2COZA

Solution structure of the cap-gly domain in human centrosome-associated protein cap350
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
122
structure length
122
Chain Sequence
GSSGSSGVEHEQQVTESPSLASVPTADELFDFHIGDRVLIGNVQPGILRFKGETSFAKGFWAGVELDKPEGNNNGTYDGIAYFECKEKHGIFAPPQKISHIPENFDDYVDINEDEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords centrosome-associated protein 350
publication title Solution structure of the CAP-Gly domain in human centrosome-associated protein CAP350
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cozA01
2HKQB 1WHGA 3RDVA 4B6MA 2E3HA 1TXQA 2COZA 1WHMA 1WHLA 2CP7A 1IXDA 1TOVA 2COWA 1LPLA 2CP5A 3E2UA 2CP6A 2MPXC 2HQHA 2CP2A 3TQ7P 2Z0WA 2CP3A 2HL3A 2COYA 1WHHA 2HL5C 2HKNA 2QK0A 2M02A 2E4HA 2E3IA 1WHKA 2CP0A 1WHJA
chains in the Genus database with same CATH superfamily
1M1GA 3KFVA 2CT4A 1G2BA 3P8BB 4LUEA 3L2RA 2EIFA 3CCMQ 2L2PA 4FSXA 1VYVA 3VS5A 2CUBA 3DLLA 1W70A 3SB2A 4XU3A 1OEBA 3VYGA 3NFCA 3VS7A 1LNXA 3GNGA 1KC8U 4J5YA 4OMLA 1K8AC 3RDVA 1SPKA 3SDZA 3VRYA 3VS0A 1AWWA 2EGAA 2LX7A 3X28B 3VS2A 4EDUA 4DA4A 3LGLA 1BYMA 5GAN3 2KI7A 4II1A 4JRKA 5CVIA 1RUWA 2BZYA 3MKDA 3NHNA 1KG1A 3BE3A 2EQMA 2YLCA 3JB9G 4M7DA 4BI3A 1IGUA 1D0XA 1NEBA 4X9DA 4FYXB 3G7ZA 5GMKm 1ZA2B 1JXMA 2VC8A 3QZ5B 1FXXA 4M78E 2CS7A 1WFWA 2DL4A 1Z9ZA 1WHHA 5CKEA 1H8KA 3VS3A 2MAMA 3BDUA 3CC7T 1KQSP 4M78G 4L5GA 3HKSA 1WJSA 1ZQ1A 4N4HA 4R0KA 2CZ0B 4K11A 1MNDA 1NJIC 2JS2A 4J83A 3HSBA 2D0QB 1VQ5Q 3VV0A 1N8RR 3H0HA 3JB9H 1WIEA 4OB3B 5FRMA 4M77E 2MIOA 3OYNA 1QCFA 4LD9K 3E9GA 3QHSA 2PVDB 1X75C 1FMVA 4FM4B 1BU1A 1WDXA 4M77G 2ZPIB 3CCST 1K4US 2DPPB 1YWOA 2DIQA 1Q86U 3RKWA 2R58A 4AG2C 2FO0A 4EIKA 1M8MA 3PNWC 3UDCA 1I0CA 2E5KA 3EH2A 4PJOB 4PL6A 1BI0A 2DTHA 2XMFA 1FWZA 2ZPHB 3INZA 3CCRA 3PVLA 1UEBA 4JLGA 3SWNC 3IQLA 2YRDA 4C8QB 2P0QA 1RAGB 1ZSZA 4C92F 4PFZA 5GAOn 1UHFA 2PUKB 2KT1A 2MF2A 2I0NA 2IVWA 2CH4A 1BI2A 1YN8A 4A63B 3H0FA 4A4HA 1TOVA 3FJ5A 3H41A 4C5HA 3TVTA 1MMGA 3CD6Q 3G4ST 2HSEB 3M57A 2XICA 2RJEA 1HXDA 3FRNA 1M3CA 3CCEA 1QKWA 3EFSA 4XTXA 3JRZA 1M90C 1I1JA 2DYBA 1CSKA 1V76A 1EZZB 2RQTA 1WHJA 4BD3A 3OYCA 1WQ7A 2HQXA 4M7DC 2D9TA 3JB9J 5GAN2 5I21A 2HAXA 2LTOA 4Y92A 2JMCA 2X3WD 1Q82C 4E7ZA 1AHJB 2LQNA 4HT9A 1B34B 4A54A 4C0DC 4RTVA 1BB9A 2CP0A 1EFNA 1WNLA 8AT1B 2Y4XA 1KD1U 2HBPA 1MV3A 2YUNA 4GLKA 1VQMQ 2XDBA 2KEAA 3QYGB 4ME7A 1Y57A 1OPKA 2MI6A 1Q81U 3CCJT 2QEXA 1TH7A 3M0QA 1HK9A 2COYA 2RHXA 1G3TA 5CIUA 3HP9A 3CMAA 1OI1A 2DX1A 4PFOA 2J6KA 2LP5A 3AT1B 2QQ9A 1WQWA 4F17A 3URGA 1Y71A 1KHCA 4OMQA 3CCQT 2E3HA 1QMCA 2GTOA 2LRQA 3M0UA 3G6ET 1WZOA 3HTRA 3C0CA 3EHRA 1NYFA 2QI2A 2X51A 3G71A 3NGPA 2DRKA 3EG1A 4B9WA 4E6RA 3J80E 2YUQA 3EHQA 1OX9A 3RIRA 1VQNT 1QP2A 1W2BS 3C94A 3JCMQ 1ZHIA 3MP1A 3CCUQ 4FT2A 1R0BG 1VQ7T 1QLYA 1P92A 2P84A 3H6ZA 2BE9B 2YLBA 1XNIA 1AD5A 4JRIA 5KYXA 2GQVA 3I55Q 1BBZA 3OMGA 1ZUUA 2QTXA 5KCHA 4M7AD 2YWWA 1NLOC 4DOWA 1UFFA 1YI2A 2L8DA 3QSUA 2L0AA 1M1KU 2RO0A 1VQ9A 3I56A 4GBQA 2B86A 2FZGB 4PJLA 3T9NA 1LJOA 2DTIA 1MMDA 2MYSA 3FDRA 2DILA 4ZGDB 2K79A 2DE0X 5LJ3d 3PMIA 2F2XA 4A4KA 3A5ZB 3CC4Q 2F1LA 3HRTA 2GNCA 3RMSA 3TSWA 4WTOB 3V7CA 2BUDA 1SSFA 2M0OA 3M54A 3VUZA 4M78A 4QQGA 1BKBA 1C1AA 1Y07A 3JAME 4M7DE 1VQLT 5IT9E 1V29B 2VVKA 5FU6B 5IHKA 1QVFA 1IHVA 4L6V5 1RAEB 2CH4W 2LJ1A 3S3OA 2K5IA 4DBHA 1QVFS 2JTMA 1VQKT 1QKXA 2WACA 3L2VA 2DXCA 4M75B 4BACA 5IHNA 5CKDA 3OYDA 1KC8R 4M7DG 5LJ3g 2EYYA 1H641 5DM7R 1NE8A 2LCSA 1YJ9A 1X69A 1HD3A 1ACMB 4PJOA 1YJWA 3CCMA 4M77A 2DLPA 4A53A 3M5AA 4C92B 5FWCA 4J9EA 1C6VX 3FB9A 1U06A 2F5KA 2K3XA 3TEEA 3HFNA 4C8QA 3OSSC 3VU3C 2FRWA 2I2LA 3PVQA 2LT1A 3P8HA 2R5MA 3OYBA 3MP6A 3S3NA 1YHQA 4RTUA 5KH6A 2SRCA 1G5VA 4DBRA 3CEYA 2VXFA 3RNJA 5LJ3j 3MEAA 1H3ZA 4C92D 2X4YA 3CC7Q 1YCSB 4ATOA 4EMHA 4C0FA 2L89A 5KYWB 2ZPGB 5IAYA 1HSQA 3NTIA 4BDYA 1LVKA 2EQUA 3GOXA 2XI9A 5LJ3h 4XU1A 1OOTA 5CK9A 3KBGA 4LDWA 2K9GA 2XIDA 3JB9F 4J7FA 5KYYA 4LDUA 4HCZA 3QDFA 1IO6A 2LCCA 4QW2A 5GAOl 5IHIA 3CCSQ 1NPRA 2OTLT 1OU8A 1T0JA 2E6ZA 3EG9B 1VQOT 2JM9A 1Q86R 3PIOA 2J6FA 1VQ5A 2DKGA 1VYUA 3WVDB 4OMOA 2RF0A 3KXTA 1K8AR 4HKEA 2BKDN 2ZGWA 4JZ3A 1H3HA 3DB4A 4HXJA 1AWXA 2LJ0A 5HCKA 4FCYA 3JSCA 2CSQA 4BDZA 1QP3A 1RAIB 1GRIA 2AZVA 1QW1A 2FYKA 2K57A 3X20B 2DD5A 3MO8A 2DEQA 2OAWA 1M3AA 5GANj 1AOJA 1BI3A 1ZA1B 2L3RA 3HRUA 4PJMA 4E7SA 2Z0WA 1U1SA 4FU6A 1X6OA 3G4SQ 2C0TA 2VKNA 2KXDA 1PD1A 3M0PA 2XKOC 2PZ1A 2QK0A 2W10A 2NUTA 2L3SA 4PLLA 3UPUA 1PC0A 3REAB 1N27A 1UGPB 3CMEA 2YRCA 4ZGJB 2AZSA 3GIBA 2F69A 2HBWA 4EMGA 5CAIA 5GANe 4PJOC 4VUBA 2VV5A 2QDYB 4Y28E 3EGXB 4KRTA 2DFUA 2CDTA 5GANf 3OA6A 4PLIA 1NJIR 2IG0A 4C8QC 4BUGA 2EYWA 2O01E 3CD6A 3LX7A 1NLPC 5GAN6 3UT1A 1M3BA 3QO3A 4AFZC 2DAQA 4FYVB 3UA7A 1ZLMA 3CXCA 2JTFA 3REBB 2FB7A 4QT7A 4E7KA 3CXCS 1E7OA 3VUBA 2HL5C 2QA4A 4F7UF 1RACB 4UC4A 1I5OB 1G8XA 2P4RA 3VJPA 4HVUA 2DA9A 4IIMA 4D8KA 1N6AA 2HNIA 3SWNA 2KROA 1I4K1 1WI7A 3QZ9B 2FPFA 1GCPA 3CC2A 1GL5A 3CCQQ 2AK5A 1XJWB 1DJ7B 1SHGA 3O8VA 4A4GA 4E7IA 2NUPB 4CC7A 3G6EQ 2V1RA 2E65A 3EFRA 3PE0A 1VQMA 4BY6C 4M75A 2IPOB 2KK4A 3M56A 3PT9A 4KBMB 4QKUA 1TUCA 4ZTJA 3UF4A 3QJ6A 1VQNQ 4KGVB 2RQUA 1K73C 1JJ2A 4M7AF 3FIFA 5DY9A 5GAOm 1X01A 4RCBA 1Q7YR 1JJ2S 1VQ7Q 2QQBA 3M0TA 4OP0A 1B07A 2EQIA 2K2MA 1M90R 1AZEA 1MGQA 2COZA 2RI2A 1UE9A 2FZKB 1JEGA 1ZSGA 2EW3A 3GP8A 3EFOB 2ZPBB 3ASKA 3R6NA 2VWFA 1TG0A 5KYUB 5KCOA 1X43A 3L2QA 2B8AA 1M1KR 2E12A 2K3BA 3QBYA 1NEGA 3ER0A 3HRSA 1Q82R 3OSVA 3CCUA 1WXBA 5FU7C 2KRNA 2WSEE 4CC2A 4PKCC 2K7AA 5KYWA 4EMKB 1Y96A 5GAN4 4DEYA 3I55A 4NL2A 3CCVT 1VQ6A 4RTTA 3QDRB 2KVQG 1WJQA 1UJ0A 1VQ8T 2ABLA 3OYFA 1IGQA 4PJOE 3H9NA 2X35A 2EBPA 1ZBJA 1VUBA 2GBQA 4MZTA 4LE9A 4OGCA 2O9VA 2KR3A 2GFUA 3MCAB 2JM8A 1VQLQ 2EYZA 1IXDA 1FMWA 3QXEB 1OU9A 4C8QE 2E70A 1UGSB 4PJOG 1RADB 1MMAA 5FROA 4XU0A 4MDWA 1VQKQ 1G3WA 3CC4A 2XDDA 2LDMA 3JB9D 1YCYA 1EIFA 4N0AC 5D6XA 2D6FA 2PTKA 2XD0A 5CQYA 4C8QG 5FLXE 2NYSA 1RLPC 1K8AU 1RABB 3LH0A 2QG9B 3FC3A 1FX7A 1Q81C 2ED0A 1GFDA 1S72T 2RA2A 2XG8D 4X9CA 4XTWA 2ENMA 2EQJA 1H92A 2GGRA 1ZBXA 4BI4A 3M4YA 3X25B 2RMOA 2ROTA 3EAEA 3TSZA 2DBMA 1JO8A 1S1NA 3JCMc 5FU6C 5CR2A 3VYHB 2PU9B 1B3QA 1U5SA 5DLOA 4XK8E 5GAMd 2EGEA 4M75C 1VIEA 1PCXA 2HL3A 2EJ9A 2O4XA 1QVFP 2XU8A 4AT1B 2DL7A 2HZYA 3C95A 4M7DF 1GCQA 3MJXA 4C92C 1VQ4T 2NUZA 2CKKA 1E6HA 2K5FA 1NJIU 2V8KA 3OYMA 1KSWA 1M2VB 2RD1A 4OMMA 1N5ZA 2RK1A 1X27A 1K9MC 6AT1B 4F7UB 3JCMX 2QQAA 5CO7A 3S3MA 5GAMg 1UUEA 2JZ2A 1Z9QA 1AVZC 2X4WA 1ARKA 9ATCB 3CC7A 4KUIA 2JJ9A 3H8ZA 2CSIA 2RI5A 1K1ZA 3E1SA 1PSFA 7AT1B 1IB8A 4LDVA 4PK4A 3EGDB 2OTLQ 4CC4B 3M0RA 4B9XA 2JS0A 1VQOQ 4DBQA 2JTEA 2DL5A 4OGEA 4RUGA 4R55A 1D3BB 2V1QA 3JCMd 3MEVA 3QWXX 2DVEA 1YNZA 1N8RC 1W6XA 3P8DA 1KJWA 1X2QA 2CP5A 2PNIA 4D8DA 2OTJT 1XQHA 4X34A 5GAMj 3CCSA 3V8KA 4M7AB 3JCMW 2EQKA 3DB3A 2QASA 1W2BA 1SF9A 4C0GA 4ORZA 4RG8A 1VQPT 2A08A 2DO3A 4AFSC 2VGMA 3JCMV 1VYTA 3JCMg 2ATCB 1UG1A 1RAAB 4DEXA 4DQ2A 2GFAA 1Q7YU 2CP6A 2EWNA 2GCXA 2AHJB 5GAMe 5GAMh 2GF7A 1SSHA 5LJ5d 1UDLA 4AMCA 1M90U 1EX4A 2KMTA 2PVOB 4ELZC 4CC3A 1Q95G 1W4SA 4BE2A 1NZ9A 4J9GA 2QYZA 3V7SA 2G6FX 2KGTA 4PJJA 3RKXA 3G4SA 2GTJA 1QWEA 1OULA 3OQ5A 2R5AA 1Q82U 4FIBA 4XTYA 1QQJA 1D0YA 1VIFA 2FL7A 4IIOA 2KE9A 2LCLA 2HDAA 4M75E 4XTUA 2DIGA 4C5IA 3CCLT 5LJ5g 4IKFA 1OV3A 2RPNA 2YT6A 2KBTA 3WXMB 2A28A 4E47A 1WX6A 2KRMA 3QJYA 2A7YA 3QIIA 1GCQC 1N9RA 2ED1A 4M75G 4C92E 2BE7D 2DZ9A 1Y0MA 2RB6A 2E41A 2RK2A 3NMZC 3RUXA 1E6GA 2K6DA 2E64A 3JCMh 3O5ZA 2RJDA 2M51A 3F70A 3RMQA 3HL8A 4Z02A 4JS4A 1TSFA 4J6XA 4F14A 4C92G 2X3XD 2LVMA 5FW9A 2D8HA 2YSQA 2XK0A 4JJCA 3CCJA 2MCNA 3TQ7P 1WYXA 1PSEA 2RJFA 3CCRQ 3LW5E 4GY5A 2CT3A 5LJ5j 2C06A 1NBEB 2EPDA 4MZMA 2KYMA 3J81E 3CCQA 1U3OA 2DEUA 4LUDA 2J05A 1CKAA 3CXCP 4A4EA 5CKHA 8ATCB 1WGSA 3G6EA 4BE1A 5EC7A 4DOVA 4E7JA 1AT1B 5CKBA 1R8OB 4KGXB 4XTZA 5KYNA 5GAOq 3CQTA 4RTYA 3GF5A 1YIJT 3SD4A 4JLIA 5LJ5h 5LJ5e 5CKFA 4E7HA 4CRIA 1OQKA 2EFIA 2FZCB 1VQNA 4YTLA 1OX8A 1O75A 1M2OA 1A0NB 3GNFB 4FW1A 3NPFA 5LJ5f 1QCNA 1Y7XA 4JRQA 2DF6A 2MOXA 2DRMA 2KRSA 1YITT 2C0OA 1YFNA 2KT8A 2YDLA 3AHUA 1VQ7A 1BCMA 4MMLA 1FMKA 2QAZA 1MHNA 1LCKA 3A8HB 3CCVQ 4PJNA 4OB0B 4HT8A 2RHYA 5LJ3e 3EGUA 5HK3A 1VQ8Q 4BE0A 4ZNXA 2HD0A 2VASA 4M7DD 2JNGA 1JJ2P 3OB9A 5LJ3f 1B34A 2F2VA 3M0SA 5LL6S 1GFCA 2H8HA 1YJNT 3QYHB 4JJDA 2ZAEA 1PKSA 2EAYA 2RHIA 4JDSA 4LDYA 5I2MA 5D6WA 1MMNA 3EG3A 1IHWA 4MMKA 2F2WA 5HK0A 1VA7A 1OPLA 2LNHB 4ESRA 4AFUC 3RKYA 3LWIA 1QVGA 4Z8AA 1S72Q 4ELYC 2QGGA 4M78F 5D6YA 3MEUA 1VQLA 4Z89A 4IUPA 1K73R 2AT1B 1M27C 1OZ2A 1QVGS 1WPYA 5AYFA 4Y91A 2IIMA 1PRLC 3ZL7C 2DZCA 5GMKh 1JB0E 3X24B 4J9IA 1VQKA 2QXFA 2RHUA 1WLPB 4BB7A 3V8LA 1QCOA 3CBPA 2DL8A 1UGVA 1PWTA 1T0HA 3TREA 4J6WA 1I81A 4IUQA 1UJYA 2QTVA 1FYNA 3OW2A 4O6JA 2RNAA 1KC8C 4PNOA 4DBFA 4PJOF 5A0DA 4M77F 3OW2S 1ZSZB 5C6SA 2ZPEB 2RM4A 3U23A 3LGFA 3META 2DL3A 5CCAA 1NYGA 2CP3A 4C8QF 1VQ4Q 3LLRA 3JCMb 4FL6A 1AZGB 1D1BA 3JCMJ 4TVRA 4HVVA 1VQ6T 2EYQA 3E2UA 4N0AA 2V8IA 1I07A 5GAN7 2R57A 2A37A 2EKOA 2EGCA 3CBOA 1BK2A 2E1HA 4PFPA 2MWOA 4OB1B 2CUDA 3PMTA 2FG0A 1K9AA 2O9SA 2DMOA 3UA6A 2JMAA 3VS4A 1PKTA 1LOJA 1LPLA 3GPLA 3TU4K 3ULRB 1I8FA 3UWNA 4A4FA 3EG2A 4C5GA 1KIKA 3OY9A 2AIRB 4X1VA 2OTJQ 1ABOA 1TTHB 2P0PA 2OTLA 4XU2A 3BW1A 1VQOA 2RQRA 1YJWQ 3WVEB 5J39A 3V8JA 3CCRT 2CZ6B 1VQPQ 2RI3A 1WA7A 1Q86C 4BI8B 4C92A 1YHQQ 3L2UA 3A8GB 2LMJA 3CPWA 2DXBA 4HCCA 4JZ4A 3KUFA 1TXQA 2KDSA 3CPWS 3E19A 3I5RA 5A2QE 4F04B 4RTWA 3J7AF 1WJRA 1SG5A 3CCET 2MPXC 4N4GA 3A8LB 2C0IA 4J6YA 4ZGEB 1GBQA 2JT4A 1PHTA 4M7AC 1U8RA 5KYXB 1K9MR 3DKMA 2EJGA 3UATA 1X6BA 3FLGA 3R6OA 1WXTA 4C5EA 3Q1JA 3I9QA 3HFOA 3CCLQ 2CP2A 2DBKA 2LQWA 4LN2A 3LWHA 1JRIA 1W2BP 1UGRB 1YWPA 3TCJA 3H0IA 2PVGB 4J8OA 1U1TA 2KSSA 1WHMA 2DJZA 3L42A 4LXCA 1PG5B 1NM7A 2QEXT 4Z88A 1JBMA 3M4GA 4AG1C 4FW2A 1QVPA 3EG9A 2FPDA 2L3PA 3CMAT 2K2VA 2M0YA 2OX7A 1RAFB 2BIVA 3HHTB 4M78B 2NWMA 2VB6A 1KD1C 2LNVA 4OMFB 4P5NA 3OYHA 1D09B 3OYYA 3OS0A 1PNJA 2J6OA 5A0LA 2XHCA 2K3YA 3G71T 1K73U 1TS9A 3L2ZA 2AKKA 1I5LA 2L5QA 2QDLA 1JQQA 1BIBA 4NL3A 4EPCA 2RQVA 4IUUA 1WHGA 1YIJQ 1NPPA 3M9QA 4M77B 1GXIE 4M78D 4M75F 2CP7A 3OYAA 3CMEQ 3MPUB 1HYOA 4J9FA 4F7UE 3A98A 2F5TX 2FEIA 1ZUYA 2LJ3A 2FPEA 2J06A 4RG2A 1KQ2A 4ANJA 2YUPA 2FVUA 1YITQ 3OS2A 4WF2A 2VUBA 4NS5A 4F16A 1YI2T 4F7UG 1F1BB 1RI9A 2OJ2A 3EGXA 4RTZA 5DLQE 1Q7YC 3N5BB 4CI0C 2HCKA 1VQ9T 3I56T 5IXBA 4PJOD 3QG1A 2RH2A 5KE2A 4M77D 3LH5A 2L3QA 2DK3A 1UB4A 2HQEA 5GAOp 1M9SA 2YUOA 3A8OB 2SEMA 2DXTA 3QPHA 4FT4A 4C8QD 2QA4Q 5EG2A 3GBQA 1YJNQ 1KHIA 4E7LA 3VRZA 2KXCA 1SRLA 1IREB 1M4ZA 4M7AE 1W1FA 1KQ1A 1M1KC 4QVDA 3CCVA 4J9HA 2FHDA 4HCBA 4XTVA 1GBRA 2X4JA 4BY6B 5KYYB 3CC2Q 1VQ8A 4RCCA 3NTKA 4OB2B 4R56A 3OYGA 2YRVA 4M7AG 2A0FB 3ME9A 4OF1A 1R77A 3ZEHA 3VKIA 1SKUB 2EVRA 2BZ8A 4N4IA 4OMPA 2NUPA 3SEMA 2CYZB 3MHXA 2E6NA 3G1JA 5FWBA 5IH2A 1T3SA 2G3RA 1YJ9T 2DJQA 5J3BA 4LD6A 1YJWT 2XDPA 2EJFA 3CCMT 2FRYA 4J9DA 3I35A 5I2SA 2D1XA 2K5LA 2DERA 2CREA 1KQSA 1M30A 1RAHB 4Q5WA 1K0XA 1S72A 1KQSS 1YHQT 2MK5A 5HKCA 4RMOA 2A36A 3THKA 3OYLA 4FSSA 1XTDA 5FU7B 1R0CB 3M59A 1AEYA 4XAXB 5GAMf 5L8RE 3LYIA 1BIAA 5GJVB 3EFOA 5I22A 2CGHA 5GAOr 1JXOA 2NUTB 1BI1A 3PTAA 1V1CA 4XQ3A 2RN8A 3OBYA 5KYUA 1ZX6A 1SEMA 2DNUA 4J7IA 3RESA 1TU0B 3RR6A 5HY6A 3ZFJA 4OMNA 2DVJA 1QVGP 1UHCA 2W0ZA 1VQ6Q 2DD4A 1K9MU 2P4TA 1D1CA 3OYEA 1VOMA 4WCIA 1RL2A 2O31A 1B7TA 4EMKA 2QQRA 2NLUA 1WHLA 2MWPA 2EYXA 1VQ4A 2OI3A 1AWJA 1ZSZC 2P0KA 5A0GA 2YHTA 2LX9A 1K0SA 2HKNA 3OW2P 2LT4A 1UGQB 2E3IA 1M8VA 4FYYB 2KYBA 2X4XA 2JW4A 3JV3A 3QKJA 4ZN1A 2QGFB 3JCMe 1X6GA 3MEWA 2H3JA 1VQ5T 1X2KA 4V2SA 2RQWA 1N8RU 4LNPA 2PUOB 2PQWA 3JCMf 4ZN3A 3SWNB 3BY7A 3L1AA 2HSPA 3E9FA 2ECZA 2ZPFB 2LQ8A 2V8JA 2E10A 2DTOA 4QVCA 1QWFA 3DLMA 1C0MA 1OYXA 3BDLA 2COWA 5C0MA 3VS1A 4OVAA 3L2WA 3QWYA 4JJNK 2OTJA 1AWOA 1MUZA 4RTXA 2D8JA 3BFMA 4GLMA 4KULA 3OS1A 3CCEQ 2DM1A 5GJWB 3CMET 4M7DB 1VQPA 3V7RA 1OZ3A 3EH1A 4IUTA 2JXBA 2D0NA 2Y4YA 2J7IA 2VGNA 5ECAA 4KH0B 5AT1B 5GAN5 3VS6A 4IURA 4J9BA 4QQ6A 2AKLA 5I11A 3QUIA 4M75D 4C0DB 1UTIA 1HJDA 1RLQC 3FEOA 4QVZA 4HVWA 4JJBA 3M55A 3CD6T 1TWBA 4E2FB 1MV0B 5GANd 4M4ZA 4KGZB 1M2VA 2VXEA 3I5SA 2LZ6B 4F7UA 3RBBB 2E5QA 1WXUA 3OYKA 1Y96B 2A3LA 2KQWA 2QA4T 1SHFA 2QEXQ 3CPWP 4JPBW 4L59A 1M5Q1 4MZPA 2X9HA 4HA8A 1WHKA 1N9SA 3EGDA 2Y90A 1RI0A 2O2OA 3CMAQ 2M16A 3HPWA 5GMKj 3CCLA 4MDXA 2VYTA 2ZZDA 1D3BA 4JUVA 3CC2T 3PGGA 4AFQC 2YXYA 2M9UA 4EMKC 5KE3A 5M9OA 5GANg 1YBYA 5IN1A 4QQDA 1VQMT 3JCMP 2KY9A 1K76A 2M02A 2O88A 2WSCE 3G71Q 1IZ6A 2KAFA 2HKQB 2WSFE 1PD0A 2M1HA 5GMKe 3EG0A 1M1FA 4M7AA 5GMKl 4FYWB 3OYIA 2HQHA 3OMCA 5D7UA 2EKHA 2JVVA 4ZTFA 4IUVA 2BTTA 3D7SB 4JS5A 1CKBA 2JN0A 2E4HA 3M58A 4M78C 2DXUA 5IXFA 2K4YA 4O5VA 3GLXA 5GAN8 1G83A 1O9SA 2DETA 1KFZA 2CZ7B 1YI2Q 3A1PA 1BCOA 2ESWA 2LC4A 3M53A 2BZXA 3C4SA 4D6WA 2ZCFB 1SRMA 3C12A 1MNEA 1YIJA 5GMKi 1NG2A 2HEQA 1VQ9Q 5J26A 3I56Q 1KK7A 1JU5C 3CCUT 2MMPA 2CZ1B 2O4XB 1IRXA 4KUDK 3X26B 2GQIA 1TUDA 3CPFA 3ZBDA 3JB9I 1G3SA 5GANh 3A8MB 3NTHA 2H3EB 4M77C 4HCKA 3OBWA 3PIPA 2JUFA 3I55T 4KH1B 2ROLA 1YITA 1PRMC 4LDXA 1XOVA 1J3TA 1ABQA 4KT0E 2DYIA 4J9CA 5L23A 2RHZA 3CBMA 4RKUE 4C0ZA 3OS5A 1T3LA 4B6MA 2V26A 3MP8A 1ZUKA 2OAUA 2RJCA 3OYJA 1D1AA 3SHWA 2KNBB 3S6WA 1KD1R 4JRPA 1D0ZA 2HMAA 3PFSA 1TUGB 3SFMA 3CC4T 1UECA 2LQKA 5CQXA 1Q81R 4NOYA 2QQSA 1YJNA 3CCJQ 5FRNA 3RERA 1YP5A 1G3YA 1PM3A 3FJPA 1YJ9Q 2JOYA
chains in the Genus database with same CATH topology
2HKQB 1WHGA 3RDVA 4B6MA 2E3HA 1TXQA 2COZA 1WHMA 1WHLA 2CP7A 1IXDA 1TOVA 2COWA 1LPLA 2CP5A 3E2UA 2CP6A 2MPXC 2HQHA 2CP2A 3TQ7P 2Z0WA 2CP3A 2HL3A 2COYA 1WHHA 2HL5C 2HKNA 2QK0A 2M02A 2E4HA 2E3IA 1WHKA 2CP0A 1WHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKQ B;  1WHG A;  3RDV A;  4B6M A;  2E3H A;  1TXQ A;  2COZ A;  1WHM A;  1WHL A;  2CP7 A;  1IXD A;  1TOV A;  2COW A;  1LPL A;  2CP5 A;  3E2U A;  2CP6 A;  2MPX C;  2HQH A;  2CP2 A;  3TQ7 P;  2Z0W A;  2CP3 A;  2HL3 A;  2COY A;  1WHH A;  2HL5 C;  2HKN A;  2QK0 A;  2M02 A;  2E4H A;  2E3I A;  1WHK A;  2CP0 A;  1WHJ A; 
#chains in the Genus database with same CATH topology
 1M1G A;  3KFV A;  2CT4 A;  1G2B A;  3P8B B;  4LUE A;  3L2R A;  2EIF A;  3CCM Q;  2L2P A;  4FSX A;  1VYV A;  3VS5 A;  2CUB A;  3DLL A;  1W70 A;  3SB2 A;  4XU3 A;  1OEB A;  3VYG A;  3NFC A;  3VS7 A;  1LNX A;  3GNG A;  1KC8 U;  4J5Y A;  4OML A;  1K8A C;  3RDV A;  1SPK A;  3SDZ A;  3VRY A;  3VS0 A;  1AWW A;  2EGA A;  2LX7 A;  3X28 B;  3VS2 A;  4EDU A;  4DA4 A;  3LGL A;  1BYM A;  5GAN 3;  2KI7 A;  4II1 A;  4JRK A;  5CVI A;  1RUW A;  2BZY A;  3MKD A;  3NHN A;  1KG1 A;  3BE3 A;  2EQM A;  2YLC A;  3JB9 G;  4M7D A;  4BI3 A;  1IGU A;  1D0X A;  1NEB A;  4X9D A;  4FYX B;  3G7Z A;  5GMK m;  1ZA2 B;  1JXM A;  2VC8 A;  3QZ5 B;  1FXX A;  4M78 E;  2CS7 A;  1WFW A;  2DL4 A;  1Z9Z A;  1WHH A;  5CKE A;  1H8K A;  3VS3 A;  2MAM A;  3BDU A;  3CC7 T;  1KQS P;  4M78 G;  4L5G A;  3HKS A;  1WJS A;  1ZQ1 A;  4N4H A;  4R0K A;  2CZ0 B;  4K11 A;  1MND A;  1NJI C;  2JS2 A;  4J83 A;  3HSB A;  2D0Q B;  1VQ5 Q;  3VV0 A;  1N8R R;  3H0H A;  3JB9 H;  1WIE A;  4OB3 B;  5FRM A;  4M77 E;  2MIO A;  3OYN A;  1QCF A;  4LD9 K;  3E9G A;  3QHS A;  2PVD B;  1X75 C;  1FMV A;  4FM4 B;  1BU1 A;  1WDX A;  4M77 G;  2ZPI B;  3CCS T;  1K4U S;  2DPP B;  1YWO A;  2DIQ A;  1Q86 U;  3RKW A;  2R58 A;  4AG2 C;  2FO0 A;  4EIK A;  1M8M A;  3PNW C;  3UDC A;  1I0C A;  2E5K A;  3EH2 A;  4PJO B;  4PL6 A;  1BI0 A;  2DTH A;  2XMF A;  1FWZ A;  2ZPH B;  3INZ A;  3CCR A;  3PVL A;  1UEB A;  4JLG A;  3SWN C;  3IQL A;  2YRD A;  4C8Q B;  2P0Q A;  1RAG B;  1ZSZ A;  4C92 F;  4PFZ A;  5GAO n;  1UHF A;  2PUK B;  2KT1 A;  2MF2 A;  2I0N A;  2IVW A;  2CH4 A;  1BI2 A;  1YN8 A;  4A63 B;  3H0F A;  4A4H A;  1TOV A;  3FJ5 A;  3H41 A;  4C5H A;  3TVT A;  1MMG A;  3CD6 Q;  3G4S T;  2HSE B;  3M57 A;  2XIC A;  2RJE A;  1HXD A;  3FRN A;  1M3C A;  3CCE A;  1QKW A;  3EFS A;  4XTX A;  3JRZ A;  1M90 C;  1I1J A;  2DYB A;  1CSK A;  1V76 A;  1EZZ B;  2RQT A;  1WHJ A;  4BD3 A;  3OYC A;  1WQ7 A;  2HQX A;  4M7D C;  2D9T A;  3JB9 J;  5GAN 2;  5I21 A;  2HAX A;  2LTO A;  4Y92 A;  2JMC A;  2X3W D;  1Q82 C;  4E7Z A;  1AHJ B;  2LQN A;  4HT9 A;  1B34 B;  4A54 A;  4C0D C;  4RTV A;  1BB9 A;  2CP0 A;  1EFN A;  1WNL A;  8AT1 B;  2Y4X A;  1KD1 U;  2HBP A;  1MV3 A;  2YUN A;  4GLK A;  1VQM Q;  2XDB A;  2KEA A;  3QYG B;  4ME7 A;  1Y57 A;  1OPK A;  2MI6 A;  1Q81 U;  3CCJ T;  2QEX A;  1TH7 A;  3M0Q A;  1HK9 A;  2COY A;  2RHX A;  1G3T A;  5CIU A;  3HP9 A;  3CMA A;  1OI1 A;  2DX1 A;  4PFO A;  2J6K A;  2LP5 A;  3AT1 B;  2QQ9 A;  1WQW A;  4F17 A;  3URG A;  1Y71 A;  1KHC A;  4OMQ A;  3CCQ T;  2E3H A;  1QMC A;  2GTO A;  2LRQ A;  3M0U A;  3G6E T;  1WZO A;  3HTR A;  3C0C A;  3EHR A;  1NYF A;  2QI2 A;  2X51 A;  3G71 A;  3NGP A;  2DRK A;  3EG1 A;  4B9W A;  4E6R A;  3J80 E;  2YUQ A;  3EHQ A;  1OX9 A;  3RIR A;  1VQN T;  1QP2 A;  1W2B S;  3C94 A;  3JCM Q;  1ZHI A;  3MP1 A;  3CCU Q;  4FT2 A;  1R0B G;  1VQ7 T;  1QLY A;  1P92 A;  2P84 A;  3H6Z A;  2BE9 B;  2YLB A;  1XNI A;  1AD5 A;  4JRI A;  5KYX A;  2GQV A;  3I55 Q;  1BBZ A;  3OMG A;  1ZUU A;  2QTX A;  5KCH A;  4M7A D;  2YWW A;  1NLO C;  4DOW A;  1UFF A;  1YI2 A;  2L8D A;  3QSU A;  2L0A A;  1M1K U;  2RO0 A;  1VQ9 A;  3I56 A;  4GBQ A;  2B86 A;  2FZG B;  4PJL A;  3T9N A;  1LJO A;  2DTI A;  1MMD A;  2MYS A;  3FDR A;  2DIL A;  4ZGD B;  2K79 A;  2DE0 X;  5LJ3 d;  3PMI A;  2F2X A;  4A4K A;  3A5Z B;  3CC4 Q;  2F1L A;  3HRT A;  2GNC A;  3RMS A;  3TSW A;  4WTO B;  3V7C A;  2BUD A;  1SSF A;  2M0O A;  3M54 A;  3VUZ A;  4M78 A;  4QQG A;  1BKB A;  1C1A A;  1Y07 A;  3JAM E;  4M7D E;  1VQL T;  5IT9 E;  1V29 B;  2VVK A;  5FU6 B;  5IHK A;  1QVF A;  1IHV A;  4L6V 5;  1RAE B;  2CH4 W;  2LJ1 A;  3S3O A;  2K5I A;  4DBH A;  1QVF S;  2JTM A;  1VQK T;  1QKX A;  2WAC A;  3L2V A;  2DXC A;  4M75 B;  4BAC A;  5IHN A;  5CKD A;  3OYD A;  1KC8 R;  4M7D G;  5LJ3 g;  2EYY A;  1H64 1;  5DM7 R;  1NE8 A;  2LCS A;  1YJ9 A;  1X69 A;  1HD3 A;  1ACM B;  4PJO A;  1YJW A;  3CCM A;  4M77 A;  2DLP A;  4A53 A;  3M5A A;  4C92 B;  5FWC A;  4J9E A;  1C6V X;  3FB9 A;  1U06 A;  2F5K A;  2K3X A;  3TEE A;  3HFN A;  4C8Q A;  3OSS C;  3VU3 C;  2FRW A;  2I2L A;  3PVQ A;  2LT1 A;  3P8H A;  2R5M A;  3OYB A;  3MP6 A;  3S3N A;  1YHQ A;  4RTU A;  5KH6 A;  2SRC A;  1G5V A;  4DBR A;  3CEY A;  2VXF A;  3RNJ A;  5LJ3 j;  3MEA A;  1H3Z A;  4C92 D;  2X4Y A;  3CC7 Q;  1YCS B;  4ATO A;  4EMH A;  4C0F A;  2L89 A;  5KYW B;  2ZPG B;  5IAY A;  1HSQ A;  3NTI A;  4BDY A;  1LVK A;  2EQU A;  3GOX A;  2XI9 A;  5LJ3 h;  4XU1 A;  1OOT A;  5CK9 A;  3KBG A;  4LDW A;  2K9G A;  2XID A;  3JB9 F;  4J7F A;  5KYY A;  4LDU A;  4HCZ A;  3QDF A;  1IO6 A;  2LCC A;  4QW2 A;  5GAO l;  5IHI A;  3CCS Q;  1NPR A;  2OTL T;  1OU8 A;  1T0J A;  2E6Z A;  3EG9 B;  1VQO T;  2JM9 A;  1Q86 R;  3PIO A;  2J6F A;  1VQ5 A;  2DKG A;  1VYU A;  3WVD B;  4OMO A;  2RF0 A;  3KXT A;  1K8A R;  4HKE A;  2BKD N;  2ZGW A;  4JZ3 A;  1H3H A;  3DB4 A;  4HXJ A;  1AWX A;  2LJ0 A;  5HCK A;  4FCY A;  3JSC A;  2CSQ A;  4BDZ A;  1QP3 A;  1RAI B;  1GRI A;  2AZV A;  1QW1 A;  2FYK A;  2K57 A;  3X20 B;  2DD5 A;  3MO8 A;  2DEQ A;  2OAW A;  1M3A A;  5GAN j;  1AOJ A;  1BI3 A;  1ZA1 B;  2L3R A;  3HRU A;  4PJM A;  4E7S A;  2Z0W A;  1U1S A;  4FU6 A;  1X6O A;  3G4S Q;  2C0T A;  2VKN A;  2KXD A;  1PD1 A;  3M0P A;  2XKO C;  2PZ1 A;  2QK0 A;  2W10 A;  2NUT A;  2L3S A;  4PLL A;  3UPU A;  1PC0 A;  3REA B;  1N27 A;  1UGP B;  3CME A;  2YRC A;  4ZGJ B;  2AZS A;  3GIB A;  2F69 A;  2HBW A;  4EMG A;  5CAI A;  5GAN e;  4PJO C;  4VUB A;  2VV5 A;  2QDY B;  4Y28 E;  3EGX B;  4KRT A;  2DFU A;  2CDT A;  5GAN f;  3OA6 A;  4PLI A;  1NJI R;  2IG0 A;  4C8Q C;  4BUG A;  2EYW A;  2O01 E;  3CD6 A;  3LX7 A;  1NLP C;  5GAN 6;  3UT1 A;  1M3B A;  3QO3 A;  4AFZ C;  2DAQ A;  4FYV B;  3UA7 A;  1ZLM A;  3CXC A;  2JTF A;  3REB B;  2FB7 A;  4QT7 A;  4E7K A;  3CXC S;  1E7O A;  3VUB A;  2HL5 C;  2QA4 A;  4F7U F;  1RAC B;  4UC4 A;  1I5O B;  1G8X A;  2P4R A;  3VJP A;  4HVU A;  2DA9 A;  4IIM A;  4D8K A;  1N6A A;  2HNI A;  3SWN A;  2KRO A;  1I4K 1;  1WI7 A;  3QZ9 B;  2FPF A;  1GCP A;  3CC2 A;  1GL5 A;  3CCQ Q;  2AK5 A;  1XJW B;  1DJ7 B;  1SHG A;  3O8V A;  4A4G A;  4E7I A;  2NUP B;  4CC7 A;  3G6E Q;  2V1R A;  2E65 A;  3EFR A;  3PE0 A;  1VQM A;  4BY6 C;  4M75 A;  2IPO B;  2KK4 A;  3M56 A;  3PT9 A;  4KBM B;  4QKU A;  1TUC A;  4ZTJ A;  3UF4 A;  3QJ6 A;  1VQN Q;  4KGV B;  2RQU A;  1K73 C;  1JJ2 A;  4M7A F;  3FIF A;  5DY9 A;  5GAO m;  1X01 A;  4RCB A;  1Q7Y R;  1JJ2 S;  1VQ7 Q;  2QQB A;  3M0T A;  4OP0 A;  1B07 A;  2EQI A;  2K2M A;  1M90 R;  1AZE A;  1MGQ A;  2COZ A;  2RI2 A;  1UE9 A;  2FZK B;  1JEG A;  1ZSG A;  2EW3 A;  3GP8 A;  3EFO B;  2ZPB B;  3ASK A;  3R6N A;  2VWF A;  1TG0 A;  5KYU B;  5KCO A;  1X43 A;  3L2Q A;  2B8A A;  1M1K R;  2E12 A;  2K3B A;  3QBY A;  1NEG A;  3ER0 A;  3HRS A;  1Q82 R;  3OSV A;  3CCU A;  1WXB A;  5FU7 C;  2KRN A;  2WSE E;  4CC2 A;  4PKC C;  2K7A A;  5KYW A;  4EMK B;  1Y96 A;  5GAN 4;  4DEY A;  3I55 A;  4NL2 A;  3CCV T;  1VQ6 A;  4RTT A;  3QDR B;  2KVQ G;  1WJQ A;  1UJ0 A;  1VQ8 T;  2ABL A;  3OYF A;  1IGQ A;  4PJO E;  3H9N A;  2X35 A;  2EBP A;  1ZBJ A;  1VUB A;  2GBQ A;  4MZT A;  4LE9 A;  4OGC A;  2O9V A;  2KR3 A;  2GFU A;  3MCA B;  2JM8 A;  1VQL Q;  2EYZ A;  1IXD A;  1FMW A;  3QXE B;  1OU9 A;  4C8Q E;  2E70 A;  1UGS B;  4PJO G;  1RAD B;  1MMA A;  5FRO A;  4XU0 A;  4MDW A;  1VQK Q;  1G3W A;  3CC4 A;  2XDD A;  2LDM A;  3JB9 D;  1YCY A;  1EIF A;  4N0A C;  5D6X A;  2D6F A;  2PTK A;  2XD0 A;  5CQY A;  4C8Q G;  5FLX E;  2NYS A;  1RLP C;  1K8A U;  1RAB B;  3LH0 A;  2QG9 B;  3FC3 A;  1FX7 A;  1Q81 C;  2ED0 A;  1GFD A;  1S72 T;  2RA2 A;  2XG8 D;  4X9C A;  4XTW A;  2ENM A;  2EQJ A;  1H92 A;  2GGR A;  1ZBX A;  4BI4 A;  3M4Y A;  3X25 B;  2RMO A;  2ROT A;  3EAE A;  3TSZ A;  2DBM A;  1JO8 A;  1S1N A;  3JCM c;  5FU6 C;  5CR2 A;  3VYH B;  2PU9 B;  1B3Q A;  1U5S A;  5DLO A;  4XK8 E;  5GAM d;  2EGE A;  4M75 C;  1VIE A;  1PCX A;  2HL3 A;  2EJ9 A;  2O4X A;  1QVF P;  2XU8 A;  4AT1 B;  2DL7 A;  2HZY A;  3C95 A;  4M7D F;  1GCQ A;  3MJX A;  4C92 C;  1VQ4 T;  2NUZ A;  2CKK A;  1E6H A;  2K5F A;  1NJI U;  2V8K A;  3OYM A;  1KSW A;  1M2V B;  2RD1 A;  4OMM A;  1N5Z A;  2RK1 A;  1X27 A;  1K9M C;  6AT1 B;  4F7U B;  3JCM X;  2QQA A;  5CO7 A;  3S3M A;  5GAM g;  1UUE A;  2JZ2 A;  1Z9Q A;  1AVZ C;  2X4W A;  1ARK A;  9ATC B;  3CC7 A;  4KUI A;  2JJ9 A;  3H8Z A;  2CSI A;  2RI5 A;  1K1Z A;  3E1S A;  1PSF A;  7AT1 B;  1IB8 A;  4LDV A;  4PK4 A;  3EGD B;  2OTL Q;  4CC4 B;  3M0R A;  4B9X A;  2JS0 A;  1VQO Q;  4DBQ A;  2JTE A;  2DL5 A;  4OGE A;  4RUG A;  4R55 A;  1D3B B;  2V1Q A;  3JCM d;  3MEV A;  3QWX X;  2DVE A;  1YNZ A;  1N8R C;  1W6X A;  3P8D A;  1KJW A;  1X2Q A;  2CP5 A;  2PNI A;  4D8D A;  2OTJ T;  1XQH A;  4X34 A;  5GAM j;  3CCS A;  3V8K A;  4M7A B;  3JCM W;  2EQK A;  3DB3 A;  2QAS A;  1W2B A;  1SF9 A;  4C0G A;  4ORZ A;  4RG8 A;  1VQP T;  2A08 A;  2DO3 A;  4AFS C;  2VGM A;  3JCM V;  1VYT A;  3JCM g;  2ATC B;  1UG1 A;  1RAA B;  4DEX A;  4DQ2 A;  2GFA A;  1Q7Y U;  2CP6 A;  2EWN A;  2GCX A;  2AHJ B;  5GAM e;  5GAM h;  2GF7 A;  1SSH A;  5LJ5 d;  1UDL A;  4AMC A;  1M90 U;  1EX4 A;  2KMT A;  2PVO B;  4ELZ C;  4CC3 A;  1Q95 G;  1W4S A;  4BE2 A;  1NZ9 A;  4J9G A;  2QYZ A;  3V7S A;  2G6F X;  2KGT A;  4PJJ A;  3RKX A;  3G4S A;  2GTJ A;  1QWE A;  1OUL A;  3OQ5 A;  2R5A A;  1Q82 U;  4FIB A;  4XTY A;  1QQJ A;  1D0Y A;  1VIF A;  2FL7 A;  4IIO A;  2KE9 A;  2LCL A;  2HDA A;  4M75 E;  4XTU A;  2DIG A;  4C5I A;  3CCL T;  5LJ5 g;  4IKF A;  1OV3 A;  2RPN A;  2YT6 A;  2KBT A;  3WXM B;  2A28 A;  4E47 A;  1WX6 A;  2KRM A;  3QJY A;  2A7Y A;  3QII A;  1GCQ C;  1N9R A;  2ED1 A;  4M75 G;  4C92 E;  2BE7 D;  2DZ9 A;  1Y0M A;  2RB6 A;  2E41 A;  2RK2 A;  3NMZ C;  3RUX A;  1E6G A;  2K6D A;  2E64 A;  3JCM h;  3O5Z A;  2RJD A;  2M51 A;  3F70 A;  3RMQ A;  3HL8 A;  4Z02 A;  4JS4 A;  1TSF A;  4J6X A;  4F14 A;  4C92 G;  2X3X D;  2LVM A;  5FW9 A;  2D8H A;  2YSQ A;  2XK0 A;  4JJC A;  3CCJ A;  2MCN A;  3TQ7 P;  1WYX A;  1PSE A;  2RJF A;  3CCR Q;  3LW5 E;  4GY5 A;  2CT3 A;  5LJ5 j;  2C06 A;  1NBE B;  2EPD A;  4MZM A;  2KYM A;  3J81 E;  3CCQ A;  1U3O A;  2DEU A;  4LUD A;  2J05 A;  1CKA A;  3CXC P;  4A4E A;  5CKH A;  8ATC B;  1WGS A;  3G6E A;  4BE1 A;  5EC7 A;  4DOV A;  4E7J A;  1AT1 B;  5CKB A;  1R8O B;  4KGX B;  4XTZ A;  5KYN A;  5GAO q;  3CQT A;  4RTY A;  3GF5 A;  1YIJ T;  3SD4 A;  4JLI A;  5LJ5 h;  5LJ5 e;  5CKF A;  4E7H A;  4CRI A;  1OQK A;  2EFI A;  2FZC B;  1VQN A;  4YTL A;  1OX8 A;  1O75 A;  1M2O A;  1A0N B;  3GNF B;  4FW1 A;  3NPF A;  5LJ5 f;  1QCN A;  1Y7X A;  4JRQ A;  2DF6 A;  2MOX A;  2DRM A;  2KRS A;  1YIT T;  2C0O A;  1YFN A;  2KT8 A;  2YDL A;  3AHU A;  1VQ7 A;  1BCM A;  4MML A;  1FMK A;  2QAZ A;  1MHN A;  1LCK A;  3A8H B;  3CCV Q;  4PJN A;  4OB0 B;  4HT8 A;  2RHY A;  5LJ3 e;  3EGU A;  5HK3 A;  1VQ8 Q;  4BE0 A;  4ZNX A;  2HD0 A;  2VAS A;  4M7D D;  2JNG A;  1JJ2 P;  3OB9 A;  5LJ3 f;  1B34 A;  2F2V A;  3M0S A;  5LL6 S;  1GFC A;  2H8H A;  1YJN T;  3QYH B;  4JJD A;  2ZAE A;  1PKS A;  2EAY A;  2RHI A;  4JDS A;  4LDY A;  5I2M A;  5D6W A;  1MMN A;  3EG3 A;  1IHW A;  4MMK A;  2F2W A;  5HK0 A;  1VA7 A;  1OPL A;  2LNH B;  4ESR A;  4AFU C;  3RKY A;  3LWI A;  1QVG A;  4Z8A A;  1S72 Q;  4ELY C;  2QGG A;  4M78 F;  5D6Y A;  3MEU A;  1VQL A;  4Z89 A;  4IUP A;  1K73 R;  2AT1 B;  1M27 C;  1OZ2 A;  1QVG S;  1WPY A;  5AYF A;  4Y91 A;  2IIM A;  1PRL C;  3ZL7 C;  2DZC A;  5GMK h;  1JB0 E;  3X24 B;  4J9I A;  1VQK A;  2QXF A;  2RHU A;  1WLP B;  4BB7 A;  3V8L A;  1QCO A;  3CBP A;  2DL8 A;  1UGV A;  1PWT A;  1T0H A;  3TRE A;  4J6W A;  1I81 A;  4IUQ A;  1UJY A;  2QTV A;  1FYN A;  3OW2 A;  4O6J A;  2RNA A;  1KC8 C;  4PNO A;  4DBF A;  4PJO F;  5A0D A;  4M77 F;  3OW2 S;  1ZSZ B;  5C6S A;  2ZPE B;  2RM4 A;  3U23 A;  3LGF A;  3MET A;  2DL3 A;  5CCA A;  1NYG A;  2CP3 A;  4C8Q F;  1VQ4 Q;  3LLR A;  3JCM b;  4FL6 A;  1AZG B;  1D1B A;  3JCM J;  4TVR A;  4HVV A;  1VQ6 T;  2EYQ A;  3E2U A;  4N0A A;  2V8I A;  1I07 A;  5GAN 7;  2R57 A;  2A37 A;  2EKO A;  2EGC A;  3CBO A;  1BK2 A;  2E1H A;  4PFP A;  2MWO A;  4OB1 B;  2CUD A;  3PMT A;  2FG0 A;  1K9A A;  2O9S A;  2DMO A;  3UA6 A;  2JMA A;  3VS4 A;  1PKT A;  1LOJ A;  1LPL A;  3GPL A;  3TU4 K;  3ULR B;  1I8F A;  3UWN A;  4A4F A;  3EG2 A;  4C5G A;  1KIK A;  3OY9 A;  2AIR B;  4X1V A;  2OTJ Q;  1ABO A;  1TTH B;  2P0P A;  2OTL A;  4XU2 A;  3BW1 A;  1VQO A;  2RQR A;  1YJW Q;  3WVE B;  5J39 A;  3V8J A;  3CCR T;  2CZ6 B;  1VQP Q;  2RI3 A;  1WA7 A;  1Q86 C;  4BI8 B;  4C92 A;  1YHQ Q;  3L2U A;  3A8G B;  2LMJ A;  3CPW A;  2DXB A;  4HCC A;  4JZ4 A;  3KUF A;  1TXQ A;  2KDS A;  3CPW S;  3E19 A;  3I5R A;  5A2Q E;  4F04 B;  4RTW A;  3J7A F;  1WJR A;  1SG5 A;  3CCE T;  2MPX C;  4N4G A;  3A8L B;  2C0I A;  4J6Y A;  4ZGE B;  1GBQ A;  2JT4 A;  1PHT A;  4M7A C;  1U8R A;  5KYX B;  1K9M R;  3DKM A;  2EJG A;  3UAT A;  1X6B A;  3FLG A;  3R6O A;  1WXT A;  4C5E A;  3Q1J A;  3I9Q A;  3HFO A;  3CCL Q;  2CP2 A;  2DBK A;  2LQW A;  4LN2 A;  3LWH A;  1JRI A;  1W2B P;  1UGR B;  1YWP A;  3TCJ A;  3H0I A;  2PVG B;  4J8O A;  1U1T A;  2KSS A;  1WHM A;  2DJZ A;  3L42 A;  4LXC A;  1PG5 B;  1NM7 A;  2QEX T;  4Z88 A;  1JBM A;  3M4G A;  4AG1 C;  4FW2 A;  1QVP A;  3EG9 A;  2FPD A;  2L3P A;  3CMA T;  2K2V A;  2M0Y A;  2OX7 A;  1RAF B;  2BIV A;  3HHT B;  4M78 B;  2NWM A;  2VB6 A;  1KD1 C;  2LNV A;  4OMF B;  4P5N A;  3OYH A;  1D09 B;  3OYY A;  3OS0 A;  1PNJ A;  2J6O A;  5A0L A;  2XHC A;  2K3Y A;  3G71 T;  1K73 U;  1TS9 A;  3L2Z A;  2AKK A;  1I5L A;  2L5Q A;  2QDL A;  1JQQ A;  1BIB A;  4NL3 A;  4EPC A;  2RQV A;  4IUU A;  1WHG A;  1YIJ Q;  1NPP A;  3M9Q A;  4M77 B;  1GXI E;  4M78 D;  4M75 F;  2CP7 A;  3OYA A;  3CME Q;  3MPU B;  1HYO A;  4J9F A;  4F7U E;  3A98 A;  2F5T X;  2FEI A;  1ZUY A;  2LJ3 A;  2FPE A;  2J06 A;  4RG2 A;  1KQ2 A;  4ANJ A;  2YUP A;  2FVU A;  1YIT Q;  3OS2 A;  4WF2 A;  2VUB A;  4NS5 A;  4F16 A;  1YI2 T;  4F7U G;  1F1B B;  1RI9 A;  2OJ2 A;  3EGX A;  4RTZ A;  5DLQ E;  1Q7Y C;  3N5B B;  4CI0 C;  2HCK A;  1VQ9 T;  3I56 T;  5IXB A;  4PJO D;  3QG1 A;  2RH2 A;  5KE2 A;  4M77 D;  3LH5 A;  2L3Q A;  2DK3 A;  1UB4 A;  2HQE A;  5GAO p;  1M9S A;  2YUO A;  3A8O B;  2SEM A;  2DXT A;  3QPH A;  4FT4 A;  4C8Q D;  2QA4 Q;  5EG2 A;  3GBQ A;  1YJN Q;  1KHI A;  4E7L A;  3VRZ A;  2KXC A;  1SRL A;  1IRE B;  1M4Z A;  4M7A E;  1W1F A;  1KQ1 A;  1M1K C;  4QVD A;  3CCV A;  4J9H A;  2FHD A;  4HCB A;  4XTV A;  1GBR A;  2X4J A;  4BY6 B;  5KYY B;  3CC2 Q;  1VQ8 A;  4RCC A;  3NTK A;  4OB2 B;  4R56 A;  3OYG A;  2YRV A;  4M7A G;  2A0F B;  3ME9 A;  4OF1 A;  1R77 A;  3ZEH A;  3VKI A;  1SKU B;  2EVR A;  2BZ8 A;  4N4I A;  4OMP A;  2NUP A;  3SEM A;  2CYZ B;  3MHX A;  2E6N A;  3G1J A;  5FWB A;  5IH2 A;  1T3S A;  2G3R A;  1YJ9 T;  2DJQ A;  5J3B A;  4LD6 A;  1YJW T;  2XDP A;  2EJF A;  3CCM T;  2FRY A;  4J9D A;  3I35 A;  5I2S A;  2D1X A;  2K5L A;  2DER A;  2CRE A;  1KQS A;  1M30 A;  1RAH B;  4Q5W A;  1K0X A;  1S72 A;  1KQS S;  1YHQ T;  2MK5 A;  5HKC A;  4RMO A;  2A36 A;  3THK A;  3OYL A;  4FSS A;  1XTD A;  5FU7 B;  1R0C B;  3M59 A;  1AEY A;  4XAX B;  5GAM f;  5L8R E;  3LYI A;  1BIA A;  5GJV B;  3EFO A;  5I22 A;  2CGH A;  5GAO r;  1JXO A;  2NUT B;  1BI1 A;  3PTA A;  1V1C A;  4XQ3 A;  2RN8 A;  3OBY A;  5KYU A;  1ZX6 A;  1SEM A;  2DNU A;  4J7I A;  3RES A;  1TU0 B;  3RR6 A;  5HY6 A;  3ZFJ A;  4OMN A;  2DVJ A;  1QVG P;  1UHC A;  2W0Z A;  1VQ6 Q;  2DD4 A;  1K9M U;  2P4T A;  1D1C A;  3OYE A;  1VOM A;  4WCI A;  1RL2 A;  2O31 A;  1B7T A;  4EMK A;  2QQR A;  2NLU A;  1WHL A;  2MWP A;  2EYX A;  1VQ4 A;  2OI3 A;  1AWJ A;  1ZSZ C;  2P0K A;  5A0G A;  2YHT A;  2LX9 A;  1K0S A;  2HKN A;  3OW2 P;  2LT4 A;  1UGQ B;  2E3I A;  1M8V A;  4FYY B;  2KYB A;  2X4X A;  2JW4 A;  3JV3 A;  3QKJ A;  4ZN1 A;  2QGF B;  3JCM e;  1X6G A;  3MEW A;  2H3J A;  1VQ5 T;  1X2K A;  4V2S A;  2RQW A;  1N8R U;  4LNP A;  2PUO B;  2PQW A;  3JCM f;  4ZN3 A;  3SWN B;  3BY7 A;  3L1A A;  2HSP A;  3E9F A;  2ECZ A;  2ZPF B;  2LQ8 A;  2V8J A;  2E10 A;  2DTO A;  4QVC A;  1QWF A;  3DLM A;  1C0M A;  1OYX A;  3BDL A;  2COW A;  5C0M A;  3VS1 A;  4OVA A;  3L2W A;  3QWY A;  4JJN K;  2OTJ A;  1AWO A;  1MUZ A;  4RTX A;  2D8J A;  3BFM A;  4GLM A;  4KUL A;  3OS1 A;  3CCE Q;  2DM1 A;  5GJW B;  3CME T;  4M7D B;  1VQP A;  3V7R A;  1OZ3 A;  3EH1 A;  4IUT A;  2JXB A;  2D0N A;  2Y4Y A;  2J7I A;  2VGN A;  5ECA A;  4KH0 B;  5AT1 B;  5GAN 5;  3VS6 A;  4IUR A;  4J9B A;  4QQ6 A;  2AKL A;  5I11 A;  3QUI A;  4M75 D;  4C0D B;  1UTI A;  1HJD A;  1RLQ C;  3FEO A;  4QVZ A;  4HVW A;  4JJB A;  3M55 A;  3CD6 T;  1TWB A;  4E2F B;  1MV0 B;  5GAN d;  4M4Z A;  4KGZ B;  1M2V A;  2VXE A;  3I5S A;  2LZ6 B;  4F7U A;  3RBB B;  2E5Q A;  1WXU A;  3OYK A;  1Y96 B;  2A3L A;  2KQW A;  2QA4 T;  1SHF A;  2QEX Q;  3CPW P;  4JPB W;  4L59 A;  1M5Q 1;  4MZP A;  2X9H A;  4HA8 A;  1WHK A;  1N9S A;  3EGD A;  2Y90 A;  1RI0 A;  2O2O A;  3CMA Q;  2M16 A;  3HPW A;  5GMK j;  3CCL A;  4MDX A;  2VYT A;  2ZZD A;  1D3B A;  4JUV A;  3CC2 T;  3PGG A;  4AFQ C;  2YXY A;  2M9U A;  4EMK C;  5KE3 A;  5M9O A;  5GAN g;  1YBY A;  5IN1 A;  4QQD A;  1VQM T;  3JCM P;  2KY9 A;  1K76 A;  2M02 A;  2O88 A;  2WSC E;  3G71 Q;  1IZ6 A;  2KAF A;  2HKQ B;  2WSF E;  1PD0 A;  2M1H A;  5GMK e;  3EG0 A;  1M1F A;  4M7A A;  5GMK l;  4FYW B;  3OYI A;  2HQH A;  3OMC A;  5D7U A;  2EKH A;  2JVV A;  4ZTF A;  4IUV A;  2BTT A;  3D7S B;  4JS5 A;  1CKB A;  2JN0 A;  2E4H A;  3M58 A;  4M78 C;  2DXU A;  5IXF A;  2K4Y A;  4O5V A;  3GLX A;  5GAN 8;  1G83 A;  1O9S A;  2DET A;  1KFZ A;  2CZ7 B;  1YI2 Q;  3A1P A;  1BCO A;  2ESW A;  2LC4 A;  3M53 A;  2BZX A;  3C4S A;  4D6W A;  2ZCF B;  1SRM A;  3C12 A;  1MNE A;  1YIJ A;  5GMK i;  1NG2 A;  2HEQ A;  1VQ9 Q;  5J26 A;  3I56 Q;  1KK7 A;  1JU5 C;  3CCU T;  2MMP A;  2CZ1 B;  2O4X B;  1IRX A;  4KUD K;  3X26 B;  2GQI A;  1TUD A;  3CPF A;  3ZBD A;  3JB9 I;  1G3S A;  5GAN h;  3A8M B;  3NTH A;  2H3E B;  4M77 C;  4HCK A;  3OBW A;  3PIP A;  2JUF A;  3I55 T;  4KH1 B;  2ROL A;  1YIT A;  1PRM C;  4LDX A;  1XOV A;  1J3T A;  1ABQ A;  4KT0 E;  2DYI A;  4J9C A;  5L23 A;  2RHZ A;  3CBM A;  4RKU E;  4C0Z A;  3OS5 A;  1T3L A;  4B6M A;  2V26 A;  3MP8 A;  1ZUK A;  2OAU A;  2RJC A;  3OYJ A;  1D1A A;  3SHW A;  2KNB B;  3S6W A;  1KD1 R;  4JRP A;  1D0Z A;  2HMA A;  3PFS A;  1TUG B;  3SFM A;  3CC4 T;  1UEC A;  2LQK A;  5CQX A;  1Q81 R;  4NOY A;  2QQS A;  1YJN A;  3CCJ Q;  5FRN A;  3RER A;  1YP5 A;  1G3Y A;  1PM3 A;  3FJP A;  1YJ9 Q;  2JOY A; 
#chains in the Genus database with same CATH homology
 2HKQ B;  1WHG A;  3RDV A;  4B6M A;  2E3H A;  1TXQ A;  2COZ A;  1WHM A;  1WHL A;  2CP7 A;  1IXD A;  1TOV A;  2COW A;  1LPL A;  2CP5 A;  3E2U A;  2CP6 A;  2MPX C;  2HQH A;  2CP2 A;  3TQ7 P;  2Z0W A;  2CP3 A;  2HL3 A;  2COY A;  1WHH A;  2HL5 C;  2HKN A;  2QK0 A;  2M02 A;  2E4H A;  2E3I A;  1WHK A;  2CP0 A;  1WHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...