3LH0A

Crystal structure of the 53bp1 tandem tudor domain in complex with p53k372me2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into p53 recognition by the 53BP1 tandem Tudor domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3lh0A01
2RJCA 1VQ7T 3PIPA 4QQ6A 2HQXA 2LVMA 3BDLA 4QW2A 3MEWA 3OYEA 2LRQA 2JTFA 4C5IA 4N4IA 1WJRA 3EAEA 2IG0A 2GFUA 3OS1A 1VQ4A 1G5VA 2JOYA 3ER0A 1YITA 2XK0A 3H6ZA 4IUPA 3OYKA 1JJ2A 2XHCA 4E7IA 4TVRA 1VQ4T 3QKJA 2M16A 4L59A 1YJWT 1VQMA 2L3RA 3P8BB 3KBGA 3OYNA 3I55T 3CC2T 3MEUA 3S3NA 2E6ZA 2JNGA 1K73C 1RL2A 2QQRA 2R5MA 1K8AU 4BDZA 1Q81U 2LQ8A 2F5KA 1VQKA 3LX7A 3J7AF 4E7JA 2EFIA 4E7KA 3UT1A 1YHQA 1QVFS 2EQMA 3F70A 3CCUT 3OYGA 2R57A 1OZ2A 3CCJT 3NTIA 3OMGA 2L89A 3KUFA 3CCRT 2M0OA 3MP1A 3CCUA 4IUQA 1M1GA 3G6ET 4PL6A 3LGFA 3OA6A 1Q86U 1VQ8T 3HKSA 1VQNA 3LLRA 3CCLA 2QQSA 2JVVA 1VQKT 4B9XA 4B9WA 3CCET 3META 5KE3A 2EIFA 3OYJA 2XDPA 1XTDA 4Q5WA 4Z02A 3S3OA 1VQ9T 4LD6A 5KH6A 2DO3A 2R5AA 3PIOA 2OTJT 5DM7R 3CMAA 3DLLA 2X4WA 3CPWS 2EQJA 4PLIA 1YI2A 2BKDN 3M9QA 4BD3A 4IKFA 3DLMA 3L2VA 2L8DA 2JZ2A 3MEVA 3CCST 1W2BS 1WJQA 5A2QE 3LGLA 2BIVA 5FRNA 3CMET 4IURA 1YIJT 4A4FA 1VQNT 2GF7A 2E6NA 4IUUA 3NTHA 2MWPA 3JAME 2PQWA 1OYXA 3QBYA 3FDRA 3MEAA 3I56A 5IT9E 1NJIC 1VQ6T 1QVGS 5J3BA 2E70A 3DB4A 3OQ5A 4A4HA 3OYYA 4CRIA 4BE2A 1XNIA 5LL6S 1NPPA 2M1HA 5KCHA 2BUDA 2CKKA 1Q7YC 1VQOA 3G4SA 2G3RA 5FLXE 2EQUA 3QJ6A 2R58A 1YJ9T 1NJIU 4EDUA 4BE1A 1JJ2S 2FHDA 3CCMT 3P8HA 2KDSA 4YTLA 2RO0A 1VQLT 3J80E 1YIJA 1EIFA 3OYDA 5FRMA 4N4GA 4FU6A 4C5GA 4ZN1A 2VYTA 2NLUA 2RHZA 2QEXA 1VQOT 5D6WA 3ME9A 4A4GA 3CCMA 3OYBA 2RJEA 2YRVA 3CC7T 3CMAT 3CXCS 1OZ3A 4HCZA 2OTLA 1MHNA 3Q1JA 1QVGA 2RI3A 3L2QA 3FC3A 1VQ7A 1UEBA 3OYMA 2LDMA 4QQDA 1SSFA 3TREA 3ASKA 3CCLT 4GY5A 3PMIA 1NZ9A 5J39A 2X4YA 1YJNA 1Q7YU 3PMTA 5C0MA 1Q82U 1S72A 3OW2A 2D9TA 3OS2A 3C4SA 4E7HA 3H8ZA 4E7LA 2MWOA 4PLLA 1RI0A 2HQEA 3CD6A 3S6WA 4OVAA 2KVQG 3E9GA 3L2RA 3UWNA 2GFAA 5KCOA 2JUFA 3CCRA 3E9FA 3ZEHA 3CCSA 2K3YA 3PNWC 1N8RU 1N8RC 3G4ST 3MP8A 4NS5A 3G71T 3L42A 3CC4T 1QVFA 2EKOA 2RHIA 2RHYA 4QVZA 1W2BA 1S72T 3CC2A 3OW2S 2OTLT 2P0KA 1KQSA 1M1KU 1VQ5A 5D6YA 3DB3A 2B8AA 5M9OA 5C6SA 2X35A 3G6EA 2MI6A 3O8VA 3OYCA 3QIIA 4X34A 3CPWA 2O4XB 3OMCA 3CCQT 3CMEA 3MO8A 4C5HA 4FL6A 3CCVT 1M1KC 4ZN3A 3FLGA 1NPRA 4A4EA 3CCEA 3I55A 3S3MA 2QA4A 1KHCA 3SD4A 2O4XA 2RJDA 3L2WA 1N27A 3CXCA 1VQLA 1VQ8A 4II1A 3OYLA 1YITT 2DIGA 1K73U 1KC8U 3OB9A 1KC8C 5IN1A 4IUVA 3I56T 5KE2A 4ZTFA 4BACA 2RI2A 2QEXT 4C5EA 1VQ9A 1K9MU 3CCQA 5IAYA 1VQMT 1YJWA 1Q86C 3OYAA 4QQGA 1M90C 3GOXA 5HY6A 2E5QA 4ZTJA 1VQPA 1YBYA 3NTKA 1VQ6A 3LYIA 2QA4T 3OYFA 3LH0A 1WJSA 3L2UA 2X4XA 3CCVA 3G71A 3CC4A 3A5ZB 2DIQA 4RG2A 3CCJA 2LCCA 3PFSA 4BDYA 5DLQE 4IUTA 2LTOA 1KHIA 2EQKA 3CD6T 4UC4A 1M90U 5J26A 1VQ5T 1KQSS 2RHUA 1BKBA 1YJ9A 3FEOA 2K3XA 3OYHA 5D6XA 3P8DA 5FROA 1IZ6A 1OI1A 3MP6A 2RJFA 3J81E 1WGSA 2RI5A 1YJNT 2DAQA 3OYIA 4N4HA 3CEYA 1Q82C 3CC7A 1VQPT 1YI2T 1Q81C 3OS0A 2OTJA 1K8AC 2WACA 1H3ZA 3CPFA 1KD1C 5CIUA 1KD1U 1YHQT 1X6OA 1K9MC 2RHXA 4BE0A 2LCLA 3OY9A
chains in the Genus database with same CATH superfamily
2RJCA 2FG0A 1Q95G 2LVMA 3M54A 3MEWA 2LRQA 4N4IA 1WJRA 3UF4A 3EAEA 2GFUA 1TWBA 1YI2Q 1QCNA 2KYMA 5GAN3 4PJLA 5GJVB 4LDXA 2E3IA 1AD5A 3NHNA 4E7IA 1JJ2A 1WXTA 4C92C 2KT1A 3LW5E 1VQ4T 3QZ9B 3QKJA 4R56A 5A0GA 1YJWT 1VQMA 2K2VA 5D7UA 1SG5A 3P8BB 3OYNA 3I55T 2A36A 4Z8AA 1D09B 4DBQA 1QLYA 3BDUA 4AFZC 1TH7A 1WLPB 2JN0A 1YIJQ 1I8FA 1RL2A 4DBRA 1GFCA 2R5MA 2F69A 1Q81R 2A37A 1ZSZB 2LJ0A 5KYXB 3CMEQ 1WHMA 4C92B 4MDWA 3SFMA 1QCFA 2CUDA 2LQNA 2RMOA 4M77E 4M77C 3CCUT 1AWJA 3NTIA 3OMGA 5HCKA 1UE9A 3TQ7P 1A0NB 1NLOC 1N5ZA 1R77A 2W10A 4IUQA 1M1GA 4PL6A 3LGFA 3JCMe 1Q86U 1Y0MA 5LJ5e 1BU1A 4M75D 1VQNA 4XTYA 1U1SA 2HBWA 4JRPA 2JVVA 2DTOA 2LX9A 1MV3A 1PNJA 5KE3A 2MPXC 1I81A 3OYJA 3M56A 3CBMA 1MMNA 3M59A 3S3OA 1WNLA 1JQQA 2G6FX 4LD6A 5KH6A 3ULRB 1G3YA 1YWOA 3M4YA 1UHFA 2E3HA 2X4WA 1BB9A 2PVGB 3V7RA 4M75F 3M0RA 5GMKh 3DLMA 2DL4A 2L8DA 5HK0A 3MEVA 2EPDA 2O01E 2E5KA 3CCST 5A2QE 1ZBXA 2V1RA 1IRXA 2BIVA 4ELZC 3I55Q 3ZFJA 1YIJT 3THKA 2J06A 3JB9D 5GAN4 1M90R 4HXJA 2O31A 1W2BP 2HAXA 4KGVB 5I2SA 3NTHA 2MWPA 2PQWA 1OYXA 3UA7A 2HDAA 1AWOA 2VV5A 3QBYA 5FU6C 3M0PA 3M5AA 4HKEA 4F7UE 4J6XA 2DEQA 3HPWA 5IT9E 3CCLQ 2JMAA 3M0SA 1MV0B 4JRIA 1UECA 4P5NA 4XU2A 1D3BB 2M1HA 2BUDA 3KXTA 3OSVA 3NFCA 1VQOA 2XI9A 4RG8A 1N8RR 4PFZA 1K76A 2EVRA 1RACB 2ABLA 2JW4A 2P0QA 1M4ZA 3CQTA 1VA7A 1AVZC 1WHJA 3PE0A 2J6KA 2FHDA 3WVEB 2DEUA 4C8QE 3P8HA 2KDSA 3V7SA 1VQLT 2DZCA 4GLKA 5GANj 1VQ8Q 1X6GA 3OYDA 1Z9ZA 3VS7A 2XICA 3EG2A 2DD5A 2NLUA 3CXCP 4A4GA 1AOJA 2LNHB 4BI4A 5LJ5g 1MNDA 1G3TA 4KULA 1RABB 1S1NA 1AT1B 2DMOA 1UTIA 2DD4A 3CC7T 4KGXB 5GMKm 2A28A 3CXCS 1YN8A 1QP3A 1XOVA 4E6RA 2OTLA 4RTWA 5GAMe 4PJOB 2HL5C 2I0NA 3Q1JA 3EGDA 1VQ7Q 2RI3A 2P4TA 4C92G 2DXUA 3UDCA 2LDMA 4QQDA 1HYOA 3TREA 3BY7A 3CCLT 4DBHA 2MYSA 4A63B 4C8QD 1K9AA 1RUWA 3QPHA 5GAOq 1Q7YU 4LD9K 2L2PA 4C0DB 4C92F 3OW2A 2D9TA 3JCMP 4E7HA 1WI7A 1F1BB 1UJ0A 2V8KA 1E7OA 4E7LA 4XTXA 2BZYA 1UG1A 2MWOA 5CKFA 3CD6A 3S6WA 3VS1A 4M77G 1T0HA 2NUTB 2CUBA 2DE0X 2KVQG 5FWCA 2P84A 5KCOA 3E9FA 2K3YA 3G4ST 2FRYA 3L42A 1YJWQ 1QVFA 4R55A 1FYNA 2DL3A 1WYXA 5LJ5d 4RTYA 1KQ2A 1ABOA 3EFOA 2P0KA 4LDWA 4OMLA 5I2MA 3DB3A 5M9OA 2GCXA 2MI6A 2HL3A 3OYCA 4M77B 1WXUA 3QIIA 2E41A 1TXQA 4X34A 2D8JA 1ACMB 1VQKQ 5AT1B 4DOVA 1D1BA 1YJNQ 4ZN3A 3I55A 2RQVA 3VS0A 1Y57A 1W1FA 2RJDA 1N27A 4LDVA 1VQ8A 1WZOA 1YITT 5CO7A 5LJ3e 2DZ9A 1KSWA 1I07A 2EJGA 5IN1A 4FSSA 3QWYA 3I56T 5KE2A 2OTLQ 1SHFA 3HTRA 2KSSA 4AFUC 2RI2A 9ATCB 3PTAA 1AWWA 1K9MU 2ATCB 2OAWA 4LXCA 3GLXA 2X3WD 2CP6A 3OYAA 1Q86C 4QQGA 3GOXA 4DBFA 3G1JA 4AFQC 1TU0B 4DQ2A 1M8MA 2K5FA 4KUDK 4CC3A 1VQNQ 5I21A 2LNVA 4C8QF 4F16A 1UJYA 1WJSA 2LX7A 3L2UA 3CCVA 3G71A 3VUZA 2HKNA 2DRMA 2WSEE 3QSUA 5DLQE 1PC0A 1KHIA 2XD0A 3CCJQ 4CI0C 2BE9B 2A3LA 3M0QA 1TSFA 1AWXA 4JZ3A 5D6XA 5GAMg 2MK5A 1VQMQ 1UB4A 3J81E 4LUDA 1WGSA 5GAOr 1YJNT 3OYIA 2ZPFB 3A8LB 3LWIA 1VQPT 4PJOD 1Q81C 4F17A 2MMPA 2OTJA 1K8AC 3EFRA 2YRDA 2WACA 1PCXA 5FU7B 4FM4B 2FRWA 1T3SA 2X51A 4M7AE 2A0FB 1KFZA 1GCQC 2XU8A 5CIUA 1RLQC 3VV0A 1GL5A 4M78D 2AZSA 2KRSA 2LCLA 1E6HA 1K73R 1RAEB 8ATCB 4B6MA 1AZEA 3EFOB 3BDLA 1NE8A 2KRNA 4FSXA 5LJ3g 1OULA 1R8OB 1OOTA 5LJ3d 4V2SA 2XIDA 1G5VA 1PSEA 2JOYA 2PVDB 1ZLMA 3ER0A 1YITA 3GNGA 1IXDA 4M75G 2XKOC 1GCQA 2DL5A 3JB9F 2E6ZA 2DYBA 2JS0A 1K73C 3UPUA 1M2OA 4A54A 2JTMA 1K8AU 4J7IA 1YFNA 1BI2A 2V26A 4JDSA 4M78G 2KQWA 4A53A 2CYZB 2DF6A 3QG1A 4M78E 4HA8A 4E7KA 3UT1A 5GANe 3OYGA 2R57A 1OZ2A 4M4ZA 4PFPA 3EGXA 1VQ6Q 1HSQA 3PVLA 5IHIA 3G71Q 2M0OA 3MP1A 3VS6A 3G6ET 2VXFA 3R6OA 2GGRA 4MZTA 2CZ7B 3HKSA 1KIKA 3CCLA 2FPEA 1QKWA 4B9XA 4GBQA 4B9WA 3CCET 1UDLA 3VU3C 1CSKA 2EIFA 1WHGA 3CPWP 1M3BA 4Q5WA 2K9GA 3UA6A 4O6JA 4Y92A 1VQ9T 2COZA 4J9EA 2DO3A 2R5AA 2DNUA 3PIOA 2O2OA 2OTJT 1VIEA 2AIRB 3EH1A 5CKDA 3FJPA 1I5OB 3CCMQ 4KH0B 2EQJA 3FRNA 1JU5C 2BKDN 1FMVA 1YCSB 4RKUE 3A8HB 3L2VA 2JZ2A 3N5BB 3H0IA 2H3EB 1VQLQ 2QQBA 3MKDA 4DOWA 2PNIA 1ABQA 5FRNA 1V1CA 5I22A 2EYWA 5LJ5f 2DA9A 1BK2A 4A4FA 4J9GA 3RBBB 4PJOF 1VUBA 3V8JA 3M58A 4EMKC 4IUUA 1X01A 1U3OA 1D1AA 4FW2A 2EYXA 1M1FA 1M1KR 4RTUA 4XTWA 3I56A 2LZ6B 2J6FA 1VYVA 2QGFB 1QVGS 4OGEA 4F7UG 3JCMJ 3JCMV 2K57A 5IXBA 3DB4A 1QMCA 2DX1A 2WSFE 2HEQA 2C0TA 2L3SA 5FU6B 1E6GA 1NM7A 2V8IA 4IIMA 3CMAQ 2D6FA 1JO8A 3QJ6A 1WQ7A 4EDUA 1BI0A 1HK9A 3JB9J 1D0XA 4M78F 2KNBB 1B34B 2EYQA 2FZCB 2FL7A 4NL3A 1JXMA 2QI2A 2RO0A 4C8QG 2EYZA 3M0TA 3CBOA 1VYTA 1EIFA 4M7AG 2DVJA 3WVDB 4RCBA 4C5GA 1IHWA 3QZ5B 4HVUA 4CC2A 4ZN1A 1SRMA 2RHZA 4M7DC 3BW1A 5D6WA 2L3QA 3ME9A 1X2KA 1XQHA 1PKTA 4EMHA 4XK8E 3VS4A 3TSZA 3A8OB 4JUVA 3CCMA 2RJEA 1SSHA 2ZPIB 1AZGB 2YRVA 2KI7A 1D1CA 4M77D 3HFNA 1W70A 3M55A 1YNZA 3INZA 1AHJB 4Z89A 2FPDA 4OMFB 2RM4A 2E64A 1QVGA 1UEBA 3L1AA 3OYMA 2AK5A 4M75E 2EBPA 1SSFA 1IB8A 4HVWA 2YUOA 2XDDA 4M7DA 3JSCA 1U1TA 1YJNA 3PMTA 2BE7D 2RQTA 1IGUA 3DKMA 2EGEA 1Q82U 1S72A 3EGUA 1ZBJA 3OS2A 2IIMA 1QW1A 2NUPA 3JRZA 4PNOA 2VWFA 3EFSA 2KGTA 1RI0A 4EMGA 4BI8B 2E4HA 2OI3A 3H9NA 4LNPA 3E9GA 3UWNA 2GFAA 2KROA 5LJ3f 2QDLA 3NMZC 3PNWC 1SKUB 4NS5A 1SPKA 2RHIA 3SEMA 4QVZA 1C0MA 5IXFA 1W2BA 1WPYA 2RPNA 2SEMA 1IHVA 1QVFP 2DLPA 2GTOA 1NEBA 2B8AA 1W4SA 2CH4A 2K5IA 2O4XB 3OMCA 3OSSC 2LP5A 3VJPA 1SRLA 1X43A 3MO8A 1UHCA 4C5HA 2PUOB 1M1KC 2QA4Q 3FLGA 4A4EA 3JCMQ 3CCEA 1ZSZA 4J5YA 1GRIA 1KHCA 4KT0E 3SD4A 3MPUB 2HSPA 3O5ZA 3E1SA 1BBZA 2DIGA 3G6EQ 1KC8U 3OB9A 2WSCE 3G4SQ 1S72Q 2C0IA 2E10A 4M7AC 4E2FB 1VQ5Q 3AHUA 4C5EA 2KR3A 2EW3A 2VB6A 1OX8A 4JJCA 2RA2A 2F2XA 1D0YA 1K0XA 4JJDA 4ZTJA 2O88A 1YBYA 3C94A 2IPOB 2YSQA 2FYKA 4PJOG 2F2WA 2RN8A 1KG1A 3LYIA 2J05A 2JM9A 3EHRA 1MMDA 3JCMd 3QYGB 3AT1B 4L5GA 3CC4A 4XTZA 2LQKA 4E7ZA 2DIQA 4PKCC 3CCJA 3PFSA 1K4US 2FPFA 2GQVA 1Y07A 4JJNK 1M90U 4BY6C 3CC2Q 3I5SA 1NLPC 2RHUA 5FU7C 3MJXA 1QWFA 2GTJA 1YJ9A 3REAB 1ZHIA 3SHWA 3LH5A 4OMQA 4OGCA 1OV3A 1OI1A 3MP6A 2ED1A 5L23A 5IHNA 4OF1A 4N4HA 1SEMA 3CEYA 2GQIA 2EGCA 2L0AA 1YI2T 4BY6B 1RLPC 1K8AR 4RTXA 2ROLA 2J6OA 1H3ZA 1UFFA 3E2UA 4LDYA 1VOMA 1OPLA 1M5Q1 4CC7A 2F2VA 3TU4K 2QDYB 2E12A 4BE0A 4ANJA 2EJ9A 2YRCA 1GBQA 1VQ7T 2KAFA 2Y4XA 4QQ6A 2HQXA 3QJYA 5GAMf 3OYEA 3QDFA 2JTFA 2AZVA 2IG0A 1MMGA 3OS1A 1JXOA 2HQHA 3HL8A 1CKBA 2DXTA 2CP3A 2RH2A 2XK0A 2GNCA 3H6ZA 2HMAA 4M78B 2DYIA 4IUPA 2XHCA 2DJZA 2IVWA 4L59A 2M16A 2L3RA 2HCKA 3GNFB 4M77A 3MEUA 3CC2T 4HT8A 1X27A 3H0FA 1B34A 1C1AA 4DA4A 3GPLA 3JCMh 3VS3A 3WXMB 1Q81U 2LQ8A 1NEGA 2F5KA 4PJNA 4J83A 3GF5A 3LX7A 3J7AF 3X24B 2EFIA 3REBB 3GBQA 1YHQA 1QVFS 4AMCA 2EQMA 4KRTA 1T3LA 1WHKA 4MDXA 2ESWA 1LPLA 2QTXA 2L89A 4OB2B 4AT1B 1B7TA 1WX6A 1YHQQ 3KUFA 3CCRT 5GAN5 3CC4Q 3BE3A 3OBYA 1TOVA 2D8HA 3OA6A 3CCSQ 1VQ8T 2LT1A 3LLRA 2FVUA 2KEAA 2KK4A 2VVKA 1VQKT 1LOJA 2COWA 3SDZA 4EIKA 2CDTA 2XDPA 1XTDA 2ECZA 1YJ9Q 2VKNA 1OQKA 5KYWA 5KYUB 4HVVA 3JCMf 3KFVA 2OJ2A 2C06A 2ZCFB 3CMAA 1YITQ 3DLLA 1JRIA 1YCYA 3CPWS 4PLIA 1YI2A 3M9QA 3EGDB 4IKFA 1ZQ1A 1BCOA 2P4RA 2LC4A 1GCPA 2JS2A 2DTHA 2ZPHB 3UATA 1ZUYA 2QYZA 2MIOA 1SF9A 2M9UA 3CD6Q 2EJFA 4IURA 4Y28E 3TSWA 4JRQA 4OMOA 1MNEA 2YUQA 5CAIA 2FEIA 1G3WA 1NBEB 4PJOE 2QXFA 4ORZA 1VQNT 4FYYB 4KUIA 2QTVA 5CQYA 3JAME 2JMCA 4M7AD 4MMKA 2EWNA 2OX7A 3FDRA 3PT9A 3MEAA 4JS4A 3QWXX 1NJIC 2ZPGB 2YXYA 1VQ6T 3V8LA 3EG9A 2PUKB 4IIOA 5GANg 2L5QA 1IREB 1QP2A 2COYA 1UGRB 4PJOA 1OPKA 5KYUA 2JXBA 4BE2A 5KCHA 2NUPB 2YUNA 5CVIA 2CKKA 2HD0A 4OB0B 4NOYA 4JLGA 1FMKA 3G4SA 3ZBDA 2G3RA 5GMKl 3HP9A 5FLXE 2EQUA 1T0JA 5CKEA 1VQ9Q 2R58A 4XU3A 1YJ9T 1OU9A 2BZ8A 1HJDA 1YWPA 1KJWA 1JJ2S 4Z88A 1O9SA 3CCMT 2M02A 4X9CA 3L2ZA 4YTLA 1ZSGA 3J80E 2LMJA 1BCMA 1TUCA 2XMFA 4J9HA 5FRMA 4N4GA 4FU6A 4NL2A 4M77F 3EH2A 2LQWA 1X6BA 2VYTA 4HT9A 3MCAB 2QEXA 2DKGA 1RAHB 2DXBA 5GANd 4D8DA 3OYBA 1TTHB 5L8RE 2C0OA 3BFMA 2AKLA 1M9SA 1BI1A 2Z0WA 3CCVQ 2NWMA 4M75A 3CMAT 5KYNA 4D8KA 1K1ZA 1MHNA 3FC3A 1VQ7A 2LJ3A 4MZMA 2FB7A 2KE9A 3I35A 2VASA 4OMPA 4AG1C 4F7UB 4M78A 1BIAA 1NZ9A 1BI3A 4MMLA 5J39A 1NJIR 1Q7YR 1EX4A 5C0MA 2DBKA 2CT3A 4C8QB 1GBRA 1H641 4M7DB 1BIBA 3C0CA 3HFOA 4CC4B 3CC7Q 5ECAA 3H8ZA 4KH1B 2PZ1A 4PLLA 1DJ7B 3TVTA 4C0ZA 4HCCA 2DBMA 4ESRA 4OVAA 3URGA 2P0PA 1G83A 1QVPA 2CREA 3ZEHA 5IH2A 5HKCA 1WHLA 1N8RC 1J3TA 1U8RA 3G71T 2EKOA 1KQSP 4OMNA 3CCUQ 4FIBA 3CC2A 1B07A 2JM8A 3OW2S 3I56Q 2OTLT 4RUGA 1VQ5A 2V1QA 2FZGB 4J6YA 2X35A 1Y71A 2H8HA 1RAFB 3OW2P 2O9VA 4QVDA 3CMEA 1D0ZA 3SWNB 3CCVT 3NGPA 2CSIA 2DILA 3TCJA 3RERA 4FT2A 2HNIA 2DRKA 3S3MA 2Y4YA 4BUGA 4M78C 2YHTA 2O4XA 3CXCA 1I0CA 4M7DF 4DEXA 3OYLA 1K73U 5I11A 5A0DA 2RQUA 4IUVA 2YUPA 5GAN6 3OS5A 4ZTFA 5GAMd 4BACA 1RI9A 2QEXT 1ZUUA 4J9DA 2D0QB 3CCQA 3QYHB 4FYXB 2LT4A 2PVOB 1RAAB 5HY6A 3X20B 1VQPA 2HBPA 3R6NA 3TEEA 1IO6A 4E47A 4J9FA 4HCBA 2QA4T 1M2VB 1PRLC 2DERA 3LH0A 2OAUA 5GANh 3RKWA 2X4XA 2CZ1B 2A08A 3EG9B 2J7IA 1PM3A 2KMTA 2YLCA 4FCYA 2LCCA 4RG2A 4LUEA 4M75B 1V29B 1G2BA 3JV3A 3QXEB 2VXEA 1VQ4Q 3CD6T 4UC4A 1U5SA 4ME7A 3C95A 5J26A 1VQ5T 5GAMj 5GAN8 3VYHB 1KQSS 3X25B 2EAYA 1ZUKA 2K3XA 1CKAA 2ENMA 3GP8A 2LJ1A 3QDRB 3JCMb 1WQWA 5LJ5h 2NUTA 2DTIA 2RJFA 1SHGA 4XQ3A 2A7YA 4WTOB 4X1VA 2KBTA 2X3XD 4J7FA 4LE9A 1ZA2B 1X69A 5DLOA 3D7SB 4XU1A 3CPFA 5AYFA 1KD1C 1MMAA 2CT4A 2PU9B 1KD1U 5CR2A 1YHQT 4WCIA 4FW1A 4L6V5 2E1HA 3A8MB 3M0UA 2RK2A 2DM1A 5GMKi 1WHHA 4J9IA 2RQWA 5DY9A 2NUZA 1TUGB 4J8OA 1EFNA 1U06A 4VUBA 2CP2A 2ZPBB 2DXCA 2M51A 3PIPA 5KYWB 1FMWA 2CP5A 2K5LA 4QW2A 3OBWA 2EYYA 4C5IA 3SWNC 4AG2C 4E7SA 1Y96B 1LJOA 3G7ZA 1VQ4A 3A98A 4OB1B 3OYKA 3VYGA 4TVRA 7AT1B 2CSQA 2GBQA 5GAOm 4PJJA 3VS2A 3KBGA 4HCKA 4C92A 2V8JA 3S3NA 4C8QA 2VUBA 1PKSA 2JNGA 4M7AA 4XTVA 3RUXA 2QQRA 5CK9A 3CCEQ 5KYYB 4BDZA 3MHXA 1FXXA 1VQKA 2DVEA 4E7JA 1H3HA 1K0SA 1QVGP 1I1JA 3SB2A 2X9HA 3RR6A 2MAMA 3F70A 1H92A 1RAGB 3CCJT 4PJOC 1M27C 1ZX6A 3A1PA 2BZXA 2CGHA 3CCUA 3FJ5A 5GANf 1PWTA 2XG8D 2M0YA 2QG9B 3C12A 1KK7A 4EPCA 3X28B 2QQSA 1N9SA 1OX9A 3RESA 3CBPA 1PSFA 2KT8A 3META 3JCMc 1MUZA 4D6WA 2K6DA 4Z02A 2NYSA 5CKHA 2K3BA 5LJ5j 4BI3A 1I5LA 5DM7R 4C0FA 4J6WA 1QQJA 1RAIB 2F1LA 1NYFA 3RNJA 2MOXA 1TS9A 4KGZB 4BD3A 1NYGA 2RB6A 4ZNXA 3RIRA 3E19A 3CCRQ 3V8KA 1W2BS 1WJQA 3SWNA 3LGLA 4OP0A 4J9BA 2ZGWA 2ZPEB 2DPPB 3CMET 2Y90A 2D1XA 4FYWB 1UUEA 2QQAA 3VRYA 4JPBW 5A0LA 2GF7A 2E6NA 3RKYA 3A8GB 1GFDA 4RCCA 1IGQA 1N6AA 1VYUA 5GAMh 4KBMB 1W6XA 4XTUA 2K2MA 2MCNA 1M2VA 1XJWB 2SRCA 2O9SA 4Y91A 4JRKA 1UGVA 4OMMA 1Y7XA 1G8XA 2MF2A 5J3BA 5GAN7 2E70A 2HSEB 1LNXA 1Q86R 2VC8A 3OQ5A 4A4HA 3OYYA 3EG3A 3V7CA 4CRIA 1XNIA 5LL6S 1NPPA 4JJBA 1VIFA 5LJ3j 1Q7YC 4LN2A 4R0KA 2HKQB 2KYBA 1PG5B 2ZAEA 5GAN2 2K7AA 1NJIU 4BE1A 4C0GA 1EZZB 1RADB 3I5RA 2D0NA 3EGXB 3JB9G 2CH4W 1PD0A 3HHTB 1JEGA 1D3BA 1VQPQ 1YIJA 4JZ4A 4C0DC 4XAXB 2EQIA 4OB3B 1BYMA 1PD1A 1O75A 1HD3A 1JJ2P 3JCMW 3QHSA 1VQOT 2ROTA 4N0AC 2EGAA 2I2LA 2K4YA 1JBMA 1NG2A 1WXBA 2VGMA 4GLMA 2DK3A 2K79A 3PGGA 1QKXA 4RTTA 4RTZA 2OTJQ 4QKUA 3CCQQ 3IQLA 2DFUA 2DL7A 4FT4A 3RMQA 3JCMX 2JJ9A 1OZ3A 2HZYA 4HCZA 3M53A 2QASA 3JCMg 4C92E 4RTVA 4M7AB 4C8QC 2CZ0B 3U23A 3L2QA 4ZGEB 4XU0A 4LDUA 4ZGDB 1MGQA 2AT1B 1UGSB 2E65A 4ATOA 4EMKB 1M30A 3ASKA 3FB9A 3EG1A 4GY5A 3PMIA 1LVKA 2X4YA 4N0AA 2QQ9A 3RKXA 5HK3A 1R0BG 4F14A 2FO0A 3JB9H 5FWBA 1Z9QA 2L3PA 5GMKe 2JTEA 1K9MR 3C4SA 2QEXQ 2JT4A 2RD1A 3RDVA 2YLBA 1YP5A 5EC7A 1C6VX 2YDLA 3JB9I 1M3CA 2ED0A 4PJMA 2HQEA 2AKKA 4WF2A 2AHJB 3HRTA 3VS5A 3HRUA 4MZPA 1FX7A 5CCAA 1V76A 1X75C 3L2RA 2JUFA 3CCRA 4O5VA 3CCSA 1N8RU 3MP8A 3CC4T 2RK1A 2RHYA 2W0ZA 4K11A 2QGGA 3NPFA 4C92D 1GXIE 1S72T 4M7DE 1ZSZC 1WDXA 4PK4A 1X2QA 1KQSA 1M1KU 1TUDA 1VQOQ 5D6YA 5FW9A 3VRZA 4DEYA 5C6SA 3G6EA 1KQ1A 1M8VA 1AEYA 3O8VA 5CQXA 3CPWA 5LJ3h 3CCQT 1G3SA 1TG0A 4FL6A 4F7UA 2YWWA 2QK0A 4QVCA 1NPRA 2CZ6B 2KXCA 2QA4A 1WA7A 2VGNA 2DETA 2YT6A 1M3AA 4ZGJB 2CP7A 3L2WA 1VQLA 4II1A 3HSBA 1FWZA 2DJQA 2RNAA 1KC8C 3QO3A 4X9DA 1KD1R 1WIEA 5GJWB 1VQ9A 2XDBA 3M4GA 1HXDA 4RMOA 5IAYA 6AT1B 1VQMT 1YJWA 1PRMC 1M90C 2PTKA 4M7DD 1PHTA 1QWEA 2E5QA 2X4JA 4J9CA 5GMKj 3NTKA 3GIBA 1OU8A 1VQ6A 5GAOp 1JB0E 1WFWA 1P92A 2EKHA 3OYFA 2KRMA 5GAOl 3M57A 3VKIA 4BB7A 1Y96A 3A5ZB 2CS7A 4QT7A 1KC8R 2B86A 1ZA1B 1UGQB 4BDYA 1LCKA 1N9RA 4IUTA 2LTOA 2EQKA 1ARKA 3LWHA 1UGPB 2RQRA 2F5TX 1BKBA 5KYXA 3QUIA 1B3QA 3FEOA 4M7AF 4FYVB 3FIFA 3T9NA 3OYHA 5IHKA 3PVQA 3P8DA 5FROA 1IZ6A 2CP0A 3EG0A 5CKBA 4M75C 3H41A 3I9QA 2RI5A 2DAQA 3ZL7C 2H3JA 4M7DG 1Q82C 2KY9A 1OEBA 4AFSC 3CC7A 3X26B 2RF0A 3VUBA 8AT1B 2BTTA 3OS0A 1H8KA 5GAOn 1I4K1 4F7UF 2KXDA 1R0CB 5EG2A 2ZZDA 3H0HA 4JLIA 2LCSA 4ELYC 3RMSA 2QAZA 3HRSA 3EHQA 1X6OA 1K9MC 4A4KA 5KYYA 4EMKA 2RHXA 4PFOA 1Q82R 1QCOA 2DL8A 4F04B 2FZKB 3OY9A 4JS5A
chains in the Genus database with same CATH topology
2RJCA 4VUBA 2EJ9A 2ZPBB 1VQ7T 2KAFA 2DXCA 2Y4XA 4QQ6A 2HQXA 3QJYA 3PIPA 2LVMA 3M54A 2K5LA 3BDLA 1NE8A 3MEWA 4FSXA 4QW2A 2LRQA 5GAMf 3OYEA 3OBWA 2JTFA 3SWNC 4C5IA 5LJ3g 4N4IA 1WJRA 1R8OB 3EAEA 1Y96B 1LJOA 2GFUA 2IG0A 5LJ3d 3G7ZA 3OS1A 1VQ4A 4V2SA 2XIDA 1G5VA 1PSEA 3HL8A 5GAN3 2JOYA 2PVDB 4OB1B 2DXTA 4LDXA 3ER0A 1YITA 2RH2A 2XK0A 3GNGA 3H6ZA 4IUPA 4M75G 4M78B 3VYGA 2XHCA 4C92C 3OYKA 2XKOC 4TVRA 4E7IA 3LW5E 1JJ2A 2DJZA 2IVWA 1VQ4T 3QZ9B 3QKJA 2M16A 4L59A 4R56A 5GAOm 3JB9F 5A0GA 1YJWT 1VQMA 2K2VA 2L3RA 3P8BB 3KBGA 3OYNA 3GNFB 3I55T 4M77A 4C92A 2V8JA 3MEUA 3CC2T 3S3NA 2E6ZA 4C8QA 3BDUA 1TH7A 2JN0A 2VUBA 4HT8A 2JNGA 1B34A 1K73C 1I8FA 1RL2A 4XTVA 3RUXA 2QQRA 2R5MA 4A54A 5CK9A 3GPLA 3UPUA 4DA4A 3JCMh 2JTMA 2F69A 1K8AU 3WXMB 4J7IA 4BDZA 1Q81U 2LQ8A 3MHXA 1BI2A 4M78G 1FXXA 2F5KA 4JDSA 2KQWA 4J83A 4A53A 3GF5A 4C92B 2DVEA 2CYZB 3QG1A 1VQKA 3LX7A 4E7JA 3J7AF 3X24B 4M78E 4HA8A 2EFIA 4E7KA 4MDWA 3SB2A 3SFMA 3UT1A 5GANe 1YHQA 1QVFS 2EQMA 2MAMA 3F70A 4M77E 4M77C 3CCUT 3OYGA 2R57A 4MDXA 1OZ2A 3CCJT 3NTIA 3OMGA 4PJOC 2QTXA 2L89A 4OB2B 3KUFA 3CCRT 2CGHA 5GAN5 2M0OA 3MP1A 3CCUA 4IUQA 3OBYA 1M1GA 2VXFA 4PL6A 3R6OA 3LGFA 3JCMe 2XG8D 5GANf 3OA6A 3G6ET 4MZTA 1Q86U 2CZ7B 3HKSA 1VQ8T 5LJ5e 3C12A 4M75D 1VQNA 2LT1A 1U1SA 2FVUA 3LLRA 4XTYA 4EPCA 4JRPA 3CCLA 3X28B 2QQSA 2JVVA 1N9SA 2DTOA 2KK4A 2LX9A 3RESA 1VQKT 3CBPA 4B9XA 1LOJA 1PSFA 4B9WA 3META 5KE3A 3CCET 3SDZA 3JCMc 3VU3C 1I81A 2EIFA 3OYJA 4D6WA 2XDPA 1XTDA 4Q5WA 3M56A 3CBMA 4Z02A 3M59A 4O6JA 1WNLA 3S3OA 1VQ9T 4LD6A 3JCMf 5KH6A 2DO3A 2R5AA 3PIOA 5CKHA 1G3YA 2OTJT 5LJ5j 1VIEA 3M4YA 4BI3A 1I5LA 5DM7R 4C0FA 5CKDA 4J6WA 2C06A 2ZCFB 3FJPA 3CMAA 3DLLA 1JRIA 1YCYA 2X4WA 2EQJA 4PLIA 3CPWS 1YI2A 3FRNA 2BKDN 2PVGB 3M9QA 3V7RA 4BD3A 4M75F 4RKUE 4IKFA 3A8HB 1ZQ1A 5GMKh 3DLMA 2RB6A 2L8DA 3RIRA 3L2VA 2JZ2A 3N5BB 5HK0A 2LC4A 3E19A 2QQBA 3MEVA 2O01E 4DOWA 2DTHA 3CCST 3V8KA 1W2BS 1WJQA 5A2QE 1ZBXA 3SWNA 3LGLA 2BIVA 2ZPHB 4OP0A 4ELZC 5FRNA 2ZGWA 2ZPEB 2DPPB 2M9UA 5LJ5f 3ZFJA 3CMET 2EJFA 2Y90A 4IURA 4Y28E 4A4FA 4JRQA 1YIJT 5CAIA 1G3WA 4PJOF 1VUBA 3V8JA 4PJOE 2QXFA 3M58A 3JB9D 2QQAA 5GAN4 1VQNT 4EMKC 5A0LA 2GF7A 2E6NA 3RKYA 3A8GB 4KUIA 4IUUA 1X01A 4RCCA 5I2SA 3NTHA 2HAXA 1N6AA 2MWPA 5CQYA 4KBMB 5GAMh 2PQWA 1OYXA 3JAME 4M7AD 4MMKA 4XTUA 1M1FA 2EWNA 4XTWA 2VV5A 3QBYA 5FU6C 3FDRA 3PT9A 3M5AA 3MEAA 4JS4A 4HKEA 3I56A 4F7UE 4J6XA 2DEQA 3HPWA 5IT9E 2ZPGB 1NJIC 1VQ6T 4Y91A 3V8LA 4JRKA 2PUKB 5GANg 1QVGS 2L5QA 1Y7XA 1IREB 2MF2A 4OGEA 4F7UG 1QP2A 3JCMJ 5J3BA 5GAN7 2E70A 1UGRB 1LNXA 4PJOA 3JCMV 2K57A 2VC8A 3DB4A 3OQ5A 4A4HA 4JRIA 3OYYA 2WSFE 4P5NA 3V7CA 4CRIA 1XNIA 4XU2A 1D3BB 5LL6S 4BE2A 1NPPA 2M1HA 5KCHA 1VIFA 2BUDA 3KXTA 3OSVA 5CVIA 5FU6B 5LJ3j 2CKKA 2HD0A 1Q7YC 3NFCA 1VQOA 4OB0B 2XI9A 4RG8A 4NOYA 4JLGA 2V8IA 3G4SA 3ZBDA 2G3RA 5GMKl 3HP9A 5FLXE 2EQUA 2D6FA 3QJ6A 2P0QA 1M4ZA 5CKEA 5GAN2 2R58A 4M7AA 1WQ7A 4XU3A 1YJ9T 4EDUA 1NJIU 1BI0A 4BE1A 4C0GA 1HK9A 1JJ2S 3JB9J 2FHDA 4M78F 1O9SA 3WVEB 4C8QE 1B34B 2EYQA 3JB9G 3CCMT 4NL3A 2FL7A 3P8HA 2KDSA 3HHTB 2QI2A 4X9CA 3V7SA 3L2ZA 4YTLA 2RO0A 4C8QG 1D3BA 1VQLT 3CBOA 2DZCA 3J80E 1YIJA 4GLKA 5GANj 1EIFA 4M7AG 3OYDA 4C0DC 5FRMA 3WVDB 4N4GA 4FU6A 4NL2A 4M77F 4RCBA 4XAXB 4C5GA 2XICA 4OB3B 1BYMA 3QZ5B 2DD5A 2VYTA 2NLUA 1O75A 2RHZA 3MCAB 3BW1A 4ZN1A 3JCMW 4HT9A 4M7DC 3QHSA 5D6WA 2QEXA 2DKGA 3ME9A 4N0AC 1VQOT 1XQHA 2DXBA 2I2LA 2K4YA 4XK8E 4A4GA 4EMHA 1JBMA 5GANd 4BI4A 3A8OB 4JUVA 5LJ5g 3OYBA 3CCMA 2RJEA 1G3TA 2VGMA 4KULA 2DK3A 3PGGA 5L8RE 2ZPIB 3BFMA 2YRVA 2DD4A 4M77D 3HFNA 1M9SA 4FT4A 3CC4A 3M55A 3CC7T 3RMQA 1BI1A 5GMKm 4M75A 3CMAT 3JCMX 1OZ3A 3INZA 3CXCS 1AHJB 4HCZA 3M53A 1QP3A 1XOVA 3JCMg 2OTLA 4C92E 5GAMe 4PJOB 4OMFB 4C8QC 4M7AB 1MHNA 2RM4A 2CZ0B 3Q1JA 2E64A 2RI3A 4ZGEB 3L2QA 2P4TA 1QVGA 4C92G 3FC3A 2DXUA 4XU0A 3UDCA 1VQ7A 1UEBA 3L1AA 3OYMA 4LDUA 2FB7A 2LDMA 4MZMA 4ZGDB 4M75E 4QQDA 1MGQA 1UGSB 2E65A 4ATOA 4EMKB 1SSFA 3TREA 3BY7A 3ASKA 3FB9A 3CCLT 4F7UB 4M78A 1BIAA 4GY5A 1U8RA 3PMIA 2XDDA 4M7DA 1NZ9A 1BI3A 4C8QD 3JSCA 4MMLA 5J39A 2X4YA 4N0AA 1U1TA 2QQ9A 3QPHA 3RKXA 1YJNA 5GAOq 5HK3A 1Q7YU 3PMTA 5C0MA 3DKMA 3JB9H 4LD9K 4C0DB 1Q82U 5GMKe 4C92F 1S72A 4C8QB 3OW2A 2D9TA 3OS2A 3JCMP 1H641 3C4SA 4M7DB 1BIBA 3HFOA 4E7HA 2RD1A 1QW1A 3JRZA 2V8KA 3H8ZA 4PNOA 4E7LA 2YLBA 4XTXA 3EFSA 2MWOA 4PLLA 3JB9I 1DJ7B 1RI0A 5CKFA 2HQEA 4WF2A 4C0ZA 4EMGA 3CD6A 3S6WA 4M77G 4BI8B 2AHJB 3HRTA 4HCCA 3HRUA 4MZPA 4OVAA 3URGA 2KVQG 2P0PA 1FX7A 5CCAA 3E9GA 1QVPA 1X75C 3L2RA 3UWNA 2GFAA 5KCOA 2JUFA 3E9FA 3ZEHA 5HKCA 3CCRA 4O5VA 5LJ3f 3CCSA 2K3YA 3PNWC 1N8RU 1N8RC 3MP8A 3G4ST 4NS5A 3G71T 2RK1A 2RHYA 2EKOA 3L42A 2RHIA 4R55A 3CC4T 4QVZA 1QVFA 4C92D 1GXIE 1W2BA 4FIBA 1S72T 3CC2A 4M7DE 3OW2S 1WPYA 5LJ5d 1KQ2A 2OTLT 2P0KA 4LDWA 1KQSA 1M1KU 1VQ5A 5I2MA 5D6YA 4J6YA 3DB3A 2B8AA 5M9OA 5C6SA 2GCXA 1W4SA 2X35A 3G6EA 1Y71A 2K5IA 1KQ1A 1M8VA 2MI6A 3O8VA 5CQXA 3OYCA 4M77B 3QIIA 2E41A 4X34A 3CPWA 2O4XB 3OMCA 3OSSC 5LJ3h 3CCQT 3VJPA 4QVDA 3CMEA 3MO8A 3SWNB 4C5HA 4DOVA 1G3SA 2PUOB 4F7UA 4FL6A 3CCVT 1M1KC 3FLGA 4ZN3A 1NPRA 4A4EA 4QVCA 2CZ6B 3TCJA 3JCMQ 3I55A 3CCEA 4FT2A 3RERA 2HNIA 3S3MA 2Y4YA 2QA4A 4J5YA 4BUGA 2VGNA 4M78C 1KHCA 4KT0E 2YHTA 2O4XA 3SD4A 4ZGJB 2RJDA 3L2WA 1N27A 4LDVA 3CXCA 1VQLA 4II1A 1VQ8A 4M7DF 3OYLA 3E1SA 1YITT 3HSBA 5CO7A 2DIGA 1K73U 5LJ3e 2DZ9A 1KC8U 1FWZA 3OB9A 5A0DA 2WSCE 2EJGA 5IN1A 1KC8C 4IUVA 5GAN6 2E10A 3QO3A 4M7AC 4X9DA 5KE2A 3I56T 2KSSA 3AHUA 3OS5A 4ZTFA 5GAMd 4BACA 2RI2A 2QEXT 4C5EA 3PTAA 2XDBA 1VQ9A 3M4GA 1K9MU 2D0QB 3CCQA 1HXDA 3QYHB 2LT4A 4RMOA 5IAYA 3GLXA 1VQMT 1YJWA 1Q86C 3OYAA 2PVOB 4QQGA 3GOXA 1M90C 5HY6A 2RA2A 4M7DD 3X20B 2E5QA 2X4JA 4ZTJA 1VQPA 2HBPA 1YBYA 3C94A 3TEEA 5GMKj 2FYKA 3NTKA 4PJOG 4DQ2A 2K5FA 4E47A 4KUDK 3GIBA 1KG1A 3LYIA 1VQ6A 4HCBA 5I21A 5GAOp 2QA4T 2LNVA 1JB0E 4C8QF 1P92A 3OYFA 3LH0A 2OAUA 5GANh 1WJSA 3RKWA 3L2UA 3JCMd 2X4XA 2CZ1B 3M57A 3QYGB 4L5GA 3VUZA 5GAOl 3G71A 3CCVA 3VKIA 4BB7A 1Y96A 2LQKA 3A5ZB 2YLCA 2CS7A 2DIQA 2KMTA 4PKCC 4XTZA 2LCCA 4RG2A 3PFSA 3CCJA 4M75B 1UGQB 1V29B 2WSEE 4BDYA 3QSUA 5DLQE 1N9RA 4IUTA 2GQVA 2LTOA 1KHIA 2VXEA 2EQKA 1Y07A 3QXEB 4JJNK 2XD0A 3CD6T 4UC4A 4ME7A 4CI0C 4BY6C 1M90U 3C95A 3LWHA 1UGPB 5J26A 1VQ5T 2A3LA 5GAMj 2F5TX 2RHUA 1BKBA 3VYHB 5GAN8 1KQSS 3X25B 2EAYA 5FU7C 1YJ9A 3QUIA 1ZHIA 3FEOA 2K3XA 4OGCA 4M7AF 3OYHA 3FIFA 5D6XA 3T9NA 5GAMg 3GP8A 3P8DA 5FROA 1IZ6A 3QDRB 5CKBA 1WQWA 5LJ5h 3JCMb 1OI1A 1UB4A 4M75C 2DTIA 3MP6A 2RJFA 3J81E 1WGSA 2RI5A 4OF1A 4XQ3A 5GAOr 2A7YA 2DAQA 1YJNT 2H3JA 3OYIA 4M7DG 4N4HA 3CEYA 1Q82C 2KY9A 2ZPFB 3CC7A 3X26B 3A8LB 3LWIA 1VQPT 3VUBA 4J7FA 1YI2T 4BY6B 4PJOD 1Q81C 2MMPA 3OS0A 2OTJA 1K8AC 3EFRA 2WACA 5GAOn 5FU7B 1I4K1 4F7UF 1H3ZA 4FM4B 5DLOA 4XU1A 3CPFA 4LDYA 4M7AE 5AYFA 2XU8A 2ZZDA 4JLIA 5CIUA 5EG2A 1KD1C 1M5Q1 2PU9B 4ELYC 1KD1U 3RMSA 3VV0A 5CR2A 3HRSA 3TU4K 1X6OA 1YHQT 1K9MC 2QDYB 4A4KA 2E12A 4L6V5 4M78D 4EMKA 2E1HA 3A8MB 2RK2A 2RHXA 4BE0A 5GMKi 2LCLA 5DY9A 3OY9A 4J8OA 4JS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJC A;  1VQ7 T;  3PIP A;  4QQ6 A;  2HQX A;  2LVM A;  3BDL A;  4QW2 A;  3MEW A;  3OYE A;  2LRQ A;  2JTF A;  4C5I A;  4N4I A;  1WJR A;  3EAE A;  2IG0 A;  2GFU A;  3OS1 A;  1VQ4 A;  1G5V A;  2JOY A;  3ER0 A;  1YIT A;  2XK0 A;  3H6Z A;  4IUP A;  3OYK A;  1JJ2 A;  2XHC A;  4E7I A;  4TVR A;  1VQ4 T;  3QKJ A;  2M16 A;  4L59 A;  1YJW T;  1VQM A;  2L3R A;  3P8B B;  3KBG A;  3OYN A;  3I55 T;  3CC2 T;  3MEU A;  3S3N A;  2E6Z A;  2JNG A;  1K73 C;  1RL2 A;  2QQR A;  2R5M A;  1K8A U;  4BDZ A;  1Q81 U;  2LQ8 A;  2F5K A;  1VQK A;  3LX7 A;  3J7A F;  4E7J A;  2EFI A;  4E7K A;  3UT1 A;  1YHQ A;  1QVF S;  2EQM A;  3F70 A;  3CCU T;  3OYG A;  2R57 A;  1OZ2 A;  3CCJ T;  3NTI A;  3OMG A;  2L89 A;  3KUF A;  3CCR T;  2M0O A;  3MP1 A;  3CCU A;  4IUQ A;  1M1G A;  3G6E T;  4PL6 A;  3LGF A;  3OA6 A;  1Q86 U;  1VQ8 T;  3HKS A;  1VQN A;  3LLR A;  3CCL A;  2QQS A;  2JVV A;  1VQK T;  4B9X A;  4B9W A;  3CCE T;  3MET A;  5KE3 A;  2EIF A;  3OYJ A;  2XDP A;  1XTD A;  4Q5W A;  4Z02 A;  3S3O A;  1VQ9 T;  4LD6 A;  5KH6 A;  2DO3 A;  2R5A A;  3PIO A;  2OTJ T;  5DM7 R;  3CMA A;  3DLL A;  2X4W A;  3CPW S;  2EQJ A;  4PLI A;  1YI2 A;  2BKD N;  3M9Q A;  4BD3 A;  4IKF A;  3DLM A;  3L2V A;  2L8D A;  2JZ2 A;  3MEV A;  3CCS T;  1W2B S;  1WJQ A;  5A2Q E;  3LGL A;  2BIV A;  5FRN A;  3CME T;  4IUR A;  1YIJ T;  4A4F A;  1VQN T;  2GF7 A;  2E6N A;  4IUU A;  3NTH A;  2MWP A;  3JAM E;  2PQW A;  1OYX A;  3QBY A;  3FDR A;  3MEA A;  3I56 A;  5IT9 E;  1NJI C;  1VQ6 T;  1QVG S;  5J3B A;  2E70 A;  3DB4 A;  3OQ5 A;  4A4H A;  3OYY A;  4CRI A;  4BE2 A;  1XNI A;  5LL6 S;  1NPP A;  2M1H A;  5KCH A;  2BUD A;  2CKK A;  1Q7Y C;  1VQO A;  3G4S A;  2G3R A;  5FLX E;  2EQU A;  3QJ6 A;  2R58 A;  1YJ9 T;  1NJI U;  4EDU A;  4BE1 A;  1JJ2 S;  2FHD A;  3CCM T;  3P8H A;  2KDS A;  4YTL A;  2RO0 A;  1VQL T;  3J80 E;  1YIJ A;  1EIF A;  3OYD A;  5FRM A;  4N4G A;  4FU6 A;  4C5G A;  4ZN1 A;  2VYT A;  2NLU A;  2RHZ A;  2QEX A;  1VQO T;  5D6W A;  3ME9 A;  4A4G A;  3CCM A;  3OYB A;  2RJE A;  2YRV A;  3CC7 T;  3CMA T;  3CXC S;  1OZ3 A;  4HCZ A;  2OTL A;  1MHN A;  3Q1J A;  1QVG A;  2RI3 A;  3L2Q A;  3FC3 A;  1VQ7 A;  1UEB A;  3OYM A;  2LDM A;  4QQD A;  1SSF A;  3TRE A;  3ASK A;  3CCL T;  4GY5 A;  3PMI A;  1NZ9 A;  5J39 A;  2X4Y A;  1YJN A;  1Q7Y U;  3PMT A;  5C0M A;  1Q82 U;  1S72 A;  3OW2 A;  2D9T A;  3OS2 A;  3C4S A;  4E7H A;  3H8Z A;  4E7L A;  2MWO A;  4PLL A;  1RI0 A;  2HQE A;  3CD6 A;  3S6W A;  4OVA A;  2KVQ G;  3E9G A;  3L2R A;  3UWN A;  2GFA A;  5KCO A;  2JUF A;  3CCR A;  3E9F A;  3ZEH A;  3CCS A;  2K3Y A;  3PNW C;  1N8R U;  1N8R C;  3G4S T;  3MP8 A;  4NS5 A;  3G71 T;  3L42 A;  3CC4 T;  1QVF A;  2EKO A;  2RHI A;  2RHY A;  4QVZ A;  1W2B A;  1S72 T;  3CC2 A;  3OW2 S;  2OTL T;  2P0K A;  1KQS A;  1M1K U;  1VQ5 A;  5D6Y A;  3DB3 A;  2B8A A;  5M9O A;  5C6S A;  2X35 A;  3G6E A;  2MI6 A;  3O8V A;  3OYC A;  3QII A;  4X34 A;  3CPW A;  2O4X B;  3OMC A;  3CCQ T;  3CME A;  3MO8 A;  4C5H A;  4FL6 A;  3CCV T;  1M1K C;  4ZN3 A;  3FLG A;  1NPR A;  4A4E A;  3CCE A;  3I55 A;  3S3M A;  2QA4 A;  1KHC A;  3SD4 A;  2O4X A;  2RJD A;  3L2W A;  1N27 A;  3CXC A;  1VQL A;  1VQ8 A;  4II1 A;  3OYL A;  1YIT T;  2DIG A;  1K73 U;  1KC8 U;  3OB9 A;  1KC8 C;  5IN1 A;  4IUV A;  3I56 T;  5KE2 A;  4ZTF A;  4BAC A;  2RI2 A;  2QEX T;  4C5E A;  1VQ9 A;  1K9M U;  3CCQ A;  5IAY A;  1VQM T;  1YJW A;  1Q86 C;  3OYA A;  4QQG A;  1M90 C;  3GOX A;  5HY6 A;  2E5Q A;  4ZTJ A;  1VQP A;  1YBY A;  3NTK A;  1VQ6 A;  3LYI A;  2QA4 T;  3OYF A;  3LH0 A;  1WJS A;  3L2U A;  2X4X A;  3CCV A;  3G71 A;  3CC4 A;  3A5Z B;  2DIQ A;  4RG2 A;  3CCJ A;  2LCC A;  3PFS A;  4BDY A;  5DLQ E;  4IUT A;  2LTO A;  1KHI A;  2EQK A;  3CD6 T;  4UC4 A;  1M90 U;  5J26 A;  1VQ5 T;  1KQS S;  2RHU A;  1BKB A;  1YJ9 A;  3FEO A;  2K3X A;  3OYH A;  5D6X A;  3P8D A;  5FRO A;  1IZ6 A;  1OI1 A;  3MP6 A;  2RJF A;  3J81 E;  1WGS A;  2RI5 A;  1YJN T;  2DAQ A;  3OYI A;  4N4H A;  3CEY A;  1Q82 C;  3CC7 A;  1VQP T;  1YI2 T;  1Q81 C;  3OS0 A;  2OTJ A;  1K8A C;  2WAC A;  1H3Z A;  3CPF A;  1KD1 C;  5CIU A;  1KD1 U;  1YHQ T;  1X6O A;  1K9M C;  2RHX A;  4BE0 A;  2LCL A;  3OY9 A; 
#chains in the Genus database with same CATH topology
 2RJC A;  2FG0 A;  1Q95 G;  2LVM A;  3M54 A;  3MEW A;  2LRQ A;  4N4I A;  1WJR A;  3UF4 A;  3EAE A;  2GFU A;  1TWB A;  1YI2 Q;  1QCN A;  2KYM A;  5GAN 3;  4PJL A;  5GJV B;  4LDX A;  2E3I A;  1AD5 A;  3NHN A;  4E7I A;  1JJ2 A;  1WXT A;  4C92 C;  2KT1 A;  3LW5 E;  1VQ4 T;  3QZ9 B;  3QKJ A;  4R56 A;  5A0G A;  1YJW T;  1VQM A;  2K2V A;  5D7U A;  1SG5 A;  3P8B B;  3OYN A;  3I55 T;  2A36 A;  4Z8A A;  1D09 B;  4DBQ A;  1QLY A;  3BDU A;  4AFZ C;  1TH7 A;  1WLP B;  2JN0 A;  1YIJ Q;  1I8F A;  1RL2 A;  4DBR A;  1GFC A;  2R5M A;  2F69 A;  1Q81 R;  2A37 A;  1ZSZ B;  2LJ0 A;  5KYX B;  3CME Q;  1WHM A;  4C92 B;  4MDW A;  3SFM A;  1QCF A;  2CUD A;  2LQN A;  2RMO A;  4M77 E;  4M77 C;  3CCU T;  1AWJ A;  3NTI A;  3OMG A;  5HCK A;  1UE9 A;  3TQ7 P;  1A0N B;  1NLO C;  1N5Z A;  1R77 A;  2W10 A;  4IUQ A;  1M1G A;  4PL6 A;  3LGF A;  3JCM e;  1Q86 U;  1Y0M A;  5LJ5 e;  1BU1 A;  4M75 D;  1VQN A;  4XTY A;  1U1S A;  2HBW A;  4JRP A;  2JVV A;  2DTO A;  2LX9 A;  1MV3 A;  1PNJ A;  5KE3 A;  2MPX C;  1I81 A;  3OYJ A;  3M56 A;  3CBM A;  1MMN A;  3M59 A;  3S3O A;  1WNL A;  1JQQ A;  2G6F X;  4LD6 A;  5KH6 A;  3ULR B;  1G3Y A;  1YWO A;  3M4Y A;  1UHF A;  2E3H A;  2X4W A;  1BB9 A;  2PVG B;  3V7R A;  4M75 F;  3M0R A;  5GMK h;  3DLM A;  2DL4 A;  2L8D A;  5HK0 A;  3MEV A;  2EPD A;  2O01 E;  2E5K A;  3CCS T;  5A2Q E;  1ZBX A;  2V1R A;  1IRX A;  2BIV A;  4ELZ C;  3I55 Q;  3ZFJ A;  1YIJ T;  3THK A;  2J06 A;  3JB9 D;  5GAN 4;  1M90 R;  4HXJ A;  2O31 A;  1W2B P;  2HAX A;  4KGV B;  5I2S A;  3NTH A;  2MWP A;  2PQW A;  1OYX A;  3UA7 A;  2HDA A;  1AWO A;  2VV5 A;  3QBY A;  5FU6 C;  3M0P A;  3M5A A;  4HKE A;  4F7U E;  4J6X A;  2DEQ A;  3HPW A;  5IT9 E;  3CCL Q;  2JMA A;  3M0S A;  1MV0 B;  4JRI A;  1UEC A;  4P5N A;  4XU2 A;  1D3B B;  2M1H A;  2BUD A;  3KXT A;  3OSV A;  3NFC A;  1VQO A;  2XI9 A;  4RG8 A;  1N8R R;  4PFZ A;  1K76 A;  2EVR A;  1RAC B;  2ABL A;  2JW4 A;  2P0Q A;  1M4Z A;  3CQT A;  1VA7 A;  1AVZ C;  1WHJ A;  3PE0 A;  2J6K A;  2FHD A;  3WVE B;  2DEU A;  4C8Q E;  3P8H A;  2KDS A;  3V7S A;  1VQL T;  2DZC A;  4GLK A;  5GAN j;  1VQ8 Q;  1X6G A;  3OYD A;  1Z9Z A;  3VS7 A;  2XIC A;  3EG2 A;  2DD5 A;  2NLU A;  3CXC P;  4A4G A;  1AOJ A;  2LNH B;  4BI4 A;  5LJ5 g;  1MND A;  1G3T A;  4KUL A;  1RAB B;  1S1N A;  1AT1 B;  2DMO A;  1UTI A;  2DD4 A;  3CC7 T;  4KGX B;  5GMK m;  2A28 A;  3CXC S;  1YN8 A;  1QP3 A;  1XOV A;  4E6R A;  2OTL A;  4RTW A;  5GAM e;  4PJO B;  2HL5 C;  2I0N A;  3Q1J A;  3EGD A;  1VQ7 Q;  2RI3 A;  2P4T A;  4C92 G;  2DXU A;  3UDC A;  2LDM A;  4QQD A;  1HYO A;  3TRE A;  3BY7 A;  3CCL T;  4DBH A;  2MYS A;  4A63 B;  4C8Q D;  1K9A A;  1RUW A;  3QPH A;  5GAO q;  1Q7Y U;  4LD9 K;  2L2P A;  4C0D B;  4C92 F;  3OW2 A;  2D9T A;  3JCM P;  4E7H A;  1WI7 A;  1F1B B;  1UJ0 A;  2V8K A;  1E7O A;  4E7L A;  4XTX A;  2BZY A;  1UG1 A;  2MWO A;  5CKF A;  3CD6 A;  3S6W A;  3VS1 A;  4M77 G;  1T0H A;  2NUT B;  2CUB A;  2DE0 X;  2KVQ G;  5FWC A;  2P84 A;  5KCO A;  3E9F A;  2K3Y A;  3G4S T;  2FRY A;  3L42 A;  1YJW Q;  1QVF A;  4R55 A;  1FYN A;  2DL3 A;  1WYX A;  5LJ5 d;  4RTY A;  1KQ2 A;  1ABO A;  3EFO A;  2P0K A;  4LDW A;  4OML A;  5I2M A;  3DB3 A;  5M9O A;  2GCX A;  2MI6 A;  2HL3 A;  3OYC A;  4M77 B;  1WXU A;  3QII A;  2E41 A;  1TXQ A;  4X34 A;  2D8J A;  1ACM B;  1VQK Q;  5AT1 B;  4DOV A;  1D1B A;  1YJN Q;  4ZN3 A;  3I55 A;  2RQV A;  3VS0 A;  1Y57 A;  1W1F A;  2RJD A;  1N27 A;  4LDV A;  1VQ8 A;  1WZO A;  1YIT T;  5CO7 A;  5LJ3 e;  2DZ9 A;  1KSW A;  1I07 A;  2EJG A;  5IN1 A;  4FSS A;  3QWY A;  3I56 T;  5KE2 A;  2OTL Q;  1SHF A;  3HTR A;  2KSS A;  4AFU C;  2RI2 A;  9ATC B;  3PTA A;  1AWW A;  1K9M U;  2ATC B;  2OAW A;  4LXC A;  3GLX A;  2X3W D;  2CP6 A;  3OYA A;  1Q86 C;  4QQG A;  3GOX A;  4DBF A;  3G1J A;  4AFQ C;  1TU0 B;  4DQ2 A;  1M8M A;  2K5F A;  4KUD K;  4CC3 A;  1VQN Q;  5I21 A;  2LNV A;  4C8Q F;  4F16 A;  1UJY A;  1WJS A;  2LX7 A;  3L2U A;  3CCV A;  3G71 A;  3VUZ A;  2HKN A;  2DRM A;  2WSE E;  3QSU A;  5DLQ E;  1PC0 A;  1KHI A;  2XD0 A;  3CCJ Q;  4CI0 C;  2BE9 B;  2A3L A;  3M0Q A;  1TSF A;  1AWX A;  4JZ3 A;  5D6X A;  5GAM g;  2MK5 A;  1VQM Q;  1UB4 A;  3J81 E;  4LUD A;  1WGS A;  5GAO r;  1YJN T;  3OYI A;  2ZPF B;  3A8L B;  3LWI A;  1VQP T;  4PJO D;  1Q81 C;  4F17 A;  2MMP A;  2OTJ A;  1K8A C;  3EFR A;  2YRD A;  2WAC A;  1PCX A;  5FU7 B;  4FM4 B;  2FRW A;  1T3S A;  2X51 A;  4M7A E;  2A0F B;  1KFZ A;  1GCQ C;  2XU8 A;  5CIU A;  1RLQ C;  3VV0 A;  1GL5 A;  4M78 D;  2AZS A;  2KRS A;  2LCL A;  1E6H A;  1K73 R;  1RAE B;  8ATC B;  4B6M A;  1AZE A;  3EFO B;  3BDL A;  1NE8 A;  2KRN A;  4FSX A;  5LJ3 g;  1OUL A;  1R8O B;  1OOT A;  5LJ3 d;  4V2S A;  2XID A;  1G5V A;  1PSE A;  2JOY A;  2PVD B;  1ZLM A;  3ER0 A;  1YIT A;  3GNG A;  1IXD A;  4M75 G;  2XKO C;  1GCQ A;  2DL5 A;  3JB9 F;  2E6Z A;  2DYB A;  2JS0 A;  1K73 C;  3UPU A;  1M2O A;  4A54 A;  2JTM A;  1K8A U;  4J7I A;  1YFN A;  1BI2 A;  2V26 A;  4JDS A;  4M78 G;  2KQW A;  4A53 A;  2CYZ B;  2DF6 A;  3QG1 A;  4M78 E;  4HA8 A;  4E7K A;  3UT1 A;  5GAN e;  3OYG A;  2R57 A;  1OZ2 A;  4M4Z A;  4PFP A;  3EGX A;  1VQ6 Q;  1HSQ A;  3PVL A;  5IHI A;  3G71 Q;  2M0O A;  3MP1 A;  3VS6 A;  3G6E T;  2VXF A;  3R6O A;  2GGR A;  4MZT A;  2CZ7 B;  3HKS A;  1KIK A;  3CCL A;  2FPE A;  1QKW A;  4B9X A;  4GBQ A;  4B9W A;  3CCE T;  1UDL A;  3VU3 C;  1CSK A;  2EIF A;  1WHG A;  3CPW P;  1M3B A;  4Q5W A;  2K9G A;  3UA6 A;  4O6J A;  4Y92 A;  1VQ9 T;  2COZ A;  4J9E A;  2DO3 A;  2R5A A;  2DNU A;  3PIO A;  2O2O A;  2OTJ T;  1VIE A;  2AIR B;  3EH1 A;  5CKD A;  3FJP A;  1I5O B;  3CCM Q;  4KH0 B;  2EQJ A;  3FRN A;  1JU5 C;  2BKD N;  1FMV A;  1YCS B;  4RKU E;  3A8H B;  3L2V A;  2JZ2 A;  3N5B B;  3H0I A;  2H3E B;  1VQL Q;  2QQB A;  3MKD A;  4DOW A;  2PNI A;  1ABQ A;  5FRN A;  1V1C A;  5I22 A;  2EYW A;  5LJ5 f;  2DA9 A;  1BK2 A;  4A4F A;  4J9G A;  3RBB B;  4PJO F;  1VUB A;  3V8J A;  3M58 A;  4EMK C;  4IUU A;  1X01 A;  1U3O A;  1D1A A;  4FW2 A;  2EYX A;  1M1F A;  1M1K R;  4RTU A;  4XTW A;  3I56 A;  2LZ6 B;  2J6F A;  1VYV A;  2QGF B;  1QVG S;  4OGE A;  4F7U G;  3JCM J;  3JCM V;  2K57 A;  5IXB A;  3DB4 A;  1QMC A;  2DX1 A;  2WSF E;  2HEQ A;  2C0T A;  2L3S A;  5FU6 B;  1E6G A;  1NM7 A;  2V8I A;  4IIM A;  3CMA Q;  2D6F A;  1JO8 A;  3QJ6 A;  1WQ7 A;  4EDU A;  1BI0 A;  1HK9 A;  3JB9 J;  1D0X A;  4M78 F;  2KNB B;  1B34 B;  2EYQ A;  2FZC B;  2FL7 A;  4NL3 A;  1JXM A;  2QI2 A;  2RO0 A;  4C8Q G;  2EYZ A;  3M0T A;  3CBO A;  1VYT A;  1EIF A;  4M7A G;  2DVJ A;  3WVD B;  4RCB A;  4C5G A;  1IHW A;  3QZ5 B;  4HVU A;  4CC2 A;  4ZN1 A;  1SRM A;  2RHZ A;  4M7D C;  3BW1 A;  5D6W A;  2L3Q A;  3ME9 A;  1X2K A;  1XQH A;  1PKT A;  4EMH A;  4XK8 E;  3VS4 A;  3TSZ A;  3A8O B;  4JUV A;  3CCM A;  2RJE A;  1SSH A;  2ZPI B;  1AZG B;  2YRV A;  2KI7 A;  1D1C A;  4M77 D;  3HFN A;  1W70 A;  3M55 A;  1YNZ A;  3INZ A;  1AHJ B;  4Z89 A;  2FPD A;  4OMF B;  2RM4 A;  2E64 A;  1QVG A;  1UEB A;  3L1A A;  3OYM A;  2AK5 A;  4M75 E;  2EBP A;  1SSF A;  1IB8 A;  4HVW A;  2YUO A;  2XDD A;  4M7D A;  3JSC A;  1U1T A;  1YJN A;  3PMT A;  2BE7 D;  2RQT A;  1IGU A;  3DKM A;  2EGE A;  1Q82 U;  1S72 A;  3EGU A;  1ZBJ A;  3OS2 A;  2IIM A;  1QW1 A;  2NUP A;  3JRZ A;  4PNO A;  2VWF A;  3EFS A;  2KGT A;  1RI0 A;  4EMG A;  4BI8 B;  2E4H A;  2OI3 A;  3H9N A;  4LNP A;  3E9G A;  3UWN A;  2GFA A;  2KRO A;  5LJ3 f;  2QDL A;  3NMZ C;  3PNW C;  1SKU B;  4NS5 A;  1SPK A;  2RHI A;  3SEM A;  4QVZ A;  1C0M A;  5IXF A;  1W2B A;  1WPY A;  2RPN A;  2SEM A;  1IHV A;  1QVF P;  2DLP A;  2GTO A;  1NEB A;  2B8A A;  1W4S A;  2CH4 A;  2K5I A;  2O4X B;  3OMC A;  3OSS C;  2LP5 A;  3VJP A;  1SRL A;  1X43 A;  3MO8 A;  1UHC A;  4C5H A;  2PUO B;  1M1K C;  2QA4 Q;  3FLG A;  4A4E A;  3JCM Q;  3CCE A;  1ZSZ A;  4J5Y A;  1GRI A;  1KHC A;  4KT0 E;  3SD4 A;  3MPU B;  2HSP A;  3O5Z A;  3E1S A;  1BBZ A;  2DIG A;  3G6E Q;  1KC8 U;  3OB9 A;  2WSC E;  3G4S Q;  1S72 Q;  2C0I A;  2E10 A;  4M7A C;  4E2F B;  1VQ5 Q;  3AHU A;  4C5E A;  2KR3 A;  2EW3 A;  2VB6 A;  1OX8 A;  4JJC A;  2RA2 A;  2F2X A;  1D0Y A;  1K0X A;  4JJD A;  4ZTJ A;  2O88 A;  1YBY A;  3C94 A;  2IPO B;  2YSQ A;  2FYK A;  4PJO G;  2F2W A;  2RN8 A;  1KG1 A;  3LYI A;  2J05 A;  2JM9 A;  3EHR A;  1MMD A;  3JCM d;  3QYG B;  3AT1 B;  4L5G A;  3CC4 A;  4XTZ A;  2LQK A;  4E7Z A;  2DIQ A;  4PKC C;  3CCJ A;  3PFS A;  1K4U S;  2FPF A;  2GQV A;  1Y07 A;  4JJN K;  1M90 U;  4BY6 C;  3CC2 Q;  3I5S A;  1NLP C;  2RHU A;  5FU7 C;  3MJX A;  1QWF A;  2GTJ A;  1YJ9 A;  3REA B;  1ZHI A;  3SHW A;  3LH5 A;  4OMQ A;  4OGC A;  1OV3 A;  1OI1 A;  3MP6 A;  2ED1 A;  5L23 A;  5IHN A;  4OF1 A;  4N4H A;  1SEM A;  3CEY A;  2GQI A;  2EGC A;  2L0A A;  1YI2 T;  4BY6 B;  1RLP C;  1K8A R;  4RTX A;  2ROL A;  2J6O A;  1H3Z A;  1UFF A;  3E2U A;  4LDY A;  1VOM A;  1OPL A;  1M5Q 1;  4CC7 A;  2F2V A;  3TU4 K;  2QDY B;  2E12 A;  4BE0 A;  4ANJ A;  2EJ9 A;  2YRC A;  1GBQ A;  1VQ7 T;  2KAF A;  2Y4X A;  4QQ6 A;  2HQX A;  3QJY A;  5GAM f;  3OYE A;  3QDF A;  2JTF A;  2AZV A;  2IG0 A;  1MMG A;  3OS1 A;  1JXO A;  2HQH A;  3HL8 A;  1CKB A;  2DXT A;  2CP3 A;  2RH2 A;  2XK0 A;  2GNC A;  3H6Z A;  2HMA A;  4M78 B;  2DYI A;  4IUP A;  2XHC A;  2DJZ A;  2IVW A;  4L59 A;  2M16 A;  2L3R A;  2HCK A;  3GNF B;  4M77 A;  3MEU A;  3CC2 T;  4HT8 A;  1X27 A;  3H0F A;  1B34 A;  1C1A A;  4DA4 A;  3GPL A;  3JCM h;  3VS3 A;  3WXM B;  1Q81 U;  2LQ8 A;  1NEG A;  2F5K A;  4PJN A;  4J83 A;  3GF5 A;  3LX7 A;  3J7A F;  3X24 B;  2EFI A;  3REB B;  3GBQ A;  1YHQ A;  1QVF S;  4AMC A;  2EQM A;  4KRT A;  1T3L A;  1WHK A;  4MDX A;  2ESW A;  1LPL A;  2QTX A;  2L89 A;  4OB2 B;  4AT1 B;  1B7T A;  1WX6 A;  1YHQ Q;  3KUF A;  3CCR T;  5GAN 5;  3CC4 Q;  3BE3 A;  3OBY A;  1TOV A;  2D8H A;  3OA6 A;  3CCS Q;  1VQ8 T;  2LT1 A;  3LLR A;  2FVU A;  2KEA A;  2KK4 A;  2VVK A;  1VQK T;  1LOJ A;  2COW A;  3SDZ A;  4EIK A;  2CDT A;  2XDP A;  1XTD A;  2ECZ A;  1YJ9 Q;  2VKN A;  1OQK A;  5KYW A;  5KYU B;  4HVV A;  3JCM f;  3KFV A;  2OJ2 A;  2C06 A;  2ZCF B;  3CMA A;  1YIT Q;  3DLL A;  1JRI A;  1YCY A;  3CPW S;  4PLI A;  1YI2 A;  3M9Q A;  3EGD B;  4IKF A;  1ZQ1 A;  1BCO A;  2P4R A;  2LC4 A;  1GCP A;  2JS2 A;  2DTH A;  2ZPH B;  3UAT A;  1ZUY A;  2QYZ A;  2MIO A;  1SF9 A;  2M9U A;  3CD6 Q;  2EJF A;  4IUR A;  4Y28 E;  3TSW A;  4JRQ A;  4OMO A;  1MNE A;  2YUQ A;  5CAI A;  2FEI A;  1G3W A;  1NBE B;  4PJO E;  2QXF A;  4ORZ A;  1VQN T;  4FYY B;  4KUI A;  2QTV A;  5CQY A;  3JAM E;  2JMC A;  4M7A D;  4MMK A;  2EWN A;  2OX7 A;  3FDR A;  3PT9 A;  3MEA A;  4JS4 A;  3QWX X;  1NJI C;  2ZPG B;  2YXY A;  1VQ6 T;  3V8L A;  3EG9 A;  2PUK B;  4IIO A;  5GAN g;  2L5Q A;  1IRE B;  1QP2 A;  2COY A;  1UGR B;  4PJO A;  1OPK A;  5KYU A;  2JXB A;  4BE2 A;  5KCH A;  2NUP B;  2YUN A;  5CVI A;  2CKK A;  2HD0 A;  4OB0 B;  4NOY A;  4JLG A;  1FMK A;  3G4S A;  3ZBD A;  2G3R A;  5GMK l;  3HP9 A;  5FLX E;  2EQU A;  1T0J A;  5CKE A;  1VQ9 Q;  2R58 A;  4XU3 A;  1YJ9 T;  1OU9 A;  2BZ8 A;  1HJD A;  1YWP A;  1KJW A;  1JJ2 S;  4Z88 A;  1O9S A;  3CCM T;  2M02 A;  4X9C A;  3L2Z A;  4YTL A;  1ZSG A;  3J80 E;  2LMJ A;  1BCM A;  1TUC A;  2XMF A;  4J9H A;  5FRM A;  4N4G A;  4FU6 A;  4NL2 A;  4M77 F;  3EH2 A;  2LQW A;  1X6B A;  2VYT A;  4HT9 A;  3MCA B;  2QEX A;  2DKG A;  1RAH B;  2DXB A;  5GAN d;  4D8D A;  3OYB A;  1TTH B;  5L8R E;  2C0O A;  3BFM A;  2AKL A;  1M9S A;  1BI1 A;  2Z0W A;  3CCV Q;  2NWM A;  4M75 A;  3CMA T;  5KYN A;  4D8K A;  1K1Z A;  1MHN A;  3FC3 A;  1VQ7 A;  2LJ3 A;  4MZM A;  2FB7 A;  2KE9 A;  3I35 A;  2VAS A;  4OMP A;  4AG1 C;  4F7U B;  4M78 A;  1BIA A;  1NZ9 A;  1BI3 A;  4MML A;  5J39 A;  1NJI R;  1Q7Y R;  1EX4 A;  5C0M A;  2DBK A;  2CT3 A;  4C8Q B;  1GBR A;  1H64 1;  4M7D B;  1BIB A;  3C0C A;  3HFO A;  4CC4 B;  3CC7 Q;  5ECA A;  3H8Z A;  4KH1 B;  2PZ1 A;  4PLL A;  1DJ7 B;  3TVT A;  4C0Z A;  4HCC A;  2DBM A;  4ESR A;  4OVA A;  3URG A;  2P0P A;  1G83 A;  1QVP A;  2CRE A;  3ZEH A;  5IH2 A;  5HKC A;  1WHL A;  1N8R C;  1J3T A;  1U8R A;  3G71 T;  2EKO A;  1KQS P;  4OMN A;  3CCU Q;  4FIB A;  3CC2 A;  1B07 A;  2JM8 A;  3OW2 S;  3I56 Q;  2OTL T;  4RUG A;  1VQ5 A;  2V1Q A;  2FZG B;  4J6Y A;  2X35 A;  1Y71 A;  2H8H A;  1RAF B;  3OW2 P;  2O9V A;  4QVD A;  3CME A;  1D0Z A;  3SWN B;  3CCV T;  3NGP A;  2CSI A;  2DIL A;  3TCJ A;  3RER A;  4FT2 A;  2HNI A;  2DRK A;  3S3M A;  2Y4Y A;  4BUG A;  4M78 C;  2YHT A;  2O4X A;  3CXC A;  1I0C A;  4M7D F;  4DEX A;  3OYL A;  1K73 U;  5I11 A;  5A0D A;  2RQU A;  4IUV A;  2YUP A;  5GAN 6;  3OS5 A;  4ZTF A;  5GAM d;  4BAC A;  1RI9 A;  2QEX T;  1ZUU A;  4J9D A;  2D0Q B;  3CCQ A;  3QYH B;  4FYX B;  2LT4 A;  2PVO B;  1RAA B;  5HY6 A;  3X20 B;  1VQP A;  2HBP A;  3R6N A;  3TEE A;  1IO6 A;  4E47 A;  4J9F A;  4HCB A;  2QA4 T;  1M2V B;  1PRL C;  2DER A;  3LH0 A;  2OAU A;  5GAN h;  3RKW A;  2X4X A;  2CZ1 B;  2A08 A;  3EG9 B;  2J7I A;  1PM3 A;  2KMT A;  2YLC A;  4FCY A;  2LCC A;  4RG2 A;  4LUE A;  4M75 B;  1V29 B;  1G2B A;  3JV3 A;  3QXE B;  2VXE A;  1VQ4 Q;  3CD6 T;  4UC4 A;  1U5S A;  4ME7 A;  3C95 A;  5J26 A;  1VQ5 T;  5GAM j;  5GAN 8;  3VYH B;  1KQS S;  3X25 B;  2EAY A;  1ZUK A;  2K3X A;  1CKA A;  2ENM A;  3GP8 A;  2LJ1 A;  3QDR B;  3JCM b;  1WQW A;  5LJ5 h;  2NUT A;  2DTI A;  2RJF A;  1SHG A;  4XQ3 A;  2A7Y A;  4WTO B;  4X1V A;  2KBT A;  2X3X D;  4J7F A;  4LE9 A;  1ZA2 B;  1X69 A;  5DLO A;  3D7S B;  4XU1 A;  3CPF A;  5AYF A;  1KD1 C;  1MMA A;  2CT4 A;  2PU9 B;  1KD1 U;  5CR2 A;  1YHQ T;  4WCI A;  4FW1 A;  4L6V 5;  2E1H A;  3A8M B;  3M0U A;  2RK2 A;  2DM1 A;  5GMK i;  1WHH A;  4J9I A;  2RQW A;  5DY9 A;  2NUZ A;  1TUG B;  4J8O A;  1EFN A;  1U06 A;  4VUB A;  2CP2 A;  2ZPB B;  2DXC A;  2M51 A;  3PIP A;  5KYW B;  1FMW A;  2CP5 A;  2K5L A;  4QW2 A;  3OBW A;  2EYY A;  4C5I A;  3SWN C;  4AG2 C;  4E7S A;  1Y96 B;  1LJO A;  3G7Z A;  1VQ4 A;  3A98 A;  4OB1 B;  3OYK A;  3VYG A;  4TVR A;  7AT1 B;  2CSQ A;  2GBQ A;  5GAO m;  4PJJ A;  3VS2 A;  3KBG A;  4HCK A;  4C92 A;  2V8J A;  3S3N A;  4C8Q A;  2VUB A;  1PKS A;  2JNG A;  4M7A A;  4XTV A;  3RUX A;  2QQR A;  5CK9 A;  3CCE Q;  5KYY B;  4BDZ A;  3MHX A;  1FXX A;  1VQK A;  2DVE A;  4E7J A;  1H3H A;  1K0S A;  1QVG P;  1I1J A;  3SB2 A;  2X9H A;  3RR6 A;  2MAM A;  3F70 A;  1H92 A;  1RAG B;  3CCJ T;  4PJO C;  1M27 C;  1ZX6 A;  3A1P A;  2BZX A;  2CGH A;  3CCU A;  3FJ5 A;  5GAN f;  1PWT A;  2XG8 D;  2M0Y A;  2QG9 B;  3C12 A;  1KK7 A;  4EPC A;  3X28 B;  2QQS A;  1N9S A;  1OX9 A;  3RES A;  3CBP A;  1PSF A;  2KT8 A;  3MET A;  3JCM c;  1MUZ A;  4D6W A;  2K6D A;  4Z02 A;  2NYS A;  5CKH A;  2K3B A;  5LJ5 j;  4BI3 A;  1I5L A;  5DM7 R;  4C0F A;  4J6W A;  1QQJ A;  1RAI B;  2F1L A;  1NYF A;  3RNJ A;  2MOX A;  1TS9 A;  4KGZ B;  4BD3 A;  1NYG A;  2RB6 A;  4ZNX A;  3RIR A;  3E19 A;  3CCR Q;  3V8K A;  1W2B S;  1WJQ A;  3SWN A;  3LGL A;  4OP0 A;  4J9B A;  2ZGW A;  2ZPE B;  2DPP B;  3CME T;  2Y90 A;  2D1X A;  4FYW B;  1UUE A;  2QQA A;  3VRY A;  4JPB W;  5A0L A;  2GF7 A;  2E6N A;  3RKY A;  3A8G B;  1GFD A;  4RCC A;  1IGQ A;  1N6A A;  1VYU A;  5GAM h;  4KBM B;  1W6X A;  4XTU A;  2K2M A;  2MCN A;  1M2V A;  1XJW B;  2SRC A;  2O9S A;  4Y91 A;  4JRK A;  1UGV A;  4OMM A;  1Y7X A;  1G8X A;  2MF2 A;  5J3B A;  5GAN 7;  2E70 A;  2HSE B;  1LNX A;  1Q86 R;  2VC8 A;  3OQ5 A;  4A4H A;  3OYY A;  3EG3 A;  3V7C A;  4CRI A;  1XNI A;  5LL6 S;  1NPP A;  4JJB A;  1VIF A;  5LJ3 j;  1Q7Y C;  4LN2 A;  4R0K A;  2HKQ B;  2KYB A;  1PG5 B;  2ZAE A;  5GAN 2;  2K7A A;  1NJI U;  4BE1 A;  4C0G A;  1EZZ B;  1RAD B;  3I5R A;  2D0N A;  3EGX B;  3JB9 G;  2CH4 W;  1PD0 A;  3HHT B;  1JEG A;  1D3B A;  1VQP Q;  1YIJ A;  4JZ4 A;  4C0D C;  4XAX B;  2EQI A;  4OB3 B;  1BYM A;  1PD1 A;  1O75 A;  1HD3 A;  1JJ2 P;  3JCM W;  3QHS A;  1VQO T;  2ROT A;  4N0A C;  2EGA A;  2I2L A;  2K4Y A;  1JBM A;  1NG2 A;  1WXB A;  2VGM A;  4GLM A;  2DK3 A;  2K79 A;  3PGG A;  1QKX A;  4RTT A;  4RTZ A;  2OTJ Q;  4QKU A;  3CCQ Q;  3IQL A;  2DFU A;  2DL7 A;  4FT4 A;  3RMQ A;  3JCM X;  2JJ9 A;  1OZ3 A;  2HZY A;  4HCZ A;  3M53 A;  2QAS A;  3JCM g;  4C92 E;  4RTV A;  4M7A B;  4C8Q C;  2CZ0 B;  3U23 A;  3L2Q A;  4ZGE B;  4XU0 A;  4LDU A;  4ZGD B;  1MGQ A;  2AT1 B;  1UGS B;  2E65 A;  4ATO A;  4EMK B;  1M30 A;  3ASK A;  3FB9 A;  3EG1 A;  4GY5 A;  3PMI A;  1LVK A;  2X4Y A;  4N0A A;  2QQ9 A;  3RKX A;  5HK3 A;  1R0B G;  4F14 A;  2FO0 A;  3JB9 H;  5FWB A;  1Z9Q A;  2L3P A;  5GMK e;  2JTE A;  1K9M R;  3C4S A;  2QEX Q;  2JT4 A;  2RD1 A;  3RDV A;  2YLB A;  1YP5 A;  5EC7 A;  1C6V X;  2YDL A;  3JB9 I;  1M3C A;  2ED0 A;  4PJM A;  2HQE A;  2AKK A;  4WF2 A;  2AHJ B;  3HRT A;  3VS5 A;  3HRU A;  4MZP A;  1FX7 A;  5CCA A;  1V76 A;  1X75 C;  3L2R A;  2JUF A;  3CCR A;  4O5V A;  3CCS A;  1N8R U;  3MP8 A;  3CC4 T;  2RK1 A;  2RHY A;  2W0Z A;  4K11 A;  2QGG A;  3NPF A;  4C92 D;  1GXI E;  1S72 T;  4M7D E;  1ZSZ C;  1WDX A;  4PK4 A;  1X2Q A;  1KQS A;  1M1K U;  1TUD A;  1VQO Q;  5D6Y A;  5FW9 A;  3VRZ A;  4DEY A;  5C6S A;  3G6E A;  1KQ1 A;  1M8V A;  1AEY A;  3O8V A;  5CQX A;  3CPW A;  5LJ3 h;  3CCQ T;  1G3S A;  1TG0 A;  4FL6 A;  4F7U A;  2YWW A;  2QK0 A;  4QVC A;  1NPR A;  2CZ6 B;  2KXC A;  2QA4 A;  1WA7 A;  2VGN A;  2DET A;  2YT6 A;  1M3A A;  4ZGJ B;  2CP7 A;  3L2W A;  1VQL A;  4II1 A;  3HSB A;  1FWZ A;  2DJQ A;  2RNA A;  1KC8 C;  3QO3 A;  4X9D A;  1KD1 R;  1WIE A;  5GJW B;  1VQ9 A;  2XDB A;  3M4G A;  1HXD A;  4RMO A;  5IAY A;  6AT1 B;  1VQM T;  1YJW A;  1PRM C;  1M90 C;  2PTK A;  4M7D D;  1PHT A;  1QWE A;  2E5Q A;  2X4J A;  4J9C A;  5GMK j;  3NTK A;  3GIB A;  1OU8 A;  1VQ6 A;  5GAO p;  1JB0 E;  1WFW A;  1P92 A;  2EKH A;  3OYF A;  2KRM A;  5GAO l;  3M57 A;  3VKI A;  4BB7 A;  1Y96 A;  3A5Z B;  2CS7 A;  4QT7 A;  1KC8 R;  2B86 A;  1ZA1 B;  1UGQ B;  4BDY A;  1LCK A;  1N9R A;  4IUT A;  2LTO A;  2EQK A;  1ARK A;  3LWH A;  1UGP B;  2RQR A;  2F5T X;  1BKB A;  5KYX A;  3QUI A;  1B3Q A;  3FEO A;  4M7A F;  4FYV B;  3FIF A;  3T9N A;  3OYH A;  5IHK A;  3PVQ A;  3P8D A;  5FRO A;  1IZ6 A;  2CP0 A;  3EG0 A;  5CKB A;  4M75 C;  3H41 A;  3I9Q A;  2RI5 A;  2DAQ A;  3ZL7 C;  2H3J A;  4M7D G;  1Q82 C;  2KY9 A;  1OEB A;  4AFS C;  3CC7 A;  3X26 B;  2RF0 A;  3VUB A;  8AT1 B;  2BTT A;  3OS0 A;  1H8K A;  5GAO n;  1I4K 1;  4F7U F;  2KXD A;  1R0C B;  5EG2 A;  2ZZD A;  3H0H A;  4JLI A;  2LCS A;  4ELY C;  3RMS A;  2QAZ A;  3HRS A;  3EHQ A;  1X6O A;  1K9M C;  4A4K A;  5KYY A;  4EMK A;  2RHX A;  4PFO A;  1Q82 R;  1QCO A;  2DL8 A;  4F04 B;  2FZK B;  3OY9 A;  4JS5 A; 
#chains in the Genus database with same CATH homology
 2RJC A;  4VUB A;  2EJ9 A;  2ZPB B;  1VQ7 T;  2KAF A;  2DXC A;  2Y4X A;  4QQ6 A;  2HQX A;  3QJY A;  3PIP A;  2LVM A;  3M54 A;  2K5L A;  3BDL A;  1NE8 A;  3MEW A;  4FSX A;  4QW2 A;  2LRQ A;  5GAM f;  3OYE A;  3OBW A;  2JTF A;  3SWN C;  4C5I A;  5LJ3 g;  4N4I A;  1WJR A;  1R8O B;  3EAE A;  1Y96 B;  1LJO A;  2GFU A;  2IG0 A;  5LJ3 d;  3G7Z A;  3OS1 A;  1VQ4 A;  4V2S A;  2XID A;  1G5V A;  1PSE A;  3HL8 A;  5GAN 3;  2JOY A;  2PVD B;  4OB1 B;  2DXT A;  4LDX A;  3ER0 A;  1YIT A;  2RH2 A;  2XK0 A;  3GNG A;  3H6Z A;  4IUP A;  4M75 G;  4M78 B;  3VYG A;  2XHC A;  4C92 C;  3OYK A;  2XKO C;  4TVR A;  4E7I A;  3LW5 E;  1JJ2 A;  2DJZ A;  2IVW A;  1VQ4 T;  3QZ9 B;  3QKJ A;  2M16 A;  4L59 A;  4R56 A;  5GAO m;  3JB9 F;  5A0G A;  1YJW T;  1VQM A;  2K2V A;  2L3R A;  3P8B B;  3KBG A;  3OYN A;  3GNF B;  3I55 T;  4M77 A;  4C92 A;  2V8J A;  3MEU A;  3CC2 T;  3S3N A;  2E6Z A;  4C8Q A;  3BDU A;  1TH7 A;  2JN0 A;  2VUB A;  4HT8 A;  2JNG A;  1B34 A;  1K73 C;  1I8F A;  1RL2 A;  4XTV A;  3RUX A;  2QQR A;  2R5M A;  4A54 A;  5CK9 A;  3GPL A;  3UPU A;  4DA4 A;  3JCM h;  2JTM A;  2F69 A;  1K8A U;  3WXM B;  4J7I A;  4BDZ A;  1Q81 U;  2LQ8 A;  3MHX A;  1BI2 A;  4M78 G;  1FXX A;  2F5K A;  4JDS A;  2KQW A;  4J83 A;  4A53 A;  3GF5 A;  4C92 B;  2DVE A;  2CYZ B;  3QG1 A;  1VQK A;  3LX7 A;  4E7J A;  3J7A F;  3X24 B;  4M78 E;  4HA8 A;  2EFI A;  4E7K A;  4MDW A;  3SB2 A;  3SFM A;  3UT1 A;  5GAN e;  1YHQ A;  1QVF S;  2EQM A;  2MAM A;  3F70 A;  4M77 E;  4M77 C;  3CCU T;  3OYG A;  2R57 A;  4MDX A;  1OZ2 A;  3CCJ T;  3NTI A;  3OMG A;  4PJO C;  2QTX A;  2L89 A;  4OB2 B;  3KUF A;  3CCR T;  2CGH A;  5GAN 5;  2M0O A;  3MP1 A;  3CCU A;  4IUQ A;  3OBY A;  1M1G A;  2VXF A;  4PL6 A;  3R6O A;  3LGF A;  3JCM e;  2XG8 D;  5GAN f;  3OA6 A;  3G6E T;  4MZT A;  1Q86 U;  2CZ7 B;  3HKS A;  1VQ8 T;  5LJ5 e;  3C12 A;  4M75 D;  1VQN A;  2LT1 A;  1U1S A;  2FVU A;  3LLR A;  4XTY A;  4EPC A;  4JRP A;  3CCL A;  3X28 B;  2QQS A;  2JVV A;  1N9S A;  2DTO A;  2KK4 A;  2LX9 A;  3RES A;  1VQK T;  3CBP A;  4B9X A;  1LOJ A;  1PSF A;  4B9W A;  3MET A;  5KE3 A;  3CCE T;  3SDZ A;  3JCM c;  3VU3 C;  1I81 A;  2EIF A;  3OYJ A;  4D6W A;  2XDP A;  1XTD A;  4Q5W A;  3M56 A;  3CBM A;  4Z02 A;  3M59 A;  4O6J A;  1WNL A;  3S3O A;  1VQ9 T;  4LD6 A;  3JCM f;  5KH6 A;  2DO3 A;  2R5A A;  3PIO A;  5CKH A;  1G3Y A;  2OTJ T;  5LJ5 j;  1VIE A;  3M4Y A;  4BI3 A;  1I5L A;  5DM7 R;  4C0F A;  5CKD A;  4J6W A;  2C06 A;  2ZCF B;  3FJP A;  3CMA A;  3DLL A;  1JRI A;  1YCY A;  2X4W A;  2EQJ A;  4PLI A;  3CPW S;  1YI2 A;  3FRN A;  2BKD N;  2PVG B;  3M9Q A;  3V7R A;  4BD3 A;  4M75 F;  4RKU E;  4IKF A;  3A8H B;  1ZQ1 A;  5GMK h;  3DLM A;  2RB6 A;  2L8D A;  3RIR A;  3L2V A;  2JZ2 A;  3N5B B;  5HK0 A;  2LC4 A;  3E19 A;  2QQB A;  3MEV A;  2O01 E;  4DOW A;  2DTH A;  3CCS T;  3V8K A;  1W2B S;  1WJQ A;  5A2Q E;  1ZBX A;  3SWN A;  3LGL A;  2BIV A;  2ZPH B;  4OP0 A;  4ELZ C;  5FRN A;  2ZGW A;  2ZPE B;  2DPP B;  2M9U A;  5LJ5 f;  3ZFJ A;  3CME T;  2EJF A;  2Y90 A;  4IUR A;  4Y28 E;  4A4F A;  4JRQ A;  1YIJ T;  5CAI A;  1G3W A;  4PJO F;  1VUB A;  3V8J A;  4PJO E;  2QXF A;  3M58 A;  3JB9 D;  2QQA A;  5GAN 4;  1VQN T;  4EMK C;  5A0L A;  2GF7 A;  2E6N A;  3RKY A;  3A8G B;  4KUI A;  4IUU A;  1X01 A;  4RCC A;  5I2S A;  3NTH A;  2HAX A;  1N6A A;  2MWP A;  5CQY A;  4KBM B;  5GAM h;  2PQW A;  1OYX A;  3JAM E;  4M7A D;  4MMK A;  4XTU A;  1M1F A;  2EWN A;  4XTW A;  2VV5 A;  3QBY A;  5FU6 C;  3FDR A;  3PT9 A;  3M5A A;  3MEA A;  4JS4 A;  4HKE A;  3I56 A;  4F7U E;  4J6X A;  2DEQ A;  3HPW A;  5IT9 E;  2ZPG B;  1NJI C;  1VQ6 T;  4Y91 A;  3V8L A;  4JRK A;  2PUK B;  5GAN g;  1QVG S;  2L5Q A;  1Y7X A;  1IRE B;  2MF2 A;  4OGE A;  4F7U G;  1QP2 A;  3JCM J;  5J3B A;  5GAN 7;  2E70 A;  1UGR B;  1LNX A;  4PJO A;  3JCM V;  2K57 A;  2VC8 A;  3DB4 A;  3OQ5 A;  4A4H A;  4JRI A;  3OYY A;  2WSF E;  4P5N A;  3V7C A;  4CRI A;  1XNI A;  4XU2 A;  1D3B B;  5LL6 S;  4BE2 A;  1NPP A;  2M1H A;  5KCH A;  1VIF A;  2BUD A;  3KXT A;  3OSV A;  5CVI A;  5FU6 B;  5LJ3 j;  2CKK A;  2HD0 A;  1Q7Y C;  3NFC A;  1VQO A;  4OB0 B;  2XI9 A;  4RG8 A;  4NOY A;  4JLG A;  2V8I A;  3G4S A;  3ZBD A;  2G3R A;  5GMK l;  3HP9 A;  5FLX E;  2EQU A;  2D6F A;  3QJ6 A;  2P0Q A;  1M4Z A;  5CKE A;  5GAN 2;  2R58 A;  4M7A A;  1WQ7 A;  4XU3 A;  1YJ9 T;  4EDU A;  1NJI U;  1BI0 A;  4BE1 A;  4C0G A;  1HK9 A;  1JJ2 S;  3JB9 J;  2FHD A;  4M78 F;  1O9S A;  3WVE B;  4C8Q E;  1B34 B;  2EYQ A;  3JB9 G;  3CCM T;  4NL3 A;  2FL7 A;  3P8H A;  2KDS A;  3HHT B;  2QI2 A;  4X9C A;  3V7S A;  3L2Z A;  4YTL A;  2RO0 A;  4C8Q G;  1D3B A;  1VQL T;  3CBO A;  2DZC A;  3J80 E;  1YIJ A;  4GLK A;  5GAN j;  1EIF A;  4M7A G;  3OYD A;  4C0D C;  5FRM A;  3WVD B;  4N4G A;  4FU6 A;  4NL2 A;  4M77 F;  4RCB A;  4XAX B;  4C5G A;  2XIC A;  4OB3 B;  1BYM A;  3QZ5 B;  2DD5 A;  2VYT A;  2NLU A;  1O75 A;  2RHZ A;  3MCA B;  3BW1 A;  4ZN1 A;  3JCM W;  4HT9 A;  4M7D C;  3QHS A;  5D6W A;  2QEX A;  2DKG A;  3ME9 A;  4N0A C;  1VQO T;  1XQH A;  2DXB A;  2I2L A;  2K4Y A;  4XK8 E;  4A4G A;  4EMH A;  1JBM A;  5GAN d;  4BI4 A;  3A8O B;  4JUV A;  5LJ5 g;  3OYB A;  3CCM A;  2RJE A;  1G3T A;  2VGM A;  4KUL A;  2DK3 A;  3PGG A;  5L8R E;  2ZPI B;  3BFM A;  2YRV A;  2DD4 A;  4M77 D;  3HFN A;  1M9S A;  4FT4 A;  3CC4 A;  3M55 A;  3CC7 T;  3RMQ A;  1BI1 A;  5GMK m;  4M75 A;  3CMA T;  3JCM X;  1OZ3 A;  3INZ A;  3CXC S;  1AHJ B;  4HCZ A;  3M53 A;  1QP3 A;  1XOV A;  3JCM g;  2OTL A;  4C92 E;  5GAM e;  4PJO B;  4OMF B;  4C8Q C;  4M7A B;  1MHN A;  2RM4 A;  2CZ0 B;  3Q1J A;  2E64 A;  2RI3 A;  4ZGE B;  3L2Q A;  2P4T A;  1QVG A;  4C92 G;  3FC3 A;  2DXU A;  4XU0 A;  3UDC A;  1VQ7 A;  1UEB A;  3L1A A;  3OYM A;  4LDU A;  2FB7 A;  2LDM A;  4MZM A;  4ZGD B;  4M75 E;  4QQD A;  1MGQ A;  1UGS B;  2E65 A;  4ATO A;  4EMK B;  1SSF A;  3TRE A;  3BY7 A;  3ASK A;  3FB9 A;  3CCL T;  4F7U B;  4M78 A;  1BIA A;  4GY5 A;  1U8R A;  3PMI A;  2XDD A;  4M7D A;  1NZ9 A;  1BI3 A;  4C8Q D;  3JSC A;  4MML A;  5J39 A;  2X4Y A;  4N0A A;  1U1T A;  2QQ9 A;  3QPH A;  3RKX A;  1YJN A;  5GAO q;  5HK3 A;  1Q7Y U;  3PMT A;  5C0M A;  3DKM A;  3JB9 H;  4LD9 K;  4C0D B;  1Q82 U;  5GMK e;  4C92 F;  1S72 A;  4C8Q B;  3OW2 A;  2D9T A;  3OS2 A;  3JCM P;  1H64 1;  3C4S A;  4M7D B;  1BIB A;  3HFO A;  4E7H A;  2RD1 A;  1QW1 A;  3JRZ A;  2V8K A;  3H8Z A;  4PNO A;  4E7L A;  2YLB A;  4XTX A;  3EFS A;  2MWO A;  4PLL A;  3JB9 I;  1DJ7 B;  1RI0 A;  5CKF A;  2HQE A;  4WF2 A;  4C0Z A;  4EMG A;  3CD6 A;  3S6W A;  4M77 G;  4BI8 B;  2AHJ B;  3HRT A;  4HCC A;  3HRU A;  4MZP A;  4OVA A;  3URG A;  2KVQ G;  2P0P A;  1FX7 A;  5CCA A;  3E9G A;  1QVP A;  1X75 C;  3L2R A;  3UWN A;  2GFA A;  5KCO A;  2JUF A;  3E9F A;  3ZEH A;  5HKC A;  3CCR A;  4O5V A;  5LJ3 f;  3CCS A;  2K3Y A;  3PNW C;  1N8R U;  1N8R C;  3MP8 A;  3G4S T;  4NS5 A;  3G71 T;  2RK1 A;  2RHY A;  2EKO A;  3L42 A;  2RHI A;  4R55 A;  3CC4 T;  4QVZ A;  1QVF A;  4C92 D;  1GXI E;  1W2B A;  4FIB A;  1S72 T;  3CC2 A;  4M7D E;  3OW2 S;  1WPY A;  5LJ5 d;  1KQ2 A;  2OTL T;  2P0K A;  4LDW A;  1KQS A;  1M1K U;  1VQ5 A;  5I2M A;  5D6Y A;  4J6Y A;  3DB3 A;  2B8A A;  5M9O A;  5C6S A;  2GCX A;  1W4S A;  2X35 A;  3G6E A;  1Y71 A;  2K5I A;  1KQ1 A;  1M8V A;  2MI6 A;  3O8V A;  5CQX A;  3OYC A;  4M77 B;  3QII A;  2E41 A;  4X34 A;  3CPW A;  2O4X B;  3OMC A;  3OSS C;  5LJ3 h;  3CCQ T;  3VJP A;  4QVD A;  3CME A;  3MO8 A;  3SWN B;  4C5H A;  4DOV A;  1G3S A;  2PUO B;  4F7U A;  4FL6 A;  3CCV T;  1M1K C;  3FLG A;  4ZN3 A;  1NPR A;  4A4E A;  4QVC A;  2CZ6 B;  3TCJ A;  3JCM Q;  3I55 A;  3CCE A;  4FT2 A;  3RER A;  2HNI A;  3S3M A;  2Y4Y A;  2QA4 A;  4J5Y A;  4BUG A;  2VGN A;  4M78 C;  1KHC A;  4KT0 E;  2YHT A;  2O4X A;  3SD4 A;  4ZGJ B;  2RJD A;  3L2W A;  1N27 A;  4LDV A;  3CXC A;  1VQL A;  4II1 A;  1VQ8 A;  4M7D F;  3OYL A;  3E1S A;  1YIT T;  3HSB A;  5CO7 A;  2DIG A;  1K73 U;  5LJ3 e;  2DZ9 A;  1KC8 U;  1FWZ A;  3OB9 A;  5A0D A;  2WSC E;  2EJG A;  5IN1 A;  1KC8 C;  4IUV A;  5GAN 6;  2E10 A;  3QO3 A;  4M7A C;  4X9D A;  5KE2 A;  3I56 T;  2KSS A;  3AHU A;  3OS5 A;  4ZTF A;  5GAM d;  4BAC A;  2RI2 A;  2QEX T;  4C5E A;  3PTA A;  2XDB A;  1VQ9 A;  3M4G A;  1K9M U;  2D0Q B;  3CCQ A;  1HXD A;  3QYH B;  2LT4 A;  4RMO A;  5IAY A;  3GLX A;  1VQM T;  1YJW A;  1Q86 C;  3OYA A;  2PVO B;  4QQG A;  3GOX A;  1M90 C;  5HY6 A;  2RA2 A;  4M7D D;  3X20 B;  2E5Q A;  2X4J A;  4ZTJ A;  1VQP A;  2HBP A;  1YBY A;  3C94 A;  3TEE A;  5GMK j;  2FYK A;  3NTK A;  4PJO G;  4DQ2 A;  2K5F A;  4E47 A;  4KUD K;  3GIB A;  1KG1 A;  3LYI A;  1VQ6 A;  4HCB A;  5I21 A;  5GAO p;  2QA4 T;  2LNV A;  1JB0 E;  4C8Q F;  1P92 A;  3OYF A;  3LH0 A;  2OAU A;  5GAN h;  1WJS A;  3RKW A;  3L2U A;  3JCM d;  2X4X A;  2CZ1 B;  3M57 A;  3QYG B;  4L5G A;  3VUZ A;  5GAO l;  3G71 A;  3CCV A;  3VKI A;  4BB7 A;  1Y96 A;  2LQK A;  3A5Z B;  2YLC A;  2CS7 A;  2DIQ A;  2KMT A;  4PKC C;  4XTZ A;  2LCC A;  4RG2 A;  3PFS A;  3CCJ A;  4M75 B;  1UGQ B;  1V29 B;  2WSE E;  4BDY A;  3QSU A;  5DLQ E;  1N9R A;  4IUT A;  2GQV A;  2LTO A;  1KHI A;  2VXE A;  2EQK A;  1Y07 A;  3QXE B;  4JJN K;  2XD0 A;  3CD6 T;  4UC4 A;  4ME7 A;  4CI0 C;  4BY6 C;  1M90 U;  3C95 A;  3LWH A;  1UGP B;  5J26 A;  1VQ5 T;  2A3L A;  5GAM j;  2F5T X;  2RHU A;  1BKB A;  3VYH B;  5GAN 8;  1KQS S;  3X25 B;  2EAY A;  5FU7 C;  1YJ9 A;  3QUI A;  1ZHI A;  3FEO A;  2K3X A;  4OGC A;  4M7A F;  3OYH A;  3FIF A;  5D6X A;  3T9N A;  5GAM g;  3GP8 A;  3P8D A;  5FRO A;  1IZ6 A;  3QDR B;  5CKB A;  1WQW A;  5LJ5 h;  3JCM b;  1OI1 A;  1UB4 A;  4M75 C;  2DTI A;  3MP6 A;  2RJF A;  3J81 E;  1WGS A;  2RI5 A;  4OF1 A;  4XQ3 A;  5GAO r;  2A7Y A;  2DAQ A;  1YJN T;  2H3J A;  3OYI A;  4M7D G;  4N4H A;  3CEY A;  1Q82 C;  2KY9 A;  2ZPF B;  3CC7 A;  3X26 B;  3A8L B;  3LWI A;  1VQP T;  3VUB A;  4J7F A;  1YI2 T;  4BY6 B;  4PJO D;  1Q81 C;  2MMP A;  3OS0 A;  2OTJ A;  1K8A C;  3EFR A;  2WAC A;  5GAO n;  5FU7 B;  1I4K 1;  4F7U F;  1H3Z A;  4FM4 B;  5DLO A;  4XU1 A;  3CPF A;  4LDY A;  4M7A E;  5AYF A;  2XU8 A;  2ZZD A;  4JLI A;  5CIU A;  5EG2 A;  1KD1 C;  1M5Q 1;  2PU9 B;  4ELY C;  1KD1 U;  3RMS A;  3VV0 A;  5CR2 A;  3HRS A;  3TU4 K;  1X6O A;  1YHQ T;  1K9M C;  2QDY B;  4A4K A;  2E12 A;  4L6V 5;  4M78 D;  4EMK A;  2E1H A;  3A8M B;  2RK2 A;  2RHX A;  4BE0 A;  5GMK i;  2LCL A;  5DY9 A;  3OY9 A;  4J8O A;  4JS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...