2G3RA

Crystal structure of 53bp1 tandem tudor domains at 1.2 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
SFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle/transcription
molecule keywords Tumor suppressor p53-binding protein 1
publication title Structural Basis for the Methylation State-Specific Recognition of Histone H4-K20 by 53BP1 and Crb2 in DNA Repair.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2g3rA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2g3rA01
1WJSA 1YIJA 3S3OA 2JNGA 3G6EA 4BE2A 2RJCA 1XTDA 3L2UA 2OTLT 3QBYA 3CMEA 3MEUA 1Q81C 4II1A 2EQJA 3CCUA 2EKOA 5IN1A 3DLMA 3PMTA 3OYJA 1QVFA 3E9GA 3OB9A 1YJWT 2OTJT 3S6WA 3G71A 1VQ8A 3CCLT 4ZTJA 3LH0A 1VQ5T 3SD4A 2B8AA 3CCQT 3E9FA 4QQ6A 2GFAA 3L2QA 2HQEA 5KCHA 3OYKA 1NZ9A 2BUDA 3MP1A 5M9OA 5FRMA 3TREA 3CCJA 2D9TA 3OYGA 1W2BA 1YITA 3OMCA 1S72T 3CCVA 1KC8C 4TVRA 2R5MA 4B9WA 4IUTA 3P8DA 3CCMT 3PFSA 1WJQA 1YI2T 4E7IA 2LCLA 3CCSA 4OVAA 2RHUA 3OMGA 3UT1A 1RL2A 4X34A 1YJNA 1Q81U 2QQRA 4FL6A 1VQ4A 4PL6A 1QVFS 3CMAA 1NJIU 3CC2A 2DIGA 3ME9A 1NPPA 3CCRT 3ZEHA 3OYMA 3QJ6A 1VQLT 1XNIA 3OYHA 1VQPA 1OZ3A 2RHIA 2JUFA 4IKFA 2BIVA 1W2BS 3UWNA 1VQNA 5A2QE 4E7HA 4ZN3A 3JAME 3P8BB 1YHQT 2JZ2A 3OQ5A 4CRIA 2GFUA 2R58A 2RJEA 4ZTFA 4RG2A 1VQ6A 1VQOA 4QQGA 1M1GA 2XHCA 2CKKA 3CPWA 1KQSA 1EIFA 5C6SA 1IZ6A 3QIIA 3MP8A 5HY6A 1YJ9A 4N4IA 1VQ9T 3C4SA 1SSFA 2M16A 3CC7T 1KHCA 5KCOA 2QQSA 4IUQA 2BKDN 1VQMT 2X4XA 2LQ8A 1NJIC 1H3ZA 3J7AF 3BDLA 1K9MU 2RHYA 3H6ZA 2F5KA 4N4GA 2OTLA 1G5VA 3NTIA 2FHDA 4E7LA 2QEXT 4E7KA 3OYNA 3OYFA 3CPWS 1YJWA 2OTJA 1KQSS 1K73U 3O8VA 4IUUA 5KE3A 4N4HA 3CCLA 2WACA 1VQ5A 3CCQA 4IUVA 1WGSA 3S3MA 2R5AA 3J80E 4QQDA 3MEVA 4NS5A 1Q82C 1Q86U 5FROA 3L2VA 3MEAA 4E7JA 3CC4T 1Q7YU 4EDUA 2K3XA 1S72A 4A4GA 3NTHA 3CXCA 4FU6A 1OYXA 3OS1A 4Q5WA 3I55T 3CCMA 3OA6A 1N8RU 1YI2A 3OYDA 1VQKT 4BE0A 3OYLA 1MHNA 4QW2A 3OYIA 3PNWC 3LLRA 3META 3FLGA 1K9MC 1VQPT 2XDPA 2EIFA 3G4ST 2QA4T 4BDYA 3CCRA 2RHZA 3KUFA 2DIQA 3ER0A 1M90C 3F70A 3DB4A 1VQLA 5J39A 3CCET 3ASKA 3L42A 5CIUA 4BD3A 2DAQA 3CD6T 5D6YA 1K73C 2NLUA 2RO0A 3HKSA 2E6NA 3FDRA 3I56T 1Q82U 1VQ7T 4PLIA 5D6XA 5DM7R 3PIOA 1KHIA 1BKBA 1YHQA 1M1KU 2X35A 3CXCS 1Q86C 3LGLA 2RI5A 3DB3A 3L2WA 2E70A 4B9XA 2EFIA 1Q7YC 1YIJT 3G6ET 1QVGA 4LD6A 4BDZA 1KD1C 4C5GA 3LYIA 3CMET 3L2RA 3CCUT 4BACA 1N8RC 2X4YA 2RJDA 2MWOA 1UEBA 1YBYA 1VQ9A 3P8HA 2EQKA 3GOXA 4BE1A 2GF7A 5J3BA 3CC7A 3CPFA 3LGFA 3G71T 1VQ8T 2DO3A 3OYCA 3OW2A 1VQMA 1JJ2A 3CEYA 1M90U 2L3RA 2MI6A 2IG0A 3PIPA 3OYAA 3CCJT 1YITT 5D6WA 2LTOA 2KDSA 5C0MA 3M9QA 3CCVT 2MWPA 2JVVA 2R57A 5LL6S 3H8ZA 2M1HA 4QVZA 2QEXA 4IUPA 2O4XA 1K8AU 5FLXE 5DLQE 4C5HA 3EAEA 3CCST 1QVGS 1M1KC 3LX7A 2RJFA 2XK0A 1NPRA 2K3YA 3MP6A 3OYEA 2PQWA 1KD1U 3OYYA 5KH6A 1YJNT 4HCZA 1VQ4T 4C5EA 1N27A 3S3NA 3FEOA 3CMAT 2RI3A 2L8DA 3CC2T 4PLLA 1WJRA 5FRNA 2LVMA 5J26A 3CC4A 2E5QA 3MO8A 2JTFA 1RI0A 3OW2S 3FC3A 2G3RA 3J81E 3KBGA 5KE2A 1JJ2S 1OZ2A 5IT9E 4GY5A 4A4FA 2HQXA 4C5IA 3I55A 2LRQA 3MEWA 3OY9A 1VQKA 1VQNT 5IAYA 3A5ZB 4YTLA 2P0KA 1OI1A 3OS2A 4L59A 3OS0A 2LCCA 2LDMA 3Q1JA 3DLLA 1VQOT 1VQ6T 4IURA 3PMIA 3G4SA 2QA4A 2KVQG 2JOYA 3NTKA 4ZN1A 2L89A 1YJ9T 3CCEA 1K8AC 1KC8U 4UC4A 2E6ZA 3CD6A 2RI2A 2O4XB 2VYTA 3OYBA 2X4WA 4A4HA 3I56A 1X6OA 2EQMA 2RHXA 2YRVA 1VQ7A 2EQUA 3QKJA 2M0OA 4Z02A 4A4EA
chains in the Genus database with same CATH superfamily
4N0AC 4LNPA 1RACB 1RAEB 2CSIA 3URGA 1YIJA 2KAFA 2AHJB 1TG0A 4DOWA 1N9RA 4F7UG 3CMEA 1Y0MA 3T9NA 4J7IA 4HT8A 4IIMA 1QVFA 1J3TA 2KE9A 1YJWT 1VQ4Q 2OTJT 3SD4A 2B8AA 4QQ6A 3M0UA 2CP5A 2HQEA 2JT4A 2ESWA 5KCHA 2HKNA 1NZ9A 2BUDA 4JZ4A 4M7AD 5FRMA 2DTOA 3OYGA 3EFRA 3OMCA 1A0NB 8AT1B 2AKLA 2LC4A 4MMKA 4PJOA 3SB2A 4B9WA 1Y07A 5GAOn 4LD9K 3SDZA 3M53A 3CCSA 2DNUA 2I2LA 3EG1A 1H8KA 3JCMg 4OVAA 3I56Q 3EH1A 1P92A 3UT1A 3RR6A 1RL2A 4X34A 4PL6A 1B7TA 1OX9A 2NUZA 2VUBA 2Y4XA 1UDLA 3CMAA 1NJIU 1X2KA 3ME9A 1XJWB 4HVUA 4BB7A 2KQWA 3QJ6A 3TQ7P 2CZ7B 1GCQA 1VQLT 1SG5A 4QVCA 4LDXA 2MAMA 1XNIA 4BI8B 2FPFA 1VQPA 3CCUQ 1WZOA 1X01A 3VS5A 3LWIA 2BIVA 1W2BS 2HNIA 1VQNA 2GQVA 2P4RA 3JAME 2LZ6B 1AVZC 3ZL7C 1YFNA 2F1LA 4OMLA 3E2UA 1KFZA 2GFUA 4M78F 1VQOA 1KQ2A 2CKKA 1KQSA 1BBZA 1OPLA 2GQIA 2RN8A 5C6SA 1IZ6A 3QPHA 1YITQ 1WI7A 3QIIA 2COYA 4PJOB 2EGCA 1YJ9A 1PRLC 1W2BP 1OOTA 3JB9J 2M16A 1K76A 2ZPIB 2AIRB 1KHCA 2PUKB 4IUQA 1HYOA 1EX4A 2RMOA 5GMKl 1CKBA 4DEXA 2EGAA 2DM1A 3EHRA 4LUEA 3J7AF 2BTTA 3VS1A 4Z8AA 5LJ5j 2FPEA 2BZYA 1RADB 1LOJA 1YJNQ 4DBFA 3JCMe 1K9MU 3A98A 3FJPA 2QAZA 3CCMQ 2D0NA 2E5KA 4KGXB 2MIOA 3C0CA 2CYZB 4M75D 1M4ZA 2CGHA 4AMCA 1G5VA 1ZSZB 4E7LA 3KFVA 4M77A 1IHWA 5CQYA 4E7KA 1PCXA 2FVUA 2A08A 1QP3A 4HT9A 3CPWS 2W10A 2VVKA 5KE3A 4Y91A 1WXBA 2WACA 4KH0B 4ZNXA 4IUVA 2EVRA 4OB2B 4DBQA 2HKQB 4M78A 2DVJA 1PM3A 4MDWA 1Q82C 1M30A 4DOVA 1HJDA 1VQ6Q 1Q7YU 4EDUA 2K3XA 3TVTA 2MYSA 1S72A 3ULRB 3NTHA 4CC3A 3VS2A 4FU6A 1OYXA 2NYSA 3CPWP 1ARKA 3DKMA 2Z0WA 1YI2A 4ELYC 1D09B 1FMVA 1VQKT 1WHMA 3WVEB 1QP2A 5GANe 2DXUA 2H8HA 4J9CA 2JM8A 3FLGA 3A8HB 1B07A 4XU2A 4JLGA 2XDPA 2HL3A 3G4ST 4C92A 3KUFA 2CZ6B 1M90C 3JCMd 3F70A 2FEIA 3VS6A 1QVFP 3RIRA 2DJZA 3ASKA 1W4SA 3CCET 3L42A 5CIUA 5GAOp 2QASA 4M77B 2YT6A 5D6YA 1FX7A 3OS5A 1U3OA 2CT3A 3HKSA 5GAOm 3A8LB 4PLIA 2DTIA 1KHIA 1BKBA 5DM7R 1YHQA 1YJWQ 2X35A 3CXCS 1WDXA 2DBMA 3LGLA 4M78B 5LJ3e 5CR2A 5GMKi 2E70A 2K3BA 1PG5B 2E3IA 3EG0A 4LUDA 4B9XA 4CC2A 3G6ET 4Z88A 4RCCA 1KD1C 2L2PA 5GAN8 2OI3A 2XI9A 1K4US 4BACA 3H41A 5GMKe 2DXTA 2KMTA 4AFQC 1VQ9A 4OMNA 3GOXA 1IREB 3UA6A 1UJ0A 2PU9B 1R8OB 2VV5A 2ROLA 2RF0A 2DXBA 3CXCP 3CC7A 2YUQA 3OBWA 3LGFA 2DXCA 1VQ8T 4M77E 5CQXA 1ZLMA 3VV0A 1JJ2A 1RLPC 4OB0B 5GANd 3JCMh 2MI6A 1BU1A 1WPYA 4HCCA 5EC7A 3CCJT 1QVPA 2K7AA 4ZGDB 1NG2A 2D8HA 4M78E 2MWPA 4C92B 1NEGA 4C8QF 3JB9G 4QVZA 2O9VA 2QEXA 4IUPA 2VXFA 2DRMA 4QVDA 1K8AU 1WHKA 1QVGS 1M1KC 2H3EB 1F1BB 5CKHA 3MP6A 2PQWA 5KH6A 4A63B 2H3JA 1VQ4T 3O5ZA 3M0QA 3S3NA 1AHJB 3FEOA 4QKUA 5IHIA 2L8DA 2V1RA 2SEMA 2XU8A 3GP8A 1KC8R 4X9DA 5LJ3d 2LVMA 1UGPB 4MZTA 2JTFA 2QK0A 3OW2S 3FC3A 2JTEA 9ATCB 1QVGP 3QJYA 2HQXA 4C5IA 4JJDA 2LNVA 2LMJA 1JXMA 2PVGB 3BDUA 5GANh 2EWNA 3CBPA 4FYVB 1X6GA 4HVVA 4C92E 3OY9A 1N6AA 4AFSC 2P0KA 4EMGA 4MMLA 1C0MA 2FL7A 1ZBJA 2DJQA 2KVQG 4C8QA 4KRTA 4LDYA 2JOYA 4ATOA 4WCIA 3NTKA 3HL8A 3GF5A 4UC4A 3G71Q 2E1HA 4CI0C 2E6ZA 2XIDA 4JRQA 2RI2A 4PFZA 3C12A 2X4WA 3I56A 1UHCA 2RNAA 4PJOC 1V76A 2YRVA 2EQUA 3SFMA 5LJ3h 1PKSA 3I5SA 3QZ9B 2QYZA 2EJGA 1R77A 1UUEA 5CVIA 1WJSA 2E4HA 3S3OA 2JNGA 1LCKA 3LWHA 2V8JA 2J7IA 1Y7XA 3L2UA 4C0DB 2DPPB 1G8XA 3QHSA 3MJXA 5GMKh 2OTLT 2HSEB 3VS3A 4CC4B 4M7DA 2EQJA 2EKOA 2PNIA 1TUDA 3CCUA 4NL2A 4JJCA 4RMOA 5IN1A 3DLMA 1M1FA 3G7ZA 1Q95G 2KY9A 3OYJA 3M58A 2FPDA 3OB9A 5A0GA 3AT1B 1ZSZC 1W6XA 3CCLT 1VQKQ 2GFAA 2YRDA 3L2QA 4C0GA 2QTVA 3HHTB 2BZXA 2X4JA 4PK4A 1M8MA 2M51A 1W2BA 1YITA 5I2MA 2MF2A 1Y57A 1QCOA 4JS4A 1E7OA 1G83A 3HRUA 1LNXA 4TVRA 5IH2A 4C8QB 2A36A 3G4SQ 3JCMX 2CP2A 4IUTA 4L6V5 8ATCB 2DA9A 5FU7B 3P8DA 2AKKA 2O88A 3U23A 1O9SA 3CCMT 4CC7A 2FZGB 1WJQA 1JO8A 5CAIA 2EAYA 2DZ9A 4EMKA 2YUOA 5CK9A 2A28A 3R6OA 4J5YA 2PVDB 3ZBDA 1YJNA 1Q81U 4FL6A 2HBPA 1AZGB 1I07A 3A8GB 1RABB 4LDVA 2IPOB 3CCRT 1WLPB 3X25B 2HSPA 4M7AF 2YRCA 4M7DB 3OYHA 1WNLA 2DLPA 3PT9A 2L3PA 3BFMA 1OZ3A 4IKFA 3MKDA 2F2XA 4C8QE 2AZVA 1JJ2P 5A2QE 2CSQA 3X28B 5GAN4 5FW9A 4M77C 2JZ2A 3GIBA 2ZPFB 2DF6A 2KR3A 1JB0E 1VQ8Q 1SRMA 1HXDA 3INZA 1RAAB 4ZTFA 4RG2A 1VQ6A 3CPWA 5LJ5g 1EIFA 2K4YA 1NLOC 2GBQA 4M78C 3JCMc 2M0YA 1K73R 2F69A 4N4IA 4RTXA 3CCQQ 4M7DE 4EMKB 1ZUKA 2VASA 1XOVA 3IQLA 1Q86R 3VRYA 2L5QA 5DY9A 2EBPA 1VQMT 3RESA 1UGVA 2EYXA 4JJBA 2WSEE 4DA4A 2E10A 2YXYA 2GTOA 2FB7A 2DL3A 2DK3A 2LP5A 1U5SA 2B86A 5EG2A 4M7AA 2RHYA 4EIKA 1N8RR 1QMCA 2DL5A 3JCMJ 3OYNA 1M2OA 4C92C 3L2ZA 4LDWA 1YJWA 2OTJA 3VUBA 1R0CB 4IUUA 2C0IA 3JSCA 2SRCA 2DTHA 4E2FB 4WTOB 1WGSA 3S3MA 3GPLA 2GCXA 3J80E 3L1AA 1D1CA 3UA7A 2ABLA 2EJFA 3CC4T 1X27A 5GJVB 2E41A 4A4GA 3CXCA 1TS9A 1G3YA 3OS1A 5GAOl 2ROTA 3I55T 3RKXA 5LJ5e 2C06A 1UGRB 1CSKA 1UTIA 2DX1A 1AEYA 3FIFA 1ZSGA 1YCYA 1ZQ1A 2BE7D 3HRSA 1ZSZA 4JS5A 1MGQA 2DBKA 3LLRA 2FO0A 1PWTA 1QWFA 4M77F 5HCKA 1VQPT 1MMNA 3LW5E 3VRZA 2QA4T 4J83A 2RK2A 4M7AB 2RHZA 4P5NA 1VQLA 1SF9A 4XK8E 2OTLQ 2LJ1A 3BE3A 2GNCA 2COZA 3CD6T 1MV0B 4XAXB 2E6NA 3FDRA 3I9QA 2KXCA 2LQWA 1NYGA 2X3XD 3M55A 1M1KU 2CT4A 2JMAA 1X6BA 1YNZA 3RMQA 3CCLQ 2RI5A 3QG1A 3L2WA 2RH2A 4D6WA 4PNOA 2F5TX 1QVGA 4FIBA 3QSUA 3SWNB 3OSVA 3LYIA 2NUTA 3EHQA 3L2RA 1QCNA 4JDSA 2RJDA 2MWOA 3N5BB 4PJOG 4M75A 1UGSB 2DRKA 4C0DC 2EQKA 4M7AE 1UHFA 2VC8A 5J3BA 2XICA 1GFCA 3M57A 5LJ5d 2EYYA 3M0PA 3G71T 2OAUA 4C92F 3OYCA 3OW2A 2FZKB 3I5RA 1FXXA 2K2VA 2HEQA 2ZPEB 4VUBA 1U8RA 2ECZA 2K9GA 4XQ3A 2J05A 2LTOA 1Q81R 3M9QA 1GL5A 2KYBA 3CCVT 1G3TA 2R57A 4ANJA 1AWXA 3CCRQ 2K2MA 2DD5A 1QKXA 5KYNA 1WXUA 4RTYA 1MV3A 4ORZA 5DLQE 3EAEA 4OP0A 4HXJA 1MNEA 4J7FA 4C8QC 1UE9A 2RJFA 2JS0A 2XK0A 5FU7C 2K3YA 4LE9A 3UATA 2KRMA 3KXTA 2AZSA 3V8LA 1U06A 2RI3A 3CC2T 4EMHA 3E19A 4MZPA 1WJRA 4F14A 1JU5C 2E5QA 5J26A 3MO8A 5IHNA 2DYIA 4AFZC 1RI0A 2NUTB 1YWPA 1OZ2A 3BW1A 5I21A 4M75B 1BYMA 3EGDA 2DYBA 4XU0A 4J9EA 3M0SA 1I8FA 1VQKA 4M7DC 2LNHB 4YTLA 3UF4A 3JB9I 1YIJQ 3HFOA 4L59A 1OULA 4B6MA 1KIKA 3CMEQ 2YLBA 5GAMj 1VQMQ 1SSHA 1IGUA 2V26A 2Y90A 4IURA 3VYGA 1HD3A 2BZ8A 3JB9D 4PFPA 4K11A 3G4SA 4JLIA 4DBRA 2VXEA 3OBYA 2L89A 3CCEA 2KRSA 4PJJA 1GRIA 4M4ZA 2QTXA 4KBMB 4M77G 2VYTA 1M3CA 3OYBA 5A0LA 4GBQA 2W0ZA 2MK5A 2A7YA 4M75E 5KYWA 4Z02A 4A4EA 2RD1A 3GNGA 4XTUA 1QW1A 4FW2A 3M4GA 2VKNA 3RDVA 4EMKC 2K5FA 4M78G 5KYUA 2J6KA 3G6EA 2RJCA 1ACMB 2E65A 1D0YA 2JTMA 4II1A 3CC4Q 1K1ZA 1I4K1 1PHTA 2YSQA 1WHJA 5I11A 3FJ5A 2L0AA 3E9GA 4LN2A 3EGDB 4XTZA 2P0PA 3I55Q 2HZYA 3JRZA 3S6WA 5GANj 1NJIR 1VQ8A 4ZTJA 2JW4A 3LH0A 1VQ5T 3CCQT 1NE8A 1MMDA 1V29B 3H0FA 1MMAA 3PTAA 1M9SA 3TEEA 3MP1A 2CP3A 3C95A 5M9OA 3A8MB 1YCSB 3TREA 1NBEB 3CCJA 2D9TA 2YDLA 1FWZA 1VQPQ 4KT0E 1KC8C 3EFOA 4E7SA 2HMAA 3HP9A 4C92G 2QA4Q 1SHGA 1VQNQ 2XG8D 2QI2A 5LJ5f 2ZGWA 4Y28E 2KT1A 3PFSA 2DD4A 1SHFA 2HCKA 2LCLA 2DEUA 2RK1A 3AHUA 3CD6Q 4RTWA 2LT4A 4FW1A 4J8OA 2RPNA 2RHUA 3OMGA 2O9SA 3TCJA 1KQ1A 5KYWB 4M7DF 2Y4YA 1PSEA 2ED1A 5KYXA 1VQ4A 3EFSA 5LJ3j 2EW3A 5KYUB 1NPPA 1H3HA 3ZEHA 3SHWA 3CBMA 4GLKA 2OX7A 1C1AA 1MUZA 1YN8A 2J6FA 4PKCC 1RLQC 3V7SA 5GMKj 1IXDA 3VJPA 1V1CA 2D6FA 4M7AC 2JUFA 2MOXA 1DJ7B 3OW2P 2ATCB 3I35A 3UWNA 1ZX6A 3JB9H 4E7HA 2CP7A 3PVLA 3P8BB 4JUVA 1K9MR 2LX9A 1TUCA 3UPUA 1ABQA 1BI3A 3SEMA 3NFCA 1AWWA 5GAN2 3VYHB 4CRIA 2RJEA 2F2VA 1T0JA 2OJ2A 4OB1B 4PJMA 1M1GA 1VIFA 4BY6B 4F04B 3EFOB 2CUBA 4J6WA 3MP8A 1WFWA 3CCVQ 3SWNC 3C4SA 4FT4A 2CH4W 1SSFA 2PVOB 1U1TA 2LCSA 2HL5C 1BB9A 2ZPBB 1WHHA 3C94A 1TUGB 2QQSA 2X3WD 2X4XA 2RB6A 5GAMf 3HRTA 2XD0A 1Q7YR 1S72Q 5KYXB 1QWEA 4HA8A 3WVDB 5GJWB 4KULA 3CC2Q 4N4GA 3H6ZA 1YI2Q 2OTLA 4C0ZA 2RQUA 3EGUA 2F2WA 2FHDA 2L3QA 4JRPA 1NM7A 4LDUA 1OQKA 1TWBA 2DL7A 1D3BB 2O2OA 2O01E 4RKUE 1X69A 1RAHB 4J6YA 4N4HA 3CCLA 1JRIA 1W1FA 2RM4A 3M0RA 1ZUUA 4PJLA 2FYKA 2R5AA 4GLMA 3MEVA 2DMOA 1YP5A 5FROA 3L2VA 1KG1A 1QCFA 1MMGA 3MCAB 4MDXA 2HBWA 5GAOq 4DBHA 1B3QA 5HK0A 5HKCA 4C8QG 1OEBA 1I1JA 2K5IA 2RQVA 1BIAA 2JXBA 1YHQQ 4MZMA 2A0FB 2HDAA 5CKEA 1KJWA 3CCMA 4OMOA 3THKA 3REBB 3OYDA 1JBMA 1ZA1B 1X43A 2HQHA 2KRNA 2KI7A 3OYLA 1Z9QA 3V8JA 1WHGA 4QW2A 4M75C 2FRYA 4J6XA 2CZ1B 2KEAA 1RAFB 2EJ9A 3PNWC 3META 2CS7A 2P0QA 4RUGA 4PFOA 2EYQA 3M4YA 1VIEA 2LJ0A 4ELZC 2P84A 1VYTA 3CCRA 2KBTA 2DIQA 5FWCA 4FSSA 3DB4A 4AG1C 3CC7Q 4KUIA 4M7DG 4OMMA 1GFDA 2KYMA 1HSQA 2DAQA 1M2VA 1K73C 5FWBA 4OGCA 2C0TA 4AG2C 2RO0A 5CKDA 1Q82U 5AYFA 2DFUA 4Z89A 1VQ7T 2DVEA 3D7SB 5D6XA 1D1AA 3X26B 1OV3A 4JJNK 1Q86C 2VWFA 1VQ5Q 1PD1A 1U1SA 2EFIA 1YIJT 1TSFA 4E6RA 2QEXQ 2DEQA 2EKHA 1X2QA 3RUXA 4F7UB 1HK9A 3CMET 1BI1A 1K8AR 4RG8A 1JQQA 4JZ3A 4D8DA 3QYGB 1N8RC 2X4YA 2I0NA 1E6HA 3MPUB 2NWMA 1D1BA 4O5VA 2QXFA 3P8HA 2M9UA 4BE1A 2JM9A 3UDCA 2DKGA 4HKEA 3M56A 2GF7A 3GBQA 4OB3B 3TU4K 2CP0A 2X51A 1CKAA 3VS7A 1RAGB 3CPFA 2ENMA 1VQMA 3HTRA 5L8RE 3CEYA 2NUPA 2RA2A 1M90U 5I2SA 4AT1B 5FU6B 2EGEA 4NL3A 1RUWA 5C0MA 2GTJA 5GAN6 1GBQA 2VB6A 3VKIA 2JN0A 5LL6S 2M1HA 1C6VX 2O4XA 4F7UE 4J9BA 3EGXA 1M2VB 3SWNA 4C0FA 4C5HA 5FLXE 3HSBA 3CCST 7AT1B 1JXOA 1X75C 1TH7A 1BI2A 2E64A 3M0TA 2WSCE 1NPRA 4OMFB 3OYEA 1KD1U 3OYYA 1AWJA 4LXCA 2A37A 4HCZA 4C5EA 1N27A 4Y92A 2QGGA 2FRWA 4M75F 3CMAT 1Z9ZA 2QQBA 1NLPC 5GAMg 4XU3A 5L23A 4X9CA 4PJOD 3CC4A 4AFUC 1G3WA 2PUOB 3J81E 3KBGA 1I0CA 4OMPA 5KE2A 2LX7A 3QDRB 4GY5A 1SKUB 5IT9E 1ABOA 1UG1A 3I55A 5GAOr 4X1VA 2DETA 5GAN5 2LRQA 3MEWA 2CZ0B 1VQNT 3E1SA 3A5ZB 4OMQA 4DQ2A 1OX8A 2V8KA 2NUPB 2V8IA 1PNJA 3EH2A 5CO7A 3Q1JA 1VQOT 3PMIA 1KSWA 1W70A 3HFNA 2D0QB 4NOYA 3H0IA 2QA4A 2CH4A 3QWYA 4F17A 2COWA 4M7AG 1N9SA 3RKWA 1LJOA 2L3SA 4ZN1A 1YJ9T 1KC8U 4BY6C 1M27C 3QUIA 1WQWA 1ZBXA 3CD6A 2D1XA 2O4XB 4A4HA 3EGXB 1X6OA 2EQMA 1AZEA 2RHXA 2J06A 3PGGA 1TXQA 5GANg 1PSFA 4KH1B 2G6FX 2ZAEA 4BE2A 1K0SA 1XTDA 3NPFA 4F16A 2YUNA 3QBYA 3MEUA 2CREA 1Q81C 4EPCA 1SRLA 1AWOA 1T3LA 5HK3A 3EG3A 3JB9F 3G1JA 3PMTA 3GNFB 1LPLA 5GAMe 3A1PA 1YWOA 2A3LA 4ZGEB 2EYWA 4E7ZA 3G71A 3JCMV 3E9FA 3OYKA 4J9IA 5AT1B 2EQIA 3CBOA 2KXDA 1WXTA 3H9NA 2IVWA 3WXMB 1RAIB 5LJ3g 4PJOE 3M54A 1S72T 3CCVA 2R5MA 4M77D 2HAXA 1M5Q1 1R0BG 3NHNA 1TOVA 2FG0A 3V7RA 2KT8A 1YI2T 4E7IA 1FYNA 4N0AA 3RBBB 1OU8A 4J9DA 2VGMA 4FCYA 2LT1A 3FRNA 4M78D 5LJ5h 4XTXA 2XDDA 4FYXB 1Q82R 1VQ7Q 2QQRA 3MHXA 1QVFS 2K57A 3CC2A 1UB4A 3RERA 2DIGA 5CCAA 2QDYB 1UJYA 3VS0A 3QZ5B 3OYMA 4HVWA 2D8JA 1ZHIA 5D7UA 2LQKA 3X24B 5ECAA 2YWWA 1BCMA 4ME7A 4A53A 2QGFB 2RHIA 4J9GA 4M75G 2C0OA 1D0XA 4FT2A 4JPBW 3QYHB 2AK5A 3GLXA 4E47A 2DILA 1D0ZA 5GAMd 1VA7A 2EYZA 4ZN3A 2ZZDA 2JJ9A 1YHQT 4PJNA 2QQAA 2WSFE 4OGEA 3ZFJA 1Y96A 3NGPA 3OQ5A 4RTUA 2R58A 3M5AA 4QQGA 4BUGA 4C92D 2XHCA 1M90R 2KGTA 2CUDA 1TTHB 3QXEB 1VOMA 2OTJQ 3R6NA 2JS2A 4DEYA 5HY6A 3EG2A 2ZPHB 2IIMA 4HCKA 1VQ9T 1NEBA 2K79A 3M59A 1ZA2B 2VGNA 1WIEA 2J6OA 4OF1A 1QQJA 4J9FA 1BCOA 1FMKA 1BK2A 3CC7T 2PZ1A 3REAB 4BI3A 5KCOA 3CCSQ 3CQTA 2BKDN 4R0KA 2LQ8A 2CDTA 4XTYA 1VUBA 4V2SA 3VUZA 1NJIC 1H3ZA 2DERA 3BY7A 2QDLA 3V8KA 1KD1R 3BDLA 1QKWA 4D8KA 1BI0A 1SPKA 1WX6A 3CMAQ 2F5KA 1B34A 5GAMh 5FU6C 2OAWA 1O75A 3NTIA 2QEXT 3OYFA 3JCMb 4O6JA 3FB9A 4XTVA 1IB8A 1KQSS 1K73U 3O8VA 1WA7A 3PVQA 3RKYA 1VQ5A 1H641 3CCQA 1N5ZA 3LH5A 5GMKm 1G2BA 4QQDA 1WHLA 4NS5A 5IXFA 1Y96B 2BE9B 1VQLQ 1Q86U 4RCBA 2DE0X 3QO3A 1M3BA 2DL8A 1H92A 3MEAA 4E7JA 1VQOQ 1IGQA 1QLYA 2LJ3A 1GCPA 3JCMQ 2MMPA 3JV3A 1NYFA 1KQSP 4Q5WA 1UGQB 1M1KR 4HCBA 3OA6A 3JCMP 1N8RU 1YJ9Q 1AT1B 2YUPA 1TU0B 2ZPGB 3TSWA 2QG9B 4BE0A 3RMSA 1GBRA 1MHNA 3A8OB 3OYIA 2KSSA 2X9HA 1UECA 1JEGA 1K9MC 1D3BA 1I5LA 2K5LA 2EIFA 3PE0A 4BDYA 2RQWA 3ER0A 4ZGJB 1OPKA 1B34B 1I5OB 4RTTA 3NMZC 5J39A 1Y71A 4BD3A 2LQNA 4WF2A 4A54A 2NLUA 4ESRA 2PTKA 3I56T 3HPWA 4FYYB 4F7UF 4FSXA 2YHTA 3PIOA 4BI4A 1KK7A 1BIBA 5A0DA 4FYWB 3DB3A 1M3AA 5KYYA 1T3SA 1Q7YC 3H0HA 6AT1B 1IHVA 4C8QD 4LD6A 4BDZA 4C5GA 5IHKA 2KK4A 5DLOA 3QDFA 1VYUA 1E6GA 2P4TA 3CCUT 4KGZB 2XKOC 1AD5A 1M8VA 1UEBA 1YBYA 3JCMf 2YLCA 3JCMW 4J9HA 2KROA 1K9AA 2DZCA 1SEMA 3RNJA 2DO3A 3VS4A 4KUDK 1VYVA 5GAN7 2XMFA 2L3RA 5I22A 4FM4B 2IG0A 3PIPA 3OYAA 2K6DA 1YITT 5D6WA 2KDSA 4M7DD 2ZCFB 1GCQC 2JVVA 1IO6A 4R56A 3EG9A 3H8ZA 2HD0A 1EZZB 2CP6A 4JRIA 4JRKA 1FMWA 2DL4A 4A4KA 1PKTA 2XDBA 2M02A 1OU9A 4F7UA 3LX7A 1XQHA 3X20B 1G3SA 1IRXA 4KGVB 1YJNT 3TSZA 1EFNA 5KYYB 4PLLA 3CCEQ 5GANf 5FRNA 2FZCB 1PRMC 2MCNA 2G3RA 2KNBB 1S1NA 3QWXX 2V1QA 1JJ2S 1AOJA 1T0HA 2JMCA 1ZUYA 4A4FA 1K0XA 2AT1B 1WYXA 1I81A 1LVKA 2O31A 1VQ9Q 2GGRA 5IAYA 5GAN3 4L5GA 2RQTA 4XU1A 1OI1A 2E12A 3G6EQ 3OS2A 4RTZA 1PD0A 1WQ7A 3OS0A 2LCCA 4IIOA 1RI9A 2LDMA 2QQ9A 3DLLA 1VQ6T 2EPDA 3OSSC 3V7CA 1MNDA 5IXBA 3EG9B 5LJ3f 4PJOF 2RQRA 1K8AC 4RTVA 4R55A 4QT7A 4XTWA 2E3HA 1UFFA 1GXIE 1PC0A 3VU3C 1VQ7A 3QKJA 3CCJQ 2M0OA 2MPXC 5CKFA 2ED0A 5CKBA
chains in the Genus database with same CATH topology
2EJGA 4N0AC 4EMKC 5CVIA 2K5FA 4M78G 1WJSA 3URGA 1YIJA 3S3OA 2JNGA 3G6EA 2KAFA 2V8JA 2AHJB 2RJCA 4DOWA 3LWHA 1Y7XA 1N9RA 1XTDA 4C0DB 2E65A 3L2UA 2DPPB 3QHSA 5GMKh 4F7UG 3QBYA 2OTLT 3CMEA 3MEUA 2JTMA 4II1A 2EQJA 4EPCA 1Q81C 4M7DA 5HK3A 2EKOA 3T9NA 3CCUA 3JB9F 4NL2A 4J7IA 4RMOA 5IN1A 1I4K1 3DLMA 3PMTA 4HT8A 1M1FA 3G7ZA 3GNFB 5GAMe 2KY9A 3OYJA 3M58A 1QVFA 3E9GA 4XTZA 3OB9A 5A0GA 1YJWT 2OTJT 2A3LA 2P0PA 4ZGEB 3JRZA 3S6WA 5GANj 3G71A 1VQ8A 3CCLT 4ZTJA 3LH0A 1VQ5T 3SD4A 2B8AA 3JCMV 3CCQT 3E9FA 1NE8A 2GFAA 1V29B 4QQ6A 3L2QA 2HQEA 4C0GA 5KCHA 3HHTB 3PTAA 3OYKA 2X4JA 1M9SA 3CBOA 1NZ9A 3TEEA 2BUDA 3MP1A 3C95A 5M9OA 3A8MB 4M7AD 5FRMA 2IVWA 3WXMB 3TREA 2DTOA 3CCJA 2D9TA 3OYGA 1W2BA 1FWZA 5LJ3g 5I2MA 1YITA 3EFRA 2MF2A 3OMCA 4PJOE 4JS4A 3M54A 4KT0E 2LC4A 3CCVA 1S72T 1KC8C 4MMKA 3HRUA 1LNXA 4TVRA 4PJOA 2R5MA 3HP9A 4M77D 4C8QB 4C92G 2HAXA 3JCMX 3SB2A 4IUTA 4B9WA 2XG8D 2QI2A 4L6V5 5LJ5f 5FU7B 2ZGWA 1M5Q1 3P8DA 1Y07A 4Y28E 5GAOn 1O9SA 3CCMT 4LD9K 3PFSA 3SDZA 2DD4A 1WJQA 3V7RA 1YI2T 4E7IA 3M53A 2LCLA 5CAIA 2EAYA 4N0AA 2DZ9A 3CCSA 4EMKA 2RK1A 3AHUA 2I2LA 2VGMA 2LT1A 5CK9A 2LT4A 3FRNA 3JCMg 4OVAA 3R6OA 4J8OA 4M78D 2RHUA 3OMGA 5LJ5h 4XTXA 3TCJA 4J5YA 2XDDA 1P92A 1KQ1A 2PVDB 4M7DF 2Y4YA 3UT1A 3ZBDA 1PSEA 1RL2A 4X34A 2QQRA 4PL6A 4FL6A 2HBPA 4BE2A 1VQ4A 1YJNA 1Q81U 3EFSA 3MHXA 2VUBA 2Y4XA 5LJ3j 1QVFS 3CMAA 1NJIU 2K57A 4HCBA 3CC2A 1UB4A 3A8GB 3RERA 2DIGA 3ME9A 4LDVA 5CCAA 1NPPA 2QDYB 3CCRT 3ZEHA 3X25B 3QZ5B 3OYMA 3CBMA 4GLKA 4BB7A 4M7AF 2KQWA 3QJ6A 1ZHIA 2CZ7B 2LQKA 3X24B 1VQLT 4PKCC 4QVCA 4LDXA 2MAMA 1XNIA 4M7DB 3V7SA 4BI8B 3OYHA 4ME7A 4A53A 1WNLA 5GMKj 3VJPA 1VQPA 3PT9A 3BFMA 1OZ3A 2D6FA 2RHIA 4M75G 1X01A 2JUFA 3LWIA 1DJ7B 2BIVA 4IKFA 4FT2A 3QYHB 3GLXA 4C8QE 4E47A 1W2BS 2HNIA 3UWNA 5GAMd 1VQNA 2GQVA 3JB9H 5A2QE 4E7HA 4M7AE 4ZN3A 3JAME 2ZZDA 3P8BB 4JUVA 3X28B 5GAN4 1YHQT 4M77C 2JZ2A 2QQAA 2WSFE 2ZPFB 4OGEA 3GIBA 2LX9A 3UPUA 1JB0E 3ZFJA 1BI3A 1HXDA 1Y96A 3INZA 3NFCA 3OQ5A 5GAN2 2GFUA 2R58A 2RJEA 4M78F 3VYHB 4CRIA 4RG2A 4ZTFA 1VQ6A 3M5AA 4OB1B 1VQOA 4QQGA 4BUGA 1M1GA 1VIFA 2XHCA 4BY6B 4C92D 1KQ2A 2CKKA 3CPWA 4PJOD 5LJ5g 1KQSA 1EIFA 2K4YA 5C6SA 1IZ6A 4M78C 3JCMc 3QPHA 3QXEB 4J6WA 3QIIA 4PJOB 3MP8A 5HY6A 1YJ9A 2F69A 2ZPHB 4N4IA 3SWNC 1VQ9T 3C4SA 4FT4A 3JB9J 3M59A 2VGNA 1SSFA 2M16A 2PVOB 1U1TA 4OF1A 4M7DE 3CC7T 2ZPIB 4EMKB 1XOVA 1KHCA 2PUKB 2ZPBB 4BI3A 2L5QA 3C94A 2QQSA 4IUQA 5KCOA 5DY9A 2BKDN 1VQMT 2X4XA 2LQ8A 4XTYA 5GMKl 1VUBA 4V2SA 2RB6A 5GAMf 3VUZA 1NJIC 1H3ZA 3RESA 3HRTA 2XD0A 3BY7A 2WSEE 4DA4A 3J7AF 2E10A 3WVDB 4HA8A 3V8KA 5LJ5j 2FB7A 3BDLA 2DK3A 1LOJA 3JCMe 1K9MU 5EG2A 3FJPA 4M7AA 1BI0A 4KULA 2RHYA 3H6ZA 2F5KA 4N4GA 2OTLA 1B34A 4C0ZA 5GAMh 5FU6C 2CYZB 4M75D 1M4ZA 2CGHA 1O75A 1G5VA 3NTIA 2FHDA 4E7LA 2QEXT 4M77A 5CQYA 4E7KA 3JCMJ 4JRPA 3OYNA 2FVUA 3OYFA 4LDUA 3JCMb 1D3BB 4O6JA 2O01E 1QP3A 3FB9A 3L2ZA 4C92C 4HT9A 3CPWS 4LDWA 1YJWA 4XTVA 2OTJA 3VUBA 1KQSS 4RKUE 1K73U 3O8VA 4IUUA 5KE3A 3JSCA 4Y91A 4J6YA 4N4HA 2WACA 3RKYA 1JRIA 2DTHA 3CCLA 1VQ5A 1H641 3CCQA 4IUVA 2RM4A 4OB2B 1WGSA 3S3MA 4M78A 5GMKm 2FYKA 2R5AA 3GPLA 2GCXA 3J80E 4NS5A 3MEVA 3L1AA 4QQDA 1Y96B 4MDWA 1Q82C 1Q86U 4RCBA 3QO3A 4DOVA 5FROA 3L2VA 1KG1A 3MEAA 2EJFA 4E7JA 3CC4T 3MCAB 1Q7YU 4MDXA 4EDUA 2K3XA 1S72A 5GAOq 2E41A 4A4GA 3NTHA 5HK0A 5HKCA 3CXCA 4C8QG 1G3YA 4FU6A 3JCMQ 2K5IA 1OYXA 1BIAA 3OS1A 2MMPA 4MZMA 1UGQB 4Q5WA 5GAOl 3DKMA 5CKEA 3RKXA 5LJ5e 3OA6A 3I55T 3CCMA 3JCMP 1YI2A 1N8RU 4ELYC 3HSBA 2C06A 1UGRB 3OYDA 2ZPGB 1JBMA 1VQKT 4BE0A 3FIFA 3RMSA 1YCYA 1ZQ1A 1QP2A 3WVEB 5GANe 2DXUA 3V8JA 3OYLA 4BE1A 1MHNA 3A8OB 4QW2A 3OYIA 3HRSA 4M75C 2KSSA 4J6XA 4JS5A 2CZ1B 1MGQA 3PNWC 2EJ9A 3LLRA 3META 2CS7A 2P0QA 3FLGA 2EYQA 3A8HB 1K9MC 4M77F 1D3BA 1VQPT 1I5LA 4XU2A 3M4YA 2K5LA 4JLGA 2XDPA 3LW5E 2EIFA 1VIEA 4ELZC 3G4ST 2QA4T 4J83A 3CCRA 2RK2A 4BDYA 4M7AB 2RHZA 3KUFA 4C92A 2DIQA 2CZ6B 3ER0A 4P5NA 4ZGJB 1M90C 3JCMd 3F70A 1B34B 3DB4A 1VQLA 4XK8E 2DJZA 3RIRA 4KUIA 5J39A 1Y71A 4M7DG 3ASKA 1W4SA 3CCET 3L42A 5CIUA 4BD3A 5GAOp 4M77B 2DAQA 4WF2A 5D6YA 4A54A 1FX7A 1K73C 3CD6T 4OGCA 2NLUA 2RO0A 3OS5A 3HKSA 2E6NA 3FDRA 4XAXB 5GAOm 3I56T 3HPWA 3A8LB 5CKDA 1Q82U 5AYFA 4F7UF 1VQ7T 2DVEA 4PLIA 4FSXA 2DTIA 2YHTA 3M55A 1KHIA 1BKBA 5D6XA 3X26B 4BI4A 5DM7R 3PIOA 1YHQA 2X35A 1M1KU 1BIBA 3CXCS 5A0DA 4JJNK 1Q86C 3LGLA 3RMQA 2RI5A 4M78B 3DB3A 3QG1A 5LJ3e 5CR2A 3L2WA 2RH2A 5GMKi 1U1SA 2E70A 2EFIA 4B9XA 4D6WA 1Q7YC 1YIJT 4PNOA 2F5TX 3G6ET 1QVGA 4FIBA 4RCCA 3QSUA 3SWNB 2DEQA 3OSVA 4C8QD 4LD6A 4BDZA 1KD1C 3RUXA 4F7UB 4C5GA 3LYIA 2KK4A 1HK9A 5DLOA 5GAN8 3CMET 1BI1A 4RG8A 2P4TA 2XI9A 3L2RA 3CCUT 4BACA 3QYGB 2XKOC 4JDSA 1N8RC 2X4YA 2RJDA 2MWOA 3N5BB 1M8VA 4PJOG 5GMKe 2DXTA 1UEBA 1YBYA 2KMTA 4M75A 1VQ9A 1UGSB 2QXFA 3P8HA 2EQKA 2M9UA 4O5VA 3JCMf 3UDCA 4C0DC 2DKGA 2YLCA 1IREB 3M56A 2GF7A 2PU9B 2VC8A 1R8OB 4HKEA 4OB3B 3TU4K 5J3BA 3JCMW 2VV5A 2XICA 2DXBA 3CC7A 3M57A 2DZCA 3OBWA 5LJ5d 3CPFA 3LGFA 2DXCA 3G71T 1VQ8T 2OAUA 2DO3A 4M77E 4C92F 3OYCA 3OW2A 5CQXA 1VQMA 4KUDK 5GAN7 3VV0A 1JJ2A 5L8RE 4OB0B 1FXXA 3CEYA 2RA2A 3JCMh 5GANd 5I2SA 2L3RA 2K2VA 1M90U 2MI6A 2ZPEB 5FU6B 4VUBA 1WPYA 4FM4B 4NL3A 1U8RA 4HCCA 2IG0A 4XQ3A 3PIPA 3OYAA 3CCJT 1YITT 5D6WA 2LTOA 2KDSA 5C0MA 1QVPA 4M7DD 4ZGDB 3M9QA 2ZCFB 5GAN6 3CCVT 4M78E 2MWPA 2JVVA 4C92B 3VKIA 1G3TA 2JN0A 2R57A 5LL6S 4R56A 3H8ZA 4C8QF 2M1HA 3JB9G 2HD0A 4QVZA 2DD5A 2QEXA 4IUPA 4JRIA 4JRKA 2O4XA 2VXFA 4F7UE 4QVDA 4A4KA 3SWNA 1K8AU 4C0FA 5DLQE 4C5HA 3EAEA 4OP0A 5FLXE 3CCST 4J7FA 1QVGS 4F7UA 1M1KC 4C8QC 2XDBA 3M4GA 3LX7A 1X75C 1TH7A 1BI2A 2RJFA 2E64A 5CKHA 2XK0A 2WSCE 1NPRA 1XQHA 2K3YA 4OMFB 5FU7C 3X20B 3MP6A 3OYEA 1G3SA 2PQWA 1KD1U 3OYYA 5KH6A 2H3JA 3KXTA 4HCZA 1YJNT 4C5EA 1VQ4T 1N27A 3S3NA 1AHJB 4M75F 3FEOA 3V8LA 3CMAT 2RI3A 2L8DA 2QQBA 4PLLA 3CC2T 4EMHA 2XU8A 3E19A 4XU3A 5GAMg 4MZPA 1WJRA 5GANf 4X9CA 4X9DA 3GP8A 5FRNA 5LJ3d 2LVMA 1UGPB 2E5QA 5J26A 3MO8A 1G3WA 4MZTA 2JTFA 3CC4A 2PUOB 1RI0A 3OW2S 3FC3A 2G3RA 3J81E 3KBGA 5KE2A 3QDRB 1JJ2S 1OZ2A 4GY5A 5IT9E 3BW1A 3QJYA 4A4FA 2HQXA 4C5IA 2LNVA 5I21A 4M75B 2PVGB 3BDUA 3I55A 5GAOr 5GANh 1BYMA 5GAN5 1I81A 2EWNA 2LRQA 4M7AC 3MEWA 4XU0A 3CBPA 4C92E 3OY9A 2CZ0B 1I8FA 1N6AA 1VQKA 1VQNT 5IAYA 4M7DC 3E1SA 3A5ZB 5GAN3 4YTLA 3JB9I 4L5GA 2P0KA 4XU1A 1OI1A 2E12A 3OS2A 4EMGA 3HFOA 1WQ7A 4MMLA 4L59A 3OS0A 4DQ2A 2FL7A 2LCCA 2V8KA 2YLBA 2V8IA 5GAMj 5CO7A 2LDMA 3Q1JA 2QQ9A 3DLLA 1VQOT 1VQ6T 2Y90A 4IURA 3PMIA 3HFNA 3OSSC 2D0QB 3VYGA 4NOYA 3V7CA 3JB9D 3G4SA 2QA4A 4JLIA 2KVQG 4M7AG 4C8QA 4ATOA 4LDYA 2JOYA 1N9SA 2VXEA 3RKWA 3NTKA 1LJOA 3HL8A 3GF5A 3OBYA 2L89A 5LJ3f 4PJOF 4ZN1A 3CCEA 1YJ9T 4BY6C 4UC4A 1KC8U 3QUIA 2E1HA 1K8AC 4CI0C 2E6ZA 1WQWA 2QTXA 2XIDA 1ZBXA 4JRQA 3CD6A 2RI2A 4KBMB 4R55A 2O4XB 4M77G 3GOXA 2VYTA 4XTWA 3C12A 3OYBA 2X4WA 4A4HA 3I56A 1X6OA 2EQMA 5A0LA 1GXIE 4PJOC 3VU3C 2RHXA 2YRVA 1VQ7A 3PGGA 2EQUA 3SFMA 2A7YA 3QKJA 2M0OA 4M75E 4Z02A 5LJ3h 4A4EA 2RD1A 3QZ9B 3GNGA 4XTUA 1QW1A 5CKFA 5GANg 1PSFA 5CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJS A;  1YIJ A;  3S3O A;  2JNG A;  3G6E A;  4BE2 A;  2RJC A;  1XTD A;  3L2U A;  2OTL T;  3QBY A;  3CME A;  3MEU A;  1Q81 C;  4II1 A;  2EQJ A;  3CCU A;  2EKO A;  5IN1 A;  3DLM A;  3PMT A;  3OYJ A;  1QVF A;  3E9G A;  3OB9 A;  1YJW T;  2OTJ T;  3S6W A;  3G71 A;  1VQ8 A;  3CCL T;  4ZTJ A;  3LH0 A;  1VQ5 T;  3SD4 A;  2B8A A;  3CCQ T;  3E9F A;  4QQ6 A;  2GFA A;  3L2Q A;  2HQE A;  5KCH A;  3OYK A;  1NZ9 A;  2BUD A;  3MP1 A;  5M9O A;  5FRM A;  3TRE A;  3CCJ A;  2D9T A;  3OYG A;  1W2B A;  1YIT A;  3OMC A;  1S72 T;  3CCV A;  1KC8 C;  4TVR A;  2R5M A;  4B9W A;  4IUT A;  3P8D A;  3CCM T;  3PFS A;  1WJQ A;  1YI2 T;  4E7I A;  2LCL A;  3CCS A;  4OVA A;  2RHU A;  3OMG A;  3UT1 A;  1RL2 A;  4X34 A;  1YJN A;  1Q81 U;  2QQR A;  4FL6 A;  1VQ4 A;  4PL6 A;  1QVF S;  3CMA A;  1NJI U;  3CC2 A;  2DIG A;  3ME9 A;  1NPP A;  3CCR T;  3ZEH A;  3OYM A;  3QJ6 A;  1VQL T;  1XNI A;  3OYH A;  1VQP A;  1OZ3 A;  2RHI A;  2JUF A;  4IKF A;  2BIV A;  1W2B S;  3UWN A;  1VQN A;  5A2Q E;  4E7H A;  4ZN3 A;  3JAM E;  3P8B B;  1YHQ T;  2JZ2 A;  3OQ5 A;  4CRI A;  2GFU A;  2R58 A;  2RJE A;  4ZTF A;  4RG2 A;  1VQ6 A;  1VQO A;  4QQG A;  1M1G A;  2XHC A;  2CKK A;  3CPW A;  1KQS A;  1EIF A;  5C6S A;  1IZ6 A;  3QII A;  3MP8 A;  5HY6 A;  1YJ9 A;  4N4I A;  1VQ9 T;  3C4S A;  1SSF A;  2M16 A;  3CC7 T;  1KHC A;  5KCO A;  2QQS A;  4IUQ A;  2BKD N;  1VQM T;  2X4X A;  2LQ8 A;  1NJI C;  1H3Z A;  3J7A F;  3BDL A;  1K9M U;  2RHY A;  3H6Z A;  2F5K A;  4N4G A;  2OTL A;  1G5V A;  3NTI A;  2FHD A;  4E7L A;  2QEX T;  4E7K A;  3OYN A;  3OYF A;  3CPW S;  1YJW A;  2OTJ A;  1KQS S;  1K73 U;  3O8V A;  4IUU A;  5KE3 A;  4N4H A;  3CCL A;  2WAC A;  1VQ5 A;  3CCQ A;  4IUV A;  1WGS A;  3S3M A;  2R5A A;  3J80 E;  4QQD A;  3MEV A;  4NS5 A;  1Q82 C;  1Q86 U;  5FRO A;  3L2V A;  3MEA A;  4E7J A;  3CC4 T;  1Q7Y U;  4EDU A;  2K3X A;  1S72 A;  4A4G A;  3NTH A;  3CXC A;  4FU6 A;  1OYX A;  3OS1 A;  4Q5W A;  3I55 T;  3CCM A;  3OA6 A;  1N8R U;  1YI2 A;  3OYD A;  1VQK T;  4BE0 A;  3OYL A;  1MHN A;  4QW2 A;  3OYI A;  3PNW C;  3LLR A;  3MET A;  3FLG A;  1K9M C;  1VQP T;  2XDP A;  2EIF A;  3G4S T;  2QA4 T;  4BDY A;  3CCR A;  2RHZ A;  3KUF A;  2DIQ A;  3ER0 A;  1M90 C;  3F70 A;  3DB4 A;  1VQL A;  5J39 A;  3CCE T;  3ASK A;  3L42 A;  5CIU A;  4BD3 A;  2DAQ A;  3CD6 T;  5D6Y A;  1K73 C;  2NLU A;  2RO0 A;  3HKS A;  2E6N A;  3FDR A;  3I56 T;  1Q82 U;  1VQ7 T;  4PLI A;  5D6X A;  5DM7 R;  3PIO A;  1KHI A;  1BKB A;  1YHQ A;  1M1K U;  2X35 A;  3CXC S;  1Q86 C;  3LGL A;  2RI5 A;  3DB3 A;  3L2W A;  2E70 A;  4B9X A;  2EFI A;  1Q7Y C;  1YIJ T;  3G6E T;  1QVG A;  4LD6 A;  4BDZ A;  1KD1 C;  4C5G A;  3LYI A;  3CME T;  3L2R A;  3CCU T;  4BAC A;  1N8R C;  2X4Y A;  2RJD A;  2MWO A;  1UEB A;  1YBY A;  1VQ9 A;  3P8H A;  2EQK A;  3GOX A;  4BE1 A;  2GF7 A;  5J3B A;  3CC7 A;  3CPF A;  3LGF A;  3G71 T;  1VQ8 T;  2DO3 A;  3OYC A;  3OW2 A;  1VQM A;  1JJ2 A;  3CEY A;  1M90 U;  2L3R A;  2MI6 A;  2IG0 A;  3PIP A;  3OYA A;  3CCJ T;  1YIT T;  5D6W A;  2LTO A;  2KDS A;  5C0M A;  3M9Q A;  3CCV T;  2MWP A;  2JVV A;  2R57 A;  5LL6 S;  3H8Z A;  2M1H A;  4QVZ A;  2QEX A;  4IUP A;  2O4X A;  1K8A U;  5FLX E;  5DLQ E;  4C5H A;  3EAE A;  3CCS T;  1QVG S;  1M1K C;  3LX7 A;  2RJF A;  2XK0 A;  1NPR A;  2K3Y A;  3MP6 A;  3OYE A;  2PQW A;  1KD1 U;  3OYY A;  5KH6 A;  1YJN T;  4HCZ A;  1VQ4 T;  4C5E A;  1N27 A;  3S3N A;  3FEO A;  3CMA T;  2RI3 A;  2L8D A;  3CC2 T;  4PLL A;  1WJR A;  5FRN A;  2LVM A;  5J26 A;  3CC4 A;  2E5Q A;  3MO8 A;  2JTF A;  1RI0 A;  3OW2 S;  3FC3 A;  2G3R A;  3J81 E;  3KBG A;  5KE2 A;  1JJ2 S;  1OZ2 A;  5IT9 E;  4GY5 A;  4A4F A;  2HQX A;  4C5I A;  3I55 A;  2LRQ A;  3MEW A;  3OY9 A;  1VQK A;  1VQN T;  5IAY A;  3A5Z B;  4YTL A;  2P0K A;  1OI1 A;  3OS2 A;  4L59 A;  3OS0 A;  2LCC A;  2LDM A;  3Q1J A;  3DLL A;  1VQO T;  1VQ6 T;  4IUR A;  3PMI A;  3G4S A;  2QA4 A;  2KVQ G;  2JOY A;  3NTK A;  4ZN1 A;  2L89 A;  1YJ9 T;  3CCE A;  1K8A C;  1KC8 U;  4UC4 A;  2E6Z A;  3CD6 A;  2RI2 A;  2O4X B;  2VYT A;  3OYB A;  2X4W A;  4A4H A;  3I56 A;  1X6O A;  2EQM A;  2RHX A;  2YRV A;  1VQ7 A;  2EQU A;  3QKJ A;  2M0O A;  4Z02 A;  4A4E A; 
#chains in the Genus database with same CATH topology
 4N0A C;  4LNP A;  1RAC B;  1RAE B;  2CSI A;  3URG A;  1YIJ A;  2KAF A;  2AHJ B;  1TG0 A;  4DOW A;  1N9R A;  4F7U G;  3CME A;  1Y0M A;  3T9N A;  4J7I A;  4HT8 A;  4IIM A;  1QVF A;  1J3T A;  2KE9 A;  1YJW T;  1VQ4 Q;  2OTJ T;  3SD4 A;  2B8A A;  4QQ6 A;  3M0U A;  2CP5 A;  2HQE A;  2JT4 A;  2ESW A;  5KCH A;  2HKN A;  1NZ9 A;  2BUD A;  4JZ4 A;  4M7A D;  5FRM A;  2DTO A;  3OYG A;  3EFR A;  3OMC A;  1A0N B;  8AT1 B;  2AKL A;  2LC4 A;  4MMK A;  4PJO A;  3SB2 A;  4B9W A;  1Y07 A;  5GAO n;  4LD9 K;  3SDZ A;  3M53 A;  3CCS A;  2DNU A;  2I2L A;  3EG1 A;  1H8K A;  3JCM g;  4OVA A;  3I56 Q;  3EH1 A;  1P92 A;  3UT1 A;  3RR6 A;  1RL2 A;  4X34 A;  4PL6 A;  1B7T A;  1OX9 A;  2NUZ A;  2VUB A;  2Y4X A;  1UDL A;  3CMA A;  1NJI U;  1X2K A;  3ME9 A;  1XJW B;  4HVU A;  4BB7 A;  2KQW A;  3QJ6 A;  3TQ7 P;  2CZ7 B;  1GCQ A;  1VQL T;  1SG5 A;  4QVC A;  4LDX A;  2MAM A;  1XNI A;  4BI8 B;  2FPF A;  1VQP A;  3CCU Q;  1WZO A;  1X01 A;  3VS5 A;  3LWI A;  2BIV A;  1W2B S;  2HNI A;  1VQN A;  2GQV A;  2P4R A;  3JAM E;  2LZ6 B;  1AVZ C;  3ZL7 C;  1YFN A;  2F1L A;  4OML A;  3E2U A;  1KFZ A;  2GFU A;  4M78 F;  1VQO A;  1KQ2 A;  2CKK A;  1KQS A;  1BBZ A;  1OPL A;  2GQI A;  2RN8 A;  5C6S A;  1IZ6 A;  3QPH A;  1YIT Q;  1WI7 A;  3QII A;  2COY A;  4PJO B;  2EGC A;  1YJ9 A;  1PRL C;  1W2B P;  1OOT A;  3JB9 J;  2M16 A;  1K76 A;  2ZPI B;  2AIR B;  1KHC A;  2PUK B;  4IUQ A;  1HYO A;  1EX4 A;  2RMO A;  5GMK l;  1CKB A;  4DEX A;  2EGA A;  2DM1 A;  3EHR A;  4LUE A;  3J7A F;  2BTT A;  3VS1 A;  4Z8A A;  5LJ5 j;  2FPE A;  2BZY A;  1RAD B;  1LOJ A;  1YJN Q;  4DBF A;  3JCM e;  1K9M U;  3A98 A;  3FJP A;  2QAZ A;  3CCM Q;  2D0N A;  2E5K A;  4KGX B;  2MIO A;  3C0C A;  2CYZ B;  4M75 D;  1M4Z A;  2CGH A;  4AMC A;  1G5V A;  1ZSZ B;  4E7L A;  3KFV A;  4M77 A;  1IHW A;  5CQY A;  4E7K A;  1PCX A;  2FVU A;  2A08 A;  1QP3 A;  4HT9 A;  3CPW S;  2W10 A;  2VVK A;  5KE3 A;  4Y91 A;  1WXB A;  2WAC A;  4KH0 B;  4ZNX A;  4IUV A;  2EVR A;  4OB2 B;  4DBQ A;  2HKQ B;  4M78 A;  2DVJ A;  1PM3 A;  4MDW A;  1Q82 C;  1M30 A;  4DOV A;  1HJD A;  1VQ6 Q;  1Q7Y U;  4EDU A;  2K3X A;  3TVT A;  2MYS A;  1S72 A;  3ULR B;  3NTH A;  4CC3 A;  3VS2 A;  4FU6 A;  1OYX A;  2NYS A;  3CPW P;  1ARK A;  3DKM A;  2Z0W A;  1YI2 A;  4ELY C;  1D09 B;  1FMV A;  1VQK T;  1WHM A;  3WVE B;  1QP2 A;  5GAN e;  2DXU A;  2H8H A;  4J9C A;  2JM8 A;  3FLG A;  3A8H B;  1B07 A;  4XU2 A;  4JLG A;  2XDP A;  2HL3 A;  3G4S T;  4C92 A;  3KUF A;  2CZ6 B;  1M90 C;  3JCM d;  3F70 A;  2FEI A;  3VS6 A;  1QVF P;  3RIR A;  2DJZ A;  3ASK A;  1W4S A;  3CCE T;  3L42 A;  5CIU A;  5GAO p;  2QAS A;  4M77 B;  2YT6 A;  5D6Y A;  1FX7 A;  3OS5 A;  1U3O A;  2CT3 A;  3HKS A;  5GAO m;  3A8L B;  4PLI A;  2DTI A;  1KHI A;  1BKB A;  5DM7 R;  1YHQ A;  1YJW Q;  2X35 A;  3CXC S;  1WDX A;  2DBM A;  3LGL A;  4M78 B;  5LJ3 e;  5CR2 A;  5GMK i;  2E70 A;  2K3B A;  1PG5 B;  2E3I A;  3EG0 A;  4LUD A;  4B9X A;  4CC2 A;  3G6E T;  4Z88 A;  4RCC A;  1KD1 C;  2L2P A;  5GAN 8;  2OI3 A;  2XI9 A;  1K4U S;  4BAC A;  3H41 A;  5GMK e;  2DXT A;  2KMT A;  4AFQ C;  1VQ9 A;  4OMN A;  3GOX A;  1IRE B;  3UA6 A;  1UJ0 A;  2PU9 B;  1R8O B;  2VV5 A;  2ROL A;  2RF0 A;  2DXB A;  3CXC P;  3CC7 A;  2YUQ A;  3OBW A;  3LGF A;  2DXC A;  1VQ8 T;  4M77 E;  5CQX A;  1ZLM A;  3VV0 A;  1JJ2 A;  1RLP C;  4OB0 B;  5GAN d;  3JCM h;  2MI6 A;  1BU1 A;  1WPY A;  4HCC A;  5EC7 A;  3CCJ T;  1QVP A;  2K7A A;  4ZGD B;  1NG2 A;  2D8H A;  4M78 E;  2MWP A;  4C92 B;  1NEG A;  4C8Q F;  3JB9 G;  4QVZ A;  2O9V A;  2QEX A;  4IUP A;  2VXF A;  2DRM A;  4QVD A;  1K8A U;  1WHK A;  1QVG S;  1M1K C;  2H3E B;  1F1B B;  5CKH A;  3MP6 A;  2PQW A;  5KH6 A;  4A63 B;  2H3J A;  1VQ4 T;  3O5Z A;  3M0Q A;  3S3N A;  1AHJ B;  3FEO A;  4QKU A;  5IHI A;  2L8D A;  2V1R A;  2SEM A;  2XU8 A;  3GP8 A;  1KC8 R;  4X9D A;  5LJ3 d;  2LVM A;  1UGP B;  4MZT A;  2JTF A;  2QK0 A;  3OW2 S;  3FC3 A;  2JTE A;  9ATC B;  1QVG P;  3QJY A;  2HQX A;  4C5I A;  4JJD A;  2LNV A;  2LMJ A;  1JXM A;  2PVG B;  3BDU A;  5GAN h;  2EWN A;  3CBP A;  4FYV B;  1X6G A;  4HVV A;  4C92 E;  3OY9 A;  1N6A A;  4AFS C;  2P0K A;  4EMG A;  4MML A;  1C0M A;  2FL7 A;  1ZBJ A;  2DJQ A;  2KVQ G;  4C8Q A;  4KRT A;  4LDY A;  2JOY A;  4ATO A;  4WCI A;  3NTK A;  3HL8 A;  3GF5 A;  4UC4 A;  3G71 Q;  2E1H A;  4CI0 C;  2E6Z A;  2XID A;  4JRQ A;  2RI2 A;  4PFZ A;  3C12 A;  2X4W A;  3I56 A;  1UHC A;  2RNA A;  4PJO C;  1V76 A;  2YRV A;  2EQU A;  3SFM A;  5LJ3 h;  1PKS A;  3I5S A;  3QZ9 B;  2QYZ A;  2EJG A;  1R77 A;  1UUE A;  5CVI A;  1WJS A;  2E4H A;  3S3O A;  2JNG A;  1LCK A;  3LWH A;  2V8J A;  2J7I A;  1Y7X A;  3L2U A;  4C0D B;  2DPP B;  1G8X A;  3QHS A;  3MJX A;  5GMK h;  2OTL T;  2HSE B;  3VS3 A;  4CC4 B;  4M7D A;  2EQJ A;  2EKO A;  2PNI A;  1TUD A;  3CCU A;  4NL2 A;  4JJC A;  4RMO A;  5IN1 A;  3DLM A;  1M1F A;  3G7Z A;  1Q95 G;  2KY9 A;  3OYJ A;  3M58 A;  2FPD A;  3OB9 A;  5A0G A;  3AT1 B;  1ZSZ C;  1W6X A;  3CCL T;  1VQK Q;  2GFA A;  2YRD A;  3L2Q A;  4C0G A;  2QTV A;  3HHT B;  2BZX A;  2X4J A;  4PK4 A;  1M8M A;  2M51 A;  1W2B A;  1YIT A;  5I2M A;  2MF2 A;  1Y57 A;  1QCO A;  4JS4 A;  1E7O A;  1G83 A;  3HRU A;  1LNX A;  4TVR A;  5IH2 A;  4C8Q B;  2A36 A;  3G4S Q;  3JCM X;  2CP2 A;  4IUT A;  4L6V 5;  8ATC B;  2DA9 A;  5FU7 B;  3P8D A;  2AKK A;  2O88 A;  3U23 A;  1O9S A;  3CCM T;  4CC7 A;  2FZG B;  1WJQ A;  1JO8 A;  5CAI A;  2EAY A;  2DZ9 A;  4EMK A;  2YUO A;  5CK9 A;  2A28 A;  3R6O A;  4J5Y A;  2PVD B;  3ZBD A;  1YJN A;  1Q81 U;  4FL6 A;  2HBP A;  1AZG B;  1I07 A;  3A8G B;  1RAB B;  4LDV A;  2IPO B;  3CCR T;  1WLP B;  3X25 B;  2HSP A;  4M7A F;  2YRC A;  4M7D B;  3OYH A;  1WNL A;  2DLP A;  3PT9 A;  2L3P A;  3BFM A;  1OZ3 A;  4IKF A;  3MKD A;  2F2X A;  4C8Q E;  2AZV A;  1JJ2 P;  5A2Q E;  2CSQ A;  3X28 B;  5GAN 4;  5FW9 A;  4M77 C;  2JZ2 A;  3GIB A;  2ZPF B;  2DF6 A;  2KR3 A;  1JB0 E;  1VQ8 Q;  1SRM A;  1HXD A;  3INZ A;  1RAA B;  4ZTF A;  4RG2 A;  1VQ6 A;  3CPW A;  5LJ5 g;  1EIF A;  2K4Y A;  1NLO C;  2GBQ A;  4M78 C;  3JCM c;  2M0Y A;  1K73 R;  2F69 A;  4N4I A;  4RTX A;  3CCQ Q;  4M7D E;  4EMK B;  1ZUK A;  2VAS A;  1XOV A;  3IQL A;  1Q86 R;  3VRY A;  2L5Q A;  5DY9 A;  2EBP A;  1VQM T;  3RES A;  1UGV A;  2EYX A;  4JJB A;  2WSE E;  4DA4 A;  2E10 A;  2YXY A;  2GTO A;  2FB7 A;  2DL3 A;  2DK3 A;  2LP5 A;  1U5S A;  2B86 A;  5EG2 A;  4M7A A;  2RHY A;  4EIK A;  1N8R R;  1QMC A;  2DL5 A;  3JCM J;  3OYN A;  1M2O A;  4C92 C;  3L2Z A;  4LDW A;  1YJW A;  2OTJ A;  3VUB A;  1R0C B;  4IUU A;  2C0I A;  3JSC A;  2SRC A;  2DTH A;  4E2F B;  4WTO B;  1WGS A;  3S3M A;  3GPL A;  2GCX A;  3J80 E;  3L1A A;  1D1C A;  3UA7 A;  2ABL A;  2EJF A;  3CC4 T;  1X27 A;  5GJV B;  2E41 A;  4A4G A;  3CXC A;  1TS9 A;  1G3Y A;  3OS1 A;  5GAO l;  2ROT A;  3I55 T;  3RKX A;  5LJ5 e;  2C06 A;  1UGR B;  1CSK A;  1UTI A;  2DX1 A;  1AEY A;  3FIF A;  1ZSG A;  1YCY A;  1ZQ1 A;  2BE7 D;  3HRS A;  1ZSZ A;  4JS5 A;  1MGQ A;  2DBK A;  3LLR A;  2FO0 A;  1PWT A;  1QWF A;  4M77 F;  5HCK A;  1VQP T;  1MMN A;  3LW5 E;  3VRZ A;  2QA4 T;  4J83 A;  2RK2 A;  4M7A B;  2RHZ A;  4P5N A;  1VQL A;  1SF9 A;  4XK8 E;  2OTL Q;  2LJ1 A;  3BE3 A;  2GNC A;  2COZ A;  3CD6 T;  1MV0 B;  4XAX B;  2E6N A;  3FDR A;  3I9Q A;  2KXC A;  2LQW A;  1NYG A;  2X3X D;  3M55 A;  1M1K U;  2CT4 A;  2JMA A;  1X6B A;  1YNZ A;  3RMQ A;  3CCL Q;  2RI5 A;  3QG1 A;  3L2W A;  2RH2 A;  4D6W A;  4PNO A;  2F5T X;  1QVG A;  4FIB A;  3QSU A;  3SWN B;  3OSV A;  3LYI A;  2NUT A;  3EHQ A;  3L2R A;  1QCN A;  4JDS A;  2RJD A;  2MWO A;  3N5B B;  4PJO G;  4M75 A;  1UGS B;  2DRK A;  4C0D C;  2EQK A;  4M7A E;  1UHF A;  2VC8 A;  5J3B A;  2XIC A;  1GFC A;  3M57 A;  5LJ5 d;  2EYY A;  3M0P A;  3G71 T;  2OAU A;  4C92 F;  3OYC A;  3OW2 A;  2FZK B;  3I5R A;  1FXX A;  2K2V A;  2HEQ A;  2ZPE B;  4VUB A;  1U8R A;  2ECZ A;  2K9G A;  4XQ3 A;  2J05 A;  2LTO A;  1Q81 R;  3M9Q A;  1GL5 A;  2KYB A;  3CCV T;  1G3T A;  2R57 A;  4ANJ A;  1AWX A;  3CCR Q;  2K2M A;  2DD5 A;  1QKX A;  5KYN A;  1WXU A;  4RTY A;  1MV3 A;  4ORZ A;  5DLQ E;  3EAE A;  4OP0 A;  4HXJ A;  1MNE A;  4J7F A;  4C8Q C;  1UE9 A;  2RJF A;  2JS0 A;  2XK0 A;  5FU7 C;  2K3Y A;  4LE9 A;  3UAT A;  2KRM A;  3KXT A;  2AZS A;  3V8L A;  1U06 A;  2RI3 A;  3CC2 T;  4EMH A;  3E19 A;  4MZP A;  1WJR A;  4F14 A;  1JU5 C;  2E5Q A;  5J26 A;  3MO8 A;  5IHN A;  2DYI A;  4AFZ C;  1RI0 A;  2NUT B;  1YWP A;  1OZ2 A;  3BW1 A;  5I21 A;  4M75 B;  1BYM A;  3EGD A;  2DYB A;  4XU0 A;  4J9E A;  3M0S A;  1I8F A;  1VQK A;  4M7D C;  2LNH B;  4YTL A;  3UF4 A;  3JB9 I;  1YIJ Q;  3HFO A;  4L59 A;  1OUL A;  4B6M A;  1KIK A;  3CME Q;  2YLB A;  5GAM j;  1VQM Q;  1SSH A;  1IGU A;  2V26 A;  2Y90 A;  4IUR A;  3VYG A;  1HD3 A;  2BZ8 A;  3JB9 D;  4PFP A;  4K11 A;  3G4S A;  4JLI A;  4DBR A;  2VXE A;  3OBY A;  2L89 A;  3CCE A;  2KRS A;  4PJJ A;  1GRI A;  4M4Z A;  2QTX A;  4KBM B;  4M77 G;  2VYT A;  1M3C A;  3OYB A;  5A0L A;  4GBQ A;  2W0Z A;  2MK5 A;  2A7Y A;  4M75 E;  5KYW A;  4Z02 A;  4A4E A;  2RD1 A;  3GNG A;  4XTU A;  1QW1 A;  4FW2 A;  3M4G A;  2VKN A;  3RDV A;  4EMK C;  2K5F A;  4M78 G;  5KYU A;  2J6K A;  3G6E A;  2RJC A;  1ACM B;  2E65 A;  1D0Y A;  2JTM A;  4II1 A;  3CC4 Q;  1K1Z A;  1I4K 1;  1PHT A;  2YSQ A;  1WHJ A;  5I11 A;  3FJ5 A;  2L0A A;  3E9G A;  4LN2 A;  3EGD B;  4XTZ A;  2P0P A;  3I55 Q;  2HZY A;  3JRZ A;  3S6W A;  5GAN j;  1NJI R;  1VQ8 A;  4ZTJ A;  2JW4 A;  3LH0 A;  1VQ5 T;  3CCQ T;  1NE8 A;  1MMD A;  1V29 B;  3H0F A;  1MMA A;  3PTA A;  1M9S A;  3TEE A;  3MP1 A;  2CP3 A;  3C95 A;  5M9O A;  3A8M B;  1YCS B;  3TRE A;  1NBE B;  3CCJ A;  2D9T A;  2YDL A;  1FWZ A;  1VQP Q;  4KT0 E;  1KC8 C;  3EFO A;  4E7S A;  2HMA A;  3HP9 A;  4C92 G;  2QA4 Q;  1SHG A;  1VQN Q;  2XG8 D;  2QI2 A;  5LJ5 f;  2ZGW A;  4Y28 E;  2KT1 A;  3PFS A;  2DD4 A;  1SHF A;  2HCK A;  2LCL A;  2DEU A;  2RK1 A;  3AHU A;  3CD6 Q;  4RTW A;  2LT4 A;  4FW1 A;  4J8O A;  2RPN A;  2RHU A;  3OMG A;  2O9S A;  3TCJ A;  1KQ1 A;  5KYW B;  4M7D F;  2Y4Y A;  1PSE A;  2ED1 A;  5KYX A;  1VQ4 A;  3EFS A;  5LJ3 j;  2EW3 A;  5KYU B;  1NPP A;  1H3H A;  3ZEH A;  3SHW A;  3CBM A;  4GLK A;  2OX7 A;  1C1A A;  1MUZ A;  1YN8 A;  2J6F A;  4PKC C;  1RLQ C;  3V7S A;  5GMK j;  1IXD A;  3VJP A;  1V1C A;  2D6F A;  4M7A C;  2JUF A;  2MOX A;  1DJ7 B;  3OW2 P;  2ATC B;  3I35 A;  3UWN A;  1ZX6 A;  3JB9 H;  4E7H A;  2CP7 A;  3PVL A;  3P8B B;  4JUV A;  1K9M R;  2LX9 A;  1TUC A;  3UPU A;  1ABQ A;  1BI3 A;  3SEM A;  3NFC A;  1AWW A;  5GAN 2;  3VYH B;  4CRI A;  2RJE A;  2F2V A;  1T0J A;  2OJ2 A;  4OB1 B;  4PJM A;  1M1G A;  1VIF A;  4BY6 B;  4F04 B;  3EFO B;  2CUB A;  4J6W A;  3MP8 A;  1WFW A;  3CCV Q;  3SWN C;  3C4S A;  4FT4 A;  2CH4 W;  1SSF A;  2PVO B;  1U1T A;  2LCS A;  2HL5 C;  1BB9 A;  2ZPB B;  1WHH A;  3C94 A;  1TUG B;  2QQS A;  2X3W D;  2X4X A;  2RB6 A;  5GAM f;  3HRT A;  2XD0 A;  1Q7Y R;  1S72 Q;  5KYX B;  1QWE A;  4HA8 A;  3WVD B;  5GJW B;  4KUL A;  3CC2 Q;  4N4G A;  3H6Z A;  1YI2 Q;  2OTL A;  4C0Z A;  2RQU A;  3EGU A;  2F2W A;  2FHD A;  2L3Q A;  4JRP A;  1NM7 A;  4LDU A;  1OQK A;  1TWB A;  2DL7 A;  1D3B B;  2O2O A;  2O01 E;  4RKU E;  1X69 A;  1RAH B;  4J6Y A;  4N4H A;  3CCL A;  1JRI A;  1W1F A;  2RM4 A;  3M0R A;  1ZUU A;  4PJL A;  2FYK A;  2R5A A;  4GLM A;  3MEV A;  2DMO A;  1YP5 A;  5FRO A;  3L2V A;  1KG1 A;  1QCF A;  1MMG A;  3MCA B;  4MDX A;  2HBW A;  5GAO q;  4DBH A;  1B3Q A;  5HK0 A;  5HKC A;  4C8Q G;  1OEB A;  1I1J A;  2K5I A;  2RQV A;  1BIA A;  2JXB A;  1YHQ Q;  4MZM A;  2A0F B;  2HDA A;  5CKE A;  1KJW A;  3CCM A;  4OMO A;  3THK A;  3REB B;  3OYD A;  1JBM A;  1ZA1 B;  1X43 A;  2HQH A;  2KRN A;  2KI7 A;  3OYL A;  1Z9Q A;  3V8J A;  1WHG A;  4QW2 A;  4M75 C;  2FRY A;  4J6X A;  2CZ1 B;  2KEA A;  1RAF B;  2EJ9 A;  3PNW C;  3MET A;  2CS7 A;  2P0Q A;  4RUG A;  4PFO A;  2EYQ A;  3M4Y A;  1VIE A;  2LJ0 A;  4ELZ C;  2P84 A;  1VYT A;  3CCR A;  2KBT A;  2DIQ A;  5FWC A;  4FSS A;  3DB4 A;  4AG1 C;  3CC7 Q;  4KUI A;  4M7D G;  4OMM A;  1GFD A;  2KYM A;  1HSQ A;  2DAQ A;  1M2V A;  1K73 C;  5FWB A;  4OGC A;  2C0T A;  4AG2 C;  2RO0 A;  5CKD A;  1Q82 U;  5AYF A;  2DFU A;  4Z89 A;  1VQ7 T;  2DVE A;  3D7S B;  5D6X A;  1D1A A;  3X26 B;  1OV3 A;  4JJN K;  1Q86 C;  2VWF A;  1VQ5 Q;  1PD1 A;  1U1S A;  2EFI A;  1YIJ T;  1TSF A;  4E6R A;  2QEX Q;  2DEQ A;  2EKH A;  1X2Q A;  3RUX A;  4F7U B;  1HK9 A;  3CME T;  1BI1 A;  1K8A R;  4RG8 A;  1JQQ A;  4JZ3 A;  4D8D A;  3QYG B;  1N8R C;  2X4Y A;  2I0N A;  1E6H A;  3MPU B;  2NWM A;  1D1B A;  4O5V A;  2QXF A;  3P8H A;  2M9U A;  4BE1 A;  2JM9 A;  3UDC A;  2DKG A;  4HKE A;  3M56 A;  2GF7 A;  3GBQ A;  4OB3 B;  3TU4 K;  2CP0 A;  2X51 A;  1CKA A;  3VS7 A;  1RAG B;  3CPF A;  2ENM A;  1VQM A;  3HTR A;  5L8R E;  3CEY A;  2NUP A;  2RA2 A;  1M90 U;  5I2S A;  4AT1 B;  5FU6 B;  2EGE A;  4NL3 A;  1RUW A;  5C0M A;  2GTJ A;  5GAN 6;  1GBQ A;  2VB6 A;  3VKI A;  2JN0 A;  5LL6 S;  2M1H A;  1C6V X;  2O4X A;  4F7U E;  4J9B A;  3EGX A;  1M2V B;  3SWN A;  4C0F A;  4C5H A;  5FLX E;  3HSB A;  3CCS T;  7AT1 B;  1JXO A;  1X75 C;  1TH7 A;  1BI2 A;  2E64 A;  3M0T A;  2WSC E;  1NPR A;  4OMF B;  3OYE A;  1KD1 U;  3OYY A;  1AWJ A;  4LXC A;  2A37 A;  4HCZ A;  4C5E A;  1N27 A;  4Y92 A;  2QGG A;  2FRW A;  4M75 F;  3CMA T;  1Z9Z A;  2QQB A;  1NLP C;  5GAM g;  4XU3 A;  5L23 A;  4X9C A;  4PJO D;  3CC4 A;  4AFU C;  1G3W A;  2PUO B;  3J81 E;  3KBG A;  1I0C A;  4OMP A;  5KE2 A;  2LX7 A;  3QDR B;  4GY5 A;  1SKU B;  5IT9 E;  1ABO A;  1UG1 A;  3I55 A;  5GAO r;  4X1V A;  2DET A;  5GAN 5;  2LRQ A;  3MEW A;  2CZ0 B;  1VQN T;  3E1S A;  3A5Z B;  4OMQ A;  4DQ2 A;  1OX8 A;  2V8K A;  2NUP B;  2V8I A;  1PNJ A;  3EH2 A;  5CO7 A;  3Q1J A;  1VQO T;  3PMI A;  1KSW A;  1W70 A;  3HFN A;  2D0Q B;  4NOY A;  3H0I A;  2QA4 A;  2CH4 A;  3QWY A;  4F17 A;  2COW A;  4M7A G;  1N9S A;  3RKW A;  1LJO A;  2L3S A;  4ZN1 A;  1YJ9 T;  1KC8 U;  4BY6 C;  1M27 C;  3QUI A;  1WQW A;  1ZBX A;  3CD6 A;  2D1X A;  2O4X B;  4A4H A;  3EGX B;  1X6O A;  2EQM A;  1AZE A;  2RHX A;  2J06 A;  3PGG A;  1TXQ A;  5GAN g;  1PSF A;  4KH1 B;  2G6F X;  2ZAE A;  4BE2 A;  1K0S A;  1XTD A;  3NPF A;  4F16 A;  2YUN A;  3QBY A;  3MEU A;  2CRE A;  1Q81 C;  4EPC A;  1SRL A;  1AWO A;  1T3L A;  5HK3 A;  3EG3 A;  3JB9 F;  3G1J A;  3PMT A;  3GNF B;  1LPL A;  5GAM e;  3A1P A;  1YWO A;  2A3L A;  4ZGE B;  2EYW A;  4E7Z A;  3G71 A;  3JCM V;  3E9F A;  3OYK A;  4J9I A;  5AT1 B;  2EQI A;  3CBO A;  2KXD A;  1WXT A;  3H9N A;  2IVW A;  3WXM B;  1RAI B;  5LJ3 g;  4PJO E;  3M54 A;  1S72 T;  3CCV A;  2R5M A;  4M77 D;  2HAX A;  1M5Q 1;  1R0B G;  3NHN A;  1TOV A;  2FG0 A;  3V7R A;  2KT8 A;  1YI2 T;  4E7I A;  1FYN A;  4N0A A;  3RBB B;  1OU8 A;  4J9D A;  2VGM A;  4FCY A;  2LT1 A;  3FRN A;  4M78 D;  5LJ5 h;  4XTX A;  2XDD A;  4FYX B;  1Q82 R;  1VQ7 Q;  2QQR A;  3MHX A;  1QVF S;  2K57 A;  3CC2 A;  1UB4 A;  3RER A;  2DIG A;  5CCA A;  2QDY B;  1UJY A;  3VS0 A;  3QZ5 B;  3OYM A;  4HVW A;  2D8J A;  1ZHI A;  5D7U A;  2LQK A;  3X24 B;  5ECA A;  2YWW A;  1BCM A;  4ME7 A;  4A53 A;  2QGF B;  2RHI A;  4J9G A;  4M75 G;  2C0O A;  1D0X A;  4FT2 A;  4JPB W;  3QYH B;  2AK5 A;  3GLX A;  4E47 A;  2DIL A;  1D0Z A;  5GAM d;  1VA7 A;  2EYZ A;  4ZN3 A;  2ZZD A;  2JJ9 A;  1YHQ T;  4PJN A;  2QQA A;  2WSF E;  4OGE A;  3ZFJ A;  1Y96 A;  3NGP A;  3OQ5 A;  4RTU A;  2R58 A;  3M5A A;  4QQG A;  4BUG A;  4C92 D;  2XHC A;  1M90 R;  2KGT A;  2CUD A;  1TTH B;  3QXE B;  1VOM A;  2OTJ Q;  3R6N A;  2JS2 A;  4DEY A;  5HY6 A;  3EG2 A;  2ZPH B;  2IIM A;  4HCK A;  1VQ9 T;  1NEB A;  2K79 A;  3M59 A;  1ZA2 B;  2VGN A;  1WIE A;  2J6O A;  4OF1 A;  1QQJ A;  4J9F A;  1BCO A;  1FMK A;  1BK2 A;  3CC7 T;  2PZ1 A;  3REA B;  4BI3 A;  5KCO A;  3CCS Q;  3CQT A;  2BKD N;  4R0K A;  2LQ8 A;  2CDT A;  4XTY A;  1VUB A;  4V2S A;  3VUZ A;  1NJI C;  1H3Z A;  2DER A;  3BY7 A;  2QDL A;  3V8K A;  1KD1 R;  3BDL A;  1QKW A;  4D8K A;  1BI0 A;  1SPK A;  1WX6 A;  3CMA Q;  2F5K A;  1B34 A;  5GAM h;  5FU6 C;  2OAW A;  1O75 A;  3NTI A;  2QEX T;  3OYF A;  3JCM b;  4O6J A;  3FB9 A;  4XTV A;  1IB8 A;  1KQS S;  1K73 U;  3O8V A;  1WA7 A;  3PVQ A;  3RKY A;  1VQ5 A;  1H64 1;  3CCQ A;  1N5Z A;  3LH5 A;  5GMK m;  1G2B A;  4QQD A;  1WHL A;  4NS5 A;  5IXF A;  1Y96 B;  2BE9 B;  1VQL Q;  1Q86 U;  4RCB A;  2DE0 X;  3QO3 A;  1M3B A;  2DL8 A;  1H92 A;  3MEA A;  4E7J A;  1VQO Q;  1IGQ A;  1QLY A;  2LJ3 A;  1GCP A;  3JCM Q;  2MMP A;  3JV3 A;  1NYF A;  1KQS P;  4Q5W A;  1UGQ B;  1M1K R;  4HCB A;  3OA6 A;  3JCM P;  1N8R U;  1YJ9 Q;  1AT1 B;  2YUP A;  1TU0 B;  2ZPG B;  3TSW A;  2QG9 B;  4BE0 A;  3RMS A;  1GBR A;  1MHN A;  3A8O B;  3OYI A;  2KSS A;  2X9H A;  1UEC A;  1JEG A;  1K9M C;  1D3B A;  1I5L A;  2K5L A;  2EIF A;  3PE0 A;  4BDY A;  2RQW A;  3ER0 A;  4ZGJ B;  1OPK A;  1B34 B;  1I5O B;  4RTT A;  3NMZ C;  5J39 A;  1Y71 A;  4BD3 A;  2LQN A;  4WF2 A;  4A54 A;  2NLU A;  4ESR A;  2PTK A;  3I56 T;  3HPW A;  4FYY B;  4F7U F;  4FSX A;  2YHT A;  3PIO A;  4BI4 A;  1KK7 A;  1BIB A;  5A0D A;  4FYW B;  3DB3 A;  1M3A A;  5KYY A;  1T3S A;  1Q7Y C;  3H0H A;  6AT1 B;  1IHV A;  4C8Q D;  4LD6 A;  4BDZ A;  4C5G A;  5IHK A;  2KK4 A;  5DLO A;  3QDF A;  1VYU A;  1E6G A;  2P4T A;  3CCU T;  4KGZ B;  2XKO C;  1AD5 A;  1M8V A;  1UEB A;  1YBY A;  3JCM f;  2YLC A;  3JCM W;  4J9H A;  2KRO A;  1K9A A;  2DZC A;  1SEM A;  3RNJ A;  2DO3 A;  3VS4 A;  4KUD K;  1VYV A;  5GAN 7;  2XMF A;  2L3R A;  5I22 A;  4FM4 B;  2IG0 A;  3PIP A;  3OYA A;  2K6D A;  1YIT T;  5D6W A;  2KDS A;  4M7D D;  2ZCF B;  1GCQ C;  2JVV A;  1IO6 A;  4R56 A;  3EG9 A;  3H8Z A;  2HD0 A;  1EZZ B;  2CP6 A;  4JRI A;  4JRK A;  1FMW A;  2DL4 A;  4A4K A;  1PKT A;  2XDB A;  2M02 A;  1OU9 A;  4F7U A;  3LX7 A;  1XQH A;  3X20 B;  1G3S A;  1IRX A;  4KGV B;  1YJN T;  3TSZ A;  1EFN A;  5KYY B;  4PLL A;  3CCE Q;  5GAN f;  5FRN A;  2FZC B;  1PRM C;  2MCN A;  2G3R A;  2KNB B;  1S1N A;  3QWX X;  2V1Q A;  1JJ2 S;  1AOJ A;  1T0H A;  2JMC A;  1ZUY A;  4A4F A;  1K0X A;  2AT1 B;  1WYX A;  1I81 A;  1LVK A;  2O31 A;  1VQ9 Q;  2GGR A;  5IAY A;  5GAN 3;  4L5G A;  2RQT A;  4XU1 A;  1OI1 A;  2E12 A;  3G6E Q;  3OS2 A;  4RTZ A;  1PD0 A;  1WQ7 A;  3OS0 A;  2LCC A;  4IIO A;  1RI9 A;  2LDM A;  2QQ9 A;  3DLL A;  1VQ6 T;  2EPD A;  3OSS C;  3V7C A;  1MND A;  5IXB A;  3EG9 B;  5LJ3 f;  4PJO F;  2RQR A;  1K8A C;  4RTV A;  4R55 A;  4QT7 A;  4XTW A;  2E3H A;  1UFF A;  1GXI E;  1PC0 A;  3VU3 C;  1VQ7 A;  3QKJ A;  3CCJ Q;  2M0O A;  2MPX C;  5CKF A;  2ED0 A;  5CKB A; 
#chains in the Genus database with same CATH homology
 2EJG A;  4N0A C;  4EMK C;  5CVI A;  2K5F A;  4M78 G;  1WJS A;  3URG A;  1YIJ A;  3S3O A;  2JNG A;  3G6E A;  2KAF A;  2V8J A;  2AHJ B;  2RJC A;  4DOW A;  3LWH A;  1Y7X A;  1N9R A;  1XTD A;  4C0D B;  2E65 A;  3L2U A;  2DPP B;  3QHS A;  5GMK h;  4F7U G;  3QBY A;  2OTL T;  3CME A;  3MEU A;  2JTM A;  4II1 A;  2EQJ A;  4EPC A;  1Q81 C;  4M7D A;  5HK3 A;  2EKO A;  3T9N A;  3CCU A;  3JB9 F;  4NL2 A;  4J7I A;  4RMO A;  5IN1 A;  1I4K 1;  3DLM A;  3PMT A;  4HT8 A;  1M1F A;  3G7Z A;  3GNF B;  5GAM e;  2KY9 A;  3OYJ A;  3M58 A;  1QVF A;  3E9G A;  4XTZ A;  3OB9 A;  5A0G A;  1YJW T;  2OTJ T;  2A3L A;  2P0P A;  4ZGE B;  3JRZ A;  3S6W A;  5GAN j;  3G71 A;  1VQ8 A;  3CCL T;  4ZTJ A;  3LH0 A;  1VQ5 T;  3SD4 A;  2B8A A;  3JCM V;  3CCQ T;  3E9F A;  1NE8 A;  2GFA A;  1V29 B;  4QQ6 A;  3L2Q A;  2HQE A;  4C0G A;  5KCH A;  3HHT B;  3PTA A;  3OYK A;  2X4J A;  1M9S A;  3CBO A;  1NZ9 A;  3TEE A;  2BUD A;  3MP1 A;  3C95 A;  5M9O A;  3A8M B;  4M7A D;  5FRM A;  2IVW A;  3WXM B;  3TRE A;  2DTO A;  3CCJ A;  2D9T A;  3OYG A;  1W2B A;  1FWZ A;  5LJ3 g;  5I2M A;  1YIT A;  3EFR A;  2MF2 A;  3OMC A;  4PJO E;  4JS4 A;  3M54 A;  4KT0 E;  2LC4 A;  3CCV A;  1S72 T;  1KC8 C;  4MMK A;  3HRU A;  1LNX A;  4TVR A;  4PJO A;  2R5M A;  3HP9 A;  4M77 D;  4C8Q B;  4C92 G;  2HAX A;  3JCM X;  3SB2 A;  4IUT A;  4B9W A;  2XG8 D;  2QI2 A;  4L6V 5;  5LJ5 f;  5FU7 B;  2ZGW A;  1M5Q 1;  3P8D A;  1Y07 A;  4Y28 E;  5GAO n;  1O9S A;  3CCM T;  4LD9 K;  3PFS A;  3SDZ A;  2DD4 A;  1WJQ A;  3V7R A;  1YI2 T;  4E7I A;  3M53 A;  2LCL A;  5CAI A;  2EAY A;  4N0A A;  2DZ9 A;  3CCS A;  4EMK A;  2RK1 A;  3AHU A;  2I2L A;  2VGM A;  2LT1 A;  5CK9 A;  2LT4 A;  3FRN A;  3JCM g;  4OVA A;  3R6O A;  4J8O A;  4M78 D;  2RHU A;  3OMG A;  5LJ5 h;  4XTX A;  3TCJ A;  4J5Y A;  2XDD A;  1P92 A;  1KQ1 A;  2PVD B;  4M7D F;  2Y4Y A;  3UT1 A;  3ZBD A;  1PSE A;  1RL2 A;  4X34 A;  2QQR A;  4PL6 A;  4FL6 A;  2HBP A;  4BE2 A;  1VQ4 A;  1YJN A;  1Q81 U;  3EFS A;  3MHX A;  2VUB A;  2Y4X A;  5LJ3 j;  1QVF S;  3CMA A;  1NJI U;  2K57 A;  4HCB A;  3CC2 A;  1UB4 A;  3A8G B;  3RER A;  2DIG A;  3ME9 A;  4LDV A;  5CCA A;  1NPP A;  2QDY B;  3CCR T;  3ZEH A;  3X25 B;  3QZ5 B;  3OYM A;  3CBM A;  4GLK A;  4BB7 A;  4M7A F;  2KQW A;  3QJ6 A;  1ZHI A;  2CZ7 B;  2LQK A;  3X24 B;  1VQL T;  4PKC C;  4QVC A;  4LDX A;  2MAM A;  1XNI A;  4M7D B;  3V7S A;  4BI8 B;  3OYH A;  4ME7 A;  4A53 A;  1WNL A;  5GMK j;  3VJP A;  1VQP A;  3PT9 A;  3BFM A;  1OZ3 A;  2D6F A;  2RHI A;  4M75 G;  1X01 A;  2JUF A;  3LWI A;  1DJ7 B;  2BIV A;  4IKF A;  4FT2 A;  3QYH B;  3GLX A;  4C8Q E;  4E47 A;  1W2B S;  2HNI A;  3UWN A;  5GAM d;  1VQN A;  2GQV A;  3JB9 H;  5A2Q E;  4E7H A;  4M7A E;  4ZN3 A;  3JAM E;  2ZZD A;  3P8B B;  4JUV A;  3X28 B;  5GAN 4;  1YHQ T;  4M77 C;  2JZ2 A;  2QQA A;  2WSF E;  2ZPF B;  4OGE A;  3GIB A;  2LX9 A;  3UPU A;  1JB0 E;  3ZFJ A;  1BI3 A;  1HXD A;  1Y96 A;  3INZ A;  3NFC A;  3OQ5 A;  5GAN 2;  2GFU A;  2R58 A;  2RJE A;  4M78 F;  3VYH B;  4CRI A;  4RG2 A;  4ZTF A;  1VQ6 A;  3M5A A;  4OB1 B;  1VQO A;  4QQG A;  4BUG A;  1M1G A;  1VIF A;  2XHC A;  4BY6 B;  4C92 D;  1KQ2 A;  2CKK A;  3CPW A;  4PJO D;  5LJ5 g;  1KQS A;  1EIF A;  2K4Y A;  5C6S A;  1IZ6 A;  4M78 C;  3JCM c;  3QPH A;  3QXE B;  4J6W A;  3QII A;  4PJO B;  3MP8 A;  5HY6 A;  1YJ9 A;  2F69 A;  2ZPH B;  4N4I A;  3SWN C;  1VQ9 T;  3C4S A;  4FT4 A;  3JB9 J;  3M59 A;  2VGN A;  1SSF A;  2M16 A;  2PVO B;  1U1T A;  4OF1 A;  4M7D E;  3CC7 T;  2ZPI B;  4EMK B;  1XOV A;  1KHC A;  2PUK B;  2ZPB B;  4BI3 A;  2L5Q A;  3C94 A;  2QQS A;  4IUQ A;  5KCO A;  5DY9 A;  2BKD N;  1VQM T;  2X4X A;  2LQ8 A;  4XTY A;  5GMK l;  1VUB A;  4V2S A;  2RB6 A;  5GAM f;  3VUZ A;  1NJI C;  1H3Z A;  3RES A;  3HRT A;  2XD0 A;  3BY7 A;  2WSE E;  4DA4 A;  3J7A F;  2E10 A;  3WVD B;  4HA8 A;  3V8K A;  5LJ5 j;  2FB7 A;  3BDL A;  2DK3 A;  1LOJ A;  3JCM e;  1K9M U;  5EG2 A;  3FJP A;  4M7A A;  1BI0 A;  4KUL A;  2RHY A;  3H6Z A;  2F5K A;  4N4G A;  2OTL A;  1B34 A;  4C0Z A;  5GAM h;  5FU6 C;  2CYZ B;  4M75 D;  1M4Z A;  2CGH A;  1O75 A;  1G5V A;  3NTI A;  2FHD A;  4E7L A;  2QEX T;  4M77 A;  5CQY A;  4E7K A;  3JCM J;  4JRP A;  3OYN A;  2FVU A;  3OYF A;  4LDU A;  3JCM b;  1D3B B;  4O6J A;  2O01 E;  1QP3 A;  3FB9 A;  3L2Z A;  4C92 C;  4HT9 A;  3CPW S;  4LDW A;  1YJW A;  4XTV A;  2OTJ A;  3VUB A;  1KQS S;  4RKU E;  1K73 U;  3O8V A;  4IUU A;  5KE3 A;  3JSC A;  4Y91 A;  4J6Y A;  4N4H A;  2WAC A;  3RKY A;  1JRI A;  2DTH A;  3CCL A;  1VQ5 A;  1H64 1;  3CCQ A;  4IUV A;  2RM4 A;  4OB2 B;  1WGS A;  3S3M A;  4M78 A;  5GMK m;  2FYK A;  2R5A A;  3GPL A;  2GCX A;  3J80 E;  4NS5 A;  3MEV A;  3L1A A;  4QQD A;  1Y96 B;  4MDW A;  1Q82 C;  1Q86 U;  4RCB A;  3QO3 A;  4DOV A;  5FRO A;  3L2V A;  1KG1 A;  3MEA A;  2EJF A;  4E7J A;  3CC4 T;  3MCA B;  1Q7Y U;  4MDX A;  4EDU A;  2K3X A;  1S72 A;  5GAO q;  2E41 A;  4A4G A;  3NTH A;  5HK0 A;  5HKC A;  3CXC A;  4C8Q G;  1G3Y A;  4FU6 A;  3JCM Q;  2K5I A;  1OYX A;  1BIA A;  3OS1 A;  2MMP A;  4MZM A;  1UGQ B;  4Q5W A;  5GAO l;  3DKM A;  5CKE A;  3RKX A;  5LJ5 e;  3OA6 A;  3I55 T;  3CCM A;  3JCM P;  1YI2 A;  1N8R U;  4ELY C;  3HSB A;  2C06 A;  1UGR B;  3OYD A;  2ZPG B;  1JBM A;  1VQK T;  4BE0 A;  3FIF A;  3RMS A;  1YCY A;  1ZQ1 A;  1QP2 A;  3WVE B;  5GAN e;  2DXU A;  3V8J A;  3OYL A;  4BE1 A;  1MHN A;  3A8O B;  4QW2 A;  3OYI A;  3HRS A;  4M75 C;  2KSS A;  4J6X A;  4JS5 A;  2CZ1 B;  1MGQ A;  3PNW C;  2EJ9 A;  3LLR A;  3MET A;  2CS7 A;  2P0Q A;  3FLG A;  2EYQ A;  3A8H B;  1K9M C;  4M77 F;  1D3B A;  1VQP T;  1I5L A;  4XU2 A;  3M4Y A;  2K5L A;  4JLG A;  2XDP A;  3LW5 E;  2EIF A;  1VIE A;  4ELZ C;  3G4S T;  2QA4 T;  4J83 A;  3CCR A;  2RK2 A;  4BDY A;  4M7A B;  2RHZ A;  3KUF A;  4C92 A;  2DIQ A;  2CZ6 B;  3ER0 A;  4P5N A;  4ZGJ B;  1M90 C;  3JCM d;  3F70 A;  1B34 B;  3DB4 A;  1VQL A;  4XK8 E;  2DJZ A;  3RIR A;  4KUI A;  5J39 A;  1Y71 A;  4M7D G;  3ASK A;  1W4S A;  3CCE T;  3L42 A;  5CIU A;  4BD3 A;  5GAO p;  4M77 B;  2DAQ A;  4WF2 A;  5D6Y A;  4A54 A;  1FX7 A;  1K73 C;  3CD6 T;  4OGC A;  2NLU A;  2RO0 A;  3OS5 A;  3HKS A;  2E6N A;  3FDR A;  4XAX B;  5GAO m;  3I56 T;  3HPW A;  3A8L B;  5CKD A;  1Q82 U;  5AYF A;  4F7U F;  1VQ7 T;  2DVE A;  4PLI A;  4FSX A;  2DTI A;  2YHT A;  3M55 A;  1KHI A;  1BKB A;  5D6X A;  3X26 B;  4BI4 A;  5DM7 R;  3PIO A;  1YHQ A;  2X35 A;  1M1K U;  1BIB A;  3CXC S;  5A0D A;  4JJN K;  1Q86 C;  3LGL A;  3RMQ A;  2RI5 A;  4M78 B;  3DB3 A;  3QG1 A;  5LJ3 e;  5CR2 A;  3L2W A;  2RH2 A;  5GMK i;  1U1S A;  2E70 A;  2EFI A;  4B9X A;  4D6W A;  1Q7Y C;  1YIJ T;  4PNO A;  2F5T X;  3G6E T;  1QVG A;  4FIB A;  4RCC A;  3QSU A;  3SWN B;  2DEQ A;  3OSV A;  4C8Q D;  4LD6 A;  4BDZ A;  1KD1 C;  3RUX A;  4F7U B;  4C5G A;  3LYI A;  2KK4 A;  1HK9 A;  5DLO A;  5GAN 8;  3CME T;  1BI1 A;  4RG8 A;  2P4T A;  2XI9 A;  3L2R A;  3CCU T;  4BAC A;  3QYG B;  2XKO C;  4JDS A;  1N8R C;  2X4Y A;  2RJD A;  2MWO A;  3N5B B;  1M8V A;  4PJO G;  5GMK e;  2DXT A;  1UEB A;  1YBY A;  2KMT A;  4M75 A;  1VQ9 A;  1UGS B;  2QXF A;  3P8H A;  2EQK A;  2M9U A;  4O5V A;  3JCM f;  3UDC A;  4C0D C;  2DKG A;  2YLC A;  1IRE B;  3M56 A;  2GF7 A;  2PU9 B;  2VC8 A;  1R8O B;  4HKE A;  4OB3 B;  3TU4 K;  5J3B A;  3JCM W;  2VV5 A;  2XIC A;  2DXB A;  3CC7 A;  3M57 A;  2DZC A;  3OBW A;  5LJ5 d;  3CPF A;  3LGF A;  2DXC A;  3G71 T;  1VQ8 T;  2OAU A;  2DO3 A;  4M77 E;  4C92 F;  3OYC A;  3OW2 A;  5CQX A;  1VQM A;  4KUD K;  5GAN 7;  3VV0 A;  1JJ2 A;  5L8R E;  4OB0 B;  1FXX A;  3CEY A;  2RA2 A;  3JCM h;  5GAN d;  5I2S A;  2L3R A;  2K2V A;  1M90 U;  2MI6 A;  2ZPE B;  5FU6 B;  4VUB A;  1WPY A;  4FM4 B;  4NL3 A;  1U8R A;  4HCC A;  2IG0 A;  4XQ3 A;  3PIP A;  3OYA A;  3CCJ T;  1YIT T;  5D6W A;  2LTO A;  2KDS A;  5C0M A;  1QVP A;  4M7D D;  4ZGD B;  3M9Q A;  2ZCF B;  5GAN 6;  3CCV T;  4M78 E;  2MWP A;  2JVV A;  4C92 B;  3VKI A;  1G3T A;  2JN0 A;  2R57 A;  5LL6 S;  4R56 A;  3H8Z A;  4C8Q F;  2M1H A;  3JB9 G;  2HD0 A;  4QVZ A;  2DD5 A;  2QEX A;  4IUP A;  4JRI A;  4JRK A;  2O4X A;  2VXF A;  4F7U E;  4QVD A;  4A4K A;  3SWN A;  1K8A U;  4C0F A;  5DLQ E;  4C5H A;  3EAE A;  4OP0 A;  5FLX E;  3CCS T;  4J7F A;  1QVG S;  4F7U A;  1M1K C;  4C8Q C;  2XDB A;  3M4G A;  3LX7 A;  1X75 C;  1TH7 A;  1BI2 A;  2RJF A;  2E64 A;  5CKH A;  2XK0 A;  2WSC E;  1NPR A;  1XQH A;  2K3Y A;  4OMF B;  5FU7 C;  3X20 B;  3MP6 A;  3OYE A;  1G3S A;  2PQW A;  1KD1 U;  3OYY A;  5KH6 A;  2H3J A;  3KXT A;  4HCZ A;  1YJN T;  4C5E A;  1VQ4 T;  1N27 A;  3S3N A;  1AHJ B;  4M75 F;  3FEO A;  3V8L A;  3CMA T;  2RI3 A;  2L8D A;  2QQB A;  4PLL A;  3CC2 T;  4EMH A;  2XU8 A;  3E19 A;  4XU3 A;  5GAM g;  4MZP A;  1WJR A;  5GAN f;  4X9C A;  4X9D A;  3GP8 A;  5FRN A;  5LJ3 d;  2LVM A;  1UGP B;  2E5Q A;  5J26 A;  3MO8 A;  1G3W A;  4MZT A;  2JTF A;  3CC4 A;  2PUO B;  1RI0 A;  3OW2 S;  3FC3 A;  2G3R A;  3J81 E;  3KBG A;  5KE2 A;  3QDR B;  1JJ2 S;  1OZ2 A;  4GY5 A;  5IT9 E;  3BW1 A;  3QJY A;  4A4F A;  2HQX A;  4C5I A;  2LNV A;  5I21 A;  4M75 B;  2PVG B;  3BDU A;  3I55 A;  5GAO r;  5GAN h;  1BYM A;  5GAN 5;  1I81 A;  2EWN A;  2LRQ A;  4M7A C;  3MEW A;  4XU0 A;  3CBP A;  4C92 E;  3OY9 A;  2CZ0 B;  1I8F A;  1N6A A;  1VQK A;  1VQN T;  5IAY A;  4M7D C;  3E1S A;  3A5Z B;  5GAN 3;  4YTL A;  3JB9 I;  4L5G A;  2P0K A;  4XU1 A;  1OI1 A;  2E12 A;  3OS2 A;  4EMG A;  3HFO A;  1WQ7 A;  4MML A;  4L59 A;  3OS0 A;  4DQ2 A;  2FL7 A;  2LCC A;  2V8K A;  2YLB A;  2V8I A;  5GAM j;  5CO7 A;  2LDM A;  3Q1J A;  2QQ9 A;  3DLL A;  1VQO T;  1VQ6 T;  2Y90 A;  4IUR A;  3PMI A;  3HFN A;  3OSS C;  2D0Q B;  3VYG A;  4NOY A;  3V7C A;  3JB9 D;  3G4S A;  2QA4 A;  4JLI A;  2KVQ G;  4M7A G;  4C8Q A;  4ATO A;  4LDY A;  2JOY A;  1N9S A;  2VXE A;  3RKW A;  3NTK A;  1LJO A;  3HL8 A;  3GF5 A;  3OBY A;  2L89 A;  5LJ3 f;  4PJO F;  4ZN1 A;  3CCE A;  1YJ9 T;  4BY6 C;  4UC4 A;  1KC8 U;  3QUI A;  2E1H A;  1K8A C;  4CI0 C;  2E6Z A;  1WQW A;  2QTX A;  2XID A;  1ZBX A;  4JRQ A;  3CD6 A;  2RI2 A;  4KBM B;  4R55 A;  2O4X B;  4M77 G;  3GOX A;  2VYT A;  4XTW A;  3C12 A;  3OYB A;  2X4W A;  4A4H A;  3I56 A;  1X6O A;  2EQM A;  5A0L A;  1GXI E;  4PJO C;  3VU3 C;  2RHX A;  2YRV A;  1VQ7 A;  3PGG A;  2EQU A;  3SFM A;  2A7Y A;  3QKJ A;  2M0O A;  4M75 E;  4Z02 A;  5LJ3 h;  4A4E A;  2RD1 A;  3QZ9 B;  3GNG A;  4XTU A;  1QW1 A;  5CKF A;  5GAN g;  1PSF A;  5CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...