3UDCA

Crystal structure of a membrane protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDDLIEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Small-conductance mechanosensitive channel, C-terminal pepti
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
total genus 79
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3udcA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3udcA03
2RH2A 5B0AA 4Q2LA 4EFAC 1AFIA 2QIFA 3KG0A 1MWZA 1FE4A 2OFGX 2RMLA 1Q4RA 3KG1A 1XBWA 1AFJA 1GXUA 5F0UA 2EW9A 2BYCA 1N5VA 2HFOA 2GCFA 4QOTA 2OD6A 1VQSA 1RJJA 4YEAA 2KKHA 2K7JA 2Q3PA 3HHLC 5B0GA 1X8DA 2HLTA 1W2IA 1WD6A 1VIFA 2VV5A 4A48A 1YRXA 5K9FA 1APSA 2OMOA 2OFHX 1R6YA 5B0FA 2CRLA 2OD4A 4OJ3A 2QLXA 1TZ0A 1Y3JA 2XMWA 3HX9A 2VH7A 1URRA 4OIXA 1OQ6A 4Y2MA 2XMUA 1TR0A 2K1RA 4HI1A 1FEEA 3HHLB 2ROPA 2AW0A 1FD8A 1YJUA 1VQYA 1X0PA 2RK1A 2FTRA 2BJDA 2RILA 2ZDOA 1Y0HA 3BB5A 3I9ZA 2G9OA 2N4CA 3BN7A 1AW0A 2XMTA 1OQ3A 3DCAA 3F44A 3BDEA 3GZ7A 2LQBA 4OJGA 4U9RA 1N5TA 1MWYA 1TUVA 2ACYA 2L3MA 2RK2A 2AJ1A 3HFKA 2GV1A 2ZDPA 3KNGA 1N5QA 1OSDA 1QUPA 2KT2A 3SFMA 2K2PA 1U7LA 2ROEA 1CC8A 1VIEA 2QYCA 1P8GA 1KQKA 3K7RA 3VTIA 3BGUA 1FE0A 1N5SA 4NPOA 5F0WA 4DL0C 1YJVA 3WDOA 3HF5A 2BJEA 4Q2MA 1KVIA 3TRGA 4OJ1A 4A4JA 3HHLA 2N4DA 3LGMA 2GGPB 4OJHA 4Y2KA 4ZA1A 1YG0A 1SQEA 1TL5A 1OPZA 2JDJA 2BUNA 3FRYA 2XMJA 1ULRA 4HL9A 3BM7A 1X7VA 1GXTA 5B0CA 3FMBA 3HDSA 2XMMA 1Y3KA 4DPOA 3IWXA 2LQ9A 4A47A 5T7LB 4ZOSA 2IYGA 2W4CA 3BF4A 3T9NA 2KT3A 3KKFA 4YDXA 2AP6A 2XMVA 5B09A 2W4PA 2FHMA 2P4TA 5B08A 2PGCA 1JK9B 1S6OA 4Y2IA 1FVQA 3CJKB 1CPZA 2OP5A 2FB0A 2AJ0A 1JWWA 3IWLA 1FVSA 2HIQA 3DXSX 1TL4A 3MCSA 1LQ9A 1IUJA 3TOQA 4A46A 5B0BA 1Q8LA 1Q8BA 2GGPA 3MZIA 2GA7A 2KYZA 4HH1A 3UDCA 3BR8A 2OKQA 4HI2A 5IXUA 2FIUA 2LXFA 2HFNA 2ASYA 2IFXA 2N7YA 3E8OA 3QGPA 4FNIA 5KAKA 1KVJA 2GO8A 1Q53A 2PD1A 2ROGA 1FESA 1P6TA 2BBEA 2GFFA 2RU9A 2K7KA 4FNHA 2LDIA 5B0DA 2HQIA 5B0EA 3TNVA 3LGNA 5T7LA 1SI9A 2W4DA 1K0VA 1V3ZA 4NL5A 3QMQA 2HLUA 1SB6A 3HHLD 3LO3A 2XMKA 3FGVA 3CJKA 4HH0A 1CC7A 2GQVA 5A6PA 1Y9OA 2IYIA 4F67A 1S6UA 5A6WA 2QLWA 4DN9A 1YJRA 2OAUA 2K1RB 2RSQA 1YJTA
chains in the Genus database with same CATH superfamily
2HNDA 4QR2A 2K3XA 4KTQA 4Y65A 3CMET 3H2LA 1LWFB 5DRKA 4IRKA 4DOZA 4EZ9A 1U5SA 1JXMA 3F0NA 3AOCA 1VBZA 2CRLA 1QSYA 1FWZA 2FJXA 5RUBA 2BJ7A 2OH2A 2HHVA 4IKFA 3H9NA 3DOMA 5FIIA 1HWJA 5LXRA 1SHGA 3M2RB 4NXNJ 2PNIA 1SJ1A 4ED1A 4YFUA 1HR0F 2XO7A 2KJVA 5A0YA 4ER8A 5HKCA 3PJWA 1VQKA 1WJQA 1WI6A 1IKYB 4V2SA 2A28A 2D3UA 4J9IA 2ZD1A 2LQNA 5IT9E 2RMOA 3R1LA 2Y90A 2FJAB 3D1HA 5D0HA 2F3JA 2BJ9A 1RT6B 4PJNA 1R8CA 2ZH9A 4J9KA 4OX8A 4BWMA 3PT9A 1VJQA 3UATA 5GAMf 3GCXP 2DHGA 4OB2B 3JCMg 4ECRA 4HR2A 1GL5A 1MN9A 3H98A 1X27A 3Q8SB 2GA7A 5LMNJ 1I4K1 5IT9U 2RDJA 1U06A 4C92E 2VZ9A 4JI2F 4K5RA 2GIRA 3JB9G 3NLCA 2FC8A 4ECYA 4L74A 2XMKA 2YQ1A 3QXEB 5KFKA 2IYIA 2I5JA 2Q6CA 4M95A 2PSZA 3OXLA 1WC6A 4ETZA 1YI2S 1S72T 2QK0A 1VIXA 2QC3A 3G96A 2BJ1A 4LD6A 4P73A 4WXOA 3PHEA 4FXWA 4G1QB 3CJ5A 1MHNA 3DDKA 2NZ4A 1TWBA 4ZPBA 5IFMA 1VQMQ 3EXCX 1WYXA 1HWIA 1LJOA 4HCKA 2MLZA 2BE9B 5FW9A 1M8MA 1TV6B 1M1KU 2GMJA 4DSIA 4KIAA 3VS4A 5FDLB 1FT8A 3F41A 1HBUB 2Z0GA 4W90B 5FLXY 4OJ1A 2YVSA 1R3NA 2UXDJ 1Q81U 4J9SA 2UVWA 3GFZA 1UGRB 2HBPA 1JNZB 1FX4A 2VL1A 3KXTA 3TREA 1RHKB 2XMAA 4A8MP 2KVQG 3PKYA 5GAOr 2HAXA 1G6BA 1PJ5A 4RKUE 1RHRB 5E3PA 4NLPA 3KUEA 4N77A 1SJQA 4WFYA 1JLCB 3D3BJ 2ZPGB 4DS4A 3HM9A 2CP0A 3CQTA 1Y7XA 4J37A 3IFEA 3BO3A 5T7LA 5GANh 5CIUA 3CCSQ 1KQ2A 4NL5A 2LJ3A 2ZPEB 1MMLA 3FC3A 2QEXS 1M9SA 1Y5NB 5I2MA 4CM0A 2X4XA 4X4RA 3GE9A 1T94A 3CCMQ 2D41A 1WACA 2B7BB 3TZZA 4USJC 3W8PA 2YNIB 1WX6A 4FF3A 1KQFB 2VC8A 2BM0A 3ENAA 4NYOA 5ETKA 1RI7A 4NLWA 4ZLNA 5CK9A 1Q1KA 5JJBA 2RU3A 3V6DA 2B9YA 1AWOA 5T41A 1PBAA 5I42B 2YNFB 2F69A 2ZHBA 3H0HA 2KRSA 2Z58B 2EVZA 2PQWA 2DRMA 2RQWA 3HJFA 2RVJA 3ZFJA 2KXHA 3KJQB 1VQ7Q 1PAEX 3QJ6A 2UVVA 3IS9B 1X7VA 4WIIA 3CPWR 2P6TA 3CXCA 4WP9A 2QTWA 2EYYA 3T5LA 2Y8YA 2RQRA 3IM8A 3ITHA 3EH1A 1FVQA 1FJGJ 3AD7C 5KFTA 3CJQA 2QQAA 1TKXB 2OKQA 4ES2A 5KFCA 2YHTA 1UWBA 3J81j 2D6FA 5DLFA 5GAN5 5LJ5e 1NK6A 4RW4B 2AHJB 1Q86C 5LJ5Y 3DDNA 1G8XA 3LO3A 4AXIA 1C1AA 4DWIA 1RAAB 4ILRA 2LJ1A 3HMJG 3S1TA 2CJYB 4B3RF 4DR4J 4LJMA 3EJMA 1UGQB 2ZWPA 3H4BA 1VQ6A 4TY9A 2MF2A 1YJNQ 1CSKA 3L4BC 2RRAA 1JEGA 4HCCA 1DTTA 2KHCA 2AJ4A 4DPWA 2CZ1B 1IRXA 4XAXB 3AY0A 3FKBA 3QDRB 3IR6B 4KBIA 2C06A 1JXEA 1HNWF 2K8GA 1U0HA 4USWA 2B4UA 4Q5WA 3Q2SC 1FWPA 5U47A 2VXFA 1JJ2R 4FKYA 2MZ1A 1K73U 3E9GA 1M2VB 3S3NA 2ZKTA 3HJVA 3QJJA 3NY0A 5DJBA 5IT4A 4AQYJ 1RT4A 4CDIA 3RW6A 2ZFHA 3NS5A 1VQ7S 3OFFA 3R5BA 2BOAA 2D3OR 2LRQA 2O3DA 4R25A 4F2RA 3OJUA 1RTDA 2NXCA 2J06A 1RHQB 3VUBA 2COZA 3S8SA 5DQIA 4A4GA 3A3PB 2RS2A 1WUUA 4CQ1A 3PIPA 3W3SA 2HRTA 2GNKA 2RQVA 4WFZA 3JB9H 3QUIA 4NLTA 3D2WA 3ILOA 2GVZA 1IBCB 1VQOA 3OYNA 1HBNA 3MD1A 3HP6A 3EHQA 3M6VA 2XY5A 4A4HA 1YJWA 4ZPDA 1ZTWA 3V81B 2NUHA 1HNIB 5E3RA 3DKMA 3HSBA 3FJ5A 3D4JA 2OMLA 2KYBA 2E29A 1S1XA 1S6QA 2FVQA 4F4YA 3G71T 2HG4A 3SCLE 2MQMA 2QQRA 3E19A 4LT6A 5FRMA 3CCES 5IXFA 3Q83A 3KK1A 4JS4A 5D78A 3SSRA 2DBKA 1VQLS 2G2OA 4AFSC 4O4RA 1YJNS 4JS5A 3PYEA 1U6BA 3SSQA 3PTAA 2HSEB 5LJ3g 4J9VA 4TU9A 1V76A 3D3CJ 2OPPA 3DYAB 3H90A 5CKEA 3DC2A 4OZNA 3CC4Q 4QWAA 1VQNQ 2HPUA 1JLAB 4DQPA 3NTKA 5GMKh 2OLWA 1EKRA 4YDDB 2NWMA 1N52B 2B56A 1HW9A 3PNIA 3TRGA 3PFSA 5DLOA 1KHCA 4C0DB 2MKIA 4DQQA 1W4SA 3RR7A 1WHGA 1RHJB 4BD3A 1VOMA 4X84A 5IHKA 4FSXA 5EHHA 2CDTA 2IYGA 1T7PA 3TQ1A 4F25A 2GAGC 4PYAA 2HQEA 3M8QB 2QRRA 3AXKA 2DGXA 3BR8A 3V7RA 2HBQB 4RW7A 4OVAA 3R9LA 2YUNA 2H8HA 8RUCA 3Q2TC 3LX7A 3BGRA 2OHDA 1RGVA 2CVEA 1U0SA 1S76D 2GCXA 4ICLB 3GILA 4DL4A 4PJOA 2MMYA 4CLSA 1D1AA 1KLNA 5F0UA 1D3BA 1T3LA 3SFUA 1YVFA 3IR5B 3CJTA 2CJAA 4DUYF 4HCBA 2OFHX 4RJVA 2YY3A 4YY3J 2QASA 1UVLA 4BY6C 3KLFB 3NGRA 3CC4S 4M8LA 2GS8A 2HFUA 1N36J 2FEIA 3FQKA 1TUVA 4WYLA 3TARA 1I94F 1P8GA 3G82A 2O5DA 5HL7Q 2GGPB 3OS2A 1EZZB 3WX4A 3PY8A 2EJFA 2DY1A 2OJ3A 1PKUA 5BR8J 3HKZD 3MM8B 3T9NA 2M3DA 2I0NA 3VRYA 3ETOA 2RF0A 3GTYX 1XTDA 3EGZA 3VGSA 2MKSA 2RE1A 2JLFA 4WYWA 4CP5A 2JW4A 1HMVB 2XD0A 1M5OC 2MKKA 3OTOF 2DVIA 3BN4A 2O31A 2J6OA 2HBRB 1VQ8Q 3UI3A 4F36A 4P75A 3D68A 2PZ1A 3QWPA 1UG1A 3MEDA 2CP7A 2A0FB 4TU7A 3GIBA 2YWWA 2PDAA 2GVDA 2VC0A 3V8KA 2LCLA 1FRJA 3U1MA 2ZKUA 4U7UD 4ESRA 5C25B 1GXLA 5CVIA 3M2VA 5KT6A 4EBEA 3L2QA 4HI1A 2QA4G 3GFXA 2DGQA 4EGLA 4USKA 3OW2A 2AZ1A 4JV0A 1YHQA 3MM6A 1UJ6A 3T1YJ 3VYHB 3JCMW 1LWEA 4YHHJ 2P2CB 3BY7A 1K9MT 3HRUA 3JCMQ 4ED2A 2NREA 1KR4A 3TYTA 3NGSA 2QX0A 2C2RA 2FLNA 4ELYC 3QBYA 4NLRA 1BUXA 2F5KA 5KG0A 5J1EB 1RBOB 1OS5A 1BXNA 3C6TA 1B99A 2NPIA 5JXSA 2W8KA 4JI7F 3CPWP 1U8WA 2KT3A 4JYAF 3ZZZA 2KRNA 3CCJS 1M5PC 4NZ7A 1Q79A 4J7CA 3CBOA 4OV1A 4JZ4A 1IBLJ 1RHMB 2BA9A 1KDNA 3I96A 2Q1LA 1FRIA 1UB4A 1L5UA 2RU9A 3Q8YA 5C7PA 2E7XA 1UMJA 2CQ0A 4ME7A 4ZIVA 4X4TA 1N5YB 2RDIA 5AXMA 1GTEA 4JZ3A 2GQQA 5LJ3j 2IJNA 4CIOA 1TL7B 4ED4A 4QPXA 1UPPA 5J2MB 2ZPIB 1D09B 2G4BA 1TAUA 3THPA 2UUCF 3MEKA 2OTJA 5A8WB 2LQ8A 3CMEA 2MZJA 1SKWA 2AGQA 4HACB 5A2QY 4O3NA 3TQ7P 2RT3A 3CDUA 3FQLA 4FYVB 3W65A 4L59A 2XNRA 5GANf 1H7XA 3CCTA 4DQIA 4QU7A 2RAQA 1TKZB 4LFBF 1M5KC 1XIQA 4F7UE 1KEKA 3RESA 5CR2A 1RWWB 3BB5A 4NLOA 3MAQA 1JJ2P 3F44A 4J9LA 3LALA 1F5CA 2E9RX 5EG2A 1T9XA 3LGHA 1YIJQ 5D4NA 4N5SA 1FMVA 1SJ3P 1HA1A 1SC3B 1E6HA 2VVKA 4DI6A 2EKHA 2DF6A 4DSEA 3NMRA 3D66A 2LCWA 2ZBQA 1WOPA 2P9EA 1AA1B 3ADAC 3CCQS 4JRQA 3WC2A 4MKAA 2ZPHB 4C0BA 1Q82R 3FLGA 1X5SA 3PMTA 1N27A 2KTQA 4NLSA 2WVCA 1BQXA 2ALYB 4DR3F 2P8IA 5IXUA 4FNHA 3WBZA 2CZ6B 2DL5A 2P4RA 3J81Y 1R77A 3QSUA 4MMKA 3UVJA 4J9FA 1KQSA 2HVZA 1QAYA 4G6VB 2HLUA 1RT2A 4M63A 5IV4A 2HVHA 5CKHA 4B3SF 5GVQA 1WHLA 2XMWA 4PFOA 2EFNA 3ENQA 1QM9A 3LAMA 1SG5A 4NOHA 4JI4J 1NK4A 9ATCB 5C2CA 4NRUA 5HO4A 2HVDA 3M9MB 1IBMF 1HNVB 5BYRA 3CC2S 2HHXA 3ILIA 2DGOA 3JSYA 3Q23A 3QWXX 3RZAA 1OQ6A 1XNQJ 1ZA2B 2RD5C 2VBXA 1MWQA 5A76A 3PW7A 2O4XA 4RG2A 1VQPQ 1LOJA 2JC1A 3FCVA 1X6BA 1PC4A 5F8NA 2VFRA 4QYZK 2AEFA 5I3UA 2Y3YA 2NUUG 3EDRB 3W9IA 3KNGA 1OU9A 5GAOn 2BKPA 2X3GA 1M5Q1 2A3JA 4EDUA 3US5A 2CNOB 2J76E 3VWSA 4JRPA 4NE9C 3NWGA 4C5HA 1ULRA 2ESWA 4KGZB 1RADB 4PFZA 2YWFA 3KJVA 3C14A 1MSWD 4GVBB 5GAN8 2LQ5A 2VPWB 2JC0A 4QCLA 4EBCA 1M1KC 5C24B 4OHWA 1IUJA 2DBBA 4JUZA 2BXJA 1B4SA 4PRFA 2SEMA 5G4DA 1S10A 3CPWS 3JYTB 1Q81C 3SHWA 1BIBA 3T19A 1ZH5A 1TFYA 4R5PB 5LL6d 4LF4J 4Q2LA 1KNZA 5GANd 2CKKA 1WKKA 1K0TA 1S97A 4R8UA 1N5VA 4J6XA 1X8DA 5GAOp 2YNHA 3GIIA 4N4IA 1FRKA 4IH6A 4EZ6A 3TU4K 4JV5J 3EFOB 3G6XA 2DPJA 2KM8C 5KYWA 4O3PA 3J7A1 2JWNA 3Q8QB 1BI2A 2QDYB 1MMAA 3MMCA 3MPVA 5D3GA 2L3SA 2F4VF 2RILA 1H98A 2R8HA 4U9RA 3RB3A 3EG3A 4YR2A 2J5AA 4RKUC 4DF4A 2X4WA 1U1SA 1RTIA 1N6QA 4W92B 1G5VA 1IJEB 2ZOFA 1LV5A 3JS9A 3WDOA 1XR6A 1S0OA 2CJBA 3KLVA 1VCTA 1I51B 7AT1B 4EMKA 4OMLA 4HA8A 2RJFA 1T05A 1XR7A 4UY85 1JJ2S 4DV7F 1JNRB 4TN2A 2AYBA 4OX9F 2FHKA 5AE2A 5ETNA 2DEJA 2R2TA 1AWXA 5CCMA 2H48B 2ZH7A 1S1NA 4B3OA 4KV8A 2HAIA 3NFCA 3D0HE 3EZUA 3C16A 2FJWA 1NEGA 3AT1B 4AUKA 1CS4A 3NHNA 1D0EA 3EVWA 2ROGA 3GONA 2ED0A 2BBEA 5E33A 2LDIA 1X43A 3QO9B 1PWTA 1IREB 1RT1B 4C3LA 4MKYA 4YB1P 3RBZA 1CG2A 2HFSA 4UQTA 3G6EQ 5F8MA 2QIFA 4WKYA 2ACMA 4O3OA 1LW0B 4DXLA 1QCNA 1Q8IA 4TXSA 5L38A 4M5KA 1VRUB 3QGGA 3A8GB 2B4PA 2FVCA 2C3UA 4DBQA 4DBHA 2DTJA 1JB0E 4F02A 3AQPA 1AZSA 2V2KA 4UOHA 1WJ9A 1N0VC 1K47A 3B78A 5KT7A 3BQ1A 3JXOA 3M8WA 1MWYA 1KOOA 1WG5A 1FKPB 4XAKA 4K59A 3VS5A 3PX0A 1S6PB 2LDYA 2L41A 2CZ4A 4L5GA 4P6QA 2R9LA 1I5LA 3DM2B 2NYHA 4MK7A 1RT4B 4JI1J 1IKVB 2V9WA 3GU0A 4BE2A 3MR3A 3BV8A 1OY8A 2D3ZA 2C2ZB 1ZX6A 1RTDB 1MG7A 1X4DA 3GB0A 2G0JA 3CCUS 1FA0A 3R5JB 1EAYC 2E12A 1K73C 4NMLA 1X4EA 1IR2A 4LF6J 3HHKA 5HCKA 3K8VA 4ANDA 4URQU 3OYHA 2V0NA 2ZH2A 2R8JA 1RCOB 5CZVA 4FNIA 1DLOB 1BKBA 4GC7A 4OV6A 2XWYA 3ZZ0A 2VODA 3C2PA 2FJDB 1K1SA 3X25B 2O01E 2E65A 2V2QA 5IAYA 4C8QE 3MXHP 2E41A 2UUBJ 3G71A 2VQEF 3HFOA 1O51A 5KFIA 3G6ES 2GTOA 5ETPA 4PJOF 4Y34A 2GCFA 3ETMA 5CD4H 5IZHA 1MV0B 2A3LA 1YSJA 3QGIA 2DNKA 3G6YA 3CUNA 5KYYB 4A8WA 2A36A 3ZZUA 4MFBB 4A4FA 2CGHA 1ZOTA 2DZ9A 2CPDA 2J0QD 1T3OA 2E1CA 5SZTA 3CDAA 2DT9A 3D1OA 3TA1A 2NYSA 4UY8T 3P3DA 4LSNA 1UETA 4I7FA 4Q0BB 2HMIB 1B3QA 2ZDPA 3AH6A 4IO1A 1WHVA 1PYSB 4K0KF 4BY6B 3EVMA 2N4DA 4Q8FA 9RUBA 1KC8T 5LJ5h 1UTAA 2YKNA 3DI6A 2F40A 1W6XA 1RTJB 3SDEA 3OL9A 1Y3KA 2FZGB 4RLEA 2CQIA 4XTVA 4AFFA 4FL6A 1OZ3A 4ZPWR 1OPIA 4OZJA 4KJIA 3CC7T 4QIFA 1QVPA 2IFXA 3I5CA 4KHRA 3NBPB 2XIDA 3SV4A 1HBMB 2C22A 3I56Q 2J6UA 2CPJA 4WF9Q 2WVBA 2JOQA 2F8EX 3IXQA 1J5OB 4YOEA 2G1DA 1GXUA 5KFRA 2CZ0B 2JS0A 1VI7A 1WJRA 2ZBIA 5SUHA 1Q95G 2QQBA 3AA9A 3TUPA 1HNZF 3RRGA 4K4ZA 3ZO7A 4LUBA 2CT4A 2LVWA 2X4YA 2KYXA 4DEYA 4J9PA 1WF1A 1ZUUA 3ILLA 4LR7A 3AHPA 2FG0A 2KK4A 2K06A 3H25A 3M9OB 2HEQA 4I64A 4L73A 5KFAA 3CD6Q 2COWA 4ZVGA 4J9CA 5M2UA 4IFYA 5GMEA 3H2VE 4LIRA 4DS5A 2O9VA 3M9QA 2RJDA 3CWJA 2Z30B 5KOXA 2UUTA 3MCMA 2EQKA 5IQQA 1SVDA 1NYFA 4C8QD 4IUVA 2MI6A 3MURP 3BREA 2HNYB 1RWOB 3D5MA 1NKBA 2HHUA 4F17A 4TLQA 3HRTA 4QQ6A 2ZM6J 1K8AT 1RT5B 1JU5C 5HROB 3HI9A 2DA9A 1HYSB 1VQ9S 1QP2A 2AJ0A 1ABQA 2DRAA 2DR6A 3P8BB 1RI0A 4JI0F 2VBZA 1G83A 3MMAB 2J6FA 2RKIB 3MECB 4RUGA 1AZGB 1NLPC 2K3IA 1N8RT 1WSRA 5A6WA 2CQBA 2NUPA 3D54A 3QLHB 1AFIA 2VPXB 2VFVA 3I55T 1QVFP 2DNOA 2CPEA 3B4MA 1VQ4T 3BH7B 1IBKF 3M6WA 1XMOF 2RA2A 1K8AU 4Q45A 3NNAA 5J2QB 1XK8A 2AEJA 3EHRA 4EIKA 2YXYA 5E7OB 5FLXU 1Y0HA 2UV8G 2CH4A 3KHHA 4R0EA 4DA4A 5F8GA 4YP3A 2M7SA 4ZPAA 3CD6S 3DMJB 2FHJA 3HSZA 2LP5A 2LT1A 3K7RA 2OSRA 1R89A 4ZVEA 3TO8A 2BACA 2COLA 4CCHA 4A63B 1NJIC 2QL7B 2C3YA 1W1FA 3GF5A 4MT1A 3VU3C 3Q89A 5B09A 4LNPA 2N3LA 4ZGJB 1X31C 3OD2A 4LF9J 2Z2ZA 2FB0A 5H9EK 3HPWA 2DTIA 4KT0E 4FF1A 1NCLA 4NXNF 2VG6A 1RWKB 5HLFB 2PMHA 1G3WA 3L1AA 2AV5A 2MQPA 4B9NA 3QMQA 1VRTB 2MZQA 4JOUA 3UCGA 1WSVA 2J7KA 3SBMA 3ZTRA 4RNNA 1RTHA 1HJDA 3OTDA 4HKQA 2C3PA 3R5CA 4DSFA 2DO3A 4FW1A 3EFSA 1JLEA 2MKHA 1U1QA 3E01B 4EK2A 2QQ9A 2QMWA 1X2QA 3QIDA 4CH7A 1OPKA 3T5JA 1NJXA 4HXJA 3ZBDA 3O8WA 1RUWA 3KDOA 3CXCR 3PXGa 2D8JA 5J2PA 3HVRA 1FDAA 1RAGB 2CKWA 4D3GA 3BDUA 3CDBA 2DO4A 2K3BA 3VZHA 2EWHA 2EEYA 2HWIA 3FB9A 1QAJA 4QWBA 2E5KA 1H3HA 3LP1A 4FIBA 1VQMT 2AEMA 3LWMA 3GIMA 3FRYA 2X3WD 3R5GA 1JLFA 2JH3A 2MEWA 4QWDA 1X4FA 4ANJA 4DX6A 2O88A 1RT7A 4ZOSA 4CLYA 3R5DA 4IOBA 5JMNA 2JJ9A 2XCPA 4LMZA 2CQ2A 2IAJB 2D1CA 3M53A 2RN8A 3M1VB 2ZGWA 1C0TB 1CULB 3MUTP 4X9DA 2ZJPQ 3O1LA 4EWTA 1U25A 4TKTA 1UVMA 1F3FA 3KFWX 5KE3A 4OZ2A 1VC5A 5ETMA 3UVJB 3DRYA 4ZVRB 4KB7A 2BANB 2KDOA 3TAQA 2KXDA 5I2SA 2DPPB 2UXDF 1D9FA 3HVWA 2FPFA 4F0HA 1IGUA 4M7AA 3J7AF 5ETRA 2OD4A 3V4MA 1CJTA 3H20A 3CCST 4ES3A 4JRIA 2ZJRQ 1LXJA 2GJ2A 2ENMA 5H9FK 4KPYA 4UC4A 3RRKA 2XWXA 4OHXA 4H4KA 5D6XA 2PEHA 3CCMT 1QVFS 2KM8B 3OYAA 2A08A 1OPLA 3QAEA 2YUOA 4J9EA 1VR6A 2VG7A 4L75A 1U7LA 4QWCA 3NS6A 1GFDA 1U26A 1OY9A 2E5GA 3PM9A 5DZ7A 1T03A 3TZWA 4KULA 2DH7A 1OU8A 2ZAEA 4DX8H 4CLFA 2ABYA 2YX4A 4F3MA 2E7WA 4ZP8A 4A47A 3VAHA 5KFZA 2O2OA 4A8KA 1Q82T 3H0FA 4XO0A 3SYZA 1LQ9A 2IA6A 4C8LA 3N5BA 3DLJA 3DLHA 2EQIA 2LXFA 2NZCA 3RAXA 5KAKA 1YRTA 2DNNA 5KFYA 3NWRA 2LYVA 2XSJB 3S6WA 4O3QA 2MQQA 1UVJA 3EG0A 4H4MA 2GZOA 2E1MC 1KLMA 3JRZA 4EMDA 3KLEB 1Y10A 1NK9A 1NLOC 3DLKA 3PVQA 1A9NB 5AE3A 2OTLS 3LWIA 4Y3CA 5K8PA 4PJLA 4QQDA 4QOTA 2LZ6B 5I3PA 2OEJA 1Q82U 4J8OA 2C0IA 3N6NA 3KHLA 1G4CA 3GWCA 2CFXA 1NJIT 1FJGF 2MQOA 2CPYA 4R0JA 2QLBB 4AMCA 2VIHA 4ZVSB 1C2PA 3EGXB 1UHFA 2ZNYA 3TVYA 4CC2A 3GZ7A 4DV3J 4NCGA 3I9V9 4OI4A 3RBBB 2W9BB 3ISZA 1YJNT 3HFVA 3SFMA 2K2PA 1N6QB 3BGUA 1N5SA 2QSFA 1WF2A 3SXLA 3MPYA 4Y2KA 4L72B 4NLUA 2MDAA 5KG6A 1SC4B 4DR4F 1T3SA 1X4BA 4OI0A 2HHHJ 1JLBA 3NCQA 5AYFA 2YQ0A 3IWXA 1H3ZA 3KJFB 3J80E 2O66A 2RRBA 3GP8A 3JTNA 2AHOB 4YQWA 4FVCA 2DIVA 1BI0A 2CPZA 4A46A 1Q8LA 2W10A 4WTYA 2VC1A 4YS2A 5J1NA 5DDPC 1UFWA 4WK3A 4RNMA 2POKA 1OYDA 3K58A 2KRBA 3FRNA 4N0AA 1OYEA 4RW6B 2EGAA 5KG1A 2XI2A 3LPEA 3J80U 4F04B 5EWFA 1BQMB 3INZA 2B51A 3IN5A 2K4YA 2BJ3A 1S6UA 1H0HB 2ASLA 4AQYF 2LA4A 4IR9A 5FD1A 3W63A 1X60A 3JCMh 2VKZG 1U8SA 5AJ3J 3C12A 3OR1B 2K7JA 6FD1A 1RBAA 3CD0A 2MAMA 1TFWA 1D0XA 1Y3JA 2X1FA 3CSKA 2G1HA 3TUJC 4Z7YA 1JO8A 2K9GA 4D8KA 2RRNA 3HCXA 2DNQA 2J6SA 3KOAA 2R2UA 2B8PA 3VQTA 2DHHA 1DQAA 1CSJA 4DR2J 2MCNA 2PUKB 4DV4J 4DCJB 5KFVA 4RNOA 3QWYA 3V8LA 5HP1A 2HHWA 2B9WA 2Y1RI 2E9ZA 4K4TA 3NKYA 1TL3B 1YZ6A 3CC4T 1F0XA 5D8HB 2J6TA 3W7BA 1VQNT 1EETA 2UUWA 5E0OA 2BR0A 5CYJA 4MK8A 2GJFA 1Y11A 2KVQE 2LLZA 3MR5A 1JXOA 4BE0A 5KFSA 2HS3A 2M1HA 1QVGA 3MWBA 2ASYA 5CKBA 2CQHA 3LH5A 3CJ4A 1FESA 1TK5A 1N9SA 4NZ0A 1N4LA 4R55A 2WTFA 2P6SA 3L42A 2XHCA 1SRMA 1G3SA 2HIYA 1VRQC 1ZTTA 3C15B 2JTFA 5D4OA 1CJKA 1F9HA 3FSYA 3OW2R 3OA6A 4LXCA 3RB4A 2FJVA 3NCRA 3OSVA 2MZTA 5KFMA 3IG1A 4WWSA 1FX2A 3CPFA 3KLGB 3CJSA 4M78A 2J9DA 5A0LA 3CD7A 3EM1A 4C92A 1F60B 3QRPA 5CYQB 4X2BA 4ZHRB 3A5ZB 4CNYA 4DX5A 2J6KA 1K4US 2YBVA 3HP9A 1S1VA 2JEGA 4M77A 2CAJA 5E5NA 2FTRA 2K5FA 1Y4ZB 1WHWA 3CXCP 1C1BB 3G8QA 4X4NA 2YTCA 1FJ7A 2J05A 1N54B 1VQKS 5ETVA 4UQGA 3BPDA 3M8YA 1H92A 1L3SA 2WCXA 4FYYB 1X4GA 5D0EA 3T9ZA 1QCOA 2H3JA 4C0OC 1N5ZA 3QRQA 3PZPA 3VS3A 3M0PA 2O01C 2DIUA 4EUVA 3R6NA 4C8QC 3SI8A 3LYIA 4K4WA 1WC0A 3G86A 1MMGA 5G0RA 4CTAA 3OBYA 5GAOm 3TOQA 3CC7A 3H7HB 3L2WA 1ZBTA 2AZVA 1M90T 3P8HA 1PG5B 1N36F 3DRRA 2JJ4D 1I81A 4IDKA 4JLGA 4BE1A 5A2QU 3B4DA 3JAMY 1GXIE 4OYWA 1D8YA 2E1AA 4PXEA 1D1BA 2YH0A 3TCJA 2IC3B 4WKRA 1YJ9A 2HS4A 3EPGA 1ZA1B 1AD5A 4A53A 4HHHA 2HQFA 1UFFA 3GJSB 3FMWA 3VKIA 1UP1A 2GX8A 1VS3A 4YEAA 3M9NB 3M05A 2CZVC 1R6YA 2B9XA 3DOLA 1FHTA 2FB7A 1MROB 2VH7A 1VQ8T 2DY9A 2GHVC 3BSNA 4ECWA 3OJSA 3ZXWA 2CDRB 4ZVUB 2C3MA 2RB7A 3PKMA 4CO3A 5K8MA 2HQXA 3JCMJ 2QA4Q 1HQUB 3VF0B 3QT5A 4RW8A 3R7BB 2AX0A 3GSDA 4IFYB 1DFDA 2QT7A 3UR0A 4OB0B 2DM1A 3LOUA 3TVZA 3L2VA 4OZ3A 1OX9A 3KLIA 1M2OA 1KQSR 3X28B 1IM4A 3QIPA 3SQOP 4ECUA 2E9TA 2LMIA 3URGA 2PFDA 2P4TA 2LNHB 3W2VA 3TP2A 2DCLA 3T1HJ 1SKSA 4CZCA 5IQ6A 3N28A 2XYHB 2IM3A 1I1JA 4DSKA 1NJZA 3RMSA 1FYNA 3T1YF 2GHPA 3N4WA 1N48A 2RF2B 4JYAJ 4YHHF 3CCWA 3OUYA 1NDPA 4CO4A 4C11A 1Z4UA 2FHDA 4NI2B 5KFBA 4IFVB 1R0AA 4FN5A 1G7CB 5GANe 4O0IA 4XTXA 1VMBA 2A2DA 3I55A 3P49B 1NK7A 3P6YC 2XO6A 4EYHB 2IRYA 1VQ4A 3GYGA 1MU2A 4NRTA 3H8YA 5KFFA 3POTA 4OHVA 2PVGB 4U8VA 1IBLF 4P74A 1AXQA 3GBQA 3DLGA 4V19X 1BGXT 4NEYA 1VQYA 2GFAA 1H2UX 4F3QA 3R1HA 4P5NA 4PG4A 1QSSA 4QPTA 3H8ZA 4X34A 1PD0A 2NCKL 3DU6A 2NSBA 3I6PA 1ZHIA 2PO4A 5I22A 2PVDB 1N88A 1NSKL 3CXCS 2LDMA 1P27B 2YKMA 2DK2A 1CLFA 1DTQB 3QAUA 1RT3A 3CJKB 3SQGA 1YIJT 3EUNA 2YDLA 5HK3A 3NAIA 1KHVA 3V7CA 1BC6A 1O5JA 3M2UA 2VG6B 2CJQA 3UDVA 2KU7A 2YWHA 3MCOA 4DPXA 1RLCL 2MYFA 3HHLD 3IBCB 1NZ8A 4IH7A 4B08A 2UP1A 1UDLA 4BHQA 1X5PA 2PU9B 3OY9A 1FMWA 4CYUB 1J5EJ 5HQMA 2O9SA 4PWDB 5IHIA 1T95A 1G3TA 2NLUA 4M7AF 4B3SJ 3N6LA 3NCPA 3W9HA 1OQKA 1IKWB 3TEGA 3UWTA 4UZBA 4RU9A 1HWLA 1WORA 4UW2A 2EYWA 2B43A 2M70A 1SEMA 4C9DA 4LQ3A 3OL8A 1WXBA 4MIAA 2X3DA 2CVIA 2VBWA 2RUGA 4USHA 4KT0C 5M2PA 4RW9B 3AA8A 3GJRB 2OO4A 4AG1C 5GAN3 2QL9B 1WG1A 3EFRA 1VQMA 2OELA 2EYZA 4JI4F 1VQPT 2V8GA 3LF0A 3BBCA 1KTQA 4G65A 3S01A 5HBMA 3QSIA 4KAIA 3DGPA 5K8OA 1FFWB 4C8QG 3QBCA 1REVA 4DFMA 1XNQF 3W5XA 3RR6A 2V4JB 4LF7J 3VS7A 1LW2B 2HQCA 4DR1J 4FF4A 1VQOS 2JLGA 4DV1F 3MO8A 2HHTA 5J2NB 4LSLA 2C0OA 3OYIA 4ZTFA 1SUQB 2ZOGA 4HT8A 1YJWS 5D7UA 2IMWP 2ZBRA 2LCCA 2DL8A 1HQ2A 1TKTB 1KONA 1ZPWX 3OW2P 3A13A 3M6UA 4P52A 4EFAC 1F1BB 3D28A 5GAEU 4KGVB 3OYDA 2DGUA 2VFTA 4J91A 4ZLLA 1NE8A 2KRMA 2BMBA 2V63A 4WZQA 2QLXA 5ETOA 2D7SA 3CCSA 4OB3B 4MZTA 4F7VA 3IWNC 2B5JA 3D9BA 3MDFA 3CCLQ 3VALA 2YKOA 4NL2A 1G1XA 1VISA 2IA0A 4QIWD 5DQGA 3JCMf 1MLAA 2XMTA 3CCMA 2LQBA 1GCQC 5C42A 3GSIA 2ACYA 2E3IA 2M5YA 3OTEA 4QYZJ 4NS5A 3RAQA 3I0RB 1P9QC 3RMQA 2EFPA 2VG7B 4B6MA 4WPAA 3ENWA 4LVOP 4F4WA 4TY8B 3DOKA 4LF4F 2VA2A 1B3TA 4E7KA 4BDZA 3MP1A 2AX1A 2V50A 4NYZA 4OQJA 2KH9A 3OS5A 1SPBP 3FJPA 2XM3A 4WE1B 2DETA 2EIFA 3QG1A 2DD8S 3NG8A 1HBOA 4H4OB 1V6HA 1VYUA 2HURA 1U1OA 3TEHB 2I6WA 1KHIA 2I38A 3MP6A 1P6TA 1FNMA 1JJ4A 2DLPA 5K14B 2LQKA 2WB1D 2EFVA 2BZXA 3M32B 2CG8A 3U1NA 3QSYB 3UD3P 2RH2A 4IRCA 2DRBA 1YITQ 1XOVA 1IHWA 2KROA 3N9UC 2BYCA 1UKUA 3UCZP 4IR1A 2LX7A 2R7TA 3QQCD 4WP3A 1TP7A 1XQHA 1QWEA 1KSPA 3MMBB 5GAN4 1RWNB 1SH3A 1TR0A 2ZE2A 5BXIA 1F9FA 3G8TA 1MNEA 1RAFB 2FGCA 4QIGA 2DR5A 2PN6A 3G6ET 2VICA 2ZPBB 3OYGA 3RW7A 2RHZA 4P2XA 1VLYA 2WSEC 2FLLA 3RG6A 4Q8EA 1IKXB 2MTLA 8AT1B 3N0VA 3OMCA 3H0PA 2YPYA 3BGLA 5EX0A 3FVYA 1YG0A 3MEEB 3UFCX 3W62A 4UOCA 1FFSB 1NJYA 3PEJA 3HL8A 3HKWA 1KQSP 2J0XA 3M0UA 3PGGA 2ZHOA 4U6PA 3VGUA 1UA1A 2VXEA 1QMCA 3EPIA 2E5IA 1TVRB 3N6MA 4YB7A 1GBRA 2M4MA 4OMFG 4O4GB 3UNYA 2KQWA 3JSMA 1GMWA 2L3QA 2OPSB 2W4DA 3AODA 4M5DA 3GPAA 4KY3A 2EW3A 3CB4A 3DKDA 1SBRA 1R43A 1U1KA 3LTOA 1YTYA 2BRKA 1SV5A 3QPIA 5HJXA 4OYXA 2OTJQ 4H54A 1K76A 4TVRA 1PO6A 5A8KB 1YITS 2RI5A 5DGBA 2I8EA 2OD6A 3IAM9 3MAAA 3ET6A 1RU1A 1KD1T 1U2RA 4IYQA 5F8HA 4M78F 3SEOA 3JCMd 4C92F 1WC5A 4I2PA 3HT0A 4HEA9 4PG8A 4E6RA 4LF6F 1ELOA 3OW2S 1GK8A 3TAPA 4NZ6A 3UT1A 3DLLQ 3CNQP 1NPRA 2N4CA 2ZPFB 3I5BA 1YHQS 4M77F 2MZSA 3T41A 2M2BA 3IBWA 1I1GA 4XTUA 1WHHA 3NTIA 1J2VA 2GV1A 1RTZA 3FFIA 1GFWB 3DU5A 2KEAA 3LQVA 4OJHA 4DLEA 2UUBF 2JDJA 3QJYA 2NXUA 4F7UA 1OSCA 2X9HA 2AU0A 4IG0B 1VQNA 3C46A 2D8HA 4FU6A 4I2QA 3MEUA 4DR7J 1JWWA 3EWGA 3NGTA 5FROA 2GQCA 2UZAA 2N7YA 5HVGA 4C8QB 3EMTA 2BZYA 4M75A 2CDQA 4NCAA 2L89A 2J9CA 2KJWA 3IR7B 2V68A 4HYKA 1CJKB 4PJOE 1VYAA 1SIZA 3EZOA 4P72A 2LEBA 2ALZA 3KUGA 1PKTA 1AWJA 1S4FA 2XDPA 1ZUKA 3OBWA 1YJTA 3H4DA 2OTJS 2GTJA 3BSCA 3CMES 4BI8B 2JVOA 2L8DA 1K9MR 3NMAA 3PFEA 3ER0A 3W1YC 4CLZA 2OPQB 2CUBA 1FK9A 2CPXA 4DJBA 3I0SB 2QG9B 3I56T 4FT4A 2PMWA 2IVWA 5KYXB 2MJUA 2AW0A 4C5GA 1JLGB 5HI7A 3L7UA 2KI7A 4NLVA 1BMQB 1Y57A 2VOPA 3RIRA 4KH1B 1ZSZA 3HTRA 3PCOB 4KFBA 3JB9I 4CI0B 4CNZA 4NOYA 4NYPA 3QPHA 1VIEA 2A37A 2KDSA 1VYVA 1AWWA 4NA2A 1QAIA 2BABA 1ARKA 2DBMA 4CLTA 1RAHB 3KJNB 4PK4A 4MDWA 3ZTOA 2XMMA 2EVRA 2K6DA 5GMKi 3PRBA 2HL5C 3CD6T 3VGTA 1NH8A 2HAFA 4NL3A 3UA6A 4ZJOA 2N3OA 2OEKA 3IGVA 3L7PA 1H641 1FKOB 4WIQA 2FIUA 1GNKA 2NXJA 4M5MA 2QV6A 4B9SA 2VG5A 3EVOA 1QJHA 4PJMA 1MGQA 4J9HA 1KQSS 4CH0S 1K9AA 2W2MP 2RHXA 3N79A 4JI0J 4F4ZA 3EGDA 1ZETA 3OSSC 4XTYA 1U1LA 3Q0AA 5A0DA 1FNXH 1U1NA 1NKCA 3QWUA 5IS2A 3MM9A 2ZM6F 8ATCB 1O9SA 3BZQA 4OJ3A 1FJCA 2JSXA 1XNRJ 4MYTA 3ONQA 1VQ8A 3KK2B 4PYDA 1S77D 2VWFA 5KFXA 5IC6B 3KMQA 3VAFA 4J6WA 2AD9A 5CO7A 2J9EA 3UQSA 2EKOA 3JSBA 1IBKJ 2VASA 5HVFA 2B7CB 3J7YU 4OYZA 4J9NA 4QVDA 4PJOD 4WFXA 4E8UA 1M1GA 1HWUA 2MQNA 2RO0A 1DBDA 2RIJA 4J83A 2M0GB 1BLUA 3W64A 1RHUB 4GY5A 2FHMA 3OFEA 2C2EA 1YI2Q 1G3YA 4C3KA 4ID5A 2JFDA 2QAZA 3VGVA 2XULA 4ALZA 5HMZA 3EX7B 2GIQA 1TUGB 4J9OA 3ZNUA 4ID8A 1S5ZA 3CEYA 4OMFB 3HZGA 3HKSA 4F67A 1QE1A 4RUHA 3MHYA 3MM5A 2CQCA 2MGZB 3ZTPA 1PAUB 1F5BA 1B0VA 3BDPA 3A3OB 4O0NA 3HHLC 2YKQA 2ZBCA 2XDDA 1HKAA 2DNLA 1T8EA 4LF9F 1S1TA 3M4YA 2DNPA 1OX8A 3W8GA 2ZITA 2LCSA 3TQEA 1SXLA 1JMTA 1FRXA 1NDCA 2AWZA 4U7UK 1N5TA 1C0UA 2R5AA 3HT3A 3MD3A 3MKDA 2YT6A 3OFHA 3RB0A 3TSZA 3P45B 5CYMB 1W2BR 3SEMA 2FVUA 3R5AA 2G2ZA 1YK9A 2JT4A 2DYIA 2WAQD 4ZGDB 1N32J 3ASKA 1TUWA 3PRDA 2YPZA 3KKFA 2QEXQ 2IM2A 3W2WB 1UL3A 1LNQA 4DPUA 4QBUA 3IRXB 1YIJA 3SQGB 1TL4A 5LJ3d 2HQ3A 6FDRA 2XY6A 2Y0SD 2GMLA 2DMOA 5H9EJ 2AZ3A 2FPEA 5KYUB 4XU0A 2KL8A 5LSOA 2DVJA 3E8OA 4C8ZA 1Q16B 3PYGA 2GNCA 1PNJA 1S7IA 3M2UB 3PR5B 2DR7A 1TMMA 2DEQA 2BQUA 2DIQA 4BUGA 4A8SA 1AUDA 3OSPA 3L7OA 4ELZC 3IMQJ 4KO0B 4ECTA 3GP9A 1MUZA 4ZVOB 2C2DA 3EG9A 1Q4RA 2E5JA 1C6VX 2CPIA 2ZEJA 1RLPC 2AT1B 1PSDA 1ZM4A 5DG7A 4BCAA 1S9EA 2G2YA 3F73A 3ENVA 2LJ0A 1GTHA 2JTEA 1PSEA 2YX1A 3MEAA 2YWKA 2BE2A 3LGFA 1RLDA 3Q1JA 2WBMA 3WX8A 1GH8A 1S4EA 2IHR1 3KK3B 4LR9A 2E3HA 4R56A 2EK6A 3OT9A 1NEEA 3QYGB 2LEAA 3HFZB 1KFZA 2AF6A 2RNAA 3H40A 4BWJA 1SH0A 2P9CA 1VQPA 2LU2A 2HGNA 4RUAA 5B0CA 3CCRQ 3MPDA 2YSQA 3TI0A 4GKJJ 4MKBA 2RS8A 3GLJA 1BQNA 3R6LB 2DJZA 2H65B 1E6VB 2W9CA 4IRDA 3M30A 3UN5A 2HMAA 5B0BA 4U95A 1UW9A 1WDXA 5I21A 3MEGB 3L95X 4PUOB 1PIEA 2WBRA 5DLQE 4DQSA 1NB2A 5D6GA 4HVWA 3BKUA 1K0VA 2V5HG 1X9WA 1JLQA 1DZ5A 2XS2A 2RQTA 2ZZDA 4Y92A 3HD1A 2JZ2A 1FI4A 4DN9A 1W25A 1XEZA 1WKLA 3U1LA 2NXNA 1QUVA 3LP0A 3G9CA 4LN2A 1HL6A 4GBQA 3E2UA 3SIPB 4I0WA 2FL7A 1R31A 1EP4A 4ENOA 5KYNA 5KE2A 1RA7A 3GQCA 2G0CA 4CLLA 1B34B 4IUPA 4NXMJ 4Y2AA 2MHEA 1T0JA 1HXDA 4J9DA 3UD4P 4G1IA 2CREA 4ZVQB 5H9FJ 4P10A 2MSTA 4WCIA 2VD3A 5L1IA 1QWFA 2PFFB 1SIWB 2L2PA 3KTQA 4M7DA 4K4YA 2RQKA 3RU0A 2NUTA 3X3UA 1QVGR 3MF5A 4KKOA 3SWNA 3LANA 2RQCA 4X4VA 2DRKA 3HRSA 4OMPA 4DBFA 1WOSA 2QJ3A 1TK8A 2J8SA 2CJ9A 2RUSA 2WONB 2MYSA 1XN9A 1S9FA 3KLHA 3CCRS 4LF5J 4RUBA 1T9WA 2ZUAA 5GMKm 3TJ8A 4AD6A 5EWGA 2QFJA 4B9UA 3ZFVA 3CCEQ 2HK2A 1U1PA 2QE5A 2COYA 1VQLQ 4DV3F 1E7OA 2H5JB 2JFKA 1U49A 2W24A 4ILLA 3MM7B 2EAYA 5FRNA 3DRPB 5LM7E 2H4WB 4K4SA 5MAOA 4BLGA 4KRWA 2XGPA 2UXBJ 4YB6A 3K59A 1D9AA 1HNXJ 3RBXA 2HHHF 3HVTA 2FLPA 3ZL7C 2R7OA 2WOMA 1T3NA 4A48A 3GNFB 2V4QA 3V4IB 4Y00A 4KBMB 3QGHA 1LWCB 1KC8R 4DZ6A 3QRRA 2KAFA 3A8JA 1YDLA 5A8RB 1FEEA 2GQIA 3OYYA 3LH0A 3F70A 3G6EA 4NCBA 4G3IA 1LWFA 5D0RA 3JB9k 4DV0J 2K2VA 3U23A 3OTCA 2Y1JA 1CJVA 1RU2A 2V8IA 1RWXB 1HQEB 4CO0A 4DL0C 3G4SA 2JS2A 3HHTB 5I11A 1GMVA 4Q2MA 5EX3A 2RPNA 2VQFJ 1WKJA 5LMUJ 3ZZTA 3M2RA 2JX2A 4PCQA 3JQJA 2E5HA 5AJ3F 3OLBA 2Y0BB 4USTA 2AQ4A 4F7UF 3BPSP 1IKYA 3FK4A 3SCIE 2CXEA 2W7OA 3A12A 3TJ9A 2MWPA 3QGPA 3D6FB 5FWBA 2G6FX 1RT6A 4ZKAA 1N34F 3KMSA 4CO1A 5ADZA 1NB7A 2KG1A 3I87A 3M8PB 5IOLA 4M75F 4PPDA 2Z8QA 3KHRA 4DR2F 3IA0A 4DV4F 1PRMC 4Z37A 3I32A 1Y96B 3ZNJ1 1KFDA 2K1RB 2MPXC 3R8YA 3OYLA 2P9GA 2ASDA 3DN9A 4DPTA 4USIA 5GAHI 3NNCA 1NZ9A 2CUYA 3PDNA 4NEZA 3PYFA 2VB6A 2HWTA 3OYEA 2KO1A 4B17A 2CWXA 3OLAA 1R6VA 2K79A 5HN0A 1UJYA 5F41A 3A8KA 3VAMA 4ZLJA 3OQ5A 2BZ2A 1C1CA 1LKZA 5D6WA 1X0PA 5H1SV 3AB2B 3THTA 5DM7R 1K8AR 1NNDA 3F56A 4OZ5A 4G1QA 2Z4PA 3I9QA 3V8JA 1BCOA 4DUZJ 4DL6A 1TUDA 1EB0A 2ZH6A 4DG1B 4FPRA 1FWKA 4YTLA 3CW2C 1KVIA 2FYKA 4JRKA 2JVRA 3H6ZA 2HHSA 1SQEA 3CBPA 1YWPA 2BUNA 1TV6A 3M57A 3RKXA 2KYMA 4RMOA 1JXLA 1QKWA 5FDLA 1N8RR 2CNLB 1D1CA 3CF5Q 1MNDA 1HBUA 1JK9B 3DHWC 1EIFA 1M30A 2KT1A 2K2MA 4KH0B 4C48A 2DAQA 4MMLA 1GQEA 1WFWA 2E5LJ 1FX7A 4M5GA 1V3SA 1LXNA 4K4VA 1SI9A 5KFOA 2DGSA 3MFHA 3SB2A 4QW2A 2KN4A 5ETSA 2HEKA 3TUIC 1S59A 1GCQA 4PQUB 2M02A 1ZSGA 3QHSA 4TQSA 1JLCA 1NPKA 4O44A 4OI1A 4TU8A 1M5SA 5EGYA 2FJEB 1EHWA 5K9FA 1IR0A 2BIVA 4QKUA 2XI9A 3DHXA 3I56A 1D0ZA 2KE9A 1QKXA 3CT9A 2V8DA 1Q86T 2YKAA 3NXZA 2OGUA 4XDCA 2YNIA 4USMA 4RWWA 1PM3A 1S1UB 3CCJQ 5HK4A 5LJ5g 1TMJA 2HK3A 2M0OA 2DX1A 4XTTA 4N47A 2GQ2A 4B3MJ 4X4OA 1FE0A 3TAMB 5JVHQ 4X9CA 5KOWA 5CHCB 1TXQA 3IC1A 2X51A 1ZAVA 4HDGA 1AZEA 2V6AA 1S99A 4ES1A 5AXLA 5I42A 2YNFA 4TYAA 1B07A 4PJOC 1YWXA 2QA4T 5K5MA 5KT3A 4L3KA 4OYOA 3V6KA 2E66A 4HCZA 2OI2A 1VQ5T 3A1YG 2V67A 2BEFA 2LU1A 4ITSA 1Q86U 2IG0A 3Q8RB 2AJFE 2GFFA 3DB4A 2W8LA 3H2UB 3M56A 2UUAJ 2DILA 2WSCC 2IDEA 2VKNA 2HS0A 3CIZA 4NASA 1T0HA 5HMWA 2XY7A 2XS7A 3PEHA 4C8OA 2JLEA 1SCJB 1TKXA 4A8FA 4EMGA 3I4HX 4NLYA 3AB4B 3EGVA 2LTOA 1JKHB 3PR4A 2EW9A 4DZDA 5KT5A 4RW4A 2RJZA 4RU2A 3GR0A 2QTVA 2YLCA 4NA1A 4DOWA 3SFGA 1IM6A 3T1HF 3HHLB 3V7SA 3VS2A 3CCQQ 2PC6A 3I9ZA 1Q7YC 4M7DG 1FEHA 5GMKa 4JV1A 3NMZC 3TSWA 2MY8A 1KWMA 4V1Ak 4ZVPB 1AYEA 1NO8A 2HBYB 4KPCA 4LDUA 3RUXA 4CC4B 4ZA1A 1QVGP 4PG5A 4XU3A 3AD8C 1M2VA 2YNGB 3H5SA 5AT1B 4M5IA 1CJUA 1X69A 4J9RA 4ECVA 3OR2B 1UEBA 1K9MU 4B9MA 2KT8A 1H3DA 3NRBA 1UPMB 3A98A 1SL0A 1HWKA 2B8QA 2EJGA 2KYZA 1D3WA 2HNDB 2NUZA 4ID5B 4CRIA 4QR0A 1NK8A 3CC2Q 4F4AA 1SL1A 2DEIA 1LNXA 1Q5VA 4ZP9A 1JX4A 4MYUA 2VKRA 3GG1A 1DURA 4EPCA 2DH9A 2ILZA 1M3AA 2E6ZA 2B6AA 4WK1A 2KXNB 4D3HA 1QE1B 3DOMB 2NR0A 4OYPA 3MGJA 2PMZD 4B3TJ 2I1RA 1WC3A 1Z2LA 4Q44A 1RJJA 5A0YB 2RDDA 4RTWA 4NLDA 4DSJA 1BIAA 2WB4A 3LAKA 4J7IA 2AJ2A 3FDSA 4DFKA 1HNIA 1KBRA 4DHVA 2MQLA 1WPYA 2ZD1B 2AYGA 4XTZA 2HQGA 5HVHA 1ROFA 2ABLA 1J3TA 5CAIA 2M16A 1UW4A 3Q8VA 2DXDA 2HW3A 1PD1A 2AJ1A 2R7UA 3MOZA 1A7GE 1RYRA 2DB1A 2V26A 3H42A 1FTRA 4J9BA 4WJBA 2Y4YA 1N0UA 3DYAA 2QI2A 3VAGA 1QP3A 1JLAA 4GO5X 4LF8J 5FWCA 1WDDA 1RXOB 2C2MB 4FZVA 1GX5A 1J5EF 4QR1A 1NPPA 4CLWA 2B8AA 4DMZA 2CPFA 1KKHA 2I5JB 2KVIA 1S72A 5LSRA 4X65J 1FTCA 2MK5A 4C0ZA 1S1WA 2FHJD 3ZZOA 4E7HA 2LA6A 2W2PP 1KOHA 2BKNA 2VFSA 4DR6J 2FY8A 2F2XA 2AYMA 1NJIR 4TQRA 2SXLA 1T9TA 4GRSA 3M8QA 4RG8A 1VA7A 3VJPA 2NLWA 4DV1J 2RNEA 1H2TZ 1CQNA 4M7AE 3RKYA 4N4HA 3ZTQA 2DPIA 1H6KX 1Y07A 3HULA 3JCMe 3R6GB 5LJ5j 3BGOP 2NSCA 2R7VA 4LRBA 4ICLA 4C8YA 1WGSA 1H8KA 3PNWC 4LF7F 1YJUA 4DR1F 3WIUA 2DNGA 1FNOA 2R4FA 3GV7B 4AL5A 3BBBA 4Y28E 2ZZMA 3CMAQ 4AFUC 4P7VA 2UU9J 2M9KA 3RAMA 4M7DF 2DR8A 3CCLT 2HFZA 2AGOA 4OI3A 2K3YA 4ZVTB 4PJOG 5T7LB 4J90A 2EG2A 2DXCA 4QWEA 1BQNB 4UUWA 3K5NA 3I5AA 4ZCKA 3CC7Q 3EAEA 4HT7A 1Y5IB 2GGPA 5HMYA 2BQ3A 3CCVT 2MLYA 5EUHA 1QVGS 4X66J 2R2SA 1UZDA 1TL1A 3MM8A 3TNVA 4E7LA 4MK9A 4QIEA 4P71A 3OBIA 4KHPJ 3FGVA 1YJ9Q 2Q6BA 3T6BA 5L1JA 3VQSA 4LFAJ 1KRPA 4GKKJ 3V6DB 2C2KB 2UVUA 1BBZA 3PV8A 1KN6A 1UEUA 1EARA 1HMVA 2HKEA 4LUEA 2LXIA 3EYZA 4ZIWA 2V1QA 2DRDA 3VAKA 5B0FA 3AFGA 2AGPA 4ED0A 3HX9A 4AL7A 4XQ3A 3ZEHA 4DLGA 4F8RA 2QN6B 2W01A 1LPLA 2AKKA 1HK9A 3NGKA 1U6ZA 4HTIA 5LXYA 1YITT 2L3MA 4Q7AA 4KHMA 2KXFA 3CCUQ 5DM6Q 3FUYA 2NXEA 3ITHB 3TZXA 5KG2A 3CMAS 5C25A 3MEWA 4PWUA 4ATNA 3EG2A 4PZVA 3SWNB 3L9ZA 4M7AD 2IM1A 1R8BA 3Q8UA 2EK1A 3HSDA 1UWBB 1U1RA 4B9LA 1WNEA 4RNFA 1X9MA 1SPKA 4TYBA 1FJEB 4CO2A 3ZTSA 1QDUB 3NOGA 2V8HA 2H1YA 3UNGC 3MR2A 3FNNA 4ERDA 2BJ8A 2AMCB 3WZ0A 3CC7S 3GJQB 1V5IB 3NAHA 1MN7A 3UDCA 1VJWA 2V69A 1DQ9A 1Q53A 5J1EA 2E1RA 1ZUYA 3D6TB 1NJWA 1RISA 1A0OB 1DTTB 2F2VA 4EYIB 3M4GA 1RABB 3A8MB 1GEHA 2L08A 1Y9OA 4RWXA 1YJ9S 1YJRA 1GBQA 1U0HB 5CKFA 5J26A 4R0KA 4IUQA 3TEEA 3BO2A 2J0SD 4JUVA 1FRMA 1UEVA 1OZ2A 2HQDA 4TLRA 3X24B 3HVTB 4K4XA 1N5YA 2DXFA 4PLLA 4EMKC 1VK8A 3MOJB 1HHSA 3O2IA 4F50A 1NAQA 1TL7A 2LMJA 1RWUA 3PVXA 4UUXA 1R8AA 3LH2S 5J2MA 3T5HA 2B86A 2QO3A 4YB5A 2X1GA 5A8WA 2OTJT 3QJLA 1S7HA 3DCAA 4HACA 3E9FA 3I35A 4LUDA 1VFJA 2VUBA 4M5HA 5F9NA 3EGNA 5HANA 5KFGA 1TKZA 1CJVB 1PGZA 2KFZA 1M90R 2LQWA 2GVZB 1OPZA 2XMJA 1HBNB 3QDFA 2ECZA 3TANA 2RI2A 1QAXA 1KQGB 1WOOA 3WQPA 2EC2A 3NGUA 1JBMA 4CT9A 1ZM9A 3M4XA 5B0DA 1S1XB 1S6QB 3UDLA 2M52A 4XIUA 1X75C 1KVJA 4HLBA 4K5SA 3KK1B 4MAKA 4CRJA 2V2ZA 4U96A 3QZ9B 4LRDA 4DQRA 4DR5J 3DNCA 2E70A 2OPPB 1DY3A 4PG7A 2OAWA 3I55S 4M78E 2J9DE 4I1TA 1VQ4S 4CWBA 1M1KT 2RQMA 1L3TA 1OY6A 3A8LB 1FXRA 2APOA 2RM4A 3GIRA 1CVJA 4M77E 4DR7F 4X4QA 2HKQB 2A7YA 1C1CB 2VU5A 1Q81T 3U7JA 1WI7A 4XK8E 1SRLA 2J7UA 1HNVA 1VQ9Q 2RH3A 2DJQA 4WU3A 4FXDA 1RBLA 1NU4A 2CQPA 3J7AN 3OS0A 1ZQ1A 4N4GA 1BD6A 4RW7B 1UGPB 3ELHA 4LSZB 3BGRB 1R27B 5IWAJ 3VV0A 5LJ3e 1RP5A 3LW5E 2VGNA 2MB0B 5EDWA 2LXUA 1UJ0A 5LJ3Y 3DXSX 4PJOB 1KC8U 5KCHA 3LA0A 2A10A 3X20B 1OV3A 3PO4A 1FWLA 1TOVA 1D3BB 1O75A 1WA7A 1VLOA 4GVBA 1BB9A 2XK0A 1LWXA 4DBRA 5KFHA 4QVZA 2IDLA 5C24A 5JUMA 2UXCJ 2YH1A 1APSA 2C3OA 2A1BA 1HD0A 4KGMA 2F5GA 5EWEA 1ITPA 5D4PA 4O44B 4OYIA 2MQ8A 4DV5J 3JYTA 1VIFA 4O5VA 3REAB 1YZ7A 2K3KA 3V6JA 1IN0A 2VONA 3G82B 5ECAA 4R5PA 2B4VA 2EGEA 4WFAQ 3DXBA 4OLOA 1OQ3A 3N5FA 4BB7A 1RLQC 2ZZNA 5L8RE 3AHUA 2DHXA 3EFOA 2CQDA 1CEZA 4F3OA 4BI4A 3DLEA 4B9XA 3GOXA 3X1LB 2ZZTA 3JQKA 1VQMS 1UJ4A 4M78D 4FDFA 4C92D 3K5OA 1EQMA 1A0NB 4ZCMA 4KQZA 2QA4A 4OI2A 1KP6A 1SKRA 2EQUA 4M77D 2GFUA 1VQ5A 2W2OP 3PO5A 1XNRF 5F3ZA 3NGDA 1K44A 1RWPB 3EGWB 3MEDB 5FLXE 4UT4A 1F9EB 1GMUA 5GAMd 1FD2A 4KE5A 2DIGA 3NGPA 2CNKB 2GVDB 2CUDA 4HHJA 1TU0B 4YMEA 5F3TA 1X01A 3UN2A 1T9VA 3M2VB 2LKZA 4LDWA 3MI7X 1YI2T 3BE3A 2DHAA 3SDZA 3G87A 2HVEA 4Z7CA 1K73T 3MM6B 3QO9A 1S0NA 2BOPA 1LWEB 1PRLC 1O6XA 1RT1A 1SSFA 4A8OA 5CKDA 2DKGA 1N8RU 1FXXA 2FZKB 3TX8A 2CSIA 3CCSS 1R7IA 5C6SA 4M4ZA 1HD1A 3OHAA 1NG2A 2JHEA 1WZOA 3RUBL 5LOQA 2RK1A 3P5TL 3QZ7A 3JB9F 1TELA 2JEIA 2G9OA 4CLPA 3CCMS 1LW0A 3BDEA 3HSJA 1EJ7L 3C6TB 2HDAA 4DV6J 1LCKA 1B7TA 1KFSA 1RK8A 1VRUA 3MR6A 4QQGA 3VAJA 4E7JA 2CP5A 3B54A 1HHTP 2QLJB 2ROEA 3OYBA 4O3SA 5KG3A 3CE8A 4RTTA 2A2CA 2ZHAA 2MHNA 1QCFA 3A4TA 4RBTA 1HI8A 1ZBXA 2B9EA 1C4AA 2KXCA 4DV2J 1CJUB 3M0TA 2XSFA 1FKPA 2F65A 1S6PA 4Q43A 1DQ8A 4DL5A 4DOVA 3DM2A 3MZIA 1HARA 3HPOA 2XLJA 2CJXB 4ZMMA 2DCUB 5GJVB 1IKVA 2KI2A 2X4JA 1S12A 2FRWA 5A0GA 4G1PA 5IN1A 4HT9A 2XG8A 2OJ2A 4HDHA 1YP5A 2QEXT 5A6PA 1YCSB 1T0TV 2B6AB 3SZ2A 1U47A 4C97A 1U2FA 3B82A 1FXLA 1K9MC 2L3RA 3S7RA 3CIMA 2OFGX 3PYDA 1DLOA 1SSHA 1N32F 4ECQA 2GHWA 4E7IA 5F8IA 3BS9A 2VV5A 1XERA 4RL1A 2BV3A 3CJRA 2W2NP 1WELA 3NP5A 2KMTA 2ROPA 1NLKL 1UFKA 4OX7A 5KT2A 4WFNQ 2KZZA 2DNUA 5KYYA 1RZMA 2NQPA 1Y5LB 1WHJA 4MFBA 2E4HA 1PJ6A 2HZVA 2MKCA 2G3RA 1NHVA 1FO1A 5CD4A 1JQQA 4Q0BA 4DPOA 1N56A 2HMIA 3MTKA 2DD5A 4W98A 4JLIA 4ZVHA 3OYCA 2DZCA 2HBZB 1RT2B 3PE0A 2EI5A 1B0TA 4PQAA 3Q22A 1BYMA 4ZN1A 1RAOA 4E47A 3K5LA 3CEDA 5M2RA 1X5OA 4JJCA 2OTLQ 3BFMA 1SC1B 1GX6A 5D77A 2WHOA 4UOFA 1NK5A 1AEYA 1RTJA 3KXDA 1GT8A 4DN0A 4LQ9A 1SJFA 1HIYA 1S1WB 2ZVSA 2M88A 5GAN6 3CCRT 4A8YA 3DDIA 1D9DA 4LF2A 1NDLA 4YR3A 5E3QA 2XQCA 2WZ1A 2O4XB 1QLYA 2WSFE 4OF1A 4LD9K 3PMIA 1QSLA 3D1QA 2WW8A 4C8MA 1WXUA 2WVEA 3NBPA 2Q3PA 1TS9A 2XZWA 1M5VC 5I3UB 3ZC4A 1UVKA 5CXTA 1HBMA 4GKJF 4JI6J 4JI5J 2GMHA 2X1BA 2IJRA 1TKDA 2GF7A 2F8MA 2ZCFB 4OMNA 2Y9HA 4Z2XA 3QZ5B 4LREA 3OVBA 1J5OA 3RBEA 3DLMA 4JI8J 4OI6A 1I6JA 4ZPVR 1GRIA 3KJVB 2A6OA 1WHYA 3C14B 2CP3A 2Q43A 3J80Y 2WRMA 5IXBA 3I31A 4F16A 1JJHA 2QYCA 1YN8A 2GJIA 4CH1A 2WSEE 3JCMP 2QZ8A 5F0WA 1TSFA 5AE1A 3BQ2A 2BDPA 2U1AA 1XR5A 1PBUA 1W2BA 3MFIA 4J5YA 3CCLA 1KQ1A 1VQ7T 4FS2A 1NUEA 5HMXA 1RE1B 2CQ3A 2R8IA 3NPFA 3V5RA 1VQNS 3T1AA 4YDXA 4NMXA 4PXBA 4MZMA 3D0GE 3K2YA 1I0CA 2W9AA 3O6QA 4NXMF 4M7AC 2DGTA 2HNYA 3CCVA 2LNVA 2YRVA 1B7FA 2I9SA 2M0YA 2YRDA 4JI3J 1KD1R 4R8UB 1TL1B 1RT5A 2OPRA 2YNHB 5HROA 4KC5A 1HYSA 1M1HA 4H4KC 1QQJA 1YLXA 2EXUA 5KYWB 2LC4A 5GAMg 3MMCB 4M5NA 5D3GB 1X2KA 1UGSB 2YLBA 3M58A 4EO6A 4Y28C 1MW7A 3Q86A 4C98A 1NM7A 3CCET 1HLWA 3MMAA 2L9DA 1GCPA 5B0GA 2RKIA 1VQLT 4XU1A 3MECA 2OEMA 4LF5F 1L3KA 1RTIB 1Z1ZA 2QYZA 4MMOA 4WCEQ 2P84A 3QFHA 2JOYA 1FCAA 3QLHA 3O8VA 4ZPCA 4EMKB 4EMHA 1MMNA 1T05B 1IZ6A 2XDBA 4ELUA 1YITA 1S0VA 3ISND 1U48A 2Z57B 5J2QA 3UF4A 2EGCA 1LK5A 2WVFA 2HL3A 2L5QA 1NJIU 3GG0A 2OI3A 2BJEA 2HYIB 4B3OB 1RACB 4KV8B 3THVA 4D8DA 2F5TX 1FDNA 2IVYA 3C66A 5GAGU 3C16B 2UXBF 3CCZA 3FSXA 4AG2C 1CS4B 4GMKA 1KK7A 4ZJLA 3FEOA 1HNXF 3HDSA 2QGFB 1IJFB 1TAQA 5F9LA 5FJ4A 1OOTA 2LQ9A 3DMJA 2JN0A 4FT2A 2W4PA 2CPHA 2P5VA 2HFVA 3B8HA 2VDIA 1I07A 2R7SA 1N33J 2X7IA 1R8OB 2HBWA 3C3LA 2OUGA 4ED3A 3JSCA 5THWA 4DV0F 3A1PA 5CCAA 3NNHA 3L2ZA 1XQIA 4B9TA 4O6JA 1HD3A 2YXLA 1NSQA 1AHJB 2VQFF 5LMUF 1C4CA 1AZSB 4LF1A 1N34J 1XBWA 2HRUA 4NA3A 5HLFA 1VQKQ 3TWZA 2V4RA 4J9UE 2ADCA 2OMOA 1VRTA 1S9GA 4RTUA 3P96A 4PNOA 1VQ8S 2DHSA 2XEXA 1X4HA 3EXYA 4DUTA 3PW5A 1YGYA 4Y6IA 4MJKA 1WF0A 2V8JA 1VUBA 4PPZA 4OJGA 4A8QA 2XZTB 3E01A 2DXTA 3RRHA 2RQ4A 5DGAA 1LOUA 3THKA 1WHXA 2MLXA 2VF3A 4N0AC 2LEPA 4PFPA 1VBYA 5KG5A 3R7NB 3FZ2A 4OHZA 3UPUA 3DLLA 4FXVA 3L2UA 1UVNA 3CJ0A 4LRFA 1TUCA 2F2WA 3PVLA 2RHQB 2XLIA 1S79A 2R8KA 2VGMA 3EGUA 3VUZA 2V34A 3M6XA 4M75E 4Z89A 3K0JA 1XWLA 4KYZA 2GO8A 2E44A 3CGIA 4OMQA 1QD1A 2D74B 2XC9A 4DUZF 1OYXA 2IAJA 4AYBD 1CC7A 3TJAA 4P2MA 3M1VA 4EO8A 2BKOA 1C0TA 2LQJA 2XYGB 1CULA 2D9TA 2K57A 3SMZA 4FM4B 4LSNB 3KG4A 4MIBA 4I7FB 1Z2ZA 4HHUA 3R97A 1U3OA 4L6V3 2BANA 3UDEA 3PJXA 4JV2A 2F9JA 3MCNA 1FD8A 1GMWD 2YKNB 3DI6B 2E5LF 3AJDA 2HZYA 2M8HA 4IURA 2B0GA 3SDEB 2HNIA 2ROTA 5A2QE 3VV2B 2Q66A 2C42A 3PIOA 1Q0NA 4CM2A 1N5QA 3P5BP 2B4OA 2PEBA 4K11A 3OXGA 3FBEA 3BDLA 3FBFA 1FDBA 4WTOB 2EPIA 1CBKA 2D9OA 4E98A 2CZ7B 3MPUB 2FZCB 1ZAWA 1VHIA 5FU7C 4DL3A 3PFOA 4I6AA 3CCJT 1SKUB 3NL0A 2ZH4A 1YIJS 4M78C 5GAMj 4C92C 2IY5B 3SV3A 1Q8BA 4M7AG 1KVKA 1IQZA 3RYLA 5KFWA 3CD5A 4M77C 3W66A 5FU6C 1XMQJ 1B7YB 1JRIA 4B3MF 3V2UC 4U8YA 4XK8C 1M90U 4CI0C 1IB8A 2MIOA 3DRSA 5E3AA 1ICEB 4OB1B 3J81E 4MH8A 4DSLA 3AXMA 2XSJA 1KC8C 1UGVA 3M8ZA 2ED1A 3KYLA 2Y8WA 2JNGA 3RTVA 4M75D 3KLEA 1Q8KA 1QVFR 3M0SA 4LRCA 4FP9A 5KFPA 4ED7A 5I4MA 4WBFA 3A8HB 3LW5C 4NLGA 4OMOA 2UUAF 3J81U 5C0MA 3W5YA 1B70B 3K89A 4FVMA 2DO0A 1BK2A 3DLEB 3EGXA 3FC9A 4CLUA 1VQPS 2KFNA 1NH7A 2V8VA 1DHMA 3CCQT 2ZH3A 3H5YA 1ZZFA 2JZ5A 2YKPA 2PVOB 2EFQA 3RKWA 2W9BA 3TX0A 2YUPA 4IG3A 2HWHA 2UV8A 2CYZB 1T9UA 1BWVA 4HT5A 2FDNA 4M5JA 2CADA 2JRSA 1OIAA 1HHQA 2NYIA 1T9YA 2NUPB 4RNHA 1VQ6Q 5I3QA 2EQJA 2XU8A 5KTQA 2H4YB 4MTPA 2DXBA 4IKAA 4QW9A 4IOCQ 2QLFB 2RSQA 3AQOA 1YI2A 2ATCB 5L8RC 1NXIA 1TQLA 3O5TB 3U02A 4MKVA 3CC2T 2HLTA 3ZZPA 3BQ0A 4RW6A 1VIOA 4J7FA 2MJNA 1BQMA 1H2VZ 2DITA 2AK5A 3FCWA 1Q7LB 1URRA 4LE9A 2C2OB 4OIXA 5CQYA 1K8AC 1RKJA 1EX4A 2ZDOA 3BN7A 5LJ3h 3OR1A 1JIHA 4ZVFA 1S48A 4ELVA 2CNNB 3BBFA 3PIPQ 5KFNA 1X6OA 3G4SQ 2MKYA 2E10A 3VVTA 2DGWA 1IO6A 3M0RA 4E7SA 4E0DA 1VQOQ 1U1MA 1KTVA 1LK7A 3PW2A 2JMAA 5KCOA 2Y1LB 1N8RC 4B3TF 1YJWQ 4PL6A 7FD1A 1XTZA 3UO0A 3K57A 3OFGA 4BBYA 1LVKA 3BEGB 1VDHA 3PW0A 2CP2A 4OHYA 3PX4A 1RTHB 4X62J 3T5KA 1B0PA 2DNMA 4LBPA 4EEYA 4RTXA 1TL3A 1VQ6S 4RO0A 3E2EA 1JLEB 4DCPB 1N9RA 2KY9A 2W1BA 3LGNA 1DAXA 1V5VA 1WIEA 2QEXA 2EBGA 1SJ4P 1U2CA 1FERA 5AXNA 3FDRA 5B0AA 4D6WA 4ELTA 4PR6A 2RMLA 2VJUA 1AFJA 3OSNA 3IO1A 3QT7A 5J2PB 4PXCA 4LF8F 4LR8A 5J1PA 4C3MA 5CQXA 1NHUA 4O23A 5CCLA 2CZ9A 4XPCA 3C15A 1VC0A 2LX9A 1HPZA 5GAOl 2YQ3A 4CT8A 3LP1B 2FHOB 2V8KA 4BC7A 1M3BA 4X65F 1JLFB 3FSIA 2V8PA 1RUSA 4PJJA 1LFPA 1FRHA 3KLGA 1RT7B 4PEOA 2R58A 4DR6F 3HFKA 5CYQA 2PI5A 1QUPA 4ZHRA 4FW2A 3IBFB 3G4SS 2EYXA 1SHFA 2CS7A 2BX6A 1TL5A 3UR3C 2LFVA 1C1BA 4ZS6A 3AOAA 3OL7A 2CIMA 2HSPA 1UEKA 4M1KA 2HZAA 2J8AA 2OSQA 1RDRA 3NS7B 4TNOA 1X9SA 3CMAT 4NLQA 2K7AA 1W7WA 4M78G 2AYEA 4C92G 1BI1A 3I5RA 1VHFA 3LP2A 2R2RA 1HW8A 3QKJA 3BSAA 3TVTA 5KT4A 4ED8A 4KUIA 4QIVA 5C2GA 4X64J 2NPFA 4C6AA 4M7AB 4OZ1A 4IH5A 1R0CB 4M77G 1U6FA 3CCRA 3NOCA 3ULHA 3G6VA 4KR0B 3J7Z5 3KNAA 1CJTB 4HH0A 2UU9F 5ITHA 2ZH8A 4FPIA 5JVGQ 1M27C 4AXJA 3CJ8A 2U2FA 2LVMA 2IIMA 2W2QP 1WEXA 1R8PA 5IV3A 4M5LA 3R7SB 1M3CA 1O0PA 1IR1A 4N7TA 1YRUA 4F14A 2GW8A 1U09A 5DLGA 2R7QA 1UCNA 3ILJA 2IC3A 2N7CA 3OTBA 1YJ9T 1PC5A 2OX7A 5KFJA 1UE9A 3FZBA 1WI8A 2JEJA 1T03B 2XKOC 4X66F 2BKDN 4RCBA 4M7DE 4FYDA 1K1ZA 3O5ZA 2AJQA 4PLIA 1MROA 4KHPF 4V19J 1ACMB 3RDVA 5GMDA 5GANg 1MV3A 4ORZA 1G2BA 4B9WA 3N5BB 4LFAF 3ISNC 4GKKF 2PI4A 1VQ7A 1HQUA 4LFCJ 1AOJA 2P0PA 3VS1A 1TTHB 2GAHC 4PG6A 3VVUA 2WSFC 3CCUT 4H4MB 2ZC3A 3GIKA 2QYGA 2F1LA 1KLMB 3DLKB 2JUFA 2BM1A 2W7PA 4F4XA 2VHGA 5MLCV 1QTMA 2JVVA 2MKJA 2MOXA 1KIKA 4RR5A 1SC6A 5IHNA 4AL6A 1PC0A 5DZ6A 2DTOA 2OPRB 3PX6A 4AFQC 1EIYB 4RCCA 4II1A 3L3CA 2RQUA 2VDHA 3VZIA 4RUCA 2P0QA 3OHBA 5D0GA 1F3VA 2WW4A 1YHQQ 3MCAB 4N56A 4I67A 2MPUA 3ICLA 3MJXA 4P7TA 3CCEA 4NCGB 1VQSA 2GO9A 2GC8A 2RF2A 4EBDA 1VQLA 2FPHX 1YJNA 1CKBA 3GJTB 4NI2A 4IFVA 2E64A 3H41A 3S6EA 2DISA 2KNBB 3I56S 3MUMP 1E6YA 3Q8PB 2ADBA 2ZNZA 3R6OA 1Q82C 4ECZA 4LBHA 2K5LA 4WXWA 1JLBB 4C7QA 1PHTA 1C0MA 5B7WA 1SJRA 1FF2A 1F6TA 1DRZA 1URNA 4C5IA 1FRLA 3VHQA 2E6NA 2G0IA 4QU6A 2IM0A 5DY9A 5D4LA 1RI9A 3FBCA 3GFYA 3AD9C 2DGVA 4M94A 1F5AA 1K1QA 3J7ZT 4J9MA 1ZZNA 2KBTA 4F0MA 3D6HB 1I8FA 4J5OA 5GAMe 5ETLA 1ZM3A 3CMEQ 4KUDK 2H5EA 1ZM2A 3W61A 3IQLA 4IUTA 1HR0J 2ZC4A 2R5MA 4BI3A 5EC7A 4DDFA 3META 4M7DD 2FQQB 1BU1A 2YWGA 1DTQA 1I3OB 3EDQB 2FLOA 2KRRA 3CJKA 2KHDA 1Q86R 2I2LA 3C94A 3DRXA 1Y71A 1WHKA 1JXVA 4IO9Q 4DFPA 3GV5B 4PKCC 5HK0A 3JCMb 2VPZB 4FBUA 2JNJA 5M9OA 3VS0A 1V3RA 1S9GB 1H73A 5HP1B 1UZHA 3CVKA 2D1XA 3IP0A 5L1LA 3CC4A 4JI2J 1Z9QA 4A8XA 2R42A 1EFNA 1KD1U 2F1FA 4CYUA 1Q78A 1EETB 1AT1B 1UECA 1X5TA 5IH2A 2ASJA 4PWDA 2KT2A 3WIVA 1KQKA 2GGRA 4DR5F 3WHIA 4Y91A 1IKWA 2XS5A 3UE2A 3GFHA 1UA0A 3HVAA 3G2XA 3MMJA 5LMNF 3RGIA 3C4SA 2QTXA 4KGXB 1GXTA 5T14A 4QZVB 2FUG9 1YBAA 4ED5A 1VQ9T 3FJ2A 2MMPA 4ZITA 4RW9A 4ZK7M 2XBPA 1S72Q 3W9JA 1ZLMA 4GVLA 5GAGI 5FU7B 4F2SA 1ZS6A 3IG1B 2J0WA 2PD1A 3I82A 4M78B 2DH8A 3KUHA 4C92B 2YRCA 4ZP6A 1OWXA 2WVDA 1NRKA 5GADU 4Z02A 1DARA 1W26A 3PG9A 2WSCE 1S1VB 2X1AA 1CQMA 2LP4A 2CA9A 2V4JA 4M77B 1LW2A 5FU6B 2HRYA 5DG8A 5J2NA 2BW7A 2Z2MA 1SUQA 1XJWB 4RTVA 2XNQA 1RAEB 4K4UA 5IWAF 3WC0A 1RYSA 4RX6A 2DFUA 1TKTA 5GANj 3AOBA 2BJDA 3CDWA 1SF9A 3GCWP 3DLBA 3WXMB 2MSSA 4CC3A 4M75C 5DG9A 2FJBB 2UXCF 5G0RB 4CTAB 1SL2A 2VOOA 2HGLA 1VGYA 3G1JA 4XU2A 4ZGEB 5LJ3f 2H9ZA 3OMGA 1XNIA 3DRRB 4DV5F 4IDKB 3P4UB 1H38A 5F8JA 2RHUA 1NSAA 3KFVA 3I0RA 5KFEA 1RSCA 5AXKA 3CCJA 1YKWA 5BYSA 3IM9A 4OGEA 4TY8A 1KSWA 2L3PA 1OO0B 1S72S 1PKSA 5CQGA 3HSGA 5L46A 3FEZA 2IVFB 3I4PA 4WE1A 3FCHA 4ETXA 3DOLB 4H4OA 1Z9ZA 4FYXB 1ZSZC 5IT9Y 3KG0A 1M0SA 2DVEA 5K8NA 3DRSB 2HFOA 4MDXA 4RW8B 4PXDA 2HNZA 3JQMA 2AKLA 3VYGA 3OV7A 1X6GA 1IQTA 1LFWA 1QLNA 2F8HA 2XTJP 5K14A 3HK2A 4B02A 3C6UA 1HSQA 1SH2A 3M32A 4QQBA 2XMFA 1RAIB 4C5EA 1NZAA 2MY7A 1UFLA 3UWNA 4L6V5 3KLIB 2ILYA 2L0AA 3S3OA 2Z2YB 5GAN7 2JEFA 3QIPB 1M90C 3BKFA 2F9DA 4C0GA 3W2VB 3LPYA 1RQ0A 3M5AA 3MMBA 3UCUP 3R3TA 5CAAA 2DKOB 2CQ1A 4B3RJ 2DE0X 3JB9J 2PE8A 4QYRA 5KH6A 3CCQA 3LWLA 1IKXA 3OUYB 5HSPA 3OXFA 4C11B 4AFZC 4DX7A 4IG3B 1R0AB 5EN1A 5B08A 4ZJQA 3CBMA 3QT6A 4TVAB 3CJ3A 3C95A 1HNWJ 2LECA 3A3NB 2I2YA 2RHIA 3MEEA 4HI2A 2HFNA 4LIWA 2K7KA 3EICA 2RJCA 4DV6F 4KRTA 3UA7A 1MU2B 3BYRA 4ZCLA 3CMQA 4FKXA 1A6LA 3POTB 4OFZA 5DDRC 1TVRA 2M51A 3DLGB 1RAJA 2EC0A 5LJ5f 4IUFA 4O4GA 5HQLA 3CC2A 4DV2F 2OPSA 3JCMX 1BE4A 1WTFA 3M59A 1Y7PA 3NEKA 4MIWA 2XICA 1H7WA 4RTZA 4LDVA 4PABA 1VBXA 5L39A 4ECSA 4ANEA 1X4AA 5A8KA 3IRWP 1D8ZA 2EJ9A 2BTTA 2XYPB 4P2SA 2CP6A 2YKMB 3OYKA 2VFUA 4HTJA 2CT3A 5DO2A 1NKEA 3FEYB 4I56A 1RT3B 2EPDA 4OYBA 1QW1A 4OYAA 3OVAA 2KB2A 3VCDA 2KR3A 2DERA 1WEZA 4HL9A 3KHGA 5LSLA 3FMBA 2WACA 3CULA 4OP0A 1B64A 1YFNA 1YCYA 4J9GA 1OEBA 1Q7YR 5BJRA 2XHWA 1BWEA 2DYAA 4J9QA 1NHKL 3G71Q 2HIQA 5GMKj 2H5IB 1TH7A 1UTIA 2O67A 3HHDA 1WC1A 2R3VA 1KHWA 5L9XA 4OMMA 3W5ZA 1UUEA 4ZDNA 4IG0A 5KFDA 2ZBPA 2C2NA 3OPKA 2DJWA 3CPWA 2AZSA 1NEBA 1U1TA 1SB6A 5GAOq 1S49A 1V9OA 1WG4A 3GYXB 2R7WA 1MWZA 4C8QA 2OTLT 2F4FA 1QY7A 2HQHA 3OL6A 1ZBJA 1JB0C 4VUBA 1WWHA 3KWMA 4F7UG 4YN3B 1GFCA 3D0IE 4Y2MA 2DL4A 3HFNA 3UPFA 1HPZB 1YBUA 4C8KA 1G3OA 1NYGA 2C1EB 5C5JA 4ZTJA 1FFGB 3L2RA 4PKDB 1AW0A 1U24A 2CSQA 2RB6A 5HBMB 2OPQA 3C0CA 2QXFA 2HGMA 3DGPB 3I0SA 1REVB 4M75G 5HY6A 4NPOA 1Y00A 4BS2A 3BYPA 5KYXA 3O3LA 4ANCA 3PRVA 2AKWB 1JLGA 6AT1B 2BW2A 4LSLB 3QJPA 2DTHA 2CQ4A 3BH6B 3I5SA 1JJ2A 4ZCIA 3JB9D 4HVVA 1PJ7A 4DUYJ 4JI6F 1RCXB 4JI5F 3OS1A 1PCXA 3CMAA 1AROP 4UZCA 2XZDB 4L3NA 2JM8A 4WZMA 4J6YA 1P1LA 3M54A 1SQGA 3SSSA 3G71S 1U45A 1YNZA 1P1TA 2CQGA 1YBYA 1M1FA 1P9YA 2KFYA 1I5OB 3LP2B 7FDRA 4JI8F 3VR1A 2VJVA 1O8BA 4WF2A 4P2FA 4GLKA 3HD2A 1ZAXA 1I94J 4HVZA 2K5IA 4IQMA 4OX6A 5LJ5d 5DS7A 2GQVA 3UW1A 3GNGA 3ME9A 1OJ4A 4C0HA 4YY3F 2B5JB 1J27A 4FS1A 1FKOA 4ATOA 3A8EA 2D3O1 2Q79A 3UN3A 2KSSA 1P92A 5C42B 3G8SA 1W2IA 2D0NA 5ETTA 3O44A 5HQ8A 3EG1A 3D67A 2I0XA 4JP8A 3HO1A 1IVZA 3DOKB 5LL6S 3QO3A 5D6YA 2EBPA 3TVKA 3BW1A 5J3BA 1N6AA 4JI3F 3QFWA 1MMDA 1IGQA 3OTOJ 5BR8F 3U27A