3UDCA

Crystal structure of a membrane protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDDLIEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel, C-terminal pepti
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
total genus 79
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3udcA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3udcA03
2GA7A 1Q8BA 1MWYA 2BYCA 2K7JA 2IYIA 1VIEA 5B0DA 1OQ3A 3IWXA 1KVIA 2PGCA 2HIQA 2QLXA 2IFXA 1FE0A 1LQ9A 3TNVA 2P4TA 1X8DA 2FHMA 2XMMA 1JK9B 2L3MA 1FESA 1FEEA 3BN7A 5T7LA 1X7VA 1YRXA 2OMOA 4Q2LA 2ROPA 4ZA1A 1CC7A 2HQIA 3HF5A 3CJKB 1N5TA 4A48A 3KNGA 2KT2A 4DN9A 3HX9A 3LO3A 5A6WA 3FGVA 5B08A 3BM7A 1AFJA 1P8GA 2QYCA 1OPZA 3TOQA 3IWLA 1YJTA 4A46A 2N4DA 2FB0A 2ZDOA 3LGMA 3E8OA 3QMQA 2RK2A 1VQYA 5T7LB 2XMVA 1FVSA 2GGPB 4F67A 2LQBA 2Q3PA 4HI2A 3WDOA 1CPZA 1W2IA 3CJKA 2RK1A 4FNIA 2G9OA 4OJ3A 2OAUA 2K1RA 3VTIA 1Y3JA 1OQ6A 4HH0A 2OP5A 1U7LA 1TR0A 3BR8A 3KG1A 1FVQA 2PD1A 2VH7A 2GQVA 2KYZA 2XMJA 1GXUA 1KQKA 4Q2MA 1FE4A 2GGPA 1SI9A 3HHLA 1IUJA 2AW0A 4NPOA 4DL0C 2LQ9A 2GO8A 2BJEA 1VIFA 2ASYA 4EFAC 2ACYA 2OD4A 3MCSA 4HH1A 1Q8LA 4YEAA 2HFOA 3F44A 4FNHA 1AFIA 1VQSA 2K1RB 4HL9A 3DXSX 4QOTA 2ZDPA 4ZOSA 1Y0HA 2KT3A 5B0CA 2RH2A 3UDCA 2OKQA 1SB6A 1FD8A 1YJRA 1N5QA 1YJVA 2LXFA 3LGNA 4U9RA 4Y2KA 1KVJA 2IYGA 3HHLB 5B0AA 3SFMA 1S6UA 1Y9OA 2RSQA 2W4PA 2OD6A 2LDIA 1R6YA 2AJ0A 4HI1A 3T9NA 2HLTA 2AJ1A 5B0FA 1RJJA 3FRYA 2ROGA 3HHLC 1S6OA 1URRA 1WD6A 5B09A 4A47A 2BJDA 2EW9A 1X0PA 2QIFA 2RILA 2CRLA 2GCFA 2N7YA 3BDEA 2FIUA 3DCAA 4YDXA 2GFFA 2W4CA 3K7RA 2VV5A 1XBWA 5F0WA 3MZIA 1AW0A 3QGPA 2XMTA 1Q4RA 3GZ7A 4A4JA 1N5SA 1ULRA 5F0UA 4OJGA 1SQEA 2JDJA 3TRGA 1N5VA 4OIXA 1TZ0A 2BUNA 4Y2MA 2KKHA 1TL4A 3HHLD 1V3ZA 5KAKA 3BGUA 1QUPA 5IXUA 4NL5A 1CC8A 3KG0A 2K7KA 2RMLA 2ROEA 1GXTA 1Y3KA 1Q53A 2AP6A 2W4DA 2XMWA 1P6TA 2N4CA 2HFNA 2XMKA 2OFHX 3FMBA 5K9FA 3HDSA 1TL5A 2GV1A 4OJ1A 2RU9A 1JWWA 3BB5A 1K0VA 3BF4A 2K2PA 3I9ZA 1OSDA 5B0GA 5A6PA 5B0BA 1MWZA 2OFGX 3HFKA 2XMUA 2QLWA 1APSA 2HLUA 2FTRA 4OJHA 5B0EA 2BBEA 4DPOA 4Y2IA 1YJUA 1YG0A 3KKFA 1TUVA
chains in the Genus database with same CATH superfamily
1WA7A 3IWXA 2R7SA 3IG1A 4CC4B 4ZKAA 2DHHA 4QR0A 3IMQJ 1GL5A 5KG1A 2N3OA 1VK3A 2E9ZA 4USUA 3SV3A 3I56T 4DV6F 1W1FA 4LREA 2DGUA 2FYKA 4IKAA 3BPDA 1D1CA 4F3MA 1RLDA 4QVZA 2D3ZA 3LWLA 2YKPA 1C2PA 4H4MA 2LQ9A 4PNOA 3SCJE 1HQUA 3A3NB 3DMJB 3J7Z5 3IP0A 1U09A 2I0NA 2V8JA 1C0UA 1UJ6A 3OYLA 1UTIA 5KT7A 2HNDB 4DBRA 4YFUA 1I8FA 5FDLB 2L3SA 3VVUA 3VR1A 4OHXA 2H65B 3AJ2A 3M8WA 3PR5B 2LQWA 3UA6A 3IGNA 4LSLB 3H40A 2RQMA 4DF4A 4DQIA 2XIDA 4RW6B 4QQDA 2RT3A 1XQIA 4ZN1A 1DQ8A 5I3UA 5KT6A 1WSVA 3FRZA 2FPFA 1RLQC 1B7TA 3U1LA 2FYXA 3JCMP 3FQKA 3I0RB 1IREB 3QDRB 4C9DA 5IH2A 4GO5X 1FJ7A 1UEBA 3H5XA 2QLWA 3KLIA 4BDZA 5KFGA 3L4BC 2LMIA 3N0VA 2F8EX 1GT8A 3FDSA 4OX7A 1T9WA 2E5HA 4DV1F 5LJ3j 1CG2A 4O3OA 4GC6A 1W2BP 1N0VC 3NNCA 1CBKA 1TXQA 2VPWB 2XYHB 4IUUA 1VQ8T 2YWEA 5M2UA 2R2UA 3R5CA 2DGWA 2A0FB 2A37A 4PLIA 3DLMA 3FDRA 4C92C 2VONA 2M16A 1V6HA 1EX4A 4WIIA 3X26B 1VQNQ 3Q8UA 3MMCA 2KDSA 3EG2A 8AT1B 4C8NA 1WORA 2GGPA 4M5MA 1OX9A 4NLUA 2QX0A 2KG0A 4RW8B 5FU7C 3META 4R8UB 3DOKB 3L2WA 1TV6B 4IURA 1O6XA 3G9CA 2CQHA 3TZZA 3HL8A 1NSKL 3SCIE 3VALA 1TKTA 3MXHP 2P9GA 4C8QA 1JLQA 3HSBA 1PBUA 2GCFA 1RWWB 3CC4S 1NK4A 1OWXA 4J6XA 2JL9A 2MHNA 4XU0A 3HLUA 1RAEB 1FI4A 5HK0A 2ZUGA 4PXCA 4XAKA 3ENVA 4CM0A 1BQNB 3QBCA 5F8IA 3PTWA 3QAUA 1TK0A 2KAFA 5J3BA 3UR0A 2OEJA 1N52B 4F2RA 2DPJA 3OTCA 2HAXA 3IRXB 2BIVA 1N48A 3D5MA 5C2CA 1QSLA 4ETXA 1EIFA 2FLPA 3MPUB 1Q7YC 3W3SA 2KRSA 3UE2A 4C0ZA 2DY1A 5KYXB 1H641 1WHJA 1JJ2A 2VC1A 3M8QB 5DLQE 2HIQA 3W1YC 4RW7A 2XS5A 1BCMA 3AOBA 2RD1A 4F26A 2RRNA 3PKMA 2C42A 2KT2A 3RBDA 5AE3A 3OMCA 4R5PA 3LWHA 4M63A 2B9WA 3HT3A 2X4JA 3EGUA 1FVQA 2AIRB 1BLUA 2DIVA 3OS1A 3DOLB 3HHLA 4IH6A 3KHHA 1PSFA 4ED4A 1KVIA 3BY7A 1FKPB 2L0AA 4JLGA 2QSFA 5B0CA 2HQFA 4IYQA 2O4XA 4J91A 2VA3A 3HZEA 2YKAA 2WK4A 2KGTA 2F4VF 2ZH4A 4RO0A 4PQUA 4M75G 1HBNB 4HACA 3MCMA 3SYZA 4MMLA 2QIFA 4M7DC 5CABA 4OGCA 3FNNA 4DL7A 1YCSB 4Z7YA 4RZRA 2ASLA 3L2ZA 1OJ4A 1HR0F 2E7WA 2FJAB 5MLCV 4M77G 3NS6A 4C11A 3V4IB 5GADU 1Z1ZA 1WUUA 3W2WB 4WZQA 2RQVA 1CJUA 3DRRB 4J9IA 4LNPA 3NGDA 3BQ2A 2B6AA 4TY8A 1N27A 2JTFA 2VXFA 4ES1A 4FP9A 5KFYA 2PA3A 4JRQA 3MM8B 2WTFA 4NRTA 1HNXJ 4JI7F 3DLGA 1VQOQ 5AJ3F 2AT1B 3KOAA 3H7HB 2UXDJ 4N0AA 4USMA 1N8RT 3PV8A 3K17A 2HPUA 4OX8A 3DI6B 4HKEA 1E6VB 1IQTA 1LVKA 1SVDA 2DXDA 4AL5A 5HMXA 1T0TV 3KG1A 3CJQA 2FC9A 3OFFA 2JFDA 1WG4A 3EFRA 4KY3A 1MUZA 3ADAC 1RWOB 2EI5A 2R2SA 2J6TA 1S72A 2HFSA 3TEHB 1RTIA 2VUBA 3PFOA 5B0AA 2LDIA 3OL8A 3D9BA 2V8KA 2YKNB 2RHYA 2C2RA 3EUNA 4BDYA 4DV4F 3OJUA 3RGIA 1DARA 5E3RA 3LP1A 5F0UA 2X7IA 1FX4A 2QT7A 2CADA 4QVDA 2DAQA 1Q53A 1S99A 3LP0A 4YDDB 3C6UA 2KXDA 4I68A 1OSDA 2CPDA 4DR7J 2FTRA 4K5RA 4ZLPA 2L48A 3OYMA 1NDPA 3JTOA 4QW8A 3HKZD 2YWHA 3CC4A 4EBEA 3N6LA 4ED3A 4DF8A 4YN3B 5LL6d 1G3WA 4F36A 1NJYA 4KAIA 2EYWA 5DLOA 1S4FA 4J9RA 2Y1JA 3IS9B 1G4CA 4TQSA 4X4NA 3IRWP 2HZVA 2R7RA 1C1CB 4USKA 3KLFA 2OI2A 3RB3A 3C14A 3VTIA 5D7UA 2CZ0B 4ECQA 3JTPA 1WPYA 1ZBXA 4QW2A 2KN4A 2E5LJ 4CC3A 1U1RA 4UUXA 4EMKB 2GO9A 3R6OA 1PCAA 1Q82T 4U9RA 1XR7A 4OMFG 2X3DA 4OMMA 5DGAA 4LBHA 2JMAA 3NPFA 2LEAA 1VRQC 1IKXB 1S9GB 3A8KA 1FJCA 4X34A 4CLUA 4E6RA 2C2ZB 5GAN8 2KKHA 4KJIA 3PW4A 1X9SA 5KG7A 4DR5J 3K5PA 5AE1A 1TKZA 4EO8A 5HLFB 4ZCLA 2CDRB 3BGRA 1H74A 3THKA 3PJXA 2OPPB 3KNAA 2EVZA 3D6MB 3ET6B 3TAPA 3RBEA 4EU0A 1OPIA 1UETA 3MF5A 1ZSGA 2LQJA 2GCXA 2OPQB 5A0YA 4M1KA 4ECYA 2PI5A 1WC4A 3VYHB 3BE3A 1K1QA 3H0FA 1YRXA 4RPFA 1VHIA 3KJQB 3BH6B 3G6YA 4ICLA 1YGYA 5J2QA 1HWKA 2VIHA 3MOZA 1X4HA 2VFRA 1N33F 3I5RA 2YNFA 2XG8D 4M7AG 3OMGA 3CCVT 2AD9A 4MDXA 2EWHA 4DCJB 5BXIA 1REGX 2YPZA 4B3TF 5HK3A 1XN9A 1EX8A 1S72T 5H9FJ 2AKLA 4P7TA 1L3UA 2K57A 1ZTWA 1S6QA 3LW5E 2DNNA 1EIYB 2B5JB 2ALYB 2YX7A 3JAMU 4E7KA 3C46A 3OW2P 1YJNQ 3SSRA 3UN2A 2BE9B 1ZAWA 1X69A 5HBMB 3M8RA 3GFYA 4ZP6A 4ZJOA 1UWBA 3AD9C 1YJWA 3N6NA 2EYYA 1A0OB 1U1KA 3RR7A 4E7SA 1HNVB 2R8IA 1TZ0A 2QTWA 4WTYA 2VC0A 3ER0A 4Y28E 3VCDA 1T0JA 1UVKA 2BJ3A 1YITA 1RT6B 4JPBW 2EKYA 3BKTA 3HKWA 4X65J 2BW2A 3HDSA 2CPJA 1U02A 2L3QA 2VG6A 2LQ8A 2QAZA 4G1QB 5HP1A 2MKCA 1Q8BA 1UA1A 1WKKA 3TEEA 3TVYA 1JK9B 2EC2A 2COZA 2M5YA 2VPZB 1VQMS 4DR2J 2CKKA 5LMUJ 5FLXU 1FRIA 1HLWA 1T03A 4IQXA 4A4HA 5C25B 1TL1B 2I1RA 2RUGA 2RI2A 2ZNYA 1XNRJ 2HNZA 2DA9A 3OL6A 2JEIA 2E1PA 3CD7A 2EEYA 3VS6A 4BD3A 4PXEA 1WELA 3AXKA 3R3TA 1YJ7A 2FRYA 4LF9J 4U7CA 1Q86R 4MT1A 3U02A 1N32F 1Q16B 3R2CJ 3LLRA 4ZLNA 4ECXA 2AJ2A 2V4RA 2XCAA 2KJVA 4IFYB 4AXJA 4K4UA 4HYKA 1C6VX 2VJUA 3P8HA 1RWXB 1FJGF 1H3ZA 1LNXA 2EXUA 4OJGA 1N34J 4IIMA 2NSBA 1FWLA 4B9NA 3N5BA 2OTJS 1K47A 3F73A 3SEOA 3EXYA 3JQMA 3MWBA 5GMKe 4ZLLA 4E7ZA 1ZSZB 3I9ZA 2X35A 1IKVB 2JS0A 2QYZA 2BQ3A 5LJ3f 4IUTA 4LBIA 5CHCB 1W2BS 1KTQA 1LQ9A 3EVOA 1NYGA 2H5IB 5IHIA 3OFHA 2E1AA 3KUFA 3KNGA 2QFIA 5EWFA 2ZPEB 4XQ3A 2JTMA 4EDUA 5L8RC 2GZOA 2QQBA 4PFPA 1J5OB 1R77A 3OYJA 1NK5A 4B3SJ 2QJ3A 3TP2A 1VQ7S 1C0UB 2F7VA 3KK2A 4O4GA 2R8JA 2JLEA 2DILA 2GO8A 3DLEB 2RQUA 1RT3A 4M5IA 1BI3A 1YJWT 4PUOA 2WW4A 3I55S 1RA6A 3LX7A 3MURP 4DX7A 3C6TB 5BYQA 1ZM2A 4ED5A 3DLKA 1NKCA 1QSYA 2GIQA 4NZ6A 2ABYA 2YQ1A 4JI0J 4RTYA 3CD6S 3OTOF 2FDNA 3BDUA 1YITT 5C6SA 1NDLA 2W9AA 1QP2A 2ZZDA 1HW8A 3RBZA 1JLCB 4F3QA 3M2VB 3EDQB 4JI6F 1CEZA 2DR6A 5D0HA 1DY3A 4OI1A 2BANB 2HRUA 2BUDA 2M0OA 1G3YA 4AYBD 3DXBA 5GMKj 2CNOB 5IT0A 2DR7A 5A6PA 2GAGC 1RTDA 1JO8A 1W4SA 5G0RA 4ZDNA 5M2PA 3CJ5A 2UXBF 4CIOA 1QTNB 1FEEA 1KQGB 4FXWA 4NYOA 3H0IA 2K6DA 2B4PA 1S1VA 3PYEA 1AD5A 4MDWA 1H2VZ 2YNHA 4KHRA 4QBUA 2WB4A 3BBFA 3MMCB 3HXMA 1TTHB 2MZ1A 2GGPB 2LQBA 2GJFA 1CQMA 2DNLA 3MMBA 3MR7A 3G6ES 3M9QA 4KV8B 2DNPA 1SI9A 5DDQC 1D9DA 3S01A 1TL7B 3R6GB 2MY7A 4CTAA 4CO2A 3MAAB 4NLWA 2MQLA 5KYUA 1UE9A 3NTHA 3ISNC 2HW3A 4WE1B 1VQMA 4BI8B 1X6OA 4FSXA 3KDNA 4DU8A 3B82A 5KFPA 2H54B 2ZH9A 1ITPA 4KT0E 3CPWP 2FJBB 3JTNA 2D9PA 2EFVA 3KLGB 3ZZYA 2ZAEA 1SQGA 4AFUC 2NXNA 4ECSA 2VFUA 2D8JA 4C0GA 3HTRA 3QT6A 4PJOG 1KG1A 3RBXA 1C4AA 3TQEA 2BZYA 4B9SA 2DK3A 4ETZA 3OY9A 3C8YA 3I9QA 1NK8A 3AY0A 4UW2A 4MYTA 2ROEA 3M59A 4B3RJ 2DT9A 1XIQA 2MZSA 2ZNZA 4O23A 2Z4PA 2DIGA 3EWGA 1T9YA 4KO0A 1MWQA 2L9NA 1VBXA 5A0LA 3QQCD 4HTJA 5B0DA 2BE2A 4J5YA 2X3XD 3EZUA 3MECB 2ROPA 4OHZA 1WOPA 3T5JA 3LW5C 2KXHA 1YLXA 2K79A 3EAEA 3QMQA 4DSKA 3TREA 2Q3PA 2OTJA 3CJKA 4B9VA 4K4ZA 1NU4A 1D3WA 4H4OA 3KK3B 4HHHA 5DZ7A 3M4YA 3BS9A 4JI1F 2VYTA 1WEZA 4WP3A 5J2MB 2RHZA 3TZYA 4PQUB 2ZDPA 4PR6A 2P9CA 4DPTA 1W2BA 1FFGB 2BM1A 4JI2F 2LXFA 5GAGU 1LWCB 1XR5A 3MD1A 5EHHA 4KGXB 1GCQC 3UO0A 4A47A 2CKWA 2FIUA 1SF9A 4A53A 4QR1A 2HHXA 4C11B 2ZZMA 1FFSB 3PVXA 2YDLA 1VQ7A 1IXKA 5F8MA 2JRSA 3KK1B 2F9DA 3EH1A 1NK7A 5CYQB 1W2BR 1V3ZA 1UTAA 2CG4A 1UHCA 2RRAA 2PIIA 3CVKA 2N82B 1U2RA 5IT9U 1S72Q 4CRIA 4OMPA 2WSFC 1AEYA 4JI4F 2YUQA 3EGZA 4NLVA 3HHDA 2F2WA 1VQ9A 4LRBA 3HSGA 1TKXA 3I55A 3DLGB 2CZ1B 2BBEA 4KGZB 2HK2A 2P4RA 3OLBA 2O2OA 3QT8A 1ZBJA 5IZHA 2MXYA 2XYPB 2OJ3A 2HURA 5KFSA 3T9ZA 3CD6A 3I5CA 2GS8A 5GANj 4DV0F 3BV8A 2H5JB 3NNAA 4HVUA 3W63A 5GMKl 3OTBA 2KH9A 2K5IA 2LKZA 3QSIA 1IBCB 1VQ6S 2V2QA 4D3GA 3OUYB 3PNIA 3KLVA 1KLMA 5K14B 4X84A 4DEXA 1U8WA 2XKOC 1Q81C 4X1VA 3R5DA 2V8GA 2LNHB 2V63A 1WOOA 2ILZA 1FDAA 1RK8A 3H20A 2HQDA 4U95A 4CLYA 1VC0A 4LUDA 3VAGA 3CC4Q 4K4WA 3MEVA 3VUBA 4DR1J 3U1NA 4J9FA 4JP8A 2XB2D 1JKHA 2DBBA 3FEOA 4CH7A 1ZUYA 1JQGA 5GAHI 4DV7J 2LCCA 4W4MA 1NJIR 2IPOB 3PW5A 4J9HA 2RS8A 1BI0A 1HNZJ 3CCQT 4OB1B 1AA1B 1WHYA 2QEXS 3WHIA 2HGNA 3G6EA 2CG8A 1VDHA 4RBVA 3RB4A 5H9FK 2D8HA 1WG5A 4Y00A 5KFHA 2O1PA 2CQIA 3REAB 4X62F 3SCLE 1J2VA 5LOQA 1NEGA 1J3TA 2KZZA 3K5OA 1T7PA 4GVLA 1EJ7L 4FU6A 1Y07A 2VGNA 1R8AA 4Y2IA 1OPLA 1U45A 2I6WA 5KG3A 4OQJA 4LF4F 4Q2LA 2JHEA 2DRKA 3MUMP 3QO9A 4NEZA 3RRGA 1YSJA 1L3SA 1SUQB 1WSRA 2V8VA 1VQ4S 3G8SA 2ZOMA 2ZDOA 2QK0A 3RBBB 1PYOB 4II1A 2OHDA 1JXVA 4DDFA 1GRIA 3PKYA 2HNYB 2RUSA 1KD1R 1N6QB 2F69A 3O3LA 2AW0A 5H9EJ 4CNYA 4DG1B 4FF1A 3QZ9B 3MM7B 3TAMB 3ENAA 5GAEI 2ZFHA 2OKQA 3CEDA 4DWIA 3D68A 2DXUA 3CCUS 2DL7A 4PWDA 2ZBRA 3T9NA 5GJVB 6FD1A 3SSQA 3MO8A 4O3SA 1UHFA 2MWOA 1TWBA 5BYSA 1REVB 2XICA 4JI8F 2G13A 3C16B 2C2EA 4ZGDB 1JLFA 2OPSA 4IOAQ 2XMAA 3US5A 2RO0A 1VQ9T 4NLSA 2KYXA 4BE1A 4ILMA 4M78C 3I55T 1QDUB 2XG8A 1Y3KA 1SG5A 2L3RA 3OYNA 1HPZA 4KR0B 1MROA 3CD6T 4YR3A 1K9MC 3LTOA 2RQRA 1NSQA 2VJVA 2UXCJ 3L42A 5CYMB 5B0EA 1FTCA 1X4GA 5DJBA 2DTOA 2FHJD 4C7QA 3GP9A 4GVBB 1N56A 3EH2A 1YJWQ 1AXQA 1BHNA 1RWUA 3KLHB 3UWNA 2Z2LA 5D8HB 3P49B 1AROP 1YJTA 3QLHA 4PXBA 5RUBA 1HD0A 1EETB 2ZH6A 5FROA 3VQTA 3OR1A 2MMYA 1NHVA 4N5SA 1YITQ 1YBAA 5KFLA 3LH2S 2EFQA 3PDNA 1DQ9A 3PYFA 3GMGA 2XWXA 2E66A 2MKJA 2RH2A 4UUWA 2OTLS 1Z9ZA 1SB6A 1YJRA 4MIAA 2L9DA 2IMOA 3RAXA 1FX2A 2YWGA 1TSFA 1PC0A 1UFKA 1WD6A 3NNHA 3MEUA 1VA7A 4OL8A 9ATCB 3FEYB 1G2BA 1KBRA 2KRBA 2XMTA 1FWPA 2JNGA 3CCRS 1O0PA 3DDIA 3MEEA 1VQ5S 1HK9A 2BUNA 2QASA 1M8MA 5HY6A 2ZBQA 1PKSA 5IXUA 3SWNB 2HVDA 4ENOA 5ETRA 2CXEA 3M32B 4Z2XA 2VPYB 3QRRA 2RNAA 2GQ2A 4J9UE 2DNHA 2POKA 2IM1A 2XC9A 1PAEX 2KVIA 3AQPA 2HGMA 2E29A 4EYIB 1X2KA 3Q83A 2J6SA 4MK8A 3HF5A 2QEXA 1S49A 4K2XA 3X25B 1F1BB 1OPZA 2PEHA 3TR5A 2XS2A 4HT7A 1KHWA 4ZVUB 2ZEJA 1ZSZC 3JB9H 3T5KA 4MIWA 1IKWB 3GPAA 1D9AA 3JCMb 4OP0A 2XGQA 2C3UA 2J8SA 1MNDA 3JB9G 3QNWB 4C97A 2HQHA 3CCMS 5GMKi 2GW8A 3M8SA 2E5QA 4PCQA 2DX1A 4USJC 3RKXA 2FGOA 3T41A 1ZUKA 2CS7A 1VQ4A 2DLPA 1IKYA 3ETOA 5HQMA 4KB7A 5I11A 3N5BB 1GTEA 3I6PA 1JMTA 4DV6J 4Y3CA 5KAKA 1IZ6A 1QUPA 5GMEA 3D54A 5LMNF 1X43A 3QZ5B 4KYZA 4ZMMA 2GFAA 4NI2A 4I6WA 2C2OB 1U3OA 3CCUA 2YPYA 5KFFA 3GYGA 3HFNA 4ZLJA 2DGOA 1YG0A 4ZOSA 4OZJA 3EGXA 4GBQA 2W7PA 3B8HA 2HS0A 5KE3A 3CCTA 2OLWA 1Q7YU 3G86A 1IR2A 3NS5A 4WP9A 1UGQB 2XMFA 2FLLA 1CS4B 4IG0A 2ASJA 1ZM4A 1U4BA 1RKIA 2G1HA 2DVJA 2CJAA 1SIWB 1KHVA 3OW2R 1FMVA 1YIJT 4PG6A 1BCOA 1NJZA 1RKJA 1S57A 4QR2A 5A8RB 4ATOA 4JZ3A 1Q8LA 4PYAA 2W2OP 1S0OA 3VHQA 2P0KA 3WXMB 4M4ZA 1OYDA 2XNQA 3CQTA 1RT2B 2X4YA 1BB9A 2CA9A 4K4XA 2IBOA 1X0PA 2CQ0A 3CPWS 4JJBA 2D3O1 2ZCFB 1MMDA 2XSJB 3EVWA 3JSMB 2VF3A 2BJ9A 2RKIA 4F4WA 4LR7A 4Z7CA 2NLUA 4AMCA 1SC1B 3N28A 4C8QC 5HAOA 1EP4B 4MZPA 3IGVA 2X1AA 2XMWA 5H1SV 2OTLA 4WFBQ 2IM3A 3KLEA 1U49A 2XY6A 4PJJA 2HQCA 2RI3A 4PEOA 3QWXX 1FRLA 2WAQD 3M56A 1Z9QA 3VGUA 2M8DB 3CD5A 1WQWA 5D6GA 3KHGA 8ATCB 2JLFA 4RG2A 3JCMJ 5IXFA 4FF4A 3NY0A 3HK2A 2CIMA 4CT8A 2BV3A 1VQ5A 3UDVA 3HHEA 3G4SS 4DBHA 1VLOA 1YKWA 5CH7B 1HARA 1C4CA 2H9ZA 4CP5A 2YQ0A 1I07A 5DETA 2CQCA 2Q79A 3V5RA 2I9SA 2C06A 4KTQA 1GTHA 2XI9A 3EG9B 1E6YB 4HH1A 1VRUA 2VFSA 1RWMB 5J39A 2B7CB 1GX6A 5IOLA 2ZPBB 2U1AA 2ZHOA 5K8MA 2B4UA 4JS4A 2ALZA 4U7UK 3MM5A 4OYXA 1IQZA 5E2QA 1RJJA 1UVMA 3SSSA 3HHLC 4GC7A 1M1HA 2J9DE 1MHNA 1WGSA 1B3TA 2CUBA 3TVZA 2OTJQ 3PM9A 1D0ZA 1S79A 4WFXA 3PZPA 4JJCA 1OSCA 1L3TA 3POTA 3ZXWA 3DGVA 2HAIA 3CCMA 3MKDA 4GY5A 4OMFB 4ED8A 4ZIVA 2QL5B 2W4DA 1TAUA 1JJHA 3OVAA 4ILRA 1UJYA 2MJNA 2R57A 2BKPA 3S8SA 2MHEA 5ETPA 3VAIA 1S76D 1U1OA 4J5OA 1BI2A 2B8AA 2VDIA 2NPFA 4P52A 4C8LA 2DNZA 5IWAJ 1SKUB 5GANf 2FHMA 1HNWJ 3WZ0A 3BN7A 1UWAA 2ZPGB 2YX4A 2F4VJ 1ZM3A 1BD6A 3CJKB 1VQ7Q 3BJYA 3UWTA 2DZ9A 3M6XA 1JB0E 3L09A 3ZFVA 4ESRA 2MZRA 1HNXF 1WXUA 1CJKA 5HJYA 2MKKA 3A8HB 5AYFA 2DGQA 5L9NA 4FNIA 1M5PC 1VRTA 2UXDF 3D3CJ 2XDPA 3CC2T 1MU2B 1VQ9Q 1R8BA 3M05A 2KE9A 2DNUA 3I55Q 1YBTA 9RUBA 3HPWA 1UGPB 1NEEA 2DEIA 3CD6Q 1EFNA 4Q44A 1IGQA 1RTJB 2CFXA 4M7AB 1UGRB 1UJ0A 4F0MA 1VLYA 3M6VA 3LQVA 1U1PA 5MAOA 1LPLA 4JI7J 1FKAF 4M77E 5AJ3J 1GFCA 4RW4A 1RT5B 2MKSA 4AL6A 2JDJA 2XLKA 4R0KA 1CULA 5LL6S 4JV0A 1QKWA 2D9TA 5EC7A 5H9EK 2AJFE 1DQAA 3VGVA 4FVMA 3CXCR 2P8IA 1RT1A 3J7AF 4L73A 4HCKA 3G1JA 3NGRA 2IIMA 3G71A 1JBMA 4KGKA 2LCLA 5CQXA 3CPWA 1PSDA 1VIEA 2ZOGA 2C0OA 1QJHA 2MQQA 2DD5A 3PVQA 4DR7F 4OI2A 4BC9A 2RB6A 4ZHRB 3G6EQ 3R8YA 3B78A 2OIHA 4DV4J 3UVJB 4G6VB 1XEZA 3GB0A 3JB9k 5F8NA 2W9CA 5AXNA 4Z89A 4X64J 1Q7YT 2H51B 3CPWR 4JJNK 5EG2A 3R7BB 1RISA 2Z2YB 5LJ3h 1JKHB 5KFCA 2GGRA 3DXSX 2V2KA 3CC7S 3EHRA 1TOVA 3QIDA 1T0HA 2G0CA 2E5LF 2ABLA 1N5YB 3A8LB 4J7FA 5DDPC 1FFWB 4ERDA 3G4SA 4PG8A 2QQ9A 4MJKA 5CCLA 4Q8EA 2JH3A 2YNIA 2K3XA 2LP4A 2VBZA 1MN9A 2HEKA 4EEYA 2MGZA 1HIYA 4ZPCA 3HVTB 2YUOA 2V1QA 3MP8A 4KBMB 1B64A 2EAYA 3HCXA 3CJ8A 3A1PA 1E6GA 1F3FA 4XTYA 2K3YA 1BWEA 1R89A 2CJBA 3TSWA 4AUKA 1R0CB 1X01A 4DR5F 1LWEA 2QA4A 2DGSA 1PJ7A 2LTOA 2IHR1 3MEWA 3TA0A 2HRYA 1CSJA 3M30A 4ECVA 2R7TA 5ETKA 3D4JA 1H73A 1TQLA 5GAN6 3OR2A 4USTA 4M5DB 4NLOA 5I42A 1HHSA 3KWMA 3ULHA 1NEBA 3UCUP 1RTZA 4L6V5 2UUWA 4K50A 4C98A 4NPOA 3FBCA 2HEQA 3A8JA 4C8YA 2GHWA 3VRZA 1JEGA 2VZ9A 2HD0A 3M58A 2HMAA 1G8XA 4E7LA 1IM6A 2K4YA 2E65A 5DG7A 3AQOA 4MKYA 3DGPA 5HJXA 3ILLA 3EM1A 4ANDA 2DGXA 1RHUB 3BSAA 2VHGA 3VS7A 5D4NA 2M8HA 1V5IB 4MMKA 4ZVFA 1RTHA 5D78A 3J7ZT 2OPSB 4CLSA 2FHJA 1S9EA 5IQQA 5A8WB 1Z4UA 3N79A 3AJDA 4P5NA 2Z2ZA 1NXIA 3O5ZA 1FDNA 2LDYA 4OIXA 4N56A 2RIJA 3D3BJ 2GMLA 1FYNA 2ZUAA 3G71T 1SPKA 2GTOA 2DTHA 4LF8F 3AB4B 3NCRA 4Q43A 2GAHC 2WSCE 4O3QA 4XK8E 1ZAXA 1HYSA 3E1SA 3EZOA 3OTEA 5ETTA 4RTXA 4LJMA 3X28B 3ZZTA 1KQ1A 4X65F 3VWSA 3TU4K 1I1JA 3QLHB 2EFIA 4PG5A 1RL2A 1HYOA 1SH2A 4UTGA 4FKXA 1HI1A 2KROA 4M7AE 2IJRA 4CLFA 1D9FA 3VQSA 3MAHA 4DR2F 4MK9A 4NZ7A 2RK1A 3FEXB 2LT1A 4EUVA 1H3HA 5LMUF 3V6KA 4AL7A 1PJ6A 3UPUA 3ZTQA 3RR8A 3DHWC 1RCXB 1XNRF 1P9QC 4OYOA 3H8ZA 5FW9A 1QY7A 1IM4A 4ZVPB 3DC2A 2XDDA 2XLJA 4HI1A 3KMSA 3SV4A 4LF9F 2YKMB 2KI2A 4WZMA 3HPOA 4HDHA 3TX8A 1JIHA 4IH5A 1PJ5A 3CJ4A 4ZPTR 1BYMA 1PBAA 3GIBA 3CDEA 2KMTA 2FG0A 2BOPA 2E5GA 2Y90A 3RUXA 3DRYA 5F9NA 3A8IA 3A3PB 2QA4T 1HBOB 2ADCA 2K8GA 1N34F 2GQIA 2BTTA 2RRBA 3I87A 2FVSA 2NYHA 3JCMg 2N7CA 1RYSA 1TUVA 3CEYA 2ZITA 4ID5A 4PJOB 1X8DA 2JT4A 2QC3A 5KYYB 2HQIA 3N5FA 3M1VA 4RU2A 5GMDA 4WWSA 1OS5A 3OVBA 5A6WA 4RNNA 1VK8A 3I5BA 1IB8A 3FCWA 4RCCA 3GYXB 3L2UA 3DMJA 3CBOA 3DLJA 1D1UA 5FRNA 1FTRA 4OGEA 4LRAA 4L72B 3CCUQ 2VOOA 4Q2MA 2HNDA 3HRSA 4RW9B 3BO4A 3RB6A 4QWEA 2PE8A 2J0XA 3PVLA 4ZPBA 2J7UA 2HVIA 2L41A 4OZNA 2QDLA 4DQ2A 3TJ8A 1S9FA 2O9SA 2IRUA 2QTVA 4MYUA 3VS4A 4LSLA 1M5KC 4I1TA 1VUBA 1XMOF 1M1GA 2BZ8A 4L59A 3GU0A 4ZPAA 2E70A 1XK8A 5D6XA 5F41A 2VQEJ 5J1EB 1QVFS 1Y00A 3RR6A 3I0RA 2D6FA 3MPWA 2B51A 4ID8A 1PHTA 2AJQA 2C3PA 3BKFA 4LF2A 1SRLA 2J05A 4JI0F 3KG0A 4RKUC 2P2CB 2PSZA 2IVWA 3GFXA 1ZZFA 1P6TA 3W5ZA 1RAGB 2ECZA 4C92G 3JCMd 4CI0B 1ZH5A 1F6TA 1N36J 1TL5A 1TK5A 2E10A 2OFGX 3K2YA 3I82A 3D2WA 4ES2A 2QQAA 4NWBA 4UT4A 2NUTB 1WJSA 1KS2A 2K7JA 1NK9A 4QIGA 3A4TA 4X66J 2ZBIA 1TUCA 5HQ8A 1X7VA 5LJ5g 3CDUA 4M5GA 5LM7E 1WC5A 1K8AC 5KE2A 5I2SA 4I4BA 2ZM6J 3CCJA 3E3XA 2RVJA 2VKNA 3VGSA 1YX2A 3QJYA 2OUGA 2RMOA 4RW8A 2OTLQ 3U7JA 4R8UA 3W9HA 1HQEA 3DOKA 4XAXB 1TV6A 2D41A 3NCPA 1FK9B 5L1IA 4ORZA 1BMQB 4EFAC 4CO3A 3QYGB 1UPPA 2OD4A 2VA2A 1SL1A 1JU5C 3LAMA 5IN1A 2DXFA 1PKTA 5CQYA 3OVSA 1URNA 2R7QA 4M5KA 2D3OR 2FL7A 3I96A 1U0SA 2UVWA 5J26A 1VQ5Q 2CRLA 3U1MA 5CD4A 3HVWA 4A8KA 4DN0A 3VS5A 1BQNA 5EUHA 1XJWB 1R31A 1NPKA 5CO7A 3M7VA 1HWUA 4RUCA 4QWDA 2L08A 2VU5A 2LXIA 1VS3A 4DX5A 4OX9J 2F2XA 1KC8U 4CT9A 4XTUA 2EJGA 2F4FA 2LYVA 2VG5B 2YLBA 3GE9A 1Q8KA 4DX8H 4F4XA 3M8QA 2PU9B 5CKFA 1RACB 2DH7A 1ZOTA 3B4MA 2CT3A 4B3RF 2ZBPA 1M90C 5LJ5d 5KT5A 4IRCA 1FE0A 2RF0A 3CO0P 3RJMB 4J9MA 2KI7A 3OFEA 2XLIA 1H8KA 1UW4A 2UV8G 5F3ZA 1X5PA 1SC4B 2ASDA 1Q1KA 3OXLA 1QCNA 4YMEA 3DOLA 5T7LB 3G6XA 3DM2A 3CCMQ 4M7DG 4FZVA 4JB8B 4KKOB 3BGOP 1FKPA 3D1OA 2XMJA 2QLBB 4NCAA 1WDDA 4X4UA 2PVOB 5E3CA 1KVKA 3Q89A 1WHXA 1HBNA 3KXDA 1Q81U 3UD3P 4PL6A 2U2FA 3AOCA 2KL8A 3KUEA 2FRWA 2K7AA 1BY9A 5B0FA 3MR2A 3UNGC 4XK8C 3BDPA 3FZBA 4FSSA 3BYRA 2VV5A 3V4IA 4EBDA 1O51A 4PJOE 2AZ3A 5ETQA 3OYKA 4C6AA 4KH0B 3W2WA 2XULA 3BREA 2HZYA 4G3IA 3DRRA 3OYIA 4OZ0A 2YVSA 3CO9A 3PXGa 3ZTRA 4D6WA 1YDLA 4BDPA 3GV5B 4Y65A 4UZBA 2PN6A 2AZSA 2J6FA 4J9OA 3MM8A 2NZ4A 1VFJA 1K0VA 4JI1J 1RUWA 3VAHA 2WBRA 4P71A 2AWZA 4LF5J 3H41A 1Y96A 2DL3A 5I3QA 4LF1A 3DI6A 3CCJT 4KULA 1E6VA 3IR6B 1Q7LB 2MYSA 4CLWA 4C8OA 4BY6C 5BYRA 1QVFA 3HP6A 3GCWP 3C0CA 5KFZA 3H59A 4IH7A 4IO9Q 1B7YB 1HWIA 3QUIA 1M2VB 2VBXA 5K20B 4FN5A 4HH0A 1TR0A 4CO5A 3R1HA 1RI9A 2KZMA 1G6BA 2X9HA 4YP3A 3OSNA 3TZWA 3EZ5A 2CYYA 3G71Q 3PFSA 3SCKE 2WACA 4JUVA 2RQ4A 2L3PA 2YKNA 4IRKA 3JQJA 3NOCA 2R8KA 5LSOA 3AA9A 3F41A 4JI4J 3CNQP 4BS2A 5LSRA 5F8LA 1VGYA 1NJIC 2P0PA 1C0MA 1O9SA 4HCBA 4DUYJ 4XU3A 2FQQB 5HQLA 3M0RA 4F17A 5DM7R 4PKCC 3HO1A 2I2LA 4USVA 3DRXA 2B43A 3P6YC 2CQ4A 2CQDA 4FCYA 4H4KC 1KFDA 5KFQA 2EJ9A 4DHVA 1H3DA 1QVGP 1WX6A 1RWNB 1TK8A 4DV7F 5K8NA 3UN3A 2HYIB 2ZE2B 2JX2A 3T1YJ 1LXJA 4ES3A 3PW2A 1LWFB 5ETSA 4U8YA 4XO0A 2NS1B 2G6FX 4F4ZA 2NSCA 4P72A 1ZA2B 4DPYA 1PD1A 1YJUA 4EZ6A 3G4SQ 3IS9A 5CAIA 2JFKA 3CMES 4NEYA 4WXOA 1OULA 1K9MU 1C1CA 2QA4G 4RNOA 5GAGI 4ELVA 1DLOB 2WSEC 3ILOA 2IA0A 2KEAA 2ZH7A 4A46A 4FT2A 1KD1C 1RBAA 4C0HA 4J9KA 1OU9A 1GQEA 3JSCA 1UEKA 3DYAA 1NBEB 3CMAS 2Q6BA 3ILIA 4EMKA 2DJWA 1OQ6A 2R2RA 1LK7A 1BU1A 3AFGA 4DR4F 4F2SA 3L2QA 1NLKL 4X62J 2EFNA 1OEBA 4CLKA 2LT4A 2QA4Q 1YI2S 3D0HE 1KHIA 1N5QA 3HMJG 5KFBA 4KPCA 4K0KF 2ZJPQ 3G7ZA 1IKXA 1S9GA 3V6HA 2RILA 1LW0A 4DZDA 1DRZA 1YBYA 3SMZA 2V4QA 3PFEA 2CP0A 3MP6A 5GAN3 1Y10A 5HLFA 2NREA 2GNCA 4OB0B 4WJBA 4DPUA 5HVHA 3BN4A 3THTA 5EDWA 2OPPA 2BE7D 2DGTA 3ET6A 1ZPVA 2BM0A 1KFSA 2OPQA 3VS1A 3W5XA 2BZXA 3GONA 1NH7A 4J83A 3PE0A 2VBWA 4XU2A 3EGVA 4LDWA 3M30B 1B07A 4I64A 2HBZB 5IQ6A 2CREA 3G87A 2QLXA 3C3LA 1YZ7A 3CCSS 1QUVA 2UXCF 2HHPA 2HSEB 4LD6A 5ECAA 1RAHB 2UUTA 3UDEA 1YWPA 4C5GA 4UY8T 2A28A 2VGMA 3TARA 3SDZA 3H98A 4NASA 3OL7A 3NRBA 2KFYA 2PFDA 1SKWA 1NMEB 3MCSA 3WIUA 2JXBA 5HBMA 3LGNA 5ITHA 4R55A 4HDGA 3MOJB 2ZVSA 1H72C 1U06A 2AKKA 3LP2A 1RWPB 2FZCB 3G82B 5KFOA 1AYEA 2N7YA 1BBZA 3NKYA 2W4CA 4PJLA 2AZVA 1RHMB 5KCHA 1H92A 1Q81T 2XWYA 3CWJA 2QMUB 4K11A 1R0AB 1SQEA 1RT6A 5DQGA 3GYNA 3EJMA 2NXEA 4LDXA 5ETNA 4BC7A 4F04B 3IXQA 2BJ7A 3C66A 3W9IA 4CWBA 1NH8A 2ERRA 4LF7F 3MP1A 2BVZA 4G1QA 3TWZA 3DB3A 2ZWPA 1LEOA 2OAWA 4M75F 4OMLA 4FF2A 1FXDA 4GKJJ 1QKXA 3OYAA 2QI2A 2J8AA 1S0MA 3M8PB 3PR4A 1NCLA 3J7YU 4I7FB 3WX4A 4A4EA 4I2PB 2EW3A 4X4VA 4M77F 1TELA 2R7VA 3EGDB 5KFDA 4P73A 4P6QA 1VOMA 1CKBA 4ZVGA 2CDQA 3G6VA 3MCNA 2A1BA 4NOYA 4EIKA 1NLPC 1SJQA 3LGFA 5I21A 2GHVC 1Q7YR 2J0SD 5J2PB 1LKZA 4OHWA 4BLGA 3CDWA 3QJPA 3J80Y 1W7WA 1SQFA 3MMAB 4IFYA 3EFOA 2RJDA 2HSPA 2AX1A 3FJPA 1MLAA 4OYIA 2IVFB 2FUG9 4DUTA 2F65A 4O6JA 5GANh 3CMEA 4Y2AA 1XMQJ 3Q8VA 1OYEA 1S6UA 1UVIA 1KQSP 5DO2A 5E7OB 2YBVA 5JJBA 1YHQS 1U1NA 1SEMA 4PKDB 5IV3A 2B0GA 5L38A 3OHBA 3CMAA 4X2BA 1R43A 2GTJA 4C4WA 1QP3A 5LJ3e 2DERA 5KFIA 2IA6A 1ZSZA 1IKVA 4NL5A 1H2TZ 2KHDA 4ZVRB 4V19J 4A8MP 1YI2A 3JAME 3W8GA 4ID5B 2Y1LB 4QT7A 3ZL7C 3AD7C 5GAOn 1OPKA 5KFAA 1SKRA 1QMCA 2YRDA 4RTZA 3V2UC 4NA3A 1R8HA 1I0CA 3M1VB 4QCLA 2K3BA 1NM2A 2F8MA 4C0OC 2DXCA 2BEFA 2A6OA 1J5OA 1HBMB 1RA7A 4M75D 1L5UA 2DCLA 4OZ5A 1TU0B 1WXTA 2RA2A 3E9GA 3O8VA 3RRHA 4J8OA 4AD6A 2M88A 5DGBA 3IR7B 3BEGB 4F7UG 4CI0C 2GVZB 5KOXA 4N77A 1OU8A 5A8KB 2M51A 3DLEA 4MKAA 3M9OB 1K9MT 2PT0A 4HCCA 4M77D 2AZ1A 3MHYA 1N54B 4ZK7M 3GSIA 3D0GE 4J9EA 2NLWA 5L1JA 1OX8A 3NGUA 5LMNJ 4TYBA 4X4OA 3C6TA 3E2EA 1AWWA 2NZCA 1GBQA 5HSPA 5GMKa 3J7AN 5FLXE 2F5GA 3LH0A 4KBIA 3NOGA 3THPA 4Y91A 2XDBA 5CD4H 2M70A 3CCJQ 1JLCA 3M2VA 2FJEB 1NDKA 4QQGA 1YJNT 1NZAA 4AQYF 5ETMA 1KTVA 5CR2A 2RD5C 1RGVA 2BANA 2GQQA 4OI6A 5G4DA 3M9NB 1D09B 2V34A 4Y92A 1NG2A 4A4KA 1XERA 4W98A 1TUDA 2IY5B 2HFNA 2KNBB 3FLGA 2DBKA 1M1KR 1Y4ZB 3M0UA 2EQJA 3GG0A 1WC3A 1Q82U 3DFEA 3GOXA 4P9SA 1XQHA 2HHWA 2A3LA 3FBBA 1KONA 4FS2A 4V1Ak 3OPKA 3RESA 2C2MB 1FO1A 1UCNA 3INZA 3FJ2A 1R3NA 5HL7Q 1PC5A 2V4JB 3LGHA 4TNOA 3SIPB 1HQEB 1PILA 3R9LA 4KV8A 1FCAA 4K4TA 3P45B 2XMVA 2V8DA 3FUYA 2NR0A 1B34B 1TL7A 4M5HA 3MMJA 1N0UA 1Q5YA 1Y3JA 2XEXA 3BH7B 3MAAA 2ZPIB 1WJRA 4WE1A 2AK5A 4FT4A 2IM2A 5KFKA 3PHEA 2OO4A 2HQ3A 2LQKA 3CCES 3PW7A 4A4GA 1WC0A 2ENMA 3IM9A 3AB2B 3KLGA 2CJYB 1Y7XA 1RBOB 2O01C 4LD9K 1KNZA 2J0QD 2DYIA 3A1YG 2DL5A 3FRYA 3I9V9 3PACA 1RB0A 5AT1B 2G1DA 3QBYA 4M7AF 3NMZC 4BHQA 3TO8A 3FEZA 4B9LA 2VICA 1H7WA 2AEJA 2MAMA 3L7OA 3R5JB 4U6PA 4ZTJA 3ISZA 2AP6A 1RI7A 1OI1A 3NLCA 2G0IA 1ZQ1A 1QE1B 2DRMA 2KRRA 2MQ8A 4CYUB 5ADZA 1NJXA 4RUAA 3MECA 5GAOr 1XOVA 3KFWX 3GIIA 3HP9A 4L5GA 1UFWA 1MMLA 5D15A 1YHQA 4DOVA 3NGSA 3RU0A 1HD3A 5HKCA 3DM2B 3F0NA 3D66A 2WVEA 5B08A 3KK3A 4F4YA 5L39A 1K76A 3TOQA 3PO4A 5F3TA 5IHKA 4RLEA 2L9WA 4IUFA 2DCUB 5IWAF 3GTYX 2FY8A 4OX6A 2Y0BB 1VQLS 1HNWF 1GFDA 3CJTA 5J2MA 3OYEA 2DVIA 5F9LA 2NXUA 4LIRA 3OTDA 1BK2A 2XTJP 1ROFA 2CH4W 2QG9B 4IG3B 3CCLS 1JLAA 4FYVB 1FRMA 3Q8YA 3ZZUA 1LWCA 4FBUA 1CSKA 4FYYB 1HD1A 3O2IA 2V0NA 2EQMA 3UI3A 3D6FB 3TJ9A 3HULA 3AH6A 3RW6A 4NL3A 4HHJA 3KK1A 4TN2A 5CYQA 3JSYA 2R4FA 5T14A 2XZWA 3SEMA 2QZ8A 2ZH1A 1VQNS 4TU7A 2E1MC 1VQKS 1QVGS 1TL4A 1B99A 5M9OA 4M7AD 2RMLA 5KFUA 2XHWA 4PABA 2DPIA 2IC3B 1Y96B 5IM0B 2NUUG 3QSYB 3M54A 2DEUA 1LOUA 1IO6A 5SUHA 4FYXB 5B0BA 4ECTA 3M5AA 1SHFA 3KKFA 5ETLA 5EGYA 4A8WA 4C0DB 4RCBA 3OUYA 4ZA1A 1HSQA 3UPFA 5K14A 3BGLA 4J9CA 4G1IA 3ZTPA 5C7PA 2RDJA 2PZ1A 1WNEA 5LJ5Y 5CIUA 3NMRA 1U24A 1TAQA 1QLNA 2KYZA 3P96A 2DJQA 4IO1A 2MQPA 4O3PA 3HJFA 1LW2A 1YBUA 2CSIA 4LXCA 4HL9A 4QYZJ 4PZVA 2Z56B 3V8JA 1HKAA 4X64F 1X75C 1D1BA 2HVHA 1YP5A 4A8QA 3EHQA 4DA4A 3V6DB 3PX0A 1D1AA 5D3GB 1C1AA 3M2RB 1EKSA 2O5DA 2QV6A 1R6VA 1UUEA 2LECA 3WX8A 4W90B 3T6JA 3PRDA 1YWOA 3BQ1A 3SQGB 2FVPA 1WJ9A 3CCEA 5D6WA 2KYBA 2JTEA 2YT6A 5HCKA 5D77A 5J1PA 3QIPB 3WIVA 3MJXA 3J81Y 2C2DA 4OJ1A 2G3RA 4WKYA 4ED2A 1U6ZA 4IRDA 2FJXA 5EN1A 4DPOA 1ZTTA 1SUQA 4LR8A 3G96A 3OT9A 3EFSA 4ME7A 5DG8A 1U26A 1HBUB 2HCKA 4LVNP 2ZC4A 3DYAB 4RTUA 2LCWA 4NLDA 4YR2A 2HNYA 1N6QA 2JOYA 2HAFA 3RMSA 3H0PA 1WHHA 2PDAA 3QJJA 3E8OA 1EQ0A 2DZCA 4IR1A 5IT9E 2N3LA 4DOZA 3E51A 1FDBA 1F9HA 2IRYA 4DG1A 2XHCA 3MM7A 2DEQA 3TAMA 2Q43A 2O31A 4A8XA 2GHPA 2CQ3A 1J27A 1M30A 1NPPA 2COYA 3QFWA 2DJZA 3DRSB 5DRKA 4DCPB 2OI3A 3NL0A 2CYZB 3CTRA 4LF6J 3LPEA 4M78G 1F60B 4P10A 2DD8S 3H4DA 1SV5B 3SQOP 1CQNA 1M9SA 1LW0B 1REVA 4B9TA 3F70A 2R7XA 3C16A 3IQLA 1HFEL 1HNIB 4OLOA 4PG4A 3IBCB 3TA2A 2HL3A 4O0IA 1TG0A 1I94F 3D6HB 1V3SA 1TL3B 2ZBCA 2VOPA 1VQLA 2I38A 3D67A 1G3TA 2NUZA 1Q4RA 2R7OA 3O44A 3M9MB 3HD1A 4A4FA 1H0HB 2DTJA 3MCOA 3CCLA 2DB1A 5L9XA 4MZMA 3W7BA 4MH8A 2RJCA 3Q8QB 4PFZA 2P84A 5CYMA 5GAOl 5FWCA 3CJ2A 1RU2A 2E3IA 4G1PA 5B0GA 4GVBA 1FKOB 3S3MA 1VQPS 3V8KA 3KLHA 4PAAA 2FPHX 2COWA 1SJFA 3SD4A 2D0NA 2LEBA 2R8GA 3W62A 5JVGQ 1EETA 1NE8A 4PJOF 1PC4A 5L1KA 2LP5A 2F8HA 4C92B 1VQKA 1QVGA 1T9VA 2ZPFB 2JN0A 4IR9A 3U27A 3QPHA 3GILA 4DFKA 2R7WA 2OPRB 2CJKA 2RAQA 3H4BA 2VODA 4YB7A 1K0SA 2J7WA 1R7IA 3T1HJ 3B54A 1QWEA 3F56A 3W65A 2ASYA 4LF8J 3LP2B 1Y0HA 2DK2A 3ZNJ1 1Y57A 1JXEA 1FD8A 2I5JB 1QVGR 2DKOB 4V2SA 4O0NA 3D6TB 3M2UB 2B4VA 1OMSA 2AMCB 4DR3J 1LK5A 1KQSS 2LJ0A 3DHXA 3CC4T 1NZ9A 3GV7B 2R3VA 1WNLA 3SWNA 1AZGB 3GBQA 4B08A 1WEYA 5CQGA 3TRGA 2IDLA 1X4FA 4P2FA 3M32A 4N76A 2J9DA 4LN2A 2RF2B 1VHFA 2OFHX 2V6AA 3CMEQ 2FVUA 2JWNA 2K2PA 3CBPA 2LU1A 2B9XA 2DRAA 3GJSB 1X6GA 1MWYA 2C0IA 2LCSA 5F8HA 5E3QA 2W2PP 4PRFA 3GR1A 4B3OB 4OFZA 4MKVA 3CMAQ 2EKOA 3H2VE 2AEFA 2DNMA 2OELA 3UR3C 2JNJA 4QQBA 1IKWA 3LO3A 2V8IA 1KRPA 3I56S 2K2MA 4NCGB 1S77D 1UMJA 4M5JA 3G8QA 5CK9A 4C3MA 1MGQA 3NBPB 2G4BA 2HL5C 1K8AU 3EFOB 1YI2Q 4OI3A 1WHLA 2E5KA 1U7LA 4GMKA 3WC2A 4PJOD 5GAN2 3GP8A 2HFUA 1UW9A 2R9LA 5K5MA 1Z2LA 1SJ1A 4UZCA 4KPYA 4NYPA 3GJQB 2ILYA 1E6HA 2OD6A 5K8PA 1HMVB 4M7DB 5L46A 2MCNA 2EYZA 2K3KA 4DFJA 2CZVC 2FO0A 2Y1RI 1M5OC 1K73C 2LU2A 3WBZA 1RQ0A 5ETVA 2LZ6B 4B9XA 4TU8A 1S1UB 1YZ6A 1S1XB 3IO1A 1UFLA 4RL1A 3VAJA 4P75A 1I81A 1GNKA 2QL9B 2AQ4A 2VQEF 2DETA 1FNOA 2XM3A 1BQXA 3EPGA 2CUYA 4M77A 3I4PA 2AX0A 5A2QU 3VV2B 3CUNA 4OJHA 1CS4A 1KC8R 4DUZJ 2A6MA 1VQKT 4J7CA 2EC0A 2ZH3A 3QWYA 1N36F 1RP5A 5GAEU 4K4SA 3CCWA 2QQSA 4OI0A 2C0TA 1N5TA 5LJ3Y 1VQ8S 1XMOJ 4R56A 4DV2J 2QFJA 1M90U 1JJ4A 2Z8QA 2HMIB 4X66F 1K1SA 2MPXC 1T94A 5A8RA 4WXWA 4C8KA 4C8MA 1T11A 5KG6A 1ZPWX 4DLGA 4QW9A 4DL6A 3BR8A 4DX6A 3MR6A 1D0XA 2ZM6F 3BYPA 1RT2A 1VQPA 5IC4B 2K1RB 1WHGA 5LJ5j 4HLBA 4C8QG 5KFRA 4LDVA 4Q0BB 2AYBA 3SFMA 2BJ8A 1IBLJ 2XSJA 3JSMA 2V67A 4EPCA 2AJ1A 3PMTA 3BKUA 3DCAA 5CCAA 5GMKm 3GV8B 2E1CA 3M6WA 1XBWA 2K06A 4I2QA 1EP4A 1CJTA 1D0YA 1M5VC 4JV5J 2M9UA 1BUXA 2ZJRQ 1OY8A 2WONB 4F50A 4C92E 1HHTP 4AFQC 3MHXA 1ABQA 3CXCP 4DSIA 4Q7AA 5K9FA 3ZO7A 4ZGEB 1KLNA 2RI5A 4OV6A 4OX9F 3JCMX 3FSIA 2HVEA 5AXLA 2DXTA 2HLUA 3CPFA 3LWMA 1AVZC 4E98A 1IR1A 3GJRB 4WCEQ 4P7VA 4HR2A 3I0SB 4DPWA 4OLPA 2RQCA 4IOCQ 2V8HA 4YQWA 3C4SA 3ASKA 2ZHAA 4OYZA 2RQWA 2QYCA 3MD3A 4IDKA 2Y9HA 4O4RA 3EG9A 1E6YA 2J7KA 1U0HA 3QJLA 2QE5A 2X4XA 2HHVA 3DRPB 1KQSR 4GO7X 4IFVB 2JEJA 4YEAA 3VV0A 1S6PB 1YHQQ 5DS7A 5LSLA 2DY9A 1S48A 3PRBA 4BBYA 4DZ6A 2IAJB 3I56A 1NYFA 3ZC4A 2CSQA 1TKDA 1QSSA 5EX0A 1NJIU 3NFCA 1IRXA 5I2MA 2OMLA 1T3NA 3C94A 3LA0A 3FB9A 1I5LA 3JXOA 2E3HA 4QZVB 2LA6A 3IM8A 2KM8B 5AE2A 5GANe 2FVRA 4RWWA 2DNGA 2M3DA 4QYZK 2CPZA 3GIJA 3NCQA 3BB5A 1X9MA 1M3CA 4YS2A 2XMUA 1U2FA 3P8BB 4ELTA 3BSNA 2EG2A 1SL2A 3ZTOA 2P4TA 2PA8D 3V8LA 2GC8A 1NDCA 4QVCA 1FHTA 1X2QA 4LF5F 2OH2A 3V7CA 5FD1A 4M7DE 2P6SA 2PUKB 1MU2A 2YXYA 1JLAB 2MJUA 4Y28C 3HT0A 2IVYA 3NWRA 3VYGA 2BRLA 2JS2A 1SJ3P 2HBQB 4F0KA 1Q8IA 4O3RA 2EQUA 5FJ4A 2DL8A 3A8OB 1FXRA 1JNZB 3EGNA 2H48B 3H5UA 1UECA 2V8PA 3I5SA 1RTJA 4C0DC 6AT1B 2RHUA 3PJWA 4JI5J 4M7AA 3L2VA 1PRMC 5GAN4 1UPMB 3QZ8A 1K8AT 2EGCA 1AHJB 1Y9OA 3MPVA 4R0EA 2NCKL 2VKRA 4QU6A 1VQ8A 1RT5A 3DU6A 5IV4A 4ZPVR 4F4AA 2QXFA 4J9SA 3KYLA 3FKBA 3K5MA 2MQMA 4DUYF 5D0EA 2NQPA 1YK9A 3C15B 3NTKA 1IR0A 3C95A 4K5SA 1WLPB 1TVRA 3BR9A 2KG1A 2W01A 5DZ6A 2XMKA 5F8GA 2KRMA 4NE9C 2KVQG 3OLAA 1LJOA 3T1YF 4XPEA 4K4YA 4AFSC 5JMNA 1UVJA 1AWJA 4HVZA 4ZHRA 3OQ5A 1IHWA 3JSBA 1A0NB 1VQMT 4TY9A 3UVJA 4HVVA 2X4WA 2EKHA 3GIRA 4ZIWA 1C1BB 4AFFA 3LH5A 3ZEHA 3JYTB 1H7XA 3JAMY 1W6XA 3L1AA 1LW2B 4H4KA 1EZZB 3S6WA 3CCEQ 2CZ9A 4C3KA 2HBWA 2BZ2A 5D4LA 1GXUA 2UUBJ 2E7XA 1LWXA 1N5YA 1M90T 3MPDA 1FA0A 3M55A 4XU1A 1AB8A 1EB0A 2JVOA 3V7RA 1UJ4A 2M9KA 2QA2A 4LDUA 4EMKC 4OYPA 4LQ3A 3OYDA 5HATA 4JS5A 3FBFA 3HVTA 3R1LA 3MM6B 2O67A 4FKYA 4TVAB 1X4AA 2JM8A 3K8WA 3IWNC 2OTJT 2K5FA 1ICEB 2NWMA 2QMXA 2N4CA 4C3LA 2R42A 5FLXY 2AF6A 2HZCA 3OB9A 4E0DA 1HA1A 5CYJA 1I6JA 3JB9D 4DR4J 1FX7A 2DNOA 1FRXA 2DMOA 3M8ZA 3EGWB 2OJ2A 1P1LA 4M5DA 2D74B 2YUPA 2Z57B 2JMCA 1VQLQ 3AOAA 3OYYA 1S97A 2E4HA 4K0KJ 3MEDB 2M0GB 2UUCF 3C19A 1CVJA 3CCLQ 1AUSL 3QHSA 4BI4A 1RT4B 2JVRA 2CP5A 3CCVS 1S0NA 3ILJA 1VQ7T 3OW2S 2HHTA 2A2DA 1S72S 1TUWA 4WFAQ 2MMPA 2DNKA 2E9TA 4NA2A 5E3PA 1TFYA 3AT1B 2FHOB 2KJWA 1R8OB 2IG0A 3MR5A 4RNMA 3A8GB 4EYHB 4F7UB 2RSQA 3GFZA 1IJEB 3Q1JA 5A8WA 2FVQA 1ZZNA 1RWVB 3MM9B 1VQKQ 4BE0A 1ABOA 4WCIA 1BE4A 4A8OA 3TEGA 3PGGA 1AZSB 1IVZA 2KY9A 1BXNA 4KSEB 1MW7A 2DHXA 5DQHA 3TVTA 1U25A 3W2VB 1PWTA 4RBTA 1R0BG 5DLFA 1V5VA 2Y1IA 2HWIA 3A3OB 5C24A 3L9ZA 4EMDA 2F3JA 2W2MP 2XZDB 1N8RR 1NJIT 2JC0A 3NG8A 5A2QY 5D6YA 4RTVA 1WQ7A 3QYYA 3R7NB 5HROA 4B6MA 4KT0C 3H25A 2L2PA 3AJ1A 8RUCA 4L3KA 3PIOA 2VD3A 4GKJF 1E7OA 1YJ9S 4D8DA 1DTTB 5M2RA 1OQKA 5CZVA 1RSCA 4QU7A 4U67Q 2YNGA 4ZP7A 1TMMA 3JCMf 3HFOA 2PTKA 3OS5A 2FHKA 3I5AA 4GLKA 3FC3A 3MEKA 3G6ET 2GQVA 3CIZA 3OS0A 1VQ6A 4IUVA 3VF0B 3Q23A 4E2FB 2DXEA 1FWKA 2CUDA 2DBMA 1J5EJ 1JLEA 2YKMA 4LF7J 5IHNA 1I3OB 2W2NP 4CLZA 2WVDA 5J2NA 2LJ1A 3MCAB 2H3EB 1S1WB 2MQOA 3KG4A 2BR0A 3RDVA 1KD1T 2AEMA 4MFBB 1JJ2R 3ZZRA 1X9WA 4WYLA 1XMQF 2P5VA 1PGZA 2BRKA 1B0VA 2VG7B 3Q8PB 3ENWA 5KT3A 2KYMA 1HBOA 1WKLA 2A2CA 4O44B 2HQXA 3DLHA 2QDYB 4Y2MA 2WOMB 1K0XA 2HS4A 3Q8SB 4PJMA 1D8ZA 1CC8A 2RPNA 1WACA 3WC0A 4P2MA 1BQMA 4QIWD 1WC1A 1B70B 2WVCA 2MOXA 2CQBA 4K2JA 4PJOA 3R6LB 3MEAA 2VDHA 5KYYA 2RJZA 2KRNA 3PYDA 4DPXA 3IN5A 3SHWA 3EE3A 4Y2CA 1JQQA 4N47A 1IBKJ 2EG1A 4F02A 1QM9A 1DHMA 3RAQA 2PI4A 1ZYQA 1Q82R 3OYGA 1VQYA 4RW9A 2CJXB 4TU9A 1W26A 2LVWA 4DR6J 5CKHA 1AOJA 3BFMA 3FZ2A 2FJWA 2KFZA 4OB2B 2M4MA 1RU1A 5HVGA 2E6ZA 1T05B 1QLYA 1VIXA 4PG7A 5LJ5f 4HT9A 3TVKA 3H5SA 2B8PA 1N4LA 4HHUA 5F8JA 4C0BA 4LR9A 1FD2A 2HHHF 4UOCA 1YJWS 1VC5A 4TLQA 4M75B 5J1EA 4HEA9 2L5QA 3TQ7P 4FF3A 3QT5A 5A0DA 5KFEA 1W25A 3J7YI 4XTVA 3K5LA 2AHOB 3CCVA 3OW2A 4A4JA 3V81B 1YITS 2YY3A 3N4WA 3A8EA 5L8RE 4JRPA 2G2ZA 4M77B 3FRNA 1VQPQ 1M1KC 2XI2A 3QG1A 2NUTA 5EX3A 3R6NA 4DOWA 3CXCS 4XTZA 3LWIA 5BR8J 2ROTA 1TUGB 2ESWA 4NOHA 5T41A 2BACA 3OV7A 4ZN3A 4JV1A 2OGUA 4WFZA 3K8VA 4UQGA 2Y3YA 1HI8A 3H5YA 1FESA 4CO1A 4NCBA 2LEPA 4F7UE 2QYGA 1UL3A 4ANEA 5KYWA 3OYHA 4I56A 4FVCA 2CP3A 1VQ6T 3AXMA 3S6EA 1FK9A 3T6BA 5KFVA 2MZJA 4AQYJ 3V4MA 2CP2A 3KJVB 1HJDA 3UCGA 1DAXA 4CCHA 5C42A 3PX4A 2OX7A 3W61A 2ACMA 2MYFA 2ZGWA 3P8DA 3E01A 2RS2A 3BZQA 2A3JA 2DITA 2HLTA 4I2QB 5CA5A 1YJ9A 4K59A 1CJTB 1S6OA 5IT9Y 4FYDA 4JYAJ 2EYXA 1VISA 1QD1A 4AXIA 4PPDA 2ATLA 4OHYA 2V2ZA 1VQMQ 2DR5A 1PNJA 4NL2A 1TFWA 2VG5A 2QEXT 2SXLA 4TLRA 1SRMA 3RAMA 4KRTA 3DOMA 2WHOA 1K9AA 2PVDB 2YKQA 1X6BA 3PO5A 1GMVA 3CCRA 4PFOA 1WHVA 2LX9A 3EG1A 2MLYA 4U96A 2DEJA 2KT5A 2CPEA 3I56Q 1AUDA 3GPLA 2DGVA 5I4MA 4KFBB 5FWBA 2LFVA 4IDKB 1DBDA 5CAAA 4NLTA 1Z2ZA 4RG8A 5T7LA 2UUAJ 4NLYA 3VZHA 4YOEA 1QVPA 2H8HA 2GVDB 3JCMV 1R8CA 1U0HB 3HX9A 4LVOP 4KKOA 5KTQA 1VQ4T 2KM8C 1Q78A 2CPHA 1RCOB 3MFHA 4KC5A 1LXNA 1DTQB 3GLJA 1WKJA 5D0RA 3VZIA 4LUBA 1QTMA 2PC6A 2NUPB 3EPIA 4FNHA 2HGLA 1X4EA 4LFAF 3JCMQ 1WEXA 1DZ5A 1G5VA 4I69A 2B8QA 4MZTA 3CCUT 2DKGA 1B0PA 1D0EA 4LRDA 2HG4A 1WYXA 3P3DA 4LE9A 2NXJA 4ZVSB 2EFOA 1OY9A 1RHKB 5HI7A 4BWJA 3TW0A 3VKIA 4UQTA 1Y5NB 3O5TB 1RAAB 1AW0A 1A6LA 2YQ3A 4M78B 4E47A 2ZH2A 2KQWA 2NYIA 2FHDA 2NYSA 3K0JA 3J80E 2MLZA 1S1TA 3AHUA 1S4EA 1YVFA 1DJ0A 1SIZA 1HHQA 4WFNQ 4ECRA 3W60A 2XGPA 1NHKL 3UATA 2KK4A 1KK7A 3PY8A 4OV1A 2DISA 1VQ8Q 2PUOB 1T9TA 1OQ3A 1JJCB 3HHTB 2OSQA 2AV5A 3TNVA 3VAKA 2OMOA 3M8YA 3T19A 3T5LA 1M2VA 4Z8AA 4F16A 2HBPA 4YR0A 2MQNA 3D1QA 4D8KA 1U6BA 4M75E 1Y11A 2YWKA 3QXEB 5HMYA 2V9WA 1SJ4P 3SDEB 4QIVA 2ZD1B 3QPIA 3CXCA 2BQUA 3QWPA 5HMZA 3SFGA 4RJVA 4QIFA 1KHCA 2C2NA 1YJ9T 4NLRA 1RAFB 3M0TA 2FC8A 4WTOB 3GR0A 2MB0B 1F9FA 3DKMA 2OTLT 2WSFE 1R27B 3AHPA 4J9NA 3NEKA 3OYBA 4J6WA 1T9XA 5JXSA 3IAS9 1W70A 3RZAA 2BJDA 2KTQA 3HHNB 1M5SA 2PNIA 2BX6A 1OV3A 1PG5B 2ZE2A 1KKHA 5D0GA 3FVYA 2M52A 1TVRB 1PO6A 1NRKA 2CPIA 2J7IA 3CCQS 1LWFA 3CCRT 3BSCA 1VQ5T 4UOHA 2KBTA 4KHPJ 5KG2A 4GKKJ 3TA1A 4OMNA 1LFWA 2MKHA 2XS7A 2Z58B 1NAQA 1UDLA 1V1CA 2PVGB 1C0TB 3Q22A 5GAMg 3NWGA 2IBKA 4WF9Q 4X4PA 1S59A 4PXDA 2P0QA 3UT1A 2V5HG 3W5YA 1DLOA 4LSNB 1YNZA 1BKBA 2GJ2A 3W64A 1JLGB 1RWKB 4DS4A 3DLBA 2M1HA 1YCYA 3ZZOA 2CH4A 5GADI 1JLBA 4FXVA 3IG1B 4P2SA 3VGTA 2B7BB 4NXNJ 1GCPA 4L75A 3X20B 3OYCA 1FVSA 1OYXA 4RR5A 4XTXA 4C92F 4UY85 1QAJA 2HZAA 3PNWC 2H4WB 3CT9A 4OYAA 7FDRA 4FPRA 2K9GA 5EWGA 4JRKA 1I51B 3CCMT 4FBTA 2X1FA 4FW1A 2EVRA 1K1ZA 3RNJA 4H4MB 2EK1A 4ZVEA 1VBYA 2AJ0A 4ED1A 1HQUB 4LF6F 3BDEA 4WF2A 5L23A 1IXDA 4B9UA 2L8DA 1G2EA 1F2HA 4USWA 4ILLA 4ELZC 1TP7A 5EWEA 2GBQA 1IWAA 1N9SA 4CC2A 2XQCA 1VQ9S 4DBFA 1FEHA 4DV3J 2FGCA 4N4IA 3DLLA 1JRIA 1FNXH 5GAMd 4MAKA 5CVIA 1AZEA 5DQIA 3H2LA 5I3UB 2ZPHB 4DL3A 1KQ2A 2QQRA 3ULRB 2PFFB 1K44A 2XK0A 5CXTA 1AT1B 3BGFA 1UZHA 2O3DA 1XR6A 2F5TX 2CPYA 4X4SA 4PYDA 2RN8A 2KFNA 1NJWA 2DM1A 3KLIB 2CP6A 2KO1A 3EG0A 4RMOA 3OL9A 1X27A 4FW2A 2YWFA 1IHVA 3BM7A 1I94J 1AFJA 2GMJA 1I5OB 1S12A 4DV5J 5KG5A 2FB0A 4USIA 1W2IA 2HFZA 1X4BA 2PQWA 1YFNA 4M78E 2WBMA 2MSTA 4CLPA 3F44A 2Y0SD 4ZPDA 3G82A 3S3OA 1PD0A 4C92D 2KU7A 1M3AA 4Q5WA 3G2XA 3T1HF 2XY7A 1QCFA 1K8AR 1KVJA 4M5LA 1U1SA 3ZZ0A 3PIOQ 3LUYA 3R5AA 3W9JA 2JC1A 1L3KA 4HT5A 3A5ZB 2ROGA 1MV0B 1R0AA 1PIEA 4OHVA 4M7DF 1WDTA 3NGPA 1OZ3A 2CNKB 1B0TA 4DR3F 1TKTB 3CDBA 2G2OA 5C24B 1QAIA 4C8QB 1JLQB 1OO0B 2GNKA 2HHUA 1ELOA 2FPEA 1GAOA 3CB4A 1VQ6Q 1K73U 3OBIA 3HI9A 3LF0A 3X24B 3R97A 1WJQA 2EBGA 1OOTA 2AGQA 2CVEA 3M8PA 5HROB 3SWNC 4PK4A 4I7FA 4I2PA 3PT9A 1APSA 1M5Q1 2LMJA 2LXUA 4X9DA 3EGDA 1L3VA 2VL1A 4ZPWR 1Q86C 2P6TA 5K8OA 3UCZP 2YNGB 1UVNA 4NMLA 4XDCA 2KXFA 3CCQA 4IUQA 2BKOA 4B3MF 1P8GA 3G4ST 2XCPA 5J2PA 4RW7B 1U47A 4WFYA 2X3WD 4YHHJ 2DXBA 3R2DJ 3MMAA 2IRXA 4USHA 1ZAVA 2QEXQ 1JLEB 2XU8A 2VH7A 3X3UA 3HJVA 1G1XA 2FZKB 2VPXB 5J2NB 4DL0C 3UQSA 3KHLA 2SRCA 4R5PB 1M90R 2VKZG 2MKYA 1NHUA 1YJVA 4L6V3 3EG3A 2EWNA 4KUDK 3HHLB 1UJ5A 4ANCA 2QTXA 1V76A 3DNCA 3FFIA 1JB0C 2O4XB 3M0QA 3CC7A 3VU3C 4NZ0A 1NLOC 4RUHA 4ANJA 1WI7A 4ECZA 4HXJA 4F0HA 1X5SA 4HACB 4Y34A 4MMOA 4YUDA 4V19X 1BQMB 1VQ4Q 1SSHA 4Y0FA 1SC6A 4DEYA 4CH0S 2BKNA 3QATA 5HK4A 4M7DD 2JEGA 2BDPA 2COLA 1SH0A 5GAMh 1KC8C 4Q45A 4M75C 2DNYA 2RU9A 1N88A 2V1RA 1YRUA 1HBMA 2QGFB 3SBMA 3CULA 1RT7A 1CJUB 4BCAA 1RAOA 3PYGA 2B6AB 4TY8B 1Q5VA 2AU0A 2V94A 4OYMA 4Z88A 2GVZA 3KJNB 3CCVQ 4M77C 3FC9A 3HFVA 3D28A 5A8KA 3RERA 3LGLA 4EGLA 4DUZF 2N4DA 4J9LA 3TI0A 4WBFA 3NMAA 2CNNB 3JB9I 2W2QP 2DIQA 4Q5VA 1T9UA 3QGHA 4TYAA 3SZ2A 1G7CB 3J81E 5DDOC 1S1NA 3I35A 2PD1A 2LQNA 1YIJS 4DV2F 2DHAA 4CZCA 3OD2A 2Y4XA 2BJEA 4NXMF 1Y5LB 3PEJA 5IFMA 1YN8A 2JJ9A 2VFTA 3K59A 3M4GA 1TMJA 1BIAA 3GG1A 3QGIA 2H3JA 4MIBA 3GNFB 1KOOA 3CJ0A 4B9WA 4X4TA 1LFPA 4JOUA 5BJRA 2CWKA 3ME9A 3JV3A 1RTIB 3W8PA 4URGA 2V26A 5CKEA 1IBLF 2UP1A 4U8VA 3M6UA 4E7HA 3B4DA 3N6MA 4A8YA 4J9DA 2HIYA 5GVQA 1VBKA 1QCOA 2RQTA 4A54A 3LP1B 1MMNA 4QKUA 4JV5F 2RB7A 4LSZB 1IBMF 3GLXA 2JJ4D 2Z2MA 2DO4A 1TS9A 1MWZA 1SBRA 1G3SA 4DBQA 5A0GA 2JEFA 1YJ9Q 1KP6A 3LP0B 4I0WA 2X1GA 4YY3J 4ZP8A 2C3YA 2V4JA 3LPYA 3C6UB 5KYWB 2ZZTA 1AWXA 5U47A 3ETMA 1B34A 4LFCF 2FJVA 1G3OA 1K0TA 3KTQA 3FGVA 4CM2A 1GBRA 2RHXA 5E0OA 4D3HA 5C42B 4ZITA 1UGVA 4DI6A 3P5BP 5E3AA 1UP1A 5FRMA 2RE1A 4FPIA 3QGGA 4IOBA 2PO4A 3CCRQ 2DVEA 5IC6B 4C8ZA 4VUBA 3QWUA 3E01B 2NPIA 2JUFA 4C8QE 3OFGA 2WVBA 3KLFB 1NSAA 3C14B 3ENQA 3BO3A 3SI8A 1Y7PA 3T1AA 2CZ7B 3CC7T 4WYWA 2EIFA 3HSZA 3BQ0A 3R5BA 4LIWA 2VASA 1Y5IB 3DOMB 3Q86A 3VS3A 4JV2A 4Z02A 4ED6A 3QGPA 2J0WA 2D69A 3LYIA 4K7QA 3CJ3A 3VAMA 1RABB 1QE1A 4O5VA 2SEMA 4L76A 4CYUA 1X5OA 1GMWD 3WQPA 1U1QA 3FCHA 3N01A 4X4RA 5THWA 4NRUA 2KR3A 3MR3A 1FXLA 2ZOFA 1BC6A 2ATCB 3CF5Q 1TKZB 3BGRB 4BUGA 1K73T 4QWAA 1DJ7B 2GA7A 2CVIA 4Q8FA 1UAWA 2E64A 1IJFB 1VIOA 3GF5A 2MY8A 4J9VA 4LFBF 2M7SA 4HTIA 2AGPA 5A0YB 4PLLA 3BO2A 4IG3A 3W66A 4ZVOB 2CQPA 3JSRA 1KSWA 4CRJA 4GLMA 4J37A 3PX6A 1P92A 2RNEA 3VRYA 4ICLB 5J2QB 2MIOA 3CC2S 2WSCC 4QQ6A 1HXDA 4AE5A 2YNFB 4CLTA 3PJ9A 3BW1A 1BGXT 4CNZA 1NB7A 1S0VA 1UZDA 2IVMA 2R7UA 5KG0A 1XNQF 2W0ZA 2C1EB 1ZA1B 1NPRA 1UKUA 4FYWB 1S6QB 4JI5F 2DO0A 1PSEA 3S3NA 2W8LA 4M7AC 4WPAA 3JCMh 1WG1A 3ITHA 3OBWA 1S1TB 1FERA 3GQCA 1RBLA 3QZ7A 3FCVA 1ULRA 1LV5A 2IC3A 5IM0A 2EPDA 1K4US 3KMQA 1YIJA 2B86A 1UWBB 4MTPA 3T5HA 5IS2A 2HKNA 2ED0A 1SXLA 2W9BA 4J9GA 1NNDA 5D4PA 2V9KA 2VQFJ 2PGCA 2HK3A 1Y0MA 1HW9A 2VG6B 4CDIA 3EICA 1RDRA 1F9EB 2ZH5A 5HP1B 1RZMA 5HVFA 1M4ZA 3KUGA 2CWXA 1PRLC 4LT6A 4DJBA 2HNIA 2A18A 3FSYA 2F1FA 3HHKA 1T03B 2MDAA 4P2XA 3JB9J 1VYTA 5DG9A 3D7SB 1KQKA 3GSDA 4LUEA 1KFZA 1DFDA 4Z37A 1KN6A 3VVTA 2DHSA 2HNZB 2XBPA 3V6DA 1VCTA 5D3GA 4XTWA 3IBFB 3ZTSA 4F25A 3M2RA 3HRTA 1WHMA 4NA1A 3DDNA 1T8EA 3MAQA 2UUBF 1KWMA 3QRQA 2IIHA 1LNQA 2X3GA 5KFJA 2QGGA 4F7UF 1QAYA 1RYRA 2UU9J 2E41A 2GFFA 3SQGA 2AHJB 4JI3J 3ELHA 4XTTA 3IR5B 1VJQA 2APOA 5B7WA 3RUBL 2J9CA 4B9MA 3GZ7A 2R8HA 2HHSA 1I1GA 1D3BA 3RB0A 3QRPA 2DPPB 3QIPA 4ZVTB 2YLCA 3H9NA 5LJ5h 4N4HA 2KVQE 2EGAA 2C22A 2E5IA 3OXFA 3MUVP 2YWWA 3LANA 2QLFB 3BDLA 1HBUA 2B4OA 2MF2A 2EBPA 2RHQB 4RNFA 2ZZNA 1JLBB 1YQHA 1QAXA 3I4HX 4RUBA 3NAIA 2PEBA 3A13A 2DRBA 1M27C 5KFNA 3NXZA 3K5NA 3UDLA 3H8YA 2ZWOA 2LC4A 1WDXA 3DRSA 2HBRB 2MK5A 4HI2A 3DLLQ 2AJ4A 2OAUA 4Y6IA 3PEHA 1SV5A 2BQRA 5KH6A 2CQ1A 3BPSP 3Q24A 1HNIA 2QRRA 2VVKA 3KK2B 4OZ2A 4O4GB 4TXSA 1T95A 4URQU 1M8VA 1TL3A 3E19A 3AODA 3DDKA 2Z0GA 4CQ1A 2CP7A 1RT3B 3NS7B 4NMXA 3ZZPA 4PJNA 5J1NA 4PUOB 5F0WA 5LJ3g 3PHTA 2UUCJ 5L1LA 3CC2A 3JS9A 3DLKB 3GWCA 2FY1A 2F2VA 4OMQA 5AXKA 1GK8A 2EQKA 1N8RC 1P9YA 1FRHA 1FKOA 3G71S 1MSWD 4FL6A 4DV1J 2HDAA 3Q0AA 1U1TA 1B7FA 2GF7A 3HSJA 2E6NA 4PWUA 1GEHA 3VS0A 1U1MA 1EQMA 2DR9A 4ZJQA 1NK6A 1MN7A 3CDAA 1WHKA 1QVFP 3TJAA 4C92A 3M53A 1RTDB 2HVZA 2X1BA 4DQRA 4KIAA 3B6BA 4DN9A 2O9VA 2OPRA 3QO3A 1M5HA 3PIPA 5G0RB 3ZZZA 4ELYC 2LDMA 3NGTA 4YB6A 1SHGA 3P4UB 5HANA 3MEGA 1VR6A 1S1VB 5CKDA 2YNHB 4E7IA 4OZ1A 2ZH8A 1SJRA 2AYMA 2I5JA 1FE4A 3GIKA 2DE0X 1TH7A 4ATNA 3RIRA 3M2UA 4RX6A 5JVHQ 1RHJB 3MMBB 3H6ZA 4JLIA 1B4SA 2E1RA 3FMWA 5KFMA 2FZGB 4EMGA 4ED0A 4OMOA 1VC6A 3H42A 3AD8C 3CCQQ 4NYZA 1WFWA 1J5EF 4CTAB 3OSVA 4NLGA 3S7RA 1N9RA 3H0HA 2GFUA 5KYUB 2W7OA 5LJ3d 2FPDA 3M0SA 4X9CA 3MI7X 5KFWA 3ISND 2CNLB 3FQLA 2RF2A 2F40A 2JLGA 3RW7A 2LJ3A 1U8SA 1KJWA 4HA8A 2QA4S 3FSXA 1XWLA 3TZXA 2ZVIA 1JWWA 1X4CA 3FBEA 4C5IA 3PG9A 2RDIA 4B3OA 4RTWA 1M1KU 4FXDA 1FF2A 5LXYA 3CC7Q 4NCGA 2C28A 3AA8A 1FMKA 1OZ2A 2L3MA 2F63A 1Q82C 4PJOC 4KO0B 1ZETA 3NBPA 2BKDN 3TUZC 2BE2B 3MUTP 3IWLA 1XTZA 1VI7A 5D4OA 2RQKA 4ECWA 1FMWA 1SKSA 1G83A 3WDOA 5DY9A 3THVA 4OJ3A 1IBKF 2Y8WA 5GJWB 3EVMA 2FLNA 1U6FA 2UV8A 5IXBA 3QAEA 2D1XA 4ITSA 1O5JA 1DURA 3DKDA 1RXOB 4NLPA 3TYTA 3UFCX 4E7JA 2EFPA 1HMVA 4M7DA 2HFOA 4MK7A 3H2UB 4DR6F 4H4OB 2ZKTA 3FFIB 5E33A 4JZ4A 3CJSA 2IYGA 4A63B 2W25A 4ZJLA 1H98A 1F2GA 2VWFA 4LBPA 4J9PA 2Q6CA 1HR0J 5A76A 1S1UA 1S1XA 2ZJQQ 3CJRA 2XD0A 4N0AC 1FNMA 4KHMA 4DMZA 1PYTA 3KBGA 3NGKA 4LMZA 3TAQA 3A12A 4IKFA 3QT7A 1QWFA 4ZCKA 2HS3A 3T3FA 4WIQA 4P74A 3IBWA 1WI6A 1RT7B 2QLJB 3GFHA 1VJWA 4F7VA 1PKUA 2LVMA 2J6KA 3GJTB 1EAYC 4BY6B 4EO6A 3LOUA 4RNHA 5BR8F 4NLQA 2HHHJ 2HMIA 1TKXB 4CO4A 4DL4A 2WB1D 1BI1A 1GFWB 3SXLA 2GMHA 3R7SB 2D3UA 7FD1A 2EKNA 4RWXA 3RRKA 2E9RX 1H38A 2BOAA 4K4VA 4WK3A 1NUEA 1F5CA 5KCOA 3RYLA 1V9OA 1CJVA 1CKAA 3CCSA 3KDOA 2LX7A 2K1RA 4MKBA 2J6UA 4DSEA 3BBBA 2CGHA 1KR4A 1Q79A 1JXOA 4Q0BA 4KQZA 1IUJA 1BWVA 1IGUA 4RKUE 1GXIE 1KLMB 2HFVA 4AT1B 5C5JA 2HKEA 2KHCA 2W10A 1R6YA 4DS5A 4HCZA 4AG1C 2CQ2A 3RMQA 2BW7A 3ONQA 2EW9A 5CZXA 2W7AA 1S7IA 2CT4A 4UOGA 2WONA 5GAN7 2CAJA 1OIAA 3BSOA 4B02A 4WU2A 4DEZA 1NO8A 4JYAF 3LAKA 3PW0A 3V6JA 2F9JA 4M78F 3UD4P 2GX8A 2WVFA 2ZC3A 2VC8A 3LALA 3CMQA 4F14A 2O88A 3I0SA 2A7YA 1UGSB 2MLXA 1WC6A 1AWOA 1GH8A 3GIMA 3WVDB 3OA6A 2MI6A 1U8RA 4DLEA 3CMET 4F8RA 2XNRA 4N4GA 1YTYA 3L7UA 1MMAA 3MPYA 3I31A 3Q2TC 2L89A 3DRPA 5FU6B 3ZNUA 1FDDA 3LGMA 1KOHA 4F67A 3UNYA 4O3NA 2UUAF 4IFVA 3OSSC 3CMAT 5DLGA 3QO9B 2B9YA 1U48A 2JW4A 5A2QE 1RAJA 2WCXA 1S6PA 4DL5A 1WTBA 3CSKA 3V7SA 3J7A1 3GNGA 2KDOA 3FJ5A 1GMWA 2HKQB 5C2GA 2IAJA 1YI2T 1YRTA 5IT4A 2XO7A 2FEIA 3TX0A 2UZAA 4XIUA 3U23A 2J06A 1SC3B 3UN5A 3K7RA 2VXEA 4PWDB 2GIFA 4DQQA 2AGOA 2DNQA 4JUZA 2EFGA 2KT1A 1HWLA 2GQCA 4M8LA 1F3VA 2YRVA 1WHWA 3UW1A 1RLCL 1JLFB 3MGJA 3HRUA 1HWJA 1GXLA 3E9FA 3QKJA 4URSA 3HFKA 1M0SA 5CCMA 1T02A 4FIBA 1F0XA 2DO3A 3C2PA 4KH1B 4M78D 2E44A 2K2VA 1HPZB 4LFAJ 3JQKA 1MROB 1N33J 2HRTA 4YB5A 3CCJS 4IQMA 3CCST 4B3TJ 1RHQB 2DTIA 1YIJQ 1M1KT 1VYUA 3IFEA 3OSPA 4BE2A 2EPIA 4ZCIA 2GIRA 2EK6A 1U2CA 5GAMe 2FD2A 3OJSA 2CQGA 5GAOm 4QPTA 1NSPA 1ACMB 2MZTA 4EI2A 3PCOB 4J9BA