2COZA

Solution structure of the cap-gly domain in human centrosome-associated protein cap350
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
122
structure length
122
Chain Sequence
GSSGSSGVEHEQQVTESPSLASVPTADELFDFHIGDRVLIGNVQPGILRFKGETSFAKGFWAGVELDKPEGNNNGTYDGIAYFECKEKHGIFAPPQKISHIPENFDDYVDINEDEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords centrosome-associated protein 350
publication title Solution structure of the CAP-Gly domain in human centrosome-associated protein CAP350
rcsb
source organism Homo sapiens
total genus 5
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cozA01
2CP7A 2MPXC 2COWA 2HKNA 2CP0A 1LPLA 1WHHA 1TXQA 2E4HA 1WHJA 2E3HA 2CP2A 1WHGA 1WHMA 2QK0A 2Z0WA 1TOVA 2HKQB 1WHKA 1WHLA 1IXDA 2CP3A 3RDVA 2HL3A 3TQ7P 3E2UA 2CP6A 2M02A 2COYA 2E3IA 2CP5A 2COZA 2HL5C 4B6MA 2HQHA
chains in the Genus database with same CATH superfamily
2RJDA 3I56A 4MMKA 1VQ5T 4XTVA 2D0NA 1M1FA 1WQWA 1TTHB 3EG3A 1Q86C 2HQXA 1S72A 3CCQQ 3CCJT 2F1LA 4LNPA 4BDZA 2KYMA 4N0AA 3I55Q 3OYEA 4D8KA 1ZUUA 3SWNC 1QVGA 5GAN5 1N8RC 4A53A 4ZGEB 3VV0A 2DMOA 1KK7A 3QG1A 1C0MA 3ZFJA 1FXXA 5LJ5e 1Q7YR 5KYUB 3S6WA 2RHIA 2JS0A 1N9RA 5J3BA 2JN0A 4C0FA 1MV0B 1K0XA 2HQEA 1NJIU 5CKHA 1M2VB 2L0AA 1OQKA 4K11A 3I9QA 4B9XA 4XTZA 2DJZA 3DLMA 1S1NA 2DD5A 2MCNA 3CCQT 1YI2T 1EFNA 3CCSQ 4BI8B 3I55T 4JJCA 3G4SQ 1HJDA 4LDUA 4HT8A 4KH1B 4IUPA 2PQWA 3VS3A 4PJJA 4F16A 1Q81U 2AZVA 3JV3A 5GAOp 5D6WA 3CMAA 2H3JA 1D0ZA 4AG1C 1TXQA 1WGSA 4C92A 2YUOA 2HBWA 1V29B 1UFFA 3CC2Q 2RQWA 1Q86U 1SPKA 4HKEA 1LCKA 1UGRB 4PJOA 3NMZC 1W70A 4OGCA 1RAAB 4DA4A 4N4GA 2YRDA 3TSWA 2RJCA 1N8RU 2ED0A 1YWPA 1M27C 1KC8C 2YLBA 5CQXA 3QZ5B 3G4ST 2CGHA 4ATOA 4RTVA 2RJFA 1UJYA 3CCMQ 3OYKA 1SKUB 2DRMA 1QVGS 2X4XA 2EGAA 1M3AA 5EC7A 5GANh 4JS4A 1G2BA 3THKA 4EIKA 4M7DF 4JRPA 1MMAA 2ZAEA 3ME9A 5AYFA 1IHWA 1Z9ZA 5CKBA 4BE2A 3R6OA 1KG1A 2DXCA 1RUWA 1RADB 1YJWT 4CC7A 2E70A 4KUIA 2K5IA 2EQIA 1AT1B 3RMQA 4LDYA 2E5KA 2DIQA 1BK2A 1S72Q 2CYZB 2Y90A 5L8RE 4XU2A 2JMAA 2VWFA 4JPBW 3OMGA 1WX6A 3PMIA 2HQHA 5GAOl 1QVFP 2LP5A 2L89A 1RAFB 4J7FA 2HD0A 4P5NA 2VV5A 3JCMh 5GJVB 3KFVA 1GBRA 1AOJA 4M7AD 5KH6A 2PU9B 2OX7A 4J9DA 1RACB 2G3RA 2VASA 3CCLA 1VQ4Q 3HRSA 3V7RA 4PJNA 1KC8U 1PKTA 5IN1A 2FVUA 2VYTA 4EMKC 3UA6A 3M4GA 2AIRB 3M0TA 2CH4A 1GXIE 2DXBA 2RB6A 3WVEB 1VQPQ 3NTIA 3JCMX 2B8AA 1M30A 2M02A 5A0GA 1HD3A 4IIMA 3VS5A 1OPLA 2EWNA 1AWJA 3JB9F 1VQOT 2A0FB 1MMNA 1U8RA 5GAMh 2KRMA 2JZ2A 2XKOC 4XU1A 2DAQA 2RI3A 3NPFA 2RQVA 2LT1A 2PUOB 2M16A 1AWXA 2OTJA 3MEUA 1AZEA 4QVDA 3VUZA 4MZPA 3RIRA 3RDVA 4DEXA 1TH7A 2C06A 3VS4A 3CMEA 2K3BA 3I5RA 3RR6A 5CKFA 4C8QC 4ORZA 2IPOB 4EMGA 4OMQA 3QIIA 3IQLA 1NG2A 4CC4B 4C0GA 4FL6A 2E41A 1KFZA 3P8HA 3M9QA 2M9UA 1RLQC 1X01A 2AKLA 4LUDA 4FIBA 4D8DA 4RUGA 2KGTA 3JB9H 4OMLA 1KQ1A 2XD0A 2HBPA 2RHYA 3OYCA 2QDYB 1CSKA 3MCAB 3M56A 5D6YA 3RMSA 1TUGB 4M7AC 3GBQA 2E6ZA 5GANf 4R56A 2JJ9A 3CCUT 2R57A 3VJPA 3CBOA 2FHDA 2QXFA 1OU9A 4M7DA 2LJ1A 1NEGA 1UG1A 1XQHA 2ZGWA 3OYMA 2DE0X 1X6OA 3JCMd 4M77F 1NYFA 3TQ7P 3SD4A 2E65A 5AT1B 1YITT 2COYA 4JZ3A 3TVTA 4II1A 1YIJA 2J6KA 3QBYA 5GJWB 3PIOA 2NWMA 4M75D 4J5YA 3R6NA 4E6RA 3CCLQ 3CCEA 1QW1A 1VQ9A 2RO0A 3TSZA 2NYSA 1VQ8T 1WI7A 2BZ8A 2R5AA 3EFRA 2DEUA 1GCQC 3QDRB 4MDWA 2EYWA 2I2LA 3LLRA 3JCMf 1BI0A 3SEMA 2JUFA 4A4EA 2V8KA 1M8MA 1AHJB 3E9GA 3OS2A 3OYIA 3RKWA 2YRVA 4PKCC 1Y7XA 1IREB 5GAMd 2DYIA 3FC3A 1B3QA 2EGEA 2EYQA 4ZGJB 2CZ1B 1KHIA 4OMPA 2J05A 2EKHA 5I2SA 4NL2A 3SWNB 3JCMQ 3E19A 4EMHA 3O8VA 2XDDA 1UGQB 3H6ZA 4E2FB 4FW1A 3A5ZB 2V8IA 4FCYA 2C0OA 3NTKA 5J26A 3L2VA 1W2BA 1WHKA 3CCRA 1VUBA 5GAN4 5GAMf 2L8DA 2VXFA 2DLPA 3RKXA 2ZPGB 2KXDA 2JW4A 2EQKA 5LJ3h 5FRNA 4DBQA 3V7SA 4DEYA 2DXTA 4N4IA 5FLXE 1VIEA 4BY6C 4Y92A 1N27A 2MMPA 1JB0E 3UA7A 1E6GA 1QVPA 1OPKA 3V8JA 3EFSA 5GAN2 5GANe 4BUGA 2YWWA 1TS9A 1Z9QA 1LOJA 3WVDB 4LN2A 2IG0A 4M75C 3MHXA 1DJ7B 3G6ET 1K4US 1X2QA 1KJWA 2D8JA 3QYHB 4C8QG 2Y4XA 4RTUA 1VYUA 1MNDA 1PRLC 3RERA 3RUXA 1JJ2P 2ZPEB 1U06A 3QHSA 1UGVA 3EGUA 3E1SA 4ZNXA 3M55A 5FW9A 3CCJA 4KRTA 3HFNA 4J9IA 3CPWP 4IUVA 1N6AA 1YIJQ 1YJ9T 4V2SA 5GAN6 3G71Q 1VQ6A 1Q7YC 1O9SA 5I21A 2AKKA 5GAN3 1H641 1YHQT 3I5SA 3M0RA 4M7AG 4RTXA 1BBZA 4M77A 5CO7A 3KUFA 3LGFA 3JCMe 1NYGA 1IGQA 4KULA 2GTJA 3F70A 3REBB 1ZQ1A 4ZGDB 4OB1B 2DERA 1QP2A 2ZPFB 3CPWA 3TREA 1X75C 1W2BS 1KQSP 1AVZC 4AFQC 1M4ZA 3DB3A 3CCQA 1YI2A 3I55A 2HSEB 2GFAA 3EHRA 5KYXB 3OYBA 2J06A 5HK0A 3G71T 4OB0B 4C8QE 5FU6B 2B86A 4PL6A 3M0SA 2V8JA 3QXEB 3JCMV 5I2MA 2L3PA 3X28B 5LJ5g 4BDYA 1HK9A 2MPXC 4GLKA 1KQSA 1KQ2A 5GAMe 1FMVA 2AK5A 3MO8A 1BI1A 4MDXA 1ZSZB 4A4KA 4M7AE 4F17A 2HL3A 1Q7YU 3V8LA 2YUNA 4EMKB 4FU6A 2DJQA 3DB4A 1C1AA 4OVAA 1LJOA 3G4SA 3MEAA 2LMJA 3FIFA 3Q1JA 2ZZDA 1BKBA 4FYWB 1XNIA 5LJ3f 5GAOr 1N5ZA 4J83A 2MYSA 2XI9A 3GF5A 2YT6A 5GAOn 5IHNA 1VQ5Q 2FG0A 1K9MR 2QQ9A 2HEQA 4KBMB 1ZSZA 3L2UA 3RNJA 2QGGA 3CCJQ 2CP2A 2HNIA 3CPWS 3VYGA 2A08A 1MGQA 4OGEA 1V76A 2DK3A 5CQYA 4C8QB 3LX7A 4IKFA 1WFWA 3EG9B 2W0ZA 1TWBA 3QSUA 3VUBA 3CCMA 4IIOA 1PWTA 1JRIA 3M57A 2KAFA 4PFOA 3AT1B 2DX1A 1K1ZA 2IVWA 2YXYA 4M75G 1WHHA 3BDUA 3NHNA 2I0NA 2LX7A 4M78D 1TG0A 2QG9B 5CAIA 1VQLQ 1KQSS 2QEXT 2BIVA 2HMAA 1G3WA 4RCBA 1YI2Q 3CD6T 2PVDB 2EJ9A 2HL5C 2XDPA 3EH2A 2ZCFB 2WSEE 5KE3A 2DEQA 3OYDA 5C6SA 4NOYA 1KIKA 3OYYA 1PHTA 4XAXB 2LZ6B 1SSFA 5HCKA 3A8GB 8AT1B 4JZ4A 2JTFA 5GMKj 4MZMA 1TU0B 2FYKA 3VRZA 1TUDA 1Y96B 2F2WA 2QGFB 1VQ4A 1VQLT 2EKOA 5CIUA 2YLCA 4M75E 4J6XA 4RTWA 4XTYA 2YSQA 2HZYA 2A3LA 3A8HB 5IHKA 3P8BB 1VQPA 2LRQA 3VS0A 4LD6A 3QZ9B 2J7IA 2EGCA 5LJ3e 1D09B 4XTXA 2KI7A 5KYUA 1WHJA 3EHQA 3PNWC 1SG5A 3L42A 1SRLA 1YJWQ 2MK5A 3KBGA 5EG2A 3X26B 1M2VA 2PVOB 3OYFA 1Y96A 2AHJB 1K9AA 1MUZA 3U23A 3OBWA 4M78C 4DBRA 2DYBA 2JM8A 1D3BB 1K73R 2RNAA 3BE3A 1D0XA 1AD5A 3GNGA 1B07A 1KSWA 4E7KA 3UDCA 2O2OA 1QLYA 1JU5C 2EPDA 2JNGA 2K6DA 4C0DB 4HA8A 2V26A 2RMOA 2A37A 3FB9A 5A2QE 4BY6B 1YWOA 4QVCA 1M90R 2CSQA 1VQMQ 2OTLQ 4X1VA 2FPEA 1WPYA 3QJYA 2JVVA 2NLUA 2O4XB 3HL8A 4HVUA 4C5EA 1M5Q1 1OZ2A 2HKQB 1OZ3A 1IXDA 4M75B 2DKGA 1OX8A 3SDZA 1VQNT 5FU7C 2MAMA 5KCHA 4OMOA 2DETA 2KT8A 3MP1A 4BE1A 2QK0A 5J39A 3HFOA 1QWFA 1VQOQ 2VGNA 3JRZA 4GBQA 2FRYA 3A8LB 1WIEA 1VQMT 1R77A 2FPDA 3M59A 2VVKA 3CCVQ 2OTLT 2RHUA 4XQ3A 3JCMP 1JBMA 1ZX6A 1QMCA 1PRMC 1YN8A 3I35A 4HT9A 1OI1A 5GAOm 1X27A 4RMOA 1QVFA 2QI2A 1RL2A 3I56T 1ZUYA 1FWZA 2E64A 2RQRA 3HHTB 2H3EB 4OF1A 1U1TA 2GBQA 2YUQA 3VS7A 4J8OA 4E7HA 4M4ZA 2P0QA 1YJNQ 3P8DA 4NS5A 2HKNA 1SF9A 1SEMA 1PD0A 7AT1B 3O5ZA 3ZBDA 4C92D 3CCVT 1U5SA 2E6NA 4LDXA 3LH0A 2CUDA 3VS6A 3CC4Q 3N5BB 3CCUQ 4PJOD 2QQRA 3T9NA 2ENMA 4HCBA 2L2PA 1NE8A 2DL8A 2IIMA 2RN8A 2ZPHB 1LPLA 1Q95G 1UEBA 4DOVA 1YITQ 4PLIA 4HCKA 4HCCA 2VKNA 1OX9A 1B34B 5HY6A 2P4TA 4FYYB 4N0AC 1YJNT 3CPFA 2KDSA 1YHQA 4BACA 1OV3A 3SFMA 4A54A 1VQKQ 3OYHA 5IXBA 2V1QA 4YTLA 1R8OB 4XTWA 2OI3A 3VS1A 3NFCA 1VQ8Q 4DBHA 3C12A 4M78G 1I07A 2ED1A 3GIBA 2QASA 2LCSA 3CC4T 3VRYA 5CKDA 5GANg 3CMAT 1IRXA 3JB9J 4ZN3A 2EJFA 5D7UA 1B7TA 2M0YA 1FMKA 4WCIA 2GQVA 1QP3A 3V7CA 3C94A 2XICA 3QWXX 1X2KA 1Y07A 1QVFS 3HKSA 2JOYA 3X24B 3JCMW 1B34A 5KYYB 4CC2A 2XDBA 3G71A 3M53A 2RHZA 3PIPA 5GAN8 1M9SA 1VIFA 1V1CA 2ECZA 1VQKT 4RTZA 4D6WA 3BFMA 2DTIA 1KD1R 1HYOA 3M5AA 3EGXB 3H0FA 1W6XA 8ATCB 2F5KA 3CBPA 3PVQA 4J9FA 4C92C 2DO3A 5GANj 2P0KA 4DOWA 1T0HA 5HKCA 4PJOC 1I0CA 2X4YA 4E47A 1YP5A 5IXFA 2K57A 4M78E 1M3BA 2MI6A 5DY9A 1BB9A 1H92A 4OMFB 2A7YA 3SHWA 2F2VA 3WXMB 4QT7A 3EFOB 9ATCB 1G8XA 1I5OB 4FW2A 4F7UG 3C95A 1WA7A 3EGXA 5LL6S 1K9MC 4ANJA 1X69A 3G6EQ 4PNOA 2DRKA 5FWBA 5GAMg 2RA2A 1YFNA 2CT4A 2L5QA 1SRMA 2QYZA 2DM1A 4Y28E 2K9GA 2DTHA 2FO0A 2GF7A 4B6MA 1YJ9Q 3UATA 3DKMA 1OOTA 2DVEA 1R0CB 1G5VA 1YHQQ 4OP0A 3SWNA 3EFOA 5D6XA 1RI0A 2RD1A 2R5MA 2KE9A 2K3YA 2L3SA 3C0CA 5DLOA 4Z02A 1TUCA 3JSCA 3X20B 1E6HA 2KNBB 4FSSA 2YDLA 1NEBA 4AFZC 2XHCA 1FMWA 4A63B 1VQ5A 1VOMA 5KYNA 1PSFA 3A1PA 3OYLA 1MHNA 4F7UE 4M7DD 4M78B 1OULA 2YUPA 2MIOA 1QCOA 4HVWA 2SEMA 4Z89A 3BDLA 2K2VA 2LJ0A 3EGDB 4OMNA 3GP8A 3OW2P 2KQWA 4QW2A 1K9MU 2F69A 4ZN1A 1GFDA 3X25B 1WXBA 1RAGB 2KROA 2XMFA 1CKBA 5GMKh 4IUUA 4JJNK 1T3SA 2GTOA 4C8QF 1XJWB 1K0SA 4X9DA 1G3TA 2PZ1A 1BCOA 1JJ2A 2F5TX 5GMKi 4J6WA 1VQLA 2AZSA 1VQ7Q 2CP7A 3QO3A 2BKDN 1PC0A 1ZBXA 3OW2A 5FROA 1BI3A 1ZA1B 2ROTA 3EGDA 1C6VX 2FZCB 2EVRA 2RPNA 4M7AF 1JQQA 2FZGB 3FLGA 4PLLA 3CC7Q 2LQKA 4PFPA 1KHCA 2ATCB 2FRWA 2FL7A 2KBTA 4JS5A 4DBFA 1X6GA 2EYZA 2NUTB 4C92G 3CXCP 2QA4T 5M9OA 4X9CA 2EBPA 1K73C 5KYWB 4MMLA 1RAHB 2LX9A 2O9SA 4PJOG 4HVVA 2DILA 1AZGB 2D9TA 2H8HA 1M1KR 1VQ7T 3EH1A 4F7UB 3RKYA 3JB9D 2DFUA 2O01E 2CUBA 1D1BA 5KYXA 4J9BA 4M7DC 3J80E 3CXCA 1M90C 1T0JA 1QCFA 1WLPB 4EDUA 3CC7T 3MP6A 5LJ3g 2VGMA 4JUVA 2NUZA 3D7SB 1K8AR 1U1SA 2EYXA 5GMKl 5LJ5j 5GAN7 1YJWA 5KYWA 2BE7D 1I81A 1BCMA 1M3CA 3BY7A 2QEXQ 2LTOA 1JJ2S 1IGUA 2E3HA 1WHGA 2LQNA 1PNJA 3CD6Q 1WHMA 1OYXA 3FRNA 4EMKA 4C92E 2RI5A 4XU0A 1VQNA 2Y4YA 1YCYA 2MOXA 2CZ7B 3OW2S 2OAUA 1ABOA 3QYGB 4PJOE 2FZKB 3REAB 1JXOA 4OMMA 4RTTA 1UHFA 3URGA 5CKEA 2LCLA 4B9WA 3PTAA 1K73U 1JEGA 5LJ3j 1NPRA 1IB8A 1VQMA 3J7AF 4OB3B 4E7ZA 4M77D 1Y71A 2OTLA 2HCKA 1WZOA 1NPPA 2CP6A 3OYJA 4OB2B 1ZUKA 3UPUA 1QVGP 3GLXA 2YHTA 4M7AB 3M54A 1WNLA 4DQ2A 1I5LA 4FT2A 2RHXA 1QKXA 1M90U 3H41A 4C8QA 1QCNA 3EG9A 1JXMA 3OS5A 3PT9A 3H9NA 4M75F 3NTHA 4QQGA 4GLMA 2BUDA 2ABLA 1VQOA 3AHUA 3CXCS 2E3IA 4E7LA 3ZEHA 1YBYA 3OY9A 1ARKA 1VQ6T 1WXTA 3CCVA 4FYXB 2RM4A 4C5IA 2FB7A 2R58A 2RK1A 2FPFA 2DPPB 4M7AA 2WSFE 1HXDA 2HSPA 4C92B 4KGZB 1Q82R 3C4SA 4HCZA 4NL3A 4E7JA 1HSQA 3CEYA 2O9VA 3OYNA 1NLPC 1W1FA 2CP5A 4PJOB 5A0DA 2EQJA 1ZBJA 3UT1A 1UJ0A 2DIGA 1K76A 2P84A 4J9GA 2LQ8A 1LNXA 2M0OA 2X51A 4XTUA 1YJNA 2M51A 3HSBA 2D1XA 1I4K1 1WJRA 3PVLA 4N4HA 2O88A 3EG0A 3SB2A 1H3ZA 3VYHB 2KRSA 2D0QB 1M2OA 3CC4A 1BIAA 2CREA 2QQBA 4M77C 1GCQA 1M1GA 3CCUA 1VQNQ 3QJ6A 1NM7A 4M7DG 3OMCA 2GQIA 2RH2A 2X35A 1AWWA 1VYTA 3E9FA 1YITA 2W10A 2BZYA 5I11A 3VKIA 1D1CA 1T3LA 4E7IA 1NLOC 2VUBA 5L23A 4WF2A 1IO6A 1I8FA 2E10A 2D6FA 3OA6A 3M4YA 3JCMJ 1ZSGA 3M0QA 2SRCA 1NZ9A 4Z8AA 1KD1C 3CCST 4RCCA 1VQKA 3QPHA 1G3SA 3PGGA 4GY5A 1ZA2B 1VQ8A 4JRQA 4L59A 4J6YA 4ME7A 4A4GA 2PNIA 4L5GA 5GMKe 1D3BA 3UF4A 2K3XA 5CR2A 3I56Q 1NBEB 1ZLMA 4JLGA 3CC2T 4KGVB 1XTDA 2A28A 5IT9E 3MEVA 2CZ6B 4C8QD 3PMTA 4KH0B 2AT1B 2LDMA 4Y91A 1IZ6A 4M7DE 1WXUA 2E12A 5FU6C 3L1AA 1NJIR 2CDTA 1GFCA 4IUQA 2L3RA 2WACA 2O4XA 2X9HA 2YRCA 3QUIA 2J6FA 1H3HA 3CCMT 2J6OA 3QDFA 4M75A 1PG5B 1MMDA 1TOVA 3PFSA 1J3TA 3JB9G 2KR3A 2A36A 2PVGB 5GAOq 4LDWA 1Q81R 1PM3A 1ZSZC 1KD1U 1UECA 1ACMB 4F14A 4HXJA 1S72T 2JTMA 3KXTA 2DBKA 1N9SA 2JXBA 2KVQG 4PJLA 2KMTA 5IHIA 1Q86R 4BE0A 3MP8A 1H8KA 3INZA 4Z88A 3H8ZA 2GFUA 4JJDA 3BW1A 2DVJA 3TEEA 4CRIA 4PJMA 3CMAQ 3G6EA 2VXEA 3JCMc 3HTRA 2C0IA 1N8RR 1EIFA 3PE0A 2JS2A 2XG8D 1OU8A 2V1RA 3V8KA 2GNCA 1WJSA 2DL5A 3VU3C 2KK4A 1WDXA 2CKKA 4XU3A 1VQ4T 4RG2A 3G1JA 1YJ9A 4KGXB 1MMGA 4IURA 5CCAA 3FJ5A 1QQJA 1EZZB 2JT4A 2X3XD 4J9HA 3QKJA 4M7DB 4BB7A 5GANd 1UDLA 3S3MA 2EJGA 3OSSC 1IHVA 3DLLA 2DBMA 4O5VA 4ESRA 2LNHB 1VQPT 1TSFA 4M77G 2VC8A 2C0TA 4FM4B 4O6JA 4E7SA 4MZTA 4L6V5 2L3QA 2BE9B 2QTVA 4AT1B 1RI9A 2JTEA 4QQ6A 3M0UA 1JO8A 4LXCA 1MV3A 5C0MA 1X6BA 2MF2A 1UE9A 4JDSA 1PKSA 1PCXA 2CH4W 3OYGA 3TU4K 2O31A 2X4WA 3MPUB 1D0YA 2Z0WA 4ELZC 5IAYA 4M78F 3QWYA 3E2UA 3EG1A 2QA4A 2E5QA 1KC8R 2EIFA 4LE9A 1GBQA 2OAWA 4FYVB 2QDLA 4CI0C 5FWCA 1M1KC 4RTYA 3JCMg 3RBBB 5CVIA 2QTXA 3A98A 2DL4A 2QAZA 1UGPB 3OSVA 1VQ7A 3GOXA 4C5GA 3LW5E 4PK4A 3CBMA 4A4HA 1WHLA 3HP9A 4RG8A 4M77E 2DA9A 1UHCA 4ZTFA 5KYYA 1EX4A 2K2MA 2K79A 3VS2A 4AFUC 3EG2A 1K8AC 2HAXA 4BD3A 2DTOA 2QQAA 3CC7A 2KSSA 1W2BP 1A0NB 5I22A 4LD9K 4VUBA 4QKUA 5DM7R 5LJ5h 2KT1A 2KRNA 3HRUA 2WSCE 4QVZA 3JB9I 4KUDK 2FEIA 2NUPB 1RLPC 1AWOA 4A4FA 3CCLT 2CP0A 2CSIA 2OTJQ 2BZXA 4AG2C 1BYMA 2EFIA 3CMEQ 5FRMA 4F7UF 1GRIA 1P92A 1UTIA 1GL5A 4FT4A 4RKUE 2DXUA 2P0PA 4JLIA 4C0DC 1M1KU 2QQSA 1Y0MA 2RF0A 2JM9A 5HK3A 1BU1A 2CT3A 4AFSC 4JJBA 2M1HA 4C5HA 1ABQA 3L2WA 2K5LA 1SSHA 4PFZA 2LQWA 3L2ZA 1RAIB 1D1AA 4JRIA 1I1JA 2LCCA 2GCXA 1UUEA 2QEXA 1UGSB 2ROLA 3GNFB 5GAMj 2NUPA 3CD6A 1CKAA 3OBYA 2VB6A 4M77B 1K8AU 2OTJT 1ZHIA 3S3OA 3A8OB 3JCMb 2K7AA 3S3NA 2DF6A 2LVMA 1E7OA 4UC4A 1R0BG 3L2RA 3CMET 3LH5A 2KEAA 3TCJA 3ER0A 1FX7A 3OQ5A 1MNEA 1G3YA 2EYYA 2QA4Q 4TVRA 3LGLA 1AEYA 3UWNA 3JAME 1QWEA 2CZ0B 2RQTA 3FEOA 1U3OA 2GGRA 2MWPA 5ECAA 3RESA 1Q82C 2KY9A 2PTKA 3HRTA 2LNVA 1YCSB 3LYIA 1QKWA 3CCEQ 1VQ9Q 2E4HA 4M78A 3MJXA 3FDRA 3ASKA 1XOVA 2LJ3A 1M8VA 5CK9A 2P4RA 5LJ5d 5DLQE 3MEWA 2K5FA 2G6FX 5FU7B 2EW3A 3M0PA 1BI2A 5IH2A 1Y57A 4BI4A 1RABB 3MKDA 2COWA 3OYAA 4J7IA 3OS1A 3J81E 1FYNA 4LUEA 6AT1B 2EQMA 2LC4A 1YIJT 4ELYC 5A0LA 1WYXA 2XK0A 2ZPIB 2CP3A 4BI3A 3H0IA 1G83A 2MWOA 1SHFA 3CCET 5LJ5f 1VQ9T 4ZTJA 2ZPBB 1PSEA 5LJ3d 2K4YA 2DL3A 3CCRQ 1WJQA 4F04B 5KE2A 1GCPA 2D8HA 1SHGA 1VA7A 4R0KA 2DD4A 1RAEB 4C92F 3LWIA 3L2QA 2XIDA 1O75A 1UB4A 4LDVA 3HPWA 2NUTA 3G7ZA 4R55A 2F2XA 4X34A 1Q82U 3CCSA 4PJOF 2CS7A 3NGPA 3A8MB 2KYBA 3GPLA 2COZA 2ESWA 4JRKA 2RI2A 2KXCA 1X43A 4J9CA 3META 3FJPA 4KT0E 2RQUA 1BIBA 4F7UA 2DNUA 3ULRB 1W4SA 4WTOB 2RJEA 3CQTA 4IUTA 4XK8E 2HDAA 1LVKA 2DZ9A 4C0ZA 2X3WD 3EAEA 3CC2A 3CCRT 4CC3A 2X4JA 4AMCA 5GMKm 2XU8A 4EPCA 2EQUA 1NJIC 1OEBA 4QQDA 4FSXA 2DL7A 1F1BB 4J9EA 1VQ6Q 3OB9A 2DZCA 2RK2A 1VYVA 3OS0A 5KCOA 1PD1A 2BTTA 2EAYA 3M58A 1WQ7A 3H0HA 3ZL7C 2JMCA 3LWHA 2E1HA 2PUKB 1YNZA 2LT4A 4Q5WA 1Q81C 2OJ2A
chains in the Genus database with same CATH topology
2CP7A 2MPXC 2COWA 2HKNA 2CP0A 1LPLA 1WHHA 1TXQA 2E4HA 1WHJA 2E3HA 2CP2A 1WHGA 1WHMA 2QK0A 2Z0WA 1TOVA 2HKQB 1WHKA 1WHLA 1IXDA 2CP3A 3RDVA 2HL3A 3TQ7P 3E2UA 2CP6A 2M02A 2COYA 2E3IA 2CP5A 2COZA 2HL5C 4B6MA 2HQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP7 A;  2MPX C;  2COW A;  2HKN A;  2CP0 A;  1LPL A;  1WHH A;  1TXQ A;  2E4H A;  1WHJ A;  2E3H A;  2CP2 A;  1WHG A;  1WHM A;  2QK0 A;  2Z0W A;  1TOV A;  2HKQ B;  1WHK A;  1WHL A;  1IXD A;  2CP3 A;  3RDV A;  2HL3 A;  3TQ7 P;  3E2U A;  2CP6 A;  2M02 A;  2COY A;  2E3I A;  2CP5 A;  2COZ A;  2HL5 C;  4B6M A;  2HQH A; 
#chains in the Genus database with same CATH topology
 2RJD A;  3I56 A;  4MMK A;  1VQ5 T;  4XTV A;  2D0N A;  1M1F A;  1WQW A;  1TTH B;  3EG3 A;  1Q86 C;  2HQX A;  1S72 A;  3CCQ Q;  3CCJ T;  2F1L A;  4LNP A;  4BDZ A;  2KYM A;  4N0A A;  3I55 Q;  3OYE A;  4D8K A;  1ZUU A;  3SWN C;  1QVG A;  5GAN 5;  1N8R C;  4A53 A;  4ZGE B;  3VV0 A;  2DMO A;  1KK7 A;  3QG1 A;  1C0M A;  3ZFJ A;  1FXX A;  5LJ5 e;  1Q7Y R;  5KYU B;  3S6W A;  2RHI A;  2JS0 A;  1N9R A;  5J3B A;  2JN0 A;  4C0F A;  1MV0 B;  1K0X A;  2HQE A;  1NJI U;  5CKH A;  1M2V B;  2L0A A;  1OQK A;  4K11 A;  3I9Q A;  4B9X A;  4XTZ A;  2DJZ A;  3DLM A;  1S1N A;  2DD5 A;  2MCN A;  3CCQ T;  1YI2 T;  1EFN A;  3CCS Q;  4BI8 B;  3I55 T;  4JJC A;  3G4S Q;  1HJD A;  4LDU A;  4HT8 A;  4KH1 B;  4IUP A;  2PQW A;  3VS3 A;  4PJJ A;  4F16 A;  1Q81 U;  2AZV A;  3JV3 A;  5GAO p;  5D6W A;  3CMA A;  2H3J A;  1D0Z A;  4AG1 C;  1TXQ A;  1WGS A;  4C92 A;  2YUO A;  2HBW A;  1V29 B;  1UFF A;  3CC2 Q;  2RQW A;  1Q86 U;  1SPK A;  4HKE A;  1LCK A;  1UGR B;  4PJO A;  3NMZ C;  1W70 A;  4OGC A;  1RAA B;  4DA4 A;  4N4G A;  2YRD A;  3TSW A;  2RJC A;  1N8R U;  2ED0 A;  1YWP A;  1M27 C;  1KC8 C;  2YLB A;  5CQX A;  3QZ5 B;  3G4S T;  2CGH A;  4ATO A;  4RTV A;  2RJF A;  1UJY A;  3CCM Q;  3OYK A;  1SKU B;  2DRM A;  1QVG S;  2X4X A;  2EGA A;  1M3A A;  5EC7 A;  5GAN h;  4JS4 A;  1G2B A;  3THK A;  4EIK A;  4M7D F;  4JRP A;  1MMA A;  2ZAE A;  3ME9 A;  5AYF A;  1IHW A;  1Z9Z A;  5CKB A;  4BE2 A;  3R6O A;  1KG1 A;  2DXC A;  1RUW A;  1RAD B;  1YJW T;  4CC7 A;  2E70 A;  4KUI A;  2K5I A;  2EQI A;  1AT1 B;  3RMQ A;  4LDY A;  2E5K A;  2DIQ A;  1BK2 A;  1S72 Q;  2CYZ B;  2Y90 A;  5L8R E;  4XU2 A;  2JMA A;  2VWF A;  4JPB W;  3OMG A;  1WX6 A;  3PMI A;  2HQH A;  5GAO l;  1QVF P;  2LP5 A;  2L89 A;  1RAF B;  4J7F A;  2HD0 A;  4P5N A;  2VV5 A;  3JCM h;  5GJV B;  3KFV A;  1GBR A;  1AOJ A;  4M7A D;  5KH6 A;  2PU9 B;  2OX7 A;  4J9D A;  1RAC B;  2G3R A;  2VAS A;  3CCL A;  1VQ4 Q;  3HRS A;  3V7R A;  4PJN A;  1KC8 U;  1PKT A;  5IN1 A;  2FVU A;  2VYT A;  4EMK C;  3UA6 A;  3M4G A;  2AIR B;  3M0T A;  2CH4 A;  1GXI E;  2DXB A;  2RB6 A;  3WVE B;  1VQP Q;  3NTI A;  3JCM X;  2B8A A;  1M30 A;  2M02 A;  5A0G A;  1HD3 A;  4IIM A;  3VS5 A;  1OPL A;  2EWN A;  1AWJ A;  3JB9 F;  1VQO T;  2A0F B;  1MMN A;  1U8R A;  5GAM h;  2KRM A;  2JZ2 A;  2XKO C;  4XU1 A;  2DAQ A;  2RI3 A;  3NPF A;  2RQV A;  2LT1 A;  2PUO B;  2M16 A;  1AWX A;  2OTJ A;  3MEU A;  1AZE A;  4QVD A;  3VUZ A;  4MZP A;  3RIR A;  3RDV A;  4DEX A;  1TH7 A;  2C06 A;  3VS4 A;  3CME A;  2K3B A;  3I5R A;  3RR6 A;  5CKF A;  4C8Q C;  4ORZ A;  2IPO B;  4EMG A;  4OMQ A;  3QII A;  3IQL A;  1NG2 A;  4CC4 B;  4C0G A;  4FL6 A;  2E41 A;  1KFZ A;  3P8H A;  3M9Q A;  2M9U A;  1RLQ C;  1X01 A;  2AKL A;  4LUD A;  4FIB A;  4D8D A;  4RUG A;  2KGT A;  3JB9 H;  4OML A;  1KQ1 A;  2XD0 A;  2HBP A;  2RHY A;  3OYC A;  2QDY B;  1CSK A;  3MCA B;  3M56 A;  5D6Y A;  3RMS A;  1TUG B;  4M7A C;  3GBQ A;  2E6Z A;  5GAN f;  4R56 A;  2JJ9 A;  3CCU T;  2R57 A;  3VJP A;  3CBO A;  2FHD A;  2QXF A;  1OU9 A;  4M7D A;  2LJ1 A;  1NEG A;  1UG1 A;  1XQH A;  2ZGW A;  3OYM A;  2DE0 X;  1X6O A;  3JCM d;  4M77 F;  1NYF A;  3TQ7 P;  3SD4 A;  2E65 A;  5AT1 B;  1YIT T;  2COY A;  4JZ3 A;  3TVT A;  4II1 A;  1YIJ A;  2J6K A;  3QBY A;  5GJW B;  3PIO A;  2NWM A;  4M75 D;  4J5Y A;  3R6N A;  4E6R A;  3CCL Q;  3CCE A;  1QW1 A;  1VQ9 A;  2RO0 A;  3TSZ A;  2NYS A;  1VQ8 T;  1WI7 A;  2BZ8 A;  2R5A A;  3EFR A;  2DEU A;  1GCQ C;  3QDR B;  4MDW A;  2EYW A;  2I2L A;  3LLR A;  3JCM f;  1BI0 A;  3SEM A;  2JUF A;  4A4E A;  2V8K A;  1M8M A;  1AHJ B;  3E9G A;  3OS2 A;  3OYI A;  3RKW A;  2YRV A;  4PKC C;  1Y7X A;  1IRE B;  5GAM d;  2DYI A;  3FC3 A;  1B3Q A;  2EGE A;  2EYQ A;  4ZGJ B;  2CZ1 B;  1KHI A;  4OMP A;  2J05 A;  2EKH A;  5I2S A;  4NL2 A;  3SWN B;  3JCM Q;  3E19 A;  4EMH A;  3O8V A;  2XDD A;  1UGQ B;  3H6Z A;  4E2F B;  4FW1 A;  3A5Z B;  2V8I A;  4FCY A;  2C0O A;  3NTK A;  5J26 A;  3L2V A;  1W2B A;  1WHK A;  3CCR A;  1VUB A;  5GAN 4;  5GAM f;  2L8D A;  2VXF A;  2DLP A;  3RKX A;  2ZPG B;  2KXD A;  2JW4 A;  2EQK A;  5LJ3 h;  5FRN A;  4DBQ A;  3V7S A;  4DEY A;  2DXT A;  4N4I A;  5FLX E;  1VIE A;  4BY6 C;  4Y92 A;  1N27 A;  2MMP A;  1JB0 E;  3UA7 A;  1E6G A;  1QVP A;  1OPK A;  3V8J A;  3EFS A;  5GAN 2;  5GAN e;  4BUG A;  2YWW A;  1TS9 A;  1Z9Q A;  1LOJ A;  3WVD B;  4LN2 A;  2IG0 A;  4M75 C;  3MHX A;  1DJ7 B;  3G6E T;  1K4U S;  1X2Q A;  1KJW A;  2D8J A;  3QYH B;  4C8Q G;  2Y4X A;  4RTU A;  1VYU A;  1MND A;  1PRL C;  3RER A;  3RUX A;  1JJ2 P;  2ZPE B;  1U06 A;  3QHS A;  1UGV A;  3EGU A;  3E1S A;  4ZNX A;  3M55 A;  5FW9 A;  3CCJ A;  4KRT A;  3HFN A;  4J9I A;  3CPW P;  4IUV A;  1N6A A;  1YIJ Q;  1YJ9 T;  4V2S A;  5GAN 6;  3G71 Q;  1VQ6 A;  1Q7Y C;  1O9S A;  5I21 A;  2AKK A;  5GAN 3;  1H64 1;  1YHQ T;  3I5S A;  3M0R A;  4M7A G;  4RTX A;  1BBZ A;  4M77 A;  5CO7 A;  3KUF A;  3LGF A;  3JCM e;  1NYG A;  1IGQ A;  4KUL A;  2GTJ A;  3F70 A;  3REB B;  1ZQ1 A;  4ZGD B;  4OB1 B;  2DER A;  1QP2 A;  2ZPF B;  3CPW A;  3TRE A;  1X75 C;  1W2B S;  1KQS P;  1AVZ C;  4AFQ C;  1M4Z A;  3DB3 A;  3CCQ A;  1YI2 A;  3I55 A;  2HSE B;  2GFA A;  3EHR A;  5KYX B;  3OYB A;  2J06 A;  5HK0 A;  3G71 T;  4OB0 B;  4C8Q E;  5FU6 B;  2B86 A;  4PL6 A;  3M0S A;  2V8J A;  3QXE B;  3JCM V;  5I2M A;  2L3P A;  3X28 B;  5LJ5 g;  4BDY A;  1HK9 A;  2MPX C;  4GLK A;  1KQS A;  1KQ2 A;  5GAM e;  1FMV A;  2AK5 A;  3MO8 A;  1BI1 A;  4MDX A;  1ZSZ B;  4A4K A;  4M7A E;  4F17 A;  2HL3 A;  1Q7Y U;  3V8L A;  2YUN A;  4EMK B;  4FU6 A;  2DJQ A;  3DB4 A;  1C1A A;  4OVA A;  1LJO A;  3G4S A;  3MEA A;  2LMJ A;  3FIF A;  3Q1J A;  2ZZD A;  1BKB A;  4FYW B;  1XNI A;  5LJ3 f;  5GAO r;  1N5Z A;  4J83 A;  2MYS A;  2XI9 A;  3GF5 A;  2YT6 A;  5GAO n;  5IHN A;  1VQ5 Q;  2FG0 A;  1K9M R;  2QQ9 A;  2HEQ A;  4KBM B;  1ZSZ A;  3L2U A;  3RNJ A;  2QGG A;  3CCJ Q;  2CP2 A;  2HNI A;  3CPW S;  3VYG A;  2A08 A;  1MGQ A;  4OGE A;  1V76 A;  2DK3 A;  5CQY A;  4C8Q B;  3LX7 A;  4IKF A;  1WFW A;  3EG9 B;  2W0Z A;  1TWB A;  3QSU A;  3VUB A;  3CCM A;  4IIO A;  1PWT A;  1JRI A;  3M57 A;  2KAF A;  4PFO A;  3AT1 B;  2DX1 A;  1K1Z A;  2IVW A;  2YXY A;  4M75 G;  1WHH A;  3BDU A;  3NHN A;  2I0N A;  2LX7 A;  4M78 D;  1TG0 A;  2QG9 B;  5CAI A;  1VQL Q;  1KQS S;  2QEX T;  2BIV A;  2HMA A;  1G3W A;  4RCB A;  1YI2 Q;  3CD6 T;  2PVD B;  2EJ9 A;  2HL5 C;  2XDP A;  3EH2 A;  2ZCF B;  2WSE E;  5KE3 A;  2DEQ A;  3OYD A;  5C6S A;  4NOY A;  1KIK A;  3OYY A;  1PHT A;  4XAX B;  2LZ6 B;  1SSF A;  5HCK A;  3A8G B;  8AT1 B;  4JZ4 A;  2JTF A;  5GMK j;  4MZM A;  1TU0 B;  2FYK A;  3VRZ A;  1TUD A;  1Y96 B;  2F2W A;  2QGF B;  1VQ4 A;  1VQL T;  2EKO A;  5CIU A;  2YLC A;  4M75 E;  4J6X A;  4RTW A;  4XTY A;  2YSQ A;  2HZY A;  2A3L A;  3A8H B;  5IHK A;  3P8B B;  1VQP A;  2LRQ A;  3VS0 A;  4LD6 A;  3QZ9 B;  2J7I A;  2EGC A;  5LJ3 e;  1D09 B;  4XTX A;  2KI7 A;  5KYU A;  1WHJ A;  3EHQ A;  3PNW C;  1SG5 A;  3L42 A;  1SRL A;  1YJW Q;  2MK5 A;  3KBG A;  5EG2 A;  3X26 B;  1M2V A;  2PVO B;  3OYF A;  1Y96 A;  2AHJ B;  1K9A A;  1MUZ A;  3U23 A;  3OBW A;  4M78 C;  4DBR A;  2DYB A;  2JM8 A;  1D3B B;  1K73 R;  2RNA A;  3BE3 A;  1D0X A;  1AD5 A;  3GNG A;  1B07 A;  1KSW A;  4E7K A;  3UDC A;  2O2O A;  1QLY A;  1JU5 C;  2EPD A;  2JNG A;  2K6D A;  4C0D B;  4HA8 A;  2V26 A;  2RMO A;  2A37 A;  3FB9 A;  5A2Q E;  4BY6 B;  1YWO A;  4QVC A;  1M90 R;  2CSQ A;  1VQM Q;  2OTL Q;  4X1V A;  2FPE A;  1WPY A;  3QJY A;  2JVV A;  2NLU A;  2O4X B;  3HL8 A;  4HVU A;  4C5E A;  1M5Q 1;  1OZ2 A;  2HKQ B;  1OZ3 A;  1IXD A;  4M75 B;  2DKG A;  1OX8 A;  3SDZ A;  1VQN T;  5FU7 C;  2MAM A;  5KCH A;  4OMO A;  2DET A;  2KT8 A;  3MP1 A;  4BE1 A;  2QK0 A;  5J39 A;  3HFO A;  1QWF A;  1VQO Q;  2VGN A;  3JRZ A;  4GBQ A;  2FRY A;  3A8L B;  1WIE A;  1VQM T;  1R77 A;  2FPD A;  3M59 A;  2VVK A;  3CCV Q;  2OTL T;  2RHU A;  4XQ3 A;  3JCM P;  1JBM A;  1ZX6 A;  1QMC A;  1PRM C;  1YN8 A;  3I35 A;  4HT9 A;  1OI1 A;  5GAO m;  1X27 A;  4RMO A;  1QVF A;  2QI2 A;  1RL2 A;  3I56 T;  1ZUY A;  1FWZ A;  2E64 A;  2RQR A;  3HHT B;  2H3E B;  4OF1 A;  1U1T A;  2GBQ A;  2YUQ A;  3VS7 A;  4J8O A;  4E7H A;  4M4Z A;  2P0Q A;  1YJN Q;  3P8D A;  4NS5 A;  2HKN A;  1SF9 A;  1SEM A;  1PD0 A;  7AT1 B;  3O5Z A;  3ZBD A;  4C92 D;  3CCV T;  1U5S A;  2E6N A;  4LDX A;  3LH0 A;  2CUD A;  3VS6 A;  3CC4 Q;  3N5B B;  3CCU Q;  4PJO D;  2QQR A;  3T9N A;  2ENM A;  4HCB A;  2L2P A;  1NE8 A;  2DL8 A;  2IIM A;  2RN8 A;  2ZPH B;  1LPL A;  1Q95 G;  1UEB A;  4DOV A;  1YIT Q;  4PLI A;  4HCK A;  4HCC A;  2VKN A;  1OX9 A;  1B34 B;  5HY6 A;  2P4T A;  4FYY B;  4N0A C;  1YJN T;  3CPF A;  2KDS A;  1YHQ A;  4BAC A;  1OV3 A;  3SFM A;  4A54 A;  1VQK Q;  3OYH A;  5IXB A;  2V1Q A;  4YTL A;  1R8O B;  4XTW A;  2OI3 A;  3VS1 A;  3NFC A;  1VQ8 Q;  4DBH A;  3C12 A;  4M78 G;  1I07 A;  2ED1 A;  3GIB A;  2QAS A;  2LCS A;  3CC4 T;  3VRY A;  5CKD A;  5GAN g;  3CMA T;  1IRX A;  3JB9 J;  4ZN3 A;  2EJF A;  5D7U A;  1B7T A;  2M0Y A;  1FMK A;  4WCI A;  2GQV A;  1QP3 A;  3V7C A;  3C94 A;  2XIC A;  3QWX X;  1X2K A;  1Y07 A;  1QVF S;  3HKS A;  2JOY A;  3X24 B;  3JCM W;  1B34 A;  5KYY B;  4CC2 A;  2XDB A;  3G71 A;  3M53 A;  2RHZ A;  3PIP A;  5GAN 8;  1M9S A;  1VIF A;  1V1C A;  2ECZ A;  1VQK T;  4RTZ A;  4D6W A;  3BFM A;  2DTI A;  1KD1 R;  1HYO A;  3M5A A;  3EGX B;  3H0F A;  1W6X A;  8ATC B;  2F5K A;  3CBP A;  3PVQ A;  4J9F A;  4C92 C;  2DO3 A;  5GAN j;  2P0K A;  4DOW A;  1T0H A;  5HKC A;  4PJO C;  1I0C A;  2X4Y A;  4E47 A;  1YP5 A;  5IXF A;  2K57 A;  4M78 E;  1M3B A;  2MI6 A;  5DY9 A;  1BB9 A;  1H92 A;  4OMF B;  2A7Y A;  3SHW A;  2F2V A;  3WXM B;  4QT7 A;  3EFO B;  9ATC B;  1G8X A;  1I5O B;  4FW2 A;  4F7U G;  3C95 A;  1WA7 A;  3EGX A;  5LL6 S;  1K9M C;  4ANJ A;  1X69 A;  3G6E Q;  4PNO A;  2DRK A;  5FWB A;  5GAM g;  2RA2 A;  1YFN A;  2CT4 A;  2L5Q A;  1SRM A;  2QYZ A;  2DM1 A;  4Y28 E;  2K9G A;  2DTH A;  2FO0 A;  2GF7 A;  4B6M A;  1YJ9 Q;  3UAT A;  3DKM A;  1OOT A;  2DVE A;  1R0C B;  1G5V A;  1YHQ Q;  4OP0 A;  3SWN A;  3EFO A;  5D6X A;  1RI0 A;  2RD1 A;  2R5M A;  2KE9 A;  2K3Y A;  2L3S A;  3C0C A;  5DLO A;  4Z02 A;  1TUC A;  3JSC A;  3X20 B;  1E6H A;  2KNB B;  4FSS A;  2YDL A;  1NEB A;  4AFZ C;  2XHC A;  1FMW A;  4A63 B;  1VQ5 A;  1VOM A;  5KYN A;  1PSF A;  3A1P A;  3OYL A;  1MHN A;  4F7U E;  4M7D D;  4M78 B;  1OUL A;  2YUP A;  2MIO A;  1QCO A;  4HVW A;  2SEM A;  4Z89 A;  3BDL A;  2K2V A;  2LJ0 A;  3EGD B;  4OMN A;  3GP8 A;  3OW2 P;  2KQW A;  4QW2 A;  1K9M U;  2F69 A;  4ZN1 A;  1GFD A;  3X25 B;  1WXB A;  1RAG B;  2KRO A;  2XMF A;  1CKB A;  5GMK h;  4IUU A;  4JJN K;  1T3S A;  2GTO A;  4C8Q F;  1XJW B;  1K0S A;  4X9D A;  1G3T A;  2PZ1 A;  1BCO A;  1JJ2 A;  2F5T X;  5GMK i;  4J6W A;  1VQL A;  2AZS A;  1VQ7 Q;  2CP7 A;  3QO3 A;  2BKD N;  1PC0 A;  1ZBX A;  3OW2 A;  5FRO A;  1BI3 A;  1ZA1 B;  2ROT A;  3EGD A;  1C6V X;  2FZC B;  2EVR A;  2RPN A;  4M7A F;  1JQQ A;  2FZG B;  3FLG A;  4PLL A;  3CC7 Q;  2LQK A;  4PFP A;  1KHC A;  2ATC B;  2FRW A;  2FL7 A;  2KBT A;  4JS5 A;  4DBF A;  1X6G A;  2EYZ A;  2NUT B;  4C92 G;  3CXC P;  2QA4 T;  5M9O A;  4X9C A;  2EBP A;  1K73 C;  5KYW B;  4MML A;  1RAH B;  2LX9 A;  2O9S A;  4PJO G;  4HVV A;  2DIL A;  1AZG B;  2D9T A;  2H8H A;  1M1K R;  1VQ7 T;  3EH1 A;  4F7U B;  3RKY A;  3JB9 D;  2DFU A;  2O01 E;  2CUB A;  1D1B A;  5KYX A;  4J9B A;  4M7D C;  3J80 E;  3CXC A;  1M90 C;  1T0J A;  1QCF A;  1WLP B;  4EDU A;  3CC7 T;  3MP6 A;  5LJ3 g;  2VGM A;  4JUV A;  2NUZ A;  3D7S B;  1K8A R;  1U1S A;  2EYX A;  5GMK l;  5LJ5 j;  5GAN 7;  1YJW A;  5KYW A;  2BE7 D;  1I81 A;  1BCM A;  1M3C A;  3BY7 A;  2QEX Q;  2LTO A;  1JJ2 S;  1IGU A;  2E3H A;  1WHG A;  2LQN A;  1PNJ A;  3CD6 Q;  1WHM A;  1OYX A;  3FRN A;  4EMK A;  4C92 E;  2RI5 A;  4XU0 A;  1VQN A;  2Y4Y A;  1YCY A;  2MOX A;  2CZ7 B;  3OW2 S;  2OAU A;  1ABO A;  3QYG B;  4PJO E;  2FZK B;  3REA B;  1JXO A;  4OMM A;  4RTT A;  1UHF A;  3URG A;  5CKE A;  2LCL A;  4B9W A;  3PTA A;  1K73 U;  1JEG A;  5LJ3 j;  1NPR A;  1IB8 A;  1VQM A;  3J7A F;  4OB3 B;  4E7Z A;  4M77 D;  1Y71 A;  2OTL A;  2HCK A;  1WZO A;  1NPP A;  2CP6 A;  3OYJ A;  4OB2 B;  1ZUK A;  3UPU A;  1QVG P;  3GLX A;  2YHT A;  4M7A B;  3M54 A;  1WNL A;  4DQ2 A;  1I5L A;  4FT2 A;  2RHX A;  1QKX A;  1M90 U;  3H41 A;  4C8Q A;  1QCN A;  3EG9 A;  1JXM A;  3OS5 A;  3PT9 A;  3H9N A;  4M75 F;  3NTH A;  4QQG A;  4GLM A;  2BUD A;  2ABL A;  1VQO A;  3AHU A;  3CXC S;  2E3I A;  4E7L A;  3ZEH A;  1YBY A;  3OY9 A;  1ARK A;  1VQ6 T;  1WXT A;  3CCV A;  4FYX B;  2RM4 A;  4C5I A;  2FB7 A;  2R58 A;  2RK1 A;  2FPF A;  2DPP B;  4M7A A;  2WSF E;  1HXD A;  2HSP A;  4C92 B;  4KGZ B;  1Q82 R;  3C4S A;  4HCZ A;  4NL3 A;  4E7J A;  1HSQ A;  3CEY A;  2O9V A;  3OYN A;  1NLP C;  1W1F A;  2CP5 A;  4PJO B;  5A0D A;  2EQJ A;  1ZBJ A;  3UT1 A;  1UJ0 A;  2DIG A;  1K76 A;  2P84 A;  4J9G A;  2LQ8 A;  1LNX A;  2M0O A;  2X51 A;  4XTU A;  1YJN A;  2M51 A;  3HSB A;  2D1X A;  1I4K 1;  1WJR A;  3PVL A;  4N4H A;  2O88 A;  3EG0 A;  3SB2 A;  1H3Z A;  3VYH B;  2KRS A;  2D0Q B;  1M2O A;  3CC4 A;  1BIA A;  2CRE A;  2QQB A;  4M77 C;  1GCQ A;  1M1G A;  3CCU A;  1VQN Q;  3QJ6 A;  1NM7 A;  4M7D G;  3OMC A;  2GQI A;  2RH2 A;  2X35 A;  1AWW A;  1VYT A;  3E9F A;  1YIT A;  2W10 A;  2BZY A;  5I11 A;  3VKI A;  1D1C A;  1T3L A;  4E7I A;  1NLO C;  2VUB A;  5L23 A;  4WF2 A;  1IO6 A;  1I8F A;  2E10 A;  2D6F A;  3OA6 A;  3M4Y A;  3JCM J;  1ZSG A;  3M0Q A;  2SRC A;  1NZ9 A;  4Z8A A;  1KD1 C;  3CCS T;  4RCC A;  1VQK A;  3QPH A;  1G3S A;  3PGG A;  4GY5 A;  1ZA2 B;  1VQ8 A;  4JRQ A;  4L59 A;  4J6Y A;  4ME7 A;  4A4G A;  2PNI A;  4L5G A;  5GMK e;  1D3B A;  3UF4 A;  2K3X A;  5CR2 A;  3I56 Q;  1NBE B;  1ZLM A;  4JLG A;  3CC2 T;  4KGV B;  1XTD A;  2A28 A;  5IT9 E;  3MEV A;  2CZ6 B;  4C8Q D;  3PMT A;  4KH0 B;  2AT1 B;  2LDM A;  4Y91 A;  1IZ6 A;  4M7D E;  1WXU A;  2E12 A;  5FU6 C;  3L1A A;  1NJI R;  2CDT A;  1GFC A;  4IUQ A;  2L3R A;  2WAC A;  2O4X A;  2X9H A;  2YRC A;  3QUI A;  2J6F A;  1H3H A;  3CCM T;  2J6O A;  3QDF A;  4M75 A;  1PG5 B;  1MMD A;  1TOV A;  3PFS A;  1J3T A;  3JB9 G;  2KR3 A;  2A36 A;  2PVG B;  5GAO q;  4LDW A;  1Q81 R;  1PM3 A;  1ZSZ C;  1KD1 U;  1UEC A;  1ACM B;  4F14 A;  4HXJ A;  1S72 T;  2JTM A;  3KXT A;  2DBK A;  1N9S A;  2JXB A;  2KVQ G;  4PJL A;  2KMT A;  5IHI A;  1Q86 R;  4BE0 A;  3MP8 A;  1H8K A;  3INZ A;  4Z88 A;  3H8Z A;  2GFU A;  4JJD A;  3BW1 A;  2DVJ A;  3TEE A;  4CRI A;  4PJM A;  3CMA Q;  3G6E A;  2VXE A;  3JCM c;  3HTR A;  2C0I A;  1N8R R;  1EIF A;  3PE0 A;  2JS2 A;  2XG8 D;  1OU8 A;  2V1R A;  3V8K A;  2GNC A;  1WJS A;  2DL5 A;  3VU3 C;  2KK4 A;  1WDX A;  2CKK A;  4XU3 A;  1VQ4 T;  4RG2 A;  3G1J A;  1YJ9 A;  4KGX B;  1MMG A;  4IUR A;  5CCA A;  3FJ5 A;  1QQJ A;  1EZZ B;  2JT4 A;  2X3X D;  4J9H A;  3QKJ A;  4M7D B;  4BB7 A;  5GAN d;  1UDL A;  3S3M A;  2EJG A;  3OSS C;  1IHV A;  3DLL A;  2DBM A;  4O5V A;  4ESR A;  2LNH B;  1VQP T;  1TSF A;  4M77 G;  2VC8 A;  2C0T A;  4FM4 B;  4O6J A;  4E7S A;  4MZT A;  4L6V 5;  2L3Q A;  2BE9 B;  2QTV A;  4AT1 B;  1RI9 A;  2JTE A;  4QQ6 A;  3M0U A;  1JO8 A;  4LXC A;  1MV3 A;  5C0M A;  1X6B A;  2MF2 A;  1UE9 A;  4JDS A;  1PKS A;  1PCX A;  2CH4 W;  3OYG A;  3TU4 K;  2O31 A;  2X4W A;  3MPU B;  1D0Y A;  2Z0W A;  4ELZ C;  5IAY A;  4M78 F;  3QWY A;  3E2U A;  3EG1 A;  2QA4 A;  2E5Q A;  1KC8 R;  2EIF A;  4LE9 A;  1GBQ A;  2OAW A;  4FYV B;  2QDL A;  4CI0 C;  5FWC A;  1M1K C;  4RTY A;  3JCM g;  3RBB B;  5CVI A;  2QTX A;  3A98 A;  2DL4 A;  2QAZ A;  1UGP B;  3OSV A;  1VQ7 A;  3GOX A;  4C5G A;  3LW5 E;  4PK4 A;  3CBM A;  4A4H A;  1WHL A;  3HP9 A;  4RG8 A;  4M77 E;  2DA9 A;  1UHC A;  4ZTF A;  5KYY A;  1EX4 A;  2K2M A;  2K79 A;  3VS2 A;  4AFU C;  3EG2 A;  1K8A C;  2HAX A;  4BD3 A;  2DTO A;  2QQA A;  3CC7 A;  2KSS A;  1W2B P;  1A0N B;  5I22 A;  4LD9 K;  4VUB A;  4QKU A;  5DM7 R;  5LJ5 h;  2KT1 A;  2KRN A;  3HRU A;  2WSC E;  4QVZ A;  3JB9 I;  4KUD K;  2FEI A;  2NUP B;  1RLP C;  1AWO A;  4A4F A;  3CCL T;  2CP0 A;  2CSI A;  2OTJ Q;  2BZX A;  4AG2 C;  1BYM A;  2EFI A;  3CME Q;  5FRM A;  4F7U F;  1GRI A;  1P92 A;  1UTI A;  1GL5 A;  4FT4 A;  4RKU E;  2DXU A;  2P0P A;  4JLI A;  4C0D C;  1M1K U;  2QQS A;  1Y0M A;  2RF0 A;  2JM9 A;  5HK3 A;  1BU1 A;  2CT3 A;  4AFS C;  4JJB A;  2M1H A;  4C5H A;  1ABQ A;  3L2W A;  2K5L A;  1SSH A;  4PFZ A;  2LQW A;  3L2Z A;  1RAI B;  1D1A A;  4JRI A;  1I1J A;  2LCC A;  2GCX A;  1UUE A;  2QEX A;  1UGS B;  2ROL A;  3GNF B;  5GAM j;  2NUP A;  3CD6 A;  1CKA A;  3OBY A;  2VB6 A;  4M77 B;  1K8A U;  2OTJ T;  1ZHI A;  3S3O A;  3A8O B;  3JCM b;  2K7A A;  3S3N A;  2DF6 A;  2LVM A;  1E7O A;  4UC4 A;  1R0B G;  3L2R A;  3CME T;  3LH5 A;  2KEA A;  3TCJ A;  3ER0 A;  1FX7 A;  3OQ5 A;  1MNE A;  1G3Y A;  2EYY A;  2QA4 Q;  4TVR A;  3LGL A;  1AEY A;  3UWN A;  3JAM E;  1QWE A;  2CZ0 B;  2RQT A;  3FEO A;  1U3O A;  2GGR A;  2MWP A;  5ECA A;  3RES A;  1Q82 C;  2KY9 A;  2PTK A;  3HRT A;  2LNV A;  1YCS B;  3LYI A;  1QKW A;  3CCE Q;  1VQ9 Q;  2E4H A;  4M78 A;  3MJX A;  3FDR A;  3ASK A;  1XOV A;  2LJ3 A;  1M8V A;  5CK9 A;  2P4R A;  5LJ5 d;  5DLQ E;  3MEW A;  2K5F A;  2G6F X;  5FU7 B;  2EW3 A;  3M0P A;  1BI2 A;  5IH2 A;  1Y57 A;  4BI4 A;  1RAB B;  3MKD A;  2COW A;  3OYA A;  4J7I A;  3OS1 A;  3J81 E;  1FYN A;  4LUE A;  6AT1 B;  2EQM A;  2LC4 A;  1YIJ T;  4ELY C;  5A0L A;  1WYX A;  2XK0 A;  2ZPI B;  2CP3 A;  4BI3 A;  3H0I A;  1G83 A;  2MWO A;  1SHF A;  3CCE T;  5LJ5 f;  1VQ9 T;  4ZTJ A;  2ZPB B;  1PSE A;  5LJ3 d;  2K4Y A;  2DL3 A;  3CCR Q;  1WJQ A;  4F04 B;  5KE2 A;  1GCP A;  2D8H A;  1SHG A;  1VA7 A;  4R0K A;  2DD4 A;  1RAE B;  4C92 F;  3LWI A;  3L2Q A;  2XID A;  1O75 A;  1UB4 A;  4LDV A;  3HPW A;  2NUT A;  3G7Z A;  4R55 A;  2F2X A;  4X34 A;  1Q82 U;  3CCS A;  4PJO F;  2CS7 A;  3NGP A;  3A8M B;  2KYB A;  3GPL A;  2COZ A;  2ESW A;  4JRK A;  2RI2 A;  2KXC A;  1X43 A;  4J9C A;  3MET A;  3FJP A;  4KT0 E;  2RQU A;  1BIB A;  4F7U A;  2DNU A;  3ULR B;  1W4S A;  4WTO B;  2RJE A;  3CQT A;  4IUT A;  4XK8 E;  2HDA A;  1LVK A;  2DZ9 A;  4C0Z A;  2X3W D;  3EAE A;  3CC2 A;  3CCR T;  4CC3 A;  2X4J A;  4AMC A;  5GMK m;  2XU8 A;  4EPC A;  2EQU A;  1NJI C;  1OEB A;  4QQD A;  4FSX A;  2DL7 A;  1F1B B;  4J9E A;  1VQ6 Q;  3OB9 A;  2DZC A;  2RK2 A;  1VYV A;  3OS0 A;  5KCO A;  1PD1 A;  2BTT A;  2EAY A;  3M58 A;  1WQ7 A;  3H0H A;  3ZL7 C;  2JMC A;  3LWH A;  2E1H A;  2PUK B;  1YNZ A;  2LT4 A;  4Q5W A;  1Q81 C;  2OJ2 A; 
#chains in the Genus database with same CATH homology
 2CP7 A;  2MPX C;  2COW A;  2HKN A;  2CP0 A;  1LPL A;  1WHH A;  1TXQ A;  2E4H A;  1WHJ A;  2E3H A;  2CP2 A;  1WHG A;  1WHM A;  2QK0 A;  2Z0W A;  1TOV A;  2HKQ B;  1WHK A;  1WHL A;  1IXD A;  2CP3 A;  3RDV A;  2HL3 A;  3TQ7 P;  3E2U A;  2CP6 A;  2M02 A;  2COY A;  2E3I A;  2CP5 A;  2COZ A;  2HL5 C;  4B6M A;  2HQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...