2VXEA

Solution structure of the lsm domain of drosophila melanogaster tral (trailer hitch)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
88
structure length
88
Chain Sequence
GAMAMSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG10686-PA
publication title Similar Modes of Interaction Enable Trailer Hitch and Edc3 to Associate with Dcp1 and Me31B in Distinct Protein Complexes.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 10
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vxeA00
4C92G 3JCMf 3JB9I 2QTXA 4M75G 3V8JA 4EMKA 5GANh 5GAOr 1M5Q1 5GAN4 4M78E 4M7AC 5LJ3d 3SWNA 4M7DG 4M77D 5LJ3h 4Y91A 3JB9G 1U1TA 1WQWA 1I81A 3JCMQ 3RKYA 4F7UF 1YCYA 4XTYA 3PGGA 1LNXA 3BDUA 4JLIA 5GANg 3JCMJ 2YHTA 1N9RA 4M77G 4M7AB 4M77C 4PJOC 3JCMW 1KQ1A 2DEQA 3BFMA 4M78B 1KQ2A 4C8QD 2EJFA 2VXFA 2Y90A 3QSUA 3V7CA 4MMKA 5CAIA 2EAYA 3FB9A 2DVEA 3SWNB 5GAOp 3M4GA 4X9CA 2VXEA 2RM4A 1BIAA 3RUXA 4C8QC 3JB9H 5GMKm 4M7AA 3FJPA 1H641 3INZA 4JUVA 3HFOA 2E1HA 5DY9A 2RA2A 3V8KA 2DZ9A 2K57A 3V8LA 4C92C 5GANd 4M7AE 4M75C 3VU3C 5GAOm 5GMKe 4M7DC 2ZGWA 4JRKA 4J6WA 4OP0A 4PJOA 2FB7A 5GAMf 5LJ5f 3QUIA 5GAN2 1WQ7A 2JN0A 4X9DA 3AHUA 4M78F 1JBMA 4QVCA 3JCMV 4RCCA 1Y96B 2EJ9A 5GANf 4C8QA 5GMKh 2E41A 5GAOl 4XQ3A 5LJ3f 4A53A 2E10A 1HXDA 1WNLA 4M78D 4PNOA 4M77B 4NL3A 4PJOB 3RERA 4C92A 4F7UG 5LJ5j 2DJZA 3L2ZA 5GAMj 4HT9A 4M75A 4MMLA 4XU1A 1I5LA 3JCMe 4XTVA 3JCMX 3SB2A 4M7DA 4C92E 5GAOn 4M78G 1M8VA 1Y96A 2DXUA 3GIBA 5GMKi 2HNIA 5GANj 1U1SA 5GAN7 4XTUA 4C8QB 2DXTA 3HSBA 3EFRA 3QHSA 5LJ3j 3EFSA 5GAMe 5GAN3 1B34A 1I4K1 4M77A 2DTIA 2DTOA 4EMGA 1N9SA 3JCMh 4C92B 5GMKl 4M77E 4PJOE 4M75B 2RD1A 5GAN6 4HT8A 4M7AF 5GAN8 4N0AC 2E64A 3JB9J 4M7DB 2DZCA 5LJ3e 2DTHA 4XTXA 4NOYA 4DQ2A 4F7UE 3JCMg 5GAMh 4M7AD 1JRIA 4QVDA 2CGHA 4NL2A 3RKXA 4M77F 4J6YA 2EWNA 1B34B 4PJOF 4C8QE 2YLCA 3JCMP 4V2SA 3JCMc 3JCMb 4WF2A 2E65A 4M7AG 5I21A 1LOJA 5LJ5g 5GAMg 4PJOD 3V7SA 1D3BA 4M78C 4M75E 2FYKA 3RESA 5GAN5 3HFNA 3RKWA 1MGQA 4J6XA 3BW1A 1I8FA 3BY7A 4C8QF 4EMKC 4JRIA 4F7UB 4M7DE 4J5YA 2DKGA 3SWNC 5LJ5e 4XU3A 3L1AA 4N0AA 1TH7A 4PJOG 1X01A 1HK9A 3V7RA 2I2LA 5LJ3g 2VC8A 4XU0A 3JCMd 4C92F 3RIRA 1LJOA 4A54A 2EJGA 4M75F 4XTZA 4EMKB 4M7DF 5GANe 4XU2A 4RCBA 5GAOq 4EMHA 1WPYA 3JB9F 1D3BB 4C92D 3FIFA 2RB6A 5GMKj 5LJ5d 4C8QG 4M75D 4F7UA 5GAMd 5LJ5h 1BIBA 4M7DD 2YLBA 3QO3A 4HA8A 4XTWA 3JB9D 4M78A
chains in the Genus database with same CATH superfamily
1JJ2A 3A1PA 4J9IA 1ZUKA 3LX7A 2ATCB 3RKYA 5IT9E 1YCYA 3G4SQ 1ZQ1A 2OTJT 4J7IA 1WYXA 1GXIE 3I56T 4EPCA 3CC7T 2VKNA 5LL6S 3S3NA 1QVPA 2H3EB 2GTJA 5C6SA 2LQWA 2E1HA 2PVGB 1WX6A 4D8KA 2VV5A 1OYXA 1UGVA 3EGDB 2YUPA 2DLPA 5GAMf 4QQGA 4X9DA 2LDMA 4GLKA 1HYOA 2EPDA 5A0DA 1MNDA 1N8RU 2V8IA 2MOXA 4M77B 3MP6A 5LJ5j 2KRNA 1BYMA 5IHNA 1UE9A 3OYMA 2QEXA 2MF2A 3CCQA 3EH1A 1IB8A 5D6YA 4M7AF 1KD1C 2CP2A 1OX9A 4P5NA 2XK0A 3CCJQ 1G5VA 4XTXA 5C0MA 4M77F 4X34A 3JCMP 3EAEA 2RJCA 3LWIA 2E65A 5I21A 5D7UA 1VIFA 2HKNA 2QASA 4M78C 1YFNA 1M1KU 2NLUA 4KUIA 1S72T 4BE0A 1YIJA 4XTZA 3L2QA 2MAMA 5I11A 5GAOq 1WI7A 2CREA 2JM9A 2VWFA 2V1RA 3OYBA 5CIUA 3X28B 1VQ8T 3VS6A 3OW2P 1NLPC 1VQLA 1FMWA 1KG1A 4RTXA 2KGTA 1BU1A 1RACB 3PGGA 2RJEA 4ORZA 2RQUA 3BFMA 3H0FA 5FU7C 1VQPA 1VQ9Q 2DJQA 4MMKA 1LCKA 2LMJA 4MZMA 3LGLA 1YJWT 2DRMA 2QG9B 1XQHA 4AG1C 1M4ZA 1JQQA 4HCZA 4C0FA 4M7AE 2C0TA 3C95A 2HSPA 5FRNA 1ZA2B 5J26A 2FB7A 1K8AU 3PVQA 4JJNK 2K5FA 2VASA 2WSFE 4RTZA 4L59A 1A0NB 2MCNA 5CQXA 2DYIA 3OB9A 1HD3A 1IO6A 3M0SA 4II1A 2DJZA 1MHNA 5GAOn 2AHJB 2R5AA 1W70A 3EFOB 5CKEA 4AFUC 2DYBA 3CBPA 2A0FB 1QKWA 3VV0A 4E7IA 2QYZA 5CKBA 2Z0WA 1MNEA 1VQ7T 3KBGA 2DZCA 2KT1A 1NZ9A 3ULRB 2RQVA 4PLIA 5GAMh 1K0SA 4DOVA 2RN8A 1VQKT 3G4SA 2YRDA 5CKFA 4M7AG 1LOJA 3M4YA 3CCLQ 1K9MC 3V7SA 2DE0X 4M7DE 3OYHA 4F7UB 3OSSC 2RO0A 2KYMA 2GFUA 2DVJA 2XHCA 4RCBA 1NJIU 1B7TA 1G3WA 2RB6A 4FU6A 4M7DD 3MHXA 1EFNA 1KQSA 1K73C 3FC3A 1QCNA 1KIKA 2K3XA 2XDBA 3NMZC 1ZHIA 3HL8A 3LH0A 3JCMQ 4R56A 3OYAA 4F7UF 2B86A 4KGXB 1PD1A 5HK0A 2X4YA 1QQJA 3HHTB 2F1LA 1BCOA 3ZBDA 2GGRA 4B9XA 1YJNQ 2CP7A 2E3IA 4QQ6A 5DM7R 2L5QA 3EG9A 1OZ3A 1YP5A 2FPEA 3JSCA 3HFOA 1TG0A 3M54A 4QT7A 5GANd 3CCST 3OYYA 1C6VX 1RAEB 3CCJA 2QAZA 1TUGB 3QWYA 3ER0A 2ESWA 1QW1A 2MMPA 3OS2A 5GANf 3J80E 5LJ3f 1ZSZB 2E10A 2O01E 3RERA 3G6ET 1SEMA 1SPKA 4GBQA 3SB2A 4M7DA 1UECA 5FRMA 2DXUA 1QVGP 4ELZC 3VS3A 3H9NA 2K9GA 1QWEA 2DIQA 3QPHA 2BKDN 4LDWA 2MWPA 5DLOA 2YRVA 3M0TA 2EW3A 2C0OA 5IXFA 3E1SA 4C5IA 3HRTA 2DTHA 2CDTA 3CMEA 1TSFA 1N8RR 4NL2A 4OMNA 4ZNXA 2J6OA 2YLCA 4OMLA 2RHXA 1ABQA 3WVEB 3CXCS 1PHTA 2QA4T 4F16A 2CSIA 5FW9A 2KY9A 4QQDA 3CCRA 3BW1A 1R0CB 2E5KA 3A8MB 1R77A 1HK9A 2VC8A 1PNJA 3GOXA 3X25B 3MO8A 2X4XA 2ENMA 3PIPA 3JB9F 3CCMQ 1KK7A 2JM8A 1YWOA 4IKFA 1D1BA 1WHJA 1VQ4T 1UJYA 1MMAA 3GP8A 2CKKA 2J6FA 3CC4Q 2CZ7B 4E7JA 1CKAA 3PMTA 3VKIA 2EYYA 3JCMJ 1M1KR 3BDUA 2LZ6B 1GBRA 3REAB 3MEVA 1XOVA 2V26A 4J83A 2ZAEA 2C0IA 3ZL7C 1BIAA 3MEUA 3CBMA 1I0CA 5GMKm 3TSWA 3FJPA 4E2FB 1RI0A 1GFDA 2J6KA 1CKBA 1RAGB 3DB4A 5FLXE 2JZ2A 2ZGWA 2NUTA 1TTHB 2MPXC 3RBBB 3A8LB 1WHLA 2MI6A 4DEYA 1D1AA 4RCCA 2EJ9A 1O9SA 3CCLA 2LCCA 3CBOA 3P8HA 1PG5B 5KE2A 1UGRB 3R6NA 2IPOB 2FPDA 3CPWP 1QCOA 2ECZA 1M2VB 5CK9A 4WTOB 2P4TA 1QVFS 5I2MA 3JV3A 4EMGA 2CH4W 1WHMA 2NUZA 3JCMh 4C92B 5GMKl 1K8AR 1KFZA 4DA4A 3SD4A 3JB9J 2COZA 4F17A 2CT3A 2GQVA 2BTTA 2W0ZA 2QEXT 1D09B 4C8QE 3CCQT 2EVRA 1PRMC 2KXCA 4AFZC 2DK3A 1BBZA 1M8MA 1I1JA 2A3LA 3CCEQ 2D8HA 1NG2A 2M0YA 1YJNA 1Q7YR 4JRIA 2JS2A 4N0AA 2ZPHB 4A4FA 2OX7A 4OB0B 4C92F 3NGPA 1Q81C 1RI9A 5IAYA 5HCKA 2HEQA 5HKCA 5LJ5d 4IURA 1ZLMA 2ZZDA 1BIBA 4RMOA 3S3OA 4ZN3A 2P0KA 4JJDA 1NBEB 4N4IA 4OMMA 3OW2A 3E9GA 1YIJT 2LCLA 1BB9A 3JB9G 2JNGA 1ARKA 1JB0E 4RTVA 2QTVA 1RAHB 3REBB 4RTWA 1K9AA 2Y4XA 4YTLA 1VQLT 4CRIA 1NJIR 1IREB 2O31A 2F2XA 5CKHA 1AOJA 1VQPT 1X2KA 4QVZA 2QXFA 4OP0A 2L8DA 5EG2A 2XD0A 4PFOA 1AZGB 1WQ7A 5GJWB 4OGCA 2LC4A 2K2MA 4C8QA 4IUVA 1PKTA 1VYUA 2OAUA 5GAOl 1KQSS 1OZ2A 2NYSA 2C06A 2K4YA 1FMVA 1NM7A 2RHUA 3IQLA 2KAFA 1KJWA 4C92E 1N6AA 2X4JA 1HSQA 2PQWA 1U1SA 1PSEA 5GAN7 2X51A 2DTOA 5ECAA 2ROLA 4PJOE 2RD1A 1WGSA 5KCOA 1IGQA 2HL5C 4KGVB 3QJYA 3HPWA 3I35A 4PJLA 3CC4A 1JRIA 1SG5A 4JS4A 4PJOD 2LCSA 4AFSC 1X43A 5GAN5 3RKWA 3BY7A 2KROA 1Q86C 1AVZC 5LJ5e 4ELYC 3L1AA 1K1ZA 1X01A 1XNIA 2BZXA 2AKKA 1B07A 2EIFA 2XU8A 4C0DB 1NE8A 2LQKA 3OYGA 3GNGA 2EYQA 4BY6B 1OI1A 3OYJA 2K5IA 2R57A 2YSQA 1PRLC 2MYSA 4A4KA 4C92G 1MV0B 3QJ6A 4E7SA 2QQRA 4KRTA 4OGEA 4J9GA 3DB3A 1Q95G 1OOTA 4RG2A 1MMDA 1D0YA 2V8KA 3HKSA 3U23A 3QZ9B 3A98A 2JTFA 2FG0A 4ZTJA 2HQHA 4KULA 3V8LA 2EQUA 3CMAQ 2XI9A 4M7DC 3H8ZA 2EYZA 4PFZA 4PJOA 3PE0A 2D0NA 2FL7A 2BZ8A 5GMKh 3FLGA 4FYVB 4LUDA 3CCEA 3CCJT 4IUQA 2CH4A 4A4HA 4CC3A 3SFMA 1X27A 3X26B 3N5BB 3CXCA 4XTUA 5A0GA 3QKJA 2FRWA 1B34A 2FZGB 3FJ5A 4B9WA 4KUDK 4M75B 1X6OA 5KYYB 2DD5A 4ATOA 5L23A 3J81E 1WHGA 1VQ6Q 1UTIA 5KCHA 3OA6A 5GAMg 4ZGEB 3A8OB 3CMET 2CZ6B 4J5YA 1AWOA 2NWMA 1VOMA 2K3YA 4M75F 1BI0A 1V29B 2HQEA 1X6GA 3HRSA 2KRMA 4C5HA 4HKEA 2GBQA 5GMKj 1VYVA 3H6ZA 3CCRT 1PWTA 4JS5A 1M5Q1 1IZ6A 4D8DA 1PCXA 1WDXA 2OTJQ 1N27A 3PIOA 1UEBA 2HD0A 5HK3A 4F14A 3M57A 1M90C 4J9FA 4OVAA 2DVEA 3SWNB 2H8HA 2RK1A 3QDFA 4CC4B 3VRYA 2DZ9A 4LUEA 2E5QA 2YDLA 2D1XA 1T3SA 2F2VA 3I5RA 3PFSA 2H3JA 3RMSA 2A08A 2ABLA 4AFQC 1QVFA 1WHKA 1JEGA 4QVCA 2CUDA 2L3PA 3JCMV 1TU0B 4PKCC 2M02A 1PKSA 1UDLA 4C0GA 3I55Q 2A7YA 1IHWA 2QGGA 3OW2S 1YCSB 4J9CA 2BUDA 3CPWA 1VIEA 1VQMA 5IXBA 4OMPA 5GMKi 3I9QA 2L0AA 3EFRA 4FW2A 4X1VA 5GAMe 1AD5A 3CCLT 3EHQA 3META 4M77E 2D9TA 1OX8A 4JPBW 4N0AC 3OYEA 4M7AD 4C5EA 2RHZA 2E12A 2ZPEB 3JCMc 4V2SA 2DEUA 2QQSA 2FYKA 1S72Q 2W10A 1EZZB 2IG0A 4FYYB 3RIRA 4A54A 4FT2A 5A2QE 4D6WA 1OU9A 1VYTA 3CMAA 1VA7A 1VQ8Q 1YJNT 2EQJA 2YLBA 1Q82U 3M0RA 4XTWA 1U5SA 2QTXA 3A5ZB 4A4EA 4M75G 4EMKA 2COYA 2PU9B 3LGFA 1KC8U 1KHIA 2X3XD 4Y91A 4WCIA 5AT1B 1Z9QA 2A37A 4M77G 2XIDA 3JCMW 2I0NA 4M78B 4PJJA 1FX7A 1RAIB 4FYXB 3FB9A 5I22A 2ED0A 3EGDA 3T9NA 4HCBA 3E19A 2RM4A 4C8QC 4NS5A 4M7AA 4QKUA 1R8OB 4E7LA 2K6DA 3LW5E 4JJCA 1ZX6A 1TOVA 1G3TA 4FW1A 1YJ9Q 4J6WA 3CEYA 5CCAA 1VQ6A 3CD6Q 2DERA 2OTLT 3UATA 4M78F 1IRXA 2F5TX 2GTOA 3MP1A 5D6WA 4A53A 1W2BP 4LE9A 3UWNA 2DD4A 2JT4A 4JRPA 5FU7B 5GAMj 3L2ZA 5KYXA 1I5LA 4XTVA 4CI0C 1NPRA 2R5MA 2QGFB 2G6FX 1VQOQ 1YHQQ 2P0PA 2VVKA 3HSBA 1ABOA 1YN8A 2LP5A 2DTIA 1BI3A 4OMFB 4HT8A 3TU4K 2E64A 1RLPC 2DF6A 1BI2A 1W1FA 4NOYA 3VS4A 3JCMg 1FWZA 2GCXA 5CKDA 4LD6A 5IHKA 1JJ2P 3M55A 1GCQC 3R6OA 2FHDA 1QCFA 1Y7XA 2O2OA 1B3QA 3NFCA 1UGPB 4J6XA 4PK4A 1MMGA 2VYTA 2NUPA 2QI2A 5LJ3g 3RMQA 1VQNQ 4E47A 1KD1U 4JZ3A 2DXBA 2VGNA 4LDYA 3MEAA 2CP5A 1WIEA 2P84A 2WSCE 2XG8D 5KYWA 1YI2Q 3QO3A 4F7UE 1TUCA 2X35A 2FO0A 4J9EA 4HVUA 4M78E 4LDXA 1AEYA 1VQ9A 1WQWA 2ED1A 3NTKA 1LNXA 3I55A 4PJOC 4LDUA 2VXFA 3QYGB 2RH2A 3M4GA 1PM3A 1Y57A 2KQWA 3S3MA 4BD3A 4FM4B 2HDAA 4IIOA 4DBRA 1T0HA 3OYDA 3TREA 3C0CA 4JZ4A 1WA7A 3L42A 2LVMA 2GNCA 2KSSA 4FL6A 4DBHA 3EFOA 4IUTA 3QWXX 1G2BA 2KVQG 4ME7A 3QIIA 4Y92A 3BE3A 4PNOA 3G71Q 4F7UG 4BB7A 3VS1A 3JCMe 3JCMX 5IH2A 5KH6A 4M78G 2QQBA 1Y96A 3GIBA 2HNIA 3EFSA 1LPLA 1WFWA 1UGQB 4BACA 3CCET 3FEOA 4OF1A 4JLGA 1S1NA 3SDZA 2PTKA 3CPFA 2WACA 4LXCA 4ZGJB 5LJ3e 2RQTA 2XDDA 4OB2B 4J9DA 1TS9A 3OQ5A 2RI2A 1JXMA 4M4ZA 2DILA 4RUGA 1AWJA 1P92A 3PTAA 3E2UA 1X75C 3NTIA 1JO8A 2F5KA 1RUWA 2HBWA 3A8GB 1WPYA 3EGXB 1D3BB 5KYUA 2M1HA 4N4GA 4DBFA 3CPWS 1YJ9A 3P8BB 1GFCA 4B6MA 3JB9D 2FVUA 2DA9A 3CD6A 5GANh 1K9MU 5J39A 3OBWA 5LJ3h 1CSKA 1UGSB 5EC7A 1U1TA 2RJDA 2AZVA 4OMOA 1TWBA 4C8QD 4XAXB 2MK5A 1SRLA 1N8RC 3Q1JA 5GAOp 1VQOA 1W6XA 1YHQA 3GF5A 3PMIA 1H641 1K73U 2KRSA 1Q82R 1PSFA 5GAOm 1ZSZA 1KC8R 5FU6C 4KH1B 4LN2A 3QDRB 1IHVA 5LJ5f 1Z9ZA 4IUPA 5GAN2 1X2QA 1W4SA 2PUOB 4PL6A 3OY9A 1WJSA 1D0ZA 2CYZB 4DOWA 2LQ8A 1ZUYA 3OYNA 4L5GA 3H0HA 4AG2C 4HT9A 1E6GA 4DEXA 1I07A 3HTRA 2IVWA 1VQNA 2RI3A 2KNBB 3J7AF 2HSEB 5GANj 1D0XA 3RNJA 5LJ3j 1M1KC 2DX1A 1I4K1 3M5AA 1NEGA 3CC2Q 1YI2A 1GL5A 1AT1B 4AMCA 2JUFA 1VQ5Q 1VQMT 4CC2A 2PVDB 4XK8E 4DQ2A 3SEMA 3NHNA 1SSHA 3EHRA 2LT4A 1AWXA 2RJFA 1LVKA 4J6YA 5HY6A 1KQSP 4R0KA 4WF2A 3TCJA 2QQAA 3C12A 2SEMA 2DBKA 3RESA 3DLLA 3H41A 4EMKC 1M1GA 3EG3A 3DLMA 4CC7A 3CCMA 2M16A 3LYIA 3TQ7P 4XU2A 1AZEA 4C92D 2LX9A 4Z89A 1YIJQ 4O5VA 2P4RA 4M7AC 2O9VA 2FRYA 2LX7A 2EQKA 3CMAT 2PVOB 4J9HA 3CCUQ 1K8AC 4PJNA 8ATCB 1N9RA 3G71A 4M77C 4E7ZA 1SKUB 2EJFA 2VB6A 1KD1R 3G4ST 2GF7A 3MPUB 1WHHA 3QZ5B 3RUXA 4JJBA 5FROA 1J3TA 3OSVA 1GCQA 2QK0A 1K0XA 2RA2A 3L2RA 5GMKe 1Q7YC 2DNUA 5KYNA 1U06A 5AYFA 2JN0A 4RG8A 2GFAA 3CCVQ 1K76A 1RLQC 2JMCA 1G83A 3TSZA 1MMNA 1O75A 4NL3A 4ZTFA 2EYXA 4C92A 4MMLA 4XU1A 4F04B 1NLOC 2GQIA 1VQ6T 3UDCA 1OV3A 2DXCA 1BCMA 2O4XA 2KEAA 2ZPIB 2M0OA 1EIFA 1WZOA 1N9SA 3M56A 4KBMB 3OS0A 1YITQ 5GAN6 3L2UA 2YUQA 4KGZB 2DIGA 1SHFA 1NJIC 4QVDA 2CGHA 4Z88A 1RAFB 3QBYA 4ANJA 4JRQA 2FZCB 2A28A 1QVGA 3OYFA 3DKMA 2D8JA 3THKA 3M0UA 3QXEB 1WXTA 2O9SA 1TH7A 2DAQA 2YUOA 4FSXA 2E3HA 3TVTA 4EMKB 2YRCA 3CQTA 2AKLA 3VS5A 3KXTA 5L8RE 4J8OA 3FIFA 5GAMd 2MIOA 2DM1A 1WXUA 1IXDA 2RMOA 3ZFJA 2B8AA 3OS1A 2EGEA 2AT1B 3V8JA 2J05A 2LTOA 2VGMA 2YUNA 3JRZA 4JLIA 4M7AB 1SSFA 3OMCA 2DEQA 3C94A 1KQ2A 1G3SA 1SRMA 1Q81U 1OU8A 3V7CA 1YNZA 4HVWA 4BE1A 2AK5A 1VQ9T 3PNWC 1QKXA 3VJPA 3I55T 3OYKA 5DY9A 3AT1B 3CC2A 4AT1B 2EGCA 1K9MR 1VQ5A 3FDRA 1DJ7B 2PNIA 2AIRB 3EG9B 5KYXB 3VYHB 3I56Q 3CC7Q 3UF4A 1ZBXA 4J9BA 3GLXA 2V8JA 4BI4A 1WJRA 1V76A 2AZSA 3VUBA 2BZYA 2ZPFB 2LJ1A 5CR2A 1K73R 2F2WA 2HMAA 1XJWB 2EBPA 2JMAA 3QHSA 4TVRA 3WVDB 4M7DB 2LT1A 1RL2A 3M0PA 1X6BA 3MJXA 2DETA 2EWNA 2XMFA 3KUFA 2NUPB 4C0ZA 3CCUA 1UG1A 2J7IA 3KFVA 2L3RA 3CMEQ 1H3ZA 8AT1B 3JAME 2RI5A 4FSSA 4M75E 1JXOA 3HFNA 1MGQA 1EX4A 1WLPB 6AT1B 3M58A 1R0BG 4XU3A 5KYWB 1RADB 5FWCA 1NPPA 4PFPA 2E70A 1LJOA 1M9SA 2JJ9A 1IGUA 2RHIA 3CCRQ 4M7DF 4BDYA 5CVIA 4HXJA 2JVVA 2RQRA 4M75D 2E6NA 4JDSA 2DMOA 3GBQA 2DL7A 2CT4A 4IIMA 4HVVA 4MDWA 4Z02A 4M77D 3CCVA 2JW4A 1Q86U 1I81A 2IIMA 2DBMA 1ZSZC 1YJ9T 1MUZA 1RABB 2KK4A 1M2OA 1RAAB 3H0IA 3CD6T 2JTMA 1OULA 3O5ZA 3UA6A 2VXEA 2E6ZA 2K7AA 3M9QA 2CSQA 3JB9H 2WSEE 4MZPA 3V8KA 3HP9A 1YITA 1Q7YU 3D7SB 4JRKA 1X69A 4HCCA 1VQOT 1YHQT 2HZYA 4VUBA 2KT8A 3QUIA 2YWWA 1U8RA 4OMQA 1Y96B 2Y4YA 9ATCB 1YJWQ 3L2WA 3PT9A 3MP8A 1G3YA 4PJMA 2NUTB 3EG1A 5M9OA 4ESRA 4M75A 1M1FA 5KYYA 3O8VA 3VRZA 1T3LA 3EG2A 4FT4A 1JU5C 3P8DA 5GAN3 1V1CA 2L89A 4M77A 3URGA 3NTHA 2O88A 2HBPA 2EKOA 2FEIA 3NPFA 1VQNT 1MV3A 1BKBA 3EH2A 1FMKA 1TUDA 2LRQA 1YI2T 5A0LA 1H92A 1YBYA 4BE2A 5KYUB 2K2VA 1M3BA 3OMGA 1VQ7Q 4XU0A 3JCMd 1SF9A 2JOYA 2JXBA 2EJGA 2YT6A 2KXDA 3OYCA 3PVLA 1W2BS 1E6HA 3ME9A 3F70A 1VQKQ 2XICA 2OTJA 2ZCFB 2MWOA 3CCMT 3JCMf 3I56A 5GAN4 3CC7A 5LJ3d 3SWNA 4M7DG 2RQWA 4RTYA 3HRUA 2ZPBB 4LD9K 4XTYA 5I2SA 1QMCA 5GANg 1Y0MA 3CC4T 1UHCA 4HCKA 3MCAB 3OYIA 5CO7A 1N5ZA 2Y90A 3QSUA 3VUZA 2EAYA 2M51A 4ZGDB 1JJ2S 3OYLA 2X3WD 4EDUA 2DL5A 2R58A 1QVGS 2OI3A 2BE9B 2P0QA 3G71T 4C92C 3VU3C 1BK2A 2VUBA 3CXCP 1ACMB 2EQIA 2OTLQ 2RF0A 2DFUA 1M90U 1M27C 3AHUA 1JBMA 4PLLA 4Z8AA 3X20B 1BI1A 2KMTA 1Q81R 5CQYA 2E41A 3FRNA 4LNPA 4E7KA 4M78D 3CCSQ 3GPLA 2HAXA 1PC0A 4BI3A 3LWHA 3UA7A 3RDVA 2BE7D 1QWFA 2K5LA 4C8QB 2DXTA 2JTEA 3G1JA 5D6XA 2RPNA 1H8KA 2DPPB 4GY5A 1D1CA 4UC4A 5GAN8 3QG1A 4OB3B 3L2VA 2DO3A 1Y71A 2EKHA 1GCPA 4L6V5 2XKOC 3G6EQ 1S72A 3MKDA 4A4GA 2D6FA 1ZBJA 5GJVB 3EGUA 3MEWA 2K3BA 2X9HA 3ZEHA 4C8QF 1QP3A 4GLMA 2DKGA 4OB1B 1VQ8A 2I2LA 3WXMB 4FCYA 2FZKB 2BIVA 2RNAA 1AWWA 5GANe 2OAWA 2HL3A 2CP0A 4F7UA 1WXBA 2EFIA 7AT1B 2QA4Q 4M78A 2EQMA 2F69A 3S6WA 4KH0B 4IUUA 5J3BA 4N4HA 2SRCA 2DL8A 1YJWA 1C0MA 1F1BB 2K79A 1KQ1A 1QVFP 1UHFA 3LLRA 4Q5WA 4E7HA 2KE9A 1UUEA 1M3CA 2E4HA 2KYBA 1VQ4Q 2KI7A 4QW2A 3G7ZA 2K57A 4Y28E 2EGAA 1Q86R 2L3SA 2ZPGB 1H3HA 3E9FA 3LH5A 3CC2T 2XDPA 4XQ3A 1NEBA 2O4XB 1VQ5T 1HXDA 1WNLA 2CP3A 1FXXA 4PJOB 1ZA1B 1NYFA 2LQNA 4J7FA 4E6RA 4MZTA 1M30A 1VQ7A 1M8VA 2PZ1A 4DBQA 4RTUA 1K4US 3SHWA 4C0DC 1FYNA 2DL4A 2LJ3A 1VQKA 4BY6C 2DRKA 2FPFA 4C5GA 3VS2A 2CUBA 2X4WA 1OEBA 1KSWA 2L2PA 4PJOF 1B34B 4FYWB 3A8HB 1TXQA 1ZSGA 1SHGA 5LJ5g 2CZ1B 1WJQA 1M3AA 2A36A 3EG0A 4BDZA 1I8FA 3C4SA 3VYGA 4RTTA 1OQKA 5KE3A 3RR6A 3CCUT 3ASKA 2LNHB 4R55A 3I5SA 3VS7A 2QEXQ 2J06A 3M53A 3VS0A 3CCQQ 4C8QG 2D0QB 2OTLA 1QP2A 2QQ9A 3BDLA 4HA8A 4K11A 2G3RA 3JB9I 3M59A 4BUGA 1OPLA 5GAOr 2PUKB 2M9UA 1YWPA 2EYWA 3GNFB 2YHTA 2LJ0A 4ZN1A 2KDSA 5DLQE 3CCSA 5CAIA 2KBTA 1T0JA 2COWA 4X9CA 3CCVT 1I5OB 3OBYA 5IN1A 3INZA 4JUVA 1VUBA 2HCKA 1UJ0A 4M75C 1PD0A 1QLYA 3G6EA 3TEEA 2CP6A 1VQLQ 1G8XA 1YITT 2RHYA 1GRIA 4FIBA 1VQPQ 2QDYB 1U3OA 4MDXA 1HJDA 2KR3A 2LNVA 4LDVA 3QYHB 1Y07A 1VQMQ 2QA4A 2DL3A 2QDLA 2JS0A 5FU6B 2ROTA 1M90R 2HQXA 3OS5A 1E7OA 1M2VA 5FWBA 1W2BA 1UFFA 3UT1A 1OPKA 3RKXA 3UPUA 1UB4A 1Q82C 4KT0E 3JCMb 5IHIA 2YXYA 1XTDA 4A63B 3EGXA 3M0QA 1KC8C 1D3BA 4O6JA 2L3QA 1NYGA 1ZUUA 2HKQB 2CS7A 1GBQA 3SWNC 4BI8B 4PJOG 3V7RA 1KHCA 1C1AA 2CZ0B 1VQ4A 2V1QA 1AHJB 2RK2A 3X24B 2OJ2A 4EMHA 4RKUE 5LJ5h 4EIKA
chains in the Genus database with same CATH topology
1JJ2A 3OW2A 2X35A 4MDWA 3LX7A 3E9GA 4M78E 1YIJT 4Z02A 4LDXA 4M77D 2LCLA 3CCVA 1VQ9A 3JB9G 1Q86U 1WQWA 1I81A 2JNGA 1JB0E 3RKYA 5IT9E 1YCYA 3NTKA 1LNXA 3I55A 2OTJT 1ZQ1A 1YJ9T 2KK4A 4PJOC 4LDUA 4J7IA 2VXFA 1GXIE 2Y4XA 4YTLA 3CD6T 3QYGB 2JTMA 3I56T 4EPCA 1VQLT 3CC7T 2RH2A 3M4GA 4CRIA 5LL6S 2VXEA 3S3NA 2E6ZA 1QVPA 1IREB 3M9QA 3JB9H 2KQWA 5CKHA 3S3MA 5C6SA 2WSEE 2E1HA 4FM4B 4MZPA 4BD3A 3V8KA 2PVGB 3HP9A 1YITA 1VQPT 1Q7YU 2VV5A 1OYXA 4QVZA 3OYDA 3TREA 4JRKA 4HCCA 2QXFA 4OP0A 2L8DA 5EG2A 1VQOT 1YHQT 2XD0A 4VUBA 5GAMf 3QUIA 3L42A 4QQGA 2LVMA 1WQ7A 2KSSA 4FL6A 4X9DA 1U8RA 2LDMA 4GLKA 4OGCA 5A0DA 2LC4A 1Y96B 2Y4YA 4IUTA 1N8RU 4C8QA 3L2WA 2KVQG 2V8IA 3QIIA 3PT9A 2OAUA 4IUVA 3MP8A 4ME7A 5GAOl 1G3YA 1OZ2A 1KQSS 5M9OA 4PNOA 4M77B 3MP6A 4F7UG 2K4YA 5LJ5j 2C06A 4M75A 4BB7A 1M1FA 2RHUA 3JCMe 1BYMA 2KAFA 3JCMX 4C92E 5KH6A 4M78G 1N6AA 3O8VA 2QQBA 2X4JA 1Y96A 3GIBA 2HNIA 2PQWA 1U1SA 4FT4A 3OYMA 1PSEA 5GAN7 3P8DA 2QEXA 3EFSA 5GAN3 1UGQB 2L89A 4M77A 2MF2A 3URGA 3CCQA 4BACA 3CCET 3FEOA 3NTHA 4OF1A 2DTOA 4JLGA 5D6YA 4PJOE 2RD1A 1KD1C 4M7AF 1WGSA 3SDZA 5KCOA 2HBPA 3CPFA 2EKOA 3QJYA 2XK0A 2WACA 3HPWA 4P5NA 4ZGJB 5LJ3e 1VQNT 1G5VA 2XDDA 4XTXA 5C0MA 3CC4A 4OB2B 1JRIA 1BKBA 4M77F 4X34A 3JCMP 3EAEA 2RJCA 3LWIA 2E65A 2LRQA 3OQ5A 2RI2A 5I21A 1YI2T 1VIFA 5A0LA 4JS4A 4PJOD 1YBYA 4M78C 5GAN5 4BE2A 3RKWA 3BY7A 1Q86C 1M1KU 2K2VA 2NLUA 1P92A 5LJ5e 3PTAA 4KUIA 4ELYC 3L1AA 3OMGA 1X01A 1X75C 1XNIA 1S72T 3NTIA 4XU0A 3JCMd 2JOYA 4BE0A 2EIFA 2EJGA 3OYCA 1YIJA 4XTZA 2F5KA 2XU8A 3L2QA 4C0DB 1W2BS 2MAMA 1NE8A 2LQKA 3OYGA 3GNGA 5GAOq 3A8GB 1WPYA 3ME9A 1D3BB 2EYQA 3F70A 2M1HA 4N4GA 2XICA 4BY6B 1OI1A 3P8BB 3CPWS 3OYJA 1YJ9A 2OTJA 2ZCFB 2K5IA 2MWOA 3OYBA 2R57A 3CCMT 3JB9D 5CIUA 3X28B 3JCMf 2FVUA 4A4KA 4C92G 1VQ8T 3CD6A 5GANh 3I56A 1K9MU 3QJ6A 5GAN4 5J39A 5LJ3d 3SWNA 3OBWA 3CC7A 1VQLA 5LJ3h 1UGSB 4M7DG 1KG1A 2QQRA 1U1TA 4OGEA 2RJDA 3HRUA 3DB3A 2ZPBB 4LD9K 4XTYA 5I2SA 3PGGA 2RJEA 5GANg 3CC4T 4RG2A 3MCAB 3OYIA 3BFMA 5FU7C 4C8QD 1VQPA 4XAXB 5CO7A 2Y90A 3QSUA 2V8KA 3HKSA 4MMKA 2EAYA 3VUZA 1N8RC 4MZMA 4ZGDB 3Q1JA 5GAOp 1VQOA 1YHQA 3GF5A 3LGLA 1YJWT 3PMIA 1JJ2S 3QZ9B 1XQHA 3OYLA 2JTFA 4EDUA 1H641 2R58A 1QVGS 1M4ZA 1K73U 2P0QA 3G71T 1PSFA 4HCZA 4ZTJA 4C0FA 4KULA 4C92C 3V8LA 4M7AE 3C95A 2EQUA 2XI9A 3VU3C 5GAOm 2VUBA 5FU6C 4M7DC 5FRNA 3H8ZA 5J26A 4PJOA 3QDRB 2FB7A 5LJ5f 4IUPA 1K8AU 5GAN2 2FL7A 2K5FA 4JJNK 1W4SA 1M90U 3AHUA 2WSFE 2PUOB 1JBMA 4L59A 4PLLA 4PL6A 3X20B 1BI1A 3OY9A 1WJSA 2KMTA 5GMKh 3FLGA 5CQYA 2E41A 2CYZB 5CQXA 3FRNA 4E7KA 4DOWA 3CCEA 4M78D 2LQ8A 3OB9A 4IUQA 3OYNA 3CCJT 4A4HA 4L5GA 4II1A 2DJZA 4HT9A 3SFMA 2HAXA 1MHNA 3GPLA 3X26B 4BI3A 2IVWA 5GAOn 3N5BB 2AHJB 3LWHA 2R5AA 2RI3A 1VQNA 3J7AF 5GANj 5CKEA 3CXCA 2K5LA 4XTUA 4C8QB 2DXTA 3QKJA 5A0GA 5LJ3j 1M1KC 1B34A 1I4K1 3CBPA 5D6XA 3M5AA 4B9WA 2DPPB 3VV0A 4E7IA 5CKBA 4KUDK 1YI2A 4M75B 4GY5A 1X6OA 4UC4A 5GAN8 3QG1A 1VQ7T 2DD5A 2JUFA 3KBGA 4OB3B 3L2VA 2DO3A 1Y71A 2DZCA 1VQMT 4L6V5 2PVDB 2XKOC 1NZ9A 4ATOA 4XK8E 4DQ2A 4PLIA 5GAMh 3J81E 2LT4A 4DOVA 2RJFA 1S72A 4J6YA 5HY6A 4A4GA 2D6FA 1VQKT 5KCHA 4WF2A 3G4SA 5CKFA 3OA6A 3TCJA 4M7AG 1LOJA 2QQAA 3M4YA 3MEWA 5GAMg 4ZGEB 3C12A 3V7SA 1K9MC 3A8OB 3RESA 3DLLA 3ZEHA 4M7DE 4C8QF 1QP3A 4EMKC 1M1GA 3OYHA 4F7UB 3CMET 2CZ6B 4J5YA 2DKGA 3DLMA 3CCMA 4OB1B 2M16A 1VQ8A 2I2LA 3WXMB 3LYIA 3OSSC 2RO0A 2K3YA 4M75F 2BIVA 1BI0A 1V29B 2HQEA 5GANe 2GFUA 3HRSA 4XU2A 2XHCA 4RCBA 4C5HA 1NJIU 4C92D 1G3WA 2RB6A 4HKEA 4FU6A 5GMKj 4F7UA 2LX9A 3H6ZA 3CCRT 2EFIA 4M7DD 3MHXA 1KQSA 4O5VA 4M78A 4JS5A 1K73C 2EQMA 3FC3A 2F69A 2K3XA 3S6WA 2XDBA 1M5Q1 4IUUA 5J3BA 4M7AC 1IZ6A 1ZHIA 3HL8A 3LH0A 1N27A 4N4HA 3PIOA 1YJWA 1UEBA 3JCMQ 4R56A 3OYAA 3CMAT 2EQKA 4F7UF 2HD0A 2PVOB 5HK3A 1K8AC 5HK0A 1N9RA 2X4YA 3G71A 4M77C 3HHTB 1KQ1A 3M57A 1KD1U 1M90C 2EJFA 3ZBDA 4OVAA 3LLRA 3G4ST 4B9XA 2GF7A 4Q5WA 2DVEA 4E7HA 3SWNB 2RK1A 3QZ5B 4QQ6A 3RUXA 5DM7R 2L5QA 5FROA 1OZ3A 3OSVA 3JSCA 3HFOA 3M54A 4QW2A 2RA2A 3G7ZA 2DZ9A 2K57A 5GANd 3L2RA 2E5QA 3CCST 4Y28E 3OYYA 5GMKe 1Q7YC 3CCJA 3ER0A 3PFSA 2ZPGB 2H3JA 3RMSA 1QW1A 2MMPA 1QVFA 5AYFA 2JN0A 3E9FA 4RG8A 2GFAA 4QVCA 3JCMV 3OS2A 5GANf 3CC2T 4PKCC 2XDPA 3J80E 4XQ3A 2O4XB 5LJ3f 4C0GA 2E10A 1VQ5T 1HXDA 1O75A 1WNLA 2O01E 2A7YA 1FXXA 4NL3A 4ZTFA 3G6ET 3OW2S 4C92A 3RERA 4PJOB 4J7FA 4MMLA 4MZTA 2BUDA 4XU1A 3CPWA 1VQ7A 1VQ6T 3SB2A 3UDCA 4M7DA 1VIEA 1VQMA 5FRMA 1M8VA 2DXCA 2DXUA 4ELZC 5GMKi 2O4XA 2ZPIB 2DIQA 3QPHA 2BKDN 3EFRA 2M0OA 4LDWA 4C0DC 5GAMe 3CCLT 1EIFA 2MWPA 2YRVA 5DLOA 1VQKA 1N9SA 3M56A 4KBMB 3META 4M77E 4BY6C 2D9TA 3OS0A 5GAN6 4C5GA 4N0AC 3OYEA 3L2UA 3E1SA 2X4WA 4C5IA 2DIGA 3HRTA 2DTHA 3CMEA 1NJIC 4M7AD 4QVDA 2CGHA 4NL2A 4C5EA 4PJOF 1B34B 2RHZA 2E12A 2YLCA 2RHXA 2ZPEB 3A8HB 3JCMc 3WVEB 4V2SA 3CXCS 3QBYA 2CZ1B 5LJ5g 2QA4T 1WJQA 4JRQA 1QVGA 3OYFA 3DKMA 2QQSA 2FYKA 2KY9A 4QQDA 4BDZA 3QXEB 3BW1A 1I8FA 3CCRA 3C4SA 3VYGA 2IG0A 3A8MB 1TH7A 5KE3A 1HK9A 2DAQA 2VC8A 3RIRA 4A54A 4FSXA 3CCUT 3ASKA 4FT2A 3X25B 4EMKB 3MO8A 3GOXA 4R55A 2X4XA 5A2QE 3KXTA 4D6WA 5L8RE 3PIPA 3JB9F 3M53A 3FIFA 4J8OA 3CMAA 4C8QG 5GAMd 2D0QB 1YJNT 2OTLA 2EQJA 4IKFA 1QP2A 2QQ9A 2YLBA 3BDLA 4HA8A 1Q82U 4XTWA 3ZFJA 2B8AA 3OS1A 2G3RA 3JB9I 2QTXA 3A5ZB 4A4EA 4M75G 3V8JA 4EMKA 3M59A 4BUGA 3LGFA 2PU9B 5GAOr 1VQ4T 1KC8U 1KHIA 2PUKB 3GP8A 2CKKA 2LTOA 2M9UA 4Y91A 2CZ7B 4E7JA 2VGMA 3JRZA 3PMTA 3VKIA 3JCMJ 4JLIA 3BDUA 3GNFB 2YHTA 3MEVA 4M77G 2XIDA 4M7AB 1SSFA 1XOVA 4ZN1A 3OMCA 2DEQA 3C94A 3JCMW 4M78B 1KQ2A 1G3SA 1FX7A 2KDSA 5DLQE 1Q81U 3CCSA 3V7CA 5CAIA 3FB9A 4J83A 4BE1A 4X9CA 3T9NA 3CCVT 4HCBA 3E19A 1VQ9T 2RM4A 1BIAA 3PNWC 3MEUA 3OBYA 5IN1A 4NS5A 3CBMA 4C8QC 5GMKm 3VJPA 4M7AA 3FJPA 3I55T 3INZA 1RI0A 4JUVA 3OYKA 1VUBA 1R8OB 5DY9A 4E7LA 3LW5E 3CC2A 4M75C 3DB4A 5FLXE 1G3TA 2JZ2A 1VQ5A 2ZGWA 3FDRA 1DJ7B 4J6WA 3G6EA 3CEYA 3TEEA 5CCAA 3A8LB 1VQ6A 3VYHB 2OTLT 2MI6A 4M78F 1ZBXA 3GLXA 4RCCA 2V8JA 2EJ9A 2F5TX 1YITT 4BI4A 1O9SA 1WJRA 2RHYA 3MP1A 5D6WA 3VUBA 2LCCA 4A53A 3CCLA 2ZPFB 3CBOA 3P8HA 2DD4A 3UWNA 4JRPA 5FU7B 5GAMj 3L2ZA 5KE2A 5CR2A 4FIBA 1I5LA 1UGRB 2QDYB 4XTVA 4CI0C 1NPRA 4MDXA 2R5MA 2P0PA 5CK9A 2LNVA 2P4TA 3HSBA 4LDVA 3QHSA 1QVFS 5I2MA 3QYHB 1Y07A 2DTIA 4TVRA 3WVDB 4EMGA 3JCMh 4C92B 5GMKl 2QA4A 1BI3A 4OMFB 4DA4A 4HT8A 3SD4A 5FU6B 2E64A 3TU4K 3JB9J 4M7DB 2HQXA 3OS5A 1BI2A 2GQVA 2LT1A 4NOYA 3JCMg 1FWZA 1RL2A 1W2BA 2GCXA 3UT1A 2QEXT 3RKXA 4C8QE 2EWNA 3UPUA 3KUFA 1UB4A 3CCQT 4C0ZA 4KT0E 4LD6A 5CKDA 3JCMb 3CCUA 1Q82C 2L3RA 3M55A 1XTDA 2DK3A 1H3ZA 2A3LA 3R6OA 3JAME 2FHDA 1KC8C 2RI5A 1D3BA 4M75E 1Y7XA 4O6JA 3HFNA 1UGPB 1MGQA 3NFCA 4J6XA 1YJNA 3M58A 4JRIA 2CS7A 3SWNC 4BI8B 2VYTA 4N0AA 4XU3A 4PJOG 2ZPHB 4A4FA 2QI2A 3V7RA 5LJ3g 1KHCA 3RMQA 2CZ0B 1NPPA 2E70A 4OB0B 1LJOA 1M9SA 4C92F 2DXBA 2VGNA 4E47A 4LDYA 2RHIA 1VQ4A 3MEAA 1Q81C 5IAYA 4BDYA 4M7DF 5CVIA 1AHJB 2RK2A 3X24B 5HKCA 4EMHA 2JVVA 5LJ5d 4RKUE 4M75D 2WSCE 2E6NA 4IURA 4JDSA 5LJ5h 2ZZDA 1BIBA 2XG8D 4RMOA 3QO3A 3S3OA 4ZN3A 2P0KA 4F7UE 4N4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 G;  3JCM f;  3JB9 I;  2QTX A;  4M75 G;  3V8J A;  4EMK A;  5GAN h;  5GAO r;  1M5Q 1;  5GAN 4;  4M78 E;  4M7A C;  5LJ3 d;  3SWN A;  4M7D G;  4M77 D;  5LJ3 h;  4Y91 A;  3JB9 G;  1U1T A;  1WQW A;  1I81 A;  3JCM Q;  3RKY A;  4F7U F;  1YCY A;  4XTY A;  3PGG A;  1LNX A;  3BDU A;  4JLI A;  5GAN g;  3JCM J;  2YHT A;  1N9R A;  4M77 G;  4M7A B;  4M77 C;  4PJO C;  3JCM W;  1KQ1 A;  2DEQ A;  3BFM A;  4M78 B;  1KQ2 A;  4C8Q D;  2EJF A;  2VXF A;  2Y90 A;  3QSU A;  3V7C A;  4MMK A;  5CAI A;  2EAY A;  3FB9 A;  2DVE A;  3SWN B;  5GAO p;  3M4G A;  4X9C A;  2VXE A;  2RM4 A;  1BIA A;  3RUX A;  4C8Q C;  3JB9 H;  5GMK m;  4M7A A;  3FJP A;  1H64 1;  3INZ A;  4JUV A;  3HFO A;  2E1H A;  5DY9 A;  2RA2 A;  3V8K A;  2DZ9 A;  2K57 A;  3V8L A;  4C92 C;  5GAN d;  4M7A E;  4M75 C;  3VU3 C;  5GAO m;  5GMK e;  4M7D C;  2ZGW A;  4JRK A;  4J6W A;  4OP0 A;  4PJO A;  2FB7 A;  5GAM f;  5LJ5 f;  3QUI A;  5GAN 2;  1WQ7 A;  2JN0 A;  4X9D A;  3AHU A;  4M78 F;  1JBM A;  4QVC A;  3JCM V;  4RCC A;  1Y96 B;  2EJ9 A;  5GAN f;  4C8Q A;  5GMK h;  2E41 A;  5GAO l;  4XQ3 A;  5LJ3 f;  4A53 A;  2E10 A;  1HXD A;  1WNL A;  4M78 D;  4PNO A;  4M77 B;  4NL3 A;  4PJO B;  3RER A;  4C92 A;  4F7U G;  5LJ5 j;  2DJZ A;  3L2Z A;  5GAM j;  4HT9 A;  4M75 A;  4MML A;  4XU1 A;  1I5L A;  3JCM e;  4XTV A;  3JCM X;  3SB2 A;  4M7D A;  4C92 E;  5GAO n;  4M78 G;  1M8V A;  1Y96 A;  2DXU A;  3GIB A;  5GMK i;  2HNI A;  5GAN j;  1U1S A;  5GAN 7;  4XTU A;  4C8Q B;  2DXT A;  3HSB A;  3EFR A;  3QHS A;  5LJ3 j;  3EFS A;  5GAM e;  5GAN 3;  1B34 A;  1I4K 1;  4M77 A;  2DTI A;  2DTO A;  4EMG A;  1N9S A;  3JCM h;  4C92 B;  5GMK l;  4M77 E;  4PJO E;  4M75 B;  2RD1 A;  5GAN 6;  4HT8 A;  4M7A F;  5GAN 8;  4N0A C;  2E64 A;  3JB9 J;  4M7D B;  2DZC A;  5LJ3 e;  2DTH A;  4XTX A;  4NOY A;  4DQ2 A;  4F7U E;  3JCM g;  5GAM h;  4M7A D;  1JRI A;  4QVD A;  2CGH A;  4NL2 A;  3RKX A;  4M77 F;  4J6Y A;  2EWN A;  1B34 B;  4PJO F;  4C8Q E;  2YLC A;  3JCM P;  4V2S A;  3JCM c;  3JCM b;  4WF2 A;  2E65 A;  4M7A G;  5I21 A;  1LOJ A;  5LJ5 g;  5GAM g;  4PJO D;  3V7S A;  1D3B A;  4M78 C;  4M75 E;  2FYK A;  3RES A;  5GAN 5;  3HFN A;  3RKW A;  1MGQ A;  4J6X A;  3BW1 A;  1I8F A;  3BY7 A;  4C8Q F;  4EMK C;  4JRI A;  4F7U B;  4M7D E;  4J5Y A;  2DKG A;  3SWN C;  5LJ5 e;  4XU3 A;  3L1A A;  4N0A A;  1TH7 A;  4PJO G;  1X01 A;  1HK9 A;  3V7R A;  2I2L A;  5LJ3 g;  2VC8 A;  4XU0 A;  3JCM d;  4C92 F;  3RIR A;  1LJO A;  4A54 A;  2EJG A;  4M75 F;  4XTZ A;  4EMK B;  4M7D F;  5GAN e;  4XU2 A;  4RCB A;  5GAO q;  4EMH A;  1WPY A;  3JB9 F;  1D3B B;  4C92 D;  3FIF A;  2RB6 A;  5GMK j;  5LJ5 d;  4C8Q G;  4M75 D;  4F7U A;  5GAM d;  5LJ5 h;  1BIB A;  4M7D D;  2YLB A;  3QO3 A;  4HA8 A;  4XTW A;  3JB9 D;  4M78 A; 
#chains in the Genus database with same CATH topology
 1JJ2 A;  3A1P A;  4J9I A;  1ZUK A;  3LX7 A;  2ATC B;  3RKY A;  5IT9 E;  1YCY A;  3G4S Q;  1ZQ1 A;  2OTJ T;  4J7I A;  1WYX A;  1GXI E;  3I56 T;  4EPC A;  3CC7 T;  2VKN A;  5LL6 S;  3S3N A;  1QVP A;  2H3E B;  2GTJ A;  5C6S A;  2LQW A;  2E1H A;  2PVG B;  1WX6 A;  4D8K A;  2VV5 A;  1OYX A;  1UGV A;  3EGD B;  2YUP A;  2DLP A;  5GAM f;  4QQG A;  4X9D A;  2LDM A;  4GLK A;  1HYO A;  2EPD A;  5A0D A;  1MND A;  1N8R U;  2V8I A;  2MOX A;  4M77 B;  3MP6 A;  5LJ5 j;  2KRN A;  1BYM A;  5IHN A;  1UE9 A;  3OYM A;  2QEX A;  2MF2 A;  3CCQ A;  3EH1 A;  1IB8 A;  5D6Y A;  4M7A F;  1KD1 C;  2CP2 A;  1OX9 A;  4P5N A;  2XK0 A;  3CCJ Q;  1G5V A;  4XTX A;  5C0M A;  4M77 F;  4X34 A;  3JCM P;  3EAE A;  2RJC A;  3LWI A;  2E65 A;  5I21 A;  5D7U A;  1VIF A;  2HKN A;  2QAS A;  4M78 C;  1YFN A;  1M1K U;  2NLU A;  4KUI A;  1S72 T;  4BE0 A;  1YIJ A;  4XTZ A;  3L2Q A;  2MAM A;  5I11 A;  5GAO q;  1WI7 A;  2CRE A;  2JM9 A;  2VWF A;  2V1R A;  3OYB A;  5CIU A;  3X28 B;  1VQ8 T;  3VS6 A;  3OW2 P;  1NLP C;  1VQL A;  1FMW A;  1KG1 A;  4RTX A;  2KGT A;  1BU1 A;  1RAC B;  3PGG A;  2RJE A;  4ORZ A;  2RQU A;  3BFM A;  3H0F A;  5FU7 C;  1VQP A;  1VQ9 Q;  2DJQ A;  4MMK A;  1LCK A;  2LMJ A;  4MZM A;  3LGL A;  1YJW T;  2DRM A;  2QG9 B;  1XQH A;  4AG1 C;  1M4Z A;  1JQQ A;  4HCZ A;  4C0F A;  4M7A E;  2C0T A;  3C95 A;  2HSP A;  5FRN A;  1ZA2 B;  5J26 A;  2FB7 A;  1K8A U;  3PVQ A;  4JJN K;  2K5F A;  2VAS A;  2WSF E;  4RTZ A;  4L59 A;  1A0N B;  2MCN A;  5CQX A;  2DYI A;  3OB9 A;  1HD3 A;  1IO6 A;  3M0S A;  4II1 A;  2DJZ A;  1MHN A;  5GAO n;  2AHJ B;  2R5A A;  1W70 A;  3EFO B;  5CKE A;  4AFU C;  2DYB A;  3CBP A;  2A0F B;  1QKW A;  3VV0 A;  4E7I A;  2QYZ A;  5CKB A;  2Z0W A;  1MNE A;  1VQ7 T;  3KBG A;  2DZC A;  2KT1 A;  1NZ9 A;  3ULR B;  2RQV A;  4PLI A;  5GAM h;  1K0S A;  4DOV A;  2RN8 A;  1VQK T;  3G4S A;  2YRD A;  5CKF A;  4M7A G;  1LOJ A;  3M4Y A;  3CCL Q;  1K9M C;  3V7S A;  2DE0 X;  4M7D E;  3OYH A;  4F7U B;  3OSS C;  2RO0 A;  2KYM A;  2GFU A;  2DVJ A;  2XHC A;  4RCB A;  1NJI U;  1B7T A;  1G3W A;  2RB6 A;  4FU6 A;  4M7D D;  3MHX A;  1EFN A;  1KQS A;  1K73 C;  3FC3 A;  1QCN A;  1KIK A;  2K3X A;  2XDB A;  3NMZ C;  1ZHI A;  3HL8 A;  3LH0 A;  3JCM Q;  4R56 A;  3OYA A;  4F7U F;  2B86 A;  4KGX B;  1PD1 A;  5HK0 A;  2X4Y A;  1QQJ A;  3HHT B;  2F1L A;  1BCO A;  3ZBD A;  2GGR A;  4B9X A;  1YJN Q;  2CP7 A;  2E3I A;  4QQ6 A;  5DM7 R;  2L5Q A;  3EG9 A;  1OZ3 A;  1YP5 A;  2FPE A;  3JSC A;  3HFO A;  1TG0 A;  3M54 A;  4QT7 A;  5GAN d;  3CCS T;  3OYY A;  1C6V X;  1RAE B;  3CCJ A;  2QAZ A;  1TUG B;  3QWY A;  3ER0 A;  2ESW A;  1QW1 A;  2MMP A;  3OS2 A;  5GAN f;  3J80 E;  5LJ3 f;  1ZSZ B;  2E10 A;  2O01 E;  3RER A;  3G6E T;  1SEM A;  1SPK A;  4GBQ A;  3SB2 A;  4M7D A;  1UEC A;  5FRM A;  2DXU A;  1QVG P;  4ELZ C;  3VS3 A;  3H9N A;  2K9G A;  1QWE A;  2DIQ A;  3QPH A;  2BKD N;  4LDW A;  2MWP A;  5DLO A;  2YRV A;  3M0T A;  2EW3 A;  2C0O A;  5IXF A;  3E1S A;  4C5I A;  3HRT A;  2DTH A;  2CDT A;  3CME A;  1TSF A;  1N8R R;  4NL2 A;  4OMN A;  4ZNX A;  2J6O A;  2YLC A;  4OML A;  2RHX A;  1ABQ A;  3WVE B;  3CXC S;  1PHT A;  2QA4 T;  4F16 A;  2CSI A;  5FW9 A;  2KY9 A;  4QQD A;  3CCR A;  3BW1 A;  1R0C B;  2E5K A;  3A8M B;  1R77 A;  1HK9 A;  2VC8 A;  1PNJ A;  3GOX A;  3X25 B;  3MO8 A;  2X4X A;  2ENM A;  3PIP A;  3JB9 F;  3CCM Q;  1KK7 A;  2JM8 A;  1YWO A;  4IKF A;  1D1B A;  1WHJ A;  1VQ4 T;  1UJY A;  1MMA A;  3GP8 A;  2CKK A;  2J6F A;  3CC4 Q;  2CZ7 B;  4E7J A;  1CKA A;  3PMT A;  3VKI A;  2EYY A;  3JCM J;  1M1K R;  3BDU A;  2LZ6 B;  1GBR A;  3REA B;  3MEV A;  1XOV A;  2V26 A;  4J83 A;  2ZAE A;  2C0I A;  3ZL7 C;  1BIA A;  3MEU A;  3CBM A;  1I0C A;  5GMK m;  3TSW A;  3FJP A;  4E2F B;  1RI0 A;  1GFD A;  2J6K A;  1CKB A;  1RAG B;  3DB4 A;  5FLX E;  2JZ2 A;  2ZGW A;  2NUT A;  1TTH B;  2MPX C;  3RBB B;  3A8L B;  1WHL A;  2MI6 A;  4DEY A;  1D1A A;  4RCC A;  2EJ9 A;  1O9S A;  3CCL A;  2LCC A;  3CBO A;  3P8H A;  1PG5 B;  5KE2 A;  1UGR B;  3R6N A;  2IPO B;  2FPD A;  3CPW P;  1QCO A;  2ECZ A;  1M2V B;  5CK9 A;  4WTO B;  2P4T A;  1QVF S;  5I2M A;  3JV3 A;  4EMG A;  2CH4 W;  1WHM A;  2NUZ A;  3JCM h;  4C92 B;  5GMK l;  1K8A R;  1KFZ A;  4DA4 A;  3SD4 A;  3JB9 J;  2COZ A;  4F17 A;  2CT3 A;  2GQV A;  2BTT A;  2W0Z A;  2QEX T;  1D09 B;  4C8Q E;  3CCQ T;  2EVR A;  1PRM C;  2KXC A;  4AFZ C;  2DK3 A;  1BBZ A;  1M8M A;  1I1J A;  2A3L A;  3CCE Q;  2D8H A;  1NG2 A;  2M0Y A;  1YJN A;  1Q7Y R;  4JRI A;  2JS2 A;  4N0A A;  2ZPH B;  4A4F A;  2OX7 A;  4OB0 B;  4C92 F;  3NGP A;  1Q81 C;  1RI9 A;  5IAY A;  5HCK A;  2HEQ A;  5HKC A;  5LJ5 d;  4IUR A;  1ZLM A;  2ZZD A;  1BIB A;  4RMO A;  3S3O A;  4ZN3 A;  2P0K A;  4JJD A;  1NBE B;  4N4I A;  4OMM A;  3OW2 A;  3E9G A;  1YIJ T;  2LCL A;  1BB9 A;  3JB9 G;  2JNG A;  1ARK A;  1JB0 E;  4RTV A;  2QTV A;  1RAH B;  3REB B;  4RTW A;  1K9A A;  2Y4X A;  4YTL A;  1VQL T;  4CRI A;  1NJI R;  1IRE B;  2O31 A;  2F2X A;  5CKH A;  1AOJ A;  1VQP T;  1X2K A;  4QVZ A;  2QXF A;  4OP0 A;  2L8D A;  5EG2 A;  2XD0 A;  4PFO A;  1AZG B;  1WQ7 A;  5GJW B;  4OGC A;  2LC4 A;  2K2M A;  4C8Q A;  4IUV A;  1PKT A;  1VYU A;  2OAU A;  5GAO l;  1KQS S;  1OZ2 A;  2NYS A;  2C06 A;  2K4Y A;  1FMV A;  1NM7 A;  2RHU A;  3IQL A;  2KAF A;  1KJW A;  4C92 E;  1N6A A;  2X4J A;  1HSQ A;  2PQW A;  1U1S A;  1PSE A;  5GAN 7;  2X51 A;  2DTO A;  5ECA A;  2ROL A;  4PJO E;  2RD1 A;  1WGS A;  5KCO A;  1IGQ A;  2HL5 C;  4KGV B;  3QJY A;  3HPW A;  3I35 A;  4PJL A;  3CC4 A;  1JRI A;  1SG5 A;  4JS4 A;  4PJO D;  2LCS A;  4AFS C;  1X43 A;  5GAN 5;  3RKW A;  3BY7 A;  2KRO A;  1Q86 C;  1AVZ C;  5LJ5 e;  4ELY C;  3L1A A;  1K1Z A;  1X01 A;  1XNI A;  2BZX A;  2AKK A;  1B07 A;  2EIF A;  2XU8 A;  4C0D B;  1NE8 A;  2LQK A;  3OYG A;  3GNG A;  2EYQ A;  4BY6 B;  1OI1 A;  3OYJ A;  2K5I A;  2R57 A;  2YSQ A;  1PRL C;  2MYS A;  4A4K A;  4C92 G;  1MV0 B;  3QJ6 A;  4E7S A;  2QQR A;  4KRT A;  4OGE A;  4J9G A;  3DB3 A;  1Q95 G;  1OOT A;  4RG2 A;  1MMD A;  1D0Y A;  2V8K A;  3HKS A;  3U23 A;  3QZ9 B;  3A98 A;  2JTF A;  2FG0 A;  4ZTJ A;  2HQH A;  4KUL A;  3V8L A;  2EQU A;  3CMA Q;  2XI9 A;  4M7D C;  3H8Z A;  2EYZ A;  4PFZ A;  4PJO A;  3PE0 A;  2D0N A;  2FL7 A;  2BZ8 A;  5GMK h;  3FLG A;  4FYV B;  4LUD A;  3CCE A;  3CCJ T;  4IUQ A;  2CH4 A;  4A4H A;  4CC3 A;  3SFM A;  1X27 A;  3X26 B;  3N5B B;  3CXC A;  4XTU A;  5A0G A;  3QKJ A;  2FRW A;  1B34 A;  2FZG B;  3FJ5 A;  4B9W A;  4KUD K;  4M75 B;  1X6O A;  5KYY B;  2DD5 A;  4ATO A;  5L23 A;  3J81 E;  1WHG A;  1VQ6 Q;  1UTI A;  5KCH A;  3OA6 A;  5GAM g;  4ZGE B;  3A8O B;  3CME T;  2CZ6 B;  4J5Y A;  1AWO A;  2NWM A;  1VOM A;  2K3Y A;  4M75 F;  1BI0 A;  1V29 B;  2HQE A;  1X6G A;  3HRS A;  2KRM A;  4C5H A;  4HKE A;  2GBQ A;  5GMK j;  1VYV A;  3H6Z A;  3CCR T;  1PWT A;  4JS5 A;  1M5Q 1;  1IZ6 A;  4D8D A;  1PCX A;  1WDX A;  2OTJ Q;  1N27 A;  3PIO A;  1UEB A;  2HD0 A;  5HK3 A;  4F14 A;  3M57 A;  1M90 C;  4J9F A;  4OVA A;  2DVE A;  3SWN B;  2H8H A;  2RK1 A;  3QDF A;  4CC4 B;  3VRY A;  2DZ9 A;  4LUE A;  2E5Q A;  2YDL A;  2D1X A;  1T3S A;  2F2V A;  3I5R A;  3PFS A;  2H3J A;  3RMS A;  2A08 A;  2ABL A;  4AFQ C;  1QVF A;  1WHK A;  1JEG A;  4QVC A;  2CUD A;  2L3P A;  3JCM V;  1TU0 B;  4PKC C;  2M02 A;  1PKS A;  1UDL A;  4C0G A;  3I55 Q;  2A7Y A;  1IHW A;  2QGG A;  3OW2 S;  1YCS B;  4J9C A;  2BUD A;  3CPW A;  1VIE A;  1VQM A;  5IXB A;  4OMP A;  5GMK i;  3I9Q A;  2L0A A;  3EFR A;  4FW2 A;  4X1V A;  5GAM e;  1AD5 A;  3CCL T;  3EHQ A;  3MET A;  4M77 E;  2D9T A;  1OX8 A;  4JPB W;  4N0A C;  3OYE A;  4M7A D;  4C5E A;  2RHZ A;  2E12 A;  2ZPE B;  3JCM c;  4V2S A;  2DEU A;  2QQS A;  2FYK A;  1S72 Q;  2W10 A;  1EZZ B;  2IG0 A;  4FYY B;  3RIR A;  4A54 A;  4FT2 A;  5A2Q E;  4D6W A;  1OU9 A;  1VYT A;  3CMA A;  1VA7 A;  1VQ8 Q;  1YJN T;  2EQJ A;  2YLB A;  1Q82 U;  3M0R A;  4XTW A;  1U5S A;  2QTX A;  3A5Z B;  4A4E A;  4M75 G;  4EMK A;  2COY A;  2PU9 B;  3LGF A;  1KC8 U;  1KHI A;  2X3X D;  4Y91 A;  4WCI A;  5AT1 B;  1Z9Q A;  2A37 A;  4M77 G;  2XID A;  3JCM W;  2I0N A;  4M78 B;  4PJJ A;  1FX7 A;  1RAI B;  4FYX B;  3FB9 A;  5I22 A;  2ED0 A;  3EGD A;  3T9N A;  4HCB A;  3E19 A;  2RM4 A;  4C8Q C;  4NS5 A;  4M7A A;  4QKU A;  1R8O B;  4E7L A;  2K6D A;  3LW5 E;  4JJC A;  1ZX6 A;  1TOV A;  1G3T A;  4FW1 A;  1YJ9 Q;  4J6W A;  3CEY A;  5CCA A;  1VQ6 A;  3CD6 Q;  2DER A;  2OTL T;  3UAT A;  4M78 F;  1IRX A;  2F5T X;  2GTO A;  3MP1 A;  5D6W A;  4A53 A;  1W2B P;  4LE9 A;  3UWN A;  2DD4 A;  2JT4 A;  4JRP A;  5FU7 B;  5GAM j;  3L2Z A;  5KYX A;  1I5L A;  4XTV A;  4CI0 C;  1NPR A;  2R5M A;  2QGF B;  2G6F X;  1VQO Q;  1YHQ Q;  2P0P A;  2VVK A;  3HSB A;  1ABO A;  1YN8 A;  2LP5 A;  2DTI A;  1BI3 A;  4OMF B;  4HT8 A;  3TU4 K;  2E64 A;  1RLP C;  2DF6 A;  1BI2 A;  1W1F A;  4NOY A;  3VS4 A;  3JCM g;  1FWZ A;  2GCX A;  5CKD A;  4LD6 A;  5IHK A;  1JJ2 P;  3M55 A;  1GCQ C;  3R6O A;  2FHD A;  1QCF A;  1Y7X A;  2O2O A;  1B3Q A;  3NFC A;  1UGP B;  4J6X A;  4PK4 A;  1MMG A;  2VYT A;  2NUP A;  2QI2 A;  5LJ3 g;  3RMQ A;  1VQN Q;  4E47 A;  1KD1 U;  4JZ3 A;  2DXB A;  2VGN A;  4LDY A;  3MEA A;  2CP5 A;  1WIE A;  2P84 A;  2WSC E;  2XG8 D;  5KYW A;  1YI2 Q;  3QO3 A;  4F7U E;  1TUC A;  2X35 A;  2FO0 A;  4J9E A;  4HVU A;  4M78 E;  4LDX A;  1AEY A;  1VQ9 A;  1WQW A;  2ED1 A;  3NTK A;  1LNX A;  3I55 A;  4PJO C;  4LDU A;  2VXF A;  3QYG B;  2RH2 A;  3M4G A;  1PM3 A;  1Y57 A;  2KQW A;  3S3M A;  4BD3 A;  4FM4 B;  2HDA A;  4IIO A;  4DBR A;  1T0H A;  3OYD A;  3TRE A;  3C0C A;  4JZ4 A;  1WA7 A;  3L42 A;  2LVM A;  2GNC A;  2KSS A;  4FL6 A;  4DBH A;  3EFO A;  4IUT A;  3QWX X;  1G2B A;  2KVQ G;  4ME7 A;  3QII A;  4Y92 A;  3BE3 A;  4PNO A;  3G71 Q;  4F7U G;  4BB7 A;  3VS1 A;  3JCM e;  3JCM X;  5IH2 A;  5KH6 A;  4M78 G;  2QQB A;  1Y96 A;  3GIB A;  2HNI A;  3EFS A;  1LPL A;  1WFW A;  1UGQ B;  4BAC A;  3CCE T;  3FEO A;  4OF1 A;  4JLG A;  1S1N A;  3SDZ A;  2PTK A;  3CPF A;  2WAC A;  4LXC A;  4ZGJ B;  5LJ3 e;  2RQT A;  2XDD A;  4OB2 B;  4J9D A;  1TS9 A;  3OQ5 A;  2RI2 A;  1JXM A;  4M4Z A;  2DIL A;  4RUG A;  1AWJ A;  1P92 A;  3PTA A;  3E2U A;  1X75 C;  3NTI A;  1JO8 A;  2F5K A;  1RUW A;  2HBW A;  3A8G B;  1WPY A;  3EGX B;  1D3B B;  5KYU A;  2M1H A;  4N4G A;  4DBF A;  3CPW S;  1YJ9 A;  3P8B B;  1GFC A;  4B6M A;  3JB9 D;  2FVU A;  2DA9 A;  3CD6 A;  5GAN h;  1K9M U;  5J39 A;  3OBW A;  5LJ3 h;  1CSK A;  1UGS B;  5EC7 A;  1U1T A;  2RJD A;  2AZV A;  4OMO A;  1TWB A;  4C8Q D;  4XAX B;  2MK5 A;  1SRL A;  1N8R C;  3Q1J A;  5GAO p;  1VQO A;  1W6X A;  1YHQ A;  3GF5 A;  3PMI A;  1H64 1;  1K73 U;  2KRS A;  1Q82 R;  1PSF A;  5GAO m;  1ZSZ A;  1KC8 R;  5FU6 C;  4KH1 B;  4LN2 A;  3QDR B;  1IHV A;  5LJ5 f;  1Z9Z A;  4IUP A;  5GAN 2;  1X2Q A;  1W4S A;  2PUO B;  4PL6 A;  3OY9 A;  1WJS A;  1D0Z A;  2CYZ B;  4DOW A;  2LQ8 A;  1ZUY A;  3OYN A;  4L5G A;  3H0H A;  4AG2 C;  4HT9 A;  1E6G A;  4DEX A;  1I07 A;  3HTR A;  2IVW A;  1VQN A;  2RI3 A;  2KNB B;  3J7A F;  2HSE B;  5GAN j;  1D0X A;  3RNJ A;  5LJ3 j;  1M1K C;  2DX1 A;  1I4K 1;  3M5A A;  1NEG A;  3CC2 Q;  1YI2 A;  1GL5 A;  1AT1 B;  4AMC A;  2JUF A;  1VQ5 Q;  1VQM T;  4CC2 A;  2PVD B;  4XK8 E;  4DQ2 A;  3SEM A;  3NHN A;  1SSH A;  3EHR A;  2LT4 A;  1AWX A;  2RJF A;  1LVK A;  4J6Y A;  5HY6 A;  1KQS P;  4R0K A;  4WF2 A;  3TCJ A;  2QQA A;  3C12 A;  2SEM A;  2DBK A;  3RES A;  3DLL A;  3H41 A;  4EMK C;  1M1G A;  3EG3 A;  3DLM A;  4CC7 A;  3CCM A;  2M16 A;  3LYI A;  3TQ7 P;  4XU2 A;  1AZE A;  4C92 D;  2LX9 A;  4Z89 A;  1YIJ Q;  4O5V A;  2P4R A;  4M7A C;  2O9V A;  2FRY A;  2LX7 A;  2EQK A;  3CMA T;  2PVO B;  4J9H A;  3CCU Q;  1K8A C;  4PJN A;  8ATC B;  1N9R A;  3G71 A;  4M77 C;  4E7Z A;  1SKU B;  2EJF A;  2VB6 A;  1KD1 R;  3G4S T;  2GF7 A;  3MPU B;  1WHH A;  3QZ5 B;  3RUX A;  4JJB A;  5FRO A;  1J3T A;  3OSV A;  1GCQ A;  2QK0 A;  1K0X A;  2RA2 A;  3L2R A;  5GMK e;  1Q7Y C;  2DNU A;  5KYN A;  1U06 A;  5AYF A;  2JN0 A;  4RG8 A;  2GFA A;  3CCV Q;  1K76 A;  1RLQ C;  2JMC A;  1G83 A;  3TSZ A;  1MMN A;  1O75 A;  4NL3 A;  4ZTF A;  2EYX A;  4C92 A;  4MML A;  4XU1 A;  4F04 B;  1NLO C;  2GQI A;  1VQ6 T;  3UDC A;  1OV3 A;  2DXC A;  1BCM A;  2O4X A;  2KEA A;  2ZPI B;  2M0O A;  1EIF A;  1WZO A;  1N9S A;  3M56 A;  4KBM B;  3OS0 A;  1YIT Q;  5GAN 6;  3L2U A;  2YUQ A;  4KGZ B;  2DIG A;  1SHF A;  1NJI C;  4QVD A;  2CGH A;  4Z88 A;  1RAF B;  3QBY A;  4ANJ A;  4JRQ A;  2FZC B;  2A28 A;  1QVG A;  3OYF A;  3DKM A;  2D8J A;  3THK A;  3M0U A;  3QXE B;  1WXT A;  2O9S A;  1TH7 A;  2DAQ A;  2YUO A;  4FSX A;  2E3H A;  3TVT A;  4EMK B;  2YRC A;  3CQT A;  2AKL A;  3VS5 A;  3KXT A;  5L8R E;  4J8O A;  3FIF A;  5GAM d;  2MIO A;  2DM1 A;  1WXU A;  1IXD A;  2RMO A;  3ZFJ A;  2B8A A;  3OS1 A;  2EGE A;  2AT1 B;  3V8J A;  2J05 A;  2LTO A;  2VGM A;  2YUN A;  3JRZ A;  4JLI A;  4M7A B;  1SSF A;  3OMC A;  2DEQ A;  3C94 A;  1KQ2 A;  1G3S A;  1SRM A;  1Q81 U;  1OU8 A;  3V7C A;  1YNZ A;  4HVW A;  4BE1 A;  2AK5 A;  1VQ9 T;  3PNW C;  1QKX A;  3VJP A;  3I55 T;  3OYK A;  5DY9 A;  3AT1 B;  3CC2 A;  4AT1 B;  2EGC A;  1K9M R;  1VQ5 A;  3FDR A;  1DJ7 B;  2PNI A;  2AIR B;  3EG9 B;  5KYX B;  3VYH B;  3I56 Q;  3CC7 Q;  3UF4 A;  1ZBX A;  4J9B A;  3GLX A;  2V8J A;  4BI4 A;  1WJR A;  1V76 A;  2AZS A;  3VUB A;  2BZY A;  2ZPF B;  2LJ1 A;  5CR2 A;  1K73 R;  2F2W A;  2HMA A;  1XJW B;  2EBP A;  2JMA A;  3QHS A;  4TVR A;  3WVD B;  4M7D B;  2LT1 A;  1RL2 A;  3M0P A;  1X6B A;  3MJX A;  2DET A;  2EWN A;  2XMF A;  3KUF A;  2NUP B;  4C0Z A;  3CCU A;  1UG1 A;  2J7I A;  3KFV A;  2L3R A;  3CME Q;  1H3Z A;  8AT1 B;  3JAM E;  2RI5 A;  4FSS A;  4M75 E;  1JXO A;  3HFN A;  1MGQ A;  1EX4 A;  1WLP B;  6AT1 B;  3M58 A;  1R0B G;  4XU3 A;  5KYW B;  1RAD B;  5FWC A;  1NPP A;  4PFP A;  2E70 A;  1LJO A;  1M9S A;  2JJ9 A;  1IGU A;  2RHI A;  3CCR Q;  4M7D F;  4BDY A;  5CVI A;  4HXJ A;  2JVV A;  2RQR A;  4M75 D;  2E6N A;  4JDS A;  2DMO A;  3GBQ A;  2DL7 A;  2CT4 A;  4IIM A;  4HVV A;  4MDW A;  4Z02 A;  4M77 D;  3CCV A;  2JW4 A;  1Q86 U;  1I81 A;  2IIM A;  2DBM A;  1ZSZ C;  1YJ9 T;  1MUZ A;  1RAB B;  2KK4 A;  1M2O A;  1RAA B;  3H0I A;  3CD6 T;  2JTM A;  1OUL A;  3O5Z A;  3UA6 A;  2VXE A;  2E6Z A;  2K7A A;  3M9Q A;  2CSQ A;  3JB9 H;  2WSE E;  4MZP A;  3V8K A;  3HP9 A;  1YIT A;  1Q7Y U;  3D7S B;  4JRK A;  1X69 A;  4HCC A;  1VQO T;  1YHQ T;  2HZY A;  4VUB A;  2KT8 A;  3QUI A;  2YWW A;  1U8R A;  4OMQ A;  1Y96 B;  2Y4Y A;  9ATC B;  1YJW Q;  3L2W A;  3PT9 A;  3MP8 A;  1G3Y A;  4PJM A;  2NUT B;  3EG1 A;  5M9O A;  4ESR A;  4M75 A;  1M1F A;  5KYY A;  3O8V A;  3VRZ A;  1T3L A;  3EG2 A;  4FT4 A;  1JU5 C;  3P8D A;  5GAN 3;  1V1C A;  2L89 A;  4M77 A;  3URG A;  3NTH A;  2O88 A;  2HBP A;  2EKO A;  2FEI A;  3NPF A;  1VQN T;  1MV3 A;  1BKB A;  3EH2 A;  1FMK A;  1TUD A;  2LRQ A;  1YI2 T;  5A0L A;  1H92 A;  1YBY A;  4BE2 A;  5KYU B;  2K2V A;  1M3B A;  3OMG A;  1VQ7 Q;  4XU0 A;  3JCM d;  1SF9 A;  2JOY A;  2JXB A;  2EJG A;  2YT6 A;  2KXD A;  3OYC A;  3PVL A;  1W2B S;  1E6H A;  3ME9 A;  3F70 A;  1VQK Q;  2XIC A;  2OTJ A;  2ZCF B;  2MWO A;  3CCM T;  3JCM f;  3I56 A;  5GAN 4;  3CC7 A;  5LJ3 d;  3SWN A;  4M7D G;  2RQW A;  4RTY A;  3HRU A;  2ZPB B;  4LD9 K;  4XTY A;  5I2S A;  1QMC A;  5GAN g;  1Y0M A;  3CC4 T;  1UHC A;  4HCK A;  3MCA B;  3OYI A;  5CO7 A;  1N5Z A;  2Y90 A;  3QSU A;  3VUZ A;  2EAY A;  2M51 A;  4ZGD B;  1JJ2 S;  3OYL A;  2X3W D;  4EDU A;  2DL5 A;  2R58 A;  1QVG S;  2OI3 A;  2BE9 B;  2P0Q A;  3G71 T;  4C92 C;  3VU3 C;  1BK2 A;  2VUB A;  3CXC P;  1ACM B;  2EQI A;  2OTL Q;  2RF0 A;  2DFU A;  1M90 U;  1M27 C;  3AHU A;  1JBM A;  4PLL A;  4Z8A A;  3X20 B;  1BI1 A;  2KMT A;  1Q81 R;  5CQY A;  2E41 A;  3FRN A;  4LNP A;  4E7K A;  4M78 D;  3CCS Q;  3GPL A;  2HAX A;  1PC0 A;  4BI3 A;  3LWH A;  3UA7 A;  3RDV A;  2BE7 D;  1QWF A;  2K5L A;  4C8Q B;  2DXT A;  2JTE A;  3G1J A;  5D6X A;  2RPN A;  1H8K A;  2DPP B;  4GY5 A;  1D1C A;  4UC4 A;  5GAN 8;  3QG1 A;  4OB3 B;  3L2V A;  2DO3 A;  1Y71 A;  2EKH A;  1GCP A;  4L6V 5;  2XKO C;  3G6E Q;  1S72 A;  3MKD A;  4A4G A;  2D6F A;  1ZBJ A;  5GJV B;  3EGU A;  3MEW A;  2K3B A;  2X9H A;  3ZEH A;  4C8Q F;  1QP3 A;  4GLM A;  2DKG A;  4OB1 B;  1VQ8 A;  2I2L A;  3WXM B;  4FCY A;  2FZK B;  2BIV A;  2RNA A;  1AWW A;  5GAN e;  2OAW A;  2HL3 A;  2CP0 A;  4F7U A;  1WXB A;  2EFI A;  7AT1 B;  2QA4 Q;  4M78 A;  2EQM A;  2F69 A;  3S6W A;  4KH0 B;  4IUU A;  5J3B A;  4N4H A;  2SRC A;  2DL8 A;  1YJW A;  1C0M A;  1F1B B;  2K79 A;  1KQ1 A;  1QVF P;  1UHF A;  3LLR A;  4Q5W A;  4E7H A;  2KE9 A;  1UUE A;  1M3C A;  2E4H A;  2KYB A;  1VQ4 Q;  2KI7 A;  4QW2 A;  3G7Z A;  2K57 A;  4Y28 E;  2EGA A;  1Q86 R;  2L3S A;  2ZPG B;  1H3H A;  3E9F A;  3LH5 A;  3CC2 T;  2XDP A;  4XQ3 A;  1NEB A;  2O4X B;  1VQ5 T;  1HXD A;  1WNL A;  2CP3 A;  1FXX A;  4PJO B;  1ZA1 B;  1NYF A;  2LQN A;  4J7F A;  4E6R A;  4MZT A;  1M30 A;  1VQ7 A;  1M8V A;  2PZ1 A;  4DBQ A;  4RTU A;  1K4U S;  3SHW A;  4C0D C;  1FYN A;  2DL4 A;  2LJ3 A;  1VQK A;  4BY6 C;  2DRK A;  2FPF A;  4C5G A;  3VS2 A;  2CUB A;  2X4W A;  1OEB A;  1KSW A;  2L2P A;  4PJO F;  1B34 B;  4FYW B;  3A8H B;  1TXQ A;  1ZSG A;  1SHG A;  5LJ5 g;  2CZ1 B;  1WJQ A;  1M3A A;  2A36 A;  3EG0 A;  4BDZ A;  1I8F A;  3C4S A;  3VYG A;  4RTT A;  1OQK A;  5KE3 A;  3RR6 A;  3CCU T;  3ASK A;  2LNH B;  4R55 A;  3I5S A;  3VS7 A;  2QEX Q;  2J06 A;  3M53 A;  3VS0 A;  3CCQ Q;  4C8Q G;  2D0Q B;  2OTL A;  1QP2 A;  2QQ9 A;  3BDL A;  4HA8 A;  4K11 A;  2G3R A;  3JB9 I;  3M59 A;  4BUG A;  1OPL A;  5GAO r;  2PUK B;  2M9U A;  1YWP A;  2EYW A;  3GNF B;  2YHT A;  2LJ0 A;  4ZN1 A;  2KDS A;  5DLQ E;  3CCS A;  5CAI A;  2KBT A;  1T0J A;  2COW A;  4X9C A;  3CCV T;  1I5O B;  3OBY A;  5IN1 A;  3INZ A;  4JUV A;  1VUB A;  2HCK A;  1UJ0 A;  4M75 C;  1PD0 A;  1QLY A;  3G6E A;  3TEE A;  2CP6 A;  1VQL Q;  1G8X A;  1YIT T;  2RHY A;  1GRI A;  4FIB A;  1VQP Q;  2QDY B;  1U3O A;  4MDX A;  1HJD A;  2KR3 A;  2LNV A;  4LDV A;  3QYH B;  1Y07 A;  1VQM Q;  2QA4 A;  2DL3 A;  2QDL A;  2JS0 A;  5FU6 B;  2ROT A;  1M90 R;  2HQX A;  3OS5 A;  1E7O A;  1M2V A;  5FWB A;  1W2B A;  1UFF A;  3UT1 A;  1OPK A;  3RKX A;  3UPU A;  1UB4 A;  1Q82 C;  4KT0 E;  3JCM b;  5IHI A;  2YXY A;  1XTD A;  4A63 B;  3EGX A;  3M0Q A;  1KC8 C;  1D3B A;  4O6J A;  2L3Q A;  1NYG A;  1ZUU A;  2HKQ B;  2CS7 A;  1GBQ A;  3SWN C;  4BI8 B;  4PJO G;  3V7R A;  1KHC A;  1C1A A;  2CZ0 B;  1VQ4 A;  2V1Q A;  1AHJ B;  2RK2 A;  3X24 B;  2OJ2 A;  4EMH A;  4RKU E;  5LJ5 h;  4EIK A; 
#chains in the Genus database with same CATH homology
 1JJ2 A;  3OW2 A;  2X35 A;  4MDW A;  3LX7 A;  3E9G A;  4M78 E;  1YIJ T;  4Z02 A;  4LDX A;  4M77 D;  2LCL A;  3CCV A;  1VQ9 A;  3JB9 G;  1Q86 U;  1WQW A;  1I81 A;  2JNG A;  1JB0 E;  3RKY A;  5IT9 E;  1YCY A;  3NTK A;  1LNX A;  3I55 A;  2OTJ T;  1ZQ1 A;  1YJ9 T;  2KK4 A;  4PJO C;  4LDU A;  4J7I A;  2VXF A;  1GXI E;  2Y4X A;  4YTL A;  3CD6 T;  3QYG B;  2JTM A;  3I56 T;  4EPC A;  1VQL T;  3CC7 T;  2RH2 A;  3M4G A;  4CRI A;  5LL6 S;  2VXE A;  3S3N A;  2E6Z A;  1QVP A;  1IRE B;  3M9Q A;  3JB9 H;  2KQW A;  5CKH A;  3S3M A;  5C6S A;  2WSE E;  2E1H A;  4FM4 B;  4MZP A;  4BD3 A;  3V8K A;  2PVG B;  3HP9 A;  1YIT A;  1VQP T;  1Q7Y U;  2VV5 A;  1OYX A;  4QVZ A;  3OYD A;  3TRE A;  4JRK A;  4HCC A;  2QXF A;  4OP0 A;  2L8D A;  5EG2 A;  1VQO T;  1YHQ T;  2XD0 A;  4VUB A;  5GAM f;  3QUI A;  3L42 A;  4QQG A;  2LVM A;  1WQ7 A;  2KSS A;  4FL6 A;  4X9D A;  1U8R A;  2LDM A;  4GLK A;  4OGC A;  5A0D A;  2LC4 A;  1Y96 B;  2Y4Y A;  4IUT A;  1N8R U;  4C8Q A;  3L2W A;  2KVQ G;  2V8I A;  3QII A;  3PT9 A;  2OAU A;  4IUV A;  3MP8 A;  4ME7 A;  5GAO l;  1G3Y A;  1OZ2 A;  1KQS S;  5M9O A;  4PNO A;  4M77 B;  3MP6 A;  4F7U G;  2K4Y A;  5LJ5 j;  2C06 A;  4M75 A;  4BB7 A;  1M1F A;  2RHU A;  3JCM e;  1BYM A;  2KAF A;  3JCM X;  4C92 E;  5KH6 A;  4M78 G;  1N6A A;  3O8V A;  2QQB A;  2X4J A;  1Y96 A;  3GIB A;  2HNI A;  2PQW A;  1U1S A;  4FT4 A;  3OYM A;  1PSE A;  5GAN 7;  3P8D A;  2QEX A;  3EFS A;  5GAN 3;  1UGQ B;  2L89 A;  4M77 A;  2MF2 A;  3URG A;  3CCQ A;  4BAC A;  3CCE T;  3FEO A;  3NTH A;  4OF1 A;  2DTO A;  4JLG A;  5D6Y A;  4PJO E;  2RD1 A;  1KD1 C;  4M7A F;  1WGS A;  3SDZ A;  5KCO A;  2HBP A;  3CPF A;  2EKO A;  3QJY A;  2XK0 A;  2WAC A;  3HPW A;  4P5N A;  4ZGJ B;  5LJ3 e;  1VQN T;  1G5V A;  2XDD A;  4XTX A;  5C0M A;  3CC4 A;  4OB2 B;  1JRI A;  1BKB A;  4M77 F;  4X34 A;  3JCM P;  3EAE A;  2RJC A;  3LWI A;  2E65 A;  2LRQ A;  3OQ5 A;  2RI2 A;  5I21 A;  1YI2 T;  1VIF A;  5A0L A;  4JS4 A;  4PJO D;  1YBY A;  4M78 C;  5GAN 5;  4BE2 A;  3RKW A;  3BY7 A;  1Q86 C;  1M1K U;  2K2V A;  2NLU A;  1P92 A;  5LJ5 e;  3PTA A;  4KUI A;  4ELY C;  3L1A A;  3OMG A;  1X01 A;  1X75 C;  1XNI A;  1S72 T;  3NTI A;  4XU0 A;  3JCM d;  2JOY A;  4BE0 A;  2EIF A;  2EJG A;  3OYC A;  1YIJ A;  4XTZ A;  2F5K A;  2XU8 A;  3L2Q A;  4C0D B;  1W2B S;  2MAM A;  1NE8 A;  2LQK A;  3OYG A;  3GNG A;  5GAO q;  3A8G B;  1WPY A;  3ME9 A;  1D3B B;  2EYQ A;  3F70 A;  2M1H A;  4N4G A;  2XIC A;  4BY6 B;  1OI1 A;  3P8B B;  3CPW S;  3OYJ A;  1YJ9 A;  2OTJ A;  2ZCF B;  2K5I A;  2MWO A;  3OYB A;  2R57 A;  3CCM T;  3JB9 D;  5CIU A;  3X28 B;  3JCM f;  2FVU A;  4A4K A;  4C92 G;  1VQ8 T;  3CD6 A;  5GAN h;  3I56 A;  1K9M U;  3QJ6 A;  5GAN 4;  5J39 A;  5LJ3 d;  3SWN A;  3OBW A;  3CC7 A;  1VQL A;  5LJ3 h;  1UGS B;  4M7D G;  1KG1 A;  2QQR A;  1U1T A;  4OGE A;  2RJD A;  3HRU A;  3DB3 A;  2ZPB B;  4LD9 K;  4XTY A;  5I2S A;  3PGG A;  2RJE A;  5GAN g;  3CC4 T;  4RG2 A;  3MCA B;  3OYI A;  3BFM A;  5FU7 C;  4C8Q D;  1VQP A;  4XAX B;  5CO7 A;  2Y90 A;  3QSU A;  2V8K A;  3HKS A;  4MMK A;  2EAY A;  3VUZ A;  1N8R C;  4MZM A;  4ZGD B;  3Q1J A;  5GAO p;  1VQO A;  1YHQ A;  3GF5 A;  3LGL A;  1YJW T;  3PMI A;  1JJ2 S;  3QZ9 B;  1XQH A;  3OYL A;  2JTF A;  4EDU A;  1H64 1;  2R58 A;  1QVG S;  1M4Z A;  1K73 U;  2P0Q A;  3G71 T;  1PSF A;  4HCZ A;  4ZTJ A;  4C0F A;  4KUL A;  4C92 C;  3V8L A;  4M7A E;  3C95 A;  2EQU A;  2XI9 A;  3VU3 C;  5GAO m;  2VUB A;  5FU6 C;  4M7D C;  5FRN A;  3H8Z A;  5J26 A;  4PJO A;  3QDR B;  2FB7 A;  5LJ5 f;  4IUP A;  1K8A U;  5GAN 2;  2FL7 A;  2K5F A;  4JJN K;  1W4S A;  1M90 U;  3AHU A;  2WSF E;  2PUO B;  1JBM A;  4L59 A;  4PLL A;  4PL6 A;  3X20 B;  1BI1 A;  3OY9 A;  1WJS A;  2KMT A;  5GMK h;  3FLG A;  5CQY A;  2E41 A;  2CYZ B;  5CQX A;  3FRN A;  4E7K A;  4DOW A;  3CCE A;  4M78 D;  2LQ8 A;  3OB9 A;  4IUQ A;  3OYN A;  3CCJ T;  4A4H A;  4L5G A;  4II1 A;  2DJZ A;  4HT9 A;  3SFM A;  2HAX A;  1MHN A;  3GPL A;  3X26 B;  4BI3 A;  2IVW A;  5GAO n;  3N5B B;  2AHJ B;  3LWH A;  2R5A A;  2RI3 A;  1VQN A;  3J7A F;  5GAN j;  5CKE A;  3CXC A;  2K5L A;  4XTU A;  4C8Q B;  2DXT A;  3QKJ A;  5A0G A;  5LJ3 j;  1M1K C;  1B34 A;  1I4K 1;  3CBP A;  5D6X A;  3M5A A;  4B9W A;  2DPP B;  3VV0 A;  4E7I A;  5CKB A;  4KUD K;  1YI2 A;  4M75 B;  4GY5 A;  1X6O A;  4UC4 A;  5GAN 8;  3QG1 A;  1VQ7 T;  2DD5 A;  2JUF A;  3KBG A;  4OB3 B;  3L2V A;  2DO3 A;  1Y71 A;  2DZC A;  1VQM T;  4L6V 5;  2PVD B;  2XKO C;  1NZ9 A;  4ATO A;  4XK8 E;  4DQ2 A;  4PLI A;  5GAM h;  3J81 E;  2LT4 A;  4DOV A;  2RJF A;  1S72 A;  4J6Y A;  5HY6 A;  4A4G A;  2D6F A;  1VQK T;  5KCH A;  4WF2 A;  3G4S A;  5CKF A;  3OA6 A;  3TCJ A;  4M7A G;  1LOJ A;  2QQA A;  3M4Y A;  3MEW A;  5GAM g;  4ZGE B;  3C12 A;  3V7S A;  1K9M C;  3A8O B;  3RES A;  3DLL A;  3ZEH A;  4M7D E;  4C8Q F;  1QP3 A;  4EMK C;  1M1G A;  3OYH A;  4F7U B;  3CME T;  2CZ6 B;  4J5Y A;  2DKG A;  3DLM A;  3CCM A;  4OB1 B;  2M16 A;  1VQ8 A;  2I2L A;  3WXM B;  3LYI A;  3OSS C;  2RO0 A;  2K3Y A;  4M75 F;  2BIV A;  1BI0 A;  1V29 B;  2HQE A;  5GAN e;  2GFU A;  3HRS A;  4XU2 A;  2XHC A;  4RCB A;  4C5H A;  1NJI U;  4C92 D;  1G3W A;  2RB6 A;  4HKE A;  4FU6 A;  5GMK j;  4F7U A;  2LX9 A;  3H6Z A;  3CCR T;  2EFI A;  4M7D D;  3MHX A;  1KQS A;  4O5V A;  4M78 A;  4JS5 A;  1K73 C;  2EQM A;  3FC3 A;  2F69 A;  2K3X A;  3S6W A;  2XDB A;  1M5Q 1;  4IUU A;  5J3B A;  4M7A C;  1IZ6 A;  1ZHI A;  3HL8 A;  3LH0 A;  1N27 A;  4N4H A;  3PIO A;  1YJW A;  1UEB A;  3JCM Q;  4R56 A;  3OYA A;  3CMA T;  2EQK A;  4F7U F;  2HD0 A;  2PVO B;  5HK3 A;  1K8A C;  5HK0 A;  1N9R A;  2X4Y A;  3G71 A;  4M77 C;  3HHT B;  1KQ1 A;  3M57 A;  1KD1 U;  1M90 C;  2EJF A;  3ZBD A;  4OVA A;  3LLR A;  3G4S T;  4B9X A;  2GF7 A;  4Q5W A;  2DVE A;  4E7H A;  3SWN B;  2RK1 A;  3QZ5 B;  4QQ6 A;  3RUX A;  5DM7 R;  2L5Q A;  5FRO A;  1OZ3 A;  3OSV A;  3JSC A;  3HFO A;  3M54 A;  4QW2 A;  2RA2 A;  3G7Z A;  2DZ9 A;  2K57 A;  5GAN d;  3L2R A;  2E5Q A;  3CCS T;  4Y28 E;  3OYY A;  5GMK e;  1Q7Y C;  3CCJ A;  3ER0 A;  3PFS A;  2ZPG B;  2H3J A;  3RMS A;  1QW1 A;  2MMP A;  1QVF A;  5AYF A;  2JN0 A;  3E9F A;  4RG8 A;  2GFA A;  4QVC A;  3JCM V;  3OS2 A;  5GAN f;  3CC2 T;  4PKC C;  2XDP A;  3J80 E;  4XQ3 A;  2O4X B;  5LJ3 f;  4C0G A;  2E10 A;  1VQ5 T;  1HXD A;  1O75 A;  1WNL A;  2O01 E;  2A7Y A;  1FXX A;  4NL3 A;  4ZTF A;  3G6E T;  3OW2 S;  4C92 A;  3RER A;  4PJO B;  4J7F A;  4MML A;  4MZT A;  2BUD A;  4XU1 A;  3CPW A;  1VQ7 A;  1VQ6 T;  3SB2 A;  3UDC A;  4M7D A;  1VIE A;  1VQM A;  5FRM A;  1M8V A;  2DXC A;  2DXU A;  4ELZ C;  5GMK i;  2O4X A;  2ZPI B;  2DIQ A;  3QPH A;  2BKD N;  3EFR A;  2M0O A;  4LDW A;  4C0D C;  5GAM e;  3CCL T;  1EIF A;  2MWP A;  2YRV A;  5DLO A;  1VQK A;  1N9S A;  3M56 A;  4KBM B;  3MET A;  4M77 E;  4BY6 C;  2D9T A;  3OS0 A;  5GAN 6;  4C5G A;  4N0A C;  3OYE A;  3L2U A;  3E1S A;  2X4W A;  4C5I A;  2DIG A;  3HRT A;  2DTH A;  3CME A;  1NJI C;  4M7A D;  4QVD A;  2CGH A;  4NL2 A;  4C5E A;  4PJO F;  1B34 B;  2RHZ A;  2E12 A;  2YLC A;  2RHX A;  2ZPE B;  3A8H B;  3JCM c;  3WVE B;  4V2S A;  3CXC S;  3QBY A;  2CZ1 B;  5LJ5 g;  2QA4 T;  1WJQ A;  4JRQ A;  1QVG A;  3OYF A;  3DKM A;  2QQS A;  2FYK A;  2KY9 A;  4QQD A;  4BDZ A;  3QXE B;  3BW1 A;  1I8F A;  3CCR A;  3C4S A;  3VYG A;  2IG0 A;  3A8M B;  1TH7 A;  5KE3 A;  1HK9 A;  2DAQ A;  2VC8 A;  3RIR A;  4A54 A;  4FSX A;  3CCU T;  3ASK A;  4FT2 A;  3X25 B;  4EMK B;  3MO8 A;  3GOX A;  4R55 A;  2X4X A;  5A2Q E;  3KXT A;  4D6W A;  5L8R E;  3PIP A;  3JB9 F;  3M53 A;  3FIF A;  4J8O A;  3CMA A;  4C8Q G;  5GAM d;  2D0Q B;  1YJN T;  2OTL A;  2EQJ A;  4IKF A;  1QP2 A;  2QQ9 A;  2YLB A;  3BDL A;  4HA8 A;  1Q82 U;  4XTW A;  3ZFJ A;  2B8A A;  3OS1 A;  2G3R A;  3JB9 I;  2QTX A;  3A5Z B;  4A4E A;  4M75 G;  3V8J A;  4EMK A;  3M59 A;  4BUG A;  3LGF A;  2PU9 B;  5GAO r;  1VQ4 T;  1KC8 U;  1KHI A;  2PUK B;  3GP8 A;  2CKK A;  2LTO A;  2M9U A;  4Y91 A;  2CZ7 B;  4E7J A;  2VGM A;  3JRZ A;  3PMT A;  3VKI A;  3JCM J;  4JLI A;  3BDU A;  3GNF B;  2YHT A;  3MEV A;  4M77 G;  2XID A;  4M7A B;  1SSF A;  1XOV A;  4ZN1 A;  3OMC A;  2DEQ A;  3C94 A;  3JCM W;  4M78 B;  1KQ2 A;  1G3S A;  1FX7 A;  2KDS A;  5DLQ E;  1Q81 U;  3CCS A;  3V7C A;  5CAI A;  3FB9 A;  4J83 A;  4BE1 A;  4X9C A;  3T9N A;  3CCV T;  4HCB A;  3E19 A;  1VQ9 T;  2RM4 A;  1BIA A;  3PNW C;  3MEU A;  3OBY A;  5IN1 A;  4NS5 A;  3CBM A;  4C8Q C;  5GMK m;  3VJP A;  4M7A A;  3FJP A;  3I55 T;  3INZ A;  1RI0 A;  4JUV A;  3OYK A;  1VUB A;  1R8O B;  5DY9 A;  4E7L A;  3LW5 E;  3CC2 A;  4M75 C;  3DB4 A;  5FLX E;  1G3T A;  2JZ2 A;  1VQ5 A;  2ZGW A;  3FDR A;  1DJ7 B;  4J6W A;  3G6E A;  3CEY A;  3TEE A;  5CCA A;  3A8L B;  1VQ6 A;  3VYH B;  2OTL T;  2MI6 A;  4M78 F;  1ZBX A;  3GLX A;  4RCC A;  2V8J A;  2EJ9 A;  2F5T X;  1YIT T;  4BI4 A;  1O9S A;  1WJR A;  2RHY A;  3MP1 A;  5D6W A;  3VUB A;  2LCC A;  4A53 A;  3CCL A;  2ZPF B;  3CBO A;  3P8H A;  2DD4 A;  3UWN A;  4JRP A;  5FU7 B;  5GAM j;  3L2Z A;  5KE2 A;  5CR2 A;  4FIB A;  1I5L A;  1UGR B;  2QDY B;  4XTV A;  4CI0 C;  1NPR A;  4MDX A;  2R5M A;  2P0P A;  5CK9 A;  2LNV A;  2P4T A;  3HSB A;  4LDV A;  3QHS A;  1QVF S;  5I2M A;  3QYH B;  1Y07 A;  2DTI A;  4TVR A;  3WVD B;  4EMG A;  3JCM h;  4C92 B;  5GMK l;  2QA4 A;  1BI3 A;  4OMF B;  4DA4 A;  4HT8 A;  3SD4 A;  5FU6 B;  2E64 A;  3TU4 K;  3JB9 J;  4M7D B;  2HQX A;  3OS5 A;  1BI2 A;  2GQV A;  2LT1 A;  4NOY A;  3JCM g;  1FWZ A;  1RL2 A;  1W2B A;  2GCX A;  3UT1 A;  2QEX T;  3RKX A;  4C8Q E;  2EWN A;  3UPU A;  3KUF A;  1UB4 A;  3CCQ T;  4C0Z A;  4KT0 E;  4LD6 A;  5CKD A;  3JCM b;  3CCU A;  1Q82 C;  2L3R A;  3M55 A;  1XTD A;  2DK3 A;  1H3Z A;  2A3L A;  3R6O A;  3JAM E;  2FHD A;  1KC8 C;  2RI5 A;  1D3B A;  4M75 E;  1Y7X A;  4O6J A;  3HFN A;  1UGP B;  1MGQ A;  3NFC A;  4J6X A;  1YJN A;  3M58 A;  4JRI A;  2CS7 A;  3SWN C;  4BI8 B;  2VYT A;  4N0A A;  4XU3 A;  4PJO G;  2ZPH B;  4A4F A;  2QI2 A;  3V7R A;  5LJ3 g;  1KHC A;  3RMQ A;  2CZ0 B;  1NPP A;  2E70 A;  4OB0 B;  1LJO A;  1M9S A;  4C92 F;  2DXB A;  2VGN A;  4E47 A;  4LDY A;  2RHI A;  1VQ4 A;  3MEA A;  1Q81 C;  5IAY A;  4BDY A;  4M7D F;  5CVI A;  1AHJ B;  2RK2 A;  3X24 B;  5HKC A;  4EMH A;  2JVV A;  5LJ5 d;  4RKU E;  4M75 D;  2WSC E;  2E6N A;  4IUR A;  4JDS A;  5LJ5 h;  2ZZD A;  1BIB A;  2XG8 D;  4RMO A;  3QO3 A;  3S3O A;  4ZN3 A;  2P0K A;  4F7U E;  4N4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...