2KBTA

Attachment of an nmr-invisible solubility enhancement tag (inset) using a sortase-mediated protein ligation method
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
GPGTFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDYSEYLPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Attachment of an NMR-invisible solubility enhancement tag using a sortase-mediated protein ligation method
pubmed doi rcsb
source organism Mus musculus, synthetic, streptococcus sp. 'group g'
molecule tags Signaling protein
molecule keywords chimera of Proto-oncogene vav, linker, Immunoglobulin G-bind
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kbtA00
2AZSA 2K9GA 1M8MA 2JS0A 1H3HA 2F2XA 1NEBA 1X43A 2EW3A 2CUDA 1RI9A 2LJ1A 4RTVA 1UUEA 4Z89A 3PE0A 1S1NA 3SEMA 2JM9A 1UHFA 2DE0X 4F16A 1GCQA 3M0PA 2KRSA 1AVZC 1U06A 1BU1A 2LQWA 2CSIA 2DM1A 1AWWA 2RQWA 3H0FA 2AK5A 1K76A 1PHTA 5GJWB 4X1VA 2L2PA 2CREA 4RTYA 1GFDA 3M0TA 2YUQA 1NYFA 2LJ3A 4JJBA 4D8DA 4F17A 2KXCA 2ABLA 2B86A 1GBRA 2V1QA 2MCNA 4ZNXA 4OMPA 2CH4W 2AZVA 4CC2A 2M51A 1SEMA 3VRZA 1PRLC 2JMAA 4CC7A 1RLQC 4OMMA 2W10A 2O9SA 1SRLA 1SSHA 2D1XA 4JZ3A 2J6KA 1T3SA 1ZUUA 1K1ZA 2JM8A 2O88A 1TUCA 1TG0A 2LNHB 1X6BA 1W1FA 1PWTA 2VVKA 1SHGA 5I22A 1X6GA 2X3XD 1M3CA 1GBQA 4M4ZA 2LMJA 2FRWA 1IO6A 1ZX6A 1WDXA 4K11A 1HD3A 4RTXA 4J9BA 2LCSA 2L0AA 1SPKA 2J06A 2BZXA 1X2QA 2A37A 3EG3A 2KYMA 2F2VA 1OOTA 1KFZA 1W70A 2YDLA 2ED0A 1NG2A 2KRMA 2LX7A 4HVUA 4J9HA 1FYNA 2EGEA 1X69A 4AG1C 1X27A 1WA7A 3NGPA 1NLOC 2MIOA 1QWEA 1ZBJA 2FO0A 4HXJA 3EHQA 2GQIA 2YUNA 2CDTA 2A28A 2O9VA 2ROLA 5FWCA 1QWFA 2D0NA 1G2BA 4HCKA 5FW9A 2DJQA 2FPDA 5EC7A 3QWXX 1A0NB 4F14A 1OPKA 2GBQA 3QWYA 2M0YA 4JJCA 3LH5A 2X3WD 3THKA 4AG2C 1K0XA 4OMQA 2EYZA 2ESWA 1VYUA 3UATA 1BB9A 1I07A 2EKHA 2ENMA 2EYYA 4AFZC 1UHCA 1W6XA 1KIKA 4IIOA 1UTIA 3RBBB 3NMZC 2VKNA 1JXMA 2MOXA 1AZGB 3VRYA 4GBQA 2L3QA 2AKLA 4DEYA 3PVLA 2DF6A 2CUBA 3JV3A 1CKAA 1NLPC 4OMLA 5IHNA 4E6RA 1E6GA 2DBMA 1PNJA 2NUZA 1UE9A 1HSQA 1YN8A 2RQRA 3EHRA 4ESRA 2V1RA 2DL5A 2DILA 2J7IA 1E6HA 1G83A 4LN2A 3EG0A 1B07A 1ARKA 3EGUA 4OMNA 4RTTA 3I5SA 2GGRA 2HBWA 1E7OA 1JO8A 3H0IA 3REBB 2HCKA 2RQVA 3VS3A 2YT6A 4J9FA 1JU5C 1UGVA 1QKXA 2EVRA 1WI7A 4QT7A 2OAWA 3TVTA 4LUDA 2EPDA 3VS6A 4EIKA 2BZYA 3NPFA 2K3BA 2FPEA 2K2MA 1AOJA 1H8KA 1AWXA 3VS1A 5L23A 3VS0A 2E5KA 1JQQA 2DRKA 4GLMA 2DL3A 2YUOA 2D8HA 2BZ8A 2O2OA 2C0TA 3I9QA 3TSZA 2C0IA 4R0KA 3ZL7C 5IXBA 3A98A 3H0HA 2BTTA 4CC4B 4J9CA 2K7AA 4RTZA 1YCSB 1NEGA 1QCFA 3FJ5A 1ZUKA 1Z9QA 2FPFA 1WIEA 2DX1A 2K79A 2NWMA 1ZLMA 3M0RA 4Y92A 3CQTA 1VYVA 4JJDA 5IH2A 3UF4A 1WFWA 1YNZA 4Z8AA 1N5ZA 1UECA 4J9DA 1X2KA 2RN8A 1GFCA 1UJYA 1UDLA 2CT3A 4KRTA 3TSWA 2KYBA 2DLPA 1XOVA 2OI3A 2KEAA 2ROTA 2YSQA 1AEYA 3EG2A 3R6NA 4Z88A 1Y57A 2FEIA 1I1JA 1JEGA 1K4US 1U5SA 1M3BA 2CT4A 2KT1A 2SRCA 1H92A 1YWPA 4ORZA 1GL5A 2DBKA 2QDLA 3I35A 2DA9A 4DEXA 1UG1A 3U23A 2OJ2A 2JMCA 3SHWA 2KRNA 1V1CA 1QKWA 1WXTA 1M30A 5GJVB 2LP5A 4AFQC 4LNPA 1T0JA 1LCKA 1AWJA 2KROA 4WCIA 1WX6A 3M0UA 2LQNA 2ECZA 2DL7A 1GCQC 1WXUA 2JS2A 1FMKA 3UA7A 1PKTA 4LUEA 1Z9ZA 2G6FX 2KBTA 2D8JA 2KXDA 3VS7A 1K9AA 2RNAA 2W0ZA 2KR3A 2HDAA 4A63B 1AD5A 1OEBA 1VYTA 5I11A 4RUGA 3M0QA 2AKKA 3O5ZA 1PKSA 3RNJA 2RQUA 1MV3A 1HJDA 4OMOA 2ED1A 4D8KA 4J9GA 1U3OA 1UJ0A 2L3PA 1ABQA 1M27C 2DVJA 2DYBA 1J3TA 2DNUA 1WYXA 2GTJA 4RTWA 2LJ0A 2PNIA 4JZ4A 1SRMA 2J6FA 2RPNA 2GNCA 3C0CA 1MUZA 1ABOA 2EBPA 1AZEA 2I0NA 2EYXA 4RTUA 2RQTA 2JW4A 2H8HA 2DMOA 1M3AA 4CC3A 5ECAA 2J6OA 4HVWA 2EQIA 1GRIA 4J9EA 3PVQA 1YP5A 1VA7A 2F2WA 1B3QA 2KT8A 2DL8A 1NM7A 1NYGA 2RMOA 1T3LA 4HVVA 1MV0B 1UFFA 1WXBA 2GTOA 3GBQA 1OPLA 2HEQA 4IIMA 2DL4A 2CH4A 3UA6A 1AWOA 3NHNA 5HCKA 2EGCA 2J05A 2SEMA 1YWOA 1I0CA 3EG1A 2FG0A 5IHIA 3ULRB 1TUDA 1ZUYA 2JTEA 5IHKA 2K6DA 3REAB 4AFSC 2FRYA 3M0SA 2IIMA 2RF0A 1CSKA 3VS4A 2YUPA 5FWBA 5IXFA 1GCPA 1T0HA 2DRMA 4LE9A 3I5RA 3KFVA 1RLPC 4FSSA 1OV3A 2JXBA 2VWFA 1RUWA 3IQLA 1PRMC 4AFUC 2C0OA 2JT4A 2EGAA 2KGTA 2CSQA 2EYWA 1SHFA 2LZ6B 1EFNA 1K0SA 3H41A 2P4RA 2XMFA 2A08A 1QLYA 2PZ1A 1Y0MA 1JXOA 2L3SA 2KNBB 2KE9A 3VS5A 3VS2A 1CKBA 1ZSGA 2HSPA 2A36A 1KSWA 4J9IA 1KJWA 1WLPB 1BBZA 2O31A 1BK2A 4JPBW 2PTKA
chains in the Genus database with same CATH superfamily
2AZSA 4OB2B 2MMPA 5I2MA 2P4TA 2JS0A 3OY9A 3BDLA 2RJCA 5CO7A 1K9MC 3CCRT 2EW3A 4RTVA 3GIBA 4M77F 3LX7A 3L2VA 2RHZA 3SEMA 3CPFA 1GCQA 1D1BA 2K4YA 2MWOA 3M0PA 4ATOA 2LQWA 2DXUA 1U1TA 3X25B 3P8BB 4M7AA 2BUDA 2NUPB 5GJWB 5HKCA 1QQJA 5J39A 1Q86C 1TUGB 2YUQA 1NYFA 2LJ3A 3LLRA 4PFZA 1BI2A 2ABLA 3GLXA 2MPXC 1JRIA 4ZNXA 4OMPA 2AZVA 4M75A 1TWBA 2FZCB 4CC7A 2E1HA 4FM4B 2D1XA 1T3SA 1ZUUA 2YHTA 3A5ZB 1YJWA 3EFRA 1X6BA 4XAXB 5GAN3 1Y96B 1SHGA 1X6GA 2X3XD 1IO6A 4PJOD 2Z0WA 1K8AC 1WDXA 4OF1A 1VQLQ 4JLIA 2O4XB 2J06A 1LJOA 2QTVA 2FB7A 4A4KA 2RJDA 4EPCA 3LGLA 1KFZA 4M77C 1W70A 3CCQA 3BW1A 2ED0A 2P0QA 2LX7A 4HVUA 2EGEA 2E4HA 1X27A 3CMAA 1NLOC 2MIOA 2ZZDA 2E12A 3EHQA 1JJ2A 3BDUA 2A28A 4Z02A 2RA2A 4XTYA 2XI9A 2QI2A 4HCKA 4HKEA 3ZFJA 5GMKi 2NLUA 1MMDA 2KI7A 2E3IA 1A0NB 4M78F 4ZN3A 1MHNA 2M0YA 4JJCA 3TU4K 2ZPGB 3LH5A 5GAN8 4FT2A 2BKDN 2EYZA 2E5QA 1SG5A 3C4SA 2EKHA 2JOYA 4R56A 1IB8A 1KQSP 1W6XA 4M7DD 2Y90A 1KIKA 4IIOA 1UTIA 3PTAA 4FCYA 3NMZC 2COWA 1VQ4T 1VQKQ 1TS9A 2MOXA 4F7UG 2XDBA 4GBQA 2M16A 2L3QA 3F70A 1D3BA 1Q95G 2AKLA 4J8OA 2LQKA 4RMOA 2CUBA 2CP3A 3C95A 4M7DG 3OYMA 5GAOl 1E6GA 3EFSA 3UT1A 1HSQA 3NFCA 4JRKA 4NOYA 2VYTA 2XDDA 2RQRA 2V1RA 4C5IA 1SKUB 3EG0A 4LDYA 4BUGA 4C8QE 5DM7R 4M78D 3A8LB 4OMNA 3FB9A 3I5SA 2L8DA 1X01A 3H0IA 1OZ2A 3CBOA 2HCKA 2XU8A 1C6VX 5GAOr 1RAFB 1V76A 2EPDA 4C0GA 3E2UA 1H8KA 1YHQQ 4KUIA 3CCJA 3VS1A 5L23A 2VGMA 2F1LA 3EFOA 4GLMA 3TCJA 3OYJA 2L3RA 2CZ7B 3VJPA 4KH1B 3EAEA 4RG2A 4O5VA 4F7UE 2HZYA 1WNLA 2RK1A 3DLLA 3H0HA 4CC4B 3I56T 4J9CA 5GANh 3PIPA 8AT1B 2K7AA 2QYZA 4E7LA 4ELZC 1QCFA 2G3RA 4M7DF 5CQYA 4ANJA 1Z9QA 5CKFA 2HL3A 1IRXA 2K79A 2NWMA 4J6YA 1VYVA 3G4ST 3CEYA 5IH2A 5KYYB 4M77D 7AT1B 2DAQA 1UDLA 4OGEA 2QK0A 4FYWB 2CP7A 3L2RA 3OS0A 1XOVA 2E3HA 2EAYA 4ELYC 4PJOA 2JTFA 3AHUA 2FEIA 1PD1A 3V8JA 3G71T 1VQMT 1Q82U 2KT1A 3MEWA 3JAME 1GL5A 4YTLA 2DBKA 2X4JA 4F7UB 2M0OA 4KBMB 4IUTA 2O01E 2HKQB 2OJ2A 2JMCA 2ZCFB 3JB9J 3SHWA 2LRQA 2DERA 2KRNA 1QKWA 3CXCP 2F5KA 1M30A 4KGVB 3GPLA 2LTOA 3QPHA 1T0JA 3JB9I 4WCIA 5CR2A 1YBYA 1X75C 1VQPQ 1FWZA 1C0MA 3ME9A 1KD1R 1I5OB 1GCQC 2JS2A 3M59A 3SD4A 1RAIB 4ZGJB 4R55A 1Q7YC 2G6FX 2KBTA 2RNAA 1LVKA 3OYHA 3LW5E 3M0QA 1G8XA 1QVGP 1BI1A 4PJLA 1MV3A 4OMOA 1Q86R 4NL3A 4DBHA 4J9GA 1U3OA 2OTJA 1M27C 2DVJA 1J3TA 5GAN4 1TH7A 1WYXA 2ZPHB 4MMKA 4BB7A 3INZA 2LJ0A 2VB6A 3EGDB 1KK7A 3QIIA 4E7SA 4JZ4A 1SRMA 2GNCA 5GAMf 4M7AE 2P84A 1ABOA 3V7RA 4EMKB 4LXCA 1VQ8Q 1NBEB 3A8OB 4QVZA 4XU2A 2DMOA 5KYWB 1YCYA 3S6WA 2DVEA 2E64A 4C92A 2CKKA 3CC2T 5D7UA 4ZTJA 2RK2A 1RABB 5LJ5g 3PIOA 1B3QA 2GFAA 1YITQ 2KT8A 2DL8A 1NM7A 1JJ2S 3OBWA 2JZ2A 1UFFA 1WXBA 1OPLA 1KD1U 3ZEHA 1BIAA 4C92E 1TU0B 3QJYA 4KGXB 2XK0A 5GANf 4EDUA 2K6DA 2FRYA 2IIMA 2RF0A 1M9SA 5FWBA 3DB4A 1GCPA 1WHKA 1I4K1 4JJNK 4FYXB 5KYNA 3I5RA 2RB6A 1EX4A 1VQOA 3L1AA 2DKGA 2RM4A 1Q82R 3CCET 3IQLA 1PRMC 3I56A 4CI0C 1XTDA 1VOMA 2EYWA 1SHFA 1IHWA 2NUTB 1WJQA 3H41A 4N0AA 1YJNT 1QLYA 3NTHA 1Y0MA 4PJJA 2DTOA 3VS5A 1ZSGA 3MP8A 2DO3A 1PCXA 3BE3A 3JRZA 2O31A 2PTKA 3CCVT 1KQSS 5GMKe 2K9GA 1WPYA 4PLIA 2NUTA 4V2SA 2IG0A 5CKBA 2RHXA 4C92D 4Z89A 3CCQT 1BCMA 2JM9A 1UHFA 2HKNA 3L2QA 3G71A 1YFNA 1AWWA 2RQWA 2K5FA 1PHTA 3VKIA 4X1VA 3JSCA 4RTYA 1KQ1A 2ZAEA 4PJOB 4IUUA 4XU1A 1GBRA 2B86A 1N8RR 2V1QA 2M51A 4KULA 1SEMA 2DXBA 2JMAA 4OMMA 2W10A 2O9SA 2EJGA 1SSHA 2K3XA 2PUKB 2J6KA 2QEXQ 1Y7XA 2O88A 1TUCA 2LNHB 4XTXA 1PWTA 4F7UF 1M3CA 4FL6A 5KYWA 4QKUA 2DIQA 4K11A 4RTXA 2LCSA 4J9BA 2L0AA 4C5GA 2DEUA 4PK4A 1X2QA 2A37A 1RACB 4M7DA 3JCMh 1M1KC 4FT4A 2K57A 1KC8C 4BD3A 1FYNA 1W4SA 3NGPA 1W2BA 1F1BB 1QWEA 4XU3A 2MF2A 4C0ZA 2DZCA 1VIFA 4IUPA 3RDVA 4M77B 4GY5A 2D0NA 1NE8A 2CP5A 2DJQA 4MZTA 3QWXX 4GLKA 3FEOA 3H6ZA 2GBQA 2QASA 2CYZB 2BIVA 3C94A 3THKA 4AG2C 2E70A 4M7AG 5CCAA 4OMQA 3CBMA 5FU7B 1OU9A 4C8QA 2ENMA 1QCOA 2X9HA 1W2BP 2CS7A 4AFZC 4EMHA 1UHCA 2DD4A 2HSEB 4MZMA 3MEUA 3RBBB 2YRCA 4M7AC 2VKNA 1RADB 4E7HA 4ZN1A 1YJWT 1VQ6A 3CCMT 4M7DE 3OS2A 1UGQB 4DEYA 5LJ5h 3CCRQ 3JV3A 1CKAA 4OMLA 4PJMA 1M1GA 2DBMA 1H3ZA 5GAN6 4DQ2A 5CVIA 3OMGA 1YI2A 4JRQA 1YN8A 5FRMA 3PGGA 1G5VA 1DJ7B 4LN2A 1PD0A 2YXYA 3CMEQ 3EGUA 3V7CA 2EQMA 2RI2A 5DLQE 4FW2A 1JO8A 3ZBDA 3CCST 3D7SB 4FU6A 4XQ3A 4RG8A 5CKEA 3CCUT 1QMCA 2DTHA 3HPWA 2RQVA 3VS3A 3CD6T 2YT6A 2QA4T 3M9QA 4OB1B 3CCQQ 1JU5C 1MNDA 1K8AU 4WF2A 2EVRA 2OAUA 5D6WA 2E65A 3TVTA 2OAWA 4LUDA 1V29B 2CZ1B 2B8AA 5KYUB 4M78A 2K3BA 1ZSZB 2X35A 3CMAT 2QQAA 2BZ8A 4M75B 2O2OA 4X9CA 4QQ6A 2C0IA 2CP0A 3FRNA 3ZL7C 5GAMd 3OW2S 4OMFB 1ACMB 3A98A 4JLGA 5KYUA 2FYKA 4F04B 5KYYA 4C5EA 3HFNA 3N5BB 1VQMA 1YCSB 3FJ5A 2VXFA 1S72T 3EG9A 3G6EA 3VU3C 1WIEA 3M54A 2KVQG 4VUBA 3HRSA 3MHXA 4B9XA 3OS1A 1IGUA 1WFWA 1YNZA 5C0MA 3L2WA 1UJYA 2CT3A 4KRTA 2HNIA 4BI8B 4M7AB 3R6OA 1AEYA 3R6NA 3MJXA 2DD5A 2OTJQ 1M90U 3OYDA 2M02A 2AHJB 4M75F 2JJ9A 3CBPA 1QCNA 2SRCA 3VUZA 5KE3A 3I35A 1Q81C 1BYMA 5IT9E 3CC7T 2JVVA 3CMEA 1U1SA 1WXTA 1OULA 2KY9A 2LP5A 1WHGA 2Y4YA 2QA4Q 1AWJA 2KROA 2EQKA 5GAOm 3M0UA 5CKHA 2C06A 3CCRA 2LQNA 1PSFA 1WXUA 2PU9B 1TXQA 5KCHA 2HBPA 1O9SA 4LUEA 4IUQA 1M8VA 3VS7A 2D8JA 1VUBA 4BE2A 1LNXA 2KR3A 2HDAA 5LJ5e 1VQ5A 2OTLA 1OEBA 1VYTA 5I11A 2AKKA 4A4GA 3S3NA 1D09B 3RNJA 3OSSC 2RQUA 3WVEB 1HJDA 1WHHA 4D8KA 1UGRB 1QP3A 2LNVA 5GAN2 1NJIR 1IGQA 3DKMA 4EMGA 1G3WA 3MP6A 3ER0A 3OYFA 2J6FA 5HK0A 2RPNA 2VC8A 3HTRA 2K5LA 5GMKh 1JB0E 3CCMA 2PQWA 4PKCC 2COYA 1KC8R 2K3YA 1VQ7Q 2I0NA 3RKXA 2EYXA 1UGPB 2EIFA 2RQTA 2H8HA 1WQWA 4RKUE 1OX9A 5ECAA 1RAHB 1GRIA 3S3MA 4J6WA 3RKWA 4OB0B 2F2WA 3CPWP 2DXTA 2RI5A 1T3LA 2JN0A 3VYGA 2ZPFB 4IUVA 1M5Q1 4IIMA 2XIDA 4LD6A 5KYXA 3E19A 1AWOA 2EGCA 1QVGA 2J05A 3SWNA 1YWOA 1I0CA 2E6NA 2FG0A 2NUPA 1NJIC 3ULRB 2JTEA 5IHKA 2HD0A 3REAB 4AFSC 3M0SA 5IXFA 3VS4A 1Q7YU 1OU8A 1YJ9A 1N8RC 1UGSB 5CIUA 1R0BG 1T0HA 4BACA 1MMNA 2QXFA 4LE9A 4X9DA 3META 3KFVA 5KYXB 5LJ3e 1VQ4Q 1RAGB 3BFMA 1Q7YR 5GAMj 1VIEA 3HRUA 2VWFA 4L59A 3SFMA 4AFUC 5EG2A 1N8RU 2HAXA 2EGAA 3URGA 2JUFA 1K0SA 2DK3A 2XMFA 2A08A 3PFSA 3T9NA 4C8QF 1KHCA 2PZ1A 2EQUA 2L3SA 2DIGA 3VS2A 1CKBA 3HHTB 3CCLA 2A36A 2RO0A 1KSWA 1WLPB 2RD1A 5GAMg 4BE0A 1D0YA 2D6FA 1BK2A 4JPBW 4HCBA 1XQHA 1VQOT 1M8MA 5J26A 2F2XA 1X43A 3CC4A 3P8DA 2LJ1A 4MDXA 1UUEA 3PE0A 5HY6A 2ZPEB 3GP8A 4C0DB 3VYHB 3ASKA 1S1NA 2V26A 4F16A 1NPRA 2QA4A 2WSEE 2KRSA 4HT9A 1U06A 4OGCA 5LL6S 2RI3A 1RAEB 2DM1A 4M77A 3H0FA 1C1AA 1K76A 1MMAA 2L2PA 1D0XA 2CREA 3M4YA 4KT0E 3M0TA 4D8DA 3I56Q 2RJEA 4CRIA 4E7IA 3M53A 5A2QE 1VQOQ 1OYXA 4F7UA 3OB9A 4LDVA 2CH4W 3M56A 3E9FA 1RLQC 3EH1A 4JZ3A 2DYIA 2DPPB 2ZPBB 2O4XA 2PUOB 2X4YA 1K1ZA 1XNIA 2P0KA 2A0FB 2VVKA 2LVMA 4J83A 4M4ZA 1YIJT 4P5NA 2DXCA 1VQ7T 2R57A 3CCJQ 4PLLA 1YJWQ 1SPKA 5J3BA 2BZXA 3M55A 3EG3A 5KE2A 3OMCA 2YDLA 1R0CB 4A53A 2LQ8A 4N0AC 4J9HA 2KSSA 1MGQA 1WA7A 4XK8E 1M90R 1ZBJA 3QUIA 3JCMd 4C0DC 2FZKB 2YUNA 5M9OA 2O9VA 2ROLA 3OYKA 3OYIA 1EIFA 1G3YA 2LCLA 1I81A 1PC0A 1WHLA 2FPDA 1B34A 1WHMA 3QYGB 1YI2Q 3AT1B 4M75G 4B9WA 3QWYA 4B6MA 4XTWA 1BKBA 4O6JA 2X3WD 1K0XA 4D6WA 2ESWA 3CCSA 3JB9G 3UATA 1BB9A 1I07A 1WHJA 2GCXA 1RI0A 2EYYA 4L6V5 1VQ6Q 3MEVA 5GANj 1VQKA 1R77A 4BE1A 3A8GB 3CXCA 3VRYA 4BY6C 1AT1B 1GXIE 1D1CA 2EYQA 1YJ9T 1KHIA 3H8ZA 2DF6A 4N4IA 5GAMe 2LDMA 4FSXA 4E6RA 2NUZA 3JCMe 5D6XA 4ESRA 3OQ5A 2DL5A 4OP0A 3G1JA 1G83A 1VQKT 1B07A 1HK9A 3QZ5B 1E7OA 2RH2A 3EGDA 2GF7A 1VQNA 2GQVA 4C92G 1IXDA 2QQ9A 4PJOG 3PMIA 3CCVA 5LJ3j 3CCJT 1UGVA 3CC2A 1M2VA 3VS6A 3SDZA 3UWNA 4EIKA 2BZYA 2LT4A 2YLBA 3NPFA 2FPEA 1AOJA 4C92F 4BI3A 2E5KA 4KUDK 2DRKA 2H3EB 4FYYB 2YUOA 3J7AF 3QG1A 1VQPT 5FROA 3CCUA 3QJ6A 3NTIA 3I9QA 3TSZA 2H3JA 2NYSA 4M7DB 3CC7Q 3LYIA 3CCLT 1IHVA 5IXBA 4EMKC 3CXCS 3HRTA 3E9GA 1FMWA 2VASA 3CD6A 2CZ6B 1ZQ1A 1TSFA 1TOVA 3SB2A 4C8QG 2DX1A 1ZLMA 3CCEQ 4Y92A 4C92B 3CQTA 2KK4A 3EGXA 4IKFA 3UF4A 4MDWA 4FIBA 4Z8AA 2RN8A 3RMQA 1GFCA 1VQ6T 3OSVA 3BY7A 3TSWA 2KYBA 2DLPA 2YSQA 2ROTA 3JB9F 4WTOB 1Y57A 4IURA 4E2FB 4NL2A 3SWNB 5LJ5j 5GAN5 1K4US 1M3BA 5FU7C 1U8RA 3V8KA 1PSEA 4RCBA 2QDLA 5FU6C 2DA9A 4M75D 4JS5A 3JCMf 5GANg 1I5LA 5KH6A 1WJSA 1V1CA 2E41A 5GJVB 1JBMA 4AFQC 4LNPA 1YHQT 1LCKA 1G3TA 3G71Q 4J5YA 4DOWA 2DFUA 2OX7A 5LJ3h 4M7AD 3I55T 3FC3A 4J7FA 3OYGA 1Y71A 3UA7A 2HQXA 4M78E 1PKTA 1M1KR 2YRDA 1VQ8T 2AIRB 2KXDA 5D6YA 2W0ZA 1N9RA 1AD5A 1QVPA 4RUGA 1LOJA 2M9UA 4LDXA 3EGXB 1D0ZA 2VGNA 2DETA 1BI3A 3QBYA 2ED1A 1YJ9Q 1FMVA 3JCMQ 1UJ0A 2FVUA 2F5TX 1ABQA 4Q5WA 5GANd 2DYBA 1K73U 1UB4A 2R5AA 1VQ5T 9ATCB 3PNWC 3A1PA 1HXDA 3GNFB 1AZEA 1K73R 3QXEB 4QVDA 3I55A 4E47A 2CGHA 2DTIA 1M1FA 1VQ9T 3CMAQ 3LH0A 1OQKA 1R8OB 1M3AA 3E1SA 4CC3A 2J6OA 1ZA1B 2EQIA 2FZGB 3JB9H 4J9EA 5A0DA 3PVQA 1VA7A 2R58A 1NZ9A 2EKOA 1NYGA 2RMOA 2X4XA 2FHDA 5LJ3f 4HVVA 5L8RE 3VV0A 3CC7A 2XICA 1M90C 3M5AA 5CAIA 2HEQA 2DL4A 3CCUQ 2CH4A 3RUXA 5I2SA 1VQ9A 3UA6A 4HCCA 3NHNA 5HCKA 3SWNC 2D9TA 4X34A 5GAOq 3X24B 2SEMA 1KG1A 4E7KA 2V8IA 1N9SA 1I8FA 4MMLA 1YITA 8ATCB 1CSKA 2YUPA 3CC2Q 4KGZB 1YJNQ 5LJ3g 2DRMA 2OTJT 1Y07A 3GNGA 4FSSA 1FXXA 1RAAB 2JXBA 4DA4A 3HSBA 3I55Q 2KDSA 1RUWA 3G4SA 3HKSA 2MK5A 5LJ5f 2RJFA 1KD1C 1EFNA 2XG8D 3UDCA 5GANe 1WZOA 4JRPA 2HQEA 1JXOA 2KE9A 2HSPA 5GAOn 2YLCA 2QG9B 4J9IA 1KJWA 4Y28E 4C0FA 3JCMc 1B34B 3OS5A 2RHUA 4BDYA 1VQ5Q 1H3HA 2A7YA 1NEBA 3CPWS 5GAN7 2ZPIB 2CUDA 1RI9A 1ZBXA 3OW2P 2P0PA 2EJ9A 3MO8A 1YITT 2EWNA 2DE0X 3WVDB 3QZ9B 3TEEA 1AVZC 1B7TA 5KCOA 2BE9B 1BU1A 4PJOF 2CSIA 2AK5A 3OYCA 3FJPA 5GMKj 1QW1A 1GFDA 1Q86U 4HA8A 2DEQA 3QHSA 4JJBA 4F17A 2LX9A 2KXCA 3JB9D 5IN1A 1YI2T 2KAFA 5CKDA 2MCNA 4HT8A 4JRIA 1S72Q 1VQ4A 1SF9A 1FX7A 4CC2A 2IPOB 3OBYA 5CQXA 4OVAA 3J81E 3VRZA 1PRLC 1M2OA 2PVDB 3M57A 2K2VA 2IVWA 1HYOA 1SRLA 1RL2A 1VQMQ 4LDUA 4PJOE 3P8HA 4Y91A 4E7ZA 2JM8A 3OYAA 1TG0A 4II1A 1MMGA 1KQ2A 1W1FA 4JUVA 1VQLA 2CP6A 5I22A 2V8KA 6AT1B 5DLOA 1M2VB 1GBQA 2LMJA 2FRWA 1ZX6A 1VQ9Q 5HK3A 4JS4A 1HD3A 4AT1B 5FLXE 4M75E 2R5MA 1WGSA 2JTMA 4PJOC 4M78C 2JNGA 2I2LA 2QTXA 3M58A 2KYMA 4M7AF 4M77E 4DBRA 1X6OA 3G6EQ 2F2VA 1OOTA 1Q81U 3J80E 3CCVQ 4XTVA 4PJNA 1NG2A 2KRMA 3PT9A 4OB3B 1X69A 4AG1C 4PFOA 3DLMA 4A4HA 3JCMg 3OYYA 1XJWB 4A4EA 2FO0A 4HXJA 3RERA 2GQIA 2CDTA 5FWCA 1QVFP 4C8QB 1K9MR 3CPWA 1QWFA 2EFIA 3CCMQ 3RIRA 3OYBA 2XD0A 4NS5A 1G2BA 5FW9A 3RESA 3LWIA 5EC7A 3RR6A 1YHQA 4F14A 4XTUA 1OPKA 4J6XA 1EZZB 2MWPA 2LCCA 5A0GA 5CK9A 2Y4XA 4DOVA 2PVOB 3V8LA 4DBFA 1VYUA 1K73C 3GOXA 3CC4Q 4C8QD 3MP1A 5GMKl 2PVGB 1JXMA 3DB3A 1AZGB 4XU0A 3X26B 3QYHB 1G3SA 3M4GA 2KQWA 3CCSQ 3PVLA 2QEXT 3CCLQ 2X4WA 2LC4A 2A3LA 1NLPC 2LT1A 3LWHA 5IHNA 4A54A 1PNJA 1UE9A 3G7ZA 3EH2A 3NTKA 4C5HA 4FYVB 3EHRA 2DILA 1D3BB 1E6HA 2J7IA 4QQDA 4DBQA 4L5GA 1ARKA 2RHYA 2XKOC 4RTTA 2GGRA 2HBWA 2DJZA 3MCAB 5AT1B 3REBB 1QVGS 3LGFA 4XTZA 1K9MU 3QSUA 4J9FA 3L2UA 1QVFA 2CZ0B 3GF5A 2WACA 1QKXA 1WI7A 4QT7A 5I21A 1OX8A 1QP2A 2K2MA 1AWXA 2CP2A 3VS0A 1Q81R 1JQQA 3EG9B 5C6SA 5FU6B 2DL3A 2D8HA 2ZGWA 4BDZA 3CMET 5AYFA 2C0TA 3L42A 4R0KA 2AT1B 5LJ3d 2BTTA 3CCEA 3H9NA 1N6AA 2RHIA 4RTZA 3L2ZA 1NEGA 3C12A 1ZSZA 1PG5B 1ZUKA 5GAMh 2MAMA 2FPFA 4ZGEB 4JDSA 4PFPA 3M0RA 1KQSA 2DZ9A 4JJDA 1W2BS 5LJ5d 1VQ8A 1WJRA 3KBGA 1N5ZA 1UECA 4J9DA 1X2KA 4C92C 4QQGA 2WSCE 3S3OA 1Y96A 2OI3A 1AHJB 2KEAA 1O75A 2XHCA 3EG2A 2KMTA 2QEXA 4Z88A 1I1JA 3MEAA 2VV5A 2GFUA 4EMKA 5DY9A 4M78G 1JEGA 4M7DC 1U5SA 4TVRA 1OZ3A 4A4FA 4M75C 2CT4A 1H92A 1YWPA 4ORZA 1ZSZC 1Q82C 2OTLQ 1M1KU 1VQNQ 4N4HA 2L89A 4DEXA 1UG1A 3U23A 3FLGA 3OYLA 2ATCB 1D1AA 1UEBA 3TREA 2FL7A 5A0LA 2BE7D 2D0QB 4C8QC 2QQSA 2XDPA 3X28B 4ME7A 1WX6A 1WQ7A 2X51A 3CC4T 3OYNA 2ECZA 3WXMB 3O8VA 2DL7A 4ZTFA 1FMKA 1MNEA 1P92A 1BCOA 3JCMP 1Z9ZA 3G4SQ 2YRVA 3JCMb 2EJFA 1K9AA 4A63B 4M78B 3VUBA 3KUFA 5IAYA 4E7JA 1ZHIA 2OTLT 4N4GA 2MYSA 3O5ZA 1PKSA 3QDRB 2E10A 3A8MB 3HFOA 2QGGA 1K8AR 1YJNA 2HL5C 2QDYB 2E6ZA 4PL6A 3UPUA 3EFOB 2L3PA 4BY6B 2DNUA 2GTJA 4RTWA 1KC8U 1N27A 5GMKm 1LPLA 2PNIA 4HCZA 1YIJA 2QQBA 3C0CA 1MUZA 2EBPA 1NJIU 2EQJA 4LD9K 4RTUA 2MI6A 3QKJA 2JW4A 3OW2A 3FDRA 4UC4A 4HVWA 5FRNA 1ZA2B 3KXTA 1YP5A 4ZGDB 3CD6Q 1JJ2P 3HL8A 4QW2A 1VQNT 3OYEA 4M77G 1MV0B 3PMTA 4FW1A 2GTOA 3GBQA 2V8JA 3JCMV 1OI1A 1M4ZA 2F69A 3JCMW 3EG1A 4J7IA 4QVCA 4AMCA 3MPUB 5IHIA 1TUDA 1ZUYA 1BIBA 4PNOA 1QVFS 2QAZA 3JCMX 3Q1JA 3G6ET 1RLPC 1SSFA 2QQRA 1OV3A 4KH0B 1S72A 3FIFA 2VXEA 3A8HB 1VQ7A 3OA6A 2M1HA 4MZPA 2C0OA 2JT4A 3MKDA 2KGTA 2HQHA 2CSQA 3X20B 2HMAA 3QO3A 1TTHB 3JCMJ 2LZ6B 3HP9A 1YIJQ 3RKYA 1VQPA 2P4RA 1VQLT 4LDWA 2VUBA 1NPPA 4RCCA 1IREB 2KNBB 3TQ7P 1IZ6A 2L5QA 2K5IA 4BI4A 5GAOp 2YWWA 1BI0A 2COZA 2WSFE 1BBZA 1PM3A 2QGFB 3QDFA 1H641 3V7SA 3RMSA
chains in the Genus database with same CATH topology
2AZSA 2K9GA 1M8MA 2JS0A 1H3HA 2F2XA 1NEBA 1X43A 2EW3A 2CUDA 1RI9A 2LJ1A 4RTVA 1UUEA 4Z89A 3PE0A 1S1NA 3SEMA 2JM9A 1UHFA 2DE0X 4F16A 1GCQA 3M0PA 2KRSA 1AVZC 1U06A 1BU1A 2LQWA 2CSIA 2DM1A 1AWWA 2RQWA 3H0FA 2AK5A 1K76A 1PHTA 5GJWB 4X1VA 2L2PA 2CREA 4RTYA 1GFDA 3M0TA 2YUQA 1NYFA 2LJ3A 4JJBA 4D8DA 4F17A 2KXCA 2ABLA 2B86A 1GBRA 2V1QA 2MCNA 4ZNXA 4OMPA 2CH4W 2AZVA 4CC2A 2M51A 1SEMA 3VRZA 1PRLC 2JMAA 4CC7A 1RLQC 4OMMA 2W10A 2O9SA 1SRLA 1SSHA 2D1XA 4JZ3A 2J6KA 1T3SA 1ZUUA 1K1ZA 2JM8A 2O88A 1TUCA 1TG0A 2LNHB 1X6BA 1W1FA 1PWTA 2VVKA 1SHGA 5I22A 1X6GA 2X3XD 1M3CA 1GBQA 4M4ZA 2LMJA 2FRWA 1IO6A 1ZX6A 1WDXA 4K11A 1HD3A 4RTXA 4J9BA 2LCSA 2L0AA 1SPKA 2J06A 2BZXA 1X2QA 2A37A 3EG3A 2KYMA 2F2VA 1OOTA 1KFZA 1W70A 2YDLA 2ED0A 1NG2A 2KRMA 2LX7A 4HVUA 4J9HA 1FYNA 2EGEA 1X69A 4AG1C 1X27A 1WA7A 3NGPA 1NLOC 2MIOA 1QWEA 1ZBJA 2FO0A 4HXJA 3EHQA 2GQIA 2YUNA 2CDTA 2A28A 2O9VA 2ROLA 5FWCA 1QWFA 2D0NA 1G2BA 4HCKA 5FW9A 2DJQA 2FPDA 5EC7A 3QWXX 1A0NB 4F14A 1OPKA 2GBQA 3QWYA 2M0YA 4JJCA 3LH5A 2X3WD 3THKA 4AG2C 1K0XA 4OMQA 2EYZA 2ESWA 1VYUA 3UATA 1BB9A 1I07A 2EKHA 2ENMA 2EYYA 4AFZC 1UHCA 1W6XA 1KIKA 4IIOA 1UTIA 3RBBB 3NMZC 2VKNA 1JXMA 2MOXA 1AZGB 3VRYA 4GBQA 2L3QA 2AKLA 4DEYA 3PVLA 2DF6A 2CUBA 3JV3A 1CKAA 1NLPC 4OMLA 5IHNA 4E6RA 1E6GA 2DBMA 1PNJA 2NUZA 1UE9A 1HSQA 1YN8A 2RQRA 3EHRA 4ESRA 2V1RA 2DL5A 2DILA 2J7IA 1E6HA 1G83A 4LN2A 3EG0A 1B07A 1ARKA 3EGUA 4OMNA 4RTTA 3I5SA 2GGRA 2HBWA 1E7OA 1JO8A 3H0IA 3REBB 2HCKA 2RQVA 3VS3A 2YT6A 4J9FA 1JU5C 1UGVA 1QKXA 2EVRA 1WI7A 4QT7A 2OAWA 3TVTA 4LUDA 2EPDA 3VS6A 4EIKA 2BZYA 3NPFA 2K3BA 2FPEA 2K2MA 1AOJA 1H8KA 1AWXA 3VS1A 5L23A 3VS0A 2E5KA 1JQQA 2DRKA 4GLMA 2DL3A 2YUOA 2D8HA 2BZ8A 2O2OA 2C0TA 3I9QA 3TSZA 2C0IA 4R0KA 3ZL7C 5IXBA 3A98A 3H0HA 2BTTA 4CC4B 4J9CA 2K7AA 4RTZA 1YCSB 1NEGA 1QCFA 3FJ5A 1ZUKA 1Z9QA 2FPFA 1WIEA 2DX1A 2K79A 2NWMA 1ZLMA 3M0RA 4Y92A 3CQTA 1VYVA 4JJDA 5IH2A 3UF4A 1WFWA 1YNZA 4Z8AA 1N5ZA 1UECA 4J9DA 1X2KA 2RN8A 1GFCA 1UJYA 1UDLA 2CT3A 4KRTA 3TSWA 2KYBA 2DLPA 1XOVA 2OI3A 2KEAA 2ROTA 2YSQA 1AEYA 3EG2A 3R6NA 4Z88A 1Y57A 2FEIA 1I1JA 1JEGA 1K4US 1U5SA 1M3BA 2CT4A 2KT1A 2SRCA 1H92A 1YWPA 4ORZA 1GL5A 2DBKA 2QDLA 3I35A 2DA9A 4DEXA 1UG1A 3U23A 2OJ2A 2JMCA 3SHWA 2KRNA 1V1CA 1QKWA 1WXTA 1M30A 5GJVB 2LP5A 4AFQC 4LNPA 1T0JA 1LCKA 1AWJA 2KROA 4WCIA 1WX6A 3M0UA 2LQNA 2ECZA 2DL7A 1GCQC 1WXUA 2JS2A 1FMKA 3UA7A 1PKTA 4LUEA 1Z9ZA 2G6FX 2KBTA 2D8JA 2KXDA 3VS7A 1K9AA 2RNAA 2W0ZA 2KR3A 2HDAA 4A63B 1AD5A 1OEBA 1VYTA 5I11A 4RUGA 3M0QA 2AKKA 3O5ZA 1PKSA 3RNJA 2RQUA 1MV3A 1HJDA 4OMOA 2ED1A 4D8KA 4J9GA 1U3OA 1UJ0A 2L3PA 1ABQA 1M27C 2DVJA 2DYBA 1J3TA 2DNUA 1WYXA 2GTJA 4RTWA 2LJ0A 2PNIA 4JZ4A 1SRMA 2J6FA 2RPNA 2GNCA 3C0CA 1MUZA 1ABOA 2EBPA 1AZEA 2I0NA 2EYXA 4RTUA 2RQTA 2JW4A 2H8HA 2DMOA 1M3AA 4CC3A 5ECAA 2J6OA 4HVWA 2EQIA 1GRIA 4J9EA 3PVQA 1YP5A 1VA7A 2F2WA 1B3QA 2KT8A 2DL8A 1NM7A 1NYGA 2RMOA 1T3LA 4HVVA 1MV0B 1UFFA 1WXBA 2GTOA 3GBQA 1OPLA 2HEQA 4IIMA 2DL4A 2CH4A 3UA6A 1AWOA 3NHNA 5HCKA 2EGCA 2J05A 2SEMA 1YWOA 1I0CA 3EG1A 2FG0A 5IHIA 3ULRB 1TUDA 1ZUYA 2JTEA 5IHKA 2K6DA 3REAB 4AFSC 2FRYA 3M0SA 2IIMA 2RF0A 1CSKA 3VS4A 2YUPA 5FWBA 5IXFA 1GCPA 1T0HA 2DRMA 4LE9A 3I5RA 3KFVA 1RLPC 4FSSA 1OV3A 2JXBA 2VWFA 1RUWA 3IQLA 1PRMC 4AFUC 2C0OA 2JT4A 2EGAA 2KGTA 2CSQA 2EYWA 1SHFA 2LZ6B 1EFNA 1K0SA 3H41A 2P4RA 2XMFA 2A08A 1QLYA 2PZ1A 1Y0MA 1JXOA 2L3SA 2KNBB 2KE9A 3VS5A 3VS2A 1CKBA 1ZSGA 2HSPA 2A36A 1KSWA 4J9IA 1KJWA 1WLPB 1BBZA 2O31A 1BK2A 4JPBW 2PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZS A;  2K9G A;  1M8M A;  2JS0 A;  1H3H A;  2F2X A;  1NEB A;  1X43 A;  2EW3 A;  2CUD A;  1RI9 A;  2LJ1 A;  4RTV A;  1UUE A;  4Z89 A;  3PE0 A;  1S1N A;  3SEM A;  2JM9 A;  1UHF A;  2DE0 X;  4F16 A;  1GCQ A;  3M0P A;  2KRS A;  1AVZ C;  1U06 A;  1BU1 A;  2LQW A;  2CSI A;  2DM1 A;  1AWW A;  2RQW A;  3H0F A;  2AK5 A;  1K76 A;  1PHT A;  5GJW B;  4X1V A;  2L2P A;  2CRE A;  4RTY A;  1GFD A;  3M0T A;  2YUQ A;  1NYF A;  2LJ3 A;  4JJB A;  4D8D A;  4F17 A;  2KXC A;  2ABL A;  2B86 A;  1GBR A;  2V1Q A;  2MCN A;  4ZNX A;  4OMP A;  2CH4 W;  2AZV A;  4CC2 A;  2M51 A;  1SEM A;  3VRZ A;  1PRL C;  2JMA A;  4CC7 A;  1RLQ C;  4OMM A;  2W10 A;  2O9S A;  1SRL A;  1SSH A;  2D1X A;  4JZ3 A;  2J6K A;  1T3S A;  1ZUU A;  1K1Z A;  2JM8 A;  2O88 A;  1TUC A;  1TG0 A;  2LNH B;  1X6B A;  1W1F A;  1PWT A;  2VVK A;  1SHG A;  5I22 A;  1X6G A;  2X3X D;  1M3C A;  1GBQ A;  4M4Z A;  2LMJ A;  2FRW A;  1IO6 A;  1ZX6 A;  1WDX A;  4K11 A;  1HD3 A;  4RTX A;  4J9B A;  2LCS A;  2L0A A;  1SPK A;  2J06 A;  2BZX A;  1X2Q A;  2A37 A;  3EG3 A;  2KYM A;  2F2V A;  1OOT A;  1KFZ A;  1W70 A;  2YDL A;  2ED0 A;  1NG2 A;  2KRM A;  2LX7 A;  4HVU A;  4J9H A;  1FYN A;  2EGE A;  1X69 A;  4AG1 C;  1X27 A;  1WA7 A;  3NGP A;  1NLO C;  2MIO A;  1QWE A;  1ZBJ A;  2FO0 A;  4HXJ A;  3EHQ A;  2GQI A;  2YUN A;  2CDT A;  2A28 A;  2O9V A;  2ROL A;  5FWC A;  1QWF A;  2D0N A;  1G2B A;  4HCK A;  5FW9 A;  2DJQ A;  2FPD A;  5EC7 A;  3QWX X;  1A0N B;  4F14 A;  1OPK A;  2GBQ A;  3QWY A;  2M0Y A;  4JJC A;  3LH5 A;  2X3W D;  3THK A;  4AG2 C;  1K0X A;  4OMQ A;  2EYZ A;  2ESW A;  1VYU A;  3UAT A;  1BB9 A;  1I07 A;  2EKH A;  2ENM A;  2EYY A;  4AFZ C;  1UHC A;  1W6X A;  1KIK A;  4IIO A;  1UTI A;  3RBB B;  3NMZ C;  2VKN A;  1JXM A;  2MOX A;  1AZG B;  3VRY A;  4GBQ A;  2L3Q A;  2AKL A;  4DEY A;  3PVL A;  2DF6 A;  2CUB A;  3JV3 A;  1CKA A;  1NLP C;  4OML A;  5IHN A;  4E6R A;  1E6G A;  2DBM A;  1PNJ A;  2NUZ A;  1UE9 A;  1HSQ A;  1YN8 A;  2RQR A;  3EHR A;  4ESR A;  2V1R A;  2DL5 A;  2DIL A;  2J7I A;  1E6H A;  1G83 A;  4LN2 A;  3EG0 A;  1B07 A;  1ARK A;  3EGU A;  4OMN A;  4RTT A;  3I5S A;  2GGR A;  2HBW A;  1E7O A;  1JO8 A;  3H0I A;  3REB B;  2HCK A;  2RQV A;  3VS3 A;  2YT6 A;  4J9F A;  1JU5 C;  1UGV A;  1QKX A;  2EVR A;  1WI7 A;  4QT7 A;  2OAW A;  3TVT A;  4LUD A;  2EPD A;  3VS6 A;  4EIK A;  2BZY A;  3NPF A;  2K3B A;  2FPE A;  2K2M A;  1AOJ A;  1H8K A;  1AWX A;  3VS1 A;  5L23 A;  3VS0 A;  2E5K A;  1JQQ A;  2DRK A;  4GLM A;  2DL3 A;  2YUO A;  2D8H A;  2BZ8 A;  2O2O A;  2C0T A;  3I9Q A;  3TSZ A;  2C0I A;  4R0K A;  3ZL7 C;  5IXB A;  3A98 A;  3H0H A;  2BTT A;  4CC4 B;  4J9C A;  2K7A A;  4RTZ A;  1YCS B;  1NEG A;  1QCF A;  3FJ5 A;  1ZUK A;  1Z9Q A;  2FPF A;  1WIE A;  2DX1 A;  2K79 A;  2NWM A;  1ZLM A;  3M0R A;  4Y92 A;  3CQT A;  1VYV A;  4JJD A;  5IH2 A;  3UF4 A;  1WFW A;  1YNZ A;  4Z8A A;  1N5Z A;  1UEC A;  4J9D A;  1X2K A;  2RN8 A;  1GFC A;  1UJY A;  1UDL A;  2CT3 A;  4KRT A;  3TSW A;  2KYB A;  2DLP A;  1XOV A;  2OI3 A;  2KEA A;  2ROT A;  2YSQ A;  1AEY A;  3EG2 A;  3R6N A;  4Z88 A;  1Y57 A;  2FEI A;  1I1J A;  1JEG A;  1K4U S;  1U5S A;  1M3B A;  2CT4 A;  2KT1 A;  2SRC A;  1H92 A;  1YWP A;  4ORZ A;  1GL5 A;  2DBK A;  2QDL A;  3I35 A;  2DA9 A;  4DEX A;  1UG1 A;  3U23 A;  2OJ2 A;  2JMC A;  3SHW A;  2KRN A;  1V1C A;  1QKW A;  1WXT A;  1M30 A;  5GJV B;  2LP5 A;  4AFQ C;  4LNP A;  1T0J A;  1LCK A;  1AWJ A;  2KRO A;  4WCI A;  1WX6 A;  3M0U A;  2LQN A;  2ECZ A;  2DL7 A;  1GCQ C;  1WXU A;  2JS2 A;  1FMK A;  3UA7 A;  1PKT A;  4LUE A;  1Z9Z A;  2G6F X;  2KBT A;  2D8J A;  2KXD A;  3VS7 A;  1K9A A;  2RNA A;  2W0Z A;  2KR3 A;  2HDA A;  4A63 B;  1AD5 A;  1OEB A;  1VYT A;  5I11 A;  4RUG A;  3M0Q A;  2AKK A;  3O5Z A;  1PKS A;  3RNJ A;  2RQU A;  1MV3 A;  1HJD A;  4OMO A;  2ED1 A;  4D8K A;  4J9G A;  1U3O A;  1UJ0 A;  2L3P A;  1ABQ A;  1M27 C;  2DVJ A;  2DYB A;  1J3T A;  2DNU A;  1WYX A;  2GTJ A;  4RTW A;  2LJ0 A;  2PNI A;  4JZ4 A;  1SRM A;  2J6F A;  2RPN A;  2GNC A;  3C0C A;  1MUZ A;  1ABO A;  2EBP A;  1AZE A;  2I0N A;  2EYX A;  4RTU A;  2RQT A;  2JW4 A;  2H8H A;  2DMO A;  1M3A A;  4CC3 A;  5ECA A;  2J6O A;  4HVW A;  2EQI A;  1GRI A;  4J9E A;  3PVQ A;  1YP5 A;  1VA7 A;  2F2W A;  1B3Q A;  2KT8 A;  2DL8 A;  1NM7 A;  1NYG A;  2RMO A;  1T3L A;  4HVV A;  1MV0 B;  1UFF A;  1WXB A;  2GTO A;  3GBQ A;  1OPL A;  2HEQ A;  4IIM A;  2DL4 A;  2CH4 A;  3UA6 A;  1AWO A;  3NHN A;  5HCK A;  2EGC A;  2J05 A;  2SEM A;  1YWO A;  1I0C A;  3EG1 A;  2FG0 A;  5IHI A;  3ULR B;  1TUD A;  1ZUY A;  2JTE A;  5IHK A;  2K6D A;  3REA B;  4AFS C;  2FRY A;  3M0S A;  2IIM A;  2RF0 A;  1CSK A;  3VS4 A;  2YUP A;  5FWB A;  5IXF A;  1GCP A;  1T0H A;  2DRM A;  4LE9 A;  3I5R A;  3KFV A;  1RLP C;  4FSS A;  1OV3 A;  2JXB A;  2VWF A;  1RUW A;  3IQL A;  1PRM C;  4AFU C;  2C0O A;  2JT4 A;  2EGA A;  2KGT A;  2CSQ A;  2EYW A;  1SHF A;  2LZ6 B;  1EFN A;  1K0S A;  3H41 A;  2P4R A;  2XMF A;  2A08 A;  1QLY A;  2PZ1 A;  1Y0M A;  1JXO A;  2L3S A;  2KNB B;  2KE9 A;  3VS5 A;  3VS2 A;  1CKB A;  1ZSG A;  2HSP A;  2A36 A;  1KSW A;  4J9I A;  1KJW A;  1WLP B;  1BBZ A;  2O31 A;  1BK2 A;  4JPB W;  2PTK A; 
#chains in the Genus database with same CATH topology
 2AZS A;  4OB2 B;  2MMP A;  5I2M A;  2P4T A;  2JS0 A;  3OY9 A;  3BDL A;  2RJC A;  5CO7 A;  1K9M C;  3CCR T;  2EW3 A;  4RTV A;  3GIB A;  4M77 F;  3LX7 A;  3L2V A;  2RHZ A;  3SEM A;  3CPF A;  1GCQ A;  1D1B A;  2K4Y A;  2MWO A;  3M0P A;  4ATO A;  2LQW A;  2DXU A;  1U1T A;  3X25 B;  3P8B B;  4M7A A;  2BUD A;  2NUP B;  5GJW B;  5HKC A;  1QQJ A;  5J39 A;  1Q86 C;  1TUG B;  2YUQ A;  1NYF A;  2LJ3 A;  3LLR A;  4PFZ A;  1BI2 A;  2ABL A;  3GLX A;  2MPX C;  1JRI A;  4ZNX A;  4OMP A;  2AZV A;  4M75 A;  1TWB A;  2FZC B;  4CC7 A;  2E1H A;  4FM4 B;  2D1X A;  1T3S A;  1ZUU A;  2YHT A;  3A5Z B;  1YJW A;  3EFR A;  1X6B A;  4XAX B;  5GAN 3;  1Y96 B;  1SHG A;  1X6G A;  2X3X D;  1IO6 A;  4PJO D;  2Z0W A;  1K8A C;  1WDX A;  4OF1 A;  1VQL Q;  4JLI A;  2O4X B;  2J06 A;  1LJO A;  2QTV A;  2FB7 A;  4A4K A;  2RJD A;  4EPC A;  3LGL A;  1KFZ A;  4M77 C;  1W70 A;  3CCQ A;  3BW1 A;  2ED0 A;  2P0Q A;  2LX7 A;  4HVU A;  2EGE A;  2E4H A;  1X27 A;  3CMA A;  1NLO C;  2MIO A;  2ZZD A;  2E12 A;  3EHQ A;  1JJ2 A;  3BDU A;  2A28 A;  4Z02 A;  2RA2 A;  4XTY A;  2XI9 A;  2QI2 A;  4HCK A;  4HKE A;  3ZFJ A;  5GMK i;  2NLU A;  1MMD A;  2KI7 A;  2E3I A;  1A0N B;  4M78 F;  4ZN3 A;  1MHN A;  2M0Y A;  4JJC A;  3TU4 K;  2ZPG B;  3LH5 A;  5GAN 8;  4FT2 A;  2BKD N;  2EYZ A;  2E5Q A;  1SG5 A;  3C4S A;  2EKH A;  2JOY A;  4R56 A;  1IB8 A;  1KQS P;  1W6X A;  4M7D D;  2Y90 A;  1KIK A;  4IIO A;  1UTI A;  3PTA A;  4FCY A;  3NMZ C;  2COW A;  1VQ4 T;  1VQK Q;  1TS9 A;  2MOX A;  4F7U G;  2XDB A;  4GBQ A;  2M16 A;  2L3Q A;  3F70 A;  1D3B A;  1Q95 G;  2AKL A;  4J8O A;  2LQK A;  4RMO A;  2CUB A;  2CP3 A;  3C95 A;  4M7D G;  3OYM A;  5GAO l;  1E6G A;  3EFS A;  3UT1 A;  1HSQ A;  3NFC A;  4JRK A;  4NOY A;  2VYT A;  2XDD A;  2RQR A;  2V1R A;  4C5I A;  1SKU B;  3EG0 A;  4LDY A;  4BUG A;  4C8Q E;  5DM7 R;  4M78 D;  3A8L B;  4OMN A;  3FB9 A;  3I5S A;  2L8D A;  1X01 A;  3H0I A;  1OZ2 A;  3CBO A;  2HCK A;  2XU8 A;  1C6V X;  5GAO r;  1RAF B;  1V76 A;  2EPD A;  4C0G A;  3E2U A;  1H8K A;  1YHQ Q;  4KUI A;  3CCJ A;  3VS1 A;  5L23 A;  2VGM A;  2F1L A;  3EFO A;  4GLM A;  3TCJ A;  3OYJ A;  2L3R A;  2CZ7 B;  3VJP A;  4KH1 B;  3EAE A;  4RG2 A;  4O5V A;  4F7U E;  2HZY A;  1WNL A;  2RK1 A;  3DLL A;  3H0H A;  4CC4 B;  3I56 T;  4J9C A;  5GAN h;  3PIP A;  8AT1 B;  2K7A A;  2QYZ A;  4E7L A;  4ELZ C;  1QCF A;  2G3R A;  4M7D F;  5CQY A;  4ANJ A;  1Z9Q A;  5CKF A;  2HL3 A;  1IRX A;  2K79 A;  2NWM A;  4J6Y A;  1VYV A;  3G4S T;  3CEY A;  5IH2 A;  5KYY B;  4M77 D;  7AT1 B;  2DAQ A;  1UDL A;  4OGE A;  2QK0 A;  4FYW B;  2CP7 A;  3L2R A;  3OS0 A;  1XOV A;  2E3H A;  2EAY A;  4ELY C;  4PJO A;  2JTF A;  3AHU A;  2FEI A;  1PD1 A;  3V8J A;  3G71 T;  1VQM T;  1Q82 U;  2KT1 A;  3MEW A;  3JAM E;  1GL5 A;  4YTL A;  2DBK A;  2X4J A;  4F7U B;  2M0O A;  4KBM B;  4IUT A;  2O01 E;  2HKQ B;  2OJ2 A;  2JMC A;  2ZCF B;  3JB9 J;  3SHW A;  2LRQ A;  2DER A;  2KRN A;  1QKW A;  3CXC P;  2F5K A;  1M30 A;  4KGV B;  3GPL A;  2LTO A;  3QPH A;  1T0J A;  3JB9 I;  4WCI A;  5CR2 A;  1YBY A;  1X75 C;  1VQP Q;  1FWZ A;  1C0M A;  3ME9 A;  1KD1 R;  1I5O B;  1GCQ C;  2JS2 A;  3M59 A;  3SD4 A;  1RAI B;  4ZGJ B;  4R55 A;  1Q7Y C;  2G6F X;  2KBT A;  2RNA A;  1LVK A;  3OYH A;  3LW5 E;  3M0Q A;  1G8X A;  1QVG P;  1BI1 A;  4PJL A;  1MV3 A;  4OMO A;  1Q86 R;  4NL3 A;  4DBH A;  4J9G A;  1U3O A;  2OTJ A;  1M27 C;  2DVJ A;  1J3T A;  5GAN 4;  1TH7 A;  1WYX A;  2ZPH B;  4MMK A;  4BB7 A;  3INZ A;  2LJ0 A;  2VB6 A;  3EGD B;  1KK7 A;  3QII A;  4E7S A;  4JZ4 A;  1SRM A;  2GNC A;  5GAM f;  4M7A E;  2P84 A;  1ABO A;  3V7R A;  4EMK B;  4LXC A;  1VQ8 Q;  1NBE B;  3A8O B;  4QVZ A;  4XU2 A;  2DMO A;  5KYW B;  1YCY A;  3S6W A;  2DVE A;  2E64 A;  4C92 A;  2CKK A;  3CC2 T;  5D7U A;  4ZTJ A;  2RK2 A;  1RAB B;  5LJ5 g;  3PIO A;  1B3Q A;  2GFA A;  1YIT Q;  2KT8 A;  2DL8 A;  1NM7 A;  1JJ2 S;  3OBW A;  2JZ2 A;  1UFF A;  1WXB A;  1OPL A;  1KD1 U;  3ZEH A;  1BIA A;  4C92 E;  1TU0 B;  3QJY A;  4KGX B;  2XK0 A;  5GAN f;  4EDU A;  2K6D A;  2FRY A;  2IIM A;  2RF0 A;  1M9S A;  5FWB A;  3DB4 A;  1GCP A;  1WHK A;  1I4K 1;  4JJN K;  4FYX B;  5KYN A;  3I5R A;  2RB6 A;  1EX4 A;  1VQO A;  3L1A A;  2DKG A;  2RM4 A;  1Q82 R;  3CCE T;  3IQL A;  1PRM C;  3I56 A;  4CI0 C;  1XTD A;  1VOM A;  2EYW A;  1SHF A;  1IHW A;  2NUT B;  1WJQ A;  3H41 A;  4N0A A;  1YJN T;  1QLY A;  3NTH A;  1Y0M A;  4PJJ A;  2DTO A;  3VS5 A;  1ZSG A;  3MP8 A;  2DO3 A;  1PCX A;  3BE3 A;  3JRZ A;  2O31 A;  2PTK A;  3CCV T;  1KQS S;  5GMK e;  2K9G A;  1WPY A;  4PLI A;  2NUT A;  4V2S A;  2IG0 A;  5CKB A;  2RHX A;  4C92 D;  4Z89 A;  3CCQ T;  1BCM A;  2JM9 A;  1UHF A;  2HKN A;  3L2Q A;  3G71 A;  1YFN A;  1AWW A;  2RQW A;  2K5F A;  1PHT A;  3VKI A;  4X1V A;  3JSC A;  4RTY A;  1KQ1 A;  2ZAE A;  4PJO B;  4IUU A;  4XU1 A;  1GBR A;  2B86 A;  1N8R R;  2V1Q A;  2M51 A;  4KUL A;  1SEM A;  2DXB A;  2JMA A;  4OMM A;  2W10 A;  2O9S A;  2EJG A;  1SSH A;  2K3X A;  2PUK B;  2J6K A;  2QEX Q;  1Y7X A;  2O88 A;  1TUC A;  2LNH B;  4XTX A;  1PWT A;  4F7U F;  1M3C A;  4FL6 A;  5KYW A;  4QKU A;  2DIQ A;  4K11 A;  4RTX A;  2LCS A;  4J9B A;  2L0A A;  4C5G A;  2DEU A;  4PK4 A;  1X2Q A;  2A37 A;  1RAC B;  4M7D A;  3JCM h;  1M1K C;  4FT4 A;  2K57 A;  1KC8 C;  4BD3 A;  1FYN A;  1W4S A;  3NGP A;  1W2B A;  1F1B B;  1QWE A;  4XU3 A;  2MF2 A;  4C0Z A;  2DZC A;  1VIF A;  4IUP A;  3RDV A;  4M77 B;  4GY5 A;  2D0N A;  1NE8 A;  2CP5 A;  2DJQ A;  4MZT A;  3QWX X;  4GLK A;  3FEO A;  3H6Z A;  2GBQ A;  2QAS A;  2CYZ B;  2BIV A;  3C94 A;  3THK A;  4AG2 C;  2E70 A;  4M7A G;  5CCA A;  4OMQ A;  3CBM A;  5FU7 B;  1OU9 A;  4C8Q A;  2ENM A;  1QCO A;  2X9H A;  1W2B P;  2CS7 A;  4AFZ C;  4EMH A;  1UHC A;  2DD4 A;  2HSE B;  4MZM A;  3MEU A;  3RBB B;  2YRC A;  4M7A C;  2VKN A;  1RAD B;  4E7H A;  4ZN1 A;  1YJW T;  1VQ6 A;  3CCM T;  4M7D E;  3OS2 A;  1UGQ B;  4DEY A;  5LJ5 h;  3CCR Q;  3JV3 A;  1CKA A;  4OML A;  4PJM A;  1M1G A;  2DBM A;  1H3Z A;  5GAN 6;  4DQ2 A;  5CVI A;  3OMG A;  1YI2 A;  4JRQ A;  1YN8 A;  5FRM A;  3PGG A;  1G5V A;  1DJ7 B;  4LN2 A;  1PD0 A;  2YXY A;  3CME Q;  3EGU A;  3V7C A;  2EQM A;  2RI2 A;  5DLQ E;  4FW2 A;  1JO8 A;  3ZBD A;  3CCS T;  3D7S B;  4FU6 A;  4XQ3 A;  4RG8 A;  5CKE A;  3CCU T;  1QMC A;  2DTH A;  3HPW A;  2RQV A;  3VS3 A;  3CD6 T;  2YT6 A;  2QA4 T;  3M9Q A;  4OB1 B;  3CCQ Q;  1JU5 C;  1MND A;  1K8A U;  4WF2 A;  2EVR A;  2OAU A;  5D6W A;  2E65 A;  3TVT A;  2OAW A;  4LUD A;  1V29 B;  2CZ1 B;  2B8A A;  5KYU B;  4M78 A;  2K3B A;  1ZSZ B;  2X35 A;  3CMA T;  2QQA A;  2BZ8 A;  4M75 B;  2O2O A;  4X9C A;  4QQ6 A;  2C0I A;  2CP0 A;  3FRN A;  3ZL7 C;  5GAM d;  3OW2 S;  4OMF B;  1ACM B;  3A98 A;  4JLG A;  5KYU A;  2FYK A;  4F04 B;  5KYY A;  4C5E A;  3HFN A;  3N5B B;  1VQM A;  1YCS B;  3FJ5 A;  2VXF A;  1S72 T;  3EG9 A;  3G6E A;  3VU3 C;  1WIE A;  3M54 A;  2KVQ G;  4VUB A;  3HRS A;  3MHX A;  4B9X A;  3OS1 A;  1IGU A;  1WFW A;  1YNZ A;  5C0M A;  3L2W A;  1UJY A;  2CT3 A;  4KRT A;  2HNI A;  4BI8 B;  4M7A B;  3R6O A;  1AEY A;  3R6N A;  3MJX A;  2DD5 A;  2OTJ Q;  1M90 U;  3OYD A;  2M02 A;  2AHJ B;  4M75 F;  2JJ9 A;  3CBP A;  1QCN A;  2SRC A;  3VUZ A;  5KE3 A;  3I35 A;  1Q81 C;  1BYM A;  5IT9 E;  3CC7 T;  2JVV A;  3CME A;  1U1S A;  1WXT A;  1OUL A;  2KY9 A;  2LP5 A;  1WHG A;  2Y4Y A;  2QA4 Q;  1AWJ A;  2KRO A;  2EQK A;  5GAO m;  3M0U A;  5CKH A;  2C06 A;  3CCR A;  2LQN A;  1PSF A;  1WXU A;  2PU9 B;  1TXQ A;  5KCH A;  2HBP A;  1O9S A;  4LUE A;  4IUQ A;  1M8V A;  3VS7 A;  2D8J A;  1VUB A;  4BE2 A;  1LNX A;  2KR3 A;  2HDA A;  5LJ5 e;  1VQ5 A;  2OTL A;  1OEB A;  1VYT A;  5I11 A;  2AKK A;  4A4G A;  3S3N A;  1D09 B;  3RNJ A;  3OSS C;  2RQU A;  3WVE B;  1HJD A;  1WHH A;  4D8K A;  1UGR B;  1QP3 A;  2LNV A;  5GAN 2;  1NJI R;  1IGQ A;  3DKM A;  4EMG A;  1G3W A;  3MP6 A;  3ER0 A;  3OYF A;  2J6F A;  5HK0 A;  2RPN A;  2VC8 A;  3HTR A;  2K5L A;  5GMK h;  1JB0 E;  3CCM A;  2PQW A;  4PKC C;  2COY A;  1KC8 R;  2K3Y A;  1VQ7 Q;  2I0N A;  3RKX A;  2EYX A;  1UGP B;  2EIF A;  2RQT A;  2H8H A;  1WQW A;  4RKU E;  1OX9 A;  5ECA A;  1RAH B;  1GRI A;  3S3M A;  4J6W A;  3RKW A;  4OB0 B;  2F2W A;  3CPW P;  2DXT A;  2RI5 A;  1T3L A;  2JN0 A;  3VYG A;  2ZPF B;  4IUV A;  1M5Q 1;  4IIM A;  2XID A;  4LD6 A;  5KYX A;  3E19 A;  1AWO A;  2EGC A;  1QVG A;  2J05 A;  3SWN A;  1YWO A;  1I0C A;  2E6N A;  2FG0 A;  2NUP A;  1NJI C;  3ULR B;  2JTE A;  5IHK A;  2HD0 A;  3REA B;  4AFS C;  3M0S A;  5IXF A;  3VS4 A;  1Q7Y U;  1OU8 A;  1YJ9 A;  1N8R C;  1UGS B;  5CIU A;  1R0B G;  1T0H A;  4BAC A;  1MMN A;  2QXF A;  4LE9 A;  4X9D A;  3MET A;  3KFV A;  5KYX B;  5LJ3 e;  1VQ4 Q;  1RAG B;  3BFM A;  1Q7Y R;  5GAM j;  1VIE A;  3HRU A;  2VWF A;  4L59 A;  3SFM A;  4AFU C;  5EG2 A;  1N8R U;  2HAX A;  2EGA A;  3URG A;  2JUF A;  1K0S A;  2DK3 A;  2XMF A;  2A08 A;  3PFS A;  3T9N A;  4C8Q F;  1KHC A;  2PZ1 A;  2EQU A;  2L3S A;  2DIG A;  3VS2 A;  1CKB A;  3HHT B;  3CCL A;  2A36 A;  2RO0 A;  1KSW A;  1WLP B;  2RD1 A;  5GAM g;  4BE0 A;  1D0Y A;  2D6F A;  1BK2 A;  4JPB W;  4HCB A;  1XQH A;  1VQO T;  1M8M A;  5J26 A;  2F2X A;  1X43 A;  3CC4 A;  3P8D A;  2LJ1 A;  4MDX A;  1UUE A;  3PE0 A;  5HY6 A;  2ZPE B;  3GP8 A;  4C0D B;  3VYH B;  3ASK A;  1S1N A;  2V26 A;  4F16 A;  1NPR A;  2QA4 A;  2WSE E;  2KRS A;  4HT9 A;  1U06 A;  4OGC A;  5LL6 S;  2RI3 A;  1RAE B;  2DM1 A;  4M77 A;  3H0F A;  1C1A A;  1K76 A;  1MMA A;  2L2P A;  1D0X A;  2CRE A;  3M4Y A;  4KT0 E;  3M0T A;  4D8D A;  3I56 Q;  2RJE A;  4CRI A;  4E7I A;  3M53 A;  5A2Q E;  1VQO Q;  1OYX A;  4F7U A;  3OB9 A;  4LDV A;  2CH4 W;  3M56 A;  3E9F A;  1RLQ C;  3EH1 A;  4JZ3 A;  2DYI A;  2DPP B;  2ZPB B;  2O4X A;  2PUO B;  2X4Y A;  1K1Z A;  1XNI A;  2P0K A;  2A0F B;  2VVK A;  2LVM A;  4J83 A;  4M4Z A;  1YIJ T;  4P5N A;  2DXC A;  1VQ7 T;  2R57 A;  3CCJ Q;  4PLL A;  1YJW Q;  1SPK A;  5J3B A;  2BZX A;  3M55 A;  3EG3 A;  5KE2 A;  3OMC A;  2YDL A;  1R0C B;  4A53 A;  2LQ8 A;  4N0A C;  4J9H A;  2KSS A;  1MGQ A;  1WA7 A;  4XK8 E;  1M90 R;  1ZBJ A;  3QUI A;  3JCM d;  4C0D C;  2FZK B;  2YUN A;  5M9O A;  2O9V A;  2ROL A;  3OYK A;  3OYI A;  1EIF A;  1G3Y A;  2LCL A;  1I81 A;  1PC0 A;  1WHL A;  2FPD A;  1B34 A;  1WHM A;  3QYG B;  1YI2 Q;  3AT1 B;  4M75 G;  4B9W A;  3QWY A;  4B6M A;  4XTW A;  1BKB A;  4O6J A;  2X3W D;  1K0X A;  4D6W A;  2ESW A;  3CCS A;  3JB9 G;  3UAT A;  1BB9 A;  1I07 A;  1WHJ A;  2GCX A;  1RI0 A;  2EYY A;  4L6V 5;  1VQ6 Q;  3MEV A;  5GAN j;  1VQK A;  1R77 A;  4BE1 A;  3A8G B;  3CXC A;  3VRY A;  4BY6 C;  1AT1 B;  1GXI E;  1D1C A;  2EYQ A;  1YJ9 T;  1KHI A;  3H8Z A;  2DF6 A;  4N4I A;  5GAM e;  2LDM A;  4FSX A;  4E6R A;  2NUZ A;  3JCM e;  5D6X A;  4ESR A;  3OQ5 A;  2DL5 A;  4OP0 A;  3G1J A;  1G83 A;  1VQK T;  1B07 A;  1HK9 A;  3QZ5 B;  1E7O A;  2RH2 A;  3EGD A;  2GF7 A;  1VQN A;  2GQV A;  4C92 G;  1IXD A;  2QQ9 A;  4PJO G;  3PMI A;  3CCV A;  5LJ3 j;  3CCJ T;  1UGV A;  3CC2 A;  1M2V A;  3VS6 A;  3SDZ A;  3UWN A;  4EIK A;  2BZY A;  2LT4 A;  2YLB A;  3NPF A;  2FPE A;  1AOJ A;  4C92 F;  4BI3 A;  2E5K A;  4KUD K;  2DRK A;  2H3E B;  4FYY B;  2YUO A;  3J7A F;  3QG1 A;  1VQP T;  5FRO A;  3CCU A;  3QJ6 A;  3NTI A;  3I9Q A;  3TSZ A;  2H3J A;  2NYS A;  4M7D B;  3CC7 Q;  3LYI A;  3CCL T;  1IHV A;  5IXB A;  4EMK C;  3CXC S;  3HRT A;  3E9G A;  1FMW A;  2VAS A;  3CD6 A;  2CZ6 B;  1ZQ1 A;  1TSF A;  1TOV A;  3SB2 A;  4C8Q G;  2DX1 A;  1ZLM A;  3CCE Q;  4Y92 A;  4C92 B;  3CQT A;  2KK4 A;  3EGX A;  4IKF A;  3UF4 A;  4MDW A;  4FIB A;  4Z8A A;  2RN8 A;  3RMQ A;  1GFC A;  1VQ6 T;  3OSV A;  3BY7 A;  3TSW A;  2KYB A;  2DLP A;  2YSQ A;  2ROT A;  3JB9 F;  4WTO B;  1Y57 A;  4IUR A;  4E2F B;  4NL2 A;  3SWN B;  5LJ5 j;  5GAN 5;  1K4U S;  1M3B A;  5FU7 C;  1U8R A;  3V8K A;  1PSE A;  4RCB A;  2QDL A;  5FU6 C;  2DA9 A;  4M75 D;  4JS5 A;  3JCM f;  5GAN g;  1I5L A;  5KH6 A;  1WJS A;  1V1C A;  2E41 A;  5GJV B;  1JBM A;  4AFQ C;  4LNP A;  1YHQ T;  1LCK A;  1G3T A;  3G71 Q;  4J5Y A;  4DOW A;  2DFU A;  2OX7 A;  5LJ3 h;  4M7A D;  3I55 T;  3FC3 A;  4J7F A;  3OYG A;  1Y71 A;  3UA7 A;  2HQX A;  4M78 E;  1PKT A;  1M1K R;  2YRD A;  1VQ8 T;  2AIR B;  2KXD A;  5D6Y A;  2W0Z A;  1N9R A;  1AD5 A;  1QVP A;  4RUG A;  1LOJ A;  2M9U A;  4LDX A;  3EGX B;  1D0Z A;  2VGN A;  2DET A;  1BI3 A;  3QBY A;  2ED1 A;  1YJ9 Q;  1FMV A;  3JCM Q;  1UJ0 A;  2FVU A;  2F5T X;  1ABQ A;  4Q5W A;  5GAN d;  2DYB A;  1K73 U;  1UB4 A;  2R5A A;  1VQ5 T;  9ATC B;  3PNW C;  3A1P A;  1HXD A;  3GNF B;  1AZE A;  1K73 R;  3QXE B;  4QVD A;  3I55 A;  4E47 A;  2CGH A;  2DTI A;  1M1F A;  1VQ9 T;  3CMA Q;  3LH0 A;  1OQK A;  1R8O B;  1M3A A;  3E1S A;  4CC3 A;  2J6O A;  1ZA1 B;  2EQI A;  2FZG B;  3JB9 H;  4J9E A;  5A0D A;  3PVQ A;  1VA7 A;  2R58 A;  1NZ9 A;  2EKO A;  1NYG A;  2RMO A;  2X4X A;  2FHD A;  5LJ3 f;  4HVV A;  5L8R E;  3VV0 A;  3CC7 A;  2XIC A;  1M90 C;  3M5A A;  5CAI A;  2HEQ A;  2DL4 A;  3CCU Q;  2CH4 A;  3RUX A;  5I2S A;  1VQ9 A;  3UA6 A;  4HCC A;  3NHN A;  5HCK A;  3SWN C;  2D9T A;  4X34 A;  5GAO q;  3X24 B;  2SEM A;  1KG1 A;  4E7K A;  2V8I A;  1N9S A;  1I8F A;  4MML A;  1YIT A;  8ATC B;  1CSK A;  2YUP A;  3CC2 Q;  4KGZ B;  1YJN Q;  5LJ3 g;  2DRM A;  2OTJ T;  1Y07 A;  3GNG A;  4FSS A;  1FXX A;  1RAA B;  2JXB A;  4DA4 A;  3HSB A;  3I55 Q;  2KDS A;  1RUW A;  3G4S A;  3HKS A;  2MK5 A;  5LJ5 f;  2RJF A;  1KD1 C;  1EFN A;  2XG8 D;  3UDC A;  5GAN e;  1WZO A;  4JRP A;  2HQE A;  1JXO A;  2KE9 A;  2HSP A;  5GAO n;  2YLC A;  2QG9 B;  4J9I A;  1KJW A;  4Y28 E;  4C0F A;  3JCM c;  1B34 B;  3OS5 A;  2RHU A;  4BDY A;  1VQ5 Q;  1H3H A;  2A7Y A;  1NEB A;  3CPW S;  5GAN 7;  2ZPI B;  2CUD A;  1RI9 A;  1ZBX A;  3OW2 P;  2P0P A;  2EJ9 A;  3MO8 A;  1YIT T;  2EWN A;  2DE0 X;  3WVD B;  3QZ9 B;  3TEE A;  1AVZ C;  1B7T A;  5KCO A;  2BE9 B;  1BU1 A;  4PJO F;  2CSI A;  2AK5 A;  3OYC A;  3FJP A;  5GMK j;  1QW1 A;  1GFD A;  1Q86 U;  4HA8 A;  2DEQ A;  3QHS A;  4JJB A;  4F17 A;  2LX9 A;  2KXC A;  3JB9 D;  5IN1 A;  1YI2 T;  2KAF A;  5CKD A;  2MCN A;  4HT8 A;  4JRI A;  1S72 Q;  1VQ4 A;  1SF9 A;  1FX7 A;  4CC2 A;  2IPO B;  3OBY A;  5CQX A;  4OVA A;  3J81 E;  3VRZ A;  1PRL C;  1M2O A;  2PVD B;  3M57 A;  2K2V A;  2IVW A;  1HYO A;  1SRL A;  1RL2 A;  1VQM Q;  4LDU A;  4PJO E;  3P8H A;  4Y91 A;  4E7Z A;  2JM8 A;  3OYA A;  1TG0 A;  4II1 A;  1MMG A;  1KQ2 A;  1W1F A;  4JUV A;  1VQL A;  2CP6 A;  5I22 A;  2V8K A;  6AT1 B;  5DLO A;  1M2V B;  1GBQ A;  2LMJ A;  2FRW A;  1ZX6 A;  1VQ9 Q;  5HK3 A;  4JS4 A;  1HD3 A;  4AT1 B;  5FLX E;  4M75 E;  2R5M A;  1WGS A;  2JTM A;  4PJO C;  4M78 C;  2JNG A;  2I2L A;  2QTX A;  3M58 A;  2KYM A;  4M7A F;  4M77 E;  4DBR A;  1X6O A;  3G6E Q;  2F2V A;  1OOT A;  1Q81 U;  3J80 E;  3CCV Q;  4XTV A;  4PJN A;  1NG2 A;  2KRM A;  3PT9 A;  4OB3 B;  1X69 A;  4AG1 C;  4PFO A;  3DLM A;  4A4H A;  3JCM g;  3OYY A;  1XJW B;  4A4E A;  2FO0 A;  4HXJ A;  3RER A;  2GQI A;  2CDT A;  5FWC A;  1QVF P;  4C8Q B;  1K9M R;  3CPW A;  1QWF A;  2EFI A;  3CCM Q;  3RIR A;  3OYB A;  2XD0 A;  4NS5 A;  1G2B A;  5FW9 A;  3RES A;  3LWI A;  5EC7 A;  3RR6 A;  1YHQ A;  4F14 A;  4XTU A;  1OPK A;  4J6X A;  1EZZ B;  2MWP A;  2LCC A;  5A0G A;  5CK9 A;  2Y4X A;  4DOV A;  2PVO B;  3V8L A;  4DBF A;  1VYU A;  1K73 C;  3GOX A;  3CC4 Q;  4C8Q D;  3MP1 A;  5GMK l;  2PVG B;  1JXM A;  3DB3 A;  1AZG B;  4XU0 A;  3X26 B;  3QYH B;  1G3S A;  3M4G A;  2KQW A;  3CCS Q;  3PVL A;  2QEX T;  3CCL Q;  2X4W A;  2LC4 A;  2A3L A;  1NLP C;  2LT1 A;  3LWH A;  5IHN A;  4A54 A;  1PNJ A;  1UE9 A;  3G7Z A;  3EH2 A;  3NTK A;  4C5H A;  4FYV B;  3EHR A;  2DIL A;  1D3B B;  1E6H A;  2J7I A;  4QQD A;  4DBQ A;  4L5G A;  1ARK A;  2RHY A;  2XKO C;  4RTT A;  2GGR A;  2HBW A;  2DJZ A;  3MCA B;  5AT1 B;  3REB B;  1QVG S;  3LGF A;  4XTZ A;  1K9M U;  3QSU A;  4J9F A;  3L2U A;  1QVF A;  2CZ0 B;  3GF5 A;  2WAC A;  1QKX A;  1WI7 A;  4QT7 A;  5I21 A;  1OX8 A;  1QP2 A;  2K2M A;  1AWX A;  2CP2 A;  3VS0 A;  1Q81 R;  1JQQ A;  3EG9 B;  5C6S A;  5FU6 B;  2DL3 A;  2D8H A;  2ZGW A;  4BDZ A;  3CME T;  5AYF A;  2C0T A;  3L42 A;  4R0K A;  2AT1 B;  5LJ3 d;  2BTT A;  3CCE A;  3H9N A;  1N6A A;  2RHI A;  4RTZ A;  3L2Z A;  1NEG A;  3C12 A;  1ZSZ A;  1PG5 B;  1ZUK A;  5GAM h;  2MAM A;  2FPF A;  4ZGE B;  4JDS A;  4PFP A;  3M0R A;  1KQS A;  2DZ9 A;  4JJD A;  1W2B S;  5LJ5 d;  1VQ8 A;  1WJR A;  3KBG A;  1N5Z A;  1UEC A;  4J9D A;  1X2K A;  4C92 C;  4QQG A;  2WSC E;  3S3O A;  1Y96 A;  2OI3 A;  1AHJ B;  2KEA A;  1O75 A;  2XHC A;  3EG2 A;  2KMT A;  2QEX A;  4Z88 A;  1I1J A;  3MEA A;  2VV5 A;  2GFU A;  4EMK A;  5DY9 A;  4M78 G;  1JEG A;  4M7D C;  1U5S A;  4TVR A;  1OZ3 A;  4A4F A;  4M75 C;  2CT4 A;  1H92 A;  1YWP A;  4ORZ A;  1ZSZ C;  1Q82 C;  2OTL Q;  1M1K U;  1VQN Q;  4N4H A;  2L89 A;  4DEX A;  1UG1 A;  3U23 A;  3FLG A;  3OYL A;  2ATC B;  1D1A A;  1UEB A;  3TRE A;  2FL7 A;  5A0L A;  2BE7 D;  2D0Q B;  4C8Q C;  2QQS A;  2XDP A;  3X28 B;  4ME7 A;  1WX6 A;  1WQ7 A;  2X51 A;  3CC4 T;  3OYN A;  2ECZ A;  3WXM B;  3O8V A;  2DL7 A;  4ZTF A;  1FMK A;  1MNE A;  1P92 A;  1BCO A;  3JCM P;  1Z9Z A;  3G4S Q;  2YRV A;  3JCM b;  2EJF A;  1K9A A;  4A63 B;  4M78 B;  3VUB A;  3KUF A;  5IAY A;  4E7J A;  1ZHI A;  2OTL T;  4N4G A;  2MYS A;  3O5Z A;  1PKS A;  3QDR B;  2E10 A;  3A8M B;  3HFO A;  2QGG A;  1K8A R;  1YJN A;  2HL5 C;  2QDY B;  2E6Z A;  4PL6 A;  3UPU A;  3EFO B;  2L3P A;  4BY6 B;  2DNU A;  2GTJ A;  4RTW A;  1KC8 U;  1N27 A;  5GMK m;  1LPL A;  2PNI A;  4HCZ A;  1YIJ A;  2QQB A;  3C0C A;  1MUZ A;  2EBP A;  1NJI U;  2EQJ A;  4LD9 K;  4RTU A;  2MI6 A;  3QKJ A;  2JW4 A;  3OW2 A;  3FDR A;  4UC4 A;  4HVW A;  5FRN A;  1ZA2 B;  3KXT A;  1YP5 A;  4ZGD B;  3CD6 Q;  1JJ2 P;  3HL8 A;  4QW2 A;  1VQN T;  3OYE A;  4M77 G;  1MV0 B;  3PMT A;  4FW1 A;  2GTO A;  3GBQ A;  2V8J A;  3JCM V;  1OI1 A;  1M4Z A;  2F69 A;  3JCM W;  3EG1 A;  4J7I A;  4QVC A;  4AMC A;  3MPU B;  5IHI A;  1TUD A;  1ZUY A;  1BIB A;  4PNO A;  1QVF S;  2QAZ A;  3JCM X;  3Q1J A;  3G6E T;  1RLP C;  1SSF A;  2QQR A;  1OV3 A;  4KH0 B;  1S72 A;  3FIF A;  2VXE A;  3A8H B;  1VQ7 A;  3OA6 A;  2M1H A;  4MZP A;  2C0O A;  2JT4 A;  3MKD A;  2KGT A;  2HQH A;  2CSQ A;  3X20 B;  2HMA A;  3QO3 A;  1TTH B;  3JCM J;  2LZ6 B;  3HP9 A;  1YIJ Q;  3RKY A;  1VQP A;  2P4R A;  1VQL T;  4LDW A;  2VUB A;  1NPP A;  4RCC A;  1IRE B;  2KNB B;  3TQ7 P;  1IZ6 A;  2L5Q A;  2K5I A;  4BI4 A;  5GAO p;  2YWW A;  1BI0 A;  2COZ A;  2WSF E;  1BBZ A;  1PM3 A;  2QGF B;  3QDF A;  1H64 1;  3V7S A;  3RMS A; 
#chains in the Genus database with same CATH homology
 2AZS A;  2K9G A;  1M8M A;  2JS0 A;  1H3H A;  2F2X A;  1NEB A;  1X43 A;  2EW3 A;  2CUD A;  1RI9 A;  2LJ1 A;  4RTV A;  1UUE A;  4Z89 A;  3PE0 A;  1S1N A;  3SEM A;  2JM9 A;  1UHF A;  2DE0 X;  4F16 A;  1GCQ A;  3M0P A;  2KRS A;  1AVZ C;  1U06 A;  1BU1 A;  2LQW A;  2CSI A;  2DM1 A;  1AWW A;  2RQW A;  3H0F A;  2AK5 A;  1K76 A;  1PHT A;  5GJW B;  4X1V A;  2L2P A;  2CRE A;  4RTY A;  1GFD A;  3M0T A;  2YUQ A;  1NYF A;  2LJ3 A;  4JJB A;  4D8D A;  4F17 A;  2KXC A;  2ABL A;  2B86 A;  1GBR A;  2V1Q A;  2MCN A;  4ZNX A;  4OMP A;  2CH4 W;  2AZV A;  4CC2 A;  2M51 A;  1SEM A;  3VRZ A;  1PRL C;  2JMA A;  4CC7 A;  1RLQ C;  4OMM A;  2W10 A;  2O9S A;  1SRL A;  1SSH A;  2D1X A;  4JZ3 A;  2J6K A;  1T3S A;  1ZUU A;  1K1Z A;  2JM8 A;  2O88 A;  1TUC A;  1TG0 A;  2LNH B;  1X6B A;  1W1F A;  1PWT A;  2VVK A;  1SHG A;  5I22 A;  1X6G A;  2X3X D;  1M3C A;  1GBQ A;  4M4Z A;  2LMJ A;  2FRW A;  1IO6 A;  1ZX6 A;  1WDX A;  4K11 A;  1HD3 A;  4RTX A;  4J9B A;  2LCS A;  2L0A A;  1SPK A;  2J06 A;  2BZX A;  1X2Q A;  2A37 A;  3EG3 A;  2KYM A;  2F2V A;  1OOT A;  1KFZ A;  1W70 A;  2YDL A;  2ED0 A;  1NG2 A;  2KRM A;  2LX7 A;  4HVU A;  4J9H A;  1FYN A;  2EGE A;  1X69 A;  4AG1 C;  1X27 A;  1WA7 A;  3NGP A;  1NLO C;  2MIO A;  1QWE A;  1ZBJ A;  2FO0 A;  4HXJ A;  3EHQ A;  2GQI A;  2YUN A;  2CDT A;  2A28 A;  2O9V A;  2ROL A;  5FWC A;  1QWF A;  2D0N A;  1G2B A;  4HCK A;  5FW9 A;  2DJQ A;  2FPD A;  5EC7 A;  3QWX X;  1A0N B;  4F14 A;  1OPK A;  2GBQ A;  3QWY A;  2M0Y A;  4JJC A;  3LH5 A;  2X3W D;  3THK A;  4AG2 C;  1K0X A;  4OMQ A;  2EYZ A;  2ESW A;  1VYU A;  3UAT A;  1BB9 A;  1I07 A;  2EKH A;  2ENM A;  2EYY A;  4AFZ C;  1UHC A;  1W6X A;  1KIK A;  4IIO A;  1UTI A;  3RBB B;  3NMZ C;  2VKN A;  1JXM A;  2MOX A;  1AZG B;  3VRY A;  4GBQ A;  2L3Q A;  2AKL A;  4DEY A;  3PVL A;  2DF6 A;  2CUB A;  3JV3 A;  1CKA A;  1NLP C;  4OML A;  5IHN A;  4E6R A;  1E6G A;  2DBM A;  1PNJ A;  2NUZ A;  1UE9 A;  1HSQ A;  1YN8 A;  2RQR A;  3EHR A;  4ESR A;  2V1R A;  2DL5 A;  2DIL A;  2J7I A;  1E6H A;  1G83 A;  4LN2 A;  3EG0 A;  1B07 A;  1ARK A;  3EGU A;  4OMN A;  4RTT A;  3I5S A;  2GGR A;  2HBW A;  1E7O A;  1JO8 A;  3H0I A;  3REB B;  2HCK A;  2RQV A;  3VS3 A;  2YT6 A;  4J9F A;  1JU5 C;  1UGV A;  1QKX A;  2EVR A;  1WI7 A;  4QT7 A;  2OAW A;  3TVT A;  4LUD A;  2EPD A;  3VS6 A;  4EIK A;  2BZY A;  3NPF A;  2K3B A;  2FPE A;  2K2M A;  1AOJ A;  1H8K A;  1AWX A;  3VS1 A;  5L23 A;  3VS0 A;  2E5K A;  1JQQ A;  2DRK A;  4GLM A;  2DL3 A;  2YUO A;  2D8H A;  2BZ8 A;  2O2O A;  2C0T A;  3I9Q A;  3TSZ A;  2C0I A;  4R0K A;  3ZL7 C;  5IXB A;  3A98 A;  3H0H A;  2BTT A;  4CC4 B;  4J9C A;  2K7A A;  4RTZ A;  1YCS B;  1NEG A;  1QCF A;  3FJ5 A;  1ZUK A;  1Z9Q A;  2FPF A;  1WIE A;  2DX1 A;  2K79 A;  2NWM A;  1ZLM A;  3M0R A;  4Y92 A;  3CQT A;  1VYV A;  4JJD A;  5IH2 A;  3UF4 A;  1WFW A;  1YNZ A;  4Z8A A;  1N5Z A;  1UEC A;  4J9D A;  1X2K A;  2RN8 A;  1GFC A;  1UJY A;  1UDL A;  2CT3 A;  4KRT A;  3TSW A;  2KYB A;  2DLP A;  1XOV A;  2OI3 A;  2KEA A;  2ROT A;  2YSQ A;  1AEY A;  3EG2 A;  3R6N A;  4Z88 A;  1Y57 A;  2FEI A;  1I1J A;  1JEG A;  1K4U S;  1U5S A;  1M3B A;  2CT4 A;  2KT1 A;  2SRC A;  1H92 A;  1YWP A;  4ORZ A;  1GL5 A;  2DBK A;  2QDL A;  3I35 A;  2DA9 A;  4DEX A;  1UG1 A;  3U23 A;  2OJ2 A;  2JMC A;  3SHW A;  2KRN A;  1V1C A;  1QKW A;  1WXT A;  1M30 A;  5GJV B;  2LP5 A;  4AFQ C;  4LNP A;  1T0J A;  1LCK A;  1AWJ A;  2KRO A;  4WCI A;  1WX6 A;  3M0U A;  2LQN A;  2ECZ A;  2DL7 A;  1GCQ C;  1WXU A;  2JS2 A;  1FMK A;  3UA7 A;  1PKT A;  4LUE A;  1Z9Z A;  2G6F X;  2KBT A;  2D8J A;  2KXD A;  3VS7 A;  1K9A A;  2RNA A;  2W0Z A;  2KR3 A;  2HDA A;  4A63 B;  1AD5 A;  1OEB A;  1VYT A;  5I11 A;  4RUG A;  3M0Q A;  2AKK A;  3O5Z A;  1PKS A;  3RNJ A;  2RQU A;  1MV3 A;  1HJD A;  4OMO A;  2ED1 A;  4D8K A;  4J9G A;  1U3O A;  1UJ0 A;  2L3P A;  1ABQ A;  1M27 C;  2DVJ A;  2DYB A;  1J3T A;  2DNU A;  1WYX A;  2GTJ A;  4RTW A;  2LJ0 A;  2PNI A;  4JZ4 A;  1SRM A;  2J6F A;  2RPN A;  2GNC A;  3C0C A;  1MUZ A;  1ABO A;  2EBP A;  1AZE A;  2I0N A;  2EYX A;  4RTU A;  2RQT A;  2JW4 A;  2H8H A;  2DMO A;  1M3A A;  4CC3 A;  5ECA A;  2J6O A;  4HVW A;  2EQI A;  1GRI A;  4J9E A;  3PVQ A;  1YP5 A;  1VA7 A;  2F2W A;  1B3Q A;  2KT8 A;  2DL8 A;  1NM7 A;  1NYG A;  2RMO A;  1T3L A;  4HVV A;  1MV0 B;  1UFF A;  1WXB A;  2GTO A;  3GBQ A;  1OPL A;  2HEQ A;  4IIM A;  2DL4 A;  2CH4 A;  3UA6 A;  1AWO A;  3NHN A;  5HCK A;  2EGC A;  2J05 A;  2SEM A;  1YWO A;  1I0C A;  3EG1 A;  2FG0 A;  5IHI A;  3ULR B;  1TUD A;  1ZUY A;  2JTE A;  5IHK A;  2K6D A;  3REA B;  4AFS C;  2FRY A;  3M0S A;  2IIM A;  2RF0 A;  1CSK A;  3VS4 A;  2YUP A;  5FWB A;  5IXF A;  1GCP A;  1T0H A;  2DRM A;  4LE9 A;  3I5R A;  3KFV A;  1RLP C;  4FSS A;  1OV3 A;  2JXB A;  2VWF A;  1RUW A;  3IQL A;  1PRM C;  4AFU C;  2C0O A;  2JT4 A;  2EGA A;  2KGT A;  2CSQ A;  2EYW A;  1SHF A;  2LZ6 B;  1EFN A;  1K0S A;  3H41 A;  2P4R A;  2XMF A;  2A08 A;  1QLY A;  2PZ1 A;  1Y0M A;  1JXO A;  2L3S A;  2KNB B;  2KE9 A;  3VS5 A;  3VS2 A;  1CKB A;  1ZSG A;  2HSP A;  2A36 A;  1KSW A;  4J9I A;  1KJW A;  1WLP B;  1BBZ A;  2O31 A;  1BK2 A;  4JPB W;  2PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...