3UDCA

Crystal structure of a membrane protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDDLIEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
molecule keywords Small-conductance mechanosensitive channel, C-terminal pepti
total genus 79
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3udcA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3udcA03
1AFJA 1FD8A 4OJ1A 1FE0A 2BJDA 2QLXA 3MZIA 4DN9A 2GQVA 4Y2KA 1YJUA 1X8DA 2OFGX 1TUVA 2HFOA 3LGNA 5F0UA 2G9OA 2FHMA 4DPOA 2IFXA 2AP6A 1Q53A 2HQIA 2VV5A 2K1RB 2GO8A 3HHLC 5T7LA 3BM7A 3KG1A 1P6TA 1FVSA 1VQSA 4OJGA 4QOTA 1VIEA 4ZOSA 1YRXA 1GXTA 2PGCA 2XMTA 1V3ZA 1YJTA 1CC7A 1K0VA 2RK1A 1XBWA 2OMOA 2QYCA 2EW9A 2XMUA 2XMVA 4ZA1A 1N5SA 2GV1A 1R6YA 4FNIA 2QIFA 1IUJA 3IWLA 2BUNA 2GCFA 1OQ6A 2RU9A 4Q2MA 2JDJA 1QUPA 3F44A 1OSDA 2BJEA 1VQYA 2KT3A 3QGPA 1LQ9A 1N5QA 5F0WA 5B0FA 2RK2A 2ACYA 2W4CA 2L3MA 3LO3A 4FNHA 5A6WA 4A48A 1FE4A 2FTRA 5B0DA 2RSQA 1SQEA 2ROEA 2N4CA 2ROGA 3HHLB 1SI9A 3E8OA 4DL0C 2GGPB 3TNVA 2IYGA 1FESA 5B0BA 3QMQA 3I9ZA 2HFNA 2LQBA 2RILA 3FMBA 2KYZA 3CJKA 3GZ7A 1RJJA 3BF4A 3FGVA 5A6PA 2ZDOA 4NL5A 1Q8LA 1AFIA 2ZDPA 3DCAA 3WDOA 1URRA 2KKHA 3HF5A 5B0CA 1AW0A 1S6OA 2OFHX 2OAUA 2RMLA 1Q4RA 3BN7A 2K1RA 2XMJA 1FVQA 1ULRA 3T9NA 4OIXA 4Q2LA 2VH7A 2N4DA 1VIFA 1YJVA 2CRLA 2GA7A 1N5TA 2FB0A 3BGUA 2W4PA 4HI1A 4A46A 2OKQA 1N5VA 2XMWA 4Y2MA 3K7RA 1P8GA 2HLUA 3MCSA 2LDIA 1X0PA 3KKFA 4YEAA 1JK9B 3SFMA 3IWXA 1JWWA 2AJ1A 2N7YA 2P4TA 2ASYA 2LXFA 1OPZA 1CPZA 2W4DA 3LGMA 5B09A 1Y0HA 2IYIA 2HIQA 1TL5A 1TL4A 2KT2A 1CC8A 2GFFA 3HX9A 5T7LB 1X7VA 1OQ3A 1KVJA 2OP5A 2QLWA 4HL9A 1Q8BA 3FRYA 3HHLA 3KNGA 4U9RA 5B0AA 2AW0A 2PD1A 4HH0A 1Y9OA 2BBEA 5K9FA 3BB5A 2K2PA 1MWYA 4HI2A 2HLTA 3KG0A 4OJ3A 1TZ0A 1APSA 2ROPA 1W2IA 1YJRA 2K7KA 3CJKB 1FEEA 2K7JA 2OD6A 3UDCA 3TRGA 1S6UA 5B0EA 5B0GA 5IXUA 4OJHA 1U7LA 4F67A 4EFAC 1YG0A 2XMMA 3HDSA 4NPOA 3VTIA 1KQKA 3HHLD 4A4JA 4YDXA 3BDEA 1WD6A 4Y2IA 5B08A 2XMKA 3DXSX 1Y3KA 1KVIA 4HH1A 2Q3PA 2FIUA 1SB6A 2OD4A 4A47A 2GGPA 5KAKA 1MWZA 3HFKA 3TOQA 1GXUA 2BYCA 1TR0A 2AJ0A 3BR8A 1Y3JA 2RH2A 2LQ9A
chains in the Genus database with same CATH superfamily
2JC1A 3C94A 1KR4A 1EZZB 1MG7A 3WHIA 1U45A 1EETB 2ADCA 1VLOA 4ZOSA 3I55S 2PGCA 2X4XA 3GG1A 4QR2A 1JJ2P 1WHMA 1RHKB 4OHXA 1NK8A 2DR8A 3PVQA 1VOMA 3SWNC 4MAKA 2RK2A 4FNHA 3ZTSA 1FE4A 2PU9B 2ZC3A 1N32J 3HP9A 2H1YA 2CYYA 4EMHA 1KDNA 3Q8RB 2O01E 3M59A 3G71Q 1C0TA 4J9EA 2DY9A 4JI4F 4CC3A 3LWMA 1Q8LA 2FL7A 2EPIA 5HMZA 3M6XA 5CR2A 3EYZA 1LK5A 3MPYA 3D2WA 1ZETA 2XHCA 4RG8A 5GAN6 3UQSA 3C6TB 3M9MB 4HA8A 1U47A 1NJXA 5HJYA 5HI7A 3A3OB 3EGUA 3CJ0A 2MQPA 4DBFA 3KFVA 4QQ6A 2LJ3A 3JCMd 1D3WA 3AA9A 3FRNA 2CDTA 2KSSA 2RHXA 3N6NA 1D0YA 1D0ZA 1HIYA 1N6QA 5GAMd 4OHVA 2ESWA 1YZ7A 2CJYB 4NPOA 1KQKA 5IT0A 2C2MB 3BDEA 4FP9A 2IC3B 5DZ6A 2HNYA 1BBZA 2Q79A 3HFZB 3M8QA 5ETOA 3T6BA 3A8EA 1HNZJ 1RXOB 2D3O1 4QR1A 3PCOB 3QGIA 1UEKA 1RWVB 3C95A 4KFBA 3Q2SC 3LF0A 1RAIB 3GIMA 4C98A 3EICA 5GANf 3PJ9A 2V8VA 2ZZDA 4TYBA 3H0PA 2ROEA 3CT9A 3QJJA 4HXJA 3SSRA 1NDLA 5F8NA 2P6TA 4ECSA 3GZ7A 2ZDPA 5HANA 3AOBA 1KKHA 2AKLA 4QWAA 1YHQQ 2HBZB 3ZTOA 4DUYF 4ZCIA 2OTLS 4ZK7M 2HHVA 2LEPA 5GAN5 4P2XA 4QIGA 1JKHA 3A8IA 3SEOA 4EMGA 2ZH2A 3AAWB 1C0UB 3HK2A 2F9JA 2KGTA 3TWZA 1RBAA 2KO1A 2ZZTA 3MECB 4U9RA 3TAMB 2X3WD 3MF5A 3R6NA 1VQPA 4Z2XA 4JI3J 3N6MA 1H3ZA 1B70B 2K7KA 2XDDA 4UT4A 3LP1B 2WRMA 2ATCB 2HZVA 4DEZA 3MEGA 1OSCA 3JS9A 5L8RC 3OS5A 2EFNA 1XTDA 2JW4A 1WA7A 4DQPA 3U23A 4Y00A 1PJ6A 1V5IB 4GO5X 4F7VA 2E70A 4ILMA 4M78G 5KFKA 2IM1A 2CP3A 5C25A 3QZ5B 1K0VA 3TUIC 1PHTA 1DTTB 3CPFA 2DD8S 1RT4B 3Q22A 1QE1A 5FU6C 2LVWA 2JMCA 2KT3A 4ECYA 3H40A 1XOVA 5A6WA 1YK9A 2H4YB 2VPZB 3HRTA 2AZ1A 5DM7R 3NL0A 1NAQA 2F5KA 4YS2A 5J1PA 2OTLA 1HSQA 1GH8A 2XSFA 4GKKJ 4ZJQA 2YKAA 4JS4A 3MEGB 4PJOD 4ZVEA 2QXFA 3MUVP 1GFCA 3ENQA 2NLWA 2R7WA 3UNYA 5AE2A 3AT1B 2V34A 3OYGA 4ZPWR 4CYUB 3MUTP 3DKMA 2APOA 2IIHA 4C3MA 2UXDJ 4M1KA 4FM4B 3HFVA 4JV2A 2Y9HA 2B8PA 1KG1A 4KYZA 3M9OB 4NA3A 3C2PA 2G6FX 3G8SA 3OYJA 1F9HA 1TL7A 3M2VA 1GL5A 1K44A 4RW9B 4EZ9A 1EKRA 2JEFA 2YY3A 5GMKm 1FT8A 1HNVB 3CCVQ 1M90T 5KYNA 3EVWA 1W2BR 1JJ4A 2B8QA 2VU5A 3HVAA 1S1UB 3W2WA 1RHRB 4ELZC 4IH5A 4U95A 4RL1A 4B3RF 3M57A 2C3MA 1HD3A 2BE2B 3AQOA 3QWYA 2CZVC 4MKVA 2AP6A 3HHLC 2QA2A 1VQ5Q 2BZ8A 1VQ7Q 1KS2A 4ZLNA 2HHSA 3AOAA 1VRTB 2JNJA 2NZCA 2OHDA 3HD1A 4XTTA 1LOJA 1FXLA 3LH0A 1B64A 2YRCA 2XHWA 2IMOA 1LVKA 1WHYA 3PYFA 2ZH5A 3QFHA 2IBKA 1JXEA 4U6PA 4C0ZA 1RHQB 1N5YB 4PWWA 4OB2B 3G4SA 4JV5J 2GIFA 3KLFA 2BZYA 2W2QP 1HHQA 3NRBA 3V7SA 1TL3B 3FBCA 1S9FA 3MEDB 3ZTQA 1WC5A 2LA4A 1NLPC 3O5TB 4M7AG 2DNPA 2P5VA 2J8SA 5GAOm 5C24B 4PXEA 4L59A 2P6SA 3EG0A 1TL4A 1OO0B 2AK5A 5L23A 1RT1A 4H4MA 3T6JA 5KFNA 3KLVA 2W2MP 3IR6B 1RI0A 1S6UA 2Z30B 2EFOA 1HBOA 1ZS6A 4PAAA 3JB9k 4CNZA 3BJYA 2E12A 3JTOA 1T05A 1VQ9S 4ED6A 5HSPA 3IBWA 5H1SV 1YNZA 2HMAA 2CNNB 1XMOJ 2DHSA 4WCIA 5DO2A 3UN5A 1M9SA 1FRLA 4NS5A 4Y65A 4PKCC 2OTJA 5ETPA 5KFBA 1TK5A 1LK7A 4NLWA 3FZBA 5EUHA 1VMBA 2MZSA 2FZGB 1T8EA 1KHIA 2C42A 1UG1A 3MAQA 4AE5A 1Q81R 3CC7S 2NUHA 5B0DA 2R5AA 5GAN2 2EW3A 2EVZA 5KT4A 3EG3A 3NAIA 2DT9A 2DNYA 2W8KA 3TUPA 1W26A 2M5YA 3TYTA 1RWPB 3UPFA 1XNRJ 3V8JA 3D3BJ 1H2TZ 1QQJA 1A6LA 2CUBA 1VIFA 3ILLA 4QZVB 3ZC4A 1ZBXA 1ZPWX 2DJQA 3TJAA 5GAHI 2V8PA 4M7AB 1BI3A 1AD5A 2WVCA 1WHJA 1WHVA 3ETOA 3G7ZA 4C0HA 4J9PA 3HKSA 3ZXWA 4I7FA 1MROB 1IJEB 1RDRA 2DD5A 2LA6A 2VC0A 4B3SF 3PMIA 2K9GA 3RRKA 1WEZA 2R7XA 3TSWA 4CI0B 1SVDA 1FO1A 2AZVA 5HKCA 2R8IA 1D3BA 1YBTA 1EAYC 2JTEA 3CDEA 5KCOA 3MDFA 4IUVA 3OR1A 2E9ZA 2HEKA 5E5NA 3CB4A 4AMCA 2MXYA 1H98A 2KHCA 4QWCA 1RT7B 3D6MB 2X7IA 3MMBA 1IR1A 5FJ4A 2KFZA 3UT1A 5LJ3e 2XSJA 1ZSZC 2B4PA 1N34J 2J0XA 3QGHA 3PW0A 4RW9A 2LP5A 1T7PA 1OSDA 1VQYA 2ZOMA 4I7FB 2DXUA 4I2QB 2ROGA 4ZGEB 4KSEB 2GVDB 4EYHB 1C4AA 2PA8D 4KT0E 5KFOA 1IHVA 2CNOB 3HF5A 3R6GB 4A8OA 4A8SA 2D69A 1I94J 5GAMh 1HFEL 4QKUA 4BHQA 1UAWA 3GSDA 4GKKF 1TQLA 1O0PA 2OKQA 4FKXA 5GAN8 2YPYA 5IM0B 2KU7A 2RQUA 2IRXA 4M77B 1BWVA 1FK9A 3GILA 2N3LA 2J7UA 1UKUA 1IB8A 3CD0A 1S59A 1KFSA 1CC8A 2XCAA 2JN0A 4RTXA 4LFAF 2EK1A 1HNXF 2AJ4A 3TQEA 3JB9I 4H4KA 4KKOA 5J2PA 1IXDA 2H3JA 1YBYA 2K5LA 1RTJA 3CD5A 2OPPB 5HN0A 3FQKA 2BM1A 1TH7A 1SKUB 4IUTA 2C2EA 5EWGA 1JO8A 2K8GA 1R27B 4IIMA 2GMJA 4UZBA 4ZIWA 2DHHA 3DHXA 2M8HA 4BY6B 3PFSA 1C1AA 3CCSA 1VQ9A 1AOJA 5L9XA 4J9QA 3LGNA 3G71S 1M2VB 2I38A 4EZ6A 2LXIA 2XS7A 4C5IA 4P72A 5IHIA 1RT1B 4K4YA 1P9YA 2R3VA 2DNRA 1FKOA 5J1EB 4ZA1A 2YH1A 2EFVA 3O8VA 3M30A 5A8KA 1LQ9A 4QYZK 4WK3A 2EQMA 1E6YA 2F5TX 2A10A 1CJUA 2V94A 1NEBA 2E5KA 4UOHA 3FMWA 2C3UA 4FBTA 3WC2A 4C8OA 2BXJA 3J80Y 3PKMA 2QEXT 1IBLJ 3IWNC 4B3OB 2RA2A 2DKOB 4ESRA 3BPSP 2DCLA 2DPPB 1SJ3P 1JLQB 2CZ9A 2HKEA 4DR5F 2PA3A 5HP1A 4J9OA 2GQQA 1WTFA 4LF7F 3QJYA 1IKYA 3ZFJA 2ZJQQ 2R58A 1BQMA 4F3QA 1ZUKA 3KHRA 2JSXA 5A76A 3K8WA 4N7TA 4F4XA 1SC6A 1EJ7L 2BIVA 2OPRA 1T9TA 4H4OB 2XK0A 4ZN3A 2F8MA 3CDUA 4DZDA 5F9LA 1H7XA 1CULA 4LBPA 3V6KA 2CQIA 4F2RA 4M75G 2M7SA 1G3OA 3L2UA 1M1KC 4TNOA 3EGWB 2B43A 2VODA 4C8QB 4DX6A 3RYLA 4DHVA 1ZA2B 4USMA 3GF5A 1KLMB 2NXJA 4NLUA 3THVA 1M90C 4QIWD 2XDBA 2JZ5A 4YTLA 1SJFA 1MSWD 2YPZA 1KHCA 2ZH8A 5IAYA 1SKSA 2ZZMA 3T3FA 5KFFA 3EAEA 3BH7B 4ILRA 2DXFA 2LEBA 1CEZA 3ZZYA 3QYHB 3PGGA 1UEUA 3SQGA 5SZTA 2VOPA 5HQ8A 2IYGA 2K5IA 3EG9A 3SQOP 4ED1A 3CCST 3CJKA 4D8DA 3N5FA 3CD6S 5B0CA 2R2RA 3G6YA 3N5BB 1AWXA 5KYWA 1S9EA 2A1BA 1CSJA 2MWOA 5DQGA 4MDXA 1N54B 2POKA 3BN4A 5CHCB 4DV5F 3LGMA 1VQNA 4CNYA 2Y90A 2DMOA 2FVUA 4HT5A 3VCDA 1MHNA 3MMAB 1LNXA 2FRWA 2BBEA 3PHTA 4X62F 1S0NA 1UDLA 2KXHA 1U1MA 4NEZA 1QVGP 1T3LA 1QE1B 1VQKA 4B3SJ 3T19A 4USVA 2QLBB 3UCGA 1VA7A 3OYDA 1G2EA 2C22A 3VGSA 3PVXA 4V19X 3V81B 3OTBA 1F3FA 1Y3JA 3BDUA 1S49A 3HJFA 4ME7A 2BANA 3DDKA 1FX7A 3TVZA 4JPBW 2Y1LB 3K59A 2VKNA 1PM3A 3SSSA 1YJNT 2ZOFA 1H7WA 3AXMA 4W4MA 1YI2S 2ED1A 3MJXA 1VQPS 3SBMA 3VYHB 4PPZA 4X66J 3ISNC 4QPXA 1GCQC 3HRSA 4CLTA 4MYUA 3D4JA 4DL6A 1XC9A 4DXLA 3QWPA 3BSNA 3THTA 3EGXA 4HEA9 4PPDA 2IA0A 3W5YA 4KPYA 2Z2YB 2C2RA 2GAHC 1SXLA 4JRPA 1CS4B 3MM6A 1QAXA 1HNVA 2EJGA 4LDVA 2WSCC 4LN2A 4QVCA 2VC8A 4DF8A 4UQTA 1YJ7A 1NPRA 2RHUA 5C42A 3UI3A 4ZPVR 3QIPB 2FJDB 2UUAF 1OPKA 4F4YA 1E6YB 4USUA 4LBHA 5B0AA 3ZZOA 1RP5A 4PLIA 4LFAJ 4NLOA 3SV4A 1CLFA 2LLZA 4OHZA 3TR5A 1PKSA 1UWBB 4A8XA 4JI6J 3QXEB 1XNRF 2VKRA 4NZ0A 2DK3A 3EZ5A 4JI0J 1UTAA 3M2UA 1G6BA 4HCCA 1GXUA 3A12A 3DOLB 3SFUA 2BJDA 3BGRB 3CPWR 5CZXA 1IBMJ 1QWFA 4K0KJ 2AIRB 2W7PA 3TEGA 4QWBA 3MP1A 1WWHA 2F65A 5HY6A 3AODA 4Q0BB 1JNRB 3L2RA 3MAHA 3CMET 2DH8A 2BJEA 1PC0A 3DI6A 4PJJA 1WHHA 5IV3A 2DB1A 4IKAA 3I5RA 2ZPFB 1QM9A 2JZ2A 1GX6A 2FYKA 1U3OA 4C9DA 5JVHQ 2D41A 1GX5A 3PW7A 4URQU 4C8QA 1F3VA 4XTVA 4A8FA 3A1YG 3FCVA 4MIBA 3AD8C 3QSUA 3T9NA 3OR2B 1TUDA 1F5AA 2DAQA 2HW3A 2OELA 4Y3CA 4X4SA 3K58A 4YDDB 2YWWA 1RT4A 2C2ZB 4WBFA 1EQMA 1SSHA 2EJFA 4IFYA 2HK2A 2GJIA 2R7RA 4RNHA 5IC6B 4Z89A 1RAGB 3BO2A 3S3OA 2PVGB 3GIBA 2ROPA 2DNZA 4C6AA 3Q89A 4DR6F 1VCTA 1B7TA 5KFPA 4OJHA 3QGGA 2FJEB 2D8JA 3CD6T 3OYKA 3CCSS 4RTUA 4F7UB 4C48A 2CP5A 1M3AA 2FB7A 1I3OB 4KV8A 4XU3A 1CQNA 4B9XA 5KFGA 3LWLA 2KG1A 1KQGB 4FPIA 1NHKL 4TN2A 2X1GA 5HATA 2PUKB 2XMUA 4KC5A 2D9TA 2XWYA 2JMAA 4FNIA 4YFUA 3GFZA 3J81j 4LF5F 3QDFA 2O3DA 4A48A 2CPXA 5FLXY 3RBEA 1I5OB 4OL8A 2FEIA 2VDHA 3EFOA 1YJ9A 3C6UA 1B3QA 3EDQB 4OB1B 9RUBA 2FJWA 2NPFA 2LQBA 2EFQA 2NZ4A 2X3DA 2DA9A 1AA1B 3QSYB 4PZVA 5EN1A 1VQ9Q 3G8QA 3HT0A 1NHUA 1HWJA 4OI2A 4OI4A 1WJSA 4LIWA 2WK4A 5CO7A 3SFMA 3QNWB 3RW6A 2W10A 3GPAA 4F2SA 3DRSB 2O5DA 2QRRA 3AQPA 4ID8A 1AWJA 3HKZD 2P0PA 4L76A 5DGBA 2K2PA 4GC7A 5GAMg 3G4SQ 2HNZB 2ZKUA 4AQYF 3G6VA 3NPFA 4RW8B 3EZUA 4Y0FA 1DFDA 4IO9Q 3CCRT 4DL7A 1FXXA 2AHJB 2GGPA 2JEIA 4Z37A 1NLKL 3I5SA 3CC2Q 4FYVB 1J5EJ 1FD8A 2Z0GA 4DQRA 4NOYA 4C97A 1SH2A 3M8YA 4AYBD 1JLAA 3CCMA 3V7CA 1NO8A 4UF4A 4B6MA 3QATA 1YJWT 1JQGA 2DO0A 1WUUA 2M51A 3I32A 2HS4A 2F1FA 1G5VA 5HVGA 4C8QF 3CCMQ 3G6ES 1M5SA 1VQLS 1FCAA 4CLZA 2KJWA 2RF2A 4PG7A 2XC9A 1I4K1 1FTCA 1XNQJ 4NL3A 2CPDA 4YHHF 4MK8A 2MGZB 2CYZB 1PRLC 3VGTA 1OX8A 1ZBJA 2HGMA 1N0VC 3MM5B 4OI1A 1KJWA 3G71A 3QKJA 2YNGB 1OY8A 2FGOA 4C8QG 2R4FA 1ZSZA 3M0RA 3IN5A 3H5YA 2A08A 3VAGA 2AJFE 4ED8A 1SUQA 3NP5A 2B9WA 4UOCA 3MEUA 3BS9A 4MFBB 4N56A 3JCMJ 2R5MA 1FKPA 2MZRA 1S72S 2WBMA 2RNAA 3VU3C 2HZCA 2ZWOA 1P1TA 3N79A 1WF1A 2GTJA 2AZSA 5I3QA 4N47A 3AXKA 3DLLA 4WE1B 4F36A 2O67A 4X4OA 2KR3A 3VKIA 3NCPA 1JB0E 2AX1A 3VAMA 2MZQA 3NTIA 2YWGA 3A3PB 3LH5A 3VGVA 4LF9F 2CZ6B 5GMKj 1WGSA 2BE7D 3MM5A 2ZKTA 4G6VB 1GXTA 4X4TA 2YNGA 3HHEA 3NNHA 2DIVA 2UU9F 2NUTA 1N5SA 1YI2A 3B82A 2QIFA 4RBUA 4WXWA 5ETVA 1VK8A 1JLEB 3IM9A 5B0FA 3HSJA 1FNXH 3UN2A 4CC7A 2OSQA 2M52A 3MM8A 1WHXA 4OX7A 4H4OA 3L2ZA 1KBRA 2K3XA 3WDOA 5AXLA 4PEOA 4PJMA 2I1RA 4AFSC 4J5OA 3LQVA 2U1AA 2VGMA 4ZVSB 3GJRB 1T9XA 3X1LB 4WIIA 4WTOB 1VQMT 3ZZ0A 4FW2A 4OZ5A 4E0DA 1QVFA 4KBIA 1F5CA 2MSSA 4IUPA 4EPCA 3GONA 3UDVA 3ULHA 3KK1A 4JI1F 2ALZA 3RAQA 4CRIA 2BJ7A 1Q8BA 3VVUA 5HLFA 3RMQA 2ZH6A 2A37A 1OYXA 1X4DA 4DV7F 1N33F 4ECUA 3FSIA 3NNCA 3SCLE 4EU0A 1VISA 1WI7A 1UW9A 4A4JA 2AGOA 3SQGB 2ZGWA 4A47A 1XR7A 2PVOB 2RI5A 3K89A 4NXMF 4WKYA 1ZX6A 2CKKA 2QSFA 3GV8B 1F1BB 2R42A 3MEWA 2WOMB 2RUSA 1ZAXA 4ZP9A 4J9RA 1AZSA 3BM7A 1BE4A 2DNMA 4F7UF 1A7GE 2EC2A 2IM3A 2RQCA 5K8NA 5J2PB 1B99A 3IG1B 1HMVA 3AHPA 3OSPA 1TL7B 5I3UB 1QUPA 1SV5A 3MM9B 4DA4A 1R0AB 2QEXS 2J9DE 3MP6A 4RW7B 1J27A 2X1FA 1HHSA 3OA6A 1OPLA 2ZE2A 2MK5A 1R43A 4DSIA 3FCWA 2RKIB 2F63A 4LF1A 5KFCA 1RKIA 3M0UA 5I42A 5GAMj 4AL7A 2XMJA 1YRUA 3CBOA 3DLLQ 1C2PA 1KD1U 2YKNA 1WSRA 3QZ8A 3Q24A 1ARKA 3CCQS 4LQ3A 4PUOA 1WJQA 2XI9A 1ZLMA 2QTWA 1VRUB 3IAM9 5M2RA 2B9XA 2Q6CA 4ELYC 3A8OB 1TKZA 3VHQA 1X4GA 4TXSA 2XYGB 5IWAF 4C92A 3KJQB 1CBKA 3IG1A 1XMQJ 4Q5WA 4CRJA 2B9EA 2E3HA 2OTJT 1U02A 4N76A 2H51B 4LDXA 4ZGDB 4BE0A 1ZBTA 2O4XB 4IOCQ 2EWHA 3R8YA 2OI2A 2NSBA 1S0MA 2L2PA 2BW2A 2FHMA 2V4JA 3C15B 3KLHB 4E7LA 1Y4ZB 1YJTA 3VV0A 3D66A 2GGRA 3MMCA 1FJGJ 2KHDA 1FRKA 3OSVA 1VQ6T 2L0AA 5K8PA 4OX9F 4HCKA 1ZUYA 4K4ZA 2HDAA 4M7AC 3D54A 3OMGA 3HI9A 2O9VA 2CQDA 4DX8H 5GANg 1HQUB 2FRYA 1ELOA 3I96A 4OIXA 1K0SA 2CH4W 4LDUA 4IQMA 2KYMA 3CCEA 4USIA 2HBWA 3DDIA 3KLGA 2MAMA 2DPIA 2EXUA 2YUNA 3SDZA 2XLJA 4DSEA 2IBOA 2EK6A 5GAHU 2RAQA 1FNMA 3MR7A 3CCEQ 4DOVA 4ED3A 5H9FJ 3GPLA 2EEYA 1TAUA 1U8RA 4O4GB 3VWSA 4TKTA 2G1DA 1ABQA 1Q86C 4DBHA 4C7QA 3MEEA 3HVWA 4ZDNA 3DMJA 1HNIB 5L1LA 1Q0NA 1BY9A 2GVZB 2HRTA 4NLQA 2CJKA 4MDWA 1LW0A 2H8HA 1YWOA 1YLXA 1M1KU 1QAIA 4QQGA 4DV6J 2VV5A 3PRDA 1PKTA 3MMAA 2J0WA 1S1TA 2HFUA 5J3BA 4B9NA 2Z57B 2CZ1B 4CP5A 4JRKA 1S72A 1R3NA 4DR1F 5FU6B 4BACA 2QFJA 2DVEA 2E64A 5CAIA 1K73U 2KFYA 4HR2A 4IH7A 2EFGA 4BS2A 4BDPA 1RKJA 4XTYA 5KFQA 4R0JA 3NTKA 5KE3A 1K0XA 3I9ZA 1RYRA 1MMNA 1AFIA 2V1RA 4KH0B 1PC5A 1G83A 2VBZA 1RYSA 2J6SA 5GMKe 2XSJB 4M77D 3GR1A 1E6GA 3CCQQ 4DPTA 2QLJB 2OO4A 4M8LA 5CXTA 1T03B 1RAJA 5HBMA 3LALA 5D8HB 2KT8A 3SWNB 4XTUA 1S76D 1OYEA 3HX9A 3VZIA 3H8YA 4LSNA 3PR5B 4CLFA 4Q5VA 1JX4A 1JMTA 3US5A 4Y2CA 3CCJS 1ICEB 2MSTA 4EDUA 3EMTA 1CJTB 2OI3A 1NZAA 3GLJA 3TJ8A 5LJ3Y 2NSCA 1S1VB 2U2FA 1RISA 3EG9B 1CKBA 1AUSL 1TK0A 4WFNQ 2WW8A 2GIQA 2ZBCA 4RO0A 2V2ZA 1D0EA 2P8IA 5H9EK 2CGHA 5LMUJ 3CD6A 4C8LA 4DEXA 3D9BA 1G2BA 4M5HA 3HLUA 4BDZA 1WQWA 2AEJA 2BUNA 3VF0B 3IS9A 2XIDA 2P0KA 4HCZA 1PIEA 1KD1R 2RB7A 3RIRA 4K2JA 1SQFA 4O3SA 2UUAJ 3ILIA 4BI3A 2NXUA 2DL5A 3PTAA 3OXGA 3UDLA 4M5KA 4M77C 3OS2A 1Q95G 1I5LA 2NCKL 3BF4A 1NSAA 1WHLA 4RW8A 2HVZA 2J0QD 4E47A 1VRQC 4OZ0A 5IC4B 2PNIA 1WEYA 1UMJA 2C1EB 1DLOA 3GWCA 3F41A 3E9GA 1Q81C 2L41A 3H0HA 1QJHA 3ZFVA 4LD9K 5FLXU 5IHNA 1KEKA 1R0CB 1HYSA 2QX0A 1X01A 4JOUA 3TRGA 4G65A 2CPHA 2V8DA 1NSKL 4RNNA 3VR1A 1SB6A 2W2PP 4J9SA 3HXMA 2B7CB 1LW2B 3R1LA 4JV5F 2J6UA 3K0JA 3W65A 3RESA 1RWWB 5D0EA 2JTMA 4J9CA 3OYYA 4DDFA 2HNIA 3KHLA 2AT1B 4GMKA 1KQ2A 2KDOA 4D6WA 4DSFA 3OBWA 3MEEB 3H0FA 3J81E 3O5ZA 4KUDK 3W7BA 2EFIA 2NUZA 4ELTA 4AFQC 2OH2A 2J7KA 3VS2A 3M4XA 4MKBA 2VUGA 3NS7B 4C0DC 2QAZA 3ENAA 2ALYB 2VZ9A 2CJBA 3H25A 2M8DB 3EHRA 2MQMA 5J2NA 3SCJE 4NLYA 1MMGA 2WTFA 4JI0F 2VUBA 4TY8B 1H641 2HZAA 5F41A 1P8GA 3IR7B 3G8TA 3UE2A 4DU8A 2AX0A 2VC1A 4O5VA 1M1KR 1NM2A 1JLFA 5BR8J 5ITHA 2MLYA 1JJCB 1F5BA 2WSEC 2FPHX 2DGVA 1APSA 3K8VA 5KTQA 2IDLA 3R97A 3QJ6A 2M2BA 1WF0A 2XI2A 5M9OA 1RU1A 4ZPDA 2CQ2A 1SC3B 3CJ2A 2G0CA 1V5VA 3BQ2A 3BE3A 2LCLA 1K1ZA 4X34A 2HQHA 2V8IA 4ZN1A 1VQMA 1N36J 4EGLA 4CC2A 2IFXA 4FKYA 3S6WA 4E7HA 4U96A 1ZUUA 2J9EA 3V4MA 1MMDA 4DSJA 1Y71A 4YQWA 2GQIA 3D67A 3EXCX 1UZDA 1X75C 1RWNB 4FBUA 1PBAA 2EKYA 4MYTA 2JS2A 3ZTPA 1DHMA 1AB8A 1PAEX 2CXEA 2EYQA 3PX4A 4FN5A 4FZVA 4OP0A 1GMUA 4DOZA 4RNOA 1RUWA 4C8NA 3G87A 3R2DJ 2B5JB 3P8DA 2QFIA 3JCMe 2VD3A 4DU7A 2X51A 1S6OA 2RMLA 1B3TA 2DTJA 2YUQA 4Q2LA 3G2XA 3PO5A 5KFRA 2E3IA 3A3NB 3G6ET 1MUZA 2SEMA 2WZ1A 4EIKA 5GADI 4PQUA 1UPMB 1UGRB 1EHWA 2UP1A 2VONA 3KK3A 2JVVA 2LDYA 4NYZA 1Y0HA 4KGKA 1SHFA 2KXFA 4E7JA 5L46A 4RTTA 4AD6A 2EWNA 2RF2B 4F3OA 3POTA 1J3TA 4VUBA 1LEOA 2VFVA 1QAYA 3PT9A 4TYAA 3KLFB 1AZEA 3MEAA 3I5BA 2QQ9A 3DGVA 3M9QA 1CS4A 3MM6B 4B3TJ 2MGZA 1RU2A 2DXTA 4FT2A 2OTLQ 4Q45A 1TL1A 1KSPA 3H9NA 3VUBA 2V50A 1KVIA 1RAEB 2RNEA 2UUBF 3KUGA 4FCYA 5KAKA 3GJSB 2UXBJ 1DTQA 4E6RA 2QGFB 1Q7YC 3J7A1 5JXSA 2M0GB 3EXYA 1QP2A 1X69A 4UUWA 1P6TA 2NUUG 4M7DF 5GAOp 4RWXA 3G86A 2H5EA 3CCUS 2EQIA 2CPYA 3GFYA 2R8JA 1HBOB 2J7WA 2CG8A 3C16B 3IBCB 4P2SA 1CSKA 3OB9A 1TKXA 2PI4A 1Z9ZA 1GRIA 2NUPA 1WZOA 3PX0A 2JXBA 4C8KA 2IVFB 4M5DB 2OTJS 2F9DA 1TL1B 2BKNA 2O88A 2UXCJ 4MZTA 4NL2A 3BDLA 1AWOA 1UL3A 1EQ0A 4FDFA 3BBFA 4P73A 3K7RA 4H4KC 2IRUA 3I0RA 3IA0A 1K1QA 3D0IE 1CJKB 3QHSA 1OY9A 2XCPA 3NGKA 4B3MJ 4CO0A 5I4MA 1WOPA 3Q1JA 2EBPA 2HD0A 2LNVA 4A4FA 3MKDA 1TZ0A 1JRIA 3OL7A 2X1BA 2J05A 4X66F 2JEGA 2IAJB 4WFXA 3K57A 3V8KA 3I55T 3WVEB 1UFFA 2BMBA 3KJVB 1WHGA 2HQFA 1M8MA 4DQQA 4PFPA 2HS3A 5DGAA 1U1PA 2Y0SD 2LQKA 2AD9A 4KR0B 1T0JA 4ZVFA 3OW2S 1U0HA 3P5BP 3UA6A 4PJOB 1BK2A 1YIJQ 3KK1B 2YHTA 2EKHA 3H6ZA 1J5OA 1ZSGA 2QQSA 3CD7A 4C2MA 2F1LA 1BIAA 1FJEB 2OMOA 5GJWB 2H9ZA 3HSBA 4JI3F 3QZ7A 2XG8A 5KFSA 2NS1B 2B6AB 4C3KA 4R8UA 1T9UA 2XU8A 2D7SA 1YJ9T 5LL6d 4M7DB 3WIUA 4IDKA 4DL0C 2ZDOA 3DGPA 1N9RA 4DUYJ 4KV8B 2NPIA 3P96A 4ID5A 4J9DA 4AFZC 4C92C 4W92B 4X4RA 2DHAA 4Y28C 1U6BA 3CPWS 1IKWA 4LRBA 3OQ5A 1FERA 1LXJA 3EDRB 4DR1J 4K4WA 1X27A 1V76A 4RUBA 2YVSA 2V4QA 3TO8A 2DRMA 2OMLA 3GP8A 1RQ0A 2RI2A 2LFVA 1S1NA 5CYMA 2GQCA 5BYRA 3DLBA 2G2YA 1OY6A 1KD1C 2EYXA 2QMXA 2BUDA 1Y0MA 1ZZNA 1X0FA 1ROFA 3Q23A 3U02A 1JLBB 2HHPA 2L08A 4I68A 2CUYA 1KQSA 3KXTA 2E10A 2CKWA 3MM7A 4DPUA 2QQRA 4TVRA 3LWIA 3DRRB 4ECVA 2DEIA 2DPJA 4LR8A 3KMSA 5HROA 3FFIB 4N8OA 5DG8A 4ETZA 4M7AD 1Z1ZA 4LF6F 4ITSA 2HHWA 1ZM2A 1Y5NB 4J9KA 1AROP 3SWNA 1Q8IA 1KC8C 2FLPA 4I64A 3WXMB 4LRAA 3JCMb 8RUCA 2GBQA 2XS5A 2W2OP 4K4UA 1P9QC 4J6YA 4J7FA 1QSSA 4I2PA 1YQHA 4ANDA 2HFNA 3CMEA 1C4CA 4PG6A 1RJJA 2DM1A 2YWEA 3IRXB 1JXMA 2BE2A 2OFHX 3JQJA 2E29A 7AT1B 2DNNA 1YRTA 4FYYB 1F0XA 2LMIA 3BGUA 2VFSA 4LFBJ 2HHHJ 3DRYA 3VAHA 2C0TA 4LD6A 2VG6A 3CTRA 3DRRA 2KROA 1OPZA 1RTHB 1VFJA 2R9LA 1PSEA 3JAMU 2FY8A 5IOLA 1X7VA 4LF7J 1ZZFA 4MT1A 1U8SA 2BZXA 1KNZA 1VQKS 5I22A 1UVJA 2FLLA 4JV1A 1HW9A 2HURA 2PFDA 3QDRB 1K73R 2DL3A 1NHVA 3QAUA 3NS5A 2E4HA 2E1MC 5CKEA 1UCNA 2PSZA 2MY7A 1XN9A 1FRIA 1TG0A 4B3OA 3KDOA 2C0IA 4C0GA 1N32F 4ZNXA 1GAOA 2ZJPQ 5JUMA 4DL3A 3EVMA 3PG9A 1SJRA 5I2MA 2BEFA 2QDLA 2XS2A 3W9HA 4K7QA 5AE1A 2AU0A 1RT6A 2W1BA 4ZP7A 2HHXA 2E9RX 3LGFA 4L6V5 2CNLB 2YKNB 1W1FA 5KYXA 2DO3A 3M53A 2MHEA 5CYQB 4M5MA 3GG0A 3FRZA 4DQSA 1B34B 5KOXA 3NS6A 3CC4Q 4C8QC 4V19J 2OPPA 2VG5B 3M0PA 5GJVB 2ASDA 3GE9A 1KFDA 3CJRA 3TI0A 4DSLA 5D6YA 1M2OA 1U1TA 3JQMA 4KQZA 2QLFB 3B4MA 2F4FA 1S1TB 2HAXA 5DM6Q 1MW7A 4IOBA 2KL8A 4OVAA 2N7YA 5A8RA 3OFFA 4U7UK 2B6AA 3CC7A 5T7LB 4EMDA 1YVFA 2GS8A 2UV8A 1M5PC 2E1HA 3QT5A 1IZ6A 2E65A 4M7DD 1RWUA 1NJYA 1L5UA 1FJGF 3NXZA 2OPSA 1F6TA 3HO1A 5KG7A 3TA1A 2L3SA 1VUBA 1NKBA 4WP9A 4BI8B 3RAMA 1D1UA 4J9NA 2Q6BA 1RE1B 2FVCA 4WFAQ 4I1TA 4OMMA 2VQFJ 3DLEA 4ECXA 2ABLA 4X84A 4J37A 1MNDA 2KRSA 2K1RB 1R77A 2FHJA 4QOTA 4ECRA 1CJVA 5GAN3 2MLXA 5L8RE 1UZHA 3EVOA 1GMVA 5HP1B 4RPFA 1LWEB 2HWTA 2JJ9A 2RJZA 4F17A 2LQ5A 2YRDA 1FX4A 3MPWA 3BO4A 2V5HG 4LBIA 4CO2A 4O3QA 2CP7A 2QA4G 2QASA 1SI9A 2MQQA 1T9WA 3SDEB 3HFOA 5A6PA 1BHNA 2NYIA 3REAB 5IXBA 2FPDA 2FHKA 2UVRA 3RR8A 4QPTA 2IG0A 3RRHA 3RR6A 4C0DB 1H3DA 2GA7A 2F40A 2VL1A 1LW0B 2J6OA 1FTRA 3F0NA 2DNKA 4QIFA 1WKLA 1XIQA 1K76A 1VI7A 1D9FA 3IS9B 3KUHA 4CO5A 3DLKB 2W9CB 3OVBA 2FJXA 2WHOA 3OFGA 5CD4A 2UVWA 3G71T 1Y9OA 4QU6A 3PE0A 1D9AA 2RKIA 2K2VA 2LYVA 1BCMA 1FJCA 1IBKJ 2BZ2A 3CE8A 3GCWP 2D9PA 2KEAA 1H38A 1VYVA 1M8VA 2DF6A 5JMNA 4F4WA 4HDHA 4KE5A 1D9DA 1WACA 1U48A 3CCSQ 2B5JA 3MHXA 2DNGA 4DN0A 1QTNB 2ZH3A 2XBPA 4DPXA 3CMAA 5D15A 4WJBA 4KHMA 2QA1A 2XMVA 1TAQA 2DY1A 4EO6A 1QP3A 1UVLA 4PQAA 4UUXA 2OJ3A 4IIOA 4LUBA 3VV2B 1IN0A 3DRSA 1RK8A 3NCRA 3BO3A 3OS1A 2DGQA 2C2OB 5LMUF 1Q7YT 3CC7Q 8AT1B 4OMPA 3H42A 3U27A 3P8BB 4RZRA 4OZLA 1S6PA 2KYZA 4ER8A 3R3TA 1KC8T 3M58A 1U1OA 3RU0A 3HHKA 3RJMB 1X2QA 1ULRA 4V1Ak 4GLMA 3FJ2A 4KHPF 1JJ2S 4M75D 3S6EA 3EPGA 1NJIC 4EBCA 4JI4J 1R8AA 2B4OA 2DK2A 3BKTA 1NK4A 3CCLA 1VQKQ 5KFTA 5CA5A 1AUDA 3DI6B 2ABYA 2OP5A 1BQNB 5ETRA 4DR5J 3SSQA 1M3CA 1M1GA 2K7JA 1OX9A 1S72Q 3NGPA 5KYUB 3CUNA 1P27B 3FZ2A 1HBNB 4Q44A 5AJ3J 3JB9G 3DLHA 3M2RA 2HHHF 3WBZA 2VJUA 1BMQB 2AGPA 4C8ZA 2DR7A 3OTCA 1TL3A 4FW1A 3H5SA 2CPEA 2KAFA 1H73A 4QQBA 1IKYB 4JZ3A 1XJWB 5T7LA 4L75A 1PCAA 2D8HA 4NI2B 3BGOP 4M75C 5KFZA 3R5GA 2COZA 1U26A 2E7VA 1YWXA 1OOTA 3I0RB 3LH2S 5IT9Y 2EJ9A 3CSKA 1I6JA 3PRBA 2AF6A 2YNIA 4DV2F 2ACYA 1VQOQ 2C0OA 4U8YA 2VQFF 1X2KA 1YI2T 4Y91A 4YY3J 4ERDA 2DXCA 1U8WA 3S7RA 2OAUA 2ZHOA 1E6VA 5J2QB 2A7YA 3GYNA 2VH7A 3ZL7C 1O51A 2HIYA 3UD5A 5DLQE 3M2RB 2QA4A 3MGJA 4DLGA 1MLAA 4M78A 2RQRA 4UW2A 5DG7A 3BGRA 3D6FB 2QDYB 5FRNA 2VQEF 3CCVS 2D74B 5IT9U 5HL7Q 4BY6C 2XDPA 1D1BA 1HWLA 4DV3F 1UJ6A 2Y0BB 4P52A 3FJPA 3CJKB 4OB3B 3TU4K 3IR5B 3CVKA 3CMEQ 4EFAC 4R8UB 1NEGA 3K2YA 2JFDA 3TAPA 2CVEA 5L1IA 3U1LA 2RRNA 5A8WA 2B9YA 5K5MA 4LRCA 3MZIA 3P45B 1Q82U 2YQ3A 1UVNA 5E7OB 1O6XA 3BZQA 2MKJA 2KBTA 3A8KA 4RW4B 2GO8A 3OR2A 2V63A 2XULA 1GTHA 2AYMA 1G8XA 2VDIA 1EKSA 1SPKA 1AYEA 2DVJA 4LNPA 5CK9A 2GV1A 2VYTA 2C06A 3OHAA 4O23A 3CNQP 2YXYA 3C19A 2DIGA 1Y11A 3TVYA 3EHQA 4DJBA 3CCVT 1N5QA 1XQHA 1SSFA 2M3DA 2ED0A 3O1LA 5KG2A 4NXNF 1FXRA 2P0QA 4AXJA 3W2WB 2HFSA 2OGUA 4I56A 5LJ5h 1U09A 5A2QY 5FW9A 4FF2A 5M2PA 3W62A 1Z2ZA 5AT1B 1KQSP 2D3OR 1W2BS 4B3TF 2DCUB 3CD6Q 3LAMA 3PNIA 1QLNA 1S1XB 2EKNA 3CJQA 2MJNA 2YNFA 2QL9B 4LRFA 3SIPB 3KBGA 1AZSB 4N0AC 2EGEA 4RTYA 1KONA 5HROB 5D4OA 3AD9C 4G1IA 1LV5A 3JTPA 4RUCA 2PD1A 1FRMA 2JTFA 3IFEA 2FHOB 1FMKA 3I55A 1S7IA 5KFHA 3N28A 4F67A 2K2MA 3VTIA 4IR1A 3HHLD 2COLA 2JOQA 3CCJQ 3FEYB 1VQMS 2OD4A 1UJYA 2K3BA 2Y1JA 4RNFA 3MD3A 3R5JB 2GVDA 2ILZA 3FKBA 3L7OA 4YR2A 3VS6A 3GV5B 1W70A 1NMEB 1X6GA 1DBDA 2JNGA 1FVSA 1VQ4T 1GMWA 4WU2A 4H4MB 2MKHA 2AEMA 3FJ5A 2L8DA 2CUDA 1EX4A 2QA4S 3PEJA 2OPQB 4KBMB 2YX7A 2RE1A 2Y1IA 4BWMA 1N5ZA 2AJ2A 5GMEA 3HD2A 4TLQA 4WE1A 1VQOA 4WP8A 3V2UC 3LP2B 1TWBA 1RTJB 5LSRA 4NASA 2DBBA 1UGQB 4X65F 1OMSA 3ULRB 5F8JA 4M63A 3CIZA 3OT9A 1KC8U 1X4HA 1NJIR 3CEDA 5ETMA 3CCRQ 3BYRA 3HSZA 4HKQA 2HAIA 2CQ3A 3OQ2A 2XMWA 2LNHB 4YMEA 1UWAA 3LAKA 1L3SA 2DZ9A 3V6DA 5H9EJ 4E7ZA 2ZH7A 3NMZC 5HVHA 1VIOA 2FYXA 3HFNA 2WB1D 3L2VA 4LT6A 4Y2AA 3QZ9B 3LTOA 2QMUB 3MM8B 2LZ6B 1R0BG 4OJ3A 2KZZA 3W64A 4UZCA 4NA1A 2YWHA 5GAGI 1WELA 3CCMT 2RQKA 1WJRA 1VBZA 1GFDA 1WOOA 3CCLS 3CGIA 3EG2A 1QCOA 1SL1A 2LQ9A 2DRBA 1E7OA 2M70A 4CLUA 2QC3A 2CJXB 2RPNA 3VS4A 1HNWJ 4JV0A 3VQTA 3LGHA 3FSYA 1A0OB 4P6QA 4Z02A 1UW4A 3RMSA 2V8KA 2MEWA 1Q16B 3HHTB 2CS7A 2HHQA 4MZPA 2L3MA 2KM8B 3PW4A 4GRSA 1B4SA 5EHHA 2HKNA 4JI8J 1GCQA 1HXDA 1W2BP 3E3XA 3TZWA 3ZZTA 2MWPA 1VQPQ 3NFCA 1YJWS 2V1QA 4ZLLA 2E5QA 3SB2A 3I56Q 2WCXA 4CLWA 2HWIA 4C11B 4R5PA 3I4PA 5HMXA 2QK0A 2BA9A 2BABA 4PLLA 3RZAA 3CCRS 4NXMJ 4D3GA 1N88A 4OLPA 2NREA 1REVB 3RB6A 4XQ3A 1HWUA 3EFOB 1TFYA 5EWEA 4I2PB 3AOCA 2BOAA 4QYZJ 3RB3A 1UEVA 1ACMB 2R7VA 3VZHA 2RQMA 2EYZA 4ELVA 2BW7A 4M5NA 5BJRA 3M8PA 5LXRA 1W2BA 4FYXB 3OLAA 4M5JA 3DXSX 2WSEE 4FYWB 4DUZJ 2WSFC 2QL7B 4P71A 2PT0A 4W98A 2BYCA 1TUWA 4NEYA 1X4AA 2J8AA 3PIOQ 3EH2A 2XMFA 4M75E 4CYUA 5DG9A 2IVWA 3LX7A 3THKA 5HQMA 2V8HA 1LWCA 2GQ2A 3H5XA 3ITHB 3W8GA 4OHYA 2V8JA 3RRGA 1FMVA 1VYAA 5HBMB 3E2UA 2CPFA 1VQMQ 2IMWP 5GAMe 1KHVA 1UVIA 1LXNA 3MAAB 4ANCA 2KH9A 2DNOA 3D7SB 3JCMP 3D3CJ 2GHWA 2BRKA 3C14B 5HLFB 1DAXA 2DR6A 2AEFA 1N56A 5I21A 2UXBF 5GAN4 3GV7B 3HVTB 3DRXA 5FU7B 2GCXA 5FIIA 4KTQA 2KY9A 2ZPBB 2N4DA 2BQ3A 2RS2A 2VBWA 1FFWB 4TLRA 3FEZA 4L73A 4CCHA 2JLFA 4LQ9A 3AB4B 1O75A 3T1YF 3C16A 3FFIA 4ZJLA 4PCQA 5LL6S 1IKXB 3ISZA 5GMKh 1N5YA 5ADZA 4ZPTR 1S0OA 2HCKA 5KT7A 1QVGA 4NA2A 3TCJA 4C4WA 3LW5E 2KM8C 2JRSA 4NOHA 3M8WA 3QO9B 1RAAB 2W9AA 4WTYA 1SJQA 3W9JA 4BLGA 1M1FA 4DV4J 1RT3B 3N0VA 2HSEB 3MD1A 1EP4B 3R7SB 2MIOA 1K9MT 2W7AA 4OZNA 3GBQA 1Q82R 1VBXA 2PTKA 4ZJOA 3KLEB 5T41A 3RBZA 3MPVA 1JEGA 1OWXA 1QVFP 5HVFA 3AHUA 1OQ6A 3AJ2A 3AD7C 2MCNA 1XNQF 5CABA 3TJ9A 1WKKA 3RTVA 2MKSA 3L1AA 2MOXA 4B9LA 1HYSB 1WX6A 4C92B 4RJVA 3FIFA 3LPYA 3M0TA 3FGVA 2DILA 4O6JA 3U1MA 4C0FA 4ATOA 1VS3A 1URRA 4OFZA 5D0HA 1FD2A 5KFXA 4U67Q 2K1RA 2HPUA 3DLGB 1VJWA 2IC3A 2ZITA 2O4XA 2DJWA 3PVLA 4CT9A 3KK2A 1NK7A 3VGUA 5LJ3j 5D6WA 4MIWA 2PFFB 2NXEA 2DGXA 4NI2A 2L89A 2Y4YA 2P84A 3EGZA 4PG8A 3D68A 1S97A 3EWGA 4O44A 5D3GA 3HM9A 1K1SA 3ASKA 3TP2A 2FIUA 4JP8A 3V4IB 1RHUB 4ZPBA 1T3NA 1KD1T 4ES1A 4B9SA 2F3JA 3DM2B 5DRKA 2HQIA 1E6VB 3P6YC 2P9CA 1S0VA 5FWCA 4LFCF 1U2CA 4DUZF 3ETMA 4A4EA 4ZCLA 4M7DG 2XZDB 4TY8A 1TELA 4R56A 1KOHA 1UB4A 4DV3J 2DL4A 1G4CA 4MMOA 2BACA 4Q2MA 4QR0A 1RACB 1G3WA 2P4RA 1Q8KA 3CDAA 2VQEJ 2XEXA 4PYAA 1DRZA 2FTRA 2W01A 4X4QA 2DRKA 5CD4H 4F25A 3CCET 3OR1B 3CULA 2E1AA 4CQ1A 2OPSB 2N7CA 3LP1A 3WC0A 2YKMB 2E1RA 1KRPA 1UFKA 4GY5A 2R7OA 4OX6A 1RA6A 3MPDA 1YJNQ 1I51B 3R5DA 1ITPA 2DEJA 1FWPA 4Y2MA 4WKRA 3J80U 2VASA 2LU2A 5I3UA 3RW7A 4ANEA 1YITQ 2JOYA 2QEXA 4WF2A 4DV2J 3CC7T 1Q1KA 5C25B 3MP8A 1C0TB 3JAMY 3IC1A 3DN9A 4N5SA 2ZVIA 2AKWB 4I69A 2YNHB 1TKTB 1IKVA 2J7IA 5B08A 3VAKA 1T3OA 4DFPA 1MWQA 1VHFA 3QWUA 3OYBA 3CPWA 1BI0A 2AHOB 1BCOA 4DV1F 3VRZA 3Q8YA 5A0LA 3I82A 2JM9A 3R6LB 5FDLA 4DX5A 1WTBA 1Q86T 3OSSC 1GT8A 4OJGA 4LVOP 2X3GA 4NX9A 2Q1LA 1QVGS 2N3OA 3L95X 2ZPHB 4KGVB 3B54A 1IWGA 4CC4B 3WQPA 4LE9A 5DDQC 4Q8EA 2M9UA 1PYOB 4CZCA 5HJXA 3POTB 3IP0A 3META 4YHHJ 2CJ9A 4WYWA 3JCMc 3IO1A 4FF1A 2HBQB 3Q8QB 1A9NB 4E8UA 2KK4A 4F0MA 1N8RR 4RW6A 2XYPB 4OMNA 3I6PA 3K5OA 3MEKA 1YHQS 3HTRA 1IKVB 4P7TA 1C1BA 2LTOA 4O3OA 1M5VC 5KH6A 4RLEA 2EBGA 2C2NA 1BU1A 3CDBA 2KTQA 4DR7J 5B09A 3C66A 3QT6A 2GIRA 3D28A 3T5KA 3PW5A 4EMKC 4PK4A 4NCAA 3BDPA 1CJUB 3TX0A 3A8MB 3UA7A 2ZNZA 4W90B 3UD4P 2F8HA 3RG6A 3I4HX 2OPQA 2LU1A 4OMLA 2WSFE 5CZVA 3D1HA 2RQWA 2KI7A 3RB0A 2E5LJ 4OGEA 3EGXB 1S1WA 4IG0A 4KRTA 5KFAA 3O3LA 4RW6B 4GVBB 2RDJA 1N48A 1K8AR 4JI6F 4B08A 2NXNA 3MURP 1Q7YR 4K8RA 2LC4A 5KT5A 5DDPC 3ET6A 3JSRA 2R7UA 3QBYA 4JBCA 3DYAB 1PSDA 1NNDA 3RDVA 2F4VF 2A0FB 5KFUA 3H4BA 1Q82T 2D0QB 3DHWC 1Y5IB 2E6ZA 4JYAF 1MN9A 4MFBA 2RSQA 2DETA 2KMTA 1I94F 2W9BB 4HT9A 4F7UA 2VA2A 5KOWA 4F7UG 3C46A 2D1XA 2DEQA 4RU9A 4Z8AA 5CVIA 2W2NP 4LR7A 1RWXB 2EYYA 3M1VB 1NE8A 5LJ5j 1OIAA 1NUEA 5IN1A 4PFZA 1NRKA 1QCNA 4URSA 3OS0A 1FMWA 4QW9A 1N0UA 2EYWA 2EVRA 4ED2A 2PZ1A 4JI7F 1KVJA 2DL8A 1N33J 1UUEA 4KULA 1BKBA 2RHZA 2ZAEA 3NAHA 5J26A 2B7BB 2K79A 2I5JA 2D3ZA 4CLSA 2AYEA 1YJNS 4QIVA 1GBRA 1NB7A 3C8YA 2YNIB 2G1HA 4LFBF 4YDXA 4ED5A 4YB5A 3M9NB 3RAXA 4BE1A 1X6OA 3OYCA 1RI7A 4LIRA 2CSQA 5K20B 3KLIB 3DGPB 5ETTA 3ME9A 4KY3A 3OL8A 2LDMA 2G3RA 1VIEA 5J2MA 5AXKA 3BQ1A 2QQBA 2JUFA 3S01A 2EW9A 1P92A 5F8GA 2RQ4A 4UOGA 4JJNK 2RM4A 3UR0A 4K11A 4ES2A 1CJTA 3NOCA 2N4CA 1T11A 1M1HA 3TAMA 1R31A 2XO7A 1NYFA 5L9NA 5CCLA 4EO8A 3NMRA 5F3ZA 1UFLA 1G7CB 3MR3A 3H2LA 4MH8A 2BANB 5HK4A 2F8EX 2FD2A 5LMNF 4YB7A 4I6AA 3TUZC 2LQNA 1EETA 3L09A 1FXDA 1K8AT 3HHDA 4GBQA 2B51A 3IM8A 1WKJA 1QMCA 2SXLA 4PR6A 3TREA 2WAQD 3BSOA 1VQOS 4TY9A 2AJQA 2IYIA 1AVZC 5ECAA 4HYKA 1VQ4S 1B0VA 3IGNA 2HQ3A 2EBEA 4MIAA 1IXKA 2CDRB 1DTTA 2ZPEB 3FDRA 2F4VJ 3KJFB 5IXUA 2DL7A 4X64F 3V5RA 3HPWA 2ZPIB 2MMYA 1X6BA 1HNZF 4I2QA 3CJSA 2GAGC 2MTLA 3HMJG 2FDNA 4IYQA 2DYIA 3QYYA 3VS1A 9ATCB 3DB4A 3I9QA 1Y00A 3LOUA 3HVTA 2MKYA 3MWBA 1IREB 1BC6A 2NQPA 1Q53A 4ZIVA 1NZ8A 3VAFA 2EQUA 1HBMA 1HQEA 1S4EA 1D8YA 2B4UA 1YP5A 2I2LA 3MO8A 1FK9B 2NLUA 5EG2A 3QFWA 1N6QB 2RDDA 1AEYA 4J9BA 1HI8A 1VQLA 5A0GA 1KQ1A 3NEKA 4WP3A 1QSYA 3BW1A 4GVBA 2YH0A 1LW2A 1FRXA 4DG1B 3K17A 2M1HA 1KC8R 2MB0B 1O9SA 1HI1A 1HARA 1VBKA 1YHQA 2HMIA 1RT3A 5KFVA 2V6AA 5E2QA 2PE8A 1C1CB 3G4SS 4X65J 2AJ1A 4IG3A 2ASYA 1TV6A 1RTDA 3OUYB 2MKCA 3UPUA 1DJ0A 1T0HA 1D8ZA 6FDRA 1HQEB 2KVQG 4M7DE 2GO9A 4NLTA 4OZ1A 5IQ6A 1SKRA 3OL6A 1R7IA 1H6KX 5D77A 3M4YA 2G13A 4RTWA 3M30B 4AUKA 4M4ZA 2FVRA 4OMQA 2HBYB 4ID5B 2KYXA 3CXCR 1HNXJ 2Q66A 5A2QE 1SPBP 1V3SA 1PJ7A 5DS7A 2JC0A 3RKYA 2FPEA 1YCSB 4P10A 3GIRA 4IOAQ 1GNKA 5KFDA 4DL5A 5AYFA 4CTAB 2GJ2A 2LQWA 1XBWA 5GMKl 1DQ9A 2NR0A 2DXBA 3SV3A 1N36F 3QPHA 1Y7PA 4LREA 2X3XD 1HPZB 1BI2A 3UCZP 1D3BB 3A13A 3HPOA 2DZCA 3M8RA 4NLXA 3JB9F 5C2GA 1OU9A 1FESA 3KLIA 2JHEA 4XDCA 4OZJA 2E41A 1RLPC 2WONA 3I56S 3DMJB 3PM9A 3I55Q 3MMBB 4RUAA 3RBBB 5CAAA 3UNGC 2UUBJ 2COYA 3QLHB 4CM0A 3J81Y 3NKYA 1HD1A 1R6VA 3OXLA 2LQ8A 2W0ZA 4RCBA 3KTQA 4QWDA 3QRRA 5JJBA 2ZZNA 2IRYA 5E3PA 5GMDA 2I6WA 4NXNJ 3JYTA 2A2DA 4DZ6A 2VOOA 1JU5C 1LWEA 4QVZA 5I42B 4TU8A 4Y2IA 4AXIA 3L4BC 3TUJC 1X5TA 5MLCV 4KO0A 3VS3A 1NK6A 2JLGA 2Y8WA 4B9MA 2R8GA 3M54A 4C11A 4R5PB 3UCUP 2H65B 4PRFA 2EFPA 5E3CA 4F0KA 1SRMA 2RK1A 2E1PA 1SIWB 2W7OA 3NGUA 1VGYA 2BVZA 1NLOC 1UVKA 1UA0A 4UY85 5E0OA 2LJ1A 4PJOE 2B3TB 2W9CA 4B9UA 4LMZA 1OPIA 2CVIA 3PJWA 2CFXA 1OEBA 3JYTB 2ZVSA 2GGPB 2UZAA 4N8NA 2HG4A 4ZVOB 2OEMA 1JJ2A 1SG5A 4PYDA 3DCAA 1AW0A 3HCXA 1XTZA 1PCXA 1UEBA 4PWDB 4ORZA 3UWNA 1LWFB 5THWA 1M5HA 1U1RA 2MI6A 2W4PA 3H4DA 3UVJA 5KYXB 1IWAA 1UJ5A 5D0GA 3A8HB 2BJ1A 4FXVA 2M4MA 1IRXA 4PL6A 3OMCA 1IM4A 2DH7A 2RD5C 1HL6A 1X9MA 2C3PA 1UHFA 3JAME 4NCBA 2I9SA 4DQ2A 2BV3A 1Q81T 4QVDA 3UR3C 2ERRA 1ZYQA 2H4WB 1VQ5S 1K9MC 3ISND 4RUGA 3DLMA 1U7LA 3GFXA 4QWEA 1QVFR 3MAAA 3GYXB 1U2RA 2QE5A 4YR3A 3NGTA 2D3UA 4IG3B 2G9OA 3I0SA 2IY5B 1CJKA 4LF5J 1Y07A 3CJ8A 1WSVA 1Y96B 5U47A 4PJOF 4RR5A 5EWFA 4O44B 2V2KA 5GAEU 2XKOC 3OTOJ 1VRUA 3L9ZA 2E6NA 5IT9E 1IKXA 1VQ7A 4J9GA 1RAFB 2VFTA 6FD1A 2MZ1A 2AGQA 2QA4T 2VVKA 1J5EF 4IURA 4K50A 4CH1A 4F04B 2PMZD 2CZ0B 4OYOA 3GJTB 4FXWA 1ZQ1A 2CP2A 3L7UA 4I6WA 4USKA 2J9DA 4OGCA 4FSXA 2PC6A 3AFGA 1T3SA 2JVRA 1IM6A 4LSLB 3GIKA 2HQEA 5AE3A 2RU3A 5T14A 4RBVA 4C0OC 3LGLA 1CG2A 1SQGA 2ZCFB 2HFVA 3VAIA 2C2DA 1IR2A 2MZTA 1IJFB 2DXDA 3MOZA 1M2VA 3I0SB 4LJMA 2WBRA 4AQYJ 4C92G 4AL6A 3NY0A 4OV6A 2CREA 3OYAA 4Y34A 2VXEA 5DM7Q 1IBCB 3CCUQ 4K5SA 3FBFA 3GIIA 2ZD1A 4NWBA 3U1NA 5FD1A 4DCJB 3BSAA 5M2UA 5C2CA 3KUEA 3H2UB 3KDNA 4DLEA 3DRPB 2FUG9 3DFEA 3ELHA 2W9BA 1VQNS 3FSXA 3I5AA 3CC4T 4RG2A 4F14A 4Y2KA 3BFMA 1P1LA 3L42A 3PIPA 5CKHA 2L9DA 1MN7A 2JEJA 1N6AA 2M0OA 1VQSA 2QEXQ 2ILYA 2YLCA 3PX6A 1FDDA 4M77G 2LCSA 3KK2B 3CC4A 2JS0A 1NK0A 5L39A 5I3PA 5C7PA 1VQ6A 1M27C 4IFYB 1TKTA 4E7IA 4QIEA 3PW2A 3MCMA 3T1YJ 5LJ5d 1SL0A 3OFEA 2LKZA 4WF9Q 2CQ4A 3BV8A 4RTZA 3OVSA 3SZ2A 1MU2A 2O9SA 2FZCB 2B0GA 4GLKA 2F2WA 3D0GE 2UV8G 4N4IA 2K3KA 3ITHA 5GMKi 2I8EA 3GP9A 2DGTA 1YWPA 2I0NA 5BR8F 1U4BA 2X4YA 2RN8A 1VQ8Q 1GXIE 4OF1A 5DQHA 3MR2A 1NK9A 4M75B 2GHPA 4PJLA 3OV7A 4L6V3 2GFFA 3MTKA 1YX2A 4LFCJ 2V68A 2DBKA 4FS2A 3FRYA 1CJVB 1S6QB 3P3DA 2DLPA 2KNBB 3CC2S 5IT4A 4XK8E 3KG0A 1QTMA 2PMHA 2ENMA 4DR3J 1Q86R 5GADU 2XMMA 4X2BA 4G1PA 4B9WA 5GAN7 3E1SA 4NLDA 3HULA 1QAJA 4OI0A 3URGA 1TR0A 3NLCA 2IVYA 4FSSA 1MU2B 2VG6B 4MMKA 3Q83A 1NPPA 1FFSB 1VQ7S 3GMGA 4NYPA 4KT0C 1T94A 1OJ4A 1Y10A 3CXCA 2LT1A 1N4LA 4ZVUB 1X9SA 3NG8A 2FJVA 3X25B 1ZPVA 3DLKA 4A4HA 2R2SA 3EX7B 4WFZA 1QD1A 3E8OA 3G96A 1S9GB 1Q82C 2V69A 3BR9A 2XY6A 5A0YB 3FCHA 4KUIA 3M8SA 3D6HB 2MKIA 4NL5A 2H54B 2OUGA 2HL3A 4TVAB 2ZH1A 1R8OB 1UJ0A 2R7SA 1S1UA 4X4UA 5HO4A 3PRVA 2VGNA 2NXCA 5HQLA 3TQ1A 4U7CA 4QQDA 1X0PA 3V8LA 2MYFA 4N4GA 1FYNA 4Q0BA 4KB7A 2PDAA 2MHNA 3V6JA 4HTJA 2SRCA 2LQJA 1OQ3A 3M6VA 1VQLT 2AWZA 5FU7C 3HHLA 1G3SA 4DWIA 4PKDB 2RIJA 3ZZRA 1PKUA 3CBMA 2K3IA 3MFHA 3SCKE 3P8HA 1YCYA 4FF4A 1JBMA 3N6LA 2CNKB 1HQUA 1UE9A 4N4HA 3CDWA 4I0WA 1BQXA 1GQEA 2NUPB 1PD0A 4YB6A 2BX6A 5DDOC 3R5BA 4NMLA 3QT8A 3I87A 3LP0B 3ADAC 2NYSA 1WC1A 2FVSA 1AHJB 2X4WA 3QIIA 3WVDB 2QYCA 3ILJA 2XLKA 2ZHAA 3C6TA 1JB0C 3QYGB 2ZD1B 1PNJA 3MCAB 2I5JB 4WWSA 1FF2A 3TW0A 3V6DB 1NKCA 1K8AC 1NYGA 3QJLA 1RTIB 3JSMB 5K8MA 1WJ9A 4DFKA 4KGMA 3A8JA 2BDPA 3HL8A 4ED4A 1BWEA 4OYAA 3HHLB 3TA2A 1N34F 3X20B 2DHXA 2O1PA 4PJNA 3V4IA 2VJVA 5L1KA 3W3SA 2YKOA 5IV4A 1FX2A 3DM2A 2AKKA 3G6EA 4J8OA 3ONQA 1FFGB 4A54A 3NWRA 4IUUA 4A46A 1N5VA 3DOLA 1DURA 5D4PA 1WC6A 3BBCA 1LCKA 4GC6A 3W61A 4X64J 4HH0A 1Q86U 4KFBB 2CQBA 4CLPA 4M77E 4ZVRB 3M5AA 1RTIA 3JSMA 2MF2A 3VUZA 5CQYA 5IQQA 1Y3KA 2J76E 3RNJA 4P75A 3PO4A 3I35A 3W9IA 1CQMA 1FRHA 5F9NA 3T41A 2RDIA 1XR6A 3ZZZA 1TUVA 1OI1A 3NBPA 5J2NB 3OTOF 2CPZA 1X43A 3VS7A 5EX0A 4ZLPA 4HHUA 3M2VB 5CCMA 1BXNA 5IFMA 2RVJA 2L5QA 5LJ3d 1LKZA 2QYGA 1PRMC 1JLFB 2RHQB 1YJWA 3QIDA 1U1KA 3W8PA 1T0TV 2MPUA 2UUCF 3JXOA 1K4US 2JJ4D 5HAOA 3Q0AA 2CH4A 1YJWQ 2FHDA 5MAOA 5C5JA 2IIMA 2H5IB 3JB9D 3R9LA 2J5AA 2IA6A 3G82B 3NCQA 3UATA 3MM7B 5DETA 4WYLA 5ETQA 4DV7J 3OHBA 1GEHA 2KT2A 2KE9A 2AW0A 3EFRA 3CJ3A 4NZ7A 1GXLA 1FEEA 3LW5C 3L2QA 1IBLF 1X4BA 2E5HA 3FLGA 4ZTJA 4X1VA 4RW7A 2G4BA 3RBXA 2JL9A 1V9OA 1PYTA 4ZLJA 1C1CA 3QBCA 3J7YU 2Y4XA 1OU8A 1SUQB 2A18A 1PAUB 2KVQE 2MY8A 1T9VA 4IO1A 1NKEA 1FKAF 5GANj 5IM0A 1JLGB 4XPCA 5LJ5f 1Q79A 2ZEJA 2LX7A 5LSLA 1RTHA 2P9EA 2JDJA 1YIJA 4M7AF 1U24A 4PXCA 2HRUA 1TKZB 4JRIA 2K06A 2KRRA 3OBIA 4ENOA 4KKOB 2YUOA 3ILOA 4USTA 3F56A 3Q86A 5DY9A 5KFMA 1YIJT 3AA8A 1SJ4P 3O6QA 3ICLA 3T9ZA 4ZPAA 5LJ3f 5GANh 1L3VA 1JNZB 1N8RU 2DEUA 2DRAA 1B0PA 1MV3A 3MTJA 2DRDA 1GBQA 5CCAA 1KQSS 2H3EB 4A8QA 3M6WA 4OYWA 3KMQA 3RUXA 4E7KA 4J9IA 1SH3A 3OYIA 1JLEA 3C15A 3JCMX 1JJHA 1RLQC 1YJ9Q 2RRBA 4M5LA 2RRAA 3ER0A 2XM3A 1VQ7T 3CJ5A 4YUDA 3OSNA 1MWYA 1VQ8S 4ZCKA 2XICA 4EUVA 2VKZG 2CWKA 1W4SA 3QQCD 3V7RA 4AG1C 1HNWF 4F4AA 1HJDA 3QLHA 2B4VA 4NLSA 2R8KA 5C0MA 4YR0A 2HHUA 1FEHA 4OI3A 1YJUA 3S8SA 3HKWA 3PXGa 1KQSR 4XTXA 1C0UA 5GANd 2R7TA 2IJFA 5GAOr 3DKDA 4ECQA 3M0SA 5CYMB 4WIQA 1RZMA 3MECA 2HRYA 3WZ0A 3H41A 1K8AU 1NDPA 5EX3A 4HVUA 5A8RB 4B02A 1RTDB 4J7IA 4XTWA 4F4ZA 3RUBL 1BIBA 5F0WA 1I1JA 3KXDA 3C4SA 4JI1J 3PDNA 5D6XA 1KLNA 3OJSA 4DR2F 4G1QA 2XB2D 4IRKA 2JT4A 3GU0A 1DJ7B 2QTXA 3V6HA 4WFYA 3K5MA 4XPEA 2GVZA 4LVNP 4ZHRA 1RT5A 1TOVA 1YJNA 2Z2LA 2LP4A 1WEXA 3CJTA 5RUBA 2FHJD 4YEAA 3MCSA 5D0RA 3CC2A 2V8GA 3MEVA 4E98A 2MKKA 2P4TA 4ECTA 1VC6A 4ILLA 1X4CA 1KLMA 3DOKB 5IWAJ 2VA3A 3MM9A 4L3NA 1R0AA 2CPJA 1NDKA 1YITS 3PYEA 2KXCA 2NUTB 4OMFB 5LJ3g 2DIUA 4PWUA 2PUOB 2KXNB 1FWLA 3RBDA 4XDDA 2JVOA 1NXIA 3M4GA 1RADB 2HQCA 1LWFA 3HJVA 4K0KF 3FK4A 3MUMP 1RHMB 1KIKA 5GAEI 3LANA 3W5XA 1AFJA 4OJ1A 1VQNQ 5CQGA 4ICLA 1YJ9S 2HZYA 1X8DA 3ZEHA 1S12A 3E19A 1Q81U 2ROLA 2CQPA 4KH1B 1NU4A 4O0NA 2DO4A 4JJCA 4ANJA 4ETXA 4LF9J 3P4UB 2G0JA 2RU9A 1EARA 2KJVA 4QT7A 2A2CA 1A0NB 3JCMQ 4LF2A 2N82B 2OEKA 4WCEQ 2ZM6F 2CAJA 4TQSA 1DTQB 3CCUA 3HSDA 3R27A 3BKFA 4HHJA 2IM0A 3SCIE 2GX8A 1XEZA 1TTHB 3EG1A 1UP1A 4EI2A 2DYBA 2FJAB 2V2VA 4NZ6A 3GYGA 5CYQA 1RT7A 1WI8A 4DOWA 3REBB 4F0HA 5DDRC 3PKYA 2BTTA 4R0KA 2QA4Q 1RCXB 3RGIA 2QT7A 2BRLA 3CWJA 3OD2A 3J81U 1HMVB 1S48A 1FDNA 2CPIA 1B07A 1PC4A 2PMWA 1NEEA 1NJIT 1WC3A 3RERA 5KG3A 4E7SA 3MEDA 4RKUC 2D1CA 2F69A 4LDWA 2CIMA 1OZ3A 3DLGA 1IQZA 3OTEA 2ZH9A 4LSLA 4YP3A 3FVYA 1RT2B 3O2IA 4PG4A 5A0YA 1YTYA 4RTVA 2ZFHA 2LCWA 3IRXA 2OFGX 5K14A 2HFOA 2QO3A 2DGWA 3FDSA 4ZKAA 4C8MA 2GMHA 2RF0A 1QVGR 5EDWA 1M3BA 3KHGA 2DXEA 1WDDA 2EIFA 1U1NA 3DRPA 2HBPA 1SQEA 3ENVA 5BYQA 1N27A 3MR6A 4L74A 4A4KA 4FF3A 1H92A 4I4BA 3HVRA 5IS2A 1F2GA 2KKHA 4MK7A 4ED0A 2PVDB 4NRTA 1TUCA 2JX2A 2OTJQ 2RJEA 1HWKA 3MCNA 1UFWA 4HI1A 2JH3A 1I81A 3IGVA 1V6HA 2CJAA 3JSCA 2LXFA 4FIBA 2RD1A 1ZOTA 3CEYA 1HR0F 3TX8A 2GZOA 2O2OA 2RS8A 4IFVB 4YOEA 3GB0A 2G2OA 3SXLA 1TVRA 4ZVPB 1FKOB 2QQAA 2VBXA 3MMCB 2M0YA 2FLNA 4O3RA 5B0EA 4WFBQ 3KUFA 3X28B 3T5JA 1R8BA 1RT5B 4KJIA 1HBUB 1QCFA 5KYWB 3N5BA 4Z88A 3QRQA 2XO6A 2YWKA 4CDIA 1H2VZ 1KTVA 1M90U 5LSOA 3QMQA 1UGPB 4M7AA 1OZ2A 5H9FK 2FVQA 3EFSA 1K9MR 1BUXA 4K4VA 3OXFA 5KG6A 3SI8A 2XMTA 2VHGA 2AQ4A 5GAOn 2VBYA 5J1NA 1V3RA 2A3JA 1WC0A 2CQCA 4A63B 2RHIA 2KRNA 4ZTFA 1WQ7A 2GTOA 2R2TA 4HTIA 1FNOA 1TP7A 1RABB 5SUHA 5KCHA 3W60A 4K4TA 2E9TA 3SEMA 3CCZA 4M7AE 3KOAA 2YUPA 3K5PA 4ZS6A 1M90R 5LM7E 1S99A 2QGGA 4CO1A 2BQRA 3GOXA 1XK8A 4L3KA 4M95A 3GQCA 3W63A 3MFIA 4CM2A 2EGCA 4DV0J 1RHJB 1AWWA 1M0SA 4I67A 3HZGA 4HVZA 3C14A 3TQ7P 5GANe 1T02A 1YJRA 1U1LA 3K5LA 4BC7A 2MMPA 4C5HA 1IO6A 2GFAA 3VS0A 4O3PA 2VPWB 2ADBA 2LMJA 2ZWPA 2ZUGA 3SDEA 5D6GA 5C42B 3LYIA 3FB9A 4DUTA 4ZP8A 2AYBA 1FE0A 1TSFA 1F9FA 4PUOB 2FZKB 4P2MA 4U7UD 1I07A 3AJDA 1VC0A 1OV3A 3Q8VA 1RUSA 1IQTA 3CCQT 5EGYA 4WXOA 1IUJA 2DNLA 4M75A 1HKAA 1ZM3A 2XY5A 3CCVA 3QO9A 2J9CA 2LCCA 2NYHA 2COWA 4JS5A 4JDSA 1VHIA 2G2ZA 2LXUA 1WHKA 2P2CB 2PN6A 4CWBA 4J7CA 3UW1A 1YGYA 4RNMA 4UC4A 5CH7B 1ZHIA 2X35A 3FC9A 2A36A 1UGVA 2DBMA 4JUZA 3CCLQ 3KLHA 1HQ2A 4YY3F 1OQKA 1Y7XA 1G3TA 4FL6A 3CC4S 4P7VA 3OTDA 3BH6B 2E5LF 1K73C 2DGSA 2DITA 3JCMh 5C6SA 2L48A 1LNQA 4NMXA 1HHTP 3PEHA 4DR7F 2KRBA 1JLGA 2ZH4A 4GO7X 4I6YA 1DQ8A 2UVVA 4ZPCA 3QWXX 4OLOA 1M30A 3M0QA 1YHQT 2HBRB 4A4GA 4M78F 3EUNA 3FEOA 4XU0A 2EG2A 4HCBA 3TA0A 3E01B 2JFKA 4CLLA 2AJ0A 3T1AA 1JKHB 2RQVA 2DTOA 1UJ4A 2BE9B 4A8YA 5ETNA 5HCKA 1WG5A 1SC1B 5FROA 2WVEA 4JI2J 4MMLA 3CJ4A 1UVMA 1S10A 5CKFA 1F9EB 2L3PA 1BQNA 1PWTA 4M7DC 2Y8YA 3OJUA 2XMAA 4PNOA 3CXCP 2A3LA 1S57A 3QUIA 4HT8A 1BLUA 1I1GA 4USWA 4DR3F 1S77D 4K4XA 5KYUA 3BN7A 3MCOA 2XI3A 1N5TA 3M2UB 4P5NA 1HK9A 3ZBDA 4KGZB 2ZBQA 2F5GA 4Q7AA 5FWBA 1J5OB 1VQ4A 2XNRA 3CMAT 1IR0A 1RLDA 4J90A 4BBYA 2J0SD 3J7AN 1SJ1A 3EE3A 1F60B 2ECZA 4F8RA 4QBUA 3B78A 4PABA 4DR4F 3BGFA 4ZCMA 4WK1A 4RCCA 1HA1A 2CJQA 3S1TA 3G6EQ 1S9EB 4BCAA 2E5GA 4KGXB 2DGUA 2HAFA 4A8KA 6AT1B 3FUYA 4DR4J 1T03A 5BYSA 3JCMV 1ZTWA 1MV0B 5GAGU 3M1VA 1VIXA 1WNEA 2HNDA 1YRXA 3C12A 1S6QA 5CIUA 3WIVA 5KT2A 1QKWA 4JI8F 4EBEA 4M78B 4MKYA 2KZMA 3PTWA 2DTHA 3SD4A 1WPYA 2OTLT 1XWLA 3DOKA 4V2SA 4LXCA 4WZQA 3M6UA 1S1VA 2XQCA 2VFUA 2RB6A 1YIJS 3GFHA 4AL5A 3O8WA 2V26A 4XK8C 2HVHA 4N77A 4XU2A 1NSQA 2W25A 3LPEA 3VS5A 2LDIA 4EBDA 1KN6A 1CPZA 3PYDA 2GFUA 2DISA 4RW4A 3EGDA 1NJIU 2KG0A 4DR2J 2BM0A 4YN3B 3AB2B 2DE0X 3CCTA 3OVAA 4M78E 2AYGA 1V1CA 1VLYA 4XO0A 4NYOA 3H0IA 1SL2A 4DG1A 5E3AA 4J83A 2QSWA 2J6KA 2E7WA 2XLIA 3PIPQ 5KYYA 4U8VA 4KHPJ 1FI4A 1C1BB 2XMKA 4NLVA 4HH1A 5D7UA 4JJBA 3J7Z5 3FNNA 5G0RA 4TU7A 2O31A 3N9UC 1T9YA 4RUHA 4DFJA 5E41A 1E6HA 1RGVA 1WXTA 3OY9A 1KWMA 1FDBA 1GCPA 3CCQA 5CQXA 3TVTA 2YWFA 1VQ6S 2VIHA 3W1YC 1KHWA 3GSIA 2QJ3A 3G82A 2YNFB 4LF8J 1YBUA 5E3QA 3DC2A 2HK3A 4DV5J 1IVZA 2LT4A 1JXLA 2LEAA 4R0EA 5HMWA 3GR0A 2L3QA 2RILA 1QKXA 1U2FA 2HNZA 4USJC 2YTCA 3BSCA 1NG2A 5KYYB 1XERA 1TK8A 3CF5Q 2FC8A 5B7WA 4CTAA 2CRLA 5LMNJ 3JSBA 5GMKa 4D8KA 4MTPA 3ZNUA 3CC2T 1X9WA 1JK9B 3B8HA 1ZH5A 3VRYA 1H74A 4RKUE 1DQAA 1UETA 1N8RC 3OYNA 1DZ5A 2CT3A 1XMBA 4KIAA 4M78D 1SRLA 4PXBA 2KB2A 2YKPA 2RO0A 1NH7A 1HD0A 1WHWA 4BUGA 1YG0A 3WX4A 3EPIA 2EC0A 3DNCA 2Y3YA 1B34A 1TKXB 4Y92A 1HLWA 1QVFS 4C8QD 2I0XA 1REGX 2LJ0A 1K47A 2KT1A 2Z0WA 3CBPA 1BD6A 1O8BA 4PJOG 2HMIB 1YN8A 2CG4A 1KFZA 2KYBA 4A53A 1S7HA 3HT3A 4IRDA 3CO9A 2DIQA 2E7XA 2RI3A 1VK3A 4LRDA 5DJBA 4ZMMA 1U49A 3R5CA 4A8WA 1BQMB 1WFWA 4UOFA 4ES3A 4A8MP 4X4PA 3AJ1A 2YRVA 3IQLA 2HQXA 3HRUA 3AY0A 2ROTA 1VQNT 4F50A 4QJVA 4ECWA 2FY1A 5I2SA 1CULB 1LWCB 2YSQA 2DJZA 4K59A 5CYJA 4K5RA 2RQTA 5J2MB 1D0XA 3JRZA 4F7UE 3BPDA 2C28A 1EIYB 2J06A 2AZ3A 4M77F 3GTYX 4DPYA 3QT7A 5KFIA 4LUDA 1NH8A 2EG1A 4Q43A 2HEQA 1S5ZA 3S3NA 4IUQA 3PMTA 1KVKA 3BB5A 2HLTA 3M7VA 1VDHA 2IM2A 2E5JA 3A8GB 1W25A 2YX1A 2XYHB 4DF4A 4IQXA 1QLYA 4NLRA 1F2HA 1XMOF 1RLCL 1WG1A 1NM7A 3BREA 3AH6A 2ACMA 4R25A 1SHGA 2DGOA 3OFHA 3VJPA 3E2EA 2QLXA 2NWMA 3DU5A 1UGSB 4PFOA 2YKMA 2M16A 2XGQA 4OHWA 4PXDA 3EGDB 3QG1A 4QYRA 4F4KA 3VAJA 2KT5A 1CKAA 1ZA1B 1RCOB 2QV6A 1ZM4A 1NPKA 2C2KB 4Y28E 1GMWD 3R7NB 4DV0F 1MNEA 3L3CA 4OI6A 1TMJA 1QSLA 2XZTB 4GKJJ 1SCJB 5CKBA 3ZZPA 4P9SA 3OYLA 1QY7A 3CXCS 2FG0A 3R7BB 2CQ1A 4ZP6A 4YB1P 1IBKF 1OYDA 1JLBA 2ZC4A 4DL2A 3PHEA 1HBMB 2QYZA 2XNQA 3MR5A 5KFYA 5J1EA 2VPXB 4CO4A 4KO0B 1R89A 1SKWA 3W66A 5F8HA 5LOQA 3JCMg 4O4RA 1HYOA 1NSPA 4PG5A 1JXOA 1QW1A 3CO0P 1FWZA 3I9V9 2XG8D 4OV1A 1URNA 3H8ZA 1TU0B 3FQLA 2L9WA 2MPXC 1PYSB 2ATLA 2HVEA 5KFEA 2YQ0A 1HI0P 1X5SA 1NDCA 1XMQF 1ZSZB 3SFGA 5C24A 3CQTA 2GQVA 1N52B 1RSCA 1X4FA 1MGQA 3E51A 2PI5A 1T95A 4AFFA 2HWHA 4JI5F 1W7WA 4K4SA 3OYEA 4D3HA 3W2VA 1TVRB 3BYPA 3X24B 3GLXA 4O4GA 3QIPA 2WSCE 3KG4A 5GAOl 4XAXB 2IAJA 4C8QE 3TEHB 1G1XA 5KT6A 4LF6J 2F2VA 4G3IA 1HR0J 1HBUA 2M02A 2FJBB 3INZA 3TAQA 3BQ0A 1OS5A 1B7YB 3HZEA 4F26A 3NWGA 4ALZA 3M32A 2ZM6J 3TARA 1DY3A 3FC3A 1XQIA 1HW8A 1YJVA 3VYGA 3JB9J 3ZTRA 1S1WB 4IG0B 3SYZA 1RT2A 1JLCB 1VC5A 4RX6A 4OMFG 3UN3A 1JWWA 4RWWA 3A8LB 1KOOA 1LJOA 1FRJA 3UFCX 1TL5A 2Z4PA 1TFWA 1QVPA 2QL5B 1VYTA 4OX9J 3DYAA 3FBEA 3CW2C 3KNGA 4XU1A 3X26B 1BYMA 5LJ5Y 2LECA 3CMQA 3N01A 4URGA 1YITA 5KG1A 2HVIA 3JCMf 3UWTA 3H90A 3HDSA 4FXDA 1WNLA 4O3NA 3B4DA 1RBOB 2WW4A 3TOQA 1IKWB 4MZMA 1UTIA 2KXDA 1GTEA 3TEEA 1D09B 1YITT 4MJKA 2KFNA 2RJFA 1Q5YA 3GCXP 1X31C 4P2FA 1V3ZA 1JLCA 2MLZA 3KLGB 1BB9A 3KHHA 5IHKA 2DFUA 1UHCA 2VG7B 2D6FA 3OYMA 4DBRA 4KRWA 2VB6A 4FYDA 3EH1A 4DEYA 3R6OA 3B6BA 1V29B 4QW2A 5CKDA 5L38A 5D3GB 4DCPB 2Z2ZA 3Q8SB 4JJDA 3ENWA 2J6TA 5FDLB 1AZGB 5F8LA 3THPA 3OBYA 4GKJF 1EX8A 1M5Q1 4LDYA 3PFEA 1BI1A 1NB2A 3SMZA 2HIQA 3NBPB 5K8OA 1SV5B 4NRUA 3DXBA 2Y1RI 4JYAJ 2QLWA 3WX8A 4B17A 1U0SA 1SH0A 4C8YA 2FQQB 1H72C 1S4FA 2BKPA 1W2IA 2MZJA 3PFOA 3J80E 5B0GA 2FLOA 2VG7A 3CCLT 1LFWA 1MMLA 3J7ZT 2FC9A 5DQIA 2DHGA 2CDQA 3D0HE 2ASLA 2DNUA 4CIOA 2X4JA 1TXQA 4M5GA 1VQKT 1SF9A 3DDNA 4DPOA 1PGZA 1D1AA 2AMCB 3NTHA 3U7JA 1JIHA 4B9TA 4CH0S 3CCES 2XD0A 1VQ8T 2HQDA 3IWLA 3PR4A 1Q7YU 1S72T 3F44A 4KPCA 4UQGA 1W6XA 4AFUC 4F3MA 5KFJA 4C92D 8ATCB 1FHTA 2IPOB 4LSNB 2O01C 5D4LA 4HT7A 1R8PA 2DVIA 1EP4A 2H5JB 2VWFA 4N0AA 3DOMB 4X4VA 4JI5J 3P5TL 5K14B 5LJ5g 3MHYA 4L72B 3M05A 1Z4UA 3CCJA 1WXUA 2WACA 3OL9A 3QJPA 2ZJRQ 3KNAA 4QCLA 4XIUA 2YBVA 2MJUA 1X5PA 3H20A 1WYXA 3A4TA 1VQOT 4OQJA 4HL9A 4JI2F 1YI2Q 2L3RA 4NLGA 4JUVA 4TU9A 2PEBA 1PJ5A 2Z56B 3BEGB 1U1SA 1KSWA 2LX9A 2OEJA 1OULA 2X1AA 2L9NA 3K5NA 2XGPA 4FU6A 3L2WA 4C0BA 4O0IA 3BR8A 2M9KA 2ZBPA 2ZBIA 1NJWA 2WB4A 4II1A 5F0UA 1G3YA 1WG4A 4LF4J 3CMAQ 2KN4A