1TOVA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
NESDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein F53F4.3 in chromosome V
publication title Crystal Structure of the Cytoskeleton-Associated Protein Glycine-Rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1tovA00
2CP7A 4B6MA 3E2UA 1WHKA 2M02A 2HQHA 2E4HA 2CP5A 1TXQA 2CP0A 2HKNA 1WHMA 1WHJA 2COYA 2CP6A 2E3IA 2HL5C 2QK0A 2COZA 3RDVA 3TQ7P 1WHGA 1WHHA 2MPXC 2HKQB 1WHLA 1IXDA 2Z0WA 2E3HA 2CP2A 1LPLA 2HL3A 2CP3A 1TOVA 2COWA
chains in the Genus database with same CATH superfamily
4Y28E 2OTLA 1RLQC 5EG2A 2EFIA 1OEBA 3VJPA 4ME7A 3OYMA 2QTXA 2J6KA 3HHTB 4HXJA 1QCOA 2CUBA 1WPYA 3CMAA 5CAIA 3T9NA 1U5SA 2Y4XA 1WHHA 1YP5A 5I11A 3RERA 4M77F 3EH2A 2CT3A 4CC3A 2MF2A 1QCFA 2KK4A 4M7AG 3VS3A 4A4FA 3CXCS 2ABLA 2JM8A 1MNEA 4LDVA 2L2PA 4N0AA 2MMPA 3RUXA 3JCMe 2QA4A 4KGVB 4IUTA 1BBZA 2E3IA 4B9XA 2C06A 1U1SA 2EGCA 2X4XA 1P92A 4M7AA 4DBHA 5CKDA 1B07A 4F7UF 3TU4K 1Q86R 3CCVT 2PUKB 4O5VA 2X3WD 2DXUA 1I1JA 1KHCA 2GTJA 3MEWA 1G2BA 2RHZA 2DYBA 4LE9A 1H3ZA 2CS7A 4CC7A 4E7KA 1M3CA 2DL8A 4OMOA 5KE2A 1ZSZC 2RHUA 2NUZA 1BI3A 2KVQG 2GNCA 2XD0A 4M78G 1PKSA 3OYEA 5LL6S 1DJ7B 1QVFS 2GFUA 2EKHA 1ZA2B 1N27A 2O9VA 1Y7XA 2CZ6B 1OV3A 3CCUT 1TH7A 3R6NA 2JTMA 3OS1A 1VQPQ 5HK3A 3CCRQ 2V26A 4EMGA 4KGZB 4M78A 4OGCA 4UC4A 2LCCA 3O5ZA 4RTWA 4C92G 3FEOA 3QSUA 5GANd 1VQNT 1PKTA 4M77E 2M02A 3FC3A 1H3HA 1VYTA 2HCKA 1VQ4A 5LJ3f 3KUFA 1D1AA 1AHJB 1M90U 2OAWA 3MJXA 4OVAA 1R77A 2HQXA 4C92A 1YCSB 1T3LA 4FCYA 3OYCA 2ZPBB 3I55Q 3EGXB 5LJ3h 1PD1A 5IXFA 2MCNA 4BDYA 3UA7A 4F7UE 4PKCC 4ORZA 3JCMP 2V8IA 2YLCA 2RJCA 2OI3A 2V1QA 5KYXB 2SRCA 1WHJA 3CPWS 1FMKA 1D1CA 1WHGA 2XDDA 3G4SA 9ATCB 4EMHA 2YUPA 2X35A 4RTTA 5GAOn 2PTKA 4E6RA 2QGGA 1FMWA 3BW1A 1K4US 5LJ5e 2E41A 3LYIA 1Q82U 1W2BS 3OYGA 2DPPB 3RMQA 1NZ9A 4R0KA 3OSVA 4M7DD 2NUTB 1G3TA 2AZVA 4JUVA 4ANJA 4OMPA 1MMGA 5LJ3g 4CI0C 2EYWA 3SFMA 5IHNA 3L2ZA 2JUFA 4F17A 1Q7YC 3CCVQ 4ZGDB 3C94A 1AWXA 2DE0X 4C5EA 3H0IA 2E6NA 2X9HA 5FU7B 3FB9A 1S72A 3EFSA 1B7TA 3H0HA 3CBPA 4RTXA 1Q81R 1D3BB 2EW3A 2DEQA 3OS2A 3V8LA 3P8HA 2E5QA 3KFVA 1YJ9T 4F04B 2JZ2A 3CD6A 5IH2A 1FWZA 1UTIA 4MZTA 2DJQA 4BACA 4XQ3A 3CCUQ 4JJDA 1T0JA 1K1ZA 5GAN7 3SWNB 1VQMA 2VXEA 4XU1A 4EPCA 2LQ8A 1JXOA 1FYNA 2E6ZA 3PMTA 4VUBA 3NHNA 1B3QA 3G71T 3N5BB 1N5ZA 2QQ9A 2X4YA 5CK9A 3R6OA 3L2UA 1IHVA 3X26B 2L8DA 3CCLT 4JJCA 1Q81C 1JRIA 2M1HA 1CKBA 2M9UA 4IUQA 2CZ7B 3HFNA 3QJ6A 4JRPA 5GMKh 4LUEA 3L2RA 3VS0A 1K0XA 1GCQC 4XAXB 3VS5A 2LT1A 1PM3A 1PRMC 2OX7A 4R56A 3EG2A 4C0FA 3CMET 1Q86U 4XU0A 2K79A 5GMKm 4QQ6A 5DM7R 1VQ6T 3INZA 2OTJT 2CH4W 2LNHB 1WXUA 4A53A 1FMVA 3META 2RJFA 3FIFA 3CPFA 4ZTFA 3RKXA 1VQ5Q 2YRVA 2BIVA 5FW9A 4EMKC 2FVUA 2LCSA 1I4K1 1S1NA 3LLRA 3JCMX 5GAOm 3S3OA 1WJQA 3BY7A 2FG0A 3L2VA 4PJNA 1YJNQ 1KC8C 2DXTA 1U06A 3TQ7P 3V7SA 3JRZA 4J9FA 2EYXA 3I56T 2HKQB 1NPRA 4E7HA 1VQOT 3GIBA 1PWTA 4M77D 1OYXA 1CSKA 3OQ5A 3ER0A 4GLMA 4OB3B 3JCMJ 2C0TA 3PGGA 2O2OA 4C8QG 2FEIA 3MKDA 3VYHB 5GANe 1D0ZA 1WHMA 3CCST 3QBYA 4RTYA 2DILA 3CCJA 3PFSA 3CC2Q 3EGDB 2VASA 3GLXA 4BE2A 3MCAB 3LW5E 1D1BA 4C8QA 1K76A 2IPOB 3PTAA 2RMOA 4E7LA 3CXCP 1QMCA 2DL3A 2YRCA 5FROA 1VIFA 2RQUA 2JS2A 1YJ9Q 2HZYA 1JJ2S 4FSXA 2A7YA 1K9MU 2F2XA 3X24B 3VKIA 4X9CA 1YHQA 4CRIA 1QVFA 1KJWA 2M51A 1NLPC 4LDYA 3BE3A 4FU6A 3G71Q 1W6XA 1VQ7T 2CZ0B 3CCLQ 3GNGA 3JSCA 2RHIA 1JXMA 1LNXA 2DTHA 3QG1A 4LNPA 1UB4A 1YI2A 4FW2A 2O01E 1M8MA 3A8GB 1QKWA 2A3LA 2RJEA 1QLYA 4QW2A 3H6ZA 1M8VA 4PJLA 4X1VA 2X4JA 1VYUA 1I0CA 5HCKA 2FYKA 1NE8A 1V1CA 3V7CA 2XKOC 1QVFP 3CMEQ 4FM4B 1IGUA 2VV5A 2EQKA 2X51A 4QT7A 2COZA 1LJOA 2CZ1B 1VQ6Q 2O4XA 2OTJQ 2IVWA 2OJ2A 4RMOA 2GQIA 1NYGA 4XK8E 2WSCE 3LWIA 1HD3A 2J06A 1M2VB 5KYUA 3VS7A 2GGRA 4FSSA 2EQMA 2RI3A 4E2FB 2H3EB 4RKUE 4JJBA 3M0RA 3JCMb 4MMKA 5KCOA 4KH0B 1Z9QA 5IAYA 5CKBA 1GBRA 1H8KA 2ED0A 1R0BG 2FPEA 3A8OB 4NS5A 4HCCA 2XU8A 4NL3A 3D7SB 3I56Q 1E6HA 3CCQA 1VQOQ 3E2UA 3RIRA 1WA7A 1M90R 4PJOG 1R8OB 2QDLA 1NLOC 2E4HA 2JM9A 3NGPA 1YWOA 3E19A 3TSZA 2KRNA 3A8HB 1M1FA 4II1A 1OPKA 4J9BA 3CCSQ 1ZBJA 3CPWP 3EH1A 4JJNK 2E10A 1X2KA 3I5RA 4PJOA 2L3RA 4QQGA 2E1HA 1AOJA 1AWJA 4QVCA 1O75A 4OMFB 1OX9A 3SHWA 3OYBA 4OMNA 3EAEA 2PVDB 1UGQB 1W2BP 2DBMA 5DLOA 3LH0A 2I0NA 2JT4A 2KSSA 1QVGS 1B34B 1V29B 2C0OA 3RMSA 3U23A 2CP6A 2RI2A 2E64A 3VUZA 1X69A 5CKHA 3FJ5A 4L59A 4RTVA 3EFOB 2LNVA 2DZ9A 2G6FX 3G6ET 5GAOq 3ZBDA 1GFCA 4N0AC 3A98A 2HL3A 4QKUA 1M90C 4KRTA 1WXTA 1OULA 1MMDA 3VS4A 1OZ2A 3DKMA 4M7AC 4MZPA 1TS9A 2DF6A 2HD0A 5HK0A 5GJVB 5CIUA 2HSEB 3CCRA 5GAMf 1LOJA 3C95A 3QHSA 5J3BA 2PUOB 2KAFA 2EGEA 4M7AB 2QDYB 5LJ3d 3JCMf 2P4TA 5GAMh 3DLLA 4GBQA 6AT1B 4OMQA 3EFRA 4A4EA 3DLMA 4ZN3A 2L3SA 1YJWA 2A08A 3OYJA 2F69A 1Q82C 3JCMh 1RAAB 1BI2A 4IIOA 3A5ZB 3I55T 2EJ9A 4PLIA 3G1JA 3PT9A 5I2SA 2RO0A 2QI2A 1K8AU 2EVRA 1AD5A 4J7FA 4PJMA 2LCLA 1JO8A 5A0GA 1PCXA 2KMTA 5CKFA 1VQLT 1T3SA 4MZMA 4A54A 1IB8A 5HKCA 4M78C 2MK5A 4X9DA 3LX7A 2ZAEA 1MMAA 2RH2A 3HP9A 5GANj 3NFCA 1Q95G 4ZNXA 1WIEA 3TEEA 3S3MA 3HTRA 1KQSS 1SKUB 3CMAT 4M75G 5GAMg 2JXBA 4YTLA 2VKNA 4C92C 1YCYA 1HSQA 2LP5A 4XTZA 3OA6A 1Y96A 2DEUA 3JCMg 2V8JA 4DEXA 1BI0A 5GAN8 1SSHA 3V7RA 1TUGB 3WVDB 4M75A 3J80E 2EYYA 2DD5A 1M30A 4C92B 4DEYA 5CVIA 4A63B 2KDSA 4QQDA 4A4KA 3PNWC 2DFUA 1ABQA 2HEQA 3SB2A 2R57A 4AFQC 2J6FA 3MP8A 3M54A 2YT6A 1F1BB 1BKBA 1VQKQ 3P8BB 4JRIA 5KYYA 4XTVA 4OP0A 1BCOA 2ESWA 3HSBA 3CCMQ 1BI1A 2RHYA 2M16A 3CQTA 4PNOA 2DA9A 3G6EQ 2D8HA 1YN8A 1GRIA 1YITT 4Z88A 5EC7A 1JJ2A 3QKJA 2FRWA 3JV3A 2HL5C 1ZSZB 5M9OA 2QG9B 2IIMA 2YLBA 5I2MA 4Z89A 1AT1B 2EQIA 4C92F 1Q86C 3CCUA 4Y91A 5LJ5f 2EJGA 2NYSA 4JRQA 4NL2A 4M7AE 3AT1B 3WVEB 5LJ5h 2X3XD 4DQ2A 2OAUA 1VQNA 1X6GA 4KGXB 3M0TA 3LH5A 5FWCA 1JJ2P 4D6WA 3OMGA 2EYQA 2K2MA 1UGVA 3SDZA 4QVZA 2DAQA 4EIKA 2PZ1A 3CBMA 4CC2A 3I9QA 4FYVB 5D6YA 1AWOA 1QKXA 2W0ZA 3Q1JA 2QEXQ 4OGEA 3L2QA 3URGA 2J7IA 4PJJA 1K9MR 2K5IA 2BZYA 1VQLQ 2P4RA 1M9SA 2DERA 2VXFA 3LGFA 2DTOA 3IQLA 3CC7Q 1VQ5T 3JB9G 3FDRA 2PVOB 2OTLQ 4OB2B 3OY9A 4DOWA 3CC4T 1QWFA 4PFPA 2RHXA 2KY9A 2PU9B 2DVJA 2GQVA 5LJ5g 3G4ST 3VRYA 2KT8A 3CMAQ 4MMLA 1YJNT 4M78E 2WSFE 2JTEA 1VYVA 2MWOA 2QAZA 3LWHA 2DZCA 3VU3C 1Z9ZA 2K4YA 3M0UA 4HT9A 2ECZA 4J6XA 1C0MA 1ZX6A 3V8JA 2D1XA 4AFSC 5KYNA 1X6OA 2DVEA 3RESA 2E5KA 1K9MC 3QDFA 3QXEB 4C92E 3G7ZA 3GOXA 1D0XA 3GBQA 2LVMA 5LJ3e 1QVPA 3DB3A 2NUPA 1MMNA 2XICA 3CC2T 3UDCA 2L3PA 3A8LB 1RAIB 4DA4A 5KYWA 1QVGA 1M27C 3M0SA 1YITQ 3QWXX 2LT4A 2D8JA 3EGXA 2VWFA 1FX7A 4PL6A 3ZL7C 1MGQA 3O8VA 1YJ9A 4RTUA 3EHQA 2KE9A 2ZPHB 1M2OA 3P8DA 1VOMA 5KYXA 4KT0E 3MHXA 3F70A 1I81A 3NTHA 3VS1A 1VQMT 5I22A 3G71A 2B8AA 3M59A 1YIJT 3PIPA 1QVGP 2HAXA 4DBRA 3H8ZA 3CCLA 1WGSA 4C8QC 2BZ8A 4FYYB 2MYSA 2VGNA 1WHLA 1SPKA 2FRYA 2JMCA 4F14A 2GCXA 4BB7A 2JOYA 1VQ4Q 2MOXA 1ZHIA 2O31A 4RCBA 2HDAA 3M4GA 5GANf 5GAN5 2DXBA 4C8QB 4D8KA 5J26A 4Y92A 1NPPA 1UJ0A 2CREA 1RACB 1Y57A 3CMEA 2DETA 5GANh 3M53A 1GL5A 2YUOA 1M4ZA 2E12A 1VQ6A 2BE9B 2YWWA 4FW1A 1NYFA 3EHRA 1PRLC 1OPLA 1QCNA 3MP1A 3CC4Q 4HA8A 1AWWA 1D3BA 4X34A 3G4SQ 1QP2A 1XTDA 4EMKB 1ZA1B 3CXCA 2QYZA 3RR6A 2ROTA 2QGFB 3FJPA 3NTKA 3QIIA 4AFZC 4M7AD 3I56A 1RAFB 1HXDA 4C8QF 5J39A 1VQOA 5GMKe 1QQJA 3SWNA 2RQTA 2BZXA 5GANg 1K8AR 2DNUA 1WX6A 3OBYA 3REBB 1K0SA 3CCSA 2DL4A 3ASKA 4BDZA 2JJ9A 4LN2A 2O4XB 2J6OA 4XTYA 1X27A 1T0HA 4OF1A 3CCJT 1WJRA 1S72Q 1KQSP 3FRNA 1ZUYA 2RQVA 4PK4A 1WQ7A 1BU1A 2DM1A 2DRMA 4AFUC 1IO6A 2QQRA 2PNIA 2L3QA 3A1PA 1KHIA 4J9IA 3H9NA 1MUZA 2P0KA 5L23A 1GXIE 4D8DA 1GCQA 1SEMA 4C5IA 2V1RA 2KGTA 2Y4YA 2GBQA 2JMAA 2HQEA 4IIMA 1K8AC 1N9SA 3CCET 1VQMQ 5GAMd 1J3TA 4PJOC 4LUDA 1JU5C 4FT4A 1VQ7A 1YIJQ 2FZGB 1Y71A 3GNFB 2EQUA 3SEMA 4J5YA 4OB1B 3HFOA 4C92D 3QYHB 2KROA 3OYNA 2H8HA 1XOVA 4LDUA 3VUBA 3M56A 4LDXA 4PJOB 4GLKA 1AEYA 1UECA 5GAN2 1RAEB 3THKA 3L1AA 1PSEA 4PLLA 3M57A 3X28B 4C8QE 2GFAA 1RUWA 4RG2A 5GAOr 1H92A 5D6XA 4HVUA 1GFDA 1RABB 2F2VA 4MDWA 4C5HA 4ESRA 1OI1A 2CT4A 2VVKA 2D6FA 1C1AA 1UDLA 4OMMA 1VQ9A 1BIBA 2LX9A 1KD1U 1RI0A 1I5LA 2K3XA 3CPWA 2RD1A 1ZUUA 3EGDA 4HVWA 1PC0A 2ENMA 2DKGA 3RKYA 1UGRB 4OMLA 1RAGB 1Y0MA 1ZSGA 4XTWA 3JCMW 4N4IA 1W2BA 3TSWA 2ZPEB 3EG9B 2CP2A 5LJ3j 4PJOF 2K2VA 1M5Q1 4J7IA 2RF0A 3OW2S 2XG8D 1RI9A 3OB9A 5D7UA 4M7DG 1XJWB 1W70A 1WI7A 1TWBA 4JS4A 2AKKA 2FZCB 1PSFA 3QWYA 1BB9A 3S6WA 2E70A 2XK0A 2VYTA 4IKFA 4DBFA 5A2QE 1NEGA 2RB6A 1E6GA 4M7DA 2RI5A 3GPLA 1ZUKA 2HBPA 4IUPA 2QQSA 2M0OA 1VQKT 1Y07A 2DLPA 1NM7A 3CCJQ 1AZEA 1LVKA 2AKLA 3BDLA 3OYIA 4DOVA 3CCMT 2RQWA 2V8KA 1VQ8T 4BI3A 1KC8U 5CQYA 1AVZC 2K5LA 4FYWB 2K3BA 3OYFA 3PVQA 3G6EA 2SEMA 5KE3A 3HPWA 2LJ1A 4RG8A 2K3YA 5CQXA 3MEVA 2COYA 2CUDA 3PVLA 1NEBA 4M75C 1YHQQ 3OYHA 1M2VA 3CCEQ 4MDXA 4LDWA 5A0LA 1G3YA 1VQPA 4BY6C 3GP8A 3UPUA 4J6YA 2EWNA 3EG3A 2K6DA 1MV3A 4R55A 2LQNA 4M75B 3OS0A 2DL5A 2YSQA 2PVGB 1IZ6A 2HNIA 8AT1B 2DK3A 1SHGA 2CP0A 5FRNA 4PJOE 1FXXA 1WQWA 1K73U 1YI2Q 4BY6B 1KG1A 2B86A 2RQRA 1D09B 2VUBA 4O6JA 2KQWA 3NTIA 4XTUA 5KYYB 2QEXT 3I55A 2LJ0A 1KFZA 4IURA 1I8FA 4BE1A 2BE7D 4Z02A 5D6WA 4XTXA 4IUUA 3CC7T 4F16A 1PNJA 3M4YA 1VUBA 1MNDA 2RK2A 4NOYA 5GMKj 2OTLT 2VC8A 3OMCA 4L5GA 4M7AF 3LGLA 4AMCA 7AT1B 4B6MA 3VRZA 4M78B 4A4GA 2FL7A 3EFOA 5GAOl 3QDRB 3OYDA 1M3BA 3C12A 3OBWA 2DX1A 2LTOA 3PE0A 1U8RA 4KUDK 3UF4A 3OSSC 2XI9A 3QZ9B 2HBWA 5GAN6 3CCQQ 2F5TX 5GAN4 4M77G 5GAMe 2JW4A 3REAB 2KYBA 2VB6A 2QA4T 1TSFA 2QQBA 2XHCA 3MO8A 5DLQE 1O9SA 4RCCA 1UE9A 4C8QD 3CCVA 1WFWA 2H3JA 2AT1B 4FYXB 1D0YA 4XU3A 4M77A 3PMIA 1QWEA 2NWMA 1NJIU 1I5OB 3EG1A 1TUDA 2M0YA 1W1FA 4C0ZA 4F7UG 1VQ8Q 2LZ6B 4M78F 1JEGA 2K7AA 2LRQA 1WHKA 2A37A 4Z8AA 1SHFA 1QP3A 2EYZA 4XU2A 1YITA 4BE0A 2DIQA 2ED1A 2KNBB 4F7UA 2DXCA 1X2QA 2E65A 2RA2A 2CYZB 3UT1A 2XDPA 5CR2A 1UG1A 2CP7A 3QZ5B 4HCZA 1NBEB 4J9EA 2GTOA 4WF2A 4ZN1A 4JPBW 3M55A 4GY5A 4M75E 1PHTA 2QTVA 2QQAA 2F5KA 3NMZC 3FLGA 1BCMA 2EIFA 1WLPB 1W4SA 3HRTA 4HKEA 2NUPB 2KBTA 2D0NA 1VQ4T 2EBPA 4KULA 5KCHA 4BI4A 1KQ2A 2FB7A 2QXFA 1JQQA 3BDUA 1YJWQ 3TVTA 2CGHA 1OU8A 5KYWB 1BIAA 2ZZDA 2AK5A 4J9DA 1ARKA 3JB9F 2W10A 2YDLA 1M1KU 2NLUA 1OX8A 3ZFJA 3ULRB 1VQ5A 5HY6A 2COWA 2ZPFB 3JB9I 1Q7YR 3GF5A 4OB0B 3H0FA 3C4SA 4J8OA 2L0AA 1N9RA 2D9TA 3CC4A 3VYGA 3RNJA 5CO7A 2ZPIB 1YJNA 2G3RA 2RPNA 4HVVA 1BYMA 4HCKA 1KQ1A 3J7AF 4JS5A 3OW2A 2E3HA 1UJYA 2EPDA 1LCKA 1N8RU 3M5AA 1ZSZA 2QA4Q 4PJOD 3QJYA 2LQKA 3JB9H 2RM4A 3KBGA 3ME9A 4KBMB 2RNAA 1UHFA 3ZEHA 3EGUA 1TTHB 1VIEA 1SRMA 5FU7C 1KD1R 2ROLA 2WACA 4FL6A 3VV0A 3CC2A 2HSPA 1UHCA 2BKDN 5KH6A 1S72T 2EAYA 5IHIA 1OQKA 3QUIA 5IN1A 3E9FA 3OW2P 1TUCA 1TXQA 2CSIA 4WCIA 2K5FA 2MPXC 4PFOA 2DL7A 4ZTJA 3TCJA 2VGMA 1U1TA 1IRXA 2P0PA 3SWNC 4BUGA 4AG1C 3CD6T 3RBBB 2AIRB 2CSQA 1YFNA 3M9QA 2RK1A 3QYGB 4IUVA 4J6WA 2K57A 1MHNA 3JCMQ 1KD1C 1X6BA 3E1SA 3E9GA 1IXDA 4J83A 1TU0B 1YIJA 2KXCA 4E7JA 2P0QA 4JZ4A 1EFNA 4RUGA 2C0IA 2NUTA 1VQNQ 1A0NB 1XQHA 4J9CA 4FIBA 2D0QB 4P5NA 5CCAA 2AHJB 1YWPA 1U3OA 1WDXA 1WNLA 5L8RE 2QK0A 1KC8R 2ZGWA 1EX4A 1X43A 3CBOA 1OU9A 3UWNA 1GBQA 1WYXA 5AYFA 2R5AA 2OTJA 2YRDA 3HRSA 1ABOA 1N6AA 3MEAA 1YBYA 3EG0A 4JLIA 2LQWA 2QASA 2CDTA 1RLPC 1QW1A 4ELYC 1AZGB 2MWPA 5GAOp 2KR3A 5GAMj 2EQJA 1C6VX 3QPHA 5ECAA 1G5VA 5FWBA 4ZGEB 4PFZA 4TVRA 3DB4A 1TG0A 2L5QA 1KQSA 2JVVA 2Z0WA 2YUQA 3MPUB 1LPLA 4KUIA 3A8MB 2X4WA 1TOVA 1HK9A 1K73R 4M75D 2BUDA 1NG2A 2GF7A 3L42A 2KT1A 1UGSB 1OZ3A 3RDVA 2WSEE 3OYYA 4J9GA 2YHTA 3TREA 4LXCA 3VS2A 2DRKA 2R58A 1V76A 5GMKi 2A36A 2EKOA 2ZPGB 2XDBA 4E47A 3PIOA 3M58A 2DD4A 5KYUB 5IXBA 4DBQA 2FHDA 3I5SA 4LD9K 4B9WA 3KXTA 1G3WA 1JBMA 2RN8A 1YNZA 2MAMA 2P84A 2J05A 2JTFA 1K73C 1JB0E 3M0QA 5A0DA 5I21A 1X75C 5IHKA 4M78D 2AZSA 3CD6Q 1ZLMA 2IG0A 2FZKB 1YHQT 2KI7A 1ZBXA 4J9HA 1Q7YU 2KRSA 5FU6C 4ATOA 3MEUA 4M7DC 3RKWA 4ELZC 3CCEA 2DYIA 1EIFA 3JCMd 4C5GA 4HT8A 2FO0A 4E7ZA 1NJIR 5FU6B 2DIGA 4JRKA 4EMKA 1YI2T 3OYAA 4M7DB 2JNGA 4FT2A 3JCMc 1H641 2MI6A 3UA6A 2LMJA 3JB9J 2XMFA 1M1GA 2JN0A 3JAME 1CKAA 4K11A 3HRUA 2LJ3A 3X25B 1PG5B 1BK2A 2CP3A 1M3AA 2LC4A 3X20B 4A4HA 4LD6A 3BFMA 3V8KA 2CKKA 4EDUA 4RTZA 3I35A 5LJ5j 1G8XA 2MIOA 2O88A 5C0MA 5GJWB 2F2WA 3UATA 1VQ9T 8ATCB 3JB9D 1I07A 1Q81U 1G3SA 4E7IA 2KEAA 2A0FB 2F1LA 4BI8B 1NJIC 2HQHA 4QVDA 4M7DF 4AT1B 1XNIA 4C0GA 3NPFA 1ZQ1A 2DTIA 1KIKA 1IREB 5AT1B 3M0PA 2L89A 3CCQT 5IT9E 1OOTA 2KRMA 1RL2A 4C0DC 2ZCFB 2A28A 1SF9A 2KYMA 1WZOA 1R0CB 2EGAA 2PQWA 4JDSA 2YXYA 5DY9A 3JCMV 2KXDA 1RAHB 1M1KR 1HJDA 4C0DB 3J81E 1K9AA 1EZZB 1ACMB 3H41A 1VQKA 2BTTA 2O9SA 2EJFA 4JZ3A 2DBKA 3CCMA 1GCPA 1KK7A 3MP6A 3AHUA 2DJZA 1WJSA 3OYKA 1VQ8A 5FRMA 2FPDA 3OS5A 2CP5A 2JS0A 1SSFA 3CEYA 5C6SA 1UEBA 2HKNA 4N4GA 2LDMA 3QO3A 4L6V5 5LJ5d 2CH4A 1Q82R 2Y90A 1N8RR 1UUEA 3L2WA 1Y96B 1IHWA 2DMOA 2XIDA 4WTOB 2R5MA 1IGQA 1SG5A 1UFFA 4M77C 1M1KC 4Q5WA 1UGPB 1VQ7Q 1VQPT 4V2SA 3CCRT 1MV0B 1KSWA 2DO3A 3EG9A 2ATCB 2YUNA 3SD4A 2LX7A 4JLGA 4M7DE 3OYLA 1PD0A 4CC4B 1SRLA 3S3NA 4ZGJB 5CKEA 3C0CA 5GAN3 4M77B 1E7OA 1X01A 4E7SA 3HL8A 1YJWT 1RADB 3VS6A 5FLXE 1VA7A 3HKSA 2QEXA 2K9GA 5GMKl 4N4HA 4BD3A 1N8RC 1VQLA 1HYOA 4M4ZA 4KH1B 3WXMB 1G83A 2I2LA 1VQ9Q 2RJDA 1WXBA 4HCBA 3CC7A 2FPFA 4F7UB 4AG2C 2HMAA 4M75F 1B34A
chains in the Genus database with same CATH topology
2CP7A 4B6MA 3E2UA 1WHKA 2M02A 2HQHA 2E4HA 2CP5A 1TXQA 2CP0A 2HKNA 1WHMA 1WHJA 2COYA 2CP6A 2E3IA 2HL5C 2QK0A 2COZA 3RDVA 3TQ7P 1WHGA 1WHHA 2MPXC 2HKQB 1WHLA 1IXDA 2Z0WA 2E3HA 2CP2A 1LPLA 2HL3A 2CP3A 1TOVA 2COWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP7 A;  4B6M A;  3E2U A;  1WHK A;  2M02 A;  2HQH A;  2E4H A;  2CP5 A;  1TXQ A;  2CP0 A;  2HKN A;  1WHM A;  1WHJ A;  2COY A;  2CP6 A;  2E3I A;  2HL5 C;  2QK0 A;  2COZ A;  3RDV A;  3TQ7 P;  1WHG A;  1WHH A;  2MPX C;  2HKQ B;  1WHL A;  1IXD A;  2Z0W A;  2E3H A;  2CP2 A;  1LPL A;  2HL3 A;  2CP3 A;  1TOV A;  2COW A; 
#chains in the Genus database with same CATH topology
 4Y28 E;  2OTL A;  1RLQ C;  5EG2 A;  2EFI A;  1OEB A;  3VJP A;  4ME7 A;  3OYM A;  2QTX A;  2J6K A;  3HHT B;  4HXJ A;  1QCO A;  2CUB A;  1WPY A;  3CMA A;  5CAI A;  3T9N A;  1U5S A;  2Y4X A;  1WHH A;  1YP5 A;  5I11 A;  3RER A;  4M77 F;  3EH2 A;  2CT3 A;  4CC3 A;  2MF2 A;  1QCF A;  2KK4 A;  4M7A G;  3VS3 A;  4A4F A;  3CXC S;  2ABL A;  2JM8 A;  1MNE A;  4LDV A;  2L2P A;  4N0A A;  2MMP A;  3RUX A;  3JCM e;  2QA4 A;  4KGV B;  4IUT A;  1BBZ A;  2E3I A;  4B9X A;  2C06 A;  1U1S A;  2EGC A;  2X4X A;  1P92 A;  4M7A A;  4DBH A;  5CKD A;  1B07 A;  4F7U F;  3TU4 K;  1Q86 R;  3CCV T;  2PUK B;  4O5V A;  2X3W D;  2DXU A;  1I1J A;  1KHC A;  2GTJ A;  3MEW A;  1G2B A;  2RHZ A;  2DYB A;  4LE9 A;  1H3Z A;  2CS7 A;  4CC7 A;  4E7K A;  1M3C A;  2DL8 A;  4OMO A;  5KE2 A;  1ZSZ C;  2RHU A;  2NUZ A;  1BI3 A;  2KVQ G;  2GNC A;  2XD0 A;  4M78 G;  1PKS A;  3OYE A;  5LL6 S;  1DJ7 B;  1QVF S;  2GFU A;  2EKH A;  1ZA2 B;  1N27 A;  2O9V A;  1Y7X A;  2CZ6 B;  1OV3 A;  3CCU T;  1TH7 A;  3R6N A;  2JTM A;  3OS1 A;  1VQP Q;  5HK3 A;  3CCR Q;  2V26 A;  4EMG A;  4KGZ B;  4M78 A;  4OGC A;  4UC4 A;  2LCC A;  3O5Z A;  4RTW A;  4C92 G;  3FEO A;  3QSU A;  5GAN d;  1VQN T;  1PKT A;  4M77 E;  2M02 A;  3FC3 A;  1H3H A;  1VYT A;  2HCK A;  1VQ4 A;  5LJ3 f;  3KUF A;  1D1A A;  1AHJ B;  1M90 U;  2OAW A;  3MJX A;  4OVA A;  1R77 A;  2HQX A;  4C92 A;  1YCS B;  1T3L A;  4FCY A;  3OYC A;  2ZPB B;  3I55 Q;  3EGX B;  5LJ3 h;  1PD1 A;  5IXF A;  2MCN A;  4BDY A;  3UA7 A;  4F7U E;  4PKC C;  4ORZ A;  3JCM P;  2V8I A;  2YLC A;  2RJC A;  2OI3 A;  2V1Q A;  5KYX B;  2SRC A;  1WHJ A;  3CPW S;  1FMK A;  1D1C A;  1WHG A;  2XDD A;  3G4S A;  9ATC B;  4EMH A;  2YUP A;  2X35 A;  4RTT A;  5GAO n;  2PTK A;  4E6R A;  2QGG A;  1FMW A;  3BW1 A;  1K4U S;  5LJ5 e;  2E41 A;  3LYI A;  1Q82 U;  1W2B S;  3OYG A;  2DPP B;  3RMQ A;  1NZ9 A;  4R0K A;  3OSV A;  4M7D D;  2NUT B;  1G3T A;  2AZV A;  4JUV A;  4ANJ A;  4OMP A;  1MMG A;  5LJ3 g;  4CI0 C;  2EYW A;  3SFM A;  5IHN A;  3L2Z A;  2JUF A;  4F17 A;  1Q7Y C;  3CCV Q;  4ZGD B;  3C94 A;  1AWX A;  2DE0 X;  4C5E A;  3H0I A;  2E6N A;  2X9H A;  5FU7 B;  3FB9 A;  1S72 A;  3EFS A;  1B7T A;  3H0H A;  3CBP A;  4RTX A;  1Q81 R;  1D3B B;  2EW3 A;  2DEQ A;  3OS2 A;  3V8L A;  3P8H A;  2E5Q A;  3KFV A;  1YJ9 T;  4F04 B;  2JZ2 A;  3CD6 A;  5IH2 A;  1FWZ A;  1UTI A;  4MZT A;  2DJQ A;  4BAC A;  4XQ3 A;  3CCU Q;  4JJD A;  1T0J A;  1K1Z A;  5GAN 7;  3SWN B;  1VQM A;  2VXE A;  4XU1 A;  4EPC A;  2LQ8 A;  1JXO A;  1FYN A;  2E6Z A;  3PMT A;  4VUB A;  3NHN A;  1B3Q A;  3G71 T;  3N5B B;  1N5Z A;  2QQ9 A;  2X4Y A;  5CK9 A;  3R6O A;  3L2U A;  1IHV A;  3X26 B;  2L8D A;  3CCL T;  4JJC A;  1Q81 C;  1JRI A;  2M1H A;  1CKB A;  2M9U A;  4IUQ A;  2CZ7 B;  3HFN A;  3QJ6 A;  4JRP A;  5GMK h;  4LUE A;  3L2R A;  3VS0 A;  1K0X A;  1GCQ C;  4XAX B;  3VS5 A;  2LT1 A;  1PM3 A;  1PRM C;  2OX7 A;  4R56 A;  3EG2 A;  4C0F A;  3CME T;  1Q86 U;  4XU0 A;  2K79 A;  5GMK m;  4QQ6 A;  5DM7 R;  1VQ6 T;  3INZ A;  2OTJ T;  2CH4 W;  2LNH B;  1WXU A;  4A53 A;  1FMV A;  3MET A;  2RJF A;  3FIF A;  3CPF A;  4ZTF A;  3RKX A;  1VQ5 Q;  2YRV A;  2BIV A;  5FW9 A;  4EMK C;  2FVU A;  2LCS A;  1I4K 1;  1S1N A;  3LLR A;  3JCM X;  5GAO m;  3S3O A;  1WJQ A;  3BY7 A;  2FG0 A;  3L2V A;  4PJN A;  1YJN Q;  1KC8 C;  2DXT A;  1U06 A;  3TQ7 P;  3V7S A;  3JRZ A;  4J9F A;  2EYX A;  3I56 T;  2HKQ B;  1NPR A;  4E7H A;  1VQO T;  3GIB A;  1PWT A;  4M77 D;  1OYX A;  1CSK A;  3OQ5 A;  3ER0 A;  4GLM A;  4OB3 B;  3JCM J;  2C0T A;  3PGG A;  2O2O A;  4C8Q G;  2FEI A;  3MKD A;  3VYH B;  5GAN e;  1D0Z A;  1WHM A;  3CCS T;  3QBY A;  4RTY A;  2DIL A;  3CCJ A;  3PFS A;  3CC2 Q;  3EGD B;  2VAS A;  3GLX A;  4BE2 A;  3MCA B;  3LW5 E;  1D1B A;  4C8Q A;  1K76 A;  2IPO B;  3PTA A;  2RMO A;  4E7L A;  3CXC P;  1QMC A;  2DL3 A;  2YRC A;  5FRO A;  1VIF A;  2RQU A;  2JS2 A;  1YJ9 Q;  2HZY A;  1JJ2 S;  4FSX A;  2A7Y A;  1K9M U;  2F2X A;  3X24 B;  3VKI A;  4X9C A;  1YHQ A;  4CRI A;  1QVF A;  1KJW A;  2M51 A;  1NLP C;  4LDY A;  3BE3 A;  4FU6 A;  3G71 Q;  1W6X A;  1VQ7 T;  2CZ0 B;  3CCL Q;  3GNG A;  3JSC A;  2RHI A;  1JXM A;  1LNX A;  2DTH A;  3QG1 A;  4LNP A;  1UB4 A;  1YI2 A;  4FW2 A;  2O01 E;  1M8M A;  3A8G B;  1QKW A;  2A3L A;  2RJE A;  1QLY A;  4QW2 A;  3H6Z A;  1M8V A;  4PJL A;  4X1V A;  2X4J A;  1VYU A;  1I0C A;  5HCK A;  2FYK A;  1NE8 A;  1V1C A;  3V7C A;  2XKO C;  1QVF P;  3CME Q;  4FM4 B;  1IGU A;  2VV5 A;  2EQK A;  2X51 A;  4QT7 A;  2COZ A;  1LJO A;  2CZ1 B;  1VQ6 Q;  2O4X A;  2OTJ Q;  2IVW A;  2OJ2 A;  4RMO A;  2GQI A;  1NYG A;  4XK8 E;  2WSC E;  3LWI A;  1HD3 A;  2J06 A;  1M2V B;  5KYU A;  3VS7 A;  2GGR A;  4FSS A;  2EQM A;  2RI3 A;  4E2F B;  2H3E B;  4RKU E;  4JJB A;  3M0R A;  3JCM b;  4MMK A;  5KCO A;  4KH0 B;  1Z9Q A;  5IAY A;  5CKB A;  1GBR A;  1H8K A;  2ED0 A;  1R0B G;  2FPE A;  3A8O B;  4NS5 A;  4HCC A;  2XU8 A;  4NL3 A;  3D7S B;  3I56 Q;  1E6H A;  3CCQ A;  1VQO Q;  3E2U A;  3RIR A;  1WA7 A;  1M90 R;  4PJO G;  1R8O B;  2QDL A;  1NLO C;  2E4H A;  2JM9 A;  3NGP A;  1YWO A;  3E19 A;  3TSZ A;  2KRN A;  3A8H B;  1M1F A;  4II1 A;  1OPK A;  4J9B A;  3CCS Q;  1ZBJ A;  3CPW P;  3EH1 A;  4JJN K;  2E10 A;  1X2K A;  3I5R A;  4PJO A;  2L3R A;  4QQG A;  2E1H A;  1AOJ A;  1AWJ A;  4QVC A;  1O75 A;  4OMF B;  1OX9 A;  3SHW A;  3OYB A;  4OMN A;  3EAE A;  2PVD B;  1UGQ B;  1W2B P;  2DBM A;  5DLO A;  3LH0 A;  2I0N A;  2JT4 A;  2KSS A;  1QVG S;  1B34 B;  1V29 B;  2C0O A;  3RMS A;  3U23 A;  2CP6 A;  2RI2 A;  2E64 A;  3VUZ A;  1X69 A;  5CKH A;  3FJ5 A;  4L59 A;  4RTV A;  3EFO B;  2LNV A;  2DZ9 A;  2G6F X;  3G6E T;  5GAO q;  3ZBD A;  1GFC A;  4N0A C;  3A98 A;  2HL3 A;  4QKU A;  1M90 C;  4KRT A;  1WXT A;  1OUL A;  1MMD A;  3VS4 A;  1OZ2 A;  3DKM A;  4M7A C;  4MZP A;  1TS9 A;  2DF6 A;  2HD0 A;  5HK0 A;  5GJV B;  5CIU A;  2HSE B;  3CCR A;  5GAM f;  1LOJ A;  3C95 A;  3QHS A;  5J3B A;  2PUO B;  2KAF A;  2EGE A;  4M7A B;  2QDY B;  5LJ3 d;  3JCM f;  2P4T A;  5GAM h;  3DLL A;  4GBQ A;  6AT1 B;  4OMQ A;  3EFR A;  4A4E A;  3DLM A;  4ZN3 A;  2L3S A;  1YJW A;  2A08 A;  3OYJ A;  2F69 A;  1Q82 C;  3JCM h;  1RAA B;  1BI2 A;  4IIO A;  3A5Z B;  3I55 T;  2EJ9 A;  4PLI A;  3G1J A;  3PT9 A;  5I2S A;  2RO0 A;  2QI2 A;  1K8A U;  2EVR A;  1AD5 A;  4J7F A;  4PJM A;  2LCL A;  1JO8 A;  5A0G A;  1PCX A;  2KMT A;  5CKF A;  1VQL T;  1T3S A;  4MZM A;  4A54 A;  1IB8 A;  5HKC A;  4M78 C;  2MK5 A;  4X9D A;  3LX7 A;  2ZAE A;  1MMA A;  2RH2 A;  3HP9 A;  5GAN j;  3NFC A;  1Q95 G;  4ZNX A;  1WIE A;  3TEE A;  3S3M A;  3HTR A;  1KQS S;  1SKU B;  3CMA T;  4M75 G;  5GAM g;  2JXB A;  4YTL A;  2VKN A;  4C92 C;  1YCY A;  1HSQ A;  2LP5 A;  4XTZ A;  3OA6 A;  1Y96 A;  2DEU A;  3JCM g;  2V8J A;  4DEX A;  1BI0 A;  5GAN 8;  1SSH A;  3V7R A;  1TUG B;  3WVD B;  4M75 A;  3J80 E;  2EYY A;  2DD5 A;  1M30 A;  4C92 B;  4DEY A;  5CVI A;  4A63 B;  2KDS A;  4QQD A;  4A4K A;  3PNW C;  2DFU A;  1ABQ A;  2HEQ A;  3SB2 A;  2R57 A;  4AFQ C;  2J6F A;  3MP8 A;  3M54 A;  2YT6 A;  1F1B B;  1BKB A;  1VQK Q;  3P8B B;  4JRI A;  5KYY A;  4XTV A;  4OP0 A;  1BCO A;  2ESW A;  3HSB A;  3CCM Q;  1BI1 A;  2RHY A;  2M16 A;  3CQT A;  4PNO A;  2DA9 A;  3G6E Q;  2D8H A;  1YN8 A;  1GRI A;  1YIT T;  4Z88 A;  5EC7 A;  1JJ2 A;  3QKJ A;  2FRW A;  3JV3 A;  2HL5 C;  1ZSZ B;  5M9O A;  2QG9 B;  2IIM A;  2YLB A;  5I2M A;  4Z89 A;  1AT1 B;  2EQI A;  4C92 F;  1Q86 C;  3CCU A;  4Y91 A;  5LJ5 f;  2EJG A;  2NYS A;  4JRQ A;  4NL2 A;  4M7A E;  3AT1 B;  3WVE B;  5LJ5 h;  2X3X D;  4DQ2 A;  2OAU A;  1VQN A;  1X6G A;  4KGX B;  3M0T A;  3LH5 A;  5FWC A;  1JJ2 P;  4D6W A;  3OMG A;  2EYQ A;  2K2M A;  1UGV A;  3SDZ A;  4QVZ A;  2DAQ A;  4EIK A;  2PZ1 A;  3CBM A;  4CC2 A;  3I9Q A;  4FYV B;  5D6Y A;  1AWO A;  1QKX A;  2W0Z A;  3Q1J A;  2QEX Q;  4OGE A;  3L2Q A;  3URG A;  2J7I A;  4PJJ A;  1K9M R;  2K5I A;  2BZY A;  1VQL Q;  2P4R A;  1M9S A;  2DER A;  2VXF A;  3LGF A;  2DTO A;  3IQL A;  3CC7 Q;  1VQ5 T;  3JB9 G;  3FDR A;  2PVO B;  2OTL Q;  4OB2 B;  3OY9 A;  4DOW A;  3CC4 T;  1QWF A;  4PFP A;  2RHX A;  2KY9 A;  2PU9 B;  2DVJ A;  2GQV A;  5LJ5 g;  3G4S T;  3VRY A;  2KT8 A;  3CMA Q;  4MML A;  1YJN T;  4M78 E;  2WSF E;  2JTE A;  1VYV A;  2MWO A;  2QAZ A;  3LWH A;  2DZC A;  3VU3 C;  1Z9Z A;  2K4Y A;  3M0U A;  4HT9 A;  2ECZ A;  4J6X A;  1C0M A;  1ZX6 A;  3V8J A;  2D1X A;  4AFS C;  5KYN A;  1X6O A;  2DVE A;  3RES A;  2E5K A;  1K9M C;  3QDF A;  3QXE B;  4C92 E;  3G7Z A;  3GOX A;  1D0X A;  3GBQ A;  2LVM A;  5LJ3 e;  1QVP A;  3DB3 A;  2NUP A;  1MMN A;  2XIC A;  3CC2 T;  3UDC A;  2L3P A;  3A8L B;  1RAI B;  4DA4 A;  5KYW A;  1QVG A;  1M27 C;  3M0S A;  1YIT Q;  3QWX X;  2LT4 A;  2D8J A;  3EGX A;  2VWF A;  1FX7 A;  4PL6 A;  3ZL7 C;  1MGQ A;  3O8V A;  1YJ9 A;  4RTU A;  3EHQ A;  2KE9 A;  2ZPH B;  1M2O A;  3P8D A;  1VOM A;  5KYX A;  4KT0 E;  3MHX A;  3F70 A;  1I81 A;  3NTH A;  3VS1 A;  1VQM T;  5I22 A;  3G71 A;  2B8A A;  3M59 A;  1YIJ T;  3PIP A;  1QVG P;  2HAX A;  4DBR A;  3H8Z A;  3CCL A;  1WGS A;  4C8Q C;  2BZ8 A;  4FYY B;  2MYS A;  2VGN A;  1WHL A;  1SPK A;  2FRY A;  2JMC A;  4F14 A;  2GCX A;  4BB7 A;  2JOY A;  1VQ4 Q;  2MOX A;  1ZHI A;  2O31 A;  4RCB A;  2HDA A;  3M4G A;  5GAN f;  5GAN 5;  2DXB A;  4C8Q B;  4D8K A;  5J26 A;  4Y92 A;  1NPP A;  1UJ0 A;  2CRE A;  1RAC B;  1Y57 A;  3CME A;  2DET A;  5GAN h;  3M53 A;  1GL5 A;  2YUO A;  1M4Z A;  2E12 A;  1VQ6 A;  2BE9 B;  2YWW A;  4FW1 A;  1NYF A;  3EHR A;  1PRL C;  1OPL A;  1QCN A;  3MP1 A;  3CC4 Q;  4HA8 A;  1AWW A;  1D3B A;  4X34 A;  3G4S Q;  1QP2 A;  1XTD A;  4EMK B;  1ZA1 B;  3CXC A;  2QYZ A;  3RR6 A;  2ROT A;  2QGF B;  3FJP A;  3NTK A;  3QII A;  4AFZ C;  4M7A D;  3I56 A;  1RAF B;  1HXD A;  4C8Q F;  5J39 A;  1VQO A;  5GMK e;  1QQJ A;  3SWN A;  2RQT A;  2BZX A;  5GAN g;  1K8A R;  2DNU A;  1WX6 A;  3OBY A;  3REB B;  1K0S A;  3CCS A;  2DL4 A;  3ASK A;  4BDZ A;  2JJ9 A;  4LN2 A;  2O4X B;  2J6O A;  4XTY A;  1X27 A;  1T0H A;  4OF1 A;  3CCJ T;  1WJR A;  1S72 Q;  1KQS P;  3FRN A;  1ZUY A;  2RQV A;  4PK4 A;  1WQ7 A;  1BU1 A;  2DM1 A;  2DRM A;  4AFU C;  1IO6 A;  2QQR A;  2PNI A;  2L3Q A;  3A1P A;  1KHI A;  4J9I A;  3H9N A;  1MUZ A;  2P0K A;  5L23 A;  1GXI E;  4D8D A;  1GCQ A;  1SEM A;  4C5I A;  2V1R A;  2KGT A;  2Y4Y A;  2GBQ A;  2JMA A;  2HQE A;  4IIM A;  1K8A C;  1N9S A;  3CCE T;  1VQM Q;  5GAM d;  1J3T A;  4PJO C;  4LUD A;  1JU5 C;  4FT4 A;  1VQ7 A;  1YIJ Q;  2FZG B;  1Y71 A;  3GNF B;  2EQU A;  3SEM A;  4J5Y A;  4OB1 B;  3HFO A;  4C92 D;  3QYH B;  2KRO A;  3OYN A;  2H8H A;  1XOV A;  4LDU A;  3VUB A;  3M56 A;  4LDX A;  4PJO B;  4GLK A;  1AEY A;  1UEC A;  5GAN 2;  1RAE B;  3THK A;  3L1A A;  1PSE A;  4PLL A;  3M57 A;  3X28 B;  4C8Q E;  2GFA A;  1RUW A;  4RG2 A;  5GAO r;  1H92 A;  5D6X A;  4HVU A;  1GFD A;  1RAB B;  2F2V A;  4MDW A;  4C5H A;  4ESR A;  1OI1 A;  2CT4 A;  2VVK A;  2D6F A;  1C1A A;  1UDL A;  4OMM A;  1VQ9 A;  1BIB A;  2LX9 A;  1KD1 U;  1RI0 A;  1I5L A;  2K3X A;  3CPW A;  2RD1 A;  1ZUU A;  3EGD A;  4HVW A;  1PC0 A;  2ENM A;  2DKG A;  3RKY A;  1UGR B;  4OML A;  1RAG B;  1Y0M A;  1ZSG A;  4XTW A;  3JCM W;  4N4I A;  1W2B A;  3TSW A;  2ZPE B;  3EG9 B;  2CP2 A;  5LJ3 j;  4PJO F;  2K2V A;  1M5Q 1;  4J7I A;  2RF0 A;  3OW2 S;  2XG8 D;  1RI9 A;  3OB9 A;  5D7U A;  4M7D G;  1XJW B;  1W70 A;  1WI7 A;  1TWB A;  4JS4 A;  2AKK A;  2FZC B;  1PSF A;  3QWY A;  1BB9 A;  3S6W A;  2E70 A;  2XK0 A;  2VYT A;  4IKF A;  4DBF A;  5A2Q E;  1NEG A;  2RB6 A;  1E6G A;  4M7D A;  2RI5 A;  3GPL A;  1ZUK A;  2HBP A;  4IUP A;  2QQS A;  2M0O A;  1VQK T;  1Y07 A;  2DLP A;  1NM7 A;  3CCJ Q;  1AZE A;  1LVK A;  2AKL A;  3BDL A;  3OYI A;  4DOV A;  3CCM T;  2RQW A;  2V8K A;  1VQ8 T;  4BI3 A;  1KC8 U;  5CQY A;  1AVZ C;  2K5L A;  4FYW B;  2K3B A;  3OYF A;  3PVQ A;  3G6E A;  2SEM A;  5KE3 A;  3HPW A;  2LJ1 A;  4RG8 A;  2K3Y A;  5CQX A;  3MEV A;  2COY A;  2CUD A;  3PVL A;  1NEB A;  4M75 C;  1YHQ Q;  3OYH A;  1M2V A;  3CCE Q;  4MDX A;  4LDW A;  5A0L A;  1G3Y A;  1VQP A;  4BY6 C;  3GP8 A;  3UPU A;  4J6Y A;  2EWN A;  3EG3 A;  2K6D A;  1MV3 A;  4R55 A;  2LQN A;  4M75 B;  3OS0 A;  2DL5 A;  2YSQ A;  2PVG B;  1IZ6 A;  2HNI A;  8AT1 B;  2DK3 A;  1SHG A;  2CP0 A;  5FRN A;  4PJO E;  1FXX A;  1WQW A;  1K73 U;  1YI2 Q;  4BY6 B;  1KG1 A;  2B86 A;  2RQR A;  1D09 B;  2VUB A;  4O6J A;  2KQW A;  3NTI A;  4XTU A;  5KYY B;  2QEX T;  3I55 A;  2LJ0 A;  1KFZ A;  4IUR A;  1I8F A;  4BE1 A;  2BE7 D;  4Z02 A;  5D6W A;  4XTX A;  4IUU A;  3CC7 T;  4F16 A;  1PNJ A;  3M4Y A;  1VUB A;  1MND A;  2RK2 A;  4NOY A;  5GMK j;  2OTL T;  2VC8 A;  3OMC A;  4L5G A;  4M7A F;  3LGL A;  4AMC A;  7AT1 B;  4B6M A;  3VRZ A;  4M78 B;  4A4G A;  2FL7 A;  3EFO A;  5GAO l;  3QDR B;  3OYD A;  1M3B A;  3C12 A;  3OBW A;  2DX1 A;  2LTO A;  3PE0 A;  1U8R A;  4KUD K;  3UF4 A;  3OSS C;  2XI9 A;  3QZ9 B;  2HBW A;  5GAN 6;  3CCQ Q;  2F5T X;  5GAN 4;  4M77 G;  5GAM e;  2JW4 A;  3REA B;  2KYB A;  2VB6 A;  2QA4 T;  1TSF A;  2QQB A;  2XHC A;  3MO8 A;  5DLQ E;  1O9S A;  4RCC A;  1UE9 A;  4C8Q D;  3CCV A;  1WFW A;  2H3J A;  2AT1 B;  4FYX B;  1D0Y A;  4XU3 A;  4M77 A;  3PMI A;  1QWE A;  2NWM A;  1NJI U;  1I5O B;  3EG1 A;  1TUD A;  2M0Y A;  1W1F A;  4C0Z A;  4F7U G;  1VQ8 Q;  2LZ6 B;  4M78 F;  1JEG A;  2K7A A;  2LRQ A;  1WHK A;  2A37 A;  4Z8A A;  1SHF A;  1QP3 A;  2EYZ A;  4XU2 A;  1YIT A;  4BE0 A;  2DIQ A;  2ED1 A;  2KNB B;  4F7U A;  2DXC A;  1X2Q A;  2E65 A;  2RA2 A;  2CYZ B;  3UT1 A;  2XDP A;  5CR2 A;  1UG1 A;  2CP7 A;  3QZ5 B;  4HCZ A;  1NBE B;  4J9E A;  2GTO A;  4WF2 A;  4ZN1 A;  4JPB W;  3M55 A;  4GY5 A;  4M75 E;  1PHT A;  2QTV A;  2QQA A;  2F5K A;  3NMZ C;  3FLG A;  1BCM A;  2EIF A;  1WLP B;  1W4S A;  3HRT A;  4HKE A;  2NUP B;  2KBT A;  2D0N A;  1VQ4 T;  2EBP A;  4KUL A;  5KCH A;  4BI4 A;  1KQ2 A;  2FB7 A;  2QXF A;  1JQQ A;  3BDU A;  1YJW Q;  3TVT A;  2CGH A;  1OU8 A;  5KYW B;  1BIA A;  2ZZD A;  2AK5 A;  4J9D A;  1ARK A;  3JB9 F;  2W10 A;  2YDL A;  1M1K U;  2NLU A;  1OX8 A;  3ZFJ A;  3ULR B;  1VQ5 A;  5HY6 A;  2COW A;  2ZPF B;  3JB9 I;  1Q7Y R;  3GF5 A;  4OB0 B;  3H0F A;  3C4S A;  4J8O A;  2L0A A;  1N9R A;  2D9T A;  3CC4 A;  3VYG A;  3RNJ A;  5CO7 A;  2ZPI B;  1YJN A;  2G3R A;  2RPN A;  4HVV A;  1BYM A;  4HCK A;  1KQ1 A;  3J7A F;  4JS5 A;  3OW2 A;  2E3H A;  1UJY A;  2EPD A;  1LCK A;  1N8R U;  3M5A A;  1ZSZ A;  2QA4 Q;  4PJO D;  3QJY A;  2LQK A;  3JB9 H;  2RM4 A;  3KBG A;  3ME9 A;  4KBM B;  2RNA A;  1UHF A;  3ZEH A;  3EGU A;  1TTH B;  1VIE A;  1SRM A;  5FU7 C;  1KD1 R;  2ROL A;  2WAC A;  4FL6 A;  3VV0 A;  3CC2 A;  2HSP A;  1UHC A;  2BKD N;  5KH6 A;  1S72 T;  2EAY A;  5IHI A;  1OQK A;  3QUI A;  5IN1 A;  3E9F A;  3OW2 P;  1TUC A;  1TXQ A;  2CSI A;  4WCI A;  2K5F A;  2MPX C;  4PFO A;  2DL7 A;  4ZTJ A;  3TCJ A;  2VGM A;  1U1T A;  1IRX A;  2P0P A;  3SWN C;  4BUG A;  4AG1 C;  3CD6 T;  3RBB B;  2AIR B;  2CSQ A;  1YFN A;  3M9Q A;  2RK1 A;  3QYG B;  4IUV A;  4J6W A;  2K57 A;  1MHN A;  3JCM Q;  1KD1 C;  1X6B A;  3E1S A;  3E9G A;  1IXD A;  4J83 A;  1TU0 B;  1YIJ A;  2KXC A;  4E7J A;  2P0Q A;  4JZ4 A;  1EFN A;  4RUG A;  2C0I A;  2NUT A;  1VQN Q;  1A0N B;  1XQH A;  4J9C A;  4FIB A;  2D0Q B;  4P5N A;  5CCA A;  2AHJ B;  1YWP A;  1U3O A;  1WDX A;  1WNL A;  5L8R E;  2QK0 A;  1KC8 R;  2ZGW A;  1EX4 A;  1X43 A;  3CBO A;  1OU9 A;  3UWN A;  1GBQ A;  1WYX A;  5AYF A;  2R5A A;  2OTJ A;  2YRD A;  3HRS A;  1ABO A;  1N6A A;  3MEA A;  1YBY A;  3EG0 A;  4JLI A;  2LQW A;  2QAS A;  2CDT A;  1RLP C;  1QW1 A;  4ELY C;  1AZG B;  2MWP A;  5GAO p;  2KR3 A;  5GAM j;  2EQJ A;  1C6V X;  3QPH A;  5ECA A;  1G5V A;  5FWB A;  4ZGE B;  4PFZ A;  4TVR A;  3DB4 A;  1TG0 A;  2L5Q A;  1KQS A;  2JVV A;  2Z0W A;  2YUQ A;  3MPU B;  1LPL A;  4KUI A;  3A8M B;  2X4W A;  1TOV A;  1HK9 A;  1K73 R;  4M75 D;  2BUD A;  1NG2 A;  2GF7 A;  3L42 A;  2KT1 A;  1UGS B;  1OZ3 A;  3RDV A;  2WSE E;  3OYY A;  4J9G A;  2YHT A;  3TRE A;  4LXC A;  3VS2 A;  2DRK A;  2R58 A;  1V76 A;  5GMK i;  2A36 A;  2EKO A;  2ZPG B;  2XDB A;  4E47 A;  3PIO A;  3M58 A;  2DD4 A;  5KYU B;  5IXB A;  4DBQ A;  2FHD A;  3I5S A;  4LD9 K;  4B9W A;  3KXT A;  1G3W A;  1JBM A;  2RN8 A;  1YNZ A;  2MAM A;  2P84 A;  2J05 A;  2JTF A;  1K73 C;  1JB0 E;  3M0Q A;  5A0D A;  5I21 A;  1X75 C;  5IHK A;  4M78 D;  2AZS A;  3CD6 Q;  1ZLM A;  2IG0 A;  2FZK B;  1YHQ T;  2KI7 A;  1ZBX A;  4J9H A;  1Q7Y U;  2KRS A;  5FU6 C;  4ATO A;  3MEU A;  4M7D C;  3RKW A;  4ELZ C;  3CCE A;  2DYI A;  1EIF A;  3JCM d;  4C5G A;  4HT8 A;  2FO0 A;  4E7Z A;  1NJI R;  5FU6 B;  2DIG A;  4JRK A;  4EMK A;  1YI2 T;  3OYA A;  4M7D B;  2JNG A;  4FT2 A;  3JCM c;  1H64 1;  2MI6 A;  3UA6 A;  2LMJ A;  3JB9 J;  2XMF A;  1M1G A;  2JN0 A;  3JAM E;  1CKA A;  4K11 A;  3HRU A;  2LJ3 A;  3X25 B;  1PG5 B;  1BK2 A;  2CP3 A;  1M3A A;  2LC4 A;  3X20 B;  4A4H A;  4LD6 A;  3BFM A;  3V8K A;  2CKK A;  4EDU A;  4RTZ A;  3I35 A;  5LJ5 j;  1G8X A;  2MIO A;  2O88 A;  5C0M A;  5GJW B;  2F2W A;  3UAT A;  1VQ9 T;  8ATC B;  3JB9 D;  1I07 A;  1Q81 U;  1G3S A;  4E7I A;  2KEA A;  2A0F B;  2F1L A;  4BI8 B;  1NJI C;  2HQH A;  4QVD A;  4M7D F;  4AT1 B;  1XNI A;  4C0G A;  3NPF A;  1ZQ1 A;  2DTI A;  1KIK A;  1IRE B;  5AT1 B;  3M0P A;  2L89 A;  3CCQ T;  5IT9 E;  1OOT A;  2KRM A;  1RL2 A;  4C0D C;  2ZCF B;  2A28 A;  1SF9 A;  2KYM A;  1WZO A;  1R0C B;  2EGA A;  2PQW A;  4JDS A;  2YXY A;  5DY9 A;  3JCM V;  2KXD A;  1RAH B;  1M1K R;  1HJD A;  4C0D B;  3J81 E;  1K9A A;  1EZZ B;  1ACM B;  3H41 A;  1VQK A;  2BTT A;  2O9S A;  2EJF A;  4JZ3 A;  2DBK A;  3CCM A;  1GCP A;  1KK7 A;  3MP6 A;  3AHU A;  2DJZ A;  1WJS A;  3OYK A;  1VQ8 A;  5FRM A;  2FPD A;  3OS5 A;  2CP5 A;  2JS0 A;  1SSF A;  3CEY A;  5C6S A;  1UEB A;  2HKN A;  4N4G A;  2LDM A;  3QO3 A;  4L6V 5;  5LJ5 d;  2CH4 A;  1Q82 R;  2Y90 A;  1N8R R;  1UUE A;  3L2W A;  1Y96 B;  1IHW A;  2DMO A;  2XID A;  4WTO B;  2R5M A;  1IGQ A;  1SG5 A;  1UFF A;  4M77 C;  1M1K C;  4Q5W A;  1UGP B;  1VQ7 Q;  1VQP T;  4V2S A;  3CCR T;  1MV0 B;  1KSW A;  2DO3 A;  3EG9 A;  2ATC B;  2YUN A;  3SD4 A;  2LX7 A;  4JLG A;  4M7D E;  3OYL A;  1PD0 A;  4CC4 B;  1SRL A;  3S3N A;  4ZGJ B;  5CKE A;  3C0C A;  5GAN 3;  4M77 B;  1E7O A;  1X01 A;  4E7S A;  3HL8 A;  1YJW T;  1RAD B;  3VS6 A;  5FLX E;  1VA7 A;  3HKS A;  2QEX A;  2K9G A;  5GMK l;  4N4H A;  4BD3 A;  1N8R C;  1VQL A;  1HYO A;  4M4Z A;  4KH1 B;  3WXM B;  1G83 A;  2I2L A;  1VQ9 Q;  2RJD A;  1WXB A;  4HCB A;  3CC7 A;  2FPF A;  4F7U B;  4AG2 C;  2HMA A;  4M75 F;  1B34 A; 
#chains in the Genus database with same CATH homology
 2CP7 A;  4B6M A;  3E2U A;  1WHK A;  2M02 A;  2HQH A;  2E4H A;  2CP5 A;  1TXQ A;  2CP0 A;  2HKN A;  1WHM A;  1WHJ A;  2COY A;  2CP6 A;  2E3I A;  2HL5 C;  2QK0 A;  2COZ A;  3RDV A;  3TQ7 P;  1WHG A;  1WHH A;  2MPX C;  2HKQ B;  1WHL A;  1IXD A;  2Z0W A;  2E3H A;  2CP2 A;  1LPL A;  2HL3 A;  2CP3 A;  1TOV A;  2COW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...