2VXEA

Solution structure of the lsm domain of drosophila melanogaster tral (trailer hitch)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
88
structure length
88
Chain Sequence
GAMAMSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVVNNHTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG10686-PA
publication title Similar Modes of Interaction Enable Trailer Hitch and Edc3 to Associate with Dcp1 and Me31B in Distinct Protein Complexes.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 10
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vxeA00
5LJ3j 4XTVA 4XTUA 4M75G 3RKWA 4XU0A 1WQWA 4XTWA 2DXUA 4A54A 5GMKi 5GAMh 4M7DC 1KQ1A 2ZGWA 3JB9J 3VU3C 3SWNA 5DY9A 3L1AA 4M78F 4JRIA 1X01A 4XU3A 4F7UA 1I5LA 3RUXA 4PJOC 4XU2A 4XTZA 5GAOq 5GAOm 1M8VA 1D3BA 2E10A 1WNLA 2E1HA 1JBMA 4M75A 3JCMQ 4NL3A 4C92A 4MMKA 4QVDA 2EWNA 5GAN8 4XQ3A 4M7AA 4M7DB 4M77C 4C8QD 4M78G 1HXDA 2CGHA 5GAMg 3EFRA 3PGGA 3JB9G 3JCMd 3HFNA 2VXEA 2DZ9A 4PJOB 3V7SA 3GIBA 4Y91A 3RKXA 5GAOn 2DEQA 4A53A 2E65A 2FB7A 4OP0A 5LJ5f 5LJ5h 5LJ3d 4M77B 3L2ZA 5GAN5 2E64A 3BY7A 3BW1A 4M78A 4C92G 5GAOl 4M7DE 1H641 3BFMA 5GAMf 1HK9A 4M7AG 3RIRA 4M7DF 2DJZA 4RCCA 5GAN3 5GMKh 1U1SA 4WF2A 4N0AC 1LOJA 4PJOE 5LJ5g 5GAMe 4PJOF 4M75D 4RCBA 4C92D 3V8LA 5CAIA 4M7AD 4M77E 5GAOr 4V2SA 2EJGA 4J5YA 3JCMJ 4M77F 5GMKm 3FIFA 4C8QE 2DXTA 2JN0A 2RD1A 4JRKA 1I81A 1LNXA 1WPYA 2DTHA 2DZCA 3BDUA 4C8QC 4C8QF 4EMKC 2YLBA 1Y96A 4M7DA 1U1TA 4M78D 5GAN4 3JB9D 4MMLA 4JUVA 3JCMh 3JCMf 5I21A 2Y90A 4C8QB 4PJOA 1I4K1 1B34B 5LJ5e 5GANf 5GANh 4EMKB 4NOYA 1N9RA 4X9DA 3JB9H 4X9CA 3QSUA 3M4GA 4JLIA 2DTIA 5LJ3f 5LJ3h 3V8JA 2FYKA 4M77A 3SWNC 4F7UE 5LJ5d 3RERA 2EJFA 3JCMV 4F7UF 1M5Q1 1BIAA 3EFSA 5LJ5j 4DQ2A 1YCYA 2VXFA 5GANe 3JCMP 3FB9A 4M7DG 4M75E 1JRIA 2EAYA 3INZA 4XTYA 3JCMg 2RB6A 1N9SA 5GMKe 4M75C 5GAMd 4M75F 4C92C 1TH7A 4M7AC 5GAMj 5GANg 4PJOG 3HSBA 3V8KA 2RM4A 4EMGA 3SWNB 4F7UB 3JB9I 5LJ3g 4M7DD 4J6YA 2QTXA 3RKYA 4J6XA 1D3BB 4M77G 4M75B 3JCMb 2VC8A 2YLCA 4C92B 5GAN2 2DKGA 1LJOA 4M7AB 3JCMW 1KQ2A 3SB2A 2E41A 4M78E 4N0AA 4C8QG 4PJOD 2EJ9A 4M78C 2HNIA 4QVCA 3QUIA 3V7CA 3JB9F 4NL2A 2RA2A 4XTXA 1MGQA 4XU1A 4M77D 3JCMc 3RESA 3V7RA 5GMKl 3QO3A 1Y96B 3AHUA 2DVEA 4J6WA 3JCMe 1I8FA 2K57A 3JCMX 5GAN6 2I2LA 3FJPA 1BIBA 4HT9A 3HFOA 4HA8A 4M78B 4C8QA 1B34A 4C92E 2DTOA 4EMKA 4PNOA 2YHTA 5LJ3e 5GAN7 5GANd 4M7AE 4C92F 5GAOp 4HT8A 3QHSA 4M7AF 4F7UG 4EMHA 5GANj 1WQ7A 5GMKj
chains in the Genus database with same CATH superfamily
1BCOA 3MEVA 2C06A 2DX1A 4J9DA 1VQ9Q 4P5NA 5ECAA 3SWNA 1ZSZA 2YUQA 2QGGA 3RNJA 1AWJA 3X28B 2FO0A 4M77C 1VQLA 3G6EQ 2RHXA 3EHQA 3TQ7P 4PJOB 2XMFA 4QVZA 3HPWA 1RLPC 2PUKB 4BDZA 5LJ5f 4PL6A 2RI2A 1OI1A 3IQLA 1NM7A 1K0SA 2ZPHB 4J9HA 3UA7A 1ZX6A 1WIEA 2XU8A 1RAFB 3V8LA 5M9OA 1QW1A 4IIMA 2L2PA 4FIBA 2A3LA 1WHKA 1M1FA 2DERA 3E9FA 3M5AA 2RO0A 5FWBA 2JZ2A 4RTTA 1WXTA 1VQMQ 2C0OA 2NUTA 5HK0A 3EGXA 3EFOA 3OMCA 3CXCA 2AHJB 1Q81R 3CCET 4BI3A 3OBYA 5CR2A 4OMFB 4JLIA 5LJ3h 2LQ8A 3MP6A 1ZSGA 5LJ5j 1Q81C 5CVIA 1G3SA 1T0JA 3ZFJA 2RQTA 2D0QB 2VVKA 2QK0A 3HSBA 1UGQB 2P84A 4J6XA 3JAME 1S72T 4J8OA 4JLGA 4PJOD 3X26B 1NYFA 3FLGA 3I55T 1JJ2A 1KD1U 4E7LA 5C6SA 1NLPC 3THKA 1K8AR 3PFSA 3EGDB 4GLKA 1YWPA 4M78B 2DL4A 4EMKA 4M7AE 1ZA2B 2HAXA 3EG9A 3CPFA 1RI9A 2IG0A 1K8AC 2PUOB 3H0HA 1LVKA 3MHXA 1W2BA 3OW2A 2QQRA 4OMNA 4JJNK 3VJPA 2LQNA 1TG0A 3ZEHA 1WHLA 4PJOC 2DJQA 5GAOq 2HKNA 1YITT 4NL3A 2EWNA 1HXDA 1BB9A 2OTLA 4IUTA 1VQNA 4DBHA 2COZA 3A8MB 1BI2A 2LX7A 1IZ6A 5J3BA 5GAN5 3QJ6A 1VQ6Q 5CIUA 1BKBA 3EG0A 2OAUA 1T3LA 5A0DA 4KGZB 5GAN3 4E7JA 3Q1JA 3S3OA 3CCUQ 5IHNA 1Y57A 3A8HB 3I5SA 1U06A 1AZEA 2DXTA 1UUEA 2JN0A 4C5HA 2P4RA 2GFAA 2VGNA 4M78D 4B9XA 2ESWA 3CCJT 3JB9D 3H0IA 2Y90A 2C0TA 2AKLA 3LGLA 3CC2A 4ATOA 1IO6A 2D6FA 3EFSA 2HDAA 3DB3A 3CCVQ 4XTYA 2QI2A 4JRQA 1TXQA 2EGCA 5IXBA 2JNGA 4BE0A 5IXFA 1NE8A 2VGMA 4EMGA 1M2VB 3BE3A 1NPRA 5KYUB 4CRIA 3CCLA 2W10A 2XI9A 2MWPA 3CCQT 1M4ZA 1H3HA 1WHMA 2J05A 2PTKA 4M78C 3QXEB 5FW9A 2B8AA 3CCMT 5D7UA 1UEBA 4A4GA 1U8RA 1R8OB 1TUDA 4QKUA 2M51A 5GAN6 1EX4A 1NPPA 3PT9A 4JDSA 2LJ1A 3HFOA 1B34A 4XK8E 1VQOQ 1OYXA 2E3HA 2VASA 4M7AF 1YIJQ 1SG5A 2G6FX 3M0TA 4XTUA 1GXIE 2CYZB 1W1FA 3CD6A 4Z02A 1PSEA 1Q95G 1ZQ1A 2JTEA 1NEGA 4MDXA 1N6AA 3HRSA 1D3BA 2V1QA 5KYYB 1MMNA 3I56T 2EYXA 1ACMB 8AT1B 5GJVB 3PGGA 3RR6A 6AT1B 7AT1B 3HL8A 1WHHA 2H3JA 3CMEQ 3VKIA 1YI2A 2KDSA 1YJNQ 1M8MA 1QP3A 4FW2A 1UDLA 4Q5WA 1VQ5A 3HRTA 4E47A 4OGCA 1YHQT 2J06A 1SRMA 2ZZDA 1UE9A 4ZNXA 1TSFA 2DD4A 4JJCA 1Y0MA 1X27A 2AZVA 2YUPA 3O8VA 1D1AA 2M16A 3WVDB 2FPFA 4M7DA 4BUGA 4MMLA 4AFSC 1E6HA 1SF9A 1V1CA 3JSCA 3JB9H 2WSFE 3TCJA 4HVUA 4RG2A 4KT0E 3CCST 1KHIA 1X2KA 3PVLA 3EAEA 4YTLA 4EDUA 2QEXT 1YJWQ 1Y07A 2DMOA 1WI7A 4FU6A 4DA4A 2F2WA 2AK5A 2PVDB 1FX7A 3JB9I 3VRYA 4C0DB 2CSQA 4B9WA 1W70A 1B3QA 3OYMA 4LNPA 3UDCA 1DJ7B 3ASKA 5A0LA 1MV3A 1X6OA 1YJNA 4HCBA 3A98A 1D0XA 1Y96B 4LD9K 1NEBA 2EBPA 2BE9B 2NWMA 2ZPGB 2RI5A 3EHRA 2FHDA 1WDXA 1VQ4A 1B7TA 2HL3A 2ZPBB 1WQWA 5CKHA 3META 1C0MA 1Q81U 1K0XA 2QA4A 2BZYA 1WNLA 4BB7A 2M0YA 2R58A 3TVTA 3OYHA 1YJWA 2E6NA 3NPFA 3VV0A 3RKXA 2XDDA 1R0BG 2CH4A 4OP0A 5LJ5h 3EG1A 3QBYA 5HKCA 2E64A 1RL2A 3BY7A 1VQ7T 4M7AG 1QP2A 2O2OA 3SDZA 1M90R 4WF2A 2HSPA 2KSSA 2KYBA 4J9FA 1PNJA 4QQDA 2RQWA 4IUPA 2EGEA 3FIFA 1K8AU 2QGFB 4HKEA 1VQKA 3OYGA 2YLBA 4N4GA 2X35A 3CCRT 2ED1A 1YHQQ 3CMAQ 1C1AA 2KXDA 1K73R 4BACA 3I5RA 4X9DA 4X9CA 3V8JA 5LJ5d 3H0FA 2RQVA 2EJFA 2J6KA 1SEMA 4C0DC 1D1CA 3R6NA 1K73C 1RAGB 1KJWA 3QIIA 4F7UB 5LJ3g 4J6YA 4C0FA 3KFVA 3URGA 1FMVA 1WJSA 2IVWA 2E41A 4M78E 4N0AA 2YT6A 4OF1A 1NLOC 2I0NA 3A5ZB 4ZTJA 3V7CA 2DL8A 3QO3A 3JCMX 2ZAEA 3G4SA 3CC7T 4FSSA 1BIBA 2MPXC 1G3WA 2XG8D 3VUBA 5LJ3e 2DF6A 5AT1B 4GBQA 3FC3A 3S3MA 4O5VA 4AFZC 4A4HA 2QQ9A 4XTWA 1K1ZA 1H8KA 1YCSB 4JJDA 1YNZA 1X75C 2YSQA 4LDYA 4E7IA 3MCAB 1MUZA 3OYLA 1VQ9T 4C92A 4QVDA 2NYSA 3NMZC 2DA9A 3MJXA 1PD0A 2BIVA 2DRKA 2PU9B 3A8GB 2EIFA 2K2MA 1ARKA 2HBPA 4A53A 4L59A 1EZZB 4MZTA 3LYIA 3G6ET 4M7DE 4JS4A 3OYIA 2CZ1B 4F17A 1XOVA 1SPKA 3A1PA 1I5OB 4LDWA 2YXYA 4VUBA 3OYEA 4EPCA 4E7KA 3WVEB 1V29B 2DD5A 3O5ZA 2MAMA 3SHWA 1WPYA 4L5GA 1WGSA 2X4YA 1BK2A 3G7ZA 5KYXA 2LT1A 3MO8A 1EFNA 1VQPA 2VB6A 4F04B 1I4K1 4PFPA 1VQMT 2A08A 2CSIA 2CKKA 1TS9A 4QT7A 1X43A 3OYNA 1WX6A 3QDRB 3MEWA 4ELYC 2LX9A 2O4XA 3QG1A 1KC8R 1VQNT 2IIMA 2K5LA 2QTVA 3M0SA 2BZXA 3UF4A 2X4XA 1ABQA 5A2QE 1O9SA 4QW2A 3CC4A 3QWYA 3NGPA 3JB9F 4LUEA 1IGUA 3JV3A 1KQSS 1N8RC 2LQWA 2MIOA 5I11A 1VQLQ 2KVQG 3OA6A 2QG9B 2CZ7B 2K7AA 4LD6A 3M0PA 1VQ8A 3F70A 1BBZA 2L89A 1TTHB 1AVZC 5GAMh 2MYSA 2YRCA 3ZL7C 4LDXA 5I22A 2GTOA 2DILA 4XU3A 4K11A 1UFFA 2ZPEB 2SRCA 3OYKA 1JBMA 2P0PA 4B6MA 1M3AA 1PCXA 2ENMA 2H3EB 2BUDA 2Y4XA 2JJ9A 1ZBXA 3UA6A 2PVGB 4ORZA 3UATA 1CSKA 5GAOl 3OS0A 1R77A 4M7DF 2DJZA 3LLRA 1WXUA 4JZ4A 1VQ6T 3EH1A 3E9GA 1KQSP 4ZGJB 4IKFA 2OTJA 2EJGA 5GMKm 3CCUT 4ANJA 2RD1A 2DBMA 5D6YA 3VS7A 3QDFA 4L6V5 2QQBA 2JM8A 3QJYA 3M0RA 3JCMf 1ZUKA 1VYVA 2WACA 1TWBA 2LCCA 4HVVA 4M77A 3JCMV 1U5SA 2CS7A 1YCYA 2M1HA 2RHYA 2RPNA 1T3SA 2RJDA 1Z9ZA 2CP7A 3C0CA 2M02A 3CCVT 1D0ZA 1JXOA 2HQXA 3N5BB 1KG1A 2RJCA 2FRWA 4LE9A 3OS5A 4PLIA 3M4YA 3RESA 3ME9A 1PG5B 5GMKl 1M90U 2DVEA 3OYYA 3VS2A 1GL5A 2DL3A 2RHIA 1G8XA 2COWA 2JW4A 4JJBA 4C92E 2JTMA 1GCQC 2OTLQ 1VQNQ 1SRLA 4IUQA 2JS0A 1WZOA 3OSSC 1OOTA 2OAWA 1PM3A 1RLQC 2X51A 2DM1A 1VQOT 3HTRA 2MCNA 3JB9J 1IGQA 2QYZA 3DB4A 1YIJT 2MOXA 2KYMA 2DL5A 1K73U 2E1HA 4KRTA 5L8RE 3CQTA 4MMKA 1IB8A 3REAB 4M78G 2CGHA 2R5AA 4OB1B 4FYXB 3JB9G 2A0FB 2K2VA 5IAYA 2M9UA 2VXEA 2OI3A 4E6RA 2DEQA 3C95A 2E65A 2CUBA 5LJ3d 5KE2A 2K3XA 4OMLA 3CC2Q 3OBWA 1OPKA 3CMET 1U1SA 3C94A 5LJ5g 1YJNT 3L2QA 1XJWB 3LGFA 1HYOA 2D8HA 3OB9A 4CC7A 4RG8A 3T9NA 3FEOA 2DPPB 3M58A 1K4US 1I0CA 3CCLQ 4HCKA 3G1JA 1RACB 5GAN4 1QVFA 1RAIB 4ESRA 4C8QB 4PJOA 5LJ5e 4LUDA 1YJ9A 1BI1A 1KIKA 4JPBW 2JMAA 2RJEA 4PJNA 4F7UE 2RI3A 4M7DG 3PVQA 4HXJA 4IIOA 5HCKA 2PZ1A 2RM4A 4E7ZA 1YJWT 1BYMA 2QTXA 5CQXA 3CD6Q 1KQ2A 2BTTA 4PK4A 3PMTA 4KH1B 1YN8A 3JCMc 4WCIA 2JM9A 3SFMA 3V7RA 1UJYA 2DIGA 2LJ3A 3U23A 4KUDK 4HT9A 1TUGB 1VIEA 2KE9A 2RHZA 3VS3A 1O75A 4C92F 1PKTA 5CO7A 3LWHA 1YI2Q 2PVOB 2RMOA 3MPUB 3OS2A 1VQ5Q 2QAZA 1FWZA 5KCOA 1WLPB 3M53A 2VUBA 2NUZA 2E10A 2K4YA 3A8LB 4C8QD 4PJLA 3V7SA 2EQJA 4Y91A 3EGDA 2PNIA 1J3TA 1T0HA 1QKWA 1HD3A 4M78A 3M0UA 2HQHA 2W0ZA 4CC2A 5GAMf 1Q82R 1ZBJA 4FSXA 1NBEB 2EPDA 1TOVA 1N8RU 3G71A 5FU7B 2F69A 4RCBA 4RTUA 4M77E 1Q82C 2FEIA 3JCMJ 3CPWA 2LT4A 2EYZA 5L23A 4C8QC 1U1TA 1IREB 2FL7A 2AIRB 5GANf 3OYAA 3QSUA 4F7UF 1M5Q1 2VKNA 3CMAT 2EYYA 3EG3A 2L3SA 1VQ4Q 5GAMj 3J80E 1UGSB 2XK0A 4CI0C 3CCEA 1V76A 5CK9A 3X20B 4CC4B 4J9GA 1QLYA 1BI3A 2EJ9A 1WA7A 2QA4Q 2X4WA 2RQUA 4J6WA 2YUOA 1G2BA 2LC4A 2EYQA 2KQWA 3NTHA 2GQVA 2DTOA 2E70A 1S72A 5GAN7 5GAOp 4HT8A 4J83A 3QHSA 1PKSA 1ABOA 5GANj 1WQ7A 3QWXX 4FYWB 2J7IA 4Z8AA 3I55A 2DXUA 5GMKi 2GF7A 2JTFA 1M2VA 2LMJA 3E2UA 1X01A 5KYUA 3RUXA 1BI0A 3PNWC 3LW5E 2CP5A 3JCMQ 5GAMg 2RNAA 4GY5A 1CKAA 1VQKQ 2KK4A 3QZ9B 2X3WD 3M59A 3E19A 3L2ZA 5FU7C 4FW1A 1MNDA 3HKSA 4C92G 3CXCS 3BFMA 1FMKA 1YITA 1K9MR 1GCPA 2YDLA 1ZUYA 4PJOE 2HKQB 5GAMe 5CAIA 1LCKA 4LDUA 1X6GA 1K9MC 3L2WA 4M77F 2E5KA 2K5FA 3VRZA 4OB3B 2A28A 1LNXA 2DTHA 3H41A 2CP6A 2JUFA 1Z9QA 5KYYA 3HHTB 5HY6A 3GF5A 3C4SA 2O88A 1QVGA 3JCMh 5FLXE 4AFUC 2KEAA 4KUIA 4C5IA 2ED0A 1JJ2S 3I9QA 3RERA 3G4SQ 5GANe 2VXFA 3KUFA 3OQ5A 2MWOA 1M90C 3J7AF 1PD1A 3CCJA 1MHNA 4AG2C 2F2VA 5KYWB 1OEBA 2KXCA 4AG1C 1W2BS 4HVWA 3CXCP 4M75B 3OW2S 1OX9A 2DKGA 3ZBDA 4M7AB 2V26A 4IUUA 2L5QA 2B86A 4PJJA 3GBQA 4AMCA 3FJPA 4HA8A 2DYBA 4F7UG 3CCQA 2KGTA 2F1LA 2K5IA 4J9BA 1VQLT 4PKCC 4XTVA 2D8JA 3SD4A 3CCMA 1SSHA 2ZGWA 2O01E 4ME7A 1JJ2P 3VU3C 4XTZA 1M9SA 2NUPB 2K3YA 1AEYA 2DLPA 4RUGA 4XQ3A 3H9NA 3NFCA 2DZ9A 1NZ9A 5J39A 4IURA 2FB7A 3UWNA 1W2BP 5IT9E 3OW2P 4MZPA 3L2VA 3ER0A 1AT1B 2SEMA 2F5TX 1VQPQ 1H641 1HK9A 1VYUA 3RIRA 2D9TA 3NHNA 5GMKh 4PJMA 3P8DA 4LDVA 4PJOF 4M75D 3RMQA 4M7AD 5CKFA 2E12A 1Q7YR 4MZMA 4C8QE 2L3QA 1C6VX 1JU5C 4ZGEB 1Q7YC 4J9IA 5D6WA 2KAFA 5FU6B 2FG0A 2DVJA 3CC4Q 2F5KA 5EC7A 4A4KA 4C0GA 2VYTA 2CDTA 2CP0A 2DTIA 3FRNA 5I2MA 2Y4YA 3R6OA 4DBFA 1PSFA 2DK3A 1YBYA 3FB9A 4OMOA 3QKJA 4M75C 1VQ8Q 1VUBA 4M7AC 1JXMA 3V8KA 3SWNB 1VIFA 1ZSZB 3LWIA 2L0AA 4M77G 2L8DA 5GJWB 3OYCA 4Y92A 5GAN2 2EYWA 5D6XA 1LJOA 3CCSA 3EG2A 1X6BA 2QEXA 3QUIA 4XU1A 2LCLA 2HL5C 1Q82U 2FPEA 2RH2A 3A8OB 3NTKA 2HEQA 2NLUA 1WJQA 4PNOA 2K6DA 2XIDA 4EMHA 2EQMA 2OTLT 1MMDA 4XU0A 1GFCA 1KQ1A 2DAQA 1OZ3A 1KHCA 4F7UA 4M78F 1YFNA 5GAOm 1KC8C 1M8VA 2OTJQ 2NUTB 2CT4A 4RTYA 3EGXB 3EFOB 2FZKB 1PC0A 3M9QA 2VWFA 2HZYA 2K79A 1M3CA 2AKKA 5A0GA 2DL7A 2K3BA 4RCCA 2HSEB 8ATCB 1SSFA 2E3IA 1QCFA 1MMGA 1H3ZA 3CC2T 5EG2A 2CUDA 4XAXB 5FU6C 5LL6S 3EGUA 1QWEA 1VQ7A 1AOJA 4C8QF 2AZSA 1K9AA 4JUVA 2KR3A 5I21A 2V8IA 3CCLT 5GANh 4EMKB 4NOYA 4OB0B 2YRDA 3EG9B 4C5EA 2CH4W 3SWNC 2KRNA 3DKMA 4DQ2A 1ZSZC 2LQKA 1RAHB 5GAMd 2RK1A 1SHFA 2A36A 1G83A 2HD0A 4PJOG 3CCRA 2G3RA 4E7SA 1I1JA 3GLXA 4D8KA 3JCMW 1OX8A 2KBTA 4EIKA 2FPDA 4QVCA 3PTAA 2FVUA 3MEAA 3CD6T 4AFQC 1K9MU 1G5VA 4PFZA 3G71T 4J9CA 2DXBA 4FT2A 5GANd 3VS1A 1W6XA 2VV5A 4DBQA 1QVGS 4BI4A 1UGPB 1YI2T 1X69A 3CC7A 4JRIA 4RKUE 3PIOA 5FRMA 1VQ5T 4ELZC 4FYVB 4QQ6A 3KXTA 1K76A 2LRQA 3M0QA 1VA7A 5KE3A 1HJDA 2J6OA 2CREA 4Z89A 2CP3A 2FZCB 1D09B 1KFZA 2EQKA 1RAEB 1YJ9Q 3KBGA 4FM4B 1FXXA 1VQ9A 4ZN1A 2YWWA 3SEMA 2R5MA 1GCQA 1UJ0A 3ULRB 1UHFA 4J5YA 3G6EA 4EMKC 3M57A 2H8HA 3VYGA 1QVGP 2ROLA 2A7YA 4RMOA 5CKEA 1B34B 4F16A 4J9EA 4BY6B 3GNFB 2ZCFB 1H92A 1KK7A 3JCMP 1AWOA 4M75E 3JCMg 5HK3A 4DOVA 1UG1A 2XD0A 2HBWA 3VS0A 2L3PA 4E7HA 1AZGB 3RKYA 4OMPA 1G3TA 1D3BB 1VQMA 1N5ZA 1VQ4T 3M56A 2LVMA 2O31A 3L2RA 4C8QG 4J7FA 2HMAA 2GCXA 3P8BB 1I07A 4NL2A 1BU1A 1SKUB 3VS6A 3JCMe 1IXDA 4R55A 2QA4T 3VS4A 3TU4K 1Q7YU 1AWXA 5GMKj 1WXBA 3OSVA 5DM7R 2CZ0B 4CC3A 1XQHA 1TUCA 2YUNA 1RABB 1OULA 2OJ2A 3G71Q 1I5LA 4R0KA 3WXMB 2JOYA 4M7DB 5GAN8 5CQYA 1A0NB 1BCMA 4Z88A 5GAOn 1Q86R 1QQJA 1JO8A 2EFIA 1OZ2A 1S1NA 2RHUA 5AYFA 2D0NA 1VQKT 4OMQA 5FWCA 2DXCA 3BW1A 4A4FA 1Q86C 2HCKA 2JMCA 1AD5A 2LNHB 2EKHA 2MMPA 2BKDN 4KBMB 4Y28E 3OYFA 3CCEQ 4JRKA 5CCAA 1I81A 2BZ8A 1RADB 3BDUA 5FRNA 4BY6C 4BD3A 1OV3A 3MP1A 4RTXA 2EW3A 1VQ6A 3UPUA 3GP8A 3OMGA 3H8ZA 1KC8U 4J7IA 2DBKA 4BE1A 2QXFA 3CCUA 1BIAA 1ZUUA 1VYTA 4QQGA 5GMKe 1S72Q 1GRIA 4M75F 2KNBB 2MF2A 1WFWA 1SHGA 1B07A 3G4ST 2EQUA 3VYHB 2COYA 4M7DD 2M0OA 3REBB 3I55Q 2V8JA 4AT1B 2E5QA 3OYBA 1M1KR 2RJFA 2HNIA 3MEUA 4X34A 4RTWA 3LX7A 1NJIR 1RAAB 2I2LA 1W4SA 2C0IA 3FDRA 2JS2A 2KMTA 2Z0WA 4C8QA 1M1KC 3CCVA 1U3OA 1QMCA 1NJIC 2MK5A 4JZ3A 3EH2A 1AHJB 4RTVA 3RKWA 4M7DC 1YITQ 2DYIA 4D6WA 4JRPA 2KRSA 1WJRA 1M27C 2X4JA 4UC4A 1Y7XA 1KQSA 3PE0A 3EFRA 1PRLC 3HFNA 2PQWA 1D1BA 4JS5A 1VQOA 2LP5A 3M55A 2F2XA 1JB0E 1YIJA 3GPLA 1MNEA 2P4TA 4PLLA 2XKOC 2A37A 1JQQA 2YRVA 2ATCB 5KH6A 3FJ5A 2BE7D 1LOJA 1VQPT 5CKBA 2KT8A 3TSZA 5GAOr 4V2SA 1QVPA 3CCJQ 2KROA 2LCSA 1UECA 2EGAA 3RMSA 4DBRA 2E4HA 4E2FB 1JEGA 5J26A 1UB4A 3CMEA 1QCOA 3AT1B 2DFUA 5IHIA 3TSWA 1N9RA 4DEYA 1IHWA 5LJ3f 4FL6A 4A4EA 5IN1A 2P0KA 4II1A 3CC4T 3INZA 1RUWA 2LTOA 3CBPA 1HSQA 2ECZA 5GANg 3CCQQ 4KGXB 1GBQA 2EKOA 4KH0B 3VUZA 3CCMQ 1VQ8T 4BI8B 1OU9A 2VC8A 4C92B 1UHCA 3MKDA 3LH5A 3SB2A 1OPLA 3DLMA 2DE0X 2IPOB 2RA2A 2KI7A 1XTDA 5DLQE 1YP5A 1I8FA 5KYNA 2QASA 3CBOA 3RDVA 1UGRB 1XNIA 2JT4A 2LDMA 3LH0A 1ZHIA 4BDYA 4D8DA 5LJ3j 4M75G 1IRXA 2LJ0A 4A54A 1TU0B 3I56Q 1YWOA 3QZ5B 1PHTA 2CZ6B 5DY9A 3L1AA 4IUVA 4XU2A 1G3YA 2GGRA 3C12A 1OQKA 5KYXB 1F1BB 3JCMd 3X25B 3CBMA 3GIBA 2OTJT 3L42A 4X1VA 2E6ZA 4M4ZA 1FMWA 3E1SA 5FROA 1NYGA 2MI6A 2OX7A 2WSCE 5DLOA 2EQIA 1KD1R 1QVFS 4F14A 1E7OA 4OB2B 3BDLA 2ZPIB 1LPLA 4N0AC 4DEXA 5I2SA 1X2QA 4GLMA 4FT4A 4C92D 2DNUA 1KD1C 2O4XB 4ZTFA 1QWFA 3MP8A 9ATCB 1CKBA 2AT1B 4N4HA 2EVRA 4PFOA 1Y96A 4TVRA 2O9SA 3GOXA 4C5GA 3CCSQ 1M30A 2QEXQ 5IH2A 3J81E 3I56A 1D0YA 3M4GA 3TREA 2DO3A 5IHKA 2FYKA 4A63B 4C0ZA 1ZLMA 4LXCA 3CEYA 2X9HA 4ZGDB 1JRIA 1VOMA 2KY9A 2RB6A 1N9SA 2K9GA 4C92C 3RBBB 1PWTA 4HCZA 4OGEA 5KCHA 1UTIA 4O6JA 1R0CB 1WYXA 1Q86U 2ZPFB 1QVFP 1N27A 2YLCA 2QQSA 1YHQA 2CT3A 3CMAA 1MGQA 1EIFA 3D7SB 3AHUA 2D1XA 2V8KA 3OYJA 4ZN3A 1PRMC 2DRMA 2V1RA 1M3BA 2YHTA 2L3RA 1MV0B 1UGVA 4KGVB 2KT1A 2RN8A 4MDWA 3PIPA 4LN2A 1FYNA 2J6FA 3OYDA 4BE2A 5KYWA 1MMAA 3JRZA 2CP2A 2GFUA 4M75A 2GNCA 4M7AA 4NS5A 3CPWS 2JVVA 1VQ7Q 1M2OA 1QCNA 2QDLA 2QDYB 4M77B 1OU8A 3S3NA 1AWWA 2KRMA 2HQEA 2R57A 2XHCA 1NG2A 3QYHB 1RI0A 2O9VA 1M1KU 3TEEA 2QQAA 5C0MA 1YJ9T 3P8HA 2JXBA 1NJIU 3CCRQ 2P0QA 2FRYA 2DZCA 2NUPA 4OMMA 2LZ6B 2GTJA 3DLLA 1N8RR 3X24B 4HCCA 1GBRA 2GBQA 2WSEE 2XDBA 2XICA 5CKDA 3OY9A 4FCYA 3L2UA 3GNGA 1ZA1B 2FZGB 1QKXA 2ROTA 2EAYA 3CPWP 3M54A 1E6GA 1P92A 1TH7A 3QYGB 3PMIA 2RQRA 3QPHA 3S6WA 3NTIA 3VS5A 3JCMb 1KSWA 4FYYB 4RTZA 2ABLA 2X3XD 4OVAA 1M1GA 1Y71A 1GFDA 1IHVA 3CC7Q 2RK2A 2XDPA 4XTXA 2DEUA 4M77D 4DOWA 4R56A 2LNVA 2DETA 2DIQA 2K57A 1WHGA 3HP9A 3HRUA 3H6ZA 4WTOB 3I35A 1WHJA 3OS1A 3UT1A 4KULA 2RF0A 4N4IA 2GQIA
chains in the Genus database with same CATH topology
4O5VA 3MEVA 4A4HA 3I55A 5DM7R 2CZ0B 2QQ9A 4XTWA 2DXUA 5GMKi 2GF7A 2C06A 2JTFA 1XQHA 4P5NA 1X75C 3SWNA 1X01A 1I5LA 3RUXA 4LDYA 4E7IA 1BI0A 3MCAB 3PNWC 3WXMB 2JOYA 3LW5E 3JCMQ 4C92A 4QVDA 5GAN8 3X28B 3OYLA 1VQ9T 5CQYA 4M7DB 4M77C 5GAMg 2BIVA 4GY5A 1VQLA 2RHXA 2PU9B 3A8GB 2EIFA 2KK4A 4PJOB 4QVZA 3HPWA 5GAOn 2HBPA 3QZ9B 2PUKB 4A53A 4L59A 2EFIA 4BDZA 3M59A 5LJ5f 1OZ2A 4PL6A 3E19A 2RI2A 1OI1A 3L2ZA 2RHUA 3LYIA 4MZTA 5FU7C 5AYFA 3G6ET 1VQKT 2DXCA 3BW1A 3HKSA 4A4FA 4C92G 3CXCS 4M7DE 4JS4A 3BFMA 3E9FA 3OYIA 2ZPHB 2CZ1B 1Q86C 1YITA 1XOVA 4PJOE 2XU8A 5GAMe 3V8LA 5CAIA 4LDWA 5M9OA 4LDUA 2MMPA 1QW1A 4VUBA 3OYEA 2BKDN 4EPCA 4FIBA 1K9MC 3L2WA 2A3LA 4E7KA 4KBMB 4M77F 1V29B 3WVEB 2DD5A 2MAMA 2K5FA 4Y28E 1M1FA 4OB3B 3OYFA 4JRKA 5CCAA 1I81A 1LNXA 1WPYA 2DTHA 1WGSA 2X4YA 3BDUA 2RO0A 2JUFA 2JZ2A 3M5AA 4L5GA 4BY6C 3HHTB 4BD3A 3G7ZA 3MP1A 5HY6A 3GF5A 3C4SA 5HK0A 2LT1A 3OMCA 1VQ6A 3CXCA 2AHJB 3UPUA 3GP8A 1QVGA 3CCET 3MO8A 3H8ZA 3OMGA 3JCMh 4BI3A 3OBYA 5FLXE 1VQPA 5CR2A 1I4K1 1KC8U 4KUIA 4J7IA 4C5IA 1VQMT 4OMFB 1JJ2S 4BE1A 4JLIA 2QXFA 5LJ3h 2CKKA 3RERA 2LQ8A 3CCUA 3MP6A 1Q81C 1BIAA 5LJ5j 5CVIA 5GANe 2VXFA 3KUFA 4QQGA 1G3SA 3OQ5A 3ZFJA 5GMKe 2MWOA 3OYNA 1M90C 4M75F 2D0QB 3J7AF 2MF2A 3HSBA 3QDRB 3CCJA 1MHNA 1UGQB 2EQUA 3G4ST 3MEWA 3VYHB 4M7DD 2M0OA 4ELYC 4J6XA 2LX9A 2O4XA 2V8JA 3QG1A 3JAME 1S72T 1W2BS 2K5LA 4J8OA 4JLGA 1VQNT 4M75B 3OW2S 2DKGA 2E5QA 4M7AB 3ZBDA 4PJOD 3X26B 2X4XA 5A2QE 4IUUA 1O9SA 4QW2A 3OYBA 2RJFA 2HNIA 3FLGA 3MEUA 3I55T 1JJ2A 1KD1U 3CC4A 3JB9F 4E7LA 4X34A 5C6SA 2L5QA 3LX7A 3PFSA 1KQSS 1N8RC 4GLKA 2I2LA 1W4SA 3FJPA 2KVQG 3FDRA 2KMTA 3OA6A 4M78B 4HA8A 4C8QA 2CZ7B 1M1KC 3CCVA 4EMKA 4M7AE 4LD6A 2HAXA 1VQ8A 3CPFA 3F70A 4F7UG 2IG0A 3CCQA 1K8AC 1NJIC 2PUOB 2L89A 2K5IA 1VQLT 4PKCC 4XTVA 1AHJB 3MHXA 1W2BA 3RKWA 3SD4A 3CCMA 2QQRA 3OW2A 5GAMh 4M7DC 1YJ9A 2ZGWA 2O01E 4LDXA 4JJNK 3VJPA 4ME7A 4D6WA 3ZEHA 3VU3C 4JRPA 4XU3A 1WJRA 4PJOC 2ZPEB 4XTZA 1M9SA 5GAOq 2K3YA 2X4JA 3OYKA 1JBMA 4UC4A 1Y7XA 4NL3A 1YITT 2P0PA 1KQSA 2EWNA 4XQ3A 1HXDA 3NFCA 3EFRA 3HFNA 2PQWA 2OTLA 4IUTA 2DZ9A 1NZ9A 1VQNA 4JS5A 1VQOA 2BUDA 2Y4XA 5J39A 3A8MB 1BI2A 4IURA 2FB7A 1ZBXA 3UWNA 3M55A 1IZ6A 5IT9E 1JB0E 2PVGB 5J3BA 1YIJA 4MZPA 5GAN5 3QJ6A 3L2VA 3ER0A 2P4TA 3GPLA 2F5TX 5CIUA 1BKBA 4PLLA 2XKOC 5GAOl 1H641 1HK9A 2OAUA 3OS0A 3RIRA 4M7DF 2D9TA 2YRVA 2DJZA 5A0DA 3LLRA 5GAN3 5GMKh 5KH6A 4E7JA 3Q1JA 3S3OA 1LOJA 1VQ6T 3P8DA 3E9GA 4LDVA 5CKBA 4M75D 4PJOF 4ZGJB 1VQPT 3RMQA 4IKFA 2OTJA 4M7AD 5CKFA 5GAOr 2E12A 3A8HB 4V2SA 2EJGA 5GMKm 4MZMA 1QVPA 3CCUT 4C8QE 2DXTA 2JN0A 2RD1A 4C5HA 5D6YA 3RMSA 2GFAA 4ZGEB 5J26A 1UB4A 2VGNA 4L6V5 3CMEA 1Q7YC 5D6WA 2QQBA 4M78D 4B9XA 3QJYA 2KAFA 5FU6B 3CCJT 3JB9D 3JCMf 2Y90A 2F5KA 2WACA 3CC2A 3LGLA 1N9RA 4A4KA 4C0GA 4ATOA 2LCCA 2VYTA 2DTIA 3FRNA 4FL6A 5LJ3f 4M77A 2Y4YA 3R6OA 5I2MA 1PSFA 2DK3A 1YBYA 5IN1A 3JCMV 2P0KA 4II1A 3EFSA 2CS7A 2D6FA 1YCYA 3FB9A 3CC4T 3DB3A 2RHYA 2M1HA 2QI2A 3INZA 4XTYA 3QKJA 4JRQA 2LTOA 4M75C 2JNGA 2RJDA 3CBPA 1VUBA 4BE0A 5GANg 4M7AC 1NE8A 2VGMA 3V8KA 4EMGA 3SWNB 2EKOA 1VIFA 1NPRA 3VUZA 3LWIA 3CCVT 4CRIA 3CCLA 4M77G 2HQXA 2L8DA 3N5BB 3OYCA 1VQ8T 2XI9A 4BI8B 2VC8A 2MWPA 5D6XA 4C92B 5GAN2 1LJOA 1M4ZA 3CCQT 2RJCA 3SB2A 1KG1A 3CCSA 4M78C 3DLMA 2QEXA 3QXEB 2B8AA 3QUIA 3OS5A 4PLIA 4XU1A 2RA2A 2LCLA 3M4YA 3CCMT 1UEBA 3RESA 3ME9A 4A4GA 5GMKl 1U8RA 1Q82U 1XTDA 2DVEA 3OYYA 5DLQE 1M90U 1I8FA 1R8OB 2RH2A 5GAN6 1NPPA 3PT9A 4JDSA 3A8OB 2RHIA 3CBOA 3NTKA 3HFOA 2NLUA 1B34A 2JTMA 1WJQA 4C92E 4XK8E 4PNOA 4A4EA 1UGRB 4IUQA 2XIDA 3OSSC 1OYXA 1XNIA 4M7AF 4EMHA 2LDMA 2EQMA 3LH0A 1ZHIA 4BDYA 5LJ3j 2OTLT 4XTUA 4M75G 1GXIE 2CYZB 4XU0A 1VQOT 3CD6A 4A54A 4Z02A 1PSEA 1KQ1A 3JB9J 1ZQ1A 2DAQA 3DB4A 3QZ5B 1YIJT 1OZ3A 2CZ6B 1KHCA 5DY9A 3L1AA 4M78F 4F7UA 4IUVA 4XU2A 4MDXA 5GAOm 1G3YA 1N6AA 3C12A 3HRSA 1D3BA 1KC8C 1K73U 1M8VA 2E1HA 3I56T 5L8RE 4MMKA 4M78G 2CGHA 2R5AA 3PGGA 4OB1B 3JB9G 3M9QA 2K2VA 3JCMd 5IAYA 2M9UA 2VXEA 3X25B 5FRNA 3CBMA 3HL8A 3GIBA 2OTJT 3L42A 2H3JA 2DEQA 3C95A 2E65A 3VKIA 5LJ3d 1YI2A 2E6ZA 2KDSA 5KE2A 3E1SA 5FROA 2MI6A 2WSCE 1QP3A 2K3XA 5A0GA 5DLOA 1QVFS 4Q5WA 3OBWA 1VQ5A 4OB2B 3CMET 3BDLA 4RCCA 1U1SA 3C94A 2ZPIB 3HRTA 4N0AC 1SSFA 4E47A 5I2SA 5LJ5g 4OGCA 3L2QA 1YHQT 1YJNT 4FT4A 4C92D 3LGFA 1H3ZA 1KD1C 2O4XB 3OB9A 4ZTFA 3CC2T 5EG2A 2ZZDA 3MP8A 4RG8A 4XAXB 3T9NA 3FEOA 5FU6C 5LL6S 2DD4A 4N4HA 2DPPB 1VQ7A 3M58A 3O8VA 4C8QF 2M16A 3WVDB 4TVRA 1Y96A 4M7DA 5GAN4 4BUGA 3GOXA 4MMLA 1QVFA 4JUVA 4C5GA 5I21A 3JSCA 4C8QB 4PJOA 2V8IA 5LJ5e 5GANh 4EMKB 4NOYA 3J81E 3I56A 3CCLT 4OB0B 1BI1A 2WSFE 3TCJA 3JB9H 3M4GA 3TREA 2DO3A 4RG2A 2RJEA 4C5EA 4F7UE 2FYKA 2RI3A 3SWNC 4C0ZA 3DKMA 4KT0E 3CCST 1KHIA 3CEYA 3EAEA 4YTLA 4DQ2A 4EDUA 4ZGDB 2QEXT 4M7DG 1JRIA 1Y07A 2LQKA 2KY9A 2RB6A 1N9SA 5GAMd 2RK1A 4C92C 4FU6A 4DA4A 2HD0A 4PJOG 2PVDB 4HCZA 2RM4A 1FX7A 4OGEA 3CCRA 2G3RA 5KCHA 3JB9I 1YJWT 4C0DB 1BYMA 2QTXA 4O6JA 3GLXA 5CQXA 4B9WA 1Q86U 2ZPFB 1N27A 3OYMA 2YLCA 3UDCA 2QQSA 3JCMW 1DJ7B 1KQ2A 3ASKA 5A0LA 1X6OA 1YJNA 1YHQA 3PMTA 3CMAA 4HCBA 4QVCA 3PTAA 2FVUA 3MEAA 1MGQA 3JCMc 3CD6T 3SFMA 1EIFA 3V7RA 3AHUA 1Y96B 1K9MU 2DIGA 4LD9K 2V8KA 3OYJA 1G5VA 4ZN3A 2ZPGB 3G71T 4KUDK 4HT9A 2RI5A 2FHDA 1VIEA 2DXBA 4FT2A 2RHZA 2YHTA 1O75A 2L3RA 5GANd 4C92F 1VQ4A 5CO7A 3LWHA 2PVOB 4MDWA 2ZPBB 3PIPA 2VV5A 1QVGS 1WQWA 4BI4A 3OS2A 3OYDA 1FWZA 1UGPB 5CKHA 1YI2T 5KCOA 4BE2A 3M53A 3META 3CC7A 4JRIA 1Q81U 2VUBA 4RKUE 3JRZA 3PIOA 2QA4A 5FRMA 2E10A 4BB7A 1WNLA 2K4YA 3A8LB 2GFUA 2R58A 1VQ5T 4M75A 4ELZC 4QQ6A 4M7AA 3OYHA 4C8QD 3KXTA 1YJWA 4NS5A 3CPWS 2JVVA 2LRQA 2E6NA 3V7SA 3VV0A 2EQJA 4Y91A 5KE3A 3RKXA 2XDDA 4OP0A 5LJ5h 2QDYB 4M77B 3QBYA 5HKCA 2E64A 1RL2A 3BY7A 1VQ7T 4M78A 3S3NA 2EQKA 5GAMf 1QP2A 4M7AG 2HQEA 3KBGA 3SDZA 2R57A 2XHCA 4FM4B 4FSXA 1FXXA 1VQ9A 4WF2A 3QYHB 2KSSA 1RI0A 4ZN1A 1N8RU 3G71A 5FU7B 2F69A 4RCBA 2R5MA 1M1KU 3TEEA 2QQAA 5C0MA 1YJ9T 3P8HA 4M77E 1Q82C 4QQDA 4IUPA 4J5YA 3JCMJ 3CPWA 2LT4A 3FIFA 1NJIU 1K8AU 2P0QA 4HKEA 1VQKA 3G6EA 4C8QC 2DZCA 3OYGA 4EMKC 2YLBA 3M57A 4N4GA 3VYGA 1U1TA 1IREB 2FL7A 2X35A 3DLLA 3CCRT 2A7YA 4RMOA 5CKEA 3X24B 4HCCA 4BACA 1B34B 5GANf 4BY6B 3OYAA 2WSEE 4X9DA 2XDBA 2XICA 3GNFB 4X9CA 5CKDA 3QSUA 3OY9A 2ZCFB 3V8JA 5LJ5d 2EJFA 4F7UF 1M5Q1 3L2UA 3GNGA 4C0DC 3JCMP 3CMAT 4M75E 2EAYA 1K73C 3M54A 3JCMg 5HK3A 4DOVA 1P92A 1TH7A 3QIIA 3QYGB 5GAMj 3PMIA 3J80E 1UGSB 2XD0A 3QPHA 2XK0A 3S6WA 4CI0C 3CCEA 4F7UB 4E7HA 5CK9A 3NTIA 5LJ3g 4J6YA 4C0FA 3RKYA 1G3TA 3X20B 1D3BB 3URGA 1VQMA 1WJSA 2IVWA 1VQ4T 3JCMb 3M56A 2LVMA 4OVAA 1M1GA 1Y71A 3L2RA 2E41A 4M78E 4N0AA 4C8QG 1BI3A 2EJ9A 4J7FA 4OF1A 2RK2A 3A5ZB 2XDPA 4ZTJA 2GCXA 3P8BB 3V7CA 4NL2A 4XTXA 4M77D 2X4WA 4DOWA 4R56A 3QO3A 4J6WA 2LNVA 3JCMe 2DIQA 2K57A 3JCMX 2LC4A 3HP9A 2EYQA 2KQWA 3G4SA 3HRUA 3CC7T 1BIBA 3H6ZA 4R55A 3NTHA 1G3WA 2GQVA 2DTOA 2E70A 2XG8D 3VUBA 5GAN7 5LJ3e 2QA4T 1S72A 3TU4K 5GAOp 4HT8A 4J83A 3QHSA 1Q7YU 3OS1A 3UT1A 4KULA 5GANj 1WQ7A 3FC3A 5GMKj 4N4IA 3S3MA 3OSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 j;  4XTV A;  4XTU A;  4M75 G;  3RKW A;  4XU0 A;  1WQW A;  4XTW A;  2DXU A;  4A54 A;  5GMK i;  5GAM h;  4M7D C;  1KQ1 A;  2ZGW A;  3JB9 J;  3VU3 C;  3SWN A;  5DY9 A;  3L1A A;  4M78 F;  4JRI A;  1X01 A;  4XU3 A;  4F7U A;  1I5L A;  3RUX A;  4PJO C;  4XU2 A;  4XTZ A;  5GAO q;  5GAO m;  1M8V A;  1D3B A;  2E10 A;  1WNL A;  2E1H A;  1JBM A;  4M75 A;  3JCM Q;  4NL3 A;  4C92 A;  4MMK A;  4QVD A;  2EWN A;  5GAN 8;  4XQ3 A;  4M7A A;  4M7D B;  4M77 C;  4C8Q D;  4M78 G;  1HXD A;  2CGH A;  5GAM g;  3EFR A;  3PGG A;  3JB9 G;  3JCM d;  3HFN A;  2VXE A;  2DZ9 A;  4PJO B;  3V7S A;  3GIB A;  4Y91 A;  3RKX A;  5GAO n;  2DEQ A;  4A53 A;  2E65 A;  2FB7 A;  4OP0 A;  5LJ5 f;  5LJ5 h;  5LJ3 d;  4M77 B;  3L2Z A;  5GAN 5;  2E64 A;  3BY7 A;  3BW1 A;  4M78 A;  4C92 G;  5GAO l;  4M7D E;  1H64 1;  3BFM A;  5GAM f;  1HK9 A;  4M7A G;  3RIR A;  4M7D F;  2DJZ A;  4RCC A;  5GAN 3;  5GMK h;  1U1S A;  4WF2 A;  4N0A C;  1LOJ A;  4PJO E;  5LJ5 g;  5GAM e;  4PJO F;  4M75 D;  4RCB A;  4C92 D;  3V8L A;  5CAI A;  4M7A D;  4M77 E;  5GAO r;  4V2S A;  2EJG A;  4J5Y A;  3JCM J;  4M77 F;  5GMK m;  3FIF A;  4C8Q E;  2DXT A;  2JN0 A;  2RD1 A;  4JRK A;  1I81 A;  1LNX A;  1WPY A;  2DTH A;  2DZC A;  3BDU A;  4C8Q C;  4C8Q F;  4EMK C;  2YLB A;  1Y96 A;  4M7D A;  1U1T A;  4M78 D;  5GAN 4;  3JB9 D;  4MML A;  4JUV A;  3JCM h;  3JCM f;  5I21 A;  2Y90 A;  4C8Q B;  4PJO A;  1I4K 1;  1B34 B;  5LJ5 e;  5GAN f;  5GAN h;  4EMK B;  4NOY A;  1N9R A;  4X9D A;  3JB9 H;  4X9C A;  3QSU A;  3M4G A;  4JLI A;  2DTI A;  5LJ3 f;  5LJ3 h;  3V8J A;  2FYK A;  4M77 A;  3SWN C;  4F7U E;  5LJ5 d;  3RER A;  2EJF A;  3JCM V;  4F7U F;  1M5Q 1;  1BIA A;  3EFS A;  5LJ5 j;  4DQ2 A;  1YCY A;  2VXF A;  5GAN e;  3JCM P;  3FB9 A;  4M7D G;  4M75 E;  1JRI A;  2EAY A;  3INZ A;  4XTY A;  3JCM g;  2RB6 A;  1N9S A;  5GMK e;  4M75 C;  5GAM d;  4M75 F;  4C92 C;  1TH7 A;  4M7A C;  5GAM j;  5GAN g;  4PJO G;  3HSB A;  3V8K A;  2RM4 A;  4EMG A;  3SWN B;  4F7U B;  3JB9 I;  5LJ3 g;  4M7D D;  4J6Y A;  2QTX A;  3RKY A;  4J6X A;  1D3B B;  4M77 G;  4M75 B;  3JCM b;  2VC8 A;  2YLC A;  4C92 B;  5GAN 2;  2DKG A;  1LJO A;  4M7A B;  3JCM W;  1KQ2 A;  3SB2 A;  2E41 A;  4M78 E;  4N0A A;  4C8Q G;  4PJO D;  2EJ9 A;  4M78 C;  2HNI A;  4QVC A;  3QUI A;  3V7C A;  3JB9 F;  4NL2 A;  2RA2 A;  4XTX A;  1MGQ A;  4XU1 A;  4M77 D;  3JCM c;  3RES A;  3V7R A;  5GMK l;  3QO3 A;  1Y96 B;  3AHU A;  2DVE A;  4J6W A;  3JCM e;  1I8F A;  2K57 A;  3JCM X;  5GAN 6;  2I2L A;  3FJP A;  1BIB A;  4HT9 A;  3HFO A;  4HA8 A;  4M78 B;  4C8Q A;  1B34 A;  4C92 E;  2DTO A;  4EMK A;  4PNO A;  2YHT A;  5LJ3 e;  5GAN 7;  5GAN d;  4M7A E;  4C92 F;  5GAO p;  4HT8 A;  3QHS A;  4M7A F;  4F7U G;  4EMH A;  5GAN j;  1WQ7 A;  5GMK j; 
#chains in the Genus database with same CATH topology
 1BCO A;  3MEV A;  2C06 A;  2DX1 A;  4J9D A;  1VQ9 Q;  4P5N A;  5ECA A;  3SWN A;  1ZSZ A;  2YUQ A;  2QGG A;  3RNJ A;  1AWJ A;  3X28 B;  2FO0 A;  4M77 C;  1VQL A;  3G6E Q;  2RHX A;  3EHQ A;  3TQ7 P;  4PJO B;  2XMF A;  4QVZ A;  3HPW A;  1RLP C;  2PUK B;  4BDZ A;  5LJ5 f;  4PL6 A;  2RI2 A;  1OI1 A;  3IQL A;  1NM7 A;  1K0S A;  2ZPH B;  4J9H A;  3UA7 A;  1ZX6 A;  1WIE A;  2XU8 A;  1RAF B;  3V8L A;  5M9O A;  1QW1 A;  4IIM A;  2L2P A;  4FIB A;  2A3L A;  1WHK A;  1M1F A;  2DER A;  3E9F A;  3M5A A;  2RO0 A;  5FWB A;  2JZ2 A;  4RTT A;  1WXT A;  1VQM Q;  2C0O A;  2NUT A;  5HK0 A;  3EGX A;  3EFO A;  3OMC A;  3CXC A;  2AHJ B;  1Q81 R;  3CCE T;  4BI3 A;  3OBY A;  5CR2 A;  4OMF B;  4JLI A;  5LJ3 h;  2LQ8 A;  3MP6 A;  1ZSG A;  5LJ5 j;  1Q81 C;  5CVI A;  1G3S A;  1T0J A;  3ZFJ A;  2RQT A;  2D0Q B;  2VVK A;  2QK0 A;  3HSB A;  1UGQ B;  2P84 A;  4J6X A;  3JAM E;  1S72 T;  4J8O A;  4JLG A;  4PJO D;  3X26 B;  1NYF A;  3FLG A;  3I55 T;  1JJ2 A;  1KD1 U;  4E7L A;  5C6S A;  1NLP C;  3THK A;  1K8A R;  3PFS A;  3EGD B;  4GLK A;  1YWP A;  4M78 B;  2DL4 A;  4EMK A;  4M7A E;  1ZA2 B;  2HAX A;  3EG9 A;  3CPF A;  1RI9 A;  2IG0 A;  1K8A C;  2PUO B;  3H0H A;  1LVK A;  3MHX A;  1W2B A;  3OW2 A;  2QQR A;  4OMN A;  4JJN K;  3VJP A;  2LQN A;  1TG0 A;  3ZEH A;  1WHL A;  4PJO C;  2DJQ A;  5GAO q;  2HKN A;  1YIT T;  4NL3 A;  2EWN A;  1HXD A;  1BB9 A;  2OTL A;  4IUT A;  1VQN A;  4DBH A;  2COZ A;  3A8M B;  1BI2 A;  2LX7 A;  1IZ6 A;  5J3B A;  5GAN 5;  3QJ6 A;  1VQ6 Q;  5CIU A;  1BKB A;  3EG0 A;  2OAU A;  1T3L A;  5A0D A;  4KGZ B;  5GAN 3;  4E7J A;  3Q1J A;  3S3O A;  3CCU Q;  5IHN A;  1Y57 A;  3A8H B;  3I5S A;  1U06 A;  1AZE A;  2DXT A;  1UUE A;  2JN0 A;  4C5H A;  2P4R A;  2GFA A;  2VGN A;  4M78 D;  4B9X A;  2ESW A;  3CCJ T;  3JB9 D;  3H0I A;  2Y90 A;  2C0T A;  2AKL A;  3LGL A;  3CC2 A;  4ATO A;  1IO6 A;  2D6F A;  3EFS A;  2HDA A;  3DB3 A;  3CCV Q;  4XTY A;  2QI2 A;  4JRQ A;  1TXQ A;  2EGC A;  5IXB A;  2JNG A;  4BE0 A;  5IXF A;  1NE8 A;  2VGM A;  4EMG A;  1M2V B;  3BE3 A;  1NPR A;  5KYU B;  4CRI A;  3CCL A;  2W10 A;  2XI9 A;  2MWP A;  3CCQ T;  1M4Z A;  1H3H A;  1WHM A;  2J05 A;  2PTK A;  4M78 C;  3QXE B;  5FW9 A;  2B8A A;  3CCM T;  5D7U A;  1UEB A;  4A4G A;  1U8R A;  1R8O B;  1TUD A;  4QKU A;  2M51 A;  5GAN 6;  1EX4 A;  1NPP A;  3PT9 A;  4JDS A;  2LJ1 A;  3HFO A;  1B34 A;  4XK8 E;  1VQO Q;  1OYX A;  2E3H A;  2VAS A;  4M7A F;  1YIJ Q;  1SG5 A;  2G6F X;  3M0T A;  4XTU A;  1GXI E;  2CYZ B;  1W1F A;  3CD6 A;  4Z02 A;  1PSE A;  1Q95 G;  1ZQ1 A;  2JTE A;  1NEG A;  4MDX A;  1N6A A;  3HRS A;  1D3B A;  2V1Q A;  5KYY B;  1MMN A;  3I56 T;  2EYX A;  1ACM B;  8AT1 B;  5GJV B;  3PGG A;  3RR6 A;  6AT1 B;  7AT1 B;  3HL8 A;  1WHH A;  2H3J A;  3CME Q;  3VKI A;  1YI2 A;  2KDS A;  1YJN Q;  1M8M A;  1QP3 A;  4FW2 A;  1UDL A;  4Q5W A;  1VQ5 A;  3HRT A;  4E47 A;  4OGC A;  1YHQ T;  2J06 A;  1SRM A;  2ZZD A;  1UE9 A;  4ZNX A;  1TSF A;  2DD4 A;  4JJC A;  1Y0M A;  1X27 A;  2AZV A;  2YUP A;  3O8V A;  1D1A A;  2M16 A;  3WVD B;  2FPF A;  4M7D A;  4BUG A;  4MML A;  4AFS C;  1E6H A;  1SF9 A;  1V1C A;  3JSC A;  3JB9 H;  2WSF E;  3TCJ A;  4HVU A;  4RG2 A;  4KT0 E;  3CCS T;  1KHI A;  1X2K A;  3PVL A;  3EAE A;  4YTL A;  4EDU A;  2QEX T;  1YJW Q;  1Y07 A;  2DMO A;  1WI7 A;  4FU6 A;  4DA4 A;  2F2W A;  2AK5 A;  2PVD B;  1FX7 A;  3JB9 I;  3VRY A;  4C0D B;  2CSQ A;  4B9W A;  1W70 A;  1B3Q A;  3OYM A;  4LNP A;  3UDC A;  1DJ7 B;  3ASK A;  5A0L A;  1MV3 A;  1X6O A;  1YJN A;  4HCB A;  3A98 A;  1D0X A;  1Y96 B;  4LD9 K;  1NEB A;  2EBP A;  2BE9 B;  2NWM A;  2ZPG B;  2RI5 A;  3EHR A;  2FHD A;  1WDX A;  1VQ4 A;  1B7T A;  2HL3 A;  2ZPB B;  1WQW A;  5CKH A;  3MET A;  1C0M A;  1Q81 U;  1K0X A;  2QA4 A;  2BZY A;  1WNL A;  4BB7 A;  2M0Y A;  2R58 A;  3TVT A;  3OYH A;  1YJW A;  2E6N A;  3NPF A;  3VV0 A;  3RKX A;  2XDD A;  1R0B G;  2CH4 A;  4OP0 A;  5LJ5 h;  3EG1 A;  3QBY A;  5HKC A;  2E64 A;  1RL2 A;  3BY7 A;  1VQ7 T;  4M7A G;  1QP2 A;  2O2O A;  3SDZ A;  1M90 R;  4WF2 A;  2HSP A;  2KSS A;  2KYB A;  4J9F A;  1PNJ A;  4QQD A;  2RQW A;  4IUP A;  2EGE A;  3FIF A;  1K8A U;  2QGF B;  4HKE A;  1VQK A;  3OYG A;  2YLB A;  4N4G A;  2X35 A;  3CCR T;  2ED1 A;  1YHQ Q;  3CMA Q;  1C1A A;  2KXD A;  1K73 R;  4BAC A;  3I5R A;  4X9D A;  4X9C A;  3V8J A;  5LJ5 d;  3H0F A;  2RQV A;  2EJF A;  2J6K A;  1SEM A;  4C0D C;  1D1C A;  3R6N A;  1K73 C;  1RAG B;  1KJW A;  3QII A;  4F7U B;  5LJ3 g;  4J6Y A;  4C0F A;  3KFV A;  3URG A;  1FMV A;  1WJS A;  2IVW A;  2E41 A;  4M78 E;  4N0A A;  2YT6 A;  4OF1 A;  1NLO C;  2I0N A;  3A5Z B;  4ZTJ A;  3V7C A;  2DL8 A;  3QO3 A;  3JCM X;  2ZAE A;  3G4S A;  3CC7 T;  4FSS A;  1BIB A;  2MPX C;  1G3W A;  2XG8 D;  3VUB A;  5LJ3 e;  2DF6 A;  5AT1 B;  4GBQ A;  3FC3 A;  3S3M A;  4O5V A;  4AFZ C;  4A4H A;  2QQ9 A;  4XTW A;  1K1Z A;  1H8K A;  1YCS B;  4JJD A;  1YNZ A;  1X75 C;  2YSQ A;  4LDY A;  4E7I A;  3MCA B;  1MUZ A;  3OYL A;  1VQ9 T;  4C92 A;  4QVD A;  2NYS A;  3NMZ C;  2DA9 A;  3MJX A;  1PD0 A;  2BIV A;  2DRK A;  2PU9 B;  3A8G B;  2EIF A;  2K2M A;  1ARK A;  2HBP A;  4A53 A;  4L59 A;  1EZZ B;  4MZT A;  3LYI A;  3G6E T;  4M7D E;  4JS4 A;  3OYI A;  2CZ1 B;  4F17 A;  1XOV A;  1SPK A;  3A1P A;  1I5O B;  4LDW A;  2YXY A;  4VUB A;  3OYE A;  4EPC A;  4E7K A;  3WVE B;  1V29 B;  2DD5 A;  3O5Z A;  2MAM A;  3SHW A;  1WPY A;  4L5G A;  1WGS A;  2X4Y A;  1BK2 A;  3G7Z A;  5KYX A;  2LT1 A;  3MO8 A;  1EFN A;  1VQP A;  2VB6 A;  4F04 B;  1I4K 1;  4PFP A;  1VQM T;  2A08 A;  2CSI A;  2CKK A;  1TS9 A;  4QT7 A;  1X43 A;  3OYN A;  1WX6 A;  3QDR B;  3MEW A;  4ELY C;  2LX9 A;  2O4X A;  3QG1 A;  1KC8 R;  1VQN T;  2IIM A;  2K5L A;  2QTV A;  3M0S A;  2BZX A;  3UF4 A;  2X4X A;  1ABQ A;  5A2Q E;  1O9S A;  4QW2 A;  3CC4 A;  3QWY A;  3NGP A;  3JB9 F;  4LUE A;  1IGU A;  3JV3 A;  1KQS S;  1N8R C;  2LQW A;  2MIO A;  5I11 A;  1VQL Q;  2KVQ G;  3OA6 A;  2QG9 B;  2CZ7 B;  2K7A A;  4LD6 A;  3M0P A;  1VQ8 A;  3F70 A;  1BBZ A;  2L89 A;  1TTH B;  1AVZ C;  5GAM h;  2MYS A;  2YRC A;  3ZL7 C;  4LDX A;  5I22 A;  2GTO A;  2DIL A;  4XU3 A;  4K11 A;  1UFF A;  2ZPE B;  2SRC A;  3OYK A;  1JBM A;  2P0P A;  4B6M A;  1M3A A;  1PCX A;  2ENM A;  2H3E B;  2BUD A;  2Y4X A;  2JJ9 A;  1ZBX A;  3UA6 A;  2PVG B;  4ORZ A;  3UAT A;  1CSK A;  5GAO l;  3OS0 A;  1R77 A;  4M7D F;  2DJZ A;  3LLR A;  1WXU A;  4JZ4 A;  1VQ6 T;  3EH1 A;  3E9G A;  1KQS P;  4ZGJ B;  4IKF A;  2OTJ A;  2EJG A;  5GMK m;  3CCU T;  4ANJ A;  2RD1 A;  2DBM A;  5D6Y A;  3VS7 A;  3QDF A;  4L6V 5;  2QQB A;  2JM8 A;  3QJY A;  3M0R A;  3JCM f;  1ZUK A;  1VYV A;  2WAC A;  1TWB A;  2LCC A;  4HVV A;  4M77 A;  3JCM V;  1U5S A;  2CS7 A;  1YCY A;  2M1H A;  2RHY A;  2RPN A;  1T3S A;  2RJD A;  1Z9Z A;  2CP7 A;  3C0C A;  2M02 A;  3CCV T;  1D0Z A;  1JXO A;  2HQX A;  3N5B B;  1KG1 A;  2RJC A;  2FRW A;  4LE9 A;  3OS5 A;  4PLI A;  3M4Y A;  3RES A;  3ME9 A;  1PG5 B;  5GMK l;  1M90 U;  2DVE A;  3OYY A;  3VS2 A;  1GL5 A;  2DL3 A;  2RHI A;  1G8X A;  2COW A;  2JW4 A;  4JJB A;  4C92 E;  2JTM A;  1GCQ C;  2OTL Q;  1VQN Q;  1SRL A;  4IUQ A;  2JS0 A;  1WZO A;  3OSS C;  1OOT A;  2OAW A;  1PM3 A;  1RLQ C;  2X51 A;  2DM1 A;  1VQO T;  3HTR A;  2MCN A;  3JB9 J;  1IGQ A;  2QYZ A;  3DB4 A;  1YIJ T;  2MOX A;  2KYM A;  2DL5 A;  1K73 U;  2E1H A;  4KRT A;  5L8R E;  3CQT A;  4MMK A;  1IB8 A;  3REA B;  4M78 G;  2CGH A;  2R5A A;  4OB1 B;  4FYX B;  3JB9 G;  2A0F B;  2K2V A;  5IAY A;  2M9U A;  2VXE A;  2OI3 A;  4E6R A;  2DEQ A;  3C95 A;  2E65 A;  2CUB A;  5LJ3 d;  5KE2 A;  2K3X A;  4OML A;  3CC2 Q;  3OBW A;  1OPK A;  3CME T;  1U1S A;  3C94 A;  5LJ5 g;  1YJN T;  3L2Q A;  1XJW B;  3LGF A;  1HYO A;  2D8H A;  3OB9 A;  4CC7 A;  4RG8 A;  3T9N A;  3FEO A;  2DPP B;  3M58 A;  1K4U S;  1I0C A;  3CCL Q;  4HCK A;  3G1J A;  1RAC B;  5GAN 4;  1QVF A;  1RAI B;  4ESR A;  4C8Q B;  4PJO A;  5LJ5 e;  4LUD A;  1YJ9 A;  1BI1 A;  1KIK A;  4JPB W;  2JMA A;  2RJE A;  4PJN A;  4F7U E;  2RI3 A;  4M7D G;  3PVQ A;  4HXJ A;  4IIO A;  5HCK A;  2PZ1 A;  2RM4 A;  4E7Z A;  1YJW T;  1BYM A;  2QTX A;  5CQX A;  3CD6 Q;  1KQ2 A;  2BTT A;  4PK4 A;  3PMT A;  4KH1 B;  1YN8 A;  3JCM c;  4WCI A;  2JM9 A;  3SFM A;  3V7R A;  1UJY A;  2DIG A;  2LJ3 A;  3U23 A;  4KUD K;  4HT9 A;  1TUG B;  1VIE A;  2KE9 A;  2RHZ A;  3VS3 A;  1O75 A;  4C92 F;  1PKT A;  5CO7 A;  3LWH A;  1YI2 Q;  2PVO B;  2RMO A;  3MPU B;  3OS2 A;  1VQ5 Q;  2QAZ A;  1FWZ A;  5KCO A;  1WLP B;  3M53 A;  2VUB A;  2NUZ A;  2E10 A;  2K4Y A;  3A8L B;  4C8Q D;  4PJL A;  3V7S A;  2EQJ A;  4Y91 A;  3EGD A;  2PNI A;  1J3T A;  1T0H A;  1QKW A;  1HD3 A;  4M78 A;  3M0U A;  2HQH A;  2W0Z A;  4CC2 A;  5GAM f;  1Q82 R;  1ZBJ A;  4FSX A;  1NBE B;  2EPD A;  1TOV A;  1N8R U;  3G71 A;  5FU7 B;  2F69 A;  4RCB A;  4RTU A;  4M77 E;  1Q82 C;  2FEI A;  3JCM J;  3CPW A;  2LT4 A;  2EYZ A;  5L23 A;  4C8Q C;  1U1T A;  1IRE B;  2FL7 A;  2AIR B;  5GAN f;  3OYA A;  3QSU A;  4F7U F;  1M5Q 1;  2VKN A;  3CMA T;  2EYY A;  3EG3 A;  2L3S A;  1VQ4 Q;  5GAM j;  3J80 E;  1UGS B;  2XK0 A;  4CI0 C;  3CCE A;  1V76 A;  5CK9 A;  3X20 B;  4CC4 B;  4J9G A;  1QLY A;  1BI3 A;  2EJ9 A;  1WA7 A;  2QA4 Q;  2X4W A;  2RQU A;  4J6W A;  2YUO A;  1G2B A;  2LC4 A;  2EYQ A;  2KQW A;  3NTH A;  2GQV A;  2DTO A;  2E70 A;  1S72 A;  5GAN 7;  5GAO p;  4HT8 A;  4J83 A;  3QHS A;  1PKS A;  1ABO A;  5GAN j;  1WQ7 A;  3QWX X;  4FYW B;  2J7I A;  4Z8A A;  3I55 A;  2DXU A;  5GMK i;  2GF7 A;  2JTF A;  1M2V A;  2LMJ A;  3E2U A;  1X01 A;  5KYU A;  3RUX A;  1BI0 A;  3PNW C;  3LW5 E;  2CP5 A;  3JCM Q;  5GAM g;  2RNA A;  4GY5 A;  1CKA A;  1VQK Q;  2KK4 A;  3QZ9 B;  2X3W D;  3M59 A;  3E19 A;  3L2Z A;  5FU7 C;  4FW1 A;  1MND A;  3HKS A;  4C92 G;  3CXC S;  3BFM A;  1FMK A;  1YIT A;  1K9M R;  1GCP A;  2YDL A;  1ZUY A;  4PJO E;  2HKQ B;  5GAM e;  5CAI A;  1LCK A;  4LDU A;  1X6G A;  1K9M C;  3L2W A;  4M77 F;  2E5K A;  2K5F A;  3VRZ A;  4OB3 B;  2A28 A;  1LNX A;  2DTH A;  3H41 A;  2CP6 A;  2JUF A;  1Z9Q A;  5KYY A;  3HHT B;  5HY6 A;  3GF5 A;  3C4S A;  2O88 A;  1QVG A;  3JCM h;  5FLX E;  4AFU C;  2KEA A;  4KUI A;  4C5I A;  2ED0 A;  1JJ2 S;  3I9Q A;  3RER A;  3G4S Q;  5GAN e;  2VXF A;  3KUF A;  3OQ5 A;  2MWO A;  1M90 C;  3J7A F;  1PD1 A;  3CCJ A;  1MHN A;  4AG2 C;  2F2V A;  5KYW B;  1OEB A;  2KXC A;  4AG1 C;  1W2B S;  4HVW A;  3CXC P;  4M75 B;  3OW2 S;  1OX9 A;  2DKG A;  3ZBD A;  4M7A B;  2V26 A;  4IUU A;  2L5Q A;  2B86 A;  4PJJ A;  3GBQ A;  4AMC A;  3FJP A;  4HA8 A;  2DYB A;  4F7U G;  3CCQ A;  2KGT A;  2F1L A;  2K5I A;  4J9B A;  1VQL T;  4PKC C;  4XTV A;  2D8J A;  3SD4 A;  3CCM A;  1SSH A;  2ZGW A;  2O01 E;  4ME7 A;  1JJ2 P;  3VU3 C;  4XTZ A;  1M9S A;  2NUP B;  2K3Y A;  1AEY A;  2DLP A;  4RUG A;  4XQ3 A;  3H9N A;  3NFC A;  2DZ9 A;  1NZ9 A;  5J39 A;  4IUR A;  2FB7 A;  3UWN A;  1W2B P;  5IT9 E;  3OW2 P;  4MZP A;  3L2V A;  3ER0 A;  1AT1 B;  2SEM A;  2F5T X;  1VQP Q;  1H64 1;  1HK9 A;  1VYU A;  3RIR A;  2D9T A;  3NHN A;  5GMK h;  4PJM A;  3P8D A;  4LDV A;  4PJO F;  4M75 D;  3RMQ A;  4M7A D;  5CKF A;  2E12 A;  1Q7Y R;  4MZM A;  4C8Q E;  2L3Q A;  1C6V X;  1JU5 C;  4ZGE B;  1Q7Y C;  4J9I A;  5D6W A;  2KAF A;  5FU6 B;  2FG0 A;  2DVJ A;  3CC4 Q;  2F5K A;  5EC7 A;  4A4K A;  4C0G A;  2VYT A;  2CDT A;  2CP0 A;  2DTI A;  3FRN A;  5I2M A;  2Y4Y A;  3R6O A;  4DBF A;  1PSF A;  2DK3 A;  1YBY A;  3FB9 A;  4OMO A;  3QKJ A;  4M75 C;  1VQ8 Q;  1VUB A;  4M7A C;  1JXM A;  3V8K A;  3SWN B;  1VIF A;  1ZSZ B;  3LWI A;  2L0A A;  4M77 G;  2L8D A;  5GJW B;  3OYC A;  4Y92 A;  5GAN 2;  2EYW A;  5D6X A;  1LJO A;  3CCS A;  3EG2 A;  1X6B A;  2QEX A;  3QUI A;  4XU1 A;  2LCL A;  2HL5 C;  1Q82 U;  2FPE A;  2RH2 A;  3A8O B;  3NTK A;  2HEQ A;  2NLU A;  1WJQ A;  4PNO A;  2K6D A;  2XID A;  4EMH A;  2EQM A;  2OTL T;  1MMD A;  4XU0 A;  1GFC A;  1KQ1 A;  2DAQ A;  1OZ3 A;  1KHC A;  4F7U A;  4M78 F;  1YFN A;  5GAO m;  1KC8 C;  1M8V A;  2OTJ Q;  2NUT B;  2CT4 A;  4RTY A;  3EGX B;  3EFO B;  2FZK B;  1PC0 A;  3M9Q A;  2VWF A;  2HZY A;  2K79 A;  1M3C A;  2AKK A;  5A0G A;  2DL7 A;  2K3B A;  4RCC A;  2HSE B;  8ATC B;  1SSF A;  2E3I A;  1QCF A;  1MMG A;  1H3Z A;  3CC2 T;  5EG2 A;  2CUD A;  4XAX B;  5FU6 C;  5LL6 S;  3EGU A;  1QWE A;  1VQ7 A;  1AOJ A;  4C8Q F;  2AZS A;  1K9A A;  4JUV A;  2KR3 A;  5I21 A;  2V8I A;  3CCL T;  5GAN h;  4EMK B;  4NOY A;  4OB0 B;  2YRD A;  3EG9 B;  4C5E A;  2CH4 W;  3SWN C;  2KRN A;  3DKM A;  4DQ2 A;  1ZSZ C;  2LQK A;  1RAH B;  5GAM d;  2RK1 A;  1SHF A;  2A36 A;  1G83 A;  2HD0 A;  4PJO G;  3CCR A;  2G3R A;  4E7S A;  1I1J A;  3GLX A;  4D8K A;  3JCM W;  1OX8 A;  2KBT A;  4EIK A;  2FPD A;  4QVC A;  3PTA A;  2FVU A;  3MEA A;  3CD6 T;  4AFQ C;  1K9M U;  1G5V A;  4PFZ A;  3G71 T;  4J9C A;  2DXB A;  4FT2 A;  5GAN d;  3VS1 A;  1W6X A;  2VV5 A;  4DBQ A;  1QVG S;  4BI4 A;  1UGP B;  1YI2 T;  1X69 A;  3CC7 A;  4JRI A;  4RKU E;  3PIO A;  5FRM A;  1VQ5 T;  4ELZ C;  4FYV B;  4QQ6 A;  3KXT A;  1K76 A;  2LRQ A;  3M0Q A;  1VA7 A;  5KE3 A;  1HJD A;  2J6O A;  2CRE A;  4Z89 A;  2CP3 A;  2FZC B;  1D09 B;  1KFZ A;  2EQK A;  1RAE B;  1YJ9 Q;  3KBG A;  4FM4 B;  1FXX A;  1VQ9 A;  4ZN1 A;  2YWW A;  3SEM A;  2R5M A;  1GCQ A;  1UJ0 A;  3ULR B;  1UHF A;  4J5Y A;  3G6E A;  4EMK C;  3M57 A;  2H8H A;  3VYG A;  1QVG P;  2ROL A;  2A7Y A;  4RMO A;  5CKE A;  1B34 B;  4F16 A;  4J9E A;  4BY6 B;  3GNF B;  2ZCF B;  1H92 A;  1KK7 A;  3JCM P;  1AWO A;  4M75 E;  3JCM g;  5HK3 A;  4DOV A;  1UG1 A;  2XD0 A;  2HBW A;  3VS0 A;  2L3P A;  4E7H A;  1AZG B;  3RKY A;  4OMP A;  1G3T A;  1D3B B;  1VQM A;  1N5Z A;  1VQ4 T;  3M56 A;  2LVM A;  2O31 A;  3L2R A;  4C8Q G;  4J7F A;  2HMA A;  2GCX A;  3P8B B;  1I07 A;  4NL2 A;  1BU1 A;  1SKU B;  3VS6 A;  3JCM e;  1IXD A;  4R55 A;  2QA4 T;  3VS4 A;  3TU4 K;  1Q7Y U;  1AWX A;  5GMK j;  1WXB A;  3OSV A;  5DM7 R;  2CZ0 B;  4CC3 A;  1XQH A;  1TUC A;  2YUN A;  1RAB B;  1OUL A;  2OJ2 A;  3G71 Q;  1I5L A;  4R0K A;  3WXM B;  2JOY A;  4M7D B;  5GAN 8;  5CQY A;  1A0N B;  1BCM A;  4Z88 A;  5GAO n;  1Q86 R;  1QQJ A;  1JO8 A;  2EFI A;  1OZ2 A;  1S1N A;  2RHU A;  5AYF A;  2D0N A;  1VQK T;  4OMQ A;  5FWC A;  2DXC A;  3BW1 A;  4A4F A;  1Q86 C;  2HCK A;  2JMC A;  1AD5 A;  2LNH B;  2EKH A;  2MMP A;  2BKD N;  4KBM B;  4Y28 E;  3OYF A;  3CCE Q;  4JRK A;  5CCA A;  1I81 A;  2BZ8 A;  1RAD B;  3BDU A;  5FRN A;  4BY6 C;  4BD3 A;  1OV3 A;  3MP1 A;  4RTX A;  2EW3 A;  1VQ6 A;  3UPU A;  3GP8 A;  3OMG A;  3H8Z A;  1KC8 U;  4J7I A;  2DBK A;  4BE1 A;  2QXF A;  3CCU A;  1BIA A;  1ZUU A;  1VYT A;  4QQG A;  5GMK e;  1S72 Q;  1GRI A;  4M75 F;  2KNB B;  2MF2 A;  1WFW A;  1SHG A;  1B07 A;  3G4S T;  2EQU A;  3VYH B;  2COY A;  4M7D D;  2M0O A;  3REB B;  3I55 Q;  2V8J A;  4AT1 B;  2E5Q A;  3OYB A;  1M1K R;  2RJF A;  2HNI A;  3MEU A;  4X34 A;  4RTW A;  3LX7 A;  1NJI R;  1RAA B;  2I2L A;  1W4S A;  2C0I A;  3FDR A;  2JS2 A;  2KMT A;  2Z0W A;  4C8Q A;  1M1K C;  3CCV A;  1U3O A;  1QMC A;  1NJI C;  2MK5 A;  4JZ3 A;  3EH2 A;  1AHJ B;  4RTV A;  3RKW A;  4M7D C;  1YIT Q;  2DYI A;  4D6W A;  4JRP A;  2KRS A;  1WJR A;  1M27 C;  2X4J A;  4UC4 A;  1Y7X A;  1KQS A;  3PE0 A;  3EFR A;  1PRL C;  3HFN A;  2PQW A;  1D1B A;  4JS5 A;  1VQO A;  2LP5 A;  3M55 A;  2F2X A;  1JB0 E;  1YIJ A;  3GPL A;  1MNE A;  2P4T A;  4PLL A;  2XKO C;  2A37 A;  1JQQ A;  2YRV A;  2ATC B;  5KH6 A;  3FJ5 A;  2BE7 D;  1LOJ A;  1VQP T;  5CKB A;  2KT8 A;  3TSZ A;  5GAO r;  4V2S A;  1QVP A;  3CCJ Q;  2KRO A;  2LCS A;  1UEC A;  2EGA A;  3RMS A;  4DBR A;  2E4H A;  4E2F B;  1JEG A;  5J26 A;  1UB4 A;  3CME A;  1QCO A;  3AT1 B;  2DFU A;  5IHI A;  3TSW A;  1N9R A;  4DEY A;  1IHW A;  5LJ3 f;  4FL6 A;  4A4E A;  5IN1 A;  2P0K A;  4II1 A;  3CC4 T;  3INZ A;  1RUW A;  2LTO A;  3CBP A;  1HSQ A;  2ECZ A;  5GAN g;  3CCQ Q;  4KGX B;  1GBQ A;  2EKO A;  4KH0 B;  3VUZ A;  3CCM Q;  1VQ8 T;  4BI8 B;  1OU9 A;  2VC8 A;  4C92 B;  1UHC A;  3MKD A;  3LH5 A;  3SB2 A;  1OPL A;  3DLM A;  2DE0 X;  2IPO B;  2RA2 A;  2KI7 A;  1XTD A;  5DLQ E;  1YP5 A;  1I8F A;  5KYN A;  2QAS A;  3CBO A;  3RDV A;  1UGR B;  1XNI A;  2JT4 A;  2LDM A;  3LH0 A;  1ZHI A;  4BDY A;  4D8D A;  5LJ3 j;  4M75 G;  1IRX A;  2LJ0 A;  4A54 A;  1TU0 B;  3I56 Q;  1YWO A;  3QZ5 B;  1PHT A;  2CZ6 B;  5DY9 A;  3L1A A;  4IUV A;  4XU2 A;  1G3Y A;  2GGR A;  3C12 A;  1OQK A;  5KYX B;  1F1B B;  3JCM d;  3X25 B;  3CBM A;  3GIB A;  2OTJ T;  3L42 A;  4X1V A;  2E6Z A;  4M4Z A;  1FMW A;  3E1S A;  5FRO A;  1NYG A;  2MI6 A;  2OX7 A;  2WSC E;  5DLO A;  2EQI A;  1KD1 R;  1QVF S;  4F14 A;  1E7O A;  4OB2 B;  3BDL A;  2ZPI B;  1LPL A;  4N0A C;  4DEX A;  5I2S A;  1X2Q A;  4GLM A;  4FT4 A;  4C92 D;  2DNU A;  1KD1 C;  2O4X B;  4ZTF A;  1QWF A;  3MP8 A;  9ATC B;  1CKB A;  2AT1 B;  4N4H A;  2EVR A;  4PFO A;  1Y96 A;  4TVR A;  2O9S A;  3GOX A;  4C5G A;  3CCS Q;  1M30 A;  2QEX Q;  5IH2 A;  3J81 E;  3I56 A;  1D0Y A;  3M4G A;  3TRE A;  2DO3 A;  5IHK A;  2FYK A;  4A63 B;  4C0Z A;  1ZLM A;  4LXC A;  3CEY A;  2X9H A;  4ZGD B;  1JRI A;  1VOM A;  2KY9 A;  2RB6 A;  1N9S A;  2K9G A;  4C92 C;  3RBB B;  1PWT A;  4HCZ A;  4OGE A;  5KCH A;  1UTI A;  4O6J A;  1R0C B;  1WYX A;  1Q86 U;  2ZPF B;  1QVF P;  1N27 A;  2YLC A;  2QQS A;  1YHQ A;  2CT3 A;  3CMA A;  1MGQ A;  1EIF A;  3D7S B;  3AHU A;  2D1X A;  2V8K A;  3OYJ A;  4ZN3 A;  1PRM C;  2DRM A;  2V1R A;  1M3B A;  2YHT A;  2L3R A;  1MV0 B;  1UGV A;  4KGV B;  2KT1 A;  2RN8 A;  4MDW A;  3PIP A;  4LN2 A;  1FYN A;  2J6F A;  3OYD A;  4BE2 A;  5KYW A;  1MMA A;  3JRZ A;  2CP2 A;  2GFU A;  4M75 A;  2GNC A;  4M7A A;  4NS5 A;  3CPW S;  2JVV A;  1VQ7 Q;  1M2O A;  1QCN A;  2QDL A;  2QDY B;  4M77 B;  1OU8 A;  3S3N A;  1AWW A;  2KRM A;  2HQE A;  2R57 A;  2XHC A;  1NG2 A;  3QYH B;  1RI0 A;  2O9V A;  1M1K U;  3TEE A;  2QQA A;  5C0M A;  1YJ9 T;  3P8H A;  2JXB A;  1NJI U;  3CCR Q;  2P0Q A;  2FRY A;  2DZC A;  2NUP A;  4OMM A;  2LZ6 B;  2GTJ A;  3DLL A;  1N8R R;  3X24 B;  4HCC A;  1GBR A;  2GBQ A;  2WSE E;  2XDB A;  2XIC A;  5CKD A;  3OY9 A;  4FCY A;  3L2U A;  3GNG A;  1ZA1 B;  2FZG B;  1QKX A;  2ROT A;  2EAY A;  3CPW P;  3M54 A;  1E6G A;  1P92 A;  1TH7 A;  3QYG B;  3PMI A;  2RQR A;  3QPH A;  3S6W A;  3NTI A;  3VS5 A;  3JCM b;  1KSW A;  4FYY B;  4RTZ A;  2ABL A;  2X3X D;  4OVA A;  1M1G A;  1Y71 A;  1GFD A;  1IHV A;  3CC7 Q;  2RK2 A;  2XDP A;  4XTX A;  2DEU A;  4M77 D;  4DOW A;  4R56 A;  2LNV A;  2DET A;  2DIQ A;  2K57 A;  1WHG A;  3HP9 A;  3HRU A;  3H6Z A;  4WTO B;  3I35 A;  1WHJ A;  3OS1 A;  3UT1 A;  4KUL A;  2RF0 A;  4N4I A;  2GQI A; 
#chains in the Genus database with same CATH homology
 4O5V A;  3MEV A;  4A4H A;  3I55 A;  5DM7 R;  2CZ0 B;  2QQ9 A;  4XTW A;  2DXU A;  5GMK i;  2GF7 A;  2C06 A;  2JTF A;  1XQH A;  4P5N A;  1X75 C;  3SWN A;  1X01 A;  1I5L A;  3RUX A;  4LDY A;  4E7I A;  1BI0 A;  3MCA B;  3PNW C;  3WXM B;  2JOY A;  3LW5 E;  3JCM Q;  4C92 A;  4QVD A;  5GAN 8;  3X28 B;  3OYL A;  1VQ9 T;  5CQY A;  4M7D B;  4M77 C;  5GAM g;  2BIV A;  4GY5 A;  1VQL A;  2RHX A;  2PU9 B;  3A8G B;  2EIF A;  2KK4 A;  4PJO B;  4QVZ A;  3HPW A;  5GAO n;  2HBP A;  3QZ9 B;  2PUK B;  4A53 A;  4L59 A;  2EFI A;  4BDZ A;  3M59 A;  5LJ5 f;  1OZ2 A;  4PL6 A;  3E19 A;  2RI2 A;  1OI1 A;  3L2Z A;  2RHU A;  3LYI A;  4MZT A;  5FU7 C;  5AYF A;  3G6E T;  1VQK T;  2DXC A;  3BW1 A;  3HKS A;  4A4F A;  4C92 G;  3CXC S;  4M7D E;  4JS4 A;  3BFM A;  3E9F A;  3OYI A;  2ZPH B;  2CZ1 B;  1Q86 C;  1YIT A;  1XOV A;  4PJO E;  2XU8 A;  5GAM e;  3V8L A;  5CAI A;  4LDW A;  5M9O A;  4LDU A;  2MMP A;  1QW1 A;  4VUB A;  3OYE A;  2BKD N;  4EPC A;  4FIB A;  1K9M C;  3L2W A;  2A3L A;  4E7K A;  4KBM B;  4M77 F;  1V29 B;  3WVE B;  2DD5 A;  2MAM A;  2K5F A;  4Y28 E;  1M1F A;  4OB3 B;  3OYF A;  4JRK A;  5CCA A;  1I81 A;  1LNX A;  1WPY A;  2DTH A;  1WGS A;  2X4Y A;  3BDU A;  2RO0 A;  2JUF A;  2JZ2 A;  3M5A A;  4L5G A;  4BY6 C;  3HHT B;  4BD3 A;  3G7Z A;  3MP1 A;  5HY6 A;  3GF5 A;  3C4S A;  5HK0 A;  2LT1 A;  3OMC A;  1VQ6 A;  3CXC A;  2AHJ B;  3UPU A;  3GP8 A;  1QVG A;  3CCE T;  3MO8 A;  3H8Z A;  3OMG A;  3JCM h;  4BI3 A;  3OBY A;  5FLX E;  1VQP A;  5CR2 A;  1I4K 1;  1KC8 U;  4KUI A;  4J7I A;  4C5I A;  1VQM T;  4OMF B;  1JJ2 S;  4BE1 A;  4JLI A;  2QXF A;  5LJ3 h;  2CKK A;  3RER A;  2LQ8 A;  3CCU A;  3MP6 A;  1Q81 C;  1BIA A;  5LJ5 j;  5CVI A;  5GAN e;  2VXF A;  3KUF A;  4QQG A;  1G3S A;  3OQ5 A;  3ZFJ A;  5GMK e;  2MWO A;  3OYN A;  1M90 C;  4M75 F;  2D0Q B;  3J7A F;  2MF2 A;  3HSB A;  3QDR B;  3CCJ A;  1MHN A;  1UGQ B;  2EQU A;  3G4S T;  3MEW A;  3VYH B;  4M7D D;  2M0O A;  4ELY C;  4J6X A;  2LX9 A;  2O4X A;  2V8J A;  3QG1 A;  3JAM E;  1S72 T;  1W2B S;  2K5L A;  4J8O A;  4JLG A;  1VQN T;  4M75 B;  3OW2 S;  2DKG A;  2E5Q A;  4M7A B;  3ZBD A;  4PJO D;  3X26 B;  2X4X A;  5A2Q E;  4IUU A;  1O9S A;  4QW2 A;  3OYB A;  2RJF A;  2HNI A;  3FLG A;  3MEU A;  3I55 T;  1JJ2 A;  1KD1 U;  3CC4 A;  3JB9 F;  4E7L A;  4X34 A;  5C6S A;  2L5Q A;  3LX7 A;  3PFS A;  1KQS S;  1N8R C;  4GLK A;  2I2L A;  1W4S A;  3FJP A;  2KVQ G;  3FDR A;  2KMT A;  3OA6 A;  4M78 B;  4HA8 A;  4C8Q A;  2CZ7 B;  1M1K C;  3CCV A;  4EMK A;  4M7A E;  4LD6 A;  2HAX A;  1VQ8 A;  3CPF A;  3F70 A;  4F7U G;  2IG0 A;  3CCQ A;  1K8A C;  1NJI C;  2PUO B;  2L89 A;  2K5I A;  1VQL T;  4PKC C;  4XTV A;  1AHJ B;  3MHX A;  1W2B A;  3RKW A;  3SD4 A;  3CCM A;  2QQR A;  3OW2 A;  5GAM h;  4M7D C;  1YJ9 A;  2ZGW A;  2O01 E;  4LDX A;  4JJN K;  3VJP A;  4ME7 A;  4D6W A;  3ZEH A;  3VU3 C;  4JRP A;  4XU3 A;  1WJR A;  4PJO C;  2ZPE B;  4XTZ A;  1M9S A;  5GAO q;  2K3Y A;  2X4J A;  3OYK A;  1JBM A;  4UC4 A;  1Y7X A;  4NL3 A;  1YIT T;  2P0P A;  1KQS A;  2EWN A;  4XQ3 A;  1HXD A;  3NFC A;  3EFR A;  3HFN A;  2PQW A;  2OTL A;  4IUT A;  2DZ9 A;  1NZ9 A;  1VQN A;  4JS5 A;  1VQO A;  2BUD A;  2Y4X A;  5J39 A;  3A8M B;  1BI2 A;  4IUR A;  2FB7 A;  1ZBX A;  3UWN A;  3M55 A;  1IZ6 A;  5IT9 E;  1JB0 E;  2PVG B;  5J3B A;  1YIJ A;  4MZP A;  5GAN 5;  3QJ6 A;  3L2V A;  3ER0 A;  2P4T A;  3GPL A;  2F5T X;  5CIU A;  1BKB A;  4PLL A;  2XKO C;  5GAO l;  1H64 1;  1HK9 A;  2OAU A;  3OS0 A;  3RIR A;  4M7D F;  2D9T A;  2YRV A;  2DJZ A;  5A0D A;  3LLR A;  5GAN 3;  5GMK h;  5KH6 A;  4E7J A;  3Q1J A;  3S3O A;  1LOJ A;  1VQ6 T;  3P8D A;  3E9G A;  4LDV A;  5CKB A;  4M75 D;  4PJO F;  4ZGJ B;  1VQP T;  3RMQ A;  4IKF A;  2OTJ A;  4M7A D;  5CKF A;  5GAO r;  2E12 A;  3A8H B;  4V2S A;  2EJG A;  5GMK m;  4MZM A;  1QVP A;  3CCU T;  4C8Q E;  2DXT A;  2JN0 A;  2RD1 A;  4C5H A;  5D6Y A;  3RMS A;  2GFA A;  4ZGE B;  5J26 A;  1UB4 A;  2VGN A;  4L6V 5;  3CME A;  1Q7Y C;  5D6W A;  2QQB A;  4M78 D;  4B9X A;  3QJY A;  2KAF A;  5FU6 B;  3CCJ T;  3JB9 D;  3JCM f;  2Y90 A;  2F5K A;  2WAC A;  3CC2 A;  3LGL A;  1N9R A;  4A4K A;  4C0G A;  4ATO A;  2LCC A;  2VYT A;  2DTI A;  3FRN A;  4FL6 A;  5LJ3 f;  4M77 A;  2Y4Y A;  3R6O A;  5I2M A;  1PSF A;  2DK3 A;  1YBY A;  5IN1 A;  3JCM V;  2P0K A;  4II1 A;  3EFS A;  2CS7 A;  2D6F A;  1YCY A;  3FB9 A;  3CC4 T;  3DB3 A;  2RHY A;  2M1H A;  2QI2 A;  3INZ A;  4XTY A;  3QKJ A;  4JRQ A;  2LTO A;  4M75 C;  2JNG A;  2RJD A;  3CBP A;  1VUB A;  4BE0 A;  5GAN g;  4M7A C;  1NE8 A;  2VGM A;  3V8K A;  4EMG A;  3SWN B;  2EKO A;  1VIF A;  1NPR A;  3VUZ A;  3LWI A;  3CCV T;  4CRI A;  3CCL A;  4M77 G;  2HQX A;  2L8D A;  3N5B B;  3OYC A;  1VQ8 T;  2XI9 A;  4BI8 B;  2VC8 A;  2MWP A;  5D6X A;  4C92 B;  5GAN 2;  1LJO A;  1M4Z A;  3CCQ T;  2RJC A;  3SB2 A;  1KG1 A;  3CCS A;  4M78 C;  3DLM A;  2QEX A;  3QXE B;  2B8A A;  3QUI A;  3OS5 A;  4PLI A;  4XU1 A;  2RA2 A;  2LCL A;  3M4Y A;  3CCM T;  1UEB A;  3RES A;  3ME9 A;  4A4G A;  5GMK l;  1U8R A;  1Q82 U;  1XTD A;  2DVE A;  3OYY A;  5DLQ E;  1M90 U;  1I8F A;  1R8O B;  2RH2 A;  5GAN 6;  1NPP A;  3PT9 A;  4JDS A;  3A8O B;  2RHI A;  3CBO A;  3NTK A;  3HFO A;  2NLU A;  1B34 A;  2JTM A;  1WJQ A;  4C92 E;  4XK8 E;  4PNO A;  4A4E A;  1UGR B;  4IUQ A;  2XID A;  3OSS C;  1OYX A;  1XNI A;  4M7A F;  4EMH A;  2LDM A;  2EQM A;  3LH0 A;  1ZHI A;  4BDY A;  5LJ3 j;  2OTL T;  4XTU A;  4M75 G;  1GXI E;  2CYZ B;  4XU0 A;  1VQO T;  3CD6 A;  4A54 A;  4Z02 A;  1PSE A;  1KQ1 A;  3JB9 J;  1ZQ1 A;  2DAQ A;  3DB4 A;  3QZ5 B;  1YIJ T;  1OZ3 A;  2CZ6 B;  1KHC A;  5DY9 A;  3L1A A;  4M78 F;  4F7U A;  4IUV A;  4XU2 A;  4MDX A;  5GAO m;  1G3Y A;  1N6A A;  3C12 A;  3HRS A;  1D3B A;  1KC8 C;  1K73 U;  1M8V A;  2E1H A;  3I56 T;  5L8R E;  4MMK A;  4M78 G;  2CGH A;  2R5A A;  3PGG A;  4OB1 B;  3JB9 G;  3M9Q A;  2K2V A;  3JCM d;  5IAY A;  2M9U A;  2VXE A;  3X25 B;  5FRN A;  3CBM A;  3HL8 A;  3GIB A;  2OTJ T;  3L42 A;  2H3J A;  2DEQ A;  3C95 A;  2E65 A;  3VKI A;  5LJ3 d;  1YI2 A;  2E6Z A;  2KDS A;  5KE2 A;  3E1S A;  5FRO A;  2MI6 A;  2WSC E;  1QP3 A;  2K3X A;  5A0G A;  5DLO A;  1QVF S;  4Q5W A;  3OBW A;  1VQ5 A;  4OB2 B;  3CME T;  3BDL A;  4RCC A;  1U1S A;  3C94 A;  2ZPI B;  3HRT A;  4N0A C;  1SSF A;  4E47 A;  5I2S A;  5LJ5 g;  4OGC A;  3L2Q A;  1YHQ T;  1YJN T;  4FT4 A;  4C92 D;  3LGF A;  1H3Z A;  1KD1 C;  2O4X B;  3OB9 A;  4ZTF A;  3CC2 T;  5EG2 A;  2ZZD A;  3MP8 A;  4RG8 A;  4XAX B;  3T9N A;  3FEO A;  5FU6 C;  5LL6 S;  2DD4 A;  4N4H A;  2DPP B;  1VQ7 A;  3M58 A;  3O8V A;  4C8Q F;  2M16 A;  3WVD B;  4TVR A;  1Y96 A;  4M7D A;  5GAN 4;  4BUG A;  3GOX A;  4MML A;  1QVF A;  4JUV A;  4C5G A;  5I21 A;  3JSC A;  4C8Q B;  4PJO A;  2V8I A;  5LJ5 e;  5GAN h;  4EMK B;  4NOY A;  3J81 E;  3I56 A;  3CCL T;  4OB0 B;  1BI1 A;  2WSF E;  3TCJ A;  3JB9 H;  3M4G A;  3TRE A;  2DO3 A;  4RG2 A;  2RJE A;  4C5E A;  4F7U E;  2FYK A;  2RI3 A;  3SWN C;  4C0Z A;  3DKM A;  4KT0 E;  3CCS T;  1KHI A;  3CEY A;  3EAE A;  4YTL A;  4DQ2 A;  4EDU A;  4ZGD B;  2QEX T;  4M7D G;  1JRI A;  1Y07 A;  2LQK A;  2KY9 A;  2RB6 A;  1N9S A;  5GAM d;  2RK1 A;  4C92 C;  4FU6 A;  4DA4 A;  2HD0 A;  4PJO G;  2PVD B;  4HCZ A;  2RM4 A;  1FX7 A;  4OGE A;  3CCR A;  2G3R A;  5KCH A;  3JB9 I;  1YJW T;  4C0D B;  1BYM A;  2QTX A;  4O6J A;  3GLX A;  5CQX A;  4B9W A;  1Q86 U;  2ZPF B;  1N27 A;  3OYM A;  2YLC A;  3UDC A;  2QQS A;  3JCM W;  1DJ7 B;  1KQ2 A;  3ASK A;  5A0L A;  1X6O A;  1YJN A;  1YHQ A;  3PMT A;  3CMA A;  4HCB A;  4QVC A;  3PTA A;  2FVU A;  3MEA A;  1MGQ A;  3JCM c;  3CD6 T;  3SFM A;  1EIF A;  3V7R A;  3AHU A;  1Y96 B;  1K9M U;  2DIG A;  4LD9 K;  2V8K A;  3OYJ A;  1G5V A;  4ZN3 A;  2ZPG B;  3G71 T;  4KUD K;  4HT9 A;  2RI5 A;  2FHD A;  1VIE A;  2DXB A;  4FT2 A;  2RHZ A;  2YHT A;  1O75 A;  2L3R A;  5GAN d;  4C92 F;  1VQ4 A;  5CO7 A;  3LWH A;  2PVO B;  4MDW A;  2ZPB B;  3PIP A;  2VV5 A;  1QVG S;  1WQW A;  4BI4 A;  3OS2 A;  3OYD A;  1FWZ A;  1UGP B;  5CKH A;  1YI2 T;  5KCO A;  4BE2 A;  3M53 A;  3MET A;  3CC7 A;  4JRI A;  1Q81 U;  2VUB A;  4RKU E;  3JRZ A;  3PIO A;  2QA4 A;  5FRM A;  2E10 A;  4BB7 A;  1WNL A;  2K4Y A;  3A8L B;  2GFU A;  2R58 A;  1VQ5 T;  4M75 A;  4ELZ C;  4QQ6 A;  4M7A A;  3OYH A;  4C8Q D;  3KXT A;  1YJW A;  4NS5 A;  3CPW S;  2JVV A;  2LRQ A;  2E6N A;  3V7S A;  3VV0 A;  2EQJ A;  4Y91 A;  5KE3 A;  3RKX A;  2XDD A;  4OP0 A;  5LJ5 h;  2QDY B;  4M77 B;  3QBY A;  5HKC A;  2E64 A;  1RL2 A;  3BY7 A;  1VQ7 T;  4M78 A;  3S3N A;  2EQK A;  5GAM f;  1QP2 A;  4M7A G;  2HQE A;  3KBG A;  3SDZ A;  2R57 A;  2XHC A;  4FM4 B;  4FSX A;  1FXX A;  1VQ9 A;  4WF2 A;  3QYH B;  2KSS A;  1RI0 A;  4ZN1 A;  1N8R U;  3G71 A;  5FU7 B;  2F69 A;  4RCB A;  2R5M A;  1M1K U;  3TEE A;  2QQA A;  5C0M A;  1YJ9 T;  3P8H A;  4M77 E;  1Q82 C;  4QQD A;  4IUP A;  4J5Y A;  3JCM J;  3CPW A;  2LT4 A;  3FIF A;  1NJI U;  1K8A U;  2P0Q A;  4HKE A;  1VQK A;  3G6E A;  4C8Q C;  2DZC A;  3OYG A;  4EMK C;  2YLB A;  3M57 A;  4N4G A;  3VYG A;  1U1T A;  1IRE B;  2FL7 A;  2X35 A;  3DLL A;  3CCR T;  2A7Y A;  4RMO A;  5CKE A;  3X24 B;  4HCC A;  4BAC A;  1B34 B;  5GAN f;  4BY6 B;  3OYA A;  2WSE E;  4X9D A;  2XDB A;  2XIC A;  3GNF B;  4X9C A;  5CKD A;  3QSU A;  3OY9 A;  2ZCF B;  3V8J A;  5LJ5 d;  2EJF A;  4F7U F;  1M5Q 1;  3L2U A;  3GNG A;  4C0D C;  3JCM P;  3CMA T;  4M75 E;  2EAY A;  1K73 C;  3M54 A;  3JCM g;  5HK3 A;  4DOV A;  1P92 A;  1TH7 A;  3QII A;  3QYG B;  5GAM j;  3PMI A;  3J80 E;  1UGS B;  2XD0 A;  3QPH A;  2XK0 A;  3S6W A;  4CI0 C;  3CCE A;  4F7U B;  4E7H A;  5CK9 A;  3NTI A;  5LJ3 g;  4J6Y A;  4C0F A;  3RKY A;  1G3T A;  3X20 B;  1D3B B;  3URG A;  1VQM A;  1WJS A;  2IVW A;  1VQ4 T;  3JCM b;  3M56 A;  2LVM A;  4OVA A;  1M1G A;  1Y71 A;  3L2R A;  2E41 A;  4M78 E;  4N0A A;  4C8Q G;  1BI3 A;  2EJ9 A;  4J7F A;  4OF1 A;  2RK2 A;  3A5Z B;  2XDP A;  4ZTJ A;  2GCX A;  3P8B B;  3V7C A;  4NL2 A;  4XTX A;  4M77 D;  2X4W A;  4DOW A;  4R56 A;  3QO3 A;  4J6W A;  2LNV A;  3JCM e;  2DIQ A;  2K57 A;  3JCM X;  2LC4 A;  3HP9 A;  2EYQ A;  2KQW A;  3G4S A;  3HRU A;  3CC7 T;  1BIB A;  3H6Z A;  4R55 A;  3NTH A;  1G3W A;  2GQV A;  2DTO A;  2E70 A;  2XG8 D;  3VUB A;  5GAN 7;  5LJ3 e;  2QA4 T;  1S72 A;  3TU4 K;  5GAO p;  4HT8 A;  4J83 A;  3QHS A;  1Q7Y U;  3OS1 A;  3UT1 A;  4KUL A;  5GAN j;  1WQ7 A;  3FC3 A;  5GMK j;  4N4I A;  3S3M A;  3OSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...