3INZA

H57t hfq from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
KGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKTAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title The structures of mutant forms of Hfq from Pseudomonas aeruginosa reveal the importance of the conserved His57 for the protein hexamer organization.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 15
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3inzA00
3JB9G 4PNOA 3HSBA 3RKXA 4JRIA 5GAMg 4M7DE 4M7DD 3JCMb 1KQ1A 4C92F 3V7CA 5GAMf 3JCMJ 4M75G 3PGGA 5LJ5j 4C92A 5LJ5e 5GANe 5GANj 2DTOA 3JCMe 3BDUA 3QHSA 3AHUA 2JN0A 2FB7A 2Y90A 5GAN4 4HT9A 4J5YA 4XTYA 3L2ZA 4HT8A 5GAOq 4RCBA 3RESA 4C8QF 5GANh 2E1HA 4M75C 3JCMh 4XTVA 5GMKe 4C92E 5GMKj 4PJOF 4C8QA 4C92D 4X9DA 4M7DG 1X01A 4XU1A 3JCMV 5GAN5 4M78A 4PJOA 4F7UB 2CGHA 2DKGA 4C8QB 1M8VA 5GAN2 2K57A 5LJ3d 4M78B 3V8LA 1HK9A 2RM4A 2DZCA 4M75B 4N0AA 2RD1A 2HNIA 2E41A 3HFOA 4QVDA 4NL3A 4C8QE 4C8QD 5GAN6 4PJOE 5GAMd 3BFMA 4M78E 3RERA 2ZGWA 4M78D 4V2SA 1WQ7A 5GAN3 4PJOD 3FIFA 3V7SA 1JBMA 5LJ3e 5LJ3j 2VXFA 3JB9I 1TH7A 4EMGA 4M77G 1MGQA 2EJFA 2RB6A 2EWNA 4XU3A 3BY7A 5GAOr 4M7AG 5GMKi 3JB9H 2E65A 2QTXA 4J6WA 4A53A 2FYKA 4X9CA 4F7UF 5GAMe 5GAMj 5LJ3h 4F7UA 2VXEA 1KQ2A 4M78F 5GAN8 5I21A 4M75F 1N9SA 2EJGA 1I4K1 3FJPA 4J6XA 2YLBA 2YHTA 4M77C 4M75A 4XQ3A 2RA2A 3RKYA 3SB2A 4NOYA 5GAMh 3JCMc 1I5LA 3SWNC 5CAIA 3BW1A 1BIBA 3VU3C 3V7RA 1H641 4Y91A 2DXTA 4NL2A 4F7UE 4JUVA 3QSUA 3JB9D 4M7DC 3RUXA 4MMKA 3HFNA 1B34A 3L1AA 2I2LA 5GAN7 3JCMX 5GAOl 4M77B 4M7AB 4C92G 4M75E 4M75D 4A54A 1B34B 2DXUA 4XTXA 1N9RA 3M4GA 4QVCA 5LJ5g 2DEQA 4M7DA 4XU0A 1D3BA 1LNXA 5GANg 3JCMg 1I81A 5LJ5f 4M7DB 1D3BB 4EMKC 3V8KA 5GANf 2EJ9A 3JCMf 3JB9F 1LJOA 2EAYA 4XU2A 4C92C 3EFSA 4C8QG 1WPYA 4HA8A 3JCMP 4PJOG 4M78G 3EFRA 4EMKA 1LOJA 4JLIA 3QO3A 3JB9J 1U1SA 1M5Q1 4RCCA 4EMKB 4M7AC 4J6YA 4M77F 1WQWA 4M7AF 4WF2A 2E64A 4JRKA 4XTUA 3V8JA 2YLCA 3FB9A 4M77A 4C92B 4M7AA 1Y96A 2DTIA 1JRIA 4C8QC 5GMKl 4M7AD 3INZA 1I8FA 3SWNA 4PJOC 4M78C 1Y96B 5LJ5h 4M7DF 1U1TA 3SWNB 2DVEA 5GMKm 2DZ9A 5GAOn 3RIRA 4XTZA 3RKWA 3JCMQ 5GAOm 3JCMW 1HXDA 2E10A 4DQ2A 2DTHA 4MMLA 1BIAA 4N0AC 4M77E 5LJ3g 4M77D 5LJ5d 3GIBA 3QUIA 4M7AE 5DY9A 5GANd 1YCYA 2DJZA 5LJ3f 1WNLA 3JCMd 5GAOp 4EMHA 4PJOB 4XTWA 4F7UG 5GMKh 4OP0A 2VC8A
chains in the Genus database with same CATH superfamily
4PNOA 3HSBA 5GAMg 3CCSA 1G3SA 5FU6C 1XJWB 4JJCA 1IREB 1XOVA 3GLXA 1M30A 3BDUA 1K9MR 1W6XA 5GAN4 1PC0A 2XHCA 4J5YA 2LZ6B 3CCLA 3CPWS 1N27A 2V8IA 2B8AA 2E1HA 2J06A 4XTVA 1Q86U 1XQHA 4A63B 4M7DG 4Y28E 2WSFE 3EGXA 1M8VA 2JTFA 3L2RA 3EGXB 1ZUYA 3CQTA 2QA4Q 1NLPC 3ZEHA 2JMAA 4C8QE 3RERA 1QP2A 3LGFA 1FYNA 4JLGA 3DLMA 2DD5A 5I2MA 2YWWA 3C94A 3OYMA 2RF0A 2E65A 3HRSA 2RQWA 2MWOA 1VQ5Q 3O5ZA 1VQLA 2DE0X 2YUOA 2GTJA 1M3BA 4JRPA 4NOYA 1ZUKA 3SWNC 3FC3A 3P8BB 1LVKA 3CMET 2E12A 1N9RA 2FO0A 4BI3A 3MEAA 1Y0MA 1G2BA 3UATA 1E6HA 1VQNT 4EMKC 1FX7A 1VQ7T 2R5MA 2AZVA 2JMCA 4CC2A 2RJDA 4RCCA 1TG0A 4J6YA 2KI7A 4C0DB 4DBFA 3CCUT 3L42A 1JRIA 4PJLA 3LH5A 3NFCA 1BI1A 4BDZA 4DBQA 4M78C 5LJ5h 3CC7A 1G3TA 2DZ9A 2E3IA 2IVWA 1KC8C 2DJZA 3JCMd 4MZPA 3G4SQ 1PHTA 1KQ1A 3G4SA 3L2QA 2CP3A 2OTLT 4IUVA 2HKQB 3QHSA 2O2OA 3X20B 3ASKA 4PLIA 1SF9A 3QXEB 2DIQA 2JTMA 3DKMA 3QKJA 2FPEA 3G7ZA 4QW2A 5AT1B 2CZ1B 1WXUA 2X4WA 9ATCB 3LX7A 3LH0A 4IIMA 5LJ3d 2DPPB 1YITA 1M27C 5AYFA 2RI5A 1VQKQ 3FDRA 1SEMA 2E41A 5KCHA 3ULRB 1ZBXA 4V2SA 3OB9A 3PVQA 3UA6A 2L89A 2LQ8A 3V7SA 4JRQA 3RMQA 5LJ3j 2LRQA 4C0FA 8AT1B 4XU3A 4M7AG 4F17A 1Q81U 4A53A 1K1ZA 1AZGB 1OI1A 1OX8A 2J05A 4M78F 3TSWA 2OTJT 5KYYB 2WACA 4TVRA 2RHXA 3G6EA 4HVVA 3PNWC 4J9IA 1I4K1 2VGNA 2EGCA 3H41A 1ABQA 1YIJT 1OU8A 4LDVA 2RJCA 3WVEB 1M90U 3R6NA 3OS1A 4M7DA 3G1JA 3HTRA 2KXDA 1VQ4T 4M7DB 1LPLA 1YHQT 1TUDA 4LDUA 2QAZA 1IHWA 4RG8A 3DB4A 4HA8A 1O9SA 1ZX6A 3EFRA 4PFPA 4IURA 4PK4A 1K4US 4LN2A 2QTVA 1RAEB 3GF5A 3SD4A 2MYSA 1VQ8T 3Q1JA 1QCFA 2DD4A 2X3WD 2A7YA 2GNCA 2JM9A 2VB6A 3OYBA 4RMOA 1M1KU 1OZ2A 3S3MA 4M7DE 1ZBJA 3JCMb 3M0RA 1QLYA 5LJ5e 4K11A 4JS5A 2EQIA 4FU6A 4YTLA 2NUTA 3E9GA 2NUTB 4J9BA 1UB4A 3E19A 3JCMh 3EHQA 1J3TA 1V29B 1AHJB 5GAN5 2DA9A 2LC4A 3X24B 4FYYB 4E6RA 3CCJQ 4CC3A 3CD6Q 1M4ZA 1KQSA 2BIVA 4ELZC 1WJQA 2PUOB 4J7FA 2LT4A 3BFMA 3OYHA 3HRUA 4QQDA 2KRMA 2AKLA 1NBEB 3CC4Q 2CKKA 1UEBA 1KSWA 5LJ3h 1IXDA 1M1GA 2O31A 3CBPA 1RABB 4LUDA 1EFNA 1HYOA 3MP8A 1I5LA 1JO8A 5IXBA 2RQVA 5KYNA 2K3YA 1QVGP 2PQWA 3PT9A 2EGAA 2D0QB 1W4SA 1BI3A 3CCVT 7AT1B 2GF7A 5KCOA 4HKEA 2DF6A 2JT4A 4HXJA 3M57A 1H92A 4RTTA 3JV3A 4BACA 2C0TA 2RHYA 2Y4YA 2A3LA 4PJOG 1LOJA 1ZA1B 3CCQA 4F14A 1G8XA 2E64A 4PJJA 5HKCA 4M7AA 2DTIA 1I8FA 4AG2C 5CQXA 4ME7A 4B9XA 1P92A 2DVEA 2NUPA 1KD1R 1S72Q 2NUPB 1SKUB 2MMPA 4M7AD 2K9GA 2RNAA 2O88A 2DL5A 4OMLA 1BCOA 4QQGA 1NM7A 3TREA 3ZFJA 3UA7A 5GAMf 1RACB 5GANe 2LCLA 2GQIA 3L2WA 1AWOA 3KUFA 4ORZA 4M75C 3UDCA 1Q81C 1TU0B 1R0BG 1FMKA 5IXFA 5FRNA 2RM4A 3PMIA 1PM3A 3HFOA 3SEMA 4J8OA 2PVDB 2Z0WA 2QQSA 2AHJB 3BDLA 4MDWA 3EG3A 1VQOT 2QEXA 1M90C 1D0ZA 1TH7A 1NYGA 4M77G 2ENMA 1PWTA 5FW9A 2D1XA 1YJ9Q 1UGRB 3EHRA 2EFIA 3L2UA 4AFUC 5D6YA 2ZZDA 3VKIA 3M9QA 2K5LA 2VV5A 5I22A 1PSFA 2XK0A 1WLPB 1G5VA 2CZ7B 4RTVA 4ZTJA 1WHMA 6AT1B 1D1AA 4J9EA 4KUDK 1JQQA 1JJ2P 1PD1A 4JPBW 5DLQE 4XU0A 3QG1A 2A37A 3CC2A 2XDBA 3JCMg 2D0NA 4OVAA 3L2VA 3VS6A 1YN8A 3JB9F 2JNGA 2QDLA 4C8QG 1Y07A 3PVLA 2GBQA 1M1KC 1X75C 4PFOA 1IRXA 4RTZA 2E6ZA 1QMCA 3QIIA 2QG9B 4WF2A 4C92B 3OYDA 3CXCA 3QBYA 1W2BP 3TU4K 3VS4A 3VS2A 3JCMQ 2P4TA 1UUEA 5LJ3g 2KR3A 3CCEQ 3P8DA 1SRLA 2FVUA 3QUIA 2KE9A 2H8HA 5GAOp 2ROLA 2CP0A 3FLGA 3C12A 5KE3A 2DRKA 1WI7A 2I0NA 1QW1A 3SHWA 1VQ6T 3A8HB 1ZQ1A 2KT8A 3G71A 4PFZA 4BE0A 1QVFA 1ARKA 1MHNA 2R5AA 1FMWA 2QQBA 1VOMA 5FU6B 3WXMB 2RQTA 4C92E 5J3BA 4L59A 3OYYA 2X4XA 2X51A 4PJOA 4F7UB 4MZTA 3M59A 2K57A 3CPFA 3QWXX 2FZCB 2CP2A 2NUZA 3A8LB 1JU5C 3CMAQ 3UF4A 1MMGA 4PJOD 3CCRQ 4AG1C 4KUIA 1YJNQ 3H0IA 3C95A 3CPWA 3BE3A 4E7ZA 2HQXA 4ZGDB 2EYWA 1KC8U 2FRWA 1OQKA 1EX4A 2LP5A 2YDLA 3M0QA 2OX7A 1N9SA 1PD0A 4FYXB 1KK7A 2YHTA 3LGLA 3SB2A 1KFZA 3V7RA 1MV3A 4F7UE 3A8MB 2F1LA 4FW1A 2HKNA 2HSPA 1QVFP 3VJPA 2KDSA 1NJIC 1I1JA 3MJXA 3QDRB 5I2SA 2RI3A 3M55A 4RUGA 1M3AA 5CO7A 4QKUA 2HD0A 1WZOA 2HAXA 3CCMQ 2KROA 4ANJA 4EMKA 4C0GA 3VS3A 3OYCA 4EMKB 1D0XA 1UJYA 2H3EB 4M7AF 2W0ZA 1NPPA 4M77A 4E7KA 2FRYA 8ATCB 3O8VA 1RAAB 2J7IA 1N6AA 1I0CA 1Q82R 3DLLA 2YUNA 5GMKm 1BB9A 2E10A 5LJ5d 1YJWT 4M77D 3CMEA 5GMKh 2DL3A 4E7HA 3RKXA 2QYZA 2K6DA 1VQNA 5LJ5j 2OAWA 2C06A 4NS5A 4OB1B 2DL8A 1VQ7A 1RI9A 4BUGA 1TXQA 2EPDA 2XDDA 5IHNA 2L3QA 1GFCA 4J9CA 1X2KA 1G3WA 3T9NA 3ME9A 5D6XA 4C8QA 4Z02A 4X9DA 3JCMV 4R56A 4FW2A 4C8QB 3CCSQ 1HK9A 2DO3A 1VQ9T 4B6MA 3M0TA 2LQWA 2A08A 4C8QD 4WTOB 4M78E 3A1PA 5GAN3 1JBMA 3CCLQ 4E7JA 1Q86R 2ZPFB 2XIDA 2EWNA 2HSEB 3BY7A 1VQMQ 2E6NA 4KULA 2V8JA 1HD3A 1OX9A 3I56Q 2A36A 1G3YA 2X4YA 4A4FA 4E7IA 2DERA 1VQMA 3I56A 2ECZA 1QP3A 2LVMA 3M56A 1K8AR 4OGCA 3REBB 2FG0A 2HBWA 1PKTA 2FHDA 4OMNA 3RUXA 2E5QA 1VQPT 3L1AA 2CDTA 2ZPBB 2PZ1A 4ELYC 2HQEA 1K9MU 1D3BA 4X1VA 3PIPA 1VYTA 1VQLQ 2DVJA 2KVQG 1GBQA 1D3BB 2EJ9A 1H3HA 1LJOA 2MIOA 5CCAA 1I07A 1N8RR 2CYZB 1WPYA 2O01E 2DIGA 3THKA 2BUDA 3I35A 2G6FX 5CR2A 1BI0A 3GP8A 2DETA 2XG8D 3X25B 2OTJA 3V8JA 4BD3A 1IGQA 2CSQA 4HCKA 4DEXA 2JXBA 1YI2T 2CP7A 1IB8A 1SG5A 2ED0A 5DLOA 4PL6A 2F5TX 2FPDA 1YIJA 2NWMA 4XK8E 2RJEA 5GANd 3M0PA 4EPCA 1K73R 1UTIA 2GTOA 2LMJA 1VIEA 1VQ4A 5CKFA 2LQKA 1YHQA 4OF1A 5GANj 5M9OA 4CI0C 3CC7Q 4JDSA 1Q7YR 2DJQA 3MP6A 3PIOA 2MK5A 1TS9A 2P0PA 5GMKe 3VV0A 4M4ZA 4PJOF 3MO8A 4JZ3A 2DKGA 4A4KA 1HJDA 2GFUA 1B7TA 3R6OA 4OB3B 1VQ8A 4N0AA 5D6WA 2JUFA 5EG2A 1TTHB 1X69A 4FM4B 4EMGA 1VYVA 4KGXB 2JW4A 1K0XA 3GOXA 3LWIA 2COWA 1OZ3A 2VASA 1YITQ 2V8KA 2EJGA 3H8ZA 2EW3A 4DOWA 4RTYA 1PSEA 4DOVA 3JCMc 5CAIA 4J9GA 2F2VA 4FCYA 4PJNA 1BI2A 5C6SA 1HSQA 1GL5A 1BBZA 3M4YA 3G6EQ 5KYYA 2W10A 2QA4T 3JCMf 4N4HA 4XU2A 4JZ4A 4AT1B 5CKBA 4M77F 1AWWA 2YLCA 1NZ9A 2PTKA 2DRMA 3I9QA 1VQ5T 5FU7B 4JJDA 4XTZA 4FT2A 2F2WA 1Q82C 5DY9A 3UT1A 5LJ3f 3GNGA 3TCJA 4O6JA 3CCVA 2IG0A 4BY6B 4M7DD 2EVRA 3PGGA 1RLPC 4IUUA 3LWHA 1BU1A 3L2ZA 2RQRA 5D7UA 1H3ZA 2KYBA 4C8QF 5GANh 3A8OB 3J7AF 4KH0B 4HCZA 1AZEA 1WX6A 5A0DA 4M75B 1QVGA 2V1QA 4X34A 1Y71A 1M8MA 2COYA 3EG9A 3HL8A 1X6GA 3EG9B 1U8RA 2QTXA 3G4ST 1K9MC 1NG2A 4OMQA 2EIFA 4Y92A 4C5GA 2EKHA 3M0SA 3QDFA 5HY6A 5KE2A 3M53A 2ZAEA 1NEGA 4GLKA 1WJSA 1K8AC 4J83A 2AKKA 2DFUA 4C92G 4M75E 1IHVA 2DXUA 4BB7A 3EH1A 1UHCA 1WXBA 5LJ5g 1BYMA 2D8HA 3NPFA 3OY9A 1VQKT 2EYYA 1WGSA 1X43A 2JS0A 2RHIA 3I55Q 1VQOA 2KGTA 4KRTA 3I55A 4II1A 1PKSA 1U1SA 1Z9ZA 1QWEA 3FB9A 4N4IA 3G6ET 5HK3A 3MEVA 2O9VA 2PVOB 1WHHA 1T0HA 5C0MA 5KYXA 2DEUA 1ACMB 4MMLA 5KYXB 2XU8A 1MNDA 4IUPA 4C5HA 4F7UG 1ZUUA 4RTWA 5CK9A 3CCQQ 2K2MA 4RG2A 1K73C 5FWBA 2ZCFB 2Y90A 3SFMA 2L3RA 4HT9A 3EGUA 1NJIU 2ZPIB 4MDXA 1F1BB 2KRNA 2L3SA 3H0FA 2VUBA 1UGPB 1QKXA 5GAN2 2ESWA 2SRCA 3A5ZB 3S6WA 3ZL7C 1WJRA 2EYZA 2D8JA 2VKNA 2LCSA 4BI4A 3U23A 1JJ2A 1RUWA 3I5SA 1R77A 4LDWA 4C5EA 2EJFA 3OS5A 1VQ6A 1FMVA 1KJWA 4Z8AA 1KD1U 2ROTA 2RN8A 2K3BA 3E1SA 2IIMA 1U3OA 3NTKA 3FJPA 4XQ3A 3RKYA 1MNEA 4ZGJB 3KBGA 2KBTA 3EGDA 1H641 4NL2A 1GBRA 3EGDB 3QSUA 1VA7A 2QEXQ 2I2LA 1W2BA 3MP1A 3M4GA 2DEQA 3CCJT 1LNXA 2BE7D 5GANg 3CD6T 2JS2A 1I81A 2DILA 5J26A 2JJ9A 2DXCA 2LJ1A 2CT4A 3GNFB 3CBOA 4M78G 4C5IA 4FSXA 5HK0A 2J6KA 1FXXA 3CC4T 2HBPA 3A8GB 5GMKl 4ZN3A 2LTOA 3CC2Q 1GCQA 4M7DF 1U1TA 2YXYA 4R0KA 1Z9QA 2ABLA 1I5OB 3NGPA 2QGGA 5GJWB 3GIBA 1YCYA 2JVVA 3WVDB 2QQAA 4XTWA 2EQJA 1B3QA 2XD0A 5FWCA 3JSCA 2CP6A 4C92A 4KGVB 2QI2A 3AHUA 2DYBA 2FB7A 4BE1A 2QGFB 4HT8A 2CT3A 1TUGB 2RQUA 1KHIA 3H0HA 2ZPHB 3LLRA 5GMKj 1KIKA 1M2OA 1JXMA 4C92D 3RBBB 5IH2A 3EFOA 1ZSZC 1GCPA 4UC4A 3DB3A 3EFOB 1SPKA 4FIBA 4LDYA 2HL5C 3I5RA 3G71Q 4QVDA 1OOTA 1YJWA 2CSIA 4PKCC 1AT1B 1S72T 1ZLMA 2DYIA 1R0CB 3VYHB 4C0ZA 3S3OA 4PJMA 1SHFA 4E47A 4X9CA 2VYTA 4F7UA 1M1FA 4KGZB 2LX7A 2HMAA 1ZSGA 2YRCA 4NL3A 4M7AC 4LUEA 3OYNA 2M16A 2MPXC 4DBHA 3KXTA 4Y91A 4OMOA 2DXTA 3VRYA 3EAEA 2VVKA 1E7OA 5KYUA 3QZ5B 1KC8R 4D8KA 2RI2A 5KYUB 5FROA 1MMNA 1QCOA 2LCCA 3OYFA 1JEGA 2M51A 2RHZA 3TQ7P 2YSQA 2E4HA 2C0OA 2FZGB 1U5SA 2WSCE 1GRIA 3AT1B 5HCKA 1E6GA 4JLIA 1SSHA 2E70A 4P5NA 2JZ2A 2OAUA 2E5KA 1YJ9T 5CKHA 3SWNA 4IIOA 1Y57A 2EQUA 2EYQA 4LD6A 4FYWB 3SWNB 1T3SA 2YUQA 3JCMP 3A98A 3RDVA 1O75A 3LYIA 1YP5A 3MHXA 4RTUA 3OSSC 2YRDA 1GFDA 1MV0B 3CEYA 1R8OB 3C4SA 2DLPA 2KK4A 3CMEQ 2KNBB 3LW5E 4M78A 1PRLC 4JS4A 4M78B 1YI2A 1KD1C 4BDYA 2DAQA 1VQNQ 4ZNXA 1V1CA 2KRSA 3NMZC 3OYLA 1VQ7Q 2LDMA 4M78D 2MOXA 4AMCA 4FSSA 2LX9A 3CCET 4F16A 2CZ0B 3MCAB 2PVGB 2KSSA 3UPUA 3JRZA 4A4HA 3CCUQ 3JB9H 4JJBA 2RJFA 2FYKA 2QASA 5GAMe 4E7LA 1Q82U 1OV3A 3CCUA 1C1AA 4HVWA 1PCXA 4BI8B 1X6OA 2KYMA 3MEWA 4DEYA 2RA2A 3VU3C 1UE9A 2MAMA 2Y4XA 4JUVA 1DJ7B 1D09B 2H3JA 3VUZA 3VRZA 1YBYA 3FJ5A 3KFVA 1AWJA 4IKFA 5IT9E 4OMFB 1S1NA 2OTLQ 1YFNA 2BTTA 4D8DA 5LJ5f 1CSKA 1AOJA 1M9SA 2OTLA 2ZPGB 1NPRA 3CMAT 3EFSA 1TSFA 1VYUA 3CCRT 1YJNT 1UGSB 2RK2A 3M5AA 2YUPA 1W1FA 4PJOC 2KXCA 2LNHB 3OSVA 1W70A 1KHCA 2WSEE 2C0IA 2VC8A 1AEYA 3JB9G 1AVZC 2OTJQ 4C92F 2BZXA 2RK1A 4M75G 2QA4A 1K8AU 4PLLA 2L0AA 2P0QA 4OB2B 4XTYA 1YIJQ 3OW2S 2LT1A 4J9FA 3CCMT 3NTIA 1AD5A 4QT7A 3X28B 4XU1A 2RH2A 3OYJA 1VQ5A 3OMGA 2EQMA 2PUKB 3V8LA 1VQ4Q 1WHGA 2DXBA 3NHNA 1N8RU 1YHQQ 3P8HA 1X2QA 4OMPA 5CVIA 2AK5A 4QVZA 3PE0A 4AFQC 1OYXA 5EC7A 4ZN1A 2CH4A 2J6OA 3TVTA 5FRMA 2GGRA 4F7UF 2ZPEB 3GBQA 4LNPA 1CKAA 4IUQA 1VQ8Q 2EQKA 5A0LA 2NLUA 1M2VA 4J6XA 2MCNA 3OYGA 2YLBA 4M77C 1B07A 1D1CA 3JAME 3OYIA 2K3XA 1M2VB 1BIBA 3BW1A 2O9SA 1K73U 4KBMB 5GAN7 2ED1A 5GAOl 2CH4W 2D9TA 4A54A 1LCKA 2F69A 1PNJA 2X9HA 4QVCA 3QZ9B 3VS1A 3CCST 1Q7YU 2KAFA 5GANf 2P0KA 2QQ9A 3MPUB 2RHUA 1EZZB 5L23A 3CCLT 1QWFA 1UFFA 3JB9J 3OS2A 1VQMT 3J80E 1Y96A 3I56T 1QVPA 4C8QC 2DK3A 1Q81R 3INZA 1T0JA 2P4RA 1Y96B 4LDXA 3RKWA 4ZGEB 4DQ2A 2DTHA 4AFZC 4HCCA 2K79A 2QK0A 1D0YA 2G3RA 2DX1A 3M58A 1FWZA 4JRIA 1M90R 1Q95G 2KY9A 2K7AA 2HZYA 1VQKA 1YNZA 4VUBA 4CRIA 1VQLT 3VS5A 2LJ3A 2CS7A 2JN0A 1T3LA 4BE2A 1WA7A 1IZ6A 2GCXA 1X27A 3RESA 3MEUA 4ZTFA 1ZA2B 3RNJA 3CCVQ 5L8RE 1ABOA 1YWOA 4HCBA 2RO0A 1IGUA 2L3PA 2RD1A 5CKEA 3E2UA 2DL4A 2BE9B 3RR6A 3FIFA 5ECAA 2DBMA 3HP9A 2IPOB 4Z88A 3M0UA 1TOVA 2EKOA 2YT6A 4WCIA 2QDYB 1M1KR 5GAN8 4LD9K 4QQ6A 4AFSC 4M75A 2PNIA 2VGMA 5GJVB 5A2QE 5J39A 3CC7T 4OB0B 2K5IA 3JB9D 3HFNA 5A0GA 1QKWA 2A28A 2L2PA 1UGQB 4M75D 4CC4B 3HPWA 5I11A 1D1BA 5DM7R 1OULA 1M3CA 2GQVA 1Q86C 4C0DC 4N4GA 2X4JA 4FT4A 4D6WA 3QYGB 1BKBA 2M0OA 2FZKB 4B9WA 1RAHB 3QJ6A 2EYXA 5CKDA 4J7IA 4KT0E 3GPLA 1YITT 3PMTA 1RLQC 2R57A 1Y7XA 5GAOm 3RMSA 4N0AC 3OMCA 1VQOQ 1YCSB 1OEBA 2HDAA 1C0MA 4DA4A 3CCJA 3CD6A 3V7CA 4HVUA 1N8RC 3F70A 4A4GA 2DTOA 2E3HA 3OYEA 1TWBA 1WHKA 2JOYA 3REAB 4FYVB 3HKSA 2R58A 3CC4A 2JM8A 3UWNA 3QJYA 4OMMA 2DZCA 1ZSZA 1PRMC 2KT1A 4O5VA 1ZSZB 4J9HA 5GAMd 1NJIR 1MMDA 2HQHA 2MF2A 5FLXE 1UJ0A 2JTEA 2RB6A 1A0NB 2DBKA 5GAMj 3QWYA 4LE9A 1Q7YC 5IHKA 2OI3A 4R55A 3QPHA 3OA6A 1UGVA 2J6FA 5FU7C 1UECA 2KEAA 2DMOA 2V1RA 1KQSP 4M7DC 2A0FB 3EH2A 4M7AB 2BKDN 2AIRB 1VQ6Q 4KH1B 2RMOA 2KMTA 4BY6C 3TEEA 5IAYA 3QYHB 3V8KA 1S72A 3OYAA 2F5KA 1WYXA 4CC7A 1OPLA 1XNIA 1BCMA 1QVGS 3H6ZA 1CKBA 1M5Q1 1U06A 2X35A 4JRKA 4L6V5 1WDXA 3VS7A 2XI9A 2CUDA 2HCKA 1VIFA 2AT1B 1K0SA 4DBRA 1KG1A 4M7AE 2P84A 1WNLA 3IQLA 4OP0A 1WHJA 1KQSS 1JB0E 3OS0A 2XDPA 2XMFA 3JCMJ 3CBMA 4GY5A 3JCMe 1WHLA 3J81E 3OQ5A 2L5QA 1RAIB 2BZYA 2FEIA 3I55T 5GAOq 1RL2A 3EG2A 1RAGB 2M1HA 1TUCA 2EGEA 1V76A 1X01A 1YJ9A 2NYSA 4GBQA 2QQRA 2YRVA 1NLOC 2HL3A 5KYWA 4RTXA 3ZBDA 2XKOC 2CZ6B 1NEBA 5KYWB 3PFSA 1JXOA 5LJ3e 3JB9I 2F2XA 2VWFA 1MGQA 1C6VX 2M0YA 3CCQT 2V26A 4M75F 2DL7A 1GXIE 3D7SB 5GAMh 2MI6A 4LXCA 1YJWQ 1K9AA 4MMKA 3OYKA 1B34A 3JCMX 2RPNA 1B34B 4XTXA 2QXFA 2K2VA 3EG1A 4JJNK 4XAXB 3M54A 1QQJA 2LQNA 5CQYA 3CCEA 2DM1A 1G83A 2BZ8A 4L5GA 2DNUA 3QO3A 2K5FA 5IHIA 2GFAA 4XTUA 1JJ2S 3PTAA 1UG1A 2O4XA 1NYFA 1RAFB 2X3XD 1VQ9Q 2O4XB 1NE8A 3N5BB 1VQ9A 1BK2A 5GAOn 3RIRA 3VS0A 3JCMW 2LJ0A 5CIUA 4PJOB 4EMHA 5GAOr 2QEXT 3OBWA 1KQ2A 2AZSA 4FL6A 4ESRA 1H8KA 2COZA 1UDLA 3CMAA 1W2BS 4E7SA 2KQWA 2M02A 4EDUA 1WXTA 3CCRA 2HEQA 4Q5WA 3NTHA 4RCBA 3CXCP 1YJNA 1VQPQ 3HHTB 1N5ZA 4OGEA 5LL6S 2CGHA 3ER0A 3S3NA 1VQPA 4RKUE 4Z89A 1EIFA 3VYGA 1IO6A 3C0CA 2CREA 3X26B 2HNIA 5IN1A 3CC2T 3SDZA 2SEMA 5GAN6 4PJOE 2ZGWA 1SRMA 1WQ7A 1X6BA 1SSFA 3HRTA 4IUTA 2VXFA 4F04B 2EBPA 3OW2A 5GMKi 3URGA 4J6WA 1WFWA 2VXEA 3H9NA 1WIEA 1YI2Q 5I21A 3FRNA 2ATCB 4J9DA 3CCMA 4ATOA 1GCQC 1PG5B 4M77B 4E2FB 1AWXA 4EIKA 3CXCS 1RADB 3CPWP 4A4EA 1UHFA 3G71T 2LNVA 1OPKA 2CP5A 3TSZA 1MUZA 2EAYA 4GLMA 4C92C 2L8DA 1MMAA 3VUBA 4MZMA 2PU9B 1OU9A 2FL7A 2FPFA 1VUBA 1QCNA 3OBYA 1WQWA 1QVFS 2M9UA 1XTDA 2MWPA 3EG0A 2K4YA 3META 1RI0A 3FEOA 2CUBA 1YWPA 2XICA 3E9FA 5KH6A 1SHGA 1HXDA 1BIAA 1K76A 4M77E 3OW2P 2B86A 2D6FA 2OJ2A 3MKDA 1ZHIA
chains in the Genus database with same CATH topology
3C12A 4PNOA 5KE3A 3M58A 5CK9A 1FWZA 4JRIA 5GAMg 3HSBA 3CCSA 1G3SA 2KY9A 4RG2A 5FU6C 1QW1A 1VQ6T 1VQKA 3A8HB 1IREB 1XOVA 1ZQ1A 3GLXA 4VUBA 4CRIA 3G71A 4BE0A 1K73C 1VQLT 3BDUA 2CS7A 2JN0A 2ZCFB 2Y90A 3SFMA 5GAN4 1MHNA 2L3RA 2XHCA 4J5YA 2R5AA 4BE2A 4HT9A 1IZ6A 3CCLA 1NJIU 2GCXA 2QQBA 2ZPIB 3CPWS 4MDXA 1N27A 2V8IA 5FU6B 3RESA 3WXMB 2B8AA 2E1HA 3MEUA 4XTVA 4ZTFA 4C92E 2VUBA 5J3BA 4L59A 1Q86U 1XQHA 3OYYA 1UGPB 2X4XA 4M7DG 4PJOA 4Y28E 2WSFE 4MZTA 4F7UB 3M59A 1M8VA 2JTFA 5L8RE 4HCBA 5GAN2 2K57A 3L2RA 2RO0A 3CPFA 3A5ZB 3S6WA 2RD1A 5CKEA 1WJRA 3A8LB 3ZEHA 4C8QE 3RERA 4BI4A 4PJOD 1QP2A 1JJ2A 3FIFA 3LGFA 4JLGA 3DLMA 3HP9A 4KUIA 2DD5A 4LDWA 5I2MA 3C95A 4C5EA 2EJFA 3CPWA 3C94A 3OYMA 2EKOA 2HQXA 2E65A 4ZGDB 3OS5A 3HRSA 1KC8U 2QDYB 2MWOA 1VQ6A 5GAN8 1VQLA 1KD1U 4LD9K 3E1SA 4QQ6A 1N9SA 3NTKA 3FJPA 4XQ3A 3LGLA 2YHTA 4M75A 3RKYA 3SB2A 4JRPA 2VGMA 4ZGJB 3KBGA 4NOYA 5J39A 5A2QE 3SWNC 3FC3A 3CC7T 4OB0B 3V7RA 1H641 4NL2A 4F7UE 2K5IA 3A8MB 3P8BB 3QSUA 3JB9D 3HFNA 5A0GA 3CMET 2I2LA 1W2BA 1UGQB 2E12A 3MP1A 4M75D 3HPWA 1N9RA 3M4GA 3VJPA 2DEQA 2KDSA 1NJIC 3CCJT 1LNXA 4BI3A 3CD6T 3MEAA 5GANg 3QDRB 5DM7R 1I81A 5J26A 5I2SA 1VQNT 2GQVA 4EMKC 2RI3A 2DXCA 1FX7A 4C0DC 1Q86C 4N4GA 1VQ7T 2X4JA 3M55A 4FT4A 5CO7A 2R5MA 3GNFB 2HD0A 3CBOA 2HAXA 4D6WA 3QYGB 4M78G 1BKBA 4FSXA 4C5IA 2M0OA 4EMKA 4C0GA 5HK0A 4B9WA 2RJDA 3OYCA 4RCCA 4EMKB 4C0DB 1FXXA 4J6YA 4M7AF 3QJ6A 3CCUT 1NPPA 3CC4T 3L42A 4M77A 4E7KA 1JRIA 2HBPA 3A8GB 5CKDA 5GMKl 3NFCA 3O8VA 1BI1A 4ZN3A 4J7IA 2LTOA 4KT0E 3GPLA 4M78C 4BDZA 5LJ5h 1N6AA 1YITT 4M7DF 1U1TA 3CC7A 1G3TA 3PMTA 3DLLA 5GMKm 2DZ9A 2R57A 1Y7XA 5GAOm 3RMSA 2E10A 2IVWA 1KC8C 4N0AC 5LJ5d 3OMCA 1YJWT 3GIBA 4M77D 3CMEA 1YCYA 2DJZA 2JVVA 3WVDB 2QQAA 3JCMd 4XTWA 4MZPA 5GMKh 2EQJA 4E7HA 2XD0A 3RKXA 3JSCA 4DA4A 3CCJA 3CD6A 1KQ1A 3V7CA 1VQNA 5LJ5j 1N8RC 4C92A 3L2QA 3G4SA 4NS5A 2C06A 4OB1B 2OTLT 3F70A 2QI2A 2DTOA 4IUVA 4A4GA 3QHSA 3OYEA 1VQ7A 3X20B 3AHUA 2FB7A 3ASKA 4PLIA 4BUGA 4BE1A 2JOYA 4HT8A 2XDDA 1KHIA 2DIQA 2JTMA 2ZPHB 3DKMA 3QKJA 3QXEB 3LLRA 3HKSA 3G7ZA 1G3WA 4QW2A 5GMKj 3T9NA 3ME9A 2CZ1B 5D6XA 4C8QA 4Z02A 4C92D 2R58A 4X9DA 2X4WA 3CC4A 3JCMV 4R56A 4C8QB 4UC4A 3LX7A 3LH0A 3DB3A 5LJ3d 3UWNA 1HK9A 3QJYA 2DO3A 2DPPB 1YITA 1VQ9T 4FIBA 4LDYA 5AYFA 2DZCA 2RI5A 4O5VA 3FDRA 2E41A 4QVDA 4C8QD 5KCHA 5GAMd 1ZBXA 4M78E 1YJWA 2MF2A 4PKCC 4V2SA 3OB9A 5GAN3 2L89A 2LQ8A 1JBMA 3V7SA 3RMQA 5FLXE 5LJ3j 2LRQA 4JRQA 4E7JA 4C0FA 3VYHB 4C0ZA 3S3OA 2ZPFB 2XIDA 4XU3A 2RB6A 4M7AG 2EWNA 3BY7A 1Q81U 4A53A 2E6NA 2V8JA 4KULA 4E47A 1OI1A 4X9CA 5GAMj 2VYTA 1G3YA 4F7UA 2X4YA 1M1FA 4M78F 4A4FA 4E7IA 1Q7YC 1QVFA 2WACA 4TVRA 1VQMA 2RHXA 3G6EA 3PNWC 3I56A 1S72T 4R55A 3QPHA 1I4K1 1QP3A 2LVMA 2VGNA 4NL3A 3OA6A 3M56A 4M7AC 4OGCA 3OYNA 5FU7C 2M16A 3KXTA 4Y91A 1YIJT 2DXTA 4M7DC 3RUXA 2FHDA 3EAEA 4LDVA 2E5QA 2RJCA 3L1AA 3WVEB 1VQPT 1M90U 3QZ5B 4M7AB 2ZPBB 2RI2A 2BKDN 5FROA 3OS1A 4ELYC 4M7DA 2HQEA 1K9MU 1D3BA 3PIPA 4BY6C 2KMTA 3TEEA 5IAYA 1VQ4T 3QYHB 2KVQG 2LCCA 3OYFA 4M7DB 1D3BB 2RHZA 3V8KA 2EJ9A 1YHQT 4LDUA 1LJOA 2F5KA 5CCAA 3OYAA 1S72A 2CYZB 2WSCE 1WPYA 2O01E 2DIGA 4RG8A 3DB4A 4HA8A 1O9SA 1XNIA 3EFRA 1QVGS 2BUDA 3H6ZA 4IURA 4JLIA 2E70A 4P5NA 2JZ2A 2OAUA 5CR2A 1M5Q1 1BI0A 3GP8A 2XG8D 3X25B 2X35A 4JRKA 2OTJA 3V8JA 1YJ9T 3GF5A 3SD4A 4BD3A 4L6V5 5CKHA 3SWNA 2EQUA 1YI2T 2EYQA 4LD6A 1VQ8T 3SWNB 5DLOA 4PL6A 2F5TX 3Q1JA 1YIJA 2XI9A 2DD4A 1VIFA 2A7YA 4XK8E 2RJEA 1KG1A 4M7AE 3OYBA 5GANd 1WNLA 4RMOA 1H3ZA 4EPCA 1M1KU 3JCMP 1OZ2A 4OP0A 1VQMT 3S3MA 4M7DE 1KQSS 1JB0E 3JCMb 1VIEA 1O75A 2XDPA 3OS0A 5CKFA 1VQ4A 3LYIA 3JCMJ 3MHXA 5LJ5e 2LQKA 4JS5A 3OSSC 1YHQA 3CBMA 4GY5A 4OF1A 5M9OA 3JCMe 4FU6A 5GANj 4YTLA 4CI0C 3J81E 3OQ5A 3E9GA 2L5QA 3CEYA 4JDSA 3MP6A 1R8OB 3PIOA 1UB4A 3C4SA 3I55T 2KK4A 5GAOq 1RL2A 2P0PA 3E19A 3JCMh 3VV0A 2M1HA 5GMKe 4PJOF 1V29B 3LW5E 3MO8A 1X01A 1AHJB 1YJ9A 5GAN5 4M78A 2LC4A 2QQRA 2DKGA 2YRVA 3X24B 4JS4A 4A4KA 4M78B 1YI2A 1KD1C 1M4ZA 2GFUA 3R6OA 4OB3B 4BDYA 1VQ8A 2DAQA 1KQSA 2OTJT 2BIVA 4N0AA 3ZBDA 2XKOC 5D6WA 2JUFA 2CZ6B 5EG2A 4ELZC 1WJQA 3OYLA 2PUOB 4J7FA 2LT4A 2LDMA 3BFMA 3PFSA 4M78D 3OYHA 4FM4B 3HRUA 4QQDA 2LX9A 5LJ3e 3CCET 2CZ0B 3MCAB 3JB9I 4EMGA 2PVGB 1MGQA 3G6ET 2KSSA 3UPUA 3JRZA 4A4HA 3GOXA 3LWIA 3JB9H 2CKKA 1UEBA 2RJFA 2FYKA 1OZ3A 5GAMe 5LJ3h 4E7LA 1Q82U 3CCQT 3CCUA 1M1GA 3CBPA 4BI8B 4M75F 1X6OA 2V8KA 3MEWA 2EJGA 3H8ZA 4DOWA 3MP8A 1GXIE 2RA2A 5GAMh 1I5LA 1PSEA 4DOVA 2MI6A 3JCMc 5CAIA 3VU3C 2MAMA 2Y4XA 2K3YA 4JUVA 1DJ7B 2PQWA 3PT9A 4MMKA 3OYKA 1B34A 2D0QB 2H3JA 3VUZA 1YBYA 3JCMX 1BI2A 1W4SA 5C6SA 1B34B 4IKFA 4XTXA 5IT9E 1BI3A 3CCVT 4OMFB 2QXFA 2GF7A 2K2VA 3M4YA 5KCOA 4HKEA 4JJNK 5LJ5f 4XAXB 3M54A 2QA4T 3M57A 1M9SA 3JCMf 4BACA 4N4HA 2ZPGB 2OTLA 1NPRA 2RHYA 2Y4YA 5CQYA 3CMAT 4XU2A 3CCEA 3EFSA 2A3LA 4PJOG 4L5GA 3CCRT 1LOJA 3QO3A 2K5FA 5CKBA 1YJNT 4M77F 2GFAA 4XTUA 2E64A 3CCQA 1JJ2S 3PTAA 1NZ9A 2O4XA 1UGSB 2YLCA 5HKCA 2RK2A 2DTIA 3M5AA 4M7AA 1I8FA 1VQ5T 4PJOC 2O4XB 5CQXA 1NE8A 3N5BB 4ME7A 5FU7B 1VQ9A 4B9XA 1P92A 2DVEA 5GAOn 3RIRA 4XTZA 4FT2A 3JCMW 3OSVA 2MMPA 1Q82C 4M7AD 1KHCA 2WSEE 5DY9A 5CIUA 5LJ3f 3UT1A 4PJOB 4EMHA 5GAOr 3GNGA 3TCJA 2QEXT 2VC8A 3OBWA 4O6JA 3CCVA 3JB9G 1KQ2A 4QQGA 2IG0A 4BY6B 4FL6A 4M7DD 3TREA 3ZFJA 4C92F 5GAMf 2RK1A 4M75G 3PGGA 2QA4A 4IUUA 1K8AU 4PLLA 5GANe 2LCLA 3CMAA 1W2BS 3LWHA 2P0QA 4OB2B 3L2WA 4XTYA 3L2ZA 2KQWA 4EDUA 3CCRA 4Q5WA 3NTHA 3KUFA 4RCBA 2LT1A 4C8QF 5GANh 4M75C 3CCMT 3NTIA 3OW2S 1YJNA 3A8OB 3J7AF 3UDCA 3HHTB 1Q81C 3X28B 4XU1A 4OGEA 2RH2A 3OYJA 5LL6S 2CGHA 3ER0A 3S3NA 1VQPA 4HCZA 4RKUE 1VQ5A 3OMGA 2EQMA 2PUKB 3V8LA 5FRNA 1EIFA 2DXBA 3VYGA 2RM4A 5A0DA 4M75B 1QVGA 3X26B 1N8RU 2HNIA 5IN1A 4X34A 3PMIA 3HFOA 3P8HA 3CC2T 5CVIA 4J8OA 3SDZA 5GAN6 1Y71A 4QVZA 2PVDB 4PJOE 1OYXA 2ZGWA 1WQ7A 2QQSA 1SSFA 2AHJB 3HRTA 4IUTA 3BDLA 3HL8A 4ZN1A 2VXFA 4MDWA 1VQOT 2QEXA 1M90C 1TH7A 4M77G 5FRMA 3OW2A 5GMKi 1U8RA 3URGA 2QTXA 4J6WA 2ZPEB 1UGRB 4F7UF 3G4ST 1K9MC 2EFIA 2VXEA 2EIFA 4C5GA 3L2UA 5D6YA 2ZZDA 4IUQA 5I21A 2EQKA 3VKIA 3M9QA 5A0LA 2K5LA 2NLUA 2VV5A 4J6XA 1PSFA 2XK0A 2YLBA 3FRNA 4M77C 3JAME 3OYGA 3OYIA 1G5VA 2CZ7B 2K3XA 3BW1A 1BIBA 5HY6A 3CCMA 4ATOA 5KE2A 3M53A 4ZTJA 4GLKA 1K73U 4KBMB 1WJSA 1K8AC 4J83A 5GAN7 5GAOl 4KUDK 4M77B 2D9TA 4C92G 4M75E 4A54A 2DXUA 4BB7A 3CXCS 2F69A 4QVCA 5LJ5g 5DLQE 4XU0A 3QG1A 3QZ9B 3CC2A 3CCST 2XDBA 1BYMA 3JCMg 4A4EA 1Q7YU 4OVAA 2KAFA 3L2VA 3OY9A 5GANf 1VQKT 3JB9F 1WGSA 3G71T 2LNVA 2P0KA 2RHIA 2EAYA 2QQ9A 2JNGA 4C92C 2L8DA 4C8QG 1VQOA 1Y07A 3VUBA 2RHUA 4MZMA 3CCLT 1M1KC 1X75C 2PU9B 3I55A 4II1A 3JB9J 1U1SA 2FL7A 1VUBA 2E6ZA 3OBYA 3QIIA 1WQWA 4WF2A 3OS2A 1QVFS 2M9UA 3FB9A 4N4IA 4C92B 5HK3A 1Y96A 3J80E 3I56T 1QVPA 3OYDA 4C8QC 2DK3A 3MEVA 1XTDA 2MWPA 3INZA 2PVOB 2K4YA 3CXCA 1Y96B 3QBYA 4LDXA 3META 1RI0A 3FEOA 2XICA 3TU4K 5C0MA 3E9FA 5KH6A 3RKWA 4ZGEB 3JCMQ 2P4TA 1HXDA 5LJ3g 4DQ2A 2DTHA 4MMLA 1BIAA 4HCCA 3P8DA 2XU8A 4M77E 2FVUA 3QUIA 2D6FA 4IUPA 4C5HA 2G3RA 5GAOp 4F7UG 3FLGA 1ZHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 G;  4PNO A;  3HSB A;  3RKX A;  4JRI A;  5GAM g;  4M7D E;  4M7D D;  3JCM b;  1KQ1 A;  4C92 F;  3V7C A;  5GAM f;  3JCM J;  4M75 G;  3PGG A;  5LJ5 j;  4C92 A;  5LJ5 e;  5GAN e;  5GAN j;  2DTO A;  3JCM e;  3BDU A;  3QHS A;  3AHU A;  2JN0 A;  2FB7 A;  2Y90 A;  5GAN 4;  4HT9 A;  4J5Y A;  4XTY A;  3L2Z A;  4HT8 A;  5GAO q;  4RCB A;  3RES A;  4C8Q F;  5GAN h;  2E1H A;  4M75 C;  3JCM h;  4XTV A;  5GMK e;  4C92 E;  5GMK j;  4PJO F;  4C8Q A;  4C92 D;  4X9D A;  4M7D G;  1X01 A;  4XU1 A;  3JCM V;  5GAN 5;  4M78 A;  4PJO A;  4F7U B;  2CGH A;  2DKG A;  4C8Q B;  1M8V A;  5GAN 2;  2K57 A;  5LJ3 d;  4M78 B;  3V8L A;  1HK9 A;  2RM4 A;  2DZC A;  4M75 B;  4N0A A;  2RD1 A;  2HNI A;  2E41 A;  3HFO A;  4QVD A;  4NL3 A;  4C8Q E;  4C8Q D;  5GAN 6;  4PJO E;  5GAM d;  3BFM A;  4M78 E;  3RER A;  2ZGW A;  4M78 D;  4V2S A;  1WQ7 A;  5GAN 3;  4PJO D;  3FIF A;  3V7S A;  1JBM A;  5LJ3 e;  5LJ3 j;  2VXF A;  3JB9 I;  1TH7 A;  4EMG A;  4M77 G;  1MGQ A;  2EJF A;  2RB6 A;  2EWN A;  4XU3 A;  3BY7 A;  5GAO r;  4M7A G;  5GMK i;  3JB9 H;  2E65 A;  2QTX A;  4J6W A;  4A53 A;  2FYK A;  4X9C A;  4F7U F;  5GAM e;  5GAM j;  5LJ3 h;  4F7U A;  2VXE A;  1KQ2 A;  4M78 F;  5GAN 8;  5I21 A;  4M75 F;  1N9S A;  2EJG A;  1I4K 1;  3FJP A;  4J6X A;  2YLB A;  2YHT A;  4M77 C;  4M75 A;  4XQ3 A;  2RA2 A;  3RKY A;  3SB2 A;  4NOY A;  5GAM h;  3JCM c;  1I5L A;  3SWN C;  5CAI A;  3BW1 A;  1BIB A;  3VU3 C;  3V7R A;  1H64 1;  4Y91 A;  2DXT A;  4NL2 A;  4F7U E;  4JUV A;  3QSU A;  3JB9 D;  4M7D C;  3RUX A;  4MMK A;  3HFN A;  1B34 A;  3L1A A;  2I2L A;  5GAN 7;  3JCM X;  5GAO l;  4M77 B;  4M7A B;  4C92 G;  4M75 E;  4M75 D;  4A54 A;  1B34 B;  2DXU A;  4XTX A;  1N9R A;  3M4G A;  4QVC A;  5LJ5 g;  2DEQ A;  4M7D A;  4XU0 A;  1D3B A;  1LNX A;  5GAN g;  3JCM g;  1I81 A;  5LJ5 f;  4M7D B;  1D3B B;  4EMK C;  3V8K A;  5GAN f;  2EJ9 A;  3JCM f;  3JB9 F;  1LJO A;  2EAY A;  4XU2 A;  4C92 C;  3EFS A;  4C8Q G;  1WPY A;  4HA8 A;  3JCM P;  4PJO G;  4M78 G;  3EFR A;  4EMK A;  1LOJ A;  4JLI A;  3QO3 A;  3JB9 J;  1U1S A;  1M5Q 1;  4RCC A;  4EMK B;  4M7A C;  4J6Y A;  4M77 F;  1WQW A;  4M7A F;  4WF2 A;  2E64 A;  4JRK A;  4XTU A;  3V8J A;  2YLC A;  3FB9 A;  4M77 A;  4C92 B;  4M7A A;  1Y96 A;  2DTI A;  1JRI A;  4C8Q C;  5GMK l;  4M7A D;  3INZ A;  1I8F A;  3SWN A;  4PJO C;  4M78 C;  1Y96 B;  5LJ5 h;  4M7D F;  1U1T A;  3SWN B;  2DVE A;  5GMK m;  2DZ9 A;  5GAO n;  3RIR A;  4XTZ A;  3RKW A;  3JCM Q;  5GAO m;  3JCM W;  1HXD A;  2E10 A;  4DQ2 A;  2DTH A;  4MML A;  1BIA A;  4N0A C;  4M77 E;  5LJ3 g;  4M77 D;  5LJ5 d;  3GIB A;  3QUI A;  4M7A E;  5DY9 A;  5GAN d;  1YCY A;  2DJZ A;  5LJ3 f;  1WNL A;  3JCM d;  5GAO p;  4EMH A;  4PJO B;  4XTW A;  4F7U G;  5GMK h;  4OP0 A;  2VC8 A; 
#chains in the Genus database with same CATH topology
 4PNO A;  3HSB A;  5GAM g;  3CCS A;  1G3S A;  5FU6 C;  1XJW B;  4JJC A;  1IRE B;  1XOV A;  3GLX A;  1M30 A;  3BDU A;  1K9M R;  1W6X A;  5GAN 4;  1PC0 A;  2XHC A;  4J5Y A;  2LZ6 B;  3CCL A;  3CPW S;  1N27 A;  2V8I A;  2B8A A;  2E1H A;  2J06 A;  4XTV A;  1Q86 U;  1XQH A;  4A63 B;  4M7D G;  4Y28 E;  2WSF E;  3EGX A;  1M8V A;  2JTF A;  3L2R A;  3EGX B;  1ZUY A;  3CQT A;  2QA4 Q;  1NLP C;  3ZEH A;  2JMA A;  4C8Q E;  3RER A;  1QP2 A;  3LGF A;  1FYN A;  4JLG A;  3DLM A;  2DD5 A;  5I2M A;  2YWW A;  3C94 A;  3OYM A;  2RF0 A;  2E65 A;  3HRS A;  2RQW A;  2MWO A;  1VQ5 Q;  3O5Z A;  1VQL A;  2DE0 X;  2YUO A;  2GTJ A;  1M3B A;  4JRP A;  4NOY A;  1ZUK A;  3SWN C;  3FC3 A;  3P8B B;  1LVK A;  3CME T;  2E12 A;  1N9R A;  2FO0 A;  4BI3 A;  3MEA A;  1Y0M A;  1G2B A;  3UAT A;  1E6H A;  1VQN T;  4EMK C;  1FX7 A;  1VQ7 T;  2R5M A;  2AZV A;  2JMC A;  4CC2 A;  2RJD A;  4RCC A;  1TG0 A;  4J6Y A;  2KI7 A;  4C0D B;  4DBF A;  3CCU T;  3L42 A;  1JRI A;  4PJL A;  3LH5 A;  3NFC A;  1BI1 A;  4BDZ A;  4DBQ A;  4M78 C;  5LJ5 h;  3CC7 A;  1G3T A;  2DZ9 A;  2E3I A;  2IVW A;  1KC8 C;  2DJZ A;  3JCM d;  4MZP A;  3G4S Q;  1PHT A;  1KQ1 A;  3G4S A;  3L2Q A;  2CP3 A;  2OTL T;  4IUV A;  2HKQ B;  3QHS A;  2O2O A;  3X20 B;  3ASK A;  4PLI A;  1SF9 A;  3QXE B;  2DIQ A;  2JTM A;  3DKM A;  3QKJ A;  2FPE A;  3G7Z A;  4QW2 A;  5AT1 B;  2CZ1 B;  1WXU A;  2X4W A;  9ATC B;  3LX7 A;  3LH0 A;  4IIM A;  5LJ3 d;  2DPP B;  1YIT A;  1M27 C;  5AYF A;  2RI5 A;  1VQK Q;  3FDR A;  1SEM A;  2E41 A;  5KCH A;  3ULR B;  1ZBX A;  4V2S A;  3OB9 A;  3PVQ A;  3UA6 A;  2L89 A;  2LQ8 A;  3V7S A;  4JRQ A;  3RMQ A;  5LJ3 j;  2LRQ A;  4C0F A;  8AT1 B;  4XU3 A;  4M7A G;  4F17 A;  1Q81 U;  4A53 A;  1K1Z A;  1AZG B;  1OI1 A;  1OX8 A;  2J05 A;  4M78 F;  3TSW A;  2OTJ T;  5KYY B;  2WAC A;  4TVR A;  2RHX A;  3G6E A;  4HVV A;  3PNW C;  4J9I A;  1I4K 1;  2VGN A;  2EGC A;  3H41 A;  1ABQ A;  1YIJ T;  1OU8 A;  4LDV A;  2RJC A;  3WVE B;  1M90 U;  3R6N A;  3OS1 A;  4M7D A;  3G1J A;  3HTR A;  2KXD A;  1VQ4 T;  4M7D B;  1LPL A;  1YHQ T;  1TUD A;  4LDU A;  2QAZ A;  1IHW A;  4RG8 A;  3DB4 A;  4HA8 A;  1O9S A;  1ZX6 A;  3EFR A;  4PFP A;  4IUR A;  4PK4 A;  1K4U S;  4LN2 A;  2QTV A;  1RAE B;  3GF5 A;  3SD4 A;  2MYS A;  1VQ8 T;  3Q1J A;  1QCF A;  2DD4 A;  2X3W D;  2A7Y A;  2GNC A;  2JM9 A;  2VB6 A;  3OYB A;  4RMO A;  1M1K U;  1OZ2 A;  3S3M A;  4M7D E;  1ZBJ A;  3JCM b;  3M0R A;  1QLY A;  5LJ5 e;  4K11 A;  4JS5 A;  2EQI A;  4FU6 A;  4YTL A;  2NUT A;  3E9G A;  2NUT B;  4J9B A;  1UB4 A;  3E19 A;  3JCM h;  3EHQ A;  1J3T A;  1V29 B;  1AHJ B;  5GAN 5;  2DA9 A;  2LC4 A;  3X24 B;  4FYY B;  4E6R A;  3CCJ Q;  4CC3 A;  3CD6 Q;  1M4Z A;  1KQS A;  2BIV A;  4ELZ C;  1WJQ A;  2PUO B;  4J7F A;  2LT4 A;  3BFM A;  3OYH A;  3HRU A;  4QQD A;  2KRM A;  2AKL A;  1NBE B;  3CC4 Q;  2CKK A;  1UEB A;  1KSW A;  5LJ3 h;  1IXD A;  1M1G A;  2O31 A;  3CBP A;  1RAB B;  4LUD A;  1EFN A;  1HYO A;  3MP8 A;  1I5L A;  1JO8 A;  5IXB A;  2RQV A;  5KYN A;  2K3Y A;  1QVG P;  2PQW A;  3PT9 A;  2EGA A;  2D0Q B;  1W4S A;  1BI3 A;  3CCV T;  7AT1 B;  2GF7 A;  5KCO A;  4HKE A;  2DF6 A;  2JT4 A;  4HXJ A;  3M57 A;  1H92 A;  4RTT A;  3JV3 A;  4BAC A;  2C0T A;  2RHY A;  2Y4Y A;  2A3L A;  4PJO G;  1LOJ A;  1ZA1 B;  3CCQ A;  4F14 A;  1G8X A;  2E64 A;  4PJJ A;  5HKC A;  4M7A A;  2DTI A;  1I8F A;  4AG2 C;  5CQX A;  4ME7 A;  4B9X A;  1P92 A;  2DVE A;  2NUP A;  1KD1 R;  1S72 Q;  2NUP B;  1SKU B;  2MMP A;  4M7A D;  2K9G A;  2RNA A;  2O88 A;  2DL5 A;  4OML A;  1BCO A;  4QQG A;  1NM7 A;  3TRE A;  3ZFJ A;  3UA7 A;  5GAM f;  1RAC B;  5GAN e;  2LCL A;  2GQI A;  3L2W A;  1AWO A;  3KUF A;  4ORZ A;  4M75 C;  3UDC A;  1Q81 C;  1TU0 B;  1R0B G;  1FMK A;  5IXF A;  5FRN A;  2RM4 A;  3PMI A;  1PM3 A;  3HFO A;  3SEM A;  4J8O A;  2PVD B;  2Z0W A;  2QQS A;  2AHJ B;  3BDL A;  4MDW A;  3EG3 A;  1VQO T;  2QEX A;  1M90 C;  1D0Z A;  1TH7 A;  1NYG A;  4M77 G;  2ENM A;  1PWT A;  5FW9 A;  2D1X A;  1YJ9 Q;  1UGR B;  3EHR A;  2EFI A;  3L2U A;  4AFU C;  5D6Y A;  2ZZD A;  3VKI A;  3M9Q A;  2K5L A;  2VV5 A;  5I22 A;  1PSF A;  2XK0 A;  1WLP B;  1G5V A;  2CZ7 B;  4RTV A;  4ZTJ A;  1WHM A;  6AT1 B;  1D1A A;  4J9E A;  4KUD K;  1JQQ A;  1JJ2 P;  1PD1 A;  4JPB W;  5DLQ E;  4XU0 A;  3QG1 A;  2A37 A;  3CC2 A;  2XDB A;  3JCM g;  2D0N A;  4OVA A;  3L2V A;  3VS6 A;  1YN8 A;  3JB9 F;  2JNG A;  2QDL A;  4C8Q G;  1Y07 A;  3PVL A;  2GBQ A;  1M1K C;  1X75 C;  4PFO A;  1IRX A;  4RTZ A;  2E6Z A;  1QMC A;  3QII A;  2QG9 B;  4WF2 A;  4C92 B;  3OYD A;  3CXC A;  3QBY A;  1W2B P;  3TU4 K;  3VS4 A;  3VS2 A;  3JCM Q;  2P4T A;  1UUE A;  5LJ3 g;  2KR3 A;  3CCE Q;  3P8D A;  1SRL A;  2FVU A;  3QUI A;  2KE9 A;  2H8H A;  5GAO p;  2ROL A;  2CP0 A;  3FLG A;  3C12 A;  5KE3 A;  2DRK A;  1WI7 A;  2I0N A;  1QW1 A;  3SHW A;  1VQ6 T;  3A8H B;  1ZQ1 A;  2KT8 A;  3G71 A;  4PFZ A;  4BE0 A;  1QVF A;  1ARK A;  1MHN A;  2R5A A;  1FMW A;  2QQB A;  1VOM A;  5FU6 B;  3WXM B;  2RQT A;  4C92 E;  5J3B A;  4L59 A;  3OYY A;  2X4X A;  2X51 A;  4PJO A;  4F7U B;  4MZT A;  3M59 A;  2K57 A;  3CPF A;  3QWX X;  2FZC B;  2CP2 A;  2NUZ A;  3A8L B;  1JU5 C;  3CMA Q;  3UF4 A;  1MMG A;  4PJO D;  3CCR Q;  4AG1 C;  4KUI A;  1YJN Q;  3H0I A;  3C95 A;  3CPW A;  3BE3 A;  4E7Z A;  2HQX A;  4ZGD B;  2EYW A;  1KC8 U;  2FRW A;  1OQK A;  1EX4 A;  2LP5 A;  2YDL A;  3M0Q A;  2OX7 A;  1N9S A;  1PD0 A;  4FYX B;  1KK7 A;  2YHT A;  3LGL A;  3SB2 A;  1KFZ A;  3V7R A;  1MV3 A;  4F7U E;  3A8M B;  2F1L A;  4FW1 A;  2HKN A;  2HSP A;  1QVF P;  3VJP A;  2KDS A;  1NJI C;  1I1J A;  3MJX A;  3QDR B;  5I2S A;  2RI3 A;  3M55 A;  4RUG A;  1M3A A;  5CO7 A;  4QKU A;  2HD0 A;  1WZO A;  2HAX A;  3CCM Q;  2KRO A;  4ANJ A;  4EMK A;  4C0G A;  3VS3 A;  3OYC A;  4EMK B;  1D0X A;  1UJY A;  2H3E B;  4M7A F;  2W0Z A;  1NPP A;  4M77 A;  4E7K A;  2FRY A;  8ATC B;  3O8V A;  1RAA B;  2J7I A;  1N6A A;  1I0C A;  1Q82 R;  3DLL A;  2YUN A;  5GMK m;  1BB9 A;  2E10 A;  5LJ5 d;  1YJW T;  4M77 D;  3CME A;  5GMK h;  2DL3 A;  4E7H A;  3RKX A;  2QYZ A;  2K6D A;  1VQN A;  5LJ5 j;  2OAW A;  2C06 A;  4NS5 A;  4OB1 B;  2DL8 A;  1VQ7 A;  1RI9 A;  4BUG A;  1TXQ A;  2EPD A;  2XDD A;  5IHN A;  2L3Q A;  1GFC A;  4J9C A;  1X2K A;  1G3W A;  3T9N A;  3ME9 A;  5D6X A;  4C8Q A;  4Z02 A;  4X9D A;  3JCM V;  4R56 A;  4FW2 A;  4C8Q B;  3CCS Q;  1HK9 A;  2DO3 A;  1VQ9 T;  4B6M A;  3M0T A;  2LQW A;  2A08 A;  4C8Q D;  4WTO B;  4M78 E;  3A1P A;  5GAN 3;  1JBM A;  3CCL Q;  4E7J A;  1Q86 R;  2ZPF B;  2XID A;  2EWN A;  2HSE B;  3BY7 A;  1VQM Q;  2E6N A;  4KUL A;  2V8J A;  1HD3 A;  1OX9 A;  3I56 Q;  2A36 A;  1G3Y A;  2X4Y A;  4A4F A;  4E7I A;  2DER A;  1VQM A;  3I56 A;  2ECZ A;  1QP3 A;  2LVM A;  3M56 A;  1K8A R;  4OGC A;  3REB B;  2FG0 A;  2HBW A;  1PKT A;  2FHD A;  4OMN A;  3RUX A;  2E5Q A;  1VQP T;  3L1A A;  2CDT A;  2ZPB B;  2PZ1 A;  4ELY C;  2HQE A;  1K9M U;  1D3B A;  4X1V A;  3PIP A;  1VYT A;  1VQL Q;  2DVJ A;  2KVQ G;  1GBQ A;  1D3B B;  2EJ9 A;  1H3H A;  1LJO A;  2MIO A;  5CCA A;  1I07 A;  1N8R R;  2CYZ B;  1WPY A;  2O01 E;  2DIG A;  3THK A;  2BUD A;  3I35 A;  2G6F X;  5CR2 A;  1BI0 A;  3GP8 A;  2DET A;  2XG8 D;  3X25 B;  2OTJ A;  3V8J A;  4BD3 A;  1IGQ A;  2CSQ A;  4HCK A;  4DEX A;  2JXB A;  1YI2 T;  2CP7 A;  1IB8 A;  1SG5 A;  2ED0 A;  5DLO A;  4PL6 A;  2F5T X;  2FPD A;  1YIJ A;  2NWM A;  4XK8 E;  2RJE A;  5GAN d;  3M0P A;  4EPC A;  1K73 R;  1UTI A;  2GTO A;  2LMJ A;  1VIE A;  1VQ4 A;  5CKF A;  2LQK A;  1YHQ A;  4OF1 A;  5GAN j;  5M9O A;  4CI0 C;  3CC7 Q;  4JDS A;  1Q7Y R;  2DJQ A;  3MP6 A;  3PIO A;  2MK5 A;  1TS9 A;  2P0P A;  5GMK e;  3VV0 A;  4M4Z A;  4PJO F;  3MO8 A;  4JZ3 A;  2DKG A;  4A4K A;  1HJD A;  2GFU A;  1B7T A;  3R6O A;  4OB3 B;  1VQ8 A;  4N0A A;  5D6W A;  2JUF A;  5EG2 A;  1TTH B;  1X69 A;  4FM4 B;  4EMG A;  1VYV A;  4KGX B;  2JW4 A;  1K0X A;  3GOX A;  3LWI A;  2COW A;  1OZ3 A;  2VAS A;  1YIT Q;  2V8K A;  2EJG A;  3H8Z A;  2EW3 A;  4DOW A;  4RTY A;  1PSE A;  4DOV A;  3JCM c;  5CAI A;  4J9G A;  2F2V A;  4FCY A;  4PJN A;  1BI2 A;  5C6S A;  1HSQ A;  1GL5 A;  1BBZ A;  3M4Y A;  3G6E Q;  5KYY A;  2W10 A;  2QA4 T;  3JCM f;  4N4H A;  4XU2 A;  4JZ4 A;  4AT1 B;  5CKB A;  4M77 F;  1AWW A;  2YLC A;  1NZ9 A;  2PTK A;  2DRM A;  3I9Q A;  1VQ5 T;  5FU7 B;  4JJD A;  4XTZ A;  4FT2 A;  2F2W A;  1Q82 C;  5DY9 A;  3UT1 A;  5LJ3 f;  3GNG A;  3TCJ A;  4O6J A;  3CCV A;  2IG0 A;  4BY6 B;  4M7D D;  2EVR A;  3PGG A;  1RLP C;  4IUU A;  3LWH A;  1BU1 A;  3L2Z A;  2RQR A;  5D7U A;  1H3Z A;  2KYB A;  4C8Q F;  5GAN h;  3A8O B;  3J7A F;  4KH0 B;  4HCZ A;  1AZE A;  1WX6 A;  5A0D A;  4M75 B;  1QVG A;  2V1Q A;  4X34 A;  1Y71 A;  1M8M A;  2COY A;  3EG9 A;  3HL8 A;  1X6G A;  3EG9 B;  1U8R A;  2QTX A;  3G4S T;  1K9M C;  1NG2 A;  4OMQ A;  2EIF A;  4Y92 A;  4C5G A;  2EKH A;  3M0S A;  3QDF A;  5HY6 A;  5KE2 A;  3M53 A;  2ZAE A;  1NEG A;  4GLK A;  1WJS A;  1K8A C;  4J83 A;  2AKK A;  2DFU A;  4C92 G;  4M75 E;  1IHV A;  2DXU A;  4BB7 A;  3EH1 A;  1UHC A;  1WXB A;  5LJ5 g;  1BYM A;  2D8H A;  3NPF A;  3OY9 A;  1VQK T;  2EYY A;  1WGS A;  1X43 A;  2JS0 A;  2RHI A;  3I55 Q;  1VQO A;  2KGT A;  4KRT A;  3I55 A;  4II1 A;  1PKS A;  1U1S A;  1Z9Z A;  1QWE A;  3FB9 A;  4N4I A;  3G6E T;  5HK3 A;  3MEV A;  2O9V A;  2PVO B;  1WHH A;  1T0H A;  5C0M A;  5KYX A;  2DEU A;  1ACM B;  4MML A;  5KYX B;  2XU8 A;  1MND A;  4IUP A;  4C5H A;  4F7U G;  1ZUU A;  4RTW A;  5CK9 A;  3CCQ Q;  2K2M A;  4RG2 A;  1K73 C;  5FWB A;  2ZCF B;  2Y90 A;  3SFM A;  2L3R A;  4HT9 A;  3EGU A;  1NJI U;  2ZPI B;  4MDX A;  1F1B B;  2KRN A;  2L3S A;  3H0F A;  2VUB A;  1UGP B;  1QKX A;  5GAN 2;  2ESW A;  2SRC A;  3A5Z B;  3S6W A;  3ZL7 C;  1WJR A;  2EYZ A;  2D8J A;  2VKN A;  2LCS A;  4BI4 A;  3U23 A;  1JJ2 A;  1RUW A;  3I5S A;  1R77 A;  4LDW A;  4C5E A;  2EJF A;  3OS5 A;  1VQ6 A;  1FMV A;  1KJW A;  4Z8A A;  1KD1 U;  2ROT A;  2RN8 A;  2K3B A;  3E1S A;  2IIM A;  1U3O A;  3NTK A;  3FJP A;  4XQ3 A;  3RKY A;  1MNE A;  4ZGJ B;  3KBG A;  2KBT A;  3EGD A;  1H64 1;  4NL2 A;  1GBR A;  3EGD B;  3QSU A;  1VA7 A;  2QEX Q;  2I2L A;  1W2B A;  3MP1 A;  3M4G A;  2DEQ A;  3CCJ T;  1LNX A;  2BE7 D;  5GAN g;  3CD6 T;  2JS2 A;  1I81 A;  2DIL A;  5J26 A;  2JJ9 A;  2DXC A;  2LJ1 A;  2CT4 A;  3GNF B;  3CBO A;  4M78 G;  4C5I A;  4FSX A;  5HK0 A;  2J6K A;  1FXX A;  3CC4 T;  2HBP A;  3A8G B;  5GMK l;  4ZN3 A;  2LTO A;  3CC2 Q;  1GCQ A;  4M7D F;  1U1T A;  2YXY A;  4R0K A;  1Z9Q A;  2ABL A;  1I5O B;  3NGP A;  2QGG A;  5GJW B;  3GIB A;  1YCY A;  2JVV A;  3WVD B;  2QQA A;  4XTW A;  2EQJ A;  1B3Q A;  2XD0 A;  5FWC A;  3JSC A;  2CP6 A;  4C92 A;  4KGV B;  2QI2 A;  3AHU A;  2DYB A;  2FB7 A;  4BE1 A;  2QGF B;  4HT8 A;  2CT3 A;  1TUG B;  2RQU A;  1KHI A;  3H0H A;  2ZPH B;  3LLR A;  5GMK j;  1KIK A;  1M2O A;  1JXM A;  4C92 D;  3RBB B;  5IH2 A;  3EFO A;  1ZSZ C;  1GCP A;  4UC4 A;  3DB3 A;  3EFO B;  1SPK A;  4FIB A;  4LDY A;  2HL5 C;  3I5R A;  3G71 Q;  4QVD A;  1OOT A;  1YJW A;  2CSI A;  4PKC C;  1AT1 B;  1S72 T;  1ZLM A;  2DYI A;  1R0C B;  3VYH B;  4C0Z A;  3S3O A;  4PJM A;  1SHF A;  4E47 A;  4X9C A;  2VYT A;  4F7U A;  1M1F A;  4KGZ B;  2LX7 A;  2HMA A;  1ZSG A;  2YRC A;  4NL3 A;  4M7A C;  4LUE A;  3OYN A;  2M16 A;  2MPX C;  4DBH A;  3KXT A;  4Y91 A;  4OMO A;  2DXT A;  3VRY A;  3EAE A;  2VVK A;  1E7O A;  5KYU A;  3QZ5 B;  1KC8 R;  4D8K A;  2RI2 A;  5KYU B;  5FRO A;  1MMN A;  1QCO A;  2LCC A;  3OYF A;  1JEG A;  2M51 A;  2RHZ A;  3TQ7 P;  2YSQ A;  2E4H A;  2C0O A;  2FZG B;  1U5S A;  2WSC E;  1GRI A;  3AT1 B;  5HCK A;  1E6G A;  4JLI A;  1SSH A;  2E70 A;  4P5N A;  2JZ2 A;  2OAU A;  2E5K A;  1YJ9 T;  5CKH A;  3SWN A;  4IIO A;  1Y57 A;  2EQU A;  2EYQ A;  4LD6 A;  4FYW B;  3SWN B;  1T3S A;  2YUQ A;  3JCM P;  3A98 A;  3RDV A;  1O75 A;  3LYI A;  1YP5 A;  3MHX A;  4RTU A;  3OSS C;  2YRD A;  1GFD A;  1MV0 B;  3CEY A;  1R8O B;  3C4S A;  2DLP A;  2KK4 A;  3CME Q;  2KNB B;  3LW5 E;  4M78 A;  1PRL C;  4JS4 A;  4M78 B;  1YI2 A;  1KD1 C;  4BDY A;  2DAQ A;  1VQN Q;  4ZNX A;  1V1C A;  2KRS A;  3NMZ C;  3OYL A;  1VQ7 Q;  2LDM A;  4M78 D;  2MOX A;  4AMC A;  4FSS A;  2LX9 A;  3CCE T;  4F16 A;  2CZ0 B;  3MCA B;  2PVG B;  2KSS A;  3UPU A;  3JRZ A;  4A4H A;  3CCU Q;  3JB9 H;  4JJB A;  2RJF A;  2FYK A;  2QAS A;  5GAM e;  4E7L A;  1Q82 U;  1OV3 A;  3CCU A;  1C1A A;  4HVW A;  1PCX A;  4BI8 B;  1X6O A;  2KYM A;  3MEW A;  4DEY A;  2RA2 A;  3VU3 C;  1UE9 A;  2MAM A;  2Y4X A;  4JUV A;  1DJ7 B;  1D09 B;  2H3J A;  3VUZ A;  3VRZ A;  1YBY A;  3FJ5 A;  3KFV A;  1AWJ A;  4IKF A;  5IT9 E;  4OMF B;  1S1N A;  2OTL Q;  1YFN A;  2BTT A;  4D8D A;  5LJ5 f;  1CSK A;  1AOJ A;  1M9S A;  2OTL A;  2ZPG B;  1NPR A;  3CMA T;  3EFS A;  1TSF A;  1VYU A;  3CCR T;  1YJN T;  1UGS B;  2RK2 A;  3M5A A;  2YUP A;  1W1F A;  4PJO C;  2KXC A;  2LNH B;  3OSV A;  1W70 A;  1KHC A;  2WSE E;  2C0I A;  2VC8 A;  1AEY A;  3JB9 G;  1AVZ C;  2OTJ Q;  4C92 F;  2BZX A;  2RK1 A;  4M75 G;  2QA4 A;  1K8A U;  4PLL A;  2L0A A;  2P0Q A;  4OB2 B;  4XTY A;  1YIJ Q;  3OW2 S;  2LT1 A;  4J9F A;  3CCM T;  3NTI A;  1AD5 A;  4QT7 A;  3X28 B;  4XU1 A;  2RH2 A;  3OYJ A;  1VQ5 A;  3OMG A;  2EQM A;  2PUK B;  3V8L A;  1VQ4 Q;  1WHG A;  2DXB A;  3NHN A;  1N8R U;  1YHQ Q;  3P8H A;  1X2Q A;  4OMP A;  5CVI A;  2AK5 A;  4QVZ A;  3PE0 A;  4AFQ C;  1OYX A;  5EC7 A;  4ZN1 A;  2CH4 A;  2J6O A;  3TVT A;  5FRM A;  2GGR A;  4F7U F;  2ZPE B;  3GBQ A;  4LNP A;  1CKA A;  4IUQ A;  1VQ8 Q;  2EQK A;  5A0L A;  2NLU A;  1M2V A;  4J6X A;  2MCN A;  3OYG A;  2YLB A;  4M77 C;  1B07 A;  1D1C A;  3JAM E;  3OYI A;  2K3X A;  1M2V B;  1BIB A;  3BW1 A;  2O9S A;  1K73 U;  4KBM B;  5GAN 7;  2ED1 A;  5GAO l;  2CH4 W;  2D9T A;  4A54 A;  1LCK A;  2F69 A;  1PNJ A;  2X9H A;  4QVC A;  3QZ9 B;  3VS1 A;  3CCS T;  1Q7Y U;  2KAF A;  5GAN f;  2P0K A;  2QQ9 A;  3MPU B;  2RHU A;  1EZZ B;  5L23 A;  3CCL T;  1QWF A;  1UFF A;  3JB9 J;  3OS2 A;  1VQM T;  3J80 E;  1Y96 A;  3I56 T;  1QVP A;  4C8Q C;  2DK3 A;  1Q81 R;  3INZ A;  1T0J A;  2P4R A;  1Y96 B;  4LDX A;  3RKW A;  4ZGE B;  4DQ2 A;  2DTH A;  4AFZ C;  4HCC A;  2K79 A;  2QK0 A;  1D0Y A;  2G3R A;  2DX1 A;  3M58 A;  1FWZ A;  4JRI A;  1M90 R;  1Q95 G;  2KY9 A;  2K7A A;  2HZY A;  1VQK A;  1YNZ A;  4VUB A;  4CRI A;  1VQL T;  3VS5 A;  2LJ3 A;  2CS7 A;  2JN0 A;  1T3L A;  4BE2 A;  1WA7 A;  1IZ6 A;  2GCX A;  1X27 A;  3RES A;  3MEU A;  4ZTF A;  1ZA2 B;  3RNJ A;  3CCV Q;  5L8R E;  1ABO A;  1YWO A;  4HCB A;  2RO0 A;  1IGU A;  2L3P A;  2RD1 A;  5CKE A;  3E2U A;  2DL4 A;  2BE9 B;  3RR6 A;  3FIF A;  5ECA A;  2DBM A;  3HP9 A;  2IPO B;  4Z88 A;  3M0U A;  1TOV A;  2EKO A;  2YT6 A;  4WCI A;  2QDY B;  1M1K R;  5GAN 8;  4LD9 K;  4QQ6 A;  4AFS C;  4M75 A;  2PNI A;  2VGM A;  5GJV B;  5A2Q E;  5J39 A;  3CC7 T;  4OB0 B;  2K5I A;  3JB9 D;  3HFN A;  5A0G A;  1QKW A;  2A28 A;  2L2P A;  1UGQ B;  4M75 D;  4CC4 B;  3HPW A;  5I11 A;  1D1B A;  5DM7 R;  1OUL A;  1M3C A;  2GQV A;  1Q86 C;  4C0D C;  4N4G A;  2X4J A;  4FT4 A;  4D6W A;  3QYG B;  1BKB A;  2M0O A;  2FZK B;  4B9W A;  1RAH B;  3QJ6 A;  2EYX A;  5CKD A;  4J7I A;  4KT0 E;  3GPL A;  1YIT T;  3PMT A;  1RLQ C;  2R57 A;  1Y7X A;  5GAO m;  3RMS A;  4N0A C;  3OMC A;  1VQO Q;  1YCS B;  1OEB A;  2HDA A;  1C0M A;  4DA4 A;  3CCJ A;  3CD6 A;  3V7C A;  4HVU A;  1N8R C;  3F70 A;  4A4G A;  2DTO A;  2E3H A;  3OYE A;  1TWB A;  1WHK A;  2JOY A;  3REA B;  4FYV B;  3HKS A;  2R58 A;  3CC4 A;  2JM8 A;  3UWN A;  3QJY A;  4OMM A;  2DZC A;  1ZSZ A;  1PRM C;  2KT1 A;  4O5V A;  1ZSZ B;  4J9H A;  5GAM d;  1NJI R;  1MMD A;  2HQH A;  2MF2 A;  5FLX E;  1UJ0 A;  2JTE A;  2RB6 A;  1A0N B;  2DBK A;  5GAM j;  3QWY A;  4LE9 A;  1Q7Y C;  5IHK A;  2OI3 A;  4R55 A;  3QPH A;  3OA6 A;  1UGV A;  2J6F A;  5FU7 C;  1UEC A;  2KEA A;  2DMO A;  2V1R A;  1KQS P;  4M7D C;  2A0F B;  3EH2 A;  4M7A B;  2BKD N;  2AIR B;  1VQ6 Q;  4KH1 B;  2RMO A;  2KMT A;  4BY6 C;  3TEE A;  5IAY A;  3QYH B;  3V8K A;  1S72 A;  3OYA A;  2F5K A;  1WYX A;  4CC7 A;  1OPL A;  1XNI A;  1BCM A;  1QVG S;  3H6Z A;  1CKB A;  1M5Q 1;  1U06 A;  2X35 A;  4JRK A;  4L6V 5;  1WDX A;  3VS7 A;  2XI9 A;  2CUD A;  2HCK A;  1VIF A;  2AT1 B;  1K0S A;  4DBR A;  1KG1 A;  4M7A E;  2P84 A;  1WNL A;  3IQL A;  4OP0 A;  1WHJ A;  1KQS S;  1JB0 E;  3OS0 A;  2XDP A;  2XMF A;  3JCM J;  3CBM A;  4GY5 A;  3JCM e;  1WHL A;  3J81 E;  3OQ5 A;  2L5Q A;  1RAI B;  2BZY A;  2FEI A;  3I55 T;  5GAO q;  1RL2 A;  3EG2 A;  1RAG B;  2M1H A;  1TUC A;  2EGE A;  1V76 A;  1X01 A;  1YJ9 A;  2NYS A;  4GBQ A;  2QQR A;  2YRV A;  1NLO C;  2HL3 A;  5KYW A;  4RTX A;  3ZBD A;  2XKO C;  2CZ6 B;  1NEB A;  5KYW B;  3PFS A;  1JXO A;  5LJ3 e;  3JB9 I;  2F2X A;  2VWF A;  1MGQ A;  1C6V X;  2M0Y A;  3CCQ T;  2V26 A;  4M75 F;  2DL7 A;  1GXI E;  3D7S B;  5GAM h;  2MI6 A;  4LXC A;  1YJW Q;  1K9A A;  4MMK A;  3OYK A;  1B34 A;  3JCM X;  2RPN A;  1B34 B;  4XTX A;  2QXF A;  2K2V A;  3EG1 A;  4JJN K;  4XAX B;  3M54 A;  1QQJ A;  2LQN A;  5CQY A;  3CCE A;  2DM1 A;  1G83 A;  2BZ8 A;  4L5G A;  2DNU A;  3QO3 A;  2K5F A;  5IHI A;  2GFA A;  4XTU A;  1JJ2 S;  3PTA A;  1UG1 A;  2O4X A;  1NYF A;  1RAF B;  2X3X D;  1VQ9 Q;  2O4X B;  1NE8 A;  3N5B B;  1VQ9 A;  1BK2 A;  5GAO n;  3RIR A;  3VS0 A;  3JCM W;  2LJ0 A;  5CIU A;  4PJO B;  4EMH A;  5GAO r;  2QEX T;  3OBW A;  1KQ2 A;  2AZS A;  4FL6 A;  4ESR A;  1H8K A;  2COZ A;  1UDL A;  3CMA A;  1W2B S;  4E7S A;  2KQW A;  2M02 A;  4EDU A;  1WXT A;  3CCR A;  2HEQ A;  4Q5W A;  3NTH A;  4RCB A;  3CXC P;  1YJN A;  1VQP Q;  3HHT B;  1N5Z A;  4OGE A;  5LL6 S;  2CGH A;  3ER0 A;  3S3N A;  1VQP A;  4RKU E;  4Z89 A;  1EIF A;  3VYG A;  1IO6 A;  3C0C A;  2CRE A;  3X26 B;  2HNI A;  5IN1 A;  3CC2 T;  3SDZ A;  2SEM A;  5GAN 6;  4PJO E;  2ZGW A;  1SRM A;  1WQ7 A;  1X6B A;  1SSF A;  3HRT A;  4IUT A;  2VXF A;  4F04 B;  2EBP A;  3OW2 A;  5GMK i;  3URG A;  4J6W A;  1WFW A;  2VXE A;  3H9N A;  1WIE A;  1YI2 Q;  5I21 A;  3FRN A;  2ATC B;  4J9D A;  3CCM A;  4ATO A;  1GCQ C;  1PG5 B;  4M77 B;  4E2F B;  1AWX A;  4EIK A;  3CXC S;  1RAD B;  3CPW P;  4A4E A;  1UHF A;  3G71 T;  2LNV A;  1OPK A;  2CP5 A;  3TSZ A;  1MUZ A;  2EAY A;  4GLM A;  4C92 C;  2L8D A;  1MMA A;  3VUB A;  4MZM A;  2PU9 B;  1OU9 A;  2FL7 A;  2FPF A;  1VUB A;  1QCN A;  3OBY A;  1WQW A;  1QVF S;  2M9U A;  1XTD A;  2MWP A;  3EG0 A;  2K4Y A;  3MET A;  1RI0 A;  3FEO A;  2CUB A;  1YWP A;  2XIC A;  3E9F A;  5KH6 A;  1SHG A;  1HXD A;  1BIA A;  1K76 A;  4M77 E;  3OW2 P;  2B86 A;  2D6F A;  2OJ2 A;  3MKD A;  1ZHI A; 
#chains in the Genus database with same CATH homology
 3C12 A;  4PNO A;  5KE3 A;  3M58 A;  5CK9 A;  1FWZ A;  4JRI A;  5GAM g;  3HSB A;  3CCS A;  1G3S A;  2KY9 A;  4RG2 A;  5FU6 C;  1QW1 A;  1VQ6 T;  1VQK A;  3A8H B;  1IRE B;  1XOV A;  1ZQ1 A;  3GLX A;  4VUB A;  4CRI A;  3G71 A;  4BE0 A;  1K73 C;  1VQL T;  3BDU A;  2CS7 A;  2JN0 A;  2ZCF B;  2Y90 A;  3SFM A;  5GAN 4;  1MHN A;  2L3R A;  2XHC A;  4J5Y A;  2R5A A;  4BE2 A;  4HT9 A;  1IZ6 A;  3CCL A;  1NJI U;  2GCX A;  2QQB A;  2ZPI B;  3CPW S;  4MDX A;  1N27 A;  2V8I A;  5FU6 B;  3RES A;  3WXM B;  2B8A A;  2E1H A;  3MEU A;  4XTV A;  4ZTF A;  4C92 E;  2VUB A;  5J3B A;  4L59 A;  1Q86 U;  1XQH A;  3OYY A;  1UGP B;  2X4X A;  4M7D G;  4PJO A;  4Y28 E;  2WSF E;  4MZT A;  4F7U B;  3M59 A;  1M8V A;  2JTF A;  5L8R E;  4HCB A;  5GAN 2;  2K57 A;  3L2R A;  2RO0 A;  3CPF A;  3A5Z B;  3S6W A;  2RD1 A;  5CKE A;  1WJR A;  3A8L B;  3ZEH A;  4C8Q E;  3RER A;  4BI4 A;  4PJO D;  1QP2 A;  1JJ2 A;  3FIF A;  3LGF A;  4JLG A;  3DLM A;  3HP9 A;  4KUI A;  2DD5 A;  4LDW A;  5I2M A;  3C95 A;  4C5E A;  2EJF A;  3CPW A;  3C94 A;  3OYM A;  2EKO A;  2HQX A;  2E65 A;  4ZGD B;  3OS5 A;  3HRS A;  1KC8 U;  2QDY B;  2MWO A;  1VQ6 A;  5GAN 8;  1VQL A;  1KD1 U;  4LD9 K;  3E1S A;  4QQ6 A;  1N9S A;  3NTK A;  3FJP A;  4XQ3 A;  3LGL A;  2YHT A;  4M75 A;  3RKY A;  3SB2 A;  4JRP A;  2VGM A;  4ZGJ B;  3KBG A;  4NOY A;  5J39 A;  5A2Q E;  3SWN C;  3FC3 A;  3CC7 T;  4OB0 B;  3V7R A;  1H64 1;  4NL2 A;  4F7U E;  2K5I A;  3A8M B;  3P8B B;  3QSU A;  3JB9 D;  3HFN A;  5A0G A;  3CME T;  2I2L A;  1W2B A;  1UGQ B;  2E12 A;  3MP1 A;  4M75 D;  3HPW A;  1N9R A;  3M4G A;  3VJP A;  2DEQ A;  2KDS A;  1NJI C;  3CCJ T;  1LNX A;  4BI3 A;  3CD6 T;  3MEA A;  5GAN g;  3QDR B;  5DM7 R;  1I81 A;  5J26 A;  5I2S A;  1VQN T;  2GQV A;  4EMK C;  2RI3 A;  2DXC A;  1FX7 A;  4C0D C;  1Q86 C;  4N4G A;  1VQ7 T;  2X4J A;  3M55 A;  4FT4 A;  5CO7 A;  2R5M A;  3GNF B;  2HD0 A;  3CBO A;  2HAX A;  4D6W A;  3QYG B;  4M78 G;  1BKB A;  4FSX A;  4C5I A;  2M0O A;  4EMK A;  4C0G A;  5HK0 A;  4B9W A;  2RJD A;  3OYC A;  4RCC A;  4EMK B;  4C0D B;  1FXX A;  4J6Y A;  4M7A F;  3QJ6 A;  3CCU T;  1NPP A;  3CC4 T;  3L42 A;  4M77 A;  4E7K A;  1JRI A;  2HBP A;  3A8G B;  5CKD A;  5GMK l;  3NFC A;  3O8V A;  1BI1 A;  4ZN3 A;  4J7I A;  2LTO A;  4KT0 E;  3GPL A;  4M78 C;  4BDZ A;  5LJ5 h;  1N6A A;  1YIT T;  4M7D F;  1U1T A;  3CC7 A;  1G3T A;  3PMT A;  3DLL A;  5GMK m;  2DZ9 A;  2R57 A;  1Y7X A;  5GAO m;  3RMS A;  2E10 A;  2IVW A;  1KC8 C;  4N0A C;  5LJ5 d;  3OMC A;  1YJW T;  3GIB A;  4M77 D;  3CME A;  1YCY A;  2DJZ A;  2JVV A;  3WVD B;  2QQA A;  3JCM d;  4XTW A;  4MZP A;  5GMK h;  2EQJ A;  4E7H A;  2XD0 A;  3RKX A;  3JSC A;  4DA4 A;  3CCJ A;  3CD6 A;  1KQ1 A;  3V7C A;  1VQN A;  5LJ5 j;  1N8R C;  4C92 A;  3L2Q A;  3G4S A;  4NS5 A;  2C06 A;  4OB1 B;  2OTL T;  3F70 A;  2QI2 A;  2DTO A;  4IUV A;  4A4G A;  3QHS A;  3OYE A;  1VQ7 A;  3X20 B;  3AHU A;  2FB7 A;  3ASK A;  4PLI A;  4BUG A;  4BE1 A;  2JOY A;  4HT8 A;  2XDD A;  1KHI A;  2DIQ A;  2JTM A;  2ZPH B;  3DKM A;  3QKJ A;  3QXE B;  3LLR A;  3HKS A;  3G7Z A;  1G3W A;  4QW2 A;  5GMK j;  3T9N A;  3ME9 A;  2CZ1 B;  5D6X A;  4C8Q A;  4Z02 A;  4C92 D;  2R58 A;  4X9D A;  2X4W A;  3CC4 A;  3JCM V;  4R56 A;  4C8Q B;  4UC4 A;  3LX7 A;  3LH0 A;  3DB3 A;  5LJ3 d;  3UWN A;  1HK9 A;  3QJY A;  2DO3 A;  2DPP B;  1YIT A;  1VQ9 T;  4FIB A;  4LDY A;  5AYF A;  2DZC A;  2RI5 A;  4O5V A;  3FDR A;  2E41 A;  4QVD A;  4C8Q D;  5KCH A;  5GAM d;  1ZBX A;  4M78 E;  1YJW A;  2MF2 A;  4PKC C;  4V2S A;  3OB9 A;  5GAN 3;  2L89 A;  2LQ8 A;  1JBM A;  3V7S A;  3RMQ A;  5FLX E;  5LJ3 j;  2LRQ A;  4JRQ A;  4E7J A;  4C0F A;  3VYH B;  4C0Z A;  3S3O A;  2ZPF B;  2XID A;  4XU3 A;  2RB6 A;  4M7A G;  2EWN A;  3BY7 A;  1Q81 U;  4A53 A;  2E6N A;  2V8J A;  4KUL A;  4E47 A;  1OI1 A;  4X9C A;  5GAM j;  2VYT A;  1G3Y A;  4F7U A;  2X4Y A;  1M1F A;  4M78 F;  4A4F A;  4E7I A;  1Q7Y C;  1QVF A;  2WAC A;  4TVR A;  1VQM A;  2RHX A;  3G6E A;  3PNW C;  3I56 A;  1S72 T;  4R55 A;  3QPH A;  1I4K 1;  1QP3 A;  2LVM A;  2VGN A;  4NL3 A;  3OA6 A;  3M56 A;  4M7A C;  4OGC A;  3OYN A;  5FU7 C;  2M16 A;  3KXT A;  4Y91 A;  1YIJ T;  2DXT A;  4M7D C;  3RUX A;  2FHD A;  3EAE A;  4LDV A;  2E5Q A;  2RJC A;  3L1A A;  3WVE B;  1VQP T;  1M90 U;  3QZ5 B;  4M7A B;  2ZPB B;  2RI2 A;  2BKD N;  5FRO A;  3OS1 A;  4ELY C;  4M7D A;  2HQE A;  1K9M U;  1D3B A;  3PIP A;  4BY6 C;  2KMT A;  3TEE A;  5IAY A;  1VQ4 T;  3QYH B;  2KVQ G;  2LCC A;  3OYF A;  4M7D B;  1D3B B;  2RHZ A;  3V8K A;  2EJ9 A;  1YHQ T;  4LDU A;  1LJO A;  2F5K A;  5CCA A;  3OYA A;  1S72 A;  2CYZ B;  2WSC E;  1WPY A;  2O01 E;  2DIG A;  4RG8 A;  3DB4 A;  4HA8 A;  1O9S A;  1XNI A;  3EFR A;  1QVG S;  2BUD A;  3H6Z A;  4IUR A;  4JLI A;  2E70 A;  4P5N A;  2JZ2 A;  2OAU A;  5CR2 A;  1M5Q 1;  1BI0 A;  3GP8 A;  2XG8 D;  3X25 B;  2X35 A;  4JRK A;  2OTJ A;  3V8J A;  1YJ9 T;  3GF5 A;  3SD4 A;  4BD3 A;  4L6V 5;  5CKH A;  3SWN A;  2EQU A;  1YI2 T;  2EYQ A;  4LD6 A;  1VQ8 T;  3SWN B;  5DLO A;  4PL6 A;  2F5T X;  3Q1J A;  1YIJ A;  2XI9 A;  2DD4 A;  1VIF A;  2A7Y A;  4XK8 E;  2RJE A;  1KG1 A;  4M7A E;  3OYB A;  5GAN d;  1WNL A;  4RMO A;  1H3Z A;  4EPC A;  1M1K U;  3JCM P;  1OZ2 A;  4OP0 A;  1VQM T;  3S3M A;  4M7D E;  1KQS S;  1JB0 E;  3JCM b;  1VIE A;  1O75 A;  2XDP A;  3OS0 A;  5CKF A;  1VQ4 A;  3LYI A;  3JCM J;  3MHX A;  5LJ5 e;  2LQK A;  4JS5 A;  3OSS C;  1YHQ A;  3CBM A;  4GY5 A;  4OF1 A;  5M9O A;  3JCM e;  4FU6 A;  5GAN j;  4YTL A;  4CI0 C;  3J81 E;  3OQ5 A;  3E9G A;  2L5Q A;  3CEY A;  4JDS A;  3MP6 A;  1R8O B;  3PIO A;  1UB4 A;  3C4S A;  3I55 T;  2KK4 A;  5GAO q;  1RL2 A;  2P0P A;  3E19 A;  3JCM h;  3VV0 A;  2M1H A;  5GMK e;  4PJO F;  1V29 B;  3LW5 E;  3MO8 A;  1X01 A;  1AHJ B;  1YJ9 A;  5GAN 5;  4M78 A;  2LC4 A;  2QQR A;  2DKG A;  2YRV A;  3X24 B;  4JS4 A;  4A4K A;  4M78 B;  1YI2 A;  1KD1 C;  1M4Z A;  2GFU A;  3R6O A;  4OB3 B;  4BDY A;  1VQ8 A;  2DAQ A;  1KQS A;  2OTJ T;  2BIV A;  4N0A A;  3ZBD A;  2XKO C;  5D6W A;  2JUF A;  2CZ6 B;  5EG2 A;  4ELZ C;  1WJQ A;  3OYL A;  2PUO B;  4J7F A;  2LT4 A;  2LDM A;  3BFM A;  3PFS A;  4M78 D;  3OYH A;  4FM4 B;  3HRU A;  4QQD A;  2LX9 A;  5LJ3 e;  3CCE T;  2CZ0 B;  3MCA B;  3JB9 I;  4EMG A;  2PVG B;  1MGQ A;  3G6E T;  2KSS A;  3UPU A;  3JRZ A;  4A4H A;  3GOX A;  3LWI A;  3JB9 H;  2CKK A;  1UEB A;  2RJF A;  2FYK A;  1OZ3 A;  5GAM e;  5LJ3 h;  4E7L A;  1Q82 U;  3CCQ T;  3CCU A;  1M1G A;  3CBP A;  4BI8 B;  4M75 F;  1X6O A;  2V8K A;  3MEW A;  2EJG A;  3H8Z A;  4DOW A;  3MP8 A;  1GXI E;  2RA2 A;  5GAM h;  1I5L A;  1PSE A;  4DOV A;  2MI6 A;  3JCM c;  5CAI A;  3VU3 C;  2MAM A;  2Y4X A;  2K3Y A;  4JUV A;  1DJ7 B;  2PQW A;  3PT9 A;  4MMK A;  3OYK A;  1B34 A;  2D0Q B;  2H3J A;  3VUZ A;  1YBY A;  3JCM X;  1BI2 A;  1W4S A;  5C6S A;  1B34 B;  4IKF A;  4XTX A;  5IT9 E;  1BI3 A;  3CCV T;  4OMF B;  2QXF A;  2GF7 A;  2K2V A;  3M4Y A;  5KCO A;  4HKE A;  4JJN K;  5LJ5 f;  4XAX B;  3M54 A;  2QA4 T;  3M57 A;  1M9S A;  3JCM f;  4BAC A;  4N4H A;  2ZPG B;  2OTL A;  1NPR A;  2RHY A;  2Y4Y A;  5CQY A;  3CMA T;  4XU2 A;  3CCE A;  3EFS A;  2A3L A;  4PJO G;  4L5G A;  3CCR T;  1LOJ A;  3QO3 A;  2K5F A;  5CKB A;  1YJN T;  4M77 F;  2GFA A;  4XTU A;  2E64 A;  3CCQ A;  1JJ2 S;  3PTA A;  1NZ9 A;  2O4X A;  1UGS B;  2YLC A;  5HKC A;  2RK2 A;  2DTI A;  3M5A A;  4M7A A;  1I8F A;  1VQ5 T;  4PJO C;  2O4X B;  5CQX A;  1NE8 A;  3N5B B;  4ME7 A;  5FU7 B;  1VQ9 A;  4B9X A;  1P92 A;  2DVE A;  5GAO n;  3RIR A;  4XTZ A;  4FT2 A;  3JCM W;  3OSV A;  2MMP A;  1Q82 C;  4M7A D;  1KHC A;  2WSE E;  5DY9 A;  5CIU A;  5LJ3 f;  3UT1 A;  4PJO B;  4EMH A;  5GAO r;  3GNG A;  3TCJ A;  2QEX T;  2VC8 A;  3OBW A;  4O6J A;  3CCV A;  3JB9 G;  1KQ2 A;  4QQG A;  2IG0 A;  4BY6 B;  4FL6 A;  4M7D D;  3TRE A;  3ZFJ A;  4C92 F;  5GAM f;  2RK1 A;  4M75 G;  3PGG A;  2QA4 A;  4IUU A;  1K8A U;  4PLL A;  5GAN e;  2LCL A;  3CMA A;  1W2B S;  3LWH A;  2P0Q A;  4OB2 B;  3L2W A;  4XTY A;  3L2Z A;  2KQW A;  4EDU A;  3CCR A;  4Q5W A;  3NTH A;  3KUF A;  4RCB A;  2LT1 A;  4C8Q F;  5GAN h;  4M75 C;  3CCM T;  3NTI A;  3OW2 S;  1YJN A;  3A8O B;  3J7A F;  3UDC A;  3HHT B;  1Q81 C;  3X28 B;  4XU1 A;  4OGE A;  2RH2 A;  3OYJ A;  5LL6 S;  2CGH A;  3ER0 A;  3S3N A;  1VQP A;  4HCZ A;  4RKU E;  1VQ5 A;  3OMG A;  2EQM A;  2PUK B;  3V8L A;  5FRN A;  1EIF A;  2DXB A;  3VYG A;  2RM4 A;  5A0D A;  4M75 B;  1QVG A;  3X26 B;  1N8R U;  2HNI A;  5IN1 A;  4X34 A;  3PMI A;  3HFO A;  3P8H A;  3CC2 T;  5CVI A;  4J8O A;  3SDZ A;  5GAN 6;  1Y71 A;  4QVZ A;  2PVD B;  4PJO E;  1OYX A;  2ZGW A;  1WQ7 A;  2QQS A;  1SSF A;  2AHJ B;  3HRT A;  4IUT A;  3BDL A;  3HL8 A;  4ZN1 A;  2VXF A;  4MDW A;  1VQO T;  2QEX A;  1M90 C;  1TH7 A;  4M77 G;  5FRM A;  3OW2 A;  5GMK i;  1U8R A;  3URG A;  2QTX A;  4J6W A;  2ZPE B;  1UGR B;  4F7U F;  3G4S T;  1K9M C;  2EFI A;  2VXE A;  2EIF A;  4C5G A;  3L2U A;  5D6Y A;  2ZZD A;  4IUQ A;  5I21 A;  2EQK A;  3VKI A;  3M9Q A;  5A0L A;  2K5L A;  2NLU A;  2VV5 A;  4J6X A;  1PSF A;  2XK0 A;  2YLB A;  3FRN A;  4M77 C;  3JAM E;  3OYG A;  3OYI A;  1G5V A;  2CZ7 B;  2K3X A;  3BW1 A;  1BIB A;  5HY6 A;  3CCM A;  4ATO A;  5KE2 A;  3M53 A;  4ZTJ A;  4GLK A;  1K73 U;  4KBM B;  1WJS A;  1K8A C;  4J83 A;  5GAN 7;  5GAO l;  4KUD K;  4M77 B;  2D9T A;  4C92 G;  4M75 E;  4A54 A;  2DXU A;  4BB7 A;  3CXC S;  2F69 A;  4QVC A;  5LJ5 g;  5DLQ E;  4XU0 A;  3QG1 A;  3QZ9 B;  3CC2 A;  3CCS T;  2XDB A;  1BYM A;  3JCM g;  4A4E A;  1Q7Y U;  4OVA A;  2KAF A;  3L2V A;  3OY9 A;  5GAN f;  1VQK T;  3JB9 F;  1WGS A;  3G71 T;  2LNV A;  2P0K A;  2RHI A;  2EAY A;  2QQ9 A;  2JNG A;  4C92 C;  2L8D A;  4C8Q G;  1VQO A;  1Y07 A;  3VUB A;  2RHU A;  4MZM A;  3CCL T;  1M1K C;  1X75 C;  2PU9 B;  3I55 A;  4II1 A;  3JB9 J;  1U1S A;  2FL7 A;  1VUB A;  2E6Z A;  3OBY A;  3QII A;  1WQW A;  4WF2 A;  3OS2 A;  1QVF S;  2M9U A;  3FB9 A;  4N4I A;  4C92 B;  5HK3 A;  1Y96 A;  3J80 E;  3I56 T;  1QVP A;  3OYD A;  4C8Q C;  2DK3 A;  3MEV A;  1XTD A;  2MWP A;  3INZ A;  2PVO B;  2K4Y A;  3CXC A;  1Y96 B;  3QBY A;  4LDX A;  3MET A;  1RI0 A;  3FEO A;  2XIC A;  3TU4 K;  5C0M A;  3E9F A;  5KH6 A;  3RKW A;  4ZGE B;  3JCM Q;  2P4T A;  1HXD A;  5LJ3 g;  4DQ2 A;  2DTH A;  4MML A;  1BIA A;  4HCC A;  3P8D A;  2XU8 A;  4M77 E;  2FVU A;  3QUI A;  2D6F A;  4IUP A;  4C5H A;  2G3R A;  5GAO p;  4F7U G;  3FLG A;  1ZHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...