2VXEA

Solution structure of the lsm domain of drosophila melanogaster tral (trailer hitch)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
88
structure length
88
Chain Sequence
GAMAMSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CG10686-PA
publication title Similar Modes of Interaction Enable Trailer Hitch and Edc3 to Associate with Dcp1 and Me31B in Distinct Protein Complexes.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 10
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vxeA00
4PJOA 2K57A 2RM4A 3BY7A 3RKXA 5GMKl 4NL3A 3JB9G 5GANj 5LJ5g 5GMKe 4PJOG 4M75D 1I81A 4M77E 4EMKA 2E64A 4M7DD 4M77F 2DTHA 2E1HA 2YLCA 5LJ3h 4C92A 4C8QF 4EMHA 4C8QB 4F7UB 5I21A 4WF2A 4PJOD 5GAMj 4OP0A 4C8QG 4F7UG 5LJ3d 5GAN3 4M7AC 2RA2A 4C92G 5CAIA 5GAOr 1HXDA 3V7RA 4XTVA 4Y91A 1D3BA 5GMKi 4C92D 1I5LA 1WPYA 2HNIA 1BIBA 3QSUA 3M4GA 4M78B 3JCMJ 4M7AA 4XTWA 2CGHA 4M78G 1LJOA 4M75B 3AHUA 5GAOp 4M7DF 4M7DB 1TH7A 4NL2A 3JCMW 4M75G 4MMKA 3V8KA 5GANh 4PJOE 5LJ3e 4M78D 4PJOF 5GAN4 3JCMb 5GAOm 4M7DG 4PJOB 3V8LA 2E10A 4JRIA 5LJ3g 5LJ5j 2EJGA 5GAN5 5GANd 2I2LA 2VXFA 3JB9F 3RIRA 4M7AD 3EFRA 3JCMc 1I4K1 2DVEA 4X9DA 2VXEA 3V7SA 3V8JA 2RB6A 4C8QE 4EMKB 4F7UF 3JCMV 3JB9H 4JRKA 4JUVA 4C92E 3V7CA 2DKGA 4C92F 4C92B 2FB7A 3L2ZA 4XU2A 3JB9I 4M77C 1YCYA 2VC8A 5LJ3f 1H641 3JCMh 3SWNC 1D3BB 4M78E 5GANe 1M5Q1 3JCMd 4M78F 1M8VA 1JBMA 1WQ7A 2EJFA 4XU3A 4M75E 5GAOl 3JCMP 4M75F 4QVCA 3RERA 3QHSA 4M77A 4M7AB 4M7AF 4EMGA 2DZ9A 2DZCA 3SB2A 4M7DE 3SWNA 3QUIA 4M7AG 4HT8A 2DXUA 4V2SA 3BW1A 3FB9A 1U1SA 1N9SA 1I8FA 2YHTA 3RUXA 2QTXA 3GIBA 5GMKj 1Y96A 4XU1A 1JRIA 3JCMQ 4J6WA 4M7DC 4DQ2A 5GAMh 4J5YA 1X01A 2DXTA 4NOYA 5GANf 4QVDA 1LOJA 3JCMe 4PJOC 4PNOA 5GAOq 3JCMg 3VU3C 4A54A 5GAMd 1B34A 2E41A 4HA8A 5GAN7 5GAOn 4XTXA 2E65A 5GAN6 4XTZA 2EJ9A 5DY9A 4HT9A 5GAMf 4C8QC 1KQ2A 3RKWA 4N0AC 1HK9A 4JLIA 4RCBA 4C92C 2YLBA 1LNXA 2DJZA 3JB9J 3INZA 3QO3A 5LJ5e 1KQ1A 5GANg 4M7DA 1WQWA 4J6XA 4M7AE 4A53A 5GAN2 1U1TA 2DTIA 3JCMf 3JB9D 2JN0A 4C8QA 4F7UA 4F7UE 4M77B 4N0AA 5GMKm 5LJ5h 3HSBA 5GAMe 1N9RA 3L1AA 3PGGA 3SWNB 3BFMA 3HFOA 4M77G 2DTOA 4M78C 2EWNA 4XTUA 5GMKh 5LJ3j 5GAMg 2DEQA 5LJ5d 1WNLA 1MGQA 2Y90A 3FJPA 4X9CA 4M75C 3HFNA 4M77D 4XTYA 4XQ3A 2FYKA 2RD1A 4RCCA 1Y96B 4C8QD 1BIAA 2EAYA 4J6YA 5LJ5f 3JCMX 4XU0A 3RKYA 4M78A 4MMLA 3FIFA 2ZGWA 3RESA 1B34B 4M75A 4EMKC 3BDUA 3EFSA 5GAN8
chains in the Genus database with same CATH superfamily
1RLPC 5FWCA 1Q95G 4O5VA 2JTMA 2DD5A 3NMZC 3DKMA 4C8QF 1Q86U 1ZUUA 1OU9A 4BI4A 2LC4A 1LVKA 2LT1A 2HMAA 1WHJA 3HL8A 1LJOA 3AHUA 4RTZA 3RR6A 2K6DA 2RN8A 2NUTB 1JJ2S 2MAMA 4OMNA 3DB4A 3EFRA 1VQNT 4F7UE 4F7UF 2RB6A 2VB6A 1UGPB 3L2ZA 4LD6A 3EAEA 2P0PA 4PFPA 2K3BA 4DBRA 2YRVA 4BUGA 4Y28E 3F70A 1SKUB 1UJYA 1WQ7A 2QASA 5GAOl 1X69A 3QZ9B 1Q86R 2E6NA 3ZL7C 3BW1A 2QTXA 2KDSA 1JXMA 3PMIA 3VRZA 5GJVB 4C0ZA 2IIMA 2IG0A 4AT1B 4C5HA 1K8AC 4PLLA 5GAN6 2E65A 3E9GA 2YUQA 2PUOB 4ANJA 5KCOA 2R57A 1YWPA 2FHDA 1W4SA 5DM7R 2EGAA 2DTIA 1D09B 4N4GA 7AT1B 1AVZC 3MP1A 3VRYA 3L42A 3E1SA 2LQ8A 4M77G 3OS0A 5GMKh 3OYBA 3KBGA 5KH6A 4RCCA 5LJ5f 5KYNA 1EX4A 1BYMA 2XKOC 3PIPA 2EQUA 4BACA 4RKUE 3MEWA 1VIFA 1WXBA 2M0OA 1X43A 2L5QA 2LVMA 1NE8A 1TUGB 3OA6A 3A8LB 4ZGDB 1VQKA 4OMOA 4OB2B 1PG5B 2DYIA 2HQXA 4Y92A 5LJ3d 3HKSA 3CCST 2DE0X 4J9DA 2HSEB 1VYUA 2GBQA 1VQ8Q 2CUDA 4PLIA 1MHNA 5I11A 1OZ2A 3SEMA 3OYAA 4Z02A 5LJ5j 4IUPA 2AT1B 3OYFA 3CMEQ 2J06A 3KFVA 1X75C 3PNWC 3QYGB 4OMMA 1GRIA 4C5GA 4A4KA 4DEYA 1PKSA 2J7IA 4Z88A 5KYWA 1R8OB 4ORZA 4RTTA 1D0YA 1R0CB 2AIRB 1G3TA 3CC2T 1PCXA 4V2SA 2H8HA 3NHNA 3FDRA 3MEVA 1CKBA 3TU4K 1X6OA 4QVZA 4J83A 3JCMQ 2D1XA 4QVDA 2V8IA 4MDXA 4XTXA 4OF1A 2V8KA 1VQ4Q 1WFWA 1KHCA 2EW3A 2QXFA 4KUIA 3JB9J 1WHKA 4PJNA 1YJ9Q 4CC4B 4QT7A 4B6MA 4F7UA 1T3LA 2P0KA 2EWNA 4J6YA 5FU6C 4XU0A 4KUDK 1KD1U 3UT1A 3OY9A 3H9NA 2RHYA 4KULA 2WSFE 1OX8A 2QA4A 1I1JA 4QKUA 1BBZA 1OPKA 3CCUA 1M3BA 2E64A 1U8RA 2XK0A 1UJ0A 5FWBA 3WVDB 1VQNQ 2P0QA 3GBQA 1QWEA 1UGRB 2COYA 4DBQA 1HD3A 3JSCA 1TTHB 2LQWA 4IUVA 1PRLC 1C6VX 4M78G 4NL2A 1YJWQ 5GAN4 2L3QA 4OMQA 1VQKT 1M8MA 3CCMT 2NWMA 1SRLA 1T3SA 2QDLA 1KD1R 1E7OA 2CYZB 2K4YA 2MWPA 3AT1B 2EKHA 2RJCA 1Q81U 4DBFA 5CKHA 3I56T 5GANe 3JCMd 1NLOC 1WJRA 3RERA 2CSQA 4M7AF 2RH2A 4EMGA 1A0NB 1NEBA 4ELZC 1N8RU 2WSEE 3G71A 2V1RA 1SSFA 1ARKA 5EC7A 4ZGEB 5GAN7 1ZUYA 2EJ9A 4JS5A 1SPKA 1GCQC 3ASKA 4QQDA 4JLIA 3C12A 5KYWB 2LJ1A 2DJZA 2J6FA 4FYXB 2OTJT 1ZUKA 4A53A 1ZA2B 2DIGA 5L8RE 1GFDA 1K4US 1AHJB 1KQSA 1K0XA 1WJSA 2O2OA 5C0MA 1Q81R 4KGVB 2HL5C 2P4TA 3RKYA 3CCSQ 5IXFA 1IXDA 2JS2A 5CQXA 4BD3A 4Z89A 3RESA 3CEYA 3M0QA 4BY6C 1N8RR 2F2XA 1N5ZA 1YFNA 2IPOB 1WJQA 2ED0A 4F16A 3META 1Y71A 4HCKA 1IZ6A 5I21A 2B8AA 3HRSA 4F7UB 2JM8A 2CUBA 1V29B 4RTWA 4XTVA 4Y91A 1YN8A 2DF6A 2YUOA 2QA4T 3NPFA 3I35A 4HKEA 2QQAA 3CBMA 1VQPT 1MMGA 5GAOm 3VS5A 4HVUA 5FRNA 3OYDA 2QTVA 4RTUA 2RJDA 1IGQA 3CCJT 4RTXA 3D7SB 5KE2A 3JB9H 2LTOA 2LX7A 1Z9QA 2HQHA 3MPUB 3OQ5A 3CD6T 3LH5A 5LJ3f 2K5IA 3OW2A 3QZ5B 1JBMA 1U5SA 1VQOT 1QP3A 2MI6A 2DZ9A 1VQ8A 3BE3A 2GTJA 4D8KA 2AHJB 3OSSC 1KIKA 3FB9A 1MMAA 1XQHA 4R0KA 3DLMA 2KT8A 3OS2A 2X4JA 3GNFB 2G6FX 1KC8C 3M54A 3ZBDA 4CRIA 4M7DC 1M90U 4PJOC 5GAOq 3VS3A 1BB9A 5IHIA 3L2RA 4RCBA 2KRSA 1X27A 2QGGA 5GANg 4OB0B 2L0AA 4IKFA 5D6WA 1GFCA 3ZFJA 2JN0A 3G6EQ 4TVRA 2KRNA 5CKDA 3PGGA 4FM4B 5LJ3j 5GAMg 2QQSA 5LJ5d 1S1NA 3FJPA 3Q1JA 4MZTA 3HFNA 1Q7YC 2V26A 3OMGA 1YCSB 1W2BA 2YDLA 3BDLA 3TEEA 3OBYA 1T0JA 2KXCA 2RPNA 3RMSA 1UGSB 1VQ4A 2L3RA 4QW2A 2IVWA 2XU8A 1BU1A 1YJ9A 3I5RA 8AT1B 1M90R 2PZ1A 1G3WA 3QWYA 1ABQA 1D1CA 2RA2A 1CKAA 1HXDA 3NTHA 4JJBA 1WZOA 1UTIA 2E5QA 3UPUA 5GMKi 4EDUA 3FJ5A 1W2BP 1VQ9Q 3VS0A 3L2VA 4M7DF 1WDXA 1TH7A 4PJOE 1PD0A 4PJOF 1FX7A 4J8OA 1M2OA 1JJ2A 4R56A 3RIRA 1I4K1 3C95A 4X9DA 1JB0E 3VS4A 4RTYA 3GNGA 2XICA 2FPFA 3EH2A 5KCHA 1VQNA 1QVGS 2BZ8A 2KY9A 1Y07A 1NJIC 2BE9B 5HCKA 3QBYA 1GCPA 1H641 2L2PA 2KE9A 2BE7D 1JEGA 3QHSA 4KBMB 1K8AU 1M2VA 3J81E 3A8HB 2OTJQ 1UGQB 1N9SA 1YJWA 1KFZA 1JU5C 4LNPA 3GIBA 2H3EB 4LN2A 4PFZA 1UECA 1WLPB 4E7SA 4PNOA 3CPWS 1NLPC 3UA6A 1E6HA 2JOYA 4J7IA 2DNUA 4C8QC 3QJ6A 2Y4XA 5C6SA 1VQ7T 3INZA 2ATCB 4OGCA 3JB9D 3JCMf 1JXOA 1SEMA 2RJFA 1OEBA 1YNZA 2ZPGB 2EBPA 3BFMA 3CMET 4OVAA 1OI1A 2CH4W 1F1BB 4M77D 1FXXA 4OGEA 3ZEHA 4GY5A 1PWTA 1FMKA 4E6RA 1D1AA 5FRMA 2FO0A 3BDUA 1K8AR 1WXUA 4WTOB 3A98A 2LCCA 1WHHA 1BI3A 1VQPQ 3QDRB 1I81A 1JQQA 1ZLMA 2OAWA 2PUKB 3CCJQ 1YP5A 4JZ3A 2DJQA 4C92G 3U23A 2DAQA 2Y4YA 3CD6Q 3PFSA 1VQ4T 3FC3A 3CCSA 4XTWA 5GAOp 1YJ9T 4FCYA 1VQOQ 3M53A 5GANh 2NUZA 4PKCC 5FROA 5CCAA 2JNGA 2KVQG 2QYZA 2RI5A 3JCMc 4C5EA 4C8QE 5FLXE 2VXEA 1AT1B 3JCMV 1ZHIA 3LH0A 2B86A 1GBQA 1NYGA 2X4YA 4B9XA 4FIBA 2X4WA 1H3HA 3MHXA 2DPPB 2VASA 1PSEA 3CC2A 2YRDA 4MDWA 4J5YA 2JT4A 4OB3B 4WCIA 4F14A 1RLQC 1TUDA 4AG1C 1UUEA 2RQTA 4HCBA 1KQ2A 3RKWA 2NYSA 8ATCB 1RUWA 4QQGA 2VVKA 1YJWT 2I0NA 3M59A 1RABB 2DXCA 4Q5WA 3HSBA 1M2VB 1S72Q 2YXYA 1TSFA 3A5ZB 1EFNA 2RD1A 2J6OA 4E7KA 1BIAA 3LGFA 4C0DC 1SG5A 2JS0A 2O4XA 2X35A 5M9OA 2ZGWA 3QPHA 3EG9A 2LQKA 4IURA 5J3BA 2L3PA 1BK2A 3JB9G 1IB8A 3BY7A 3QXEB 4LDWA 1M9SA 2SRCA 2K7AA 4BI3A 1YIJT 1OX9A 2YSQA 2YLCA 3TCJA 4C92A 3M0PA 3G4SQ 5L23A 1J3TA 4F7UG 1M3CA 2LZ6B 4CC3A 2QQ9A 2ED1A 2PQWA 2MOXA 2ZPBB 2VWFA 4AFSC 1D3BA 1BIBA 3VS7A 1VUBA 2LQNA 1QKXA 3N5BB 1V1CA 4RG2A 1QCOA 4M78D 5EG2A 5LJ3g 1ZQ1A 1M30A 3MJXA 3CBOA 3QG1A 1R77A 2DVEA 1ZX6A 1XJWB 2A08A 1SSHA 4J9HA 2DKGA 3CCMA 3OYYA 2LJ3A 4II1A 1G2BA 2CREA 1IREB 3T9NA 5HK3A 2EJFA 3HRTA 1VQ7Q 4GLMA 3I56A 2KRMA 1VQ9A 4HT8A 2C0TA 1AWOA 1U1SA 2XHCA 2E5KA 1Y96A 2DRMA 1HSQA 5I22A 3M0RA 5I2MA 3VYGA 2KGTA 3CQTA 4A54A 1B34A 2E41A 2YT6A 2ZAEA 2QEXQ 2JM9A 1M1KC 2A3LA 2HD0A 2LJ0A 2EKOA 2G3RA 2CH4A 2EYYA 1O75A 1IHWA 4C8QA 3PMTA 2Z0WA 2RMOA 2CP3A 2DTOA 2OTJA 2L8DA 2MK5A 1PHTA 4XTYA 1AOJA 2RHUA 4JLGA 1CSKA 1FMVA 2JZ2A 2PU9B 2H3JA 2F2VA 3PVLA 3SD4A 2M9UA 2OAUA 5GMKl 1TOVA 1YITT 3X25B 2A0FB 4WF2A 5I2SA 1VIEA 2A7YA 4M7AC 4HCZA 5D7UA 2DFUA 2P84A 3QDFA 4ME7A 2O4XB 4LDXA 3EG9B 2VYTA 2K2MA 4BE1A 3V8KA 3JCMW 3WXMB 1YI2T 1PC0A 3G6ET 4KH0B 1GBRA 2OX7A 1Y0MA 2M16A 4ZTFA 1Z9ZA 1VQPA 4OMFB 4JRKA 2ZZDA 4C92B 6AT1B 4RTVA 3CCJA 2QK0A 2RK2A 2CZ6B 1YCYA 2PVDB 1D3BB 5FU7B 1KC8U 3CD6A 3REAB 5HKCA 2DIQA 3LX7A 4LDUA 4C0GA 1YHQQ 4CI0C 2VV5A 2DXUA 4N4HA 1VQOA 3VUBA 4XAXB 3VS1A 2DYBA 5GMKj 1UDLA 4LUDA 2KR3A 1BI0A 1U3OA 3JCMg 4ZN1A 5DY9A 1BI1A 2C0OA 2OTLQ 4N0AC 3CCRT 1Q7YU 1VQ9T 4LD9K 1I0CA 2FVUA 3OB9A 5LJ5e 2O9VA 1K76A 4M7AE 3P8HA 1T0HA 5ECAA 1Y7XA 1V76A 3CCQQ 5GAMe 1OV3A 1YIJQ 1VQ6T 5CVIA 4QQ6A 4E7IA 4FT2A 2FYKA 1Y96B 3PT9A 1WHLA 3H8ZA 1KC8R 1B34B 3VKIA 2LX9A 2QGFB 5CO7A 2RM4A 2MWOA 3RKXA 1MNDA 1OULA 1H92A 1XOVA 1BI2A 3O8VA 3A1PA 1VA7A 4HVVA 4EMHA 4C8QB 1D1BA 5FW9A 1OYXA 1PRMC 2HKNA 2KEAA 2O31A 3UATA 3V7RA 2K5FA 1QP2A 2EIFA 1S72A 2KMTA 2EQMA 1Q7YR 1G83A 3CC7T 4JJCA 4CC2A 4YTLA 3TVTA 1GL5A 4RMOA 1QW1A 1NJIU 3CCEQ 1HJDA 3OYHA 4E7HA 3V7CA 1MMNA 3JB9I 4DOWA 2CZ1B 1KQSP 2CZ0B 1X2KA 3HP9A 4ESRA 1H3ZA 3J80E 2DL8A 2WSCE 5LL6S 2DLPA 2EYXA 3RBBB 5J39A 2EYWA 1VQLT 1AD5A 2BTTA 5CKEA 3EHRA 4JPBW 3CPWA 3I55T 3CBPA 1NJIR 2FG0A 4HVWA 2GNCA 4J7FA 1AWWA 1WQWA 2ENMA 1G8XA 3C94A 1VQ7A 3OSVA 3RNJA 1C1AA 1YITQ 2OJ2A 4P5NA 4M75C 4KH1B 1OPLA 2D9TA 1VQ5Q 3CMEA 4D8DA 3UF4A 2EAYA 3EH1A 3UDCA 2KXDA 2XDPA 2QEXA 2RNAA 5KYUA 2AK5A 5LJ5g 2DL3A 2DXBA 1YI2Q 3OW2P 1IHVA 2DTHA 2RF0A 2GGRA 4PJJA 1IRXA 3EG1A 1VQMT 4C92D 1I5LA 4MZMA 9ATCB 1QVFA 4FU6A 2DM1A 3JCMJ 4M7AA 4DEXA 2X4XA 3VYHB 2JVVA 2K3YA 2HZYA 3H6ZA 3HTRA 5GANd 2BIVA 3V8JA 5HK0A 4AFQC 5A0GA 2LCLA 3NGPA 5KYXA 4E7LA 1S72T 3GOXA 1RL2A 3C0CA 2PNIA 2M1HA 2E4HA 3CCRQ 2D8JA 1SHFA 4M75E 2COWA 4M75F 3JCMP 4M7DE 1MV3A 3SB2A 4J9BA 3QUIA 1QVFP 3GF5A 2KQWA 2RI3A 3G4ST 1VQ6Q 2C06A 2FRYA 3H0HA 1RI9A 4UC4A 2D8HA 1RAIB 1X6GA 4XTZA 3MEAA 4HT9A 2GCXA 1ZSZC 1HK9A 2DETA 1YWOA 3A8MB 2E12A 3ER0A 2L3SA 3X20B 2CZ7B 5GMKm 2BKDN 4N0AA 1N9RA 3MKDA 4L59A 2ZPHB 4XQ3A 1C0MA 4LUEA 4C8QD 2CS7A 2DL7A 2M0YA 1JJ2P 4FSSA 2DX1A 4MMLA 4ZGJB 3FIFA 2JMAA 2E3IA 1QWFA 1G3SA 2XMFA 2O01E 3CC7Q 2OTLA 1X6BA 2F2WA 4PJOG 3JV3A 3M4YA 1GCQA 5IN1A 3M5AA 2DERA 2YRCA 2ESWA 2KNBB 3CXCS 1QLYA 3LWIA 2RI2A 3CCVQ 3CMAT 2LRQA 5GAN3 4A4FA 1YIJA 1NYFA 1OOTA 5GAOr 3NTIA 3IQLA 2F69A 3M58A 5IXBA 1DJ7B 2QEXT 1KSWA 1D0ZA 2CGHA 3OYEA 2HQEA 5IHKA 2EQKA 2VGNA 5LJ3e 2L89A 5KYUB 3V8LA 5GAN5 2ZPEB 3X26B 2CP5A 4FYWB 1VQLQ 2QG9B 2JTEA 1UHCA 2EQIA 4PK4A 4J9IA 3VJPA 4M77C 2JW4A 3EGDA 3I55Q 2A28A 1M27C 2CT3A 4M7AB 4Z8AA 3QWXX 3OYJA 1M1KU 5FU6B 4L5GA 1I8FA 2ECZA 3FLGA 4BDZA 3CC4T 3MP8A 3O5ZA 1SHGA 4HCCA 1IGUA 4J6WA 5GAMh 4FYYB 1X01A 3L2QA 1W2BS 3M0TA 2HEQA 5KYXB 1QKWA 3WVEB 5GAOn 3PE0A 1K0SA 3P8DA 3GPLA 2X3XD 2M02A 4KGXB 3PIOA 2A37A 1RAFB 2E70A 3G7ZA 3OMCA 1AWJA 1VYTA 1WX6A 5IHNA 4EIKA 4X34A 3NTKA 4XK8E 1TXQA 2W0ZA 2BZYA 1EZZB 1QMCA 2J05A 2PTKA 4HXJA 2DEQA 4IIOA 1N27A 2VKNA 4C5IA 1RAAB 4GLKA 2AZSA 5CIUA 2MF2A 2R58A 4JS4A 2YUPA 1VQMQ 1YJNT 2HBPA 3R6NA 4M75A 2QAZA 4EMKC 4M7DA 1VYVA 3EFSA 3JB9F 4PJOA 3G71Q 1M1KR 1YHQT 2LT4A 4M77E 3EG2A 2XIDA 3CCLQ 4M77F 2AZVA 2KYBA 3URGA 2HCKA 2KYMA 4C8QG 1YITA 1K9MC 4E2FB 2A36A 1ZBJA 1VQ5A 5DLQE 2GQVA 2BUDA 3OYCA 2MCNA 1BCMA 3NFCA 2OTLT 4BE0A 1OZ3A 1PSFA 1ZSGA 3LWHA 2XI9A 2JTFA 2EJGA 4LXCA 4K11A 3CCQT 2LP5A 2LMJA 3OS1A 1YI2A 1IO6A 3G6EA 2X51A 4O6JA 2LCSA 3TSZA 3RDVA 3H0IA 3VUZA 2ROTA 2VC8A 4BDYA 1R0BG 4NS5A 2RO0A 2QQBA 3OYIA 1GXIE 4M4ZA 2FZGB 2RK1A 2JMCA 3RUXA 4C0FA 3EGXA 4DBHA 1JRIA 2FPEA 4DQ2A 5GANf 1LOJA 1H8KA 2PVOB 4BY6B 3JCMe 4BE2A 2D0QB 3PTAA 1RAEB 2DD4A 4HA8A 1ACMB 1B3QA 5GJWB 4PFOA 1FYNA 1UEBA 5GAMf 2R5AA 4AG2C 1MV0B 3EGDB 3VS2A 3QO3A 1U06A 1FWZA 4J6XA 3CCRA 3HHTB 3H0FA 1KK7A 3CCET 1ZSZA 4KGZB 3HFOA 4M78C 4AFZC 3KXTA 1MGQA 2AKLA 4X9CA 3DB3A 1RACB 3X24B 3CMAQ 3EG0A 2HBWA 2YWWA 1M3AA 3JCMX 1VQ6A 1AWXA 3FEOA 3E9FA 4LE9A 3QKJA 1EIFA 4CC7A 2GFUA 2EVRA 4ZN3A 4GBQA 5GANj 2K3XA 3GP8A 4ZNXA 5CKFA 5GAMj 4FSXA 4A4GA 1MUZA 5IH2A 3E2UA 1N6AA 3E19A 2F5TX 4R55A 3OYNA 2ZPFB 1SF9A 3ULRB 2RQRA 2O9SA 1M4ZA 3MP6A 2NLUA 3G1JA 1AZGB 3SHWA 3KUFA 1Q86C 2E6ZA 2HL3A 4M75B 2SEMA 2AKKA 4M7DB 2RHIA 3CC7A 2FRWA 4PJOB 4JRIA 1RADB 1X2QA 2VXFA 4MZPA 4M7AD 4PJLA 3H41A 3CC4Q 1NG2A 4JUVA 1VQ5T 2GQIA 5KE3A 3CCVA 2RHZA 2HAXA 2KT1A 3SWNC 4AFUC 3OS5A 4ATOA 4M78E 1M8VA 1KJWA 4M78F 2F1LA 4E7JA 4M77A 2LNVA 2DK3A 5D6XA 3RMQA 2DILA 2YHTA 2ZCFB 3QJYA 3OYMA 1XNIA 1Y57A 3UA7A 1VQLA 1NM7A 3P8BB 4N4IA 4BB7A 3OYKA 1YJNQ 5AT1B 3I9QA 1OQKA 3HPWA 1LNXA 3I55A 1KQ1A 2HSPA 4FT4A 4KRTA 3UWNA 4A4HA 3SDZA 2DBKA 3ME9A 2FEIA 3L1AA 3EG3A 3R6OA 4JJDA 1WNLA 3THKA 1RAGB 3EGXB 2D0NA 2K9GA 2CDTA 4JRQA 4JDSA 4PL6A 1G3YA 1VOMA 3M0SA 5GAN8 2C0IA 2EFIA 2K57A 5D6YA 4EMKA 2JUFA 5LJ3h 1NPRA 2DO3A 1ZSZB 2CP6A 4OP0A 1WA7A 5IAYA 3LW5E 3L2WA 2DEUA 2EGCA 2DMOA 1W70A 1VQMA 3OYLA 3M9QA 3VS6A 2DL4A 1TG0A 3DLLA 2MPXC 2VUBA 4MMKA 4DOVA 4FW2A 5KYYA 1ABOA 4J9EA 2E3HA 4JRPA 2EPDA 3CCLA 2FB7A 1NPPA 3REBB 4RUGA 1PD1A 5CKBA 1QVPA 4IIMA 2DL5A 2ABLA 2J6KA 4QVCA 1WYXA 1RI0A 4M7AG 1BKBA 1PKTA 1TWBA 1K73U 1UFFA 2FZCB 2XDBA 2WACA 1PNJA 1AEYA 3CCVT 5A2QE 3LGLA 1B07A 1RAHB 2RQUA 4NOYA 3EFOA 3S3OA 2KBTA 3VU3C 3G4SA 1NBEB 3S3MA 1QVGA 4PJMA 4FL6A 1LCKA 4B9WA 5DLOA 2MYSA 2KI7A 2FL7A 1U1TA 1JO8A 4M77B 2F5KA 2ROLA 3M57A 5CQYA 2CP2A 4XTUA 4E47A 3M55A 2BZXA 3S6WA 3I5SA 4L6V5 1MMDA 2P4RA 3EGUA 3A8OB 1UE9A 1UG1A 4M78A 1WXTA 1YBYA 3LYIA 3CCUT 2CSIA 4JZ4A 1QVGP 4NL3A 2QQRA 1K73R 2W10A 3LLRA 3TQ7P 5GMKe 3CC2Q 1BCOA 1WI7A 4M75D 3X28B 4A63B 1I5OB 4M7DD 1KG1A 1KD1C 3HRUA 3CXCA 4PJOD 1QCFA 1O9SA 1HYOA 1LPLA 2O88A 3CMAA 2KAFA 1WHGA 3QSUA 1Q82U 2K79A 2KROA 3FRNA 1WGSA 3CPWP 1ZBXA 3TSWA 1WHMA 1QQJA 5J26A 3JCMb 2E10A 1TU0B 4AMCA 4FYVB 2KSSA 5HY6A 4OMPA 2D6FA 4EMKB 2V1QA 4E7ZA 1B7TA 2CP0A 4LDYA 2EYQA 3CXCP 2PVGB 3JCMh 4VUBA 2NUPA 4OMLA 2DBMA 1M5Q1 2XG8D 3G71T 4XU3A 2GTOA 1K9AA 2MMPA 3SWNA 4LDVA 2CP7A 4C0DB 3CCLT 1Q81C 2MIOA 2RQWA 5KYYB 1OU8A 4X1VA 4XU1A 5AYFA 2JJ9A 2DXTA 2JXBA 2HKQB 2YUNA 5GAMd 1Q82R 3CC4A 4D6WA 5CK9A 2RQVA 1N8RC 4J9GA 4C92C 1D0XA 2YLBA 4F04B 3MCAB 3TREA 2QI2A 5GAN2 1MNEA 4JJNK 1KHIA 1UHFA 3GLXA 1K1ZA 1VQKQ 3CCMQ 5FU7C 1KQSS 4BI8B 2XD0A 4FW1A 2Y90A 3EHQA 3QIIA 1AZEA 4OB1B 2VGMA 3EFOB 3VV0A 1SRMA 1UGVA 2K5LA 3I56Q 1K73C 4XU2A 1K9MU 1NEGA 1YJNA 2V8JA 2XDDA 2LDMA 2NUTA 2LNHB 2K2VA 1PM3A 2R5MA 2FZKB 2E1HA 2EYZA 3MEUA 4IUUA 1YHQA 3J7AF 1E6GA 3CPFA 4RG8A 3C4SA 5CAIA 2EGEA 1WPYA 2HNIA 4IUTA 3M4GA 4M78B 3OYGA 3M56A 1ZA1B 1NZ9A 4M75G 4M7DG 4DA4A 2I2LA 4J9FA 1I07A 2DVJA 1M1FA 2X9HA 2RJEA 2KK4A 3V7SA 1W6XA 4C92E 4C92F 3CCQA 3A8GB 3SFMA 1XTDA 1K9MR 3JRZA 1VQ8T 3PVQA 3OW2S 2ZPIB 3OBWA 2COZA 1TS9A 2DZCA 1TUCA 1W1FA 3M0UA 1Q82C 3MO8A 1G5VA 5A0DA 1FMWA 3QYHB 1M1GA 4EPCA 4A4EA 3S3NA 3JAME 2HDAA 5CR2A 2M51A 2QDYB 2QA4Q 2GFAA 3CCUQ 2NUPB 2DA9A 5IT9E 5A0LA 2CKKA 4ELYC 1M90C 2GF7A 2RHXA 1P92A 4IUQA 2FPDA 5LJ5h 2OI3A 3SWNB 4F17A 1UB4A 3L2UA 3CCEA 4KT0E 2DRKA 2CT4A 2X3WD 2EQJA 1WIEA 1QCNA 1QVFS 4ZTJA 4J9CA
chains in the Genus database with same CATH topology
1VQ4A 2GFUA 5CO7A 2L3RA 2RM4A 2MWOA 3RKXA 4ZN3A 4QW2A 2IVWA 5GANj 1XOVA 1BI2A 2XU8A 3O8VA 4O5VA 2JTMA 2DD5A 1YJ9A 3DKMA 4EMHA 4C8QF 2K3XA 4C8QB 3GP8A 1Q86U 1G3WA 5CKFA 1OYXA 5GAMj 4FSXA 2LC4A 4A4GA 4BI4A 1N6AA 2RA2A 3E19A 1HXDA 2F5TX 3NTHA 3V7RA 2ZPFB 4R55A 2K5FA 3OYNA 1QP2A 2EIFA 2E5QA 3UPUA 2KMTA 5GMKi 1S72A 2EQMA 1M4ZA 2LT1A 3MP6A 1G5VA 2NLUA 4EDUA 3CC7T 3KUFA 1Q86C 3HL8A 2E6ZA 1LJOA 4YTLA 4M75B 3AHUA 3L2VA 4M7DF 4M7DB 1TH7A 4RMOA 2RHIA 3CC7A 4PJOE 1QW1A 1FX7A 4PJOF 4J8OA 1NJIU 4PJOB 4JRIA 1JJ2S 1JJ2A 4R56A 2MAMA 2VXFA 4MZPA 3DB4A 3RIRA 3CMET 3OYHA 3EFRA 4M7AD 1I4K1 1VQNT 4E7HA 3C95A 4X9DA 4F7UE 1JB0E 4F7UF 2RB6A 4JUVA 3V7CA 1VQ5T 1UGPB 3GNGA 2XICA 3L2ZA 5KCHA 5KE3A 3JB9I 1VQNA 4LD6A 3EAEA 2P0PA 3CCVA 2KY9A 2CZ1B 4DOWA 1QVGS 1Y07A 2CZ0B 2RHZA 1NJIC 2YRVA 2HAXA 3QBYA 1H641 4BUGA 4Y28E 3SWNC 3F70A 3OS5A 4ATOA 4M78E 1M8VA 3HP9A 4M78F 1WQ7A 1H3ZA 5GAOl 4E7JA 3QHSA 4KBMB 4M77A 3QZ9B 2LNVA 2DK3A 1K8AU 3J80E 5D6XA 3A8HB 2WSCE 5LL6S 3RMQA 2E6NA 1UGQB 3J81E 3BW1A 1N9SA 1YJWA 2YHTA 2QTXA 2ZCFB 3QJYA 2KDSA 3GIBA 5J39A 3PMIA 1VQLT 5CKEA 4C0ZA 3OYMA 2IG0A 4PNOA 1XNIA 4C5HA 3CPWS 3CPWA 4PLLA 1K8AC 1VQLA 3P8BB 4N4IA 3I55T 2JOYA 2E65A 4BB7A 5GAN6 3E9GA 3OYKA 3CBPA 4J7IA 4C8QC 3QJ6A 2PUOB 2Y4XA 3HPWA 5C6SA 5KCOA 2R57A 1LNXA 3I55A 1VQ7T 3INZA 2FHDA 1KQ1A 1W4SA 5DM7R 4J7FA 1WQWA 3C94A 4OGCA 4FT4A 3JB9D 2DTIA 3JCMf 4N4GA 3UWNA 1VQ7A 3OSVA 3MP1A 4A4HA 3L42A 3E1SA 3SDZA 2RJFA 2ZPGB 3L1AA 3ME9A 2LQ8A 3BFMA 4M77G 3OS0A 5GMKh 3OYBA 4OVAA 1OI1A 3KBGA 3R6OA 4P5NA 1WNLA 5KH6A 4M75C 4M77D 2D9TA 3CMEA 4RCCA 1FXXA 4OGEA 2EAYA 3ZEHA 5LJ5f 3UDCA 4GY5A 4JRQA 4JDSA 1BYMA 2XKOC 4PL6A 3PIPA 2EQUA 1G3YA 4BACA 4RKUE 5FRMA 2XDPA 3MEWA 3BDUA 1VIFA 2QEXA 2EFIA 2K57A 2LCCA 1BI3A 2M0OA 5LJ5g 2L5QA 2DXBA 5D6YA 3QDRB 1I81A 2LVMA 4EMKA 2PUKB 2JUFA 1NE8A 2DTHA 5LJ3h 1NPRA 2DO3A 3OA6A 3A8LB 4ZGDB 1VQKA 4OP0A 4OB2B 5LJ3d 2HQXA 5IAYA 3LW5E 3HKSA 4C92G 3CCST 1VQMT 3L2WA 2DAQA 2Y4YA 3PFSA 4C92D 1I5LA 4MZMA 1VQ4T 3FC3A 1QVFA 3CCSA 1VQMA 3OYLA 4FU6A 3JCMJ 4M7AA 3M9QA 4XTWA 3DLLA 4PLIA 5GAOp 1YJ9T 1MHNA 2VUBA 1OZ2A 2X4XA 3M53A 5GANh 4MMKA 3VYHB 2JVVA 4PKCC 2K3YA 4DOVA 3H6ZA 3OYAA 4Z02A 5FROA 5CCAA 2JNGA 2KVQG 4IUPA 5LJ5j 5GANd 3OYFA 2RI5A 3JCMc 4C5EA 2BIVA 4C8QE 3V8JA 2VXEA 5FLXE 5HK0A 4JRPA 5A0GA 2LCLA 1X75C 3PNWC 3QYGB 3JCMV 4E7LA 1S72T 3CCLA 2FB7A 1NPPA 1ZHIA 3GOXA 4C5GA 4A4KA 1RL2A 5CKBA 1QVPA 3LH0A 1R8OB 2M1HA 2X4YA 4M75E 4B9XA 3JCMP 4M75F 1G3TA 4FIBA 4QVCA 4M7DE 2X4WA 3SB2A 3CC2T 1RI0A 3QUIA 3MHXA 1BKBA 3GF5A 4M7AG 4V2SA 2DPPB 1K73U 3FDRA 2KQWA 3MEVA 1PSEA 3TU4K 1X6OA 2RI3A 3CC2A 2XDBA 2WACA 4QVZA 3G4ST 3CCVT 4J83A 3JCMQ 4MDWA 5A2QE 3LGLA 4J5YA 4NOYA 4QVDA 3S3OA 2C06A 4OB3B 4UC4A 2V8IA 3VU3C 3G4SA 3S3MA 4MDXA 1QVGA 4XTXA 4OF1A 4XTZA 2V8KA 3MEAA 4HT9A 4HCBA 4FL6A 1KQ2A 3RKWA 1KHCA 2GCXA 1HK9A 2QXFA 4B9WA 3A8MB 4KUIA 5DLOA 3JB9J 4QQGA 2E12A 3ER0A 1YJWT 2FL7A 3M59A 1U1TA 3X20B 2CZ7B 4F7UA 2DXCA 2BKDN 4Q5WA 4M77B 4N0AA 5GMKm 2F5KA 3HSBA 1N9RA 2P0KA 3M57A 4L59A 5CQYA 4XTUA 2EWNA 4E47A 3M55A 2ZPHB 3A5ZB 4XQ3A 3S6WA 2RD1A 4C8QD 2CS7A 1BIAA 4J6YA 4L6V5 4E7KA 3A8OB 3LGFA 4XU0A 5FU6C 4C0DC 4KUDK 2O4XA 2X35A 4M78A 4MMLA 1KD1U 4ZGJB 3FIFA 3UT1A 5M9OA 2ZGWA 3OY9A 1YBYA 3QPHA 1G3SA 3LYIA 3CCUT 2RHYA 2O01E 2LQKA 4KULA 4IURA 2WSFE 5J3BA 4NL3A 3BY7A 2QQRA 3QXEB 4LDWA 2QA4A 3JB9G 2OTLA 1M9SA 3LLRA 3CCUA 5GMKe 4BI3A 4PJOG 4M75D 3X28B 3M4YA 2E64A 1YIJT 5IN1A 1KD1C 4M7DD 1KG1A 3M5AA 1U8RA 2XK0A 2YLCA 3HRUA 3TCJA 4C92A 3CXCA 3CXCS 3WVDB 4PJOD 3LWIA 2RI2A 3CMAT 2LRQA 2P0QA 4F7UG 5GAN3 4A4FA 1YIJA 2QQ9A 2PQWA 5GAOr 1O9SA 2ZPBB 3NTIA 2F69A 1D3BA 1UGRB 3M58A 1DJ7B 2QEXT 3CMAA 1BIBA 2KAFA 3JSCA 3QSUA 1Q82U 4IUVA 2CGHA 1VUBA 4M78G 3FRNA 1WGSA 3OYEA 2HQEA 1ZBXA 4NL2A 2EQKA 2VGNA 3N5BB 4RG2A 4M78D 5LJ3e 2L89A 5J26A 3JCMb 5GAN4 3V8LA 2E10A 5EG2A 5LJ3g 5GAN5 1VQKT 1ZQ1A 2ZPEB 3CCMT 3CBOA 3X26B 3QG1A 2DVEA 2KSSA 5HY6A 2D6FA 4EMKB 2DKGA 3CCMA 3OYYA 4LDYA 2CYZB 2K4YA 2MWPA 2EYQA 2RJCA 3VJPA 2PVGB 4M77C 1Q81U 4II1A 3JCMh 4VUBA 5CKHA 3I56T 1IREB 5GANe 3T9NA 1M5Q1 3JCMd 2XG8D 5HK3A 1WJRA 2EJFA 4XU3A 3HRTA 3G71T 3RERA 4M7AF 4M7AB 2RH2A 2MMPA 4EMGA 3I56A 3SWNA 3OYJA 1VQ9A 4HT8A 4LDVA 4ELZC 1M1KU 1N8RU 5FU6B 2WSEE 4C0DB 1U1SA 3G71A 2XHCA 4L5GA 1I8FA 3CCLT 1Q81C 4BDZA 3FLGA 3CC4T 3MP8A 1Y96A 4XU1A 5AYFA 4HCCA 4J6WA 5GAMh 1SSFA 1X01A 2DXTA 3L2QA 5I2MA 1W2BS 3VYGA 3WVEB 4A54A 4ZGEB 1B34A 2E41A 5GAMd 5GAN7 3P8DA 5GAOn 3GPLA 3CC4A 4D6WA 2EJ9A 5CK9A 4JS5A 1N8RC 2A3LA 2HD0A 1M1KC 3PIOA 3ASKA 4QQDA 4JLIA 2E70A 3C12A 3G7ZA 2EKOA 2YLBA 2DJZA 3OMCA 2G3RA 4C92C 3MCAB 3TREA 4X34A 1O75A 2OTJT 4A53A 2QI2A 5GAN2 3NTKA 4JJNK 1KHIA 4C8QA 4XK8E 3PMTA 3GLXA 2DIGA 5L8RE 1AHJB 5FU7C 1KQSS 4BI8B 1KQSA 2XD0A 1WJSA 2DTOA 2OTJA 1EIFA 2L8DA 2DEQA 2Y90A 1N27A 5C0MA 3QIIA 4XTYA 4C5IA 4GLKA 5CIUA 4OB1B 2VGMA 2MF2A 2R58A 4JS4A 2RHUA 4JLGA 3RKYA 2JZ2A 2P4TA 2H3JA 2PU9B 3VV0A 5CQXA 2HBPA 1YJNT 4BD3A 3RESA 4M75A 3SD4A 2K5LA 1K73C 2M9UA 3CEYA 4XU2A 4EMKC 4M7DA 3EFSA 1K9MU 2OAUA 3JB9F 4BY6C 1YJNA 2V8JA 4PJOA 2XDDA 5GMKl 2LDMA 1YHQT 1WJQA 2K2VA 2R5MA 1YITT 2LT4A 3X25B 3META 4M77E 1Y71A 2XIDA 4M77F 1IZ6A 2E1HA 4IUUA 3MEUA 5I21A 2B8AA 3HRSA 3URGA 4F7UB 1YHQA 4WF2A 5I2SA 3J7AF 1VIEA 3CPFA 4C8QG 1YITA 1K9MC 2A7YA 4M7AC 4RG8A 1V29B 3C4SA 5CAIA 4HCZA 4XTVA 4Y91A 1VQ5A 5DLQE 4ME7A 1WPYA 2HNIA 2GQVA 2BUDA 3OYCA 4IUTA 3NFCA 2QA4T 2OTLT 2O4XB 3M4GA 1OZ3A 4M78B 4BE0A 4LDXA 1PSFA 3OYGA 3M56A 4HKEA 1NZ9A 2QQAA 2VYTA 3CBMA 4BE1A 4M75G 3V8KA 3LWHA 2XI9A 3WXMB 3JCMW 1YI2T 1VQPT 4M7DG 5GAOm 3G6ET 5FRNA 2JTFA 2EJGA 3OYDA 4DA4A 3CCQT 2I2LA 2RJDA 3CCJT 1M1FA 2M16A 4ZTFA 2RJEA 3OS1A 1VQPA 4OMFB 5KE2A 2KK4A 3V7SA 1YI2A 3JB9H 3G6EA 4JRKA 4C92E 2LTOA 4O6JA 4C92F 2ZZDA 4C92B 3CCQA 3A8GB 3SFMA 3CCJA 2RK2A 3OQ5A 3VUZA 3CD6T 2CZ6B 1YCYA 1XTDA 2VC8A 5LJ3f 4BDYA 2PVDB 3JRZA 4NS5A 1VQ8T 1D3BB 2K5IA 3OW2A 5FU7B 2ZPIB 3OW2S 1KC8U 3CD6A 3OBWA 3QZ5B 5HKCA 1JBMA 2DIQA 3LX7A 4LDUA 1VQOT 1QP3A 2RO0A 4C0GA 2MI6A 2QQBA 2DZ9A 2DZCA 4CI0C 3OYIA 1VQ8A 2VV5A 1GXIE 2DXUA 2AHJB 3OSSC 4N4HA 3FB9A 2RK1A 1XQHA 1VQOA 3VUBA 3RUXA 4XAXB 3DLMA 4C0FA 5GMKj 3OS2A 2X4JA 3GNFB 1JRIA 1Q82C 3M54A 1BI0A 3MO8A 3ZBDA 4CRIA 4DQ2A 5GANf 1KC8C 4M7DC 5A0DA 1M90U 1LOJA 2PVOB 3QYHB 4BY6B 3JCMe 4BE2A 1M1GA 2D0QB 5GAOq 4PJOC 3JCMg 3PTAA 2DD4A 4HA8A 4EPCA 4A4EA 3S3NA 4ZN1A 5DY9A 3JAME 1BI1A 1UEBA 5CR2A 5GAMf 2QDYB 2R5AA 4N0AC 3L2RA 3CCRT 2GFAA 4RCBA 1Q7YU 1VQ9T 4LD9K 2FVUA 3OB9A 3QO3A 5A0LA 5LJ5e 2CKKA 4OB0B 4ELYC 5GANg 1FWZA 5D6WA 4J6XA 4IKFA 4M7AE 1M90C 3P8HA 2GF7A 3ZFJA 3L2UA 3CCRA 2RHXA 3HHTB 5IT9E 1P92A 2JN0A 1Y7XA 4IUQA 4TVRA 3CCET 5LJ5h 5GAMe 3PGGA 5CKDA 3SWNB 4FM4B 3HFOA 4M78C 5LJ3j 5GAMg 1VQ6T 2QQSA 5CVIA 1UB4A 4QQ6A 5LJ5d 3KXTA 3FJPA 1MGQA 3Q1JA 4MZTA 4X9CA 4E7IA 4FT2A 3DB3A 3HFNA 3X24B 4KT0E 3CCEA 1Q7YC 2FYKA 3OMGA 1Y96B 3JCMX 1W2BA 1VQ6A 3PT9A 2EQJA 3H8ZA 3BDLA 3FEOA 3TEEA 3OBYA 1QVFS 1B34B 3E9FA 2LX9A 3VKIA 3RMSA 4ZTJA 3QKJA 1UGSB 5GAN8
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO A;  2K57 A;  2RM4 A;  3BY7 A;  3RKX A;  5GMK l;  4NL3 A;  3JB9 G;  5GAN j;  5LJ5 g;  5GMK e;  4PJO G;  4M75 D;  1I81 A;  4M77 E;  4EMK A;  2E64 A;  4M7D D;  4M77 F;  2DTH A;  2E1H A;  2YLC A;  5LJ3 h;  4C92 A;  4C8Q F;  4EMH A;  4C8Q B;  4F7U B;  5I21 A;  4WF2 A;  4PJO D;  5GAM j;  4OP0 A;  4C8Q G;  4F7U G;  5LJ3 d;  5GAN 3;  4M7A C;  2RA2 A;  4C92 G;  5CAI A;  5GAO r;  1HXD A;  3V7R A;  4XTV A;  4Y91 A;  1D3B A;  5GMK i;  4C92 D;  1I5L A;  1WPY A;  2HNI A;  1BIB A;  3QSU A;  3M4G A;  4M78 B;  3JCM J;  4M7A A;  4XTW A;  2CGH A;  4M78 G;  1LJO A;  4M75 B;  3AHU A;  5GAO p;  4M7D F;  4M7D B;  1TH7 A;  4NL2 A;  3JCM W;  4M75 G;  4MMK A;  3V8K A;  5GAN h;  4PJO E;  5LJ3 e;  4M78 D;  4PJO F;  5GAN 4;  3JCM b;  5GAO m;  4M7D G;  4PJO B;  3V8L A;  2E10 A;  4JRI A;  5LJ3 g;  5LJ5 j;  2EJG A;  5GAN 5;  5GAN d;  2I2L A;  2VXF A;  3JB9 F;  3RIR A;  4M7A D;  3EFR A;  3JCM c;  1I4K 1;  2DVE A;  4X9D A;  2VXE A;  3V7S A;  3V8J A;  2RB6 A;  4C8Q E;  4EMK B;  4F7U F;  3JCM V;  3JB9 H;  4JRK A;  4JUV A;  4C92 E;  3V7C A;  2DKG A;  4C92 F;  4C92 B;  2FB7 A;  3L2Z A;  4XU2 A;  3JB9 I;  4M77 C;  1YCY A;  2VC8 A;  5LJ3 f;  1H64 1;  3JCM h;  3SWN C;  1D3B B;  4M78 E;  5GAN e;  1M5Q 1;  3JCM d;  4M78 F;  1M8V A;  1JBM A;  1WQ7 A;  2EJF A;  4XU3 A;  4M75 E;  5GAO l;  3JCM P;  4M75 F;  4QVC A;  3RER A;  3QHS A;  4M77 A;  4M7A B;  4M7A F;  4EMG A;  2DZ9 A;  2DZC A;  3SB2 A;  4M7D E;  3SWN A;  3QUI A;  4M7A G;  4HT8 A;  2DXU A;  4V2S A;  3BW1 A;  3FB9 A;  1U1S A;  1N9S A;  1I8F A;  2YHT A;  3RUX A;  2QTX A;  3GIB A;  5GMK j;  1Y96 A;  4XU1 A;  1JRI A;  3JCM Q;  4J6W A;  4M7D C;  4DQ2 A;  5GAM h;  4J5Y A;  1X01 A;  2DXT A;  4NOY A;  5GAN f;  4QVD A;  1LOJ A;  3JCM e;  4PJO C;  4PNO A;  5GAO q;  3JCM g;  3VU3 C;  4A54 A;  5GAM d;  1B34 A;  2E41 A;  4HA8 A;  5GAN 7;  5GAO n;  4XTX A;  2E65 A;  5GAN 6;  4XTZ A;  2EJ9 A;  5DY9 A;  4HT9 A;  5GAM f;  4C8Q C;  1KQ2 A;  3RKW A;  4N0A C;  1HK9 A;  4JLI A;  4RCB A;  4C92 C;  2YLB A;  1LNX A;  2DJZ A;  3JB9 J;  3INZ A;  3QO3 A;  5LJ5 e;  1KQ1 A;  5GAN g;  4M7D A;  1WQW A;  4J6X A;  4M7A E;  4A53 A;  5GAN 2;  1U1T A;  2DTI A;  3JCM f;  3JB9 D;  2JN0 A;  4C8Q A;  4F7U A;  4F7U E;  4M77 B;  4N0A A;  5GMK m;  5LJ5 h;  3HSB A;  5GAM e;  1N9R A;  3L1A A;  3PGG A;  3SWN B;  3BFM A;  3HFO A;  4M77 G;  2DTO A;  4M78 C;  2EWN A;  4XTU A;  5GMK h;  5LJ3 j;  5GAM g;  2DEQ A;  5LJ5 d;  1WNL A;  1MGQ A;  2Y90 A;  3FJP A;  4X9C A;  4M75 C;  3HFN A;  4M77 D;  4XTY A;  4XQ3 A;  2FYK A;  2RD1 A;  4RCC A;  1Y96 B;  4C8Q D;  1BIA A;  2EAY A;  4J6Y A;  5LJ5 f;  3JCM X;  4XU0 A;  3RKY A;  4M78 A;  4MML A;  3FIF A;  2ZGW A;  3RES A;  1B34 B;  4M75 A;  4EMK C;  3BDU A;  3EFS A;  5GAN 8; 
#chains in the Genus database with same CATH topology
 1RLP C;  5FWC A;  1Q95 G;  4O5V A;  2JTM A;  2DD5 A;  3NMZ C;  3DKM A;  4C8Q F;  1Q86 U;  1ZUU A;  1OU9 A;  4BI4 A;  2LC4 A;  1LVK A;  2LT1 A;  2HMA A;  1WHJ A;  3HL8 A;  1LJO A;  3AHU A;  4RTZ A;  3RR6 A;  2K6D A;  2RN8 A;  2NUT B;  1JJ2 S;  2MAM A;  4OMN A;  3DB4 A;  3EFR A;  1VQN T;  4F7U E;  4F7U F;  2RB6 A;  2VB6 A;  1UGP B;  3L2Z A;  4LD6 A;  3EAE A;  2P0P A;  4PFP A;  2K3B A;  4DBR A;  2YRV A;  4BUG A;  4Y28 E;  3F70 A;  1SKU B;  1UJY A;  1WQ7 A;  2QAS A;  5GAO l;  1X69 A;  3QZ9 B;  1Q86 R;  2E6N A;  3ZL7 C;  3BW1 A;  2QTX A;  2KDS A;  1JXM A;  3PMI A;  3VRZ A;  5GJV B;  4C0Z A;  2IIM A;  2IG0 A;  4AT1 B;  4C5H A;  1K8A C;  4PLL A;  5GAN 6;  2E65 A;  3E9G A;  2YUQ A;  2PUO B;  4ANJ A;  5KCO A;  2R57 A;  1YWP A;  2FHD A;  1W4S A;  5DM7 R;  2EGA A;  2DTI A;  1D09 B;  4N4G A;  7AT1 B;  1AVZ C;  3MP1 A;  3VRY A;  3L42 A;  3E1S A;  2LQ8 A;  4M77 G;  3OS0 A;  5GMK h;  3OYB A;  3KBG A;  5KH6 A;  4RCC A;  5LJ5 f;  5KYN A;  1EX4 A;  1BYM A;  2XKO C;  3PIP A;  2EQU A;  4BAC A;  4RKU E;  3MEW A;  1VIF A;  1WXB A;  2M0O A;  1X43 A;  2L5Q A;  2LVM A;  1NE8 A;  1TUG B;  3OA6 A;  3A8L B;  4ZGD B;  1VQK A;  4OMO A;  4OB2 B;  1PG5 B;  2DYI A;  2HQX A;  4Y92 A;  5LJ3 d;  3HKS A;  3CCS T;  2DE0 X;  4J9D A;  2HSE B;  1VYU A;  2GBQ A;  1VQ8 Q;  2CUD A;  4PLI A;  1MHN A;  5I11 A;  1OZ2 A;  3SEM A;  3OYA A;  4Z02 A;  5LJ5 j;  4IUP A;  2AT1 B;  3OYF A;  3CME Q;  2J06 A;  3KFV A;  1X75 C;  3PNW C;  3QYG B;  4OMM A;  1GRI A;  4C5G A;  4A4K A;  4DEY A;  1PKS A;  2J7I A;  4Z88 A;  5KYW A;  1R8O B;  4ORZ A;  4RTT A;  1D0Y A;  1R0C B;  2AIR B;  1G3T A;  3CC2 T;  1PCX A;  4V2S A;  2H8H A;  3NHN A;  3FDR A;  3MEV A;  1CKB A;  3TU4 K;  1X6O A;  4QVZ A;  4J83 A;  3JCM Q;  2D1X A;  4QVD A;  2V8I A;  4MDX A;  4XTX A;  4OF1 A;  2V8K A;  1VQ4 Q;  1WFW A;  1KHC A;  2EW3 A;  2QXF A;  4KUI A;  3JB9 J;  1WHK A;  4PJN A;  1YJ9 Q;  4CC4 B;  4QT7 A;  4B6M A;  4F7U A;  1T3L A;  2P0K A;  2EWN A;  4J6Y A;  5FU6 C;  4XU0 A;  4KUD K;  1KD1 U;  3UT1 A;  3OY9 A;  3H9N A;  2RHY A;  4KUL A;  2WSF E;  1OX8 A;  2QA4 A;  1I1J A;  4QKU A;  1BBZ A;  1OPK A;  3CCU A;  1M3B A;  2E64 A;  1U8R A;  2XK0 A;  1UJ0 A;  5FWB A;  3WVD B;  1VQN Q;  2P0Q A;  3GBQ A;  1QWE A;  1UGR B;  2COY A;  4DBQ A;  1HD3 A;  3JSC A;  1TTH B;  2LQW A;  4IUV A;  1PRL C;  1C6V X;  4M78 G;  4NL2 A;  1YJW Q;  5GAN 4;  2L3Q A;  4OMQ A;  1VQK T;  1M8M A;  3CCM T;  2NWM A;  1SRL A;  1T3S A;  2QDL A;  1KD1 R;  1E7O A;  2CYZ B;  2K4Y A;  2MWP A;  3AT1 B;  2EKH A;  2RJC A;  1Q81 U;  4DBF A;  5CKH A;  3I56 T;  5GAN e;  3JCM d;  1NLO C;  1WJR A;  3RER A;  2CSQ A;  4M7A F;  2RH2 A;  4EMG A;  1A0N B;  1NEB A;  4ELZ C;  1N8R U;  2WSE E;  3G71 A;  2V1R A;  1SSF A;  1ARK A;  5EC7 A;  4ZGE B;  5GAN 7;  1ZUY A;  2EJ9 A;  4JS5 A;  1SPK A;  1GCQ C;  3ASK A;  4QQD A;  4JLI A;  3C12 A;  5KYW B;  2LJ1 A;  2DJZ A;  2J6F A;  4FYX B;  2OTJ T;  1ZUK A;  4A53 A;  1ZA2 B;  2DIG A;  5L8R E;  1GFD A;  1K4U S;  1AHJ B;  1KQS A;  1K0X A;  1WJS A;  2O2O A;  5C0M A;  1Q81 R;  4KGV B;  2HL5 C;  2P4T A;  3RKY A;  3CCS Q;  5IXF A;  1IXD A;  2JS2 A;  5CQX A;  4BD3 A;  4Z89 A;  3RES A;  3CEY A;  3M0Q A;  4BY6 C;  1N8R R;  2F2X A;  1N5Z A;  1YFN A;  2IPO B;  1WJQ A;  2ED0 A;  4F16 A;  3MET A;  1Y71 A;  4HCK A;  1IZ6 A;  5I21 A;  2B8A A;  3HRS A;  4F7U B;  2JM8 A;  2CUB A;  1V29 B;  4RTW A;  4XTV A;  4Y91 A;  1YN8 A;  2DF6 A;  2YUO A;  2QA4 T;  3NPF A;  3I35 A;  4HKE A;  2QQA A;  3CBM A;  1VQP T;  1MMG A;  5GAO m;  3VS5 A;  4HVU A;  5FRN A;  3OYD A;  2QTV A;  4RTU A;  2RJD A;  1IGQ A;  3CCJ T;  4RTX A;  3D7S B;  5KE2 A;  3JB9 H;  2LTO A;  2LX7 A;  1Z9Q A;  2HQH A;  3MPU B;  3OQ5 A;  3CD6 T;  3LH5 A;  5LJ3 f;  2K5I A;  3OW2 A;  3QZ5 B;  1JBM A;  1U5S A;  1VQO T;  1QP3 A;  2MI6 A;  2DZ9 A;  1VQ8 A;  3BE3 A;  2GTJ A;  4D8K A;  2AHJ B;  3OSS C;  1KIK A;  3FB9 A;  1MMA A;  1XQH A;  4R0K A;  3DLM A;  2KT8 A;  3OS2 A;  2X4J A;  3GNF B;  2G6F X;  1KC8 C;  3M54 A;  3ZBD A;  4CRI A;  4M7D C;  1M90 U;  4PJO C;  5GAO q;  3VS3 A;  1BB9 A;  5IHI A;  3L2R A;  4RCB A;  2KRS A;  1X27 A;  2QGG A;  5GAN g;  4OB0 B;  2L0A A;  4IKF A;  5D6W A;  1GFC A;  3ZFJ A;  2JN0 A;  3G6E Q;  4TVR A;  2KRN A;  5CKD A;  3PGG A;  4FM4 B;  5LJ3 j;  5GAM g;  2QQS A;  5LJ5 d;  1S1N A;  3FJP A;  3Q1J A;  4MZT A;  3HFN A;  1Q7Y C;  2V26 A;  3OMG A;  1YCS B;  1W2B A;  2YDL A;  3BDL A;  3TEE A;  3OBY A;  1T0J A;  2KXC A;  2RPN A;  3RMS A;  1UGS B;  1VQ4 A;  2L3R A;  4QW2 A;  2IVW A;  2XU8 A;  1BU1 A;  1YJ9 A;  3I5R A;  8AT1 B;  1M90 R;  2PZ1 A;  1G3W A;  3QWY A;  1ABQ A;  1D1C A;  2RA2 A;  1CKA A;  1HXD A;  3NTH A;  4JJB A;  1WZO A;  1UTI A;  2E5Q A;  3UPU A;  5GMK i;  4EDU A;  3FJ5 A;  1W2B P;  1VQ9 Q;  3VS0 A;  3L2V A;  4M7D F;  1WDX A;  1TH7 A;  4PJO E;  1PD0 A;  4PJO F;  1FX7 A;  4J8O A;  1M2O A;  1JJ2 A;  4R56 A;  3RIR A;  1I4K 1;  3C95 A;  4X9D A;  1JB0 E;  3VS4 A;  4RTY A;  3GNG A;  2XIC A;  2FPF A;  3EH2 A;  5KCH A;  1VQN A;  1QVG S;  2BZ8 A;  2KY9 A;  1Y07 A;  1NJI C;  2BE9 B;  5HCK A;  3QBY A;  1GCP A;  1H64 1;  2L2P A;  2KE9 A;  2BE7 D;  1JEG A;  3QHS A;  4KBM B;  1K8A U;  1M2V A;  3J81 E;  3A8H B;  2OTJ Q;  1UGQ B;  1N9S A;  1YJW A;  1KFZ A;  1JU5 C;  4LNP A;  3GIB A;  2H3E B;  4LN2 A;  4PFZ A;  1UEC A;  1WLP B;  4E7S A;  4PNO A;  3CPW S;  1NLP C;  3UA6 A;  1E6H A;  2JOY A;  4J7I A;  2DNU A;  4C8Q C;  3QJ6 A;  2Y4X A;  5C6S A;  1VQ7 T;  3INZ A;  2ATC B;  4OGC A;  3JB9 D;  3JCM f;  1JXO A;  1SEM A;  2RJF A;  1OEB A;  1YNZ A;  2ZPG B;  2EBP A;  3BFM A;  3CME T;  4OVA A;  1OI1 A;  2CH4 W;  1F1B B;  4M77 D;  1FXX A;  4OGE A;  3ZEH A;  4GY5 A;  1PWT A;  1FMK A;  4E6R A;  1D1A A;  5FRM A;  2FO0 A;  3BDU A;  1K8A R;  1WXU A;  4WTO B;  3A98 A;  2LCC A;  1WHH A;  1BI3 A;  1VQP Q;  3QDR B;  1I81 A;  1JQQ A;  1ZLM A;  2OAW A;  2PUK B;  3CCJ Q;  1YP5 A;  4JZ3 A;  2DJQ A;  4C92 G;  3U23 A;  2DAQ A;  2Y4Y A;  3CD6 Q;  3PFS A;  1VQ4 T;  3FC3 A;  3CCS A;  4XTW A;  5GAO p;  1YJ9 T;  4FCY A;  1VQO Q;  3M53 A;  5GAN h;  2NUZ A;  4PKC C;  5FRO A;  5CCA A;  2JNG A;  2KVQ G;  2QYZ A;  2RI5 A;  3JCM c;  4C5E A;  4C8Q E;  5FLX E;  2VXE A;  1AT1 B;  3JCM V;  1ZHI A;  3LH0 A;  2B86 A;  1GBQ A;  1NYG A;  2X4Y A;  4B9X A;  4FIB A;  2X4W A;  1H3H A;  3MHX A;  2DPP B;  2VAS A;  1PSE A;  3CC2 A;  2YRD A;  4MDW A;  4J5Y A;  2JT4 A;  4OB3 B;  4WCI A;  4F14 A;  1RLQ C;  1TUD A;  4AG1 C;  1UUE A;  2RQT A;  4HCB A;  1KQ2 A;  3RKW A;  2NYS A;  8ATC B;  1RUW A;  4QQG A;  2VVK A;  1YJW T;  2I0N A;  3M59 A;  1RAB B;  2DXC A;  4Q5W A;  3HSB A;  1M2V B;  1S72 Q;  2YXY A;  1TSF A;  3A5Z B;  1EFN A;  2RD1 A;  2J6O A;  4E7K A;  1BIA A;  3LGF A;  4C0D C;  1SG5 A;  2JS0 A;  2O4X A;  2X35 A;  5M9O A;  2ZGW A;  3QPH A;  3EG9 A;  2LQK A;  4IUR A;  5J3B A;  2L3P A;  1BK2 A;  3JB9 G;  1IB8 A;  3BY7 A;  3QXE B;  4LDW A;  1M9S A;  2SRC A;  2K7A A;  4BI3 A;  1YIJ T;  1OX9 A;  2YSQ A;  2YLC A;  3TCJ A;  4C92 A;  3M0P A;  3G4S Q;  5L23 A;  1J3T A;  4F7U G;  1M3C A;  2LZ6 B;  4CC3 A;  2QQ9 A;  2ED1 A;  2PQW A;  2MOX A;  2ZPB B;  2VWF A;  4AFS C;  1D3B A;  1BIB A;  3VS7 A;  1VUB A;  2LQN A;  1QKX A;  3N5B B;  1V1C A;  4RG2 A;  1QCO A;  4M78 D;  5EG2 A;  5LJ3 g;  1ZQ1 A;  1M30 A;  3MJX A;  3CBO A;  3QG1 A;  1R77 A;  2DVE A;  1ZX6 A;  1XJW B;  2A08 A;  1SSH A;  4J9H A;  2DKG A;  3CCM A;  3OYY A;  2LJ3 A;  4II1 A;  1G2B A;  2CRE A;  1IRE B;  3T9N A;  5HK3 A;  2EJF A;  3HRT A;  1VQ7 Q;  4GLM A;  3I56 A;  2KRM A;  1VQ9 A;  4HT8 A;  2C0T A;  1AWO A;  1U1S A;  2XHC A;  2E5K A;  1Y96 A;  2DRM A;  1HSQ A;  5I22 A;  3M0R A;  5I2M A;  3VYG A;  2KGT A;  3CQT A;  4A54 A;  1B34 A;  2E41 A;  2YT6 A;  2ZAE A;  2QEX Q;  2JM9 A;  1M1K C;  2A3L A;  2HD0 A;  2LJ0 A;  2EKO A;  2G3R A;  2CH4 A;  2EYY A;  1O75 A;  1IHW A;  4C8Q A;  3PMT A;  2Z0W A;  2RMO A;  2CP3 A;  2DTO A;  2OTJ A;  2L8D A;  2MK5 A;  1PHT A;  4XTY A;  1AOJ A;  2RHU A;  4JLG A;  1CSK A;  1FMV A;  2JZ2 A;  2PU9 B;  2H3J A;  2F2V A;  3PVL A;  3SD4 A;  2M9U A;  2OAU A;  5GMK l;  1TOV A;  1YIT T;  3X25 B;  2A0F B;  4WF2 A;  5I2S A;  1VIE A;  2A7Y A;  4M7A C;  4HCZ A;  5D7U A;  2DFU A;  2P84 A;  3QDF A;  4ME7 A;  2O4X B;  4LDX A;  3EG9 B;  2VYT A;  2K2M A;  4BE1 A;  3V8K A;  3JCM W;  3WXM B;  1YI2 T;  1PC0 A;  3G6E T;  4KH0 B;  1GBR A;  2OX7 A;  1Y0M A;  2M16 A;  4ZTF A;  1Z9Z A;  1VQP A;  4OMF B;  4JRK A;  2ZZD A;  4C92 B;  6AT1 B;  4RTV A;  3CCJ A;  2QK0 A;  2RK2 A;  2CZ6 B;  1YCY A;  2PVD B;  1D3B B;  5FU7 B;  1KC8 U;  3CD6 A;  3REA B;  5HKC A;  2DIQ A;  3LX7 A;  4LDU A;  4C0G A;  1YHQ Q;  4CI0 C;  2VV5 A;  2DXU A;  4N4H A;  1VQO A;  3VUB A;  4XAX B;  3VS1 A;  2DYB A;  5GMK j;  1UDL A;  4LUD A;  2KR3 A;  1BI0 A;  1U3O A;  3JCM g;  4ZN1 A;  5DY9 A;  1BI1 A;  2C0O A;  2OTL Q;  4N0A C;  3CCR T;  1Q7Y U;  1VQ9 T;  4LD9 K;  1I0C A;  2FVU A;  3OB9 A;  5LJ5 e;  2O9V A;  1K76 A;  4M7A E;  3P8H A;  1T0H A;  5ECA A;  1Y7X A;  1V76 A;  3CCQ Q;  5GAM e;  1OV3 A;  1YIJ Q;  1VQ6 T;  5CVI A;  4QQ6 A;  4E7I A;  4FT2 A;  2FYK A;  1Y96 B;  3PT9 A;  1WHL A;  3H8Z A;  1KC8 R;  1B34 B;  3VKI A;  2LX9 A;  2QGF B;  5CO7 A;  2RM4 A;  2MWO A;  3RKX A;  1MND A;  1OUL A;  1H92 A;  1XOV A;  1BI2 A;  3O8V A;  3A1P A;  1VA7 A;  4HVV A;  4EMH A;  4C8Q B;  1D1B A;  5FW9 A;  1OYX A;  1PRM C;  2HKN A;  2KEA A;  2O31 A;  3UAT A;  3V7R A;  2K5F A;  1QP2 A;  2EIF A;  1S72 A;  2KMT A;  2EQM A;  1Q7Y R;  1G83 A;  3CC7 T;  4JJC A;  4CC2 A;  4YTL A;  3TVT A;  1GL5 A;  4RMO A;  1QW1 A;  1NJI U;  3CCE Q;  1HJD A;  3OYH A;  4E7H A;  3V7C A;  1MMN A;  3JB9 I;  4DOW A;  2CZ1 B;  1KQS P;  2CZ0 B;  1X2K A;  3HP9 A;  4ESR A;  1H3Z A;  3J80 E;  2DL8 A;  2WSC E;  5LL6 S;  2DLP A;  2EYX A;  3RBB B;  5J39 A;  2EYW A;  1VQL T;  1AD5 A;  2BTT A;  5CKE A;  3EHR A;  4JPB W;  3CPW A;  3I55 T;  3CBP A;  1NJI R;  2FG0 A;  4HVW A;  2GNC A;  4J7F A;  1AWW A;  1WQW A;  2ENM A;  1G8X A;  3C94 A;  1VQ7 A;  3OSV A;  3RNJ A;  1C1A A;  1YIT Q;  2OJ2 A;  4P5N A;  4M75 C;  4KH1 B;  1OPL A;  2D9T A;  1VQ5 Q;  3CME A;  4D8D A;  3UF4 A;  2EAY A;  3EH1 A;  3UDC A;  2KXD A;  2XDP A;  2QEX A;  2RNA A;  5KYU A;  2AK5 A;  5LJ5 g;  2DL3 A;  2DXB A;  1YI2 Q;  3OW2 P;  1IHV A;  2DTH A;  2RF0 A;  2GGR A;  4PJJ A;  1IRX A;  3EG1 A;  1VQM T;  4C92 D;  1I5L A;  4MZM A;  9ATC B;  1QVF A;  4FU6 A;  2DM1 A;  3JCM J;  4M7A A;  4DEX A;  2X4X A;  3VYH B;  2JVV A;  2K3Y A;  2HZY A;  3H6Z A;  3HTR A;  5GAN d;  2BIV A;  3V8J A;  5HK0 A;  4AFQ C;  5A0G A;  2LCL A;  3NGP A;  5KYX A;  4E7L A;  1S72 T;  3GOX A;  1RL2 A;  3C0C A;  2PNI A;  2M1H A;  2E4H A;  3CCR Q;  2D8J A;  1SHF A;  4M75 E;  2COW A;  4M75 F;  3JCM P;  4M7D E;  1MV3 A;  3SB2 A;  4J9B A;  3QUI A;  1QVF P;  3GF5 A;  2KQW A;  2RI3 A;  3G4S T;  1VQ6 Q;  2C06 A;  2FRY A;  3H0H A;  1RI9 A;  4UC4 A;  2D8H A;  1RAI B;  1X6G A;  4XTZ A;  3MEA A;  4HT9 A;  2GCX A;  1ZSZ C;  1HK9 A;  2DET A;  1YWO A;  3A8M B;  2E12 A;  3ER0 A;  2L3S A;  3X20 B;  2CZ7 B;  5GMK m;  2BKD N;  4N0A A;  1N9R A;  3MKD A;  4L59 A;  2ZPH B;  4XQ3 A;  1C0M A;  4LUE A;  4C8Q D;  2CS7 A;  2DL7 A;  2M0Y A;  1JJ2 P;  4FSS A;  2DX1 A;  4MML A;  4ZGJ B;  3FIF A;  2JMA A;  2E3I A;  1QWF A;  1G3S A;  2XMF A;  2O01 E;  3CC7 Q;  2OTL A;  1X6B A;  2F2W A;  4PJO G;  3JV3 A;  3M4Y A;  1GCQ A;  5IN1 A;  3M5A A;  2DER A;  2YRC A;  2ESW A;  2KNB B;  3CXC S;  1QLY A;  3LWI A;  2RI2 A;  3CCV Q;  3CMA T;  2LRQ A;  5GAN 3;  4A4F A;  1YIJ A;  1NYF A;  1OOT A;  5GAO r;  3NTI A;  3IQL A;  2F69 A;  3M58 A;  5IXB A;  1DJ7 B;  2QEX T;  1KSW A;  1D0Z A;  2CGH A;  3OYE A;  2HQE A;  5IHK A;  2EQK A;  2VGN A;  5LJ3 e;  2L89 A;  5KYU B;  3V8L A;  5GAN 5;  2ZPE B;  3X26 B;  2CP5 A;  4FYW B;  1VQL Q;  2QG9 B;  2JTE A;  1UHC A;  2EQI A;  4PK4 A;  4J9I A;  3VJP A;  4M77 C;  2JW4 A;  3EGD A;  3I55 Q;  2A28 A;  1M27 C;  2CT3 A;  4M7A B;  4Z8A A;  3QWX X;  3OYJ A;  1M1K U;  5FU6 B;  4L5G A;  1I8F A;  2ECZ A;  3FLG A;  4BDZ A;  3CC4 T;  3MP8 A;  3O5Z A;  1SHG A;  4HCC A;  1IGU A;  4J6W A;  5GAM h;  4FYY B;  1X01 A;  3L2Q A;  1W2B S;  3M0T A;  2HEQ A;  5KYX B;  1QKW A;  3WVE B;  5GAO n;  3PE0 A;  1K0S A;  3P8D A;  3GPL A;  2X3X D;  2M02 A;  4KGX B;  3PIO A;  2A37 A;  1RAF B;  2E70 A;  3G7Z A;  3OMC A;  1AWJ A;  1VYT A;  1WX6 A;  5IHN A;  4EIK A;  4X34 A;  3NTK A;  4XK8 E;  1TXQ A;  2W0Z A;  2BZY A;  1EZZ B;  1QMC A;  2J05 A;  2PTK A;  4HXJ A;  2DEQ A;  4IIO A;  1N27 A;  2VKN A;  4C5I A;  1RAA B;  4GLK A;  2AZS A;  5CIU A;  2MF2 A;  2R58 A;  4JS4 A;  2YUP A;  1VQM Q;  1YJN T;  2HBP A;  3R6N A;  4M75 A;  2QAZ A;  4EMK C;  4M7D A;  1VYV A;  3EFS A;  3JB9 F;  4PJO A;  3G71 Q;  1M1K R;  1YHQ T;  2LT4 A;  4M77 E;  3EG2 A;  2XID A;  3CCL Q;  4M77 F;  2AZV A;  2KYB A;  3URG A;  2HCK A;  2KYM A;  4C8Q G;  1YIT A;  1K9M C;  4E2F B;  2A36 A;  1ZBJ A;  1VQ5 A;  5DLQ E;  2GQV A;  2BUD A;  3OYC A;  2MCN A;  1BCM A;  3NFC A;  2OTL T;  4BE0 A;  1OZ3 A;  1PSF A;  1ZSG A;  3LWH A;  2XI9 A;  2JTF A;  2EJG A;  4LXC A;  4K11 A;  3CCQ T;  2LP5 A;  2LMJ A;  3OS1 A;  1YI2 A;  1IO6 A;  3G6E A;  2X51 A;  4O6J A;  2LCS A;  3TSZ A;  3RDV A;  3H0I A;  3VUZ A;  2ROT A;  2VC8 A;  4BDY A;  1R0B G;  4NS5 A;  2RO0 A;  2QQB A;  3OYI A;  1GXI E;  4M4Z A;  2FZG B;  2RK1 A;  2JMC A;  3RUX A;  4C0F A;  3EGX A;  4DBH A;  1JRI A;  2FPE A;  4DQ2 A;  5GAN f;  1LOJ A;  1H8K A;  2PVO B;  4BY6 B;  3JCM e;  4BE2 A;  2D0Q B;  3PTA A;  1RAE B;  2DD4 A;  4HA8 A;  1ACM B;  1B3Q A;  5GJW B;  4PFO A;  1FYN A;  1UEB A;  5GAM f;  2R5A A;  4AG2 C;  1MV0 B;  3EGD B;  3VS2 A;  3QO3 A;  1U06 A;  1FWZ A;  4J6X A;  3CCR A;  3HHT B;  3H0F A;  1KK7 A;  3CCE T;  1ZSZ A;  4KGZ B;  3HFO A;  4M78 C;  4AFZ C;  3KXT A;  1MGQ A;  2AKL A;  4X9C A;  3DB3 A;  1RAC B;  3X24 B;  3CMA Q;  3EG0 A;  2HBW A;  2YWW A;  1M3A A;  3JCM X;  1VQ6 A;  1AWX A;  3FEO A;  3E9F A;  4LE9 A;  3QKJ A;  1EIF A;  4CC7 A;  2GFU A;  2EVR A;  4ZN3 A;  4GBQ A;  5GAN j;  2K3X A;  3GP8 A;  4ZNX A;  5CKF A;  5GAM j;  4FSX A;  4A4G A;  1MUZ A;  5IH2 A;  3E2U A;  1N6A A;  3E19 A;  2F5T X;  4R55 A;  3OYN A;  2ZPF B;  1SF9 A;  3ULR B;  2RQR A;  2O9S A;  1M4Z A;  3MP6 A;  2NLU A;  3G1J A;  1AZG B;  3SHW A;  3KUF A;  1Q86 C;  2E6Z A;  2HL3 A;  4M75 B;  2SEM A;  2AKK A;  4M7D B;  2RHI A;  3CC7 A;  2FRW A;  4PJO B;  4JRI A;  1RAD B;  1X2Q A;  2VXF A;  4MZP A;  4M7A D;  4PJL A;  3H41 A;  3CC4 Q;  1NG2 A;  4JUV A;  1VQ5 T;  2GQI A;  5KE3 A;  3CCV A;  2RHZ A;  2HAX A;  2KT1 A;  3SWN C;  4AFU C;  3OS5 A;  4ATO A;  4M78 E;  1M8V A;  1KJW A;  4M78 F;  2F1L A;  4E7J A;  4M77 A;  2LNV A;  2DK3 A;  5D6X A;  3RMQ A;  2DIL A;  2YHT A;  2ZCF B;  3QJY A;  3OYM A;  1XNI A;  1Y57 A;  3UA7 A;  1VQL A;  1NM7 A;  3P8B B;  4N4I A;  4BB7 A;  3OYK A;  1YJN Q;  5AT1 B;  3I9Q A;  1OQK A;  3HPW A;  1LNX A;  3I55 A;  1KQ1 A;  2HSP A;  4FT4 A;  4KRT A;  3UWN A;  4A4H A;  3SDZ A;  2DBK A;  3ME9 A;  2FEI A;  3L1A A;  3EG3 A;  3R6O A;  4JJD A;  1WNL A;  3THK A;  1RAG B;  3EGX B;  2D0N A;  2K9G A;  2CDT A;  4JRQ A;  4JDS A;  4PL6 A;  1G3Y A;  1VOM A;  3M0S A;  5GAN 8;  2C0I A;  2EFI A;  2K57 A;  5D6Y A;  4EMK A;  2JUF A;  5LJ3 h;  1NPR A;  2DO3 A;  1ZSZ B;  2CP6 A;  4OP0 A;  1WA7 A;  5IAY A;  3LW5 E;  3L2W A;  2DEU A;  2EGC A;  2DMO A;  1W70 A;  1VQM A;  3OYL A;  3M9Q A;  3VS6 A;  2DL4 A;  1TG0 A;  3DLL A;  2MPX C;  2VUB A;  4MMK A;  4DOV A;  4FW2 A;  5KYY A;  1ABO A;  4J9E A;  2E3H A;  4JRP A;  2EPD A;  3CCL A;  2FB7 A;  1NPP A;  3REB B;  4RUG A;  1PD1 A;  5CKB A;  1QVP A;  4IIM A;  2DL5 A;  2ABL A;  2J6K A;  4QVC A;  1WYX A;  1RI0 A;  4M7A G;  1BKB A;  1PKT A;  1TWB A;  1K73 U;  1UFF A;  2FZC B;  2XDB A;  2WAC A;  1PNJ A;  1AEY A;  3CCV T;  5A2Q E;  3LGL A;  1B07 A;  1RAH B;  2RQU A;  4NOY A;  3EFO A;  3S3O A;  2KBT A;  3VU3 C;  3G4S A;  1NBE B;  3S3M A;  1QVG A;  4PJM A;  4FL6 A;  1LCK A;  4B9W A;  5DLO A;  2MYS A;  2KI7 A;  2FL7 A;  1U1T A;  1JO8 A;  4M77 B;  2F5K A;  2ROL A;  3M57 A;  5CQY A;  2CP2 A;  4XTU A;  4E47 A;  3M55 A;  2BZX A;  3S6W A;  3I5S A;  4L6V 5;  1MMD A;  2P4R A;  3EGU A;  3A8O B;  1UE9 A;  1UG1 A;  4M78 A;  1WXT A;  1YBY A;  3LYI A;  3CCU T;  2CSI A;  4JZ4 A;  1QVG P;  4NL3 A;  2QQR A;  1K73 R;  2W10 A;  3LLR A;  3TQ7 P;  5GMK e;  3CC2 Q;  1BCO A;  1WI7 A;  4M75 D;  3X28 B;  4A63 B;  1I5O B;  4M7D D;  1KG1 A;  1KD1 C;  3HRU A;  3CXC A;  4PJO D;  1QCF A;  1O9S A;  1HYO A;  1LPL A;  2O88 A;  3CMA A;  2KAF A;  1WHG A;  3QSU A;  1Q82 U;  2K79 A;  2KRO A;  3FRN A;  1WGS A;  3CPW P;  1ZBX A;  3TSW A;  1WHM A;  1QQJ A;  5J26 A;  3JCM b;  2E10 A;  1TU0 B;  4AMC A;  4FYV B;  2KSS A;  5HY6 A;  4OMP A;  2D6F A;  4EMK B;  2V1Q A;  4E7Z A;  1B7T A;  2CP0 A;  4LDY A;  2EYQ A;  3CXC P;  2PVG B;  3JCM h;  4VUB A;  2NUP A;  4OML A;  2DBM A;  1M5Q 1;  2XG8 D;  3G71 T;  4XU3 A;  2GTO A;  1K9A A;  2MMP A;  3SWN A;  4LDV A;  2CP7 A;  4C0D B;  3CCL T;  1Q81 C;  2MIO A;  2RQW A;  5KYY B;  1OU8 A;  4X1V A;  4XU1 A;  5AYF A;  2JJ9 A;  2DXT A;  2JXB A;  2HKQ B;  2YUN A;  5GAM d;  1Q82 R;  3CC4 A;  4D6W A;  5CK9 A;  2RQV A;  1N8R C;  4J9G A;  4C92 C;  1D0X A;  2YLB A;  4F04 B;  3MCA B;  3TRE A;  2QI2 A;  5GAN 2;  1MNE A;  4JJN K;  1KHI A;  1UHF A;  3GLX A;  1K1Z A;  1VQK Q;  3CCM Q;  5FU7 C;  1KQS S;  4BI8 B;  2XD0 A;  4FW1 A;  2Y90 A;  3EHQ A;  3QII A;  1AZE A;  4OB1 B;  2VGM A;  3EFO B;  3VV0 A;  1SRM A;  1UGV A;  2K5L A;  3I56 Q;  1K73 C;  4XU2 A;  1K9M U;  1NEG A;  1YJN A;  2V8J A;  2XDD A;  2LDM A;  2NUT A;  2LNH B;  2K2V A;  1PM3 A;  2R5M A;  2FZK B;  2E1H A;  2EYZ A;  3MEU A;  4IUU A;  1YHQ A;  3J7A F;  1E6G A;  3CPF A;  4RG8 A;  3C4S A;  5CAI A;  2EGE A;  1WPY A;  2HNI A;  4IUT A;  3M4G A;  4M78 B;  3OYG A;  3M56 A;  1ZA1 B;  1NZ9 A;  4M75 G;  4M7D G;  4DA4 A;  2I2L A;  4J9F A;  1I07 A;  2DVJ A;  1M1F A;  2X9H A;  2RJE A;  2KK4 A;  3V7S A;  1W6X A;  4C92 E;  4C92 F;  3CCQ A;  3A8G B;  3SFM A;  1XTD A;  1K9M R;  3JRZ A;  1VQ8 T;  3PVQ A;  3OW2 S;  2ZPI B;  3OBW A;  2COZ A;  1TS9 A;  2DZC A;  1TUC A;  1W1F A;  3M0U A;  1Q82 C;  3MO8 A;  1G5V A;  5A0D A;  1FMW A;  3QYH B;  1M1G A;  4EPC A;  4A4E A;  3S3N A;  3JAM E;  2HDA A;  5CR2 A;  2M51 A;  2QDY B;  2QA4 Q;  2GFA A;  3CCU Q;  2NUP B;  2DA9 A;  5IT9 E;  5A0L A;  2CKK A;  4ELY C;  1M90 C;  2GF7 A;  2RHX A;  1P92 A;  4IUQ A;  2FPD A;  5LJ5 h;  2OI3 A;  3SWN B;  4F17 A;  1UB4 A;  3L2U A;  3CCE A;  4KT0 E;  2DRK A;  2CT4 A;  2X3W D;  2EQJ A;  1WIE A;  1QCN A;  1QVF S;  4ZTJ A;  4J9C A; 
#chains in the Genus database with same CATH homology
 1VQ4 A;  2GFU A;  5CO7 A;  2L3R A;  2RM4 A;  2MWO A;  3RKX A;  4ZN3 A;  4QW2 A;  2IVW A;  5GAN j;  1XOV A;  1BI2 A;  2XU8 A;  3O8V A;  4O5V A;  2JTM A;  2DD5 A;  1YJ9 A;  3DKM A;  4EMH A;  4C8Q F;  2K3X A;  4C8Q B;  3GP8 A;  1Q86 U;  1G3W A;  5CKF A;  1OYX A;  5GAM j;  4FSX A;  2LC4 A;  4A4G A;  4BI4 A;  1N6A A;  2RA2 A;  3E19 A;  1HXD A;  2F5T X;  3NTH A;  3V7R A;  2ZPF B;  4R55 A;  2K5F A;  3OYN A;  1QP2 A;  2EIF A;  2E5Q A;  3UPU A;  2KMT A;  5GMK i;  1S72 A;  2EQM A;  1M4Z A;  2LT1 A;  3MP6 A;  1G5V A;  2NLU A;  4EDU A;  3CC7 T;  3KUF A;  1Q86 C;  3HL8 A;  2E6Z A;  1LJO A;  4YTL A;  4M75 B;  3AHU A;  3L2V A;  4M7D F;  4M7D B;  1TH7 A;  4RMO A;  2RHI A;  3CC7 A;  4PJO E;  1QW1 A;  1FX7 A;  4PJO F;  4J8O A;  1NJI U;  4PJO B;  4JRI A;  1JJ2 S;  1JJ2 A;  4R56 A;  2MAM A;  2VXF A;  4MZP A;  3DB4 A;  3RIR A;  3CME T;  3OYH A;  3EFR A;  4M7A D;  1I4K 1;  1VQN T;  4E7H A;  3C95 A;  4X9D A;  4F7U E;  1JB0 E;  4F7U F;  2RB6 A;  4JUV A;  3V7C A;  1VQ5 T;  1UGP B;  3GNG A;  2XIC A;  3L2Z A;  5KCH A;  5KE3 A;  3JB9 I;  1VQN A;  4LD6 A;  3EAE A;  2P0P A;  3CCV A;  2KY9 A;  2CZ1 B;  4DOW A;  1QVG S;  1Y07 A;  2CZ0 B;  2RHZ A;  1NJI C;  2YRV A;  2HAX A;  3QBY A;  1H64 1;  4BUG A;  4Y28 E;  3SWN C;  3F70 A;  3OS5 A;  4ATO A;  4M78 E;  1M8V A;  3HP9 A;  4M78 F;  1WQ7 A;  1H3Z A;  5GAO l;  4E7J A;  3QHS A;  4KBM B;  4M77 A;  3QZ9 B;  2LNV A;  2DK3 A;  1K8A U;  3J80 E;  5D6X A;  3A8H B;  2WSC E;  5LL6 S;  3RMQ A;  2E6N A;  1UGQ B;  3J81 E;  3BW1 A;  1N9S A;  1YJW A;  2YHT A;  2QTX A;  2ZCF B;  3QJY A;  2KDS A;  3GIB A;  5J39 A;  3PMI A;  1VQL T;  5CKE A;  4C0Z A;  3OYM A;  2IG0 A;  4PNO A;  1XNI A;  4C5H A;  3CPW S;  3CPW A;  4PLL A;  1K8A C;  1VQL A;  3P8B B;  4N4I A;  3I55 T;  2JOY A;  2E65 A;  4BB7 A;  5GAN 6;  3E9G A;  3OYK A;  3CBP A;  4J7I A;  4C8Q C;  3QJ6 A;  2PUO B;  2Y4X A;  3HPW A;  5C6S A;  5KCO A;  2R57 A;  1LNX A;  3I55 A;  1VQ7 T;  3INZ A;  2FHD A;  1KQ1 A;  1W4S A;  5DM7 R;  4J7F A;  1WQW A;  3C94 A;  4OGC A;  4FT4 A;  3JB9 D;  2DTI A;  3JCM f;  4N4G A;  3UWN A;  1VQ7 A;  3OSV A;  3MP1 A;  4A4H A;  3L42 A;  3E1S A;  3SDZ A;  2RJF A;  2ZPG B;  3L1A A;  3ME9 A;  2LQ8 A;  3BFM A;  4M77 G;  3OS0 A;  5GMK h;  3OYB A;  4OVA A;  1OI1 A;  3KBG A;  3R6O A;  4P5N A;  1WNL A;  5KH6 A;  4M75 C;  4M77 D;  2D9T A;  3CME A;  4RCC A;  1FXX A;  4OGE A;  2EAY A;  3ZEH A;  5LJ5 f;  3UDC A;  4GY5 A;  4JRQ A;  4JDS A;  1BYM A;  2XKO C;  4PL6 A;  3PIP A;  2EQU A;  1G3Y A;  4BAC A;  4RKU E;  5FRM A;  2XDP A;  3MEW A;  3BDU A;  1VIF A;  2QEX A;  2EFI A;  2K57 A;  2LCC A;  1BI3 A;  2M0O A;  5LJ5 g;  2L5Q A;  2DXB A;  5D6Y A;  3QDR B;  1I81 A;  2LVM A;  4EMK A;  2PUK B;  2JUF A;  1NE8 A;  2DTH A;  5LJ3 h;  1NPR A;  2DO3 A;  3OA6 A;  3A8L B;  4ZGD B;  1VQK A;  4OP0 A;  4OB2 B;  5LJ3 d;  2HQX A;  5IAY A;  3LW5 E;  3HKS A;  4C92 G;  3CCS T;  1VQM T;  3L2W A;  2DAQ A;  2Y4Y A;  3PFS A;  4C92 D;  1I5L A;  4MZM A;  1VQ4 T;  3FC3 A;  1QVF A;  3CCS A;  1VQM A;  3OYL A;  4FU6 A;  3JCM J;  4M7A A;  3M9Q A;  4XTW A;  3DLL A;  4PLI A;  5GAO p;  1YJ9 T;  1MHN A;  2VUB A;  1OZ2 A;  2X4X A;  3M53 A;  5GAN h;  4MMK A;  3VYH B;  2JVV A;  4PKC C;  2K3Y A;  4DOV A;  3H6Z A;  3OYA A;  4Z02 A;  5FRO A;  5CCA A;  2JNG A;  2KVQ G;  4IUP A;  5LJ5 j;  5GAN d;  3OYF A;  2RI5 A;  3JCM c;  4C5E A;  2BIV A;  4C8Q E;  3V8J A;  2VXE A;  5FLX E;  5HK0 A;  4JRP A;  5A0G A;  2LCL A;  1X75 C;  3PNW C;  3QYG B;  3JCM V;  4E7L A;  1S72 T;  3CCL A;  2FB7 A;  1NPP A;  1ZHI A;  3GOX A;  4C5G A;  4A4K A;  1RL2 A;  5CKB A;  1QVP A;  3LH0 A;  1R8O B;  2M1H A;  2X4Y A;  4M75 E;  4B9X A;  3JCM P;  4M75 F;  1G3T A;  4FIB A;  4QVC A;  4M7D E;  2X4W A;  3SB2 A;  3CC2 T;  1RI0 A;  3QUI A;  3MHX A;  1BKB A;  3GF5 A;  4M7A G;  4V2S A;  2DPP B;  1K73 U;  3FDR A;  2KQW A;  3MEV A;  1PSE A;  3TU4 K;  1X6O A;  2RI3 A;  3CC2 A;  2XDB A;  2WAC A;  4QVZ A;  3G4S T;  3CCV T;  4J83 A;  3JCM Q;  4MDW A;  5A2Q E;  3LGL A;  4J5Y A;  4NOY A;  4QVD A;  3S3O A;  2C06 A;  4OB3 B;  4UC4 A;  2V8I A;  3VU3 C;  3G4S A;  3S3M A;  4MDX A;  1QVG A;  4XTX A;  4OF1 A;  4XTZ A;  2V8K A;  3MEA A;  4HT9 A;  4HCB A;  4FL6 A;  1KQ2 A;  3RKW A;  1KHC A;  2GCX A;  1HK9 A;  2QXF A;  4B9W A;  3A8M B;  4KUI A;  5DLO A;  3JB9 J;  4QQG A;  2E12 A;  3ER0 A;  1YJW T;  2FL7 A;  3M59 A;  1U1T A;  3X20 B;  2CZ7 B;  4F7U A;  2DXC A;  2BKD N;  4Q5W A;  4M77 B;  4N0A A;  5GMK m;  2F5K A;  3HSB A;  1N9R A;  2P0K A;  3M57 A;  4L59 A;  5CQY A;  4XTU A;  2EWN A;  4E47 A;  3M55 A;  2ZPH B;  3A5Z B;  4XQ3 A;  3S6W A;  2RD1 A;  4C8Q D;  2CS7 A;  1BIA A;  4J6Y A;  4L6V 5;  4E7K A;  3A8O B;  3LGF A;  4XU0 A;  5FU6 C;  4C0D C;  4KUD K;  2O4X A;  2X35 A;  4M78 A;  4MML A;  1KD1 U;  4ZGJ B;  3FIF A;  3UT1 A;  5M9O A;  2ZGW A;  3OY9 A;  1YBY A;  3QPH A;  1G3S A;  3LYI A;  3CCU T;  2RHY A;  2O01 E;  2LQK A;  4KUL A;  4IUR A;  2WSF E;  5J3B A;  4NL3 A;  3BY7 A;  2QQR A;  3QXE B;  4LDW A;  2QA4 A;  3JB9 G;  2OTL A;  1M9S A;  3LLR A;  3CCU A;  5GMK e;  4BI3 A;  4PJO G;  4M75 D;  3X28 B;  3M4Y A;  2E64 A;  1YIJ T;  5IN1 A;  1KD1 C;  4M7D D;  1KG1 A;  3M5A A;  1U8R A;  2XK0 A;  2YLC A;  3HRU A;  3TCJ A;  4C92 A;  3CXC A;  3CXC S;  3WVD B;  4PJO D;  3LWI A;  2RI2 A;  3CMA T;  2LRQ A;  2P0Q A;  4F7U G;  5GAN 3;  4A4F A;  1YIJ A;  2QQ9 A;  2PQW A;  5GAO r;  1O9S A;  2ZPB B;  3NTI A;  2F69 A;  1D3B A;  1UGR B;  3M58 A;  1DJ7 B;  2QEX T;  3CMA A;  1BIB A;  2KAF A;  3JSC A;  3QSU A;  1Q82 U;  4IUV A;  2CGH A;  1VUB A;  4M78 G;  3FRN A;  1WGS A;  3OYE A;  2HQE A;  1ZBX A;  4NL2 A;  2EQK A;  2VGN A;  3N5B B;  4RG2 A;  4M78 D;  5LJ3 e;  2L89 A;  5J26 A;  3JCM b;  5GAN 4;  3V8L A;  2E10 A;  5EG2 A;  5LJ3 g;  5GAN 5;  1VQK T;  1ZQ1 A;  2ZPE B;  3CCM T;  3CBO A;  3X26 B;  3QG1 A;  2DVE A;  2KSS A;  5HY6 A;  2D6F A;  4EMK B;  2DKG A;  3CCM A;  3OYY A;  4LDY A;  2CYZ B;  2K4Y A;  2MWP A;  2EYQ A;  2RJC A;  3VJP A;  2PVG B;  4M77 C;  1Q81 U;  4II1 A;  3JCM h;  4VUB A;  5CKH A;  3I56 T;  1IRE B;  5GAN e;  3T9N A;  1M5Q 1;  3JCM d;  2XG8 D;  5HK3 A;  1WJR A;  2EJF A;  4XU3 A;  3HRT A;  3G71 T;  3RER A;  4M7A F;  4M7A B;  2RH2 A;  2MMP A;  4EMG A;  3I56 A;  3SWN A;  3OYJ A;  1VQ9 A;  4HT8 A;  4LDV A;  4ELZ C;  1M1K U;  1N8R U;  5FU6 B;  2WSE E;  4C0D B;  1U1S A;  3G71 A;  2XHC A;  4L5G A;  1I8F A;  3CCL T;  1Q81 C;  4BDZ A;  3FLG A;  3CC4 T;  3MP8 A;  1Y96 A;  4XU1 A;  5AYF A;  4HCC A;  4J6W A;  5GAM h;  1SSF A;  1X01 A;  2DXT A;  3L2Q A;  5I2M A;  1W2B S;  3VYG A;  3WVE B;  4A54 A;  4ZGE B;  1B34 A;  2E41 A;  5GAM d;  5GAN 7;  3P8D A;  5GAO n;  3GPL A;  3CC4 A;  4D6W A;  2EJ9 A;  5CK9 A;  4JS5 A;  1N8R C;  2A3L A;  2HD0 A;  1M1K C;  3PIO A;  3ASK A;  4QQD A;  4JLI A;  2E70 A;  3C12 A;  3G7Z A;  2EKO A;  2YLB A;  2DJZ A;  3OMC A;  2G3R A;  4C92 C;  3MCA B;  3TRE A;  4X34 A;  1O75 A;  2OTJ T;  4A53 A;  2QI2 A;  5GAN 2;  3NTK A;  4JJN K;  1KHI A;  4C8Q A;  4XK8 E;  3PMT A;  3GLX A;  2DIG A;  5L8R E;  1AHJ B;  5FU7 C;  1KQS S;  4BI8 B;  1KQS A;  2XD0 A;  1WJS A;  2DTO A;  2OTJ A;  1EIF A;  2L8D A;  2DEQ A;  2Y90 A;  1N27 A;  5C0M A;  3QII A;  4XTY A;  4C5I A;  4GLK A;  5CIU A;  4OB1 B;  2VGM A;  2MF2 A;  2R58 A;  4JS4 A;  2RHU A;  4JLG A;  3RKY A;  2JZ2 A;  2P4T A;  2H3J A;  2PU9 B;  3VV0 A;  5CQX A;  2HBP A;  1YJN T;  4BD3 A;  3RES A;  4M75 A;  3SD4 A;  2K5L A;  1K73 C;  2M9U A;  3CEY A;  4XU2 A;  4EMK C;  4M7D A;  3EFS A;  1K9M U;  2OAU A;  3JB9 F;  4BY6 C;  1YJN A;  2V8J A;  4PJO A;  2XDD A;  5GMK l;  2LDM A;  1YHQ T;  1WJQ A;  2K2V A;  2R5M A;  1YIT T;  2LT4 A;  3X25 B;  3MET A;  4M77 E;  1Y71 A;  2XID A;  4M77 F;  1IZ6 A;  2E1H A;  4IUU A;  3MEU A;  5I21 A;  2B8A A;  3HRS A;  3URG A;  4F7U B;  1YHQ A;  4WF2 A;  5I2S A;  3J7A F;  1VIE A;  3CPF A;  4C8Q G;  1YIT A;  1K9M C;  2A7Y A;  4M7A C;  4RG8 A;  1V29 B;  3C4S A;  5CAI A;  4HCZ A;  4XTV A;  4Y91 A;  1VQ5 A;  5DLQ E;  4ME7 A;  1WPY A;  2HNI A;  2GQV A;  2BUD A;  3OYC A;  4IUT A;  3NFC A;  2QA4 T;  2OTL T;  2O4X B;  3M4G A;  1OZ3 A;  4M78 B;  4BE0 A;  4LDX A;  1PSF A;  3OYG A;  3M56 A;  4HKE A;  1NZ9 A;  2QQA A;  2VYT A;  3CBM A;  4BE1 A;  4M75 G;  3V8K A;  3LWH A;  2XI9 A;  3WXM B;  3JCM W;  1YI2 T;  1VQP T;  4M7D G;  5GAO m;  3G6E T;  5FRN A;  2JTF A;  2EJG A;  3OYD A;  4DA4 A;  3CCQ T;  2I2L A;  2RJD A;  3CCJ T;  1M1F A;  2M16 A;  4ZTF A;  2RJE A;  3OS1 A;  1VQP A;  4OMF B;  5KE2 A;  2KK4 A;  3V7S A;  1YI2 A;  3JB9 H;  3G6E A;  4JRK A;  4C92 E;  2LTO A;  4O6J A;  4C92 F;  2ZZD A;  4C92 B;  3CCQ A;  3A8G B;  3SFM A;  3CCJ A;  2RK2 A;  3OQ5 A;  3VUZ A;  3CD6 T;  2CZ6 B;  1YCY A;  1XTD A;  2VC8 A;  5LJ3 f;  4BDY A;  2PVD B;  3JRZ A;  4NS5 A;  1VQ8 T;  1D3B B;  2K5I A;  3OW2 A;  5FU7 B;  2ZPI B;  3OW2 S;  1KC8 U;  3CD6 A;  3OBW A;  3QZ5 B;  5HKC A;  1JBM A;  2DIQ A;  3LX7 A;  4LDU A;  1VQO T;  1QP3 A;  2RO0 A;  4C0G A;  2MI6 A;  2QQB A;  2DZ9 A;  2DZC A;  4CI0 C;  3OYI A;  1VQ8 A;  2VV5 A;  1GXI E;  2DXU A;  2AHJ B;  3OSS C;  4N4H A;  3FB9 A;  2RK1 A;  1XQH A;  1VQO A;  3VUB A;  3RUX A;  4XAX B;  3DLM A;  4C0F A;  5GMK j;  3OS2 A;  2X4J A;  3GNF B;  1JRI A;  1Q82 C;  3M54 A;  1BI0 A;  3MO8 A;  3ZBD A;  4CRI A;  4DQ2 A;  5GAN f;  1KC8 C;  4M7D C;  5A0D A;  1M90 U;  1LOJ A;  2PVO B;  3QYH B;  4BY6 B;  3JCM e;  4BE2 A;  1M1G A;  2D0Q B;  5GAO q;  4PJO C;  3JCM g;  3PTA A;  2DD4 A;  4HA8 A;  4EPC A;  4A4E A;  3S3N A;  4ZN1 A;  5DY9 A;  3JAM E;  1BI1 A;  1UEB A;  5CR2 A;  5GAM f;  2QDY B;  2R5A A;  4N0A C;  3L2R A;  3CCR T;  2GFA A;  4RCB A;  1Q7Y U;  1VQ9 T;  4LD9 K;  2FVU A;  3OB9 A;  3QO3 A;  5A0L A;  5LJ5 e;  2CKK A;  4OB0 B;  4ELY C;  5GAN g;  1FWZ A;  5D6W A;  4J6X A;  4IKF A;  4M7A E;  1M90 C;  3P8H A;  2GF7 A;  3ZFJ A;  3L2U A;  3CCR A;  2RHX A;  3HHT B;  5IT9 E;  1P92 A;  2JN0 A;  1Y7X A;  4IUQ A;  4TVR A;  3CCE T;  5LJ5 h;  5GAM e;  3PGG A;  5CKD A;  3SWN B;  4FM4 B;  3HFO A;  4M78 C;  5LJ3 j;  5GAM g;  1VQ6 T;  2QQS A;  5CVI A;  1UB4 A;  4QQ6 A;  5LJ5 d;  3KXT A;  3FJP A;  1MGQ A;  3Q1J A;  4MZT A;  4X9C A;  4E7I A;  4FT2 A;  3DB3 A;  3HFN A;  3X24 B;  4KT0 E;  3CCE A;  1Q7Y C;  2FYK A;  3OMG A;  1Y96 B;  3JCM X;  1W2B A;  1VQ6 A;  3PT9 A;  2EQJ A;  3H8Z A;  3BDL A;  3FEO A;  3TEE A;  3OBY A;  1QVF S;  1B34 B;  3E9F A;  2LX9 A;  3VKI A;  3RMS A;  4ZTJ A;  3QKJ A;  1UGS B;  5GAN 8; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...