3UDCA

Crystal structure of a membrane protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDDLIEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPQMDVNFKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel, C-terminal pepti
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
total genus 79
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3udcA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3udcA03
1VQSA 2RK2A 1P8GA 2FTRA 4Q2MA 5B0DA 2VV5A 2BUNA 2IYGA 2IFXA 3HHLA 2GGPB 3HF5A 5IXUA 1VQYA 3QGPA 4U9RA 4OJHA 2ZDPA 2KKHA 1GXTA 4A4JA 3KG0A 2HQIA 2L3MA 2GQVA 2BYCA 1S6OA 1Q4RA 2K1RB 1X0PA 2PGCA 1RJJA 1Y9OA 2AW0A 2KT3A 3DCAA 4OJ3A 3CJKB 5A6PA 1W2IA 2IYIA 2BJEA 2HFOA 1OQ3A 2XMJA 1TR0A 3I9ZA 4ZOSA 3HDSA 2HFNA 4NL5A 3FGVA 1IUJA 1TZ0A 2XMVA 3FMBA 1X8DA 2N4CA 2BBEA 1Q8BA 2RILA 4A47A 4A48A 3F44A 3BN7A 2W4CA 2XMKA 3T9NA 2RK1A 3KNGA 3BF4A 4OJGA 2LQ9A 2GA7A 4QOTA 1AW0A 2GCFA 1Q8LA 1SQEA 1TUVA 5B0AA 1AFIA 2K2PA 4DL0C 3FRYA 4EFAC 4F67A 1OPZA 1FESA 5T7LA 1YRXA 2PD1A 4HL9A 1FVQA 1YJRA 3HFKA 4OJ1A 1OQ6A 2OD6A 2FIUA 2GO8A 1V3ZA 1YJUA 2ROGA 4FNIA 1KVIA 5B08A 2W4DA 3E8OA 3BGUA 1FVSA 3LGMA 5B09A 2ZDOA 2OP5A 2KYZA 1GXUA 2HIQA 3GZ7A 3HHLB 4DPOA 1LQ9A 2FHMA 1R6YA 2HLUA 3LGNA 2OAUA 1AFJA 1Y0HA 1S6UA 2EW9A 2K7KA 4HI2A 1X7VA 2LXFA 1ULRA 1MWZA 1YG0A 3SFMA 1Y3JA 2GFFA 2K1RA 4HH1A 2OFHX 2QLXA 2ACYA 5F0WA 2RSQA 5A6WA 1Q53A 2OD4A 3QMQA 3KKFA 5B0EA 2AJ0A 2AJ1A 4Y2KA 3MZIA 1JWWA 2ROEA 2OFGX 1FE4A 4Q2LA 5B0GA 3UDCA 4FNHA 5B0BA 3HHLD 2QLWA 1N5QA 2RU9A 3BDEA 2LQBA 2XMTA 5K9FA 3TRGA 2FB0A 2ROPA 3HX9A 2RMLA 1K0VA 2OMOA 1U7LA 3BB5A 4HH0A 3HHLC 5B0CA 4HI1A 2VH7A 2GGPA 2LDIA 5F0UA 2JDJA 2RH2A 2BJDA 2N7YA 4A46A 3VTIA 4ZA1A 4NPOA 2GV1A 1WD6A 1CPZA 4DN9A 1SB6A 3BR8A 2P4TA 3CJKA 1YJVA 1Y3KA 3DXSX 4OIXA 3MCSA 5KAKA 2OKQA 3IWLA 1TL5A 2HLTA 1QUPA 4YDXA 1TL4A 1VIEA 3KG1A 1SI9A 4Y2MA 2G9OA 5B0FA 4YEAA 3K7RA 1VIFA 1N5TA 3IWXA 2AP6A 2XMWA 4Y2IA 3LO3A 1FEEA 1APSA 1N5VA 1KVJA 1KQKA 2QYCA 1JK9B 1N5SA 1URRA 3WDOA 1MWYA 1XBWA 2CRLA 2KT2A 2N4DA 3TNVA 2W4PA 2Q3PA 2QIFA 3BM7A 5T7LB 3TOQA 1YJTA 1CC8A 1OSDA 1FD8A 2ASYA 1FE0A 2XMUA 1CC7A 2XMMA 1P6TA 2K7JA
chains in the Genus database with same CATH superfamily
3JTPA 4NLGA 4PJOG 1LOUA 3UVJB 2A36A 2MZSA 2YNGA 2RHSB 3OPKA 4A4JA 2RF0A 1EQMA 2XO6A 1UA1A 2E3IA 4UZCA 2OGUA 3FEXB 2JWNA 3UO0A 2M52A 2KK4A 3FZ2A 5KG1A 4ELZC 4LF1A 1YTYA 3N01A 3TVZA 1TS9A 2VONA 1MLAA 1NKEA 1KJWA 3VU3C 3TX0A 3MCOA 5K8PA 1SUQB 5GMKm 5CO7A 5C25B 1VQ5T 5GAOq 2K7KA 5KT5A 1RTHA 3VGSA 4DUZF 5DZ7A 4XAKA 3GIJA 5J2MB 3LTOA 5IQQA 4A8QA 2DETA 3J7YU 5LJ3f 2HGLA 3L2ZA 1PBAA 4LSNA 3CMEA 2B4UA 4Z7CA 3CCMA 3EH2A 4RW7B 3M4YA 4MZMA 1MNEA 3JSRA 2CZVC 4NPOA 3GYGA 3M8QB 3T3FA 2MKSA 4FYDA 5GAEI 4H4KA 2NWMA 2DL3A 2V8JA 1S99A 4USHA 1RWXB 3BBCA 1NLOC 1U0HA 2BZ2A 2CKWA 1Q81T 4M5LA 3DB4A 1J5OB 2YNIB 1UCNA 4X4QA 1NDPA 3QQCD 5LXRA 3BBBA 1JJCB 1GTHA 2E1RA 3PEHA 4UUWA 2GQVA 4DX6A 1DURA 3OFEA 1UVMA 1FMVA 4G6VB 3IR5B 2J9CA 3V4MA 2GVDB 4WP9A 4QT7A 4DL5A 3VKIA 4PWUA 2X7IA 3DOLA 2PFDA 4BY6C 1OIAA 4IQXA 4CLSA 1DJ0A 4IRKA 4DV4J 4QR0A 2L9NA 4ZPBA 6AT1B 3CCJA 2FJDB 3CXCP 3KK1B 2W25A 5CYMB 4DV0J 4OLPA 2E29A 2DZCA 3GIMA 2QRRA 4FS2A 3G71T 3OUYA 2AMCB 2X51A 1FDBA 1PAEX 2ZOGA 3TA2A 2QQRA 3VS4A 2KT5A 3M2RB 1YI2Q 3M8PB 3KJVA 1LWXA 5GANj 5ETMA 5D0RA 3OYIA 1RTZA 2XZDB 3I5SA 1KD1R 2UUCF 1D1UA 3OQ2A 2CQ2A 2CNNB 4DS5A 3CJ4A 3VZHA 1UJ5A 3DRXA 4NLWA 1VC6A 2ZPBB 1JU5C 2GIFA 2AV5A 4JI3J 1WLPB 1XNQJ 1TL1A 2FJEB 5GAN8 1GXIE 2AGQA 4JP8A 1OU8A 2XICA 3SQGA 2OELA 1NK6A 3SZ2A 2ZH6A 1RTJB 3GJTB 3UWNA 1PSDA 5F3ZA 1SL0A 1KR4A 1YSJA 1Q7YC 3DMJA 3C14B 1Q86R 1RT6A 3I6PA 5LJ3e 1N36F 1ZBXA 1U06A 3CMES 3ZTQA 1ZBTA 3ISNC 3CCMS 4WE1B 4DL6A 3Q2SC 1N6QA 2OJ2A 2GHVC 4JI4F 2EYWA 3UWTA 4UOGA 4F7UA 2LX9A 5K8NA 1QKXA 3D3BJ 4ZLPA 1YITT 4N4HA 3TJAA 4Y0FA 1OY6A 2JM9A 3S1TA 4PRFA 3P45B 4EMHA 1ZPWX 1LXNA 2V8PA 2LXFA 1YJWS 1E6YB 4DXLA 2MKJA 2K3XA 2HNDB 1KQSA 1SIZA 1D1AA 4F3OA 4ZNXA 2RUGA 4F50A 1N8RU 3QSUA 2BUDA 1RWKB 3CCLA 3MD3A 2CPIA 1NSAA 2LJ0A 1NK4A 4LBHA 5HBMB 4DN0A 3CCST 2RHYA 3CPFA 3VS3A 3AAWB 5HMZA 3GG0A 1HLWA 2E1AA 2KAFA 3ETMA 1N5TA 4EPCA 4D3HA 3OS0A 4RW4A 2R7XA 4CTAA 1X5TA 5SZTA 1GL5A 3GPAA 4IRDA 1KLMA 4J90A 1FJGJ 1TUDA 2IA6A 2MJUA 3JSMA 2MSTA 3I5RA 2AHOB 4KHMA 4DLGA 2B9YA 1CJTA 3M2VB 1IKYA 5DGAA 5E7OB 4M78B 3CJKB 3S01A 1NPKA 1UW4A 4ZHRA 3OMGA 4ANJA 4HVUA 4F0MA 2J06A 1U1NA 1ZM9A 1BQNA 1Q81R 1VUBA 3A8JA 2M9UA 4N0AA 1VQKQ 3F41A 4DSKA 1CEZA 2MYFA 2GX8A 2Z4PA 4X9DA 2WB1D 1K8AC 1V3ZA 3PG9A 1NJZA 2BZXA 4DR1J 4U95A 4RWWA 2HHSA 2NQPA 5KG4A 1TU0B 2VQEJ 5FDLB 2NXCA 1TKXB 4Y34A 4OQJA 1KC8R 1TKZA 3NOGA 2QV6A 4M7AB 3HKZD 3CQTA 1FRJA 2KI7A 1U1QA 4LRAA 4BCAA 1UKUA 1RGVA 1TK8A 2MKKA 4ES2A 1KBRA 5HJYA 3M30B 4FXVA 4OIXA 1Y96A 4C8OA 1HHTP 3W64A 2A08A 1YJ7A 2EIFA 2DL7A 4C5HA 7FDRA 2DPJA 1QP2A 2CGHA 2VASA 4KFBB 3E1SA 5A0GA 3UD3P 3LWIA 3HVWA 6FDRA 2V26A 3IXQA 2CZ6B 3EHQA 2Y1RI 4NLOA 1RABB 1KQSS 1ZA1B 5DDQC 4KB7A 4I6AA 3RDVA 3DGVA 4I2PB 4LF6J 2YNHB 3QYGB 3IBCB 5GAN2 3H7HB 2IVWA 1HMVA 2JLEA 2Z2LA 4CH1A 3CCLS 2E5IA 3TEHB 4RCBA 2KJWA 2C3YA 5GAMg 3P6YC 1OYEA 2B6AB 4ZPCA 3HCXA 1YFNA 2XB2D 4WCIA 2FRWA 1NPRA 4KAIA 3DYAA 2QLBB 1VIOA 4J6YA 5GAN4 1RE1B 4YY3J 2GCXA 5HK0A 2HG4A 5HATA 4OHVA 1FRLA 3ZO7A 3NAHA 4K2JA 2GIRA 2GS8A 1MUZA 3OL8A 2RD5C 2EFPA 2JVOA 4X1VA 2V8VA 1N5YA 2BKNA 3GIBA 1BWVA 2A6OA 4E7HA 3W2WA 2VFUA 5IHIA 2AF6A 2LVWA 3HL8A 5KT4A 5GAMd 3FRZA 2FPHX 3GONA 3JSCA 1BIAA 3HT0A 5J2NB 4AQYJ 1XK8A 1QVGR 3VRYA 2ABLA 4K8RA 1WHHA 4KPYA 1FEEA 2R7RA 1HHSA 3Q8QB 3MURP 3TVTA 1PKTA 1I3OB 2ZH5A 2W7OA 1OMSA 4JI7F 3G6EQ 4CLZA 2BUNA 4P75A 4DX8H 2O01C 5GAHI 2H3EB 1V5VA 3VZIA 2OTLT 2YKNB 2PU9B 5LJ3h 4PWDA 3GMGA 3JS9A 4C5GA 4ZOSA 2HRUA 2VFVA 3V5RA 4NL5A 5BR8F 3ET6B 1JLQA 2QG9B 3E51A 2V50A 1NEEA 4DV2J 4PQAA 5I11A 1IZ6A 1TUVA 3OJUA 3CCQA 1WEXA 4F4WA 2BW7A 2CPDA 3VRZA 1IM6A 3CT9A 3EDRB 2Y90A 4K4YA 5GMKa 1UEVA 3C16B 3R6NA 2YQ1A 4PKDB 1ZUUA 4CLTA 1RWMB 1VQNQ 5LJ5Y 1YJ9T 2CKKA 2XDDA 3UDLA 3OMCA 4WZQA 3KTQA 3OYNA 4DR4F 5KE3A 1UFFA 3I82A 1C0TA 3MEUA 3DOKA 3WZ0A 1TUGB 5E3RA 1WHKA 2KG1A 2EQMA 2LNHB 4HEA9 4DCOB 3CDAA 3DLGB 4IFVB 2VG5A 1FYNA 3RUBL 4J9VA 1FCAA 3GIRA 3TZXA 1HHQA 4QYRA 5L1KA 5D4LA 1DHMA 4IO1A 3UD5A 3QWYA 4LF9F 4XU2A 2ZBIA 1FNXH 1U5SA 1IWAA 2DR6A 4Z7YA 2KYBA 2R8JA 4OZ1A 4NOHA 2PC6A 1GFWB 1ZAXA 5ETKA 2QGGA 4B3MF 3KDOA 2XI9A 4XO0A 5HANA 2OI2A 1AA1B 3VF0B 1M1GA 2IYIA 3G7ZA 1Q82U 3ZZRA 3JTOA 2W1BA 4ECTA 3BGRB 1I8FA 3DI6B 2RI3A 2BIVA 4H4MA 4C92A 1YZ6A 4TU8A 2YQ3A 4B3TF 3M4XA 4USJC 1V3RA 4JI8F 2PSZA 1CS4A 2FQQB 1SCJB 3AJDA 4E2FB 2AT1B 1LW0A 2HKEA 1M3BA 1RZMA 4TYAA 2KXCA 2FHMA 2KXFA 3OA6A 3CCEQ 3OYEA 3TUJC 2RO0A 2OPRB 2L3PA 1Y07A 3QNWB 1KHWA 5F0WA 2LQKA 3SDZA 1WIEA 4PJLA 4P2MA 2DGWA 4IDKB 2QSWA 1ZYQA 3GP8A 1Q79A 2LX7A 5KFAA 4Y92A 2XY5A 1U3OA 4WK1A 2MQNA 4RW6B 5KFFA 1OU9A 2DNNA 2F5KA 1K44A 2L3RA 4RLEA 5I21A 3HI9A 5J1EB 5F8IA 4C92D 3CCQS 2B8PA 4KGMA 2DEUA 4USVA 1FMKA 1KEKA 5KYXA 3AA9A 3TI0A 3FJ5A 2NUPB 1S9EB 1KQSP 2W4PA 1CC8A 2MKIA 1M1KT 2XMMA 1OJ4A 2EQJA 3EPGA 3FC3A 5EGYA 4AG1C 4FN5A 4OHWA 1XJWB 1S59A 5A8RA 1QLNA 4I67A 1SKSA 2ZH2A 2AKLA 4AL7A 1NH8A 5D6WA 2HFOA 3H5XA 2HFNA 3CE8A 3PHEA 3VS5A 4Z02A 3ZFVA 2R8GA 3CJ5A 1SC1B 1PYSB 3J81U 1FVQA 1CKAA 2B8AA 2UXCF 2XKOC 1FVSA 2F1LA 1K73U 1F0XA 2R7UA 2XGQA 2DHXA 4JYAJ 4FT2A 2BOPA 1NDLA 1LWFB 4RU9A 1K1ZA 4OMFG 3A8HB 3GB0A 4ETXA 3LAKA 3OYGA 3LGHA 2AX1A 1JLEA 2RHQB 1MSWD 2E6ZA 4YS2A 5DLQE 4OYPA 2ROPA 5IWAF 2OMLA 4HI1A 1QD1A 1SVDA 3MMBA 4DCJB 2H5JB 4JRQA 5KYUB 2K6DA 1ZSGA 3QJYA 3OYMA 2B0GA 5M2RA 1XMQJ 3E01A 2YKMA 5KTQA 3T1YF 3A3OB 3V6HA 2DRKA 2M3DA 3WDOA 2J8SA 5ADZA 3FCHA 5FD1A 2ZBPA 1YITA 5HMXA 1PJ6A 1G3OA 1HQUA 4LRBA 4FPIA 1WTBA 1H98A 1SSFA 3BSNA 1QVGA 1VQ6A 2KXNB 1RWVB 2UUTA 2KZMA 1ZM2A 2NYHA 4B02A 3M8RA 1BWEA 3C6TA 4KGXB 2GNCA 5HK3A 4KGKA 3FKBA 5GMKj 2GTOA 4XTVA 4KHPF 3R2CJ 3FFIB 2ZM6J 3T1HF 3M1VB 1CJUA 2DEIA 2HMIA 4IH5A 4K4WA 3CCSA 2EEYA 3MEVA 4DPOA 1BK2A 3QFHA 4F7UE 5GAN7 2V63A 3X28B 4OLOA 3OQ5A 2EBGA 2XHWA 3O5TB 2G13A 2KR3A 1RADB 1B3TA 4CC7A 4KO0B 3JRZA 2YKPA 1Y71A 2QLJB 2R7QA 1X0FA 3GBQA 1UGRB 1SC4B 2W7PA 3BB5A 2LQWA 3H98A 1WPYA 2LDIA 2RH2A 4OZNA 1M90T 1FTRA 4R0JA 2SXLA 3NRBA 1FX2A 3A1PA 1WEYA 4DG1A 2BJ9A 2Q6CA 2VYTA 3EZOA 2XSJA 2SRCA 3HXMA 5KFBA 3CCZA 1MG7A 2A18A 3LH2S 2OEJA 4CNZA 4BDZA 3OTBA 4F7UG 2W8KA 1NJYA 2AZSA 1QSLA 4L3NA 4QQBA 2B5JB 3Q8UA 3JB9D 3AHPA 3O8WA 2KYMA 1BGXT 4DV6F 4KT0E 1S6PA 5GANg 1D8ZA 4BI3A 4XDDA 2RH3A 2VC1A 1VRUA 1L3KA 2XSFA 7FD1A 2LMIA 1F2GA 5KFMA 4CYUB 3N5BA 1EHWA 5B0AA 1KQFB 3H20A 1D1BA 4JI1F 1N27A 4QW9A 1M1KR 4E7LA 3SSQA 1FD2A 1IBMF 1HWJA 3NGTA 2DL5A 4RR5A 4CO2A 2QE5A 5KFTA 3J7YI 3RAXA 2UVWA 3MCAB 1YITS 4M77C 3CCRQ 2OD4A 4CI0B 4FXDA 5B0EA 3P96A 2AJ0A 1W6XA 5GANd 4OMMA 1WJ9A 4H4OA 3PACA 1FX7A 2QLWA 1QVGS 4KPCA 3GV8B 1H72C 4JV5J 2I5JB 3I55A 1VQ6S 3SSRA 3KHHA 3RRGA 3MCNA 4ZP9A 4MIBA 4YDDB 5ETOA 2HBWA 2JDJA 4ZGDB 3DLKB 3CW2C 5GAN3 1S1XB 3H0PA 5FRNA 5FU6C 2HK3A 3HVTA 3D54A 2Y9HA 1FXLA 1K8AU 1S1WA 1VA7A 4JLIA 2R8HA 3CCSS 1HXDA 2HQ3A 4M5IA 4UQTA 3CCWA 3NS5A 4K4ZA 2DPPB 2HCKA 2ZZMA 3RB0A 5J39A 4DCPB 1GXTA 1A9NB 2BTTA 1DTQA 2XWYA 1XC9A 3X24B 1T9XA 1N9SA 2V6AA 3CCUQ 3W63A 2XY6A 3CDBA 1RT7A 4FYXB 4RPFA 2CDTA 3HM9A 4ANEA 3RGIA 3QRQA 2P9CA 3GF5A 4NS5A 1XMBA 1JXLA 3L1AA 4TQSA 3OBIA 3EICA 2CG4A 1NG2A 1OULA 3DRYA 2MLZA 1ZBJA 3CC7A 1TL7B 3G6VA 4MKBA 3TX8A 3OS5A 3ENVA 3QBCA 2QLXA 4KKOA 3VS0A 3FEOA 4A8MP 3MZIA 2F8EX 3DM2A 2CH4W 5JUMA 2GIQA 3FQKA 4PQUB 4DFMA 3D6FB 3T5KA 1DY3A 2OTLA 2DEJA 1T3OA 9ATCB 1VQLQ 2WK4A 2KVQG 4FCYA 2PMZD 5I22A 3V2UC 3VALA 3REAB 3DLJA 1RLQC 2Q3PA 2MMPA 3I9V9 4G1QB 1FFWB 4M5DB 2HQXA 2ZUGA 3RBDA 3VAFA 4EI2A 2IFXA 1YIJA 3EJMA 3QT6A 1JLBB 2ZDPA 3THPA 1G4CA 3JQMA 1M90R 1YJ9A 1HW8A 1W2IA 3CO9A 4QIWD 2B9WA 3I55S 1VRTA 1LWCB 3LP0B 3DDIA 4QIVA 2E5KA 1JLGA 3OTOF 1RWPB 1G6BA 1RA6A 1HNZF 4PUOB 4OMQA 2HNYA 4MJKA 5KYYB 4ID5A 1CJVA 4QVZA 2XS2A 4AFSC 2J0SD 3AT1B 3MTKA 2X1AA 1WJSA 3RBZA 2YNGB 1WHLA 5GAOm 1RAAB 5KT7A 3X3UA 5HP1A 3CSKA 1DARA 4O4GA 4C0BA 1U6FA 2ROTA 1QCNA 1FI4A 2PTKA 3RIRA 4JUZA 1PHTA 5LJ5j 1NJIT 2FB0A 5B0CA 2W9CA 3PMTA 1UDLA 2X9HA 1GCPA 1HJDA 1NZAA 5DJBA 3AD9C 4PXCA 3CBPA 2VKZG 4P7TA 1P92A 5CABA 2PEBA 1JO8A 4RTTA 4RUGA 1JLFA 4WXOA 3AOAA 4UY85 3EGDA 2F4VJ 2GVZA 1N32F 2FVPA 4TY8A 3CC7S 1LNXA 2HNZA 4B9UA 1M2VB 1NDKA 2XO7A 4ERDA 2X3WD 3ZL7C 1DLOA 4LSNB 4I7FA 2E1CA 1PD1A 1TP7A 1F3FA 4MIAA 4USMA 1NMEB 5GAMh 5C42B 1X0PA 2NUTA 4OMFB 4U7UK 3BS9A 2XMVA 5KFDA 4C8LA 1YNZA 2OTLS 2JW4A 2GHPA 5KFCA 3PYFA 1VQLT 5I2MA 2C2ZB 4FDFA 4DR5J 1T05A 1NM7A 4MZTA 1GCQA 4C92E 4GVBB 2W01A 5KFEA 3KHRA 1RT2A 4GY5A 4TU7A 3L7UA 2Q1LA 4RX6A 3OSSC 4USKA 2D9PA 1YBTA 4UF4A 1UVLA 4ZTFA 4QQ6A 3QPIA 5KFIA 1JWWA 1YJNQ 1YIJS 2NPFA 2EYQA 3DOLB 1YJ9S 4J9LA 3BPSP 2OMOA 4FP9A 1OY9A 5GADI 3C15A 4KV8B 3DU5A 4JRIA 1IR1A 4QVCA 3NLCA 1Z2ZA 2PI5A 5AE2A 4M77D 2HNIA 1S9GA 1YHQQ 4F8RA 2PDAA 4HT9A 2F9DA 3OUYB 3PW2A 2J0WA 3UCGA 4PWWA 5L9NA 3CD6A 2QA1A 4LRFA 3KJVB 1X5PA 4C92G 3PY8A 4OGCA 4C3MA 5EX0A 4PPDA 4DV5F 3JCMP 1S49A 1WSRA 4M5KA 3ULRB 3J7AN 3QDRB 5ITHA 1TAUA 2NUHA 2VA2A 1VRQC 4DQ2A 3VAGA 2N7CA 1V9OA 5D15A 1L3SA 4EZ9A 5DLGA 3BQ2A 2M16A 3B82A 1H92A 1TL1B 2XMKA 2KMTA 2QC3A 3RG6A 2WVDA 4P72A 3SQGB 1F9FA 1YJRA 5E0OA 3AA8A 3NGSA 4OJ1A 3W60A 4LQ9A 3X25B 4FNIA 2XLIA 3P3DA 2V0NA 3BPDA 2DEQA 1JMTA 4FS1A 2AZ1A 1HNIB 3VS6A 4LIRA 5CCLA 2KRNA 1RT6B 4HH1A 2EC2A 1WORA 1JNRB 1FK9A 1VHIA 3D0GE 4PXBA 2BDPA 3KYLA 1N6QB 4DUYF 1K0XA 3TWZA 2DJWA 4LR9A 4F7UB 3SV3A 3C4SA 4C8QF 2ASDA 3H59A 2IDLA 4N41A 2N7YA 2E70A 1HSQA 4X62J 2UV8A 2YLCA 1BI0A 1I0CA 3X20B 1XMOJ 2DA9A 3RW6A 1RTIB 3W9IA 1R27B 3ULHA 1JB0C 5F8MA 2D7SA 5M9OA 3EH1A 5U47A 4JI2F 3JCMV 2I8EA 2MQLA 5GANe 4DPYA 2JLGA 1RLPC 2RQUA 2MGZB 2LJ3A 1UZDA 3MR3A 2K7JA 2CP2A 1PBUA 2BMBA 3TSZA 2BRKA 3V6JA 4OB1B 2QL7B 1Q5YA 3A8OB 1NJIR 1XNRF 1M8MA 2W9BA 2EVZA 4FF4A 1JIHA 3KG0A 5C7PA 3JSBA 2X35A 1LW2A 1PIEA 5DZ6A 1D0YA 2BANA 2J7WA 1FNMA 4A48A 1K9MR 4QWEA 1CBKA 2I9SA 4N8OA 1R8CA 4XTXA 2ZH3A 1YHQT 1RT3A 1BI3A 2PFFB 2JJ9A 1IBLF 5H9FK 3FDRA 3JSMB 3CD6S 2MQOA 5HVGA 3GLXA 5J2QA 1HBMB 3FUYA 3MEDB 3OJSA 3AXKA 5HQMA 3IGNA 2EFGA 4IKFA 2QL9B 3D68A 1BQNB 2HWIA 2JLFA 2E7WA 3TRGA 3GCXP 1TVRA 5IFMA 1CKBA 3TZZA 5D8HB 1RKIA 4YHHJ 2RS2A 5C2CA 4ZA1A 4KH1B 2HFVA 2VG6B 1JQGA 1BHNA 1SKWA 1NM2A 1N33F 2A6MA 4ICLB 3N5FA 3I0RA 2HZCA 3V8KA 5H9FJ 3PIPQ 2EXUA 3US5A 4C0DC 4BACA 2F40A 5CQYA 4DEYA 4DFJA 4K7QA 5A8WA 2DXBA 3ZZUA 1P8GA 3KFVA 3HHLA 4WFBQ 3G86A 2CDRB 2ZBRA 4LVOP 1QKWA 3D0IE 2ATLA 1IGQA 1WWHA 3NG8A 2G0JA 1DQ9A 1SXLA 2BYCA 8ATCB 1OS5A 5A6PA 5KG2A 2FJAB 2M2BA 1Y96B 3D1OA 1X6OA 4A4FA 1TR0A 3JB9G 3NPFA 1C0MA 5D6GA 3TSWA 5EWGA 2V69A 4ELYC 4DR3F 2XHCA 2GCFA 2VICA 1KKHA 3W62A 4LBPA 3PEJA 3BSAA 4GLKA 2GO8A 3W8GA 3BO2A 1KVIA 4RKUC 1F2HA 1ZTWA 4EBEA 4IH6A 4E7KA 1M5SA 3FBCA 1PD0A 1TQLA 2DFUA 4LBIA 2CJAA 3CNQP 3MUMP 1RWOB 1ZM4A 4F3MA 3HVRA 3UDCA 2CA9A 2K3IA 3HHLD 2J76E 3LPYA 3MPDA 3PX4A 3CC4T 3LALA 1RT1A 4KGZB 1GTEA 1KFDA 4UC4A 3IG1B 4UOFA 2MLXA 4EMDA 1FFSB 1SUQA 4OHXA 3G9CA 5L23A 4JJNK 5C25A 1N52B 1F9EB 3NCPA 3Q24A 4RWXA 3NGDA 2R2RA 1GT8A 5J2MA 4ZJOA 3FNNA 5F8JA 4I2QB 3BZQA 2C2OB 4EMKC 4OX6A 1N5YB 2KFZA 5B7WA 3AD7C 3W2WB 2KG0A 4RW7A 2V2ZA 2R8IA 2CADA 2EKNA 5KT3A 2E64A 2HGMA 3BSOA 4V1Ak 2E5LJ 3M8QA 3X26B 3FMBA 4IUFA 2GFUA 4HA8A 1XR5A 3G1JA 2BQRA 1KIKA 3H2VE 3KFWX 4RU2A 3FRYA 3IAM9 4Q8EA 1J5OA 5KG6A 1MMAA 3EGWB 4J9DA 4DU8A 2G1HA 2CZ4A 1B0TA 1RAFB 3RBXA 2DHGA 5LMUF 2K5LA 1R0BG 2RJCA 3L2QA 3OW2R 5HKCA 3SFGA 4EBCA 2HL3A 1QDUB 2H48B 2KBTA 1RU1A 3F73A 1SG5A 3GJRB 2GVDA 4QVDA 2MZRA 4YTLA 3ZNJ1 4NLUA 3OHBA 1WC6A 2LNVA 5F0UA 4B9XA 3CPWR 2QTVA 1UETA 2QMWA 3RKYA 5CYMA 1AVZC 2XTJP 3RU0A 3LQVA 5E5NA 3NGUA 5IT0A 5KG5A 2DYBA 3UT1A 4PABA 2CQ1A 4S0MA 5D4NA 4HT5A 1PKSA 4M95A 3M8PA 1XBWA 5GANh 4RW9B 1QCOA 3DOKB 3OVSA 2B86A 2O67A 1O5JA 2JFDA 2MMYA 3H5UA 1B4SA 4KC5A 4F14A 2FLPA 1ZSZC 1EP4A 1T9YA 5K5MA 3L42A 4LE9A 4RTVA 5KCHA 2FZKB 3GTYX 1FJCA 2YH0A 4QYZJ 4CO0A 3I35A 3I9ZA 2LQJA 4OB3B 3NEKA 5ETPA 4R55A 4BI4A 4KRTA 3NGKA 2U2FA 3IBFB 3J7AF 4BUGA 4RNOA 3VJPA 1AD5A 2RF2B 1PSFA 1WF2A 3SXLA 3VS7A 4OX9F 3M6XA 4FM4B 1H8KA 1SRLA 4C2MA 4ED8A 2JX2A 4EU0A 4F17A 4WTOB 2JFKA 4ZVTB 3C14A 2EGAA 1H74A 3QJLA 2H3JA 4AD6A 1GBRA 2MY8A 2NSCA 3JQKA 3VS2A 5GMKl 3DLLQ 4ZVEA 4WE1A 4F4YA 1QAYA 5IC6B 4C92B 3EM1A 3BDEA 3JTNA 4B3SJ 2RB7A 2RA2A 2L0AA 1W2BP 4IKAA 1YLXA 2AWZA 5CZVA 4O3NA 1M2OA 1NYFA 3EG2A 2UU9J 5BYSA 2VPZB 1NNDA 2X1BA 3Q83A 1HD0A 3OD2A 4MIWA 4LREA 5IT4A 2HNDA 3PJ9A 1HA1A 2UXBJ 2QA4Q 3BM7A 2QIFA 4W90B 1VQLA 4CRIA 3TA0A 4DV4F 3LYIA 1PM3A 4OX7A 4JI0F 1VQ9T 2VFSA 1WC4A 4CLFA 4DV0F 4A8FA 1VJWA 4NLRA 3KHGA 3VVUA 2HS3A 4NZ6A 1Q95G 1T3SA 4PG6A 2MI6A 3SB2A 4I6YA 1D0EA 1HBUB 2ED0A 5KYXB 2QLFB 1WNLA 4ITSA 4CNYA 1Q8KA 3OLAA 2L3SA 3GYXB 3M55A 3R5BA 2YKOA 4M77E 3TW0A 2JS0A 1X43A 1FX4A 4J9MA 5C0MA 3PT9A 3LGNA 2FG0A 3M2VA 4M78A 2B4VA 2KHCA 4JI3F 2FHKA 1IKWB 2DRAA 3ZZYA 3CWJA 2VC0A 5L38A 2DK2A 4HKEA 4YUDA 4MYTA 2HMAA 1K0VA 1T7PA 2GMJA 2NYIA 2VBYA 5GAEU 3QSIA 4ZP7A 1Y7XA 2B7BB 5LSLA 5GMEA 3BGFA 4DN9A 1UJ6A 2WVCA 3I5CA 3KXDA 3FEZA 1ZPVA 1S0NA 2HKNA 5FDLA 4UT4A 1TKXA 1GMWA 2RKIA 1VISA 3VAJA 3NTKA 2X4YA 4M77G 2DM1A 1VHFA 3AB2B 4LFCJ 4KUIA 2DIVA 4EUVA 2G1DA 5HN0A 2FZGB 4OI4A 3O2IA 2PQWA 2BZ8A 2DVEA 3MMBB 4M78D 4IUUA 1G7CB 4IOBA 2I2LA 2OHDA 2CP0A 2OSQA 4D8KA 2FPDA 2HAXA 5LJ5g 1WI7A 4A8SA 2YKMB 1H38A 5JJBA 4X4SA 1AFIA 2HZVA 4KFBA 3D9BA 2DH8A 2CQDA 3PNIA 4X64J 2OD6A 2FIUA 4FVMA 4Y2CA 5CQGA 1HQUB 1VR6A 2R2TA 2KRSA 3C94A 1VMBA 3JCMg 2Y4YA 2PA8D 1FRMA 5L46A 1VLOA 2YNHA 4JB8B 3GLJA 3U27A 1C1BA 3C6TB 1VK3A 2B51A 4LR7A 1BQMA 3E2EA 2AK5A 5HVHA 4KUDK 4AT1B 2B6AA 3OW2A 3KLEB 2MWOA 1Y57A 4X4UA 2VB6A 4RUBA 4B17A 1LPLA 4FSXA 1GRIA 1Q86U 5K8OA 3JSYA 2BQUA 4DR7F 1TL4A 1N8RT 2PI4A 2HBRB 2CJBA 2X1GA 1TH7A 4EEYA 1H2UX 1VYTA 2DJQA 2V2VA 5T7LB 3CPWA 2HVIA 4CT9A 4DR2J 3PTWA 2JEJA 1KSPA 1WEZA 3WVEB 2OO4A 4DR1F 2CXEA 1RU2A 4DSEA 1LV5A 3J80U 3K8WA 2VQEF 4NXMJ 4CO1A 5AXKA 3VR1A 2CREA 4DG1B 2CYYA 4ZCKA 3HDSA 2IVYA 2RILA 4QQGA 3CMEQ 3LP2B 1UJYA 3HULA 3MJXA 1VOMA 3CCMQ 4DV3J 3TJ8A 4CLPA 4ZGEB 1AB8A 3EFSA 3DDKA 2MEWA 4HT7A 4WFYA 5DETA 3JV3A 4XAXB 3M6UA 1IGUA 1J27A 2KYZA 2VA3A 2QQ9A 2UV8G 4U96A 1S6PB 2QZ8A 1WJQA 3CXCR 3M54A 4ECXA 2E7VA 2G2ZA 4C98A 1YJWQ 3NKYA 3ET6A 4RTXA 1B64A 1CQMA 2CS7A 1XQIA 5GMKe 1VYUA 2HQGA 1N5QA 4WF9Q 4TQRA 2HPUA 2EBEA 3CCVA 2F9JA 4O0NA 3M5AA 4WIQA 1WF0A 3CD7A 2HQFA 4N47A 2WVEA 4ZVPB 2RUSA 2BQ3A 3C16A 4RW8A 2Y8WA 1FNOA 4LF6F 1PWTA 1SJ1A 4A63B 3MI7X 1SI9A 4YR0A 3PYEA 4PG4A 5JVHQ 4UUXA 2HVDA 4C0FA 1QUVA 2D1CA 3UN5A 1Q81U 3A8GB 4GVLA 2CRLA 4I68A 2OSRA 4Y00A 4H4OB 2AJ1A 4PYDA 2EQIA 5FWBA 4FVCA 1SKUB 3IRXB 4P10A 3DLGA 4IQMA 1SPBP 4JOUA 2KHDA 2AIRB 1HWIA 3ILOA 4YY3F 3TR5A 1UGPB 3HVTB 2CP7A 3FDSA 4V2SA 2AJ4A 3ZZZA 3OW2S 3FB9A 2JEIA 1FT8A 2ASJA 2CWKA 1S1WB 4J6XA 3V7SA 3FLGA 1IXKA 1U1KA 2J6SA 1WA7A 3CC4A 3C19A 5D3GA 3O44A 4C8NA 1UE9A 2J8AA 1KOHA 3CJ2A 2W4DA 3QT5A 2DBMA 1R89A 4TYBA 2I0XA 4NZ0A 4E8UA 4GC6A 1RWNB 2CZ1B 1X7VA 3CPWS 1D0XA 2D3ZA 4U8YA 4AQYF 3Q8YA 4CC2A 4L6V3 4Z8AA 4HVWA 3RBBB 3UQSA 3BGRA 3AY0A 3DI6A 3URGA 2QXFA 3ADAC 1W26A 4X4PA 3SEMA 1M5PC 1NKCA 3W5ZA 3QJJA 4XTYA 4QBUA 4LDUA 4WF2A 2I2YA 2YY3A 1MU2B 1M27C 3BW1A 4KBIA 4WFZA 4NCGB 1UPMB 2DVIA 2KM8C 1I1GA 1AUDA 2F7VA 4E0DA 4BD3A 2RHZA 4DV2F 4IDKA 1P9YA 3PVQA 3SV4A 1H3ZA 4K11A 4KE5A 1RYRA 1YJWT 1VQMT 3DRRA 3R5AA 2CDQA 4BDPA 2HQCA 2XC9A 3VQSA 2CNOB 2P2CB 4GC7A 3BYPA 3CCVS 1JJHA 4ED6A 2FPEA 3OXFA 2A3LA 1N8RR 3CCLQ 4JZ4A 3HHEA 4DX7A 2NUPA 2UUCJ 3OYBA 3KDNA 2AQ4A 4Q43A 1Y7PA 3QPHA 2CPZA 4B9MA 4DBFA 2GNKA 3B54A 1RKJA 4BB7A 2JS2A 2JM8A 4BE2A 1FEHA 3ZZPA 4LQ3A 3FSXA 4U6PA 3PRBA 2NSBA 3UDVA 1PJ5A 1VRTB 2E3HA 1SV5B 2FVSA 3HPOA 2ZEJA 3QZ5B 3FCVA 2PIIA 2OPPB 2WAQD 3RBEA 2C42A 1L5UA 3PYDA 5F41A 3KWMA 1JB0E 4F02A 2EYYA 4ID5B 2VPWB 2LVMA 3R8YA 1FF2A 3HHKA 3BDPA 4W98A 4JI4J 3CC4S 3ASKA 1KTVA 4HHJA 1LWFA 2YNFA 3VAKA 2DNMA 1EQ0A 1RA7A 1WQWA 4M1KA 5GAHU 5CQXA 3INZA 4EYIB 1YWPA 4RTWA 2YBVA 2ZWOA 3PFEA 2AGPA 4C7QA 2K7AA 2BKOA 5G4DA 2VV5A 1ZUYA 2V2KA 1TMJA 3CVKA 3KBGA 5CA5A 2W10A 4ESRA 3H5YA 4NA1A 1VC5A 5A8KB 1EB0A 3ENAA 3WHIA 2GVZB 4IIMA 3QWUA 2CPHA 2PA3A 4NLVA 2W9AA 1WJRA 1H2TZ 4GLMA 5J26A 1U25A 3DRSB 1HWUA 1DLOB 5EWEA 2KROA 4JS5A 2RE1A 3E9GA 3UNGC 1VFJA 5MAOA 4XQ3A 2CSIA 2NUTB 2MQPA 3META 1F9HA 2FL7A 4M77B 2C28A 1OQKA 4YB5A 3MM5A 2E9ZA 5GMKh 3LX7A 1VQ9A 3FFIA 2J7IA 1V3SA 1Y5LB 2MDAA 5CZXA 4QWBA 3M1VA 2D1XA 3K17A 1XTDA 2F65A 4ZCIA 1H7XA 2IHR1 1MROB 1Y3KA 2E5GA 3CCLT 1RT2B 3CCTA 3A12A 1DJ7B 5FU6B 1SH3A 2K5IA 4QWCA 4FYVB 1HARA 1S72A 4IUPA 4QR1A 2HVHA 1X5SA 2HHVA 4KO0A 3G8SA 1IM4A 4ZIVA 5LJ5e 3M57A 1VBKA 2SEMA 3RR7A 2LA6A 4M75C 3P8BB 3C15B 5A0YB 2CPFA 3E3XA 4IOCQ 1S9GB 4JYAF 3T5HA 1S77D 1VQ7T 2Y4XA 4DPWA 3OSNA 2VF3A 1XN9A 4UOHA 2DHSA 1NCLA 3M59A 3F44A 5DQHA 2MK5A 1P1LA 3JCMe 3ZZOA 3QSYB 4C6AA 2NPIA 1FESA 3KUFA 1VQ8A 3OVBA 5B08A 2EFIA 2B5JA 5KYNA 1LQ9A 5ETVA 4M94A 1D0ZA 2M0OA 4C3KA 4NLSA 2EG2A 1I4K1 2YWHA 4XIUA 1DQAA 5AXMA 5B0BA 3MUVP 1UVKA 2JTFA 2UUWA 4CYUA 2ZAEA 2EFNA 4M78E 2JSXA 1OX8A 1UECA 5JXSA 4E7IA 4A46A 2IM0A 4LSLB 2WSFC 1XOVA 2ZC4A 3CIMA 3CBOA 2BE2A 2XU8A 1YZ7A 1SH0A 3G82A 3HFVA 3IN5A 2A0FB 3W1YC 3CCQQ 2QSFA 3PVLA 3RB3A 3OVAA 1R43A 2ASYA 4TY9A 2H9ZA 2ZM6F 2P0QA 3H2LA 2I5JA 3LWLA 5HMWA 3TAMB 4OV6A 4QKUA 4ILMA 2XNQA 2HZAA 5JMNA 3O6QA 4P2FA 4EO6A 4RTYA 2MOXA 1OQ3A 3K59A 3PFSA 1VQ9S 2QGFB 3DLHA 4XDCA 3U7JA 4MDXA 1GFDA 1U1PA 2AD9A 3AOCA 4NWBA 4M5MA 2OI3A 4B6MA 3FBEA 4PZVA 1S72S 3UFCX 1M8VA 2W9BB 2NUUG 2EW9A 3FK4A 4W92B 4XU3A 4HHHA 4HYKA 1RDRA 2XIDA 3R1HA 5GMKi 1XTZA 1DTTA 1Z4UA 4N4IA 3R5CA 1VBYA 2BANB 2RHXA 3RR6A 4I56A 2AX0A 4X4TA 5H9EK 2COZA 5A2QE 1WTFA 3V8JA 4JUVA 4B9WA 1RT3B 2PVDB 1S4FA 1TV6A 2DHHA 4FSSA 1OEBA 1N9RA 1Q82R 1NHUA 2XMAA 1Q7YT 3M8SA 1VQ8S 2CQ0A 2LCWA 4A8XA 3UN2A 1KVJA 2JN0A 3VGUA 2L9WA 1I81A 4C8YA 3AHUA 2MJNA 1NK0A 1RLDA 1K47A 1TL3B 2XG8A 1WC0A 2EWHA 1KD1T 2NXEA 2WSCE 3J7ZT 2VFTA 2O9SA 3SWNC 4RG2A 4WU3A 3RMQA 4KR0B 4F16A 4DSFA 4EZ6A 4X66J 2Z8QA 5D78A 4I4BA 1KHVA 4DOVA 1NEGA 1UWAA 5ETRA 2QDYB 5AE3A 4CC4B 4MMKA 5FJ4A 4M5JA 3ONQA 2LA4A 3LW5C 1KONA 1B0VA 5A8WB 2LEAA 2HAFA 4ED0A 2YWEA 4NI2A 3HHLB 3CCQT 3R7NB 4NLDA 2Z56B 2OPSB 4VUBA 2DNYA 4PPZA 1JLBA 4LF9J 2RHIA 2DYAA 3FCWA 2WZ1A 1Q53A 5GAOn 3CGIA 4WFAQ 2XG8D 2F69A 2ZZTA 1U2CA 1RAHB 2Z2MA 2QYGA 2BE7D 5D0HA 6FD1A 3IS9A 3PMIA 4I6WA 4AXIA 1MMNA 3JCMX 2HHTA 3V7CA 3EXCX 3GR0A 4ELTA 2VGMA 4GRSA 3IWLA 5H1SV 4M7AC 3NOCA 2PUOB 2CYZB 4QJVA 3NTIA 2P84A 3M8WA 3L9ZA 2ZH1A 4BI8B 4JI8J 1PC4A 2H65B 1URRA 1EX8A 4MMLA 2DT9A 3P5TL 4NEZA 3TOQA 3M8YA 5E3AA 2RRBA 3KK2B 3RESA 2YRVA 2BKPA 4LD6A 5LJ5h 1M1KU 3OFGA 1IR0A 4ZVQB 4NRTA 1RT1B 2RB6A 1G5VA 3C3LA 3NNAA 4ZJLA 2K1RB 2YUNA 4DQSA 2AGOA 4F4AA 4OZJA 1XEZA 4Q5VA 1HKAA 4OI6A 4IUTA 2OH2A 4ZCMA 2BKDN 4CO4A 1V1CA 1WHGA 3JAMY 3J81Y 5C5JA 3CJTA 3A98A 1VJQA 1JQQA 4M75D 2ASLA 3JCMh 1Q8LA 4ATOA 1SF9A 1M2VA 3J7A1 1HNWJ 4RBVA 2O66A 2DL4A 3DLEA 1RK8A 1RAEB 4AG2C 4DUTA 2J0XA 1T11A 5D0GA 2X1FA 3BFMA 4USIA 3TYTA 3HHDA 3G4SA 5C42A 2D6FA 2OFHX 1LVKA 2Q6BA 2WBRA 1S97A 1NJWA 1YITQ 2B9EA 2YRDA 1H641 1NE8A 1K73C 2XMTA 1X4FA 3HX9A 2EKHA 3DRPB 4IOAQ 2GGPA 1YJWA 3CJSA 1VQMA 1VQ6Q 2ZJQQ 4ZVUB 3R6OA 3M0QA 3MFHA 1X60A 4OYAA 2EQUA 4GVBA 5DG9A 3D6TB 4EK2A 3H4BA 1VIFA 3DDNA 1KC8T 1FKOB 2JEGA 3PV8A 3QLHB 4PJOC 2UVUA 2QEXT 1KVKA 5IOLA 3CCSQ 2DGSA 4NL3A 2DE0X 1T8EA 5IV4A 2J6OA 2DILA 2ACMA 3R6LB 5DGBA 5C6SA 1NSPA 3DGPB 4KV8A 1HBNB 1RB0A 2R4FA 3KUEA 1O6XA 2HHQA 5DDRC 2MZJA 3FEYB 4GO5X 1V29B 2J6UA 2XS5A 5KFVA 2UVRA 1Q7YR 1SQFA 4BWMA 5ETTA 1T9WA 3JCMQ 5AXLA 1WYXA 5IWAJ 1CG2A 1S1TA 1S7IA 4B3RF 4ZS6A 4ZPTR 2C3PA 4ZK7M 3CJQA 1OYXA 2XNRA 3GE9A 4YB7A 3QATA 1X6GA 2KZZA 2MKHA 4DFPA 2RRNA 2EYZA 1EP4B 1N5ZA 4EYHB 3QIDA 3FSYA 3IP0A 2O1PA 3EG9B 1Y0HA 2BJ8A 4ZLLA 1HBOB 3G96A 2KDSA 3MHYA 4LF4F 2F4VF 1WG5A 4JI6J 5AJ3J 3IMQJ 1NHVA 2RU3A 2HFSA 2ROEA 3MR7A 5GAOl 4C5EA 2DYIA 2UUBJ 2CQ3A 1U0SA 2VDIA 1JXEA 4ANDA 3LP1A 1UFWA 2KO1A 1BD6A 2V9WA 1VYAA 4D6WA 2DERA 4R8UB 1UEKA 3NMZC 2JH3A 5I42B 1S1UA 1M90U 2QA2A 4BC7A 2D41A 3NXZA 2PT0A 1T9UA 1HNIA 2O31A 3NHNA 1HWKA 3FJPA 2V4QA 2HFUA 3K5PA 2LFVA 1Z9ZA 4EMGA 1P27B 1QMCA 3GU0A 4M7DF 1Q7LB 1BE4A 3G4SS 1WI8A 1Y10A 3NWGA 2K3BA 3R7SB 1QVFR 1RISA 5CKFA 4DR5F 3MECA 2N82B 4Q0BA 1REVA 2R8KA 2LDMA 2C2DA 1KFSA 3OL9A 3FQLA 2JNGA 1DRZA 4DOWA 3PE0A 4KTQA 1RTIA 2BZYA 1VQMS 3I55Q 1VQ6T 3K0JA 4OI2A 2E9RX 2EGEA 5IXFA 5BYRA 2H4YB 1ZH5A 4OI1A 5CKDA 2APOA 2MGZA 1OQ6A 4IYQA 1E6VB 5KFSA 3DFEA 3DLBA 4V19X 2C3MA 1M5HA 2VXFA 3QO3A 2OIHA 2RQKA 4KYZA 2DRMA 5IS2A 4DBRA 1K8AR 2P6TA 4J9FA 2QL5B 5A6WA 4Y3CA 5FLXU 2CJKA 1ZTTA 1CJKB 1Y11A 4P6QA 4DV6J 1ZX6A 2CUDA 1WC3A 5J2PA 2CPXA 4C5IA 3SDEB 1NK5A 4L74A 2ZD1B 3C6UB 2IJRA 2WB4A 4AXJA 2P5VA 1LNQA 4IR1A 3IR6B 4C8QC 2LLZA 1VQ7A 2JOQA 3V7RA 3C66A 4FBUA 3PO5A 1HBMA 2DXFA 1FTCA 3NNCA 3MEDA 2KL8A 1RAGB 1PKUA 4EMKB 4Y6IA 4Y2IA 3CC7Q 4NXNJ 1JBMA 2YUOA 1IBMJ 4LUBA 2BJ3A 2R3VA 3H41A 2KH9A 2YH1A 2MPUA 2XI3A 1U8SA 2LT1A 2FPFA 4QR2A 3Q8VA 4RUHA 1R3NA 1S6OA 3QT7A 3BGLA 2VG6A 4J9HA 3CDWA 3C2PA 3E19A 4ICLA 2GBQA 2RKIB 1FXRA 1RQ0A 3IGVA 3Q23A 1AXQA 4MZPA 2OTLQ 1SKRA 4B08A 1RBLA 2U1AA 5L8RC 2YWKA 3NNHA 1VQPA 1SJQA 1VC0A 2D9OA 1JJ2R 2DD5A 4X62F 3QUIA 1J3TA 1XMOF 4ECSA 1LFPA 4R56A 3H42A 1HR0J 2VODA 4J9GA 1U8WA 5GADU 5T41A 4OMPA 3MM6B 2W24A 1J5EJ 1HNXJ 2PE8A 4DR6J 2G2YA 5L1JA 3M53A 3MMAB 4DL4A 1YIJQ 1U7LA 1X75C 4FIBA 4CM2A 1BB9A 1YJ9Q 2X4JA 2ZJRQ 2M70A 2DGXA 2VFRA 1JRIA 3I55T 4LDVA 2C0OA 2ZKUA 1SC3B 2C0TA 3QDFA 3UCZP 3N9UC 1C1BB 5IC4B 3V6DA 2N4DA 3HD1A 3OR2B 4G1PA 3MP8A 1YJTA 1BQMB 4LJMA 2IIMA 4HTJA 4KGVB 5CKBA 2L48A 3UD4P 2HK2A 2B3TB 2BA9A 1ZSZB 2J9DA 2DK3A 3QGPA 3HSBA 3IG1A 1S1VB 1EARA 1QWEA 3TP2A 4JDSA 3MWBA 3BY7A 1EIFA 1QY7A 3RRKA 3CEDA 3JB9k 1Q8BA 2FRYA 3M56A 2DBBA 3Q0AA 2M51A 3FBBA 3I31A 1SQEA 4I2QA 1VQ7S 2FZCB 3BKUA 2CSQA 2FVCA 3EGZA 4ATNA 1WX6A 2E5HA 1XERA 3OT9A 1N34J 3D1QA 3GWCA 3T6JA 3QJ6A 2CZ7B 5LL6S 1IJEB 4GKKJ 2RDIA 3CC7T 2J7KA 1NK8A 2G0IA 5EWFA 1FE4A 3OL7A 3OYCA 2Z0WA 2MIOA 4WKYA 2K8GA 1NJIU 3G8TA 4J9UE 5DQGA 3JB9I 3PCOB 2D0NA 3ZZTA 3ISZA 2GGRA 2MPXC 3OTOJ 4QW2A 2HVEA 3D6HB 1BCOA 2GO9A 4LFBF 2IM3A 2PMHA 1VQPS 2X3GA 3PR4A 4HTIA 3HVAA 4DPTA 1XIQA 3TNVA 2I6WA 5HSPA 2XMUA 4RBUA 2EFVA 2RK2A 1NHKL 1VQ4T 4QU7A 4P71A 1B34B 1NSQA 4RW8B 2BEFA 3MDFA 3ISND 1MV0B 3T5JA 1FWPA 1YIJT 5SUHA 3RNJA 2Q79A 3ILIA 2PN6A 2LQNA 3OSPA 2A2CA 1QVFA 4FBTA 4RW9A 2DTOA 5F8GA 2DKGA 1QTNB 1YP5A 1KLNA 1YVFA 2LCCA 5CYJA 2W2MP 2DMOA 1Q16B 2LQ5A 2H5EA 2L08A 2YX7A 3CD6Q 3OFHA 3IM9A 2BXJA 5HI7A 4MT1A 4MDWA 2GW8A 5G0RA 4K4XA 2E41A 4NA3A 4RBTA 1PYTA 3H0HA 1XQHA 4OX8A 5D3GB 2RF2A 3ZZ0A 2CWXA 2DR5A 1FKPB 3M9QA 2ZH7A 2XEXA 3D28A 1UZHA 1AEYA 1G3SA 2BOAA 2XULA 2E5LF 2ALZA 5IM0A 1RSCA 4M75E 2CQBA 4OL8A 4NCAA 1BBZA 2ZGWA 3QO9A 5HAOA 4C8QD 1QE1A 2HBZB 1TFYA 5HLFB 1K1SA 4EBDA 3CD5A 1WI6A 1R0AA 4NLYA 5KFUA 2AW0A 3AB4B 4MK7A 1RHUB 2HBPA 1K1QA 4BLGA 1QSYA 3F56A 1I5LA 2GAGC 1W4SA 3EX7B 3EGXB 1AOJA 4UW2A 2JTEA 2F5TX 1AROP 3ZNUA 4ECUA 5FIIA 1XR6A 2ZNZA 4M75G 4K0KJ 2OP5A 3I0SA 3J81j 3DRRB 4LF2A 3EHRA 4R5PA 4XK8E 2MB0B 2QEXA 1N88A 3K89A 1RI9A 1HBUA 4C9DA 1JJ2A 2RMLA 3M6VA 3ICLA 1B07A 2XY7A 3DN9A 3VTIA 2DCUB 2JC0A 4DS4A 1CPZA 2O5DA 3BEGB 2CNKB 1YKWA 3KK3B 1QVFS 3ER0A 4URQU 1GBQA 4WBFA 5A2QU 2HBYB 4LIWA 2D69A 1IKVB 1O51A 1IKWA 4C3LA 1CC7A 3HMJG 1PJ7A 4AE5A 3CD6T 3KOAA 1WG4A 4HT8A 2KXDA 1IHVA 4NASA 5I3QA 2EKYA 3DHWC 3DLMA 1LCKA 2LJ1A 2VGNA 4OJ3A 1GX6A 3PIOA 1H3DA 4J9EA 5CVIA 1HPZB 4BE0A 2RI2A 4P7VA 5KFLA 1NDCA 3MEEA 1X8DA 3M0UA 2YNFB 2MZQA 2HKQB 5CHCB 3TARA 4P52A 4TVRA 2C2KB 4DPXA 5DDPC 5GAMf 4B3SF 2DGQA 3VYGA 2PD1A 4ZLJA 3P4UB 1TUWA 3LGMA 1UB4A 2AJFE 4CIOA 1GNKA 4E6RA 3SYZA 2UU9F 4OYWA 3D66A 3OTEA 4DV7J 2DO3A 4D3GA 1GAOA 3LOUA 1NK7A 2XZTB 2UXBF 4ANCA 4BC9A 3GP9A 1MN7A 5K9FA 2JZ2A 4PXEA 2EAYA 2LMJA 2KFNA 3N6NA 1FJEB 4M75F 2XLJA 1N6AA 5LSOA 4M8LA 1YJVA 1KQGB 2N3LA 3DXSX 4ZN1A 2W2QP 1WQ7A 5LM7E 2PMWA 4HDGA 4O0IA 3MEKA 1N4LA 2K3KA 5ETNA 4X65F 3NGRA 2D0QB 1T0TV 1WSVA 4X4OA 3T6BA 1A0NB 3MM5B 1FRXA 4K2XA 1C6VX 4LXCA 2Z58B 2FTRA 5LJ3d 3KLEA 4ED1A 3QAEA 2KRBA 5FROA 2QEXS 2ZHBA 1AT1B 4JV0A 3NBPB 3ZTSA 4G3IA 4XU1A 3N6MA 2P0KA 1JJ2S 2QTWA 3SFUA 3BE3A 4F3QA 1C1AA 2N4CA 4FKXA 3KHLA 4NRUA 3CMAT 3PW4A 3R5GA 4LN2A 5GVQA 1EX4A 1NO8A 5T7LA 3I87A 4HL9A 1QSSA 1MWQA 1B99A 2AJ2A 1UJ0A 4K50A 1TWBA 1YJUA 3WX4A 1KHIA 3S7RA 2IY5B 2G4BA 3X1LB 3EDQB 2YSQA 1GXLA 3A8LB 5K14A 2FLNA 1UG1A 1VCTA 5CR2A 2BVZA 3POTB 1YBYA 4IIOA 5CXTA 2VPXB 4J9KA 4DV1J 3TVYA 1X2QA 4LFCF 3LP2A 2RNAA 5GAOr 1T3NA 5I3UB 1VGYA 2DCLA 3UATA 5GMDA 3CC2A 2XZWA 3GIKA 3C95A 1H3HA 4Y91A 2CQIA 4N7TA 2K79A 2L5QA 3EVOA 5B0FA 2A37A 5GAMe 2KM8B 2GF7A 2RD1A 3GV5B 2OUGA 4W4MA 2ENMA 2YX4A 4LF8J 5LXYA 4WP3A 1X27A 5J3BA 1AYEA 2JZ5A 5IQ6A 2GQIA 5FRMA 4MK9A 3F70A 1UL3A 2GJFA 4B3OB 3GFHA 2ZNYA 2BE2B 4NMXA 5DO2A 3BSCA 3OYYA 3L95X 3D1HA 3OS1A 3G82B 3RB6A 2AYMA 3OYKA 2BBEA 3H8YA 3T9NA 3ITHB 5KG0A 4OJGA 3OL6A 5D6XA 5A0LA 4OI0A 3JAME 3KMQA 1AWXA 4FKYA 3S3NA 1ACMB 3K58A 5DY9A 3H40A 4BE1A 2F2XA 2NUZA 1GXUA 3IRXA 2WONB 2V8IA 2ZZDA 1C2PA 2B4PA 4ECQA 1U1OA 1W25A 2LU2A 4Y2KA 3FSIA 1R8OB 2RDDA 1KHCA 2O88A 4GO7X 3VAIA 2EGCA 1VYVA 2KRMA 3I5BA 2MAMA 2VQFF 4DR2F 1RLCL 3HHNB 4ECVA 3BO3A 1QVFP 2AZ3A 3A8IA 1S7HA 1OPLA 2DNLA 2YWGA 2JT4A 1CQNA 2KN4A 3NTHA 5KG3A 1W2BR 3ZXWA 2HL5C 1JXVA 2DD8S 3C12A 2OTJA 4NXMF 1UGVA 1QUPA 3SCIE 3BR9A 4O23A 2H5IB 4ELUA 3F0NA 1DTTB 2EPDA 1N0VC 2V34A 3A3NB 5F9LA 4DV3F 3HT3A 2FLOA 2A1BA 5LMUJ 1N48A 1FMWA 4DSIA 3UI3A 1PSEA 3PNWC 2KVQE 1WOPA 3JB9J 1TV6B 5IH2A 4TKTA 2CJXB 3PGGA 5EN1A 2V8DA 2CQHA 3O1LA 1WUUA 1MU2A 1IUJA 4TLRA 1HYSB 4NCGA 3KLIB 2R5AA 4K4SA 2J9DE 2EPIA 3JCMJ 3BN7A 2ZBCA 2CIMA 2XDPA 3BO4A 3KLHB 1BY9A 2CVIA 2IA0A 3CC2S 1EFNA 2AYEA 1NH7A 2HFZA 1UA0A 1CULA 3OHAA 2FUG9 2NCKL 1TK5A 3I9QA 1RHRB 1M5KC 4M7AF 2L8DA 2IMWP 4PR6A 1NJXA 4KT0C 3QMQA 3DOMB 2AJQA 2LYVA 4ED2A 4QIFA 5E2QA 5MLCV 3WX8A 2NZCA 4OV1A 3MKDA 1VQ4A 3KG4A 4OZ3A 1O75A 2M9KA 1WHMA 4L72B 1PGZA 4NI2B 3UDEA 3P8DA 4N5SA 1B7FA 2L3QA 3D67A 4FF3A 2FJBB 3GCWP 4GBQA 2OEKA 4RJVA 3SCKE 4N0AC 1APSA 4AFQC 2WVFA 1E7OA 4OZ0A 1REGX 2J0QD 4ZPWR 1SV5A 5DS7A 1OZ3A 2NS1B 4OX9J 3PJXA 4N8NA 4Y65A 4F4KA 1PRLC 2OPPA 3MHXA 3T5LA 4A4GA 3GJQB 4K5SA 1JJ2P 2IAJB 4CLKA 3IS9B 1LOJA 4M75B 3MUTP 5KE2A 1TELA 1DBDA 3CJRA 3KJFB 4NYPA 2ADCA 1QM9A 1EETA 2BJEA 5LMNJ 1I94J 2ZH8A 3UN3A 5GAGU 3AJ2A 4WZMA 3IC1A 1NLKL 2IJFA 2AHJB 3LA0A 1OPZA 1YRXA 3AODA 4NZ7A 2OTJS 1V5IB 4MYUA 4OZ2A 1BYMA 2XLKA 3Q1JA 3HK2A 2QO3A 1N54B 2BE9B 2ILYA 5EHHA 3HO1A 2RJDA 1GQEA 2KT1A 3W5XA 2ZCFB 4JLGA 3OYFA 5D77A 3N4WA 3HSDA 5HO4A 5A8KA 1FA0A 4C8QE 1WGSA 1K9MT 4PJOF 2JMCA 4JI0J 4J83A 2DPIA 2RJEA 2EI5A 3H2UB 4LT6A 1FDDA 3PW7A 2V9KA 5JVGQ 3DRSA 4FYWB 4F4ZA 2HHHJ 1BLUA 5IHKA 3DLEB 3GPLA 3GR1A 4CDIA 4JI5F 2D3UA 1QW1A 1WKLA 4GKJJ 4LDYA 3EUNA 3Q8PB 1NUEA 3LWMA 4M77A 1D8YA 5IT9Y 3MMCB 1D3BA 2ROLA 3ETOA 5EX3A 2EJGA 1WC1A 2FJWA 2GQCA 2GGPB 1B70B 2FJXA 4O44B 4ALZA 4C8QG 4E7SA 2Y0SD 2W8LA 1HD3A 5GANf 3DC2A 1MROA 5L8RE 4O3QA 4QWDA 4G1IA 1KG1A 5D4OA 2WOMB 1VQ4S 2R58A 4NYZA 4C0GA 4J5YA 3BDLA 2W0ZA 2W4CA 2H4WB 3EFOA 4KJIA 4CM0A 4ECYA 1JKHA 4XPCA 3E2UA 1S4EA 2IRUA 2CQ4A 2DKOB 5A0YA 2IDEA 4J9PA 2DNHA 2X3DA 1PRMC 1VQOA 4DSJA 3FZBA 4C0OC 1KD1C 2QQSA 1ZETA 1UUEA 2UUAJ 2JJ4D 8RUCA 1RT5B 3H4DA 4ES3A 1S1TB 4KSEB 4L5GA 4WKRA 1RBOB 4ID8A 2UXDJ 2FVUA 3HFZB 1X4EA 2RT3A 4YP3A 4KH0B 2P4TA 4PG8A 3M8ZA 1NAQA 3MCSA 1K0TA 2VJUA 2FYKA 2MZTA 4V19J 5T14A 3OTDA 4AMCA 3QWXX 3MAAB 3RW7A 5LOQA 2RQMA 3H9NA 4X4NA 2ZH9A 3REBB 3SSSA 2ABYA 2DR7A 3SHWA 1Q86C 3L2VA 1X2KA 1W2BA 3J80Y 3VGVA 3LP1B 1X4AA 1XNIA 4YMEA 3PJWA 4XTWA 3FVYA 2HQIA 2GJ2A 4LSLA 1S1UB 2AU0A 3SWNB 1CSKA 2RQRA 2C2RA 3CCJS 5A0DA 2HS0A 5ETLA 1YBAA 2FJVA 1NYGA 2JVVA 2MQQA 4ELVA 3CCVQ 1WFWA 1PO6A 3GV7B 1JLCB 5BYQA 4DL0C 3ZEHA 4F67A 4OGEA 3A3PB 1YI2T 2ZJPQ 4OYIA 4DR7J 3MECB 1QTMA 3VYHB 3TAMA 4Q0BB 1REVB 3H8ZA 2J05A 2ATCB 2EJFA 2DGOA 1VIXA 3NY0A 3PKYA 1T0JA 3PM9A 1Q8IA 2O01E 3SQOP 1VBZA 4WWSA 2ZE2A 3W5YA 3TZWA 3B6BA 4BWJA 1X4DA 2FHOB 1ICEB 2J6FA 2JNJA 1RAIB 2R9LA 1SB6A 3K2YA 1DAXA 4PKCC 3PX0A 4O3PA 1QWFA 4WK3A 1NB7A 1IR2A 4PFPA 3SMZA 2B56A 3CMAA 3SBMA 2A3JA 2DY1A 1SEMA 4C92C 3CC4Q 4M5GA 4K4TA 1UAWA 4NLQA 1QQJA 2Z2YB 2COYA 3EMTA 1M0SA 1X4GA 3HTRA 2AEFA 3CJ8A 5J2PB 3JQJA 1VQOS 3G6YA 2E6NA 2MYSA 3I56A 1Q81C 5HROA 3KUGA 1IN0A 1EKSA 1T3LA 1S12A 5LL6d 5DM7Q 3D7SB 4F26A 1KWMA 2O3DA 5F3TA 2GA7A 1L3VA 2DZ9A 2VJVA 1X4HA 1TL3A 4DPUA 1TTHB 1KC8C 4OZ5A 3ZC4A 1YRUA 3CTRA 2V2QA 4K4UA 2XWXA 2VG7B 3PX6A 2Y8YA 2DAQA 1W2BS 4FF1A 3GJSB 1GX5A 1LK7A 3R9LA 2DR8A 1GFCA 1UTAA 3ILJA 4LFAF 2O4XA 1AZSA 5KFNA 5KFOA 4OB0B 2DO0A 3W65A 1S0VA 1OV3A 2RIJA 4WPAA 1KTQA 5AE1A 1VK8A 3CCVT 3BR8A 4PG7A 2OPSA 4ZP8A 1UFLA 4DEXA 4XTZA 4Y2MA 2IVMA 4DZDA 1WHYA 3MM9A 1UFKA 5CCMA 2DTHA 4ZVOB 1NU4A 3RR8A 2VXEA 4PJOB 1OSDA 4RTUA 1D09B 4NMLA 3GSDA 1S57A 3OR1B 1U1RA 4BY6B 3W9HA 1RWWB 2W2NP 3GG1A 3MM8B 5IXUA 1VQKT 3BQ1A 2VUGA 5D7UA 3AQPA 2ZWPA 3SI8A 2CJYB 4LDXA 4NCBA 3MO8A 4WYLA 3I32A 2LCLA 4C0ZA 4LF7J 4E7ZA 4L59A 2J6KA 3V6DB 5AXNA 4J91A 2QA4G 3KK2A 3HFKA 3EYZA 2D3O1 2DIQA 3UF4A 3CMAS 2DBKA 2DH7A 4ZPVR 2NXJA 2VDHA 4CC3A 4IG3A 2Z2ZA 3BBFA 1KK7A 1HFEL 2K1RA 1HIYA 2AZVA 5THWA 3D5MA 4M4ZA 5IAYA 3Q8SB 1RWUA 2VBWA 5J1PA 4DL3A 5HCKA 2RQTA 4F36A 2E1HA 1S79A 3I56S 1RT4B 4ILRA 2LU1A 1M4ZA 2B8QA 4I64A 4TU9A 1Y5IB 4E47A 3R6GB 2EBPA 3EXYA 1G83A 5M2PA 4URSA 1RTDA 4HXJA 4TLQA 2IPOB 1U2FA 1IBKJ 3JYTA 4LUDA 3MR6A 1S5ZA 2GMHA 4J7CA 4HKQA 4X66F 2MHEA 3QFWA 3NAIA 1UGSB 2I0NA 5GAN6 4PLIA 3U1LA 1JLAA 3DRPA 2HHWA 1S1NA 1RHQB 2E10A 2KI2A 4DL2A 2IC3A 2YPZA 2OPQB 2KT3A 4PG5A 4QCLA 2FB7A 3BH7B 2VHGA 1R31A 2DTIA 2VKNA 2CG8A 4IFYA 4DLEA 2M5YA 3TQEA 5FWCA 2BW2A 1VI7A 1VQ9Q 1U09A 2BRLA 1FKOA 5BJRA 1QCFA 3QLHA 5ETQA 2CP5A 4LNPA 1VQ5A 4QYZK 3VGTA 1HL6A 5GJWB 3DGPA 1S72Q 1HBNA 4NYOA 3MMJA 1WXUA 1X4CA 2G3RA 3SFMA 4P2XA 2FC9A 1T02A 3W7BA 4FW1A 3KKFA 4MFBB 2XCAA 3LF0A 4P5NA 1WOOA 3V81A 4O6JA 2JVRA 3TANA 2DHAA 5KFWA 2C2NA 2E12A 2WW8A 2GAHC 1FRKA 5DLOA 1C0UA 4CWBA 2EKOA 2XGPA 4C8QB 2CUYA 3JCMc 1LFWA 3UA6A 4DQIA 3EGVA 3EG9A 3G6ET 1VIEA 5CKHA 3L09A 2BM1A 1W70A 1HBOA 1ZAVA 3VAHA 2BACA 1VQ8Q 4LF5J 1MMGA 2EVRA 4MKYA 5G0RB 4ZN3A 2F2WA 1I07A 2ROGA 3TO8A 1HNWF 3QIPB 1W7WA 4Q44A 3IQLA 3H0IA 3EG1A 1IVZA 1NK9A 2KKHA 2C2EA 1UWBA 4R8UA 4P74A 4MAKA 5I42A 4HDHA 2EG1A 4QU6A 3LGFA 5L1IA 5KYWB 5KFZA 5IHNA 1SL2A 2IVFB 5IM0B 2ZPGB 1VQNT 4KY3A 2E1MC 1XR7A 2BABA 2LCSA 4J9RA 4E98A 4C11A 3QO9B 3FJ2A 2RRAA 2Y1JA 4Q8FA 3G71A 1SJ3P 5HL7Q 2EFOA 1QE1B 3KLVA 4ECZA 1AZGB 3MGJA 2HVZA 1R0AB 3C8YA 2F8HA 3Q86A 2K06A 5HMYA 2MTLA 4BDYA 5E41A 1WHXA 3JAMU 4OFZA 2OFGX 2LRQA 4BS2A 3NMRA 1IQTA 1H6KX 2V68A 2VH7A 3OYDA 3K5LA 4ZLNA 2DD4A 4ENOA 1E6VA 3SCJE 2KRRA 2A7YA 2M4MA 1U02A 3TEGA 5KOWA 3MTJA 5DLFA 3I0SB 4LMZA 2XBPA 5KFQA 2P9GA 4PK4A 4R5PB 2RHUA 1WXBA 1T03B 2L41A 1VQ5S 4RTZA 2DNRA 2N3OA 3EE3A 5F9NA 1WACA 5EG2A 1QAXA 1S72T 1CJKA 4DHVA 1A0OB 4FU6A 2W2OP 3N79A 4CT8A 2XQCA 3SDEA 2ZD1A 3C6UA 3A1YG 1RHJB 4M7DC 2BV3A 2CQGA 3UR0A 1WKJA 5DM7R 4WP8A 2MKCA 5DM6Q 3UNYA 4CLYA 1RI7A 2XS7A 1IB8A 3TUPA 1IKXB 1MHNA 4JI6F 5AJ3F 3EZUA 1AWOA 3CCET 2DIUA 1RUSA 1HI1A 1PG5B 2C3UA 4P9SA 3C46A 1XNQF 4HCKA 4FF2A 2CT4A 3OSVA 2UUBF 4TNOA 4EMKA 4N56A 2ERRA 3GZ7A 4AUKA 2VOOA 4LVNP 4R0EA 1FWZA 1VQ8T 1X01A 1IHWA 1AWWA 2D8HA 3GNFB 1KNZA 3MEEB 2K3YA 4ED4A 2KDOA 2FHDA 2YVSA 4ER8A 3CB4A 4Q45A 3M9OB 1EKRA 3MAQA 2FLLA 2BJ1A 2YHTA 3QZ8A 2KU7A 1JX4A 2LXIA 2E44A 2F63A 5GAN5 1SHGA 1Q7YU 1D9DA 1F60B 4DI6A 3VS1A 3G71S 1RXOB 3A4TA 2Z0GA 2KT2A 3MM6A 1Y0MA 2H8HA 4C8MA 1N0UA 1TKTB 3HZGA 5CYQB 1YI2A 3EZ5A 3MF5A 2ZVIA 2ZKTA 3MMAA 4WXWA 1IWGA 1U8RA 4QPTA 3CULA 1KD1U 3MM7A 1K4US 2KEAA 4J9SA 1G3YA 1T95A 2MLYA 1BKBA 4A4EA 3SEOA 3EG0A 4A8YA 5CAAA 1RP5A 5D6YA 3LANA 3SIPB 3E9FA 2M8DB 3OYHA 1U48A 1QP3A 3OR2A 2FDNA 2YQ0A 5FW9A 1R8AA 1FDNA 2JRSA 3I96A 1H2VZ 2ALYB 1FJGF 1ZSZA 2DX1A 4NA2A 2KFYA 2WHOA 2ZVSA 1S1VA 4NX9A 1M1FA 1QVPA 2COWA 3HKSA 3KNAA 5EUHA 2DXUA 2DXTA 2HRYA 3U1MA 3I5AA 3BDUA 3KLFA 1KQ1A 2EFQA 3GFYA 1YBUA 4PFZA 3FBFA 4HH0A 2D74B 4NXNF 3GYNA 4DWIA 3CEYA 1U24A 1U49A 4I1TA 1FRHA 1WF1A 1MMDA 4DMZA 3H5SA 4F04B 5KAKA 2LP5A 5K14B 3MPWA 1D1CA 4DDFA 1FO1A 2VVKA 3RZAA 3RKXA 2YLBA 1JK9B 1KQ2A 1UVIA 1RBAA 2HRTA 2M8HA 4OF1A 3QYHB 3WBZA 3V4IA 1GCQC 2KB2A 4DU7A 5DRKA 3G4SQ 2HEKA 1IXDA 4U9RA 2NLUA 5GAGI 2IIHA 3IM8A 2H1YA 1Y9OA 2UZAA 5AT1B 1HR0F 3MP1A 1M1KC 4QZVB 2E5QA 3QJPA 4L76A 1J5EF 1HNXF 4DR6F 1VQMQ 3ZBDA 3T19A 2E65A 4Y2AA 1G3TA 1GEHA 3GFXA 4KQZA 2IG0A 2RNEA 1GMUA 3S8SA 1ABQA 4J5OA 1B34A 3PDNA 2DO4A 1YI2S 5KFJA 2EK6A 4F7UF 3UCUP 2F2VA 5LJ3Y 1WNEA 2WTFA 1I6JA 3NMAA 3RKWA 1FDAA 4C97A 2RS8A 1VQKA 2BJDA 1HNVB 4M7DA 2KTQA 3JCMb 1NXIA 3WC2A 4DFKA 4DZ6A 1I51B 2D3OR 1KOOA 3IAS9 3TQ7P 3NGPA 3QXEB 5E33A 3NCQA 4F25A 4DUZJ 1FFGB 2G9OA 4K4VA 2V8KA 2DNOA 3M32A 4RZRA 3QRPA 2HHPA 2CP6A 1WHVA 2K4YA 1KC8U 2MY7A 5EDWA 2CFXA 1FD8A 3P8HA 1M1HA 1P6TA 1ZHIA 1OOTA 2LXUA 4ZPAA 4Q2MA 4JS4A 2XYGB 5IT9E 3P5BP 1VQYA 1URNA 2V4JB 3S6EA 1FKPA 4AFZC 4X9CA 1N34F 2XMJA 4BBYA 4NLPA 1SQGA 4GKKF 2CJ9A 1BC6A 3UPUA 2VPYB 1PYOB 4UTGA 3EPIA 5CIUA 2J5AA 4ORZA 4M7DD 4EFAC 3CCRT 1LWEA 2IBKA 4WIIA 3OBWA 1YK9A 1HI0P 5HLFA 2EC0A 1M9SA 2QTXA 1KFZA 4FZVA 2ZFHA 3OYJA 3BGOP 3R5DA 3AXMA 1F6TA 2HAIA 2M0YA 4TXSA 4HACA 3G4ST 5C24B 3PVXA 3EGXA 1NKBA 1W1FA 4A54A 1LJOA 1VDHA 4OHYA 4U7UD 1CULB 4WTYA 2PZ1A 2K5FA 3HFOA 1Z1ZA 3S3OA 1GMVA 3W2VA 4HCCA 2HYIB 2LEPA 3TJ9A 3CMQA 1NPPA 2XMWA 4B3RJ 1SRMA 1TXQA 1WKKA 1F5AA 5A76A 1MV3A 4IUQA 3P49B 1FJ7A 4FT4A 3CCUT 1M90C 2XK0A 1YCYA 1UPPA 2HEQA 2P0PA 4LF4J 4L73A 3RMSA 1RTHB 4IO9Q 1NZ9A 3J80E 4J9CA 4IG0A 3KK3A 3HKWA 2HIYA 1S6QA 5LJ5f 3AJ1A 3M2UA 3FRNA 1SPKA 4A47A 1VQKS 3G87A 1HQEA 1IKVA 3G8QA 1OSCA 3VAMA 4X2BA 4B9TA 3N0VA 2QMXA 4Z88A 3O8VA 1VQ7Q 4RG8A 5KFPA 3ME9A 5FU7C 3MPYA 2ZDOA 3PTAA 2R5MA 4UY8T 1ABOA 2PVOB 3G6EA 5FLXY 1N36J 3JCMf 3VWSA 1ULRA 2PNIA 4M5HA 3R3TA 2D8JA 1U0HB 4OMLA 1AZEA 1EETB 3L2RA 1UW9A 2M1HA 2G6FX 1HPZA 2DNPA 3TU4K 3MEGA 3R97A 2JXBA 2VOPA 1Q0NA 4WFNQ 3C0CA 3KXTA 1S0OA 3HHLC 2Y3YA 2WSEC 2YXYA 1Z2LA 2F5GA 1QVGP 4YB1P 1ARKA 2DISA 2V1RA 2L89A 2HQDA 3UW1A 5KFXA 2V1QA 1NBEB 1VQNA 1OX9A 4PL6A 3KMSA 1N5VA 4WFXA 1MWYA 2IJNA 1EJ7L 1VQPQ 4IR9A 2MWPA 4NLTA 2B4OA 4USUA 4PJJA 3VCDA 1TMMA 3EAEA 1OWXA 4DQPA 5DDOC 3A8MB 3K8VA 3HF5A 2DVJA 3ZTPA 4K0KF 1Q4RA 1FKAF 1Q82T 1K0SA 3BKFA 2J6TA 4RNNA 1D9AA 2R2UA 2M7SA 5CH7B 4HVVA 5HY6A 3JCMW 3GILA 2RN8A 2ZUAA 2KJVA 2LKZA 1D3BB 1KRPA 4OVAA 3LUYA 3B8HA 3DB3A 4AYBD 4DJBA 1WDTA 1C1CA 5IV3A 4HI2A 5CCAA 2DRDA 3QAUA 3GNGA 2YXLA 2YWWA 3ELHA 3NBPA 1RCXB 3V6KA 3OY9A 4C48A 4HLBA 4U7CA 2YWFA 4J7FA 3EFOB 1PCXA 1KP6A 1KS2A 1JKHB 3DMJB 4YR2A 4Z2XA 4OB2B 3LAMA 4F2RA 2CPJA 1ZM3A 2VUBA 5RUBA 3KG1A 3POTA 3CCEA 4ZJQA 2NLWA 3D3CJ 1S0MA 4RKUE 2Q43A 3THTA 1RAOA 1U6ZA 4URGA 4USTA 2BR0A 3G6ES 2AKWB 2D9TA 5KOXA 5I3UA 5L39A 1U26A 2IYGA 4CO5A 2JUFA 3RRHA 3UA7A 3TREA 4TVAB 2JHEA 3TA1A 5HK4A 3PKMA 2XM3A 2R2SA 2FVQA 2DNUA 3R27A 1O0PA 3TEEA 4KHRA 2ZITA 2DNQA 4DV7F 4IUVA 4QIGA 2QK0A 3NS7B 1Y5NB 2GTJA 1XMQF 3Q89A 3W3SA 3KNGA 3CO0P 5CD4A 1QLYA 5IN1A 4ZPDA 4Q5WA 2NREA 3MAHA 4GMKA 2NZ4A 1UHFA 1KDNA 2YDLA 1YJNT 2E5JA 1VQNS 1K73T 3WC0A 2J9EA 1Q5VA 1LKZA 3N28A 4D8DA 4ZGJB 1VQPT 4B3OA 4OZLA 2HZYA 2A2DA 4C92F 3KLGA 4RW4B 5E3QA 2ILZA 2GC8A 4CTAB 3EGNA 2MKYA 3IBWA 5I2SA 1KLMB 3ITHA 4C8KA 2C3OA 2YTCA 2F1FA 1ELOA 3EGUA 1WHWA 5HJXA 2GMLA 4JRPA 5KG7A 1RHMB 2MQ8A 2NXNA 4X4RA 1OPIA 4A8KA 2ZOFA 1CJTB 1IKYB 4FYYB 1YWOA 3VHQA 4KBMB 2WONA 1OZ2A 3A5ZB 1U2RA 3QYYA 1HYOA 4ZHRB 4RMOA 2WACA 3UE2A 4H54A 2FGCA 2AP6A 3LO3A 1NJIC 5IXBA 4DX5A 3MR5A 4XU0A 2FEIA 2NR0A 2IMOA 3WVDB 2QJ3A 3VVTA 4U67Q 4X4VA 2L2PA 1NRKA 2ZE2B 2HURA 2V4RA 2OEMA 1DQ8A 3G6XA 1K9MC 4F7VA 1ITPA 3BN4A 1TKZB 5KFRA 4J9NA 2R7WA 4B9SA 2UP1A 4HR2A 4DV1F 4QOTA 4J9BA 1PCAA 1SC6A 4JI7J 2P8IA 4DF4A 3CCES 4QQDA 2K2VA 4N77A 1R6YA 4LFBJ 4ECRA 3J7Z5 5HROB 3RUXA 5BR8J 3QHSA 1XWLA 2JL9A 4PEOA 4EO8A 2KQWA 1MGQA 1OYDA 2XI2A 1HYSA 3KLIA 2Y0BB 5B0GA 2KT8A 3M7VA 3L4BC 3A8KA 3N6LA 4RNFA 1IBCB 3KLHA 4LF8F 3UVJA 3FIFA 3BH6B 4ED3A 1QAJA 1BUXA 1OY8A 4KULA 1BXNA 1HMVB 1U45A 4B9NA 1YQHA 1F5BA 1YWXA 4F4XA 2I1RA 2QI2A 3TAPA 1VS3A 1MW7A 3BREA 4DR4J 2O9VA 2DF6A 4ZDNA 1KQKA 2JTMA 2QYCA 3DOMA 3PW0A 3HZEA 3IA0A 1JNZB 2EW3A 2DITA 2O4XB 1AZSB 1UHCA 3DYAB 1VQSA 4F0KA 4YB6A 4JV5F 4LDWA 3BQ0A 4OYZA 2LDYA 4CCHA 1PAUB 2B7CB 4AFFA 4M78C 4CZCA 2XMFA 4J8OA 3H25A 2POKA 2QEXQ 4JV2A 3FGVA 3IWNC 3PRDA 3MM9B 1TUCA 3THKA 3BF4A 3B4MA 2EJ9A 3CJ0A 2EYXA 4B3MJ 3EWGA 2A10A 4HCBA 3MOJB 2BX6A 3CD0A 1H73A 2IAJA 4PFOA 2QASA 4LRDA 1U1MA 3GFZA 4M75A 1PNJA 5D0EA 4DOZA 4YOEA 3NS6A 5KT6A 2ACYA 2J7UA 2KY9A 4A8WA 2M88A 1X5OA 2YNIA 2MQMA 3K57A 2VD3A 3IFEA 2BM0A 4FNHA 4B3TJ 2ZPEB 4ZITA 2G0CA 2LQBA 3U02A 2GQQA 3OB9A 3HP9A 2QFJA 1DZ5A 5KCOA 1ZA2B 3HFNA 3UR3C 3PIOQ 3JB9F 3TCJA 1ZOTA 1K73R 1WELA 4PWDB 5LJ3j 3HSZA 2FY1A 1O8BA 3V8LA 2DH9A 4N4GA 4IG3B 1JLQB 5A2QY 4R0KA 1K8AT 3S3MA 4DA4A 4M7DE 1HI8A 4XTTA 3TQ1A 3CF5Q 2DY9A 3CCRA 2R7TA 3THVA 2P6SA 3PR5B 5B0DA 3HP6A 4BHQA 3KK1A 1WC5A 4ED7A 2AKKA 5GAOp 1CLFA 2QQBA 2L9DA 1RTDB 2UVVA 2ZHOA 3M2RA 1X9WA 2X4XA 4OP0A 3JYTB 1C0TB 4JJDA 3OYAA 3FMWA 4DBQA 3JXOA 4ME7A 1FERA 2B9XA 1UEBA 3HJFA 2FVRA 2VG5B 3MMCA 3VUBA 1JLAB 4LD9K 4OYMA 2YKAA 3MCMA 2CT3A 4M7DG 1WG1A 2IC3B 3OBYA 4MK8A 4O44A 1YG0A 3UPFA 4CH7A 1G8XA 1T94A 2WSCC 2RMOA 2G2OA 4IFYB 2WOMA 3CCUA 3HRUA 1E6GA 3GSIA 1RTJA 3B78A 4KRWA 3K5NA 4JV1A 2UXCJ 2EWNA 3W8PA 2RQVA 2GV1A 3M9MB 1NSKL 4F2SA 2LECA 3PYGA 5K20B 4LSZB 3G2XA 1TL5A 3TUZC 4PJNA 2JC1A 4CLLA 1V76A 5LMNF 1I94F 2KGTA 1RI0A 4H4MB 3GIIA 4Y28C 4A8OA 2DXDA 3V81B 1G2EA 1CS4B 1SH2A 1M3AA 1RT5A 1GH8A 1LW0B 1RUWA 3PFOA 1X9MA 2CPYA 1GK8A 3AFGA 4DQRA 3SD4A 3KJQB 1FWLA 1C0UB 2YPYA 5CKEA 4ZCLA 2E4HA 1E6YA 2CQCA 3DCAA 2LEBA 3T1YJ 1RAJA 4XTUA 1SJFA 2QAZA 2LQ9A 3L7PA 3MAAA 2CNLB 4ZP6A 1ZZFA 3HLUA 3OTCA 3IR7B 3CC2Q 5M2UA 4AFUC 3CJ3A 5HBMA 3RYLA 2HHHF 1BIBA 2ADBA 1UEUA 1RACB 3BJYA 1UWBB 4X65J 1UTIA 3CCRS 4I0WA 3SWNA 2VU5A 1D3WA 1LK5A 4GKJF 2Q66A 2F3JA 4MKAA 2HSPA 4ZKAA 3R2DJ 2HWHA 4KHPJ 1G1XA 1BU1A 4Q2LA 4J9OA 2DR9A 4X84A 3T1HJ 1PC0A 5EC7A 3PHTA 2FO0A 1JLCA 4C0DB 3VV2B 4C11B 1MN9A 4DF8A 3QIIA 5A8RB 1JEGA 3OXLA 2HBQB 4AL5A 4UZBA 4JBCA 3MPVA 3CJKA 2FYXA 1SL1A 1S48A 4YDXA 1IO6A 2LT4A 1DFDA 3W9JA 4NLXA 3A13A 2CAJA 1AUSL 1SIWB 1ZAWA 2DXCA 2ZH4A 3MD1A 4WJBA 5C2GA 4MTPA 2DRBA 1R77A 3RERA 2CZ0B 1Y4ZB 3L7OA 3W61A 1WOSA 4PXDA 5E3PA 2HHUA 3CCUS 2DNGA 4FXWA 1JXOA 2CZ9A 1S10A 1KSWA 4M7AA 2HGNA 1JLEB 3KUHA 1UMJA 2V94A 3HD2A 4YFUA 2XD0A 2UUAF 3LH0A 5IT9U 2K2PA 4O3RA 1WXTA 1LXJA 2UXDF 2KE9A 2OTJQ 3M30A 4PJMA 1F5CA 4CLWA 3M58A 3E01B 2EK1A 1Y3JA 4EDUA 2C1EB 2O2OA 4P73A 3NP5A 2DLPA 1VBXA 4TN2A 2R42A 2HDAA 1B7YB 3TVKA 1SBRA 4JI1J 3HRTA 2HD0A 3PRVA 2FD2A 1GMWD 2HS4A 2QA4T 4I2PA 4ETZA 5BXIA 4M7AD