1TOVA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
NESDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Cytoskeleton-Associated Protein Glycine-Rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein F53F4.3 in chromosome V
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1tovA00
2CP6A 2QK0A 2COZA 1TOVA 2CP5A 3E2UA 1WHMA 2E3HA 2MPXC 2CP2A 4B6MA 2CP3A 2COYA 2Z0WA 3TQ7P 3RDVA 2E4HA 2CP7A 2E3IA 2CP0A 1WHLA 1TXQA 1WHGA 2HKNA 2HQHA 2HL5C 2HKQB 2M02A 1IXDA 1WHKA 1WHJA 2HL3A 2COWA 1WHHA 1LPLA
chains in the Genus database with same CATH superfamily
1VYUA 1R0CB 3JB9F 2ZZDA 4LDXA 1HJDA 1N27A 3HHTB 1OX8A 2NUTB 3CD6Q 2CP2A 2E10A 2PTKA 4FSXA 2WACA 2H3JA 2J7IA 2E4HA 5KYWB 1GXIE 2QTVA 1QWFA 2JMAA 1I4K1 3OYCA 3SWNC 2ESWA 2DTIA 1WHJA 2KDSA 4XU3A 5D6WA 1VQ8Q 4K11A 2L3SA 3UT1A 3HRSA 1FMWA 4AFSC 1O75A 1PSEA 2WSEE 2QAZA 3O5ZA 1VQ9T 2FG0A 2H3EB 4FT4A 4B9WA 2K4YA 1M90R 1VQKQ 2NUPA 4HVWA 3A8GB 2OAUA 3BY7A 2XD0A 1RAEB 3I5RA 4J7IA 2D8HA 3QPHA 5GMKl 4PJJA 4JZ4A 3CCUQ 4AT1B 3M4GA 1M5Q1 2E5QA 1BBZA 3J80E 4AMCA 1TOVA 2LCSA 3HRTA 4IUQA 3CMEQ 2IPOB 1U1TA 2EQJA 3VS7A 1H8KA 4BUGA 2KR3A 5D7UA 3UDCA 4QVDA 1YHQT 4ZN3A 3E19A 4M75E 3EG9B 4LD9K 2DA9A 1YN8A 1XOVA 2FPFA 4E7HA 3V7CA 3G6ET 4PFOA 3S6WA 2R5AA 5CK9A 4Y92A 1LVKA 2O31A 2K2VA 3TCJA 3JCMb 3QDRB 5GANf 3M4YA 3V8LA 3CBPA 4RCBA 4M77A 1ZX6A 4C92F 3QWYA 1M8VA 4KUIA 4MZTA 4DOWA 1PWTA 4F04B 3PVQA 1AVZC 1EX4A 3A98A 2FVUA 4C5EA 1W70A 1ZSGA 1VQ5T 1K8AU 3KUFA 3CMAQ 1X6OA 4JS4A 2CH4W 2YT6A 1VQMQ 2DZ9A 3GNGA 2MWPA 3Q1JA 1D0YA 1VQ4A 1I07A 4MMLA 1ABQA 3M53A 2GNCA 2GF7A 1W2BA 4EIKA 4JRPA 2KYBA 3CCRQ 1U1SA 4EMKA 1OZ2A 2XKOC 3QG1A 2PQWA 3ZL7C 1UB4A 1VQ7T 4RTUA 2DEUA 2RB6A 1IHVA 1N8RC 4CRIA 2KNBB 1VQNQ 1AWJA 4P5NA 4DEYA 2DIGA 1OPLA 2VYTA 3QIIA 2K3XA 1GCQA 2RHXA 4KUDK 2K9GA 3OYGA 2K5FA 4J9BA 4II1A 2LP5A 2YXYA 1YJNA 3EGUA 5FWCA 3OYEA 2LJ0A 5FW9A 4J6YA 2XI9A 1H3ZA 1QW1A 4WCIA 4E47A 1NJIR 1GFCA 5GANd 1SRMA 3UPUA 2GGRA 3QXEB 1HXDA 1VQKT 2E12A 4J9FA 2RI3A 3EAEA 4JJCA 2E70A 1MV3A 2COYA 3FLGA 2CP7A 3P8HA 5GAN4 4BE1A 1T3LA 4EDUA 3HKSA 2M51A 4PL6A 5LJ5e 2LX9A 2YUOA 3JRZA 2XHCA 1OU9A 4C0DB 3ZBDA 1KQSA 2COZA 3M0QA 2HMAA 1B7TA 1SSFA 2VXEA 2EYZA 3JCMf 4X9DA 1WYXA 2Z0WA 5GAN2 4WTOB 2AIRB 2YRDA 1I8FA 1WA7A 2DYIA 3EG1A 3CCRT 1AZEA 1MGQA 1VQ6Q 2BKDN 2FRWA 1FYNA 1Z9QA 4LE9A 1N8RR 2X4XA 2M9UA 5GJVB 1CSKA 4F16A 1X75C 5GAN5 3CMEA 2KROA 4PJOF 3CCJA 2DK3A 3UATA 1UE9A 2CZ7B 3CD6A 4M7DD 4FSSA 3MJXA 2EQIA 3OYIA 1WQ7A 1JB0E 4JRKA 3DLLA 5GAN8 1QKWA 1Q82C 1G3WA 2OJ2A 2JXBA 2RN8A 3G4SA 1RAGB 3EH1A 1KC8R 1QVGS 3CCLT 3BE3A 3PT9A 2RHUA 4ZTFA 3PIOA 1KG1A 2HQXA 4IURA 1VQ9A 3EGXA 2DBKA 4FL6A 4J9IA 2EVRA 1OULA 1WDXA 3CMET 1D3BA 1KK7A 4RMOA 3SB2A 4HVUA 4JRIA 1SPKA 3LWIA 1VQ8T 2F5TX 3S3OA 1BB9A 3VU3C 2DL8A 3OBYA 2VKNA 1AOJA 4DQ2A 5GANh 4XTZA 2ZPFB 2FB7A 5GAMd 1VQOQ 2MPXC 4N0AC 4J9HA 4LD6A 3VS3A 3JCMg 3E9GA 5KYXA 5CKFA 5KE2A 3VYHB 2FZGB 2M02A 2OTJQ 3CQTA 2VUBA 1D1BA 2DKGA 3VS0A 3INZA 1D09B 2QA4Q 1TU0B 2QQ9A 2RJDA 1YIJA 2OTJA 1VYVA 1DJ7B 1Q7YU 1MMAA 2VVKA 1IGQA 1IB8A 5FU6C 1RADB 4C5HA 4LDVA 3E9FA 3CMAT 2QA4T 3CCLQ 1G83A 3JSCA 3A8HB 3CC4Q 2WSFE 4IUPA 4Z89A 2DL3A 1K4US 4D6WA 3NMZC 4C8QB 3OY9A 1PG5B 5HCKA 1YCSB 1YJWT 3ZEHA 4N4GA 4LXCA 3M5AA 3R6NA 3M0UA 1Y96B 1IRXA 2YRCA 2PUOB 1RAIB 1AWXA 3OS0A 2R57A 1PC0A 3QHSA 3CCJQ 2C0OA 3MO8A 1WXUA 2HBPA 4XU1A 4ORZA 3WXMB 3RIRA 3C94A 3LGLA 2K79A 2JN0A 2YRVA 2HSEB 5CQYA 1N5ZA 4JJDA 4J9CA 4XK8E 2QEXQ 1X43A 2FEIA 1G3SA 5GMKj 1D0XA 2MI6A 1YJNQ 4RTVA 4E7LA 3OYHA 1QCNA 4C8QC 2RQRA 4F7UG 3EGDB 3M0PA 4RG2A 4M75F 4AG2C 5FWBA 1MMNA 4JJNK 2DL7A 4DBRA 2JMCA 2E3HA 2QDLA 4M4ZA 4KBMB 4OVAA 1X2QA 3HTRA 1PKTA 2A37A 1YJWA 4C0DC 1B3QA 3OA6A 4PKCC 1S72A 1FX7A 4X9CA 3CC2T 1LCKA 2XU8A 5AT1B 1QVPA 2DTHA 4M75B 4Y28E 3CCST 2PU9B 3T9NA 3VKIA 2PVOB 2RMOA 1PSFA 1VYTA 1QVFP 4FYXB 1N9RA 4NOYA 4M7AG 1TTHB 2KE9A 2GQIA 3VUBA 2RA2A 2DXCA 5GAN7 3I56A 1NZ9A 1UTIA 5GAOq 2X3WD 1H3HA 1YITT 3FC3A 3VUZA 4HT8A 1K9MR 2JW4A 1BI1A 1YJ9T 5C6SA 4M7DB 4M7DG 1PNJA 1RUWA 3CCRA 4Z8AA 1M8MA 1IHWA 2DM1A 3CPFA 2CH4A 1Y57A 2HKQB 4LUEA 5J39A 1N6AA 2KMTA 4PLIA 1G3YA 2XDDA 1K73C 4PJOD 3GF5A 4C8QF 3JCMc 1FWZA 2P0KA 1OOTA 2JT4A 1WFWA 4KT0E 1M2VB 3A8LB 4J9DA 2E6NA 4ANJA 4PJLA 3OSSC 1AZGB 2DBMA 5LJ5j 2LQWA 1GRIA 1RLPC 4QVCA 4IUUA 1MHNA 2JZ2A 1K0SA 5GAN3 2CZ6B 1I0CA 3CPWA 2X4WA 3NTIA 1C6VX 3LLRA 4KH0B 4ZTJA 2ECZA 3G4ST 4MMKA 1H92A 2NUPB 1UGRB 2RM4A 3EG3A 4A4FA 3REBB 1Q86C 3ASKA 2XK0A 4L5GA 1MMDA 3SHWA 2JS0A 2KXDA 2O9VA 2HL3A 2OTLT 2K6DA 4HA8A 4M75D 3EHRA 5GAMj 2ZPEB 3OW2A 4JRQA 3V7RA 3NTKA 3SWNA 2L3RA 2P84A 1YI2A 5IXBA 3OS1A 2D6FA 1ZUUA 1QVGA 1TSFA 2J6FA 2KK4A 1RABB 2ED0A 3QUIA 4C92D 2NUTA 2LCCA 1JJ2A 2X35A 5LJ3d 3OYBA 2KRNA 3GNFB 1Q81R 3HL8A 3OQ5A 1VQOA 4ZNXA 5GAMh 2LRQA 3EFSA 5CKDA 4FYVB 4OMLA 2DD4A 1GL5A 5LJ3h 1E6HA 4DBHA 2J05A 2E5KA 1OQKA 4J9GA 1K9MC 2M16A 1KD1U 1TUDA 5KYYB 4PNOA 2O01E 3GBQA 2F69A 2MIOA 3QKJA 3QZ5B 5A2QE 4C5GA 1KHCA 1I1JA 1JRIA 1QLYA 2D8JA 5CO7A 2HQHA 5GANe 1D1AA 3UA6A 3MEUA 3UF4A 2LQ8A 1RACB 1NLPC 3L1AA 2QQBA 3QZ9B 3P8BB 3CC4A 2KEAA 4OMFB 3I55Q 3RKWA 1ZHIA 3CCLA 2P4RA 5LL6S 3EHQA 3G4SQ 3JB9D 4LNPA 4M77E 4E7ZA 3QJ6A 1UUEA 1YITQ 3CBMA 3HPWA 1Q86R 1QCFA 3CCSQ 4OB1B 1NBEB 1M3BA 1WQWA 3NHNA 4C8QE 4TVRA 1MV0B 3C0CA 2KY9A 4BD3A 3OMCA 1E6GA 3PNWC 1RAAB 1J3TA 2K5LA 3OYFA 2W10A 4MDXA 5LJ5g 3TSZA 3L2WA 1YWPA 4JDSA 1JU5C 2JJ9A 1V76A 4L59A 2EYYA 2D1XA 3S3NA 3OS2A 2EW3A 2QDYB 5C0MA 2E64A 4BACA 4A54A 1YI2Q 4R0KA 3A1PA 2ENMA 3DKMA 1NLOC 4UC4A 2QGFB 3OW2S 2NUZA 2V26A 5KE3A 1VQ7A 4E2FB 3CXCA 1NEGA 2DNUA 1OU8A 3VS1A 4RTZA 1YP5A 3ER0A 3X26B 4M7DE 1T0HA 2LQNA 4F7UB 3OMGA 1W2BS 4ATOA 2LX7A 3MEAA 3JCMW 1WJQA 2YSQA 4M7AA 3JCMd 4FU6A 3O8VA 2DL5A 3LH5A 4M78F 3MP1A 5AYFA 4Z88A 1W1FA 1B34A 2F1LA 3ULRB 5I21A 2QASA 1EIFA 4BE0A 1KJWA 2XMFA 2JTFA 1VQPQ 2MYSA 3QBYA 5CCAA 1AHJB 1EZZB 5CVIA 1YWOA 2EGEA 3FJPA 2KSSA 2SEMA 1ZBXA 2BE7D 4AFQC 4EMHA 3SDZA 1BCOA 3G6EA 9ATCB 3JCMe 2GCXA 4XTVA 1VQ4T 3BDLA 2C06A 5GAOl 2GQVA 5D6YA 1GCPA 2HL5C 1VQNA 2MMPA 4KGVB 2XICA 2DRMA 3CCEA 4C8QD 1T0JA 4EMGA 1VQ6T 1B34B 1X6GA 4A63B 3FB9A 2DXTA 2I0NA 4E7JA 1QCOA 2EQMA 4A4GA 4FT2A 2ATCB 5FLXE 1FMKA 2ROLA 2X4JA 2HSPA 1QKXA 1UG1A 2HEQA 3JCMQ 1G8XA 3JV3A 2QTXA 1QP2A 3REAB 6AT1B 2CGHA 4QKUA 5KYYA 1TG0A 1PD0A 4PK4A 2DVEA 1WHKA 4GY5A 4N4IA 2VXFA 1WPYA 2RJEA 2PZ1A 2GFUA 5GAOm 2JM9A 5LJ3f 2YUNA 3VRYA 3OS5A 4M77F 3QDFA 5HK3A 3EG0A 1U06A 2DMOA 7AT1B 2EIFA 1WJSA 1NYGA 1VOMA 3CC2Q 2BIVA 4LN2A 1VQ6A 1M2VA 2FPEA 1K8AC 1QVFS 3M0TA 3TEEA 1P92A 1OYXA 1MMGA 3X20B 2GTJA 4IIMA 4EPCA 3M56A 5I2SA 2HDAA 2KVQG 1QMCA 3M54A 3JB9J 2DIQA 4RUGA 2HCKA 4M7AD 1MNEA 5CKBA 2E1HA 1UGQB 4PJOC 2EFIA 2QEXA 2EJGA 4OMPA 2J6OA 1WIEA 2ZPBB 4BE2A 5HKCA 4HCZA 5I11A 4M78E 1ZSZA 3BW1A 2I2LA 1C1AA 1Q95G 4M77C 5GAMe 1VQOT 4PJNA 5FRMA 2IIMA 1K73U 5IHNA 2P0PA 2NLUA 5CKHA 2E3IA 3FDRA 1K73R 1X69A 2NYSA 2O88A 1KFZA 1SKUB 2LT4A 4ELYC 2D0QB 1D1CA 2EGCA 1SEMA 1TUCA 4J7FA 4JPBW 4OMOA 2JTEA 3JCMP 5L8RE 5ECAA 2EKOA 2HQEA 3GLXA 2LNVA 4XU2A 2MF2A 2CUBA 2EJFA 2DILA 3I9QA 1Q7YR 2RF0A 2VV5A 1WNLA 1A0NB 4BI4A 3CC4T 4GLMA 2A7YA 4ZGEB 3CCEQ 2RQVA 4KULA 3CCQT 1SF9A 4ME7A 2AZVA 3I56Q 2GTOA 5IXFA 4C92A 2JTMA 3OYJA 1Q81U 4M78D 5KYUA 1UDLA 5GAN6 3VV0A 1Y0MA 4JLIA 2SRCA 1KQ1A 2CP5A 2KRMA 3QO3A 4GLKA 4MDWA 3NPFA 1TUGB 1BK2A 1S72Q 2PVDB 4CC2A 2R58A 1ZSZC 4CI0C 1G5VA 1K76A 1SG5A 1Q82R 1HD3A 2LDMA 1VQ9Q 1M3AA 1UECA 3M9QA 2DPPB 3SD4A 3IQLA 1VQNT 1KC8U 3JB9H 2CP3A 2BTTA 2LMJA 4J5YA 1KC8C 3RUXA 2C0IA 4IUTA 4J9EA 1EFNA 1NPPA 1Q86U 3G71T 3C4SA 2G3RA 4FCYA 1UHCA 4M75A 1VQ8A 3JCMX 3J81E 4HXJA 2CT4A 3M0SA 5CAIA 4NL2A 2L89A 1PKSA 3S3MA 1ZBJA 4FM4B 3PGGA 1K8AR 2RPNA 4ELZC 1X2KA 1YHQA 4XTXA 2QG9B 2CYZB 4VUBA 1UGSB 3CCMA 1JXMA 2EYXA 1D3BB 1GBRA 4ESRA 2HZYA 2BZYA 3CCUT 3BFMA 3CCMQ 3NGPA 2KI7A 1SHGA 1HSQA 1YHQQ 1M1KC 1BCMA 4Q5WA 2YLCA 2C0TA 1BIBA 1QP3A 3I55T 8ATCB 1BU1A 2OTLQ 4F17A 2KT8A 3PMTA 1RAFB 2HBWA 2LNHB 2DO3A 5I2MA 3CCVT 5KYXB 2LJ1A 2DYBA 1LPLA 4LDYA 3PIPA 2A28A 2ZPIB 4MZMA 2F5KA 4RKUE 4BDZA 3R6OA 4LDUA 4PJMA 4CC4B 2RO0A 4OP0A 4C5IA 4LUDA 4XAXB 1JEGA 2ABLA 5GAOn 2O4XA 1NG2A 1ZQ1A 3VYGA 2F2VA 2DD5A 1PRLC 3OYYA 2B86A 3CPWS 2K57A 3E1SA 4F7UA 3RESA 5KH6A 1WXTA 5KYWA 3L2ZA 5HK0A 2JM8A 1HK9A 3MKDA 3LWHA 2MAMA 3CCSA 2VWFA 4RTXA 3CD6T 1WJRA 5CKEA 4N4HA 5GMKi 3VS4A 1YFNA 4DBQA 1AD5A 3I55A 1IGUA 4BI3A 4OMNA 2Y90A 2VC8A 5GMKh 3BDUA 3JCMV 3CXCS 2DL4A 3L2RA 3X28B 2DAQA 3LW5E 2FL7A 1ACMB 1X6BA 1NJIC 1ABOA 1WX6A 2DE0X 5KYUB 3VS6A 1FMVA 5GMKe 4QQGA 2PNIA 5DY9A 3P8DA 3GP8A 3L42A 1QWEA 1H641 2EKHA 4M77D 4IKFA 2XIDA 4R56A 2CREA 4R55A 1YJNT 5FU7B 1N8RU 2J06A 3CCQA 1WI7A 2QQSA 1ZLMA 2NWMA 4ZGJB 1AT1B 1M90U 2M0YA 2K2MA 2ZGWA 2IG0A 3RR6A 1S72T 4XTUA 3ZFJA 1XQHA 3CBOA 2AT1B 5LJ3g 2KT1A 4PJOA 2DEQA 2AKKA 4C92G 5GAMg 4JUVA 1PCXA 1KD1R 1TXQA 3HSBA 5LJ3j 3EH2A 4M78B 1W6XA 1PM3A 3UWNA 3QSUA 1X27A 1WHHA 4A4EA 5DLOA 3OYMA 4C92C 3WVDB 5GAOp 3NTHA 3PE0A 1LJOA 3HFOA 3SWNB 1BIAA 5GANj 3GOXA 4M77B 3I56T 3PFSA 1R8OB 1V29B 1YITA 4KH1B 4OGEA 2O9SA 1Q82U 1WHLA 3TREA 2E65A 2RQTA 1IXDA 1K9MU 1SRLA 3CC7A 4PJOB 3KFVA 1VQ4Q 4RTTA 1M9SA 4X34A 2OTJT 4XTWA 3GPLA 3RBBB 3DB3A 2QEXT 1WHMA 2PUKB 5J26A 3LGFA 5EC7A 2EBPA 4HCKA 2F2XA 2LQKA 3JB9G 1GBQA 3CMAA 2AHJB 3CC7Q 2A08A 1WHGA 3LYIA 4D8KA 2RHIA 1UHFA 1UFFA 2DXBA 2RHZA 1VQMT 1AWWA 1CKAA 1UGPB 2G6FX 1YBYA 2KAFA 3H0IA 3META 4F14A 4OB2B 5KYNA 5EG2A 4FIBA 2PVGB 2LCLA 1ZSZB 4CC3A 4EMKB 1YJWQ 3DLMA 3H0HA 2FZCB 4KGXB 2JVVA 3THKA 3H9NA 4HCCA 4AG1C 2CSIA 2FO0A 1NE8A 2EAYA 2IVWA 5LJ5h 1VQLT 3JAME 4PJOG 3QWXX 2RQUA 3EFOB 3UA7A 3L2UA 1K9AA 2YUQA 4OMMA 2LVMA 1IREB 2YWWA 1SSHA 1X01A 1M4ZA 2HNIA 3OYLA 4M7DF 1Q7YC 2BZXA 2RK2A 3OSVA 3V8JA 2GFAA 1ZA2B 1RLQC 3AT1B 3VJPA 2CP6A 4OB3B 5KCOA 1VUBA 2YHTA 4NS5A 4JZ3A 5KCHA 2RI5A 2LC4A 1M27C 3EFOA 2E41A 2LJ3A 2CZ1B 2FYKA 3MEWA 1WZOA 3EGDA 3CCMT 1RI9A 2X9HA 3I35A 2CDTA 4E6RA 1VQKA 3QJYA 2RNAA 5I22A 1VQLA 2VGMA 2LZ6B 2RD1A 3CXCP 2R5MA 4M75G 5GAMf 4RCCA 3U23A 4A4KA 1XTDA 1AEYA 3FJ5A 1G2BA 2MWOA 3C95A 5CQXA 3CCET 3CCQQ 1KIKA 3RKXA 4C8QA 3G7ZA 4QQ6A 4C0FA 5FROA 1TWBA 3PMIA 3AHUA 2LTOA 1JO8A 1HYOA 4FYWB 5A0DA 2FPDA 2K5IA 2QA4A 2L2PA 3MHXA 1UJ0A 1Y96A 4FW2A 5IN1A 2MK5A 2KGTA 1YJ9Q 2A36A 4BI8B 3KXTA 4XU0A 4Z02A 4J6XA 3J7AF 4M7AC 2FZKB 1PRMC 1WGSA 1WXBA 2RQWA 2OAWA 3OB9A 1W4SA 2MOXA 1S1NA 1VQ5A 3LH0A 1OPKA 4PFZA 5IHKA 3MPUB 2EQKA 5FRNA 3FRNA 3H6ZA 2O4XB 1JBMA 2BZ8A 1U5SA 1OV3A 2EJ9A 1VA7A 1M2OA 1NPRA 2KYMA 2RJFA 4N0AA 2DXUA 1BI2A 5IHIA 1RL2A 2DLPA 1GCQC 1SHFA 2ROTA 2QYZA 3WVEB 1U8RA 1PHTA 4DOVA 2JUFA 1BYMA 3A5ZB 3I5SA 4M77G 2X4YA 3HFNA 4JLGA 2L0AA 4LDWA 1PD1A 2B8AA 2YDLA 4M7AF 2OTLA 3EFRA 1Y07A 3D7SB 3L2VA 3LX7A 4BY6B 2DVJA 3SFMA 2KRSA 4XTYA 4RG8A 1WLPB 4A53A 2P0QA 2JNGA 2VGNA 1RAHB 4C0ZA 1JJ2P 2M0OA 1QVGP 3A8OB 4F7UF 2JS2A 4M7AB 5IT9E 5A0LA 4HCBA 2DRKA 4FW1A 2F2WA 1LOJA 1IZ6A 4JJBA 5D6XA 2EGAA 4OGCA 1M90C 2L3QA 1VQ5Q 2XG8D 5GMKm 2QK0A 2DX1A 3H8ZA 4IIOA 1VIFA 4HT9A 1M1GA 4M78C 2OX7A 3HP9A 3RKYA 3PVLA 1ZUYA 1I81A 2XDPA 2RH2A 4C92B 1YJ9A 3OYKA 2HAXA 2HKNA 4KGZB 1YNZA 1R77A 4M78G 1M1FA 1R0BG 4PFPA 2K3BA 1KQSS 4J8OA 4X1VA 3GIBA 1TS9A 4OB0B 2XDBA 4FYYB 2DJZA 4DEXA 1N9SA 3RDVA 1OX9A 1YCYA 1G3TA 2W0ZA 1OZ3A 1I5LA 2H8HA 4HKEA 4KRTA 2LT1A 4DBFA 4C8QG 1VQLQ 3N5BB 4ZGDB 1M1KR 2K3YA 2V8JA 1BI0A 5LJ5f 1C0MA 2ED1A 2DZCA 4CC7A 2CSQA 1MUZA 3C12A 2A3LA 2EQUA 2CP0A 2DETA 4O6JA 4AFUC 3M58A 4GBQA 4PJOE 2COWA 3G71Q 4IUVA 1YIJT 4V2SA 1UEBA 1V1CA 3CC7T 3TSWA 1Z9ZA 1QVFA 1YI2T 1QQJA 2CUDA 2EWNA 3G71A 3H41A 2L8DA 2GBQA 3EG9A 2JOYA 1K0XA 1M30A 1FXXA 4E7SA 4WF2A 4B9XA 1VQMA 2VB6A 3MP8A 2CKKA 4OF1A 1Y7XA 5LJ3e 1KD1C 3EGXB 1KSWA 3FEOA 1KHIA 2FRYA 8AT1B 4AFZC 2L5QA 4EMKC 4D8DA 3CC2A 4YTLA 4NL3A 2WSCE 4QQDA 1CKBA 2YLBA 1K1ZA 1E7OA 4M7AE 1Q81C 3V8KA 3VRZA 3MCAB 2QI2A 3JCMh 1ZUKA 3F70A 2O2OA 2V8KA 1NM7A 4A4HA 2V1RA 2YUPA 1RI0A 2D0NA 5GANg 1OEBA 1ZA1B 3M57A 2RI2A 2J6KA 1F1BB 4B6MA 2K7AA 5M9OA 1U3OA 3JB9I 3TQ7P 2AZSA 3H0FA 3FIFA 2HD0A 3VS5A 4F7UE 1KQ2A 5CR2A 3ME9A 4OMQA 1BI3A 3KBGA 2KBTA 1TH7A 2D9TA 2X3XD 1OI1A 4BDYA 2BUDA 3E2UA 2L3PA 2OI3A 3MP6A 3NFCA 1MNDA 4M75C 3TU4K 2A0FB 1KQSP 1NJIU 2EYWA 5IH2A 3OYAA 3CCUA 3CEYA 5FU7C 4DA4A 2CT3A 3OYDA 2EYQA 4RTYA 2QXFA 2DERA 3OBWA 4Y91A 1UGVA 3RMQA 5LJ5d 3URGA 1UJYA 1T3SA 4PLLA 2EPDA 2AK5A 1I5OB 3VS2A 2KQWA 4E7IA 2QQRA 2KXCA 1IO6A 2RHYA 1JJ2S 5IAYA 2ZPHB 5HY6A 2V8IA 3HRUA 3G1JA 1YIJQ 3EG2A 2CZ0B 4M78A 1VQ7Q 2ZPGB 4MZPA 1D0ZA 2QGGA 1VQPT 2CS7A 5DLQE 1W2BP 3DB4A 3M55A 1JQQA 3QYGB 1NEBA 3X25B 4RTWA 2M1HA 3A8MB 4M7DA 1VIEA 2X51A 2RJCA 3OW2P 3X24B 1M1KU 2ZAEA 5DM7R 1BKBA 1NYFA 3SEMA 3JCMJ 4O5VA 3M59A 4C0GA 2QQAA 2RK1A 4E7KA 1M3CA 4BY6C 2P4TA 3L2QA 1XJWB 1JXOA 5J3BA 2E6ZA 3OYNA 3CCVA 2FHDA 2DF6A 2VASA 1XNIA 2V1QA 1AWOA 3M0RA 5GJWB 3G6EQ 3V7SA 1Y71A 1LNXA 1B07A 4J6WA 3CPWP 4J83A 4L6V5 5FU6B 3CCVQ 1GFDA 5L23A 4QVZA 3MEVA 4ZN1A 4QW2A 2DJQA 2Y4YA 4QT7A 4C92E 2AKLA 1VQPA 1O9SA 2DTOA 1ARKA 3QYHB 2Y4XA 3PTAA 5GAOr 5CIUA 2ZCFB 3CCJT 4XQ3A 2DFUA 3RNJA 2BE9B 3TVTA 3RMSA 4HVVA 3RERA 4JS5A 2MCNA 4BB7A 4M7DC 5A0GA
chains in the Genus database with same CATH topology
2CP6A 2QK0A 2COZA 1TOVA 2CP5A 3E2UA 1WHMA 2E3HA 2MPXC 2CP2A 4B6MA 2CP3A 2COYA 2Z0WA 3TQ7P 3RDVA 2E4HA 2CP7A 2E3IA 2CP0A 1WHLA 1TXQA 1WHGA 2HKNA 2HQHA 2HL5C 2HKQB 2M02A 1IXDA 1WHKA 1WHJA 2HL3A 2COWA 1WHHA 1LPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP6 A;  2QK0 A;  2COZ A;  1TOV A;  2CP5 A;  3E2U A;  1WHM A;  2E3H A;  2MPX C;  2CP2 A;  4B6M A;  2CP3 A;  2COY A;  2Z0W A;  3TQ7 P;  3RDV A;  2E4H A;  2CP7 A;  2E3I A;  2CP0 A;  1WHL A;  1TXQ A;  1WHG A;  2HKN A;  2HQH A;  2HL5 C;  2HKQ B;  2M02 A;  1IXD A;  1WHK A;  1WHJ A;  2HL3 A;  2COW A;  1WHH A;  1LPL A; 
#chains in the Genus database with same CATH topology
 1VYU A;  1R0C B;  3JB9 F;  2ZZD A;  4LDX A;  1HJD A;  1N27 A;  3HHT B;  1OX8 A;  2NUT B;  3CD6 Q;  2CP2 A;  2E10 A;  2PTK A;  4FSX A;  2WAC A;  2H3J A;  2J7I A;  2E4H A;  5KYW B;  1GXI E;  2QTV A;  1QWF A;  2JMA A;  1I4K 1;  3OYC A;  3SWN C;  2ESW A;  2DTI A;  1WHJ A;  2KDS A;  4XU3 A;  5D6W A;  1VQ8 Q;  4K11 A;  2L3S A;  3UT1 A;  3HRS A;  1FMW A;  4AFS C;  1O75 A;  1PSE A;  2WSE E;  2QAZ A;  3O5Z A;  1VQ9 T;  2FG0 A;  2H3E B;  4FT4 A;  4B9W A;  2K4Y A;  1M90 R;  1VQK Q;  2NUP A;  4HVW A;  3A8G B;  2OAU A;  3BY7 A;  2XD0 A;  1RAE B;  3I5R A;  4J7I A;  2D8H A;  3QPH A;  5GMK l;  4PJJ A;  4JZ4 A;  3CCU Q;  4AT1 B;  3M4G A;  1M5Q 1;  2E5Q A;  1BBZ A;  3J80 E;  4AMC A;  1TOV A;  2LCS A;  3HRT A;  4IUQ A;  3CME Q;  2IPO B;  1U1T A;  2EQJ A;  3VS7 A;  1H8K A;  4BUG A;  2KR3 A;  5D7U A;  3UDC A;  4QVD A;  1YHQ T;  4ZN3 A;  3E19 A;  4M75 E;  3EG9 B;  4LD9 K;  2DA9 A;  1YN8 A;  1XOV A;  2FPF A;  4E7H A;  3V7C A;  3G6E T;  4PFO A;  3S6W A;  2R5A A;  5CK9 A;  4Y92 A;  1LVK A;  2O31 A;  2K2V A;  3TCJ A;  3JCM b;  3QDR B;  5GAN f;  3M4Y A;  3V8L A;  3CBP A;  4RCB A;  4M77 A;  1ZX6 A;  4C92 F;  3QWY A;  1M8V A;  4KUI A;  4MZT A;  4DOW A;  1PWT A;  4F04 B;  3PVQ A;  1AVZ C;  1EX4 A;  3A98 A;  2FVU A;  4C5E A;  1W70 A;  1ZSG A;  1VQ5 T;  1K8A U;  3KUF A;  3CMA Q;  1X6O A;  4JS4 A;  2CH4 W;  2YT6 A;  1VQM Q;  2DZ9 A;  3GNG A;  2MWP A;  3Q1J A;  1D0Y A;  1VQ4 A;  1I07 A;  4MML A;  1ABQ A;  3M53 A;  2GNC A;  2GF7 A;  1W2B A;  4EIK A;  4JRP A;  2KYB A;  3CCR Q;  1U1S A;  4EMK A;  1OZ2 A;  2XKO C;  3QG1 A;  2PQW A;  3ZL7 C;  1UB4 A;  1VQ7 T;  4RTU A;  2DEU A;  2RB6 A;  1IHV A;  1N8R C;  4CRI A;  2KNB B;  1VQN Q;  1AWJ A;  4P5N A;  4DEY A;  2DIG A;  1OPL A;  2VYT A;  3QII A;  2K3X A;  1GCQ A;  2RHX A;  4KUD K;  2K9G A;  3OYG A;  2K5F A;  4J9B A;  4II1 A;  2LP5 A;  2YXY A;  1YJN A;  3EGU A;  5FWC A;  3OYE A;  2LJ0 A;  5FW9 A;  4J6Y A;  2XI9 A;  1H3Z A;  1QW1 A;  4WCI A;  4E47 A;  1NJI R;  1GFC A;  5GAN d;  1SRM A;  3UPU A;  2GGR A;  3QXE B;  1HXD A;  1VQK T;  2E12 A;  4J9F A;  2RI3 A;  3EAE A;  4JJC A;  2E70 A;  1MV3 A;  2COY A;  3FLG A;  2CP7 A;  3P8H A;  5GAN 4;  4BE1 A;  1T3L A;  4EDU A;  3HKS A;  2M51 A;  4PL6 A;  5LJ5 e;  2LX9 A;  2YUO A;  3JRZ A;  2XHC A;  1OU9 A;  4C0D B;  3ZBD A;  1KQS A;  2COZ A;  3M0Q A;  2HMA A;  1B7T A;  1SSF A;  2VXE A;  2EYZ A;  3JCM f;  4X9D A;  1WYX A;  2Z0W A;  5GAN 2;  4WTO B;  2AIR B;  2YRD A;  1I8F A;  1WA7 A;  2DYI A;  3EG1 A;  3CCR T;  1AZE A;  1MGQ A;  1VQ6 Q;  2BKD N;  2FRW A;  1FYN A;  1Z9Q A;  4LE9 A;  1N8R R;  2X4X A;  2M9U A;  5GJV B;  1CSK A;  4F16 A;  1X75 C;  5GAN 5;  3CME A;  2KRO A;  4PJO F;  3CCJ A;  2DK3 A;  3UAT A;  1UE9 A;  2CZ7 B;  3CD6 A;  4M7D D;  4FSS A;  3MJX A;  2EQI A;  3OYI A;  1WQ7 A;  1JB0 E;  4JRK A;  3DLL A;  5GAN 8;  1QKW A;  1Q82 C;  1G3W A;  2OJ2 A;  2JXB A;  2RN8 A;  3G4S A;  1RAG B;  3EH1 A;  1KC8 R;  1QVG S;  3CCL T;  3BE3 A;  3PT9 A;  2RHU A;  4ZTF A;  3PIO A;  1KG1 A;  2HQX A;  4IUR A;  1VQ9 A;  3EGX A;  2DBK A;  4FL6 A;  4J9I A;  2EVR A;  1OUL A;  1WDX A;  3CME T;  1D3B A;  1KK7 A;  4RMO A;  3SB2 A;  4HVU A;  4JRI A;  1SPK A;  3LWI A;  1VQ8 T;  2F5T X;  3S3O A;  1BB9 A;  3VU3 C;  2DL8 A;  3OBY A;  2VKN A;  1AOJ A;  4DQ2 A;  5GAN h;  4XTZ A;  2ZPF B;  2FB7 A;  5GAM d;  1VQO Q;  2MPX C;  4N0A C;  4J9H A;  4LD6 A;  3VS3 A;  3JCM g;  3E9G A;  5KYX A;  5CKF A;  5KE2 A;  3VYH B;  2FZG B;  2M02 A;  2OTJ Q;  3CQT A;  2VUB A;  1D1B A;  2DKG A;  3VS0 A;  3INZ A;  1D09 B;  2QA4 Q;  1TU0 B;  2QQ9 A;  2RJD A;  1YIJ A;  2OTJ A;  1VYV A;  1DJ7 B;  1Q7Y U;  1MMA A;  2VVK A;  1IGQ A;  1IB8 A;  5FU6 C;  1RAD B;  4C5H A;  4LDV A;  3E9F A;  3CMA T;  2QA4 T;  3CCL Q;  1G83 A;  3JSC A;  3A8H B;  3CC4 Q;  2WSF E;  4IUP A;  4Z89 A;  2DL3 A;  1K4U S;  4D6W A;  3NMZ C;  4C8Q B;  3OY9 A;  1PG5 B;  5HCK A;  1YCS B;  1YJW T;  3ZEH A;  4N4G A;  4LXC A;  3M5A A;  3R6N A;  3M0U A;  1Y96 B;  1IRX A;  2YRC A;  2PUO B;  1RAI B;  1AWX A;  3OS0 A;  2R57 A;  1PC0 A;  3QHS A;  3CCJ Q;  2C0O A;  3MO8 A;  1WXU A;  2HBP A;  4XU1 A;  4ORZ A;  3WXM B;  3RIR A;  3C94 A;  3LGL A;  2K79 A;  2JN0 A;  2YRV A;  2HSE B;  5CQY A;  1N5Z A;  4JJD A;  4J9C A;  4XK8 E;  2QEX Q;  1X43 A;  2FEI A;  1G3S A;  5GMK j;  1D0X A;  2MI6 A;  1YJN Q;  4RTV A;  4E7L A;  3OYH A;  1QCN A;  4C8Q C;  2RQR A;  4F7U G;  3EGD B;  3M0P A;  4RG2 A;  4M75 F;  4AG2 C;  5FWB A;  1MMN A;  4JJN K;  2DL7 A;  4DBR A;  2JMC A;  2E3H A;  2QDL A;  4M4Z A;  4KBM B;  4OVA A;  1X2Q A;  3HTR A;  1PKT A;  2A37 A;  1YJW A;  4C0D C;  1B3Q A;  3OA6 A;  4PKC C;  1S72 A;  1FX7 A;  4X9C A;  3CC2 T;  1LCK A;  2XU8 A;  5AT1 B;  1QVP A;  2DTH A;  4M75 B;  4Y28 E;  3CCS T;  2PU9 B;  3T9N A;  3VKI A;  2PVO B;  2RMO A;  1PSF A;  1VYT A;  1QVF P;  4FYX B;  1N9R A;  4NOY A;  4M7A G;  1TTH B;  2KE9 A;  2GQI A;  3VUB A;  2RA2 A;  2DXC A;  5GAN 7;  3I56 A;  1NZ9 A;  1UTI A;  5GAO q;  2X3W D;  1H3H A;  1YIT T;  3FC3 A;  3VUZ A;  4HT8 A;  1K9M R;  2JW4 A;  1BI1 A;  1YJ9 T;  5C6S A;  4M7D B;  4M7D G;  1PNJ A;  1RUW A;  3CCR A;  4Z8A A;  1M8M A;  1IHW A;  2DM1 A;  3CPF A;  2CH4 A;  1Y57 A;  2HKQ B;  4LUE A;  5J39 A;  1N6A A;  2KMT A;  4PLI A;  1G3Y A;  2XDD A;  1K73 C;  4PJO D;  3GF5 A;  4C8Q F;  3JCM c;  1FWZ A;  2P0K A;  1OOT A;  2JT4 A;  1WFW A;  4KT0 E;  1M2V B;  3A8L B;  4J9D A;  2E6N A;  4ANJ A;  4PJL A;  3OSS C;  1AZG B;  2DBM A;  5LJ5 j;  2LQW A;  1GRI A;  1RLP C;  4QVC A;  4IUU A;  1MHN A;  2JZ2 A;  1K0S A;  5GAN 3;  2CZ6 B;  1I0C A;  3CPW A;  2X4W A;  3NTI A;  1C6V X;  3LLR A;  4KH0 B;  4ZTJ A;  2ECZ A;  3G4S T;  4MMK A;  1H92 A;  2NUP B;  1UGR B;  2RM4 A;  3EG3 A;  4A4F A;  3REB B;  1Q86 C;  3ASK A;  2XK0 A;  4L5G A;  1MMD A;  3SHW A;  2JS0 A;  2KXD A;  2O9V A;  2HL3 A;  2OTL T;  2K6D A;  4HA8 A;  4M75 D;  3EHR A;  5GAM j;  2ZPE B;  3OW2 A;  4JRQ A;  3V7R A;  3NTK A;  3SWN A;  2L3R A;  2P84 A;  1YI2 A;  5IXB A;  3OS1 A;  2D6F A;  1ZUU A;  1QVG A;  1TSF A;  2J6F A;  2KK4 A;  1RAB B;  2ED0 A;  3QUI A;  4C92 D;  2NUT A;  2LCC A;  1JJ2 A;  2X35 A;  5LJ3 d;  3OYB A;  2KRN A;  3GNF B;  1Q81 R;  3HL8 A;  3OQ5 A;  1VQO A;  4ZNX A;  5GAM h;  2LRQ A;  3EFS A;  5CKD A;  4FYV B;  4OML A;  2DD4 A;  1GL5 A;  5LJ3 h;  1E6H A;  4DBH A;  2J05 A;  2E5K A;  1OQK A;  4J9G A;  1K9M C;  2M16 A;  1KD1 U;  1TUD A;  5KYY B;  4PNO A;  2O01 E;  3GBQ A;  2F69 A;  2MIO A;  3QKJ A;  3QZ5 B;  5A2Q E;  4C5G A;  1KHC A;  1I1J A;  1JRI A;  1QLY A;  2D8J A;  5CO7 A;  2HQH A;  5GAN e;  1D1A A;  3UA6 A;  3MEU A;  3UF4 A;  2LQ8 A;  1RAC B;  1NLP C;  3L1A A;  2QQB A;  3QZ9 B;  3P8B B;  3CC4 A;  2KEA A;  4OMF B;  3I55 Q;  3RKW A;  1ZHI A;  3CCL A;  2P4R A;  5LL6 S;  3EHQ A;  3G4S Q;  3JB9 D;  4LNP A;  4M77 E;  4E7Z A;  3QJ6 A;  1UUE A;  1YIT Q;  3CBM A;  3HPW A;  1Q86 R;  1QCF A;  3CCS Q;  4OB1 B;  1NBE B;  1M3B A;  1WQW A;  3NHN A;  4C8Q E;  4TVR A;  1MV0 B;  3C0C A;  2KY9 A;  4BD3 A;  3OMC A;  1E6G A;  3PNW C;  1RAA B;  1J3T A;  2K5L A;  3OYF A;  2W10 A;  4MDX A;  5LJ5 g;  3TSZ A;  3L2W A;  1YWP A;  4JDS A;  1JU5 C;  2JJ9 A;  1V76 A;  4L59 A;  2EYY A;  2D1X A;  3S3N A;  3OS2 A;  2EW3 A;  2QDY B;  5C0M A;  2E64 A;  4BAC A;  4A54 A;  1YI2 Q;  4R0K A;  3A1P A;  2ENM A;  3DKM A;  1NLO C;  4UC4 A;  2QGF B;  3OW2 S;  2NUZ A;  2V26 A;  5KE3 A;  1VQ7 A;  4E2F B;  3CXC A;  1NEG A;  2DNU A;  1OU8 A;  3VS1 A;  4RTZ A;  1YP5 A;  3ER0 A;  3X26 B;  4M7D E;  1T0H A;  2LQN A;  4F7U B;  3OMG A;  1W2B S;  4ATO A;  2LX7 A;  3MEA A;  3JCM W;  1WJQ A;  2YSQ A;  4M7A A;  3JCM d;  4FU6 A;  3O8V A;  2DL5 A;  3LH5 A;  4M78 F;  3MP1 A;  5AYF A;  4Z88 A;  1W1F A;  1B34 A;  2F1L A;  3ULR B;  5I21 A;  2QAS A;  1EIF A;  4BE0 A;  1KJW A;  2XMF A;  2JTF A;  1VQP Q;  2MYS A;  3QBY A;  5CCA A;  1AHJ B;  1EZZ B;  5CVI A;  1YWO A;  2EGE A;  3FJP A;  2KSS A;  2SEM A;  1ZBX A;  2BE7 D;  4AFQ C;  4EMH A;  3SDZ A;  1BCO A;  3G6E A;  9ATC B;  3JCM e;  2GCX A;  4XTV A;  1VQ4 T;  3BDL A;  2C06 A;  5GAO l;  2GQV A;  5D6Y A;  1GCP A;  2HL5 C;  1VQN A;  2MMP A;  4KGV B;  2XIC A;  2DRM A;  3CCE A;  4C8Q D;  1T0J A;  4EMG A;  1VQ6 T;  1B34 B;  1X6G A;  4A63 B;  3FB9 A;  2DXT A;  2I0N A;  4E7J A;  1QCO A;  2EQM A;  4A4G A;  4FT2 A;  2ATC B;  5FLX E;  1FMK A;  2ROL A;  2X4J A;  2HSP A;  1QKX A;  1UG1 A;  2HEQ A;  3JCM Q;  1G8X A;  3JV3 A;  2QTX A;  1QP2 A;  3REA B;  6AT1 B;  2CGH A;  4QKU A;  5KYY A;  1TG0 A;  1PD0 A;  4PK4 A;  2DVE A;  1WHK A;  4GY5 A;  4N4I A;  2VXF A;  1WPY A;  2RJE A;  2PZ1 A;  2GFU A;  5GAO m;  2JM9 A;  5LJ3 f;  2YUN A;  3VRY A;  3OS5 A;  4M77 F;  3QDF A;  5HK3 A;  3EG0 A;  1U06 A;  2DMO A;  7AT1 B;  2EIF A;  1WJS A;  1NYG A;  1VOM A;  3CC2 Q;  2BIV A;  4LN2 A;  1VQ6 A;  1M2V A;  2FPE A;  1K8A C;  1QVF S;  3M0T A;  3TEE A;  1P92 A;  1OYX A;  1MMG A;  3X20 B;  2GTJ A;  4IIM A;  4EPC A;  3M56 A;  5I2S A;  2HDA A;  2KVQ G;  1QMC A;  3M54 A;  3JB9 J;  2DIQ A;  4RUG A;  2HCK A;  4M7A D;  1MNE A;  5CKB A;  2E1H A;  1UGQ B;  4PJO C;  2EFI A;  2QEX A;  2EJG A;  4OMP A;  2J6O A;  1WIE A;  2ZPB B;  4BE2 A;  5HKC A;  4HCZ A;  5I11 A;  4M78 E;  1ZSZ A;  3BW1 A;  2I2L A;  1C1A A;  1Q95 G;  4M77 C;  5GAM e;  1VQO T;  4PJN A;  5FRM A;  2IIM A;  1K73 U;  5IHN A;  2P0P A;  2NLU A;  5CKH A;  2E3I A;  3FDR A;  1K73 R;  1X69 A;  2NYS A;  2O88 A;  1KFZ A;  1SKU B;  2LT4 A;  4ELY C;  2D0Q B;  1D1C A;  2EGC A;  1SEM A;  1TUC A;  4J7F A;  4JPB W;  4OMO A;  2JTE A;  3JCM P;  5L8R E;  5ECA A;  2EKO A;  2HQE A;  3GLX A;  2LNV A;  4XU2 A;  2MF2 A;  2CUB A;  2EJF A;  2DIL A;  3I9Q A;  1Q7Y R;  2RF0 A;  2VV5 A;  1WNL A;  1A0N B;  4BI4 A;  3CC4 T;  4GLM A;  2A7Y A;  4ZGE B;  3CCE Q;  2RQV A;  4KUL A;  3CCQ T;  1SF9 A;  4ME7 A;  2AZV A;  3I56 Q;  2GTO A;  5IXF A;  4C92 A;  2JTM A;  3OYJ A;  1Q81 U;  4M78 D;  5KYU A;  1UDL A;  5GAN 6;  3VV0 A;  1Y0M A;  4JLI A;  2SRC A;  1KQ1 A;  2CP5 A;  2KRM A;  3QO3 A;  4GLK A;  4MDW A;  3NPF A;  1TUG B;  1BK2 A;  1S72 Q;  2PVD B;  4CC2 A;  2R58 A;  1ZSZ C;  4CI0 C;  1G5V A;  1K76 A;  1SG5 A;  1Q82 R;  1HD3 A;  2LDM A;  1VQ9 Q;  1M3A A;  1UEC A;  3M9Q A;  2DPP B;  3SD4 A;  3IQL A;  1VQN T;  1KC8 U;  3JB9 H;  2CP3 A;  2BTT A;  2LMJ A;  4J5Y A;  1KC8 C;  3RUX A;  2C0I A;  4IUT A;  4J9E A;  1EFN A;  1NPP A;  1Q86 U;  3G71 T;  3C4S A;  2G3R A;  4FCY A;  1UHC A;  4M75 A;  1VQ8 A;  3JCM X;  3J81 E;  4HXJ A;  2CT4 A;  3M0S A;  5CAI A;  4NL2 A;  2L89 A;  1PKS A;  3S3M A;  1ZBJ A;  4FM4 B;  3PGG A;  1K8A R;  2RPN A;  4ELZ C;  1X2K A;  1YHQ A;  4XTX A;  2QG9 B;  2CYZ B;  4VUB A;  1UGS B;  3CCM A;  1JXM A;  2EYX A;  1D3B B;  1GBR A;  4ESR A;  2HZY A;  2BZY A;  3CCU T;  3BFM A;  3CCM Q;  3NGP A;  2KI7 A;  1SHG A;  1HSQ A;  1YHQ Q;  1M1K C;  1BCM A;  4Q5W A;  2YLC A;  2C0T A;  1BIB A;  1QP3 A;  3I55 T;  8ATC B;  1BU1 A;  2OTL Q;  4F17 A;  2KT8 A;  3PMT A;  1RAF B;  2HBW A;  2LNH B;  2DO3 A;  5I2M A;  3CCV T;  5KYX B;  2LJ1 A;  2DYB A;  1LPL A;  4LDY A;  3PIP A;  2A28 A;  2ZPI B;  4MZM A;  2F5K A;  4RKU E;  4BDZ A;  3R6O A;  4LDU A;  4PJM A;  4CC4 B;  2RO0 A;  4OP0 A;  4C5I A;  4LUD A;  4XAX B;  1JEG A;  2ABL A;  5GAO n;  2O4X A;  1NG2 A;  1ZQ1 A;  3VYG A;  2F2V A;  2DD5 A;  1PRL C;  3OYY A;  2B86 A;  3CPW S;  2K57 A;  3E1S A;  4F7U A;  3RES A;  5KH6 A;  1WXT A;  5KYW A;  3L2Z A;  5HK0 A;  2JM8 A;  1HK9 A;  3MKD A;  3LWH A;  2MAM A;  3CCS A;  2VWF A;  4RTX A;  3CD6 T;  1WJR A;  5CKE A;  4N4H A;  5GMK i;  3VS4 A;  1YFN A;  4DBQ A;  1AD5 A;  3I55 A;  1IGU A;  4BI3 A;  4OMN A;  2Y90 A;  2VC8 A;  5GMK h;  3BDU A;  3JCM V;  3CXC S;  2DL4 A;  3L2R A;  3X28 B;  2DAQ A;  3LW5 E;  2FL7 A;  1ACM B;  1X6B A;  1NJI C;  1ABO A;  1WX6 A;  2DE0 X;  5KYU B;  3VS6 A;  1FMV A;  5GMK e;  4QQG A;  2PNI A;  5DY9 A;  3P8D A;  3GP8 A;  3L42 A;  1QWE A;  1H64 1;  2EKH A;  4M77 D;  4IKF A;  2XID A;  4R56 A;  2CRE A;  4R55 A;  1YJN T;  5FU7 B;  1N8R U;  2J06 A;  3CCQ A;  1WI7 A;  2QQS A;  1ZLM A;  2NWM A;  4ZGJ B;  1AT1 B;  1M90 U;  2M0Y A;  2K2M A;  2ZGW A;  2IG0 A;  3RR6 A;  1S72 T;  4XTU A;  3ZFJ A;  1XQH A;  3CBO A;  2AT1 B;  5LJ3 g;  2KT1 A;  4PJO A;  2DEQ A;  2AKK A;  4C92 G;  5GAM g;  4JUV A;  1PCX A;  1KD1 R;  1TXQ A;  3HSB A;  5LJ3 j;  3EH2 A;  4M78 B;  1W6X A;  1PM3 A;  3UWN A;  3QSU A;  1X27 A;  1WHH A;  4A4E A;  5DLO A;  3OYM A;  4C92 C;  3WVD B;  5GAO p;  3NTH A;  3PE0 A;  1LJO A;  3HFO A;  3SWN B;  1BIA A;  5GAN j;  3GOX A;  4M77 B;  3I56 T;  3PFS A;  1R8O B;  1V29 B;  1YIT A;  4KH1 B;  4OGE A;  2O9S A;  1Q82 U;  1WHL A;  3TRE A;  2E65 A;  2RQT A;  1IXD A;  1K9M U;  1SRL A;  3CC7 A;  4PJO B;  3KFV A;  1VQ4 Q;  4RTT A;  1M9S A;  4X34 A;  2OTJ T;  4XTW A;  3GPL A;  3RBB B;  3DB3 A;  2QEX T;  1WHM A;  2PUK B;  5J26 A;  3LGF A;  5EC7 A;  2EBP A;  4HCK A;  2F2X A;  2LQK A;  3JB9 G;  1GBQ A;  3CMA A;  2AHJ B;  3CC7 Q;  2A08 A;  1WHG A;  3LYI A;  4D8K A;  2RHI A;  1UHF A;  1UFF A;  2DXB A;  2RHZ A;  1VQM T;  1AWW A;  1CKA A;  1UGP B;  2G6F X;  1YBY A;  2KAF A;  3H0I A;  3MET A;  4F14 A;  4OB2 B;  5KYN A;  5EG2 A;  4FIB A;  2PVG B;  2LCL A;  1ZSZ B;  4CC3 A;  4EMK B;  1YJW Q;  3DLM A;  3H0H A;  2FZC B;  4KGX B;  2JVV A;  3THK A;  3H9N A;  4HCC A;  4AG1 C;  2CSI A;  2FO0 A;  1NE8 A;  2EAY A;  2IVW A;  5LJ5 h;  1VQL T;  3JAM E;  4PJO G;  3QWX X;  2RQU A;  3EFO B;  3UA7 A;  3L2U A;  1K9A A;  2YUQ A;  4OMM A;  2LVM A;  1IRE B;  2YWW A;  1SSH A;  1X01 A;  1M4Z A;  2HNI A;  3OYL A;  4M7D F;  1Q7Y C;  2BZX A;  2RK2 A;  3OSV A;  3V8J A;  2GFA A;  1ZA2 B;  1RLQ C;  3AT1 B;  3VJP A;  2CP6 A;  4OB3 B;  5KCO A;  1VUB A;  2YHT A;  4NS5 A;  4JZ3 A;  5KCH A;  2RI5 A;  2LC4 A;  1M27 C;  3EFO A;  2E41 A;  2LJ3 A;  2CZ1 B;  2FYK A;  3MEW A;  1WZO A;  3EGD A;  3CCM T;  1RI9 A;  2X9H A;  3I35 A;  2CDT A;  4E6R A;  1VQK A;  3QJY A;  2RNA A;  5I22 A;  1VQL A;  2VGM A;  2LZ6 B;  2RD1 A;  3CXC P;  2R5M A;  4M75 G;  5GAM f;  4RCC A;  3U23 A;  4A4K A;  1XTD A;  1AEY A;  3FJ5 A;  1G2B A;  2MWO A;  3C95 A;  5CQX A;  3CCE T;  3CCQ Q;  1KIK A;  3RKX A;  4C8Q A;  3G7Z A;  4QQ6 A;  4C0F A;  5FRO A;  1TWB A;  3PMI A;  3AHU A;  2LTO A;  1JO8 A;  1HYO A;  4FYW B;  5A0D A;  2FPD A;  2K5I A;  2QA4 A;  2L2P A;  3MHX A;  1UJ0 A;  1Y96 A;  4FW2 A;  5IN1 A;  2MK5 A;  2KGT A;  1YJ9 Q;  2A36 A;  4BI8 B;  3KXT A;  4XU0 A;  4Z02 A;  4J6X A;  3J7A F;  4M7A C;  2FZK B;  1PRM C;  1WGS A;  1WXB A;  2RQW A;  2OAW A;  3OB9 A;  1W4S A;  2MOX A;  1S1N A;  1VQ5 A;  3LH0 A;  1OPK A;  4PFZ A;  5IHK A;  3MPU B;  2EQK A;  5FRN A;  3FRN A;  3H6Z A;  2O4X B;  1JBM A;  2BZ8 A;  1U5S A;  1OV3 A;  2EJ9 A;  1VA7 A;  1M2O A;  1NPR A;  2KYM A;  2RJF A;  4N0A A;  2DXU A;  1BI2 A;  5IHI A;  1RL2 A;  2DLP A;  1GCQ C;  1SHF A;  2ROT A;  2QYZ A;  3WVE B;  1U8R A;  1PHT A;  4DOV A;  2JUF A;  1BYM A;  3A5Z B;  3I5S A;  4M77 G;  2X4Y A;  3HFN A;  4JLG A;  2L0A A;  4LDW A;  1PD1 A;  2B8A A;  2YDL A;  4M7A F;  2OTL A;  3EFR A;  1Y07 A;  3D7S B;  3L2V A;  3LX7 A;  4BY6 B;  2DVJ A;  3SFM A;  2KRS A;  4XTY A;  4RG8 A;  1WLP B;  4A53 A;  2P0Q A;  2JNG A;  2VGN A;  1RAH B;  4C0Z A;  1JJ2 P;  2M0O A;  1QVG P;  3A8O B;  4F7U F;  2JS2 A;  4M7A B;  5IT9 E;  5A0L A;  4HCB A;  2DRK A;  4FW1 A;  2F2W A;  1LOJ A;  1IZ6 A;  4JJB A;  5D6X A;  2EGA A;  4OGC A;  1M90 C;  2L3Q A;  1VQ5 Q;  2XG8 D;  5GMK m;  2QK0 A;  2DX1 A;  3H8Z A;  4IIO A;  1VIF A;  4HT9 A;  1M1G A;  4M78 C;  2OX7 A;  3HP9 A;  3RKY A;  3PVL A;  1ZUY A;  1I81 A;  2XDP A;  2RH2 A;  4C92 B;  1YJ9 A;  3OYK A;  2HAX A;  2HKN A;  4KGZ B;  1YNZ A;  1R77 A;  4M78 G;  1M1F A;  1R0B G;  4PFP A;  2K3B A;  1KQS S;  4J8O A;  4X1V A;  3GIB A;  1TS9 A;  4OB0 B;  2XDB A;  4FYY B;  2DJZ A;  4DEX A;  1N9S A;  3RDV A;  1OX9 A;  1YCY A;  1G3T A;  2W0Z A;  1OZ3 A;  1I5L A;  2H8H A;  4HKE A;  4KRT A;  2LT1 A;  4DBF A;  4C8Q G;  1VQL Q;  3N5B B;  4ZGD B;  1M1K R;  2K3Y A;  2V8J A;  1BI0 A;  5LJ5 f;  1C0M A;  2ED1 A;  2DZC A;  4CC7 A;  2CSQ A;  1MUZ A;  3C12 A;  2A3L A;  2EQU A;  2CP0 A;  2DET A;  4O6J A;  4AFU C;  3M58 A;  4GBQ A;  4PJO E;  2COW A;  3G71 Q;  4IUV A;  1YIJ T;  4V2S A;  1UEB A;  1V1C A;  3CC7 T;  3TSW A;  1Z9Z A;  1QVF A;  1YI2 T;  1QQJ A;  2CUD A;  2EWN A;  3G71 A;  3H41 A;  2L8D A;  2GBQ A;  3EG9 A;  2JOY A;  1K0X A;  1M30 A;  1FXX A;  4E7S A;  4WF2 A;  4B9X A;  1VQM A;  2VB6 A;  3MP8 A;  2CKK A;  4OF1 A;  1Y7X A;  5LJ3 e;  1KD1 C;  3EGX B;  1KSW A;  3FEO A;  1KHI A;  2FRY A;  8AT1 B;  4AFZ C;  2L5Q A;  4EMK C;  4D8D A;  3CC2 A;  4YTL A;  4NL3 A;  2WSC E;  4QQD A;  1CKB A;  2YLB A;  1K1Z A;  1E7O A;  4M7A E;  1Q81 C;  3V8K A;  3VRZ A;  3MCA B;  2QI2 A;  3JCM h;  1ZUK A;  3F70 A;  2O2O A;  2V8K A;  1NM7 A;  4A4H A;  2V1R A;  2YUP A;  1RI0 A;  2D0N A;  5GAN g;  1OEB A;  1ZA1 B;  3M57 A;  2RI2 A;  2J6K A;  1F1B B;  4B6M A;  2K7A A;  5M9O A;  1U3O A;  3JB9 I;  3TQ7 P;  2AZS A;  3H0F A;  3FIF A;  2HD0 A;  3VS5 A;  4F7U E;  1KQ2 A;  5CR2 A;  3ME9 A;  4OMQ A;  1BI3 A;  3KBG A;  2KBT A;  1TH7 A;  2D9T A;  2X3X D;  1OI1 A;  4BDY A;  2BUD A;  3E2U A;  2L3P A;  2OI3 A;  3MP6 A;  3NFC A;  1MND A;  4M75 C;  3TU4 K;  2A0F B;  1KQS P;  1NJI U;  2EYW A;  5IH2 A;  3OYA A;  3CCU A;  3CEY A;  5FU7 C;  4DA4 A;  2CT3 A;  3OYD A;  2EYQ A;  4RTY A;  2QXF A;  2DER A;  3OBW A;  4Y91 A;  1UGV A;  3RMQ A;  5LJ5 d;  3URG A;  1UJY A;  1T3S A;  4PLL A;  2EPD A;  2AK5 A;  1I5O B;  3VS2 A;  2KQW A;  4E7I A;  2QQR A;  2KXC A;  1IO6 A;  2RHY A;  1JJ2 S;  5IAY A;  2ZPH B;  5HY6 A;  2V8I A;  3HRU A;  3G1J A;  1YIJ Q;  3EG2 A;  2CZ0 B;  4M78 A;  1VQ7 Q;  2ZPG B;  4MZP A;  1D0Z A;  2QGG A;  1VQP T;  2CS7 A;  5DLQ E;  1W2B P;  3DB4 A;  3M55 A;  1JQQ A;  3QYG B;  1NEB A;  3X25 B;  4RTW A;  2M1H A;  3A8M B;  4M7D A;  1VIE A;  2X51 A;  2RJC A;  3OW2 P;  3X24 B;  1M1K U;  2ZAE A;  5DM7 R;  1BKB A;  1NYF A;  3SEM A;  3JCM J;  4O5V A;  3M59 A;  4C0G A;  2QQA A;  2RK1 A;  4E7K A;  1M3C A;  4BY6 C;  2P4T A;  3L2Q A;  1XJW B;  1JXO A;  5J3B A;  2E6Z A;  3OYN A;  3CCV A;  2FHD A;  2DF6 A;  2VAS A;  1XNI A;  2V1Q A;  1AWO A;  3M0R A;  5GJW B;  3G6E Q;  3V7S A;  1Y71 A;  1LNX A;  1B07 A;  4J6W A;  3CPW P;  4J83 A;  4L6V 5;  5FU6 B;  3CCV Q;  1GFD A;  5L23 A;  4QVZ A;  3MEV A;  4ZN1 A;  4QW2 A;  2DJQ A;  2Y4Y A;  4QT7 A;  4C92 E;  2AKL A;  1VQP A;  1O9S A;  2DTO A;  1ARK A;  3QYH B;  2Y4X A;  3PTA A;  5GAO r;  5CIU A;  2ZCF B;  3CCJ T;  4XQ3 A;  2DFU A;  3RNJ A;  2BE9 B;  3TVT A;  3RMS A;  4HVV A;  3RER A;  4JS5 A;  2MCN A;  4BB7 A;  4M7D C;  5A0G A; 
#chains in the Genus database with same CATH homology
 2CP6 A;  2QK0 A;  2COZ A;  1TOV A;  2CP5 A;  3E2U A;  1WHM A;  2E3H A;  2MPX C;  2CP2 A;  4B6M A;  2CP3 A;  2COY A;  2Z0W A;  3TQ7 P;  3RDV A;  2E4H A;  2CP7 A;  2E3I A;  2CP0 A;  1WHL A;  1TXQ A;  1WHG A;  2HKN A;  2HQH A;  2HL5 C;  2HKQ B;  2M02 A;  1IXD A;  1WHK A;  1WHJ A;  2HL3 A;  2COW A;  1WHH A;  1LPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...