1TOVA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
NESDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Cytoskeleton-Associated Protein Glycine-Rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein F53F4.3 in chromosome V
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1tovA00
2HQHA 3TQ7P 1WHLA 2E3HA 2CP6A 2CP0A 1WHGA 2CP3A 2MPXC 2HKQB 2CP2A 2Z0WA 2CP7A 2COYA 2HKNA 4B6MA 2M02A 2COZA 1WHKA 2E4HA 1TOVA 2HL3A 3RDVA 1WHHA 2QK0A 1WHMA 1LPLA 2HL5C 2CP5A 3E2UA 1TXQA 1IXDA 2E3IA 2COWA 1WHJA
chains in the Genus database with same CATH superfamily
2K2VA 3VRYA 4PFOA 1WHLA 3X28B 1KQSA 1SEMA 1NM7A 4X34A 5CK9A 2LNHB 1K0SA 2CP7A 5C6SA 5GANh 4M7AG 2L3QA 3QWXX 3CCMQ 3VS3A 3NMZC 2JXBA 4PFZA 2KE9A 3QJYA 2DVJA 5KCHA 2KGTA 1AVZC 3EHRA 4BACA 1JJ2A 3JCMf 2KYBA 2KY9A 5L8RE 1VQPQ 2MPXC 4OP0A 3JCMX 3OYFA 3CCUQ 1AZEA 3HHTB 3EG9B 3V7CA 3VRZA 1WHHA 5GANj 4F7UG 5A0DA 1UGRB 3X25B 5FRNA 1M27C 1ARKA 3QHSA 3OYGA 1C6VX 1M1GA 1U06A 3CCVT 2VXEA 3C12A 1RACB 4RG2A 2DETA 2M0YA 4AFZC 4RTYA 4M75D 1M90R 4C0DC 3DKMA 3OYKA 4M77E 2K3YA 3L42A 1YJNQ 1XOVA 4M7AB 1W2BA 2QASA 4JDSA 1X6OA 3FIFA 4LE9A 3UA6A 4MZPA 5GAOp 2A3LA 2O9VA 1JXMA 1RLQC 2MCNA 4RTVA 4M78E 3VS7A 2D0QB 1Y71A 2DK3A 1I5OB 2JT4A 3CCRT 4KUIA 3OSVA 4A4FA 4CC7A 2HCKA 3OYDA 2LX7A 1IB8A 4RG8A 5GAN2 1D1CA 3G6ET 5HK0A 1UJ0A 3UT1A 3G7ZA 3PIOA 1NJIR 2E12A 4EMGA 2JZ2A 1QLYA 3EH2A 1BKBA 5LJ5f 2JW4A 4D6WA 2QDYB 2E4HA 2ZCFB 4FL6A 2VGNA 1K8AU 2R58A 2DMOA 3JSCA 1KSWA 5HK3A 3JAME 5I22A 3OYYA 3GBQA 1I8FA 2EJGA 2JMAA 1KQ1A 2DBMA 3OYHA 2HZYA 1WLPB 1D3BA 1H641 1ZHIA 2DX1A 2LX9A 1OV3A 1ZUYA 3OYEA 2I0NA 1ZSZC 2CSQA 2J6OA 5LJ3d 2RHUA 4OMPA 3TU4K 1Z9QA 3I55A 2E41A 2E6ZA 2ZAEA 2BUDA 1OQKA 3H9NA 2RJFA 3L2UA 5CKDA 3RMQA 4N4IA 4LDYA 4M7DC 5D6YA 3ZEHA 2RHXA 5GMKh 1UGQB 1PCXA 1E6HA 3OQ5A 4M7DB 3L2WA 4XTXA 1RABB 2VV5A 1NEBA 4R55A 1T3LA 4C8QG 3OYLA 2A0FB 3GF5A 1QCNA 4LD6A 4HCZA 4M78A 1ZSZB 3OS0A 2LJ3A 2P84A 3PIPA 3UATA 1MMNA 2QI2A 3NTIA 1UHCA 2DXUA 5LJ3e 2D9TA 2JVVA 2QQ9A 1VQPT 1YN8A 2LCSA 1U5SA 4JLGA 2DFUA 4RTUA 2MYSA 2MK5A 1B34B 2QXFA 3QKJA 3FLGA 1GCQC 1KJWA 2LC4A 4PNOA 3DB4A 3I35A 1Q82U 3M0QA 3RERA 1AWWA 1HYOA 4OMFB 1ZSGA 1VYVA 1IO6A 5CO7A 1YHQQ 4Y91A 3SFMA 3QUIA 4C5IA 1OEBA 4XAXB 4BE2A 2EYQA 3BDUA 4YTLA 4C8QC 2FPFA 1D3BB 3CCUA 1VQ5T 4R56A 2PTKA 4J9CA 2BE9B 2HQHA 1QWEA 4HT9A 4M75A 1IREB 4EMKA 3O5ZA 1VQ8A 4FYWB 1SKUB 2RB6A 2RQTA 4C92F 3BFMA 2CKKA 2PNIA 1H3ZA 1YP5A 1BK2A 3ME9A 5FWCA 1YIJQ 4RCCA 2O4XB 3CCRQ 1Q82C 1G3SA 2HMAA 2HSEB 3CCQQ 4IIMA 2HD0A 4XU3A 1M90U 1D1BA 1CSKA 4ZTFA 4FM4B 3INZA 2FPEA 4JRPA 2VGMA 1MHNA 2HEQA 4M78D 5A0GA 1HSQA 1WFWA 1CKBA 5L23A 4UC4A 2D0NA 3KBGA 2LT4A 2ROTA 4M7AD 3O8VA 3CQTA 3L1AA 3V7SA 1QVPA 2CP6A 2IIMA 4JUVA 2EIFA 1NEGA 4E7JA 3LGLA 1X2QA 1KQSS 2KBTA 2LP5A 1Y0MA 2RMOA 3CCET 4F16A 2QGGA 2KROA 1Q7YU 1YI2T 1VQ4T 1TTHB 4F17A 3CCLA 1TUGB 1NZ9A 1WJQA 2KRSA 1H8KA 3GOXA 2JUFA 2EAYA 2NUTB 2PVGB 4HCBA 2DF6A 3I56Q 3MJXA 3PMTA 4ANJA 4JJBA 5GMKj 2P0QA 2YLBA 4XK8E 1YITQ 3CCSQ 3FJ5A 2RI5A 1SSHA 2L3RA 4PLIA 2M9UA 5D6XA 3V8JA 4ZN3A 1RI9A 2KI7A 4XU1A 3MP6A 2JS0A 5FROA 3LWIA 2LQWA 5IHKA 1PRMC 2YUOA 1K0XA 3KXTA 2NUPA 4QVDA 1KHIA 3GNGA 1E7OA 2DE0X 3JCMg 3G4SQ 2LT1A 3CCJQ 4MMKA 2K5IA 3I56A 2FZCB 2FG0A 1UFFA 2QDLA 1X27A 4KGZB 1YHQT 1SHFA 5IHNA 3RIRA 5KYWA 1YJWT 2GNCA 2CS7A 1Y96A 3G71T 1WA7A 3PE0A 2VKNA 4OB3B 3A8HB 3EH1A 2P0PA 4J7FA 3WXMB 3JCMc 5GAMd 4FW1A 1OI1A 2QAZA 2OJ2A 5FLXE 3CC4A 2RQRA 3JCMQ 4X9DA 4C92D 2E1HA 4Q5WA 4NL3A 3M5AA 2DTHA 3E2UA 2L3SA 2NUPB 4IUUA 4HVWA 3VV0A 4PLLA 1UB4A 1AEYA 2YUNA 2YT6A 5IXBA 1KC8C 1VQ7Q 2LCLA 2O01E 3OW2P 1QMCA 3H41A 5GAOn 5I2MA 2K9GA 2DYIA 3PT9A 3DLLA 3UWNA 1RUWA 1RAHB 4AMCA 1RADB 1K73R 2XG8D 2A36A 2CZ6B 1G3WA 1CKAA 5GAMe 2GBQA 1WXUA 4KGVB 2LMJA 2R5MA 4E7LA 1QKXA 2E10A 4IIOA 1K76A 1PSFA 1Q86U 1T0HA 4JJCA 2QTXA 2EQKA 4XTWA 5GAMj 4DOWA 3QBYA 3MEVA 2YWWA 4J6XA 3OW2S 1M3BA 3HRTA 3ASKA 3RBBB 5LJ5h 1Q82R 3VS6A 4F7UF 4IKFA 4QQGA 2XIDA 5GAOq 2DL5A 3QYGB 2PVOB 4HCKA 1NPRA 1UHFA 2DERA 1R0CB 2DLPA 3JCMV 2MWOA 4ZN1A 1OPLA 1SG5A 2KAFA 1TWBA 3QZ9B 1N8RR 1YCYA 1NJIU 3CBPA 3EFRA 4CC4B 1PNJA 4E7SA 2DVEA 3MEUA 2DPPB 1VQ8T 1YJNT 2V8JA 2RQVA 2RI3A 1QP2A 2BIVA 2NUZA 4HVVA 1VQKQ 5CR2A 2JOYA 2XK0A 2CUDA 2JTEA 5I2SA 2MIOA 4AG2C 4RKUE 4Z88A 2RJEA 3OS1A 1WZOA 2KNBB 4FYVB 3LH5A 5CKEA 4EIKA 1ACMB 1YJ9T 4LUDA 1RI0A 4M75E 4ZTJA 4LDUA 1PD0A 2Y90A 1QVFP 4C8QD 4L5GA 2IPOB 4EMKC 2OTLA 2FL7A 2CZ1B 2AHJB 4JS5A 4JS4A 1WGSA 3ZFJA 1FWZA 4J7IA 1T0JA 5GAN6 3A5ZB 3QPHA 4ATOA 1YIJT 1K8AC 3QDFA 1VYTA 2AKLA 5GMKe 1QVGA 2RQWA 1S72A 3GNFB 3LW5E 2VYTA 1K9AA 1UJYA 1WPYA 5J3BA 3JCMP 1M1FA 1N8RC 2OTJT 4M4ZA 3LH0A 1PRLC 4GLMA 3VS5A 2QG9B 4HVUA 4EDUA 1HXDA 2M02A 5GAN8 3URGA 5J39A 2JMCA 3MPUB 3ULRB 1QVFS 2HDAA 1TS9A 5LJ5d 2E5QA 1B3QA 3I55Q 3R6OA 4LDWA 1M1KC 1PKTA 2ED1A 1BI2A 4B9WA 1KK7A 2DRKA 3CCEA 3QSUA 2YUQA 2XDDA 2F2XA 1BI0A 3E9FA 4XTYA 5AT1B 4JZ3A 8ATCB 3C0CA 4OGCA 2KT8A 3QDRB 1VQKT 2XD0A 1QVGS 2V8IA 2MAMA 4M7DF 2OTJA 3VS0A 3G1JA 1YHQA 1MV3A 3VYHB 5GANf 2VC8A 2DEQA 1D09B 2BZYA 4C0FA 3TCJA 2P4TA 4C0ZA 3CD6T 4XTZA 3TREA 5IHIA 1X43A 1X2KA 4QVCA 3MCAB 2B8AA 2HKNA 1NBEB 2AZVA 3Q1JA 3META 4M7DA 5DLOA 1JXOA 2LRQA 2PZ1A 1VQOT 1WXTA 1Q81R 2RPNA 2EYZA 5LL6S 3FRNA 4C8QF 4BI8B 3WVEB 2SEMA 1G5VA 3P8HA 4KH0B 2FZKB 4V2SA 3JRZA 3OW2A 2DEUA 3CXCA 4ZGEB 4LNPA 2M0OA 3M0RA 3OYAA 1IZ6A 2D8HA 4NOYA 3N5BB 2OTJQ 1FX7A 1PWTA 3GIBA 4A4EA 5KYXB 1IXDA 2PUOB 3C94A 1V76A 1ZQ1A 5A0LA 1JRIA 3OA6A 1KHCA 2QEXA 1MNDA 2DO3A 3HKSA 1NJIC 1AOJA 2G3RA 1KD1R 1YWOA 2CGHA 1VQ4A 5LJ3f 1GCQA 3M55A 3S6WA 2V8KA 4MMLA 1PKSA 4C5EA 4C92B 4RTZA 3HRUA 3ZL7C 3A8GB 1K8AR 3HFOA 3VUBA 5IXFA 2DL8A 1D0XA 2XDPA 1XJWB 4C92C 2LNVA 1UEBA 2K5FA 1PHTA 5GANd 4XTVA 3BY7A 2L8DA 1G3TA 4M75C 4J9BA 4KBMB 4AFSC 2OAWA 2OTLT 4C92E 2FZGB 3JB9H 1GCPA 2GQVA 4B9XA 3L2VA 4ELZC 1EX4A 2EBPA 1W2BP 4Z02A 2COYA 5CKBA 1TU0B 2MI6A 5IN1A 5LJ5j 2ZPEB 5EG2A 3RUXA 2J06A 3G6EQ 2FRYA 2HAXA 2FRWA 3JB9F 2DZ9A 3M9QA 4OVAA 4QT7A 1FMVA 3OYMA 4N4GA 3CD6A 3H0FA 2J05A 1YI2Q 3RNJA 1M2OA 2CT3A 4JPBW 1Q7YC 1B7TA 5LJ3j 2CZ0B 4N0AA 1VQNT 4M77B 4OB1B 4C8QB 2RK1A 2KQWA 1U1SA 2F5KA 2NWMA 3S3MA 1SPKA 4ME7A 5M9OA 3DB3A 2RHYA 3FC3A 3C95A 4XU2A 4M78C 2K3XA 2OX7A 1KC8U 1NE8A 4HCCA 1AZGB 2Y4XA 4BY6B 3MO8A 2E5KA 4X9CA 2WSFE 2K2MA 1X6GA 1YITT 1VQNA 2HKQB 2Z0WA 1VIFA 1GFCA 1I1JA 1I07A 4C92A 4KRTA 2HL3A 3CCLT 4M77C 5DY9A 2QQSA 1M3CA 3SWNC 5FU7B 1TXQA 5GAN7 4LDVA 1TUDA 1MMAA 3QG1A 4BDZA 4M7AF 1VQ7A 2IVWA 1NPPA 2O88A 3OYJA 2DBKA 1PM3A 4MDWA 4RTXA 1UECA 3EG3A 5CVIA 3CMAA 3CCJT 2EJFA 2L0AA 3OBWA 2KK4A 2HNIA 3EGUA 5GAOm 4E7IA 3EHQA 4PJOB 1OU9A 2J6FA 4F7UA 3TSZA 1NG2A 5CQYA 1YBYA 2OAUA 2I2LA 5IAYA 3PNWC 2X4WA 5KYYA 4AFUC 1Y57A 3NFCA 3CMET 2V26A 4HA8A 1G83A 5D7UA 4KH1B 1Q81C 1OZ2A 3SWNA 4KULA 4J9GA 3CMAT 2QEXT 5CCAA 1WIEA 5IT9E 5LJ5e 2QA4Q 1YJWA 2ZPHB 1RAGB 1UE9A 5CIUA 3CCVQ 4EMHA 3IQLA 2QQRA 3EG9A 1W1FA 2A7YA 2JNGA 1BYMA 2ZPFB 1Q7YR 4RMOA 2RNAA 5CAIA 1Q81U 4IURA 5LJ3g 3ER0A 5FW9A 1WNLA 1VQLQ 4J6WA 3OYBA 3LYIA 4OMMA 2NLUA 2RO0A 3MP1A 5GAN5 2DIGA 4WTOB 2L89A 2DD5A 5HCKA 1P92A 3HL8A 2COWA 5KYYB 2K5LA 1MGQA 1K1ZA 4C92G 1LJOA 3TQ7P 3M54A 2EGEA 3CC7T 1FMKA 1OZ3A 2ROLA 3RESA 4AG1C 4TVRA 2GFAA 4F7UE 4Z8AA 2F2WA 4A54A 2D6FA 1X01A 4QKUA 4ELYC 1EFNA 2EVRA 2RN8A 4XU0A 1ZA1B 4PJOF 1RAEB 2MOXA 4HXJA 1S72Q 4DBRA 5KE2A 4ZGDB 4JJNK 5KYNA 3RMSA 3CPWS 1ZBXA 2KRMA 1JEGA 2LCCA 1ZX6A 2DZCA 6AT1B 2A08A 1Y7XA 2F5TX 4PK4A 3E9GA 1BIBA 1YI2A 2AKKA 3RR6A 2JS2A 3L2QA 1FYNA 5KYWB 4DEXA 1WX6A 2EPDA 2Y4YA 3UPUA 4IUQA 1LNXA 1UGPB 4XQ3A 2GCXA 2O2OA 4Y92A 1O75A 2JTMA 3HRSA 2XHCA 1VQMQ 1O9SA 2HL5C 4C8QA 3CC2Q 1KQSP 2CSIA 2K6DA 4A4GA 4JJDA 1XQHA 2A28A 2R57A 2CUBA 1VQLT 1F1BB 2AZSA 3CCMA 3LWHA 1YITA 1M90C 4PJOC 5CKHA 4RCBA 1I5LA 4OMOA 2FB7A 3S3OA 1D0ZA 1ZUUA 2LVMA 2CREA 2QK0A 4OGEA 3CCEQ 3CMEQ 1Q86R 3V7RA 2QQBA 4OMLA 1KFZA 2F1LA 2X4YA 4WF2A 2EQJA 1AWXA 5GAN4 1EIFA 5GMKm 4FSXA 4IUTA 1M8VA 3GPLA 1LCKA 2CT4A 1YFNA 3U23A 2QA4A 4F04B 4N4HA 2QGFB 3QIIA 2RI2A 1RAIB 2X9HA 4M77D 3CCMT 1YJNA 2EKOA 4IUVA 4M7AE 2BKDN 3E1SA 2X35A 5GMKl 4E7ZA 1KD1C 3M0TA 1J3TA 2GGRA 1PG5B 3QZ5B 1B07A 3GP8A 1VQNQ 1BIAA 1M5Q1 1QP3A 1IGQA 4N0AC 5GJWB 1U8RA 1X69A 3DLMA 3CPWA 2IG0A 2KSSA 2FPDA 3OMCA 1ZBJA 3JB9G 2EYWA 1VQ9A 4PL6A 5GANe 3NTKA 4OMQA 2KDSA 1QW1A 3CCJA 2VXFA 1ZSZA 1BBZA 2EGCA 3TVTA 2RA2A 4PJOA 4O6JA 3LGFA 2CH4W 2ESWA 3FEOA 5I11A 3JB9I 3CCQT 1JB0E 2LJ0A 3EG1A 1RAAB 1IGUA 1G2BA 5HKCA 1ZUKA 1V29B 1K9MC 4E7HA 2DD4A 1WHJA 2KXCA 2DL3A 3HSBA 4XTUA 4JRKA 2RD1A 4CC3A 4KT0E 3VYGA 1I0CA 2QYZA 4PJOD 4CC2A 3EGXA 1QCOA 3L2RA 3OYCA 3AHUA 2YLCA 2K57A 1UGSB 2ZZDA 3GLXA 1QWFA 1KG1A 3RDVA 5FU6B 3OMGA 5KH6A 2DA9A 4C5GA 2LZ6B 4CRIA 4DA4A 3X26B 3G4SA 4M75F 1Y96B 1N5ZA 1GXIE 4QVZA 1QQJA 1RL2A 2GTOA 3MHXA 3QYHB 1OYXA 1I81A 3H0HA 3MKDA 4LN2A 2VVKA 3HFNA 5GJVB 2R5AA 4Z89A 5A2QE 4GLKA 5DLQE 2L3PA 5FWBA 5KE3A 3BDLA 2DTOA 1D1AA 1YNZA 3VU3C 2QEXQ 2DYBA 2FHDA 4D8KA 4OF1A 2RJCA 4F7UB 2ENMA 2QA4T 1N8RU 1UG1A 2JM9A 3OS5A 4NL2A 2LQNA 3VS4A 2F2VA 1K73U 4M7DG 3CEYA 1PC0A 1WHMA 5J26A 1V1CA 3UA7A 4PJNA 4PJLA 4J9DA 5EC7A 5GAMf 3UF4A 1D0YA 1OULA 3EFOA 4LXCA 3QO3A 4MDXA 3J80E 1FXXA 3PFSA 4F14A 3CPWP 2CH4A 2C0TA 3EG2A 5D6WA 3PMIA 1K4US 1U3OA 1VQOQ 4J9EA 2KYMA 4M7DE 4R0KA 1TSFA 2VUBA 2RJDA 4A53A 1VQ8Q 2EQMA 2CYZB 3OB9A 4FYXB 1VQKA 2QTVA 4JLIA 1WHGA 4HT8A 4M7AC 1OPKA 1VQ4Q 1N9RA 1VA7A 4KGXB 2KEAA 1JO8A 1K73C 1VQ9Q 2WSEE 1TOVA 4DBHA 5GAOr 1W6XA 1YJ9Q 4II1A 5KCOA 4QW2A 3M58A 3CXCP 1PSEA 2O31A 1U1TA 3LLRA 1KC8R 4O5VA 4BI3A 2EWNA 4DQ2A 1RLPC 3NTHA 2K7AA 4LUEA 3CCQA 3TEEA 3J81E 3P8BB 1JU5C 2EKHA 4M75B 3RKXA 2PVDB 4M77F 1IHVA 1N6AA 3EFOB 3L2ZA 3VS1A 2BTTA 2JTFA 2FYKA 1VUBA 2C06A 2BZ8A 2NYSA 2JM8A 2H3JA 2EYYA 2BE7D 2DXTA 2CDTA 4L59A 1M8MA 1GRIA 3CPFA 1MNEA 1KIKA 1JJ2S 1X75C 2RM4A 1RAFB 4MZMA 1WQWA 3A98A 4RTWA 2XDBA 3CC7A 2C0OA 2A37A 1MMDA 3S3NA 1TH7A 1YIJA 1C1AA 4J9HA 2P4RA 3CMAQ 2DJQA 1YJWQ 2YRCA 2HBPA 3M4YA 3T9NA 3HPWA 2ABLA 2EJ9A 2RHZA 1VQOA 2BZXA 2H3EB 1SHGA 1VIEA 4OB0B 4ZGJB 4A4KA 2OI3A 1GBRA 3SEMA 2X3WD 4QQDA 2JN0A 4DEYA 1VQPA 4FW2A 2E6NA 2ZGWA 4C0DB 3OS2A 3SD4A 4CI0C 3BE3A 3MEWA 3CCSA 3MEAA 1H3HA 3CC4Q 3JCMh 5DM7R 1WHKA 5LJ5g 3A8LB 2DXBA 2DTIA 2V1RA 3JCMe 2DRMA 1SSFA 4JRQA 2RQUA 1M1KR 3SDZA 1ZLMA 1S1NA 2DKGA 3M56A 4AT1B 1QVFA 4C5HA 2YHTA 3VUZA 2DILA 2YRDA 2XKOC 4DBFA 3M53A 4J9FA 2ECZA 2O9SA 4JRIA 4B6MA 3CCLQ 2L5QA 4MZTA 2OTLQ 2DL7A 3FDRA 4NS5A 3EAEA 4EPCA 3JV3A 1QKWA 1MMGA 4FSSA 2DAQA 1B34A 1TUCA 1VYUA 2FO0A 2DJZA 3REAB 1LVKA 1BCMA 4C0GA 3JCMW 2GFUA 1UDLA 2E3HA 2V1QA 1WYXA 3A8OB 2CZ7B 2HSPA 4RTTA 1BCOA 2AK5A 1S72T 5GANg 3QWYA 4PJMA 2LJ1A 3JB9J 4E2FB 2M1HA 3H8ZA 1M2VB 1VQ9T 4PKCC 2H8HA 2E3IA 1NLOC 3G71A 1W70A 4BDYA 2RK2A 3PVQA 1VOMA 4IUPA 2ZPBB 4AFQC 1HK9A 1I4K1 1BU1A 3EGXB 2XICA 4PJJA 1OX9A 3NGPA 1Z9ZA 1LPLA 1KQ2A 3M57A 4M75G 3KUFA 1WJSA 3SWNB 3I56T 2WACA 1OX8A 5ECAA 2DM1A 3BW1A 2J6KA 2X51A 2K3BA 2X4JA 4ESRA 5KYXA 1VQ6T 1M3AA 4FT2A 5GAOl 2ATCB 5HY6A 2EQUA 4E6RA 3I5RA 3G6EA 3P8DA 1MUZA 3OYNA 3NPFA 3VJPA 4A63B 5KYUB 4J5YA 2CP5A 2X4XA 2GF7A 1AHJB 1UGVA 3KFVA 3CCRA 4PFPA 2G6FX 1BB9A 4FYYB 2DXCA 3JCMJ 5KYUA 4J83A 2NUTA 3CCUT 4M78B 4D8DA 4RUGA 1X6BA 3M4GA 2YSQA 2D1XA 2HQEA 5AYFA 3G4ST 2W0ZA 2K79A 1VQ6A 1EZZB 1NYGA 3MP8A 5GAN3 4J8OA 2KMTA 1SF9A 2YUPA 2ZPIB 3VS2A 3I55T 1UUEA 1AD5A 1XNIA 2O4XA 2GQIA 1LOJA 3CMEA 3QXEB 1W4SA 3H6ZA 4P5NA 3G71Q 1K9MR 3SHWA 1TG0A 5CKFA 2X3XD 2RH2A 4BE0A 2XU8A 1MV0B 2LQKA 5IH2A 3AT1B 4FCYA 1JBMA 4ORZA 5GAMg 3V8LA 3ZBDA 2YDLA 3CBMA 4EMKB 1WJRA 5GAMh 1OU8A 1M9SA 7AT1B 2FEIA 4C8QE 3CCST 4OB2B 3OSSC 3TSWA 1VQ7T 5LJ3h 4Y28E 2GTJA 3A1PA 2LTOA 9ATCB 4BD3A 2J7IA 1VQ6Q 3THKA 2MWPA 1XTDA 1Q95G 1QCFA 3JCMd 2PUKB 2E64A 3E19A 1WDXA 1ABQA 4ZNXA 2AIRB 1Y07A 2ED0A 1VQMT 2DIQA 1PD1A 2EW3A 1GBQA 4BY6C 1HJDA 1GFDA 4WCIA 3OYIA 2ZPGB 3EG0A 2E65A 3CC7Q 2RHIA 2K4YA 4BUGA 2KR3A 4LD9K 2L2PA 1R8OB 4J6YA 2D8JA 2QQAA 3PVLA 1IRXA 3I5SA 2EFIA 1C0MA 4GBQA 3JCMb 4FU6A 4A4HA 3CBOA 4M7AA 4M78F 1G8XA 3D7SB 2E70A 1M1KU 2WSCE 3CC2A 1A0NB 3REBB 1Q86C 3SB2A 3PGGA 1NYFA 3V8KA 3X24B 4PJOE 4E7KA 2XI9A 1N27A 1G3YA 1WQ7A 3C4SA 1DJ7B 1N9SA 2CP0A 3H0IA 4HKEA 2KVQG 4FIBA 4OMNA 2SRCA 1FMWA 1M2VA 3FJPA 2XMFA 3EGDB 1VQLA 3LX7A 2PQWA 1GL5A 1JQQA 2EYXA 8AT1B 2HBWA 2LDMA 1UTIA 3HP9A 2VWFA 2DNUA 4PJOG 3FB9A 4J9IA 1YWPA 5CQXA 1JJ2P 1VQ5A 3NHNA 4L6V5 5FU6C 3X20B 1OOTA 3CXCS 3OY9A 2JJ9A 4DBQA 1BI3A 1YCSB 4M77G 4BE1A 1M30A 4GY5A 3CC4T 4QQ6A 3M0PA 3CCVA 1HD3A 3J7AF 4VUBA 3WVDB 1ABOA 1AWJA 2C0IA 4JZ4A 4DOVA 4LDXA 4M78G 1H92A 2YRVA 3UDCA 1QVGP 3JB9D 4E47A 1KD1U 2EQIA 3M59A 1AT1B 3HTRA 2VASA 3EGDA 3EFSA 3A8MB 2KRNA 2VB6A 1W2BS 4KUDK 1M4ZA 1VQ5Q 3M0SA 2RF0A 1T3SA 1IHWA 5GMKi 1YJ9A 4X1VA 4M7DD 1NLPC 2KT1A 2P0KA 1E6GA 2MMPA 2DL4A 4BI4A 2COZA 2MF2A 2PU9B 5I21A 3RKYA 1ZA2B 2AT1B 2F69A 3CC2T 1SRLA 2EGAA 1R77A 3OBYA 1SRMA 4FT4A 2B86A 1VQMA 3M0UA 5FU7C 1K9MU 2W10A 2CP3A 4K11A 1BI1A 5FRMA 2YXYA 3F70A 4BB7A 2CP2A 1R0BG 1AWOA 2FVUA 3CD6Q 3I9QA 3R6NA 2LQ8A 3RKWA 3VKIA 2M16A 2HQXA 1WI7A 1WXBA 3QJ6A 2KXDA 3PTAA 2M51A 5C0MA 4M77A
chains in the Genus database with same CATH topology
2HQHA 3TQ7P 1WHLA 2E3HA 2CP6A 2CP0A 1WHGA 2CP3A 2MPXC 2HKQB 2CP2A 2Z0WA 2CP7A 2COYA 2HKNA 4B6MA 2M02A 2COZA 1WHKA 2E4HA 1TOVA 2HL3A 3RDVA 1WHHA 2QK0A 1WHMA 1LPLA 2HL5C 2CP5A 3E2UA 1TXQA 1IXDA 2E3IA 2COWA 1WHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQH A;  3TQ7 P;  1WHL A;  2E3H A;  2CP6 A;  2CP0 A;  1WHG A;  2CP3 A;  2MPX C;  2HKQ B;  2CP2 A;  2Z0W A;  2CP7 A;  2COY A;  2HKN A;  4B6M A;  2M02 A;  2COZ A;  1WHK A;  2E4H A;  1TOV A;  2HL3 A;  3RDV A;  1WHH A;  2QK0 A;  1WHM A;  1LPL A;  2HL5 C;  2CP5 A;  3E2U A;  1TXQ A;  1IXD A;  2E3I A;  2COW A;  1WHJ A; 
#chains in the Genus database with same CATH topology
 2K2V A;  3VRY A;  4PFO A;  1WHL A;  3X28 B;  1KQS A;  1SEM A;  1NM7 A;  4X34 A;  5CK9 A;  2LNH B;  1K0S A;  2CP7 A;  5C6S A;  5GAN h;  4M7A G;  2L3Q A;  3QWX X;  3CCM Q;  3VS3 A;  3NMZ C;  2JXB A;  4PFZ A;  2KE9 A;  3QJY A;  2DVJ A;  5KCH A;  2KGT A;  1AVZ C;  3EHR A;  4BAC A;  1JJ2 A;  3JCM f;  2KYB A;  2KY9 A;  5L8R E;  1VQP Q;  2MPX C;  4OP0 A;  3JCM X;  3OYF A;  3CCU Q;  1AZE A;  3HHT B;  3EG9 B;  3V7C A;  3VRZ A;  1WHH A;  5GAN j;  4F7U G;  5A0D A;  1UGR B;  3X25 B;  5FRN A;  1M27 C;  1ARK A;  3QHS A;  3OYG A;  1C6V X;  1M1G A;  1U06 A;  3CCV T;  2VXE A;  3C12 A;  1RAC B;  4RG2 A;  2DET A;  2M0Y A;  4AFZ C;  4RTY A;  4M75 D;  1M90 R;  4C0D C;  3DKM A;  3OYK A;  4M77 E;  2K3Y A;  3L42 A;  1YJN Q;  1XOV A;  4M7A B;  1W2B A;  2QAS A;  4JDS A;  1X6O A;  3FIF A;  4LE9 A;  3UA6 A;  4MZP A;  5GAO p;  2A3L A;  2O9V A;  1JXM A;  1RLQ C;  2MCN A;  4RTV A;  4M78 E;  3VS7 A;  2D0Q B;  1Y71 A;  2DK3 A;  1I5O B;  2JT4 A;  3CCR T;  4KUI A;  3OSV A;  4A4F A;  4CC7 A;  2HCK A;  3OYD A;  2LX7 A;  1IB8 A;  4RG8 A;  5GAN 2;  1D1C A;  3G6E T;  5HK0 A;  1UJ0 A;  3UT1 A;  3G7Z A;  3PIO A;  1NJI R;  2E12 A;  4EMG A;  2JZ2 A;  1QLY A;  3EH2 A;  1BKB A;  5LJ5 f;  2JW4 A;  4D6W A;  2QDY B;  2E4H A;  2ZCF B;  4FL6 A;  2VGN A;  1K8A U;  2R58 A;  2DMO A;  3JSC A;  1KSW A;  5HK3 A;  3JAM E;  5I22 A;  3OYY A;  3GBQ A;  1I8F A;  2EJG A;  2JMA A;  1KQ1 A;  2DBM A;  3OYH A;  2HZY A;  1WLP B;  1D3B A;  1H64 1;  1ZHI A;  2DX1 A;  2LX9 A;  1OV3 A;  1ZUY A;  3OYE A;  2I0N A;  1ZSZ C;  2CSQ A;  2J6O A;  5LJ3 d;  2RHU A;  4OMP A;  3TU4 K;  1Z9Q A;  3I55 A;  2E41 A;  2E6Z A;  2ZAE A;  2BUD A;  1OQK A;  3H9N A;  2RJF A;  3L2U A;  5CKD A;  3RMQ A;  4N4I A;  4LDY A;  4M7D C;  5D6Y A;  3ZEH A;  2RHX A;  5GMK h;  1UGQ B;  1PCX A;  1E6H A;  3OQ5 A;  4M7D B;  3L2W A;  4XTX A;  1RAB B;  2VV5 A;  1NEB A;  4R55 A;  1T3L A;  4C8Q G;  3OYL A;  2A0F B;  3GF5 A;  1QCN A;  4LD6 A;  4HCZ A;  4M78 A;  1ZSZ B;  3OS0 A;  2LJ3 A;  2P84 A;  3PIP A;  3UAT A;  1MMN A;  2QI2 A;  3NTI A;  1UHC A;  2DXU A;  5LJ3 e;  2D9T A;  2JVV A;  2QQ9 A;  1VQP T;  1YN8 A;  2LCS A;  1U5S A;  4JLG A;  2DFU A;  4RTU A;  2MYS A;  2MK5 A;  1B34 B;  2QXF A;  3QKJ A;  3FLG A;  1GCQ C;  1KJW A;  2LC4 A;  4PNO A;  3DB4 A;  3I35 A;  1Q82 U;  3M0Q A;  3RER A;  1AWW A;  1HYO A;  4OMF B;  1ZSG A;  1VYV A;  1IO6 A;  5CO7 A;  1YHQ Q;  4Y91 A;  3SFM A;  3QUI A;  4C5I A;  1OEB A;  4XAX B;  4BE2 A;  2EYQ A;  3BDU A;  4YTL A;  4C8Q C;  2FPF A;  1D3B B;  3CCU A;  1VQ5 T;  4R56 A;  2PTK A;  4J9C A;  2BE9 B;  2HQH A;  1QWE A;  4HT9 A;  4M75 A;  1IRE B;  4EMK A;  3O5Z A;  1VQ8 A;  4FYW B;  1SKU B;  2RB6 A;  2RQT A;  4C92 F;  3BFM A;  2CKK A;  2PNI A;  1H3Z A;  1YP5 A;  1BK2 A;  3ME9 A;  5FWC A;  1YIJ Q;  4RCC A;  2O4X B;  3CCR Q;  1Q82 C;  1G3S A;  2HMA A;  2HSE B;  3CCQ Q;  4IIM A;  2HD0 A;  4XU3 A;  1M90 U;  1D1B A;  1CSK A;  4ZTF A;  4FM4 B;  3INZ A;  2FPE A;  4JRP A;  2VGM A;  1MHN A;  2HEQ A;  4M78 D;  5A0G A;  1HSQ A;  1WFW A;  1CKB A;  5L23 A;  4UC4 A;  2D0N A;  3KBG A;  2LT4 A;  2ROT A;  4M7A D;  3O8V A;  3CQT A;  3L1A A;  3V7S A;  1QVP A;  2CP6 A;  2IIM A;  4JUV A;  2EIF A;  1NEG A;  4E7J A;  3LGL A;  1X2Q A;  1KQS S;  2KBT A;  2LP5 A;  1Y0M A;  2RMO A;  3CCE T;  4F16 A;  2QGG A;  2KRO A;  1Q7Y U;  1YI2 T;  1VQ4 T;  1TTH B;  4F17 A;  3CCL A;  1TUG B;  1NZ9 A;  1WJQ A;  2KRS A;  1H8K A;  3GOX A;  2JUF A;  2EAY A;  2NUT B;  2PVG B;  4HCB A;  2DF6 A;  3I56 Q;  3MJX A;  3PMT A;  4ANJ A;  4JJB A;  5GMK j;  2P0Q A;  2YLB A;  4XK8 E;  1YIT Q;  3CCS Q;  3FJ5 A;  2RI5 A;  1SSH A;  2L3R A;  4PLI A;  2M9U A;  5D6X A;  3V8J A;  4ZN3 A;  1RI9 A;  2KI7 A;  4XU1 A;  3MP6 A;  2JS0 A;  5FRO A;  3LWI A;  2LQW A;  5IHK A;  1PRM C;  2YUO A;  1K0X A;  3KXT A;  2NUP A;  4QVD A;  1KHI A;  3GNG A;  1E7O A;  2DE0 X;  3JCM g;  3G4S Q;  2LT1 A;  3CCJ Q;  4MMK A;  2K5I A;  3I56 A;  2FZC B;  2FG0 A;  1UFF A;  2QDL A;  1X27 A;  4KGZ B;  1YHQ T;  1SHF A;  5IHN A;  3RIR A;  5KYW A;  1YJW T;  2GNC A;  2CS7 A;  1Y96 A;  3G71 T;  1WA7 A;  3PE0 A;  2VKN A;  4OB3 B;  3A8H B;  3EH1 A;  2P0P A;  4J7F A;  3WXM B;  3JCM c;  5GAM d;  4FW1 A;  1OI1 A;  2QAZ A;  2OJ2 A;  5FLX E;  3CC4 A;  2RQR A;  3JCM Q;  4X9D A;  4C92 D;  2E1H A;  4Q5W A;  4NL3 A;  3M5A A;  2DTH A;  3E2U A;  2L3S A;  2NUP B;  4IUU A;  4HVW A;  3VV0 A;  4PLL A;  1UB4 A;  1AEY A;  2YUN A;  2YT6 A;  5IXB A;  1KC8 C;  1VQ7 Q;  2LCL A;  2O01 E;  3OW2 P;  1QMC A;  3H41 A;  5GAO n;  5I2M A;  2K9G A;  2DYI A;  3PT9 A;  3DLL A;  3UWN A;  1RUW A;  1RAH B;  4AMC A;  1RAD B;  1K73 R;  2XG8 D;  2A36 A;  2CZ6 B;  1G3W A;  1CKA A;  5GAM e;  2GBQ A;  1WXU A;  4KGV B;  2LMJ A;  2R5M A;  4E7L A;  1QKX A;  2E10 A;  4IIO A;  1K76 A;  1PSF A;  1Q86 U;  1T0H A;  4JJC A;  2QTX A;  2EQK A;  4XTW A;  5GAM j;  4DOW A;  3QBY A;  3MEV A;  2YWW A;  4J6X A;  3OW2 S;  1M3B A;  3HRT A;  3ASK A;  3RBB B;  5LJ5 h;  1Q82 R;  3VS6 A;  4F7U F;  4IKF A;  4QQG A;  2XID A;  5GAO q;  2DL5 A;  3QYG B;  2PVO B;  4HCK A;  1NPR A;  1UHF A;  2DER A;  1R0C B;  2DLP A;  3JCM V;  2MWO A;  4ZN1 A;  1OPL A;  1SG5 A;  2KAF A;  1TWB A;  3QZ9 B;  1N8R R;  1YCY A;  1NJI U;  3CBP A;  3EFR A;  4CC4 B;  1PNJ A;  4E7S A;  2DVE A;  3MEU A;  2DPP B;  1VQ8 T;  1YJN T;  2V8J A;  2RQV A;  2RI3 A;  1QP2 A;  2BIV A;  2NUZ A;  4HVV A;  1VQK Q;  5CR2 A;  2JOY A;  2XK0 A;  2CUD A;  2JTE A;  5I2S A;  2MIO A;  4AG2 C;  4RKU E;  4Z88 A;  2RJE A;  3OS1 A;  1WZO A;  2KNB B;  4FYV B;  3LH5 A;  5CKE A;  4EIK A;  1ACM B;  1YJ9 T;  4LUD A;  1RI0 A;  4M75 E;  4ZTJ A;  4LDU A;  1PD0 A;  2Y90 A;  1QVF P;  4C8Q D;  4L5G A;  2IPO B;  4EMK C;  2OTL A;  2FL7 A;  2CZ1 B;  2AHJ B;  4JS5 A;  4JS4 A;  1WGS A;  3ZFJ A;  1FWZ A;  4J7I A;  1T0J A;  5GAN 6;  3A5Z B;  3QPH A;  4ATO A;  1YIJ T;  1K8A C;  3QDF A;  1VYT A;  2AKL A;  5GMK e;  1QVG A;  2RQW A;  1S72 A;  3GNF B;  3LW5 E;  2VYT A;  1K9A A;  1UJY A;  1WPY A;  5J3B A;  3JCM P;  1M1F A;  1N8R C;  2OTJ T;  4M4Z A;  3LH0 A;  1PRL C;  4GLM A;  3VS5 A;  2QG9 B;  4HVU A;  4EDU A;  1HXD A;  2M02 A;  5GAN 8;  3URG A;  5J39 A;  2JMC A;  3MPU B;  3ULR B;  1QVF S;  2HDA A;  1TS9 A;  5LJ5 d;  2E5Q A;  1B3Q A;  3I55 Q;  3R6O A;  4LDW A;  1M1K C;  1PKT A;  2ED1 A;  1BI2 A;  4B9W A;  1KK7 A;  2DRK A;  3CCE A;  3QSU A;  2YUQ A;  2XDD A;  2F2X A;  1BI0 A;  3E9F A;  4XTY A;  5AT1 B;  4JZ3 A;  8ATC B;  3C0C A;  4OGC A;  2KT8 A;  3QDR B;  1VQK T;  2XD0 A;  1QVG S;  2V8I A;  2MAM A;  4M7D F;  2OTJ A;  3VS0 A;  3G1J A;  1YHQ A;  1MV3 A;  3VYH B;  5GAN f;  2VC8 A;  2DEQ A;  1D09 B;  2BZY A;  4C0F A;  3TCJ A;  2P4T A;  4C0Z A;  3CD6 T;  4XTZ A;  3TRE A;  5IHI A;  1X43 A;  1X2K A;  4QVC A;  3MCA B;  2B8A A;  2HKN A;  1NBE B;  2AZV A;  3Q1J A;  3MET A;  4M7D A;  5DLO A;  1JXO A;  2LRQ A;  2PZ1 A;  1VQO T;  1WXT A;  1Q81 R;  2RPN A;  2EYZ A;  5LL6 S;  3FRN A;  4C8Q F;  4BI8 B;  3WVE B;  2SEM A;  1G5V A;  3P8H A;  4KH0 B;  2FZK B;  4V2S A;  3JRZ A;  3OW2 A;  2DEU A;  3CXC A;  4ZGE B;  4LNP A;  2M0O A;  3M0R A;  3OYA A;  1IZ6 A;  2D8H A;  4NOY A;  3N5B B;  2OTJ Q;  1FX7 A;  1PWT A;  3GIB A;  4A4E A;  5KYX B;  1IXD A;  2PUO B;  3C94 A;  1V76 A;  1ZQ1 A;  5A0L A;  1JRI A;  3OA6 A;  1KHC A;  2QEX A;  1MND A;  2DO3 A;  3HKS A;  1NJI C;  1AOJ A;  2G3R A;  1KD1 R;  1YWO A;  2CGH A;  1VQ4 A;  5LJ3 f;  1GCQ A;  3M55 A;  3S6W A;  2V8K A;  4MML A;  1PKS A;  4C5E A;  4C92 B;  4RTZ A;  3HRU A;  3ZL7 C;  3A8G B;  1K8A R;  3HFO A;  3VUB A;  5IXF A;  2DL8 A;  1D0X A;  2XDP A;  1XJW B;  4C92 C;  2LNV A;  1UEB A;  2K5F A;  1PHT A;  5GAN d;  4XTV A;  3BY7 A;  2L8D A;  1G3T A;  4M75 C;  4J9B A;  4KBM B;  4AFS C;  2OAW A;  2OTL T;  4C92 E;  2FZG B;  3JB9 H;  1GCP A;  2GQV A;  4B9X A;  3L2V A;  4ELZ C;  1EX4 A;  2EBP A;  1W2B P;  4Z02 A;  2COY A;  5CKB A;  1TU0 B;  2MI6 A;  5IN1 A;  5LJ5 j;  2ZPE B;  5EG2 A;  3RUX A;  2J06 A;  3G6E Q;  2FRY A;  2HAX A;  2FRW A;  3JB9 F;  2DZ9 A;  3M9Q A;  4OVA A;  4QT7 A;  1FMV A;  3OYM A;  4N4G A;  3CD6 A;  3H0F A;  2J05 A;  1YI2 Q;  3RNJ A;  1M2O A;  2CT3 A;  4JPB W;  1Q7Y C;  1B7T A;  5LJ3 j;  2CZ0 B;  4N0A A;  1VQN T;  4M77 B;  4OB1 B;  4C8Q B;  2RK1 A;  2KQW A;  1U1S A;  2F5K A;  2NWM A;  3S3M A;  1SPK A;  4ME7 A;  5M9O A;  3DB3 A;  2RHY A;  3FC3 A;  3C95 A;  4XU2 A;  4M78 C;  2K3X A;  2OX7 A;  1KC8 U;  1NE8 A;  4HCC A;  1AZG B;  2Y4X A;  4BY6 B;  3MO8 A;  2E5K A;  4X9C A;  2WSF E;  2K2M A;  1X6G A;  1YIT T;  1VQN A;  2HKQ B;  2Z0W A;  1VIF A;  1GFC A;  1I1J A;  1I07 A;  4C92 A;  4KRT A;  2HL3 A;  3CCL T;  4M77 C;  5DY9 A;  2QQS A;  1M3C A;  3SWN C;  5FU7 B;  1TXQ A;  5GAN 7;  4LDV A;  1TUD A;  1MMA A;  3QG1 A;  4BDZ A;  4M7A F;  1VQ7 A;  2IVW A;  1NPP A;  2O88 A;  3OYJ A;  2DBK A;  1PM3 A;  4MDW A;  4RTX A;  1UEC A;  3EG3 A;  5CVI A;  3CMA A;  3CCJ T;  2EJF A;  2L0A A;  3OBW A;  2KK4 A;  2HNI A;  3EGU A;  5GAO m;  4E7I A;  3EHQ A;  4PJO B;  1OU9 A;  2J6F A;  4F7U A;  3TSZ A;  1NG2 A;  5CQY A;  1YBY A;  2OAU A;  2I2L A;  5IAY A;  3PNW C;  2X4W A;  5KYY A;  4AFU C;  1Y57 A;  3NFC A;  3CME T;  2V26 A;  4HA8 A;  1G83 A;  5D7U A;  4KH1 B;  1Q81 C;  1OZ2 A;  3SWN A;  4KUL A;  4J9G A;  3CMA T;  2QEX T;  5CCA A;  1WIE A;  5IT9 E;  5LJ5 e;  2QA4 Q;  1YJW A;  2ZPH B;  1RAG B;  1UE9 A;  5CIU A;  3CCV Q;  4EMH A;  3IQL A;  2QQR A;  3EG9 A;  1W1F A;  2A7Y A;  2JNG A;  1BYM A;  2ZPF B;  1Q7Y R;  4RMO A;  2RNA A;  5CAI A;  1Q81 U;  4IUR A;  5LJ3 g;  3ER0 A;  5FW9 A;  1WNL A;  1VQL Q;  4J6W A;  3OYB A;  3LYI A;  4OMM A;  2NLU A;  2RO0 A;  3MP1 A;  5GAN 5;  2DIG A;  4WTO B;  2L89 A;  2DD5 A;  5HCK A;  1P92 A;  3HL8 A;  2COW A;  5KYY B;  2K5L A;  1MGQ A;  1K1Z A;  4C92 G;  1LJO A;  3TQ7 P;  3M54 A;  2EGE A;  3CC7 T;  1FMK A;  1OZ3 A;  2ROL A;  3RES A;  4AG1 C;  4TVR A;  2GFA A;  4F7U E;  4Z8A A;  2F2W A;  4A54 A;  2D6F A;  1X01 A;  4QKU A;  4ELY C;  1EFN A;  2EVR A;  2RN8 A;  4XU0 A;  1ZA1 B;  4PJO F;  1RAE B;  2MOX A;  4HXJ A;  1S72 Q;  4DBR A;  5KE2 A;  4ZGD B;  4JJN K;  5KYN A;  3RMS A;  3CPW S;  1ZBX A;  2KRM A;  1JEG A;  2LCC A;  1ZX6 A;  2DZC A;  6AT1 B;  2A08 A;  1Y7X A;  2F5T X;  4PK4 A;  3E9G A;  1BIB A;  1YI2 A;  2AKK A;  3RR6 A;  2JS2 A;  3L2Q A;  1FYN A;  5KYW B;  4DEX A;  1WX6 A;  2EPD A;  2Y4Y A;  3UPU A;  4IUQ A;  1LNX A;  1UGP B;  4XQ3 A;  2GCX A;  2O2O A;  4Y92 A;  1O75 A;  2JTM A;  3HRS A;  2XHC A;  1VQM Q;  1O9S A;  2HL5 C;  4C8Q A;  3CC2 Q;  1KQS P;  2CSI A;  2K6D A;  4A4G A;  4JJD A;  1XQH A;  2A28 A;  2R57 A;  2CUB A;  1VQL T;  1F1B B;  2AZS A;  3CCM A;  3LWH A;  1YIT A;  1M90 C;  4PJO C;  5CKH A;  4RCB A;  1I5L A;  4OMO A;  2FB7 A;  3S3O A;  1D0Z A;  1ZUU A;  2LVM A;  2CRE A;  2QK0 A;  4OGE A;  3CCE Q;  3CME Q;  1Q86 R;  3V7R A;  2QQB A;  4OML A;  1KFZ A;  2F1L A;  2X4Y A;  4WF2 A;  2EQJ A;  1AWX A;  5GAN 4;  1EIF A;  5GMK m;  4FSX A;  4IUT A;  1M8V A;  3GPL A;  1LCK A;  2CT4 A;  1YFN A;  3U23 A;  2QA4 A;  4F04 B;  4N4H A;  2QGF B;  3QII A;  2RI2 A;  1RAI B;  2X9H A;  4M77 D;  3CCM T;  1YJN A;  2EKO A;  4IUV A;  4M7A E;  2BKD N;  3E1S A;  2X35 A;  5GMK l;  4E7Z A;  1KD1 C;  3M0T A;  1J3T A;  2GGR A;  1PG5 B;  3QZ5 B;  1B07 A;  3GP8 A;  1VQN Q;  1BIA A;  1M5Q 1;  1QP3 A;  1IGQ A;  4N0A C;  5GJW B;  1U8R A;  1X69 A;  3DLM A;  3CPW A;  2IG0 A;  2KSS A;  2FPD A;  3OMC A;  1ZBJ A;  3JB9 G;  2EYW A;  1VQ9 A;  4PL6 A;  5GAN e;  3NTK A;  4OMQ A;  2KDS A;  1QW1 A;  3CCJ A;  2VXF A;  1ZSZ A;  1BBZ A;  2EGC A;  3TVT A;  2RA2 A;  4PJO A;  4O6J A;  3LGF A;  2CH4 W;  2ESW A;  3FEO A;  5I11 A;  3JB9 I;  3CCQ T;  1JB0 E;  2LJ0 A;  3EG1 A;  1RAA B;  1IGU A;  1G2B A;  5HKC A;  1ZUK A;  1V29 B;  1K9M C;  4E7H A;  2DD4 A;  1WHJ A;  2KXC A;  2DL3 A;  3HSB A;  4XTU A;  4JRK A;  2RD1 A;  4CC3 A;  4KT0 E;  3VYG A;  1I0C A;  2QYZ A;  4PJO D;  4CC2 A;  3EGX A;  1QCO A;  3L2R A;  3OYC A;  3AHU A;  2YLC A;  2K57 A;  1UGS B;  2ZZD A;  3GLX A;  1QWF A;  1KG1 A;  3RDV A;  5FU6 B;  3OMG A;  5KH6 A;  2DA9 A;  4C5G A;  2LZ6 B;  4CRI A;  4DA4 A;  3X26 B;  3G4S A;  4M75 F;  1Y96 B;  1N5Z A;  1GXI E;  4QVZ A;  1QQJ A;  1RL2 A;  2GTO A;  3MHX A;  3QYH B;  1OYX A;  1I81 A;  3H0H A;  3MKD A;  4LN2 A;  2VVK A;  3HFN A;  5GJV B;  2R5A A;  4Z89 A;  5A2Q E;  4GLK A;  5DLQ E;  2L3P A;  5FWB A;  5KE3 A;  3BDL A;  2DTO A;  1D1A A;  1YNZ A;  3VU3 C;  2QEX Q;  2DYB A;  2FHD A;  4D8K A;  4OF1 A;  2RJC A;  4F7U B;  2ENM A;  2QA4 T;  1N8R U;  1UG1 A;  2JM9 A;  3OS5 A;  4NL2 A;  2LQN A;  3VS4 A;  2F2V A;  1K73 U;  4M7D G;  3CEY A;  1PC0 A;  1WHM A;  5J26 A;  1V1C A;  3UA7 A;  4PJN A;  4PJL A;  4J9D A;  5EC7 A;  5GAM f;  3UF4 A;  1D0Y A;  1OUL A;  3EFO A;  4LXC A;  3QO3 A;  4MDX A;  3J80 E;  1FXX A;  3PFS A;  4F14 A;  3CPW P;  2CH4 A;  2C0T A;  3EG2 A;  5D6W A;  3PMI A;  1K4U S;  1U3O A;  1VQO Q;  4J9E A;  2KYM A;  4M7D E;  4R0K A;  1TSF A;  2VUB A;  2RJD A;  4A53 A;  1VQ8 Q;  2EQM A;  2CYZ B;  3OB9 A;  4FYX B;  1VQK A;  2QTV A;  4JLI A;  1WHG A;  4HT8 A;  4M7A C;  1OPK A;  1VQ4 Q;  1N9R A;  1VA7 A;  4KGX B;  2KEA A;  1JO8 A;  1K73 C;  1VQ9 Q;  2WSE E;  1TOV A;  4DBH A;  5GAO r;  1W6X A;  1YJ9 Q;  4II1 A;  5KCO A;  4QW2 A;  3M58 A;  3CXC P;  1PSE A;  2O31 A;  1U1T A;  3LLR A;  1KC8 R;  4O5V A;  4BI3 A;  2EWN A;  4DQ2 A;  1RLP C;  3NTH A;  2K7A A;  4LUE A;  3CCQ A;  3TEE A;  3J81 E;  3P8B B;  1JU5 C;  2EKH A;  4M75 B;  3RKX A;  2PVD B;  4M77 F;  1IHV A;  1N6A A;  3EFO B;  3L2Z A;  3VS1 A;  2BTT A;  2JTF A;  2FYK A;  1VUB A;  2C06 A;  2BZ8 A;  2NYS A;  2JM8 A;  2H3J A;  2EYY A;  2BE7 D;  2DXT A;  2CDT A;  4L59 A;  1M8M A;  1GRI A;  3CPF A;  1MNE A;  1KIK A;  1JJ2 S;  1X75 C;  2RM4 A;  1RAF B;  4MZM A;  1WQW A;  3A98 A;  4RTW A;  2XDB A;  3CC7 A;  2C0O A;  2A37 A;  1MMD A;  3S3N A;  1TH7 A;  1YIJ A;  1C1A A;  4J9H A;  2P4R A;  3CMA Q;  2DJQ A;  1YJW Q;  2YRC A;  2HBP A;  3M4Y A;  3T9N A;  3HPW A;  2ABL A;  2EJ9 A;  2RHZ A;  1VQO A;  2BZX A;  2H3E B;  1SHG A;  1VIE A;  4OB0 B;  4ZGJ B;  4A4K A;  2OI3 A;  1GBR A;  3SEM A;  2X3W D;  4QQD A;  2JN0 A;  4DEY A;  1VQP A;  4FW2 A;  2E6N A;  2ZGW A;  4C0D B;  3OS2 A;  3SD4 A;  4CI0 C;  3BE3 A;  3MEW A;  3CCS A;  3MEA A;  1H3H A;  3CC4 Q;  3JCM h;  5DM7 R;  1WHK A;  5LJ5 g;  3A8L B;  2DXB A;  2DTI A;  2V1R A;  3JCM e;  2DRM A;  1SSF A;  4JRQ A;  2RQU A;  1M1K R;  3SDZ A;  1ZLM A;  1S1N A;  2DKG A;  3M56 A;  4AT1 B;  1QVF A;  4C5H A;  2YHT A;  3VUZ A;  2DIL A;  2YRD A;  2XKO C;  4DBF A;  3M53 A;  4J9F A;  2ECZ A;  2O9S A;  4JRI A;  4B6M A;  3CCL Q;  2L5Q A;  4MZT A;  2OTL Q;  2DL7 A;  3FDR A;  4NS5 A;  3EAE A;  4EPC A;  3JV3 A;  1QKW A;  1MMG A;  4FSS A;  2DAQ A;  1B34 A;  1TUC A;  1VYU A;  2FO0 A;  2DJZ A;  3REA B;  1LVK A;  1BCM A;  4C0G A;  3JCM W;  2GFU A;  1UDL A;  2E3H A;  2V1Q A;  1WYX A;  3A8O B;  2CZ7 B;  2HSP A;  4RTT A;  1BCO A;  2AK5 A;  1S72 T;  5GAN g;  3QWY A;  4PJM A;  2LJ1 A;  3JB9 J;  4E2F B;  2M1H A;  3H8Z A;  1M2V B;  1VQ9 T;  4PKC C;  2H8H A;  2E3I A;  1NLO C;  3G71 A;  1W70 A;  4BDY A;  2RK2 A;  3PVQ A;  1VOM A;  4IUP A;  2ZPB B;  4AFQ C;  1HK9 A;  1I4K 1;  1BU1 A;  3EGX B;  2XIC A;  4PJJ A;  1OX9 A;  3NGP A;  1Z9Z A;  1LPL A;  1KQ2 A;  3M57 A;  4M75 G;  3KUF A;  1WJS A;  3SWN B;  3I56 T;  2WAC A;  1OX8 A;  5ECA A;  2DM1 A;  3BW1 A;  2J6K A;  2X51 A;  2K3B A;  2X4J A;  4ESR A;  5KYX A;  1VQ6 T;  1M3A A;  4FT2 A;  5GAO l;  2ATC B;  5HY6 A;  2EQU A;  4E6R A;  3I5R A;  3G6E A;  3P8D A;  1MUZ A;  3OYN A;  3NPF A;  3VJP A;  4A63 B;  5KYU B;  4J5Y A;  2CP5 A;  2X4X A;  2GF7 A;  1AHJ B;  1UGV A;  3KFV A;  3CCR A;  4PFP A;  2G6F X;  1BB9 A;  4FYY B;  2DXC A;  3JCM J;  5KYU A;  4J83 A;  2NUT A;  3CCU T;  4M78 B;  4D8D A;  4RUG A;  1X6B A;  3M4G A;  2YSQ A;  2D1X A;  2HQE A;  5AYF A;  3G4S T;  2W0Z A;  2K79 A;  1VQ6 A;  1EZZ B;  1NYG A;  3MP8 A;  5GAN 3;  4J8O A;  2KMT A;  1SF9 A;  2YUP A;  2ZPI B;  3VS2 A;  3I55 T;  1UUE A;  1AD5 A;  1XNI A;  2O4X A;  2GQI A;  1LOJ A;  3CME A;  3QXE B;  1W4S A;  3H6Z A;  4P5N A;  3G71 Q;  1K9M R;  3SHW A;  1TG0 A;  5CKF A;  2X3X D;  2RH2 A;  4BE0 A;  2XU8 A;  1MV0 B;  2LQK A;  5IH2 A;  3AT1 B;  4FCY A;  1JBM A;  4ORZ A;  5GAM g;  3V8L A;  3ZBD A;  2YDL A;  3CBM A;  4EMK B;  1WJR A;  5GAM h;  1OU8 A;  1M9S A;  7AT1 B;  2FEI A;  4C8Q E;  3CCS T;  4OB2 B;  3OSS C;  3TSW A;  1VQ7 T;  5LJ3 h;  4Y28 E;  2GTJ A;  3A1P A;  2LTO A;  9ATC B;  4BD3 A;  2J7I A;  1VQ6 Q;  3THK A;  2MWP A;  1XTD A;  1Q95 G;  1QCF A;  3JCM d;  2PUK B;  2E64 A;  3E19 A;  1WDX A;  1ABQ A;  4ZNX A;  2AIR B;  1Y07 A;  2ED0 A;  1VQM T;  2DIQ A;  1PD1 A;  2EW3 A;  1GBQ A;  4BY6 C;  1HJD A;  1GFD A;  4WCI A;  3OYI A;  2ZPG B;  3EG0 A;  2E65 A;  3CC7 Q;  2RHI A;  2K4Y A;  4BUG A;  2KR3 A;  4LD9 K;  2L2P A;  1R8O B;  4J6Y A;  2D8J A;  2QQA A;  3PVL A;  1IRX A;  3I5S A;  2EFI A;  1C0M A;  4GBQ A;  3JCM b;  4FU6 A;  4A4H A;  3CBO A;  4M7A A;  4M78 F;  1G8X A;  3D7S B;  2E70 A;  1M1K U;  2WSC E;  3CC2 A;  1A0N B;  3REB B;  1Q86 C;  3SB2 A;  3PGG A;  1NYF A;  3V8K A;  3X24 B;  4PJO E;  4E7K A;  2XI9 A;  1N27 A;  1G3Y A;  1WQ7 A;  3C4S A;  1DJ7 B;  1N9S A;  2CP0 A;  3H0I A;  4HKE A;  2KVQ G;  4FIB A;  4OMN A;  2SRC A;  1FMW A;  1M2V A;  3FJP A;  2XMF A;  3EGD B;  1VQL A;  3LX7 A;  2PQW A;  1GL5 A;  1JQQ A;  2EYX A;  8AT1 B;  2HBW A;  2LDM A;  1UTI A;  3HP9 A;  2VWF A;  2DNU A;  4PJO G;  3FB9 A;  4J9I A;  1YWP A;  5CQX A;  1JJ2 P;  1VQ5 A;  3NHN A;  4L6V 5;  5FU6 C;  3X20 B;  1OOT A;  3CXC S;  3OY9 A;  2JJ9 A;  4DBQ A;  1BI3 A;  1YCS B;  4M77 G;  4BE1 A;  1M30 A;  4GY5 A;  3CC4 T;  4QQ6 A;  3M0P A;  3CCV A;  1HD3 A;  3J7A F;  4VUB A;  3WVD B;  1ABO A;  1AWJ A;  2C0I A;  4JZ4 A;  4DOV A;  4LDX A;  4M78 G;  1H92 A;  2YRV A;  3UDC A;  1QVG P;  3JB9 D;  4E47 A;  1KD1 U;  2EQI A;  3M59 A;  1AT1 B;  3HTR A;  2VAS A;  3EGD A;  3EFS A;  3A8M B;  2KRN A;  2VB6 A;  1W2B S;  4KUD K;  1M4Z A;  1VQ5 Q;  3M0S A;  2RF0 A;  1T3S A;  1IHW A;  5GMK i;  1YJ9 A;  4X1V A;  4M7D D;  1NLP C;  2KT1 A;  2P0K A;  1E6G A;  2MMP A;  2DL4 A;  4BI4 A;  2COZ A;  2MF2 A;  2PU9 B;  5I21 A;  3RKY A;  1ZA2 B;  2AT1 B;  2F69 A;  3CC2 T;  1SRL A;  2EGA A;  1R77 A;  3OBY A;  1SRM A;  4FT4 A;  2B86 A;  1VQM A;  3M0U A;  5FU7 C;  1K9M U;  2W10 A;  2CP3 A;  4K11 A;  1BI1 A;  5FRM A;  2YXY A;  3F70 A;  4BB7 A;  2CP2 A;  1R0B G;  1AWO A;  2FVU A;  3CD6 Q;  3I9Q A;  3R6N A;  2LQ8 A;  3RKW A;  3VKI A;  2M16 A;  2HQX A;  1WI7 A;  1WXB A;  3QJ6 A;  2KXD A;  3PTA A;  2M51 A;  5C0M A;  4M77 A; 
#chains in the Genus database with same CATH homology
 2HQH A;  3TQ7 P;  1WHL A;  2E3H A;  2CP6 A;  2CP0 A;  1WHG A;  2CP3 A;  2MPX C;  2HKQ B;  2CP2 A;  2Z0W A;  2CP7 A;  2COY A;  2HKN A;  4B6M A;  2M02 A;  2COZ A;  1WHK A;  2E4H A;  1TOV A;  2HL3 A;  3RDV A;  1WHH A;  2QK0 A;  1WHM A;  1LPL A;  2HL5 C;  2CP5 A;  3E2U A;  1TXQ A;  1IXD A;  2E3I A;  2COW A;  1WHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...