1TOVA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
b'NESDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein F53F4.3 in chromosome V
publication title Crystal Structure of the Cytoskeleton-Associated Protein Glycine-Rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1tovA00
2HL5C 2HL3A 2CP0A 3RDVA 1WHLA 3TQ7P 1WHHA 2E3IA 2Z0WA 2CP5A 2QK0A 2MPXC 1TOVA 1WHGA 2COZA 2E3HA 2E4HA 1WHMA 2HKNA 2CP6A 1LPLA 1WHJA 4B6MA 2CP3A 2M02A 1TXQA 2COWA 2HKQB 1WHKA 2CP7A 2HQHA 2COYA 1IXDA 2CP2A 3E2UA
chains in the Genus database with same CATH superfamily
1I1JA 2QEXQ 5CKBA 2BUDA 3JCMe 3CCRQ 5HY6A 1Y71A 1MNDA 3JRZA 1O9SA 3GNFB 1K8AU 3OA6A 4IURA 3CCQA 5GMKi 3VRZA 3E9GA 4C5IA 3G4SQ 2VGNA 5FU6C 2C06A 2VGMA 1KD1C 4PJOG 3VS7A 3M54A 1G3SA 1GCQA 3REBB 4J9EA 2K5LA 5A0DA 1PKSA 3I55Q 3CXCS 2JJ9A 5J26A 1HXDA 2CSQA 3VS2A 2CP3A 4DEXA 2DL5A 2ED1A 4YTLA 1NJIC 5I11A 4M78B 2HL3A 2VVKA 2ZPIB 2HQXA 2RQWA 1M5Q1 3VS1A 3QKJA 4QQ6A 1UDLA 1M9SA 3QIIA 3QJYA 2RHIA 5AYFA 2NUPA 1KJWA 2D0NA 1CKBA 4RCBA 2DFUA 3QDRB 3I56A 3CCQQ 2E64A 1RUWA 2I2LA 2EYWA 1OX8A 1GL5A 2KVQG 2XKOC 5GANg 2RD1A 4X1VA 2PTKA 2V1RA 4ORZA 3VS3A 3G71A 3QG1A 5LJ5e 4M7DF 1W2BP 1WHMA 2GNCA 2IPOB 1G3WA 2E12A 4ZTJA 3CEYA 2YLCA 4M77G 2A36A 3PIPA 2D9TA 3VYHB 4A54A 1YIJA 4NL3A 3P8BB 1K8AR 1UGVA 1M1KU 4C8QG 2K3BA 3PGGA 1WYXA 4M75F 1VQPT 2RM4A 3PT9A 1M4ZA 2RHYA 1PCXA 1KQ2A 1Y0MA 4Y91A 2AT1B 3JB9F 3MKDA 5KYWA 2J6FA 1M1FA 1M90C 2M1HA 1VQ7T 4D8DA 2ED0A 5GAN4 1OPLA 2R5MA 2KT8A 4PJLA 3REAB 2HSEB 3I56Q 3OYLA 4M7DE 2V8KA 4RG8A 3L2QA 1VQ8T 1S72A 1LPLA 3SD4A 2NUTA 3OYBA 2VUBA 1WJSA 5I2SA 1Q86C 3CCEA 4KT0E 2LJ3A 3QDFA 3EH1A 1C0MA 2FRWA 3OYGA 1BI2A 2D8HA 2NUPB 3ME9A 4KH1B 2RI3A 2F2WA 2JNGA 2IIMA 1YJNA 2LC4A 3TVTA 3OS5A 2F2XA 1K73R 2H3EB 5ECAA 3VS4A 1YIJQ 3M4GA 4F7UE 4M7DA 2CDTA 3QZ9B 1VQLT 4FL6A 2D1XA 1VUBA 2C0IA 1VIEA 3QXEB 3SB2A 2PUOB 2VYTA 3KXTA 1KC8C 3OMGA 4C0DB 2WACA 1WHGA 2DJZA 2P4RA 4BDZA 2QXFA 2CH4A 2BZ8A 1M8MA 4DEYA 1LJOA 1PSFA 4N4IA 4NOYA 4ZTFA 3S3NA 1UGQB 2FRYA 1V1CA 4RCCA 1PRLC 1TTHB 1FWZA 1S72Q 3EG0A 3PNWC 2HAXA 2HZYA 4BE1A 2H3JA 5GAOm 4QVZA 4F7UA 4FSXA 1K1ZA 5KYWB 4OB0B 1M1KR 4FYWB 2DXTA 3EGXB 2F2VA 4AT1B 4B9WA 3V7CA 1RI9A 4M7AD 2QAZA 4HA8A 4LDUA 3G6EA 3JAME 1U06A 1D3BB 2E65A 1X6OA 2GF7A 4KGXB 1YJNQ 4A63B 3E9FA 4CC7A 2JM9A 2V1QA 2QEXT 4AG2C 3LH5A 2BKDN 2NUTB 2GGRA 2LX9A 1Q82U 1N6AA 2E70A 4PFOA 4J9GA 3GPLA 2YLBA 1KHIA 1VIFA 3CPWA 1N5ZA 2COWA 3G4ST 2QQAA 4LN2A 4XTVA 4FU6A 1X6GA 3EH2A 4EIKA 4E7JA 1SRMA 3UPUA 4DOVA 2BIVA 2VXEA 3A8LB 3HHTB 1R0BG 4J9IA 1VQNA 3J7AF 4E7HA 3E19A 1YITA 3QZ5B 3FB9A 4AFZC 3NFCA 2RA2A 5HK3A 2EKOA 4RG2A 5CR2A 3CD6A 1VQ9A 4DA4A 4M75G 3L1AA 3JB9J 1QKWA 1PM3A 1PKTA 1PSEA 1VOMA 3JB9G 2LCSA 4C5HA 3EGDB 1QVFP 4HCKA 2E3IA 2DL3A 3GLXA 1GBQA 1TUGB 5EG2A 1GFDA 3CCMA 4BB7A 7AT1B 5CKEA 4RKUE 4GLMA 2LCLA 2L3RA 4XU2A 3CC2Q 2JW4A 4F7UB 2HDAA 3CCQT 1VYVA 3QUIA 1T0JA 3CPWS 1YP5A 4ZGDB 4XU3A 3MP8A 1VQOA 3HP9A 1K8AC 1NPRA 2EJ9A 2Z0WA 2KROA 2KXDA 4JUVA 2LX7A 1QW1A 2K3YA 4XU0A 2DTOA 5LJ3g 4NS5A 1VQNQ 1SSHA 3LGFA 1U8RA 3EFSA 1ZA1B 4IUUA 1QMCA 1VQMA 1VQ4A 2COYA 2CZ6B 3M4YA 5KCOA 3N5BB 1FMVA 2E41A 3OYFA 1YFNA 1TS9A 5J3BA 1VQ9Q 2XICA 4JPBW 1Q82R 1WQ7A 1D1CA 4E2FB 1NG2A 2BZYA 4FCYA 4GBQA 2RB6A 3JV3A 2DEQA 3JCMW 2DA9A 4ME7A 1Q95G 3I56T 4PJNA 3QYGB 3AT1B 3O8VA 1AHJB 3DKMA 1OQKA 3CC4A 5GMKh 1WNLA 3LGLA 2RPNA 3VJPA 2ZPBB 1VQOQ 2AZVA 2KQWA 3G71T 1UGSB 3TEEA 3L2UA 2JMCA 1QQJA 1MV0B 2OAUA 3CBMA 2EYXA 1UECA 4UC4A 2R58A 4ANJA 3V8JA 4BI8B 2OI3A 1B3QA 2SEMA 2EIFA 1RL2A 2G3RA 1VQMQ 2MPXC 2F5TX 1RABB 1TG0A 3GF5A 1NBEB 2SRCA 3CCSA 3M58A 3H41A 1YIJT 4O5VA 4N4HA 2EFIA 4A4EA 4C92E 3C4SA 3OQ5A 1HYOA 1M30A 1TWBA 4M78F 2ZPGB 1M1KC 3TSZA 3MEUA 2FZKB 1KG1A 2LTOA 1ZBXA 2R5AA 3J81E 3CBPA 1LCKA 5CKFA 3BFMA 3DB4A 1WXBA 4L59A 4C92C 4N0AA 2LT1A 3HRTA 3CC4Q 2KEAA 2K4YA 1S72T 3CC7A 1I4K1 4DQ2A 2Y4XA 2RH2A 4LD6A 2LQNA 1GXIE 4FIBA 3LH0A 3MEAA 2RK1A 3CCET 4LUDA 2EVRA 2VXFA 2LNHB 2XIDA 1WFWA 2O88A 2ABLA 3ER0A 5KYYA 3OBWA 3M0PA 5CO7A 2AHJB 3EFOB 5GMKj 2EGCA 2GBQA 1YJNT 3CCSQ 2JM8A 5AT1B 1BIAA 4OMMA 1I8FA 3JCMg 1AWOA 2B86A 5A0LA 1D1BA 1BIBA 4JRQA 3CCJQ 2O9VA 3M55A 2XD0A 2QA4A 2M16A 4BY6C 2LJ0A 4FYXB 3EGUA 3CCRA 3C94A 5GAOn 2HQHA 3A1PA 4OGEA 2ZPHB 1BB9A 2RQUA 1B7TA 3HPWA 2QI2A 1B34B 4LDXA 1WIEA 2Y4YA 2EQKA 2J7IA 2AK5A 2E1HA 3CC7Q 2DVJA 5GANh 2PQWA 1BKBA 1OZ3A 3NTHA 1AD5A 1NZ9A 3NGPA 2PVGB 4C5GA 1R0CB 1K76A 3I55A 1D1AA 3G6ET 1W2BA 4FT2A 1AVZC 2EPDA 4C0GA 5GANd 3M56A 4C5EA 1OPKA 4CC4B 2X4YA 1T0HA 3OS1A 6AT1B 4Z89A 2EAYA 3MO8A 4C92B 1X01A 4KUDK 2QA4Q 3X26B 1Q82C 4XK8E 3KFVA 2KR3A 3NTKA 1G83A 2P0KA 1AZEA 2LJ1A 5KYYB 1KQ1A 1WQWA 2KK4A 3PFSA 2DTHA 4OVAA 5D7UA 5KCHA 1LNXA 2FPFA 1WXUA 4F17A 4IUTA 5GANf 4DBQA 1VQNT 5GJWB 2HKQB 3L2ZA 1X43A 1YITT 5D6WA 3JCMX 4HVUA 3ZL7C 2ROLA 2DL8A 4PJJA 3JCMQ 3CD6T 2CGHA 3SDZA 1VQ9T 3PE0A 1KHCA 2C0OA 2FZCB 1HK9A 4MZPA 1W2BS 4C8QC 2CP6A 4M78G 3RIRA 4KBMB 5GMKe 4PJOD 4OB1B 3CCMT 2BE9B 5GANj 1I5OB 3MJXA 1HSQA 3CCVQ 1K4US 3PVQA 5FU7B 4J9DA 3HKSA 3TQ7P 2I0NA 4QVCA 2RNAA 2QK0A 3BDLA 2OTLA 5FRNA 5FW9A 4QT7A 1VQOT 3M0QA 9ATCB 4QQDA 1IGQA 2ZZDA 1K73U 1AZGB 4E6RA 4KH0B 3EHRA 1VQKQ 3JCMb 4JRPA 1N9SA 4OP0A 3I5RA 3JCMP 4HT8A 1UTIA 1A0NB 5D6XA 1XOVA 2RJCA 3OW2P 1VQ4T 1VQMT 2DBMA 1VA7A 1SHFA 1X2KA 3OYEA 1MMGA 2LVMA 3O5ZA 4C0ZA 1N27A 4HKEA 3MEWA 1ZA2B 4BE2A 2AKKA 4JDSA 1U5SA 4RTYA 3HFNA 2KRMA 3LX7A 3QO3A 1BCMA 1IHVA 2CSIA 4Z88A 4TVRA 5GAOp 5D6YA 4M7AE 1BU1A 1KQSA 1JJ2P 1QKXA 3H0IA 4M77D 2PVOB 2PVDB 1OU9A 1WI7A 4B6MA 3MP1A 3V7RA 2O2OA 3CC4T 2DYIA 2OTLQ 2EW3A 1Q7YR 3EGXA 4F7UF 2E6NA 4M7AC 3KBGA 2YRCA 1WPYA 5M9OA 5CIUA 4C8QD 3D7SB 3E1SA 4AFQC 2XDBA 1D3BA 3UA7A 2FYKA 4RTTA 5FU6B 4FM4B 2QGFB 3META 3IQLA 2YHTA 1XQHA 3NMZC 2OTJA 4M7AA 2QQSA 2DVEA 1PC0A 2EYQA 2M0YA 3CCST 3SFMA 5IN1A 4R55A 1FXXA 1SF9A 2W10A 2QDLA 5L8RE 3CMAQ 1OI1A 3TCJA 5FLXE 3OYIA 2RQVA 2X51A 2KNBB 4XU1A 5CQXA 4OMFB 3MHXA 4IKFA 5KYXB 1KQSS 2VASA 1W70A 4PFPA 4BACA 2QYZA 1YJWQ 2RQRA 4OF1A 5GANe 1QVFA 1KIKA 3PIOA 3NHNA 2J05A 2NWMA 2KT1A 3HTRA 1Y96B 2JT4A 2BTTA 4R0KA 2RMOA 1MMDA 1J3TA 2MAMA 4QVDA 3CC7T 2HEQA 2DNUA 1ZBJA 3EGDA 4BI3A 1YHQQ 2LRQA 1Y7XA 4M75C 1D0YA 4XQ3A 2OTJQ 5LJ3h 1VYTA 1PWTA 2HCKA 4PNOA 1S1NA 1O75A 1AWJA 3RNJA 2X3WD 2FG0A 2LZ6B 3OYMA 2J6OA 4BD3A 3GOXA 1I81A 3QSUA 3L2WA 2RHZA 1WZOA 2RJFA 2DE0X 5IH2A 1QVGP 1KQSP 3C0CA 4F14A 1MNEA 2EGAA 5LJ3d 5GAN6 2L2PA 4O6JA 1QCOA 2HSPA 2QA4T 1TH7A 5DM7R 4DOWA 1WHHA 3CCRT 1QVFS 2QTVA 2LP5A 3EG2A 4M7AB 4ELYC 3CC2A 3OYYA 4ZNXA 3OYNA 1LOJA 1CKAA 1SSFA 2PZ1A 4M7DG 3NTIA 4QKUA 2DLPA 3P8HA 2YT6A 1AWWA 3JCMV 3J80E 5LJ3f 1Z9ZA 1QWFA 5IXBA 4E7ZA 4CRIA 2O01E 5KH6A 2DXCA 3I55T 2CT3A 5CVIA 4M7DD 1VQ5A 1RAFB 1N8RU 2E5QA 3TSWA 3X24B 3HRUA 4HCZA 4Z8AA 2XK0A 3OYAA 3VKIA 1SRLA 1OU8A 4J6YA 3H0HA 1AWXA 1K0SA 4F7UG 1YNZA 2O9SA 1TSFA 3A8OB 5LJ3j 3MCAB 4LUEA 4M75D 4OMNA 3OMCA 1Y07A 2MWOA 4EPCA 3JB9D 2DTIA 2FZGB 3QBYA 1RACB 5GAN5 2HBWA 5CKHA 3SWNC 2K2VA 2EGEA 2QG9B 4A4KA 5GJVB 2NUZA 3FJPA 3A98A 2XDDA 2H8HA 1KFZA 2L3SA 2MYSA 1OX9A 1U1TA 2O4XB 2JZ2A 1QCFA 1SPKA 2M51A 4MMLA 2V26A 3M5AA 2XU8A 5CQYA 3H6ZA 1BCOA 2X9HA 4D8KA 4WCIA 1VQ5Q 5HK0A 1GRIA 4A4GA 4JRIA 3LWHA 5HCKA 3RMSA 1UGPB 1TOVA 2XMFA 2DJQA 2E10A 1MGQA 2DRMA 2KGTA 4PLIA 1E6GA 2EJFA 4DBHA 3JCMh 1PNJA 3S6WA 2OTLT 5GAMd 2HNIA 3MPUB 2KRSA 2D8JA 2YWWA 5DY9A 1PRMC 4NL2A 4C92F 2EWNA 2KI7A 1ZSZC 3EFOA 4X9CA 2GFUA 3RKWA 3BY7A 3JCMd 4IIOA 5GAN2 1YI2A 1K73C 4XAXB 2EYZA 1AEYA 3VUBA 4GY5A 2X4JA 4JLGA 1IZ6A 1N8RR 1ARKA 3RR6A 2JTFA 4RTUA 3GNGA 3UDCA 1R77A 1M2VA 1Q81U 1M27C 2F1LA 3R6NA 4R56A 4EDUA 5LL6S 4CI0C 5A2QE 2X4WA 5KE3A 2OAWA 2OJ2A 1BBZA 1YJ9Q 5FWCA 3G1JA 1B34A 2FEIA 3EAEA 4LDVA 4HVVA 4J8OA 5A0GA 2EKHA 4LDYA 4OB3B 2KRNA 2WSCE 3DLMA 5IAYA 2CS7A 3CCJA 5GAOq 2GQIA 2ZGWA 5LJ3e 3ASKA 2K7AA 2M02A 4Y28E 4A53A 1M8VA 3VRYA 2L0AA 2YUOA 5CK9A 1YI2Q 4Z02A 2DRKA 3QYHB 1QLYA 3E2UA 2PNIA 2OTJT 1NYGA 1UHFA 1V76A 2XG8D 2DKGA 2PUKB 5C6SA 2YXYA 4ESRA 1WLPB 4X34A 4C92A 2JTMA 3A8GB 4OMPA 4BDYA 3CQTA 3PMIA 1RLPC 5LJ5d 5GAMg 2G6FX 4Y92A 1UHCA 2DK3A 2DBKA 3RDVA 1RADB 4ATOA 5GAN7 1EFNA 5IHNA 1F1BB 4QW2A 3INZA 1RLQC 5KE2A 2KMTA 1BI3A 2AKLA 2D0QB 4HVWA 4PJOE 1VQ8Q 2FHDA 1M2VB 2V8IA 4E47A 2DZ9A 2LMJA 1RAHB 3ZFJA 2JUFA 5FRMA 2EJGA 1E7OA 2DD5A 2X35A 1W1FA 4A4HA 1Q81R 1M90R 2P0PA 1I5LA 1KK7A 4PJOC 1D09B 5CKDA 3U23A 2A7YA 3FLGA 4CC3A 2FPEA 3L42A 2DETA 1QCNA 1X2QA 2X3XD 1CSKA 3HL8A 5FROA 2HBPA 1VQLQ 2CYZB 3BDUA 3OB9A 1M3AA 1RAEB 3OW2A 4PJOA 1Q86R 3UA6A 1JQQA 3P8DA 3M0RA 2ZPFB 1R8OB 2GQVA 2PU9B 2X4XA 3T9NA 3V7SA 1UGRB 4OMOA 2CZ1B 1EZZB 4P5NA 2JOYA 4V2SA 3LLRA 4IUPA 3CCVA 3S3OA 3UATA 1ACMB 4CC2A 3CC2T 3NPFA 2VKNA 1ABQA 1WXTA 2CP2A 1X27A 3EG3A 1JJ2A 1WHLA 3BW1A 2DO3A 5GAN8 4MZMA 4M77E 2RHUA 3EG9B 3OYKA 1KC8R 4N4GA 3QHSA 1VQKA 2K9GA 4ZN1A 3FRNA 5LJ5g 2JTEA 5I21A 3VU3C 5DLOA 4C8QE 2V8JA 4M77C 3I9QA 1U1SA 2EBPA 4HXJA 1VQ5T 1Q7YU 8AT1B 2JVVA 3FEOA 3GP8A 3OW2S 3FIFA 5IXFA 3R6OA 1GCQC 1EX4A 1N8RC 3A5ZB 5I22A 4J6WA 4JRKA 2EQUA 4J5YA 4WTOB 4M77A 3JCMJ 3SEMA 2KXCA 2LNVA 3C95A 3DLLA 2HD0A 2F5KA 2A28A 2QGGA 3M9QA 1GCPA 3PMTA 5KYNA 4BY6B 3HRSA 1WGSA 1K0XA 4M78D 4QQGA 3Q1JA 2EQIA 4C8QA 3GIBA 2JMAA 4F04B 2NLUA 1JJ2S 2RJDA 4JJCA 2CH4W 2P0QA 4HT9A 2J6KA 3OYJA 4M7AF 2B8AA 4PJOB 1JXOA 2J06A 1YCYA 4PK4A 2QQBA 3JB9I 1JRIA 3VYGA 4OGCA 1KSWA 1M1GA 4MDXA 4LE9A 3I5SA 1ZUKA 4K11A 1WHKA 1UJ0A 2DZCA 4KGVB 4EMKC 4FW1A 2QASA 3VV0A 4FYVB 5KYXA 2RI5A 1G3YA 2RQTA 3GBQA 1ZLMA 1B07A 1UG1A 4KULA 1Y96A 2DXBA 1WDXA 2CKKA 1YJ9T 2JXBA 1UJYA 4PLLA 3WVEB 2XDPA 3EHQA 4EMKA 4PJMA 4C0DC 2A0FB 4RUGA 1VQ6A 3CMAA 1WJRA 1ZX6A 2ZCFB 1YBYA 1K9MU 2MMPA 1I0CA 4RTXA 1NLPC 1GFCA 2MIOA 2BZXA 2FB7A 3PTAA 1QVGA 1P92A 2JS0A 4L5GA 1HJDA 2EYYA 1M3BA 1NM7A 3CXCP 1YJWA 1I07A 4EMHA 1DJ7B 5C0MA 2YRDA 4D6WA 3RMQA 4BE0A 1Y57A 2LT4A 1YI2T 2ECZA 3QWYA 2CZ0B 4J7FA 2BE7D 3M53A 4LDWA 1FMWA 3UT1A 4JS5A 3JB9H 4M77B 1IHWA 3CMEA 4A4FA 3QJ6A 3URGA 3CCLA 3EG1A 1YHQA 3EFRA 1H8KA 2KSSA 2Y90A 4AG1C 3G7ZA 4II1A 2DPPB 1Q81C 3VS5A 5GMKl 2DERA 4C8QB 3VS0A 1GBRA 2MOXA 1C1AA 2HQEA 1JXMA 1VQ6Q 3CCUA 1RAGB 1FX7A 3G71Q 3CCJT 2LDMA 1WJQA 3OYCA 1QVGS 2NYSA 2R57A 3X20B 1JB0E 1NLOC 2DL7A 4M7DC 2ROTA 2HL5C 1N9RA 3JCMc 3RUXA 1G3TA 1H641 1M2OA 2RO0A 1NEBA 4M75E 4J6XA 4EMKB 2VV5A 1D0ZA 2CUBA 1JO8A 1UFFA 4JZ4A 1X69A 3CMEQ 2YUPA 3FDRA 3CCLQ 1TUCA 5GAOr 2L5QA 1BK2A 1RI0A 2P84A 1G8XA 1K9MR 3L2RA 1YN8A 2MK5A 1WA7A 5DLQE 4JZ3A 4M4ZA 4PKCC 3CBOA 2GCXA 1YWOA 2K5FA 2AZSA 3UF4A 4JS4A 1U3OA 2KBTA 2DX1A 1QP2A 4M75A 2A08A 1NEGA 2O4XA 3CCUQ 3ZBDA 4OMQA 3OS2A 4M7AG 1UB4A 2OX7A 3VS6A 3V8LA 4XTUA 4JJDA 4LXCA 1EIFA 5KYUA 3CCEQ 4AFUC 1IRXA 3VUZA 4XTZA 2LCCA 2JN0A 3AHUA 4J9BA 1RAAB 5L23A 2K3XA 2FVUA 1XJWB 1SHGA 3WXMB 1H92A 4BUGA 4B9XA 2DEUA 4C0FA 4AMCA 2GTOA 4AFSC 2DD4A 2COZA 1ZQ1A 4LD9K 3THKA 2L89A 3FJ5A 1W6XA 3OYHA 3MP6A 2K6DA 3OSSC 4XTWA 4RMOA 3RESA 2L3PA 1QP3A 1UUEA 1JBMA 4E7KA 3WVDB 3CCVT 3M57A 3CPFA 3MEVA 3QPHA 8ATCB 4FT4A 4M7DB 2ZPEB 1KD1U 4FYYB 1RAIB 2DIQA 3F70A 2RN8A 3SHWA 1PG5B 1ZSGA 3RKXA 4KRTA 3OS0A 4E7IA 2L8DA 4E7LA 2VWFA 5HKCA 2DIGA 2MWPA 1VQKT 1IXDA 1FYNA 3A8MB 3M59A 3G6EQ 2K5IA 4VUBA 5IHKA 4IUVA 2E6ZA 1NJIU 1IB8A 2YSQA 4JJBA 1NE8A 2MCNA 1BI0A 4ZN3A 2CUDA 4M75B 4PFZA 1T3SA 1FMKA 4IUQA 3SWNA 5CCAA 1Q7YC 5KYUB 2RF0A 1K9AA 4OMLA 3UWNA 4HCBA 3PVLA 2CZ7B 5GAMh 3OYDA 3M0SA 2FO0A 1YJ9A 1MHNA 1JU5C 4X9DA 2QTXA 4MZTA 2KYMA 2GFAA 2P4TA 2KE9A 1TXQA 4KGZB 2RJEA 1Z9QA 3OBYA 1YITQ 2CP7A 4J7IA 2ZAEA 4ZGEB 4ZGJB 2CP0A 1ZUUA 3OSVA 2AIRB 3CD6Q 3H9NA 3KUFA 2DYBA 3TU4K 2O31A 1T3LA 2JS2A 1NYFA 1IGUA 2MI6A 5GAOl 2KY9A 2QDYB 2ATCB 1D0XA 1MUZA 1IO6A 3CCMQ 3X25B 1H3ZA 3I35A 3CPWP 1M90U 3A8HB 5IT9E 4HCCA 1VQPA 1ZSZA 1C6VX 5J39A 1MMNA 1KD1R 2QQRA 5GAMf 3H8ZA 1AT1B 2K79A 4OB2B 1NPPA 2KDSA 1VQ6T 3RKYA 3CMAT 3M0TA 1VQ7A 2K2MA 1WX6A 2L3QA 3ZEHA 1PHTA 2YDLA 1MV3A 2E5KA 4BI4A 3M0UA 4MDWA 1K9MC 2DMOA 3JCMf 3LYIA 1YJWT 1X6BA 1Q86U 1VQ8A 1NJIR 5FWBA 1BI1A 1VQ4Q 3SWNB 1MMAA 1SEMA 2E3HA 2M9UA 3C12A 2WSFE 5GAMj 1YCSB 3TREA 3CMET 4PJOF 3CCLT 1YHQT 4N0AC 2MF2A 2YUNA 2KYBA 3V8KA 1OULA 3HSBA 2DM1A 2FL7A 3HFOA 5LJ5h 4FW2A 1UE9A 1TUDA 1E6HA 4FSSA 2W0ZA 1OYXA 5CAIA 4ELZC 1V29B 2DXUA 1VQLA 1KC8U 1VQPQ 3L2VA 1SG5A 1XTDA 2RK2A 3LWIA 4E7SA 2YRVA 1WHJA 3EG9A 3CCUT 1H3HA 1VQ7Q 4GLKA 3QWXX 2KAFA 2ESWA 1UEBA 1BYMA 4Q5WA 4RTVA 4J9HA 1VYUA 2CP5A 2RHXA 1IREB 2IVWA 1X75C 2E4HA 3BE3A 4XTXA 1ZSZB 1SKUB 1YWPA 2DL4A 2IG0A 4M78E 1PD0A 4RTZA 2EQMA 4F16A 4L6V5 5LJ5f 4J9CA 2F69A 2YUQA 2M0OA 3JSCA 2VB6A 3S3MA 1HD3A 3DB3A 4M77F 1OV3A 1OZ2A 3RERA 1M3CA 2QQ9A 5I2MA 4J83A 4DBRA 3ULRB 3FC3A 4M78C 2QEXA 1QVPA 2ENMA 5FU7C 2XI9A 4MMKA 2RI2A 2LQKA 1W4SA 2DAQA 4J9FA 4C8QF 2HMAA 2VC8A 4RTWA 4DBFA 2LQ8A 3G4SA 1G5VA 2DILA 3RBBB 4M78A 4WF2A 5LJ5j 4JJNK 1OEBA 2XHCA 1LVKA 5IHIA 2DF6A 1TU0B 4IIMA 4KUIA 3H0FA 1ZHIA 1XNIA 4C92G 2CREA 4EMGA 2D6FA 1AOJA 4LNPA 5EC7A 3X28B 4PL6A 1G2BA 1ABOA 2LQWA 1JEGA 2EQJA 4JLIA 3CXCA 5GAN3 4C92D 2WSEE 3LW5E 2K57A 2HKNA 1PD1A 5GAMe 2FPDA 5GMKm 1OOTA 2A37A 2GTJA 2C0TA 1QWEA 2A3LA 4XTYA 3OY9A 1ZUYA 2CT4A
chains in the Genus database with same CATH topology
2HL5C 2HL3A 2CP0A 3RDVA 1WHLA 3TQ7P 1WHHA 2E3IA 2Z0WA 2CP5A 2QK0A 2MPXC 1TOVA 1WHGA 2COZA 2E3HA 2E4HA 1WHMA 2HKNA 2CP6A 1LPLA 1WHJA 4B6MA 2CP3A 2M02A 1TXQA 2COWA 2HKQB 1WHKA 2CP7A 2HQHA 2COYA 1IXDA 2CP2A 3E2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL5 C;  2HL3 A;  2CP0 A;  3RDV A;  1WHL A;  3TQ7 P;  1WHH A;  2E3I A;  2Z0W A;  2CP5 A;  2QK0 A;  2MPX C;  1TOV A;  1WHG A;  2COZ A;  2E3H A;  2E4H A;  1WHM A;  2HKN A;  2CP6 A;  1LPL A;  1WHJ A;  4B6M A;  2CP3 A;  2M02 A;  1TXQ A;  2COW A;  2HKQ B;  1WHK A;  2CP7 A;  2HQH A;  2COY A;  1IXD A;  2CP2 A;  3E2U A; 
#chains in the Genus database with same CATH topology
 1I1J A;  2QEX Q;  5CKB A;  2BUD A;  3JCM e;  3CCR Q;  5HY6 A;  1Y71 A;  1MND A;  3JRZ A;  1O9S A;  3GNF B;  1K8A U;  3OA6 A;  4IUR A;  3CCQ A;  5GMK i;  3VRZ A;  3E9G A;  4C5I A;  3G4S Q;  2VGN A;  5FU6 C;  2C06 A;  2VGM A;  1KD1 C;  4PJO G;  3VS7 A;  3M54 A;  1G3S A;  1GCQ A;  3REB B;  4J9E A;  2K5L A;  5A0D A;  1PKS A;  3I55 Q;  3CXC S;  2JJ9 A;  5J26 A;  1HXD A;  2CSQ A;  3VS2 A;  2CP3 A;  4DEX A;  2DL5 A;  2ED1 A;  4YTL A;  1NJI C;  5I11 A;  4M78 B;  2HL3 A;  2VVK A;  2ZPI B;  2HQX A;  2RQW A;  1M5Q 1;  3VS1 A;  3QKJ A;  4QQ6 A;  1UDL A;  1M9S A;  3QII A;  3QJY A;  2RHI A;  5AYF A;  2NUP A;  1KJW A;  2D0N A;  1CKB A;  4RCB A;  2DFU A;  3QDR B;  3I56 A;  3CCQ Q;  2E64 A;  1RUW A;  2I2L A;  2EYW A;  1OX8 A;  1GL5 A;  2KVQ G;  2XKO C;  5GAN g;  2RD1 A;  4X1V A;  2PTK A;  2V1R A;  4ORZ A;  3VS3 A;  3G71 A;  3QG1 A;  5LJ5 e;  4M7D F;  1W2B P;  1WHM A;  2GNC A;  2IPO B;  1G3W A;  2E12 A;  4ZTJ A;  3CEY A;  2YLC A;  4M77 G;  2A36 A;  3PIP A;  2D9T A;  3VYH B;  4A54 A;  1YIJ A;  4NL3 A;  3P8B B;  1K8A R;  1UGV A;  1M1K U;  4C8Q G;  2K3B A;  3PGG A;  1WYX A;  4M75 F;  1VQP T;  2RM4 A;  3PT9 A;  1M4Z A;  2RHY A;  1PCX A;  1KQ2 A;  1Y0M A;  4Y91 A;  2AT1 B;  3JB9 F;  3MKD A;  5KYW A;  2J6F A;  1M1F A;  1M90 C;  2M1H A;  1VQ7 T;  4D8D A;  2ED0 A;  5GAN 4;  1OPL A;  2R5M A;  2KT8 A;  4PJL A;  3REA B;  2HSE B;  3I56 Q;  3OYL A;  4M7D E;  2V8K A;  4RG8 A;  3L2Q A;  1VQ8 T;  1S72 A;  1LPL A;  3SD4 A;  2NUT A;  3OYB A;  2VUB A;  1WJS A;  5I2S A;  1Q86 C;  3CCE A;  4KT0 E;  2LJ3 A;  3QDF A;  3EH1 A;  1C0M A;  2FRW A;  3OYG A;  1BI2 A;  2D8H A;  2NUP B;  3ME9 A;  4KH1 B;  2RI3 A;  2F2W A;  2JNG A;  2IIM A;  1YJN A;  2LC4 A;  3TVT A;  3OS5 A;  2F2X A;  1K73 R;  2H3E B;  5ECA A;  3VS4 A;  1YIJ Q;  3M4G A;  4F7U E;  4M7D A;  2CDT A;  3QZ9 B;  1VQL T;  4FL6 A;  2D1X A;  1VUB A;  2C0I A;  1VIE A;  3QXE B;  3SB2 A;  2PUO B;  2VYT A;  3KXT A;  1KC8 C;  3OMG A;  4C0D B;  2WAC A;  1WHG A;  2DJZ A;  2P4R A;  4BDZ A;  2QXF A;  2CH4 A;  2BZ8 A;  1M8M A;  4DEY A;  1LJO A;  1PSF A;  4N4I A;  4NOY A;  4ZTF A;  3S3N A;  1UGQ B;  2FRY A;  1V1C A;  4RCC A;  1PRL C;  1TTH B;  1FWZ A;  1S72 Q;  3EG0 A;  3PNW C;  2HAX A;  2HZY A;  4BE1 A;  2H3J A;  5GAO m;  4QVZ A;  4F7U A;  4FSX A;  1K1Z A;  5KYW B;  4OB0 B;  1M1K R;  4FYW B;  2DXT A;  3EGX B;  2F2V A;  4AT1 B;  4B9W A;  3V7C A;  1RI9 A;  4M7A D;  2QAZ A;  4HA8 A;  4LDU A;  3G6E A;  3JAM E;  1U06 A;  1D3B B;  2E65 A;  1X6O A;  2GF7 A;  4KGX B;  1YJN Q;  4A63 B;  3E9F A;  4CC7 A;  2JM9 A;  2V1Q A;  2QEX T;  4AG2 C;  3LH5 A;  2BKD N;  2NUT B;  2GGR A;  2LX9 A;  1Q82 U;  1N6A A;  2E70 A;  4PFO A;  4J9G A;  3GPL A;  2YLB A;  1KHI A;  1VIF A;  3CPW A;  1N5Z A;  2COW A;  3G4S T;  2QQA A;  4LN2 A;  4XTV A;  4FU6 A;  1X6G A;  3EH2 A;  4EIK A;  4E7J A;  1SRM A;  3UPU A;  4DOV A;  2BIV A;  2VXE A;  3A8L B;  3HHT B;  1R0B G;  4J9I A;  1VQN A;  3J7A F;  4E7H A;  3E19 A;  1YIT A;  3QZ5 B;  3FB9 A;  4AFZ C;  3NFC A;  2RA2 A;  5HK3 A;  2EKO A;  4RG2 A;  5CR2 A;  3CD6 A;  1VQ9 A;  4DA4 A;  4M75 G;  3L1A A;  3JB9 J;  1QKW A;  1PM3 A;  1PKT A;  1PSE A;  1VOM A;  3JB9 G;  2LCS A;  4C5H A;  3EGD B;  1QVF P;  4HCK A;  2E3I A;  2DL3 A;  3GLX A;  1GBQ A;  1TUG B;  5EG2 A;  1GFD A;  3CCM A;  4BB7 A;  7AT1 B;  5CKE A;  4RKU E;  4GLM A;  2LCL A;  2L3R A;  4XU2 A;  3CC2 Q;  2JW4 A;  4F7U B;  2HDA A;  3CCQ T;  1VYV A;  3QUI A;  1T0J A;  3CPW S;  1YP5 A;  4ZGD B;  4XU3 A;  3MP8 A;  1VQO A;  3HP9 A;  1K8A C;  1NPR A;  2EJ9 A;  2Z0W A;  2KRO A;  2KXD A;  4JUV A;  2LX7 A;  1QW1 A;  2K3Y A;  4XU0 A;  2DTO A;  5LJ3 g;  4NS5 A;  1VQN Q;  1SSH A;  3LGF A;  1U8R A;  3EFS A;  1ZA1 B;  4IUU A;  1QMC A;  1VQM A;  1VQ4 A;  2COY A;  2CZ6 B;  3M4Y A;  5KCO A;  3N5B B;  1FMV A;  2E41 A;  3OYF A;  1YFN A;  1TS9 A;  5J3B A;  1VQ9 Q;  2XIC A;  4JPB W;  1Q82 R;  1WQ7 A;  1D1C A;  4E2F B;  1NG2 A;  2BZY A;  4FCY A;  4GBQ A;  2RB6 A;  3JV3 A;  2DEQ A;  3JCM W;  2DA9 A;  4ME7 A;  1Q95 G;  3I56 T;  4PJN A;  3QYG B;  3AT1 B;  3O8V A;  1AHJ B;  3DKM A;  1OQK A;  3CC4 A;  5GMK h;  1WNL A;  3LGL A;  2RPN A;  3VJP A;  2ZPB B;  1VQO Q;  2AZV A;  2KQW A;  3G71 T;  1UGS B;  3TEE A;  3L2U A;  2JMC A;  1QQJ A;  1MV0 B;  2OAU A;  3CBM A;  2EYX A;  1UEC A;  4UC4 A;  2R58 A;  4ANJ A;  3V8J A;  4BI8 B;  2OI3 A;  1B3Q A;  2SEM A;  2EIF A;  1RL2 A;  2G3R A;  1VQM Q;  2MPX C;  2F5T X;  1RAB B;  1TG0 A;  3GF5 A;  1NBE B;  2SRC A;  3CCS A;  3M58 A;  3H41 A;  1YIJ T;  4O5V A;  4N4H A;  2EFI A;  4A4E A;  4C92 E;  3C4S A;  3OQ5 A;  1HYO A;  1M30 A;  1TWB A;  4M78 F;  2ZPG B;  1M1K C;  3TSZ A;  3MEU A;  2FZK B;  1KG1 A;  2LTO A;  1ZBX A;  2R5A A;  3J81 E;  3CBP A;  1LCK A;  5CKF A;  3BFM A;  3DB4 A;  1WXB A;  4L59 A;  4C92 C;  4N0A A;  2LT1 A;  3HRT A;  3CC4 Q;  2KEA A;  2K4Y A;  1S72 T;  3CC7 A;  1I4K 1;  4DQ2 A;  2Y4X A;  2RH2 A;  4LD6 A;  2LQN A;  1GXI E;  4FIB A;  3LH0 A;  3MEA A;  2RK1 A;  3CCE T;  4LUD A;  2EVR A;  2VXF A;  2LNH B;  2XID A;  1WFW A;  2O88 A;  2ABL A;  3ER0 A;  5KYY A;  3OBW A;  3M0P A;  5CO7 A;  2AHJ B;  3EFO B;  5GMK j;  2EGC A;  2GBQ A;  1YJN T;  3CCS Q;  2JM8 A;  5AT1 B;  1BIA A;  4OMM A;  1I8F A;  3JCM g;  1AWO A;  2B86 A;  5A0L A;  1D1B A;  1BIB A;  4JRQ A;  3CCJ Q;  2O9V A;  3M55 A;  2XD0 A;  2QA4 A;  2M16 A;  4BY6 C;  2LJ0 A;  4FYX B;  3EGU A;  3CCR A;  3C94 A;  5GAO n;  2HQH A;  3A1P A;  4OGE A;  2ZPH B;  1BB9 A;  2RQU A;  1B7T A;  3HPW A;  2QI2 A;  1B34 B;  4LDX A;  1WIE A;  2Y4Y A;  2EQK A;  2J7I A;  2AK5 A;  2E1H A;  3CC7 Q;  2DVJ A;  5GAN h;  2PQW A;  1BKB A;  1OZ3 A;  3NTH A;  1AD5 A;  1NZ9 A;  3NGP A;  2PVG B;  4C5G A;  1R0C B;  1K76 A;  3I55 A;  1D1A A;  3G6E T;  1W2B A;  4FT2 A;  1AVZ C;  2EPD A;  4C0G A;  5GAN d;  3M56 A;  4C5E A;  1OPK A;  4CC4 B;  2X4Y A;  1T0H A;  3OS1 A;  6AT1 B;  4Z89 A;  2EAY A;  3MO8 A;  4C92 B;  1X01 A;  4KUD K;  2QA4 Q;  3X26 B;  1Q82 C;  4XK8 E;  3KFV A;  2KR3 A;  3NTK A;  1G83 A;  2P0K A;  1AZE A;  2LJ1 A;  5KYY B;  1KQ1 A;  1WQW A;  2KK4 A;  3PFS A;  2DTH A;  4OVA A;  5D7U A;  5KCH A;  1LNX A;  2FPF A;  1WXU A;  4F17 A;  4IUT A;  5GAN f;  4DBQ A;  1VQN T;  5GJW B;  2HKQ B;  3L2Z A;  1X43 A;  1YIT T;  5D6W A;  3JCM X;  4HVU A;  3ZL7 C;  2ROL A;  2DL8 A;  4PJJ A;  3JCM Q;  3CD6 T;  2CGH A;  3SDZ A;  1VQ9 T;  3PE0 A;  1KHC A;  2C0O A;  2FZC B;  1HK9 A;  4MZP A;  1W2B S;  4C8Q C;  2CP6 A;  4M78 G;  3RIR A;  4KBM B;  5GMK e;  4PJO D;  4OB1 B;  3CCM T;  2BE9 B;  5GAN j;  1I5O B;  3MJX A;  1HSQ A;  3CCV Q;  1K4U S;  3PVQ A;  5FU7 B;  4J9D A;  3HKS A;  3TQ7 P;  2I0N A;  4QVC A;  2RNA A;  2QK0 A;  3BDL A;  2OTL A;  5FRN A;  5FW9 A;  4QT7 A;  1VQO T;  3M0Q A;  9ATC B;  4QQD A;  1IGQ A;  2ZZD A;  1K73 U;  1AZG B;  4E6R A;  4KH0 B;  3EHR A;  1VQK Q;  3JCM b;  4JRP A;  1N9S A;  4OP0 A;  3I5R A;  3JCM P;  4HT8 A;  1UTI A;  1A0N B;  5D6X A;  1XOV A;  2RJC A;  3OW2 P;  1VQ4 T;  1VQM T;  2DBM A;  1VA7 A;  1SHF A;  1X2K A;  3OYE A;  1MMG A;  2LVM A;  3O5Z A;  4C0Z A;  1N27 A;  4HKE A;  3MEW A;  1ZA2 B;  4BE2 A;  2AKK A;  4JDS A;  1U5S A;  4RTY A;  3HFN A;  2KRM A;  3LX7 A;  3QO3 A;  1BCM A;  1IHV A;  2CSI A;  4Z88 A;  4TVR A;  5GAO p;  5D6Y A;  4M7A E;  1BU1 A;  1KQS A;  1JJ2 P;  1QKX A;  3H0I A;  4M77 D;  2PVO B;  2PVD B;  1OU9 A;  1WI7 A;  4B6M A;  3MP1 A;  3V7R A;  2O2O A;  3CC4 T;  2DYI A;  2OTL Q;  2EW3 A;  1Q7Y R;  3EGX A;  4F7U F;  2E6N A;  4M7A C;  3KBG A;  2YRC A;  1WPY A;  5M9O A;  5CIU A;  4C8Q D;  3D7S B;  3E1S A;  4AFQ C;  2XDB A;  1D3B A;  3UA7 A;  2FYK A;  4RTT A;  5FU6 B;  4FM4 B;  2QGF B;  3MET A;  3IQL A;  2YHT A;  1XQH A;  3NMZ C;  2OTJ A;  4M7A A;  2QQS A;  2DVE A;  1PC0 A;  2EYQ A;  2M0Y A;  3CCS T;  3SFM A;  5IN1 A;  4R55 A;  1FXX A;  1SF9 A;  2W10 A;  2QDL A;  5L8R E;  3CMA Q;  1OI1 A;  3TCJ A;  5FLX E;  3OYI A;  2RQV A;  2X51 A;  2KNB B;  4XU1 A;  5CQX A;  4OMF B;  3MHX A;  4IKF A;  5KYX B;  1KQS S;  2VAS A;  1W70 A;  4PFP A;  4BAC A;  2QYZ A;  1YJW Q;  2RQR A;  4OF1 A;  5GAN e;  1QVF A;  1KIK A;  3PIO A;  3NHN A;  2J05 A;  2NWM A;  2KT1 A;  3HTR A;  1Y96 B;  2JT4 A;  2BTT A;  4R0K A;  2RMO A;  1MMD A;  1J3T A;  2MAM A;  4QVD A;  3CC7 T;  2HEQ A;  2DNU A;  1ZBJ A;  3EGD A;  4BI3 A;  1YHQ Q;  2LRQ A;  1Y7X A;  4M75 C;  1D0Y A;  4XQ3 A;  2OTJ Q;  5LJ3 h;  1VYT A;  1PWT A;  2HCK A;  4PNO A;  1S1N A;  1O75 A;  1AWJ A;  3RNJ A;  2X3W D;  2FG0 A;  2LZ6 B;  3OYM A;  2J6O A;  4BD3 A;  3GOX A;  1I81 A;  3QSU A;  3L2W A;  2RHZ A;  1WZO A;  2RJF A;  2DE0 X;  5IH2 A;  1QVG P;  1KQS P;  3C0C A;  4F14 A;  1MNE A;  2EGA A;  5LJ3 d;  5GAN 6;  2L2P A;  4O6J A;  1QCO A;  2HSP A;  2QA4 T;  1TH7 A;  5DM7 R;  4DOW A;  1WHH A;  3CCR T;  1QVF S;  2QTV A;  2LP5 A;  3EG2 A;  4M7A B;  4ELY C;  3CC2 A;  3OYY A;  4ZNX A;  3OYN A;  1LOJ A;  1CKA A;  1SSF A;  2PZ1 A;  4M7D G;  3NTI A;  4QKU A;  2DLP A;  3P8H A;  2YT6 A;  1AWW A;  3JCM V;  3J80 E;  5LJ3 f;  1Z9Z A;  1QWF A;  5IXB A;  4E7Z A;  4CRI A;  2O01 E;  5KH6 A;  2DXC A;  3I55 T;  2CT3 A;  5CVI A;  4M7D D;  1VQ5 A;  1RAF B;  1N8R U;  2E5Q A;  3TSW A;  3X24 B;  3HRU A;  4HCZ A;  4Z8A A;  2XK0 A;  3OYA A;  3VKI A;  1SRL A;  1OU8 A;  4J6Y A;  3H0H A;  1AWX A;  1K0S A;  4F7U G;  1YNZ A;  2O9S A;  1TSF A;  3A8O B;  5LJ3 j;  3MCA B;  4LUE A;  4M75 D;  4OMN A;  3OMC A;  1Y07 A;  2MWO A;  4EPC A;  3JB9 D;  2DTI A;  2FZG B;  3QBY A;  1RAC B;  5GAN 5;  2HBW A;  5CKH A;  3SWN C;  2K2V A;  2EGE A;  2QG9 B;  4A4K A;  5GJV B;  2NUZ A;  3FJP A;  3A98 A;  2XDD A;  2H8H A;  1KFZ A;  2L3S A;  2MYS A;  1OX9 A;  1U1T A;  2O4X B;  2JZ2 A;  1QCF A;  1SPK A;  2M51 A;  4MML A;  2V26 A;  3M5A A;  2XU8 A;  5CQY A;  3H6Z A;  1BCO A;  2X9H A;  4D8K A;  4WCI A;  1VQ5 Q;  5HK0 A;  1GRI A;  4A4G A;  4JRI A;  3LWH A;  5HCK A;  3RMS A;  1UGP B;  1TOV A;  2XMF A;  2DJQ A;  2E10 A;  1MGQ A;  2DRM A;  2KGT A;  4PLI A;  1E6G A;  2EJF A;  4DBH A;  3JCM h;  1PNJ A;  3S6W A;  2OTL T;  5GAM d;  2HNI A;  3MPU B;  2KRS A;  2D8J A;  2YWW A;  5DY9 A;  1PRM C;  4NL2 A;  4C92 F;  2EWN A;  2KI7 A;  1ZSZ C;  3EFO A;  4X9C A;  2GFU A;  3RKW A;  3BY7 A;  3JCM d;  4IIO A;  5GAN 2;  1YI2 A;  1K73 C;  4XAX B;  2EYZ A;  1AEY A;  3VUB A;  4GY5 A;  2X4J A;  4JLG A;  1IZ6 A;  1N8R R;  1ARK A;  3RR6 A;  2JTF A;  4RTU A;  3GNG A;  3UDC A;  1R77 A;  1M2V A;  1Q81 U;  1M27 C;  2F1L A;  3R6N A;  4R56 A;  4EDU A;  5LL6 S;  4CI0 C;  5A2Q E;  2X4W A;  5KE3 A;  2OAW A;  2OJ2 A;  1BBZ A;  1YJ9 Q;  5FWC A;  3G1J A;  1B34 A;  2FEI A;  3EAE A;  4LDV A;  4HVV A;  4J8O A;  5A0G A;  2EKH A;  4LDY A;  4OB3 B;  2KRN A;  2WSC E;  3DLM A;  5IAY A;  2CS7 A;  3CCJ A;  5GAO q;  2GQI A;  2ZGW A;  5LJ3 e;  3ASK A;  2K7A A;  2M02 A;  4Y28 E;  4A53 A;  1M8V A;  3VRY A;  2L0A A;  2YUO A;  5CK9 A;  1YI2 Q;  4Z02 A;  2DRK A;  3QYH B;  1QLY A;  3E2U A;  2PNI A;  2OTJ T;  1NYG A;  1UHF A;  1V76 A;  2XG8 D;  2DKG A;  2PUK B;  5C6S A;  2YXY A;  4ESR A;  1WLP B;  4X34 A;  4C92 A;  2JTM A;  3A8G B;  4OMP A;  4BDY A;  3CQT A;  3PMI A;  1RLP C;  5LJ5 d;  5GAM g;  2G6F X;  4Y92 A;  1UHC A;  2DK3 A;  2DBK A;  3RDV A;  1RAD B;  4ATO A;  5GAN 7;  1EFN A;  5IHN A;  1F1B B;  4QW2 A;  3INZ A;  1RLQ C;  5KE2 A;  2KMT A;  1BI3 A;  2AKL A;  2D0Q B;  4HVW A;  4PJO E;  1VQ8 Q;  2FHD A;  1M2V B;  2V8I A;  4E47 A;  2DZ9 A;  2LMJ A;  1RAH B;  3ZFJ A;  2JUF A;  5FRM A;  2EJG A;  1E7O A;  2DD5 A;  2X35 A;  1W1F A;  4A4H A;  1Q81 R;  1M90 R;  2P0P A;  1I5L A;  1KK7 A;  4PJO C;  1D09 B;  5CKD A;  3U23 A;  2A7Y A;  3FLG A;  4CC3 A;  2FPE A;  3L42 A;  2DET A;  1QCN A;  1X2Q A;  2X3X D;  1CSK A;  3HL8 A;  5FRO A;  2HBP A;  1VQL Q;  2CYZ B;  3BDU A;  3OB9 A;  1M3A A;  1RAE B;  3OW2 A;  4PJO A;  1Q86 R;  3UA6 A;  1JQQ A;  3P8D A;  3M0R A;  2ZPF B;  1R8O B;  2GQV A;  2PU9 B;  2X4X A;  3T9N A;  3V7S A;  1UGR B;  4OMO A;  2CZ1 B;  1EZZ B;  4P5N A;  2JOY A;  4V2S A;  3LLR A;  4IUP A;  3CCV A;  3S3O A;  3UAT A;  1ACM B;  4CC2 A;  3CC2 T;  3NPF A;  2VKN A;  1ABQ A;  1WXT A;  2CP2 A;  1X27 A;  3EG3 A;  1JJ2 A;  1WHL A;  3BW1 A;  2DO3 A;  5GAN 8;  4MZM A;  4M77 E;  2RHU A;  3EG9 B;  3OYK A;  1KC8 R;  4N4G A;  3QHS A;  1VQK A;  2K9G A;  4ZN1 A;  3FRN A;  5LJ5 g;  2JTE A;  5I21 A;  3VU3 C;  5DLO A;  4C8Q E;  2V8J A;  4M77 C;  3I9Q A;  1U1S A;  2EBP A;  4HXJ A;  1VQ5 T;  1Q7Y U;  8AT1 B;  2JVV A;  3FEO A;  3GP8 A;  3OW2 S;  3FIF A;  5IXF A;  3R6O A;  1GCQ C;  1EX4 A;  1N8R C;  3A5Z B;  5I22 A;  4J6W A;  4JRK A;  2EQU A;  4J5Y A;  4WTO B;  4M77 A;  3JCM J;  3SEM A;  2KXC A;  2LNV A;  3C95 A;  3DLL A;  2HD0 A;  2F5K A;  2A28 A;  2QGG A;  3M9Q A;  1GCP A;  3PMT A;  5KYN A;  4BY6 B;  3HRS A;  1WGS A;  1K0X A;  4M78 D;  4QQG A;  3Q1J A;  2EQI A;  4C8Q A;  3GIB A;  2JMA A;  4F04 B;  2NLU A;  1JJ2 S;  2RJD A;  4JJC A;  2CH4 W;  2P0Q A;  4HT9 A;  2J6K A;  3OYJ A;  4M7A F;  2B8A A;  4PJO B;  1JXO A;  2J06 A;  1YCY A;  4PK4 A;  2QQB A;  3JB9 I;  1JRI A;  3VYG A;  4OGC A;  1KSW A;  1M1G A;  4MDX A;  4LE9 A;  3I5S A;  1ZUK A;  4K11 A;  1WHK A;  1UJ0 A;  2DZC A;  4KGV B;  4EMK C;  4FW1 A;  2QAS A;  3VV0 A;  4FYV B;  5KYX A;  2RI5 A;  1G3Y A;  2RQT A;  3GBQ A;  1ZLM A;  1B07 A;  1UG1 A;  4KUL A;  1Y96 A;  2DXB A;  1WDX A;  2CKK A;  1YJ9 T;  2JXB A;  1UJY A;  4PLL A;  3WVE B;  2XDP A;  3EHQ A;  4EMK A;  4PJM A;  4C0D C;  2A0F B;  4RUG A;  1VQ6 A;  3CMA A;  1WJR A;  1ZX6 A;  2ZCF B;  1YBY A;  1K9M U;  2MMP A;  1I0C A;  4RTX A;  1NLP C;  1GFC A;  2MIO A;  2BZX A;  2FB7 A;  3PTA A;  1QVG A;  1P92 A;  2JS0 A;  4L5G A;  1HJD A;  2EYY A;  1M3B A;  1NM7 A;  3CXC P;  1YJW A;  1I07 A;  4EMH A;  1DJ7 B;  5C0M A;  2YRD A;  4D6W A;  3RMQ A;  4BE0 A;  1Y57 A;  2LT4 A;  1YI2 T;  2ECZ A;  3QWY A;  2CZ0 B;  4J7F A;  2BE7 D;  3M53 A;  4LDW A;  1FMW A;  3UT1 A;  4JS5 A;  3JB9 H;  4M77 B;  1IHW A;  3CME A;  4A4F A;  3QJ6 A;  3URG A;  3CCL A;  3EG1 A;  1YHQ A;  3EFR A;  1H8K A;  2KSS A;  2Y90 A;  4AG1 C;  3G7Z A;  4II1 A;  2DPP B;  1Q81 C;  3VS5 A;  5GMK l;  2DER A;  4C8Q B;  3VS0 A;  1GBR A;  2MOX A;  1C1A A;  2HQE A;  1JXM A;  1VQ6 Q;  3CCU A;  1RAG B;  1FX7 A;  3G71 Q;  3CCJ T;  2LDM A;  1WJQ A;  3OYC A;  1QVG S;  2NYS A;  2R57 A;  3X20 B;  1JB0 E;  1NLO C;  2DL7 A;  4M7D C;  2ROT A;  2HL5 C;  1N9R A;  3JCM c;  3RUX A;  1G3T A;  1H64 1;  1M2O A;  2RO0 A;  1NEB A;  4M75 E;  4J6X A;  4EMK B;  2VV5 A;  1D0Z A;  2CUB A;  1JO8 A;  1UFF A;  4JZ4 A;  1X69 A;  3CME Q;  2YUP A;  3FDR A;  3CCL Q;  1TUC A;  5GAO r;  2L5Q A;  1BK2 A;  1RI0 A;  2P84 A;  1G8X A;  1K9M R;  3L2R A;  1YN8 A;  2MK5 A;  1WA7 A;  5DLQ E;  4JZ3 A;  4M4Z A;  4PKC C;  3CBO A;  2GCX A;  1YWO A;  2K5F A;  2AZS A;  3UF4 A;  4JS4 A;  1U3O A;  2KBT A;  2DX1 A;  1QP2 A;  4M75 A;  2A08 A;  1NEG A;  2O4X A;  3CCU Q;  3ZBD A;  4OMQ A;  3OS2 A;  4M7A G;  1UB4 A;  2OX7 A;  3VS6 A;  3V8L A;  4XTU A;  4JJD A;  4LXC A;  1EIF A;  5KYU A;  3CCE Q;  4AFU C;  1IRX A;  3VUZ A;  4XTZ A;  2LCC A;  2JN0 A;  3AHU A;  4J9B A;  1RAA B;  5L23 A;  2K3X A;  2FVU A;  1XJW B;  1SHG A;  3WXM B;  1H92 A;  4BUG A;  4B9X A;  2DEU A;  4C0F A;  4AMC A;  2GTO A;  4AFS C;  2DD4 A;  2COZ A;  1ZQ1 A;  4LD9 K;  3THK A;  2L89 A;  3FJ5 A;  1W6X A;  3OYH A;  3MP6 A;  2K6D A;  3OSS C;  4XTW A;  4RMO A;  3RES A;  2L3P A;  1QP3 A;  1UUE A;  1JBM A;  4E7K A;  3WVD B;  3CCV T;  3M57 A;  3CPF A;  3MEV A;  3QPH A;  8ATC B;  4FT4 A;  4M7D B;  2ZPE B;  1KD1 U;  4FYY B;  1RAI B;  2DIQ A;  3F70 A;  2RN8 A;  3SHW A;  1PG5 B;  1ZSG A;  3RKX A;  4KRT A;  3OS0 A;  4E7I A;  2L8D A;  4E7L A;  2VWF A;  5HKC A;  2DIG A;  2MWP A;  1VQK T;  1IXD A;  1FYN A;  3A8M B;  3M59 A;  3G6E Q;  2K5I A;  4VUB A;  5IHK A;  4IUV A;  2E6Z A;  1NJI U;  1IB8 A;  2YSQ A;  4JJB A;  1NE8 A;  2MCN A;  1BI0 A;  4ZN3 A;  2CUD A;  4M75 B;  4PFZ A;  1T3S A;  1FMK A;  4IUQ A;  3SWN A;  5CCA A;  1Q7Y C;  5KYU B;  2RF0 A;  1K9A A;  4OML A;  3UWN A;  4HCB A;  3PVL A;  2CZ7 B;  5GAM h;  3OYD A;  3M0S A;  2FO0 A;  1YJ9 A;  1MHN A;  1JU5 C;  4X9D A;  2QTX A;  4MZT A;  2KYM A;  2GFA A;  2P4T A;  2KE9 A;  1TXQ A;  4KGZ B;  2RJE A;  1Z9Q A;  3OBY A;  1YIT Q;  2CP7 A;  4J7I A;  2ZAE A;  4ZGE B;  4ZGJ B;  2CP0 A;  1ZUU A;  3OSV A;  2AIR B;  3CD6 Q;  3H9N A;  3KUF A;  2DYB A;  3TU4 K;  2O31 A;  1T3L A;  2JS2 A;  1NYF A;  1IGU A;  2MI6 A;  5GAO l;  2KY9 A;  2QDY B;  2ATC B;  1D0X A;  1MUZ A;  1IO6 A;  3CCM Q;  3X25 B;  1H3Z A;  3I35 A;  3CPW P;  1M90 U;  3A8H B;  5IT9 E;  4HCC A;  1VQP A;  1ZSZ A;  1C6V X;  5J39 A;  1MMN A;  1KD1 R;  2QQR A;  5GAM f;  3H8Z A;  1AT1 B;  2K79 A;  4OB2 B;  1NPP A;  2KDS A;  1VQ6 T;  3RKY A;  3CMA T;  3M0T A;  1VQ7 A;  2K2M A;  1WX6 A;  2L3Q A;  3ZEH A;  1PHT A;  2YDL A;  1MV3 A;  2E5K A;  4BI4 A;  3M0U A;  4MDW A;  1K9M C;  2DMO A;  3JCM f;  3LYI A;  1YJW T;  1X6B A;  1Q86 U;  1VQ8 A;  1NJI R;  5FWB A;  1BI1 A;  1VQ4 Q;  3SWN B;  1MMA A;  1SEM A;  2E3H A;  2M9U A;  3C12 A;  2WSF E;  5GAM j;  1YCS B;  3TRE A;  3CME T;  4PJO F;  3CCL T;  1YHQ T;  4N0A C;  2MF2 A;  2YUN A;  2KYB A;  3V8K A;  1OUL A;  3HSB A;  2DM1 A;  2FL7 A;  3HFO A;  5LJ5 h;  4FW2 A;  1UE9 A;  1TUD A;  1E6H A;  4FSS A;  2W0Z A;  1OYX A;  5CAI A;  4ELZ C;  1V29 B;  2DXU A;  1VQL A;  1KC8 U;  1VQP Q;  3L2V A;  1SG5 A;  1XTD A;  2RK2 A;  3LWI A;  4E7S A;  2YRV A;  1WHJ A;  3EG9 A;  3CCU T;  1H3H A;  1VQ7 Q;  4GLK A;  3QWX X;  2KAF A;  2ESW A;  1UEB A;  1BYM A;  4Q5W A;  4RTV A;  4J9H A;  1VYU A;  2CP5 A;  2RHX A;  1IRE B;  2IVW A;  1X75 C;  2E4H A;  3BE3 A;  4XTX A;  1ZSZ B;  1SKU B;  1YWP A;  2DL4 A;  2IG0 A;  4M78 E;  1PD0 A;  4RTZ A;  2EQM A;  4F16 A;  4L6V 5;  5LJ5 f;  4J9C A;  2F69 A;  2YUQ A;  2M0O A;  3JSC A;  2VB6 A;  3S3M A;  1HD3 A;  3DB3 A;  4M77 F;  1OV3 A;  1OZ2 A;  3RER A;  1M3C A;  2QQ9 A;  5I2M A;  4J83 A;  4DBR A;  3ULR B;  3FC3 A;  4M78 C;  2QEX A;  1QVP A;  2ENM A;  5FU7 C;  2XI9 A;  4MMK A;  2RI2 A;  2LQK A;  1W4S A;  2DAQ A;  4J9F A;  4C8Q F;  2HMA A;  2VC8 A;  4RTW A;  4DBF A;  2LQ8 A;  3G4S A;  1G5V A;  2DIL A;  3RBB B;  4M78 A;  4WF2 A;  5LJ5 j;  4JJN K;  1OEB A;  2XHC A;  1LVK A;  5IHI A;  2DF6 A;  1TU0 B;  4IIM A;  4KUI A;  3H0F A;  1ZHI A;  1XNI A;  4C92 G;  2CRE A;  4EMG A;  2D6F A;  1AOJ A;  4LNP A;  5EC7 A;  3X28 B;  4PL6 A;  1G2B A;  1ABO A;  2LQW A;  1JEG A;  2EQJ A;  4JLI A;  3CXC A;  5GAN 3;  4C92 D;  2WSE E;  3LW5 E;  2K57 A;  2HKN A;  1PD1 A;  5GAM e;  2FPD A;  5GMK m;  1OOT A;  2A37 A;  2GTJ A;  2C0T A;  1QWE A;  2A3L A;  4XTY A;  3OY9 A;  1ZUY A;  2CT4 A; 
#chains in the Genus database with same CATH homology
 2HL5 C;  2HL3 A;  2CP0 A;  3RDV A;  1WHL A;  3TQ7 P;  1WHH A;  2E3I A;  2Z0W A;  2CP5 A;  2QK0 A;  2MPX C;  1TOV A;  1WHG A;  2COZ A;  2E3H A;  2E4H A;  1WHM A;  2HKN A;  2CP6 A;  1LPL A;  1WHJ A;  4B6M A;  2CP3 A;  2M02 A;  1TXQ A;  2COW A;  2HKQ B;  1WHK A;  2CP7 A;  2HQH A;  2COY A;  1IXD A;  2CP2 A;  3E2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...