2KBTA

Attachment of an nmr-invisible solubility enhancement tag (inset) using a sortase-mediated protein ligation method
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
GPGTFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDYSEYLPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords chimera of Proto-oncogene vav, linker, Immunoglobulin G-bind
publication title Attachment of an NMR-invisible solubility enhancement tag using a sortase-mediated protein ligation method
pubmed doi rcsb
source organism Mus musculus, synthetic, streptococcus sp. 'group g'
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2008-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kbtA00
2O2OA 1H3HA 4J9FA 2C0TA 1KSWA 1E6HA 3KFVA 1SRMA 1M3AA 1B3QA 2F2WA 1K4US 2CH4W 2QDLA 2C0OA 2JW4A 2X3WD 1MUZA 4RTTA 2HSPA 3A98A 4JJBA 1WFWA 1CKBA 1MV0B 2K6DA 1K1ZA 4RTYA 3SHWA 2FPDA 4GBQA 1NEBA 2D1XA 1X6BA 2BZYA 2HEQA 3VS5A 2JMAA 2DBMA 2DM1A 2A28A 1K0XA 2FPFA 2M0YA 1G83A 1UUEA 2M51A 3I5RA 3REAB 1LCKA 2DL5A 3TVTA 3CQTA 2JS2A 3VRYA 4K11A 2L2PA 2EGEA 2I0NA 5FWCA 1PHTA 1RUWA 2RQUA 1YWOA 2YDLA 1W70A 5L23A 4R0KA 2CUBA 1K0SA 1GFDA 3NHNA 2DNUA 1AD5A 1WIEA 1H92A 3EG3A 3ULRB 2BZ8A 1KJWA 1JXMA 4HVWA 2C0IA 3U23A 1BU1A 2L3PA 4JJCA 4RTUA 1PNJA 2FO0A 4OMMA 1AEYA 1J3TA 3M0UA 2KT8A 1SSHA 3I5SA 1RI9A 2KGTA 1CSKA 2JXBA 4M4ZA 2E5KA 2X3XD 2DJQA 2RMOA 3EHRA 4JJDA 1I07A 2KRSA 5HCKA 1X6GA 2KNBB 4OMPA 2A08A 1NLOC 1X27A 5I22A 1U3OA 1RLPC 2JS0A 4LNPA 1VA7A 4ZNXA 2ED0A 1JQQA 1X43A 4AFZC 2FEIA 2LP5A 1S1NA 1K9AA 5IXBA 1Z9QA 1VYVA 2J7IA 2DL3A 1XOVA 1OPLA 2CT4A 2MOXA 1VYUA 1JXOA 2JM9A 1TG0A 2EBPA 2EYZA 1M30A 2LCSA 1NYFA 2YSQA 2YUOA 1UHCA 2CH4A 1HD3A 4J9IA 4EIKA 1SRLA 3M0RA 1I0CA 4J9HA 2RNAA 2K7AA 1BK2A 2EGAA 1HJDA 2MIOA 1WI7A 2EYXA 1SPKA 1WXUA 2ROTA 4J9GA 1GCPA 3EG0A 2ROLA 3QWYA 1OV3A 1M3BA 2F2VA 2D8JA 3IQLA 4D8KA 3UATA 2GTJA 2CT3A 2DYBA 1ZUUA 2EQIA 1AZEA 4AG2C 4LUDA 3UA7A 1WA7A 2O88A 1SEMA 2K9GA 2G6FX 4CC2A 4J9EA 1X69A 1ZX6A 1QLYA 3FJ5A 1EFNA 3EG1A 1ZUKA 4HXJA 1M8MA 2SRCA 1G2BA 1WXTA 1BB9A 2EKHA 5IH2A 5GJWB 2ABLA 2RPNA 2IIMA 2J6KA 2LJ0A 1N5ZA 4F17A 1T0HA 2JM8A 3M0SA 3LH5A 2F2XA 1UTIA 2YT6A 1WX6A 2DL8A 4J9BA 3O5ZA 2W0ZA 2VVKA 1V1CA 1K76A 2NUZA 1JEGA 1NG2A 2RQRA 3EGUA 5IHKA 3RNJA 2VWFA 1E6GA 2DLPA 4RTXA 4ESRA 2KE9A 2DA9A 2GTOA 1KFZA 1BBZA 4OMQA 3EHQA 1ZSGA 1AOJA 1YCSB 2KYMA 5FWBA 1GBRA 1UE9A 1UFFA 1I1JA 2YUPA 3VS7A 4AFUC 1AWXA 1AVZC 1GCQA 1QWEA 2FPEA 3QWXX 5IHNA 2LMJA 1AWOA 4ORZA 4Z8AA 2CUDA 1WLPB 2PNIA 1AWWA 1UHFA 4RTVA 1IO6A 4Z88A 2JTEA 2EYWA 2YUNA 1WXBA 2NWMA 2ECZA 3NGPA 2DRKA 1JU5C 1PKTA 2DILA 1QKWA 3C0CA 1YNZA 2CDTA 4J9DA 1NM7A 4JZ4A 3VS6A 3I35A 1GCQC 2OI3A 1VYTA 2HDAA 3R6NA 2OAWA 1W1FA 2EGCA 4FSSA 4IIOA 1T0JA 4J9CA 1M3CA 1B07A 1YP5A 4LUEA 1WYXA 3M0QA 1MV3A 2KRNA 1OOTA 4AFSC 2V1RA 2BTTA 2J6OA 4RTWA 4WCIA 2K3BA 1CKAA 1QKXA 2PZ1A 2J05A 3PVQA 2KT1A 2L3SA 1ABQA 5IXFA 1OEBA 1PRLC 3NMZC 4JZ3A 4AG1C 2RQWA 2KEAA 2O9SA 1ABOA 4HVVA 2CSIA 2K79A 3TSZA 4OMNA 2GQIA 1UJYA 4OMOA 2KXCA 2AZVA 2J06A 1ZUYA 2LZ6B 1Y57A 2D0NA 2CSQA 2RF0A 2MCNA 4DEYA 2A36A 4X1VA 2AK5A 5FW9A 2KYBA 3H0FA 2L3QA 2XMFA 3VS2A 2EW3A 3EG2A 2HBWA 3REBB 1Y0MA 2EYYA 1YWPA 1PRMC 4CC7A 1X2KA 1UJ0A 1SHFA 5GJVB 5ECAA 2D8HA 3JV3A 1AZGB 3VS4A 1T3SA 4HCKA 1QWFA 4CC3A 2AKLA 1FYNA 4LN2A 2RQVA 1T3LA 1NEGA 4Y92A 3I9QA 2KROA 1PKSA 1GL5A 2SEMA 2LQWA 2FG0A 2KR3A 2RN8A 2YUQA 1QCFA 1H8KA 3UA6A 2DX1A 1JO8A 1AWJA 1UG1A 1GRIA 1GFCA 2LJ1A 2RQTA 2P4RA 4IIMA 3VS3A 2KRMA 4F16A 2JT4A 2LQNA 2GBQA 1E7OA 4DEXA 1NYGA 1HSQA 4LE9A 2H8HA 4F14A 2DL4A 2DBKA 3ZL7C 2OJ2A 4D8DA 3H41A 1TUCA 2DRMA 2JMCA 2LJ3A 3NPFA 1M27C 2LX7A 2J6FA 3TSWA 2KXDA 4AFQC 5IHIA 1TUDA 4A63B 1WDXA 2EVRA 2ESWA 3SEMA 3M0TA 1ARKA 3UF4A 2GGRA 2AZSA 2ENMA 3VS1A 5I11A 1ZLMA 1NLPC 2PTKA 2GNCA 2AKKA 1W6XA 2DF6A 2V1QA 4CC4B 1UECA 1UDLA 2CREA 1GBQA 1X2QA 1ZBJA 2HCKA 2O9VA 1UGVA 4QT7A 2DMOA 1KIKA 3VS0A 1U5SA 1PWTA 1YN8A 2FRWA 3H0HA 3PVLA 2K2MA 2LNHB 2ED1A 4RUGA 1Z9ZA 2B86A 4HVUA 4KRTA 4RTZA 2VKNA 2KBTA 4OMLA 4GLMA 5EC7A 4JPBW 2DVJA 2FRYA 2DL7A 2BZXA 2EPDA 1FMKA 3GBQA 2L0AA 3THKA 4Z89A 4E6RA 3PE0A 2A37A 2W10A 3VRZA 2DE0X 1A0NB 1OPKA 1U06A 3M0PA 1RLQC 2O31A 1SHGA 3H0IA 3RBBB
chains in the Genus database with same CATH superfamily
4XTVA 2O2OA 2HL3A 2R5AA 4C8QG 1B7TA 4J9FA 5A0DA 1VQ6A 1M4ZA 3JCMe 2CZ6B 3KFVA 1SRMA 3QZ9B 2VV5A 4C0DC 2X4YA 3JCMJ 1M2OA 3MO8A 2C0OA 1W2BS 2JW4A 1MUZA 4F7UB 1OQKA 1W4SA 2M16A 2Y4YA 3A98A 2X51A 1WFWA 3G7ZA 3OYMA 4LDWA 3LH0A 1Q81C 4M78D 5CK9A 3OYLA 4M78B 4PJJA 3CMAT 4E7KA 1K1ZA 5LL6S 2FPDA 4GBQA 3CCLT 4A4FA 1NEBA 1WHMA 1X6BA 1IHVA 2BZYA 2JMAA 2QQAA 3X28B 1LCKA 2DL5A 2PVDB 3CQTA 2JS2A 2BKDN 3HRUA 1FMWA 5A2QE 3TREA 3EFOA 2RHYA 3JCMd 1KHIA 3VJPA 1RUWA 3HP9A 4M78F 1W70A 1I4K1 3EH1A 4F7UG 2CUBA 3A1PA 4KUIA 2DNUA 5DLOA 1AD5A 4M78G 3RKWA 1H92A 4HCBA 1Y96A 2YLCA 2BZ8A 4OMFB 1Q86R 1JXMA 2HNIA 1YJ9Q 5CQYA 4Q5WA 2E3HA 2DAQA 4RTUA 2FO0A 2EAYA 4OMMA 1AEYA 2KT8A 1P92A 2KGTA 1CSKA 3JB9I 1N8RR 5HCKA 3CD6T 2COWA 4DBQA 5I22A 1U3OA 2MF2A 2JS0A 4C0FA 2D0QB 3OW2S 2DIGA 2KMTA 2LP5A 4HT9A 1ZA2B 1N27A 2RHZA 2LRQA 2CP2A 1VYUA 4N0AA 1VQLQ 1MNEA 8ATCB 1SRLA 2BE7D 2RJFA 1BK2A 1YCYA 2MIOA 1SPKA 1WXUA 1Q81U 2D8JA 3IQLA 3M59A 4D8KA 3KXTA 4LUDA 3UA7A 2DK3A 3G4SQ 4QKUA 3UWNA 5CQXA 1KC8R 3LWHA 3RDVA 3OQ5A 1W2BP 1MMAA 3HPWA 1ZUKA 3QZ5B 2SRCA 3E9FA 2KAFA 2EFIA 1EIFA 1LJOA 1WXTA 2V26A 3JRZA 3OYHA 2ABLA 5C6SA 1T0HA 1G3TA 3M0SA 2D6FA 3OMCA 2YT6A 1VQ5Q 2VVKA 1V1CA 2JJ9A 1K76A 5LJ5f 2HQEA 2NUZA 2VGNA 2VASA 3JB9H 5GMKl 3EGUA 1I5OB 2XIDA 1D3BB 3NTKA 2KDSA 1K8AR 3JCMV 2K3YA 1C6VX 1Q86C 1ZSGA 1GBRA 5FWBA 5KYXB 1UE9A 3JSCA 1I1JA 2D9TA 2YUPA 2FYKA 3PGGA 5KYNA 3I56T 1AWXA 1ZHIA 1W2BA 2DEQA 2FPEA 2EWNA 1PD0A 5IAYA 1C0MA 1N8RC 3QPHA 3JAME 1YIJA 4RTVA 2YHTA 2HZYA 3A8MB 2MK5A 4D6WA 3CXCS 4ELZC 3FRNA 3X25B 4FYXB 1F1BB 1NM7A 4KBMB 2RI5A 1YITA 2OI3A 5CCAA 2Y90A 2HDAA 3R6NA 2OAWA 2EGCA 4FSSA 4L59A 1NPPA 2XHCA 1M3CA 4BD3A 1YP5A 4PKCC 3G6EA 2KRNA 2V1RA 3OYNA 4EDUA 4B6MA 4A54A 3E2UA 3PVQA 2ZCFB 4FCYA 1ABQA 1D0YA 4FYVB 1EZZB 2QI2A 3SWNA 2BE9B 2F5KA 5LJ5g 3LGFA 3QDFA 4LXCA 1TSFA 2RI2A 2O9SA 4KGZB 2OTJQ 3TU4K 3LWIA 4M75E 2CSIA 2K79A 3C94A 3T9NA 1KC8C 1G3YA 2LX9A 1YI2Q 4X1VA 2OX7A 2KYBA 8AT1B 1R0BG 2E5QA 3VS2A 1QP2A 3EG2A 2HBWA 2EYYA 2I2LA 5IT9E 4CC7A 1UJ0A 4UC4A 5GJVB 2DXTA 4HCKA 2YXYA 4BACA 1RAHB 3CCEQ 5LJ5e 1H3ZA 1Q86U 1YFNA 3I55A 2KROA 2SEMA 2LQWA 2KR3A 2QA4Q 4OVAA 2YUQA 3UA6A 1IHWA 1K8AC 1QMCA 2RJCA 5GAOl 5J3BA 1UG1A 2HKQB 3VS3A 4F16A 2JT4A 1N8RU 2K4YA 5LJ5j 2PQWA 5KH6A 2HL5C 2DL4A 1WHGA 4JRQA 2OJ2A 4C8QE 4D8DA 3OYEA 3H41A 2JUFA 1VQPA 2GCXA 3MEWA 1ZA1B 2ZAEA 1M1GA 1TUDA 4JJNK 2E4HA 2RA2A 2EVRA 2ESWA 5LJ5d 2QEXQ 3PFSA 3UF4A 1ZLMA 3TEEA 1UB4A 2X35A 3BDLA 2AKKA 3NTIA 4CC4B 4MZTA 1GBQA 1X2QA 1D1CA 4PNOA 5D6XA 2DMOA 1KIKA 3VS0A 4O6JA 1YIJT 4FL6A 2E65A 3CXCP 1PWTA 2FZGB 2L8DA 3L42A 2VYTA 2LNHB 4RUGA 1SSFA 2DL7A 2EPDA 3GBQA 4Z89A 4RKUE 4FW1A 3THKA 2W10A 3M53A 3EFOB 3VRZA 3M4GA 4Z02A 1YITT 1U06A 3M0PA 3HFNA 3OS0A 1YJ9A 1N6AA 2QDYB 2ZZDA 1QW1A 1KC8U 1QVGS 3G6ET 5CR2A 4M78E 5CKEA 1RL2A 1D1BA 1Y96B 1B3QA 2XDPA 1K4US 3GLXA 3VYHB 2DXCA 4EPCA 2LNVA 2HSPA 4DQ2A 2G3RA 3CXCA 4IUTA 4EMKC 3ASKA 3OYCA 2RB6A 1O75A 1LOJA 1ZSZC 3SHWA 4DOVA 4ANJA 4RG2A 2HEQA 3VS5A 2KQWA 3ZBDA 3URGA 2DBMA 3RUXA 2A28A 2CP5A 2MWOA 1IRXA 4RG8A 1AHJB 1K8AU 1VQLA 4E7IA 3TVTA 1TTHB 2DIQA 2FHDA 2L2PA 4ZTFA 4PJOD 2I0NA 2LQKA 1YJWT 1PHTA 1OI1A 2RQUA 3V7CA 5L23A 3CC2Q 1OU9A 1V29B 4R0KA 2DTHA 5KYUA 3S3NA 1WQ7A 2XKOC 4YTLA 4BE1A 1VQ9T 3EG3A 3ULRB 3CCRQ 4E47A 3DB3A 1TH7A 5J39A 2NUPA 3JCMQ 2H3JA 4BDYA 2C0IA 2LQ8A 4PJOF 4JJCA 1PNJA 2AT1B 3G4SA 1YJNQ 3QHSA 3QO3A 1BCOA 4GY5A 1VQKT 2E5KA 2X3XD 3EHRA 1MMDA 3HSBA 1OULA 4JJDA 1I07A 3H9NA 1G3SA 4JRKA 4M7DD 1X6GA 2KNBB 3BE3A 2A08A 1NLOC 2JTFA 1RAEB 5D6YA 4RMOA 1VA7A 4ZNXA 1JQQA 2QTXA 5GANf 4JS4A 3P8DA 1VIEA 2XG8D 1XOVA 1OPLA 2DETA 1YHQA 1VOMA 1JXOA 2JM9A 2ZGWA 1N9SA 2Z0WA 1MNDA 4M75C 3I55Q 2XU8A 2YSQA 2YUOA 2CH4A 4M7DF 4M7AD 4BUGA 4J9HA 2RNAA 3CCQQ 5HK0A 2EGAA 3G71Q 1WI7A 2H3EB 3CMEQ 1GCPA 4KH1B 1Q7YR 2ROLA 3QWYA 1WHHA 5DM7R 2RK2A 1QVGP 4B9XA 4E2FB 2CT3A 1YJ9T 2DYBA 1VQPQ 2EQIA 3MP6A 4AG2C 4J7IA 1WA7A 4M7AF 2PUOB 4PFZA 1VQOA 1X69A 1ZX6A 4J6XA 4KH0B 4BY6C 4LD6A 4C5GA 1EFNA 3EG1A 3LLRA 2JN0A 5AT1B 3CC7Q 5GJWB 4IKFA 3CC4Q 1N5ZA 1K9MR 2VXEA 1KQ1A 2F2XA 4KULA 4XTYA 3VV0A 3QJYA 1WX6A 2DL8A 2HSEB 4J9BA 2A0FB 4N4IA 3O5ZA 4NL2A 3CBPA 3G1JA 1G8XA 2PVOB 4AMCA 4XU0A 4C8QC 3CCVQ 5IHKA 5EG2A 3RNJA 3BDUA 1VQNQ 2DLPA 4J7FA 4RTXA 1VQLT 1QVGA 5GANg 3EFSA 3QUIA 3EHQA 4MDWA 1YCSB 1MHNA 2F69A 2OTJA 1JBMA 3JCMh 1AVZC 2JNGA 3SWNB 3CBOA 1UEBA 3META 1YI2A 6AT1B 2Y4XA 4OB2B 1U1TA 3S3MA 2LMJA 2DJZA 4II1A 2CUDA 1WLPB 1BI3A 2P0PA 1AWWA 3CMAQ 2JTEA 5GAN4 2EYWA 1QCOA 3S6WA 3CCLQ 1BI0A 4PL6A 4HA8A 4PJOA 2DILA 4LDXA 5GANe 5IN1A 2C06A 3MEUA 3QSUA 3CCEA 4JZ4A 3PTAA 3I35A 2DXBA 4PLIA 4M78C 5KE3A 1VQ8A 1VYTA 4PJLA 2QA4A 2E70A 2WACA 3OYAA 3MEAA 2A3LA 5D7UA 3M0QA 1VQ5T 2CZ7B 3O8VA 2J6OA 4RTWA 2RD1A 4ME7A 5A0GA 1CKAA 4C92D 5GANj 3L2WA 2L5QA 9ATCB 2J05A 1Q7YC 3M4YA 1X01A 4RCCA 1MMNA 5IXFA 1WGSA 3NMZC 1IB8A 1RACB 4AG1C 4JUVA 5FU7B 3GNGA 2XD0A 3RKYA 4Y91A 3UDCA 5GANd 1I5LA 4M7DA 1G3WA 1VQ6T 2KXCA 2DZ9A 2QEXA 1K73R 2OTLA 1ZUYA 2CSQA 2RF0A 4DEYA 1NE8A 3QBYA 2AK5A 4C92F 2PVGB 3MPUB 3H0FA 2L3QA 2E10A 1KHCA 2EW3A 1NBEB 1WHKA 2CP7A 4ZGEB 2V8JA 2PUKB 1X2KA 1OU8A 1K9MC 1SHFA 2QTVA 2QGFB 5ECAA 1AZGB 1T3SA 4CC3A 5FU6B 4M7AA 5GAOq 2RJEA 3MKDA 1YHQQ 1NEGA 4Y92A 1WHJA 2HMAA 3VUZA 1PG5B 4BI3A 1GL5A 2FG0A 4N4GA 1QCFA 1H8KA 3P8HA 3X24B 3OYJA 5KCOA 3J7AF 1GRIA 1Y71A 1VQ4A 1ZQ1A 2RQTA 2P4RA 1RAIB 4QVZA 4QVCA 5CO7A 2KRMA 3MEVA 1PM3A 1UGPB 3OBWA 3H8ZA 2LQNA 5GAOp 3OYBA 1FXXA 1HSQA 4F14A 2H8HA 1OX9A 4QVDA 3ZL7C 2EQUA 2ZPEB 1TUCA 3GIBA 5C0MA 3JCMP 3TSWA 2X4XA 4J6WA 2RO0A 2YRDA 3RERA 2GFUA 2VB6A 2DTOA 2EIFA 1WDXA 3ER0A 1VQOQ 1UGRB 1ARKA 1WJQA 2ENMA 3VS1A 2FL7A 2QXFA 1NLPC 4OGEA 5HY6A 2GNCA 4C5IA 5FU7C 1W6XA 2V1QA 3OBYA 1UECA 1R0CB 3JCMc 4XTZA 4WF2A 4QT7A 3QJ6A 1WJSA 3V8KA 3OW2P 3M55A 4IUVA 1VUBA 3MP8A 3MCAB 1Y7XA 2B86A 4KRTA 3CC2A 3PIPA 3EGXA 1Q7YU 1FMKA 2L0AA 4ZN3A 4J6YA 3CCET 2QG9B 3H6ZA 4FSXA 2DE0X 3CCRA 2QA4T 1RLQC 2O31A 5KYUB 5FU6C 2CYZB 3H0IA 2ZPBB 1VQ7Q 1B34A 1H3HA 1YJNA 1WNLA 1KSWA 3OY9A 2P0QA 3RR6A 3QIIA 3ME9A 4C0GA 5KYYA 1TOVA 2JZ2A 2NUPB 1K73C 2F2WA 1V76A 4PLLA 2QDLA 2K5FA 1JB0E 4J8OA 1K9MU 2X3WD 4RTTA 1FMVA 3OW2A 1NJIR 5I2SA 5I21A 1MV0B 4LDYA 3L2RA 3OSSC 4PJOE 3DKMA 2K6DA 4RTYA 2DVEA 2DPPB 4FYWB 3A8LB 2VGMA 3HTRA 4EMHA 1SG5A 3JB9D 3WVDB 1K0XA 2FPFA 3GNFB 1C1AA 1UUEA 2M51A 3I5RA 3REAB 1MMGA 1VQ8Q 2JVVA 5HK3A 2E3IA 4C92A 4ATOA 2EGEA 1I81A 3RIRA 4XU1A 5FWCA 2EJGA 1R77A 1LNXA 3CCQA 4XU3A 3G71A 1K0SA 3CPFA 4XK8E 1KG1A 3NHNA 3CMEA 1WIEA 3L1AA 3OB9A 4FW2A 3V8LA 3JB9F 5GMKj 1RAFB 1IXDA 1KJWA 3SDZA 3RESA 2K5IA 4M7DE 3U23A 3HRTA 2L3PA 3JB9G 4NL3A 5DLQE 4HCZA 1X6OA 3M0UA 4O5VA 3X26B 1SSHA 2OTLQ 3I5SA 1SKUB 1WQWA 2JXBA 2KRSA 3M9QA 2MPXC 1MGQA 3CC7A 4OMPA 4J5YA 3A5ZB 3CC4A 3FB9A 1RADB 1GXIE 4M7AE 4X34A 4R56A 2EQMA 2DXUA 3PMTA 3CCSA 1S1NA 4N4HA 3FEOA 4J83A 5LJ5h 1M2VA 1VYVA 2J7IA 2MAMA 2CT4A 3CCVA 1KD1R 3X20B 3SFMA 1VQNA 2EBPA 3CCUQ 1M30A 2VC8A 2CZ0B 5FROA 5L8RE 1UHCA 3OYKA 4E7HA 2BIVA 4MZPA 1HD3A 2QQ9A 3CCJA 4EIKA 2E1HA 3NTHA 2GF7A 3M0RA 4AT1B 1VQ4Q 4WTOB 4DOWA 1VQMQ 2RHXA 3OYFA 1K73U 2DD5A 5GAN6 1OX8A 2E41A 1HJDA 2EYXA 2K2VA 2X4JA 3EG0A 1M1KR 2V8IA 1OV3A 1M3BA 4TVRA 4A4EA 3EGDA 3CCRT 3LGLA 1PSFA 2E12A 3UATA 4M77D 1NJIC 2O88A 4XTWA 2K9GA 2VXFA 3CMAA 1OYXA 1YJNT 3CCLA 4OB1B 4BE0A 4J9EA 5GMKi 4XQ3A 2WSCE 3L2VA 2ZPIB 2P84A 2CP6A 3AHUA 2F5TX 3EG9A 3VKIA 4PFOA 1BB9A 2EKHA 5GAOm 2RPNA 2DYIA 2J6KA 4X9DA 4F17A 2JM8A 3LH5A 4M77F 5GAN7 4PJOB 1JRIA 4V2SA 5J26A 3CCMQ 3EAEA 2DZCA 3OYGA 4QQDA 2EJ9A 1JEGA 1QQJA 2RQRA 4XTXA 1WPYA 2VWFA 1E6GA 2NLUA 4BB7A 4ESRA 3I55T 4F04B 1Q82R 2GTOA 1KFZA 1LVKA 4C0DB 1BBZA 4OMQA 3LYIA 2KYMA 3TQ7P 3VS7A 3CCQT 4AFUC 3G71T 3FJPA 1GCQA 2FB7A 3QWXX 4PJOG 3A8GB 1PC0A 4XTUA 1I8FA 4GLKA 2MWPA 4ZGDB 2YRVA 1AWOA 3DLLA 2FZCB 3CD6A 1D0ZA 3FDRA 4M7DB 1VQPT 3OS5A 4CRIA 1X75C 4E7JA 4JS5A 4PFPA 2NWMA 2ECZA 3NGPA 1JU5C 2DD4A 3CBMA 1PKTA 3C0CA 4MMLA 4C92E 2DFUA 4J9DA 2HQXA 2LCLA 1KD1C 4MZMA 2LDMA 3OYDA 3CC7T 2R57A 2L89A 5FRNA 4ZGJB 4BE2A 4IIOA 1ACMB 4M7AB 1B07A 2E64A 2DO3A 4JRPA 1D0XA 5GAN5 3QYGB 4JLIA 3KUFA 1D09B 4M7DG 2K3BA 3AT1B 5KYWA 2PZ1A 1VQ9Q 1VQNT 2KSSA 4EMKA 4PJOC 1NJIU 2K3XA 1M1KC 4QQGA 4JZ3A 1RAAB 1ZSZA 2RQWA 4IUPA 4DBRA 4N0AC 2EQJA 1S72Q 1KK7A 2KEAA 5GAMf 5LJ3f 2NUTA 3TSZA 4OMNA 2LC4A 3OS2A 3N5BB 1UJYA 4BI4A 2AHJB 4OMOA 2F1LA 2AZVA 3SD4A 3FLGA 2LZ6B 1VQKQ 2O4XA 2D0NA 2MCNA 2A36A 3CPWS 4M7AG 3DLMA 5FW9A 2EJFA 2HQHA 2RHUA 3M5AA 1XQHA 4KGXB 2JOYA 5CAIA 3L2QA 1TU0B 1PRMC 3V8JA 2FVUA 5GAOn 2D8HA 3ZEHA 1WZOA 5CVIA 3CCSQ 2KVQG 2X4WA 1QWFA 2PU9B 3GOXA 4M7DC 1T3LA 1NPRA 3I9QA 1M90R 3OMGA 4E7LA 3C4SA 1JJ2S 4F7UF 1PKSA 2RN8A 2L3RA 5GAOr 1Q82C 3EGXB 2XICA 3HL8A 3CCJQ 2DX1A 1JO8A 1AWJA 2WSEE 2LJ1A 1VQ7A 3I56A 1OZ3A 2QAZA 4M77A 3BW1A 3PIOA 1QVPA 2K57A 1NYGA 3M57A 4M7AC 1XTDA 3E9GA 2DBKA 2K5LA 1B34B 5CKHA 3HRSA 2DRMA 2JMCA 2LJ3A 4LDVA 1BI1A 1M27C 3FC3A 2J6FA 2KXDA 1KQSS 5KYYB 4AFQC 1NZ9A 5IHIA 3G4ST 4A63B 3M0TA 2GGRA 2AZSA 4M75A 5I11A 1KD1U 3MJXA 3PT9A 1IREB 1O9SA 5GAMg 5LJ3g 2COZA 4RCBA 2DF6A 1UDLA 3HFOA 4MMKA 1TWBA 2ED1A 4BI8B 4HVUA 1Y07A 2VKNA 2KBTA 3TCJA 4OMLA 4GLMA 4JPBW 2CZ1B 2DVJA 4OF1A 2BZXA 4IURA 1M1KU 5CIUA 3J81E 1YHQT 3F70A 4C92B 1QCNA 3SB2A 3Q1JA 5GAN3 4C5HA 3OYYA 2AIRB 3JCMX 1WJRA 5GAMe 2C0TA 5LJ3e 1E6HA 1M3AA 3QXEB 2E6ZA 2CH4W 2RK1A 1RAGB 3CD6Q 4JJBA 1CKBA 5D6WA 4C92G 3SWNC 4C5EA 4C8QA 1U1SA 3CPWP 2KI7A 1VQOT 2D1XA 5GAMj 4DBFA 5GANh 5LJ3j 3WXMB 3M56A 3E1SA 3GP8A 2V8KA 2DM1A 4ZN1A 4FM4B 1BIAA 2M0YA 1G83A 1Q82U 2COYA 3QYHB 3EFRA 3CCUA 3VRYA 1M90C 4K11A 2YRCA 5GAMd 1HK9A 5LJ3d 1M2VB 1YWOA 2YDLA 1VQMA 1SF9A 2IG0A 1GFDA 1JJ2P 2CP3A 3P8BB 2P0KA 1FWZA 4VUBA 2ZPHB 4OGCA 4A4GA 3R6OA 4HVWA 1BU1A 4PJNA 5GAMh 2A7YA 1PD1A 5LJ3h 2OTJT 3CPWA 4F7UA 1QP3A 2CS7A 4C92C 1VQ7T 1VQ6Q 1J3TA 2EQKA 1PSEA 2M02A 1RI9A 3EGDB 4M78A 2MYSA 4M4ZA 1YI2T 1HXDA 2DJQA 2RMOA 1BKBA 2DERA 1KQSP 3MP1A 1X27A 3INZA 4DA4A 1RLPC 4LNPA 4PK4A 2ED0A 1X43A 4BDZA 4AFZC 1LPLA 2FEIA 2YWWA 1M9SA 3CCMA 3EG9B 1K9AA 5IXBA 1JJ2A 1Z9QA 2O01E 2DL3A 4C0ZA 2MOXA 1N9RA 3QG1A 3JB9J 1TG0A 2EYZA 2LCSA 1VQ8T 1NYFA 3M54A 2GFAA 4J9IA 4M77E 1I0CA 1HYOA 3V7RA 2K7AA 3I56Q 5FLXE 3PMIA 1TUGB 1QVFS 2ROTA 2NYSA 3A8OB 4J9GA 3FIFA 2RM4A 2CP0A 1KQSA 2F2VA 4HKEA 2GTJA 1ZUUA 1AZEA 4OB3B 3GF5A 3J80E 1SEMA 2R58A 2G6FX 4CC2A 3S3OA 2RH2A 2XDBA 5CKFA 5GMKm 2OTLT 2HKNA 4FIBA 2QEXT 2LT4A 1QLYA 3FJ5A 7AT1B 4E7ZA 1M5Q1 1M90U 4L5GA 4HXJA 1M8MA 3EH2A 1G2BA 3CEYA 2XI9A 4B9WA 5IH2A 5GMKe 2IIMA 2LJ0A 4JDSA 5AYFA 4P5NA 1UTIA 1YJWA 1EX4A 5KE2A 3V7SA 2R5MA 3BFMA 2W0ZA 4ELYC 1NG2A 4DBHA 1VIFA 1VQ9A 3RMQA 2KE9A 3CCUT 2OAUA 2DA9A 1WHLA 4JRIA 1AOJA 1S72A 2KK4A 3JCMb 1UFFA 3RBBB 1VQ4T 5I2MA 2MI6A 5KYWB 1VQMT 1TXQA 3GPLA 4OP0A 2M0OA 4EMKB 1M1FA 4X9CA 2QQSA 5FRMA 2P4TA 1QWEA 2QQBA 3PNWC 4XAXB 1VQKA 5IHNA 1ZSZB 1BIBA 3KBGA 1RI0A 4ORZA 4Z8AA 2M1HA 4Y28E 5HKCA 2NUTB 3NFCA 4R55A 2DKGA 2PNIA 4HCCA 1UHFA 1IO6A 4Z88A 2O4XB 4XU2A 4MDXA 4FU6A 2YUNA 1WXBA 4ZTJA 2DRKA 1QKWA 4A4HA 5GMKh 1YNZA 2CGHA 2CDTA 3VS6A 5KCHA 4KUDK 1GCQC 1ZBXA 5GAN2 3OYIA 1D3BA 1W1FA 4PJMA 3RKXA 1T0JA 4J9CA 2KY9A 4LUEA 1WYXA 1MV3A 3CC2T 1OOTA 4AFSC 3CCMT 3ZFJA 2BTTA 2LVMA 5CKBA 3BY7A 2CKKA 2EYQA 4KT0E 2QQRA 2WSFE 4WCIA 5KYXA 2LTOA 4FT4A 1BI2A 2LCCA 3C12A 5CKDA 1QKXA 2RHIA 1DJ7B 2KT1A 2L3SA 2E6NA 1OEBA 1PRLC 4F7UE 3OA6A 3QDRB 4CI0C 3L2UA 1ABOA 5DY9A 4M77B 4HVVA 1BYMA 3JCMf 1QVFP 2GQIA 2YLBA 2J06A 2ZPFB 1Y57A 2DTIA 3DB4A 1IZ6A 2BUDA 1KQ2A 2XMFA 3JCMW 2FZKB 2QASA 1Q81R 3REBB 1Y0MA 3UPUA 1YWPA 1YIJQ 4M75D 2EKOA 4OB0B 2HD0A 4M75B 5GAN8 1UGSB 3JV3A 2VUBA 3VS4A 4A53A 2IPOB 2RJDA 3MHXA 4IUUA 1XJWB 2AKLA 1FYNA 4LN2A 4M77G 2JTMA 2RQVA 3D7SB 2QYZA 1YITQ 3VUBA 3HHTB 1XNIA 3UT1A 2B8AA 2GQVA 1IGUA 4L6V5 2MMPA 1QVFA 4M75F 3G6EQ 1GFCA 1RABB 3VU3C 4IIMA 4IUQA 4A4KA 4JLGA 2QGGA 1AT1B 4E7SA 2LT1A 4M75G 3OS1A 3CMET 1M8VA 2GBQA 1E7OA 4DEXA 4LE9A 1TS9A 4NS5A 4BY6B 3RMSA 1IGQA 4QQ6A 3LX7A 2X9HA 2ZPGB 3NPFA 1Q95G 1S72T 2LX7A 2DEUA 3WVEB 3E19A 4EMGA 4HT8A 2M9UA 3SEMA 5A0LA 3A8HB 2PTKA 1D1AA 3OSVA 3LW5E 3JCMg 4M77C 1FX7A 4C8QD 2CREA 2O9VA 2HCKA 1ZBJA 4C8QB 1UGVA 1UGQB 1U8RA 3CC4T 1U5SA 1R8OB 2XDDA 2HBPA 1YN8A 1YJWQ 2FRWA 2XK0A 3H0HA 3PVLA 2HAXA 2K2MA 4RTZA 1Z9ZA 4KGVB 4FYYB 4FT2A 4LDUA 4NOYA 1VQ5A 1G5VA 5EC7A 3CCST 2FRYA 5M9OA 1H641 2QK0A 4QW2A 4LD9K 4E6RA 3L2ZA 1BCMA 2ATCB 2RI3A 3PE0A 3QKJA 2A37A 3CCVT 3VYGA 1A0NB 1OPKA 4C8QF 1YBYA 1OZ2A 3CCJT 1PCXA 1SHGA 3HKSA 3M58A 2IVWA 3C95A
chains in the Genus database with same CATH topology
2O2OA 1H3HA 4J9FA 2C0TA 1KSWA 1E6HA 3KFVA 1SRMA 1M3AA 1B3QA 2F2WA 1K4US 2CH4W 2QDLA 2C0OA 2JW4A 2X3WD 1MUZA 4RTTA 2HSPA 3A98A 4JJBA 1WFWA 1CKBA 1MV0B 2K6DA 1K1ZA 4RTYA 3SHWA 2FPDA 4GBQA 1NEBA 2D1XA 1X6BA 2BZYA 2HEQA 3VS5A 2JMAA 2DBMA 2DM1A 2A28A 1K0XA 2FPFA 2M0YA 1G83A 1UUEA 2M51A 3I5RA 3REAB 1LCKA 2DL5A 3TVTA 3CQTA 2JS2A 3VRYA 4K11A 2L2PA 2EGEA 2I0NA 5FWCA 1PHTA 1RUWA 2RQUA 1YWOA 2YDLA 1W70A 5L23A 4R0KA 2CUBA 1K0SA 1GFDA 3NHNA 2DNUA 1AD5A 1WIEA 1H92A 3EG3A 3ULRB 2BZ8A 1KJWA 1JXMA 4HVWA 2C0IA 3U23A 1BU1A 2L3PA 4JJCA 4RTUA 1PNJA 2FO0A 4OMMA 1AEYA 1J3TA 3M0UA 2KT8A 1SSHA 3I5SA 1RI9A 2KGTA 1CSKA 2JXBA 4M4ZA 2E5KA 2X3XD 2DJQA 2RMOA 3EHRA 4JJDA 1I07A 2KRSA 5HCKA 1X6GA 2KNBB 4OMPA 2A08A 1NLOC 1X27A 5I22A 1U3OA 1RLPC 2JS0A 4LNPA 1VA7A 4ZNXA 2ED0A 1JQQA 1X43A 4AFZC 2FEIA 2LP5A 1S1NA 1K9AA 5IXBA 1Z9QA 1VYVA 2J7IA 2DL3A 1XOVA 1OPLA 2CT4A 2MOXA 1VYUA 1JXOA 2JM9A 1TG0A 2EBPA 2EYZA 1M30A 2LCSA 1NYFA 2YSQA 2YUOA 1UHCA 2CH4A 1HD3A 4J9IA 4EIKA 1SRLA 3M0RA 1I0CA 4J9HA 2RNAA 2K7AA 1BK2A 2EGAA 1HJDA 2MIOA 1WI7A 2EYXA 1SPKA 1WXUA 2ROTA 4J9GA 1GCPA 3EG0A 2ROLA 3QWYA 1OV3A 1M3BA 2F2VA 2D8JA 3IQLA 4D8KA 3UATA 2GTJA 2CT3A 2DYBA 1ZUUA 2EQIA 1AZEA 4AG2C 4LUDA 3UA7A 1WA7A 2O88A 1SEMA 2K9GA 2G6FX 4CC2A 4J9EA 1X69A 1ZX6A 1QLYA 3FJ5A 1EFNA 3EG1A 1ZUKA 4HXJA 1M8MA 2SRCA 1G2BA 1WXTA 1BB9A 2EKHA 5IH2A 5GJWB 2ABLA 2RPNA 2IIMA 2J6KA 2LJ0A 1N5ZA 4F17A 1T0HA 2JM8A 3M0SA 3LH5A 2F2XA 1UTIA 2YT6A 1WX6A 2DL8A 4J9BA 3O5ZA 2W0ZA 2VVKA 1V1CA 1K76A 2NUZA 1JEGA 1NG2A 2RQRA 3EGUA 5IHKA 3RNJA 2VWFA 1E6GA 2DLPA 4RTXA 4ESRA 2KE9A 2DA9A 2GTOA 1KFZA 1BBZA 4OMQA 3EHQA 1ZSGA 1AOJA 1YCSB 2KYMA 5FWBA 1GBRA 1UE9A 1UFFA 1I1JA 2YUPA 3VS7A 4AFUC 1AWXA 1AVZC 1GCQA 1QWEA 2FPEA 3QWXX 5IHNA 2LMJA 1AWOA 4ORZA 4Z8AA 2CUDA 1WLPB 2PNIA 1AWWA 1UHFA 4RTVA 1IO6A 4Z88A 2JTEA 2EYWA 2YUNA 1WXBA 2NWMA 2ECZA 3NGPA 2DRKA 1JU5C 1PKTA 2DILA 1QKWA 3C0CA 1YNZA 2CDTA 4J9DA 1NM7A 4JZ4A 3VS6A 3I35A 1GCQC 2OI3A 1VYTA 2HDAA 3R6NA 2OAWA 1W1FA 2EGCA 4FSSA 4IIOA 1T0JA 4J9CA 1M3CA 1B07A 1YP5A 4LUEA 1WYXA 3M0QA 1MV3A 2KRNA 1OOTA 4AFSC 2V1RA 2BTTA 2J6OA 4RTWA 4WCIA 2K3BA 1CKAA 1QKXA 2PZ1A 2J05A 3PVQA 2KT1A 2L3SA 1ABQA 5IXFA 1OEBA 1PRLC 3NMZC 4JZ3A 4AG1C 2RQWA 2KEAA 2O9SA 1ABOA 4HVVA 2CSIA 2K79A 3TSZA 4OMNA 2GQIA 1UJYA 4OMOA 2KXCA 2AZVA 2J06A 1ZUYA 2LZ6B 1Y57A 2D0NA 2CSQA 2RF0A 2MCNA 4DEYA 2A36A 4X1VA 2AK5A 5FW9A 2KYBA 3H0FA 2L3QA 2XMFA 3VS2A 2EW3A 3EG2A 2HBWA 3REBB 1Y0MA 2EYYA 1YWPA 1PRMC 4CC7A 1X2KA 1UJ0A 1SHFA 5GJVB 5ECAA 2D8HA 3JV3A 1AZGB 3VS4A 1T3SA 4HCKA 1QWFA 4CC3A 2AKLA 1FYNA 4LN2A 2RQVA 1T3LA 1NEGA 4Y92A 3I9QA 2KROA 1PKSA 1GL5A 2SEMA 2LQWA 2FG0A 2KR3A 2RN8A 2YUQA 1QCFA 1H8KA 3UA6A 2DX1A 1JO8A 1AWJA 1UG1A 1GRIA 1GFCA 2LJ1A 2RQTA 2P4RA 4IIMA 3VS3A 2KRMA 4F16A 2JT4A 2LQNA 2GBQA 1E7OA 4DEXA 1NYGA 1HSQA 4LE9A 2H8HA 4F14A 2DL4A 2DBKA 3ZL7C 2OJ2A 4D8DA 3H41A 1TUCA 2DRMA 2JMCA 2LJ3A 3NPFA 1M27C 2LX7A 2J6FA 3TSWA 2KXDA 4AFQC 5IHIA 1TUDA 4A63B 1WDXA 2EVRA 2ESWA 3SEMA 3M0TA 1ARKA 3UF4A 2GGRA 2AZSA 2ENMA 3VS1A 5I11A 1ZLMA 1NLPC 2PTKA 2GNCA 2AKKA 1W6XA 2DF6A 2V1QA 4CC4B 1UECA 1UDLA 2CREA 1GBQA 1X2QA 1ZBJA 2HCKA 2O9VA 1UGVA 4QT7A 2DMOA 1KIKA 3VS0A 1U5SA 1PWTA 1YN8A 2FRWA 3H0HA 3PVLA 2K2MA 2LNHB 2ED1A 4RUGA 1Z9ZA 2B86A 4HVUA 4KRTA 4RTZA 2VKNA 2KBTA 4OMLA 4GLMA 5EC7A 4JPBW 2DVJA 2FRYA 2DL7A 2BZXA 2EPDA 1FMKA 3GBQA 2L0AA 3THKA 4Z89A 4E6RA 3PE0A 2A37A 2W10A 3VRZA 2DE0X 1A0NB 1OPKA 1U06A 3M0PA 1RLQC 2O31A 1SHGA 3H0IA 3RBBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2O A;  1H3H A;  4J9F A;  2C0T A;  1KSW A;  1E6H A;  3KFV A;  1SRM A;  1M3A A;  1B3Q A;  2F2W A;  1K4U S;  2CH4 W;  2QDL A;  2C0O A;  2JW4 A;  2X3W D;  1MUZ A;  4RTT A;  2HSP A;  3A98 A;  4JJB A;  1WFW A;  1CKB A;  1MV0 B;  2K6D A;  1K1Z A;  4RTY A;  3SHW A;  2FPD A;  4GBQ A;  1NEB A;  2D1X A;  1X6B A;  2BZY A;  2HEQ A;  3VS5 A;  2JMA A;  2DBM A;  2DM1 A;  2A28 A;  1K0X A;  2FPF A;  2M0Y A;  1G83 A;  1UUE A;  2M51 A;  3I5R A;  3REA B;  1LCK A;  2DL5 A;  3TVT A;  3CQT A;  2JS2 A;  3VRY A;  4K11 A;  2L2P A;  2EGE A;  2I0N A;  5FWC A;  1PHT A;  1RUW A;  2RQU A;  1YWO A;  2YDL A;  1W70 A;  5L23 A;  4R0K A;  2CUB A;  1K0S A;  1GFD A;  3NHN A;  2DNU A;  1AD5 A;  1WIE A;  1H92 A;  3EG3 A;  3ULR B;  2BZ8 A;  1KJW A;  1JXM A;  4HVW A;  2C0I A;  3U23 A;  1BU1 A;  2L3P A;  4JJC A;  4RTU A;  1PNJ A;  2FO0 A;  4OMM A;  1AEY A;  1J3T A;  3M0U A;  2KT8 A;  1SSH A;  3I5S A;  1RI9 A;  2KGT A;  1CSK A;  2JXB A;  4M4Z A;  2E5K A;  2X3X D;  2DJQ A;  2RMO A;  3EHR A;  4JJD A;  1I07 A;  2KRS A;  5HCK A;  1X6G A;  2KNB B;  4OMP A;  2A08 A;  1NLO C;  1X27 A;  5I22 A;  1U3O A;  1RLP C;  2JS0 A;  4LNP A;  1VA7 A;  4ZNX A;  2ED0 A;  1JQQ A;  1X43 A;  4AFZ C;  2FEI A;  2LP5 A;  1S1N A;  1K9A A;  5IXB A;  1Z9Q A;  1VYV A;  2J7I A;  2DL3 A;  1XOV A;  1OPL A;  2CT4 A;  2MOX A;  1VYU A;  1JXO A;  2JM9 A;  1TG0 A;  2EBP A;  2EYZ A;  1M30 A;  2LCS A;  1NYF A;  2YSQ A;  2YUO A;  1UHC A;  2CH4 A;  1HD3 A;  4J9I A;  4EIK A;  1SRL A;  3M0R A;  1I0C A;  4J9H A;  2RNA A;  2K7A A;  1BK2 A;  2EGA A;  1HJD A;  2MIO A;  1WI7 A;  2EYX A;  1SPK A;  1WXU A;  2ROT A;  4J9G A;  1GCP A;  3EG0 A;  2ROL A;  3QWY A;  1OV3 A;  1M3B A;  2F2V A;  2D8J A;  3IQL A;  4D8K A;  3UAT A;  2GTJ A;  2CT3 A;  2DYB A;  1ZUU A;  2EQI A;  1AZE A;  4AG2 C;  4LUD A;  3UA7 A;  1WA7 A;  2O88 A;  1SEM A;  2K9G A;  2G6F X;  4CC2 A;  4J9E A;  1X69 A;  1ZX6 A;  1QLY A;  3FJ5 A;  1EFN A;  3EG1 A;  1ZUK A;  4HXJ A;  1M8M A;  2SRC A;  1G2B A;  1WXT A;  1BB9 A;  2EKH A;  5IH2 A;  5GJW B;  2ABL A;  2RPN A;  2IIM A;  2J6K A;  2LJ0 A;  1N5Z A;  4F17 A;  1T0H A;  2JM8 A;  3M0S A;  3LH5 A;  2F2X A;  1UTI A;  2YT6 A;  1WX6 A;  2DL8 A;  4J9B A;  3O5Z A;  2W0Z A;  2VVK A;  1V1C A;  1K76 A;  2NUZ A;  1JEG A;  1NG2 A;  2RQR A;  3EGU A;  5IHK A;  3RNJ A;  2VWF A;  1E6G A;  2DLP A;  4RTX A;  4ESR A;  2KE9 A;  2DA9 A;  2GTO A;  1KFZ A;  1BBZ A;  4OMQ A;  3EHQ A;  1ZSG A;  1AOJ A;  1YCS B;  2KYM A;  5FWB A;  1GBR A;  1UE9 A;  1UFF A;  1I1J A;  2YUP A;  3VS7 A;  4AFU C;  1AWX A;  1AVZ C;  1GCQ A;  1QWE A;  2FPE A;  3QWX X;  5IHN A;  2LMJ A;  1AWO A;  4ORZ A;  4Z8A A;  2CUD A;  1WLP B;  2PNI A;  1AWW A;  1UHF A;  4RTV A;  1IO6 A;  4Z88 A;  2JTE A;  2EYW A;  2YUN A;  1WXB A;  2NWM A;  2ECZ A;  3NGP A;  2DRK A;  1JU5 C;  1PKT A;  2DIL A;  1QKW A;  3C0C A;  1YNZ A;  2CDT A;  4J9D A;  1NM7 A;  4JZ4 A;  3VS6 A;  3I35 A;  1GCQ C;  2OI3 A;  1VYT A;  2HDA A;  3R6N A;  2OAW A;  1W1F A;  2EGC A;  4FSS A;  4IIO A;  1T0J A;  4J9C A;  1M3C A;  1B07 A;  1YP5 A;  4LUE A;  1WYX A;  3M0Q A;  1MV3 A;  2KRN A;  1OOT A;  4AFS C;  2V1R A;  2BTT A;  2J6O A;  4RTW A;  4WCI A;  2K3B A;  1CKA A;  1QKX A;  2PZ1 A;  2J05 A;  3PVQ A;  2KT1 A;  2L3S A;  1ABQ A;  5IXF A;  1OEB A;  1PRL C;  3NMZ C;  4JZ3 A;  4AG1 C;  2RQW A;  2KEA A;  2O9S A;  1ABO A;  4HVV A;  2CSI A;  2K79 A;  3TSZ A;  4OMN A;  2GQI A;  1UJY A;  4OMO A;  2KXC A;  2AZV A;  2J06 A;  1ZUY A;  2LZ6 B;  1Y57 A;  2D0N A;  2CSQ A;  2RF0 A;  2MCN A;  4DEY A;  2A36 A;  4X1V A;  2AK5 A;  5FW9 A;  2KYB A;  3H0F A;  2L3Q A;  2XMF A;  3VS2 A;  2EW3 A;  3EG2 A;  2HBW A;  3REB B;  1Y0M A;  2EYY A;  1YWP A;  1PRM C;  4CC7 A;  1X2K A;  1UJ0 A;  1SHF A;  5GJV B;  5ECA A;  2D8H A;  3JV3 A;  1AZG B;  3VS4 A;  1T3S A;  4HCK A;  1QWF A;  4CC3 A;  2AKL A;  1FYN A;  4LN2 A;  2RQV A;  1T3L A;  1NEG A;  4Y92 A;  3I9Q A;  2KRO A;  1PKS A;  1GL5 A;  2SEM A;  2LQW A;  2FG0 A;  2KR3 A;  2RN8 A;  2YUQ A;  1QCF A;  1H8K A;  3UA6 A;  2DX1 A;  1JO8 A;  1AWJ A;  1UG1 A;  1GRI A;  1GFC A;  2LJ1 A;  2RQT A;  2P4R A;  4IIM A;  3VS3 A;  2KRM A;  4F16 A;  2JT4 A;  2LQN A;  2GBQ A;  1E7O A;  4DEX A;  1NYG A;  1HSQ A;  4LE9 A;  2H8H A;  4F14 A;  2DL4 A;  2DBK A;  3ZL7 C;  2OJ2 A;  4D8D A;  3H41 A;  1TUC A;  2DRM A;  2JMC A;  2LJ3 A;  3NPF A;  1M27 C;  2LX7 A;  2J6F A;  3TSW A;  2KXD A;  4AFQ C;  5IHI A;  1TUD A;  4A63 B;  1WDX A;  2EVR A;  2ESW A;  3SEM A;  3M0T A;  1ARK A;  3UF4 A;  2GGR A;  2AZS A;  2ENM A;  3VS1 A;  5I11 A;  1ZLM A;  1NLP C;  2PTK A;  2GNC A;  2AKK A;  1W6X A;  2DF6 A;  2V1Q A;  4CC4 B;  1UEC A;  1UDL A;  2CRE A;  1GBQ A;  1X2Q A;  1ZBJ A;  2HCK A;  2O9V A;  1UGV A;  4QT7 A;  2DMO A;  1KIK A;  3VS0 A;  1U5S A;  1PWT A;  1YN8 A;  2FRW A;  3H0H A;  3PVL A;  2K2M A;  2LNH B;  2ED1 A;  4RUG A;  1Z9Z A;  2B86 A;  4HVU A;  4KRT A;  4RTZ A;  2VKN A;  2KBT A;  4OML A;  4GLM A;  5EC7 A;  4JPB W;  2DVJ A;  2FRY A;  2DL7 A;  2BZX A;  2EPD A;  1FMK A;  3GBQ A;  2L0A A;  3THK A;  4Z89 A;  4E6R A;  3PE0 A;  2A37 A;  2W10 A;  3VRZ A;  2DE0 X;  1A0N B;  1OPK A;  1U06 A;  3M0P A;  1RLQ C;  2O31 A;  1SHG A;  3H0I A;  3RBB B; 
#chains in the Genus database with same CATH topology
 4XTV A;  2O2O A;  2HL3 A;  2R5A A;  4C8Q G;  1B7T A;  4J9F A;  5A0D A;  1VQ6 A;  1M4Z A;  3JCM e;  2CZ6 B;  3KFV A;  1SRM A;  3QZ9 B;  2VV5 A;  4C0D C;  2X4Y A;  3JCM J;  1M2O A;  3MO8 A;  2C0O A;  1W2B S;  2JW4 A;  1MUZ A;  4F7U B;  1OQK A;  1W4S A;  2M16 A;  2Y4Y A;  3A98 A;  2X51 A;  1WFW A;  3G7Z A;  3OYM A;  4LDW A;  3LH0 A;  1Q81 C;  4M78 D;  5CK9 A;  3OYL A;  4M78 B;  4PJJ A;  3CMA T;  4E7K A;  1K1Z A;  5LL6 S;  2FPD A;  4GBQ A;  3CCL T;  4A4F A;  1NEB A;  1WHM A;  1X6B A;  1IHV A;  2BZY A;  2JMA A;  2QQA A;  3X28 B;  1LCK A;  2DL5 A;  2PVD B;  3CQT A;  2JS2 A;  2BKD N;  3HRU A;  1FMW A;  5A2Q E;  3TRE A;  3EFO A;  2RHY A;  3JCM d;  1KHI A;  3VJP A;  1RUW A;  3HP9 A;  4M78 F;  1W70 A;  1I4K 1;  3EH1 A;  4F7U G;  2CUB A;  3A1P A;  4KUI A;  2DNU A;  5DLO A;  1AD5 A;  4M78 G;  3RKW A;  1H92 A;  4HCB A;  1Y96 A;  2YLC A;  2BZ8 A;  4OMF B;  1Q86 R;  1JXM A;  2HNI A;  1YJ9 Q;  5CQY A;  4Q5W A;  2E3H A;  2DAQ A;  4RTU A;  2FO0 A;  2EAY A;  4OMM A;  1AEY A;  2KT8 A;  1P92 A;  2KGT A;  1CSK A;  3JB9 I;  1N8R R;  5HCK A;  3CD6 T;  2COW A;  4DBQ A;  5I22 A;  1U3O A;  2MF2 A;  2JS0 A;  4C0F A;  2D0Q B;  3OW2 S;  2DIG A;  2KMT A;  2LP5 A;  4HT9 A;  1ZA2 B;  1N27 A;  2RHZ A;  2LRQ A;  2CP2 A;  1VYU A;  4N0A A;  1VQL Q;  1MNE A;  8ATC B;  1SRL A;  2BE7 D;  2RJF A;  1BK2 A;  1YCY A;  2MIO A;  1SPK A;  1WXU A;  1Q81 U;  2D8J A;  3IQL A;  3M59 A;  4D8K A;  3KXT A;  4LUD A;  3UA7 A;  2DK3 A;  3G4S Q;  4QKU A;  3UWN A;  5CQX A;  1KC8 R;  3LWH A;  3RDV A;  3OQ5 A;  1W2B P;  1MMA A;  3HPW A;  1ZUK A;  3QZ5 B;  2SRC A;  3E9F A;  2KAF A;  2EFI A;  1EIF A;  1LJO A;  1WXT A;  2V26 A;  3JRZ A;  3OYH A;  2ABL A;  5C6S A;  1T0H A;  1G3T A;  3M0S A;  2D6F A;  3OMC A;  2YT6 A;  1VQ5 Q;  2VVK A;  1V1C A;  2JJ9 A;  1K76 A;  5LJ5 f;  2HQE A;  2NUZ A;  2VGN A;  2VAS A;  3JB9 H;  5GMK l;  3EGU A;  1I5O B;  2XID A;  1D3B B;  3NTK A;  2KDS A;  1K8A R;  3JCM V;  2K3Y A;  1C6V X;  1Q86 C;  1ZSG A;  1GBR A;  5FWB A;  5KYX B;  1UE9 A;  3JSC A;  1I1J A;  2D9T A;  2YUP A;  2FYK A;  3PGG A;  5KYN A;  3I56 T;  1AWX A;  1ZHI A;  1W2B A;  2DEQ A;  2FPE A;  2EWN A;  1PD0 A;  5IAY A;  1C0M A;  1N8R C;  3QPH A;  3JAM E;  1YIJ A;  4RTV A;  2YHT A;  2HZY A;  3A8M B;  2MK5 A;  4D6W A;  3CXC S;  4ELZ C;  3FRN A;  3X25 B;  4FYX B;  1F1B B;  1NM7 A;  4KBM B;  2RI5 A;  1YIT A;  2OI3 A;  5CCA A;  2Y90 A;  2HDA A;  3R6N A;  2OAW A;  2EGC A;  4FSS A;  4L59 A;  1NPP A;  2XHC A;  1M3C A;  4BD3 A;  1YP5 A;  4PKC C;  3G6E A;  2KRN A;  2V1R A;  3OYN A;  4EDU A;  4B6M A;  4A54 A;  3E2U A;  3PVQ A;  2ZCF B;  4FCY A;  1ABQ A;  1D0Y A;  4FYV B;  1EZZ B;  2QI2 A;  3SWN A;  2BE9 B;  2F5K A;  5LJ5 g;  3LGF A;  3QDF A;  4LXC A;  1TSF A;  2RI2 A;  2O9S A;  4KGZ B;  2OTJ Q;  3TU4 K;  3LWI A;  4M75 E;  2CSI A;  2K79 A;  3C94 A;  3T9N A;  1KC8 C;  1G3Y A;  2LX9 A;  1YI2 Q;  4X1V A;  2OX7 A;  2KYB A;  8AT1 B;  1R0B G;  2E5Q A;  3VS2 A;  1QP2 A;  3EG2 A;  2HBW A;  2EYY A;  2I2L A;  5IT9 E;  4CC7 A;  1UJ0 A;  4UC4 A;  5GJV B;  2DXT A;  4HCK A;  2YXY A;  4BAC A;  1RAH B;  3CCE Q;  5LJ5 e;  1H3Z A;  1Q86 U;  1YFN A;  3I55 A;  2KRO A;  2SEM A;  2LQW A;  2KR3 A;  2QA4 Q;  4OVA A;  2YUQ A;  3UA6 A;  1IHW A;  1K8A C;  1QMC A;  2RJC A;  5GAO l;  5J3B A;  1UG1 A;  2HKQ B;  3VS3 A;  4F16 A;  2JT4 A;  1N8R U;  2K4Y A;  5LJ5 j;  2PQW A;  5KH6 A;  2HL5 C;  2DL4 A;  1WHG A;  4JRQ A;  2OJ2 A;  4C8Q E;  4D8D A;  3OYE A;  3H41 A;  2JUF A;  1VQP A;  2GCX A;  3MEW A;  1ZA1 B;  2ZAE A;  1M1G A;  1TUD A;  4JJN K;  2E4H A;  2RA2 A;  2EVR A;  2ESW A;  5LJ5 d;  2QEX Q;  3PFS A;  3UF4 A;  1ZLM A;  3TEE A;  1UB4 A;  2X35 A;  3BDL A;  2AKK A;  3NTI A;  4CC4 B;  4MZT A;  1GBQ A;  1X2Q A;  1D1C A;  4PNO A;  5D6X A;  2DMO A;  1KIK A;  3VS0 A;  4O6J A;  1YIJ T;  4FL6 A;  2E65 A;  3CXC P;  1PWT A;  2FZG B;  2L8D A;  3L42 A;  2VYT A;  2LNH B;  4RUG A;  1SSF A;  2DL7 A;  2EPD A;  3GBQ A;  4Z89 A;  4RKU E;  4FW1 A;  3THK A;  2W10 A;  3M53 A;  3EFO B;  3VRZ A;  3M4G A;  4Z02 A;  1YIT T;  1U06 A;  3M0P A;  3HFN A;  3OS0 A;  1YJ9 A;  1N6A A;  2QDY B;  2ZZD A;  1QW1 A;  1KC8 U;  1QVG S;  3G6E T;  5CR2 A;  4M78 E;  5CKE A;  1RL2 A;  1D1B A;  1Y96 B;  1B3Q A;  2XDP A;  1K4U S;  3GLX A;  3VYH B;  2DXC A;  4EPC A;  2LNV A;  2HSP A;  4DQ2 A;  2G3R A;  3CXC A;  4IUT A;  4EMK C;  3ASK A;  3OYC A;  2RB6 A;  1O75 A;  1LOJ A;  1ZSZ C;  3SHW A;  4DOV A;  4ANJ A;  4RG2 A;  2HEQ A;  3VS5 A;  2KQW A;  3ZBD A;  3URG A;  2DBM A;  3RUX A;  2A28 A;  2CP5 A;  2MWO A;  1IRX A;  4RG8 A;  1AHJ B;  1K8A U;  1VQL A;  4E7I A;  3TVT A;  1TTH B;  2DIQ A;  2FHD A;  2L2P A;  4ZTF A;  4PJO D;  2I0N A;  2LQK A;  1YJW T;  1PHT A;  1OI1 A;  2RQU A;  3V7C A;  5L23 A;  3CC2 Q;  1OU9 A;  1V29 B;  4R0K A;  2DTH A;  5KYU A;  3S3N A;  1WQ7 A;  2XKO C;  4YTL A;  4BE1 A;  1VQ9 T;  3EG3 A;  3ULR B;  3CCR Q;  4E47 A;  3DB3 A;  1TH7 A;  5J39 A;  2NUP A;  3JCM Q;  2H3J A;  4BDY A;  2C0I A;  2LQ8 A;  4PJO F;  4JJC A;  1PNJ A;  2AT1 B;  3G4S A;  1YJN Q;  3QHS A;  3QO3 A;  1BCO A;  4GY5 A;  1VQK T;  2E5K A;  2X3X D;  3EHR A;  1MMD A;  3HSB A;  1OUL A;  4JJD A;  1I07 A;  3H9N A;  1G3S A;  4JRK A;  4M7D D;  1X6G A;  2KNB B;  3BE3 A;  2A08 A;  1NLO C;  2JTF A;  1RAE B;  5D6Y A;  4RMO A;  1VA7 A;  4ZNX A;  1JQQ A;  2QTX A;  5GAN f;  4JS4 A;  3P8D A;  1VIE A;  2XG8 D;  1XOV A;  1OPL A;  2DET A;  1YHQ A;  1VOM A;  1JXO A;  2JM9 A;  2ZGW A;  1N9S A;  2Z0W A;  1MND A;  4M75 C;  3I55 Q;  2XU8 A;  2YSQ A;  2YUO A;  2CH4 A;  4M7D F;  4M7A D;  4BUG A;  4J9H A;  2RNA A;  3CCQ Q;  5HK0 A;  2EGA A;  3G71 Q;  1WI7 A;  2H3E B;  3CME Q;  1GCP A;  4KH1 B;  1Q7Y R;  2ROL A;  3QWY A;  1WHH A;  5DM7 R;  2RK2 A;  1QVG P;  4B9X A;  4E2F B;  2CT3 A;  1YJ9 T;  2DYB A;  1VQP Q;  2EQI A;  3MP6 A;  4AG2 C;  4J7I A;  1WA7 A;  4M7A F;  2PUO B;  4PFZ A;  1VQO A;  1X69 A;  1ZX6 A;  4J6X A;  4KH0 B;  4BY6 C;  4LD6 A;  4C5G A;  1EFN A;  3EG1 A;  3LLR A;  2JN0 A;  5AT1 B;  3CC7 Q;  5GJW B;  4IKF A;  3CC4 Q;  1N5Z A;  1K9M R;  2VXE A;  1KQ1 A;  2F2X A;  4KUL A;  4XTY A;  3VV0 A;  3QJY A;  1WX6 A;  2DL8 A;  2HSE B;  4J9B A;  2A0F B;  4N4I A;  3O5Z A;  4NL2 A;  3CBP A;  3G1J A;  1G8X A;  2PVO B;  4AMC A;  4XU0 A;  4C8Q C;  3CCV Q;  5IHK A;  5EG2 A;  3RNJ A;  3BDU A;  1VQN Q;  2DLP A;  4J7F A;  4RTX A;  1VQL T;  1QVG A;  5GAN g;  3EFS A;  3QUI A;  3EHQ A;  4MDW A;  1YCS B;  1MHN A;  2F69 A;  2OTJ A;  1JBM A;  3JCM h;  1AVZ C;  2JNG A;  3SWN B;  3CBO A;  1UEB A;  3MET A;  1YI2 A;  6AT1 B;  2Y4X A;  4OB2 B;  1U1T A;  3S3M A;  2LMJ A;  2DJZ A;  4II1 A;  2CUD A;  1WLP B;  1BI3 A;  2P0P A;  1AWW A;  3CMA Q;  2JTE A;  5GAN 4;  2EYW A;  1QCO A;  3S6W A;  3CCL Q;  1BI0 A;  4PL6 A;  4HA8 A;  4PJO A;  2DIL A;  4LDX A;  5GAN e;  5IN1 A;  2C06 A;  3MEU A;  3QSU A;  3CCE A;  4JZ4 A;  3PTA A;  3I35 A;  2DXB A;  4PLI A;  4M78 C;  5KE3 A;  1VQ8 A;  1VYT A;  4PJL A;  2QA4 A;  2E70 A;  2WAC A;  3OYA A;  3MEA A;  2A3L A;  5D7U A;  3M0Q A;  1VQ5 T;  2CZ7 B;  3O8V A;  2J6O A;  4RTW A;  2RD1 A;  4ME7 A;  5A0G A;  1CKA A;  4C92 D;  5GAN j;  3L2W A;  2L5Q A;  9ATC B;  2J05 A;  1Q7Y C;  3M4Y A;  1X01 A;  4RCC A;  1MMN A;  5IXF A;  1WGS A;  3NMZ C;  1IB8 A;  1RAC B;  4AG1 C;  4JUV A;  5FU7 B;  3GNG A;  2XD0 A;  3RKY A;  4Y91 A;  3UDC A;  5GAN d;  1I5L A;  4M7D A;  1G3W A;  1VQ6 T;  2KXC A;  2DZ9 A;  2QEX A;  1K73 R;  2OTL A;  1ZUY A;  2CSQ A;  2RF0 A;  4DEY A;  1NE8 A;  3QBY A;  2AK5 A;  4C92 F;  2PVG B;  3MPU B;  3H0F A;  2L3Q A;  2E10 A;  1KHC A;  2EW3 A;  1NBE B;  1WHK A;  2CP7 A;  4ZGE B;  2V8J A;  2PUK B;  1X2K A;  1OU8 A;  1K9M C;  1SHF A;  2QTV A;  2QGF B;  5ECA A;  1AZG B;  1T3S A;  4CC3 A;  5FU6 B;  4M7A A;  5GAO q;  2RJE A;  3MKD A;  1YHQ Q;  1NEG A;  4Y92 A;  1WHJ A;  2HMA A;  3VUZ A;  1PG5 B;  4BI3 A;  1GL5 A;  2FG0 A;  4N4G A;  1QCF A;  1H8K A;  3P8H A;  3X24 B;  3OYJ A;  5KCO A;  3J7A F;  1GRI A;  1Y71 A;  1VQ4 A;  1ZQ1 A;  2RQT A;  2P4R A;  1RAI B;  4QVZ A;  4QVC A;  5CO7 A;  2KRM A;  3MEV A;  1PM3 A;  1UGP B;  3OBW A;  3H8Z A;  2LQN A;  5GAO p;  3OYB A;  1FXX A;  1HSQ A;  4F14 A;  2H8H A;  1OX9 A;  4QVD A;  3ZL7 C;  2EQU A;  2ZPE B;  1TUC A;  3GIB A;  5C0M A;  3JCM P;  3TSW A;  2X4X A;  4J6W A;  2RO0 A;  2YRD A;  3RER A;  2GFU A;  2VB6 A;  2DTO A;  2EIF A;  1WDX A;  3ER0 A;  1VQO Q;  1UGR B;  1ARK A;  1WJQ A;  2ENM A;  3VS1 A;  2FL7 A;  2QXF A;  1NLP C;  4OGE A;  5HY6 A;  2GNC A;  4C5I A;  5FU7 C;  1W6X A;  2V1Q A;  3OBY A;  1UEC A;  1R0C B;  3JCM c;  4XTZ A;  4WF2 A;  4QT7 A;  3QJ6 A;  1WJS A;  3V8K A;  3OW2 P;  3M55 A;  4IUV A;  1VUB A;  3MP8 A;  3MCA B;  1Y7X A;  2B86 A;  4KRT A;  3CC2 A;  3PIP A;  3EGX A;  1Q7Y U;  1FMK A;  2L0A A;  4ZN3 A;  4J6Y A;  3CCE T;  2QG9 B;  3H6Z A;  4FSX A;  2DE0 X;  3CCR A;  2QA4 T;  1RLQ C;  2O31 A;  5KYU B;  5FU6 C;  2CYZ B;  3H0I A;  2ZPB B;  1VQ7 Q;  1B34 A;  1H3H A;  1YJN A;  1WNL A;  1KSW A;  3OY9 A;  2P0Q A;  3RR6 A;  3QII A;  3ME9 A;  4C0G A;  5KYY A;  1TOV A;  2JZ2 A;  2NUP B;  1K73 C;  2F2W A;  1V76 A;  4PLL A;  2QDL A;  2K5F A;  1JB0 E;  4J8O A;  1K9M U;  2X3W D;  4RTT A;  1FMV A;  3OW2 A;  1NJI R;  5I2S A;  5I21 A;  1MV0 B;  4LDY A;  3L2R A;  3OSS C;  4PJO E;  3DKM A;  2K6D A;  4RTY A;  2DVE A;  2DPP B;  4FYW B;  3A8L B;  2VGM A;  3HTR A;  4EMH A;  1SG5 A;  3JB9 D;  3WVD B;  1K0X A;  2FPF A;  3GNF B;  1C1A A;  1UUE A;  2M51 A;  3I5R A;  3REA B;  1MMG A;  1VQ8 Q;  2JVV A;  5HK3 A;  2E3I A;  4C92 A;  4ATO A;  2EGE A;  1I81 A;  3RIR A;  4XU1 A;  5FWC A;  2EJG A;  1R77 A;  1LNX A;  3CCQ A;  4XU3 A;  3G71 A;  1K0S A;  3CPF A;  4XK8 E;  1KG1 A;  3NHN A;  3CME A;  1WIE A;  3L1A A;  3OB9 A;  4FW2 A;  3V8L A;  3JB9 F;  5GMK j;  1RAF B;  1IXD A;  1KJW A;  3SDZ A;  3RES A;  2K5I A;  4M7D E;  3U23 A;  3HRT A;  2L3P A;  3JB9 G;  4NL3 A;  5DLQ E;  4HCZ A;  1X6O A;  3M0U A;  4O5V A;  3X26 B;  1SSH A;  2OTL Q;  3I5S A;  1SKU B;  1WQW A;  2JXB A;  2KRS A;  3M9Q A;  2MPX C;  1MGQ A;  3CC7 A;  4OMP A;  4J5Y A;  3A5Z B;  3CC4 A;  3FB9 A;  1RAD B;  1GXI E;  4M7A E;  4X34 A;  4R56 A;  2EQM A;  2DXU A;  3PMT A;  3CCS A;  1S1N A;  4N4H A;  3FEO A;  4J83 A;  5LJ5 h;  1M2V A;  1VYV A;  2J7I A;  2MAM A;  2CT4 A;  3CCV A;  1KD1 R;  3X20 B;  3SFM A;  1VQN A;  2EBP A;  3CCU Q;  1M30 A;  2VC8 A;  2CZ0 B;  5FRO A;  5L8R E;  1UHC A;  3OYK A;  4E7H A;  2BIV A;  4MZP A;  1HD3 A;  2QQ9 A;  3CCJ A;  4EIK A;  2E1H A;  3NTH A;  2GF7 A;  3M0R A;  4AT1 B;  1VQ4 Q;  4WTO B;  4DOW A;  1VQM Q;  2RHX A;  3OYF A;  1K73 U;  2DD5 A;  5GAN 6;  1OX8 A;  2E41 A;  1HJD A;  2EYX A;  2K2V A;  2X4J A;  3EG0 A;  1M1K R;  2V8I A;  1OV3 A;  1M3B A;  4TVR A;  4A4E A;  3EGD A;  3CCR T;  3LGL A;  1PSF A;  2E12 A;  3UAT A;  4M77 D;  1NJI C;  2O88 A;  4XTW A;  2K9G A;  2VXF A;  3CMA A;  1OYX A;  1YJN T;  3CCL A;  4OB1 B;  4BE0 A;  4J9E A;  5GMK i;  4XQ3 A;  2WSC E;  3L2V A;  2ZPI B;  2P84 A;  2CP6 A;  3AHU A;  2F5T X;  3EG9 A;  3VKI A;  4PFO A;  1BB9 A;  2EKH A;  5GAO m;  2RPN A;  2DYI A;  2J6K A;  4X9D A;  4F17 A;  2JM8 A;  3LH5 A;  4M77 F;  5GAN 7;  4PJO B;  1JRI A;  4V2S A;  5J26 A;  3CCM Q;  3EAE A;  2DZC A;  3OYG A;  4QQD A;  2EJ9 A;  1JEG A;  1QQJ A;  2RQR A;  4XTX A;  1WPY A;  2VWF A;  1E6G A;  2NLU A;  4BB7 A;  4ESR A;  3I55 T;  4F04 B;  1Q82 R;  2GTO A;  1KFZ A;  1LVK A;  4C0D B;  1BBZ A;  4OMQ A;  3LYI A;  2KYM A;  3TQ7 P;  3VS7 A;  3CCQ T;  4AFU C;  3G71 T;  3FJP A;  1GCQ A;  2FB7 A;  3QWX X;  4PJO G;  3A8G B;  1PC0 A;  4XTU A;  1I8F A;  4GLK A;  2MWP A;  4ZGD B;  2YRV A;  1AWO A;  3DLL A;  2FZC B;  3CD6 A;  1D0Z A;  3FDR A;  4M7D B;  1VQP T;  3OS5 A;  4CRI A;  1X75 C;  4E7J A;  4JS5 A;  4PFP A;  2NWM A;  2ECZ A;  3NGP A;  1JU5 C;  2DD4 A;  3CBM A;  1PKT A;  3C0C A;  4MML A;  4C92 E;  2DFU A;  4J9D A;  2HQX A;  2LCL A;  1KD1 C;  4MZM A;  2LDM A;  3OYD A;  3CC7 T;  2R57 A;  2L89 A;  5FRN A;  4ZGJ B;  4BE2 A;  4IIO A;  1ACM B;  4M7A B;  1B07 A;  2E64 A;  2DO3 A;  4JRP A;  1D0X A;  5GAN 5;  3QYG B;  4JLI A;  3KUF A;  1D09 B;  4M7D G;  2K3B A;  3AT1 B;  5KYW A;  2PZ1 A;  1VQ9 Q;  1VQN T;  2KSS A;  4EMK A;  4PJO C;  1NJI U;  2K3X A;  1M1K C;  4QQG A;  4JZ3 A;  1RAA B;  1ZSZ A;  2RQW A;  4IUP A;  4DBR A;  4N0A C;  2EQJ A;  1S72 Q;  1KK7 A;  2KEA A;  5GAM f;  5LJ3 f;  2NUT A;  3TSZ A;  4OMN A;  2LC4 A;  3OS2 A;  3N5B B;  1UJY A;  4BI4 A;  2AHJ B;  4OMO A;  2F1L A;  2AZV A;  3SD4 A;  3FLG A;  2LZ6 B;  1VQK Q;  2O4X A;  2D0N A;  2MCN A;  2A36 A;  3CPW S;  4M7A G;  3DLM A;  5FW9 A;  2EJF A;  2HQH A;  2RHU A;  3M5A A;  1XQH A;  4KGX B;  2JOY A;  5CAI A;  3L2Q A;  1TU0 B;  1PRM C;  3V8J A;  2FVU A;  5GAO n;  2D8H A;  3ZEH A;  1WZO A;  5CVI A;  3CCS Q;  2KVQ G;  2X4W A;  1QWF A;  2PU9 B;  3GOX A;  4M7D C;  1T3L A;  1NPR A;  3I9Q A;  1M90 R;  3OMG A;  4E7L A;  3C4S A;  1JJ2 S;  4F7U F;  1PKS A;  2RN8 A;  2L3R A;  5GAO r;  1Q82 C;  3EGX B;  2XIC A;  3HL8 A;  3CCJ Q;  2DX1 A;  1JO8 A;  1AWJ A;  2WSE E;  2LJ1 A;  1VQ7 A;  3I56 A;  1OZ3 A;  2QAZ A;  4M77 A;  3BW1 A;  3PIO A;  1QVP A;  2K57 A;  1NYG A;  3M57 A;  4M7A C;  1XTD A;  3E9G A;  2DBK A;  2K5L A;  1B34 B;  5CKH A;  3HRS A;  2DRM A;  2JMC A;  2LJ3 A;  4LDV A;  1BI1 A;  1M27 C;  3FC3 A;  2J6F A;  2KXD A;  1KQS S;  5KYY B;  4AFQ C;  1NZ9 A;  5IHI A;  3G4S T;  4A63 B;  3M0T A;  2GGR A;  2AZS A;  4M75 A;  5I11 A;  1KD1 U;  3MJX A;  3PT9 A;  1IRE B;  1O9S A;  5GAM g;  5LJ3 g;  2COZ A;  4RCB A;  2DF6 A;  1UDL A;  3HFO A;  4MMK A;  1TWB A;  2ED1 A;  4BI8 B;  4HVU A;  1Y07 A;  2VKN A;  2KBT A;  3TCJ A;  4OML A;  4GLM A;  4JPB W;  2CZ1 B;  2DVJ A;  4OF1 A;  2BZX A;  4IUR A;  1M1K U;  5CIU A;  3J81 E;  1YHQ T;  3F70 A;  4C92 B;  1QCN A;  3SB2 A;  3Q1J A;  5GAN 3;  4C5H A;  3OYY A;  2AIR B;  3JCM X;  1WJR A;  5GAM e;  2C0T A;  5LJ3 e;  1E6H A;  1M3A A;  3QXE B;  2E6Z A;  2CH4 W;  2RK1 A;  1RAG B;  3CD6 Q;  4JJB A;  1CKB A;  5D6W A;  4C92 G;  3SWN C;  4C5E A;  4C8Q A;  1U1S A;  3CPW P;  2KI7 A;  1VQO T;  2D1X A;  5GAM j;  4DBF A;  5GAN h;  5LJ3 j;  3WXM B;  3M56 A;  3E1S A;  3GP8 A;  2V8K A;  2DM1 A;  4ZN1 A;  4FM4 B;  1BIA A;  2M0Y A;  1G83 A;  1Q82 U;  2COY A;  3QYH B;  3EFR A;  3CCU A;  3VRY A;  1M90 C;  4K11 A;  2YRC A;  5GAM d;  1HK9 A;  5LJ3 d;  1M2V B;  1YWO A;  2YDL A;  1VQM A;  1SF9 A;  2IG0 A;  1GFD A;  1JJ2 P;  2CP3 A;  3P8B B;  2P0K A;  1FWZ A;  4VUB A;  2ZPH B;  4OGC A;  4A4G A;  3R6O A;  4HVW A;  1BU1 A;  4PJN A;  5GAM h;  2A7Y A;  1PD1 A;  5LJ3 h;  2OTJ T;  3CPW A;  4F7U A;  1QP3 A;  2CS7 A;  4C92 C;  1VQ7 T;  1VQ6 Q;  1J3T A;  2EQK A;  1PSE A;  2M02 A;  1RI9 A;  3EGD B;  4M78 A;  2MYS A;  4M4Z A;  1YI2 T;  1HXD A;  2DJQ A;  2RMO A;  1BKB A;  2DER A;  1KQS P;  3MP1 A;  1X27 A;  3INZ A;  4DA4 A;  1RLP C;  4LNP A;  4PK4 A;  2ED0 A;  1X43 A;  4BDZ A;  4AFZ C;  1LPL A;  2FEI A;  2YWW A;  1M9S A;  3CCM A;  3EG9 B;  1K9A A;  5IXB A;  1JJ2 A;  1Z9Q A;  2O01 E;  2DL3 A;  4C0Z A;  2MOX A;  1N9R A;  3QG1 A;  3JB9 J;  1TG0 A;  2EYZ A;  2LCS A;  1VQ8 T;  1NYF A;  3M54 A;  2GFA A;  4J9I A;  4M77 E;  1I0C A;  1HYO A;  3V7R A;  2K7A A;  3I56 Q;  5FLX E;  3PMI A;  1TUG B;  1QVF S;  2ROT A;  2NYS A;  3A8O B;  4J9G A;  3FIF A;  2RM4 A;  2CP0 A;  1KQS A;  2F2V A;  4HKE A;  2GTJ A;  1ZUU A;  1AZE A;  4OB3 B;  3GF5 A;  3J80 E;  1SEM A;  2R58 A;  2G6F X;  4CC2 A;  3S3O A;  2RH2 A;  2XDB A;  5CKF A;  5GMK m;  2OTL T;  2HKN A;  4FIB A;  2QEX T;  2LT4 A;  1QLY A;  3FJ5 A;  7AT1 B;  4E7Z A;  1M5Q 1;  1M90 U;  4L5G A;  4HXJ A;  1M8M A;  3EH2 A;  1G2B A;  3CEY A;  2XI9 A;  4B9W A;  5IH2 A;  5GMK e;  2IIM A;  2LJ0 A;  4JDS A;  5AYF A;  4P5N A;  1UTI A;  1YJW A;  1EX4 A;  5KE2 A;  3V7S A;  2R5M A;  3BFM A;  2W0Z A;  4ELY C;  1NG2 A;  4DBH A;  1VIF A;  1VQ9 A;  3RMQ A;  2KE9 A;  3CCU T;  2OAU A;  2DA9 A;  1WHL A;  4JRI A;  1AOJ A;  1S72 A;  2KK4 A;  3JCM b;  1UFF A;  3RBB B;  1VQ4 T;  5I2M A;  2MI6 A;  5KYW B;  1VQM T;  1TXQ A;  3GPL A;  4OP0 A;  2M0O A;  4EMK B;  1M1F A;  4X9C A;  2QQS A;  5FRM A;  2P4T A;  1QWE A;  2QQB A;  3PNW C;  4XAX B;  1VQK A;  5IHN A;  1ZSZ B;  1BIB A;  3KBG A;  1RI0 A;  4ORZ A;  4Z8A A;  2M1H A;  4Y28 E;  5HKC A;  2NUT B;  3NFC A;  4R55 A;  2DKG A;  2PNI A;  4HCC A;  1UHF A;  1IO6 A;  4Z88 A;  2O4X B;  4XU2 A;  4MDX A;  4FU6 A;  2YUN A;  1WXB A;  4ZTJ A;  2DRK A;  1QKW A;  4A4H A;  5GMK h;  1YNZ A;  2CGH A;  2CDT A;  3VS6 A;  5KCH A;  4KUD K;  1GCQ C;  1ZBX A;  5GAN 2;  3OYI A;  1D3B A;  1W1F A;  4PJM A;  3RKX A;  1T0J A;  4J9C A;  2KY9 A;  4LUE A;  1WYX A;  1MV3 A;  3CC2 T;  1OOT A;  4AFS C;  3CCM T;  3ZFJ A;  2BTT A;  2LVM A;  5CKB A;  3BY7 A;  2CKK A;  2EYQ A;  4KT0 E;  2QQR A;  2WSF E;  4WCI A;  5KYX A;  2LTO A;  4FT4 A;  1BI2 A;  2LCC A;  3C12 A;  5CKD A;  1QKX A;  2RHI A;  1DJ7 B;  2KT1 A;  2L3S A;  2E6N A;  1OEB A;  1PRL C;  4F7U E;  3OA6 A;  3QDR B;  4CI0 C;  3L2U A;  1ABO A;  5DY9 A;  4M77 B;  4HVV A;  1BYM A;  3JCM f;  1QVF P;  2GQI A;  2YLB A;  2J06 A;  2ZPF B;  1Y57 A;  2DTI A;  3DB4 A;  1IZ6 A;  2BUD A;  1KQ2 A;  2XMF A;  3JCM W;  2FZK B;  2QAS A;  1Q81 R;  3REB B;  1Y0M A;  3UPU A;  1YWP A;  1YIJ Q;  4M75 D;  2EKO A;  4OB0 B;  2HD0 A;  4M75 B;  5GAN 8;  1UGS B;  3JV3 A;  2VUB A;  3VS4 A;  4A53 A;  2IPO B;  2RJD A;  3MHX A;  4IUU A;  1XJW B;  2AKL A;  1FYN A;  4LN2 A;  4M77 G;  2JTM A;  2RQV A;  3D7S B;  2QYZ A;  1YIT Q;  3VUB A;  3HHT B;  1XNI A;  3UT1 A;  2B8A A;  2GQV A;  1IGU A;  4L6V 5;  2MMP A;  1QVF A;  4M75 F;  3G6E Q;  1GFC A;  1RAB B;  3VU3 C;  4IIM A;  4IUQ A;  4A4K A;  4JLG A;  2QGG A;  1AT1 B;  4E7S A;  2LT1 A;  4M75 G;  3OS1 A;  3CME T;  1M8V A;  2GBQ A;  1E7O A;  4DEX A;  4LE9 A;  1TS9 A;  4NS5 A;  4BY6 B;  3RMS A;  1IGQ A;  4QQ6 A;  3LX7 A;  2X9H A;  2ZPG B;  3NPF A;  1Q95 G;  1S72 T;  2LX7 A;  2DEU A;  3WVE B;  3E19 A;  4EMG A;  4HT8 A;  2M9U A;  3SEM A;  5A0L A;  3A8H B;  2PTK A;  1D1A A;  3OSV A;  3LW5 E;  3JCM g;  4M77 C;  1FX7 A;  4C8Q D;  2CRE A;  2O9V A;  2HCK A;  1ZBJ A;  4C8Q B;  1UGV A;  1UGQ B;  1U8R A;  3CC4 T;  1U5S A;  1R8O B;  2XDD A;  2HBP A;  1YN8 A;  1YJW Q;  2FRW A;  2XK0 A;  3H0H A;  3PVL A;  2HAX A;  2K2M A;  4RTZ A;  1Z9Z A;  4KGV B;  4FYY B;  4FT2 A;  4LDU A;  4NOY A;  1VQ5 A;  1G5V A;  5EC7 A;  3CCS T;  2FRY A;  5M9O A;  1H64 1;  2QK0 A;  4QW2 A;  4LD9 K;  4E6R A;  3L2Z A;  1BCM A;  2ATC B;  2RI3 A;  3PE0 A;  3QKJ A;  2A37 A;  3CCV T;  3VYG A;  1A0N B;  1OPK A;  4C8Q F;  1YBY A;  1OZ2 A;  3CCJ T;  1PCX A;  1SHG A;  3HKS A;  3M58 A;  2IVW A;  3C95 A; 
#chains in the Genus database with same CATH homology
 2O2O A;  1H3H A;  4J9F A;  2C0T A;  1KSW A;  1E6H A;  3KFV A;  1SRM A;  1M3A A;  1B3Q A;  2F2W A;  1K4U S;  2CH4 W;  2QDL A;  2C0O A;  2JW4 A;  2X3W D;  1MUZ A;  4RTT A;  2HSP A;  3A98 A;  4JJB A;  1WFW A;  1CKB A;  1MV0 B;  2K6D A;  1K1Z A;  4RTY A;  3SHW A;  2FPD A;  4GBQ A;  1NEB A;  2D1X A;  1X6B A;  2BZY A;  2HEQ A;  3VS5 A;  2JMA A;  2DBM A;  2DM1 A;  2A28 A;  1K0X A;  2FPF A;  2M0Y A;  1G83 A;  1UUE A;  2M51 A;  3I5R A;  3REA B;  1LCK A;  2DL5 A;  3TVT A;  3CQT A;  2JS2 A;  3VRY A;  4K11 A;  2L2P A;  2EGE A;  2I0N A;  5FWC A;  1PHT A;  1RUW A;  2RQU A;  1YWO A;  2YDL A;  1W70 A;  5L23 A;  4R0K A;  2CUB A;  1K0S A;  1GFD A;  3NHN A;  2DNU A;  1AD5 A;  1WIE A;  1H92 A;  3EG3 A;  3ULR B;  2BZ8 A;  1KJW A;  1JXM A;  4HVW A;  2C0I A;  3U23 A;  1BU1 A;  2L3P A;  4JJC A;  4RTU A;  1PNJ A;  2FO0 A;  4OMM A;  1AEY A;  1J3T A;  3M0U A;  2KT8 A;  1SSH A;  3I5S A;  1RI9 A;  2KGT A;  1CSK A;  2JXB A;  4M4Z A;  2E5K A;  2X3X D;  2DJQ A;  2RMO A;  3EHR A;  4JJD A;  1I07 A;  2KRS A;  5HCK A;  1X6G A;  2KNB B;  4OMP A;  2A08 A;  1NLO C;  1X27 A;  5I22 A;  1U3O A;  1RLP C;  2JS0 A;  4LNP A;  1VA7 A;  4ZNX A;  2ED0 A;  1JQQ A;  1X43 A;  4AFZ C;  2FEI A;  2LP5 A;  1S1N A;  1K9A A;  5IXB A;  1Z9Q A;  1VYV A;  2J7I A;  2DL3 A;  1XOV A;  1OPL A;  2CT4 A;  2MOX A;  1VYU A;  1JXO A;  2JM9 A;  1TG0 A;  2EBP A;  2EYZ A;  1M30 A;  2LCS A;  1NYF A;  2YSQ A;  2YUO A;  1UHC A;  2CH4 A;  1HD3 A;  4J9I A;  4EIK A;  1SRL A;  3M0R A;  1I0C A;  4J9H A;  2RNA A;  2K7A A;  1BK2 A;  2EGA A;  1HJD A;  2MIO A;  1WI7 A;  2EYX A;  1SPK A;  1WXU A;  2ROT A;  4J9G A;  1GCP A;  3EG0 A;  2ROL A;  3QWY A;  1OV3 A;  1M3B A;  2F2V A;  2D8J A;  3IQL A;  4D8K A;  3UAT A;  2GTJ A;  2CT3 A;  2DYB A;  1ZUU A;  2EQI A;  1AZE A;  4AG2 C;  4LUD A;  3UA7 A;  1WA7 A;  2O88 A;  1SEM A;  2K9G A;  2G6F X;  4CC2 A;  4J9E A;  1X69 A;  1ZX6 A;  1QLY A;  3FJ5 A;  1EFN A;  3EG1 A;  1ZUK A;  4HXJ A;  1M8M A;  2SRC A;  1G2B A;  1WXT A;  1BB9 A;  2EKH A;  5IH2 A;  5GJW B;  2ABL A;  2RPN A;  2IIM A;  2J6K A;  2LJ0 A;  1N5Z A;  4F17 A;  1T0H A;  2JM8 A;  3M0S A;  3LH5 A;  2F2X A;  1UTI A;  2YT6 A;  1WX6 A;  2DL8 A;  4J9B A;  3O5Z A;  2W0Z A;  2VVK A;  1V1C A;  1K76 A;  2NUZ A;  1JEG A;  1NG2 A;  2RQR A;  3EGU A;  5IHK A;  3RNJ A;  2VWF A;  1E6G A;  2DLP A;  4RTX A;  4ESR A;  2KE9 A;  2DA9 A;  2GTO A;  1KFZ A;  1BBZ A;  4OMQ A;  3EHQ A;  1ZSG A;  1AOJ A;  1YCS B;  2KYM A;  5FWB A;  1GBR A;  1UE9 A;  1UFF A;  1I1J A;  2YUP A;  3VS7 A;  4AFU C;  1AWX A;  1AVZ C;  1GCQ A;  1QWE A;  2FPE A;  3QWX X;  5IHN A;  2LMJ A;  1AWO A;  4ORZ A;  4Z8A A;  2CUD A;  1WLP B;  2PNI A;  1AWW A;  1UHF A;  4RTV A;  1IO6 A;  4Z88 A;  2JTE A;  2EYW A;  2YUN A;  1WXB A;  2NWM A;  2ECZ A;  3NGP A;  2DRK A;  1JU5 C;  1PKT A;  2DIL A;  1QKW A;  3C0C A;  1YNZ A;  2CDT A;  4J9D A;  1NM7 A;  4JZ4 A;  3VS6 A;  3I35 A;  1GCQ C;  2OI3 A;  1VYT A;  2HDA A;  3R6N A;  2OAW A;  1W1F A;  2EGC A;  4FSS A;  4IIO A;  1T0J A;  4J9C A;  1M3C A;  1B07 A;  1YP5 A;  4LUE A;  1WYX A;  3M0Q A;  1MV3 A;  2KRN A;  1OOT A;  4AFS C;  2V1R A;  2BTT A;  2J6O A;  4RTW A;  4WCI A;  2K3B A;  1CKA A;  1QKX A;  2PZ1 A;  2J05 A;  3PVQ A;  2KT1 A;  2L3S A;  1ABQ A;  5IXF A;  1OEB A;  1PRL C;  3NMZ C;  4JZ3 A;  4AG1 C;  2RQW A;  2KEA A;  2O9S A;  1ABO A;  4HVV A;  2CSI A;  2K79 A;  3TSZ A;  4OMN A;  2GQI A;  1UJY A;  4OMO A;  2KXC A;  2AZV A;  2J06 A;  1ZUY A;  2LZ6 B;  1Y57 A;  2D0N A;  2CSQ A;  2RF0 A;  2MCN A;  4DEY A;  2A36 A;  4X1V A;  2AK5 A;  5FW9 A;  2KYB A;  3H0F A;  2L3Q A;  2XMF A;  3VS2 A;  2EW3 A;  3EG2 A;  2HBW A;  3REB B;  1Y0M A;  2EYY A;  1YWP A;  1PRM C;  4CC7 A;  1X2K A;  1UJ0 A;  1SHF A;  5GJV B;  5ECA A;  2D8H A;  3JV3 A;  1AZG B;  3VS4 A;  1T3S A;  4HCK A;  1QWF A;  4CC3 A;  2AKL A;  1FYN A;  4LN2 A;  2RQV A;  1T3L A;  1NEG A;  4Y92 A;  3I9Q A;  2KRO A;  1PKS A;  1GL5 A;  2SEM A;  2LQW A;  2FG0 A;  2KR3 A;  2RN8 A;  2YUQ A;  1QCF A;  1H8K A;  3UA6 A;  2DX1 A;  1JO8 A;  1AWJ A;  1UG1 A;  1GRI A;  1GFC A;  2LJ1 A;  2RQT A;  2P4R A;  4IIM A;  3VS3 A;  2KRM A;  4F16 A;  2JT4 A;  2LQN A;  2GBQ A;  1E7O A;  4DEX A;  1NYG A;  1HSQ A;  4LE9 A;  2H8H A;  4F14 A;  2DL4 A;  2DBK A;  3ZL7 C;  2OJ2 A;  4D8D A;  3H41 A;  1TUC A;  2DRM A;  2JMC A;  2LJ3 A;  3NPF A;  1M27 C;  2LX7 A;  2J6F A;  3TSW A;  2KXD A;  4AFQ C;  5IHI A;  1TUD A;  4A63 B;  1WDX A;  2EVR A;  2ESW A;  3SEM A;  3M0T A;  1ARK A;  3UF4 A;  2GGR A;  2AZS A;  2ENM A;  3VS1 A;  5I11 A;  1ZLM A;  1NLP C;  2PTK A;  2GNC A;  2AKK A;  1W6X A;  2DF6 A;  2V1Q A;  4CC4 B;  1UEC A;  1UDL A;  2CRE A;  1GBQ A;  1X2Q A;  1ZBJ A;  2HCK A;  2O9V A;  1UGV A;  4QT7 A;  2DMO A;  1KIK A;  3VS0 A;  1U5S A;  1PWT A;  1YN8 A;  2FRW A;  3H0H A;  3PVL A;  2K2M A;  2LNH B;  2ED1 A;  4RUG A;  1Z9Z A;  2B86 A;  4HVU A;  4KRT A;  4RTZ A;  2VKN A;  2KBT A;  4OML A;  4GLM A;  5EC7 A;  4JPB W;  2DVJ A;  2FRY A;  2DL7 A;  2BZX A;  2EPD A;  1FMK A;  3GBQ A;  2L0A A;  3THK A;  4Z89 A;  4E6R A;  3PE0 A;  2A37 A;  2W10 A;  3VRZ A;  2DE0 X;  1A0N B;  1OPK A;  1U06 A;  3M0P A;  1RLQ C;  2O31 A;  1SHG A;  3H0I A;  3RBB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...