2KBTA

Attachment of an nmr-invisible solubility enhancement tag (inset) using a sortase-mediated protein ligation method
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
GPGTFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDYSEYLPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords chimera of Proto-oncogene vav, linker, Immunoglobulin G-bind
publication title Attachment of an NMR-invisible solubility enhancement tag using a sortase-mediated protein ligation method
pubmed doi rcsb
source organism Mus musculus, synthetic, streptococcus sp. 'group g'
molecule tags Signaling protein
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kbtA00
2GTOA 2J6OA 1Y57A 1K76A 4J9IA 2DBKA 1OPKA 1NLOC 4AFZC 2KYBA 1PNJA 2M0YA 4QT7A 1WX6A 2EYXA 3LH5A 2O31A 3QWYA 3EG1A 1X69A 1MV3A 1AD5A 2P4RA 2JM9A 1OPLA 2MIOA 2CREA 1HD3A 4AFUC 4CC3A 2HSPA 4LN2A 4AFSC 3M0QA 4OMQA 1N5ZA 3U23A 1K1ZA 2M51A 3RNJA 2AKKA 1EFNA 1WI7A 2DNUA 1GBRA 1PRLC 1SSHA 2D8HA 1BK2A 1SRLA 2DL8A 1X6GA 3M0PA 2GQIA 1BB9A 2FPEA 2RQWA 3VS1A 1ZBJA 2K2MA 5FWBA 5GJWB 3JV3A 2JS2A 1WXBA 4CC4B 1Y0MA 2L3QA 1JQQA 2CH4W 2CT4A 2DILA 2J6KA 2KBTA 2KT1A 1CKAA 2KXCA 2SRCA 3VS0A 3EG2A 2F2WA 3I35A 1M30A 2LJ0A 4DEXA 2VVKA 1W1FA 1YCSB 3H0FA 4RTUA 4ORZA 1GCPA 2X3WD 2LJ1A 4DEYA 1SPKA 3VS7A 2BZ8A 5IXFA 4JZ4A 2KXDA 1ZUYA 2JS0A 1U5SA 3IQLA 4HVWA 2ECZA 1ZLMA 2ROTA 4HVUA 4F16A 2CH4A 2K79A 2BTTA 4EIKA 1UJYA 2YSQA 1OOTA 3C0CA 4OMMA 3THKA 1YP5A 3PE0A 3I5SA 2LQWA 2KR3A 1K4US 2RPNA 1WXTA 2CSIA 2EYYA 2GBQA 2YUQA 4F14A 5I22A 5IXBA 1QLYA 2L3PA 2YDLA 1I0CA 2PTKA 2VWFA 2FO0A 4J9GA 1G83A 2DM1A 2MOXA 2V1RA 3REBB 1CKBA 1AZEA 1PRMC 1UHCA 3QWXX 2EYZA 5IHKA 3EHQA 2DE0X 1VYTA 2KYMA 2RQTA 2X3XD 2DX1A 2I0NA 2OI3A 1M3CA 1UE9A 1K9AA 2EKHA 2HDAA 3R6NA 2G6FX 2K7AA 3TVTA 5GJVB 1S1NA 1YWPA 1RUWA 4OMLA 4RTYA 4WCIA 4J9HA 2C0IA 2FRWA 2GTJA 2JMCA 2DF6A 2A37A 1WFWA 3M0UA 2GGRA 4KRTA 1QKWA 2NUZA 2JTEA 1E6GA 1NYFA 1Z9ZA 2J6FA 1I1JA 1OEBA 1NYGA 1UJ0A 2AZSA 2EBPA 5I11A 4IIOA 1G2BA 1GCQC 2O2OA 1VYVA 3EG3A 2KRSA 3VS3A 4A63B 4E6RA 1GRIA 1UGVA 2GNCA 2AKLA 1PWTA 2DRKA 4RTXA 3O5ZA 1GCQA 3VS5A 4FSSA 2W0ZA 1K0XA 3VS6A 1X6BA 2AK5A 2RQUA 4D8DA 3H0IA 2FPDA 2RQVA 3H0HA 1I07A 1SRMA 4HCKA 1BU1A 2ED0A 2C0OA 1LCKA 3VS2A 1X2KA 3ZL7C 2FRYA 1NLPC 1A0NB 1JO8A 2DMOA 4IIMA 2CUDA 2RMOA 1WLPB 4X1VA 5FW9A 3I5RA 1XOVA 1B3QA 1NM7A 4J9CA 4Y92A 4OMNA 1NEBA 1TUCA 2L2PA 3TSWA 1FMKA 3TSZA 1YWOA 2L3SA 3PVLA 1U3OA 1M27C 1GL5A 2H8HA 1FYNA 1M3AA 2DA9A 3UA6A 1T0JA 2EW3A 3I9QA 1GFDA 2O9SA 2DBMA 4RTZA 2B86A 2K3BA 2AZVA 1AWOA 1OV3A 1QWFA 3NGPA 4JJCA 2KEAA 2EGCA 5IHIA 1ZUUA 4HVVA 4J9DA 1PKSA 3EHRA 2KRMA 2V1QA 2F2XA 2EGEA 1TG0A 4OMOA 2A28A 1NG2A 2DLPA 5HCKA 2LX7A 1IO6A 2LNHB 3H41A 1MV0B 2D1XA 2ROLA 2RNAA 2KGTA 4JZ3A 2ED1A 2KROA 2LCSA 1PKTA 4LNPA 2DVJA 2CUBA 1E7OA 2F2VA 4RUGA 3REAB 2LQNA 1ABQA 1AWJA 2DYBA 2ENMA 2JW4A 1GFCA 2LMJA 3EGUA 2SEMA 4HXJA 1CSKA 1RLQC 4J9BA 2E5KA 3UA7A 1GBQA 1M3BA 4AFQC 2J06A 3M0SA 2YUNA 2ESWA 2DL5A 2EQIA 4Z88A 2A36A 5IHNA 1KFZA 2PNIA 2A08A 1B07A 2EVRA 2EGAA 1M8MA 1E6HA 2DRMA 2LP5A 1U06A 4ZNXA 1RI9A 2JT4A 3NPFA 1PHTA 1JU5C 2CDTA 2D8JA 1YN8A 1T3SA 1K0SA 5IH2A 1SEMA 1VYUA 1QCFA 1UFFA 1QWEA 2FG0A 1WXUA 1T3LA 5L23A 1UG1A 2YT6A 2RN8A 1X27A 1ABOA 1X43A 1ZX6A 3NHNA 1MUZA 1WA7A 1V1CA 4RTWA 3VRZA 1T0HA 2FEIA 1HSQA 1JXOA 2QDLA 1TUDA 1UECA 1X2QA 4LUDA 4OMPA 2KRNA 1AEYA 4LE9A 1YNZA 1BBZA 4D8KA 1HJDA 1JEGA 2O9VA 4AG1C 2L0AA 2EYWA 1JXMA 1WYXA 3VRYA 1KSWA 1W70A 2W10A 4M4ZA 2KE9A 1AZGB 2DJQA 2DL7A 1ARKA 4JPBW 2LJ3A 1VA7A 1KJWA 3GBQA 2DL3A 2OAWA 4J9FA 3UATA 4CC7A 2XMFA 2YUOA 4RTTA 1H3HA 2KNBB 3UF4A 1KIKA 2BZYA 3VS4A 2HBWA 5EC7A 4Z89A 2NWMA 2BZXA 2MCNA 1H92A 4J9EA 4ESRA 4LUEA 2J05A 2DL4A 1Z9QA 2VKNA 5ECAA 3CQTA 1H8KA 2ABLA 4GLMA 3RBBB 1AWXA 4K11A 2LZ6B 2RF0A 2JMAA 3M0RA 1SHFA 4CC2A 4GBQA 3FJ5A 1W6XA 4JJDA 2O88A 3EG0A 1RLPC 2D0NA 3KFVA 3M0TA 4Z8AA 2K6DA 2CT3A 1UDLA 1WDXA 1UUEA 2OJ2A 4R0KA 2IIMA 2C0TA 2EPDA 2FPFA 2JXBA 1J3TA 4JJBA 1AVZC 4F17A 1AWWA 4AG2C 2JM8A 2J7IA 1ZUKA 2KT8A 1UHFA 2YUPA 5FWCA 3SEMA 2PZ1A 1SHGA 3NMZC 4RTVA 1ZSGA 2HCKA 2CSQA 2RQRA 3PVQA 1AOJA 3SHWA 2HEQA 1UTIA 3A98A 1QKXA 1NEGA 1WIEA 3ULRB 2K9GA
chains in the Genus database with same CATH superfamily
2GTOA 3G1JA 1K76A 4M7DA 4GY5A 5FU7C 1Q7YU 1NLOC 1M2VB 2WSFE 3HP9A 2KMTA 3H8ZA 4OP0A 2O31A 3EG1A 1U8RA 4FCYA 1AD5A 2CREA 1HD3A 2RK2A 2WSEE 4LN2A 1N5ZA 1HK9A 3U23A 1K1ZA 5CKDA 2AKKA 3FJPA 4BB7A 1GBRA 5GANd 3HHTB 1HXDA 2GQIA 3SFMA 1Q7YC 3PNWC 4PJOF 1BB9A 2FPEA 2RQWA 1VQ5T 5FWBA 4C8QG 2RB6A 2DIGA 1W2BS 5FRNA 1TTHB 3VUBA 3C95A 1ZA2B 3AT1B 5GAOn 1JQQA 5I2MA 2KXCA 3VS0A 4N0AA 4J7IA 3I35A 1Q86R 3M5AA 1W1FA 1K73U 3ZBDA 1N8RR 3C12A 3NFCA 2RHUA 2DPPB 2LJ1A 1X75C 4LXCA 2BZ8A 3GIBA 1DJ7B 5KYWA 2HAXA 4PLLA 3JCMc 2JS0A 1G3YA 4M78C 3JCMd 2ECZA 2CYZB 4HVUA 2CP2A 3A8MB 2K79A 2BTTA 4PFPA 4ZGEB 3BDUA 3LYIA 5L8RE 4OMMA 3THKA 1PD0A 2VV5A 4KGVB 3I5SA 2EJFA 2KAFA 1N9RA 4ME7A 2RPNA 2GFAA 1WXTA 2AT1B 2YUQA 5DLQE 2DK3A 3O8VA 2DTIA 1G83A 5LJ3e 2GFUA 2V1RA 3REBB 1PRMC 2EYQA 1KHCA 4P5NA 2DE0X 1VYTA 2KYMA 4M77D 2X3XD 2X4WA 1UB4A 3RMSA 3PMTA 2NUPA 2KY9A 1VQKT 3A8HB 2G6FX 1HYOA 2K7AA 1BI1A 4BE1A 2CZ6B 2F69A 2ZPBB 4M7DG 2X51A 4ELZC 4WCIA 2VXFA 1QVFA 3E2UA 2KSSA 1WZOA 1VQ8T 2A37A 1WFWA 1RAHB 3M0UA 2LC4A 3OYLA 2CKKA 4C5GA 1D3BB 1NYFA 1Q81U 3QYGB 1YJNT 3DB3A 2VGMA 2E70A 5I11A 3EG9A 1G2BA 1GCQC 3EG3A 3CCMT 1K9MR 4E6RA 5HK3A 1KQSA 2GNCA 3V7CA 2DRKA 2MWOA 2OTLT 3VS5A 4EMKB 4C8QF 3CXCS 1K0XA 4YTLA 3VS6A 4BI3A 3L2UA 3DLMA 4UC4A 2RQVA 1TUGB 3PMIA 2QDYB 2ED0A 4V2SA 1LCKA 4XU0A 3ZL7C 2E6NA 2FRYA 1KK7A 2E12A 1ZBXA 1JO8A 4KGZB 4BE0A 1RAIB 4OB2B 1VIFA 4EDUA 1OQKA 1XOVA 1B3QA 1NM7A 2HSEB 2G3RA 2YLBA 4Y92A 2RHIA 4A4EA 2P4TA 1NEBA 4MZTA 3CD6Q 1SKUB 3FEOA 1M27C 3SWNB 2XI9A 3D7SB 1T0JA 3I9QA 2LCCA 1WPYA 3OMGA 1GFDA 2O9SA 2QAZA 1RADB 5GAN8 4RTZA 2B86A 3I56Q 2IPOB 3JCMX 1QWFA 2EQUA 3NGPA 2DO3A 4ZGDB 4DBRA 5FRMA 4B9XA 2PU9B 5J3BA 1EX4A 1S72Q 5D7UA 1YJ9Q 2EGEA 2WSCE 1TG0A 2DEQA 3PIOA 2A28A 4X34A 4C92E 1NG2A 2DLPA 4FM4B 1IO6A 4C92B 2ROLA 2JUFA 2NUTB 2ED1A 4M7AG 2LCSA 1EIFA 3CMEQ 1U1TA 1R8OB 3HFOA 4XU1A 3CCRQ 3L1AA 3TEEA 4OVAA 3CD6A 2LT4A 3REAB 1ABQA 2FZKB 1AWJA 3OYBA 2ENMA 1VQMA 1D09B 4HXJA 2NLUA 3UA7A 4AFQC 2RO0A 2R58A 4MMKA 4HA8A 2R5MA 4PKCC 2ZAEA 2YUNA 5CKBA 4KT0E 4ZN1A 1V76A 4XU3A 3CMAA 4EMKC 3JCMQ 1E6HA 2EFIA 4BY6C 1YJ9A 1PSFA 1NJIU 3L2WA 3LX7A 3I55T 1PHTA 5LJ3f 1OX9A 2CDTA 3CMEA 1QVGS 4RCCA 1B34B 3A8GB 2P0QA 1QCFA 3BE3A 3CCRA 3NTKA 1QWEA 5KYUA 2LTOA 2QASA 4KH1B 1X27A 2RJFA 4PJOA 1ABOA 1Y07A 3NHNA 1ZSZB 2QGFB 1V1CA 3G4SQ 5GANj 1NJIC 2DD4A 3SWNC 4E7ZA 3CC7Q 1HSQA 2QDLA 2R5AA 3ZFJA 2JTMA 4BE2A 1IHVA 1AHJB 2VB6A 2RHXA 3M57A 2DJQA 2Y90A 4JPBW 2LJ3A 4N0AC 3JRZA 4MMLA 3CC4T 1BKBA 1KJWA 3JSCA 3GBQA 4C0DB 3A8LB 4WTOB 3GPLA 2X4XA 4M77E 2OAWA 4JRKA 1VQLQ 3G71A 2D6FA 1OU9A 2DYIA 2YUOA 4M77B 4RTTA 1H3HA 3UF4A 4C92C 3OYKA 2HBWA 3RMQA 2QEXA 3META 2BZXA 5J39A 3EFOB 4IUPA 3RR6A 5GANh 5GANg 4C8QD 2DL4A 1WHJA 1H8KA 3CBPA 1D0ZA 3G4SA 3GNFB 4DQ2A 3RBBB 3QPHA 4K11A 2O4XA 2LZ6B 3EGXA 2JMAA 1WHGA 2L5QA 1SHFA 4F04B 5GAOl 2QI2A 1BCOA 2FZCB 1PD1A 3HRSA 1VQ4T 1VIEA 1W6XA 5KYYB 1RLPC 2DXBA 4JJNK 2QTVA 2LCLA 3KFVA 2CT3A 2GQVA 4N4HA 1MHNA 1WDXA 1QVFP 2OJ2A 4R0KA 4XK8E 2EPDA 1VQ6T 2COYA 2FPFA 1J3TA 1VQLA 1AVZC 4IURA 4F17A 3PTAA 5DY9A 4AG2C 1ZUKA 3CCJT 3G6ET 4M7AF 3JCMg 2YUPA 1I5OB 1LOJA 5GAN4 3BY7A 1SHGA 2JJ9A 5GMKj 2KK4A 1AOJA 3A98A 1QKXA 3ME9A 3E1SA 4RMOA 1VQOA 1KC8U 2JN0A 3QBYA 2K9GA 3RUXA 3TREA 2J6OA 1ZSZC 2GF7A 1WHHA 1YHQA 2DBKA 4C8QA 2CP0A 2XDPA 4PJOG 3QWYA 4B9WA 4LDVA 1MV3A 3EFSA 3CCSQ 1OPLA 2MIOA 3QG1A 3MKDA 4CC3A 4AFSC 2YHTA 3H9NA 4F7UE 2XDDA 1KD1R 4FYYB 4C0DC 1LNXA 3RNJA 1EFNA 2DNUA 3CCUQ 5GMKh 4F7UB 1PRLC 3FDRA 1SSHA 2D8HA 2DL8A 2F5KA 3M0PA 1FXXA 3KBGA 2JOYA 4QVZA 1TWBA 5HY6A 4DOWA 2E41A 1YI2T 4E7IA 5GJWB 3JV3A 1QQJA 1WXBA 4GLKA 4A4KA 3RKYA 3EFRA 4JRPA 2J6KA 3ASKA 2KT1A 3L2RA 2VVKA 3OYEA 1YCSB 1M90U 3H0FA 1I8FA 2HQEA 2X3WD 1YIJT 1U1SA 2FVUA 4M7DD 4JZ4A 4J83A 3E19A 3CCSA 1UGQB 2AHJB 1U5SA 3INZA 3IQLA 3OSSC 4HVWA 3OW2S 2FB7A 1M1KU 3HTRA 4FYXB 4F16A 2HQXA 2NYSA 2XICA 1BI0A 3CCVT 3CCUA 2YSQA 3ER0A 2BUDA 3S6WA 4M78E 2LQWA 5GAMf 1M90C 4M78B 2O01E 4F14A 4OB0B 1UGRB 2L3PA 1G3SA 2E64A 2CP5A 2PTKA 2FO0A 2M02A 1AZEA 1UHCA 4RKUE 1M1FA 2JVVA 3EHQA 2ZPIB 2RH2A 1NE8A 1ZQ1A 2XDBA 4KUIA 1Q7YR 2QA4T 2FYKA 5IT9E 4O6JA 4AT1B 1O75A 5LJ5e 1MMNA 2EKHA 5I21A 2HDAA 3R6NA 2ZPHB 5GJVB 3CC2T 4NL3A 1SF9A 3M55A 4OMLA 4Y91A 1XJWB 4J9HA 2FRWA 1UGSB 2JMCA 2DF6A 4PNOA 2GGRA 1I5LA 4M75A 1JB0E 1LVKA 1QKWA 2NUZA 1JJ2P 1E6GA 1Z9ZA 4E7JA 1RABB 4L59A 1N6AA 2MMPA 1AT1B 4A53A 4PK4A 4WF2A 4ELYC 2EBPA 1C0MA 4IIOA 4ZN3A 2QYZA 1VQ5A 4PJNA 4RTXA 4FSSA 1X6BA 2AK5A 3CPWP 3EGDA 1VQ7T 2FPDA 1I07A 1KHIA 4HCZA 2DXUA 1K73R 1MMDA 4KGXB 4IKFA 5DM7R 3MEVA 1BU1A 4DBHA 2C0OA 2XIDA 1M9SA 4J8OA 3CCLT 2LX9A 3X26B 4M7AD 4J5YA 3HKSA 4IIMA 1VQKQ 4OB3B 3N5BB 5GAMh 1VQ9T 2CZ7B 1OX8A 4HT8A 4X1VA 5FW9A 4C5HA 3OS0A 5LJ3d 2XK0A 1VQ8Q 3JCMb 4KH0B 4JS4A 3KXTA 3A1PA 3TSZA 1YWOA 3PVLA 3NTIA 2H8HA 4NOYA 3UA6A 2RHYA 1VQNT 2IG0A 5CKEA 1TS9A 1WJSA 2E5QA 2B8AA 2K3BA 3CCMQ 1OV3A 1QVFS 4J9DA 1MMAA 2V1QA 1N27A 2F2XA 4OMOA 2CGHA 1WHKA 2ZPGB 1K8AU 5HCKA 4NL2A 2LX7A 1KQSS 3M58A 4XQ3A 1VQKA 2KGTA 4EMGA 3C94A 4X9CA 5KYXB 1M4ZA 2DVJA 4M7AA 1VQ8A 1O9SA 1E7OA 4RUGA 1RAFB 4Y28E 5GAOm 1Q81R 5C0MA 3EGUA 3HFNA 3PFSA 1K8AC 1CSKA 1RLQC 2E5KA 4QKUA 1MNEA 3CCMA 1I4K1 4M75G 2ESWA 2DL5A 2BE7D 1OZ2A 5IHNA 1FX7A 2PNIA 3OSVA 1KFZA 1Q86C 5GMKl 2OTLA 2VUBA 1KQ2A 1N8RC 4IUVA 2DETA 2LP5A 3JCMe 3WVEB 1ZA1B 2JNGA 2MF2A 4ZNXA 4C8QC 2EQMA 2VGNA 1K0SA 5FLXE 4M7DE 4BY6B 3PGGA 3GLXA 5LJ5f 1UG1A 1XQHA 4M7DB 2RN8A 1X01A 2RHZA 5A0GA 4PJLA 1MUZA 5GAN2 2FEIA 5CQXA 1JXOA 1TU0B 3F70A 3L2QA 4O5VA 3MP1A 2DAQA 4LUDA 1BBZA 3QDFA 1VOMA 4Z02A 1JXMA 1NPPA 1QP3A 1KSWA 1ARKA 3FB9A 1VQMQ 1VA7A 3A8OB 2QGGA 2DL3A 2VYTA 3QIIA 3CBOA 9ATCB 4CC7A 6AT1B 3OS2A 1XTDA 1KIKA 2DFUA 4PJJA 1VQPQ 2CS7A 4Z89A 2QXFA 2NWMA 2MCNA 3CMAQ 1KQ1A 4C0FA 4LUEA 4J7FA 2BE9B 5GAOp 3RDVA 1K9MC 1Y96A 4L5GA 1R0BG 4EPCA 1RI0A 1AWXA 3VUZA 5KYWB 4PJOD 3CBMA 3BFMA 3VU3C 3E9GA 2XHCA 2A3LA 3M0RA 4CC2A 3RIRA 1Q95G 4JJDA 1JJ2S 1WQWA 3RKWA 2K6DA 1NJIR 4A4GA 4QVDA 2IIMA 2C0TA 1R0CB 3CCEQ 4JJBA 3X25B 2QQRA 3SD4A 1AWWA 3T9NA 2J7IA 1H641 2QQ9A 4JLGA 2HKNA 4C0ZA 5FWCA 4ANJA 1VQPA 3SEMA 1M1GA 3NMZC 1ZSGA 2HCKA 5FROA 3PVQA 2RQRA 4OMFB 2HEQA 2NUPB 4M7DC 3H6ZA 5GAMd 3JB9G 5C6SA 2X4YA 3G71Q 3ZEHA 4KBMB 3C4SA 4RG2A 3CD6T 4M75F 5HKCA 1OPKA 4AFZC 2QEXQ 1PNJA 4QT7A 1WX6A 5D6YA 2CZ0B 2EYXA 3LH5A 4OF1A 3JAME 1JJ2A 2QG9B 3I56T 3E9FA 2JM9A 2DERA 4EMHA 4AFUC 2HSPA 3M0QA 3QHSA 4OMQA 3QZ9B 3CCEA 3EG9B 3CC4A 1P92A 1S72T 3OYHA 4D6WA 1YJ9T 1BK2A 1SRLA 1X6GA 5AT1B 3CPWA 1NPRA 2EWNA 2JS2A 3CMET 5LJ3j 3SDZA 4CC4B 3OYCA 3HPWA 3CCRT 4HKEA 2CH4W 1OZ3A 3EG2A 5I2SA 2F2WA 1SSFA 4DEXA 2CZ1B 2JZ2A 3VYGA 4RTUA 1GCPA 2E3IA 4DEYA 3V8LA 3V7RA 5IN1A 3BW1A 5IXFA 1VQ4A 1ZUYA 2HMAA 5GAOq 3FLGA 4PFZA 1VQOQ 1ZLMA 4QW2A 2K3XA 2DJZA 2CH4A 3FC3A 1C1AA 4EIKA 1VQ6A 4CRIA 2MPXC 1YHQQ 1UJYA 4M78A 1FMVA 3OYAA 3MPUB 3C0CA 2FL7A 4C92F 1YP5A 5LJ3h 5GMKi 1W2BP 1BCMA 2XKOC 5LJ3g 1K4US 2CSIA 3LWHA 2GBQA 4TVRA 3WVDB 3OYMA 4M7AC 2DIQA 3VKIA 2VWFA 4FW2A 4J9GA 1KC8R 2DM1A 3PIPA 4ZGJB 5IHKA 1WHMA 1WHLA 2RQTA 2DX1A 3LW5E 4LDWA 4QQ6A 1IREB 2QK0A 2KVQG 2C06A 1YITQ 2ZPEB 1RAEB 3TVTA 3CC7T 1Q82U 2OAUA 3PT9A 4XTWA 2DTHA 1YWPA 5KCHA 2LRQA 2BKDN 1M2VA 2C0IA 4X9DA 2EAYA 2VXEA 2PUOB 4KRTA 2QTXA 2WACA 1PCXA 4JS5A 3HRTA 2JTEA 1OEBA 2CP7A 1NYGA 5GMKm 1VQLT 5CK9A 4A63B 1VYVA 1Y71A 2KRSA 3URGA 1YI2A 1W4SA 3GOXA 1Q82C 1TH7A 2AKLA 2JTFA 3JB9F 3A5ZB 1GCQA 1YJWT 2K5LA 4L6V5 4D8DA 3H0IA 2YWWA 2OTJQ 3G7ZA 1XNIA 1M90R 4IUUA 3CCQT 1QW1A 3M56A 1PC0A 1YITA 4PJOE 1NLPC 5KYUB 2OX7A 2KQWA 1MGQA 5CCAA 3QJ6A 1YIJA 2DMOA 2GCXA 2P0PA 2RMOA 4PJOB 1M1KR 1RL2A 4J9CA 1X6OA 4OMNA 4LDYA 2KI7A 4IUTA 4ZTJA 3TSWA 2PVOB 1FMKA 3CCVA 1U3OA 1M3AA 2DA9A 4M77F 1F1BB 2EW3A 4M75D 2DBMA 4KULA 5LJ5d 1WJQA 2K4YA 2E1HA 3CXCP 3TQ7P 3OA6A 2AZVA 1AWOA 2IVWA 4M78G 5DLOA 4JJCA 2DD5A 3S3NA 2EGCA 2L8DA 4HVVA 2OTJA 1PKSA 3EHRA 3MEAA 1D0XA 3MHXA 2R57A 3H41A 1VQ5Q 2RNAA 3CC2A 3GP8A 1PKTA 2RD1A 2EKOA 3BDLA 1VQ9Q 4BD3A 1I81A 4JUVA 3QYHB 1B7TA 2CUBA 2O4XB 3EGXB 3LGLA 3M59A 2DYBA 2LDMA 4A4HA 1WNLA 3S3MA 3JB9H 2RK1A 4J9BA 2COZA 3MP6A 5A2QE 3V8JA 1VQNQ 2J06A 3M0SA 1D3BA 3QSUA 2RM4A 4Z88A 2CP6A 2HL3A 2HQHA 1B07A 4E7SA 1D1AA 5GAMj 4HCCA 3X28B 1VQ7A 2V8JA 4EMKA 2VC8A 2X35A 3CCLA 3DKMA 3NTHA 1JU5C 2D8JA 4C5IA 1T3SA 5IH2A 1SEMA 3J80E 4PJOC 3QO3A 1UFFA 1VQ9A 4C8QE 3VV0A 5L23A 1KG1A 2YT6A 2YXYA 5FU6C 4C8QB 3CPFA 3J7AF 4HT9A 3QKJA 5CVIA 3MJXA 3UPUA 1WA7A 1UEBA 3FIFA 4F7UF 1YFNA 3WXMB 1G3WA 1T0HA 1IZ6A 1VQNA 3KUFA 1UECA 5GAMg 3JCMP 3OS5A 3SWNA 4FIBA 4BI4A 1AEYA 1YNZA 4D8KA 3UDCA 1JEGA 2RJEA 3DB4A 2EYWA 1PM3A 4HCBA 2W10A 4M4ZA 1AZGB 2DL7A 3UWNA 2E6ZA 1K8AR 2RI3A 1YJNQ 2COWA 3P8DA 2H3EB 1QVGP 4XTUA 1R77A 4J9FA 2PQWA 4XTZA 4A4FA 3LH0A 2PVGB 5EC7A 1WJRA 2OTLQ 4XAXB 1JRIA 4J9EA 4ESRA 4PJMA 2X4JA 4N4GA 4C92A 2J05A 3JB9D 5KCOA 2NUTA 1OYXA 1Z9QA 5ECAA 4GLMA 3V8KA 2DEUA 4XTYA 5GANe 4M78F 5CKFA 3EH2A 1Q86U 2RF0A 1IGUA 1N8RU 1WQ7A 2LT1A 2H3JA 1K73C 4FYWB 3FJ5A 4LD6A 3EG0A 4FL6A 5AYFA 3M54A 2I2LA 1W2BA 4KUDK 1NZ9A 1YJNA 3OQ5A 4E7LA 4OGEA 4BUGA 5D6XA 1TOVA 2K57A 1D0YA 3CEYA 2YRDA 1UHFA 4FT2A 2D0QB 1D1BA 4J6YA 3HL8A 4OGCA 5HK0A 1BI2A 2CSQA 2K2VA 1NBEB 3SHWA 4B6MA 4XU2A 4DBQA 3M53A 1NEGA 5KH6A 1B34A 1WIEA 5KE3A 3VYHB 3VJPA 4C0GA 1Y57A 4J9IA 2V26A 2KYBA 2L89A 2M0YA 4M75E 5CKHA 1ZSZA 2E10A 4VUBA 4M75B 1OULA 5CO7A 5GAN5 1BI3A 1X69A 2P4RA 1M8VA 4R56A 1FMWA 3DLLA 2K5FA 3RESA 3QZ5B 5GAN7 1EZZB 1IB8A 3L2ZA 2M51A 4DA4A 1WI7A 2RJDA 2P84A 3OBYA 5GAN6 2Z0WA 3EGDB 3VS1A 1ZBJA 2K2MA 3RERA 1Q81C 4LD9K 2MK5A 1K9MU 4FT4A 2MAMA 4JRQA 4M77A 5GMKe 3MEUA 2MWPA 1Y0MA 1BYMA 2CT4A 2DILA 2KBTA 2L3QA 3R6OA 1CKAA 2SRCA 3EFOA 3I55Q 5LJ5j 1G3TA 1M30A 2LJ0A 4C92G 1WGSA 4AMCA 3OYYA 4ORZA 2VASA 2PUKB 1SPKA 3VS7A 1LJOA 2KXDA 2V8IA 4DOVA 4IUQA 3M4YA 4JRIA 5GAOr 4CI0C 3J81E 5IAYA 2ROTA 3QDRB 3CXCA 5M9OA 2K3YA 5KYYA 4A54A 1OOTA 3OS1A 4N4IA 2LQKA 1ZHIA 3PE0A 2KR3A 2EYYA 2RA2A 2QQBA 3OYDA 2HZYA 2DKGA 5I22A 5IXBA 1QLYA 5LJ5h 2YDLA 1I0CA 3OMCA 4PL6A 3CC4Q 4ZTFA 5LJ5g 2MOXA 8ATCB 2M1HA 1CKBA 2EJGA 2ZZDA 3QWXX 2EYZA 3HRUA 3I55A 2QQAA 1JBMA 2OI3A 2I0NA 1M3CA 3CPWS 4M7AE 1UE9A 1K9AA 5LL6S 1LPLA 3L42A 4M7AB 3OW2P 3HSBA 1S1NA 1TSFA 3EAEA 1RUWA 4M75C 4RTYA 3I56A 3M4GA 5GANf 2XG8D 1N9SA 2GTJA 4C5EA 1VUBA 1BIBA 1VQMT 3OBWA 3M9QA 1S72A 2J6FA 3LGFA 1I1JA 2YRVA 2RI2A 4PLIA 1UJ0A 2AZSA 1YCYA 4M78D 2O2OA 4QQGA 3VS3A 1VQ4Q 4PFOA 3OYFA 1GRIA 2YRCA 3SB2A 1UGVA 3UT1A 4F7UA 1VQPT 5CIUA 1PWTA 4M7DF 4J6WA 2P0KA 3O5ZA 3L2VA 3CMAT 2W0ZA 2RQUA 1VQ6Q 3H0HA 2RJCA 2M0OA 3JCMW 3CCJQ 1SRMA 4HCKA 3G6EQ 1OI1A 3JCMf 3GNGA 4M77G 3VS2A 1X2KA 1IXDA 1G8XA 2EJ9A 1A0NB 3OB9A 1QCOA 2CUDA 3RKXA 1M5Q1 1WLPB 2DXCA 3EH1A 3QJYA 3I5RA 4LDUA 1TUCA 2L2PA 1UGPB 2L3SA 4JDSA 3OYIA 1GL5A 2XU8A 1FYNA 5GAMe 2A7YA 3LLRA 3CCET 1H3ZA 3TCJA 4OB1B 3AHUA 2D9TA 2EQKA 1RAAB 1MNDA 3OYNA 4FYVB 4E47A 3MCAB 2KEAA 1QVGA 5D6WA 2F1LA 2EQJA 5IHIA 3JCMV 1ZUUA 2Y4YA 3X24B 3OYGA 1YJWQ 2HD0A 3JB9J 2KRMA 5CR2A 3CCJA 3G6EA 1QVPA 4FU6A 3G71T 5KE2A 2RI5A 3CCQQ 2LVMA 2LNHB 1Q82R 4R55A 1MV0B 2D1XA 1YI2Q 4JZ3A 3CC7A 2KROA 1YBYA 2QEXT 1M2OA 1Y96B 4LNPA 2DVEA 2ZGWA 2FZGB 3P8HA 5KYNA 4E2FB 2F2VA 2LQNA 1Y7XA 2E3HA 2AIRB 3G4ST 2ZCFB 2JW4A 1GFCA 2LMJA 3MP8A 4RCBA 2SEMA 4BACA 1SG5A 1YIJQ 1GBQA 1M3BA 2M9UA 4QVCA 4LDXA 3JCMh 5CAIA 2EQIA 1IGQA 2A36A 1C6VX 4NS5A 1GXIE 2A08A 2EVRA 2EGAA 1YJWA 1M8MA 3S3OA 1PSEA 2HKQB 3CCVQ 3OY9A 2DRMA 1KQSP 1U06A 2ATCB 2A0FB 1IRXA 2QQSA 4BI8B 2KDSA 4F7UG 2HBPA 1RI9A 3CCQA 2JT4A 3NPFA 4ATOA 2BIVA 4Q5WA 2LQ8A 1RACB 3JB9I 1YN8A 2E4HA 1MMGA 1IHWA 4MDWA 1VYUA 2E65A 2FG0A 1WXUA 1T3LA 4MZPA 1X43A 1VQOT 1ZX6A 2QA4Q 4XTVA 4RG8A 1V29B 4RTWA 2MYSA 5FU7B 3V7SA 3VRZA 1YHQT 4DBFA 2HNIA 3CC2Q 1KC8C 1G5VA 2L3RA 1TUDA 1X2QA 3FRNA 2XD0A 2EIFA 5FU6B 4OMPA 3X20B 2KRNA 4LE9A 1HJDA 4M77C 2O9VA 3MO8A 4AG1C 2L0AA 2DZCA 1WYXA 3VRYA 1W70A 2MI6A 2KE9A 8AT1B 4XTXA 5GAN3 4JLIA 3Q1JA 2DXTA 7AT1B 4BDYA 4MZMA 1KD1U 2PVDB 4E7HA 3UATA 1RAGB 2F5TX 4MDXA 2XMFA 4FSXA 1FWZA 2KNBB 2DZ9A 2BZYA 3VS4A 1YITT 1D1CA 4BDZA 5A0LA 1H92A 2K5IA 1VQ7Q 5A0DA 5CQYA 5J26A 1TXQA 2X9HA 2QA4A 2VKNA 3CQTA 2ABLA 5KYXA 3CCLQ 1ACMB 1PG5B 3GF5A 1KD1C 2ZPFB 1OU8A 4FW1A 1QP2A 4E7KA 4GBQA 2LNVA 1QMCA 3CCST 2O88A 3QXEB 2D0NA 4Z8AA 3M0TA 3LWIA 1UDLA 4II1A 2V8KA 1UUEA 3MEWA 2JXBA 3CCUT 1BIAA 1M1KC 2OTJT 2Y4XA 2JM8A 2KT8A 3TU4K 2M16A 3P8BB 4QQDA 4J6XA 3QUIA 2YLCA 2PZ1A 2CP3A 2DTOA 4RTVA 3JCMJ 3OYJA 1QCNA 1UTIA 5EG2A 3OW2A 3ULRB 2HL5C 2FHDA 4C92D
chains in the Genus database with same CATH topology
2GTOA 2J6OA 1Y57A 1K76A 4J9IA 2DBKA 1OPKA 1NLOC 4AFZC 2KYBA 1PNJA 2M0YA 4QT7A 1WX6A 2EYXA 3LH5A 2O31A 3QWYA 3EG1A 1X69A 1MV3A 1AD5A 2P4RA 2JM9A 1OPLA 2MIOA 2CREA 1HD3A 4AFUC 4CC3A 2HSPA 4LN2A 4AFSC 3M0QA 4OMQA 1N5ZA 3U23A 1K1ZA 2M51A 3RNJA 2AKKA 1EFNA 1WI7A 2DNUA 1GBRA 1PRLC 1SSHA 2D8HA 1BK2A 1SRLA 2DL8A 1X6GA 3M0PA 2GQIA 1BB9A 2FPEA 2RQWA 3VS1A 1ZBJA 2K2MA 5FWBA 5GJWB 3JV3A 2JS2A 1WXBA 4CC4B 1Y0MA 2L3QA 1JQQA 2CH4W 2CT4A 2DILA 2J6KA 2KBTA 2KT1A 1CKAA 2KXCA 2SRCA 3VS0A 3EG2A 2F2WA 3I35A 1M30A 2LJ0A 4DEXA 2VVKA 1W1FA 1YCSB 3H0FA 4RTUA 4ORZA 1GCPA 2X3WD 2LJ1A 4DEYA 1SPKA 3VS7A 2BZ8A 5IXFA 4JZ4A 2KXDA 1ZUYA 2JS0A 1U5SA 3IQLA 4HVWA 2ECZA 1ZLMA 2ROTA 4HVUA 4F16A 2CH4A 2K79A 2BTTA 4EIKA 1UJYA 2YSQA 1OOTA 3C0CA 4OMMA 3THKA 1YP5A 3PE0A 3I5SA 2LQWA 2KR3A 1K4US 2RPNA 1WXTA 2CSIA 2EYYA 2GBQA 2YUQA 4F14A 5I22A 5IXBA 1QLYA 2L3PA 2YDLA 1I0CA 2PTKA 2VWFA 2FO0A 4J9GA 1G83A 2DM1A 2MOXA 2V1RA 3REBB 1CKBA 1AZEA 1PRMC 1UHCA 3QWXX 2EYZA 5IHKA 3EHQA 2DE0X 1VYTA 2KYMA 2RQTA 2X3XD 2DX1A 2I0NA 2OI3A 1M3CA 1UE9A 1K9AA 2EKHA 2HDAA 3R6NA 2G6FX 2K7AA 3TVTA 5GJVB 1S1NA 1YWPA 1RUWA 4OMLA 4RTYA 4WCIA 4J9HA 2C0IA 2FRWA 2GTJA 2JMCA 2DF6A 2A37A 1WFWA 3M0UA 2GGRA 4KRTA 1QKWA 2NUZA 2JTEA 1E6GA 1NYFA 1Z9ZA 2J6FA 1I1JA 1OEBA 1NYGA 1UJ0A 2AZSA 2EBPA 5I11A 4IIOA 1G2BA 1GCQC 2O2OA 1VYVA 3EG3A 2KRSA 3VS3A 4A63B 4E6RA 1GRIA 1UGVA 2GNCA 2AKLA 1PWTA 2DRKA 4RTXA 3O5ZA 1GCQA 3VS5A 4FSSA 2W0ZA 1K0XA 3VS6A 1X6BA 2AK5A 2RQUA 4D8DA 3H0IA 2FPDA 2RQVA 3H0HA 1I07A 1SRMA 4HCKA 1BU1A 2ED0A 2C0OA 1LCKA 3VS2A 1X2KA 3ZL7C 2FRYA 1NLPC 1A0NB 1JO8A 2DMOA 4IIMA 2CUDA 2RMOA 1WLPB 4X1VA 5FW9A 3I5RA 1XOVA 1B3QA 1NM7A 4J9CA 4Y92A 4OMNA 1NEBA 1TUCA 2L2PA 3TSWA 1FMKA 3TSZA 1YWOA 2L3SA 3PVLA 1U3OA 1M27C 1GL5A 2H8HA 1FYNA 1M3AA 2DA9A 3UA6A 1T0JA 2EW3A 3I9QA 1GFDA 2O9SA 2DBMA 4RTZA 2B86A 2K3BA 2AZVA 1AWOA 1OV3A 1QWFA 3NGPA 4JJCA 2KEAA 2EGCA 5IHIA 1ZUUA 4HVVA 4J9DA 1PKSA 3EHRA 2KRMA 2V1QA 2F2XA 2EGEA 1TG0A 4OMOA 2A28A 1NG2A 2DLPA 5HCKA 2LX7A 1IO6A 2LNHB 3H41A 1MV0B 2D1XA 2ROLA 2RNAA 2KGTA 4JZ3A 2ED1A 2KROA 2LCSA 1PKTA 4LNPA 2DVJA 2CUBA 1E7OA 2F2VA 4RUGA 3REAB 2LQNA 1ABQA 1AWJA 2DYBA 2ENMA 2JW4A 1GFCA 2LMJA 3EGUA 2SEMA 4HXJA 1CSKA 1RLQC 4J9BA 2E5KA 3UA7A 1GBQA 1M3BA 4AFQC 2J06A 3M0SA 2YUNA 2ESWA 2DL5A 2EQIA 4Z88A 2A36A 5IHNA 1KFZA 2PNIA 2A08A 1B07A 2EVRA 2EGAA 1M8MA 1E6HA 2DRMA 2LP5A 1U06A 4ZNXA 1RI9A 2JT4A 3NPFA 1PHTA 1JU5C 2CDTA 2D8JA 1YN8A 1T3SA 1K0SA 5IH2A 1SEMA 1VYUA 1QCFA 1UFFA 1QWEA 2FG0A 1WXUA 1T3LA 5L23A 1UG1A 2YT6A 2RN8A 1X27A 1ABOA 1X43A 1ZX6A 3NHNA 1MUZA 1WA7A 1V1CA 4RTWA 3VRZA 1T0HA 2FEIA 1HSQA 1JXOA 2QDLA 1TUDA 1UECA 1X2QA 4LUDA 4OMPA 2KRNA 1AEYA 4LE9A 1YNZA 1BBZA 4D8KA 1HJDA 1JEGA 2O9VA 4AG1C 2L0AA 2EYWA 1JXMA 1WYXA 3VRYA 1KSWA 1W70A 2W10A 4M4ZA 2KE9A 1AZGB 2DJQA 2DL7A 1ARKA 4JPBW 2LJ3A 1VA7A 1KJWA 3GBQA 2DL3A 2OAWA 4J9FA 3UATA 4CC7A 2XMFA 2YUOA 4RTTA 1H3HA 2KNBB 3UF4A 1KIKA 2BZYA 3VS4A 2HBWA 5EC7A 4Z89A 2NWMA 2BZXA 2MCNA 1H92A 4J9EA 4ESRA 4LUEA 2J05A 2DL4A 1Z9QA 2VKNA 5ECAA 3CQTA 1H8KA 2ABLA 4GLMA 3RBBB 1AWXA 4K11A 2LZ6B 2RF0A 2JMAA 3M0RA 1SHFA 4CC2A 4GBQA 3FJ5A 1W6XA 4JJDA 2O88A 3EG0A 1RLPC 2D0NA 3KFVA 3M0TA 4Z8AA 2K6DA 2CT3A 1UDLA 1WDXA 1UUEA 2OJ2A 4R0KA 2IIMA 2C0TA 2EPDA 2FPFA 2JXBA 1J3TA 4JJBA 1AVZC 4F17A 1AWWA 4AG2C 2JM8A 2J7IA 1ZUKA 2KT8A 1UHFA 2YUPA 5FWCA 3SEMA 2PZ1A 1SHGA 3NMZC 4RTVA 1ZSGA 2HCKA 2CSQA 2RQRA 3PVQA 1AOJA 3SHWA 2HEQA 1UTIA 3A98A 1QKXA 1NEGA 1WIEA 3ULRB 2K9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTO A;  2J6O A;  1Y57 A;  1K76 A;  4J9I A;  2DBK A;  1OPK A;  1NLO C;  4AFZ C;  2KYB A;  1PNJ A;  2M0Y A;  4QT7 A;  1WX6 A;  2EYX A;  3LH5 A;  2O31 A;  3QWY A;  3EG1 A;  1X69 A;  1MV3 A;  1AD5 A;  2P4R A;  2JM9 A;  1OPL A;  2MIO A;  2CRE A;  1HD3 A;  4AFU C;  4CC3 A;  2HSP A;  4LN2 A;  4AFS C;  3M0Q A;  4OMQ A;  1N5Z A;  3U23 A;  1K1Z A;  2M51 A;  3RNJ A;  2AKK A;  1EFN A;  1WI7 A;  2DNU A;  1GBR A;  1PRL C;  1SSH A;  2D8H A;  1BK2 A;  1SRL A;  2DL8 A;  1X6G A;  3M0P A;  2GQI A;  1BB9 A;  2FPE A;  2RQW A;  3VS1 A;  1ZBJ A;  2K2M A;  5FWB A;  5GJW B;  3JV3 A;  2JS2 A;  1WXB A;  4CC4 B;  1Y0M A;  2L3Q A;  1JQQ A;  2CH4 W;  2CT4 A;  2DIL A;  2J6K A;  2KBT A;  2KT1 A;  1CKA A;  2KXC A;  2SRC A;  3VS0 A;  3EG2 A;  2F2W A;  3I35 A;  1M30 A;  2LJ0 A;  4DEX A;  2VVK A;  1W1F A;  1YCS B;  3H0F A;  4RTU A;  4ORZ A;  1GCP A;  2X3W D;  2LJ1 A;  4DEY A;  1SPK A;  3VS7 A;  2BZ8 A;  5IXF A;  4JZ4 A;  2KXD A;  1ZUY A;  2JS0 A;  1U5S A;  3IQL A;  4HVW A;  2ECZ A;  1ZLM A;  2ROT A;  4HVU A;  4F16 A;  2CH4 A;  2K79 A;  2BTT A;  4EIK A;  1UJY A;  2YSQ A;  1OOT A;  3C0C A;  4OMM A;  3THK A;  1YP5 A;  3PE0 A;  3I5S A;  2LQW A;  2KR3 A;  1K4U S;  2RPN A;  1WXT A;  2CSI A;  2EYY A;  2GBQ A;  2YUQ A;  4F14 A;  5I22 A;  5IXB A;  1QLY A;  2L3P A;  2YDL A;  1I0C A;  2PTK A;  2VWF A;  2FO0 A;  4J9G A;  1G83 A;  2DM1 A;  2MOX A;  2V1R A;  3REB B;  1CKB A;  1AZE A;  1PRM C;  1UHC A;  3QWX X;  2EYZ A;  5IHK A;  3EHQ A;  2DE0 X;  1VYT A;  2KYM A;  2RQT A;  2X3X D;  2DX1 A;  2I0N A;  2OI3 A;  1M3C A;  1UE9 A;  1K9A A;  2EKH A;  2HDA A;  3R6N A;  2G6F X;  2K7A A;  3TVT A;  5GJV B;  1S1N A;  1YWP A;  1RUW A;  4OML A;  4RTY A;  4WCI A;  4J9H A;  2C0I A;  2FRW A;  2GTJ A;  2JMC A;  2DF6 A;  2A37 A;  1WFW A;  3M0U A;  2GGR A;  4KRT A;  1QKW A;  2NUZ A;  2JTE A;  1E6G A;  1NYF A;  1Z9Z A;  2J6F A;  1I1J A;  1OEB A;  1NYG A;  1UJ0 A;  2AZS A;  2EBP A;  5I11 A;  4IIO A;  1G2B A;  1GCQ C;  2O2O A;  1VYV A;  3EG3 A;  2KRS A;  3VS3 A;  4A63 B;  4E6R A;  1GRI A;  1UGV A;  2GNC A;  2AKL A;  1PWT A;  2DRK A;  4RTX A;  3O5Z A;  1GCQ A;  3VS5 A;  4FSS A;  2W0Z A;  1K0X A;  3VS6 A;  1X6B A;  2AK5 A;  2RQU A;  4D8D A;  3H0I A;  2FPD A;  2RQV A;  3H0H A;  1I07 A;  1SRM A;  4HCK A;  1BU1 A;  2ED0 A;  2C0O A;  1LCK A;  3VS2 A;  1X2K A;  3ZL7 C;  2FRY A;  1NLP C;  1A0N B;  1JO8 A;  2DMO A;  4IIM A;  2CUD A;  2RMO A;  1WLP B;  4X1V A;  5FW9 A;  3I5R A;  1XOV A;  1B3Q A;  1NM7 A;  4J9C A;  4Y92 A;  4OMN A;  1NEB A;  1TUC A;  2L2P A;  3TSW A;  1FMK A;  3TSZ A;  1YWO A;  2L3S A;  3PVL A;  1U3O A;  1M27 C;  1GL5 A;  2H8H A;  1FYN A;  1M3A A;  2DA9 A;  3UA6 A;  1T0J A;  2EW3 A;  3I9Q A;  1GFD A;  2O9S A;  2DBM A;  4RTZ A;  2B86 A;  2K3B A;  2AZV A;  1AWO A;  1OV3 A;  1QWF A;  3NGP A;  4JJC A;  2KEA A;  2EGC A;  5IHI A;  1ZUU A;  4HVV A;  4J9D A;  1PKS A;  3EHR A;  2KRM A;  2V1Q A;  2F2X A;  2EGE A;  1TG0 A;  4OMO A;  2A28 A;  1NG2 A;  2DLP A;  5HCK A;  2LX7 A;  1IO6 A;  2LNH B;  3H41 A;  1MV0 B;  2D1X A;  2ROL A;  2RNA A;  2KGT A;  4JZ3 A;  2ED1 A;  2KRO A;  2LCS A;  1PKT A;  4LNP A;  2DVJ A;  2CUB A;  1E7O A;  2F2V A;  4RUG A;  3REA B;  2LQN A;  1ABQ A;  1AWJ A;  2DYB A;  2ENM A;  2JW4 A;  1GFC A;  2LMJ A;  3EGU A;  2SEM A;  4HXJ A;  1CSK A;  1RLQ C;  4J9B A;  2E5K A;  3UA7 A;  1GBQ A;  1M3B A;  4AFQ C;  2J06 A;  3M0S A;  2YUN A;  2ESW A;  2DL5 A;  2EQI A;  4Z88 A;  2A36 A;  5IHN A;  1KFZ A;  2PNI A;  2A08 A;  1B07 A;  2EVR A;  2EGA A;  1M8M A;  1E6H A;  2DRM A;  2LP5 A;  1U06 A;  4ZNX A;  1RI9 A;  2JT4 A;  3NPF A;  1PHT A;  1JU5 C;  2CDT A;  2D8J A;  1YN8 A;  1T3S A;  1K0S A;  5IH2 A;  1SEM A;  1VYU A;  1QCF A;  1UFF A;  1QWE A;  2FG0 A;  1WXU A;  1T3L A;  5L23 A;  1UG1 A;  2YT6 A;  2RN8 A;  1X27 A;  1ABO A;  1X43 A;  1ZX6 A;  3NHN A;  1MUZ A;  1WA7 A;  1V1C A;  4RTW A;  3VRZ A;  1T0H A;  2FEI A;  1HSQ A;  1JXO A;  2QDL A;  1TUD A;  1UEC A;  1X2Q A;  4LUD A;  4OMP A;  2KRN A;  1AEY A;  4LE9 A;  1YNZ A;  1BBZ A;  4D8K A;  1HJD A;  1JEG A;  2O9V A;  4AG1 C;  2L0A A;  2EYW A;  1JXM A;  1WYX A;  3VRY A;  1KSW A;  1W70 A;  2W10 A;  4M4Z A;  2KE9 A;  1AZG B;  2DJQ A;  2DL7 A;  1ARK A;  4JPB W;  2LJ3 A;  1VA7 A;  1KJW A;  3GBQ A;  2DL3 A;  2OAW A;  4J9F A;  3UAT A;  4CC7 A;  2XMF A;  2YUO A;  4RTT A;  1H3H A;  2KNB B;  3UF4 A;  1KIK A;  2BZY A;  3VS4 A;  2HBW A;  5EC7 A;  4Z89 A;  2NWM A;  2BZX A;  2MCN A;  1H92 A;  4J9E A;  4ESR A;  4LUE A;  2J05 A;  2DL4 A;  1Z9Q A;  2VKN A;  5ECA A;  3CQT A;  1H8K A;  2ABL A;  4GLM A;  3RBB B;  1AWX A;  4K11 A;  2LZ6 B;  2RF0 A;  2JMA A;  3M0R A;  1SHF A;  4CC2 A;  4GBQ A;  3FJ5 A;  1W6X A;  4JJD A;  2O88 A;  3EG0 A;  1RLP C;  2D0N A;  3KFV A;  3M0T A;  4Z8A A;  2K6D A;  2CT3 A;  1UDL A;  1WDX A;  1UUE A;  2OJ2 A;  4R0K A;  2IIM A;  2C0T A;  2EPD A;  2FPF A;  2JXB A;  1J3T A;  4JJB A;  1AVZ C;  4F17 A;  1AWW A;  4AG2 C;  2JM8 A;  2J7I A;  1ZUK A;  2KT8 A;  1UHF A;  2YUP A;  5FWC A;  3SEM A;  2PZ1 A;  1SHG A;  3NMZ C;  4RTV A;  1ZSG A;  2HCK A;  2CSQ A;  2RQR A;  3PVQ A;  1AOJ A;  3SHW A;  2HEQ A;  1UTI A;  3A98 A;  1QKX A;  1NEG A;  1WIE A;  3ULR B;  2K9G A; 
#chains in the Genus database with same CATH topology
 2GTO A;  3G1J A;  1K76 A;  4M7D A;  4GY5 A;  5FU7 C;  1Q7Y U;  1NLO C;  1M2V B;  2WSF E;  3HP9 A;  2KMT A;  3H8Z A;  4OP0 A;  2O31 A;  3EG1 A;  1U8R A;  4FCY A;  1AD5 A;  2CRE A;  1HD3 A;  2RK2 A;  2WSE E;  4LN2 A;  1N5Z A;  1HK9 A;  3U23 A;  1K1Z A;  5CKD A;  2AKK A;  3FJP A;  4BB7 A;  1GBR A;  5GAN d;  3HHT B;  1HXD A;  2GQI A;  3SFM A;  1Q7Y C;  3PNW C;  4PJO F;  1BB9 A;  2FPE A;  2RQW A;  1VQ5 T;  5FWB A;  4C8Q G;  2RB6 A;  2DIG A;  1W2B S;  5FRN A;  1TTH B;  3VUB A;  3C95 A;  1ZA2 B;  3AT1 B;  5GAO n;  1JQQ A;  5I2M A;  2KXC A;  3VS0 A;  4N0A A;  4J7I A;  3I35 A;  1Q86 R;  3M5A A;  1W1F A;  1K73 U;  3ZBD A;  1N8R R;  3C12 A;  3NFC A;  2RHU A;  2DPP B;  2LJ1 A;  1X75 C;  4LXC A;  2BZ8 A;  3GIB A;  1DJ7 B;  5KYW A;  2HAX A;  4PLL A;  3JCM c;  2JS0 A;  1G3Y A;  4M78 C;  3JCM d;  2ECZ A;  2CYZ B;  4HVU A;  2CP2 A;  3A8M B;  2K79 A;  2BTT A;  4PFP A;  4ZGE B;  3BDU A;  3LYI A;  5L8R E;  4OMM A;  3THK A;  1PD0 A;  2VV5 A;  4KGV B;  3I5S A;  2EJF A;  2KAF A;  1N9R A;  4ME7 A;  2RPN A;  2GFA A;  1WXT A;  2AT1 B;  2YUQ A;  5DLQ E;  2DK3 A;  3O8V A;  2DTI A;  1G83 A;  5LJ3 e;  2GFU A;  2V1R A;  3REB B;  1PRM C;  2EYQ A;  1KHC A;  4P5N A;  2DE0 X;  1VYT A;  2KYM A;  4M77 D;  2X3X D;  2X4W A;  1UB4 A;  3RMS A;  3PMT A;  2NUP A;  2KY9 A;  1VQK T;  3A8H B;  2G6F X;  1HYO A;  2K7A A;  1BI1 A;  4BE1 A;  2CZ6 B;  2F69 A;  2ZPB B;  4M7D G;  2X51 A;  4ELZ C;  4WCI A;  2VXF A;  1QVF A;  3E2U A;  2KSS A;  1WZO A;  1VQ8 T;  2A37 A;  1WFW A;  1RAH B;  3M0U A;  2LC4 A;  3OYL A;  2CKK A;  4C5G A;  1D3B B;  1NYF A;  1Q81 U;  3QYG B;  1YJN T;  3DB3 A;  2VGM A;  2E70 A;  5I11 A;  3EG9 A;  1G2B A;  1GCQ C;  3EG3 A;  3CCM T;  1K9M R;  4E6R A;  5HK3 A;  1KQS A;  2GNC A;  3V7C A;  2DRK A;  2MWO A;  2OTL T;  3VS5 A;  4EMK B;  4C8Q F;  3CXC S;  1K0X A;  4YTL A;  3VS6 A;  4BI3 A;  3L2U A;  3DLM A;  4UC4 A;  2RQV A;  1TUG B;  3PMI A;  2QDY B;  2ED0 A;  4V2S A;  1LCK A;  4XU0 A;  3ZL7 C;  2E6N A;  2FRY A;  1KK7 A;  2E12 A;  1ZBX A;  1JO8 A;  4KGZ B;  4BE0 A;  1RAI B;  4OB2 B;  1VIF A;  4EDU A;  1OQK A;  1XOV A;  1B3Q A;  1NM7 A;  2HSE B;  2G3R A;  2YLB A;  4Y92 A;  2RHI A;  4A4E A;  2P4T A;  1NEB A;  4MZT A;  3CD6 Q;  1SKU B;  3FEO A;  1M27 C;  3SWN B;  2XI9 A;  3D7S B;  1T0J A;  3I9Q A;  2LCC A;  1WPY A;  3OMG A;  1GFD A;  2O9S A;  2QAZ A;  1RAD B;  5GAN 8;  4RTZ A;  2B86 A;  3I56 Q;  2IPO B;  3JCM X;  1QWF A;  2EQU A;  3NGP A;  2DO3 A;  4ZGD B;  4DBR A;  5FRM A;  4B9X A;  2PU9 B;  5J3B A;  1EX4 A;  1S72 Q;  5D7U A;  1YJ9 Q;  2EGE A;  2WSC E;  1TG0 A;  2DEQ A;  3PIO A;  2A28 A;  4X34 A;  4C92 E;  1NG2 A;  2DLP A;  4FM4 B;  1IO6 A;  4C92 B;  2ROL A;  2JUF A;  2NUT B;  2ED1 A;  4M7A G;  2LCS A;  1EIF A;  3CME Q;  1U1T A;  1R8O B;  3HFO A;  4XU1 A;  3CCR Q;  3L1A A;  3TEE A;  4OVA A;  3CD6 A;  2LT4 A;  3REA B;  1ABQ A;  2FZK B;  1AWJ A;  3OYB A;  2ENM A;  1VQM A;  1D09 B;  4HXJ A;  2NLU A;  3UA7 A;  4AFQ C;  2RO0 A;  2R58 A;  4MMK A;  4HA8 A;  2R5M A;  4PKC C;  2ZAE A;  2YUN A;  5CKB A;  4KT0 E;  4ZN1 A;  1V76 A;  4XU3 A;  3CMA A;  4EMK C;  3JCM Q;  1E6H A;  2EFI A;  4BY6 C;  1YJ9 A;  1PSF A;  1NJI U;  3L2W A;  3LX7 A;  3I55 T;  1PHT A;  5LJ3 f;  1OX9 A;  2CDT A;  3CME A;  1QVG S;  4RCC A;  1B34 B;  3A8G B;  2P0Q A;  1QCF A;  3BE3 A;  3CCR A;  3NTK A;  1QWE A;  5KYU A;  2LTO A;  2QAS A;  4KH1 B;  1X27 A;  2RJF A;  4PJO A;  1ABO A;  1Y07 A;  3NHN A;  1ZSZ B;  2QGF B;  1V1C A;  3G4S Q;  5GAN j;  1NJI C;  2DD4 A;  3SWN C;  4E7Z A;  3CC7 Q;  1HSQ A;  2QDL A;  2R5A A;  3ZFJ A;  2JTM A;  4BE2 A;  1IHV A;  1AHJ B;  2VB6 A;  2RHX A;  3M57 A;  2DJQ A;  2Y90 A;  4JPB W;  2LJ3 A;  4N0A C;  3JRZ A;  4MML A;  3CC4 T;  1BKB A;  1KJW A;  3JSC A;  3GBQ A;  4C0D B;  3A8L B;  4WTO B;  3GPL A;  2X4X A;  4M77 E;  2OAW A;  4JRK A;  1VQL Q;  3G71 A;  2D6F A;  1OU9 A;  2DYI A;  2YUO A;  4M77 B;  4RTT A;  1H3H A;  3UF4 A;  4C92 C;  3OYK A;  2HBW A;  3RMQ A;  2QEX A;  3MET A;  2BZX A;  5J39 A;  3EFO B;  4IUP A;  3RR6 A;  5GAN h;  5GAN g;  4C8Q D;  2DL4 A;  1WHJ A;  1H8K A;  3CBP A;  1D0Z A;  3G4S A;  3GNF B;  4DQ2 A;  3RBB B;  3QPH A;  4K11 A;  2O4X A;  2LZ6 B;  3EGX A;  2JMA A;  1WHG A;  2L5Q A;  1SHF A;  4F04 B;  5GAO l;  2QI2 A;  1BCO A;  2FZC B;  1PD1 A;  3HRS A;  1VQ4 T;  1VIE A;  1W6X A;  5KYY B;  1RLP C;  2DXB A;  4JJN K;  2QTV A;  2LCL A;  3KFV A;  2CT3 A;  2GQV A;  4N4H A;  1MHN A;  1WDX A;  1QVF P;  2OJ2 A;  4R0K A;  4XK8 E;  2EPD A;  1VQ6 T;  2COY A;  2FPF A;  1J3T A;  1VQL A;  1AVZ C;  4IUR A;  4F17 A;  3PTA A;  5DY9 A;  4AG2 C;  1ZUK A;  3CCJ T;  3G6E T;  4M7A F;  3JCM g;  2YUP A;  1I5O B;  1LOJ A;  5GAN 4;  3BY7 A;  1SHG A;  2JJ9 A;  5GMK j;  2KK4 A;  1AOJ A;  3A98 A;  1QKX A;  3ME9 A;  3E1S A;  4RMO A;  1VQO A;  1KC8 U;  2JN0 A;  3QBY A;  2K9G A;  3RUX A;  3TRE A;  2J6O A;  1ZSZ C;  2GF7 A;  1WHH A;  1YHQ A;  2DBK A;  4C8Q A;  2CP0 A;  2XDP A;  4PJO G;  3QWY A;  4B9W A;  4LDV A;  1MV3 A;  3EFS A;  3CCS Q;  1OPL A;  2MIO A;  3QG1 A;  3MKD A;  4CC3 A;  4AFS C;  2YHT A;  3H9N A;  4F7U E;  2XDD A;  1KD1 R;  4FYY B;  4C0D C;  1LNX A;  3RNJ A;  1EFN A;  2DNU A;  3CCU Q;  5GMK h;  4F7U B;  1PRL C;  3FDR A;  1SSH A;  2D8H A;  2DL8 A;  2F5K A;  3M0P A;  1FXX A;  3KBG A;  2JOY A;  4QVZ A;  1TWB A;  5HY6 A;  4DOW A;  2E41 A;  1YI2 T;  4E7I A;  5GJW B;  3JV3 A;  1QQJ A;  1WXB A;  4GLK A;  4A4K A;  3RKY A;  3EFR A;  4JRP A;  2J6K A;  3ASK A;  2KT1 A;  3L2R A;  2VVK A;  3OYE A;  1YCS B;  1M90 U;  3H0F A;  1I8F A;  2HQE A;  2X3W D;  1YIJ T;  1U1S A;  2FVU A;  4M7D D;  4JZ4 A;  4J83 A;  3E19 A;  3CCS A;  1UGQ B;  2AHJ B;  1U5S A;  3INZ A;  3IQL A;  3OSS C;  4HVW A;  3OW2 S;  2FB7 A;  1M1K U;  3HTR A;  4FYX B;  4F16 A;  2HQX A;  2NYS A;  2XIC A;  1BI0 A;  3CCV T;  3CCU A;  2YSQ A;  3ER0 A;  2BUD A;  3S6W A;  4M78 E;  2LQW A;  5GAM f;  1M90 C;  4M78 B;  2O01 E;  4F14 A;  4OB0 B;  1UGR B;  2L3P A;  1G3S A;  2E64 A;  2CP5 A;  2PTK A;  2FO0 A;  2M02 A;  1AZE A;  1UHC A;  4RKU E;  1M1F A;  2JVV A;  3EHQ A;  2ZPI B;  2RH2 A;  1NE8 A;  1ZQ1 A;  2XDB A;  4KUI A;  1Q7Y R;  2QA4 T;  2FYK A;  5IT9 E;  4O6J A;  4AT1 B;  1O75 A;  5LJ5 e;  1MMN A;  2EKH A;  5I21 A;  2HDA A;  3R6N A;  2ZPH B;  5GJV B;  3CC2 T;  4NL3 A;  1SF9 A;  3M55 A;  4OML A;  4Y91 A;  1XJW B;  4J9H A;  2FRW A;  1UGS B;  2JMC A;  2DF6 A;  4PNO A;  2GGR A;  1I5L A;  4M75 A;  1JB0 E;  1LVK A;  1QKW A;  2NUZ A;  1JJ2 P;  1E6G A;  1Z9Z A;  4E7J A;  1RAB B;  4L59 A;  1N6A A;  2MMP A;  1AT1 B;  4A53 A;  4PK4 A;  4WF2 A;  4ELY C;  2EBP A;  1C0M A;  4IIO A;  4ZN3 A;  2QYZ A;  1VQ5 A;  4PJN A;  4RTX A;  4FSS A;  1X6B A;  2AK5 A;  3CPW P;  3EGD A;  1VQ7 T;  2FPD A;  1I07 A;  1KHI A;  4HCZ A;  2DXU A;  1K73 R;  1MMD A;  4KGX B;  4IKF A;  5DM7 R;  3MEV A;  1BU1 A;  4DBH A;  2C0O A;  2XID A;  1M9S A;  4J8O A;  3CCL T;  2LX9 A;  3X26 B;  4M7A D;  4J5Y A;  3HKS A;  4IIM A;  1VQK Q;  4OB3 B;  3N5B B;  5GAM h;  1VQ9 T;  2CZ7 B;  1OX8 A;  4HT8 A;  4X1V A;  5FW9 A;  4C5H A;  3OS0 A;  5LJ3 d;  2XK0 A;  1VQ8 Q;  3JCM b;  4KH0 B;  4JS4 A;  3KXT A;  3A1P A;  3TSZ A;  1YWO A;  3PVL A;  3NTI A;  2H8H A;  4NOY A;  3UA6 A;  2RHY A;  1VQN T;  2IG0 A;  5CKE A;  1TS9 A;  1WJS A;  2E5Q A;  2B8A A;  2K3B A;  3CCM Q;  1OV3 A;  1QVF S;  4J9D A;  1MMA A;  2V1Q A;  1N27 A;  2F2X A;  4OMO A;  2CGH A;  1WHK A;  2ZPG B;  1K8A U;  5HCK A;  4NL2 A;  2LX7 A;  1KQS S;  3M58 A;  4XQ3 A;  1VQK A;  2KGT A;  4EMG A;  3C94 A;  4X9C A;  5KYX B;  1M4Z A;  2DVJ A;  4M7A A;  1VQ8 A;  1O9S A;  1E7O A;  4RUG A;  1RAF B;  4Y28 E;  5GAO m;  1Q81 R;  5C0M A;  3EGU A;  3HFN A;  3PFS A;  1K8A C;  1CSK A;  1RLQ C;  2E5K A;  4QKU A;  1MNE A;  3CCM A;  1I4K 1;  4M75 G;  2ESW A;  2DL5 A;  2BE7 D;  1OZ2 A;  5IHN A;  1FX7 A;  2PNI A;  3OSV A;  1KFZ A;  1Q86 C;  5GMK l;  2OTL A;  2VUB A;  1KQ2 A;  1N8R C;  4IUV A;  2DET A;  2LP5 A;  3JCM e;  3WVE B;  1ZA1 B;  2JNG A;  2MF2 A;  4ZNX A;  4C8Q C;  2EQM A;  2VGN A;  1K0S A;  5FLX E;  4M7D E;  4BY6 B;  3PGG A;  3GLX A;  5LJ5 f;  1UG1 A;  1XQH A;  4M7D B;  2RN8 A;  1X01 A;  2RHZ A;  5A0G A;  4PJL A;  1MUZ A;  5GAN 2;  2FEI A;  5CQX A;  1JXO A;  1TU0 B;  3F70 A;  3L2Q A;  4O5V A;  3MP1 A;  2DAQ A;  4LUD A;  1BBZ A;  3QDF A;  1VOM A;  4Z02 A;  1JXM A;  1NPP A;  1QP3 A;  1KSW A;  1ARK A;  3FB9 A;  1VQM Q;  1VA7 A;  3A8O B;  2QGG A;  2DL3 A;  2VYT A;  3QII A;  3CBO A;  9ATC B;  4CC7 A;  6AT1 B;  3OS2 A;  1XTD A;  1KIK A;  2DFU A;  4PJJ A;  1VQP Q;  2CS7 A;  4Z89 A;  2QXF A;  2NWM A;  2MCN A;  3CMA Q;  1KQ1 A;  4C0F A;  4LUE A;  4J7F A;  2BE9 B;  5GAO p;  3RDV A;  1K9M C;  1Y96 A;  4L5G A;  1R0B G;  4EPC A;  1RI0 A;  1AWX A;  3VUZ A;  5KYW B;  4PJO D;  3CBM A;  3BFM A;  3VU3 C;  3E9G A;  2XHC A;  2A3L A;  3M0R A;  4CC2 A;  3RIR A;  1Q95 G;  4JJD A;  1JJ2 S;  1WQW A;  3RKW A;  2K6D A;  1NJI R;  4A4G A;  4QVD A;  2IIM A;  2C0T A;  1R0C B;  3CCE Q;  4JJB A;  3X25 B;  2QQR A;  3SD4 A;  1AWW A;  3T9N A;  2J7I A;  1H64 1;  2QQ9 A;  4JLG A;  2HKN A;  4C0Z A;  5FWC A;  4ANJ A;  1VQP A;  3SEM A;  1M1G A;  3NMZ C;  1ZSG A;  2HCK A;  5FRO A;  3PVQ A;  2RQR A;  4OMF B;  2HEQ A;  2NUP B;  4M7D C;  3H6Z A;  5GAM d;  3JB9 G;  5C6S A;  2X4Y A;  3G71 Q;  3ZEH A;  4KBM B;  3C4S A;  4RG2 A;  3CD6 T;  4M75 F;  5HKC A;  1OPK A;  4AFZ C;  2QEX Q;  1PNJ A;  4QT7 A;  1WX6 A;  5D6Y A;  2CZ0 B;  2EYX A;  3LH5 A;  4OF1 A;  3JAM E;  1JJ2 A;  2QG9 B;  3I56 T;  3E9F A;  2JM9 A;  2DER A;  4EMH A;  4AFU C;  2HSP A;  3M0Q A;  3QHS A;  4OMQ A;  3QZ9 B;  3CCE A;  3EG9 B;  3CC4 A;  1P92 A;  1S72 T;  3OYH A;  4D6W A;  1YJ9 T;  1BK2 A;  1SRL A;  1X6G A;  5AT1 B;  3CPW A;  1NPR A;  2EWN A;  2JS2 A;  3CME T;  5LJ3 j;  3SDZ A;  4CC4 B;  3OYC A;  3HPW A;  3CCR T;  4HKE A;  2CH4 W;  1OZ3 A;  3EG2 A;  5I2S A;  2F2W A;  1SSF A;  4DEX A;  2CZ1 B;  2JZ2 A;  3VYG A;  4RTU A;  1GCP A;  2E3I A;  4DEY A;  3V8L A;  3V7R A;  5IN1 A;  3BW1 A;  5IXF A;  1VQ4 A;  1ZUY A;  2HMA A;  5GAO q;  3FLG A;  4PFZ A;  1VQO Q;  1ZLM A;  4QW2 A;  2K3X A;  2DJZ A;  2CH4 A;  3FC3 A;  1C1A A;  4EIK A;  1VQ6 A;  4CRI A;  2MPX C;  1YHQ Q;  1UJY A;  4M78 A;  1FMV A;  3OYA A;  3MPU B;  3C0C A;  2FL7 A;  4C92 F;  1YP5 A;  5LJ3 h;  5GMK i;  1W2B P;  1BCM A;  2XKO C;  5LJ3 g;  1K4U S;  2CSI A;  3LWH A;  2GBQ A;  4TVR A;  3WVD B;  3OYM A;  4M7A C;  2DIQ A;  3VKI A;  2VWF A;  4FW2 A;  4J9G A;  1KC8 R;  2DM1 A;  3PIP A;  4ZGJ B;  5IHK A;  1WHM A;  1WHL A;  2RQT A;  2DX1 A;  3LW5 E;  4LDW A;  4QQ6 A;  1IRE B;  2QK0 A;  2KVQ G;  2C06 A;  1YIT Q;  2ZPE B;  1RAE B;  3TVT A;  3CC7 T;  1Q82 U;  2OAU A;  3PT9 A;  4XTW A;  2DTH A;  1YWP A;  5KCH A;  2LRQ A;  2BKD N;  1M2V A;  2C0I A;  4X9D A;  2EAY A;  2VXE A;  2PUO B;  4KRT A;  2QTX A;  2WAC A;  1PCX A;  4JS5 A;  3HRT A;  2JTE A;  1OEB A;  2CP7 A;  1NYG A;  5GMK m;  1VQL T;  5CK9 A;  4A63 B;  1VYV A;  1Y71 A;  2KRS A;  3URG A;  1YI2 A;  1W4S A;  3GOX A;  1Q82 C;  1TH7 A;  2AKL A;  2JTF A;  3JB9 F;  3A5Z B;  1GCQ A;  1YJW T;  2K5L A;  4L6V 5;  4D8D A;  3H0I A;  2YWW A;  2OTJ Q;  3G7Z A;  1XNI A;  1M90 R;  4IUU A;  3CCQ T;  1QW1 A;  3M56 A;  1PC0 A;  1YIT A;  4PJO E;  1NLP C;  5KYU B;  2OX7 A;  2KQW A;  1MGQ A;  5CCA A;  3QJ6 A;  1YIJ A;  2DMO A;  2GCX A;  2P0P A;  2RMO A;  4PJO B;  1M1K R;  1RL2 A;  4J9C A;  1X6O A;  4OMN A;  4LDY A;  2KI7 A;  4IUT A;  4ZTJ A;  3TSW A;  2PVO B;  1FMK A;  3CCV A;  1U3O A;  1M3A A;  2DA9 A;  4M77 F;  1F1B B;  2EW3 A;  4M75 D;  2DBM A;  4KUL A;  5LJ5 d;  1WJQ A;  2K4Y A;  2E1H A;  3CXC P;  3TQ7 P;  3OA6 A;  2AZV A;  1AWO A;  2IVW A;  4M78 G;  5DLO A;  4JJC A;  2DD5 A;  3S3N A;  2EGC A;  2L8D A;  4HVV A;  2OTJ A;  1PKS A;  3EHR A;  3MEA A;  1D0X A;  3MHX A;  2R57 A;  3H41 A;  1VQ5 Q;  2RNA A;  3CC2 A;  3GP8 A;  1PKT A;  2RD1 A;  2EKO A;  3BDL A;  1VQ9 Q;  4BD3 A;  1I81 A;  4JUV A;  3QYH B;  1B7T A;  2CUB A;  2O4X B;  3EGX B;  3LGL A;  3M59 A;  2DYB A;  2LDM A;  4A4H A;  1WNL A;  3S3M A;  3JB9 H;  2RK1 A;  4J9B A;  2COZ A;  3MP6 A;  5A2Q E;  3V8J A;  1VQN Q;  2J06 A;  3M0S A;  1D3B A;  3QSU A;  2RM4 A;  4Z88 A;  2CP6 A;  2HL3 A;  2HQH A;  1B07 A;  4E7S A;  1D1A A;  5GAM j;  4HCC A;  3X28 B;  1VQ7 A;  2V8J A;  4EMK A;  2VC8 A;  2X35 A;  3CCL A;  3DKM A;  3NTH A;  1JU5 C;  2D8J A;  4C5I A;  1T3S A;  5IH2 A;  1SEM A;  3J80 E;  4PJO C;  3QO3 A;  1UFF A;  1VQ9 A;  4C8Q E;  3VV0 A;  5L23 A;  1KG1 A;  2YT6 A;  2YXY A;  5FU6 C;  4C8Q B;  3CPF A;  3J7A F;  4HT9 A;  3QKJ A;  5CVI A;  3MJX A;  3UPU A;  1WA7 A;  1UEB A;  3FIF A;  4F7U F;  1YFN A;  3WXM B;  1G3W A;  1T0H A;  1IZ6 A;  1VQN A;  3KUF A;  1UEC A;  5GAM g;  3JCM P;  3OS5 A;  3SWN A;  4FIB A;  4BI4 A;  1AEY A;  1YNZ A;  4D8K A;  3UDC A;  1JEG A;  2RJE A;  3DB4 A;  2EYW A;  1PM3 A;  4HCB A;  2W10 A;  4M4Z A;  1AZG B;  2DL7 A;  3UWN A;  2E6Z A;  1K8A R;  2RI3 A;  1YJN Q;  2COW A;  3P8D A;  2H3E B;  1QVG P;  4XTU A;  1R77 A;  4J9F A;  2PQW A;  4XTZ A;  4A4F A;  3LH0 A;  2PVG B;  5EC7 A;  1WJR A;  2OTL Q;  4XAX B;  1JRI A;  4J9E A;  4ESR A;  4PJM A;  2X4J A;  4N4G A;  4C92 A;  2J05 A;  3JB9 D;  5KCO A;  2NUT A;  1OYX A;  1Z9Q A;  5ECA A;  4GLM A;  3V8K A;  2DEU A;  4XTY A;  5GAN e;  4M78 F;  5CKF A;  3EH2 A;  1Q86 U;  2RF0 A;  1IGU A;  1N8R U;  1WQ7 A;  2LT1 A;  2H3J A;  1K73 C;  4FYW B;  3FJ5 A;  4LD6 A;  3EG0 A;  4FL6 A;  5AYF A;  3M54 A;  2I2L A;  1W2B A;  4KUD K;  1NZ9 A;  1YJN A;  3OQ5 A;  4E7L A;  4OGE A;  4BUG A;  5D6X A;  1TOV A;  2K57 A;  1D0Y A;  3CEY A;  2YRD A;  1UHF A;  4FT2 A;  2D0Q B;  1D1B A;  4J6Y A;  3HL8 A;  4OGC A;  5HK0 A;  1BI2 A;  2CSQ A;  2K2V A;  1NBE B;  3SHW A;  4B6M A;  4XU2 A;  4DBQ A;  3M53 A;  1NEG A;  5KH6 A;  1B34 A;  1WIE A;  5KE3 A;  3VYH B;  3VJP A;  4C0G A;  1Y57 A;  4J9I A;  2V26 A;  2KYB A;  2L89 A;  2M0Y A;  4M75 E;  5CKH A;  1ZSZ A;  2E10 A;  4VUB A;  4M75 B;  1OUL A;  5CO7 A;  5GAN 5;  1BI3 A;  1X69 A;  2P4R A;  1M8V A;  4R56 A;  1FMW A;  3DLL A;  2K5F A;  3RES A;  3QZ5 B;  5GAN 7;  1EZZ B;  1IB8 A;  3L2Z A;  2M51 A;  4DA4 A;  1WI7 A;  2RJD A;  2P84 A;  3OBY A;  5GAN 6;  2Z0W A;  3EGD B;  3VS1 A;  1ZBJ A;  2K2M A;  3RER A;  1Q81 C;  4LD9 K;  2MK5 A;  1K9M U;  4FT4 A;  2MAM A;  4JRQ A;  4M77 A;  5GMK e;  3MEU A;  2MWP A;  1Y0M A;  1BYM A;  2CT4 A;  2DIL A;  2KBT A;  2L3Q A;  3R6O A;  1CKA A;  2SRC A;  3EFO A;  3I55 Q;  5LJ5 j;  1G3T A;  1M30 A;  2LJ0 A;  4C92 G;  1WGS A;  4AMC A;  3OYY A;  4ORZ A;  2VAS A;  2PUK B;  1SPK A;  3VS7 A;  1LJO A;  2KXD A;  2V8I A;  4DOV A;  4IUQ A;  3M4Y A;  4JRI A;  5GAO r;  4CI0 C;  3J81 E;  5IAY A;  2ROT A;  3QDR B;  3CXC A;  5M9O A;  2K3Y A;  5KYY A;  4A54 A;  1OOT A;  3OS1 A;  4N4I A;  2LQK A;  1ZHI A;  3PE0 A;  2KR3 A;  2EYY A;  2RA2 A;  2QQB A;  3OYD A;  2HZY A;  2DKG A;  5I22 A;  5IXB A;  1QLY A;  5LJ5 h;  2YDL A;  1I0C A;  3OMC A;  4PL6 A;  3CC4 Q;  4ZTF A;  5LJ5 g;  2MOX A;  8ATC B;  2M1H A;  1CKB A;  2EJG A;  2ZZD A;  3QWX X;  2EYZ A;  3HRU A;  3I55 A;  2QQA A;  1JBM A;  2OI3 A;  2I0N A;  1M3C A;  3CPW S;  4M7A E;  1UE9 A;  1K9A A;  5LL6 S;  1LPL A;  3L42 A;  4M7A B;  3OW2 P;  3HSB A;  1S1N A;  1TSF A;  3EAE A;  1RUW A;  4M75 C;  4RTY A;  3I56 A;  3M4G A;  5GAN f;  2XG8 D;  1N9S A;  2GTJ A;  4C5E A;  1VUB A;  1BIB A;  1VQM T;  3OBW A;  3M9Q A;  1S72 A;  2J6F A;  3LGF A;  1I1J A;  2YRV A;  2RI2 A;  4PLI A;  1UJ0 A;  2AZS A;  1YCY A;  4M78 D;  2O2O A;  4QQG A;  3VS3 A;  1VQ4 Q;  4PFO A;  3OYF A;  1GRI A;  2YRC A;  3SB2 A;  1UGV A;  3UT1 A;  4F7U A;  1VQP T;  5CIU A;  1PWT A;  4M7D F;  4J6W A;  2P0K A;  3O5Z A;  3L2V A;  3CMA T;  2W0Z A;  2RQU A;  1VQ6 Q;  3H0H A;  2RJC A;  2M0O A;  3JCM W;  3CCJ Q;  1SRM A;  4HCK A;  3G6E Q;  1OI1 A;  3JCM f;  3GNG A;  4M77 G;  3VS2 A;  1X2K A;  1IXD A;  1G8X A;  2EJ9 A;  1A0N B;  3OB9 A;  1QCO A;  2CUD A;  3RKX A;  1M5Q 1;  1WLP B;  2DXC A;  3EH1 A;  3QJY A;  3I5R A;  4LDU A;  1TUC A;  2L2P A;  1UGP B;  2L3S A;  4JDS A;  3OYI A;  1GL5 A;  2XU8 A;  1FYN A;  5GAM e;  2A7Y A;  3LLR A;  3CCE T;  1H3Z A;  3TCJ A;  4OB1 B;  3AHU A;  2D9T A;  2EQK A;  1RAA B;  1MND A;  3OYN A;  4FYV B;  4E47 A;  3MCA B;  2KEA A;  1QVG A;  5D6W A;  2F1L A;  2EQJ A;  5IHI A;  3JCM V;  1ZUU A;  2Y4Y A;  3X24 B;  3OYG A;  1YJW Q;  2HD0 A;  3JB9 J;  2KRM A;  5CR2 A;  3CCJ A;  3G6E A;  1QVP A;  4FU6 A;  3G71 T;  5KE2 A;  2RI5 A;  3CCQ Q;  2LVM A;  2LNH B;  1Q82 R;  4R55 A;  1MV0 B;  2D1X A;  1YI2 Q;  4JZ3 A;  3CC7 A;  2KRO A;  1YBY A;  2QEX T;  1M2O A;  1Y96 B;  4LNP A;  2DVE A;  2ZGW A;  2FZG B;  3P8H A;  5KYN A;  4E2F B;  2F2V A;  2LQN A;  1Y7X A;  2E3H A;  2AIR B;  3G4S T;  2ZCF B;  2JW4 A;  1GFC A;  2LMJ A;  3MP8 A;  4RCB A;  2SEM A;  4BAC A;  1SG5 A;  1YIJ Q;  1GBQ A;  1M3B A;  2M9U A;  4QVC A;  4LDX A;  3JCM h;  5CAI A;  2EQI A;  1IGQ A;  2A36 A;  1C6V X;  4NS5 A;  1GXI E;  2A08 A;  2EVR A;  2EGA A;  1YJW A;  1M8M A;  3S3O A;  1PSE A;  2HKQ B;  3CCV Q;  3OY9 A;  2DRM A;  1KQS P;  1U06 A;  2ATC B;  2A0F B;  1IRX A;  2QQS A;  4BI8 B;  2KDS A;  4F7U G;  2HBP A;  1RI9 A;  3CCQ A;  2JT4 A;  3NPF A;  4ATO A;  2BIV A;  4Q5W A;  2LQ8 A;  1RAC B;  3JB9 I;  1YN8 A;  2E4H A;  1MMG A;  1IHW A;  4MDW A;  1VYU A;  2E65 A;  2FG0 A;  1WXU A;  1T3L A;  4MZP A;  1X43 A;  1VQO T;  1ZX6 A;  2QA4 Q;  4XTV A;  4RG8 A;  1V29 B;  4RTW A;  2MYS A;  5FU7 B;  3V7S A;  3VRZ A;  1YHQ T;  4DBF A;  2HNI A;  3CC2 Q;  1KC8 C;  1G5V A;  2L3R A;  1TUD A;  1X2Q A;  3FRN A;  2XD0 A;  2EIF A;  5FU6 B;  4OMP A;  3X20 B;  2KRN A;  4LE9 A;  1HJD A;  4M77 C;  2O9V A;  3MO8 A;  4AG1 C;  2L0A A;  2DZC A;  1WYX A;  3VRY A;  1W70 A;  2MI6 A;  2KE9 A;  8AT1 B;  4XTX A;  5GAN 3;  4JLI A;  3Q1J A;  2DXT A;  7AT1 B;  4BDY A;  4MZM A;  1KD1 U;  2PVD B;  4E7H A;  3UAT A;  1RAG B;  2F5T X;  4MDX A;  2XMF A;  4FSX A;  1FWZ A;  2KNB B;  2DZ9 A;  2BZY A;  3VS4 A;  1YIT T;  1D1C A;  4BDZ A;  5A0L A;  1H92 A;  2K5I A;  1VQ7 Q;  5A0D A;  5CQY A;  5J26 A;  1TXQ A;  2X9H A;  2QA4 A;  2VKN A;  3CQT A;  2ABL A;  5KYX A;  3CCL Q;  1ACM B;  1PG5 B;  3GF5 A;  1KD1 C;  2ZPF B;  1OU8 A;  4FW1 A;  1QP2 A;  4E7K A;  4GBQ A;  2LNV A;  1QMC A;  3CCS T;  2O88 A;  3QXE B;  2D0N A;  4Z8A A;  3M0T A;  3LWI A;  1UDL A;  4II1 A;  2V8K A;  1UUE A;  3MEW A;  2JXB A;  3CCU T;  1BIA A;  1M1K C;  2OTJ T;  2Y4X A;  2JM8 A;  2KT8 A;  3TU4 K;  2M16 A;  3P8B B;  4QQD A;  4J6X A;  3QUI A;  2YLC A;  2PZ1 A;  2CP3 A;  2DTO A;  4RTV A;  3JCM J;  3OYJ A;  1QCN A;  1UTI A;  5EG2 A;  3OW2 A;  3ULR B;  2HL5 C;  2FHD A;  4C92 D; 
#chains in the Genus database with same CATH homology
 2GTO A;  2J6O A;  1Y57 A;  1K76 A;  4J9I A;  2DBK A;  1OPK A;  1NLO C;  4AFZ C;  2KYB A;  1PNJ A;  2M0Y A;  4QT7 A;  1WX6 A;  2EYX A;  3LH5 A;  2O31 A;  3QWY A;  3EG1 A;  1X69 A;  1MV3 A;  1AD5 A;  2P4R A;  2JM9 A;  1OPL A;  2MIO A;  2CRE A;  1HD3 A;  4AFU C;  4CC3 A;  2HSP A;  4LN2 A;  4AFS C;  3M0Q A;  4OMQ A;  1N5Z A;  3U23 A;  1K1Z A;  2M51 A;  3RNJ A;  2AKK A;  1EFN A;  1WI7 A;  2DNU A;  1GBR A;  1PRL C;  1SSH A;  2D8H A;  1BK2 A;  1SRL A;  2DL8 A;  1X6G A;  3M0P A;  2GQI A;  1BB9 A;  2FPE A;  2RQW A;  3VS1 A;  1ZBJ A;  2K2M A;  5FWB A;  5GJW B;  3JV3 A;  2JS2 A;  1WXB A;  4CC4 B;  1Y0M A;  2L3Q A;  1JQQ A;  2CH4 W;  2CT4 A;  2DIL A;  2J6K A;  2KBT A;  2KT1 A;  1CKA A;  2KXC A;  2SRC A;  3VS0 A;  3EG2 A;  2F2W A;  3I35 A;  1M30 A;  2LJ0 A;  4DEX A;  2VVK A;  1W1F A;  1YCS B;  3H0F A;  4RTU A;  4ORZ A;  1GCP A;  2X3W D;  2LJ1 A;  4DEY A;  1SPK A;  3VS7 A;  2BZ8 A;  5IXF A;  4JZ4 A;  2KXD A;  1ZUY A;  2JS0 A;  1U5S A;  3IQL A;  4HVW A;  2ECZ A;  1ZLM A;  2ROT A;  4HVU A;  4F16 A;  2CH4 A;  2K79 A;  2BTT A;  4EIK A;  1UJY A;  2YSQ A;  1OOT A;  3C0C A;  4OMM A;  3THK A;  1YP5 A;  3PE0 A;  3I5S A;  2LQW A;  2KR3 A;  1K4U S;  2RPN A;  1WXT A;  2CSI A;  2EYY A;  2GBQ A;  2YUQ A;  4F14 A;  5I22 A;  5IXB A;  1QLY A;  2L3P A;  2YDL A;  1I0C A;  2PTK A;  2VWF A;  2FO0 A;  4J9G A;  1G83 A;  2DM1 A;  2MOX A;  2V1R A;  3REB B;  1CKB A;  1AZE A;  1PRM C;  1UHC A;  3QWX X;  2EYZ A;  5IHK A;  3EHQ A;  2DE0 X;  1VYT A;  2KYM A;  2RQT A;  2X3X D;  2DX1 A;  2I0N A;  2OI3 A;  1M3C A;  1UE9 A;  1K9A A;  2EKH A;  2HDA A;  3R6N A;  2G6F X;  2K7A A;  3TVT A;  5GJV B;  1S1N A;  1YWP A;  1RUW A;  4OML A;  4RTY A;  4WCI A;  4J9H A;  2C0I A;  2FRW A;  2GTJ A;  2JMC A;  2DF6 A;  2A37 A;  1WFW A;  3M0U A;  2GGR A;  4KRT A;  1QKW A;  2NUZ A;  2JTE A;  1E6G A;  1NYF A;  1Z9Z A;  2J6F A;  1I1J A;  1OEB A;  1NYG A;  1UJ0 A;  2AZS A;  2EBP A;  5I11 A;  4IIO A;  1G2B A;  1GCQ C;  2O2O A;  1VYV A;  3EG3 A;  2KRS A;  3VS3 A;  4A63 B;  4E6R A;  1GRI A;  1UGV A;  2GNC A;  2AKL A;  1PWT A;  2DRK A;  4RTX A;  3O5Z A;  1GCQ A;  3VS5 A;  4FSS A;  2W0Z A;  1K0X A;  3VS6 A;  1X6B A;  2AK5 A;  2RQU A;  4D8D A;  3H0I A;  2FPD A;  2RQV A;  3H0H A;  1I07 A;  1SRM A;  4HCK A;  1BU1 A;  2ED0 A;  2C0O A;  1LCK A;  3VS2 A;  1X2K A;  3ZL7 C;  2FRY A;  1NLP C;  1A0N B;  1JO8 A;  2DMO A;  4IIM A;  2CUD A;  2RMO A;  1WLP B;  4X1V A;  5FW9 A;  3I5R A;  1XOV A;  1B3Q A;  1NM7 A;  4J9C A;  4Y92 A;  4OMN A;  1NEB A;  1TUC A;  2L2P A;  3TSW A;  1FMK A;  3TSZ A;  1YWO A;  2L3S A;  3PVL A;  1U3O A;  1M27 C;  1GL5 A;  2H8H A;  1FYN A;  1M3A A;  2DA9 A;  3UA6 A;  1T0J A;  2EW3 A;  3I9Q A;  1GFD A;  2O9S A;  2DBM A;  4RTZ A;  2B86 A;  2K3B A;  2AZV A;  1AWO A;  1OV3 A;  1QWF A;  3NGP A;  4JJC A;  2KEA A;  2EGC A;  5IHI A;  1ZUU A;  4HVV A;  4J9D A;  1PKS A;  3EHR A;  2KRM A;  2V1Q A;  2F2X A;  2EGE A;  1TG0 A;  4OMO A;  2A28 A;  1NG2 A;  2DLP A;  5HCK A;  2LX7 A;  1IO6 A;  2LNH B;  3H41 A;  1MV0 B;  2D1X A;  2ROL A;  2RNA A;  2KGT A;  4JZ3 A;  2ED1 A;  2KRO A;  2LCS A;  1PKT A;  4LNP A;  2DVJ A;  2CUB A;  1E7O A;  2F2V A;  4RUG A;  3REA B;  2LQN A;  1ABQ A;  1AWJ A;  2DYB A;  2ENM A;  2JW4 A;  1GFC A;  2LMJ A;  3EGU A;  2SEM A;  4HXJ A;  1CSK A;  1RLQ C;  4J9B A;  2E5K A;  3UA7 A;  1GBQ A;  1M3B A;  4AFQ C;  2J06 A;  3M0S A;  2YUN A;  2ESW A;  2DL5 A;  2EQI A;  4Z88 A;  2A36 A;  5IHN A;  1KFZ A;  2PNI A;  2A08 A;  1B07 A;  2EVR A;  2EGA A;  1M8M A;  1E6H A;  2DRM A;  2LP5 A;  1U06 A;  4ZNX A;  1RI9 A;  2JT4 A;  3NPF A;  1PHT A;  1JU5 C;  2CDT A;  2D8J A;  1YN8 A;  1T3S A;  1K0S A;  5IH2 A;  1SEM A;  1VYU A;  1QCF A;  1UFF A;  1QWE A;  2FG0 A;  1WXU A;  1T3L A;  5L23 A;  1UG1 A;  2YT6 A;  2RN8 A;  1X27 A;  1ABO A;  1X43 A;  1ZX6 A;  3NHN A;  1MUZ A;  1WA7 A;  1V1C A;  4RTW A;  3VRZ A;  1T0H A;  2FEI A;  1HSQ A;  1JXO A;  2QDL A;  1TUD A;  1UEC A;  1X2Q A;  4LUD A;  4OMP A;  2KRN A;  1AEY A;  4LE9 A;  1YNZ A;  1BBZ A;  4D8K A;  1HJD A;  1JEG A;  2O9V A;  4AG1 C;  2L0A A;  2EYW A;  1JXM A;  1WYX A;  3VRY A;  1KSW A;  1W70 A;  2W10 A;  4M4Z A;  2KE9 A;  1AZG B;  2DJQ A;  2DL7 A;  1ARK A;  4JPB W;  2LJ3 A;  1VA7 A;  1KJW A;  3GBQ A;  2DL3 A;  2OAW A;  4J9F A;  3UAT A;  4CC7 A;  2XMF A;  2YUO A;  4RTT A;  1H3H A;  2KNB B;  3UF4 A;  1KIK A;  2BZY A;  3VS4 A;  2HBW A;  5EC7 A;  4Z89 A;  2NWM A;  2BZX A;  2MCN A;  1H92 A;  4J9E A;  4ESR A;  4LUE A;  2J05 A;  2DL4 A;  1Z9Q A;  2VKN A;  5ECA A;  3CQT A;  1H8K A;  2ABL A;  4GLM A;  3RBB B;  1AWX A;  4K11 A;  2LZ6 B;  2RF0 A;  2JMA A;  3M0R A;  1SHF A;  4CC2 A;  4GBQ A;  3FJ5 A;  1W6X A;  4JJD A;  2O88 A;  3EG0 A;  1RLP C;  2D0N A;  3KFV A;  3M0T A;  4Z8A A;  2K6D A;  2CT3 A;  1UDL A;  1WDX A;  1UUE A;  2OJ2 A;  4R0K A;  2IIM A;  2C0T A;  2EPD A;  2FPF A;  2JXB A;  1J3T A;  4JJB A;  1AVZ C;  4F17 A;  1AWW A;  4AG2 C;  2JM8 A;  2J7I A;  1ZUK A;  2KT8 A;  1UHF A;  2YUP A;  5FWC A;  3SEM A;  2PZ1 A;  1SHG A;  3NMZ C;  4RTV A;  1ZSG A;  2HCK A;  2CSQ A;  2RQR A;  3PVQ A;  1AOJ A;  3SHW A;  2HEQ A;  1UTI A;  3A98 A;  1QKX A;  1NEG A;  1WIE A;  3ULR B;  2K9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...