2COZA

Solution structure of the cap-gly domain in human centrosome-associated protein cap350
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
122
structure length
122
Chain Sequence
GSSGSSGVEHEQQVTESPSLASVPTADELFDFHIGDRVLIGNVQPGILRFKGETSFAKGFWAGVELDKPEGNNNGTYDGIAYFECKEKHGIFAPPQKISHIPENFDDYVDINEDEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the CAP-Gly domain in human centrosome-associated protein CAP350
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords centrosome-associated protein 350
total genus 5
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cozA01
3E2UA 2CP5A 2E3HA 1LPLA 1WHHA 3TQ7P 2COYA 1TXQA 2CP3A 1IXDA 2HL3A 4B6MA 1WHMA 2HL5C 2COWA 1WHJA 2HQHA 2M02A 2QK0A 1TOVA 2CP7A 2COZA 1WHKA 2E4HA 2CP6A 2MPXC 1WHLA 2HKQB 1WHGA 2E3IA 2CP2A 3RDVA 2CP0A 2HKNA 2Z0WA
chains in the Genus database with same CATH superfamily
5EC7A 2EYQA 3SDZA 2GF7A 4KULA 4M75E 4EIKA 4ZN3A 2NUZA 2XI9A 2K5IA 1G5VA 1IGQA 3NPFA 4C5EA 2LNHB 4XTUA 2KYBA 2JJ9A 3MPUB 3P8DA 3SFMA 4C92E 2O9SA 4XAXB 1Z9QA 2KEAA 1VYVA 2QQRA 4HA8A 4FYYB 2F5KA 1VQPA 2DFUA 4M77A 5HCKA 1RAAB 1Q81R 4BI4A 4J9IA 1AD5A 3QZ9B 3M0TA 3RERA 5I2MA 4JZ4A 4M77C 1PKTA 4M78A 4LNPA 2JT4A 2EJ9A 3OMCA 4DOWA 4PNOA 4WTOB 4CC4B 2YLBA 1I5OB 4C8QA 4E7LA 4LDWA 3CCUT 4J6XA 4IKFA 3H41A 4CC7A 2KY9A 2A3LA 2HCKA 4M7AC 1SPKA 1W2BA 4C8QC 4M77F 5FROA 1AOJA 5GAN4 3CC2A 2HKQB 1ZSZA 3VJPA 1M1KU 3I55T 2YWWA 1OV3A 4NL2A 3NTIA 1RABB 5M9OA 3CCMT 3HPWA 5GMKj 5KYUB 2EGCA 4M78E 3A5ZB 3CCUQ 1QKWA 3OYGA 3QZ5B 2EKOA 2FEIA 4HVWA 2KAFA 4M75A 1ZSGA 1Y07A 2CDTA 2MPXC 1H641 2CS7A 3PMTA 3RNJA 5GAMg 3OMGA 2DTIA 2NUPB 1N8RU 1VQ4A 3M58A 2FZGB 3V8KA 1WJRA 3P8BB 1NJIU 1PM3A 3QXEB 2QTXA 1AZGB 4M77E 1VQMA 2M02A 1Q82U 1GBQA 2VASA 4X9DA 1Q81C 2YXYA 2QGFB 1OPLA 1YJWA 4L6V5 4LDUA 3QKJA 4XU0A 3CMAA 2CP3A 1RI0A 2PUOB 1B7TA 4Y91A 3L2UA 4PFZA 3T9NA 2BZXA 1OX8A 3A8OB 3CCSA 2MIOA 4IUVA 3SWNC 1QVFP 2K2MA 3OSSC 1SHGA 2DD5A 2JM9A 3EFOA 4GY5A 1YWOA 2RJEA 3MHXA 3SWNB 2GFAA 2XICA 2VV5A 3JCMe 4GLMA 2FHDA 2H3EB 2E70A 3CCLQ 2KK4A 3PGGA 3UA7A 2ED0A 4LD9K 1TXQA 1UGRB 2CSQA 4M75B 3OYYA 2CT3A 1ZSZB 5D6XA 3EG0A 2EYXA 4C5HA 5GMKh 1V29B 2DILA 8AT1B 2O4XB 3HRUA 3EFOB 1VQPQ 2EQIA 4A63B 2GFUA 4QQDA 2DXUA 5ECAA 4II1A 3OYHA 4M7AA 1UE9A 2IPOB 1LNXA 2D8JA 5J39A 1B34A 2DLPA 1VQMT 2Y4XA 3TSWA 4RTWA 4PK4A 4C5GA 3NMZC 4FSSA 3MEVA 1WHKA 5CIUA 3G6EA 2J6FA 4DBRA 1BKBA 3M0RA 3GIBA 2AHJB 2OX7A 4AG2C 4MZMA 2K7AA 1Q82R 2O2OA 2XHCA 1GBRA 3P8HA 1IXDA 3CCLT 4J9HA 4KUDK 2DXCA 2L3PA 2DE0X 3LH5A 5C0MA 1VQ5T 4DOVA 2ZPHB 2XMFA 1VQLA 2RHYA 2RPNA 3QWXX 1BI3A 1PSFA 4P5NA 1VQOT 2OAUA 5DLOA 1SKUB 1BIAA 1UFFA 2FZCB 2BTTA 4N4IA 4FM4B 3DLLA 3LWIA 1WHHA 5FU6C 1VQNT 3ASKA 4CC2A 2YRVA 2O88A 2DIQA 1WA7A 3REBB 1SEMA 4J7FA 2DJQA 3V7SA 2RQWA 4XTZA 2J6OA 4JZ3A 5GMKm 1M5Q1 3QBYA 2J05A 1YNZA 2MMPA 2QQAA 5KYYA 4C0DB 2DERA 2B8AA 2LJ3A 3CC7A 3EFSA 4RTUA 1VQ7Q 1K9MC 2O01E 3G4ST 2HQXA 4XTYA 1D3BA 3WXMB 5IH2A 1M3BA 4J9GA 4M7DA 2E4HA 3S6WA 1GFDA 1Y0MA 1MV3A 1NLOC 2LCSA 9ATCB 2CH4W 1UB4A 3CPWP 1XQHA 1QP2A 1M3CA 1YIJA 1ABQA 3FJ5A 4C92B 4M7AF 1M1KR 4C92G 1QVPA 2LJ0A 1PRLC 4A53A 2D6FA 4J9DA 1IZ6A 3RR6A 1JRIA 1F1BB 1TG0A 3QDFA 1Q86R 4JJDA 2CZ0B 1UECA 4KUIA 1NJIC 2X4YA 2IG0A 1YITA 3C12A 3C4SA 2YUNA 1YHQA 3J81E 2QEXA 4M78C 3EAEA 3V7RA 2GQIA 3H0IA 3QG1A 4M78G 4PL6A 6AT1B 4MDXA 5KE3A 3EG9A 1VQNQ 3KFVA 3CCMQ 3X20B 4AFZC 1V76A 3HHTB 1VQPT 2QASA 2CYZB 2EAYA 3JCMc 1M90U 4OMNA 1HD3A 5FU7C 1YITQ 1SF9A 2YUOA 4DBHA 1XTDA 2VXFA 2LJ1A 3RESA 4RTTA 1Y96B 4JRQA 3RUXA 3CXCP 3X24B 1VA7A 2I2LA 2DTOA 4AMCA 5LJ5f 1FMVA 1ZUKA 3QWYA 2KXDA 4J8OA 2ABLA 2O4XA 2RMOA 3NTHA 3UT1A 2RNAA 5GAMj 2XIDA 1X6GA 4EMKB 4KGVB 5FRMA 1IREB 1WHGA 2YT6A 4M77G 1KD1C 1UGPB 1NPPA 4E2FB 2HQEA 1KC8R 3J80E 2HAXA 1IHWA 2LCCA 2QA4Q 5A0LA 3CCMA 3JB9F 4MMLA 3TU4K 2EFIA 4D8DA 3QJ6A 2DAQA 4RCBA 2A36A 1OX9A 1QVGP 1WQ7A 4M77B 4XTVA 1YJNQ 3PE0A 1S72Q 2JN0A 1AVZC 3CD6Q 1VQ4T 3TCJA 4N0AA 1JEGA 3VYGA 3OYCA 3NFCA 2VB6A 1SSHA 1RUWA 5HK3A 2RHXA 4FL6A 1U8RA 2VWFA 2KVQG 3VUBA 3VRYA 5L23A 4CRIA 2QQSA 2EKHA 4PKCC 2YRDA 1WJQA 2E1HA 4R55A 4MZPA 3M5AA 2CKKA 1J3TA 1OPKA 2IIMA 2X4WA 1D1CA 1I1JA 2LC4A 3G71T 2FB7A 5FLXE 2KXCA 4MDWA 1ZA1B 3C94A 3URGA 4ZGJB 3VS3A 4OMPA 4DBQA 4C5IA 2LDMA 3TSZA 1XJWB 1AZEA 1VQ8Q 3OYMA 1Q81U 3FEOA 2YRCA 5GMKl 1ZBXA 2RD1A 3EFRA 4E7KA 3QPHA 5GAMf 3PMIA 2GTJA 3QYGB 1TUGB 3CCQT 4BI3A 1T0JA 1P92A 2E10A 3NHNA 3ZEHA 2RI3A 2ESWA 5IHIA 3C95A 4JRIA 2DIGA 4HXJA 1UHCA 2RJDA 3CCQQ 3RKYA 4M7DG 3G7ZA 1A0NB 1IB8A 2CGHA 1KC8U 2DXTA 4XTWA 3I56Q 2JXBA 3OYBA 1O9SA 5GANg 4IIOA 4DQ2A 2LVMA 4M78D 3L2WA 2CH4A 4QQ6A 4M77D 5LJ5h 1NYGA 4BE2A 4OVAA 2D8HA 2AIRB 3CEYA 2V1RA 3OYNA 4C92C 1VQLQ 2VYTA 5KH6A 1VQOA 4PJOC 1D0YA 1YN8A 3A8HB 5GAN2 4ATOA 2A7YA 1UGQB 2M1HA 1E6GA 3CMEQ 2E41A 3CCJA 4BUGA 1K9MR 2LX7A 2OTJT 1PCXA 3PNWC 3M0UA 2CREA 2KSSA 2F2WA 2XDDA 2EQJA 3LWHA 2DL8A 2QEXT 2P0KA 2H3JA 3G6EQ 4F7UA 1QW1A 3HRTA 2VC8A 3CD6T 1M1GA 2JW4A 4EMKA 3PIPA 1U3OA 3JB9G 1PSEA 1BU1A 1KSWA 2GCXA 3CPFA 1FWZA 4OF1A 4PJMA 1M1KC 3E2UA 4OB0B 1W6XA 1JO8A 1ZBJA 1VQMQ 1YITT 1TWBA 2JZ2A 4PJJA 4EMHA 4ZTJA 3MO8A 1FMKA 3SB2A 3CCRQ 3GLXA 1M90R 3CCET 3THKA 3WVDB 2P4TA 2RK1A 4JJNK 2RQRA 2A08A 2A0FB 3M0SA 3JCMV 3OS1A 1PRMC 4HVUA 2HBWA 4M7AB 4C92F 1QVFA 2RQVA 2K5LA 1JU5C 3JB9I 3CC4A 2OTJQ 4OP0A 4OMOA 4X9CA 3GPLA 1KQ1A 3CCSQ 1VQ6Q 2ZPEB 1X69A 1NBEB 1X27A 2EYWA 4JS4A 3CMAQ 1ACMB 3CC2Q 1X43A 1YJWT 2HKNA 2FYKA 4AFQC 3GBQA 2OTJA 2E6ZA 3TVTA 2P84A 2EBPA 5LJ3d 3PVQA 4PJNA 5FWBA 4EDUA 5LJ5d 5CKHA 3JCMQ 2XU8A 1R0CB 1HXDA 1UJ0A 1WJSA 3M4GA 3CCVQ 2XG8D 3GP8A 1Q82C 5CCAA 4LD6A 3GNGA 1OQKA 5LJ5e 5KYNA 1YI2T 1ARKA 3M55A 4M7DB 1WNLA 3F70A 1TU0B 2DD4A 1YJNA 4XTXA 3LYIA 4EMGA 2R57A 1BI2A 4QQGA 1KHIA 1RLPC 3VS2A 1UJYA 2VUBA 5IXFA 4M75G 4AFSC 2L89A 1D1AA 1OU8A 5GAN7 2L3QA 5GMKi 1ZQ1A 2PVDB 3IQLA 2V8JA 3PTAA 4O5VA 3EH1A 2L3SA 4OB1B 1Q7YR 1VOMA 1VQ5A 3CCVT 4F7UB 2ZPBB 3G1JA 5IN1A 2E12A 5IT9E 1RL2A 1RAIB 3L2RA 2NYSA 3G71Q 4LXCA 1U1TA 4M7DE 1M1FA 2RH2A 1IO6A 1VUBA 3NGPA 2K2VA 3VRZA 5GJWB 2DBKA 3RKXA 2RQTA 1ZUUA 4C0FA 3FJPA 4FYVB 1KFZA 5KYWA 2P0PA 3FC3A 1NEBA 4R0KA 1D09B 1QWEA 1GXIE 1GFCA 1SRMA 3I55A 2RM4A 3VS0A 4KH0B 2EYYA 3AT1B 2MCNA 5D6YA 3CXCS 1KQ2A 4ZTFA 2JS0A 4JRPA 1WPYA 4M78F 1CSKA 2JM8A 2YUQA 3S3OA 1S72T 1QCOA 5D7UA 2NUTA 1N8RR 2FRYA 5CKDA 5GAMh 4F04B 2LP5A 1VQKA 4RMOA 2DL4A 4M7DD 3MP1A 4J7IA 1NJIR 4XU2A 4HKEA 3VS7A 3M59A 2LQ8A 3CBPA 1TTHB 1W1FA 1MV0B 1V1CA 2P4RA 1VQ8A 4GBQA 4C0GA 3A8LB 1UUEA 3JB9J 5GAMd 2SRCA 3KBGA 4OMLA 1K1ZA 1NEGA 1ZX6A 3EHRA 4M7AG 2J7IA 3ZBDA 1YJ9T 2K3XA 3BE3A 4FW1A 3QYHB 4E7JA 1QVGS 5A0GA 3QSUA 4FYWB 3OSVA 4DEYA 3MCAB 2D9TA 1M2VB 3HFNA 2AZSA 2XD0A 1AWXA 3L2ZA 2KT8A 2DZ9A 2E64A 5I21A 4GLKA 4OB3B 2KT1A 2C0OA 4KGZB 5CQYA 2PZ1A 3A8GB 1RACB 2RF0A 3FIFA 4A4GA 2A28A 3SEMA 1U06A 3I9QA 3V7CA 2KGTA 2GTOA 1VQ7A 4M7AE 2NUPA 3MEAA 1VQKQ 3I5SA 2CP5A 5LJ5g 2MK5A 5I11A 1B07A 1G3SA 5A0DA 3OW2P 2EWNA 4L59A 2EVRA 4C8QD 1MMGA 3INZA 1QQJA 2EYZA 1KD1R 2IVWA 1BI1A 3NTKA 3REAB 4QVCA 3E1SA 2DYBA 4O6JA 4NS5A 1CKAA 5KYXA 5AT1B 3Q1JA 1M90C 2XK0A 1B3QA 5CKFA 2JOYA 4M75D 1AEYA 2GQVA 2BUDA 2FVUA 4C0ZA 1I8FA 1MNEA 1KK7A 3RDVA 4BE0A 3PIOA 2JUFA 3M9QA 4J6YA 4C8QE 4RTVA 1NZ9A 1PKSA 2HQHA 2PNIA 2YUPA 2LMJA 4PFPA 5GAOp 4M4ZA 1UGSB 4JS5A 1N6AA 2V26A 3FLGA 3ZFJA 2RHZA 1FYNA 5LJ3f 1R0BG 1CKBA 1QMCA 4IIMA 2HZYA 1RLQC 2L2PA 4FT4A 1QWFA 1I81A 3UDCA 1N9RA 3X25B 4OMFB 1GRIA 3V8JA 1QVGA 4HCCA 5GAMe 2ZPGB 1MMNA 1UTIA 2DX1A 3TREA 2WSEE 2DXBA 1G3YA 1ZA2B 3H0HA 2V8IA 3CPWS 2DKGA 3SWNA 3ER0A 2X3WD 3CCLA 4XU1A 3EG1A 2AKKA 1VQ6T 1EZZB 4E7ZA 2K5FA 1Y57A 2K3YA 3E19A 1QKXA 2BE9B 1YWPA 2CP7A 2E5QA 1M8MA 1UEBA 1VQ5Q 3RMSA 2CP6A 1BBZA 2C0IA 2DRMA 5D6WA 5HK0A 2QI2A 1YJ9Q 2QAZA 5GMKe 1WI7A 1KQSS 4PJOG 2E3HA 2CZ7B 3M56A 4K11A 4A4EA 1WQWA 3CCEQ 1K9AA 1D0ZA 3CCRT 3U23A 3JB9H 5EG2A 3EH2A 3VUZA 1AWOA 4QKUA 2COZA 4J9BA 1G2BA 3A1PA 4OGEA 4C8QF 3EG3A 2CP2A 2FG0A 2KDSA 3DB3A 2L5QA 2DL5A 3TQ7P 1W2BP 1U1SA 1WFWA 2FPFA 1M27C 4ELZC 1RAFB 2HSPA 2QQBA 3OW2S 3G6ET 4C92D 1K73R 3C0CA 1WIEA 3CCEA 2FPDA 1OEBA 2ATCB 2D0NA 2MF2A 2EIFA 1Q7YU 2F5TX 4JLIA 2RJCA 5CK9A 3EHQA 2CT4A 5FU7B 3ULRB 4M7DF 2ZCFB 3JCMd 1WXUA 3HP9A 3GNFB 2FZKB 1VQ6A 3VU3C 1VQLT 1TOVA 2VGMA 5KE2A 3CC4Q 5GANh 5GAOn 4PLLA 3BFMA 4JDSA 2CP0A 1C1AA 3MEWA 1C6VX 1MUZA 2I0NA 2M0YA 2COYA 1OZ3A 5DY9A 1GL5A 3EGDA 4ELYC 3CQTA 3CCRA 1DJ7B 1EFNA 7AT1B 5GANf 1NM7A 2RHIA 2C0TA 4OGCA 5GANj 3CPWA 5GAN8 1BCMA 1I5LA 2DNUA 2AKLA 4J9FA 5KYWB 1JBMA 3SD4A 3JCMJ 1FXXA 1Q7YC 3RIRA 4PFOA 2BKDN 3CBMA 1SG5A 1SRLA 1K4US 1ZUYA 1W70A 4B6MA 4ANJA 4XK8E 4AG1C 2MYSA 1N9SA 4HVVA 2KRSA 3EGUA 1MMDA 4LE9A 2ECZA 3PFSA 3JV3A 2XDPA 1JB0E 2ZPIB 1OZ2A 1RAHB 4ZGEB 2X51A 5C6SA 3CMEA 3CCJQ 1JJ2A 2OAWA 1QCFA 1Q86U 2V8KA 4IUQA 3BDUA 2JTMA 1VQOQ 2NWMA 2QK0A 4QVDA 5IAYA 1S1NA 2B86A 2DRKA 1YJWQ 1WLPB 2LTOA 3QIIA 1TUDA 3MP8A 1VQ7T 1I0CA 3EGDB 4BI8B 1EIFA 2EGEA 3JRZA 2DETA 2X35A 2RHUA 2EJGA 3WVEB 2CSIA 4ZN1A 4MZTA 3EG2A 4PLIA 1X6BA 4WF2A 4HCBA 2RN8A 1YJNT 2X9HA 3OY9A 1VQ9A 3MJXA 3OYDA 4KGXB 1VQKT 4F7UG 4ZNXA 3CBOA 2RB6A 5CR2A 1LJOA 2PVOB 1FMWA 4C0DC 3FRNA 5GAN6 3JCMX 5IHNA 4PJOD 5KYYB 2X4JA 1ZHIA 5IHKA 4NL3A 1JJ2P 5GAOm 2XDBA 2KMTA 1W2BS 2QA4A 3M0QA 1PD0A 2R5MA 1KD1U 2ENMA 4X34A 1I07A 2YLCA 2HEQA 2JMAA 3OB9A 3O8VA 3QHSA 3LH0A 1VYUA 2L0AA 4QT7A 2PVGB 3OS5A 2JS2A 4D6WA 3X28B 1R8OB 4BACA 1XNIA 3OQ5A 2VKNA 4RG8A 1TUCA 2H8HA 2QDYB 1PD1A 2E6NA 2J06A 1SSFA 2DO3A 3H8ZA 5HY6A 1M3AA 2GBQA 2MWPA 5GAOq 2YSQA 1RAGB 4YTLA 1X2KA 2LRQA 4D8KA 1YI2A 1HSQA 2Z0WA 4J9CA 4ORZA 1KQSP 1K8AR 1ZSZC 5CO7A 3QO3A 1K8AC 4XU3A 2HBPA 1OULA 2D1XA 2KE9A 2PU9B 2BZ8A 4Y92A 2KYMA 2X4XA 2DMOA 4LDVA 1X2QA 5FRNA 2K9GA 3LLRA 1OI1A 4RTXA 4DA4A 4BD3A 4BY6B 2KRMA 1H3HA 2QDLA 1K0SA 1H8KA 1YP5A 3I56T 2ROTA 1G83A 1TSFA 2DM1A 2P0QA 4IUTA 4F14A 2QGGA 3DB4A 2CZ1B 2FL7A 1YHQQ 1X75C 3G4SA 4R56A 4Q5WA 1YI2Q 4PJOE 4JPBW 2F2XA 2WACA 3J7AF 1KQSA 4ESRA 3CCJT 1BCOA 4RCCA 1T0HA 4ZGDB 1M9SA 1HYOA 3G71A 1BB9A 2RI2A 5FWCA 3QDRB 2L3RA 2LCLA 1YIJT 3UA6A 1YIJQ 5LJ3h 3VS6A 1GCQC 3LX7A 1QVFS 3JCMf 3JAME 2W0ZA 2F1LA 1SHFA 3LGLA 5LL6S 3G4SQ 3S3NA 2PTKA 3CC2T 2RA2A 4LUDA 3RMQA 3UWNA 1ZLMA 2ZPFB 1UGVA 2K6DA 1RADB 3VKIA 4QVZA 1N8RC 2QQ9A 3OW2A 2YDLA 4NOYA 1VQNA 1JXOA 5LJ5j 5GAN3 2EQUA 2LNVA 3OYFA 3CC7Q 2VVKA 4M7AD 1WYXA 5GANe 2F2VA 2EGAA 1YCSB 2OTLQ 3EGXA 3VV0A 4B9XA 3VYHB 1TS9A 3BY7A 1VQ9Q 4E7HA 5GANd 2DYIA 2MAMA 4BB7A 2X3XD 3PVLA 1KG1A 3CCVA 3CC4T 1UDLA 3OYJA 4CC3A 2DPPB 4F16A 3GF5A 1MGQA 4AT1B 3JCMb 4E6RA 3L2VA 1M4ZA 2MWOA 4C8QB 2MI6A 3UATA 5L8RE 2CZ6B 2A37A 3OYLA 1BIBA 3M4YA 4PJOA 3PT9A 4PJOF 3OBWA 2K57A 2EJFA 2KI7A 1LVKA 4AFUC 4B9WA 2G3RA 1D0XA 4E7IA 2J6KA 1PHTA 2DF6A 2G6FX 1NG2A 3ZL7C 2EW3A 2FO0A 1BI0A 1WHLA 3FDRA 1NE8A 1IGUA 4N4GA 3KXTA 4HT9A 2PUKB 1G8XA 1X6OA 2WSCE 3LW5E 4QW2A 4J6WA 1LOJA 3TEEA 3UF4A 1RI9A 5FW9A 2M0OA 4M75C 1HK9A 3UPUA 2YHTA 2EPDA 2JTFA 4F7UE 2QG9B 2AK5A 3H6ZA 2OTLT 2EQMA 2HNIA 2VGNA 2Y90A 1JJ2S 1E6HA 4RUGA 1PNJA 2ED1A 1WGSA 4OMMA 2CUBA 1AWWA 4LN2A 1LCKA 3CXCA 2K3BA 1WX6A 3M54A 2RJFA 4A4FA 1GCPA 2QYZA 2R5AA 2DTHA 1X01A 3BW1A 2BZYA 1Z9ZA 2QXFA 5GJVB 4FSXA 4DEXA 1Q95G 4HT8A 2F69A 2JVVA 3JSCA 4JLGA 3L1AA 4F7UF 1VQ9T 1K73C 1K8AU 4J5YA 1MHNA 2WSFE 1NLPC 3SHWA 2K4YA 1KHCA 1PG5B 1Y71A 5KYUA 3HSBA 2ZGWA 1YCYA 1MNDA 3JCMW 2ZAEA 4EMKC 5HKCA 4E47A 2GNCA 3I35A 1LPLA 4M75F 4KBMB 1BYMA 4RTZA 3N5BB 3LGFA 3ME9A 3OS0A 2O31A 1VQ4Q 1FX7A 2R58A 3HL8A 4RG2A 2M16A 1UHFA 2CUDA 1NPRA 1JXMA 2ROLA 2OJ2A 2RO0A 4BE1A 1VQ8T 2V1QA 3CCUA 2KRNA 4FIBA 5CAIA 4C92A 5GAN5 1JQQA 2AZVA 2LQWA 4J83A 2FRWA 4JRKA 4FW2A 2QA4T 4JJCA 2DK3A 1IHVA 2DVEA 1KJWA 3OYKA 1YJ9A 2KQWA 1D1BA 4E7SA 4KH1B 5LJ3e 4Y28E 2C06A 1BK2A 3MP6A 1D3BB 2Y4YA 2RQUA 5LJ3j 3A8MB 5KCHA 3O5ZA 1RAEB 3L2QA 5GAOl 1EX4A 4LUEA 5FU6B 2COWA 1K9MU 3CCST 5GAOr 3MEUA 1I4K1 4WCIA 2PQWA 4TVRA 4JJBA 3H9NA 5CKBA 1AT1B 3E9FA 4PJLA 1Y7XA 4M7DC 2LT1A 5IXBA 2D0QB 3V8LA 1R77A 1M2VA 5A2QE 4V2SA 2JMCA 1S72A 4BDZA 1T3SA 1QP3A 3R6NA 1G3TA 1WHJA 1T3LA 2HMAA 1M2OA 2RI5A 3R6OA 5I22A 2ZZDA 3DLMA 3OYAA 3JCMP 3L42A 3OBYA 1Y96A 4BDYA 3AHUA 3QJYA 8ATCB 4BY6C 1WDXA 2QTVA 4LDYA 3JB9D 2EQKA 3META 2DBMA 1VIEA 3VS5A 4XQ3A 2M9UA 2DL7A 1XOVA 1KIKA 2LZ6B 1G3WA 4F17A 3OYIA 2L8DA 1PC0A 2DEQA 1QLYA 1O75A 2BE7D 1YFNA 1C0MA 2GGRA 4RKUE 5DLQE 3RKWA 3D7SB 4C8QG 3CMET 3FB9A 1PWTA 1WZOA 2E5KA 1OOTA 3VS4A 2NUTB 1N27A 3HTRA 2DZCA 4N4HA 2VXEA 4CI0C 1M8VA 1ABOA 4Z88A 1E7OA 1WXTA 4J9EA 3I56A 4FYXB 2JNGA 3JCMg 2E3IA 4FU6A 1N5ZA 3CC7T 4UC4A 3CCQA 2FPEA 2O9VA 1TH7A 2KROA 1AWJA 5LJ3g 5I2SA 2NLUA 1GCQA 2HL3A 3HKSA 1OU9A 1NYFA 3OA6A 4Z02A 3KUFA 4MMKA 3HFOA 1HJDA 1H3ZA 2M51A 2DEUA 2QEXQ 3H0FA 4KT0E 3GOXA 4N0AC 4PJOB 1VYTA 2DJZA 3OS2A 2K79A 3I5RA 4IURA 1H92A 4EPCA 2HSEB 2LX9A 2AT1B 2KBTA 1K73U 4FCYA 4KRTA 1OYXA 2HDAA 4HCKA 5J26A 4JUVA 3M57A 3MKDA 3S3MA 1U5SA 2BIVA 5DM7R 1W4SA 1K0XA 2E65A 4IUUA 1YHQT 2LT4A 1QCNA 2DL3A 5J3BA 2SEMA 2HL5C 1B34B 5CKEA 4Z8AA 4DBFA 4RTYA 3CD6A 2KR3A 2DVJA 2DA9A 4A54A 2OTLA 2W10A 3X26B 4A4KA 2XKOC 3EG9B 4M78B 1M30A 1Q86C 1YBYA 5KYXB 4LDXA 3RBBB 4L5GA 2HD0A 5CVIA 1WHMA 4FT2A 2RK2A 3HRSA 1MMAA 2KNBB 4VUBA 3BDLA 3I55Q 3E9GA 5AYFA 3OYEA 4HCZA 2LQKA 5CQXA 4A4HA 4Z89A 1VIFA 3M53A 3QUIA 4IUPA 2JTEA 3CMAT 1WXBA 3VS1A 4ME7A 2MOXA 2OI3A 5KCOA 1KC8C 1AHJB 1UG1A 4X1VA 3A98A 1K76A 3JCMh 3EGXB 2LQNA 4OB2B 4OMQA 3DKMA 1IRXA 3M0PA
chains in the Genus database with same CATH topology
3E2UA 2CP5A 2E3HA 1LPLA 1WHHA 3TQ7P 2COYA 1TXQA 2CP3A 1IXDA 2HL3A 4B6MA 1WHMA 2HL5C 2COWA 1WHJA 2HQHA 2M02A 2QK0A 1TOVA 2CP7A 2COZA 1WHKA 2E4HA 2CP6A 2MPXC 1WHLA 2HKQB 1WHGA 2E3IA 2CP2A 3RDVA 2CP0A 2HKNA 2Z0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2U A;  2CP5 A;  2E3H A;  1LPL A;  1WHH A;  3TQ7 P;  2COY A;  1TXQ A;  2CP3 A;  1IXD A;  2HL3 A;  4B6M A;  1WHM A;  2HL5 C;  2COW A;  1WHJ A;  2HQH A;  2M02 A;  2QK0 A;  1TOV A;  2CP7 A;  2COZ A;  1WHK A;  2E4H A;  2CP6 A;  2MPX C;  1WHL A;  2HKQ B;  1WHG A;  2E3I A;  2CP2 A;  3RDV A;  2CP0 A;  2HKN A;  2Z0W A; 
#chains in the Genus database with same CATH topology
 5EC7 A;  2EYQ A;  3SDZ A;  2GF7 A;  4KUL A;  4M75 E;  4EIK A;  4ZN3 A;  2NUZ A;  2XI9 A;  2K5I A;  1G5V A;  1IGQ A;  3NPF A;  4C5E A;  2LNH B;  4XTU A;  2KYB A;  2JJ9 A;  3MPU B;  3P8D A;  3SFM A;  4C92 E;  2O9S A;  4XAX B;  1Z9Q A;  2KEA A;  1VYV A;  2QQR A;  4HA8 A;  4FYY B;  2F5K A;  1VQP A;  2DFU A;  4M77 A;  5HCK A;  1RAA B;  1Q81 R;  4BI4 A;  4J9I A;  1AD5 A;  3QZ9 B;  3M0T A;  3RER A;  5I2M A;  4JZ4 A;  4M77 C;  1PKT A;  4M78 A;  4LNP A;  2JT4 A;  2EJ9 A;  3OMC A;  4DOW A;  4PNO A;  4WTO B;  4CC4 B;  2YLB A;  1I5O B;  4C8Q A;  4E7L A;  4LDW A;  3CCU T;  4J6X A;  4IKF A;  3H41 A;  4CC7 A;  2KY9 A;  2A3L A;  2HCK A;  4M7A C;  1SPK A;  1W2B A;  4C8Q C;  4M77 F;  5FRO A;  1AOJ A;  5GAN 4;  3CC2 A;  2HKQ B;  1ZSZ A;  3VJP A;  1M1K U;  3I55 T;  2YWW A;  1OV3 A;  4NL2 A;  3NTI A;  1RAB B;  5M9O A;  3CCM T;  3HPW A;  5GMK j;  5KYU B;  2EGC A;  4M78 E;  3A5Z B;  3CCU Q;  1QKW A;  3OYG A;  3QZ5 B;  2EKO A;  2FEI A;  4HVW A;  2KAF A;  4M75 A;  1ZSG A;  1Y07 A;  2CDT A;  2MPX C;  1H64 1;  2CS7 A;  3PMT A;  3RNJ A;  5GAM g;  3OMG A;  2DTI A;  2NUP B;  1N8R U;  1VQ4 A;  3M58 A;  2FZG B;  3V8K A;  1WJR A;  3P8B B;  1NJI U;  1PM3 A;  3QXE B;  2QTX A;  1AZG B;  4M77 E;  1VQM A;  2M02 A;  1Q82 U;  1GBQ A;  2VAS A;  4X9D A;  1Q81 C;  2YXY A;  2QGF B;  1OPL A;  1YJW A;  4L6V 5;  4LDU A;  3QKJ A;  4XU0 A;  3CMA A;  2CP3 A;  1RI0 A;  2PUO B;  1B7T A;  4Y91 A;  3L2U A;  4PFZ A;  3T9N A;  2BZX A;  1OX8 A;  3A8O B;  3CCS A;  2MIO A;  4IUV A;  3SWN C;  1QVF P;  2K2M A;  3OSS C;  1SHG A;  2DD5 A;  2JM9 A;  3EFO A;  4GY5 A;  1YWO A;  2RJE A;  3MHX A;  3SWN B;  2GFA A;  2XIC A;  2VV5 A;  3JCM e;  4GLM A;  2FHD A;  2H3E B;  2E70 A;  3CCL Q;  2KK4 A;  3PGG A;  3UA7 A;  2ED0 A;  4LD9 K;  1TXQ A;  1UGR B;  2CSQ A;  4M75 B;  3OYY A;  2CT3 A;  1ZSZ B;  5D6X A;  3EG0 A;  2EYX A;  4C5H A;  5GMK h;  1V29 B;  2DIL A;  8AT1 B;  2O4X B;  3HRU A;  3EFO B;  1VQP Q;  2EQI A;  4A63 B;  2GFU A;  4QQD A;  2DXU A;  5ECA A;  4II1 A;  3OYH A;  4M7A A;  1UE9 A;  2IPO B;  1LNX A;  2D8J A;  5J39 A;  1B34 A;  2DLP A;  1VQM T;  2Y4X A;  3TSW A;  4RTW A;  4PK4 A;  4C5G A;  3NMZ C;  4FSS A;  3MEV A;  1WHK A;  5CIU A;  3G6E A;  2J6F A;  4DBR A;  1BKB A;  3M0R A;  3GIB A;  2AHJ B;  2OX7 A;  4AG2 C;  4MZM A;  2K7A A;  1Q82 R;  2O2O A;  2XHC A;  1GBR A;  3P8H A;  1IXD A;  3CCL T;  4J9H A;  4KUD K;  2DXC A;  2L3P A;  2DE0 X;  3LH5 A;  5C0M A;  1VQ5 T;  4DOV A;  2ZPH B;  2XMF A;  1VQL A;  2RHY A;  2RPN A;  3QWX X;  1BI3 A;  1PSF A;  4P5N A;  1VQO T;  2OAU A;  5DLO A;  1SKU B;  1BIA A;  1UFF A;  2FZC B;  2BTT A;  4N4I A;  4FM4 B;  3DLL A;  3LWI A;  1WHH A;  5FU6 C;  1VQN T;  3ASK A;  4CC2 A;  2YRV A;  2O88 A;  2DIQ A;  1WA7 A;  3REB B;  1SEM A;  4J7F A;  2DJQ A;  3V7S A;  2RQW A;  4XTZ A;  2J6O A;  4JZ3 A;  5GMK m;  1M5Q 1;  3QBY A;  2J05 A;  1YNZ A;  2MMP A;  2QQA A;  5KYY A;  4C0D B;  2DER A;  2B8A A;  2LJ3 A;  3CC7 A;  3EFS A;  4RTU A;  1VQ7 Q;  1K9M C;  2O01 E;  3G4S T;  2HQX A;  4XTY A;  1D3B A;  3WXM B;  5IH2 A;  1M3B A;  4J9G A;  4M7D A;  2E4H A;  3S6W A;  1GFD A;  1Y0M A;  1MV3 A;  1NLO C;  2LCS A;  9ATC B;  2CH4 W;  1UB4 A;  3CPW P;  1XQH A;  1QP2 A;  1M3C A;  1YIJ A;  1ABQ A;  3FJ5 A;  4C92 B;  4M7A F;  1M1K R;  4C92 G;  1QVP A;  2LJ0 A;  1PRL C;  4A53 A;  2D6F A;  4J9D A;  1IZ6 A;  3RR6 A;  1JRI A;  1F1B B;  1TG0 A;  3QDF A;  1Q86 R;  4JJD A;  2CZ0 B;  1UEC A;  4KUI A;  1NJI C;  2X4Y A;  2IG0 A;  1YIT A;  3C12 A;  3C4S A;  2YUN A;  1YHQ A;  3J81 E;  2QEX A;  4M78 C;  3EAE A;  3V7R A;  2GQI A;  3H0I A;  3QG1 A;  4M78 G;  4PL6 A;  6AT1 B;  4MDX A;  5KE3 A;  3EG9 A;  1VQN Q;  3KFV A;  3CCM Q;  3X20 B;  4AFZ C;  1V76 A;  3HHT B;  1VQP T;  2QAS A;  2CYZ B;  2EAY A;  3JCM c;  1M90 U;  4OMN A;  1HD3 A;  5FU7 C;  1YIT Q;  1SF9 A;  2YUO A;  4DBH A;  1XTD A;  2VXF A;  2LJ1 A;  3RES A;  4RTT A;  1Y96 B;  4JRQ A;  3RUX A;  3CXC P;  3X24 B;  1VA7 A;  2I2L A;  2DTO A;  4AMC A;  5LJ5 f;  1FMV A;  1ZUK A;  3QWY A;  2KXD A;  4J8O A;  2ABL A;  2O4X A;  2RMO A;  3NTH A;  3UT1 A;  2RNA A;  5GAM j;  2XID A;  1X6G A;  4EMK B;  4KGV B;  5FRM A;  1IRE B;  1WHG A;  2YT6 A;  4M77 G;  1KD1 C;  1UGP B;  1NPP A;  4E2F B;  2HQE A;  1KC8 R;  3J80 E;  2HAX A;  1IHW A;  2LCC A;  2QA4 Q;  5A0L A;  3CCM A;  3JB9 F;  4MML A;  3TU4 K;  2EFI A;  4D8D A;  3QJ6 A;  2DAQ A;  4RCB A;  2A36 A;  1OX9 A;  1QVG P;  1WQ7 A;  4M77 B;  4XTV A;  1YJN Q;  3PE0 A;  1S72 Q;  2JN0 A;  1AVZ C;  3CD6 Q;  1VQ4 T;  3TCJ A;  4N0A A;  1JEG A;  3VYG A;  3OYC A;  3NFC A;  2VB6 A;  1SSH A;  1RUW A;  5HK3 A;  2RHX A;  4FL6 A;  1U8R A;  2VWF A;  2KVQ G;  3VUB A;  3VRY A;  5L23 A;  4CRI A;  2QQS A;  2EKH A;  4PKC C;  2YRD A;  1WJQ A;  2E1H A;  4R55 A;  4MZP A;  3M5A A;  2CKK A;  1J3T A;  1OPK A;  2IIM A;  2X4W A;  1D1C A;  1I1J A;  2LC4 A;  3G71 T;  2FB7 A;  5FLX E;  2KXC A;  4MDW A;  1ZA1 B;  3C94 A;  3URG A;  4ZGJ B;  3VS3 A;  4OMP A;  4DBQ A;  4C5I A;  2LDM A;  3TSZ A;  1XJW B;  1AZE A;  1VQ8 Q;  3OYM A;  1Q81 U;  3FEO A;  2YRC A;  5GMK l;  1ZBX A;  2RD1 A;  3EFR A;  4E7K A;  3QPH A;  5GAM f;  3PMI A;  2GTJ A;  3QYG B;  1TUG B;  3CCQ T;  4BI3 A;  1T0J A;  1P92 A;  2E10 A;  3NHN A;  3ZEH A;  2RI3 A;  2ESW A;  5IHI A;  3C95 A;  4JRI A;  2DIG A;  4HXJ A;  1UHC A;  2RJD A;  3CCQ Q;  3RKY A;  4M7D G;  3G7Z A;  1A0N B;  1IB8 A;  2CGH A;  1KC8 U;  2DXT A;  4XTW A;  3I56 Q;  2JXB A;  3OYB A;  1O9S A;  5GAN g;  4IIO A;  4DQ2 A;  2LVM A;  4M78 D;  3L2W A;  2CH4 A;  4QQ6 A;  4M77 D;  5LJ5 h;  1NYG A;  4BE2 A;  4OVA A;  2D8H A;  2AIR B;  3CEY A;  2V1R A;  3OYN A;  4C92 C;  1VQL Q;  2VYT A;  5KH6 A;  1VQO A;  4PJO C;  1D0Y A;  1YN8 A;  3A8H B;  5GAN 2;  4ATO A;  2A7Y A;  1UGQ B;  2M1H A;  1E6G A;  3CME Q;  2E41 A;  3CCJ A;  4BUG A;  1K9M R;  2LX7 A;  2OTJ T;  1PCX A;  3PNW C;  3M0U A;  2CRE A;  2KSS A;  2F2W A;  2XDD A;  2EQJ A;  3LWH A;  2DL8 A;  2QEX T;  2P0K A;  2H3J A;  3G6E Q;  4F7U A;  1QW1 A;  3HRT A;  2VC8 A;  3CD6 T;  1M1G A;  2JW4 A;  4EMK A;  3PIP A;  1U3O A;  3JB9 G;  1PSE A;  1BU1 A;  1KSW A;  2GCX A;  3CPF A;  1FWZ A;  4OF1 A;  4PJM A;  1M1K C;  3E2U A;  4OB0 B;  1W6X A;  1JO8 A;  1ZBJ A;  1VQM Q;  1YIT T;  1TWB A;  2JZ2 A;  4PJJ A;  4EMH A;  4ZTJ A;  3MO8 A;  1FMK A;  3SB2 A;  3CCR Q;  3GLX A;  1M90 R;  3CCE T;  3THK A;  3WVD B;  2P4T A;  2RK1 A;  4JJN K;  2RQR A;  2A08 A;  2A0F B;  3M0S A;  3JCM V;  3OS1 A;  1PRM C;  4HVU A;  2HBW A;  4M7A B;  4C92 F;  1QVF A;  2RQV A;  2K5L A;  1JU5 C;  3JB9 I;  3CC4 A;  2OTJ Q;  4OP0 A;  4OMO A;  4X9C A;  3GPL A;  1KQ1 A;  3CCS Q;  1VQ6 Q;  2ZPE B;  1X69 A;  1NBE B;  1X27 A;  2EYW A;  4JS4 A;  3CMA Q;  1ACM B;  3CC2 Q;  1X43 A;  1YJW T;  2HKN A;  2FYK A;  4AFQ C;  3GBQ A;  2OTJ A;  2E6Z A;  3TVT A;  2P84 A;  2EBP A;  5LJ3 d;  3PVQ A;  4PJN A;  5FWB A;  4EDU A;  5LJ5 d;  5CKH A;  3JCM Q;  2XU8 A;  1R0C B;  1HXD A;  1UJ0 A;  1WJS A;  3M4G A;  3CCV Q;  2XG8 D;  3GP8 A;  1Q82 C;  5CCA A;  4LD6 A;  3GNG A;  1OQK A;  5LJ5 e;  5KYN A;  1YI2 T;  1ARK A;  3M55 A;  4M7D B;  1WNL A;  3F70 A;  1TU0 B;  2DD4 A;  1YJN A;  4XTX A;  3LYI A;  4EMG A;  2R57 A;  1BI2 A;  4QQG A;  1KHI A;  1RLP C;  3VS2 A;  1UJY A;  2VUB A;  5IXF A;  4M75 G;  4AFS C;  2L89 A;  1D1A A;  1OU8 A;  5GAN 7;  2L3Q A;  5GMK i;  1ZQ1 A;  2PVD B;  3IQL A;  2V8J A;  3PTA A;  4O5V A;  3EH1 A;  2L3S A;  4OB1 B;  1Q7Y R;  1VOM A;  1VQ5 A;  3CCV T;  4F7U B;  2ZPB B;  3G1J A;  5IN1 A;  2E12 A;  5IT9 E;  1RL2 A;  1RAI B;  3L2R A;  2NYS A;  3G71 Q;  4LXC A;  1U1T A;  4M7D E;  1M1F A;  2RH2 A;  1IO6 A;  1VUB A;  3NGP A;  2K2V A;  3VRZ A;  5GJW B;  2DBK A;  3RKX A;  2RQT A;  1ZUU A;  4C0F A;  3FJP A;  4FYV B;  1KFZ A;  5KYW A;  2P0P A;  3FC3 A;  1NEB A;  4R0K A;  1D09 B;  1QWE A;  1GXI E;  1GFC A;  1SRM A;  3I55 A;  2RM4 A;  3VS0 A;  4KH0 B;  2EYY A;  3AT1 B;  2MCN A;  5D6Y A;  3CXC S;  1KQ2 A;  4ZTF A;  2JS0 A;  4JRP A;  1WPY A;  4M78 F;  1CSK A;  2JM8 A;  2YUQ A;  3S3O A;  1S72 T;  1QCO A;  5D7U A;  2NUT A;  1N8R R;  2FRY A;  5CKD A;  5GAM h;  4F04 B;  2LP5 A;  1VQK A;  4RMO A;  2DL4 A;  4M7D D;  3MP1 A;  4J7I A;  1NJI R;  4XU2 A;  4HKE A;  3VS7 A;  3M59 A;  2LQ8 A;  3CBP A;  1TTH B;  1W1F A;  1MV0 B;  1V1C A;  2P4R A;  1VQ8 A;  4GBQ A;  4C0G A;  3A8L B;  1UUE A;  3JB9 J;  5GAM d;  2SRC A;  3KBG A;  4OML A;  1K1Z A;  1NEG A;  1ZX6 A;  3EHR A;  4M7A G;  2J7I A;  3ZBD A;  1YJ9 T;  2K3X A;  3BE3 A;  4FW1 A;  3QYH B;  4E7J A;  1QVG S;  5A0G A;  3QSU A;  4FYW B;  3OSV A;  4DEY A;  3MCA B;  2D9T A;  1M2V B;  3HFN A;  2AZS A;  2XD0 A;  1AWX A;  3L2Z A;  2KT8 A;  2DZ9 A;  2E64 A;  5I21 A;  4GLK A;  4OB3 B;  2KT1 A;  2C0O A;  4KGZ B;  5CQY A;  2PZ1 A;  3A8G B;  1RAC B;  2RF0 A;  3FIF A;  4A4G A;  2A28 A;  3SEM A;  1U06 A;  3I9Q A;  3V7C A;  2KGT A;  2GTO A;  1VQ7 A;  4M7A E;  2NUP A;  3MEA A;  1VQK Q;  3I5S A;  2CP5 A;  5LJ5 g;  2MK5 A;  5I11 A;  1B07 A;  1G3S A;  5A0D A;  3OW2 P;  2EWN A;  4L59 A;  2EVR A;  4C8Q D;  1MMG A;  3INZ A;  1QQJ A;  2EYZ A;  1KD1 R;  2IVW A;  1BI1 A;  3NTK A;  3REA B;  4QVC A;  3E1S A;  2DYB A;  4O6J A;  4NS5 A;  1CKA A;  5KYX A;  5AT1 B;  3Q1J A;  1M90 C;  2XK0 A;  1B3Q A;  5CKF A;  2JOY A;  4M75 D;  1AEY A;  2GQV A;  2BUD A;  2FVU A;  4C0Z A;  1I8F A;  1MNE A;  1KK7 A;  3RDV A;  4BE0 A;  3PIO A;  2JUF A;  3M9Q A;  4J6Y A;  4C8Q E;  4RTV A;  1NZ9 A;  1PKS A;  2HQH A;  2PNI A;  2YUP A;  2LMJ A;  4PFP A;  5GAO p;  4M4Z A;  1UGS B;  4JS5 A;  1N6A A;  2V26 A;  3FLG A;  3ZFJ A;  2RHZ A;  1FYN A;  5LJ3 f;  1R0B G;  1CKB A;  1QMC A;  4IIM A;  2HZY A;  1RLQ C;  2L2P A;  4FT4 A;  1QWF A;  1I81 A;  3UDC A;  1N9R A;  3X25 B;  4OMF B;  1GRI A;  3V8J A;  1QVG A;  4HCC A;  5GAM e;  2ZPG B;  1MMN A;  1UTI A;  2DX1 A;  3TRE A;  2WSE E;  2DXB A;  1G3Y A;  1ZA2 B;  3H0H A;  2V8I A;  3CPW S;  2DKG A;  3SWN A;  3ER0 A;  2X3W D;  3CCL A;  4XU1 A;  3EG1 A;  2AKK A;  1VQ6 T;  1EZZ B;  4E7Z A;  2K5F A;  1Y57 A;  2K3Y A;  3E19 A;  1QKX A;  2BE9 B;  1YWP A;  2CP7 A;  2E5Q A;  1M8M A;  1UEB A;  1VQ5 Q;  3RMS A;  2CP6 A;  1BBZ A;  2C0I A;  2DRM A;  5D6W A;  5HK0 A;  2QI2 A;  1YJ9 Q;  2QAZ A;  5GMK e;  1WI7 A;  1KQS S;  4PJO G;  2E3H A;  2CZ7 B;  3M56 A;  4K11 A;  4A4E A;  1WQW A;  3CCE Q;  1K9A A;  1D0Z A;  3CCR T;  3U23 A;  3JB9 H;  5EG2 A;  3EH2 A;  3VUZ A;  1AWO A;  4QKU A;  2COZ A;  4J9B A;  1G2B A;  3A1P A;  4OGE A;  4C8Q F;  3EG3 A;  2CP2 A;  2FG0 A;  2KDS A;  3DB3 A;  2L5Q A;  2DL5 A;  3TQ7 P;  1W2B P;  1U1S A;  1WFW A;  2FPF A;  1M27 C;  4ELZ C;  1RAF B;  2HSP A;  2QQB A;  3OW2 S;  3G6E T;  4C92 D;  1K73 R;  3C0C A;  1WIE A;  3CCE A;  2FPD A;  1OEB A;  2ATC B;  2D0N A;  2MF2 A;  2EIF A;  1Q7Y U;  2F5T X;  4JLI A;  2RJC A;  5CK9 A;  3EHQ A;  2CT4 A;  5FU7 B;  3ULR B;  4M7D F;  2ZCF B;  3JCM d;  1WXU A;  3HP9 A;  3GNF B;  2FZK B;  1VQ6 A;  3VU3 C;  1VQL T;  1TOV A;  2VGM A;  5KE2 A;  3CC4 Q;  5GAN h;  5GAO n;  4PLL A;  3BFM A;  4JDS A;  2CP0 A;  1C1A A;  3MEW A;  1C6V X;  1MUZ A;  2I0N A;  2M0Y A;  2COY A;  1OZ3 A;  5DY9 A;  1GL5 A;  3EGD A;  4ELY C;  3CQT A;  3CCR A;  1DJ7 B;  1EFN A;  7AT1 B;  5GAN f;  1NM7 A;  2RHI A;  2C0T A;  4OGC A;  5GAN j;  3CPW A;  5GAN 8;  1BCM A;  1I5L A;  2DNU A;  2AKL A;  4J9F A;  5KYW B;  1JBM A;  3SD4 A;  3JCM J;  1FXX A;  1Q7Y C;  3RIR A;  4PFO A;  2BKD N;  3CBM A;  1SG5 A;  1SRL A;  1K4U S;  1ZUY A;  1W70 A;  4B6M A;  4ANJ A;  4XK8 E;  4AG1 C;  2MYS A;  1N9S A;  4HVV A;  2KRS A;  3EGU A;  1MMD A;  4LE9 A;  2ECZ A;  3PFS A;  3JV3 A;  2XDP A;  1JB0 E;  2ZPI B;  1OZ2 A;  1RAH B;  4ZGE B;  2X51 A;  5C6S A;  3CME A;  3CCJ Q;  1JJ2 A;  2OAW A;  1QCF A;  1Q86 U;  2V8K A;  4IUQ A;  3BDU A;  2JTM A;  1VQO Q;  2NWM A;  2QK0 A;  4QVD A;  5IAY A;  1S1N A;  2B86 A;  2DRK A;  1YJW Q;  1WLP B;  2LTO A;  3QII A;  1TUD A;  3MP8 A;  1VQ7 T;  1I0C A;  3EGD B;  4BI8 B;  1EIF A;  2EGE A;  3JRZ A;  2DET A;  2X35 A;  2RHU A;  2EJG A;  3WVE B;  2CSI A;  4ZN1 A;  4MZT A;  3EG2 A;  4PLI A;  1X6B A;  4WF2 A;  4HCB A;  2RN8 A;  1YJN T;  2X9H A;  3OY9 A;  1VQ9 A;  3MJX A;  3OYD A;  4KGX B;  1VQK T;  4F7U G;  4ZNX A;  3CBO A;  2RB6 A;  5CR2 A;  1LJO A;  2PVO B;  1FMW A;  4C0D C;  3FRN A;  5GAN 6;  3JCM X;  5IHN A;  4PJO D;  5KYY B;  2X4J A;  1ZHI A;  5IHK A;  4NL3 A;  1JJ2 P;  5GAO m;  2XDB A;  2KMT A;  1W2B S;  2QA4 A;  3M0Q A;  1PD0 A;  2R5M A;  1KD1 U;  2ENM A;  4X34 A;  1I07 A;  2YLC A;  2HEQ A;  2JMA A;  3OB9 A;  3O8V A;  3QHS A;  3LH0 A;  1VYU A;  2L0A A;  4QT7 A;  2PVG B;  3OS5 A;  2JS2 A;  4D6W A;  3X28 B;  1R8O B;  4BAC A;  1XNI A;  3OQ5 A;  2VKN A;  4RG8 A;  1TUC A;  2H8H A;  2QDY B;  1PD1 A;  2E6N A;  2J06 A;  1SSF A;  2DO3 A;  3H8Z A;  5HY6 A;  1M3A A;  2GBQ A;  2MWP A;  5GAO q;  2YSQ A;  1RAG B;  4YTL A;  1X2K A;  2LRQ A;  4D8K A;  1YI2 A;  1HSQ A;  2Z0W A;  4J9C A;  4ORZ A;  1KQS P;  1K8A R;  1ZSZ C;  5CO7 A;  3QO3 A;  1K8A C;  4XU3 A;  2HBP A;  1OUL A;  2D1X A;  2KE9 A;  2PU9 B;  2BZ8 A;  4Y92 A;  2KYM A;  2X4X A;  2DMO A;  4LDV A;  1X2Q A;  5FRN A;  2K9G A;  3LLR A;  1OI1 A;  4RTX A;  4DA4 A;  4BD3 A;  4BY6 B;  2KRM A;  1H3H A;  2QDL A;  1K0S A;  1H8K A;  1YP5 A;  3I56 T;  2ROT A;  1G83 A;  1TSF A;  2DM1 A;  2P0Q A;  4IUT A;  4F14 A;  2QGG A;  3DB4 A;  2CZ1 B;  2FL7 A;  1YHQ Q;  1X75 C;  3G4S A;  4R56 A;  4Q5W A;  1YI2 Q;  4PJO E;  4JPB W;  2F2X A;  2WAC A;  3J7A F;  1KQS A;  4ESR A;  3CCJ T;  1BCO A;  4RCC A;  1T0H A;  4ZGD B;  1M9S A;  1HYO A;  3G71 A;  1BB9 A;  2RI2 A;  5FWC A;  3QDR B;  2L3R A;  2LCL A;  1YIJ T;  3UA6 A;  1YIJ Q;  5LJ3 h;  3VS6 A;  1GCQ C;  3LX7 A;  1QVF S;  3JCM f;  3JAM E;  2W0Z A;  2F1L A;  1SHF A;  3LGL A;  5LL6 S;  3G4S Q;  3S3N A;  2PTK A;  3CC2 T;  2RA2 A;  4LUD A;  3RMQ A;  3UWN A;  1ZLM A;  2ZPF B;  1UGV A;  2K6D A;  1RAD B;  3VKI A;  4QVZ A;  1N8R C;  2QQ9 A;  3OW2 A;  2YDL A;  4NOY A;  1VQN A;  1JXO A;  5LJ5 j;  5GAN 3;  2EQU A;  2LNV A;  3OYF A;  3CC7 Q;  2VVK A;  4M7A D;  1WYX A;  5GAN e;  2F2V A;  2EGA A;  1YCS B;  2OTL Q;  3EGX A;  3VV0 A;  4B9X A;  3VYH B;  1TS9 A;  3BY7 A;  1VQ9 Q;  4E7H A;  5GAN d;  2DYI A;  2MAM A;  4BB7 A;  2X3X D;  3PVL A;  1KG1 A;  3CCV A;  3CC4 T;  1UDL A;  3OYJ A;  4CC3 A;  2DPP B;  4F16 A;  3GF5 A;  1MGQ A;  4AT1 B;  3JCM b;  4E6R A;  3L2V A;  1M4Z A;  2MWO A;  4C8Q B;  2MI6 A;  3UAT A;  5L8R E;  2CZ6 B;  2A37 A;  3OYL A;  1BIB A;  3M4Y A;  4PJO A;  3PT9 A;  4PJO F;  3OBW A;  2K57 A;  2EJF A;  2KI7 A;  1LVK A;  4AFU C;  4B9W A;  2G3R A;  1D0X A;  4E7I A;  2J6K A;  1PHT A;  2DF6 A;  2G6F X;  1NG2 A;  3ZL7 C;  2EW3 A;  2FO0 A;  1BI0 A;  1WHL A;  3FDR A;  1NE8 A;  1IGU A;  4N4G A;  3KXT A;  4HT9 A;  2PUK B;  1G8X A;  1X6O A;  2WSC E;  3LW5 E;  4QW2 A;  4J6W A;  1LOJ A;  3TEE A;  3UF4 A;  1RI9 A;  5FW9 A;  2M0O A;  4M75 C;  1HK9 A;  3UPU A;  2YHT A;  2EPD A;  2JTF A;  4F7U E;  2QG9 B;  2AK5 A;  3H6Z A;  2OTL T;  2EQM A;  2HNI A;  2VGN A;  2Y90 A;  1JJ2 S;  1E6H A;  4RUG A;  1PNJ A;  2ED1 A;  1WGS A;  4OMM A;  2CUB A;  1AWW A;  4LN2 A;  1LCK A;  3CXC A;  2K3B A;  1WX6 A;  3M54 A;  2RJF A;  4A4F A;  1GCP A;  2QYZ A;  2R5A A;  2DTH A;  1X01 A;  3BW1 A;  2BZY A;  1Z9Z A;  2QXF A;  5GJV B;  4FSX A;  4DEX A;  1Q95 G;  4HT8 A;  2F69 A;  2JVV A;  3JSC A;  4JLG A;  3L1A A;  4F7U F;  1VQ9 T;  1K73 C;  1K8A U;  4J5Y A;  1MHN A;  2WSF E;  1NLP C;  3SHW A;  2K4Y A;  1KHC A;  1PG5 B;  1Y71 A;  5KYU A;  3HSB A;  2ZGW A;  1YCY A;  1MND A;  3JCM W;  2ZAE A;  4EMK C;  5HKC A;  4E47 A;  2GNC A;  3I35 A;  1LPL A;  4M75 F;  4KBM B;  1BYM A;  4RTZ A;  3N5B B;  3LGF A;  3ME9 A;  3OS0 A;  2O31 A;  1VQ4 Q;  1FX7 A;  2R58 A;  3HL8 A;  4RG2 A;  2M16 A;  1UHF A;  2CUD A;  1NPR A;  1JXM A;  2ROL A;  2OJ2 A;  2RO0 A;  4BE1 A;  1VQ8 T;  2V1Q A;  3CCU A;  2KRN A;  4FIB A;  5CAI A;  4C92 A;  5GAN 5;  1JQQ A;  2AZV A;  2LQW A;  4J83 A;  2FRW A;  4JRK A;  4FW2 A;  2QA4 T;  4JJC A;  2DK3 A;  1IHV A;  2DVE A;  1KJW A;  3OYK A;  1YJ9 A;  2KQW A;  1D1B A;  4E7S A;  4KH1 B;  5LJ3 e;  4Y28 E;  2C06 A;  1BK2 A;  3MP6 A;  1D3B B;  2Y4Y A;  2RQU A;  5LJ3 j;  3A8M B;  5KCH A;  3O5Z A;  1RAE B;  3L2Q A;  5GAO l;  1EX4 A;  4LUE A;  5FU6 B;  2COW A;  1K9M U;  3CCS T;  5GAO r;  3MEU A;  1I4K 1;  4WCI A;  2PQW A;  4TVR A;  4JJB A;  3H9N A;  5CKB A;  1AT1 B;  3E9F A;  4PJL A;  1Y7X A;  4M7D C;  2LT1 A;  5IXB A;  2D0Q B;  3V8L A;  1R77 A;  1M2V A;  5A2Q E;  4V2S A;  2JMC A;  1S72 A;  4BDZ A;  1T3S A;  1QP3 A;  3R6N A;  1G3T A;  1WHJ A;  1T3L A;  2HMA A;  1M2O A;  2RI5 A;  3R6O A;  5I22 A;  2ZZD A;  3DLM A;  3OYA A;  3JCM P;  3L42 A;  3OBY A;  1Y96 A;  4BDY A;  3AHU A;  3QJY A;  8ATC B;  4BY6 C;  1WDX A;  2QTV A;  4LDY A;  3JB9 D;  2EQK A;  3MET A;  2DBM A;  1VIE A;  3VS5 A;  4XQ3 A;  2M9U A;  2DL7 A;  1XOV A;  1KIK A;  2LZ6 B;  1G3W A;  4F17 A;  3OYI A;  2L8D A;  1PC0 A;  2DEQ A;  1QLY A;  1O75 A;  2BE7 D;  1YFN A;  1C0M A;  2GGR A;  4RKU E;  5DLQ E;  3RKW A;  3D7S B;  4C8Q G;  3CME T;  3FB9 A;  1PWT A;  1WZO A;  2E5K A;  1OOT A;  3VS4 A;  2NUT B;  1N27 A;  3HTR A;  2DZC A;  4N4H A;  2VXE A;  4CI0 C;  1M8V A;  1ABO A;  4Z88 A;  1E7O A;  1WXT A;  4J9E A;  3I56 A;  4FYX B;  2JNG A;  3JCM g;  2E3I A;  4FU6 A;  1N5Z A;  3CC7 T;  4UC4 A;  3CCQ A;  2FPE A;  2O9V A;  1TH7 A;  2KRO A;  1AWJ A;  5LJ3 g;  5I2S A;  2NLU A;  1GCQ A;  2HL3 A;  3HKS A;  1OU9 A;  1NYF A;  3OA6 A;  4Z02 A;  3KUF A;  4MMK A;  3HFO A;  1HJD A;  1H3Z A;  2M51 A;  2DEU A;  2QEX Q;  3H0F A;  4KT0 E;  3GOX A;  4N0A C;  4PJO B;  1VYT A;  2DJZ A;  3OS2 A;  2K79 A;  3I5R A;  4IUR A;  1H92 A;  4EPC A;  2HSE B;  2LX9 A;  2AT1 B;  2KBT A;  1K73 U;  4FCY A;  4KRT A;  1OYX A;  2HDA A;  4HCK A;  5J26 A;  4JUV A;  3M57 A;  3MKD A;  3S3M A;  1U5S A;  2BIV A;  5DM7 R;  1W4S A;  1K0X A;  2E65 A;  4IUU A;  1YHQ T;  2LT4 A;  1QCN A;  2DL3 A;  5J3B A;  2SEM A;  2HL5 C;  1B34 B;  5CKE A;  4Z8A A;  4DBF A;  4RTY A;  3CD6 A;  2KR3 A;  2DVJ A;  2DA9 A;  4A54 A;  2OTL A;  2W10 A;  3X26 B;  4A4K A;  2XKO C;  3EG9 B;  4M78 B;  1M30 A;  1Q86 C;  1YBY A;  5KYX B;  4LDX A;  3RBB B;  4L5G A;  2HD0 A;  5CVI A;  1WHM A;  4FT2 A;  2RK2 A;  3HRS A;  1MMA A;  2KNB B;  4VUB A;  3BDL A;  3I55 Q;  3E9G A;  5AYF A;  3OYE A;  4HCZ A;  2LQK A;  5CQX A;  4A4H A;  4Z89 A;  1VIF A;  3M53 A;  3QUI A;  4IUP A;  2JTE A;  3CMA T;  1WXB A;  3VS1 A;  4ME7 A;  2MOX A;  2OI3 A;  5KCO A;  1KC8 C;  1AHJ B;  1UG1 A;  4X1V A;  3A98 A;  1K76 A;  3JCM h;  3EGX B;  2LQN A;  4OB2 B;  4OMQ A;  3DKM A;  1IRX A;  3M0P A; 
#chains in the Genus database with same CATH homology
 3E2U A;  2CP5 A;  2E3H A;  1LPL A;  1WHH A;  3TQ7 P;  2COY A;  1TXQ A;  2CP3 A;  1IXD A;  2HL3 A;  4B6M A;  1WHM A;  2HL5 C;  2COW A;  1WHJ A;  2HQH A;  2M02 A;  2QK0 A;  1TOV A;  2CP7 A;  2COZ A;  1WHK A;  2E4H A;  2CP6 A;  2MPX C;  1WHL A;  2HKQ B;  1WHG A;  2E3I A;  2CP2 A;  3RDV A;  2CP0 A;  2HKN A;  2Z0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...