1TOVA

Structural genomics of caenorhabditis elegans: cap-gly domain of f53f4.3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
NESDKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFVRPVDVKVGDFPELSIDEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Cytoskeleton-Associated Protein Glycine-Rich (CAP-Gly) Domain
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein F53F4.3 in chromosome V
total genus 20
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 1tovA00
1WHHA 2CP3A 2E4HA 1WHJA 2HQHA 2Z0WA 2QK0A 3E2UA 2COZA 1WHMA 2HKNA 2HL3A 2HKQB 2COWA 2CP0A 2CP6A 2M02A 1WHKA 1IXDA 2CP7A 1TXQA 4B6MA 3RDVA 1LPLA 2MPXC 1WHLA 2HL5C 2CP2A 2E3IA 1WHGA 2E3HA 3TQ7P 2CP5A 2COYA 1TOVA
chains in the Genus database with same CATH superfamily
4QW2A 4FT4A 2PUOB 5IHNA 1J3TA 1X01A 4ZTJA 4ELYC 1IO6A 1YJNT 1ZSGA 2DYBA 1YFNA 1WFWA 1Q82C 3DB4A 2JMAA 1V1CA 1IB8A 1OU8A 1E6GA 1QVGS 4QT7A 3CCVA 8ATCB 1NYFA 5GAMe 2JTMA 1VQMA 4OMQA 1QP3A 2L0AA 2HSEB 3JCMf 5KYNA 1HYOA 3M0UA 5CKDA 2DRKA 4Y28E 1K8AU 2J7IA 5FLXE 4WTOB 2DPPB 1ABOA 2YDLA 3OMGA 4M75E 4WCIA 3OYBA 2X4XA 2QEXT 1D0XA 2V1QA 4F17A 1UB4A 2MAMA 5IAYA 4TVRA 1YHQT 1ZA2B 5GANf 1Y96A 1T0JA 3OYMA 1QVFA 2QYZA 3FLGA 4X9DA 1PD1A 2RHUA 3CCET 4A4GA 1UHFA 4A4HA 2QA4Q 5GAMd 3C4SA 1AWWA 1YJ9A 1KQSP 1M1KU 4F16A 5CQXA 2E3HA 3JRZA 1PRMC 2JS0A 1YJNQ 2DVJA 4DBHA 1AWOA 1K73U 4RG2A 2K4YA 3L2WA 3VYGA 4JJCA 1YN8A 3CMAQ 1JO8A 4ZN1A 2JVVA 2ESWA 3FJPA 2HZYA 1PNJA 2A37A 4RMOA 2QK0A 1K9MR 4C0DB 2ZPBB 3L2VA 2YXYA 3JCMV 2RI3A 3H9NA 3OS0A 4OB0B 1BI1A 3VJPA 3OB9A 2H8HA 1CKAA 3V7RA 4C8QD 4M77G 4M7AD 3CCQQ 4A53A 4QQ6A 1B3QA 4C8QG 3DLMA 1AZEA 1X43A 3S6WA 8AT1B 2NUTB 4HXJA 5CKHA 3A8OB 5LJ3e 2E1HA 2M9UA 3JCMJ 4JLIA 3LX7A 2O01E 2QI2A 1PKTA 1RL2A 4AT1B 4XK8E 2LCCA 3RERA 3RKWA 1VQ9A 4BY6B 2ECZA 2JM8A 5D6XA 2RQTA 2CZ7B 2GQIA 4EMHA 1GCQA 2DL4A 2QASA 2EJFA 2HMAA 2EKHA 4M7AB 4RTTA 4ZTFA 4M77B 2A0FB 2OX7A 2M51A 2L2PA 5KYWB 4MZMA 4E7JA 1OX9A 3CCUT 4NOYA 1N6AA 2BZ8A 1NJIU 2EBPA 4MDXA 1UFFA 5GAN6 1WHMA 4BI4A 5GMKi 4O5VA 4QVDA 2DTIA 2J6FA 1AWXA 2DXTA 3V8LA 2CP7A 2DJQA 1WPYA 2GF7A 2LVMA 1W1FA 2XKOC 2FZCB 5J39A 4DQ2A 3CPWP 2KVQG 5FWCA 3J7AF 3P8DA 1M3CA 3PTAA 3RMQA 2YRCA 1GBQA 3BW1A 2M16A 2QXFA 5KE2A 2CS7A 4MZTA 2JOYA 3CCEQ 3L2RA 2KROA 3CMEQ 1VYVA 1K76A 1K9MU 2K7AA 1YITQ 5I21A 1ZSZB 3JB9F 3P8BB 4C92A 1ARKA 2RJEA 1QVFP 1Q7YC 2PQWA 4II1A 3CBOA 3OYIA 3BE3A 3CD6T 2YUNA 4FL6A 1B07A 2K9GA 3UA7A 5GAOq 3CCST 1S72A 1FXXA 5EC7A 4BD3A 3FRNA 1H3HA 4RG8A 2L8DA 3M0QA 1VQNT 1WGSA 1Q7YU 4XTYA 4PJOA 3VS2A 1AD5A 1YCSB 4C92D 4AFSC 3QYGB 2QQBA 1YJWT 3AHUA 3NGPA 3LLRA 3NPFA 1U8RA 2PNIA 2J06A 3NHNA 3FIFA 4BY6C 2KSSA 4FSSA 3JB9G 1WX6A 2CYZB 2QG9B 4IIOA 2CP3A 2ED1A 3UATA 4OMNA 5FRMA 1Q86U 3OA6A 5GAN2 1T3LA 2BE7D 2F1LA 2QQSA 4IURA 2J05A 4NL3A 3EG1A 2FPFA 3EGXB 4GLKA 3V7SA 3RKXA 4J8OA 3CCJA 1B34A 2O2OA 1UGRB 2CUBA 2EQUA 2EAYA 2KRMA 2DERA 4AFQC 1WXTA 2EYYA 4JJBA 3HP9A 2OTJQ 3BDLA 1UTIA 1QKXA 4JS5A 1WXBA 3RDVA 5GANh 1QVGA 4PNOA 1I8FA 5IH2A 2VB6A 5GMKh 2E65A 4R56A 2DE0X 1MNEA 2ZGWA 3M56A 4JLGA 2JN0A 3FJ5A 3GNGA 1B7TA 3GLXA 4LDYA 1Q86C 2O9VA 5GMKm 2DEUA 1WI7A 2F2VA 1OYXA 1OX8A 1BKBA 4XU3A 3SB2A 5GAMf 2FZGB 3CCLT 3CCVQ 5LJ3g 4LD6A 2LDMA 1N9RA 3HRTA 1H641 3MHXA 4M7AE 2KT1A 1X6OA 1NPRA 3S3NA 1JU5C 2F5TX 2LQ8A 5DLOA 3MO8A 3OSVA 2OTLA 4BACA 3OYGA 3SWNA 4A63B 4F7UB 2CT3A 3RESA 4D6WA 4F14A 3X24B 4RTUA 3M5AA 2VYTA 1PCXA 1M90U 1SKUB 1LJOA 1UHCA 3MEAA 4AMCA 4HVVA 2BIVA 2ZPFB 4M78D 1HXDA 2E64A 4J5YA 1MHNA 2HSPA 3CC7Q 2GFAA 3A5ZB 4LNPA 5LJ5d 1X6GA 4ME7A 4PJNA 1Q86R 4RTWA 1FMKA 1BB9A 4D8KA 1HD3A 1Z9ZA 3QBYA 4AFUC 3PVQA 1XOVA 1IHVA 4KGVB 1KC8R 2V26A 2V8KA 4QQGA 3GP8A 2DTOA 2MI6A 2DIQA 3CCUQ 1N8RC 4ESRA 5FU6C 1HJDA 3ZFJA 2EW3A 3MEWA 4ANJA 3UF4A 3JSCA 1XJWB 5CO7A 2CZ1B 1OEBA 1JBMA 2DVEA 2ZPIB 1PM3A 1VYUA 4RKUE 5KYXA 1D09B 5I11A 2O31A 2HEQA 3BDUA 2RQUA 4M78F 5LJ5g 3QWXX 1K0XA 3EGUA 5KYUA 4M77F 2YSQA 4EMKA 3GBQA 2XK0A 2FZKB 3ZBDA 4N4IA 1QVGP 4OMOA 3CCRQ 1Q81R 3LH0A 2M1HA 2PVGB 3G71Q 3VS3A 2FPDA 3CCEA 2LX9A 1YHQQ 3A8HB 1M1FA 2E3IA 5M9OA 3C94A 3EGDB 1K1ZA 2MMPA 1G83A 3P8HA 1K0SA 3QDFA 3CC2A 9ATCB 2AT1B 2R5MA 3ASKA 1YI2Q 1H3ZA 2HBPA 1Y57A 1AWJA 2CH4W 2QQAA 2CDTA 2XMFA 3PMIA 1SRMA 4C8QF 3HL8A 3ER0A 2LMJA 4JPBW 1U3OA 2XIDA 3HPWA 3V7CA 3TEEA 1RACB 1M27C 3QKJA 3PGGA 2F5KA 2RQWA 5L8RE 3I35A 1Y96B 2YRDA 2F69A 3OYHA 3EFOB 3UPUA 2D8HA 2KQWA 3A98A 1LPLA 1MMGA 2PZ1A 4M75D 2LJ3A 1VQ7T 2NWMA 4PJLA 3CCMT 2EJ9A 1QCFA 3H6ZA 1Q81C 3OYAA 5KE3A 3MEUA 4DBRA 1WHHA 3RNJA 5KYYB 1K8AC 2DZ9A 2RPNA 2EQKA 1AHJB 5IT9E 2JNGA 2ZCFB 4J6YA 4F7UE 4OB3B 4M75A 3EAEA 4OMLA 2KI7A 1S72T 1KQ1A 1BI0A 2CP2A 4OMPA 2EGAA 4C5EA 1VQPA 2ZZDA 1VQNQ 5GMKj 3G7ZA 4J9CA 4DBQA 1QW1A 1WZOA 1YJWQ 1G3TA 3RIRA 4Y92A 5L23A 1KSWA 2BZYA 1OULA 2LT4A 1KHIA 3G4SQ 2FRWA 5LJ3d 2YUOA 2LZ6B 4FW1A 4LXCA 1M1KC 1D1BA 2W10A 1NZ9A 4RTYA 3L2UA 1JXOA 3OY9A 2CT4A 1P92A 1QCNA 1YBYA 2D0QB 1X2QA 2P0QA 4M78E 1BK2A 4ORZA 4BI8B 1U06A 1RAAB 1IXDA 2E6ZA 2XDBA 2PU9B 4PJOG 4DOWA 3JAME 3L2QA 1E7OA 4JS4A 2YLBA 1C6VX 5LL6S 1NLPC 5GAOr 2OTJA 3U23A 4C0FA 1NPPA 2KT8A 4LDVA 2OI3A 2WSEE 1JJ2A 2RJDA 2EGEA 2H3EB 3G1JA 1CKBA 1O9SA 1Q95G 2G3RA 1EZZB 3JB9I 1K8AR 4N0AA 1TH7A 4VUBA 1SHFA 3REAB 2DJZA 1OU9A 1XTDA 3I56T 1MMAA 3C95A 4M4ZA 4Q5WA 3M54A 2ZPHB 3NTKA 1F1BB 2DILA 3R6OA 1W2BA 1G5VA 4A4KA 2DL5A 1NEBA 3X20B 2FG0A 1M4ZA 4KUDK 2HQEA 2MF2A 2QGFB 4PK4A 3QSUA 2CKKA 3VRZA 5HK3A 4JRQA 2GFUA 4HCBA 1U1TA 3O5ZA 4L59A 3VS7A 3MKDA 1M1GA 3LW5E 5D6WA 4D8DA 2OAUA 3I9QA 1W2BS 2VKNA 4Z8AA 1RABB 3QG1A 3E19A 4KBMB 5KYUB 3S3OA 1PRLC 2A7YA 5I22A 1ZSZC 2XU8A 3T9NA 2LCSA 2D1XA 3R6NA 2BZXA 1QQJA 2P84A 2ZPGB 2D6FA 1UE9A 2XG8D 1PSFA 4PJOD 2XI9A 1UGQB 1QVPA 1ZLMA 5KCHA 3S3MA 1KFZA 3OW2P 3CCMQ 2A36A 3PE0A 5C6SA 3CXCA 1VQLA 1KD1R 2LJ0A 2RHZA 4CC7A 1MV3A 2DO3A 1M8VA 1VOMA 1IREB 2W0ZA 3BY7A 5GAOm 4LE9A 4J7FA 2X3WD 1AEYA 2MPXC 3HFOA 5FU6B 3DKMA 3TQ7P 1MUZA 5LJ3j 2L3SA 3WXMB 1X69A 4BDYA 1MV0B 5FW9A 4XTZA 1W6XA 1NEGA 2L89A 1U5SA 2LJ1A 2EYQA 3JB9J 2NYSA 4M7DF 4PFZA 2P0KA 1K4US 2YLCA 4YTLA 2RJCA 2JS2A 2RM4A 4UC4A 1BI3A 1M2OA 1KQSA 3NFCA 2CGHA 4M7DE 2VGNA 3MJXA 5LJ5h 4C92F 3CMAA 3VU3C 2GQVA 4GBQA 3M9QA 3H8ZA 1VQ9Q 1VQ4A 2V1RA 3JCMX 5HY6A 1OZ3A 3JCMh 4X34A 4L6V5 2EIFA 5IN1A 3TSZA 3DB3A 2NLUA 4C92B 1S72Q 1KQSS 1RADB 3OYLA 3CC7A 4PL6A 2Z0WA 1UUEA 2QQRA 3MCAB 1KIKA 3PIOA 2QA4T 2WACA 5LJ5j 1VQLQ 1GFCA 1NBEB 3EH2A 2ROTA 1KQ2A 2L3RA 2RNAA 3I56Q 1PG5B 2CREA 1PSEA 5FROA 4OMMA 3OSSC 1LCKA 3J80E 3M58A 5ECAA 2L3PA 4XU2A 2RB6A 4J6WA 2LNVA 2HAXA 1VQMQ 4RCBA 3CC4Q 4IUTA 1S1NA 4C8QB 5DLQE 1XNIA 3TVTA 5GAOp 1NM7A 1C0MA 2Y4YA 1FMWA 5AYFA 2DRMA 2LQWA 1D3BB 4CC4B 1AZGB 2J6OA 2RMOA 1M3AA 2K2VA 3MP1A 2K6DA 4J9GA 7AT1B 2ATCB 3QYHB 1ZQ1A 4GY5A 2KXDA 3CEYA 3SD4A 3VUZA 4ELZC 1VQ8Q 1M30A 2E5QA 2LCLA 3OS5A 2O4XB 1BBZA 1MMDA 5I2SA 3CC4T 3CXCP 3JCMQ 3QHSA 4P5NA 2IIMA 4CRIA 2AK5A 1YJWA 5LJ5f 5LJ5e 1B34B 2K79A 3H0IA 2AHJB 4OB1B 4C8QC 2KYMA 1YI2A 2NUTA 1RAIB 2GTJA 2SEMA 3H41A 4M75F 1RLQC 2E70A 4FYXB 2D0NA 3OMCA 2DD5A 1D0YA 3N5BB 4K11A 1SHGA 5KCOA 4FM4B 2EWNA 4A4FA 2JTEA 2E6NA 4DBFA 1WDXA 1X2KA 1TUGB 2F2XA 4QKUA 4KRTA 1VQ8A 1KHCA 5HKCA 3C12A 3SDZA 3I55A 3HFNA 4PJOC 1I07A 5D6YA 1SPKA 1KD1U 4FSXA 4C5IA 3REBB 1MNDA 1X6BA 3LGLA 2J6KA 1VQ8T 2D9TA 3G6EQ 2ENMA 2KRSA 1OV3A 3EH1A 1T0HA 3A8GB 1NLOC 3EG3A 5A2QE 2QDYB 3QXEB 3HSBA 4WF2A 1WJRA 2RHYA 3CCLQ 1R0BG 3ZL7C 3EFOA 4Z88A 3VS5A 2PVOB 4EMGA 3JB9D 1VQKA 1JJ2P 2DL3A 1W70A 3SWNB 3QO3A 5CKEA 1AOJA 5DY9A 3M59A 3GF5A 1WNLA 3OBYA 1D1CA 2X9HA 2K3YA 1IRXA 4A4EA 2DD4A 2G6FX 2BTTA 2MIOA 4GLMA 2DKGA 4E7KA 1YJNA 2DXUA 2YUQA 3M0TA 5GAN8 4XAXB 3OW2A 2DBMA 1KC8C 1VQOA 3QUIA 4N0AC 4E7LA 3RMSA 3QWYA 3EHQA 3JCMd 1H8KA 3E1SA 5CCAA 4LDWA 3Q1JA 1ZUKA 2XD0A 2KYBA 1HK9A 2QDLA 1YCYA 4QQDA 3OYKA 3VV0A 2DZCA 4J83A 2F2WA 2RQVA 5CKBA 1Q82R 4XQ3A 1A0NB 4MZPA 1GCQC 2JUFA 3CCRT 3MP6A 3KBGA 2DNUA 3FEOA 3JCMg 2YHTA 2O9SA 2JT4A 2PTKA 4JZ3A 4N4GA 2JZ2A 4HKEA 2K3BA 1QVFS 4OF1A 4M7DC 2GBQA 1TOVA 5IXBA 4C8QA 4OB2B 4RTZA 4M75G 3TU4K 1ZA1B 1Z9QA 2KE9A 2BE9B 1IGUA 3ULRB 2COWA 4XU0A 1FMVA 1YIJA 4BE2A 1TG0A 1SG5A 4M77C 4OP0A 3CCVT 4KULA 2HL5C 4IUPA 4NL2A 3PFSA 4Y91A 3UWNA 3INZA 3OYYA 1OI1A 2DA9A 2KMTA 5GAN7 4ATOA 3CCSQ 2O88A 3CCLA 5GANe 3L42A 3H0FA 1YIJT 4HCCA 3CD6Q 4MMKA 3CBMA 1RUWA 2LX7A 4JDSA 2O4XA 1BI2A 4J7IA 3VYHB 1VIFA 1RAGB 2NUPB 1QWFA 2EKOA 4KUIA 2I2LA 2P0PA 2HL3A 3PNWC 1PHTA 4HVWA 2EPDA 3HHTB 2JJ9A 3MPUB 3CQTA 2K5FA 1BYMA 1YNZA 2FHDA 2ROLA 4Z02A 1WQWA 1SSFA 5GAN3 2E10A 4M7DA 1ZSZA 3A8MB 1M9SA 3WVDB 1K9MC 3EGXA 4FIBA 4C0DC 2IPOB 4FYWB 2QA4A 4JUVA 3SFMA 2MOXA 1YITT 3GIBA 2MWOA 4RUGA 1GFDA 2KDSA 2KRNA 1M2VB 1QWEA 2VV5A 3G4ST 1ZBJA 1YWPA 4J6XA 2DIGA 4BDZA 4XU1A 2QAZA 1ZHIA 3CBPA 2AKLA 4R0KA 1UDLA 3VS0A 1M3BA 2VGMA 4E7ZA 2XHCA 1LNXA 3PMTA 2VXEA 5A0GA 3GNFB 1VQ6A 5D7UA 5IXFA 3E2UA 1TUDA 4C92E 4J9HA 4RTVA 5FWBA 3RR6A 3NTIA 4KT0E 3CPWS 1G3SA 2HD0A 2YWWA 2RK1A 3F70A 1UEBA 1BCOA 4EIKA 3ME9A 1QP2A 4PJOE 1VQ6T 1I4K1 2RO0A 1N9SA 4PFPA 1N8RR 4MMLA 5GMKl 1Q81U 4M78A 1M1KR 4XTWA 1U1SA 1UGVA 2X4YA 2DF6A 1SF9A 4X1VA 5KH6A 2D8JA 2JTFA 1RAHB 4M75C 1UG1A 4ZGDB 2HBWA 2KXCA 3KUFA 4OMFB 1WIEA 2JMCA 5A0DA 2WSCE 4C5GA 1GCPA 3OYEA 2M0YA 1WJSA 2OJ2A 2BKDN 1OZ2A 4AFZC 1D1AA 4FYYB 3L2ZA 1TS9A 3EHRA 2EYZA 3EG9B 3LGFA 1WA7A 2EFIA 1N8RU 2R5AA 3PT9A 6AT1B 4LUDA 4X9CA 4OGCA 4HA8A 1SRLA 4FW2A 4M7AC 2LC4A 1Y7XA 1JEGA 5GJVB 2EYWA 2K5LA 2RH2A 2FEIA 1WYXA 4PJOB 2JM9A 1RI0A 1V29B 4QVZA 2LP5A 3VUBA 4M7DD 2CUDA 5GAOl 2HQHA 2KAFA 4B9XA 5FU7C 3WVEB 4CC2A 1QKWA 4BI3A 3LH5A 1ABQA 2K57A 1SSHA 3GOXA 1G2BA 5GANg 2DMOA 1KC8U 4M77D 4M7AG 1WHLA 5C0MA 1VA7A 3OS2A 2RQRA 2X51A 2E41A 1VQOQ 3M57A 4XTXA 4EMKB 2QTXA 2XICA 1VQPT 2LT1A 3X28B 2VUBA 2Y4XA 1OPKA 1FX7A 3IQLA 3QZ9B 3CC2Q 5GAN5 4C8QE 3M0RA 1IGQA 1KD1C 2VASA 2EJGA 4F7UA 2NUZA 3I55T 1VQ5Q 5I2MA 1N27A 3HTRA 1VQ5A 5A0LA 3JCMe 1G3WA 2ED0A 2VC8A 1LOJA 3G71T 2XDPA 3CCMA 4F7UF 4IKFA 4F04B 5GAMg 1C1AA 1FYNA 3G6ET 1D3BA 2QQ9A 1G3YA 1WHKA 4LD9K 2C0IA 3CCJT 3M55A 2NUPA 4Z89A 1RI9A 1YJ9Q 4XTUA 3CCQT 2HDAA 1YP5A 5KYWA 2LTOA 2EQMA 1UJYA 4E7HA 2LQNA 3O8VA 4KH0B 4BB7A 2E4HA 3G6EA 4IIMA 1GRIA 4IUVA 3E9GA 5GAMj 2OTLT 4CI0C 3OYCA 1GBRA 4FYVB 3EGDA 5CKFA 2RD1A 2X4WA 2LQKA 5AT1B 5GMKe 3THKA 3VS4A 1O75A 5CK9A 3G4SA 2DXBA 3AT1B 4M7AA 4E7SA 2M0OA 4C92G 2B86A 1JB0E 4M78C 2CP0A 2CP6A 2QEXA 5LJ3f 1UJ0A 4KH1B 1M8MA 3QIIA 2KY9A 2X35A 3HKSA 4LDUA 3RBBB 1I1JA 2RHXA 2DAQA 1CSKA 3LWIA 2CP5A 1GXIE 3J81E 2GCXA 1VQ7Q 1AVZC 3OYDA 5J3BA 4J9DA 3CMAT 4LDXA 1Q7YR 4JZ4A 3M0SA 2A08A 2X3XD 2MCNA 1I0CA 2DEQA 4ZN3A 1D0ZA 1JJ2S 1HSQA 1MMNA 1WQ7A 1VQ6Q 2JW4A 1Q82U 2P4RA 3OYJA 3JCMP 1SEMA 3RUXA 3I56A 1XQHA 2EVRA 5GANd 4OVAA 1OQKA 4IUUA 1MGQA 4EPCA 4EDUA 3I55Q 2OTLQ 1ZX6A 3CC7T 5IHKA 2M02A 3C0CA 1YHQA 3I5SA 3VS6A 3M4YA 3GPLA 2ZAEA 1I81A 2HNIA 2GGRA 2KNBB 1JRIA 2YT6A 3CCRA 3M53A 1E6HA 2RF0A 2YUPA 3JCMb 1YJ9T 2P4TA 3UA6A 3VKIA 1WJQA 2PVDB 1UGSB 2H3JA 3CPWA 1VYTA 3OYFA 1VQMT 2RI2A 2CZ6B 2C0TA 4C0GA 5GAN4 2AZVA 1M5Q1 2K3XA 2JXBA 2XDDA 4LUEA 5CIUA 3EG2A 2COYA 3X25B 3PIPA 4F7UG 1Y07A 1IZ6A 2FVUA 5EG2A 4JJNK 4QVCA 1BU1A 2L5QA 4ZNXA 3M0PA 4M75B 2IVWA 1VQLT 2OAWA 1YWOA 4JRIA 4M77E 4E7IA 2PUKB 3JV3A 3CXCS 1VQ9T 2BUDA 4M78G 2FPEA 5GANj 5GJWB 2SRCA 1DJ7B 1TTHB 1TU0B 1EX4A 1YITA 4C5HA 5KYYA 1N5ZA 2FRYA 3CCJQ 1NJIR 3I5RA 4DA4A 2DFUA 4O6JA 2K5IA 2LNHB 4AG1C 4KGZB 2HKQB 1KG1A 2ABLA 2DM1A 1K73C 5CAIA 1YIJQ 5CR2A 1QMCA 3H0HA 2RN8A 3CC4A 2FB7A 4M7AF 3LWHA 1JXMA 4JRKA 2VXFA 1R77A 4PJOF 5FRNA 2AIRB 1VIEA 2KGTA 1PD0A 2LRQA 3V8KA 4FU6A 2FYKA 3CC2T 1KK7A 2CH4A 5HK0A 3EG0A 1YI2T 1LVKA 3X26B 3OQ5A 4B9WA 4ZGEB 4DEXA 4V2SA 4PJMA 3VS1A 1TWBA 2KBTA 5DM7R 5GAOn 1JQQA 3A8LB 1VQ4T 3NMZC 3RKYA 1IHWA 2X4JA 1GL5A 4ZGJB 4PLIA 2DTHA 5HCKA 1W2BP 1W4SA 3QJ6A 1PWTA 3A1PA 2AZSA 2DBKA 3META 2K2MA 2CSIA 4HCKA 3OW2S 3MP8A 1I5OB 5GAMh 4RTXA 1R0CB 2DETA 2B8AA 4M77A 5J26A 1ZUYA 1OOTA 2VVKA 2KEAA 1ZBXA 1BIAA 1TUCA 2FL7A 3TCJA 4B6MA 3CMEA 4A54A 2E5KA 3QZ5B 1WXUA 1X75C 4E47A 4JRPA 1ZUUA 3SEMA 3E9FA 4DEYA 2DYIA 3MEVA 2KR3A 1TSFA 1WLPB 4OGEA 3BFMA 2C0OA 5CQYA 2ZPEB 2V8IA 2HQXA 4C0ZA 1NJIC 2EQJA 1I5LA 4M7DG 3CMET 4FT2A 3HRSA 1VQKT 1K9AA 1UGPB 2RHIA 2RK2A 4MDWA 2RJFA 3TREA 2I0NA 1K73R 4M78B 1T3SA 1V76A 1WHGA 1X27A 3KFVA 4BE1A 1VQ4Q 3CD6A 1NG2A 2Y90A 1M90C 4IUQA 4PFOA 3CCSA 1EIFA 3UDCA 2HKNA 1FWZA 4BUGA 1PKSA 3JCMW 1RAEB 3OBWA 1EFNA 1BIBA 2DK3A 2DL7A 4KGXB 1TXQA 2C06A 3SHWA 4NS5A 3FB9A 3CPFA 3ZEHA 5IHIA 5KYXB 1RAFB 5LJ3h 2EGCA 2DL8A 4BE0A 4M7DB 2V8JA 2DX1A 3QJYA 3FC3A 2A28A 1VQKQ 2KK4A 4HT9A 2MWPA 3URGA 1VQ7A 1M2VA 2QGGA 1QCOA 1BCMA 4LN2A 4RCCA 4E6RA 1VUBA 4HVUA 2MK5A 4J9FA 3M4GA 2HCKA 3VRYA 1H92A 3UT1A 1UECA 2R58A 2QEXQ 1Y0MA 2EYXA 1VQNA 4DOVA 3JB9H 2IG0A 4J9IA 3QPHA 3EG9A 1NE8A 2RA2A 4HCZA 3G71A 4C92C 2CSQA 1QLYA 5CVIA 3PVLA 3QDRB 3HRUA 1ACMB 4EMKC 4N4HA 3EFRA 2R57A 3CCUA 3JCMc 4PJJA 4CC3A 2EQIA 1PC0A 1R8OB 4PLLA 3CCQA 2YRVA 2FO0A 1M90R 3SWNC 4PKCC 1Y71A 2GTOA 2VWFA 3LYIA 2DXCA 3KXTA 3EFSA 4L5GA 2DLPA 1AT1B 3FDRA 1VQPQ 4J9EA 4XTVA 5FU7B 2CZ0B 2WSFE 3DLLA 1VQOT 2MYSA 3V8JA 4E2FB 1WHJA 4HT8A 3OS1A 2A3LA 2COZA 1G8XA 4J9BA 1RLPC 1OPLA 1VQ5T 2L3QA 3D7SB 1NYGA 4JJDA 2GNCA 4AG2C 4FCYA 2AKKA 2OTJT 3OYNA 2RI5A 3TSWA 4R55A 2E12A 1KJWA 2QTVA 3NTHA 3L1AA
chains in the Genus database with same CATH topology
1WHHA 2CP3A 2E4HA 1WHJA 2HQHA 2Z0WA 2QK0A 3E2UA 2COZA 1WHMA 2HKNA 2HL3A 2HKQB 2COWA 2CP0A 2CP6A 2M02A 1WHKA 1IXDA 2CP7A 1TXQA 4B6MA 3RDVA 1LPLA 2MPXC 1WHLA 2HL5C 2CP2A 2E3IA 1WHGA 2E3HA 3TQ7P 2CP5A 2COYA 1TOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHH A;  2CP3 A;  2E4H A;  1WHJ A;  2HQH A;  2Z0W A;  2QK0 A;  3E2U A;  2COZ A;  1WHM A;  2HKN A;  2HL3 A;  2HKQ B;  2COW A;  2CP0 A;  2CP6 A;  2M02 A;  1WHK A;  1IXD A;  2CP7 A;  1TXQ A;  4B6M A;  3RDV A;  1LPL A;  2MPX C;  1WHL A;  2HL5 C;  2CP2 A;  2E3I A;  1WHG A;  2E3H A;  3TQ7 P;  2CP5 A;  2COY A;  1TOV A; 
#chains in the Genus database with same CATH topology
 4QW2 A;  4FT4 A;  2PUO B;  5IHN A;  1J3T A;  1X01 A;  4ZTJ A;  4ELY C;  1IO6 A;  1YJN T;  1ZSG A;  2DYB A;  1YFN A;  1WFW A;  1Q82 C;  3DB4 A;  2JMA A;  1V1C A;  1IB8 A;  1OU8 A;  1E6G A;  1QVG S;  4QT7 A;  3CCV A;  8ATC B;  1NYF A;  5GAM e;  2JTM A;  1VQM A;  4OMQ A;  1QP3 A;  2L0A A;  2HSE B;  3JCM f;  5KYN A;  1HYO A;  3M0U A;  5CKD A;  2DRK A;  4Y28 E;  1K8A U;  2J7I A;  5FLX E;  4WTO B;  2DPP B;  1ABO A;  2YDL A;  3OMG A;  4M75 E;  4WCI A;  3OYB A;  2X4X A;  2QEX T;  1D0X A;  2V1Q A;  4F17 A;  1UB4 A;  2MAM A;  5IAY A;  4TVR A;  1YHQ T;  1ZA2 B;  5GAN f;  1Y96 A;  1T0J A;  3OYM A;  1QVF A;  2QYZ A;  3FLG A;  4X9D A;  1PD1 A;  2RHU A;  3CCE T;  4A4G A;  1UHF A;  4A4H A;  2QA4 Q;  5GAM d;  3C4S A;  1AWW A;  1YJ9 A;  1KQS P;  1M1K U;  4F16 A;  5CQX A;  2E3H A;  3JRZ A;  1PRM C;  2JS0 A;  1YJN Q;  2DVJ A;  4DBH A;  1AWO A;  1K73 U;  4RG2 A;  2K4Y A;  3L2W A;  3VYG A;  4JJC A;  1YN8 A;  3CMA Q;  1JO8 A;  4ZN1 A;  2JVV A;  2ESW A;  3FJP A;  2HZY A;  1PNJ A;  2A37 A;  4RMO A;  2QK0 A;  1K9M R;  4C0D B;  2ZPB B;  3L2V A;  2YXY A;  3JCM V;  2RI3 A;  3H9N A;  3OS0 A;  4OB0 B;  1BI1 A;  3VJP A;  3OB9 A;  2H8H A;  1CKA A;  3V7R A;  4C8Q D;  4M77 G;  4M7A D;  3CCQ Q;  4A53 A;  4QQ6 A;  1B3Q A;  4C8Q G;  3DLM A;  1AZE A;  1X43 A;  3S6W A;  8AT1 B;  2NUT B;  4HXJ A;  5CKH A;  3A8O B;  5LJ3 e;  2E1H A;  2M9U A;  3JCM J;  4JLI A;  3LX7 A;  2O01 E;  2QI2 A;  1PKT A;  1RL2 A;  4AT1 B;  4XK8 E;  2LCC A;  3RER A;  3RKW A;  1VQ9 A;  4BY6 B;  2ECZ A;  2JM8 A;  5D6X A;  2RQT A;  2CZ7 B;  2GQI A;  4EMH A;  1GCQ A;  2DL4 A;  2QAS A;  2EJF A;  2HMA A;  2EKH A;  4M7A B;  4RTT A;  4ZTF A;  4M77 B;  2A0F B;  2OX7 A;  2M51 A;  2L2P A;  5KYW B;  4MZM A;  4E7J A;  1OX9 A;  3CCU T;  4NOY A;  1N6A A;  2BZ8 A;  1NJI U;  2EBP A;  4MDX A;  1UFF A;  5GAN 6;  1WHM A;  4BI4 A;  5GMK i;  4O5V A;  4QVD A;  2DTI A;  2J6F A;  1AWX A;  2DXT A;  3V8L A;  2CP7 A;  2DJQ A;  1WPY A;  2GF7 A;  2LVM A;  1W1F A;  2XKO C;  2FZC B;  5J39 A;  4DQ2 A;  3CPW P;  2KVQ G;  5FWC A;  3J7A F;  3P8D A;  1M3C A;  3PTA A;  3RMQ A;  2YRC A;  1GBQ A;  3BW1 A;  2M16 A;  2QXF A;  5KE2 A;  2CS7 A;  4MZT A;  2JOY A;  3CCE Q;  3L2R A;  2KRO A;  3CME Q;  1VYV A;  1K76 A;  1K9M U;  2K7A A;  1YIT Q;  5I21 A;  1ZSZ B;  3JB9 F;  3P8B B;  4C92 A;  1ARK A;  2RJE A;  1QVF P;  1Q7Y C;  2PQW A;  4II1 A;  3CBO A;  3OYI A;  3BE3 A;  3CD6 T;  2YUN A;  4FL6 A;  1B07 A;  2K9G A;  3UA7 A;  5GAO q;  3CCS T;  1S72 A;  1FXX A;  5EC7 A;  4BD3 A;  3FRN A;  1H3H A;  4RG8 A;  2L8D A;  3M0Q A;  1VQN T;  1WGS A;  1Q7Y U;  4XTY A;  4PJO A;  3VS2 A;  1AD5 A;  1YCS B;  4C92 D;  4AFS C;  3QYG B;  2QQB A;  1YJW T;  3AHU A;  3NGP A;  3LLR A;  3NPF A;  1U8R A;  2PNI A;  2J06 A;  3NHN A;  3FIF A;  4BY6 C;  2KSS A;  4FSS A;  3JB9 G;  1WX6 A;  2CYZ B;  2QG9 B;  4IIO A;  2CP3 A;  2ED1 A;  3UAT A;  4OMN A;  5FRM A;  1Q86 U;  3OA6 A;  5GAN 2;  1T3L A;  2BE7 D;  2F1L A;  2QQS A;  4IUR A;  2J05 A;  4NL3 A;  3EG1 A;  2FPF A;  3EGX B;  4GLK A;  3V7S A;  3RKX A;  4J8O A;  3CCJ A;  1B34 A;  2O2O A;  1UGR B;  2CUB A;  2EQU A;  2EAY A;  2KRM A;  2DER A;  4AFQ C;  1WXT A;  2EYY A;  4JJB A;  3HP9 A;  2OTJ Q;  3BDL A;  1UTI A;  1QKX A;  4JS5 A;  1WXB A;  3RDV A;  5GAN h;  1QVG A;  4PNO A;  1I8F A;  5IH2 A;  2VB6 A;  5GMK h;  2E65 A;  4R56 A;  2DE0 X;  1MNE A;  2ZGW A;  3M56 A;  4JLG A;  2JN0 A;  3FJ5 A;  3GNG A;  1B7T A;  3GLX A;  4LDY A;  1Q86 C;  2O9V A;  5GMK m;  2DEU A;  1WI7 A;  2F2V A;  1OYX A;  1OX8 A;  1BKB A;  4XU3 A;  3SB2 A;  5GAM f;  2FZG B;  3CCL T;  3CCV Q;  5LJ3 g;  4LD6 A;  2LDM A;  1N9R A;  3HRT A;  1H64 1;  3MHX A;  4M7A E;  2KT1 A;  1X6O A;  1NPR A;  3S3N A;  1JU5 C;  2F5T X;  2LQ8 A;  5DLO A;  3MO8 A;  3OSV A;  2OTL A;  4BAC A;  3OYG A;  3SWN A;  4A63 B;  4F7U B;  2CT3 A;  3RES A;  4D6W A;  4F14 A;  3X24 B;  4RTU A;  3M5A A;  2VYT A;  1PCX A;  1M90 U;  1SKU B;  1LJO A;  1UHC A;  3MEA A;  4AMC A;  4HVV A;  2BIV A;  2ZPF B;  4M78 D;  1HXD A;  2E64 A;  4J5Y A;  1MHN A;  2HSP A;  3CC7 Q;  2GFA A;  3A5Z B;  4LNP A;  5LJ5 d;  1X6G A;  4ME7 A;  4PJN A;  1Q86 R;  4RTW A;  1FMK A;  1BB9 A;  4D8K A;  1HD3 A;  1Z9Z A;  3QBY A;  4AFU C;  3PVQ A;  1XOV A;  1IHV A;  4KGV B;  1KC8 R;  2V26 A;  2V8K A;  4QQG A;  3GP8 A;  2DTO A;  2MI6 A;  2DIQ A;  3CCU Q;  1N8R C;  4ESR A;  5FU6 C;  1HJD A;  3ZFJ A;  2EW3 A;  3MEW A;  4ANJ A;  3UF4 A;  3JSC A;  1XJW B;  5CO7 A;  2CZ1 B;  1OEB A;  1JBM A;  2DVE A;  2ZPI B;  1PM3 A;  1VYU A;  4RKU E;  5KYX A;  1D09 B;  5I11 A;  2O31 A;  2HEQ A;  3BDU A;  2RQU A;  4M78 F;  5LJ5 g;  3QWX X;  1K0X A;  3EGU A;  5KYU A;  4M77 F;  2YSQ A;  4EMK A;  3GBQ A;  2XK0 A;  2FZK B;  3ZBD A;  4N4I A;  1QVG P;  4OMO A;  3CCR Q;  1Q81 R;  3LH0 A;  2M1H A;  2PVG B;  3G71 Q;  3VS3 A;  2FPD A;  3CCE A;  2LX9 A;  1YHQ Q;  3A8H B;  1M1F A;  2E3I A;  5M9O A;  3C94 A;  3EGD B;  1K1Z A;  2MMP A;  1G83 A;  3P8H A;  1K0S A;  3QDF A;  3CC2 A;  9ATC B;  2AT1 B;  2R5M A;  3ASK A;  1YI2 Q;  1H3Z A;  2HBP A;  1Y57 A;  1AWJ A;  2CH4 W;  2QQA A;  2CDT A;  2XMF A;  3PMI A;  1SRM A;  4C8Q F;  3HL8 A;  3ER0 A;  2LMJ A;  4JPB W;  1U3O A;  2XID A;  3HPW A;  3V7C A;  3TEE A;  1RAC B;  1M27 C;  3QKJ A;  3PGG A;  2F5K A;  2RQW A;  5L8R E;  3I35 A;  1Y96 B;  2YRD A;  2F69 A;  3OYH A;  3EFO B;  3UPU A;  2D8H A;  2KQW A;  3A98 A;  1LPL A;  1MMG A;  2PZ1 A;  4M75 D;  2LJ3 A;  1VQ7 T;  2NWM A;  4PJL A;  3CCM T;  2EJ9 A;  1QCF A;  3H6Z A;  1Q81 C;  3OYA A;  5KE3 A;  3MEU A;  4DBR A;  1WHH A;  3RNJ A;  5KYY B;  1K8A C;  2DZ9 A;  2RPN A;  2EQK A;  1AHJ B;  5IT9 E;  2JNG A;  2ZCF B;  4J6Y A;  4F7U E;  4OB3 B;  4M75 A;  3EAE A;  4OML A;  2KI7 A;  1S72 T;  1KQ1 A;  1BI0 A;  2CP2 A;  4OMP A;  2EGA A;  4C5E A;  1VQP A;  2ZZD A;  1VQN Q;  5GMK j;  3G7Z A;  4J9C A;  4DBQ A;  1QW1 A;  1WZO A;  1YJW Q;  1G3T A;  3RIR A;  4Y92 A;  5L23 A;  1KSW A;  2BZY A;  1OUL A;  2LT4 A;  1KHI A;  3G4S Q;  2FRW A;  5LJ3 d;  2YUO A;  2LZ6 B;  4FW1 A;  4LXC A;  1M1K C;  1D1B A;  2W10 A;  1NZ9 A;  4RTY A;  3L2U A;  1JXO A;  3OY9 A;  2CT4 A;  1P92 A;  1QCN A;  1YBY A;  2D0Q B;  1X2Q A;  2P0Q A;  4M78 E;  1BK2 A;  4ORZ A;  4BI8 B;  1U06 A;  1RAA B;  1IXD A;  2E6Z A;  2XDB A;  2PU9 B;  4PJO G;  4DOW A;  3JAM E;  3L2Q A;  1E7O A;  4JS4 A;  2YLB A;  1C6V X;  5LL6 S;  1NLP C;  5GAO r;  2OTJ A;  3U23 A;  4C0F A;  1NPP A;  2KT8 A;  4LDV A;  2OI3 A;  2WSE E;  1JJ2 A;  2RJD A;  2EGE A;  2H3E B;  3G1J A;  1CKB A;  1O9S A;  1Q95 G;  2G3R A;  1EZZ B;  3JB9 I;  1K8A R;  4N0A A;  1TH7 A;  4VUB A;  1SHF A;  3REA B;  2DJZ A;  1OU9 A;  1XTD A;  3I56 T;  1MMA A;  3C95 A;  4M4Z A;  4Q5W A;  3M54 A;  2ZPH B;  3NTK A;  1F1B B;  2DIL A;  3R6O A;  1W2B A;  1G5V A;  4A4K A;  2DL5 A;  1NEB A;  3X20 B;  2FG0 A;  1M4Z A;  4KUD K;  2HQE A;  2MF2 A;  2QGF B;  4PK4 A;  3QSU A;  2CKK A;  3VRZ A;  5HK3 A;  4JRQ A;  2GFU A;  4HCB A;  1U1T A;  3O5Z A;  4L59 A;  3VS7 A;  3MKD A;  1M1G A;  3LW5 E;  5D6W A;  4D8D A;  2OAU A;  3I9Q A;  1W2B S;  2VKN A;  4Z8A A;  1RAB B;  3QG1 A;  3E19 A;  4KBM B;  5KYU B;  3S3O A;  1PRL C;  2A7Y A;  5I22 A;  1ZSZ C;  2XU8 A;  3T9N A;  2LCS A;  2D1X A;  3R6N A;  2BZX A;  1QQJ A;  2P84 A;  2ZPG B;  2D6F A;  1UE9 A;  2XG8 D;  1PSF A;  4PJO D;  2XI9 A;  1UGQ B;  1QVP A;  1ZLM A;  5KCH A;  3S3M A;  1KFZ A;  3OW2 P;  3CCM Q;  2A36 A;  3PE0 A;  5C6S A;  3CXC A;  1VQL A;  1KD1 R;  2LJ0 A;  2RHZ A;  4CC7 A;  1MV3 A;  2DO3 A;  1M8V A;  1VOM A;  1IRE B;  2W0Z A;  3BY7 A;  5GAO m;  4LE9 A;  4J7F A;  2X3W D;  1AEY A;  2MPX C;  3HFO A;  5FU6 B;  3DKM A;  3TQ7 P;  1MUZ A;  5LJ3 j;  2L3S A;  3WXM B;  1X69 A;  4BDY A;  1MV0 B;  5FW9 A;  4XTZ A;  1W6X A;  1NEG A;  2L89 A;  1U5S A;  2LJ1 A;  2EYQ A;  3JB9 J;  2NYS A;  4M7D F;  4PFZ A;  2P0K A;  1K4U S;  2YLC A;  4YTL A;  2RJC A;  2JS2 A;  2RM4 A;  4UC4 A;  1BI3 A;  1M2O A;  1KQS A;  3NFC A;  2CGH A;  4M7D E;  2VGN A;  3MJX A;  5LJ5 h;  4C92 F;  3CMA A;  3VU3 C;  2GQV A;  4GBQ A;  3M9Q A;  3H8Z A;  1VQ9 Q;  1VQ4 A;  2V1R A;  3JCM X;  5HY6 A;  1OZ3 A;  3JCM h;  4X34 A;  4L6V 5;  2EIF A;  5IN1 A;  3TSZ A;  3DB3 A;  2NLU A;  4C92 B;  1S72 Q;  1KQS S;  1RAD B;  3OYL A;  3CC7 A;  4PL6 A;  2Z0W A;  1UUE A;  2QQR A;  3MCA B;  1KIK A;  3PIO A;  2QA4 T;  2WAC A;  5LJ5 j;  1VQL Q;  1GFC A;  1NBE B;  3EH2 A;  2ROT A;  1KQ2 A;  2L3R A;  2RNA A;  3I56 Q;  1PG5 B;  2CRE A;  1PSE A;  5FRO A;  4OMM A;  3OSS C;  1LCK A;  3J80 E;  3M58 A;  5ECA A;  2L3P A;  4XU2 A;  2RB6 A;  4J6W A;  2LNV A;  2HAX A;  1VQM Q;  4RCB A;  3CC4 Q;  4IUT A;  1S1N A;  4C8Q B;  5DLQ E;  1XNI A;  3TVT A;  5GAO p;  1NM7 A;  1C0M A;  2Y4Y A;  1FMW A;  5AYF A;  2DRM A;  2LQW A;  1D3B B;  4CC4 B;  1AZG B;  2J6O A;  2RMO A;  1M3A A;  2K2V A;  3MP1 A;  2K6D A;  4J9G A;  7AT1 B;  2ATC B;  3QYH B;  1ZQ1 A;  4GY5 A;  2KXD A;  3CEY A;  3SD4 A;  3VUZ A;  4ELZ C;  1VQ8 Q;  1M30 A;  2E5Q A;  2LCL A;  3OS5 A;  2O4X B;  1BBZ A;  1MMD A;  5I2S A;  3CC4 T;  3CXC P;  3JCM Q;  3QHS A;  4P5N A;  2IIM A;  4CRI A;  2AK5 A;  1YJW A;  5LJ5 f;  5LJ5 e;  1B34 B;  2K79 A;  3H0I A;  2AHJ B;  4OB1 B;  4C8Q C;  2KYM A;  1YI2 A;  2NUT A;  1RAI B;  2GTJ A;  2SEM A;  3H41 A;  4M75 F;  1RLQ C;  2E70 A;  4FYX B;  2D0N A;  3OMC A;  2DD5 A;  1D0Y A;  3N5B B;  4K11 A;  1SHG A;  5KCO A;  4FM4 B;  2EWN A;  4A4F A;  2JTE A;  2E6N A;  4DBF A;  1WDX A;  1X2K A;  1TUG B;  2F2X A;  4QKU A;  4KRT A;  1VQ8 A;  1KHC A;  5HKC A;  3C12 A;  3SDZ A;  3I55 A;  3HFN A;  4PJO C;  1I07 A;  5D6Y A;  1SPK A;  1KD1 U;  4FSX A;  4C5I A;  3REB B;  1MND A;  1X6B A;  3LGL A;  2J6K A;  1VQ8 T;  2D9T A;  3G6E Q;  2ENM A;  2KRS A;  1OV3 A;  3EH1 A;  1T0H A;  3A8G B;  1NLO C;  3EG3 A;  5A2Q E;  2QDY B;  3QXE B;  3HSB A;  4WF2 A;  1WJR A;  2RHY A;  3CCL Q;  1R0B G;  3ZL7 C;  3EFO A;  4Z88 A;  3VS5 A;  2PVO B;  4EMG A;  3JB9 D;  1VQK A;  1JJ2 P;  2DL3 A;  1W70 A;  3SWN B;  3QO3 A;  5CKE A;  1AOJ A;  5DY9 A;  3M59 A;  3GF5 A;  1WNL A;  3OBY A;  1D1C A;  2X9H A;  2K3Y A;  1IRX A;  4A4E A;  2DD4 A;  2G6F X;  2BTT A;  2MIO A;  4GLM A;  2DKG A;  4E7K A;  1YJN A;  2DXU A;  2YUQ A;  3M0T A;  5GAN 8;  4XAX B;  3OW2 A;  2DBM A;  1KC8 C;  1VQO A;  3QUI A;  4N0A C;  4E7L A;  3RMS A;  3QWY A;  3EHQ A;  3JCM d;  1H8K A;  3E1S A;  5CCA A;  4LDW A;  3Q1J A;  1ZUK A;  2XD0 A;  2KYB A;  1HK9 A;  2QDL A;  1YCY A;  4QQD A;  3OYK A;  3VV0 A;  2DZC A;  4J83 A;  2F2W A;  2RQV A;  5CKB A;  1Q82 R;  4XQ3 A;  1A0N B;  4MZP A;  1GCQ C;  2JUF A;  3CCR T;  3MP6 A;  3KBG A;  2DNU A;  3FEO A;  3JCM g;  2YHT A;  2O9S A;  2JT4 A;  2PTK A;  4JZ3 A;  4N4G A;  2JZ2 A;  4HKE A;  2K3B A;  1QVF S;  4OF1 A;  4M7D C;  2GBQ A;  1TOV A;  5IXB A;  4C8Q A;  4OB2 B;  4RTZ A;  4M75 G;  3TU4 K;  1ZA1 B;  1Z9Q A;  2KE9 A;  2BE9 B;  1IGU A;  3ULR B;  2COW A;  4XU0 A;  1FMV A;  1YIJ A;  4BE2 A;  1TG0 A;  1SG5 A;  4M77 C;  4OP0 A;  3CCV T;  4KUL A;  2HL5 C;  4IUP A;  4NL2 A;  3PFS A;  4Y91 A;  3UWN A;  3INZ A;  3OYY A;  1OI1 A;  2DA9 A;  2KMT A;  5GAN 7;  4ATO A;  3CCS Q;  2O88 A;  3CCL A;  5GAN e;  3L42 A;  3H0F A;  1YIJ T;  4HCC A;  3CD6 Q;  4MMK A;  3CBM A;  1RUW A;  2LX7 A;  4JDS A;  2O4X A;  1BI2 A;  4J7I A;  3VYH B;  1VIF A;  1RAG B;  2NUP B;  1QWF A;  2EKO A;  4KUI A;  2I2L A;  2P0P A;  2HL3 A;  3PNW C;  1PHT A;  4HVW A;  2EPD A;  3HHT B;  2JJ9 A;  3MPU B;  3CQT A;  2K5F A;  1BYM A;  1YNZ A;  2FHD A;  2ROL A;  4Z02 A;  1WQW A;  1SSF A;  5GAN 3;  2E10 A;  4M7D A;  1ZSZ A;  3A8M B;  1M9S A;  3WVD B;  1K9M C;  3EGX A;  4FIB A;  4C0D C;  2IPO B;  4FYW B;  2QA4 A;  4JUV A;  3SFM A;  2MOX A;  1YIT T;  3GIB A;  2MWO A;  4RUG A;  1GFD A;  2KDS A;  2KRN A;  1M2V B;  1QWE A;  2VV5 A;  3G4S T;  1ZBJ A;  1YWP A;  4J6X A;  2DIG A;  4BDZ A;  4XU1 A;  2QAZ A;  1ZHI A;  3CBP A;  2AKL A;  4R0K A;  1UDL A;  3VS0 A;  1M3B A;  2VGM A;  4E7Z A;  2XHC A;  1LNX A;  3PMT A;  2VXE A;  5A0G A;  3GNF B;  1VQ6 A;  5D7U A;  5IXF A;  3E2U A;  1TUD A;  4C92 E;  4J9H A;  4RTV A;  5FWB A;  3RR6 A;  3NTI A;  4KT0 E;  3CPW S;  1G3S A;  2HD0 A;  2YWW A;  2RK1 A;  3F70 A;  1UEB A;  1BCO A;  4EIK A;  3ME9 A;  1QP2 A;  4PJO E;  1VQ6 T;  1I4K 1;  2RO0 A;  1N9S A;  4PFP A;  1N8R R;  4MML A;  5GMK l;  1Q81 U;  4M78 A;  1M1K R;  4XTW A;  1U1S A;  1UGV A;  2X4Y A;  2DF6 A;  1SF9 A;  4X1V A;  5KH6 A;  2D8J A;  2JTF A;  1RAH B;  4M75 C;  1UG1 A;  4ZGD B;  2HBW A;  2KXC A;  3KUF A;  4OMF B;  1WIE A;  2JMC A;  5A0D A;  2WSC E;  4C5G A;  1GCP A;  3OYE A;  2M0Y A;  1WJS A;  2OJ2 A;  2BKD N;  1OZ2 A;  4AFZ C;  1D1A A;  4FYY B;  3L2Z A;  1TS9 A;  3EHR A;  2EYZ A;  3EG9 B;  3LGF A;  1WA7 A;  2EFI A;  1N8R U;  2R5A A;  3PT9 A;  6AT1 B;  4LUD A;  4X9C A;  4OGC A;  4HA8 A;  1SRL A;  4FW2 A;  4M7A C;  2LC4 A;  1Y7X A;  1JEG A;  5GJV B;  2EYW A;  2K5L A;  2RH2 A;  2FEI A;  1WYX A;  4PJO B;  2JM9 A;  1RI0 A;  1V29 B;  4QVZ A;  2LP5 A;  3VUB A;  4M7D D;  2CUD A;  5GAO l;  2HQH A;  2KAF A;  4B9X A;  5FU7 C;  3WVE B;  4CC2 A;  1QKW A;  4BI3 A;  3LH5 A;  1ABQ A;  2K57 A;  1SSH A;  3GOX A;  1G2B A;  5GAN g;  2DMO A;  1KC8 U;  4M77 D;  4M7A G;  1WHL A;  5C0M A;  1VA7 A;  3OS2 A;  2RQR A;  2X51 A;  2E41 A;  1VQO Q;  3M57 A;  4XTX A;  4EMK B;  2QTX A;  2XIC A;  1VQP T;  2LT1 A;  3X28 B;  2VUB A;  2Y4X A;  1OPK A;  1FX7 A;  3IQL A;  3QZ9 B;  3CC2 Q;  5GAN 5;  4C8Q E;  3M0R A;  1IGQ A;  1KD1 C;  2VAS A;  2EJG A;  4F7U A;  2NUZ A;  3I55 T;  1VQ5 Q;  5I2M A;  1N27 A;  3HTR A;  1VQ5 A;  5A0L A;  3JCM e;  1G3W A;  2ED0 A;  2VC8 A;  1LOJ A;  3G71 T;  2XDP A;  3CCM A;  4F7U F;  4IKF A;  4F04 B;  5GAM g;  1C1A A;  1FYN A;  3G6E T;  1D3B A;  2QQ9 A;  1G3Y A;  1WHK A;  4LD9 K;  2C0I A;  3CCJ T;  3M55 A;  2NUP A;  4Z89 A;  1RI9 A;  1YJ9 Q;  4XTU A;  3CCQ T;  2HDA A;  1YP5 A;  5KYW A;  2LTO A;  2EQM A;  1UJY A;  4E7H A;  2LQN A;  3O8V A;  4KH0 B;  4BB7 A;  2E4H A;  3G6E A;  4IIM A;  1GRI A;  4IUV A;  3E9G A;  5GAM j;  2OTL T;  4CI0 C;  3OYC A;  1GBR A;  4FYV B;  3EGD A;  5CKF A;  2RD1 A;  2X4W A;  2LQK A;  5AT1 B;  5GMK e;  3THK A;  3VS4 A;  1O75 A;  5CK9 A;  3G4S A;  2DXB A;  3AT1 B;  4M7A A;  4E7S A;  2M0O A;  4C92 G;  2B86 A;  1JB0 E;  4M78 C;  2CP0 A;  2CP6 A;  2QEX A;  5LJ3 f;  1UJ0 A;  4KH1 B;  1M8M A;  3QII A;  2KY9 A;  2X35 A;  3HKS A;  4LDU A;  3RBB B;  1I1J A;  2RHX A;  2DAQ A;  1CSK A;  3LWI A;  2CP5 A;  1GXI E;  3J81 E;  2GCX A;  1VQ7 Q;  1AVZ C;  3OYD A;  5J3B A;  4J9D A;  3CMA T;  4LDX A;  1Q7Y R;  4JZ4 A;  3M0S A;  2A08 A;  2X3X D;  2MCN A;  1I0C A;  2DEQ A;  4ZN3 A;  1D0Z A;  1JJ2 S;  1HSQ A;  1MMN A;  1WQ7 A;  1VQ6 Q;  2JW4 A;  1Q82 U;  2P4R A;  3OYJ A;  3JCM P;  1SEM A;  3RUX A;  3I56 A;  1XQH A;  2EVR A;  5GAN d;  4OVA A;  1OQK A;  4IUU A;  1MGQ A;  4EPC A;  4EDU A;  3I55 Q;  2OTL Q;  1ZX6 A;  3CC7 T;  5IHK A;  2M02 A;  3C0C A;  1YHQ A;  3I5S A;  3VS6 A;  3M4Y A;  3GPL A;  2ZAE A;  1I81 A;  2HNI A;  2GGR A;  2KNB B;  1JRI A;  2YT6 A;  3CCR A;  3M53 A;  1E6H A;  2RF0 A;  2YUP A;  3JCM b;  1YJ9 T;  2P4T A;  3UA6 A;  3VKI A;  1WJQ A;  2PVD B;  1UGS B;  2H3J A;  3CPW A;  1VYT A;  3OYF A;  1VQM T;  2RI2 A;  2CZ6 B;  2C0T A;  4C0G A;  5GAN 4;  2AZV A;  1M5Q 1;  2K3X A;  2JXB A;  2XDD A;  4LUE A;  5CIU A;  3EG2 A;  2COY A;  3X25 B;  3PIP A;  4F7U G;  1Y07 A;  1IZ6 A;  2FVU A;  5EG2 A;  4JJN K;  4QVC A;  1BU1 A;  2L5Q A;  4ZNX A;  3M0P A;  4M75 B;  2IVW A;  1VQL T;  2OAW A;  1YWO A;  4JRI A;  4M77 E;  4E7I A;  2PUK B;  3JV3 A;  3CXC S;  1VQ9 T;  2BUD A;  4M78 G;  2FPE A;  5GAN j;  5GJW B;  2SRC A;  1DJ7 B;  1TTH B;  1TU0 B;  1EX4 A;  1YIT A;  4C5H A;  5KYY A;  1N5Z A;  2FRY A;  3CCJ Q;  1NJI R;  3I5R A;  4DA4 A;  2DFU A;  4O6J A;  2K5I A;  2LNH B;  4AG1 C;  4KGZ B;  2HKQ B;  1KG1 A;  2ABL A;  2DM1 A;  1K73 C;  5CAI A;  1YIJ Q;  5CR2 A;  1QMC A;  3H0H A;  2RN8 A;  3CC4 A;  2FB7 A;  4M7A F;  3LWH A;  1JXM A;  4JRK A;  2VXF A;  1R77 A;  4PJO F;  5FRN A;  2AIR B;  1VIE A;  2KGT A;  1PD0 A;  2LRQ A;  3V8K A;  4FU6 A;  2FYK A;  3CC2 T;  1KK7 A;  2CH4 A;  5HK0 A;  3EG0 A;  1YI2 T;  1LVK A;  3X26 B;  3OQ5 A;  4B9W A;  4ZGE B;  4DEX A;  4V2S A;  4PJM A;  3VS1 A;  1TWB A;  2KBT A;  5DM7 R;  5GAO n;  1JQQ A;  3A8L B;  1VQ4 T;  3NMZ C;  3RKY A;  1IHW A;  2X4J A;  1GL5 A;  4ZGJ B;  4PLI A;  2DTH A;  5HCK A;  1W2B P;  1W4S A;  3QJ6 A;  1PWT A;  3A1P A;  2AZS A;  2DBK A;  3MET A;  2K2M A;  2CSI A;  4HCK A;  3OW2 S;  3MP8 A;  1I5O B;  5GAM h;  4RTX A;  1R0C B;  2DET A;  2B8A A;  4M77 A;  5J26 A;  1ZUY A;  1OOT A;  2VVK A;  2KEA A;  1ZBX A;  1BIA A;  1TUC A;  2FL7 A;  3TCJ A;  4B6M A;  3CME A;  4A54 A;  2E5K A;  3QZ5 B;  1WXU A;  1X75 C;  4E47 A;  4JRP A;  1ZUU A;  3SEM A;  3E9F A;  4DEY A;  2DYI A;  3MEV A;  2KR3 A;  1TSF A;  1WLP B;  4OGE A;  3BFM A;  2C0O A;  5CQY A;  2ZPE B;  2V8I A;  2HQX A;  4C0Z A;  1NJI C;  2EQJ A;  1I5L A;  4M7D G;  3CME T;  4FT2 A;  3HRS A;  1VQK T;  1K9A A;  1UGP B;  2RHI A;  2RK2 A;  4MDW A;  2RJF A;  3TRE A;  2I0N A;  1K73 R;  4M78 B;  1T3S A;  1V76 A;  1WHG A;  1X27 A;  3KFV A;  4BE1 A;  1VQ4 Q;  3CD6 A;  1NG2 A;  2Y90 A;  1M90 C;  4IUQ A;  4PFO A;  3CCS A;  1EIF A;  3UDC A;  2HKN A;  1FWZ A;  4BUG A;  1PKS A;  3JCM W;  1RAE B;  3OBW A;  1EFN A;  1BIB A;  2DK3 A;  2DL7 A;  4KGX B;  1TXQ A;  2C06 A;  3SHW A;  4NS5 A;  3FB9 A;  3CPF A;  3ZEH A;  5IHI A;  5KYX B;  1RAF B;  5LJ3 h;  2EGC A;  2DL8 A;  4BE0 A;  4M7D B;  2V8J A;  2DX1 A;  3QJY A;  3FC3 A;  2A28 A;  1VQK Q;  2KK4 A;  4HT9 A;  2MWP A;  3URG A;  1VQ7 A;  1M2V A;  2QGG A;  1QCO A;  1BCM A;  4LN2 A;  4RCC A;  4E6R A;  1VUB A;  4HVU A;  2MK5 A;  4J9F A;  3M4G A;  2HCK A;  3VRY A;  1H92 A;  3UT1 A;  1UEC A;  2R58 A;  2QEX Q;  1Y0M A;  2EYX A;  1VQN A;  4DOV A;  3JB9 H;  2IG0 A;  4J9I A;  3QPH A;  3EG9 A;  1NE8 A;  2RA2 A;  4HCZ A;  3G71 A;  4C92 C;  2CSQ A;  1QLY A;  5CVI A;  3PVL A;  3QDR B;  3HRU A;  1ACM B;  4EMK C;  4N4H A;  3EFR A;  2R57 A;  3CCU A;  3JCM c;  4PJJ A;  4CC3 A;  2EQI A;  1PC0 A;  1R8O B;  4PLL A;  3CCQ A;  2YRV A;  2FO0 A;  1M90 R;  3SWN C;  4PKC C;  1Y71 A;  2GTO A;  2VWF A;  3LYI A;  2DXC A;  3KXT A;  3EFS A;  4L5G A;  2DLP A;  1AT1 B;  3FDR A;  1VQP Q;  4J9E A;  4XTV A;  5FU7 B;  2CZ0 B;  2WSF E;  3DLL A;  1VQO T;  2MYS A;  3V8J A;  4E2F B;  1WHJ A;  4HT8 A;  3OS1 A;  2A3L A;  2COZ A;  1G8X A;  4J9B A;  1RLP C;  1OPL A;  1VQ5 T;  2L3Q A;  3D7S B;  1NYG A;  4JJD A;  2GNC A;  4AG2 C;  4FCY A;  2AKK A;  2OTJ T;  3OYN A;  2RI5 A;  3TSW A;  4R55 A;  2E12 A;  1KJW A;  2QTV A;  3NTH A;  3L1A A; 
#chains in the Genus database with same CATH homology
 1WHH A;  2CP3 A;  2E4H A;  1WHJ A;  2HQH A;  2Z0W A;  2QK0 A;  3E2U A;  2COZ A;  1WHM A;  2HKN A;  2HL3 A;  2HKQ B;  2COW A;  2CP0 A;  2CP6 A;  2M02 A;  1WHK A;  1IXD A;  2CP7 A;  1TXQ A;  4B6M A;  3RDV A;  1LPL A;  2MPX C;  1WHL A;  2HL5 C;  2CP2 A;  2E3I A;  1WHG A;  2E3H A;  3TQ7 P;  2CP5 A;  2COY A;  1TOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...