1TOVA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
NESDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein F53F4.3 in chromosome V
publication title Crystal Structure of the Cytoskeleton-Associated Protein Glycine-Rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1tovA00
3E2UA 2CP3A 2E4HA 1WHJA 1WHHA 1TOVA 1IXDA 2QK0A 2HKQB 2M02A 2COZA 1WHKA 2Z0WA 1WHMA 2CP6A 2CP0A 2CP2A 1WHGA 2COYA 2COWA 2MPXC 2E3IA 2HKNA 2CP5A 3RDVA 2HL5C 1LPLA 1TXQA 3TQ7P 2E3HA 2HL3A 4B6MA 2HQHA 2CP7A 1WHLA
chains in the Genus database with same CATH superfamily
3M4GA 2RI3A 1U1SA 4NS5A 5D7UA 1OV3A 2SEMA 5LJ5e 4QW2A 1YIJA 1BBZA 3JB9F 3I5SA 4JUVA 2R5MA 4TVRA 1H3ZA 1M90R 4E7IA 1VQ6Q 3JCMf 5CAIA 2OTJT 2X51A 1N9RA 1SSHA 2FVUA 1M90C 4B9WA 4DBFA 3CMEQ 3BE3A 1B07A 5CK9A 2LMJA 3DLMA 1N27A 1U8RA 1KC8U 3X26B 4RCCA 2PVOB 2CGHA 3JV3A 3EGXA 2A08A 2E5KA 2DL7A 4CC7A 4AT1B 1JO8A 4JZ4A 5KYWA 1WXUA 1QCOA 4XTWA 1WXTA 2VGNA 3CCUT 3FC3A 4M7AD 4F04B 3CD6A 2ZPBB 5DM7R 1HK9A 1YBYA 1K9MR 2CS7A 1GCPA 2LCCA 3URGA 1YITQ 3PMIA 2VGMA 4Z88A 1YJNT 2CSIA 1UG1A 1K9MC 2FZKB 2ESWA 2VYTA 1I4K1 1QWEA 4C0ZA 2E6ZA 3VS7A 5KYXA 1SSFA 2K3BA 3LH5A 2AKLA 4A53A 1NEBA 4ANJA 1UGPB 1S1NA 1WHJA 2DL3A 4GY5A 1RAEB 1QLYA 4Q5WA 1VQPT 3M0UA 2OJ2A 1GFCA 2M51A 1VQ5A 4HVWA 1IRXA 2WSCE 5GANd 1QVGA 1W2BA 1VQOT 3CBMA 4IIOA 2EYYA 4C92D 2NUPA 3OYBA 4J8OA 4M78A 2VASA 1YJNA 1VQNT 2CH4W 3CC7Q 2O88A 1X43A 4C0DC 1VYVA 3TCJA 4AFZC 1X2QA 1XNIA 3QZ5B 2M02A 4HA8A 4RTXA 2NUTB 1WA7A 1G8XA 4X9DA 5HCKA 2RI5A 1J3TA 1PSEA 3SWNA 3CCVA 1W1FA 1ZLMA 4PJMA 3UATA 4WCIA 1Q7YR 3OYFA 1PHTA 4FL6A 4D8DA 2PNIA 1GCQA 1Q7YC 2QA4Q 4AG1C 2RF0A 3G7ZA 1UGRB 4OMOA 5KCOA 1D3BB 3MJXA 1VQNA 1D0XA 1WJRA 4BD3A 3PIOA 3I55A 1IHVA 1M8MA 1TTHB 4EPCA 2LCSA 1M1KU 3X24B 3M53A 3SDZA 2GFAA 3CCRQ 2YRCA 5LJ5d 2MWPA 1KQSA 2YWWA 2LRQA 2KBTA 2DX1A 4JJCA 4DEYA 3CCMA 1TUCA 3HTRA 2QEXQ 3QJ6A 4N4IA 4OMQA 1YJ9Q 3LWIA 4EMGA 3J80E 1PRMC 3JAME 3A8GB 1UE9A 1S72T 4LDWA 1KQSP 2JMAA 5C6SA 1MNDA 2HZYA 4JLGA 1KC8R 1AOJA 3C12A 1X6BA 3QDRB 1RI0A 5FWBA 4CC4B 1SKUB 3G1JA 7AT1B 2PUOB 1KC8C 2LVMA 1ABOA 1KQ1A 1TG0A 4DBRA 1BIAA 2DETA 1VQ5Q 3LLRA 3M9QA 2P0PA 2QQAA 4JDSA 2EGCA 1T0JA 4M7AG 4J83A 3A98A 5L23A 3DLLA 4PJOG 1QVFA 1PD0A 2E70A 3EGDB 3KXTA 4PJOE 8ATCB 1S72A 1OOTA 1Q95G 1NPPA 1JXOA 2QG9B 4M7AF 5FU6C 5KYUA 3GPLA 1KHCA 4F17A 2V8JA 2FPFA 5FU7B 1AT1B 4MDWA 1W70A 1Y71A 2ZPHB 5A2QE 1AWWA 2CZ0B 1E6GA 4J5YA 1MMNA 2JTMA 3TSZA 2FZCB 3LGFA 3JCMb 4BE2A 1WPYA 1SHFA 4PL6A 5J26A 3S6WA 2DMOA 2DJQA 2KSSA 2Y4YA 4M75G 1VQ8A 1M30A 1VQKT 4M75E 3WXMB 4C92G 1ZQ1A 4AFSC 2I2LA 4C92E 2EKOA 1ZSZA 1WDXA 4M78C 1MV3A 3OYDA 4K11A 2GF7A 2AKKA 2D8HA 2CZ1B 3KBGA 4J7IA 4C92F 3EG1A 1D1BA 2KRNA 2O9SA 3TU4K 4MMKA 2LT1A 3GBQA 2VB6A 2XD0A 2JVVA 2DEUA 2LZ6B 1IGUA 2BTTA 4M77B 5I21A 1MV0B 3CXCS 3DB3A 4EMKB 3SWNC 2G6FX 2EYXA 4C8QD 3FRNA 2QGGA 3H9NA 3S3NA 4XQ3A 2KRSA 2L8DA 3GP8A 1NE8A 3PVLA 4FSSA 2KQWA 4E47A 4F7UE 4JRQA 2EAYA 1KSWA 2C0IA 4B9XA 1GCQC 1M1KR 5HK3A 2EYWA 3OYCA 3QXEB 2QQBA 4OVAA 1VQLT 4CC3A 3G6EQ 1WIEA 3PIPA 3NGPA 3PVQA 1M1KC 2EQIA 4XU3A 4LD9K 1PNJA 2EKHA 3M0TA 1RAGB 2HNIA 4ESRA 3JRZA 1GBQA 1XTDA 3UWNA 2LQNA 2X3XD 3V7SA 1HJDA 2DXUA 3QWYA 5EC7A 1M3AA 2A36A 2X4WA 1R0CB 2P4TA 2RJCA 1RI9A 4C5GA 2EYQA 2MOXA 1M1FA 5CQXA 3CCST 3G4ST 1YJWA 1UHCA 1SEMA 3ULRB 1NJIU 4FM4B 3TQ7P 1BKBA 5AYFA 4XK8E 4DOWA 5D6XA 3JCMJ 2RQUA 1MMAA 4BUGA 2RJFA 3OYIA 2KNBB 2KT8A 2BKDN 1N8RU 5LJ3f 1VQ9A 3MKDA 2LX9A 3MEWA 2QYZA 2EGEA 2O4XB 3JCMh 3AHUA 4M7AA 4II1A 5CKDA 3OW2S 1X6OA 5GAMd 2CUDA 1MMGA 3FJPA 4A4KA 1Z9QA 1BI3A 2QAZA 2KY9A 2CT3A 3OBYA 2ZAEA 2I0NA 5I2MA 2FL7A 3LGLA 3OYAA 4IUTA 1LCKA 5A0DA 1YHQA 1X2KA 2WACA 3CCEA 2OTLA 2F2VA 3SHWA 4IKFA 1FYNA 1UB4A 3G71T 1RADB 3U23A 1KG1A 4C92A 3CMET 2EIFA 3HSBA 2KMTA 3VS6A 3T9NA 1ZX6A 4HCBA 2JNGA 3JB9I 3HHTB 2K5FA 4PJLA 2GBQA 3CCJQ 3OSSC 2ZGWA 1OYXA 2RNAA 4FYYB 2DBMA 5KYYA 1SHGA 5GAMf 1RAFB 2HCKA 3EG9A 2NUTA 3VS4A 5CQYA 4RKUE 1YITT 1H3HA 3H8ZA 4JRKA 2DKGA 2A28A 4E6RA 2FRYA 1Q86U 2FPDA 3G71A 3I56A 5L8RE 1UECA 4OMFB 5FW9A 3RMSA 4KUDK 1K4US 4C8QG 4KGZB 1G2BA 1W6XA 1Y57A 3M56A 1NYFA 3HRTA 4JRIA 4M78G 2YLBA 2PU9B 1VQ9Q 1A0NB 4HVUA 4M78E 3H0IA 3RKYA 3VJPA 4L6V5 4HKEA 3JCMQ 4C8QF 1NYGA 1BYMA 4PK4A 1RAAB 2JN0A 1U1TA 4M7DD 2FB7A 1CSKA 4ZGEB 3EG2A 3MO8A 2KYBA 4J7FA 3CCQA 3CC7T 2KAFA 1SG5A 3CPWA 2D1XA 2RHIA 3GLXA 2ZPEB 1M5Q1 4QVCA 4E7ZA 3EFOA 1NJIR 1UTIA 2NUZA 3CC2A 1NJIC 8AT1B 1N8RR 1Y96A 3EH2A 2D9TA 4C0GA 4DBQA 1MGQA 2F5TX 3CPWP 1N8RC 4OMNA 3JB9G 1FMWA 3GNGA 4N0AA 1AWXA 2QA4T 1TUGB 2XG8D 5IN1A 1VQ7Q 3VKIA 1JXMA 2DTHA 2KI7A 3SB2A 2VXEA 1OX9A 3BDLA 4M7AC 4JRPA 1UHFA 3CCLA 4C5HA 1WNLA 2EYZA 4PJOC 3A8OB 3CCRT 4PLIA 1YI2A 1SF9A 3UPUA 1IZ6A 1WZOA 4KH1B 1ABQA 2DRKA 3QHSA 4KGXB 3OA6A 2QEXT 3NMZC 4RMOA 1YJ9T 3ME9A 3CC4A 2PTKA 3J7AF 1VQ4Q 4PJJA 1VYTA 1CKAA 5KCHA 2FG0A 1RACB 4M75C 1MHNA 3DKMA 3RBBB 1IB8A 1PM3A 2RHYA 2BZ8A 4C92C 3QPHA 3CMAQ 2OTJA 1JJ2S 2R57A 1M27C 1HXDA 1M2VB 5GJVB 1TH7A 2RQRA 4V2SA 2RO0A 4C5EA 2DXCA 3OMGA 1IREB 5CKBA 5GAN4 2CDTA 2DYIA 3L2ZA 3OQ5A 2XI9A 2NWMA 4FIBA 1Q86R 3FB9A 3OB9A 5GAOn 1R0BG 2RHXA 2YUNA 3QYGB 1FMVA 5GANj 4EMKA 3CCUA 1UFFA 2BIVA 1Q86C 1UGVA 4C8QA 2DNUA 2L3PA 1H8KA 4RG8A 2L0AA 4ATOA 1EIFA 3MCAB 3AT1B 3C0CA 2M0YA 4A63B 2DL8A 1VQMQ 2VXFA 4QT7A 2YLCA 5GAOm 2DEQA 3CPFA 3VRYA 4Z8AA 5KE2A 5AT1B 1AZEA 1QVGP 1W2BP 1IGQA 5GANg 4ZTFA 3M0RA 4BY6C 1GFDA 1U3OA 1YIJQ 2DL5A 5ECAA 1O9SA 3OYGA 4JS5A 4M7DG 3X20B 3NTIA 4FT4A 3V7CA 2RA2A 4DOVA 4JLIA 5IHNA 1I0CA 1QP3A 1T0HA 2D0NA 1VQPA 2QK0A 1N9SA 1VQOA 1V1CA 1MMDA 2VWFA 2CP2A 3JB9J 4M7DF 1BB9A 2JJ9A 1UGQB 2RJEA 5I2SA 4F7UB 2E65A 5GANf 3L2VA 4C0DB 2GGRA 2C0OA 1PRLC 3L2WA 3CD6Q 3JCMW 2A0FB 5IHKA 3WVDB 2KT1A 4Y91A 2XICA 4N0AC 5J39A 3EHRA 4GLMA 2HL5C 5GJWB 3V8LA 4BI8B 3UA6A 2EPDA 4XAXB 1W2BS 3E2UA 1PWTA 2ED0A 3G6ET 3FEOA 2V8KA 2FPEA 1CKBA 4ZGDB 5LJ5g 4PLLA 4E2FB 3RNJA 4RUGA 2JS0A 1QVPA 2E12A 2H3JA 2Y4XA 5GAOl 3MEVA 2MAMA 1OPKA 2QASA 4JJDA 3JCMc 5A0GA 2GTJA 4ORZA 4HXJA 1YJNQ 3FDRA 2V1RA 1WHMA 2CP0A 3THKA 3VYHB 2X9HA 1WHGA 2JM9A 2VVKA 4M7AE 1D0ZA 4DBHA 5LJ5f 3N5BB 2J7IA 2FO0A 3CXCA 1TS9A 2DO3A 2X4JA 2DAQA 2EQMA 1DJ7B 2JW4A 4ELZC 4E7SA 4OMLA 1GBRA 3CCVQ 1K76A 2MIOA 1JB0E 3TSWA 1QVFP 4LD6A 2EJ9A 4KBMB 1WQ7A 3BW1A 2MPXC 2QDLA 4PFPA 1KQSS 2M9UA 3EHQA 2XIDA 3DB4A 2HEQA 4JPBW 3EG3A 1BK2A 2EVRA 2K5IA 1I5OB 4ZN3A 1PKTA 2F5KA 1VQNQ 2ENMA 3BY7A 1M4ZA 1R8OB 3VRZA 4UC4A 3I55Q 2YT6A 3MHXA 5KYWB 4C8QC 3OYKA 4LNPA 4JJNK 4GLKA 5FWCA 5CIUA 2J05A 1E7OA 1U06A 9ATCB 4HT9A 5GAOp 1I8FA 4M4ZA 4KRTA 5FU6B 1LOJA 4M7DA 3VS2A 1BI1A 1X27A 2GCXA 3CCMQ 2DD4A 3FLGA 2V26A 3EG0A 4XU0A 2K9GA 3VU3C 3H6ZA 5KYXB 2IVWA 4M77D 4WTOB 4KUIA 3UT1A 4BE0A 1YNZA 2DPPB 1SPKA 2J6KA 2ROTA 5LJ3j 3CCJT 1V29B 3RDVA 4BACA 2K2VA 1M1GA 1QKWA 1VQKA 1IHWA 1H641 4JS4A 1D0YA 4A4EA 2YDLA 1RAHB 4C5IA 2O01E 3QIIA 1D09B 4MZMA 3QZ9B 2K4YA 4RTWA 2E5QA 3EGUA 2DERA 2L2PA 2XU8A 1WQWA 2PUKB 5A0LA 1NG2A 1PD1A 2HKNA 4M78B 2L3RA 3M5AA 5LJ3g 1UUEA 4J6WA 4NL2A 1ZSGA 2GTOA 4A4GA 2MWOA 1C6VX 2CH4A 2DVEA 5GAN8 4IUQA 1M8VA 2DTOA 2X35A 2FYKA 2WSEE 1SRMA 3ZL7C 2DIQA 1OI1A 1S72Q 3PT9A 1BU1A 1VIEA 3KUFA 3CEYA 2X4YA 1TWBA 4PNOA 3OBWA 3SWNB 2K7AA 3UDCA 3A8HB 2YUPA 3SFMA 4BI4A 2B86A 4DEXA 1UEBA 2O2OA 1G3YA 4MMLA 1W4SA 1YCSB 3JCMX 3JCMe 2RH2A 2QI2A 1PSFA 5DLQE 1VQLA 1VQ8Q 3C94A 1AEYA 3GNFB 4BE1A 5D6WA 5DLOA 4C0FA 2OX7A 5I22A 4ZNXA 1PKSA 5GAMj 2E41A 5C0MA 3X28B 2LC4A 1K73U 1EX4A 2ZPIB 3GF5A 3M0SA 2L5QA 2OI3A 2MK5A 1OU9A 3V8JA 3RKXA 2DFUA 2JUFA 1RL2A 3CCSA 1G3WA 3OYMA 3G4SA 4ZGJB 3VUBA 2RI2A 2ATCB 1YWOA 2K3XA 4CRIA 1M2VA 2QQSA 3QJYA 3LYIA 4LN2A 5GAMg 1OX8A 1VQ7T 5GMKi 2J6FA 1BI2A 1XQHA 3ZFJA 1VQ6T 3L1AA 1C1AA 1NPRA 1WI7A 4NOYA 4GBQA 2V1QA 4QQDA 1HYOA 1MNEA 5D6YA 4XTXA 1AWOA 3MEAA 4E7LA 3S3MA 4BDYA 4J9IA 2FHDA 2EJFA 1OEBA 1QW1A 2LX7A 3I9QA 3VS0A 2DXBA 4OMMA 2KRMA 1ZHIA 4Z02A 1KFZA 2H3EB 2X4XA 2Z0WA 4ELYC 1K0SA 1ZSZC 1VQ4T 3MP6A 1AHJB 3M57A 3L42A 3A1PA 2QQRA 2P4RA 1M9SA 3HFNA 1LPLA 2ROLA 2B8AA 2HQHA 3REAB 5KYUB 4M7DC 1VQ6A 1YJWQ 1GXIE 5FRNA 1VA7A 2BZXA 1VOMA 1G3TA 1Q82U 3CMAT 2HBPA 3V7RA 2WSFE 3CMEA 2LNHB 2COZA 3QKJA 4RTUA 4AFQC 3JSCA 4KGVB 3VYGA 2DA9A 5J3BA 4C8QE 1D3BA 2OAUA 4RG2A 3HRUA 2CYZB 2YHTA 2CREA 2ZPGB 5LL6S 4M77F 3EAEA 3MPUB 3H0FA 3TREA 4RCBA 1IXDA 2DYBA 2HQXA 1KD1U 4L59A 1UJ0A 1WHKA 1B7TA 4FSXA 1YITA 2HDAA 3ZEHA 1BCMA 4XTYA 2DF6A 4F14A 2K5LA 1VQMT 2CUBA 5HKCA 2DZ9A 2KDSA 1MUZA 1ACMB 3OS5A 1X69A 5GANh 1IO6A 1ARKA 1YHQQ 3JCMd 1JEGA 4QVDA 1OQKA 2MI6A 4IIMA 4EDUA 4JZ3A 3CCEQ 1ZUKA 2E64A 4MDXA 2OTLQ 2FEIA 2E3IA 2J06A 2LQWA 4QQGA 2HQEA 1QCNA 2AZVA 2QXFA 3RIRA 3NFCA 1KIKA 1YP5A 5HY6A 1LJOA 1K73R 2BE9B 1WHHA 1NZ9A 2L89A 3P8HA 2QTVA 2ZCFB 1VYUA 1QKXA 4BDZA 2JTEA 5CCAA 2LNVA 4IUPA 1K73C 3CC7A 2LDMA 4LUEA 2V8IA 3EGDA 2L3QA 2RHUA 3NTHA 2D6FA 1R77A 1K9AA 3CD6T 4CC2A 4RTVA 2KXDA 1AZGB 2JTFA 4O6JA 2DL4A 4VUBA 1BIBA 3L2QA 1M3CA 2DVJA 1G5VA 2D0QB 4FYVB 2COYA 5KH6A 3G71Q 3I56Q 4J9EA 3R6NA 1ZA2B 4FT2A 2IIMA 2W0ZA 5LJ5h 1ZUUA 4OB0B 4J6YA 2QA4A 2LCLA 1B34B 2SRCA 2ZZDA 2E4HA 4MZPA 2DILA 2LTOA 4J9GA 1EZZB 4E7KA 1K8AU 4D8KA 4J9HA 3CPWS 3D7SB 3RUXA 4FU6A 4X1VA 4IUUA 2LJ3A 4M7AB 1VQ5T 5KE3A 3CCRA 4PJOB 2L3SA 4FW2A 4F16A 4PJOD 4L5GA 3RKWA 2EQKA 2ED1A 3QO3A 1WHLA 3C95A 3KFVA 4LUDA 2KEAA 2RM4A 4AFUC 1NM7A 1YFNA 2JMCA 3CCQQ 1M2OA 5GMKj 2FRWA 1OZ3A 2ABLA 2P0KA 2QEXA 1PG5B 3A8MB 4FYWB 1YJ9A 1Q82R 4M77A 1JQQA 3CC2Q 2RN8A 4YTLA 4HT8A 2R5AA 2ECZA 1Q82C 4RTYA 2J6OA 4LDUA 3CCVT 2QDYB 2IG0A 4LDXA 1X6GA 2OAWA 4QQ6A 4XU1A 3HPWA 4HVVA 4M75B 2NYSA 4M75D 5CKEA 1T3LA 1KHIA 1KD1R 4C92B 3PMTA 3A5ZB 2X3WD 5CO7A 3VS1A 2JOYA 4A4FA 1KD1C 1ZUYA 3GIBA 3P8DA 1OPLA 2JS2A 3I55T 3JB9H 3CCLQ 4HCKA 4M7DE 5GMKm 1N5ZA 4A4HA 2VUBA 5KYYB 2QTXA 4X9CA 3PTAA 2DXTA 4PJNA 2HKQB 2XMFA 4MZTA 2XKOC 3EG9B 2KROA 3O5ZA 5CKFA 1YI2Q 2DM1A 1JRIA 1NBEB 5IHIA 3SEMA 3RESA 3EH1A 2C06A 2KYMA 2LP5A 1AWJA 2XDPA 2O31A 2E3HA 3CCMT 4OF1A 3H41A 2GNCA 3E19A 1QCFA 4N4HA 4CI0C 3CC4Q 4A54A 5LJ5j 6AT1B 4PKCC 3OYLA 2EGAA 3MP8A 4FCYA 4N4GA 3V8KA 2M16A 2C0TA 2O4XA 4FYXB 4BY6B 1Y07A 3TEEA 1V76A 5LJ3e 4KULA 4EIKA 1Y7XA 4XU2A 4LXCA 1D1CA 4BB7A 2OTJQ 1QVGS 3MEUA 4QVZA 5IXFA 1NLPC 4ZTJA 4OB1B 3EFSA 4AG2C 4J9CA 5LJ3h 1BI0A 3WVEB 1I07A 3L2UA 4J6XA 2BZYA 2PZ1A 3CQTA 2COWA 4R0KA 2YSQA 3QYHB 4J9FA 1UGSB 2VKNA 1C0MA 5FROA 5IT9E 2RQTA 3EFOB 3A8LB 1P92A 5CKHA 1SRLA 2CKKA 3CCUQ 1UDLA 2K6DA 3ASKA 1TOVA 3M4YA 3F70A 4OGCA 5FU7C 4P5NA 1OU8A 1KJWA 2EW3A 2KGTA 1GL5A 2F2XA 4J9DA 1Y96B 1K8AR 2XK0A 1RABB 2AIRB 1KQ2A 3M55A 3VS5A 3UF4A 2K3YA 1K8AC 1K1ZA 5GMKl 3PFSA 3G6EA 2RPNA 2EJGA 2HD0A 3LW5E 3NHNA 1I5LA 2PVDB 1PC0A 1VQ8T 1E6HA 1LNXA 2EBPA 1JBMA 2F1LA 2FZGB 2MYSA 3QDFA 3QSUA 4BI3A 3FIFA 1VQPQ 2A3LA 2GQIA 4OGEA 5GAN6 5GAMe 3CXCP 4D6WA 1TXQA 1VQOQ 3M58A 3NTKA 3M54A 1WLPB 1Q81U 3M0PA 1GRIA 1VIFA 3VUZA 4PJOF 2QGFB 4E7HA 1WJQA 1H92A 3EGXB 3PE0A 3NPFA 5GAMh 3OMCA 4M77C 4EMKC 3UA7A 2YUOA 1G3SA 3LWHA 2KVQG 3OYJA 2BUDA 3BFMA 1EFNA 2HL3A 1VUBA 1M3BA 3H0HA 1Y0MA 4X34A 4J9BA 2HSPA 1O75A 2CT4A 3QBYA 1ZA1B 2HAXA 2BE7D 2KE9A 1TSFA 3OYHA 3TVTA 1XOVA 3C4SA 4M75F 3E9GA 2RJDA 1HD3A 2K2MA 1PCXA 3E1SA 3EFRA 3META 1YN8A 2PQWA 4IUVA 4KT0E 3HKSA 1QVFS 2E10A 1F1BB 1KK7A 4R55A 3OS1A 2JM8A 2YUQA 1OULA 2RB6A 3J81E 3OW2A 2R58A 3OS2A 4NL3A 1RLPC 3IQLA 4C8QB 3QG1A 3M0QA 2NUPB 1HSQA 1YJWT 5LJ3d 4F7UG 2W10A 3PGGA 4LDYA 4M78D 3FJ5A 4B6MA 2GQVA 3O8VA 2CZ7B 2JZ2A 5IXBA 3OYEA 3ZBDA 3OW2P 2M0OA 2ZPFB 4DA4A 2GFUA 4Y92A 2DTIA 2DIGA 1WXBA 4F7UF 1VQ9T 5HK0A 2HBWA 3CCJA 1RUWA 1AVZC 2A7YA 3OYYA 4XTZA 3JCMV 3RERA 1YCYA 3INZA 2RQVA 1UJYA 3MP1A 2D8JA 2DK3A 4AMCA 3LH0A 2QQ9A 1TUDA 2O9VA 1JU5C 1Z9ZA 1RAIB 4O5VA 3HP9A 4RTTA 2DRMA 2MMPA 4WF2A 2P84A 1FMKA 2YRVA 4OMPA 3LX7A 1YHQT 2DZCA 1LVKA 1B34A 2JT4A 3JB9D 1D1AA 5IAYA 3I35A 1WX6A 2VV5A 3CCET 1QMCA 1ZBXA 2OTLT 5IH2A 3CBPA 2DJZA 2CP6A 5FRMA 3S3OA 3OY9A 1N6AA 2DE0X 4PJOA 5CVIA 1BCOA 2NLUA 1XJWB 3ER0A 4PFZA 5M9OA 4R56A 3SD4A 1M90U 3BDUA 1Q81R 1FWZA 3JCMP 3RR6A 2RMOA 1VQKQ 1Q81C 2M1HA 3M59A 4HCZA 3E9FA 2LQKA 1NEGA 2CP5A 4QKUA 3X25B 2EQUA 3HL8A 2RQWA 3QUIA 1K0XA 1AD5A 1RLQC 2LQ8A 4Z89A 4ME7A 1QP2A 2P0QA 4HCCA 1FXXA 4M75A 1G83A 2AT1B 3I56T 1WJSA 5KYNA 4RTZA 2Y90A 2MF2A 4XTUA 1K9MU 3RMQA 5EG2A 2XDDA 4OB2B 4ZN1A 4OB3B 1VQ7A 1TU0B 2E1HA 1QQJA 1X01A 4LDVA 2EFIA 1B3QA 2E6NA 3CBOA 2CSQA 2G3RA 2KK4A 2CZ6B 2HMAA 1FX7A 2LJ1A 4M77G 1WFWA 2IPOB 2H8HA 5GAN2 4M77E 2DLPA 3OSVA 2XHCA 2RK1A 1I1JA 1VQLQ 3CCQT 2AHJB 2K79A 4Y28E 2YXYA 5FLXE 1OZ2A 3GOXA 4F7UA 2EWNA 1QWFA 2DD5A 5GMKe 3CC2T 5GAOq 1VQ4A 4IURA 3OS0A 4FW1A 2KR3A 2EQJA 3VV0A 5GANe 5I11A 1ZSZB 2A37A 2LJ0A 5GAN5 5GAOr 5GMKh 1X75C 3CCSQ 3G4SQ 3L2RA 3CMAA 2CP3A 4XTVA 2RHZA 2XDBA 4M7DB 2AZSA 4M78F 2K57A 1I81A 1T3SA 4OP0A 4JJBA 1NLOC 1YIJT 2DBKA 1U5SA 5CR2A 5GAN3 1WYXA 3VS3A 3P8BB 5GAN7 3CCLT 2PVGB 1Q7YU 2RD1A 2RK2A 4DQ2A 1YWPA 2LT4A 2VC8A 2AK5A 3REBB 4E7JA 1JJ2A 2F2WA 3PNWC 4KH0B 1YI2T 3JCMg 2KXCA 1WGSA 5DY9A 3QWXX 2JXBA 3R6OA 3HFOA 2MCNA 3Q1JA 4PFOA 4EMHA 1ZBJA 1VQMA 2F69A 2YRDA 3OYNA 3CC4T 3HRSA 1JJ2P 2HSEB 2CP7A 4LE9A 3I5RA
chains in the Genus database with same CATH topology
3E2UA 2CP3A 2E4HA 1WHJA 1WHHA 1TOVA 1IXDA 2QK0A 2HKQB 2M02A 2COZA 1WHKA 2Z0WA 1WHMA 2CP6A 2CP0A 2CP2A 1WHGA 2COYA 2COWA 2MPXC 2E3IA 2HKNA 2CP5A 3RDVA 2HL5C 1LPLA 1TXQA 3TQ7P 2E3HA 2HL3A 4B6MA 2HQHA 2CP7A 1WHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2U A;  2CP3 A;  2E4H A;  1WHJ A;  1WHH A;  1TOV A;  1IXD A;  2QK0 A;  2HKQ B;  2M02 A;  2COZ A;  1WHK A;  2Z0W A;  1WHM A;  2CP6 A;  2CP0 A;  2CP2 A;  1WHG A;  2COY A;  2COW A;  2MPX C;  2E3I A;  2HKN A;  2CP5 A;  3RDV A;  2HL5 C;  1LPL A;  1TXQ A;  3TQ7 P;  2E3H A;  2HL3 A;  4B6M A;  2HQH A;  2CP7 A;  1WHL A; 
#chains in the Genus database with same CATH topology
 3M4G A;  2RI3 A;  1U1S A;  4NS5 A;  5D7U A;  1OV3 A;  2SEM A;  5LJ5 e;  4QW2 A;  1YIJ A;  1BBZ A;  3JB9 F;  3I5S A;  4JUV A;  2R5M A;  4TVR A;  1H3Z A;  1M90 R;  4E7I A;  1VQ6 Q;  3JCM f;  5CAI A;  2OTJ T;  2X51 A;  1N9R A;  1SSH A;  2FVU A;  1M90 C;  4B9W A;  4DBF A;  3CME Q;  3BE3 A;  1B07 A;  5CK9 A;  2LMJ A;  3DLM A;  1N27 A;  1U8R A;  1KC8 U;  3X26 B;  4RCC A;  2PVO B;  2CGH A;  3JV3 A;  3EGX A;  2A08 A;  2E5K A;  2DL7 A;  4CC7 A;  4AT1 B;  1JO8 A;  4JZ4 A;  5KYW A;  1WXU A;  1QCO A;  4XTW A;  1WXT A;  2VGN A;  3CCU T;  3FC3 A;  4M7A D;  4F04 B;  3CD6 A;  2ZPB B;  5DM7 R;  1HK9 A;  1YBY A;  1K9M R;  2CS7 A;  1GCP A;  2LCC A;  3URG A;  1YIT Q;  3PMI A;  2VGM A;  4Z88 A;  1YJN T;  2CSI A;  1UG1 A;  1K9M C;  2FZK B;  2ESW A;  2VYT A;  1I4K 1;  1QWE A;  4C0Z A;  2E6Z A;  3VS7 A;  5KYX A;  1SSF A;  2K3B A;  3LH5 A;  2AKL A;  4A53 A;  1NEB A;  4ANJ A;  1UGP B;  1S1N A;  1WHJ A;  2DL3 A;  4GY5 A;  1RAE B;  1QLY A;  4Q5W A;  1VQP T;  3M0U A;  2OJ2 A;  1GFC A;  2M51 A;  1VQ5 A;  4HVW A;  1IRX A;  2WSC E;  5GAN d;  1QVG A;  1W2B A;  1VQO T;  3CBM A;  4IIO A;  2EYY A;  4C92 D;  2NUP A;  3OYB A;  4J8O A;  4M78 A;  2VAS A;  1YJN A;  1VQN T;  2CH4 W;  3CC7 Q;  2O88 A;  1X43 A;  4C0D C;  1VYV A;  3TCJ A;  4AFZ C;  1X2Q A;  1XNI A;  3QZ5 B;  2M02 A;  4HA8 A;  4RTX A;  2NUT B;  1WA7 A;  1G8X A;  4X9D A;  5HCK A;  2RI5 A;  1J3T A;  1PSE A;  3SWN A;  3CCV A;  1W1F A;  1ZLM A;  4PJM A;  3UAT A;  4WCI A;  1Q7Y R;  3OYF A;  1PHT A;  4FL6 A;  4D8D A;  2PNI A;  1GCQ A;  1Q7Y C;  2QA4 Q;  4AG1 C;  2RF0 A;  3G7Z A;  1UGR B;  4OMO A;  5KCO A;  1D3B B;  3MJX A;  1VQN A;  1D0X A;  1WJR A;  4BD3 A;  3PIO A;  3I55 A;  1IHV A;  1M8M A;  1TTH B;  4EPC A;  2LCS A;  1M1K U;  3X24 B;  3M53 A;  3SDZ A;  2GFA A;  3CCR Q;  2YRC A;  5LJ5 d;  2MWP A;  1KQS A;  2YWW A;  2LRQ A;  2KBT A;  2DX1 A;  4JJC A;  4DEY A;  3CCM A;  1TUC A;  3HTR A;  2QEX Q;  3QJ6 A;  4N4I A;  4OMQ A;  1YJ9 Q;  3LWI A;  4EMG A;  3J80 E;  1PRM C;  3JAM E;  3A8G B;  1UE9 A;  1S72 T;  4LDW A;  1KQS P;  2JMA A;  5C6S A;  1MND A;  2HZY A;  4JLG A;  1KC8 R;  1AOJ A;  3C12 A;  1X6B A;  3QDR B;  1RI0 A;  5FWB A;  4CC4 B;  1SKU B;  3G1J A;  7AT1 B;  2PUO B;  1KC8 C;  2LVM A;  1ABO A;  1KQ1 A;  1TG0 A;  4DBR A;  1BIA A;  2DET A;  1VQ5 Q;  3LLR A;  3M9Q A;  2P0P A;  2QQA A;  4JDS A;  2EGC A;  1T0J A;  4M7A G;  4J83 A;  3A98 A;  5L23 A;  3DLL A;  4PJO G;  1QVF A;  1PD0 A;  2E70 A;  3EGD B;  3KXT A;  4PJO E;  8ATC B;  1S72 A;  1OOT A;  1Q95 G;  1NPP A;  1JXO A;  2QG9 B;  4M7A F;  5FU6 C;  5KYU A;  3GPL A;  1KHC A;  4F17 A;  2V8J A;  2FPF A;  5FU7 B;  1AT1 B;  4MDW A;  1W70 A;  1Y71 A;  2ZPH B;  5A2Q E;  1AWW A;  2CZ0 B;  1E6G A;  4J5Y A;  1MMN A;  2JTM A;  3TSZ A;  2FZC B;  3LGF A;  3JCM b;  4BE2 A;  1WPY A;  1SHF A;  4PL6 A;  5J26 A;  3S6W A;  2DMO A;  2DJQ A;  2KSS A;  2Y4Y A;  4M75 G;  1VQ8 A;  1M30 A;  1VQK T;  4M75 E;  3WXM B;  4C92 G;  1ZQ1 A;  4AFS C;  2I2L A;  4C92 E;  2EKO A;  1ZSZ A;  1WDX A;  4M78 C;  1MV3 A;  3OYD A;  4K11 A;  2GF7 A;  2AKK A;  2D8H A;  2CZ1 B;  3KBG A;  4J7I A;  4C92 F;  3EG1 A;  1D1B A;  2KRN A;  2O9S A;  3TU4 K;  4MMK A;  2LT1 A;  3GBQ A;  2VB6 A;  2XD0 A;  2JVV A;  2DEU A;  2LZ6 B;  1IGU A;  2BTT A;  4M77 B;  5I21 A;  1MV0 B;  3CXC S;  3DB3 A;  4EMK B;  3SWN C;  2G6F X;  2EYX A;  4C8Q D;  3FRN A;  2QGG A;  3H9N A;  3S3N A;  4XQ3 A;  2KRS A;  2L8D A;  3GP8 A;  1NE8 A;  3PVL A;  4FSS A;  2KQW A;  4E47 A;  4F7U E;  4JRQ A;  2EAY A;  1KSW A;  2C0I A;  4B9X A;  1GCQ C;  1M1K R;  5HK3 A;  2EYW A;  3OYC A;  3QXE B;  2QQB A;  4OVA A;  1VQL T;  4CC3 A;  3G6E Q;  1WIE A;  3PIP A;  3NGP A;  3PVQ A;  1M1K C;  2EQI A;  4XU3 A;  4LD9 K;  1PNJ A;  2EKH A;  3M0T A;  1RAG B;  2HNI A;  4ESR A;  3JRZ A;  1GBQ A;  1XTD A;  3UWN A;  2LQN A;  2X3X D;  3V7S A;  1HJD A;  2DXU A;  3QWY A;  5EC7 A;  1M3A A;  2A36 A;  2X4W A;  1R0C B;  2P4T A;  2RJC A;  1RI9 A;  4C5G A;  2EYQ A;  2MOX A;  1M1F A;  5CQX A;  3CCS T;  3G4S T;  1YJW A;  1UHC A;  1SEM A;  3ULR B;  1NJI U;  4FM4 B;  3TQ7 P;  1BKB A;  5AYF A;  4XK8 E;  4DOW A;  5D6X A;  3JCM J;  2RQU A;  1MMA A;  4BUG A;  2RJF A;  3OYI A;  2KNB B;  2KT8 A;  2BKD N;  1N8R U;  5LJ3 f;  1VQ9 A;  3MKD A;  2LX9 A;  3MEW A;  2QYZ A;  2EGE A;  2O4X B;  3JCM h;  3AHU A;  4M7A A;  4II1 A;  5CKD A;  3OW2 S;  1X6O A;  5GAM d;  2CUD A;  1MMG A;  3FJP A;  4A4K A;  1Z9Q A;  1BI3 A;  2QAZ A;  2KY9 A;  2CT3 A;  3OBY A;  2ZAE A;  2I0N A;  5I2M A;  2FL7 A;  3LGL A;  3OYA A;  4IUT A;  1LCK A;  5A0D A;  1YHQ A;  1X2K A;  2WAC A;  3CCE A;  2OTL A;  2F2V A;  3SHW A;  4IKF A;  1FYN A;  1UB4 A;  3G71 T;  1RAD B;  3U23 A;  1KG1 A;  4C92 A;  3CME T;  2EIF A;  3HSB A;  2KMT A;  3VS6 A;  3T9N A;  1ZX6 A;  4HCB A;  2JNG A;  3JB9 I;  3HHT B;  2K5F A;  4PJL A;  2GBQ A;  3CCJ Q;  3OSS C;  2ZGW A;  1OYX A;  2RNA A;  4FYY B;  2DBM A;  5KYY A;  1SHG A;  5GAM f;  1RAF B;  2HCK A;  3EG9 A;  2NUT A;  3VS4 A;  5CQY A;  4RKU E;  1YIT T;  1H3H A;  3H8Z A;  4JRK A;  2DKG A;  2A28 A;  4E6R A;  2FRY A;  1Q86 U;  2FPD A;  3G71 A;  3I56 A;  5L8R E;  1UEC A;  4OMF B;  5FW9 A;  3RMS A;  4KUD K;  1K4U S;  4C8Q G;  4KGZ B;  1G2B A;  1W6X A;  1Y57 A;  3M56 A;  1NYF A;  3HRT A;  4JRI A;  4M78 G;  2YLB A;  2PU9 B;  1VQ9 Q;  1A0N B;  4HVU A;  4M78 E;  3H0I A;  3RKY A;  3VJP A;  4L6V 5;  4HKE A;  3JCM Q;  4C8Q F;  1NYG A;  1BYM A;  4PK4 A;  1RAA B;  2JN0 A;  1U1T A;  4M7D D;  2FB7 A;  1CSK A;  4ZGE B;  3EG2 A;  3MO8 A;  2KYB A;  4J7F A;  3CCQ A;  3CC7 T;  2KAF A;  1SG5 A;  3CPW A;  2D1X A;  2RHI A;  3GLX A;  2ZPE B;  1M5Q 1;  4QVC A;  4E7Z A;  3EFO A;  1NJI R;  1UTI A;  2NUZ A;  3CC2 A;  1NJI C;  8AT1 B;  1N8R R;  1Y96 A;  3EH2 A;  2D9T A;  4C0G A;  4DBQ A;  1MGQ A;  2F5T X;  3CPW P;  1N8R C;  4OMN A;  3JB9 G;  1FMW A;  3GNG A;  4N0A A;  1AWX A;  2QA4 T;  1TUG B;  2XG8 D;  5IN1 A;  1VQ7 Q;  3VKI A;  1JXM A;  2DTH A;  2KI7 A;  3SB2 A;  2VXE A;  1OX9 A;  3BDL A;  4M7A C;  4JRP A;  1UHF A;  3CCL A;  4C5H A;  1WNL A;  2EYZ A;  4PJO C;  3A8O B;  3CCR T;  4PLI A;  1YI2 A;  1SF9 A;  3UPU A;  1IZ6 A;  1WZO A;  4KH1 B;  1ABQ A;  2DRK A;  3QHS A;  4KGX B;  3OA6 A;  2QEX T;  3NMZ C;  4RMO A;  1YJ9 T;  3ME9 A;  3CC4 A;  2PTK A;  3J7A F;  1VQ4 Q;  4PJJ A;  1VYT A;  1CKA A;  5KCH A;  2FG0 A;  1RAC B;  4M75 C;  1MHN A;  3DKM A;  3RBB B;  1IB8 A;  1PM3 A;  2RHY A;  2BZ8 A;  4C92 C;  3QPH A;  3CMA Q;  2OTJ A;  1JJ2 S;  2R57 A;  1M27 C;  1HXD A;  1M2V B;  5GJV B;  1TH7 A;  2RQR A;  4V2S A;  2RO0 A;  4C5E A;  2DXC A;  3OMG A;  1IRE B;  5CKB A;  5GAN 4;  2CDT A;  2DYI A;  3L2Z A;  3OQ5 A;  2XI9 A;  2NWM A;  4FIB A;  1Q86 R;  3FB9 A;  3OB9 A;  5GAO n;  1R0B G;  2RHX A;  2YUN A;  3QYG B;  1FMV A;  5GAN j;  4EMK A;  3CCU A;  1UFF A;  2BIV A;  1Q86 C;  1UGV A;  4C8Q A;  2DNU A;  2L3P A;  1H8K A;  4RG8 A;  2L0A A;  4ATO A;  1EIF A;  3MCA B;  3AT1 B;  3C0C A;  2M0Y A;  4A63 B;  2DL8 A;  1VQM Q;  2VXF A;  4QT7 A;  2YLC A;  5GAO m;  2DEQ A;  3CPF A;  3VRY A;  4Z8A A;  5KE2 A;  5AT1 B;  1AZE A;  1QVG P;  1W2B P;  1IGQ A;  5GAN g;  4ZTF A;  3M0R A;  4BY6 C;  1GFD A;  1U3O A;  1YIJ Q;  2DL5 A;  5ECA A;  1O9S A;  3OYG A;  4JS5 A;  4M7D G;  3X20 B;  3NTI A;  4FT4 A;  3V7C A;  2RA2 A;  4DOV A;  4JLI A;  5IHN A;  1I0C A;  1QP3 A;  1T0H A;  2D0N A;  1VQP A;  2QK0 A;  1N9S A;  1VQO A;  1V1C A;  1MMD A;  2VWF A;  2CP2 A;  3JB9 J;  4M7D F;  1BB9 A;  2JJ9 A;  1UGQ B;  2RJE A;  5I2S A;  4F7U B;  2E65 A;  5GAN f;  3L2V A;  4C0D B;  2GGR A;  2C0O A;  1PRL C;  3L2W A;  3CD6 Q;  3JCM W;  2A0F B;  5IHK A;  3WVD B;  2KT1 A;  4Y91 A;  2XIC A;  4N0A C;  5J39 A;  3EHR A;  4GLM A;  2HL5 C;  5GJW B;  3V8L A;  4BI8 B;  3UA6 A;  2EPD A;  4XAX B;  1W2B S;  3E2U A;  1PWT A;  2ED0 A;  3G6E T;  3FEO A;  2V8K A;  2FPE A;  1CKB A;  4ZGD B;  5LJ5 g;  4PLL A;  4E2F B;  3RNJ A;  4RUG A;  2JS0 A;  1QVP A;  2E12 A;  2H3J A;  2Y4X A;  5GAO l;  3MEV A;  2MAM A;  1OPK A;  2QAS A;  4JJD A;  3JCM c;  5A0G A;  2GTJ A;  4ORZ A;  4HXJ A;  1YJN Q;  3FDR A;  2V1R A;  1WHM A;  2CP0 A;  3THK A;  3VYH B;  2X9H A;  1WHG A;  2JM9 A;  2VVK A;  4M7A E;  1D0Z A;  4DBH A;  5LJ5 f;  3N5B B;  2J7I A;  2FO0 A;  3CXC A;  1TS9 A;  2DO3 A;  2X4J A;  2DAQ A;  2EQM A;  1DJ7 B;  2JW4 A;  4ELZ C;  4E7S A;  4OML A;  1GBR A;  3CCV Q;  1K76 A;  2MIO A;  1JB0 E;  3TSW A;  1QVF P;  4LD6 A;  2EJ9 A;  4KBM B;  1WQ7 A;  3BW1 A;  2MPX C;  2QDL A;  4PFP A;  1KQS S;  2M9U A;  3EHQ A;  2XID A;  3DB4 A;  2HEQ A;  4JPB W;  3EG3 A;  1BK2 A;  2EVR A;  2K5I A;  1I5O B;  4ZN3 A;  1PKT A;  2F5K A;  1VQN Q;  2ENM A;  3BY7 A;  1M4Z A;  1R8O B;  3VRZ A;  4UC4 A;  3I55 Q;  2YT6 A;  3MHX A;  5KYW B;  4C8Q C;  3OYK A;  4LNP A;  4JJN K;  4GLK A;  5FWC A;  5CIU A;  2J05 A;  1E7O A;  1U06 A;  9ATC B;  4HT9 A;  5GAO p;  1I8F A;  4M4Z A;  4KRT A;  5FU6 B;  1LOJ A;  4M7D A;  3VS2 A;  1BI1 A;  1X27 A;  2GCX A;  3CCM Q;  2DD4 A;  3FLG A;  2V26 A;  3EG0 A;  4XU0 A;  2K9G A;  3VU3 C;  3H6Z A;  5KYX B;  2IVW A;  4M77 D;  4WTO B;  4KUI A;  3UT1 A;  4BE0 A;  1YNZ A;  2DPP B;  1SPK A;  2J6K A;  2ROT A;  5LJ3 j;  3CCJ T;  1V29 B;  3RDV A;  4BAC A;  2K2V A;  1M1G A;  1QKW A;  1VQK A;  1IHW A;  1H64 1;  4JS4 A;  1D0Y A;  4A4E A;  2YDL A;  1RAH B;  4C5I A;  2O01 E;  3QII A;  1D09 B;  4MZM A;  3QZ9 B;  2K4Y A;  4RTW A;  2E5Q A;  3EGU A;  2DER A;  2L2P A;  2XU8 A;  1WQW A;  2PUK B;  5A0L A;  1NG2 A;  1PD1 A;  2HKN A;  4M78 B;  2L3R A;  3M5A A;  5LJ3 g;  1UUE A;  4J6W A;  4NL2 A;  1ZSG A;  2GTO A;  4A4G A;  2MWO A;  1C6V X;  2CH4 A;  2DVE A;  5GAN 8;  4IUQ A;  1M8V A;  2DTO A;  2X35 A;  2FYK A;  2WSE E;  1SRM A;  3ZL7 C;  2DIQ A;  1OI1 A;  1S72 Q;  3PT9 A;  1BU1 A;  1VIE A;  3KUF A;  3CEY A;  2X4Y A;  1TWB A;  4PNO A;  3OBW A;  3SWN B;  2K7A A;  3UDC A;  3A8H B;  2YUP A;  3SFM A;  4BI4 A;  2B86 A;  4DEX A;  1UEB A;  2O2O A;  1G3Y A;  4MML A;  1W4S A;  1YCS B;  3JCM X;  3JCM e;  2RH2 A;  2QI2 A;  1PSF A;  5DLQ E;  1VQL A;  1VQ8 Q;  3C94 A;  1AEY A;  3GNF B;  4BE1 A;  5D6W A;  5DLO A;  4C0F A;  2OX7 A;  5I22 A;  4ZNX A;  1PKS A;  5GAM j;  2E41 A;  5C0M A;  3X28 B;  2LC4 A;  1K73 U;  1EX4 A;  2ZPI B;  3GF5 A;  3M0S A;  2L5Q A;  2OI3 A;  2MK5 A;  1OU9 A;  3V8J A;  3RKX A;  2DFU A;  2JUF A;  1RL2 A;  3CCS A;  1G3W A;  3OYM A;  3G4S A;  4ZGJ B;  3VUB A;  2RI2 A;  2ATC B;  1YWO A;  2K3X A;  4CRI A;  1M2V A;  2QQS A;  3QJY A;  3LYI A;  4LN2 A;  5GAM g;  1OX8 A;  1VQ7 T;  5GMK i;  2J6F A;  1BI2 A;  1XQH A;  3ZFJ A;  1VQ6 T;  3L1A A;  1C1A A;  1NPR A;  1WI7 A;  4NOY A;  4GBQ A;  2V1Q A;  4QQD A;  1HYO A;  1MNE A;  5D6Y A;  4XTX A;  1AWO A;  3MEA A;  4E7L A;  3S3M A;  4BDY A;  4J9I A;  2FHD A;  2EJF A;  1OEB A;  1QW1 A;  2LX7 A;  3I9Q A;  3VS0 A;  2DXB A;  4OMM A;  2KRM A;  1ZHI A;  4Z02 A;  1KFZ A;  2H3E B;  2X4X A;  2Z0W A;  4ELY C;  1K0S A;  1ZSZ C;  1VQ4 T;  3MP6 A;  1AHJ B;  3M57 A;  3L42 A;  3A1P A;  2QQR A;  2P4R A;  1M9S A;  3HFN A;  1LPL A;  2ROL A;  2B8A A;  2HQH A;  3REA B;  5KYU B;  4M7D C;  1VQ6 A;  1YJW Q;  1GXI E;  5FRN A;  1VA7 A;  2BZX A;  1VOM A;  1G3T A;  1Q82 U;  3CMA T;  2HBP A;  3V7R A;  2WSF E;  3CME A;  2LNH B;  2COZ A;  3QKJ A;  4RTU A;  4AFQ C;  3JSC A;  4KGV B;  3VYG A;  2DA9 A;  5J3B A;  4C8Q E;  1D3B A;  2OAU A;  4RG2 A;  3HRU A;  2CYZ B;  2YHT A;  2CRE A;  2ZPG B;  5LL6 S;  4M77 F;  3EAE A;  3MPU B;  3H0F A;  3TRE A;  4RCB A;  1IXD A;  2DYB A;  2HQX A;  1KD1 U;  4L59 A;  1UJ0 A;  1WHK A;  1B7T A;  4FSX A;  1YIT A;  2HDA A;  3ZEH A;  1BCM A;  4XTY A;  2DF6 A;  4F14 A;  2K5L A;  1VQM T;  2CUB A;  5HKC A;  2DZ9 A;  2KDS A;  1MUZ A;  1ACM B;  3OS5 A;  1X69 A;  5GAN h;  1IO6 A;  1ARK A;  1YHQ Q;  3JCM d;  1JEG A;  4QVD A;  1OQK A;  2MI6 A;  4IIM A;  4EDU A;  4JZ3 A;  3CCE Q;  1ZUK A;  2E64 A;  4MDX A;  2OTL Q;  2FEI A;  2E3I A;  2J06 A;  2LQW A;  4QQG A;  2HQE A;  1QCN A;  2AZV A;  2QXF A;  3RIR A;  3NFC A;  1KIK A;  1YP5 A;  5HY6 A;  1LJO A;  1K73 R;  2BE9 B;  1WHH A;  1NZ9 A;  2L89 A;  3P8H A;  2QTV A;  2ZCF B;  1VYU A;  1QKX A;  4BDZ A;  2JTE A;  5CCA A;  2LNV A;  4IUP A;  1K73 C;  3CC7 A;  2LDM A;  4LUE A;  2V8I A;  3EGD A;  2L3Q A;  2RHU A;  3NTH A;  2D6F A;  1R77 A;  1K9A A;  3CD6 T;  4CC2 A;  4RTV A;  2KXD A;  1AZG B;  2JTF A;  4O6J A;  2DL4 A;  4VUB A;  1BIB A;  3L2Q A;  1M3C A;  2DVJ A;  1G5V A;  2D0Q B;  4FYV B;  2COY A;  5KH6 A;  3G71 Q;  3I56 Q;  4J9E A;  3R6N A;  1ZA2 B;  4FT2 A;  2IIM A;  2W0Z A;  5LJ5 h;  1ZUU A;  4OB0 B;  4J6Y A;  2QA4 A;  2LCL A;  1B34 B;  2SRC A;  2ZZD A;  2E4H A;  4MZP A;  2DIL A;  2LTO A;  4J9G A;  1EZZ B;  4E7K A;  1K8A U;  4D8K A;  4J9H A;  3CPW S;  3D7S B;  3RUX A;  4FU6 A;  4X1V A;  4IUU A;  2LJ3 A;  4M7A B;  1VQ5 T;  5KE3 A;  3CCR A;  4PJO B;  2L3S A;  4FW2 A;  4F16 A;  4PJO D;  4L5G A;  3RKW A;  2EQK A;  2ED1 A;  3QO3 A;  1WHL A;  3C95 A;  3KFV A;  4LUD A;  2KEA A;  2RM4 A;  4AFU C;  1NM7 A;  1YFN A;  2JMC A;  3CCQ Q;  1M2O A;  5GMK j;  2FRW A;  1OZ3 A;  2ABL A;  2P0K A;  2QEX A;  1PG5 B;  3A8M B;  4FYW B;  1YJ9 A;  1Q82 R;  4M77 A;  1JQQ A;  3CC2 Q;  2RN8 A;  4YTL A;  4HT8 A;  2R5A A;  2ECZ A;  1Q82 C;  4RTY A;  2J6O A;  4LDU A;  3CCV T;  2QDY B;  2IG0 A;  4LDX A;  1X6G A;  2OAW A;  4QQ6 A;  4XU1 A;  3HPW A;  4HVV A;  4M75 B;  2NYS A;  4M75 D;  5CKE A;  1T3L A;  1KHI A;  1KD1 R;  4C92 B;  3PMT A;  3A5Z B;  2X3W D;  5CO7 A;  3VS1 A;  2JOY A;  4A4F A;  1KD1 C;  1ZUY A;  3GIB A;  3P8D A;  1OPL A;  2JS2 A;  3I55 T;  3JB9 H;  3CCL Q;  4HCK A;  4M7D E;  5GMK m;  1N5Z A;  4A4H A;  2VUB A;  5KYY B;  2QTX A;  4X9C A;  3PTA A;  2DXT A;  4PJN A;  2HKQ B;  2XMF A;  4MZT A;  2XKO C;  3EG9 B;  2KRO A;  3O5Z A;  5CKF A;  1YI2 Q;  2DM1 A;  1JRI A;  1NBE B;  5IHI A;  3SEM A;  3RES A;  3EH1 A;  2C06 A;  2KYM A;  2LP5 A;  1AWJ A;  2XDP A;  2O31 A;  2E3H A;  3CCM T;  4OF1 A;  3H41 A;  2GNC A;  3E19 A;  1QCF A;  4N4H A;  4CI0 C;  3CC4 Q;  4A54 A;  5LJ5 j;  6AT1 B;  4PKC C;  3OYL A;  2EGA A;  3MP8 A;  4FCY A;  4N4G A;  3V8K A;  2M16 A;  2C0T A;  2O4X A;  4FYX B;  4BY6 B;  1Y07 A;  3TEE A;  1V76 A;  5LJ3 e;  4KUL A;  4EIK A;  1Y7X A;  4XU2 A;  4LXC A;  1D1C A;  4BB7 A;  2OTJ Q;  1QVG S;  3MEU A;  4QVZ A;  5IXF A;  1NLP C;  4ZTJ A;  4OB1 B;  3EFS A;  4AG2 C;  4J9C A;  5LJ3 h;  1BI0 A;  3WVE B;  1I07 A;  3L2U A;  4J6X A;  2BZY A;  2PZ1 A;  3CQT A;  2COW A;  4R0K A;  2YSQ A;  3QYH B;  4J9F A;  1UGS B;  2VKN A;  1C0M A;  5FRO A;  5IT9 E;  2RQT A;  3EFO B;  3A8L B;  1P92 A;  5CKH A;  1SRL A;  2CKK A;  3CCU Q;  1UDL A;  2K6D A;  3ASK A;  1TOV A;  3M4Y A;  3F70 A;  4OGC A;  5FU7 C;  4P5N A;  1OU8 A;  1KJW A;  2EW3 A;  2KGT A;  1GL5 A;  2F2X A;  4J9D A;  1Y96 B;  1K8A R;  2XK0 A;  1RAB B;  2AIR B;  1KQ2 A;  3M55 A;  3VS5 A;  3UF4 A;  2K3Y A;  1K8A C;  1K1Z A;  5GMK l;  3PFS A;  3G6E A;  2RPN A;  2EJG A;  2HD0 A;  3LW5 E;  3NHN A;  1I5L A;  2PVD B;  1PC0 A;  1VQ8 T;  1E6H A;  1LNX A;  2EBP A;  1JBM A;  2F1L A;  2FZG B;  2MYS A;  3QDF A;  3QSU A;  4BI3 A;  3FIF A;  1VQP Q;  2A3L A;  2GQI A;  4OGE A;  5GAN 6;  5GAM e;  3CXC P;  4D6W A;  1TXQ A;  1VQO Q;  3M58 A;  3NTK A;  3M54 A;  1WLP B;  1Q81 U;  3M0P A;  1GRI A;  1VIF A;  3VUZ A;  4PJO F;  2QGF B;  4E7H A;  1WJQ A;  1H92 A;  3EGX B;  3PE0 A;  3NPF A;  5GAM h;  3OMC A;  4M77 C;  4EMK C;  3UA7 A;  2YUO A;  1G3S A;  3LWH A;  2KVQ G;  3OYJ A;  2BUD A;  3BFM A;  1EFN A;  2HL3 A;  1VUB A;  1M3B A;  3H0H A;  1Y0M A;  4X34 A;  4J9B A;  2HSP A;  1O75 A;  2CT4 A;  3QBY A;  1ZA1 B;  2HAX A;  2BE7 D;  2KE9 A;  1TSF A;  3OYH A;  3TVT A;  1XOV A;  3C4S A;  4M75 F;  3E9G A;  2RJD A;  1HD3 A;  2K2M A;  1PCX A;  3E1S A;  3EFR A;  3MET A;  1YN8 A;  2PQW A;  4IUV A;  4KT0 E;  3HKS A;  1QVF S;  2E10 A;  1F1B B;  1KK7 A;  4R55 A;  3OS1 A;  2JM8 A;  2YUQ A;  1OUL A;  2RB6 A;  3J81 E;  3OW2 A;  2R58 A;  3OS2 A;  4NL3 A;  1RLP C;  3IQL A;  4C8Q B;  3QG1 A;  3M0Q A;  2NUP B;  1HSQ A;  1YJW T;  5LJ3 d;  4F7U G;  2W10 A;  3PGG A;  4LDY A;  4M78 D;  3FJ5 A;  4B6M A;  2GQV A;  3O8V A;  2CZ7 B;  2JZ2 A;  5IXB A;  3OYE A;  3ZBD A;  3OW2 P;  2M0O A;  2ZPF B;  4DA4 A;  2GFU A;  4Y92 A;  2DTI A;  2DIG A;  1WXB A;  4F7U F;  1VQ9 T;  5HK0 A;  2HBW A;  3CCJ A;  1RUW A;  1AVZ C;  2A7Y A;  3OYY A;  4XTZ A;  3JCM V;  3RER A;  1YCY A;  3INZ A;  2RQV A;  1UJY A;  3MP1 A;  2D8J A;  2DK3 A;  4AMC A;  3LH0 A;  2QQ9 A;  1TUD A;  2O9V A;  1JU5 C;  1Z9Z A;  1RAI B;  4O5V A;  3HP9 A;  4RTT A;  2DRM A;  2MMP A;  4WF2 A;  2P84 A;  1FMK A;  2YRV A;  4OMP A;  3LX7 A;  1YHQ T;  2DZC A;  1LVK A;  1B34 A;  2JT4 A;  3JB9 D;  1D1A A;  5IAY A;  3I35 A;  1WX6 A;  2VV5 A;  3CCE T;  1QMC A;  1ZBX A;  2OTL T;  5IH2 A;  3CBP A;  2DJZ A;  2CP6 A;  5FRM A;  3S3O A;  3OY9 A;  1N6A A;  2DE0 X;  4PJO A;  5CVI A;  1BCO A;  2NLU A;  1XJW B;  3ER0 A;  4PFZ A;  5M9O A;  4R56 A;  3SD4 A;  1M90 U;  3BDU A;  1Q81 R;  1FWZ A;  3JCM P;  3RR6 A;  2RMO A;  1VQK Q;  1Q81 C;  2M1H A;  3M59 A;  4HCZ A;  3E9F A;  2LQK A;  1NEG A;  2CP5 A;  4QKU A;  3X25 B;  2EQU A;  3HL8 A;  2RQW A;  3QUI A;  1K0X A;  1AD5 A;  1RLQ C;  2LQ8 A;  4Z89 A;  4ME7 A;  1QP2 A;  2P0Q A;  4HCC A;  1FXX A;  4M75 A;  1G83 A;  2AT1 B;  3I56 T;  1WJS A;  5KYN A;  4RTZ A;  2Y90 A;  2MF2 A;  4XTU A;  1K9M U;  3RMQ A;  5EG2 A;  2XDD A;  4OB2 B;  4ZN1 A;  4OB3 B;  1VQ7 A;  1TU0 B;  2E1H A;  1QQJ A;  1X01 A;  4LDV A;  2EFI A;  1B3Q A;  2E6N A;  3CBO A;  2CSQ A;  2G3R A;  2KK4 A;  2CZ6 B;  2HMA A;  1FX7 A;  2LJ1 A;  4M77 G;  1WFW A;  2IPO B;  2H8H A;  5GAN 2;  4M77 E;  2DLP A;  3OSV A;  2XHC A;  2RK1 A;  1I1J A;  1VQL Q;  3CCQ T;  2AHJ B;  2K79 A;  4Y28 E;  2YXY A;  5FLX E;  1OZ2 A;  3GOX A;  4F7U A;  2EWN A;  1QWF A;  2DD5 A;  5GMK e;  3CC2 T;  5GAO q;  1VQ4 A;  4IUR A;  3OS0 A;  4FW1 A;  2KR3 A;  2EQJ A;  3VV0 A;  5GAN e;  5I11 A;  1ZSZ B;  2A37 A;  2LJ0 A;  5GAN 5;  5GAO r;  5GMK h;  1X75 C;  3CCS Q;  3G4S Q;  3L2R A;  3CMA A;  2CP3 A;  4XTV A;  2RHZ A;  2XDB A;  4M7D B;  2AZS A;  4M78 F;  2K57 A;  1I81 A;  1T3S A;  4OP0 A;  4JJB A;  1NLO C;  1YIJ T;  2DBK A;  1U5S A;  5CR2 A;  5GAN 3;  1WYX A;  3VS3 A;  3P8B B;  5GAN 7;  3CCL T;  2PVG B;  1Q7Y U;  2RD1 A;  2RK2 A;  4DQ2 A;  1YWP A;  2LT4 A;  2VC8 A;  2AK5 A;  3REB B;  4E7J A;  1JJ2 A;  2F2W A;  3PNW C;  4KH0 B;  1YI2 T;  3JCM g;  2KXC A;  1WGS A;  5DY9 A;  3QWX X;  2JXB A;  3R6O A;  3HFO A;  2MCN A;  3Q1J A;  4PFO A;  4EMH A;  1ZBJ A;  1VQM A;  2F69 A;  2YRD A;  3OYN A;  3CC4 T;  3HRS A;  1JJ2 P;  2HSE B;  2CP7 A;  4LE9 A;  3I5R A; 
#chains in the Genus database with same CATH homology
 3E2U A;  2CP3 A;  2E4H A;  1WHJ A;  1WHH A;  1TOV A;  1IXD A;  2QK0 A;  2HKQ B;  2M02 A;  2COZ A;  1WHK A;  2Z0W A;  1WHM A;  2CP6 A;  2CP0 A;  2CP2 A;  1WHG A;  2COY A;  2COW A;  2MPX C;  2E3I A;  2HKN A;  2CP5 A;  3RDV A;  2HL5 C;  1LPL A;  1TXQ A;  3TQ7 P;  2E3H A;  2HL3 A;  4B6M A;  2HQH A;  2CP7 A;  1WHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...