3UDCA

Crystal structure of a membrane protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
b'YDIKAVKFLLDVLKILIIAFIGIKFADFLIYRFYKLYSKSKIQLPQRKIDTLTSLTKNAVRYIIYFLAGASILKLFNIDMTSLLAVAGIGSLAIGFGAQNLVKDMISGFFIIFEDQFSVGDYVTINGISGTVEEIGLRVTKIRGFSDGLHIIPNGEIKMVTNLTKDSMMAVVNIAFPIDEDVDKIIEGLQEICEEVKKSRDDLIEGPTVLGITDMQDSKLVIMVYAKTQPMQKWAVERDIRYRVKKMFDQKNISFPYPQMDVNFKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small-conductance mechanosensitive channel, C-terminal pepti
publication title Structure and molecular mechanism of an anion-selective mechanosensitive channel of small conductance
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Membrane protein
total genus 79
structure length 267
sequence length 267
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00924 MS_channel Mechanosensitive ion channel
A PF00924 MS_channel Mechanosensitive ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3udcA02
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3udcA03
1WD6A 3HFKA 1XBWA 4Y2IA 3CJKA 5F0UA 3TNVA 1VIFA 5B0EA 5A6PA 2RK2A 5B0FA 3MCSA 1OPZA 5A6WA 2PGCA 1MWYA 2BJEA 5B0GA 3BF4A 5T7LB 1KQKA 3KNGA 1V3ZA 1K0VA 1LQ9A 2OKQA 1TL5A 2OFGX 1OQ6A 1VQSA 2LQ9A 1FESA 2Q3PA 4HL9A 2KT2A 2QLWA 3UDCA 2OFHX 2XMMA 2XMUA 3FRYA 3HDSA 2P4TA 1X8DA 1Y0HA 1Y3JA 2W4CA 3FGVA 1YRXA 4HH1A 5KAKA 1URRA 2K1RB 3F44A 2AJ0A 1N5SA 2BJDA 1RJJA 1AW0A 1GXTA 2FB0A 2XMVA 3HF5A 1TZ0A 2LQBA 2ZDOA 3FMBA 2AP6A 1FE0A 4HI1A 2N7YA 3HHLB 3IWLA 3KKFA 2IFXA 5B09A 5F0WA 5B0CA 1OSDA 3BGUA 3K7RA 4YDXA 2OP5A 2K2PA 1Q53A 2RSQA 3T9NA 4OJ3A 2HLUA 3BM7A 2RH2A 2L3MA 2CRLA 2OAUA 2RU9A 2XMKA 1JWWA 2BYCA 2AW0A 5B0DA 1P8GA 2K7JA 1R6YA 2HFNA 2HLTA 1Q8LA 2HIQA 3QMQA 5K9FA 4HI2A 2GFFA 2KYZA 3BDEA 1VQYA 2W4DA 4OJHA 4ZA1A 4NL5A 1TL4A 5B0BA 1FVQA 2ROGA 2GO8A 3MZIA 4DL0C 1FVSA 4YEAA 1ULRA 2LDIA 2QYCA 1S6OA 5T7LA 1AFIA 1FE4A 2GA7A 3QGPA 4QOTA 2RMLA 4OIXA 4Q2MA 2K7KA 1FD8A 2N4CA 4Y2MA 2GQVA 3WDOA 2GV1A 4Y2KA 1TUVA 2HFOA 2VV5A 2VH7A 1MWZA 2JDJA 4DN9A 1Y3KA 1Y9OA 2ROPA 3DXSX 2BBEA 2ASYA 2ROEA 2K1RA 1KVIA 2XMJA 2PD1A 3KG1A 3LGNA 2ZDPA 3TOQA 3CJKB 1KVJA 2GGPB 4A48A 2KKHA 4EFAC 5IXUA 2FTRA 4DPOA 2N4DA 2KT3A 1YG0A 4HH0A 3HHLA 2G9OA 2BUNA 4NPOA 1SI9A 1N5VA 3LGMA 4FNHA 5B0AA 3SFMA 1Q4RA 2GCFA 3DCAA 1CC8A 4OJ1A 1IUJA 2GGPA 3HHLC 1VIEA 2QLXA 2IYGA 1OQ3A 3HX9A 2QIFA 3KG0A 2FIUA 2AJ1A 2IYIA 2OD6A 3I9ZA 3BB5A 2RILA 2ACYA 1JK9B 2XMTA 3HHLD 3IWXA 2LXFA 1YJTA 3BN7A 4Q2LA 4A47A 4U9RA 1YJVA 1SQEA 1TR0A 1X0PA 2FHMA 2HQIA 1AFJA 1APSA 1S6UA 1N5TA 1CC7A 1SB6A 2OD4A 4FNIA 2OMOA 3GZ7A 1U7LA 1W2IA 1FEEA 1X7VA 2W4PA 3TRGA 1QUPA 1CPZA 1GXUA 1Q8BA 4OJGA 2EW9A 3VTIA 4F67A 5B08A 4A46A 1P6TA 1YJRA 4A4JA 1N5QA 3LO3A 3E8OA 2XMWA 2RK1A 3BR8A 4ZOSA 1YJUA
chains in the Genus database with same CATH superfamily
1S97A 4FN5A 2IG0A 2CQ2A 2DR8A 2EYWA 4ED6A 2IRXA 2IM3A 2OFGX 4GMKA 1FRMA 4IOAQ 2L48A 3AOBA 4OZNA 2XULA 1PSFA 3HHLB 3GV7B 2HKEA 3K17A 3RKYA 3GPLA 1BUXA 5A8KB 3BQ0A 3PTAA 3V4IA 4TY9A 2V5HG 3PNIA 3JTOA 1RAHB 2MPUA 2QEXA 1GT8A 3L2QA 1UA1A 4DR5J 3AJDA 4DF4A 3ULHA 3IA0A 1TK0A 4NEYA 3VGVA 2MQPA 3DRYA 1PO6A 5IXUA 4RUAA 4DV1J 2W01A 2UUBJ 5DQHA 3P5TL 4WF2A 3W2WB 2UUAJ 4F26A 2Y90A 4J9GA 4OI4A 1BWEA 4ERDA 4WPAA 2R4FA 2HL5C 4JUZA 3BH6B 1VC5A 3WIVA 2LMJA 4X66J 3T3FA 1OU8A 4ED1A 3CCET 4JYAJ 3OYGA 4YMEA 4S0MA 1JLAB 1QSSA 5M9OA 1HXDA 1SH0A 2BOAA 2WVFA 1U1SA 5D77A 3M8WA 3TA2A 1Q81R 3KLIB 4L3KA 1PD0A 3HPWA 4EPCA 2UV8A 1HBNA 2MKIA 2MKKA 2AJQA 1KVKA 2V2VA 2CJQA 3W9JA 2O01E 5HK0A 8RUCA 2M5YA 2W9BB 2L3MA 4F7VA 4IO1A 1AD5A 1M30A 3JCMX 2HLTA 3LW5E 1XJWB 1RTDA 2OPQA 2J0QD 3J81j 3M2VA 3N0VA 1JXVA 2HBWA 1MU2A 2XLJA 2OSQA 2EFPA 3CCVT 3UFCX 4ZMMA 1DY3A 2ZNZA 5KYWB 4BHQA 3VKIA 3PKMA 1HYOA 5GMKh 3C3LA 3SI8A 4JI5F 4NE9C 3JB9k 3IS9B 1IGUA 2WOMA 1YIJT 1S6QA 5I42A 5AYFA 4DQSA 4NXMJ 3CMAS 1KBRA 1S99A 2E1CA 2M1HA 3I5CA 4JPBW 4DSEA 2JTEA 2QT7A 2IBOA 3DLLA 3AH6A 1BIAA 2BACA 4YOEA 4HT5A 1LEOA 1C0TB 3CJTA 4CM2A 4XTUA 3JSYA 4DL3A 5L38A 3FJPA 1T0HA 1U6FA 4C0GA 2LCCA 4IG3B 2X4YA 3FRZA 3JCMh 3Q86A 2VG6B 3CEYA 3JV3A 2MMPA 3HVAA 2V8HA 1QLYA 1BWVA 4ID5B 5F9NA 4C92D 1IWGA 1IKVB 1ARKA 3I5BA 3RRGA 2D7SA 2DRBA 4P7TA 3M1VB 3M9QA 1PJ7A 2J0WA 3W60A 5A2QY 4KYZA 1YDLA 1ZAWA 2HHXA 5GVQA 4ZPAA 2HNDA 4C9DA 2W8KA 2C3OA 1LFWA 3M0PA 2OEMA 1RL2A 2JC0A 2XMJA 1X2QA 2ZPBB 2K7AA 1T3NA 2RH3A 3QXEB 5HK4A 5H9EK 2VC8A 2QFJA 1LWFA 1PKUA 1XQHA 3RG6A 2W7PA 3EH2A 1S9EA 2P6SA 4J9IA 4FP9A 5D6GA 2VJUA 3TNVA 5HSPA 2CP6A 4LQ3A 3FSYA 4DV3J 3OYAA 2XMAA 2PZ1A 3OYMA 4I69A 1IBMJ 1H72C 2MYFA 2DEQA 3CBMA 2RJCA 3EUNA 4CLZA 4F0HA 4QR2A 2NUHA 3FGVA 4GVBA 2YWKA 2GNKA 1M3BA 2B8AA 1UJ0A 2E9ZA 2R2RA 4GO7X 2J7WA 4DLEA 3PZPA 2RQRA 3O3LA 4TYAA 5HP1B 2DJZA 2NR0A 1VQOT 2KDSA 3V81A 4NL3A 5HROA 2W25A 4NLXA 3QATA 4JB8B 1OZ3A 4K4SA 1SL2A 5CZXA 3CBOA 4X64J 1IHVA 3HHDA 1BQXA 3WC2A 2RDIA 1Y3KA 1KRPA 4BC7A 3UA7A 3UNYA 5DLOA 3JQKA 4LD9K 2HEQA 1FJGF 4LF5J 2SXLA 3CO9A 5LMUF 4RTWA 4PG8A 3KFVA 2HHHF 2WACA 5BXIA 2BQ3A 2OO4A 1X9SA 2KBTA 3PM9A 4XK8C 2ZHAA 3UE2A 4F4ZA 2JEFA 3BDUA 3C46A 2EEYA 4NXNF 2JTMA 5IC6B 1NDKA 4KV8A 3R1HA 2M9KA 3EM1A 4ECRA 2GQCA 4E7KA 2FHJA 1B34B 2JLGA 4I7FA 4DX5A 2DO0A 2YWFA 2JC1A 4HTJA 1XNQJ 5ETMA 2RHIA 3L7UA 1XR7A 1RA6A 2AZSA 1S9GB 3QGHA 2M02A 4IUUA 1NPRA 4KY3A 2W9AA 2WSCE 4DR7J 4IDKA 1FYNA 3CD6S 4YS2A 4RTTA 3QAUA 3NCQA 2LQ8A 2KVQG 4LSZB 2PVGB 2HQDA 5J39A 3LQVA 2ILYA 1U1KA 4ZPWR 2HFNA 1RHQB 4YUDA 4C0BA 4OYPA 2WONA 3EG9A 2DO4A 3L95X 4L72B 2VGMA 3PNWC 1FERA 2PVDB 1KHIA 2RRNA 4FYDA 1LK7A 2RUGA 4A63B 4ED5A 1SF9A 4IUTA 1YHQT 2IJFA 4M77A 2COYA 3JSMA 1RGVA 2QQ9A 3PHEA 1EETA 1IN0A 4K11A 1UAWA 3HX9A 3SYZA 4K4UA 3CMAQ 5HN0A 2VQEJ 4A47A 1N48A 2DK2A 2EVRA 2QI2A 1FKOB 4ED8A 2ZVIA 1N8RC 1K9MT 1N8RR 2N82B 2KG1A 2YPZA 3W8PA 3KK2A 3CCLS 1RACB 4KRTA 1VQ8T 4WXOA 4C3KA 1XNRJ 1I81A 4NZ7A 2YKPA 1HWJA 1O9SA 1X31C 4DBQA 3HHNB 2XGPA 2Q3PA 5KG1A 4LSNA 1KQ1A 1IKWA 4JS5A 3O44A 3OL7A 1YWXA 2LEBA 4RW9B 3SDEA 4OMLA 4FXDA 1KQFB 3UN2A 3UWTA 4K8RA 2K3XA 2GFUA 3GLXA 4W98A 2YNFB 5KFUA 2EBEA 1HARA 4X4PA 4PKCC 5FU7C 4DSFA 4RUGA 3QGPA 5K14A 4NS5A 2VJVA 1IB8A 5KFEA 4L59A 4KH0B 1VRUA 2PTKA 1O6XA 2R8JA 2KT1A 3UCZP 5FDLA 2I1RA 1Y10A 3VRYA 1JJ2S 2X35A 5DGBA 2UVWA 2XGQA 2NUZA 1H8KA 3R2DJ 3W63A 4Y6IA 3GP8A 1SCJB 1QVGS 2MEWA 2HG4A 1WQ7A 2B8QA 3AB4B 1V5IB 2ZE2B 4QWCA 3G6ET 3QIIA 4DA4A 3AQOA 3RU0A 3VVUA 4Q7AA 2CA9A 2XS2A 4VUBA 3EFSA 4ZS6A 2DRKA 1LWEB 3T1YF 2ASDA 1D09B 2QTVA 1TU0B 2ZBQA 5B08A 2C2RA 5EG2A 4CDIA 2Y8WA 3L3CA 1KR4A 3ISZA 3DOLA 4P5NA 3HZGA 1BB9A 5CCLA 4O6JA 4LQ9A 3LW5C 2CJKA 2HL3A 5HQ8A 3L42A 2XMFA 4AL6A 5DG9A 3GQCA 2UXBJ 1FE0A 1VQNA 2L08A 5M2RA 3KXDA 1GEHA 3L2RA 2IFXA 3L2UA 3CCST 2CZVC 5LJ3h 3OFEA 2XD0A 2YQ1A 2FRYA 1I94F 2HCKA 1UVLA 2FRWA 3QWYA 2MKHA 3U7JA 2H9ZA 3SSQA 1TUCA 2HFOA 1Q1KA 2ECZA 2AEFA 5FRMA 1A9NB 1WEXA 5EWGA 2PD1A 1HWKA 5KE2A 3OTBA 4A48A 1BMQB 2LECA 3V4MA 2BW2A 3DLGB 4DG1B 2DHGA 3FJ5A 5BYQA 2L3SA 4IUQA 1K9AA 2LJ3A 2GVDA 1FDAA 4QVDA 1TVRB 1UPPA 4B3MF 5F8JA 4PG7A 3T6BA 4WKYA 3E19A 3TJ8A 3W9IA 4XTYA 1TFWA 1C1BB 1W70A 4HCBA 1WEZA 3S3OA 5IQ6A 4LRAA 2DIQA 3NCPA 4TKTA 3VYHB 4ZP7A 3CJKA 3NBPA 5EWEA 4ORZA 1QJHA 1D1CA 1WHMA 3TO8A 4M5HA 1REVA 3ISNC 2EGCA 3PIPQ 2F40A 4LD6A 2W7OA 2J7IA 1FX7A 5F3ZA 2DAQA 1TL3B 3CD6Q 3OS0A 2CZ9A 5F8IA 2DHXA 2YNHB 2R58A 4QWBA 4JDSA 1RTJB 4DR3F 4DV4F 3OSNA 2GQIA 2ASLA 3TI0A 4QQ6A 1WNEA 1UVKA 1IWAA 4OJHA 4NL5A 1X6BA 1FVQA 1O5JA 2OEJA 4KGKA 4B3RF 1M90R 3ZZ0A 1M1HA 1RT4A 2EKYA 3JB9F 3TJAA 2EFGA 4BI4A 4DSJA 4XTXA 4FPRA 4IFYB 2M8DB 2G9OA 3PHTA 2DNRA 3IP0A 4DPUA 4FYVB 1YJWS 3IWXA 2XSFA 4HDGA 4M5DA 3CCQT 4CTAA 3C2PA 1CC7A 3LPYA 4UQTA 4O3QA 2EKNA 3CCLQ 3EPGA 3VS7A 4PABA 3D6TB 3JCMf 4WFNQ 3R97A 3GPAA 4A4EA 2QA4T 4LF9F 3CCRT 1H6KX 1ZBTA 1RU2A 5CYMA 1PJ5A 3G71S 4GY5A 1Y0HA 3MP8A 3AY0A 3CJ5A 3POTA 2JOYA 4PJOC 1KIKA 3V6KA 2D69A 1NK5A 5EC7A 3EXCX 3G6VA 2KHDA 3O6QA 4WKRA 3C6UB 3EZOA 3GONA 3LX7A 1FFSB 5DS7A 2LNHB 2LQKA 3M53A 3MM6B 2NPFA 1HNVB 1KSPA 3TWZA 2IM2A 1FE4A 2V1RA 4BUGA 1TMJA 4CYUB 4MMOA 1GK8A 2Q6CA 1T3OA 3JSBA 2KXCA 3VYGA 4LUBA 1AROP 3QJJA 3G8SA 1AT1B 1YZ7A 4RPFA 2OJ2A 5KYUB 3ZXWA 2CPEA 4LRDA 4U8VA 2CT3A 1BU1A 4IH5A 4PCQA 2YUQA 1NK0A 2LFVA 2X3DA 4H4MB 3M9OB 2FVQA 1VQKQ 3WQPA 4CLFA 4JRIA 5D0EA 1N6QA 2P8IA 1HYSB 2ZM6F 2HFUA 2DD5A 3CCUT 1KKHA 5DG7A 3CO0P 2P6TA 1K9MU 3D3BJ 3MEDB 3EFOA 4OMMA 4JI8F 3D6MB 4DSKA 5FJ4A 4C92B 3RAXA 2ASJA 4L76A 1C0UA 5IT0A 3CC4T 5D15A 3L1AA 3JTPA 4O4GA 3WXMB 4HACB 4NZ6A 3H98A 2HHTA 4MKBA 1R8HA 5FU6C 3SFGA 2ENMA 2W4CA 4OX8A 1AWOA 3X26B 2IM1A 4JI2F 1WHXA 4WWSA 1AW0A 4C97A 2MQMA 3G1JA 1TZ0A 2A08A 4DV6F 5HKCA 4JI5J 2IIMA 3KKFA 4C92G 2YKOA 4K5SA 2CQ4A 1MMAA 3EHRA 4TN2A 1WXUA 1SL0A 2Z2LA 4Y2CA 4Z37A 3K8WA 3HSDA 1SKSA 2J0XA 2W2MP 3L2WA 2PDAA 3FEOA 4Z2XA 5T7LA 1QKWA 4QT7A 4GC7A 1RQ0A 3HVRA 4JV0A 4M78E 2HBQB 1UUEA 2K1RA 4B17A 1LCKA 4QPXA 1E6HA 3G8QA 2BZXA 2JM8A 4EFAC 3X24B 3PX0A 4WU2A 1U02A 3I55A 4E98A 2HVZA 4ED4A 2DJWA 2V4JA 4FBTA 1C2PA 5GAN4 4KIAA 3HHLC 4CO4A 4K4XA 1QSYA 2RB7A 4QIVA 3JB9G 4FL6A 4J9QA 1AZGB 4NMXA 2E7WA 3MD1A 2CJ9A 2KG0A 4PUOA 5U47A 3OLAA 1IR2A 4YB1P 3JQMA 1UHCA 2H5EA 4A46A 1WG5A 1CBKA 3BEGB 3UVJB 4OZ5A 4GVLA 4KE5A 1OPZA 3MCAB 4LBPA 4DQRA 4MZTA 1B99A 1TL5A 4RNNA 4QW2A 2NUPB 3IR7B 3Q8SB 3NS6A 3DMJB 3HULA 5LJ3Y 1PKTA 1VQ5S 4ZVGA 1JEGA 4ZN3A 3G86A 3CDBA 1H0HB 3N28A 1RCXB 4A4GA 2B6AA 2R8IA 2HQGA 4CC2A 3CC2A 1IO6A 2M51A 2GMJA 2F4FA 4XU0A 3FB9A 5CK9A 1U1NA 2BA9A 3RKXA 2RQMA 5KOXA 2GFFA 5HI7A 3BDEA 2LVMA 5L1JA 4L6V5 4FW2A 2RDDA 4TU8A 2NS1B 2J9DE 3J7YI 2MSSA 3CJ8A 2B9EA 2M7SA 4OP0A 5I3QA 3DRSA 2KRRA 1T9XA 3M54A 2DHHA 4E7JA 2PA8D 5D3GA 4D3HA 1SRLA 3H0IA 1NKEA 1X6OA 2K3YA 3QPHA 1YJWQ 4BS2A 3EYZA 1NM2A 3UA6A 4A8XA 2QC3A 3DM2B 2A10A 3BPSP 2GTOA 1VUBA 3NNCA 1WG4A 3N5BA 1OPKA 3A8HB 2HZCA 5C24B 4B3OB 3ZZZA 2X4JA 3QFWA 4ED2A 4UF4A 1RI0A 1RKIA 2FLOA 2FY8A 1X4BA 2MTLA 3G71Q 4ZK7M 2FB0A 2RJEA 1S49A 4D6WA 3QSYB 2QA4G 4ZGJB 1FJGJ 5LMUJ 3IRXA 3TUIC 2AD9A 1NE8A 4BWMA 2HHHJ 3CB4A 3W62A 5CD4A 1YBYA 3N79A 3THPA 3AB2B 2KXFA 4CO2A 2C0OA 1GL5A 2BW7A 4OMFB 3PGGA 5GAHU 2RHZA 1S48A 3VJPA 1XK8A 5KFTA 1VHFA 5LJ3e 1JLGA 3Q23A 3TARA 4KT0C 4J9RA 4XDCA 3CSKA 4J91A 3EPIA 2DGSA 4BDZA 1WHJA 3M0SA 3CMEA 2E6NA 2J8SA 3P8BB 1VQMA 3OL6A 2PFFB 3HMJG 3OTCA 3T5LA 2HK3A 3UW1A 3ENAA 3CJRA 4DQQA 4B9SA 4DU8A 4OMFG 3LWHA 5JVHQ 4OZ0A 3BKUA 1VYVA 1TWBA 2FVPA 3PRDA 3IBWA 4R5PB 1AUSL 1VQ7S 1PSDA 1NU4A 4IURA 4FSXA 5CQGA 2RK2A 3S7RA 2XKOC 5DLFA 5HLFA 2GQ2A 1YJ9T 1YJNA 2CPYA 2C3UA 4M7AA 4I6YA 3LALA 2BOPA 4OI3A 1RK8A 2G2ZA 2CPJA 1K1ZA 2V8PA 5LJ3f 3EDQB 1O75A 3E9GA 4IFVB 1F6TA 4CM0A 1JNZB 2ZZMA 2ZC3A 1QWEA 4MDWA 1VC6A 3FJ2A 2B7BB 2DITA 5C2CA 3AD7C 3B54A 1HHSA 2B9XA 3CDEA 4ZVSB 2GVZA 2J9EA 2PEHA 3KLEB 4IOCQ 4BACA 4NX9A 1YK9A 2QG9B 3A8LB 2RI3A 2C3PA 3M8QA 2W8LA 4X4NA 1YCYA 4LR9A 5J2NB 1C1AA 2E5IA 2XWYA 2JDJA 2WHOA 3SCLE 3TUZC 5I3UA 3KG1A 2CJYB 2JX2A 1YQHA 3RUXA 5JUMA 4UW2A 4KH1B 4AYBD 4LREA 2EFQA 1VQ4S 4JJNK 1SBRA 2LEPA 3M9MB 1DLOA 3KG0A 4UY8T 2FL7A 2YNGB 1Q8KA 2FPEA 4C11B 1VIOA 3HHTB 1YN8A 2L3RA 5IT4A 3TRGA 2EAYA 1G8XA 3FBEA 1RA7A 1OSCA 2K57A 3NEKA 4CLSA 4RU9A 4OB2B 3HZEA 4KB7A 3MCSA 1G2EA 1L3VA 1QVGP 1CJTB 4X65F 4M7DF 2OTJA 4G1QA 2ZCFB 4OHWA 2GO9A 2GFAA 1REGX 1EQ0A 1LWCA 1FRLA 2BXJA 2FHJD 2HURA 5KAKA 2E7VA 2DL3A 3G82B 1KG1A 1VQ5Q 4P10A 3T5JA 3HF5A 1UFWA 1DQAA 1CSJA 2L2PA 3M56A 3W5XA 3D6HB 2J6UA 2GIFA 5BR8F 1WSVA 2DVIA 3MFHA 3AODA 3H4BA 2QSFA 3FNNA 2NUUG 4HA8A 3PYGA 4HT8A 1CS4B 4RW7A 1TTHB 1SH2A 2R7QA 3T1YJ 3SWNB 1FEHA 4PXBA 4AFZC 2YWGA 5GAMd 3JAMU 2L0AA 2MB0B 1K4US 4M5JA 4C92E 2HHVA 2XY7A 2RQ4A 5KCHA 4KFBB 4I64A 4M77D 1RAIB 4E7IA 1WI7A 2CZ7B 1KP6A 3M6XA 3BB5A 4ECSA 1MMNA 1ZUKA 4ESRA 1D1BA 2P9GA 3SDZA 1U2CA 4ZKAA 4MTPA 1VQ6Q 2OTLS 1T9VA 3FQLA 4DU7A 1YJRA 2HNYB 3B4MA 4C2MA 4EBDA 4NI2B 1I94J 5E0OA 1HWUA 3KJFB 1EX4A 1FX4A 2QA2A 3IM9A 2IAJA 3ZTOA 1BI1A 3MMAB 3RRKA 1KDNA 4F4KA 4ILRA 1D0YA 1FESA 1HMVB 4CLUA 1TL7A 3THVA 4P7VA 2HHQA 5IXBA 2HAFA 5D4PA 3IG1B 4YTLA 1F0XA 3A8IA 5A2QE 3OQ2A 4C4WA 3CCVS 1M5HA 2BRLA 2RH2A 3ZZOA 3HFZB 2CS7A 2FPHX 1VBYA 2FD2A 4B3MJ 3TZXA 1C4CA 1KD1T 1FKPB 2PMZD 3KLVA 1XMQF 4MK9A 5K8OA 3A8OB 3QAEA 1YIJS 1NSKL 5GAN5 1S0VA 4LR8A 3Q8QB 5J3BA 3G6XA 1E7OA 4J9CA 4XTTA 4WIQA 2ACMA 3A98A 1WWHA 1VQPS 4QQDA 2JW4A 4CLPA 4CC3A 3MMBA 2YX4A 5D6WA 4HT7A 4RNFA 2V1QA 1XTDA 4ZP9A 2I38A 3HSBA 3T5KA 1NPPA 4LF8F 2PMHA 1UEBA 2Z2YB 4TXSA 1U0SA 1Q82R 3M2RB 3C95A 3RBZA 5I22A 1V9OA 1U24A 2H65B 2PNIA 2EQJA 4DL2A 2KRMA 5KYYB 2IDEA 3PIOA 3T1AA 3BPDA 2CDQA 2EW9A 3OQ5A 3SD4A 1B3QA 4DR3J 4DUYF 1R89A 2IC3B 3FFIB 1R77A 4DV4J 2CYZB 3RGIA 2MKCA 3ITHB 2RF2A 2FC8A 1LOJA 2LTOA 2V9KA 1VQ7Q 1QD1A 3AOCA 4MT1A 3SV3A 2VFVA 4M7DB 2P84A 1OWXA 3UN3A 3URGA 1KQKA 2VOPA 4TU9A 1HD3A 4FBUA 1AZSA 4B3RJ 4J9EA 3MAAA 3CD0A 1J5OA 2X1FA 2HHUA 5AXNA 5KFKA 3JB9J 2VFTA 1X4GA 3RW7A 4URGA 1TKZA 4NCAA 5C42B 2Z57B 1WC6A 3IWLA 3DRPB 3E51A 3E01A 1FMVA 2CQ0A 1WF2A 4M7DG 2KSSA 1H7WA 2DISA 5CD4H 1RT6A 2ZVSA 2JVVA 1UGVA 2HS4A 2YKMA 2K3BA 2XB2D 4IH6A 3PYFA 1W7WA 3MPUB 3ILOA 4ILLA 3MPVA 2VH7A 3PTWA 2DXTA 2V50A 3FBBA 2B4VA 2EK1A 4C0DB 1RT3B 4F3OA 3NL0A 1CLFA 2DR5A 4DBRA 4LIWA 5CABA 3UDVA 3DLHA 2D9PA 1RADB 1SRMA 3MF5A 4LF9J 4ANCA 1NEGA 1VQ4Q 3CMAT 2FIUA 2RQUA 1UPMB 2JFKA 1DTTB 2AGPA 5CR2A 3HJFA 2E4HA 2MHNA 1JKHA 3IN5A 4JV5F 3WIUA 3BKFA 1Y96A 3PKYA 1TKXA 4HCCA 2OPRA 5KE3A 2GS8A 3V6JA 3HT0A 1MWYA 3QYGB 4HKEA 4OVAA 2HQFA 3BGRB 1TK5A 4DFPA 4IOBA 1VQOS 1U06A 3QYHB 5HJXA 4X4RA 2D41A 2BJDA 1HBUA 3V4IB 3DLKB 1JMTA 4PWUA 2ZDOA 2E1MC 2HWTA 5L1IA 2YKQA 3BGUA 3MR3A 5LXYA 1TG0A 3CF5Q 3T9NA 2CRLA 4NYZA 3FMWA 1AXQA 2HZYA 1UTAA 3RW6A 4C98A 3JXOA 3OYNA 1OOTA 2QE5A 1SL1A 1JXOA 2DNLA 2DXFA 3PJWA 1YI2S 2V9WA 1FD2A 2KMTA 3GSIA 2ZM6J 2NREA 2NZ4A 1Q16B 3VS3A 3D28A 2ZOGA 2NZCA 4JI8J 2ROEA 3BFMA 1HI8A 4CT9A 1Y4ZB 5J1EB 3LGNA 3TOQA 3JSCA 1RLCL 5J2QA 4WP8A 1R8PA 4ED7A 1DURA 2ZNYA 3JRZA 1N5VA 5B0AA 3M8PB 4IUPA 3NS5A 2VODA 4OI6A 4PFZA 2Y9HA 4JI2J 2V0NA 3OTDA 1U47A 4AL7A 4DV6J 3RKWA 3UATA 3C0CA 3QIDA 2Y3YA 2DERA 5KFPA 3M30A 5EWFA 4U7UK 4HVZA 5I2SA 1FF2A 5C2GA 3TEGA 2PGCA 1S1VB 4DEYA 2JM9A 1EP4B 3P8DA 1HBNB 3HL8A 1QVFS 2QLWA 2QXFA 2CZ1B 2DF6A 3JAME 3UPUA 3ZFVA 1NB7A 4KUIA 1YWPA 4RZRA 3HM9A 4RG8A 2XYHB 3UR0A 4I67A 3EZUA 2OPQB 2NYHA 3M2VB 1K9MC 1K9MR 3CCVQ 3I6PA 2M88A 3DC2A 1YHQS 1VQKA 2AKLA 2YBVA 4KRWA 3R1LA 2DY1A 3OBWA 3VAMA 4IQXA 1YI2A 1YIJQ 3LP2A 3MM7A 2ZHOA 3OYYA 4ICLA 3SCKE 3PFOA 2WOMB 1WJ9A 1S6QB 5FLXU 1KQSA 1U6ZA 2KKHA 2N7CA 4NLVA 3TVTA 1HJDA 4KO0A 5JMNA 2AGOA 3NNHA 3M9NB 1PAUB 3DN9A 4EYIB 1S1WA 4LT6A 5DM6Q 1VQ8S 3UI3A 1DTQA 3I96A 4PL6A 5HMYA 1OU9A 4XAXB 1AFJA 5DJBA 1ZH5A 1O8BA 3EGVA 4KAIA 1Z9ZA 5M2UA 4A8YA 1FRXA 4Y28E 5AXKA 1GXUA 3TR5A 2VIHA 1XEZA 5IV4A 4R8UB 1QAIA 1DRZA 5HQLA 4KR0B 5KCOA 4OZ2A 4X9DA 4NCBA 2RI5A 4M75F 5J1PA 1RAFB 4QR1A 3R5BA 4U6PA 4Z7YA 1SQGA 4MKYA 5KG4A 3M6WA 2RAQA 1WORA 2X3WD 2BZ8A 3VS2A 1BK2A 1UFKA 2M3DA 1MLAA 2DGUA 5GMKl 4WTOB 2K2PA 1P9YA 4CO1A 1JWWA 1JB0E 2HNDB 4L6V3 4CRJA 4F4YA 4K4TA 2UUTA 4DL0C 2EGAA 5HAOA 5B7WA 4ILMA 3I0SA 3EGDB 3J81Y 2QL7B 3FCHA 2ATCB 3G6ES 3D54A 2HYIB 2EYXA 2CPDA 1U49A 1UGPB 4C8OA 2B4PA 2BANA 1NXIA 3OS2A 2KAFA 1OS5A 2HHWA 1OI1A 5ECAA 4LMZA 2PUKB 2KT8A 2R7SA 2M8HA 1H2VZ 2F8MA 2GIQA 4J9SA 3FBCA 3FQKA 1S9EB 4CNYA 1RWXB 2OPPA 3LP1A 2ZAEA 2RE1A 4JRPA 1JU5C 1CJUA 1VBZA 3SXLA 4D8KA 3SEOA 4PJLA 1WI6A 1JLBA 4ZLPA 3OW2S 1NCLA 1X7VA 4KC5A 4DZ6A 3CCLT 4MZPA 4PXCA 4QIGA 1FJEB 2FHOB 5IAYA 2XLIA 2D3O1 4X4OA 4KKOA 1HI0P 3OYKA 5BYSA 1PAEX 3CCSS 1Q86R 2DMOA 5F8HA 2E10A 1FDNA 2RDJA 2XMMA 5EGYA 2Z0GA 1VQOQ 2G2OA 4K2JA 3ZTSA 3EZ5A 1U0HB 2ZHBA 2EBGA 1VQNT 4HEA9 3ET6A 2VBXA 1A0NB 4E7HA 3EAEA 3GV5B 4G1IA 1Q53A 3PW4A 2VVKA 1JNRB 2XMKA 2DTIA 4DL6A 3NGDA 4OYWA 5D4NA 2B5JB 3L2ZA 4RR5A 2ZBCA 4WU3A 2E5HA 3OYDA 4QKUA 2J6OA 2PEBA 1M1KT 5GAOr 3KUGA 4RUCA 4ALZA 3OL8A 3GOXA 1H98A 1NHUA 2GTJA 2BUDA 3HVTA 2X3XD 2QA1A 5A8WA 2GCFA 4JI4F 3NOGA 2GGPA 1RTIB 1YRTA 1RAJA 2RJZA 4LF6F 4KV8B 1B7TA 4ECZA 2XWXA 5FLXY 3RYLA 1R8OB 3K89A 4JJBA 3CCJA 1MROB 3NXZA 2ZWOA 4IG0A 2HD0A 3FLGA 1TKTB 2WVDA 5L8RE 4F3MA 4RW8A 3P6YC 4J9BA 4ZOSA 4DPXA 5LXRA 1Z2ZA 3FK4A 1N9SA 4XPEA 3M57A 2LDYA 2DPIA 4DPYA 1NLOC 4PJOA 4OX6A 1M27C 1G4CA 1Q7YT 4WZMA 3HO1A 1U48A 1XIQA 3CMQA 5E3PA 4CP5A 2H54B 2VFRA 1RT2A 3H59A 2EQKA 4DV7J 5KTQA 2IY5B 1JLQB 4LDWA 2GHWA 4A4KA 1ZM2A 4LUDA 4LRFA 3OA6A 5F8GA 1YHQQ 1KJWA 2LT1A 1SJ1A 2KQWA 2FZGB 3AOAA 4UC4A 4OIXA 2GQVA 4CO3A 2V26A 3M4YA 4CCHA 3QYYA 3I4HX 3GJTB 3ZZRA 1EETB 2ADBA 2BBEA 3CCQS 2O67A 2HS0A 4J8OA 2KY9A 4JZ3A 3H4DA 3HP9A 2HGNA 1S1NA 1UEKA 3GIRA 2QDLA 1E6VA 1SI9A 4X65J 4ES2A 4DS5A 1ZETA 1WYXA 2C2KB 2VPWB 1VQ8Q 4RJVA 3KK2B 2HFSA 2DIGA 4USTA 1CQNA 2NCKL 4LSLA 5J2MA 3LAKA 5E2QA 2OD4A 1RT1A 3OHBA 2VBWA 4Z02A 3BV8A 4ZPDA 2MJNA 1WJQA 4EMHA 3BR8A 3Q8RB 1T9YA 3NGUA 4LSNB 4WF9Q 3TVKA 3EH1A 2RKIA 4ZVTB 5D0GA 4RTUA 4K0KF 1FHTA 3H8ZA 3IGNA 1SHGA 2DNHA 1N5SA 2MQNA 4PWDA 3EX7B 2DGQA 4M7AD 2ZBIA 2AV5A 2W9CA 4FKXA 3KHHA 2RSQA 1PKSA 3ZTPA 1TV6A 1R3NA 1W2BR 2Y0SD 1FWZA 1TK8A 1VRUB 2WBRA 5FDLB 2XEXA 3GLJA 4PLIA 5CYJA 4ZCIA 2UZAA 2V8IA 4Y92A 2UP1A 3G6EQ 4PKDB 2RJDA 3NFCA 3CXCS 3HHLA 1NKBA 3J7ZT 2CPIA 3G96A 5A8KA 4L5GA 4MFBB 1UJ6A 3QRRA 4LF1A 4QU7A 3TQ1A 1HBOB 2DHAA 1BC6A 3OD2A 4DQ2A 4E47A 2VFUA 2MLYA 3TA1A 1KFDA 2HVIA 1VYUA 1U3OA 3DOLB 3M0RA 3PG9A 3HD2A 3H2UB 4G1PA 3O2IA 1UG1A 1YJUA 1F3FA 2CQHA 2ZUAA 4NOHA 2AJFE 5CKBA 2LCSA 3W2WA 3H5XA 3CCSQ 1XMQJ 1WXTA 3AXMA 2L9DA 2HVHA 2ZH1A 2OH2A 4DQIA 4O3NA 5KG3A 1TUDA 1YRXA 3JYTA 3V6DB 1BI2A 1I4K1 2XNQA 2H8HA 1AEYA 4LF8J 4J9VA 1JLAA 3P4UB 2HZAA 4V19J 1H7XA 2RPNA 5GAN3 2CZ4A 2PC6A 4P2FA 1VQ6A 2QYCA 3GCWP 2V67A 1NK7A 3R5JB 3KLIA 2DNNA 5IS2A 1VGYA 4DUYJ 1K0SA 3H0FA 4AMCA 3D67A 3I55T 1I1GA 2DBBA 3CCZA 2DILA 1VBXA 2GHVC 4Y28C 1RI9A 1HLWA 4CH1A 1JXEA 3BQ1A 2O3DA 1H92A 1FA0A 2W9BA 1R8BA 3BGFA 1VQLS 5KFAA 1JK9B 1IQZA 1GH8A 1HIYA 5KT7A 2P0KA 1G6BA 3PY8A 3JCMW 3G4SA 1CQMA 4E2FB 1Y0MA 1REVB 1FFGB 1XR5A 3OR2A 3KLHB 2DKGA 3G6YA 4NL2A 1UA0A 5KYWA 1FXRA 2IDLA 1T3LA 4ZLJA 3IS9A 2QX0A 4FVCA 3W2VB 2QN6B 2GQQA 4HH1A 3L9ZA 4FDFA 1NJIU 5ITHA 3CC2T 2DIVA 3DU5A 1C0TA 2PUOB 1OQKA 1S6PA 4E0DA 4OHZA 3VF0B 4IQMA 2AMCB 2P0QA 4A8OA 2HIQA 4M5IA 3SCJE 2OUGA 1MUZA 3IR6B 1LFPA 3OY9A 2F9DA 4DLGA 2WCXA 4RTZA 2ZH7A 2NYIA 3D2WA 2VKRA 4UY85 5CXTA 4Q2MA 4IG3A 3HRUA 3MUTP 4C5GA 2HQXA 2VG6A 4JV5J 4B3TJ 1KVIA 2EQUA 4F8RA 2DGVA 4Z88A 3CCQQ 3L7OA 4ETXA 4RKUE 2LXIA 2CPFA 4M5DB 1IKVA 1CULB 1WHWA 4YN3B 3H40A 4UQGA 1M0SA 3QLHA 4CTAB 3ME9A 4YQWA 3T1HF 1YX2A 3VGUA 5D8HB 3R27A 5GAOq 2CQPA 2NPIA 2QLJB 2QSWA 3IC1A 1TSFA 2QASA 1FRHA 3U27A 3QKJA 4FS2A 2G6FX 5CYMB 3J80Y 3CJ4A 5B0EA 4DV5F 2YLBA 5IH2A 1CJVB 4KGMA 2WSEE 1LQ9A 5H9EJ 1F3VA 2Y4YA 4ATNA 1VQ5T 3NAHA 2CQIA 2CDTA 2IRYA 2KRNA 2M16A 3DI6B 1Q7YU 4B9WA 2QMUB 1B07A 1U2FA 2AP6A 3LTOA 2CDRB 3D5MA 5IV3A 1S9FA 2YUOA 2O1PA 2K2VA 2RHSB 4NCGB 3TZZA 2AEMA 1R31A 1SG5A 1W6XA 2V69A 3W65A 1VQ9A 5A0GA 2MZ1A 2RQVA 4L74A 1TELA 2E9RX 2PN6A 4B9LA 4Y0FA 3IMQJ 1S6OA 3P8HA 4M7DC 3S3NA 2R7RA 1AWJA 3CPWR 1Y9OA 2RUSA 3VRZA 1R0CB 1M2OA 4I68A 4AD6A 1NH8A 3OYHA 1TAUA 1S59A 2ZH4A 3CMET 3C66A 3LGMA 2CYYA 2FC9A 1B70B 3D9BA 3RAMA 1N6QB 1VQMT 2VONA 4RBUA 4WK3A 5DZ6A 3V5RA 1E6YB 3EFOB 3CC4Q 3WVDB 3M8SA 2C2ZB 1YJ9S 5LJ5d 2JHEA 3D1HA 2IA0A 4CZCA 4O4GB 4AT1B 1CJKB 2EFVA 1KOHA 1SJFA 2D0NA 2E66A 1YJNT 2GJ2A 5L39A 2QFIA 2AHJB 1Z4UA 2VPYB 4I2PB 3QRQA 1LNXA 4RX6A 4LNPA 4ZGEB 1BD6A 3R7NB 2DT9A 4C0DC 1SV5B 3TEEA 3A5ZB 3CCTA 2G0IA 3UDCA 4J5YA 3DHXA 4M77E 3C4SA 4KHMA 1EB0A 2D0QB 3CCEA 4RCBA 3NCRA 1OEBA 4X1VA 1VK8A 2C2OB 1XNIA 2EG2A 4EYHB 4QVZA 4HT9A 1WHKA 4DR6F 1Q8LA 2QV6A 4WZQA 2WB1D 3DNCA 3P3DA 5HVGA 1MSWD 1MHNA 3CC7A 4HR2A 3P49B 1I6JA 4XAKA 4URQU 3MTJA 2FYXA 2AU0A 3E3XA 2F8EX 2MI6A 3I0RB 3C15B 2ZH3A 3UD4P 3A1YG 3NHNA 3T41A 3KDNA 2H51B 2QLXA 3HD1A 1IVZA 3SCIE 2HMIB 1N9RA 2VUGA 4DWIA 2NLUA 1JXMA 2P5VA 3OSSC 2W0ZA 5E3QA 5KFVA 4C5HA 2NXUA 4PFOA 1N5ZA 1UGRB 3OSPA 5ETTA 1QWFA 3T6JA 1XR6A 1XWLA 2RA2A 1Q81T 4C0HA 4IYQA 3NGRA 3JCMQ 3OXFA 4P73A 2NLWA 5D78A 2OTJT 2D74B 4M7AF 1V1CA 3KJVA 4TQRA 2KGTA 3QZ9B 1B3TA 4PG4A 2QEXS 2LU2A 1EQMA 3MEUA 3BQ2A 2DR9A 1H73A 2OFHX 4JLIA 3TAMB 1WHHA 3H42A 4RW4B 1RAAB 1MWQA 3C14A 1WELA 3EJMA 1FWLA 3MMCB 1YJ7A 3HHKA 4RW6B 3HXMA 1FKOA 3Q2TC 1RWKB 5DDQC 2O4XB 1LXNA 4IKFA 3OPKA 3MURP 2CREA 3BSCA 4ZPCA 4QIFA 2XG8A 2GHPA 1OX9A 5B0BA 4ECTA 2R7XA 1Y5IB 4DFKA 1GNKA 3DRSB 2EFIA 3DDIA 2BX6A 2DNZA 2E44A 2VZ9A 1U6BA 3VGSA 3OMGA 2HAIA 2M0OA 4DR4F 1N54B 3KYLA 1IBKF 2KXNB 4RW9A 4C3MA 5GAOl 5IOLA 3KFWX 1UECA 1NJZA 3JCMc 1G3SA 3A8KA 2V8KA 5KFWA 1XN9A 2K6DA 3GYXB 3H7HB 4W4MA 1FTCA 3N5BB 4CLTA 3G8TA 4OHVA 1FXDA 5HBMA 4WJBA 4JLGA 3HHEA 4DZDA 3THKA 3GG1A 4Z7CA 2YXYA 3LGHA 2X1GA 2ZBRA 1I0CA 4Q5VA 1BCOA 1X43A 3N6NA 3ULRB 2QL9B 3BF4A 3TZWA 1RCOB 4KJIA 2B8PA 2FJBB 2ABLA 5EX3A 3M8ZA 2DK3A 4PJJA 1IQTA 1PC0A 3P45B 4KPYA 4NLOA 4GRSA 3L4BC 3OTOF 3EE3A 2PU9B 2XDPA 4CLWA 2XTJP 3QT8A 1H38A 3UD5A 1LWEA 1IKXB 3LH2S 5FD1A 3VAJA 1U26A 2FJEB 4JI4J 1NJXA 2AQ4A 5IZHA 1Q0NA 2FLLA 4LF6J 4OYOA 3Q22A 3NMZC 1FD8A 2XQCA 4ECXA 1JLGB 3MWBA 2K4YA 2J6FA 1SIWB 3ZTRA 2A2CA 3VS0A 5ETNA 3TCJA 2KK4A 1NZ8A 3FCWA 5IT9U 3PW0A 3TA0A 2F1FA 1UP1A 1VI7A 5KFNA 4MZMA 3MM9A 3EXYA 3RR7A 1M5OC 2BE7D 3K5PA 4GKKF 1WJRA 3MAQA 2V94A 1D3BA 1HR0F 3IBCB 2QQRA 2HMAA 4N4IA 5DM7Q 3I5AA 1YJ9Q 3NS7B 1WOSA 2BIVA 2OTLT 3BREA 3KJNB 2KB2A 4N41A 1G5VA 5EX0A 4K7QA 2WVBA 3NGTA 1NEBA 4M7AB 3OFGA 1HQEB 2DIUA 4BY6B 3PCOB 2XI2A 3KUHA 4DX6A 2V34A 4BWJA 2O31A 1K76A 2GAHC 2ATLA 4RBTA 2BJ1A 4LF2A 1WQWA 4OZLA 3ISND 1Y00A 1JRIA 4R0EA 3FRYA 4GLKA 1VHIA 4OHXA 2CG8A 2CNKB 2NXNA 1TVRA 2IJRA 1UZDA 1FMKA 5DDOC 3CTRA 1FFWB 1LK5A 4M7AG 1TKDA 2X1BA 1C1BA 2C3MA 3UDLA 1VLYA 4MYTA 1UVIA 5D0HA 1D9AA 1VQYA 2MY8A 3W5YA 4RKUC 2HWHA 4EDUA 4JI0F 1K1QA 2OLWA 4Y2KA 2JS2A 5H9FK 3HJVA 4F2RA 4ENOA 4MMLA 1VQPT 4ATOA 3MGJA 1LWXA 1PRLC 1N5YB 1S12A 5KOWA 1RHKB 1G3WA 2KI2A 3QGGA 3LUYA 1TL3A 1SC1B 1RWNB 2YNHA 5K8MA 1RAGB 2EJGA 1NH7A 4K0KJ 3S6EA 2KE9A 3MEKA 3HSZA 2ZH8A 4USJC 5GAMj 2XMTA 3KLGB 2HQIA 3BKTA 3PMTA 1URNA 2Q79A 4JI3F 1CPZA 5L9NA 2MOXA 3AA9A 3KK3B 2KZMA 5BYRA 3BGLA 3QJPA 4C7QA 1LWCB 3VAHA 3A3NB 1EAYC 1W2BP 3OSVA 1RUSA 4H4OA 3IRWP 1K0VA 4FIBA 2CG4A 2QEXQ 3RUBL 4CC4B 1KTQA 2Q43A 5GAN6 5FIIA 5KT6A 5HQMA 2HSPA 2R2TA 4QW8A 4ZVQB 1CSKA 2J7KA 1WHGA 4DFMA 4PJOD 2M2BA 5KFDA 4RUHA 2V2KA 5KFSA 4RWXA 1TL1B 1BI0A 1VISA 4RW7B 5RUBA 5GAMg 3HVWA 2GO8A 2YWWA 2GJFA 2KNBB 5J2PA 4M75C 1HW9A 3M7VA 3UCUP 3MJXA 3HSJA 3AXKA 2XO6A 2VA2A 4F2SA 4DHVA 1X75C 2J6SA 2JEGA 1I3OB 3PX4A 3GFZA 2HNZB 1WFWA 2JLFA 4RUBA 4Q0BB 4M78F 2UU9F 3I56A 3IM8A 3IGVA 1S0OA 2AYMA 1UVMA 3TREA 3NAIA 1V3RA 4R0JA 2DNUA 2JZ5A 3REAB 2WB4A 4Z89A 1HNVA 3NOCA 1NDCA 5E41A 1G2BA 2KRBA 1AA1B 2ZOFA 1T03B 2UUCF 2M4MA 1RTHB 1XERA 2Z58B 2XM3A 2MIOA 1Q81U 3VV2B 2G0CA 1VIFA 3RESA 1GXIE 1QAYA 2BRKA 1F5BA 2CNNB 1H3HA 1Z9QA 2QRRA 2E3HA 1TAQA 1NAQA 4NLUA 1Y11A 3W7BA 4AG2C 1S72A 1EX8A 1PSEA 2VPZB 1NZAA 3I4PA 3FVYA 4FM4B 1HYSA 2YT6A 2F5KA 3MEDA 1SC6A 4B08A 1IXKA 5LJ5Y 1B0VA 4C8MA 3CULA 2VPXB 2H3EB 2LXUA 3EGXA 2KROA 2VWFA 1YI2T 4YR3A 4HACA 2OSRA 3MMBB 2COZA 1N88A 2CP5A 3HCXA 4EO6A 2GZOA 3C16B 4ELYC 3BYPA 4ZLLA 1KHWA 3DLLQ 3KK1B 1FNXH 3GIBA 4ANDA 2V4RA 4JJCA 2V4QA 2IVMA 4ZTFA 1WKLA 5D4LA 2XY5A 3S3MA 2EQIA 4OJ1A 1X2KA 1A7GE 3NNAA 5K8PA 5KFZA 3HHLD 3KWMA 1F5CA 1HD0A 3R5GA 4USUA 4K4VA 2CJBA 3CQTA 1YITA 2PI5A 2RQCA 4GKJF 2CKWA 4EWTA 3CCMA 2FJWA 3ILLA 2HKNA 2KU7A 1RBAA 3GYGA 1NLPC 3OXLA 3RBEA 2VYTA 2OGUA 1TKZB 3PRVA 5E7OB 4C8LA 3ZZUA 2I5JA 2IIHA 1NEEA 1M3AA 3FDRA 4EUVA 1S57A 3PR4A 4K4YA 1PNJA 1GFCA 4J9LA 5IT9E 2ZWPA 4HI1A 4QCLA 4PXDA 2LNVA 4J90A 1RTZA 3VS5A 2RIJA 5GANd 3T1HJ 3BM7A 1DQ9A 3W1YC 1Y7XA 1KN6A 1AHJB 1RLDA 4NXMF 3UVJA 1ZZFA 4I1TA 1NSAA 3KMSA 3KDOA 5JXSA 1X5TA 3TU4K 2MGZB 1JJHA 4O44B 1T95A 3DMJA 4P6QA 5AXMA 3ZZYA 1NJIC 3WBZA 1NJIR 4M78B 4EGLA 1G3TA 4DV5J 2FHDA 2BUNA 1N36F 3MMJA 4F0KA 2KI7A 3AT1B 4GLMA 2Z8QA 1MGQA 1RKJA 2IYIA 3I9ZA 1WTBA 3PXGa 2PO4A 1Y96B 5LJ5e 3HRTA 2ZPEB 4BI8B 1TKXB 2OPRB 2O2OA 2OHDA 5KT2A 1N0VC 4FXVA 4M78G 5A0YA 1VQNS 2ZKTA 4OI2A 3OJUA 2DNMA 3TAPA 1P27B 1JJ2R 3PW2A 4RNOA 2PI4A 2YY3A 1MMDA 3M4XA 2DH9A 1KQGB 1HBUB 3BYRA 1V3ZA 4RMOA 4NLSA 1QVGR 2NUTA 2B9YA 2P4TA 1BQNA 1CKBA 3SZ2A 3CPWP 2HGLA 2YHTA 1H3ZA 3DM2A 1KEKA 4HLBA 2EBPA 1AOJA 4C8KA 4JRQA 1M90T 3H5SA 2AW0A 2FGCA 2QA4A 5C24A 1BXNA 3J7Z5 5LJ5f 3CCRA 2W2OP 1Q5VA 2KJVA 3TANA 3MP6A 4ZVRB 1SSHA 2VG5A 3C12A 4O23A 2EFOA 4JOUA 4FCYA 4WTYA 4Z8AA 3DXSX 4N4GA 1GMUA 1Q7YC 1Q7YR 3QJLA 3A8GB 3LWIA 1KK7A 4J83A 4M7AE 1WNLA 2JNGA 3RR6A 2EWHA 3KHGA 4J6YA 4LVNP 4TLRA 4OYIA 5CCMA 4NLYA 4F67A 3DYAB 4N5SA 1NSQA 2EYZA 4C0ZA 4KGXB 4FU6A 2CQ1A 3CCJT 3KHRA 4DR1F 2O01C 3M30B 4KBIA 4NOYA 3JS9A 1GBRA 1RU1A 1VIXA 1KTVA 3MAHA 4DR6J 4O3SA 3AJ1A 4V1Ak 3MM8A 3MR7A 1HNIB 1HPZA 2IM0A 3MPYA 3JCMV 2XK0A 2KHCA 3PRBA 3EDRB 4QYZK 4AFUC 4CC7A 2O88A 2VG7A 2ZD1B 3R8YA 4AUKA 4ME7A 5J26A 4ELTA 4PQUB 1FT8A 1VJQA 3MCNA 1M9SA 3CCUA 2VB6A 5FU7B 3GR0A 4ZLNA 4B3SF 4UOFA 3GIIA 1GQEA 1W2BA 1U8SA 1QMCA 2RM4A 3A3OB 3B4DA 1UETA 4R5PA 1RT5B 5KFLA 3LP2B 1RE1B 3FEYB 4ECVA 2XSJB 1X4DA 3NG8A 2A18A 1RWPB 3GV8B 4OB3B 2CADA 1AZEA 5A0DA 1S1UB 3D0GE 3OT9A 1D9FA 4X62F 1PCXA 4IFVA 1QAJA 2X9HA 3SFUA 4DPOA 1NYGA 2VHGA 1QQJA 1DTQB 2KEAA 3OXGA 3BSNA 1LNQA 4QR0A 2G1HA 3D7SB 2Z4PA 4UZBA 4F0MA 4JZ4A 4O5VA 4R55A 3VAFA 4FF3A 2IYGA 5AXLA 2LQJA 2XIDA 4C92F 1YBTA 5L1KA 3MTKA 2AK5A 2VXFA 1J27A 2NSBA 3US5A 4C8QA 4RO0A 2M9UA 3INZA 1U1OA 1FK9B 2AKKA 1W2IA 2W4PA 4PAAA 3GIJA 4ES1A 3DGPA 2OIHA 2QYGA 1NJWA 2XS7A 3HSGA 1XMBA 4PLLA 2DE0X 4JUVA 5F3TA 3DU6A 2YUNA 2JRSA 4TY8B 5B0GA 3SQGA 3LP0A 4Y2AA 3R6NA 3L7PA 2DR7A 4OHYA 3KG4A 3H6ZA 4A53A 4WYLA 1M5SA 1YBAA 3GJSB 3GTYX 1FKAF 2YNGA 1RWUA 1G3OA 1YKWA 4DR4J 1IBKJ 2A2DA 3ZZTA 1U1TA 2ZPIB 1IR1A 3VU3C 2N3OA 2D1XA 4EU0A 4ZVHA 4ZITA 1KLMB 2XDDA 4M63A 5IQQA 1AYEA 4OYMA 4WFYA 1UCNA 3MCOA 3PACA 1A6LA 3R9LA 3HK2A 4ZJQA 3SSRA 3H41A 2YQ0A 1PC4A 4F25A 3G82A 3K57A 2ZZNA 4A4FA 2OPPB 2XHWA 4BB7A 5ETLA 4CNZA 1Z1ZA 4MIBA 3UDEA 2DX1A 1CJUB 2DA9A 2E5JA 1JLBB 1OPLA 5AJ3F 2QIFA 1WC0A 4MKVA 2OI3A 2WW4A 3GP9A 1QTNB 2F69A 1SB6A 3OTOJ 2HGMA 1WHVA 2QTXA 1JJ4A 1CS4A 3W3SA 2XICA 2OEKA 2DL7A 2IVWA 4RTXA 4GBQA 1N5QA 2AT1B 1HFEL 1VQNQ 2R8KA 4NLGA 3KHLA 1RWWB 2ZH5A 1T9UA 2DO3A 2XBPA 4EO8A 1WTFA 4Y65A 3ET6B 3D4JA 1RISA 4ZVEA 1K44A 4KFBA 2DGOA 2B4OA 4UZCA 5GAGI 3FZBA 3FZ2A 4LN2A 3D0HE 1ZM3A 1L5UA 2RHXA 4NYOA 3E1SA 3K0JA 3TEHB 3C94A 2L3QA 3VGTA 2OX7A 2I2YA 3C8YA 3D68A 4B9MA 3BY7A 2O5DA 1ZTTA 1J3TA 2HNYA 1GX5A 2W7AA 3I55S 1Q78A 4NI2A 2KTQA 1RT7B 3DKDA 3UF4A 4WE1A 1HR0J 2MZQA 3MEWA 1P1LA 1D8YA 2W2PP 4C8ZA 1PIEA 4LFAF 3HVTB 2DYIA 2LX9A 5D6YA 4FYWB 1HMVA 1OZ2A 2P2CB 5HVFA 3O8WA 5C25A 2AKWB 2GGPB 4KUDK 3ONQA 1YG0A 1IBCB 4NASA 3MR2A 1SQFA 2BKDN 2XO7A 1TS9A 2JL9A 2DYAA 3BDLA 3OYJA 2DCLA 2WSCC 2HVDA 1NK4A 4FF1A 3G4ST 4N0AC 1YJTA 4ZCKA 4DCJB 4P2SA 1V6HA 1RUWA 3J80E 1OY8A 2COLA 3VUBA 2OMOA 2CUDA 1UJ5A 3UNGC 5ETRA 1HWLA 4X4TA 3LO3A 3AD8C 4QIEA 4R56A 4DFJA 3HFKA 1QCOA 3NKYA 3CC2S 1JLCA 5ETVA 3G87A 2K79A 4B9UA 4OMQA 2DZCA 3D3CJ 2OKQA 1UHFA 4JI0J 2PMWA 3W8GA 2DXUA 2E5LF 3HDSA 5I21A 3M8YA 1DJ0A 3CW2C 1GBQA 3PO5A 1K73T 3KOAA 4DPTA 2ZZTA 2QGGA 3V7SA 1RBLA 3DOKA 2ZPHB 2JT4A 5KYYA 2OP5A 2CQGA 4XK8E 4PJOG 1O51A 3FFIA 4WFXA 1ZTWA 1I07A 1XQIA 2AHOB 1M90U 4J7CA 4K50A 1W4SA 1FJCA 2CQ3A 1TFYA 4M7DA 2ALYB 2DJQA 1JLEA 3V8LA 3OYEA 4IIMA 1Q8IA 3CPWA 1UGQB 4Q45A 3NRBA 5C5JA 4RNHA 1M1FA 1C1CB 4J9FA 2JFDA 2CUYA 3O8VA 1MWZA 2HNIA 1E6VB 1UB4A 1QE1B 1YVFA 1UE9A 1IZ6A 2CP2A 2DL4A 5C42A 1CEZA 3EGNA 2F2XA 2M0YA 5AE3A 4PJMA 4I2QA 2XNRA 4FYYB 3ENWA 3U02A 2YVSA 3DRPA 2YQ3A 1ZSZB 3OB9A 5J2MB 3OL9A 5HATA 2IHR1 2EW3A 5DY9A 1VQLT 3HPOA 3H0PA 2DVEA 2LQWA 1WKJA 4M95A 2V68A 2YNIB 1UJ4A 4YHHF 5HJYA 2RB6A 4ZDNA 2DEIA 2RKIB 4RWWA 5HCKA 1ZOTA 4Y00A 5DRKA 2HSEB 2A36A 2MF2A 1V5VA 4IRKA 3IAS9 2GW8A 1U1RA 3PJXA 2OJ3A 2FYKA 2X1AA 4TLQA 1LW2A 1DTTA 3M32A 2R7OA 2JH3A 4J6XA 3QDRB 4OI1A 1Y71A 3ADAC 2UU9J 1VQ9T 2BQRA 1X01A 4OJ3A 4MMKA 3MM5A 1N32F 1HQUB 1XTZA 1VFJA 5L1LA 2RNAA 4J9PA 3L09A 4WBFA 2W4DA 3OVAA 2DETA 2ROGA 4M7AC 5A2QU 3CMES 2VBZA 3QZ8A 1SVDA 4BY6C 3BGRA 3IBFB 5CQXA 1VQMS 2UUCJ 3CIZA 4OV1A 3Q8VA 3DLKA 2AZ1A 2YH1A 2G2YA 2EJ9A 5GADI 4P2MA 4O4RA 3JCMd 1RWMB 4LBHA 4DJBA 2HBYB 1YJNS 2C2MB 4EBEA 4WFZA 4KQZA 2O9SA 1X0PA 2ZPFB 4XDDA 3HLUA 2GAGC 3VS4A 4RL1A 3J7AN 2OAWA 4MK8A 4PR6A 2G13A 1QAXA 2ZC4A 2AX0A 2Y1LB 2LJ1A 2GNCA 2XMWA 2YKNB 5J1EA 4QIWD 4F7UF 2ZOMA 4IUFA 2GC8A 1S1XA 1KHVA 3OJSA 4N4HA 3JYTB 1ZA1B 2FVUA 4NRTA 4F04B 3I5RA 2Y1JA 2FEIA 2QL5B 3DDNA 3I87A 2C06A 2DB1A 3M8PA 4X4VA 5SZTA 3QO9B 4NA1A 3ZFJA 5GAN7 2KO1A 4AL5A 3TSZA 4FF2A 3MEAA 2JJ4D 4PWWA 4NXNJ 1NHKL 5L46A 1EHWA 3J7YU 4ZN1A 1PM3A 3SB2A 4ZPTR 2VXEA 5GANe 4QWEA 1Q81C 2VDHA 1FTRA 3I55Q 1CKAA 3DB3A 2R2SA 3CC7T 3MEGA 3BSOA 1FVSA 1QDUB 1S1VA 1N34F 1EP4A 3HKZD 1VR6A 4GKJJ 5D7UA 4DR2F 1PJ6A 1WHLA 2VV5A 2DR6A 3OLBA 3VAIA 2Y4XA 2A6MA 2LP4A 3S1TA 1U09A 2HIYA 3WX4A 5GADU 1QCFA 1DHMA 2VDIA 3CNQP 2OTJS 3TQEA 5CKEA 4N47A 5D6XA 2DRAA 4DDFA 3OR2B 2J8AA 3CBPA 5CO7A 3BZQA 1GTHA 4XTWA 2HVEA 2F2VA 5GANf 3SMZA 2RHQB 4Q8FA 2DL5A 4ELZC 2RQTA 1HI1A 4G3IA 1RABB 2LP5A 2FJDB 1LJOA 3GU0A 2CFXA 1XBWA 2RI2A 2K5IA 3CC2Q 1RP5A 1GAOA 2DH8A 3NPFA 5GAN2 4EMKB 5I2MA 3ER0A 1YBUA 1ICEB 4GC6A 2RT3A 4XIUA 2JTFA 2WAQD 1B64A 1YCSB 1S6PB 3S6WA 1N33F 2LQBA 1EARA 5IN1A 4U96A 2D3OR 2IVYA 5KFGA 1M8MA 1N36J 1YLXA 4ZHRB 2AYBA 4R8UA 3DLEA 2HRTA 4NEZA 2ESWA 2RU3A 1S77D 5IXFA 1SSFA 2LDMA 2F7VA 4AFQC 4QOTA 1KQ2A 1S4FA 2KVIA 3WDOA 3VQTA 2J6TA 3IAM9 4N56A 2Z2MA 3DXBA 4FVMA 3Q8YA 3QLHB 1Q82T 1LVKA 3QG1A 1TOVA 4JBCA 2EI5A 2GCXA 4CLLA 1UWBA 2EJFA 1JJ2P 4DN0A 1LKZA 1F5AA 3GB0A 4ECWA 1G7CB 1GCPA 4YB5A 2AJ1A 5DGAA 4OYXA 5KFQA 3AHPA 3DRRB 4USKA 3GNGA 4K2XA 3EGDA 2FUG9 4F7UB 1M5KC 2VF3A 3EWGA 2CIMA 1HNXF 3JB9D 5LJ5j 1SC4B 2QEXT 3CMAA 1WDTA 3HKWA 5GMKi 4LFBF 2YXLA 1U1PA 2YRDA 3FEXB 5CA5A 1IGQA 4YP3A 2LU1A 5CYQB 2HEKA 3RR8A 4X4UA 2KFZA 1D9DA 1PBUA 1VRTB 3FMBA 4II1A 4F7UG 5KG7A 1K73U 3GYNA 2CKKA 3NMAA 4DUZF 1XOVA 4IRCA 4D3GA 4DEZA 1ZYQA 5A8RA 4DCOB 1GFWB 5LOQA 4DOZA 4ANJA 1EIFA 1H3DA 5GAOn 4EIKA 1YSJA 4LF4F 3BDPA 2KDOA 4F50A 4DR1J 3CMEQ 2RMLA 4BDPA 2N4CA 1C6VX 2VUBA 2BM0A 4O0NA 1HKAA 1VQMQ 4OLOA 3MR5A 3VAKA 1U0HA 2D8JA 3GJRB 2RS2A 1U45A 1KVJA 2I6WA 4QW9A 2DL8A 3FEZA 4JJDA 2F3JA 1F2GA 5LJ5g 4OZ3A 3GIMA 4CO0A 2G0JA 1OY9A 4PJOE 3QGIA 4LRBA 4O3OA 2Y1IA 1Y7PA 2E5QA 2CQCA 3MO8A 3BH7B 1BQMB 1YJNQ 2C2DA 2D8HA 2B5JA 2JOQA 2YX7A 3C6TB 1APSA 2CVEA 1FWKA 3DKMA 4B3SJ 3GZ7A 4YDDB 3RIRA 1OIAA 1UVNA 2AIRB 1OY6A 4A8WA 2VICA 3DOMB 3M58A 2E1AA 1PILA 4M78C 1J5EF 1KHCA 2EGEA 4I0WA 3M2UB 4UOGA 2APOA 2VD3A 5EN1A 3AHUA 3QZ7A 4Q44A 1RTIA 2DTJA 4X62J 3N9UC 2DPJA 3I82A 2BE2A 2DTOA 3QIPA 5GJWB 5KFYA 3DRXA 1EIYB 1MROA 4ZJOA 1M2VB 1TKTA 5I11A 2FZKB 1O0PA 5CAAA 2SRCA 4M75A 2HFZA 3RRHA 4OF1A 4CI0B 5LT5A 3PFEA 2KJWA 1RAOA 3A1PA 2CAJA 2MQLA 3BSAA 1JLFB 4PG5A 1X4EA 5KYXA 1W26A 4YR2A 3KJQB 1UGSB 4HXJA 2XHCA 2RQKA 5DDRC 2FQQB 1QP3A 3UPFA 1JLQA 5GAEI 5D0RA 3BE3A 4D8DA 1HW8A 5IM0A 2OTJQ 3OFFA 1K47A 2CWXA 2FPDA 3EGUA 1WGSA 4XU1A 3KJVB 5LJ3d 1IKYB 4C6AA 2Q66A 2F65A 1KFSA 2ZGWA 3AAWB 3BR9A 4FZVA 2CQDA 1FRKA 5F0UA 5GAMh 5A6WA 1U8RA 4F4WA 3C14B 1NG2A 2ADCA 4B9NA 2H4YB 4QU6A 3V7CA 1QM9A 3VAGA 1NJYA 2DVJA 1I5OB 1F9FA 2Q6BA 4V19X 5K8NA 3KLFA 3PVLA 2F5GA 3CD7A 5F0WA 3PYEA 1HBMA 3R5DA 5HMXA 3DB4A 2XCPA 4NLPA 2KXDA 5AJ3J 1K1SA 2YUPA 3PIPA 1HWIA 3N5FA 1AFIA 2XLKA 3EFRA 4KSEB 3VR1A 1NBEB 3Q1JA 2C28A 5H1SV 1TUVA 1S1TB 3CD6A 3BJYA 3ZBDA 2X51A 3Q0AA 3H90A 2ASYA 2XZWA 4R25A 3JAMY 1BY9A 3I56T 4P72A 2RRAA 4HH0A 4EI2A 5IFMA 2KFNA 1HSQA 7FD1A 1VOMA 1QP2A 1CC8A 4YY3F 5GAEU 1Q5YA 5HBMB 2K5LA 1V29B 2B86A 2MXYA 3HKSA 1WF0A 2K5FA 1LW0A 4YFUA 1T94A 4U7CA 5KFHA 1SC3B 1F60B 4TVRA 1KQSR 4C8QD 2RK1A 2MWPA 2IRUA 1WX6A 3MUMP 1UFLA 4NLQA 1T8EA 4FS1A 2CSQA 4ES3A 1VQKS 3BBBA 1B0PA 1UL3A 4LFAJ 4MFBA 1S72T 2E41A 1HBOA 1D0EA 4UUWA 1F9EB 4A4HA 1IJEB 3ZZPA 4HTIA 3K59A 3CCLA 4L73A 2B7CB 3A12A 1KQSS 2OPSA 3RNJA 3QBCA 5G4DA 1SUQA 1S5ZA 4PPDA 3DHWC 5FWCA 3TP2A 1P8GA 4A54A 1PYOB 3PW7A 3NWRA 2R7UA 2LJ0A 3R6LB 2GF7A 3CJ2A 3KTQA 2FLPA 3CIMA 4KGZB 2DRDA 1WC3A 2HBPA 1S4EA 1QVFR 2C2NA 2H5IB 4NA2A 3V6DA 3MM9B 2BQUA 3PIOQ 1Q82U 2V63A 2HS3A 2OTLQ 4K4ZA 4MK7A 1D3BB 4WYWA 6FDRA 2C0TA 4JI1F 3QUIA 2Z56B 1ZAXA 1DAXA 2E5LJ 4CQ1A 1T05A 1YITT 4X4QA 2LXFA 4PJNA 3CCMT 3EG0A 3OR1A 1S6UA 3NLCA 2ZH9A 1R0AA 3CPFA 2VKNA 1Q86T 1JJ2A 1ELOA 3TW0A 3E8OA 2VC0A 2UVUA 4K5RA 3QHSA 3RB3A 2FPFA 1KC8T 1WC5A 1RTDB 1QVGA 1QY7A 3AJ2A 1S7HA 5AT1B 5E3AA 1MU2B 1M4ZA 1OULA 2UV8G 1PC5A 4KT0E 3OUYA 3RAQA 3CD5A 4F4XA 5DQIA 2BJ9A 1RHUB 3F44A 2EKHA 1HQ2A 1SKUB 3X25B 5GMKe 2XMVA 2YRVA 3TVYA 2NXCA 5F8MA 5LSOA 2MYSA 4RTYA 5I42B 1VQPQ 1HHTP 5B0DA 3KLHA 1M3CA 2MQ8A 1RHRB 1DFDA 4UOHA 3GFYA 1RYSA 2B51A 3NP5A 1K0XA 4YHHJ 1N0UA 3W2VA 2RJFA 4LE9A 2F2WA 1T3SA 2E5KA 4OLPA 1T11A 4F7UE 3G2XA 3LH5A 3A3PB 3BBCA 3V2UC 4EZ6A 2A7YA 3JCMe 4FNHA 4BC9A 1NPKA 1BBZA 1KNZA 2GJIA 3ELHA 1M90C 1BCMA 2CP7A 3RMQA 5DLQE 1M8VA 1WUUA 1TMMA 1FNMA 2QMXA 1SQEA 2E9TA 1FDDA 4ITSA 5SUHA 3K5NA 3OFHA 2E65A 3M6VA 4H4OB 2U2FA 1VK3A 1IRXA 1N32J 3CJ0A 2B56A 4HVVA 2LKZA 4I4BA 2FJVA 1SXLA 1CULA 3GF5A 3Q8PB 2DHSA 3UCGA 2LQ9A 1GCQC 4A8FA 2XI3A 2E6ZA 1P9QC 4OX9F 4Q8EA 4LDVA 4C92C 1KD1U 3PEJA 5AE2A 2F9JA 3F56A 3OW2R 1JBMA 4M77F 4YDXA 5EDWA 3ZL7C 5J2PB 2IA6A 3IO1A 4LFCF 3ZC4A 3OVSA 3K5OA 1FRIA 1HNWF 2E3IA 2G1DA 1LWFB 3BN4A 4YB6A 3SQOP 3X3UA 5C0MA 2DH7A 3CT9A 1TUWA 1CJVA 2GA7A 3QZ5B 3E2EA 5CIUA 4M7DD 3MEEA 3I5SA 2HQ3A 3JCMJ 3EVMA 1B0TA 1T02A 5DZ7A 3CCJS 1VC0A 3DI6A 2ZH2A 1M5PC 2VGNA 2DGXA 4NPOA 3OYCA 1SJQA 4NCGA 2HDAA 2JNJA 5LMNF 2CQBA 2CSIA 4GVBB 5KT3A 2Y1RI 2VBYA 1A0OB 5KFIA 3MOJB 2DFUA 4MYUA 2MZRA 4AXJA 2QLBB 3H2VE 3N01A 3M55A 2UVRA 5THWA 1ZHIA 1H74A 1VCTA 2KVQE 2AZVA 4N77A 4U8YA 2YLCA 5ETSA 1HA1A 3NTHA 1RLPC 2EG1A 3V81B 4HHHA 1ZS6A 3RB4A 5HROB 4TYBA 2DXDA 1NK6A 1N34J 1YJWA 5F9LA 3DGVA 4DR2J 3QWUA 4WP9A 3EVOA 2HBZB 4BBYA 4J9MA 2HZVA 4G65A 3TQ7P 1ZSZC 7FDRA 1E6YA 1GXTA 1Q95G 1VDHA 1YI2Q 2B3TB 5B09A 3EGXB 4E8UA 1CJKA 1R7IA 3PW5A 3QMQA 3BGOP 2X3GA 2DCUB 2N3LA 4I2PA 3V8KA 2MZSA 3G71A 3UQSA 3IFEA 3CDWA 2A1BA 1FI4A 3IR5B 2Z2ZA 1BHNA 2H3JA 1SV5A 5GANj 3MECA 2HFVA 5A0LA 4F16A 2ROPA 1D1UA 3N6MA 4OQJA 2F63A 5F8NA 1LOUA 1WOOA 4W92B 4I7FB 4J9UE 4Y91A 2ED0A 3FRNA 4HKQA 3R5AA 4X9CA 2D3ZA 1S10A 1OPIA 1OQ3A 5ETQA 1ACMB 3JB9I 4E7SA 3QT6A 4IDKB 3ICLA 3CDUA 1N33J 4P2XA 3GIKA 1ZZNA 3TJ9A 4E7LA 1LPLA 4I6WA 2FZCB 3U1NA 2BJ7A 3VTIA 3QSUA 2B4UA 2I5JB 1CG2A 1R43A 4XTZA 2JEIA 5A6PA 3H20A 3HFNA 1JJCB 4NLTA 3I0RA 4JRKA 4WIIA 4DV0F 4JI7F 3C15A 4LIRA 2WONB 3EG9B 2PSZA 3VS1A 1SH3A 4J9OA 9ATCB 1OQ6A 5GJVB 3OV7A 2WBMA 5GANg 2HMIA 2DBMA 4M77B 3JSMB 4LR7A 2FVRA 5G0RA 2BVZA 3R3TA 1UMJA 1HNZF 2V8DA 5GAMe 3IQLA 3FSIA 4DL7A 3O5TB 4C0OC 3PMIA 1ZA2B 3CWJA 2MZTA 3REBB 3LANA 3E9FA 4P52A 2P0PA 4LUEA 4M77G 3TAMA 4DV2F 2RNEA 5IHKA 2RRBA 1X0FA 4RW4A 4ETZA 1WDDA 4BE0A 1HNXJ 5K5MA 2YRCA 1EKSA 3MMCA 4JI6F 3KUFA 3JTNA 4RW6A 1MMGA 3F70A 5CKHA 2BABA 3NY0A 5EHHA 5JVGQ 2O4XA 2PE8A 5BR8J 4N0AA 4LFBJ 4Y34A 2ZJPQ 1IUJA 4J9DA 3M4GA 1T0JA 4M94A 1X5SA 4C8QF 1IKWB 2RILA 5A0YB 1WXBA 4LF7F 5GAHI 1P1TA 3WHIA 2KT5A 3SDEB 4TNOA 2FHKA 4PZVA 2RF0A 5GAMf 4DUZJ 3TX0A 4PEOA 5IC4B 5HMZA 2DXCA 1Q86U 2H48B 3LYIA 2NUTB 4Y2MA 5LL6S 1F2HA 4KPCA 2R9LA 1BQNB 3CXCR 1RYRA 4LF4J 1KC8U 4DOWA 4NLWA 5K14B 3QT5A 3QT7A 3M0QA 4ZVOB 3EGZA 1VQ6S 4C8YA 3V7RA 1UTIA 4KHPF 1KONA 3M6UA 3NTKA 5C7PA 3K7RA 2RS8A 4C5EA 7AT1B 2VG5B 3BS9A 1HK9A 2EYYA 3ENQA 2RD1A 2POKA 1N52B 2V8VA 2G4BA 2R8HA 2Y0BB 1X5OA 1VQ5A 3A8EA 1Y5LB 5FROA 1ZPWX 2VL1A 2GV1A 3CE8A 2G3RA 4ECYA 1EZZB 4EMKC 2OELA 3PFSA 4ED0A 3G4SS 1FDBA 2D9TA 3J7A1 3FDSA 3CCJQ 1K73C 1K73R 4ZVPB 2ZJQQ 1S7IA 5MAOA 3QSIA 2I0NA 4KGVB 3S01A 4F4AA 1J5EJ 1IKXA 2A37A 4A8SA 1K0TA 3GE9A 4DBFA 1C4AA 2PIIA 2LCWA 1M5Q1 2B0GA 2ACYA 2R7TA 5HY6A 1L3TA 2EWNA 4H4KC 3DLMA 1AUDA 1PD1A 4EMDA 2ZFHA 3MM8B 4J37A 4YB7A 2D6FA 1HPZB 1SKWA 2MZJA 2VG7B 2L5QA 4MIAA 5ADZA 2JZ2A 2E1RA 1WA7A 2IMWP 2KRSA 4IUVA 4PYDA 3A13A 4FF4A 3UWNA 4ED3A 2DXBA 2R5MA 4P75A 4C8NA 5KYNA 1X8DA 4DX8H 2YKAA 3ENVA 4JS4A 1R8AA 2XI9A 2ILZA 5I4MA 1N56A 5I3PA 4OZJA 3NGSA 4PXEA 1S0NA 3H5YA 2BR0A 2JN0A 2QK0A 5HO4A 1GMVA 3PYDA 2J05A 4QPTA 5ETPA 1HQEA 6AT1B 2GVDB 2IMOA 2HW3A 1U8WA 3VVTA 2BKPA 2LEAA 2YDLA 5L9XA 2VA3A 2QDYB 2K3KA 2RHUA 2VU5A 4U95A 2CZ0B 2DNQA 2GGRA 3QQCD 2XS5A 2V2QA 1RB0A 1JQGA 3CJKB 4LDXA 3NBPB 1YNZA 4RCCA 1GTEA 4TQSA 2WRMA 1GXLA 2CJAA 1D1AA 3Q2SC 4CH7A 4C8QB 1Y5NB 2ZKUA 2YWEA 3RB0A 3SWNC 3DGPB 1Q7LB 2FHMA 5H9FJ 1QVPA 4CRIA 4AFSC 5D4OA 1JB0C 3KXTA 4IO9Q 4DV7F 4JP8A 1RHJB 3SQGB 3VZIA 3LP0B 2FDNA 4FKYA 1N5YA 2KYMA 3HI9A 2CPZA 4XO0A 4I56A 4KULA 1ABQA 5CQYA 4Y2IA 4OV6A 4C8QG 2GMLA 4M1KA 2NSCA 2UXDF 1BIBA 3T5HA 1VQ9S 4A8QA 1YRUA 1DJ7B 1UEUA 1RT4B 1RZMA 4CIOA 2R3VA 2DD4A 5FRNA 3QBYA 4PRFA 1NSPA 3KLGA 1NYFA 3P5BP 3B82A 3HT3A 3BW1A 3G7ZA 1VQ7A 2QJ3A 4AE5A 3FSXA 3KUEA 2Z30B 3KK3A 4CWBA 1M1KU 4YY3J 4ID5A 2J5AA 4MJKA 1X6GA 4N76A 2HQHA 4OMOA 2DNOA 3M1VA 4DEXA 1XMOF 4ID8A 4M75D 2UUWA 3RBDA 1WPYA 2C1EB 2V6AA 2Q1LA 5IHIA 5KG6A 1FO1A 3FUYA 1KQSP 2WVEA 2E1HA 2YX1A 2D1CA 3JSRA 3NTIA 3MD3A 5DG8A 4DUTA 1TL1A 5JJBA 2CPXA 2CXEA 3POTB 2HQCA 2V2ZA 4H54A 1KS2A 1L3KA 4FNIA 2MDAA 1K8AT 2KN4A 1SIZA 3OS1A 4CI0C 1Q8BA 2D9OA 1SEMA 3CCES 2PVOB 3LH0A 4OGEA 2P9EA 5DQGA 1VQ4A 5GMKa 2BV3A 2HNZA 3MR6A 1RHMB 4Q0BA 5IWAF 1X4CA 2MCNA 2GMHA 3R5CA 2DZ9A 2QLFB 4QJVA 2VFSA 3GBQA 2P4RA 4ER8A 1UFFA 2HPUA 2J9CA 4RU2A 2Z0WA 5ETOA 5KFMA 3CC7S 1QVFP 1QTMA 5DM7R 2AF6A 1GMWA 3FIFA 1GFDA 5KFFA 3M5AA 1T03A 2O9VA 2AJ4A 2DRMA 1RTHA 4WE1B 4JI1J 4W90B 2YTCA 3EHQA 1WF1A 3ZEHA 1FCAA 2PFDA 5CZVA 2CNOB 5HP1A 4YEAA 5GMEA 5C25B 2CGHA 5L8RC 1NM7A 1AWXA 1DBDA 3CJSA 2FJXA 4U67Q 3OYBA 3EVWA 4DBHA 2C2EA 4P74A 5KFRA 3LOUA 3G4SQ 1MW7A 1WDXA 4OI0A 1TH7A 4YR0A 1C0UB 1VYAA 4JV2A 1BKBA 3GNFB 2CUBA 3AFGA 4QQGA 3MPWA 1RBOB 5ETKA 3MCMA 3GSDA 4IRDA 3I32A 3A8MB 4N8NA 4ZGDB 2CP0A 2DEJA 2LMIA 4M5KA 3TVZA 1N5TA 2JSXA 4USVA 1JLCB 5EUHA 1X5PA 3B78A 3QFHA 4OJGA 3C16A 4BE2A 1UJYA 3GFXA 3JQJA 3KK1A 3MHXA 1Q82C 3KNAA 4C5IA 4J9NA 1JO8A 4J6WA 4P71A 4RG2A 1F9HA 1IM6A 1WIEA 2QO3A 5T7LB 4NMLA 1ZBJA 5E3RA 2IBKA 5DLGA 4XPCA 2E70A 2XMUA 3H0HA 3DOKB 5F41A 1B34A 1PWTA 2KM8B 2K1RB 2AJ0A 3K8VA 4DPWA 3EG3A 2OTLA 2XZTB 3B6BA 4BDYA 3QPIA 2WTFA 4QWAA 1RLQC 2F5TX 2JJ9A 1JLEB 1S9GA 2V4JB 4ZIVA 1PCAA 2V8JA 3PR5B 3M0UA 2AYEA 2MY7A 2B9WA 1KOOA 5GMKj 1RWOB 5M2PA 5BJRA 1U1QA 2NYSA 1VLOA 4DCPB 4PUOB 3DLJA 2LVWA 1I1JA 1VQLQ 4I2QB 2J0SD 1X27A 3QJ6A 4NZ0A 3NWGA 2EQMA 2B43A 2BKOA 3K58A 3NGPA 3CCVA 2YPYA 3OHAA 3MEVA 3I35A 1HD1A 3I9QA 2MHEA 2QQAA 3DCAA 4N7TA 4Y3CA 3ZNJ1 1KWMA 4RNMA 4OX9J 3GILA 1YIJA 5HK3A 2WZ1A 1TR0A 5KG5A 3PJ9A 2ROLA 1C0MA 2B6AB 1VQPA 2DM1A 2FVCA 5C6SA 2MGZA 3OW2P 4DL4A 4O44A 4A4JA 3U1LA 2XU8A 4OB1B 4OYZA 4LFCJ 4M78A 1TQLA 1HNWJ 3W9HA 1R8CA 3DDKA 2BJEA 5GAN8 5GAOp 2L41A 1LW2B 3M32B 1VQ9Q 2LA6A 2ZITA 1MN7A 3A4TA 2W2QP 2WVCA 4X4SA 1Y3JA 2YWHA 3BO2A 4B3TF 1NDLA 3MM5B 1T9TA 2JXBA 3D0IE 5LJ5h 1WSRA 1RI7A 5D3GB 1UVJA 2J76E 3NMRA 2C22A 4J7IA 2K8GA 5F8LA 4USWA 1AWWA 4LXCA 1ITPA 1WI8A 5LMNJ 2F8HA 1VS3A 5KFJA 3LWLA 2L3PA 1Z2LA 4OX7A 1WZOA 2ED1A 1FNOA 2K7KA 4OFZA 3J81U 3X28B 3JCMg 3VV0A 4MKAA 2YNFA 3WZ0A 4DX7A 4XU2A 1X69A 3SSSA 1E6GA 2HAXA 2IVFB 1U1MA 1KD1C 2ZDPA 1KD1R 3AA8A 2M0GB 3RBBB 5KFBA 4BLGA 3RBXA 3R2CJ 3K2YA 3OMCA 4QBUA 2EIFA 2W24A 5GMKm 1X9WA 3TSWA 3BN7A 2I9SA 3M8RA 2C42A 5CKFA 1X9MA 4KBMB 1MG7A 4FW1A 2YSQA 3CEDA 2ZE2A 2UVVA 1S1XB 3H9NA 1F1BB 1QUPA 3T19A 1UDLA 3VS6A 3IRXB 3CCEQ 1I8FA 2J9DA 4AQYF 4V2SA 2A3LA 4URSA 3THTA 4QYRA 4O3PA 2SEMA 1IBLF 1OYDA 2J7UA 4IH7A 3TYTA 2XY6A 3PT9A 1J2VA 2FVSA 3Q8UA 1D0ZA 1SPKA 2CPHA 3DYAA 3W5ZA 3CC7Q 3I9V9 1BLUA 3SV4A 1FJ7A 2A0FB 3MEGB 3RTVA 3GFHA 4IKAA 3MDFA 1UZHA 4BD3A 4C8QE 2KYZA 4QYZJ 1HNIA 3PEHA 3VALA 2WW8A 1VQOA 1YZ6A 3UT1A 2E5GA 1YTYA 4QQBA 5DETA 4PK4A 2L9NA 3KMQA 2ZD1A 3QWPA 3OVBA 2A6OA 5KFOA 3CJQA 1BYMA 4K4WA 4PQUA 1UEVA 4B02A 1EFNA 5HLFB 2Y8YA 4OYBA 2R5AA 4P9SA 4DV0J 4JI7J 2MPXC 1FRJA 4XQ3A 2DBKA 1RT5A 2KR3A 1WACA 3Q24A 1R0BG 2W2NP 1OYXA 2XSJA 3DLGA 4DG1A 3VQSA 1YGYA 3H25A 2JS0A 4MH8A 3UR3C 1K8AU 2K06A 2GVZB 1HNZJ 1ROFA 1S1UA 3QDFA 2HRYA 4N8OA 2EPDA 1ZLMA 3FKBA 4FXWA 5B0FA 2XYGB 4B9VA 2NXJA 2JWNA 3M8QB 1VQSA 1AVZC 2F4VF 4LVOP 1VA7A 4DV2J 5I3UB 1IJFB 1T0TV 1NB2A 3DLEB 4UOCA 4JI6J 4CH0S 3G9CA 1FK9A 2H5JB 1FX2A 4B9XA 1T9WA 1DLOB 1ZUUA 2K7JA 3I56S 2VQFF 1I51B 2VASA 4FYXB 1EJ7L 2DNYA 4HI2A 1MMLA 1U2RA 2QQBA 4LF7J 3L2VA 4ZA1A 3H2LA 1RTJA 3LWMA 1QVFA 1NDPA 4A8MP 4TY8A 2LDIA 3CD6T 2JVRA 2I2LA 2R7VA 4OYAA 1D3WA 2CNLB 3ETMA 4OMPA 3HFOA 1WJSA 1UWBB 2BZ2A 3MOZA 2MWOA 2WSEC 2FGOA 4EZ9A 2DYBA 2WSFE 2ZPGB 4NLDA 3TX8A 5CAIA 3PV8A 1YHQA 4G1QB 2E1PA 2ZH6A 3X20B 3N6LA 2W10A 3SFMA 3CXCP 1UWAA 4M8LA 1SKRA 1OO0B 1KLMA 1NK9A 3OBYA 1BI3A 4IFYA 3FCVA 4DSLA 5HL7Q 4KHPJ 2U1AA 1S72S 3N4WA 1JIHA 2C0IA 3QRPA 4NWBA 4OGCA 4LDYA 1VQ8A 1ZUYA 1WOPA 4HYKA 1OV3A 1IR0A 2MQOA 3PE0A 5T14A 3OYIA 4PFPA 2UXCF 3MP1A 5IHNA 5LSLA 1URRA 1RJJA 2DNGA 4RLEA 5A8RB 2VKZG 1WKKA 2L9WA 5CH7B 2FY1A 3TZYA 3MPDA 2EXUA 2DTHA 1Q86C 1JQQA 2DEUA 1ZAVA 1RWVB 1ZPVA 2LYVA 4F14A 3CGIA 6FD1A 1TL4A 1NJIT 3QJYA 1KC8C 3C6UA 1KC8R 3EMTA 2CT4A 1N8RT 2BKNA 1U1LA 4WFAQ 3Q83A 1G1XA 1SJRA 5LSRA 1YITS 1MNDA 3MM6A 1U5SA 1WLPB 3CCMS 4CLKA 5CCAA 5IT9Y 2PQWA 2ZUGA 4DI6A 4CYUA 1PG5B 2LRQA 4ZJLA 1WG1A 3CDAA 2IAJB 3D1QA 2JMAA 4M77C 4QVCA 1X4AA 1Q4RA 2KXHA 2E29A 4UTGA 4WFBQ