5GAM d;  2M0O A;  2DER A;  4J6X A;  2MF2 A;  4EMH A;  5DM7 R;  1NLO C;  2BZY A;  4HVU A;  4M75 B;  1VQ4 A;  4ELY C;  5C0M A;  3UPU A;  2LCS A;  2J05 A;  3CC7 T;  4F14 A;  1FYN A;  3OYJ A;  4XTZ A;  3VUB A;  8AT1 B;  5LJ3 h;  3RR6 A;  1M90 R;  4RTW A;  4JS4 A;  5D7U A;  1YJW T;  2V26 A;  1XNI A;  1UGP B;  2RNA A;  3CCV A;  1YJ9 Q;  2C0O A;  5LJ3 e;  4J9I A;  1OU9 A;  4ZTJ A;  1BB9 A;  1D1C A;  2FG0 A;  4J6W A;  2V1Q A;  3FLG A;  1KIK A;  5GAM e;  2KRN A;  2D6F A;  4LDV A;  1NYG A;  4OMO A;  3ER0 A;  1ZBJ A;  2LQN A;  4PLL A;  2DTO A;  1GFD A;  3QII A;  1W1F A;  1VQK Q;  3HRU A;  1QCO A;  1YP5 A;  1SEM A;  2DMO A;  5IXB A;  3LW5 E;  4FL6 A;  4ME7 A;  1YIJ Q;  1VYU A;  1JRI A;  3G4S Q;  4KUL A;  3D7S B;  6AT1 B;  3M0Q A;  4JLG A;  4B9W A;  1QVF P;  4F7U A;  1VQ5 T;  4DEX A;  2Y90 A;  2MYS A;  1YHQ Q;  1VYV A;  3JCM g;  4OB2 B;  1P92 A;  4HT9 A;  1E6G A;  2FPF A;  1UJY A;  3EH2 A;  5FU7 B;  3OS1 A;  1QKX A;  2EW3 A;  1H3Z A;  2FRW A;  1IHW A;  4OGC A;  2L89 A;  3I55 A;  1LNX A;  2RI5 A;  2JS2 A;  1VQN A;  4J7F A;  3BW1 A;  1KC8 C;  1TXQ A;  2G3R A;  1ACM B;  2ZPH B;  4FM4 B;  1B7T A;  3CCR T;  1TH7 A;  4UC4 A;  2DL5 A;  4HVV A;  1RUW A;  2VWF A;  2B8A A;  2DKG A;  1K9M C;  2LT4 A;  4PJL A;  3GP8 A;  2DL7 A;  3EHQ A;  1G2B A;  1WHJ A;  1RAF B;  1WHM A;  2C0I A;  4QQ6 A;  4BI4 A;  3H9N A;  1R0B G;  1JXM A;  3P8H A;  1VIE A;  2KXD A;  1TUG B;  4ORZ A;  1YJN T;  1W4S A;  4RCC A;  1YJ9 T;  4C8Q D;  2AZS A;  3VS4 A;  2LP5 A;  3OYE A;  2A37 A;  5FRN A;  3OA6 A;  4M78 E;  5HKC A;  3FIF A;  5KCO A;  4PLI A;  2Y4Y A;  1VQM A;  2K9G A;  3CC7 A;  2CH4 W;  3RER A;  4PJO E;  2VV5 A;  1VQK T;  3OYK A;  1M8M A;  1MHN A;  3OW2 P;  5DY9 A;  1SSF A;  2C06 A;  4F7U G;  1B07 A;  3TRE A;  1GL5 A;  1YJW A;  1NEG A;  1WXB A;  3CXC A;  4FSX A;  3EG0 A;  1QWF A;  1Q86 U;  1YHQ T;  4D8D A;  1Q7Y C;  4RKU E;  3RKY A;  2D9T A;  1UHF A;  2COY A;  4BY6 C;  2MWP A;  2X51 A;  3OY9 A;  1Q81 U;  1SF9 A;  1R8O B;  3OMG A;  4RTT A;  3JB9 J;  2EGE A;  3LH5 A;  2I2L A;  3JCM P;  2DTH A;  4M7A C; 
#chains in the Genus database with same CATH homology
 5GAN j;  4XAX B;  2QQA A;  4MML A;  2QI2 A;  5DLQ E;  1WJQ A;  2VGM A;  3JCM X;  2E1H A;  2E64 A;  3C94 A;  3P8B B;  3V7S A;  3MEU A;  4C92 C;  1VQ5 A;  4RCB A;  3M58 A;  3DLM A;  1W2B S;  2E10 A;  1PSE A;  1KD1 U;  1K8A C;  3CPW S;  3TU4 K;  3PT9 A;  4M78 G;  1Y96 B;  4J6Y A;  3JB9 G;  4KUI A;  4XQ3 A;  3X20 B;  2JNG A;  2X4J A;  5D6X A;  3RUX A;  4BI3 A;  1VQ8 A;  4OB0 B;  2PU9 B;  3HKS A;  4C5H A;  2E65 A;  4FU6 A;  1NJI U;  3V8K A;  2DEQ A;  2QXF A;  3MEW A;  4D6W A;  2HQE A;  2P0K A;  3LLR A;  5CKD A;  5AYF A;  2V8J A;  4PJO G;  3KXT A;  3A8O B;  2K2V A;  3M9Q A;  4M77 B;  4L59 A;  3M56 A;  1JJ2 S;  3BDL A;  1M1F A;  2GQV A;  3M59 A;  2CZ7 B;  3QZ5 B;  4QQD A;  5CIU A;  1BI1 A;  4ZTF A;  4E7H A;  3FEO A;  3UDC A;  3CCE A;  3G6E T;  1KQS S;  3A8L B;  4MZP A;  3A8G B;  4Q5W A;  1VQP A;  2DK3 A;  1UEB A;  2RK2 A;  4M7A G;  5GAN 2;  1N9S A;  1XOV A;  3QBY A;  4XTV A;  3CBP A;  2RI2 A;  3CCU A;  1BIB A;  4M77 C;  3CCR A;  1VQL T;  2PVD B;  2RI3 A;  3JCM V;  1Q82 C;  5GAN 5;  5LJ3 g;  2XDD A;  1GXI E;  2CGH A;  1D3B A;  1OZ2 A;  1VUB A;  3SWN A;  2XD0 A;  5GAN 8;  4Y28 E;  4HKE A;  5KCH A;  3OYH A;  3NFC A;  2E6N A;  5LJ5 f;  5GMK m;  2RB6 A;  1RL2 A;  1YCY A;  3QSU A;  4OB1 B;  2QA4 A;  2MAM A;  3RES A;  1WQW A;  4ZGJ B;  5LJ5 g;  3OW2 A;  1N8R U;  1G3Y A;  1JBM A;  4R55 A;  1YBY A;  3CC2 A;  1VQ6 T;  1U1S A;  3CC4 A;  1KQ2 A;  3CCJ A;  1XTD A;  4MDX A;  4J5Y A;  4M7D E;  4F7U B;  1Y07 A;  1Q86 C;  3WVE B;  4Z02 A;  3F70 A;  4M77 D;  2LCL A;  2CZ1 B;  4N4I A;  3I55 T;  3QHS A;  1UGQ B;  3RKW A;  3CME A;  3JB9 I;  4LD6 A;  5CKB A;  4JS5 A;  3PTA A;  2X4Y A;  2HBP A;  2RM4 A;  1Q81 C;  1G5V A;  5A2Q E;  2CZ0 B;  2VGN A;  3GNG A;  1YJN A;  3L2R A;  2QQB A;  3ZFJ A;  3E9F A;  1M4Z A;  4M75 A;  1EIF A;  5CKE A;  4M7D B;  2M16 A;  4JRK A;  5GMK e;  3CCS T;  2LT1 A;  4ZN1 A;  5FRM A;  2ZCF B;  2YLB A;  1UGR B;  4N0A C;  3FDR A;  3OQ5 A;  3ZBD A;  5KE2 A;  2VC8 A;  2EQJ A;  3SFM A;  4DOV A;  5IAY A;  2ZPE B;  1N6A A;  2X4W A;  1QVG S;  2LX9 A;  3LH0 A;  5LJ3 j;  3PIP A;  4ELZ C;  4BDZ A;  5KE3 A;  4M7D C;  1ZBX A;  4LD9 K;  1Y7X A;  2RHX A;  3PIO A;  2VXE A;  2DVE A;  4ATO A;  5GAN 7;  3FC3 A;  3HFO A;  4M78 F;  4JRP A;  1OYX A;  5C6S A;  1KD1 C;  3WVD B;  2K5F A;  2QQR A;  3A8M B;  5GAN f;  5GAN 3;  1S72 A;  3L2Z A;  4MZM A;  1LJO A;  2ZPG B;  2MI6 A;  4C0F A;  5GAN g;  2K3Y A;  4QVZ A;  2ZZD A;  2HNI A;  1NJI C;  2WSE E;  4M75 E;  3OB9 A;  2PVG B;  5A0G A;  1BKB A;  3LWH A;  5LJ3 d;  1VQO A;  1O75 A;  4JRQ A;  4M78 B;  1YIJ T;  1LOJ A;  3MHX A;  4C5E A;  2X35 A;  3G4S T;  4L5G A;  3WXM B;  4E7K A;  3JCM h;  3A5Z B;  4NS5 A;  4JRI A;  3PNW C;  2XK0 A;  1AHJ B;  4O6J A;  5LJ5 d;  2XIC A;  1JB0 E;  2R5M A;  3GOX A;  4M7A F;  4V2S A;  3R6O A;  1Y71 A;  2GFA A;  1VQ7 T;  3G71 T;  4L6V 5;  4PJO B;  2DD4 A;  4BE0 A;  3MCA B;  3OYA A;  1B34 A;  3HL8 A;  2DXB A;  4A54 A;  4C92 F;  1WJS A;  4KT0 E;  2OAU A;  4M7D G;  2CYZ B;  3PMT A;  4QVD A;  1QW1 A;  2QEX A;  1VQM T;  1XQH A;  1I81 A;  2XDP A;  2JZ2 A;  5J39 A;  5HK3 A;  3OS2 A;  3CMA A;  1Y96 A;  4PJO C;  2R5A A;  2RK1 A;  2PQW A;  5CQY A;  5LL6 S;  2PVO B;  4ZN3 A;  3FRN A;  4VUB A;  1QP2 A;  3VYG A;  3LYI A;  5DLO A;  4NL2 A;  2XHC A;  1N8R C;  5J3B A;  3MP6 A;  4N4H A;  5FU6 B;  3ME9 A;  3QYH B;  2HQX A;  4FT4 A;  4M78 D;  3JB9 D;  1I5L A;  1BI0 A;  1ZHI A;  3NTK A;  4GLK A;  4BAC A;  1NPP A;  2L5Q A;  3OBY A;  3HPW A;  2GCX A;  4ZGE B;  2DIG A;  1KQ1 A;  2DJZ A;  2WSF E;  4CRI A;  1WPY A;  2HD0 A;  4E47 A;  3GNF B;  3CCV T;  3X28 B;  2IVW A;  4PJO D;  2E70 A;  3OBW A;  4M77 F;  5FU6 C;  2DZ9 A;  2KDS A;  4A4K A;  4HT8 A;  3S6W A;  3G7Z A;  3TCJ A;  5LJ5 e;  4PKC C;  1BYM A;  3JCM Q;  1VIF A;  3JCM b;  1QVF A;  2F5K A;  3VYH B;  2EQK A;  3O8V A;  4X34 A;  5GAN d;  1YI2 T;  3ASK A;  2LC4 A;  2D0Q B;  1X75 C;  5M9O A;  4C8Q A;  4M7A D;  3M54 A;  5IN1 A;  4QQG A;  5CVI A;  3PMI A;  1BI3 A;  4A4E A;  1QP3 A;  3TEE A;  4M75 G;  4C5I A;  4C92 D;  3C95 A;  2EFI A;  4E7J A;  2NLU A;  3OYY A;  3QJ6 A;  4EMK A;  4J83 A;  4LDU A;  2O4X A;  3C12 A;  3JAM E;  1M8V A;  2EJ9 A;  4LDY A;  3OYL A;  1QVP A;  2DXC A;  5LJ3 f;  3VU3 C;  1G3S A;  4DOW A;  2E5Q A;  1UGS B;  2FYK A;  2V8I A;  4CI0 C;  5CKH A;  2EYQ A;  5FLX E;  3HFN A;  1WNL A;  2LTO A;  4F7U F;  4EPC A;  4EMG A;  3E19 A;  2DXU A;  1VQ8 T;  3CCM A;  1I4K 1;  1VQ6 A;  2LQK A;  3L1A A;  4XTX A;  2QTX A;  4GY5 A;  2RHZ A;  5GAN 6;  3MEA A;  3EAE A;  4C8Q E;  5GAM g;  3X24 B;  4BI8 B;  2EJF A;  2JTF A;  5IT9 E;  3E9G A;  2EWN A;  2O01 E;  3M55 A;  3V8J A;  3M4G A;  2YLC A;  4EDU A;  3LWI A;  3GIB A;  2RO0 A;  3L42 A;  2R58 A;  2QDY B;  2XG8 D;  4IUR A;  3OYN A;  4E7I A;  5GAN e;  5D6W A;  5KH6 A;  4X9D A;  2VUB A;  2YRV A;  1YIT T;  4OVA A;  2DPP B;  4P5N A;  3CCE T;  4M7D F;  1IZ6 A;  1VQP T;  1IRE B;  1OZ3 A;  4HCZ A;  3OYD A;  1QVF S;  5CK9 A;  1VQN T;  5GMK h;  5J26 A;  1W2B A;  3CCU T;  4N4G A;  2K5L A;  2RJE A;  4NL3 A;  1K73 U;  1G3W A;  3CPW A;  3CCS A;  4II1 A;  2RHI A;  2JOY A;  5I21 A;  2E6Z A;  1V29 B;  1YJ9 A;  4PNO A;  4HA8 A;  3BDU A;  4IUQ A;  3CXC S;  1M90 U;  3UT1 A;  4A53 A;  4WF2 A;  5FRO A;  2XDB A;  4RG8 A;  4M78 A;  3I56 T;  5GMK l;  2LCC A;  4C8Q C;  1O9S A;  2DXT A;  3QXE B;  4KBM B;  1FXX A;  3E1S A;  1JJ2 A;  3CC2 T;  3CCQ A;  3URG A;  2EAY A;  3CCL A;  3FJP A;  4O5V A;  4HCC A;  3CD6 A;  2ZGW A;  4DQ2 A;  3QUI A;  4JUV A;  5GAO p;  1M1K U;  1KQS A;  3HSB A;  4A4F A;  2RHY A;  1HK9 A;  1VQK A;  3JB9 F;  4EMK C;  4OP0 A;  5GAM j;  3OYB A;  3VKI A;  1WQ7 A;  1HXD A;  3KUF A;  3S3N A;  5HY6 A;  3J80 E;  3UWN A;  3G4S A;  3EFS A;  5CQX A;  3HHT B;  5CAI A;  3S3O A;  2EIF A;  3LGL A;  4M7A A;  3MP8 A;  4PJO F;  2DTI A;  3SWN C;  5GAO m;  2ZPF B;  1VQ9 T;  2WSC E;  3P8D A;  4XU0 A;  3M5A A;  1G3T A;  4C92 A;  3G71 A;  4J8O A;  1VQ7 A;  2P0P A;  1YHQ A;  4BUG A;  4M7D D;  2YHT A;  5GAM d;  4PL6 A;  2M0O A;  3M57 A;  5A0D A;  3AHU A;  4ZGD B;  4J6X A;  4C8Q G;  1KC8 U;  2MF2 A;  4EMH A;  5DM7 R;  2GFU A;  4M75 B;  1VQ4 A;  4C0D B;  2PUO B;  3NTH A;  3PFS A;  4ELY C;  5C0M A;  2RH2 A;  2OTJ T;  3NTI A;  3UPU A;  3CC7 T;  3V7C A;  4DA4 A;  3GF5 A;  2KVQ G;  5GAO n;  5CKF A;  3H8Z A;  2BKD N;  3OYJ A;  1M1G A;  4XTZ A;  3JB9 H;  1MGQ A;  3VUB A;  2DZC A;  2K4Y A;  5A0L A;  4M75 C;  1DJ7 B;  4C0D C;  5LJ3 h;  3L2U A;  4JS4 A;  3L2W A;  4TVR A;  5EG2 A;  2EJG A;  1YJW T;  1K9M U;  2QQ9 A;  1XNI A;  2RD1 A;  4QW2 A;  1UGP B;  4M77 A;  3CCV A;  4BD3 A;  4BE1 A;  4LDX A;  1QVG A;  5LJ3 e;  2MWO A;  2BIV A;  5LJ5 h;  3INZ A;  3L2Q A;  3VJP A;  4ZTJ A;  2KMT A;  1FX7 A;  4J6W A;  3FLG A;  3MET A;  2LNV A;  3VV0 A;  4C5G A;  1K73 C;  5GAO q;  2VXF A;  3OS5 A;  5GAM e;  2D6F A;  4LDV A;  4XU2 A;  3RKX A;  2QEX T;  3QPH A;  4M75 D;  2LQ8 A;  3ER0 A;  2R57 A;  2GF7 A;  2X4X A;  2V8K A;  4E7L A;  4PLL A;  2RJD A;  1KHC A;  2DTO A;  2K3X A;  2LRQ A;  3QII A;  3QYG B;  4OB3 B;  1M90 C;  2OTL T;  2KK4 A;  3HRU A;  1H64 1;  2PUK B;  2JUF A;  5L8R E;  3G6E A;  3JCM J;  3LW5 E;  4FL6 A;  4ME7 A;  5GMK i;  2FHD A;  1B34 B;  3CEY A;  4XK8 E;  1JRI A;  4HCB A;  3V8L A;  4M77 E;  4KUL A;  1VQL A;  4JLG A;  4A4G A;  1M1K C;  3H6Z A;  4JJN K;  3LX7 A;  4B9W A;  4F7U A;  3QO3 A;  1VQ5 T;  3JCM f;  2Y90 A;  3QDR B;  3ZEH A;  2KQW A;  3JCM g;  5GMK j;  4NOY A;  1WJR A;  4N0A A;  4B9X A;  2RA2 A;  2MMP A;  1UB4 A;  2JVV A;  2Y4X A;  1P92 A;  4MMK A;  4MZT A;  4OB2 B;  3OMC A;  4HT9 A;  2RJC A;  5FU7 B;  5CO7 A;  2EQU A;  5GAM f;  3OS1 A;  3QZ9 B;  5I2S A;  2K5I A;  3SD4 A;  3S3M A;  2CZ6 B;  2E12 A;  3C4S A;  5GAN h;  3HRS A;  4M7D A;  1H3Z A;  2P0Q A;  2DO3 A;  1YIT A;  4OGC A;  2L89 A;  3I55 A;  1LNX A;  4XTW A;  4MDW A;  2RI5 A;  4C8Q F;  2CKK A;  1VQN A;  2IG0 A;  5FU7 C;  3SB2 A;  4J7F A;  3V7R A;  3OYM A;  5D6Y A;  3BW1 A;  3GPL A;  2L8D A;  1Q7Y U;  1KC8 C;  2ZPI B;  4IUT A;  3JSC A;  4F7U E;  4C92 G;  2XI9 A;  2JTM A;  2G3R A;  2ZPH B;  1NPR A;  4FM4 B;  3CCR T;  1TH7 A;  4C8Q B;  4UC4 A;  3I56 A;  3M53 A;  2B8A A;  1X6O A;  4XU3 A;  2FVU A;  2ZPB B;  4X9C A;  2XU8 A;  4XTY A;  4OF1 A;  3OYG A;  3CCM T;  3OYC A;  4IUU A;  3T9N A;  2DKG A;  1ZQ1 A;  3N5B B;  4EMK B;  2M9U A;  1K9M C;  2LT4 A;  2O4X B;  3DB3 A;  2QA4 T;  3GP8 A;  1NZ9 A;  4Y91 A;  2BUD A;  3BFM A;  3CC4 T;  3CCJ T;  4IKF A;  1RI0 A;  4QQ6 A;  4BI4 A;  4IUV A;  2VYT A;  1D3B B;  3RMQ A;  5HK0 A;  3CPF A;  2HAX A;  1K8A U;  2JN0 A;  3SWN B;  1I8F A;  4PJO A;  3CME T;  3P8H A;  5I2M A;  1U8R A;  1N9R A;  3A8H B;  2EQM A;  1VIE A;  4M77 G;  3MO8 A;  2RHU A;  3OSV A;  1YIJ A;  1VQ9 A;  4J7I A;  2QQS A;  3QKJ A;  5GAO r;  5CCA A;  4FIB A;  1YJN T;  3JCM d;  3X26 B;  1W4S A;  3EFR A;  4RCC A;  3JCM c;  3OS0 A;  1YJ9 T;  4C8Q D;  5CR2 A;  1WGS A;  2FB7 A;  3OYE A;  4M75 F;  5FRN A;  4RG2 A;  3OA6 A;  3PGG A;  2DAQ A;  4M78 E;  4XTU A;  2L3R A;  1U1T A;  3J7A F;  5HKC A;  4OMF B;  3FIF A;  2P4T A;  5KCO A;  4PLI A;  2KY9 A;  1FWZ A;  4KUD K;  2Y4Y A;  3CD6 T;  3CCQ T;  3CCL T;  3J81 E;  4BDY A;  4LDW A;  1VQM A;  2OTJ A;  1OI1 A;  4FT2 A;  2F69 A;  3CC7 A;  5LJ5 j;  1PSF A;  2AHJ B;  2M1H A;  3RER A;  1Q82 U;  4PJO E;  2VV5 A;  2FL7 A;  2KAF A;  2WAC A;  2H3J A;  3RMS A;  3OYF A;  3OYK A;  1VQK T;  1MHN A;  2XKO C;  4JDS A;  3BY7 A;  1S72 T;  5DY9 A;  1SSF A;  2C06 A;  3HRT A;  2DIQ A;  4F7U G;  2E41 A;  3TRE A;  3JCM W;  1YJW A;  2DD5 A;  4JLI A;  2LDM A;  4M7A E;  4R56 A;  3L2V A;  4C0Z A;  1N27 A;  4A4H A;  1M5Q 1;  1VQO T;  4BY6 B;  4IUP A;  4OGE A;  3CXC A;  4BE2 A;  1BIA A;  4FSX A;  4C92 E;  5GAO l;  4XU1 A;  3GLX A;  3Q1J A;  1NE8 A;  1Q86 U;  1M9S A;  2A3L A;  1YHQ T;  4M78 C;  1Q7Y C;  5GAM h;  3JCM e;  2CS7 A;  3OSS C;  3DKM A;  4RKU E;  3RKY A;  2D9T A;  3DLL A;  3VUZ A;  3JRZ A;  2KSS A;  3KBG A;  3SDZ A;  2EKO A;  4BY6 C;  4RMO A;  2K57 A;  2MWP A;  3MP1 A;  3QG1 A;  3OY9 A;  1Q81 U;  4M7A B;  1VQ4 T;  1R8O B;  3CBM A;  3CBO A;  3OMG A;  1YI2 A;  1KG1 A;  4QVC A;  1X01 A;  2F5T X;  3DB4 A;  3LGF A;  3RIR A;  2OTL A;  4C92 B;  3QJY A;  3OW2 S;  3HP9 A;  3M4Y A;  3JB9 J;  3CMA T;  1KHI A;  4C0G A;  3OYI A;  3FB9 A;  3X25 B;  4BB7 A;  2LVM A;  2A7Y A;  2I2L A;  1BI2 A;  2RJF A;  2XID A;  4YTL A;  5GAN 4;  3JCM P;  2DTH A;  3MEV A;  4M7A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...