3INZA

H57t hfq from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
KGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKTAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title The structures of mutant forms of Hfq from Pseudomonas aeruginosa reveal the importance of the conserved His57 for the protein hexamer organization.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 15
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3inzA00
4MMLA 3JCMX 3JB9D 4M7DF 4M78B 4M78A 4J6YA 4F7UG 5GAN8 3QO3A 3SWNA 4N0AC 2YLCA 2DEQA 3RKYA 4C92D 4J5YA 4C8QC 5GAN6 5GANf 2ZGWA 4M7AE 4M78C 4M7DG 1I5LA 3QUIA 2E10A 2FYKA 3SWNC 5GAOq 2EJFA 3EFRA 5LJ3j 1WNLA 2DTIA 3RUXA 4JRKA 1Y96A 2DJZA 4PJOF 3HFNA 1M8VA 2DKGA 2RD1A 4XTXA 4HT8A 4M78D 4RCBA 1KQ2A 2JN0A 2HNIA 3VU3C 4EMHA 3JB9I 3L1AA 4M77B 3QHSA 2EJGA 4XTUA 2Y90A 4XU3A 4HT9A 3V7RA 1I81A 1I4K1 4M7AG 5LJ5j 5GAN4 3FB9A 2EWNA 4XTWA 5GMKh 4JLIA 3V8JA 1YCYA 2YLBA 4C8QB 4J6WA 3JCMP 4NL2A 3JB9H 3JCMW 3BDUA 1M5Q1 2DZCA 5GMKi 1BIAA 2VC8A 3SWNB 4F7UB 4F7UA 5GAMg 3RERA 4OP0A 3V8LA 3BFMA 4M75B 2DVEA 4M75A 4WF2A 4QVCA 1D3BA 5GAMd 3SB2A 4M77D 3RKWA 3PGGA 4RCCA 1U1TA 5GAMh 5GAN5 4M7DA 3RIRA 1Y96B 2EJ9A 4M75C 3JCMQ 4M7AF 4C8QD 3INZA 4XU1A 2FB7A 3FJPA 4M7DC 1X01A 5GANj 2E65A 3QSUA 5LJ3f 4C92E 4A53A 3RKXA 5GANe 2E41A 3JB9F 1I8FA 4M75D 5LJ3g 2DXTA 3JB9J 4EMGA 4M77E 4X9DA 1HXDA 5DY9A 4PJOB 4PJOA 5GMKm 3M4GA 5LJ3d 4C92F 2YHTA 5GAMf 4DQ2A 5GAOn 5LJ3h 5GAOm 4JRIA 4C8QE 3JB9G 1LNXA 5GMKe 2DTOA 2I2LA 4M77F 5LJ5f 4M7AC 4PJOC 3JCMf 4M78E 3JCMV 2QTXA 5GMKl 4PNOA 4XU0A 3RESA 1D3BB 2E1HA 5LJ5g 4C92G 1JRIA 2DTHA 3JCMg 4C8QF 5GAOl 2VXFA 4M75E 2EAYA 1MGQA 5LJ5d 4M77G 4M7DB 3V8KA 3JCMd 1LJOA 4M78F 5LJ5h 1KQ1A 1TH7A 4PJOD 3JCMh 5GAN2 4V2SA 1U1SA 3FIFA 3HSBA 4X9CA 4MMKA 1HK9A 4XTYA 5GAN7 4C8QG 3GIBA 1B34B 1B34A 4JUVA 5GAN3 4HA8A 4EMKB 1BIBA 4EMKA 1N9RA 4J6XA 5CAIA 4M78G 2CGHA 4XQ3A 3EFSA 4NL3A 3JCMJ 4M7AB 2RB6A 4QVDA 4M7AA 4M75G 1WPYA 1H641 4A54A 2E64A 4EMKC 1JBMA 4NOYA 4M7DD 5GMKj 4XTZA 4XTVA 4PJOE 5GANg 3AHUA 3HFOA 2K57A 3JCMb 3V7SA 5GANd 5GAOr 1N9SA 2DZ9A 4F7UE 5LJ3e 4XU2A 1LOJA 5GANh 3BY7A 2RM4A 4C92B 4C92A 2RA2A 3V7CA 5GAOp 2DXUA 5GAMj 4M7AD 2VXEA 4M77A 1WQWA 3L2ZA 4F7UF 4M7DE 4Y91A 5GAMe 5I21A 4PJOG 4M75F 4C92C 1WQ7A 3JCMc 4N0AA 5LJ5e 4C8QA 3BW1A 3JCMe 4M77C
chains in the Genus database with same CATH superfamily
3JCMX 1WGSA 3MEAA 4BB7A 2B86A 3PVLA 3LW5E 4X34A 2DIGA 3G4SQ 2NUZA 4PJOF 1CKAA 2DBMA 4D6WA 1ZA2B 2WSCE 3QHSA 2JTFA 2KROA 2HDAA 2Y90A 5GMKh 3JCMP 1YCYA 2DF6A 2F1LA 3FDRA 4RTTA 1YIJQ 2NUTA 1WZOA 2JMAA 1C0MA 4J9GA 2LQNA 4BY6B 4M75C 4ESRA 3JCMQ 4XK8E 3JAME 5DLOA 4XU1A 2QI2A 1AVZC 3FJPA 3UPUA 1D0YA 4C92E 4PJLA 1VQPT 2PNIA 1H3ZA 3KFVA 3CPWA 3HKSA 4PJOA 1Q81C 3RDVA 2O31A 2KBTA 5LJ3d 3OYDA 2X4YA 1GRIA 4DQ2A 2HD0A 2LX7A 1BK2A 1KIKA 3LLRA 2GBQA 1X6OA 4R0KA 1K9AA 2QTXA 5LJ5g 4WTOB 1M1FA 4C8QF 4N4IA 2OTJT 2K5IA 5GAN2 4ZGEB 4GLKA 1A0NB 2PU9B 3NMZC 4EMKA 5GAN3 3M58A 4HKEA 3VS6A 3UDCA 1WPYA 2CKKA 4HCKA 2DEUA 2RJDA 1QVFA 3OQ5A 4BE2A 1QVGA 2K57A 2CUBA 1TUDA 3JCMb 4DOVA 2DZ9A 3VS5A 2L2PA 2DMOA 2YWWA 5KH6A 5IT9E 3CCQT 5GAMe 5I21A 3PIPA 4RG8A 4JRPA 4C92C 2QXFA 2L3RA 4C8QA 3JCMe 4K11A 3A5ZB 1Q7YR 4N0AC 4OMOA 3H41A 4M7DG 1I5LA 2E10A 1W2BS 5HY6A 1RAEB 3QXEB 4CC2A 4M7AG 1M90R 2EWNA 2HQXA 1GCQC 2QQRA 2RQRA 4J6WA 2RQUA 1WXTA 1SKUB 5GMKi 1G83A 4PL6A 2DL8A 4JLGA 3SDZA 2M0YA 2RHYA 4AFUC 4RCCA 3HL8A 2DRKA 1Y96B 2DL5A 2ZAEA 5KE3A 1OEBA 4C5EA 2RMOA 1KD1R 2VYTA 2FRYA 2DXBA 1VQOA 3T9NA 3QDRB 1M27C 5DLQE 3R6OA 5GANe 3CCRA 2A08A 3WVDB 5GAMf 1LCKA 2J6OA 1X2KA 2QDYB 3CPFA 1N8RC 3JCMf 3JCMV 5GMKl 4FU6A 3DB3A 4HXJA 4PNOA 2YUQA 2GTOA 8ATCB 4MZPA 1VQPA 1M3BA 2K3YA 2ROTA 4FSXA 4M78F 1OQKA 2CZ0B 2O4XB 2E6NA 3CXCP 1SG5A 2DVJA 1M2OA 2ZCFB 5FWBA 5CR2A 2OTJA 4LE9A 1VQMQ 1UEBA 3META 1TOVA 2CP0A 5J39A 3G4SA 2KRNA 3OYJA 1ZX6A 5GAOr 2YRCA 3M0UA 4F7UE 5LJ3e 1WHHA 4IUVA 3CD6T 2LJ0A 1UGSB 2JJ9A 1JU5C 3LH5A 3HPWA 4PJOG 3EFOA 1K9MR 1H3HA 1NM7A 5HKCA 4M78A 4J6YA 3D7SB 2IPOB 1JEGA 1I0CA 3QWYA 2MCNA 3TU4K 4QVZA 1IGQA 3I35A 5GANf 3FRNA 4Z8AA 1TUCA 2SRCA 5AT1B 1D1BA 4PLLA 1OV3A 3LWIA 2JN0A 3CMEQ 4BY6C 2LCLA 1NEGA 2CH4A 1WHKA 4B9WA 4J9BA 1UHCA 2JS2A 1E6GA 3DKMA 4M4ZA 4D8KA 3I5RA 1Q82R 3BE3A 3BFMA 3X28B 2EQUA 3OYAA 2FHDA 7AT1B 3ZEHA 1BYMA 4QQGA 3GF5A 2VGMA 3OMCA 3QYGB 1NBEB 3ULRB 2DX1A 3HTRA 3QSUA 5KYUA 5LJ3f 5KCOA 2CDTA 3GOXA 2PQWA 4JRIA 3JB9G 2M0OA 4M77F 2ZPEB 4EDUA 3CPWS 2Y4YA 2MI6A 2CYZB 4BD3A 1D3BB 1OI1A 2VVKA 4JDSA 5GAOl 2HBWA 1VQ7Q 4M7DB 1MGQA 1OOTA 2ATCB 3JCMh 3M57A 1ABQA 1Q7YC 1QCNA 1B34B 3OS2A 4HA8A 1MHNA 3KUFA 2OAWA 2EYYA 1QLYA 1BKBA 4M7AB 5I22A 3QDFA 3FJ5A 1R8OB 2JNGA 3MPUB 2O9SA 3HHTB 1OYXA 1M90C 4OMNA 1QVFS 3BY7A 2DBKA 1UGQB 1QVGS 1PRMC 4FCYA 2DXUA 4M77A 1NJIU 2AT1B 5FRNA 3BW1A 2D1XA 3JB9D 1QVPA 4FT4A 4J9IA 3CC2Q 1XOVA 1KSWA 3CD6A 1E7OA 3CC7Q 2QG9B 4MZMA 2QA4Q 5KYNA 1X6BA 1ZSZA 2EYQA 1BCOA 2CH4W 4C5GA 3X26B 5IH2A 1YNZA 1IRXA 1PHTA 1KQ2A 2HBPA 1RL2A 5LJ5j 4J9FA 3NFCA 1VQ6Q 4Y28E 2CZ6B 2H8HA 1YWPA 2XIDA 4J9EA 2D8JA 1EX4A 1WHJA 2O01E 2AZVA 1KHIA 3MEUA 1B3QA 1BU1A 1SSFA 2RHUA 2EQKA 4LN2A 1OPKA 2GFAA 1M1KC 2EKOA 2LQWA 2EQJA 4MDWA 2ZPFB 1WYXA 2KXCA 3OW2P 2ABLA 2DL4A 4E7LA 2K2VA 5FU7B 3J7AF 4DEXA 2D0NA 3SEMA 3G71T 2PZ1A 3UATA 5CO7A 4PJOB 1VQMA 2PUOB 4R55A 1Q95G 4A4GA 3CXCA 5LJ3h 4JS4A 2KXDA 2RJCA 1SSHA 4R56A 1UGPB 2EYWA 2IVWA 1YJNQ 1LJOA 1GFDA 3FIFA 1Y57A 4EMKB 2CP5A 2D9TA 5A0GA 2QQBA 2K7AA 4N4GA 1OX8A 2L3QA 2QEXQ 1NZ9A 2RB6A 3PVQA 4BI4A 2RI2A 3M56A 1TWBA 2JVVA 2L89A 3CCLQ 3AHUA 5HCKA 2KT8A 1VQ4Q 1FXXA 4JJCA 3CCVQ 3LGLA 1TTHB 2COWA 4RKUE 1K73C 4M7DE 5C6SA 3P8HA 2BZ8A 3C95A 3J80E 2L8DA 3OYFA 2E70A 2COZA 4BDZA 1YITQ 2RNAA 2DYIA 1UTIA 2ROLA 1QCOA 3O5ZA 4N4HA 1ZUKA 3RR6A 5A0DA 2ZGWA 4M7AE 3OYHA 1MV0B 1WXBA 2M1HA 3EGDB 1SPKA 3OS1A 3HFNA 3P8DA 3ME9A 2A0FB 4FL6A 4RCBA 5ECAA 3VU3C 1EZZB 5D6WA 3JB9I 3URGA 2CP7A 5GJVB 2AHJB 1K8AR 2X3WD 3L42A 3SWNB 2RN8A 3TCJA 2LZ6B 1MUZA 1VQ7A 1TG0A 3CC4Q 5IHIA 2RQTA 2E6ZA 3EG9A 3OYIA 2DO3A 4M7DC 1PG5B 2QQ9A 2DLPA 3QPHA 2E4HA 2DD4A 3QG1A 3JB9J 3M54A 2DILA 2L5QA 2LCSA 2ZZDA 3OYMA 1YJ9T 1LNXA 4M7AC 4KUIA 1S1NA 2O2OA 3UF4A 4LDVA 1WHGA 3VJPA 1RUWA 2VV5A 5LJ5d 4FSSA 1U1SA 1VQ9Q 4MMKA 4OB3B 1YHQQ 2GCXA 2XDDA 1AWWA 4IKFA 2VGNA 3C4SA 4PJOE 3HRUA 1Q86U 2V26A 4RTXA 2F5KA 2XKOC 5KYXA 2RK2A 1FWZA 3VS3A 1VQ6A 1JXMA 2MMPA 4II1A 4MMLA 2AKLA 4J9DA 4M78B 4QQ6A 4AG2C 2FVUA 4C5HA 3M59A 2C06A 2WSEE 3RNJA 2FYKA 1YI2Q 2EJFA 2SEMA 2E5KA 4JZ4A 3UWNA 3CBMA 4E2FB 5CKDA 1K76A 1PM3A 3H9NA 3I56Q 5CKFA 3GPLA 1UUEA 4RG2A 5FU7C 2DZCA 5A2QE 1BIAA 2QDLA 2HEQA 3F70A 4Z89A 1NE8A 1YJNA 1JJ2P 1RADB 1U1TA 5GAN5 3RIRA 1SF9A 3EGXA 2M16A 1SEMA 4AG1C 5KYUB 2V8KA 2QGFB 2V1QA 2V1RA 2DXTA 1HXDA 2DFUA 1NG2A 2D6FA 4IIMA 3EH1A 2YHTA 1VQOT 5GAOn 1U5SA 5M9OA 1VQ4A 4E7ZA 4ANJA 1AEYA 3CCRT 3CCVA 3CXCS 2F2XA 4HCCA 2LT1A 4L5GA 5D7UA 2DA9A 3WXMB 4XTYA 3KXTA 1YJ9A 1Y0MA 1RI9A 1WA7A 1QP3A 3OBWA 1BB9A 1X6GA 1KQSP 2HL3A 1YJWQ 3MP1A 2OAUA 4VUBA 3QKJA 2DE0X 1YWOA 2GF7A 1BI3A 1K8AC 2IG0A 2LX9A 3VS2A 3V7CA 2RH2A 1M9SA 3OYKA 2XG8D 2X4JA 3G4ST 4F04B 4M75F 5LJ5e 3NHNA 4F14A 2FZGB 1RABB 2RF0A 3G7ZA 1RACB 4J5YA 2HZYA 4FT2A 3G6EQ 2KVQG 2Y4XA 3CC4A 1ZSZB 3SWNC 1V1CA 2XICA 1YIJT 2KEAA 1YP5A 2W0ZA 4F17A 2COYA 1OZ2A 2KSSA 1RAGB 2Z0WA 3I5SA 3V7RA 2RHIA 3PE0A 5GAN4 2XDBA 2D8HA 2PVGB 1VYTA 3OYCA 3EH2A 2FZKB 4ELYC 2A36A 2X35A 5CQYA 5GAMg 1O75A 4M75A 2K4YA 2F2WA 2RQWA 2RI3A 1VQ9A 1X75C 2KE9A 1YHQA 4OGEA 1FMVA 2DYBA 2V8IA 2E3IA 1WJQA 3RKXA 1U06A 2QAZA 5CIUA 2R57A 5GMKm 1RAFB 4C92F 1W70A 4PJMA 2DTOA 5LJ5f 5CQXA 3H6ZA 3Q1JA 3REAB 5FU6B 2JOYA 4DBQA 1PD0A 1SRMA 4ATOA 2XU8A 3EG3A 2HAXA 3HSBA 4KGZB 1TSFA 2EQMA 2CP3A 4GLMA 5J26A 4HVWA 3EFSA 1Q81U 3M5AA 2K5FA 1JBMA 4M7DD 2DL7A 4XTZA 1YI2A 4WCIA 3OSVA 3QYHB 1VIEA 1UE9A 5GANg 4FM4B 1QWEA 4GY5A 4C92A 3I56A 4M7AD 3HRTA 2EBPA 1MNDA 4OF1A 1IHVA 3TSWA 2LNVA 4DBFA 1UB4A 4N0AA 4L6V5 2QQSA 5IN1A 2QTVA 2LQ8A 4BDYA 2JMCA 5A0LA 1H8KA 1C1AA 2DK3A 4FIBA 2GTJA 1FMKA 2L0AA 3QUIA 2DD5A 2R58A 4JRKA 2P0QA 3BDLA 5CCAA 3KBGA 4MDXA 2YUOA 1EFNA 2YRDA 1JJ2A 4JZ3A 4XTWA 3O8VA 3JRZA 2BZXA 3MJXA 1ABOA 1AWOA 1O9SA 2XI9A 3BDUA 1YIJA 2K9GA 4PJNA 4F16A 1N27A 4OGCA 3RKWA 3M9QA 1QKXA 1K0SA 2G6FX 4IUPA 1MMAA 1VQ5Q 2I0NA 2E5QA 2E65A 2L3SA 1KK7A 4A53A 1JXOA 1WX6A 4EMGA 2EYZA 2RJEA 5GAOm 1HSQA 3CCEQ 2EKHA 1QMCA 1VQMT 3ER0A 2EAYA 1I07A 1KQSA 5LJ5h 4PJOD 3PMTA 4OVAA 4V2SA 5KCHA 4C8QG 1Q86R 5CK9A 4E7HA 3FLGA 4B9XA 4M75G 2G3RA 2R5MA 1K4US 4NOYA 1N8RU 1ZSGA 2C0IA 4QW2A 1N9SA 3HRSA 1QQJA 2DPPB 5KYXB 1W2BP 4F7UF 4Y91A 2ZPIB 1ZUYA 1WQ7A 3PFSA 2GFUA 2FPFA 2MYSA 3A98A 3CMET 5GAN8 2KMTA 2K2MA 1UFFA 1T0HA 2YLCA 2DEQA 2LMJA 1B07A 4J7IA 4OB1B 5IXFA 3GBQA 1T3SA 1WLPB 3CCSQ 2CP6A 4XTXA 2A37A 1TS9A 2HNIA 2EJGA 2LTOA 4IIOA 3QJ6A 1JB0E 1VQLQ 1U8RA 3CMAQ 1SHFA 4QKUA 3MCAB 3JCMW 1BCMA 1M5Q1 4UC4A 4F7UA 3PNWC 4OP0A 3V8LA 1UDLA 2HKQB 1KD1C 4E7JA 2WSFE 4KH0B 2JM8A 3L2WA 2M51A 3CEYA 8AT1B 2EFIA 3NGPA 4GBQA 1N6AA 1M8MA 2LT4A 4YTLA 2LDMA 1VQ7T 1M2VA 2FPDA 3I9QA 4KRTA 1ZBXA 2GQVA 2ZPHB 3EG1A 1RLPC 3CCUQ 2LQKA 3NTKA 2NUTB 3SFMA 2E1HA 2LJ3A 3AT1B 2VXFA 4FW2A 4J9HA 1PRLC 1VQNQ 2CZ7B 3V8KA 4A4FA 2DIQA 1S72Q 3ZFJA 1WFWA 4ELZC 2J05A 2YT6A 3CCMQ 4PLIA 4Q5WA 4A4KA 1N9RA 1RAAB 4M78G 3VV0A 2DERA 2RPNA 3M0SA 2A3LA 2C0TA 2YRVA 3M55A 4E7SA 5IXBA 3LH0A 1R0BG 3CC2T 3VS7A 3CC7T 2KYBA 1T3LA 1K9MC 2QA4T 4EIKA 3NTIA 5GAMj 3RMQA 3EG2A 3OBYA 3VYHB 1GL5A 4FYXB 4HT9A 3S3OA 1U3OA 2JUFA 3ZL7C 2QASA 3FEOA 1SHGA 1VQ6T 1VQ8Q 3M0TA 5KE2A 1KHCA 2GQIA 1Y96A 4LD9K 1VQ5A 3QZ9B 1G2BA 4PFZA 2OTLQ 3CMEA 4M78D 2HL5C 3M0PA 2NYSA 2P4RA 1FX7A 1Q82C 3I55Q 4C8QB 4JS5A 1JJ2S 1LVKA 3CCEA 1X27A 2DJQA 2F69A 3RERA 2V8JA 4M75B 2DVEA 1MMDA 2CREA 1Q86C 1PSFA 4PKCC 1YBYA 3P8BB 4BACA 5C0MA 4O6JA 1BI1A 3H0FA 1GFCA 2BE7D 2FB7A 4C0DB 1X01A 5GANj 2KR3A 1YJNT 2E41A 2EIFA 4CI0C 1NLPC 4KBMB 2RK1A 1OX9A 4J8OA 2XD0A 1W1FA 3MKDA 3E9FA 2FG0A 3S3NA 2QEXT 1M1KU 4M77G 4KGXB 3CCLT 4HVUA 1VQ4T 1PKTA 2J6KA 1QVFP 3GIBA 2X4WA 3CCVT 1IHWA 2BTTA 2DNUA 1KQSS 1HJDA 3HP9A 2HSPA 3J81E 2DL3A 3VUBA 4B6MA 3CCJQ 2DXCA 1RLQC 4OB2B 1WJRA 1W2BA 2JT4A 2K3XA 3UA6A 3HFOA 1D0XA 2EQIA 1YITT 1AWXA 3QIIA 1OZ3A 4ZGDB 1I1JA 4C92B 4CC3A 4Z02A 3MEVA 2NUPA 1VQLA 1ACMB 3S6WA 3CMAA 4RTVA 3E19A 2ESWA 3JCMc 1HYOA 2VKNA 3CC2A 4PJJA 4M7DF 5CKBA 3CC7A 2YUPA 1VQKQ 2GGRA 2QA4A 5GAN6 5KYWA 4DA4A 5GAOq 2JS0A 5CKHA 5D6YA 1RI0A 3LYIA 1KC8U 3R6NA 2RD1A 3E9GA 1AOJA 1K73U 4A4HA 4DBHA 2AIRB 3CC4T 3L1AA 4XU3A 2RHXA 1ZLMA 1XTDA 3EFOB 3TEEA 4AFZC 3A8MB 3CCUA 5D6XA 2J7IA 3DB4A 4JJNK 4FYWB 4DOWA 1D3BA 5GAMd 4AMCA 2E12A 4OMPA 1QWFA 1YFNA 1VQNA 5GJWB 4M7DA 3TSZA 3L2RA 3TVTA 2EJ9A 3CCMA 3M0QA 4IUTA 2CS7A 5FROA 1VA7A 1VQ9T 1Z9ZA 3SD4A 3OS0A 2X51A 1YHQT 1IB8A 4C8QE 3OW2A 2KYMA 4PJOC 1PKSA 1TUGB 2EYXA 1DJ7B 4M75E 2P0PA 1VQPQ 1AWJA 3X20B 2OI3A 1TH7A 1N8RR 2AKKA 3OYYA 4X9CA 5GAN7 3VKIA 4JUVA 1TU0B 3RMSA 4J6XA 2M9UA 4NL3A 3E1SA 2QEXA 4ME7A 3JCMJ 1XJWB 3L2QA 4A54A 1M3CA 4EMKC 1VQ8A 1GBRA 3CCLA 1M30A 2OTJQ 5FRMA 2D0QB 4BE1A 1Y07A 3RBBB 1OULA 5GANd 2OTLA 2DRMA 1V29B 1W6XA 1KJWA 5IAYA 2VXEA 1YI2T 2IIMA 2KK4A 1D0ZA 3I55A 3PMIA 2R5AA 3EG0A 3JB9H 4ZTJA 1EIFA 1YITA 4C5IA 2CT3A 3I56T 4XAXB 4PFPA 5EC7A 1NJIR 4C8QC 2MF2A 1WI7A 1Y71A 3MHXA 4QT7A 1WDXA 3ZBDA 3CCQQ 2XMFA 3RUXA 2FPEA 2EGAA 2VASA 2RI5A 2WACA 3X24B 1GXIE 4M77B 4PK4A 4C0DC 3V8JA 1ZBJA 3TREA 2K5LA 4F7UB 2CZ1B 4RTZA 1ZQ1A 3SB2A 4HVVA 5L23A 1PWTA 2YUNA 1UJ0A 1KG1A 4ZGJB 1WIEA 4MZTA 1BBZA 1UHFA 1M2VB 3GNFB 3CCJA 3JB9F 2QK0A 3C94A 3A8LB 2I2LA 1CSKA 1RAHB 3DLMA 4M78E 2EGCA 2H3EB 1JRIA 3JCMg 2P4TA 3EGUA 1YJWT 2KDSA 2PTKA 5CAIA 4ZTFA 4XQ3A 3A8HB 3REBB 1VQKA 1IZ6A 1K1ZA 2EPDA 4CC4B 5GMKj 4XTVA 4BUGA 1UG1A 2LJ1A 3DLLA 3CBOA 2LC4A 3EGDA 3LWHA 3VRYA 1MMGA 4JJBA 4XU2A 1Z9QA 3G6ET 2RA2A 2K3BA 3MP8A 2EVRA 1AZGB 4CC7A 3TQ7P 2J06A 3SWNA 1B7TA 1R0CB 2HCKA 1G3YA 2DAQA 2K6DA 3CD6Q 3H8ZA 5LL6S 4M78C 4OMFB 3EFRA 1K8AU 2DJZA 2X4XA 1BI0A 3CBPA 3VUZA 1PSEA 3OYBA 4XTUA 3VS4A 2HMAA 1D1CA 2YLBA 2NWMA 2ED0A 2MWOA 2CP2A 2PUKB 3FC3A 4LDYA 4BE0A 2L3PA 1PC0A 3PGGA 3PT9A 1D1AA 2ECZA 4RTYA 1AZEA 2NLUA 1ARKA 4J9CA 3INZA 3QZ5B 2W10A 1GCQA 1J3TA 5CVIA 2C0OA 1R77A 1M1KR 3QWXX 5LJ3g 4M77E 4BI8B 1HD3A 2YSQA 1CKBA 2JW4A 3VS0A 4OMLA 3GP8A 1QW1A 1K0XA 1OPLA 4C0ZA 3G1JA 3C0CA 3MP6A 3OW2S 2FRWA 2BUDA 2HSEB 2ENMA 2MOXA 3EG9B 1HK9A 1PCXA 2O9VA 1NJIC 4C0FA 5FW9A 4FW1A 3X25B 2ED1A 4O5VA 1YJWA 4J83A 2KQWA 5KYYA 4OMQA 2RJFA 3CCQA 2KRSA 1JO8A 3V7SA 2A7YA 4A4EA 1IGUA 2ZPBB 3UA7A 1QKWA 2VWFA 2NUPB 3M53A 4FYYB 5EG2A 4M77C 1KC8R 1K73R 6AT1B 4ZNXA 3OYNA 1G3WA 3G6EA 3RKYA 5AYFA 5KYWB 1T0JA 3ASKA 1C6VX 2VUBA 4AT1B 1ZSZC 1PNJA 2KY9A 1M8VA 3OA6A 4KUDK 4EMHA 3EHQA 4P5NA 1I4K1 2RO0A 3FB9A 2JTEA 2PVOB 1VQ5T 3GNGA 4RTWA 2MIOA 1E6HA 4LDWA 1IXDA 2QQAA 1YN8A 1XQHA 4OB0B 2M02A 4RTUA 5IHKA 5GAMh 3CQTA 3OB9A 1ZUUA 4C8QD 2OX7A 3CCET 4AFSC 2ZPGB 4KULA 4LUEA 1D09B 2JZ2A 4LXCA 1G8XA 4M75D 3S3MA 4ORZA 1F1BB 3M4GA 2J6FA 1GBQA 2MK5A 2P0KA 3JSCA 2F2VA 2LCCA 3A8GB 4LUDA 4C92G 3IQLA 2DTHA 1W4SA 1QCFA 5DM7R 3EGXB 1KQ1A 3G71Q 5FU6C 2AZSA 1ZHIA 2JM9A 2CT4A 2KNBB 2O88A 5IHNA 1I5OB 2QGGA 4E7KA 1H641 1NPRA 4JRQA 4NS5A 4D8DA 1ZA1B 2JXBA 4OMMA 1LOJA 5GANh 3OY9A 4X1VA 2VB6A 2LNHB 4LDXA 5GAOp 2BZYA 2XK0A 3UT1A 2X9HA 4ZN1A 5FWCA 1WHLA 3CCST 4E47A 2YXYA 3WVEB 5HK3A 3E2UA 1VUBA 2EW3A 1H92A 4C92D 2XDPA 4PFOA 1VQLT 3CMAT 1GCPA 2B8AA 2QYZA 2JTMA 1WNLA 2DTIA 2HQEA 1G3SA 2F5TX 2P84A 5L8RE 4J7FA 2EGEA 2GNCA 3VRZA 1VYVA 1M1GA 1Q7YU 1X43A 1X69A 2BIVA 1FYNA 1UGRB 1BI2A 4NL2A 5CKEA 2KI7A 2VC8A 4TVRA 2DM1A 3JV3A 3QBYA 2MWPA 1M90U 3CCUT 4QQDA 4DBRA 1AHJB 4LD6A 4BI3A 3OMGA 4FYVB 1VQNT 1I8FA 1S72T 1M3AA 3CCMT 2XHCA 2BE9B 5GMKe 1KD1U 1OU9A 1PD1A 3RESA 3OYGA 5I2SA 3CPWP 4KT0E 1KC8C 2FZCB 4IUQA 2HQHA 2O4XA 1QP2A 2BKDN 4RUGA 1YJ9Q 2KGTA 1AT1B 4Z88A 3PTAA 3VS1A 1X2QA 2OJ2A 2PVDB 3M0RA 2CSIA 4CRIA 1MV3A 4E7IA 4DEYA 1Q81R 3VYGA 5J3BA 1VQ8T 2KRMA 2RM4A 4ZN3A 1UJYA 3H0HA 1WQWA 4EPCA 4HCBA 4A63B 2MAMA 2K79A 2KAFA 1QVGP 2YDLA 2DETA 2OTLT 1IO6A 3QJYA 2FEIA 4F7UG 3QO3A 1NLOC 3I55T 1OU8A 9ATCB 1V76A 3MO8A 2LRQA 3THKA 3L2UA 5LJ3j 1LPLA 3CCSA 1FMWA 1NEBA 1K9MU 5I2MA 3OYEA 4AFQC 1MMNA 2DKGA 1IREB 4HT8A 4E6RA 2LVMA 1I81A 1WJSA 3M4YA 5FLXE 2H3JA 3NTHA 2E3HA 4JLIA 3N5BB 2X3XD 1G3TA 1YCSB 5HK0A 1NYGA 2KT1A 4RMOA 4WF2A 4QVCA 3C12A 3U23A 4KGVB 4M77D 5I11A 3G71A 1MNEA 2A28A 3OS5A 4IURA 1RAIB 4M7AF 1WXUA 1Q82U 1Y7XA 1WHMA 2HKNA 3PIOA 1G5VA 2AK5A 1JQQA 4X9DA 5DY9A 4L59A 3OSSC 1TXQA 1P92A 1VOMA 4IUUA 1N5ZA 4C0GA 4LNPA 2FL7A 3CCJT 4XU0A 3MEWA 1S72A 3JCMd 4HCZA 1UECA 1KFZA 2CSQA 1B34A 3H0IA 3NPFA 3SHWA 1VQOQ 1BIBA 1AD5A 2CGHA 1NPPA 3CCRQ 2CUDA 2FO0A 4QVDA 4M7AA 3A1PA 4Y92A 2E64A 3GLXA 5KYYB 1SRLA 3EAEA 3LX7A 3L2VA 1XNIA 1VQKT 4LDUA 3A8OB 2RHZA 1M4ZA 2MPXC 3EHRA 2RQVA 3L2ZA 2LP5A 1UGVA 1NYFA 1VIFA 3OYLA 3LGFA 4JJDA 1VYUA 4JPBW 4KH1B
chains in the Genus database with same CATH topology
3JCMX 2E70A 1WGSA 3CMET 4BDZA 5GAN8 2KMTA 3MEAA 3SWNA 2YLCA 2DEQA 4N4HA 1G3YA 2DAQA 4BB7A 4J7IA 5A0DA 3H8ZA 2ZGWA 4M7AE 4OB1B 4M78C 5LL6S 3OYHA 2M1HA 3LW5E 4X34A 4OMFB 3EFRA 2DIGA 1K8AU 2DJZA 2X4XA 3OS1A 4PJOF 3HFNA 3P8DA 1BI0A 3CBPA 3ME9A 4FL6A 4XTXA 4RCBA 3VUZA 4D6WA 2HNIA 3VU3C 1PSEA 5D6WA 3JB9I 3OYBA 2WSCE 3QHSA 2EJGA 4XTUA 2JTFA 2LTOA 2Y90A 3URGA 3QJ6A 1JB0E 2AHJB 1U8RA 5GMKh 3JCMP 1YCYA 2YLBA 3MCAB 3JCMW 3L42A 1M5Q1 3FDRA 4UC4A 3SWNB 4F7UA 2MWOA 3PNWC 4OP0A 3TCJA 3V8LA 1KD1C 4E7JA 2PUKB 2WSFE 3FC3A 4LDYA 4BE0A 1VQ7A 3PGGA 3PT9A 3L2WA 3CEYA 2NLUA 2EFIA 4BY6B 4M75C 3JCMQ 4XK8E 3JAME 5DLOA 1N6AA 3INZA 2QI2A 3QZ5B 4XU1A 2E6ZA 3OYIA 2DO3A 3FJPA 4M7DC 2LT4A 2QQ9A 5CVIA 4YTLA 3UPUA 2LDMA 1VQ7T 4C92E 3QPHA 1VQPT 2DD4A 1H3ZA 5LJ3g 3QG1A 3JB9J 3M54A 4M77E 3CPWA 3HKSA 4PJOA 1Q81C 4BI8B 1ZBXA 2L5QA 2GQVA 5LJ3d 3OYDA 2ZPHB 2X4YA 2ZZDA 4DQ2A 3OYMA 2HD0A 1YJ9T 1LNXA 2LQKA 3LLRA 3NTKA 4M7AC 1X6OA 4KUIA 3SFMA 2QTXA 4LDVA 5LJ5g 2E1HA 3GP8A 1QW1A 4C0ZA 1M1FA 3VJPA 4C8QF 2VXFA 3MP6A 2VV5A 4N4IA 5LJ5d 3OW2S 2OTJT 2BUDA 2CZ7B 3V8KA 4A4FA 2DIQA 3ZFJA 2K5IA 5GAN2 4ZGEB 1U1SA 4GLKA 4ELZC 4MMKA 1HK9A 1NJIC 4OB3B 2PU9B 4PLIA 4Q5WA 4A4KA 4C0FA 1N9RA 4EMKA 5GAN3 2GCXA 3M58A 4M78G 3VV0A 2XDDA 4HKEA 2A3LA 3X25B 3UDCA 2YRVA 4IKFA 4O5VA 1WPYA 3M55A 2VGNA 2CKKA 1YJWA 3C4SA 2KQWA 4J83A 3LH0A 4PJOE 2RJDA 1QVFA 2RJFA 3OQ5A 4BE2A 3CCQA 1QVGA 2K57A 3CC2T 3JCMb 3HRUA 3V7SA 4DOVA 1Q86U 2A7YA 4A4EA 2DZ9A 3CC7T 2ZPBB 1K9MC 2F5KA 2XKOC 2QA4T 3NTIA 5GAMj 2RK2A 3RMQA 1FWZA 5KH6A 5IT9E 1VQ6A 3CCQT 3M53A 3OBYA 5GAMe 5I21A 3PIPA 4RG8A 4JRPA 4C92C 2QXFA 3VYHB 2MMPA 2L3RA 4II1A 4HT9A 4C8QA 3S3OA 5EG2A 3JCMe 4M77C 4MMLA 2JUFA 4M78B 4QQ6A 2FVUA 3A5ZB 3FEOA 4C5HA 1G3WA 3M59A 4N0AC 3OYNA 3G6EA 3RKYA 2C06A 1VQ6T 5AYFA 4M7DG 2WSEE 1I5LA 3ASKA 5KE2A 2E10A 2FYKA 2VUBA 2EJFA 1KHCA 3OYFA 1W2BS 1Y96A 5HY6A 4LD9K 3UWNA 3CBMA 1VQ5A 3QZ9B 3QXEB 5CKDA 2KY9A 1M8VA 3CMEA 3OA6A 4M78D 4KUDK 4EMHA 1FX7A 1Q82C 4P5NA 1I4K1 5CKFA 4M7AG 2RO0A 3FB9A 2EWNA 3GPLA 2HQXA 4C8QB 2QQRA 2PVOB 4RG2A 4J6WA 1VQ5T 3GNGA 5FU7C 4JS5A 1JJ2S 4LDWA 2DZCA 5GMKi 5A2QE 1BIAA 3CCEA 3RERA 2F69A 4PL6A 2QQAA 2V8JA 4JLGA 3SDZA 2RHYA 4M75B 3F70A 2DVEA 1XQHA 1NE8A 1YJNA 4OB0B 4ZTJA 1Q86C 1PSFA 4RCCA 4PKCC 1U1TA 3HL8A 5GAMh 5GAN5 1YBYA 3P8BB 3RIRA 3OB9A 4BACA 5C0MA 1Y96B 4O6JA 2M16A 5KE3A 1BI1A 4C8QD 4C5EA 3CCET 2VYTA 1VQOA 2DXBA 2ZPGB 2FB7A 4KULA 3T9NA 1X01A 4C0DB 3QDRB 5GANj 2JZ2A 1YJNT 5DLQE 2V8KA 3R6OA 5GANe 3CCRA 2E41A 4M75D 2DXTA 3S3MA 2EIFA 1HXDA 4CI0C 2D6FA 3M4GA 4KBMB 3WVDB 2RK1A 2YHTA 4J8OA 5GAMf 1VQOT 5GAOn 2XD0A 5M9OA 1VQ4A 2QDYB 3CPFA 3E9FA 1N8RC 2P0KA 3JSCA 3JCMf 3JCMV 3CCRT 2LCCA 3A8GB 4FU6A 3DB3A 4PNOA 5GMKl 2QEXT 3CCVA 4C92G 3CXCS 2DTHA 4MZPA 4HCCA 1W4SA 1VQPA 1M1KU 2LT1A 4M77G 2K3YA 3CCLT 5DM7R 4M78F 4FSXA 4L5GA 1KQ1A 2CZ0B 2O4XB 2E6NA 3WXMB 1VQ4T 5FU6C 4XTYA 3KXTA 1ZHIA 2ZCFB 2X4WA 3CCVT 1YJ9A 3GIBA 1KQSS 3HP9A 3J81E 1QP3A 3OBWA 3VUBA 5CR2A 2DXCA 4E7KA 1H641 4OB2B 1WJRA 2OTJA 1NPRA 1W2BA 1UEBA 3META 4NS5A 2K3XA 4JRQA 3MP1A 5J39A 2OAUA 4VUBA 3QKJA 3G4SA 3HFOA 3OYJA 1YITT 2GF7A 3QIIA 4ZGDB 1OZ3A 1BI3A 5GAOr 4F7UE 5LJ3e 4IUVA 1LOJA 5GANh 3OY9A 1K8AC 2IG0A 2LX9A 4C92B 3CD6T 4LDXA 1UGSB 3V7CA 4Z02A 5GAOp 2RH2A 1M9SA 3MEVA 3OYKA 2XK0A 2XG8D 2X4JA 3UT1A 3G4ST 3S6WA 4ZN1A 3CMAA 4PJOG 3HPWA 1VQLA 4M75F 3E19A 3CCST 3JCMc 4E47A 5LJ5e 3CC2A 5HKCA 3WVEB 4M7DF 4M78A 4J6YA 5CKBA 3CC7A 5HK3A 1VUBA 3G7ZA 3TU4K 4QVZA 4C92D 2XDPA 2QA4A 4J5YA 5GAN6 4FT2A 5GANf 1VQLT 2KVQG 2Y4XA 3CC4A 3CMAT 2B8AA 3FRNA 4DA4A 2JTMA 3SWNC 5GAOq 1WNLA 2DTIA 2HQEA 5CKHA 2XICA 1G3SA 2F5TX 5D6YA 1RI0A 1YIJT 4PLLA 3LYIA 1KC8U 5L8RE 2RD1A 3E9GA 4J7FA 1K73U 4A4HA 3LWIA 2JN0A 1OZ2A 2KSSA 3CC4T 3L1AA 4XU3A 1Q7YU 1M1GA 2LCLA 2RHXA 4BY6C 3V7RA 2RHIA 2BIVA 4B9WA 5GAN4 1UGRB 1XTDA 2XDBA 2PVGB 1BI2A 3TEEA 4NL2A 3A8MB 3DKMA 5CKEA 3CCUA 3OYCA 5D6XA 2VC8A 4ELYC 2X35A 5CQYA 3DB4A 5GAMg 4JJNK 4TVRA 4DOWA 3BFMA 1O75A 4M75A 3X28B 1D3BA 2EQUA 2K4YA 3QBYA 5GAMd 2E12A 2MWPA 3OYAA 2FHDA 1VQNA 4M7DA 1M90U 3ZEHA 3L2RA 1BYMA 2RI3A 4QQGA 3GF5A 2EJ9A 4QQDA 1X75C 2VGMA 3CCUT 1VQ9A 3CCMA 3OMCA 3QYGB 4IUTA 1YHQA 4OGEA 1AHJB 2CS7A 2V8IA 4LD6A 4BI3A 3QSUA 5LJ3f 1WJQA 3OMGA 3RKXA 1VQNT 5KCOA 1I8FA 5CIUA 5FROA 1S72T 2R57A 5GMKm 1VQ9T 3SD4A 3CCMT 3OS0A 4C92F 3GOXA 1YHQT 3J80E 2PQWA 4JRIA 4C8QE 3JB9G 2XHCA 5GMKe 2DTOA 2M0OA 2ZPEB 4M77F 4EDUA 5LJ5f 2Y4YA 3CPWS 5CQXA 3OW2A 1KD1U 2MI6A 4PJOC 2CYZB 3H6ZA 3RESA 1D3BB 1OI1A 3Q1JA 4BD3A 3OYGA 1DJ7B 4JDSA 2JOYA 5FU6B 5I2SA 5GAOl 4M75E 4KT0E 1MGQA 4M7DB 2P0PA 1KC8C 4IUQA 3X20B 1TH7A 3JCMh 4ATOA 2O4XA 3OYYA 2XU8A 3HSBA 2HAXA 3M57A 4X9CA 1Q7YC 5GAN7 1QP2A 2EQMA 1B34B 2BKDN 3VKIA 4JUVA 5J26A 4HA8A 3OS2A 3RMSA 4J6XA 2M9UA 1MHNA 3KUFA 3EFSA 4NL3A 3E1SA 2QEXA 4ME7A 1Q81U 3JCMJ 1BKBA 3M5AA 4M7AB 3PTAA 3L2QA 2K5FA 4A54A 1VQ8A 4EMKC 1JBMA 2PVDB 4M7DD 3CCLA 1R8OB 4XTZA 2JNGA 3OSVA 3QYHB 1YI2A 5FRMA 1VIEA 2D0QB 3HHTB 5GANg 1OYXA 4CRIA 4BE1A 1Y07A 5GANd 4E7IA 1M90C 2OTLA 3VYGA 4FM4B 4GY5A 5J3BA 3BY7A 1V29B 2RM4A 4C92A 1UGQB 4ZN3A 1VQ8T 1QVFS 3I56A 1QVGS 2DXUA 4M7AD 1YI2T 5IAYA 2VXEA 4M77A 2KK4A 3HRTA 1WQWA 1NJIU 4EPCA 3I55A 4HCBA 4OF1A 3PMIA 5FRNA 2MAMA 2LNVA 2R5AA 2KAFA 1UB4A 4N0AA 3JB9H 4L6V5 2QQSA 3BW1A 2OTLT 3QJYA 5IN1A 1QVPA 1EIFA 3JB9D 4FT4A 2LQ8A 4C5IA 4BDYA 4F7UG 1YITA 3I56T 3QO3A 1XOVA 4XAXB 3CD6A 5A0LA 4C8QC 3I55T 2MF2A 1Y71A 2DK3A 4FIBA 4MZMA 3MHXA 2EYQA 3MO8A 3QUIA 2LRQA 2DD5A 2R58A 3L2UA 5LJ3j 3ZBDA 4C5GA 3X26B 3CCSA 3RUXA 4JRKA 2P0QA 3BDLA 1K9MU 5I2MA 3OYEA 5CCAA 3KBGA 4MDXA 2DKGA 1IREB 4HT8A 1KQ2A 2RI5A 2HBPA 2WACA 2LVMA 3X24B 1GXIE 4M77B 1RL2A 1I81A 1JJ2A 1WJSA 5LJ5j 3M4YA 5FLXE 3NFCA 2H3JA 3NTHA 4XTWA 4Y28E 3O8VA 3JRZA 2CZ6B 4JLIA 3N5BB 3V8JA 4C0DC 3TREA 1O9SA 2XI9A 2XIDA 3BDUA 1YIJA 2K5LA 1G3TA 5HK0A 4F7UB 4RMOA 2CZ1B 2O01E 1N27A 1KHIA 3MEUA 4OGCA 4WF2A 4QVCA 1ZQ1A 3C12A 3SB2A 4M77D 1SSFA 2RHUA 3RKWA 3M9QA 2EQKA 3G71A 2GFAA 1M1KC 3OS5A 2EKOA 2EQJA 4IURA 4M7AF 4MDWA 4IUPA 1KG1A 2ZPFB 2E5QA 4ZGJB 4MZTA 4E7LA 1Q82U 2E65A 1Y7XA 2K2VA 5FU7B 4A53A 3J7AF 3GNFB 3CCJA 3JB9F 3PIOA 1G5VA 3G71T 4EMGA 4X9DA 5CO7A 5DY9A 4L59A 4PJOB 1VQMA 3OSSC 1P92A 3C94A 2PUOB 4R55A 2RJEA 3A8LB 3CXCA 4A4GA 5LJ3h 5GAOm 4IUUA 4JS4A 2RJCA 2I2LA 4C0GA 3DLMA 4M78E 1UGPB 4R56A 2FL7A 3CCJT 4XU0A 2IVWA 1JRIA 3JCMg 2P4TA 1VQMT 3ER0A 2EAYA 3MEWA 1S72A 1YJWT 3JCMd 1LJOA 1KQSA 5LJ5h 4HCZA 2KDSA 4PJOD 3PMTA 4OVAA 4V2SA 3FIFA 5KCHA 4C8QG 1B34A 4EMKB 5CAIA 1BIBA 5CK9A 4ZTFA 2CGHA 4XQ3A 2D9TA 5A0GA 1NPPA 2QQBA 3A8HB 4N4GA 4E7HA 3S3NA 3FLGA 1VQKA 4B9XA 1NZ9A 2RB6A 4QVDA 4M7AA 1IZ6A 2R5MA 2RI2A 2G3RA 3M56A 2E64A 4M75G 2JVVA 4NOYA 4BI4A 3GLXA 5GMKj 2L89A 3EAEA 4XTVA 4BUGA 1N8RU 3AHUA 3DLLA 3CBOA 2LC4A 3LWHA 3LX7A 1FXXA 4QW2A 3L2VA 1N9SA 1XNIA 3HRSA 1VQKT 3LGLA 4XU2A 2DPPB 3G6ET 2RA2A 4LDUA 3MP8A 3A8OB 2RHZA 1M4ZA 4RKUE 1K73C 3L2ZA 4F7UF 4M7DE 4Y91A 3OYLA 1VIFA 2ZPIB 5C6SA 3LGFA 3P8HA 1WQ7A 3PFSA 3C95A 2GFUA 2L8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MML A;  3JCM X;  3JB9 D;  4M7D F;  4M78 B;  4M78 A;  4J6Y A;  4F7U G;  5GAN 8;  3QO3 A;  3SWN A;  4N0A C;  2YLC A;  2DEQ A;  3RKY A;  4C92 D;  4J5Y A;  4C8Q C;  5GAN 6;  5GAN f;  2ZGW A;  4M7A E;  4M78 C;  4M7D G;  1I5L A;  3QUI A;  2E10 A;  2FYK A;  3SWN C;  5GAO q;  2EJF A;  3EFR A;  5LJ3 j;  1WNL A;  2DTI A;  3RUX A;  4JRK A;  1Y96 A;  2DJZ A;  4PJO F;  3HFN A;  1M8V A;  2DKG A;  2RD1 A;  4XTX A;  4HT8 A;  4M78 D;  4RCB A;  1KQ2 A;  2JN0 A;  2HNI A;  3VU3 C;  4EMH A;  3JB9 I;  3L1A A;  4M77 B;  3QHS A;  2EJG A;  4XTU A;  2Y90 A;  4XU3 A;  4HT9 A;  3V7R A;  1I81 A;  1I4K 1;  4M7A G;  5LJ5 j;  5GAN 4;  3FB9 A;  2EWN A;  4XTW A;  5GMK h;  4JLI A;  3V8J A;  1YCY A;  2YLB A;  4C8Q B;  4J6W A;  3JCM P;  4NL2 A;  3JB9 H;  3JCM W;  3BDU A;  1M5Q 1;  2DZC A;  5GMK i;  1BIA A;  2VC8 A;  3SWN B;  4F7U B;  4F7U A;  5GAM g;  3RER A;  4OP0 A;  3V8L A;  3BFM A;  4M75 B;  2DVE A;  4M75 A;  4WF2 A;  4QVC A;  1D3B A;  5GAM d;  3SB2 A;  4M77 D;  3RKW A;  3PGG A;  4RCC A;  1U1T A;  5GAM h;  5GAN 5;  4M7D A;  3RIR A;  1Y96 B;  2EJ9 A;  4M75 C;  3JCM Q;  4M7A F;  4C8Q D;  3INZ A;  4XU1 A;  2FB7 A;  3FJP A;  4M7D C;  1X01 A;  5GAN j;  2E65 A;  3QSU A;  5LJ3 f;  4C92 E;  4A53 A;  3RKX A;  5GAN e;  2E41 A;  3JB9 F;  1I8F A;  4M75 D;  5LJ3 g;  2DXT A;  3JB9 J;  4EMG A;  4M77 E;  4X9D A;  1HXD A;  5DY9 A;  4PJO B;  4PJO A;  5GMK m;  3M4G A;  5LJ3 d;  4C92 F;  2YHT A;  5GAM f;  4DQ2 A;  5GAO n;  5LJ3 h;  5GAO m;  4JRI A;  4C8Q E;  3JB9 G;  1LNX A;  5GMK e;  2DTO A;  2I2L A;  4M77 F;  5LJ5 f;  4M7A C;  4PJO C;  3JCM f;  4M78 E;  3JCM V;  2QTX A;  5GMK l;  4PNO A;  4XU0 A;  3RES A;  1D3B B;  2E1H A;  5LJ5 g;  4C92 G;  1JRI A;  2DTH A;  3JCM g;  4C8Q F;  5GAO l;  2VXF A;  4M75 E;  2EAY A;  1MGQ A;  5LJ5 d;  4M77 G;  4M7D B;  3V8K A;  3JCM d;  1LJO A;  4M78 F;  5LJ5 h;  1KQ1 A;  1TH7 A;  4PJO D;  3JCM h;  5GAN 2;  4V2S A;  1U1S A;  3FIF A;  3HSB A;  4X9C A;  4MMK A;  1HK9 A;  4XTY A;  5GAN 7;  4C8Q G;  3GIB A;  1B34 B;  1B34 A;  4JUV A;  5GAN 3;  4HA8 A;  4EMK B;  1BIB A;  4EMK A;  1N9R A;  4J6X A;  5CAI A;  4M78 G;  2CGH A;  4XQ3 A;  3EFS A;  4NL3 A;  3JCM J;  4M7A B;  2RB6 A;  4QVD A;  4M7A A;  4M75 G;  1WPY A;  1H64 1;  4A54 A;  2E64 A;  4EMK C;  1JBM A;  4NOY A;  4M7D D;  5GMK j;  4XTZ A;  4XTV A;  4PJO E;  5GAN g;  3AHU A;  3HFO A;  2K57 A;  3JCM b;  3V7S A;  5GAN d;  5GAO r;  1N9S A;  2DZ9 A;  4F7U E;  5LJ3 e;  4XU2 A;  1LOJ A;  5GAN h;  3BY7 A;  2RM4 A;  4C92 B;  4C92 A;  2RA2 A;  3V7C A;  5GAO p;  2DXU A;  5GAM j;  4M7A D;  2VXE A;  4M77 A;  1WQW A;  3L2Z A;  4F7U F;  4M7D E;  4Y91 A;  5GAM e;  5I21 A;  4PJO G;  4M75 F;  4C92 C;  1WQ7 A;  3JCM c;  4N0A A;  5LJ5 e;  4C8Q A;  3BW1 A;  3JCM e;  4M77 C; 
#chains in the Genus database with same CATH topology
 3JCM X;  1WGS A;  3MEA A;  4BB7 A;  2B86 A;  3PVL A;  3LW5 E;  4X34 A;  2DIG A;  3G4S Q;  2NUZ A;  4PJO F;  1CKA A;  2DBM A;  4D6W A;  1ZA2 B;  2WSC E;  3QHS A;  2JTF A;  2KRO A;  2HDA A;  2Y90 A;  5GMK h;  3JCM P;  1YCY A;  2DF6 A;  2F1L A;  3FDR A;  4RTT A;  1YIJ Q;  2NUT A;  1WZO A;  2JMA A;  1C0M A;  4J9G A;  2LQN A;  4BY6 B;  4M75 C;  4ESR A;  3JCM Q;  4XK8 E;  3JAM E;  5DLO A;  4XU1 A;  2QI2 A;  1AVZ C;  3FJP A;  3UPU A;  1D0Y A;  4C92 E;  4PJL A;  1VQP T;  2PNI A;  1H3Z A;  3KFV A;  3CPW A;  3HKS A;  4PJO A;  1Q81 C;  3RDV A;  2O31 A;  2KBT A;  5LJ3 d;  3OYD A;  2X4Y A;  1GRI A;  4DQ2 A;  2HD0 A;  2LX7 A;  1BK2 A;  1KIK A;  3LLR A;  2GBQ A;  1X6O A;  4R0K A;  1K9A A;  2QTX A;  5LJ5 g;  4WTO B;  1M1F A;  4C8Q F;  4N4I A;  2OTJ T;  2K5I A;  5GAN 2;  4ZGE B;  4GLK A;  1A0N B;  2PU9 B;  3NMZ C;  4EMK A;  5GAN 3;  3M58 A;  4HKE A;  3VS6 A;  3UDC A;  1WPY A;  2CKK A;  4HCK A;  2DEU A;  2RJD A;  1QVF A;  3OQ5 A;  4BE2 A;  1QVG A;  2K57 A;  2CUB A;  1TUD A;  3JCM b;  4DOV A;  2DZ9 A;  3VS5 A;  2L2P A;  2DMO A;  2YWW A;  5KH6 A;  5IT9 E;  3CCQ T;  5GAM e;  5I21 A;  3PIP A;  4RG8 A;  4JRP A;  4C92 C;  2QXF A;  2L3R A;  4C8Q A;  3JCM e;  4K11 A;  3A5Z B;  1Q7Y R;  4N0A C;  4OMO A;  3H41 A;  4M7D G;  1I5L A;  2E10 A;  1W2B S;  5HY6 A;  1RAE B;  3QXE B;  4CC2 A;  4M7A G;  1M90 R;  2EWN A;  2HQX A;  1GCQ C;  2QQR A;  2RQR A;  4J6W A;  2RQU A;  1WXT A;  1SKU B;  5GMK i;  1G83 A;  4PL6 A;  2DL8 A;  4JLG A;  3SDZ A;  2M0Y A;  2RHY A;  4AFU C;  4RCC A;  3HL8 A;  2DRK A;  1Y96 B;  2DL5 A;  2ZAE A;  5KE3 A;  1OEB A;  4C5E A;  2RMO A;  1KD1 R;  2VYT A;  2FRY A;  2DXB A;  1VQO A;  3T9N A;  3QDR B;  1M27 C;  5DLQ E;  3R6O A;  5GAN e;  3CCR A;  2A08 A;  3WVD B;  5GAM f;  1LCK A;  2J6O A;  1X2K A;  2QDY B;  3CPF A;  1N8R C;  3JCM f;  3JCM V;  5GMK l;  4FU6 A;  3DB3 A;  4HXJ A;  4PNO A;  2YUQ A;  2GTO A;  8ATC B;  4MZP A;  1VQP A;  1M3B A;  2K3Y A;  2ROT A;  4FSX A;  4M78 F;  1OQK A;  2CZ0 B;  2O4X B;  2E6N A;  3CXC P;  1SG5 A;  2DVJ A;  1M2O A;  2ZCF B;  5FWB A;  5CR2 A;  2OTJ A;  4LE9 A;  1VQM Q;  1UEB A;  3MET A;  1TOV A;  2CP0 A;  5J39 A;  3G4S A;  2KRN A;  3OYJ A;  1ZX6 A;  5GAO r;  2YRC A;  3M0U A;  4F7U E;  5LJ3 e;  1WHH A;  4IUV A;  3CD6 T;  2LJ0 A;  1UGS B;  2JJ9 A;  1JU5 C;  3LH5 A;  3HPW A;  4PJO G;  3EFO A;  1K9M R;  1H3H A;  1NM7 A;  5HKC A;  4M78 A;  4J6Y A;  3D7S B;  2IPO B;  1JEG A;  1I0C A;  3QWY A;  2MCN A;  3TU4 K;  4QVZ A;  1IGQ A;  3I35 A;  5GAN f;  3FRN A;  4Z8A A;  1TUC A;  2SRC A;  5AT1 B;  1D1B A;  4PLL A;  1OV3 A;  3LWI A;  2JN0 A;  3CME Q;  4BY6 C;  2LCL A;  1NEG A;  2CH4 A;  1WHK A;  4B9W A;  4J9B A;  1UHC A;  2JS2 A;  1E6G A;  3DKM A;  4M4Z A;  4D8K A;  3I5R A;  1Q82 R;  3BE3 A;  3BFM A;  3X28 B;  2EQU A;  3OYA A;  2FHD A;  7AT1 B;  3ZEH A;  1BYM A;  4QQG A;  3GF5 A;  2VGM A;  3OMC A;  3QYG B;  1NBE B;  3ULR B;  2DX1 A;  3HTR A;  3QSU A;  5KYU A;  5LJ3 f;  5KCO A;  2CDT A;  3GOX A;  2PQW A;  4JRI A;  3JB9 G;  2M0O A;  4M77 F;  2ZPE B;  4EDU A;  3CPW S;  2Y4Y A;  2MI6 A;  2CYZ B;  4BD3 A;  1D3B B;  1OI1 A;  2VVK A;  4JDS A;  5GAO l;  2HBW A;  1VQ7 Q;  4M7D B;  1MGQ A;  1OOT A;  2ATC B;  3JCM h;  3M57 A;  1ABQ A;  1Q7Y C;  1QCN A;  1B34 B;  3OS2 A;  4HA8 A;  1MHN A;  3KUF A;  2OAW A;  2EYY A;  1QLY A;  1BKB A;  4M7A B;  5I22 A;  3QDF A;  3FJ5 A;  1R8O B;  2JNG A;  3MPU B;  2O9S A;  3HHT B;  1OYX A;  1M90 C;  4OMN A;  1QVF S;  3BY7 A;  2DBK A;  1UGQ B;  1QVG S;  1PRM C;  4FCY A;  2DXU A;  4M77 A;  1NJI U;  2AT1 B;  5FRN A;  3BW1 A;  2D1X A;  3JB9 D;  1QVP A;  4FT4 A;  4J9I A;  3CC2 Q;  1XOV A;  1KSW A;  3CD6 A;  1E7O A;  3CC7 Q;  2QG9 B;  4MZM A;  2QA4 Q;  5KYN A;  1X6B A;  1ZSZ A;  2EYQ A;  1BCO A;  2CH4 W;  4C5G A;  3X26 B;  5IH2 A;  1YNZ A;  1IRX A;  1PHT A;  1KQ2 A;  2HBP A;  1RL2 A;  5LJ5 j;  4J9F A;  3NFC A;  1VQ6 Q;  4Y28 E;  2CZ6 B;  2H8H A;  1YWP A;  2XID A;  4J9E A;  2D8J A;  1EX4 A;  1WHJ A;  2O01 E;  2AZV A;  1KHI A;  3MEU A;  1B3Q A;  1BU1 A;  1SSF A;  2RHU A;  2EQK A;  4LN2 A;  1OPK A;  2GFA A;  1M1K C;  2EKO A;  2LQW A;  2EQJ A;  4MDW A;  2ZPF B;  1WYX A;  2KXC A;  3OW2 P;  2ABL A;  2DL4 A;  4E7L A;  2K2V A;  5FU7 B;  3J7A F;  4DEX A;  2D0N A;  3SEM A;  3G71 T;  2PZ1 A;  3UAT A;  5CO7 A;  4PJO B;  1VQM A;  2PUO B;  4R55 A;  1Q95 G;  4A4G A;  3CXC A;  5LJ3 h;  4JS4 A;  2KXD A;  2RJC A;  1SSH A;  4R56 A;  1UGP B;  2EYW A;  2IVW A;  1YJN Q;  1LJO A;  1GFD A;  3FIF A;  1Y57 A;  4EMK B;  2CP5 A;  2D9T A;  5A0G A;  2QQB A;  2K7A A;  4N4G A;  1OX8 A;  2L3Q A;  2QEX Q;  1NZ9 A;  2RB6 A;  3PVQ A;  4BI4 A;  2RI2 A;  3M56 A;  1TWB A;  2JVV A;  2L89 A;  3CCL Q;  3AHU A;  5HCK A;  2KT8 A;  1VQ4 Q;  1FXX A;  4JJC A;  3CCV Q;  3LGL A;  1TTH B;  2COW A;  4RKU E;  1K73 C;  4M7D E;  5C6S A;  3P8H A;  2BZ8 A;  3C95 A;  3J80 E;  2L8D A;  3OYF A;  2E70 A;  2COZ A;  4BDZ A;  1YIT Q;  2RNA A;  2DYI A;  1UTI A;  2ROL A;  1QCO A;  3O5Z A;  4N4H A;  1ZUK A;  3RR6 A;  5A0D A;  2ZGW A;  4M7A E;  3OYH A;  1MV0 B;  1WXB A;  2M1H A;  3EGD B;  1SPK A;  3OS1 A;  3HFN A;  3P8D A;  3ME9 A;  2A0F B;  4FL6 A;  4RCB A;  5ECA A;  3VU3 C;  1EZZ B;  5D6W A;  3JB9 I;  3URG A;  2CP7 A;  5GJV B;  2AHJ B;  1K8A R;  2X3W D;  3L42 A;  3SWN B;  2RN8 A;  3TCJ A;  2LZ6 B;  1MUZ A;  1VQ7 A;  1TG0 A;  3CC4 Q;  5IHI A;  2RQT A;  2E6Z A;  3EG9 A;  3OYI A;  2DO3 A;  4M7D C;  1PG5 B;  2QQ9 A;  2DLP A;  3QPH A;  2E4H A;  2DD4 A;  3QG1 A;  3JB9 J;  3M54 A;  2DIL A;  2L5Q A;  2LCS A;  2ZZD A;  3OYM A;  1YJ9 T;  1LNX A;  4M7A C;  4KUI A;  1S1N A;  2O2O A;  3UF4 A;  4LDV A;  1WHG A;  3VJP A;  1RUW A;  2VV5 A;  5LJ5 d;  4FSS A;  1U1S A;  1VQ9 Q;  4MMK A;  4OB3 B;  1YHQ Q;  2GCX A;  2XDD A;  1AWW A;  4IKF A;  2VGN A;  3C4S A;  4PJO E;  3HRU A;  1Q86 U;  2V26 A;  4RTX A;  2F5K A;  2XKO C;  5KYX A;  2RK2 A;  1FWZ A;  3VS3 A;  1VQ6 A;  1JXM A;  2MMP A;  4II1 A;  4MML A;  2AKL A;  4J9D A;  4M78 B;  4QQ6 A;  4AG2 C;  2FVU A;  4C5H A;  3M59 A;  2C06 A;  2WSE E;  3RNJ A;  2FYK A;  1YI2 Q;  2EJF A;  2SEM A;  2E5K A;  4JZ4 A;  3UWN A;  3CBM A;  4E2F B;  5CKD A;  1K76 A;  1PM3 A;  3H9N A;  3I56 Q;  5CKF A;  3GPL A;  1UUE A;  4RG2 A;  5FU7 C;  2DZC A;  5A2Q E;  1BIA A;  2QDL A;  2HEQ A;  3F70 A;  4Z89 A;  1NE8 A;  1YJN A;  1JJ2 P;  1RAD B;  1U1T A;  5GAN 5;  3RIR A;  1SF9 A;  3EGX A;  2M16 A;  1SEM A;  4AG1 C;  5KYU B;  2V8K A;  2QGF B;  2V1Q A;  2V1R A;  2DXT A;  1HXD A;  2DFU A;  1NG2 A;  2D6F A;  4IIM A;  3EH1 A;  2YHT A;  1VQO T;  5GAO n;  1U5S A;  5M9O A;  1VQ4 A;  4E7Z A;  4ANJ A;  1AEY A;  3CCR T;  3CCV A;  3CXC S;  2F2X A;  4HCC A;  2LT1 A;  4L5G A;  5D7U A;  2DA9 A;  3WXM B;  4XTY A;  3KXT A;  1YJ9 A;  1Y0M A;  1RI9 A;  1WA7 A;  1QP3 A;  3OBW A;  1BB9 A;  1X6G A;  1KQS P;  2HL3 A;  1YJW Q;  3MP1 A;  2OAU A;  4VUB A;  3QKJ A;  2DE0 X;  1YWO A;  2GF7 A;  1BI3 A;  1K8A C;  2IG0 A;  2LX9 A;  3VS2 A;  3V7C A;  2RH2 A;  1M9S A;  3OYK A;  2XG8 D;  2X4J A;  3G4S T;  4F04 B;  4M75 F;  5LJ5 e;  3NHN A;  4F14 A;  2FZG B;  1RAB B;  2RF0 A;  3G7Z A;  1RAC B;  4J5Y A;  2HZY A;  4FT2 A;  3G6E Q;  2KVQ G;  2Y4X A;  3CC4 A;  1ZSZ B;  3SWN C;  1V1C A;  2XIC A;  1YIJ T;  2KEA A;  1YP5 A;  2W0Z A;  4F17 A;  2COY A;  1OZ2 A;  2KSS A;  1RAG B;  2Z0W A;  3I5S A;  3V7R A;  2RHI A;  3PE0 A;  5GAN 4;  2XDB A;  2D8H A;  2PVG B;  1VYT A;  3OYC A;  3EH2 A;  2FZK B;  4ELY C;  2A36 A;  2X35 A;  5CQY A;  5GAM g;  1O75 A;  4M75 A;  2K4Y A;  2F2W A;  2RQW A;  2RI3 A;  1VQ9 A;  1X75 C;  2KE9 A;  1YHQ A;  4OGE A;  1FMV A;  2DYB A;  2V8I A;  2E3I A;  1WJQ A;  3RKX A;  1U06 A;  2QAZ A;  5CIU A;  2R57 A;  5GMK m;  1RAF B;  4C92 F;  1W70 A;  4PJM A;  2DTO A;  5LJ5 f;  5CQX A;  3H6Z A;  3Q1J A;  3REA B;  5FU6 B;  2JOY A;  4DBQ A;  1PD0 A;  1SRM A;  4ATO A;  2XU8 A;  3EG3 A;  2HAX A;  3HSB A;  4KGZ B;  1TSF A;  2EQM A;  2CP3 A;  4GLM A;  5J26 A;  4HVW A;  3EFS A;  1Q81 U;  3M5A A;  2K5F A;  1JBM A;  4M7D D;  2DL7 A;  4XTZ A;  1YI2 A;  4WCI A;  3OSV A;  3QYH B;  1VIE A;  1UE9 A;  5GAN g;  4FM4 B;  1QWE A;  4GY5 A;  4C92 A;  3I56 A;  4M7A D;  3HRT A;  2EBP A;  1MND A;  4OF1 A;  1IHV A;  3TSW A;  2LNV A;  4DBF A;  1UB4 A;  4N0A A;  4L6V 5;  2QQS A;  5IN1 A;  2QTV A;  2LQ8 A;  4BDY A;  2JMC A;  5A0L A;  1H8K A;  1C1A A;  2DK3 A;  4FIB A;  2GTJ A;  1FMK A;  2L0A A;  3QUI A;  2DD5 A;  2R58 A;  4JRK A;  2P0Q A;  3BDL A;  5CCA A;  3KBG A;  4MDX A;  2YUO A;  1EFN A;  2YRD A;  1JJ2 A;  4JZ3 A;  4XTW A;  3O8V A;  3JRZ A;  2BZX A;  3MJX A;  1ABO A;  1AWO A;  1O9S A;  2XI9 A;  3BDU A;  1YIJ A;  2K9G A;  4PJN A;  4F16 A;  1N27 A;  4OGC A;  3RKW A;  3M9Q A;  1QKX A;  1K0S A;  2G6F X;  4IUP A;  1MMA A;  1VQ5 Q;  2I0N A;  2E5Q A;  2E65 A;  2L3S A;  1KK7 A;  4A53 A;  1JXO A;  1WX6 A;  4EMG A;  2EYZ A;  2RJE A;  5GAO m;  1HSQ A;  3CCE Q;  2EKH A;  1QMC A;  1VQM T;  3ER0 A;  2EAY A;  1I07 A;  1KQS A;  5LJ5 h;  4PJO D;  3PMT A;  4OVA A;  4V2S A;  5KCH A;  4C8Q G;  1Q86 R;  5CK9 A;  4E7H A;  3FLG A;  4B9X A;  4M75 G;  2G3R A;  2R5M A;  1K4U S;  4NOY A;  1N8R U;  1ZSG A;  2C0I A;  4QW2 A;  1N9S A;  3HRS A;  1QQJ A;  2DPP B;  5KYX B;  1W2B P;  4F7U F;  4Y91 A;  2ZPI B;  1ZUY A;  1WQ7 A;  3PFS A;  2GFU A;  2FPF A;  2MYS A;  3A98 A;  3CME T;  5GAN 8;  2KMT A;  2K2M A;  1UFF A;  1T0H A;  2YLC A;  2DEQ A;  2LMJ A;  1B07 A;  4J7I A;  4OB1 B;  5IXF A;  3GBQ A;  1T3S A;  1WLP B;  3CCS Q;  2CP6 A;  4XTX A;  2A37 A;  1TS9 A;  2HNI A;  2EJG A;  2LTO A;  4IIO A;  3QJ6 A;  1JB0 E;  1VQL Q;  1U8R A;  3CMA Q;  1SHF A;  4QKU A;  3MCA B;  3JCM W;  1BCM A;  1M5Q 1;  4UC4 A;  4F7U A;  3PNW C;  4OP0 A;  3V8L A;  1UDL A;  2HKQ B;  1KD1 C;  4E7J A;  2WSF E;  4KH0 B;  2JM8 A;  3L2W A;  2M51 A;  3CEY A;  8AT1 B;  2EFI A;  3NGP A;  4GBQ A;  1N6A A;  1M8M A;  2LT4 A;  4YTL A;  2LDM A;  1VQ7 T;  1M2V A;  2FPD A;  3I9Q A;  4KRT A;  1ZBX A;  2GQV A;  2ZPH B;  3EG1 A;  1RLP C;  3CCU Q;  2LQK A;  3NTK A;  2NUT B;  3SFM A;  2E1H A;  2LJ3 A;  3AT1 B;  2VXF A;  4FW2 A;  4J9H A;  1PRL C;  1VQN Q;  2CZ7 B;  3V8K A;  4A4F A;  2DIQ A;  1S72 Q;  3ZFJ A;  1WFW A;  4ELZ C;  2J05 A;  2YT6 A;  3CCM Q;  4PLI A;  4Q5W A;  4A4K A;  1N9R A;  1RAA B;  4M78 G;  3VV0 A;  2DER A;  2RPN A;  3M0S A;  2A3L A;  2C0T A;  2YRV A;  3M55 A;  4E7S A;  5IXB A;  3LH0 A;  1R0B G;  3CC2 T;  3VS7 A;  3CC7 T;  2KYB A;  1T3L A;  1K9M C;  2QA4 T;  4EIK A;  3NTI A;  5GAM j;  3RMQ A;  3EG2 A;  3OBY A;  3VYH B;  1GL5 A;  4FYX B;  4HT9 A;  3S3O A;  1U3O A;  2JUF A;  3ZL7 C;  2QAS A;  3FEO A;  1SHG A;  1VQ6 T;  1VQ8 Q;  3M0T A;  5KE2 A;  1KHC A;  2GQI A;  1Y96 A;  4LD9 K;  1VQ5 A;  3QZ9 B;  1G2B A;  4PFZ A;  2OTL Q;  3CME A;  4M78 D;  2HL5 C;  3M0P A;  2NYS A;  2P4R A;  1FX7 A;  1Q82 C;  3I55 Q;  4C8Q B;  4JS5 A;  1JJ2 S;  1LVK A;  3CCE A;  1X27 A;  2DJQ A;  2F69 A;  3RER A;  2V8J A;  4M75 B;  2DVE A;  1MMD A;  2CRE A;  1Q86 C;  1PSF A;  4PKC C;  1YBY A;  3P8B B;  4BAC A;  5C0M A;  4O6J A;  1BI1 A;  3H0F A;  1GFC A;  2BE7 D;  2FB7 A;  4C0D B;  1X01 A;  5GAN j;  2KR3 A;  1YJN T;  2E41 A;  2EIF A;  4CI0 C;  1NLP C;  4KBM B;  2RK1 A;  1OX9 A;  4J8O A;  2XD0 A;  1W1F A;  3MKD A;  3E9F A;  2FG0 A;  3S3N A;  2QEX T;  1M1K U;  4M77 G;  4KGX B;  3CCL T;  4HVU A;  1VQ4 T;  1PKT A;  2J6K A;  1QVF P;  3GIB A;  2X4W A;  3CCV T;  1IHW A;  2BTT A;  2DNU A;  1KQS S;  1HJD A;  3HP9 A;  2HSP A;  3J81 E;  2DL3 A;  3VUB A;  4B6M A;  3CCJ Q;  2DXC A;  1RLQ C;  4OB2 B;  1WJR A;  1W2B A;  2JT4 A;  2K3X A;  3UA6 A;  3HFO A;  1D0X A;  2EQI A;  1YIT T;  1AWX A;  3QII A;  1OZ3 A;  4ZGD B;  1I1J A;  4C92 B;  4CC3 A;  4Z02 A;  3MEV A;  2NUP A;  1VQL A;  1ACM B;  3S6W A;  3CMA A;  4RTV A;  3E19 A;  2ESW A;  3JCM c;  1HYO A;  2VKN A;  3CC2 A;  4PJJ A;  4M7D F;  5CKB A;  3CC7 A;  2YUP A;  1VQK Q;  2GGR A;  2QA4 A;  5GAN 6;  5KYW A;  4DA4 A;  5GAO q;  2JS0 A;  5CKH A;  5D6Y A;  1RI0 A;  3LYI A;  1KC8 U;  3R6N A;  2RD1 A;  3E9G A;  1AOJ A;  1K73 U;  4A4H A;  4DBH A;  2AIR B;  3CC4 T;  3L1A A;  4XU3 A;  2RHX A;  1ZLM A;  1XTD A;  3EFO B;  3TEE A;  4AFZ C;  3A8M B;  3CCU A;  5D6X A;  2J7I A;  3DB4 A;  4JJN K;  4FYW B;  4DOW A;  1D3B A;  5GAM d;  4AMC A;  2E12 A;  4OMP A;  1QWF A;  1YFN A;  1VQN A;  5GJW B;  4M7D A;  3TSZ A;  3L2R A;  3TVT A;  2EJ9 A;  3CCM A;  3M0Q A;  4IUT A;  2CS7 A;  5FRO A;  1VA7 A;  1VQ9 T;  1Z9Z A;  3SD4 A;  3OS0 A;  2X51 A;  1YHQ T;  1IB8 A;  4C8Q E;  3OW2 A;  2KYM A;  4PJO C;  1PKS A;  1TUG B;  2EYX A;  1DJ7 B;  4M75 E;  2P0P A;  1VQP Q;  1AWJ A;  3X20 B;  2OI3 A;  1TH7 A;  1N8R R;  2AKK A;  3OYY A;  4X9C A;  5GAN 7;  3VKI A;  4JUV A;  1TU0 B;  3RMS A;  4J6X A;  2M9U A;  4NL3 A;  3E1S A;  2QEX A;  4ME7 A;  3JCM J;  1XJW B;  3L2Q A;  4A54 A;  1M3C A;  4EMK C;  1VQ8 A;  1GBR A;  3CCL A;  1M30 A;  2OTJ Q;  5FRM A;  2D0Q B;  4BE1 A;  1Y07 A;  3RBB B;  1OUL A;  5GAN d;  2OTL A;  2DRM A;  1V29 B;  1W6X A;  1KJW A;  5IAY A;  2VXE A;  1YI2 T;  2IIM A;  2KK4 A;  1D0Z A;  3I55 A;  3PMI A;  2R5A A;  3EG0 A;  3JB9 H;  4ZTJ A;  1EIF A;  1YIT A;  4C5I A;  2CT3 A;  3I56 T;  4XAX B;  4PFP A;  5EC7 A;  1NJI R;  4C8Q C;  2MF2 A;  1WI7 A;  1Y71 A;  3MHX A;  4QT7 A;  1WDX A;  3ZBD A;  3CCQ Q;  2XMF A;  3RUX A;  2FPE A;  2EGA A;  2VAS A;  2RI5 A;  2WAC A;  3X24 B;  1GXI E;  4M77 B;  4PK4 A;  4C0D C;  3V8J A;  1ZBJ A;  3TRE A;  2K5L A;  4F7U B;  2CZ1 B;  4RTZ A;  1ZQ1 A;  3SB2 A;  4HVV A;  5L23 A;  1PWT A;  2YUN A;  1UJ0 A;  1KG1 A;  4ZGJ B;  1WIE A;  4MZT A;  1BBZ A;  1UHF A;  1M2V B;  3GNF B;  3CCJ A;  3JB9 F;  2QK0 A;  3C94 A;  3A8L B;  2I2L A;  1CSK A;  1RAH B;  3DLM A;  4M78 E;  2EGC A;  2H3E B;  1JRI A;  3JCM g;  2P4T A;  3EGU A;  1YJW T;  2KDS A;  2PTK A;  5CAI A;  4ZTF A;  4XQ3 A;  3A8H B;  3REB B;  1VQK A;  1IZ6 A;  1K1Z A;  2EPD A;  4CC4 B;  5GMK j;  4XTV A;  4BUG A;  1UG1 A;  2LJ1 A;  3DLL A;  3CBO A;  2LC4 A;  3EGD A;  3LWH A;  3VRY A;  1MMG A;  4JJB A;  4XU2 A;  1Z9Q A;  3G6E T;  2RA2 A;  2K3B A;  3MP8 A;  2EVR A;  1AZG B;  4CC7 A;  3TQ7 P;  2J06 A;  3SWN A;  1B7T A;  1R0C B;  2HCK A;  1G3Y A;  2DAQ A;  2K6D A;  3CD6 Q;  3H8Z A;  5LL6 S;  4M78 C;  4OMF B;  3EFR A;  1K8A U;  2DJZ A;  2X4X A;  1BI0 A;  3CBP A;  3VUZ A;  1PSE A;  3OYB A;  4XTU A;  3VS4 A;  2HMA A;  1D1C A;  2YLB A;  2NWM A;  2ED0 A;  2MWO A;  2CP2 A;  2PUK B;  3FC3 A;  4LDY A;  4BE0 A;  2L3P A;  1PC0 A;  3PGG A;  3PT9 A;  1D1A A;  2ECZ A;  4RTY A;  1AZE A;  2NLU A;  1ARK A;  4J9C A;  3INZ A;  3QZ5 B;  2W10 A;  1GCQ A;  1J3T A;  5CVI A;  2C0O A;  1R77 A;  1M1K R;  3QWX X;  5LJ3 g;  4M77 E;  4BI8 B;  1HD3 A;  2YSQ A;  1CKB A;  2JW4 A;  3VS0 A;  4OML A;  3GP8 A;  1QW1 A;  1K0X A;  1OPL A;  4C0Z A;  3G1J A;  3C0C A;  3MP6 A;  3OW2 S;  2FRW A;  2BUD A;  2HSE B;  2ENM A;  2MOX A;  3EG9 B;  1HK9 A;  1PCX A;  2O9V A;  1NJI C;  4C0F A;  5FW9 A;  4FW1 A;  3X25 B;  2ED1 A;  4O5V A;  1YJW A;  4J83 A;  2KQW A;  5KYY A;  4OMQ A;  2RJF A;  3CCQ A;  2KRS A;  1JO8 A;  3V7S A;  2A7Y A;  4A4E A;  1IGU A;  2ZPB B;  3UA7 A;  1QKW A;  2VWF A;  2NUP B;  3M53 A;  4FYY B;  5EG2 A;  4M77 C;  1KC8 R;  1K73 R;  6AT1 B;  4ZNX A;  3OYN A;  1G3W A;  3G6E A;  3RKY A;  5AYF A;  5KYW B;  1T0J A;  3ASK A;  1C6V X;  2VUB A;  4AT1 B;  1ZSZ C;  1PNJ A;  2KY9 A;  1M8V A;  3OA6 A;  4KUD K;  4EMH A;  3EHQ A;  4P5N A;  1I4K 1;  2RO0 A;  3FB9 A;  2JTE A;  2PVO B;  1VQ5 T;  3GNG A;  4RTW A;  2MIO A;  1E6H A;  4LDW A;  1IXD A;  2QQA A;  1YN8 A;  1XQH A;  4OB0 B;  2M02 A;  4RTU A;  5IHK A;  5GAM h;  3CQT A;  3OB9 A;  1ZUU A;  4C8Q D;  2OX7 A;  3CCE T;  4AFS C;  2ZPG B;  4KUL A;  4LUE A;  1D09 B;  2JZ2 A;  4LXC A;  1G8X A;  4M75 D;  3S3M A;  4ORZ A;  1F1B B;  3M4G A;  2J6F A;  1GBQ A;  2MK5 A;  2P0K A;  3JSC A;  2F2V A;  2LCC A;  3A8G B;  4LUD A;  4C92 G;  3IQL A;  2DTH A;  1W4S A;  1QCF A;  5DM7 R;  3EGX B;  1KQ1 A;  3G71 Q;  5FU6 C;  2AZS A;  1ZHI A;  2JM9 A;  2CT4 A;  2KNB B;  2O88 A;  5IHN A;  1I5O B;  2QGG A;  4E7K A;  1H64 1;  1NPR A;  4JRQ A;  4NS5 A;  4D8D A;  1ZA1 B;  2JXB A;  4OMM A;  1LOJ A;  5GAN h;  3OY9 A;  4X1V A;  2VB6 A;  2LNH B;  4LDX A;  5GAO p;  2BZY A;  2XK0 A;  3UT1 A;  2X9H A;  4ZN1 A;  5FWC A;  1WHL A;  3CCS T;  4E47 A;  2YXY A;  3WVE B;  5HK3 A;  3E2U A;  1VUB A;  2EW3 A;  1H92 A;  4C92 D;  2XDP A;  4PFO A;  1VQL T;  3CMA T;  1GCP A;  2B8A A;  2QYZ A;  2JTM A;  1WNL A;  2DTI A;  2HQE A;  1G3S A;  2F5T X;  2P84 A;  5L8R E;  4J7F A;  2EGE A;  2GNC A;  3VRZ A;  1VYV A;  1M1G A;  1Q7Y U;  1X43 A;  1X69 A;  2BIV A;  1FYN A;  1UGR B;  1BI2 A;  4NL2 A;  5CKE A;  2KI7 A;  2VC8 A;  4TVR A;  2DM1 A;  3JV3 A;  3QBY A;  2MWP A;  1M90 U;  3CCU T;  4QQD A;  4DBR A;  1AHJ B;  4LD6 A;  4BI3 A;  3OMG A;  4FYV B;  1VQN T;  1I8F A;  1S72 T;  1M3A A;  3CCM T;  2XHC A;  2BE9 B;  5GMK e;  1KD1 U;  1OU9 A;  1PD1 A;  3RES A;  3OYG A;  5I2S A;  3CPW P;  4KT0 E;  1KC8 C;  2FZC B;  4IUQ A;  2HQH A;  2O4X A;  1QP2 A;  2BKD N;  4RUG A;  1YJ9 Q;  2KGT A;  1AT1 B;  4Z88 A;  3PTA A;  3VS1 A;  1X2Q A;  2OJ2 A;  2PVD B;  3M0R A;  2CSI A;  4CRI A;  1MV3 A;  4E7I A;  4DEY A;  1Q81 R;  3VYG A;  5J3B A;  1VQ8 T;  2KRM A;  2RM4 A;  4ZN3 A;  1UJY A;  3H0H A;  1WQW A;  4EPC A;  4HCB A;  4A63 B;  2MAM A;  2K79 A;  2KAF A;  1QVG P;  2YDL A;  2DET A;  2OTL T;  1IO6 A;  3QJY A;  2FEI A;  4F7U G;  3QO3 A;  1NLO C;  3I55 T;  1OU8 A;  9ATC B;  1V76 A;  3MO8 A;  2LRQ A;  3THK A;  3L2U A;  5LJ3 j;  1LPL A;  3CCS A;  1FMW A;  1NEB A;  1K9M U;  5I2M A;  3OYE A;  4AFQ C;  1MMN A;  2DKG A;  1IRE B;  4HT8 A;  4E6R A;  2LVM A;  1I81 A;  1WJS A;  3M4Y A;  5FLX E;  2H3J A;  3NTH A;  2E3H A;  4JLI A;  3N5B B;  2X3X D;  1G3T A;  1YCS B;  5HK0 A;  1NYG A;  2KT1 A;  4RMO A;  4WF2 A;  4QVC A;  3C12 A;  3U23 A;  4KGV B;  4M77 D;  5I11 A;  3G71 A;  1MNE A;  2A28 A;  3OS5 A;  4IUR A;  1RAI B;  4M7A F;  1WXU A;  1Q82 U;  1Y7X A;  1WHM A;  2HKN A;  3PIO A;  1G5V A;  2AK5 A;  1JQQ A;  4X9D A;  5DY9 A;  4L59 A;  3OSS C;  1TXQ A;  1P92 A;  1VOM A;  4IUU A;  1N5Z A;  4C0G A;  4LNP A;  2FL7 A;  3CCJ T;  4XU0 A;  3MEW A;  1S72 A;  3JCM d;  4HCZ A;  1UEC A;  1KFZ A;  2CSQ A;  1B34 A;  3H0I A;  3NPF A;  3SHW A;  1VQO Q;  1BIB A;  1AD5 A;  2CGH A;  1NPP A;  3CCR Q;  2CUD A;  2FO0 A;  4QVD A;  4M7A A;  3A1P A;  4Y92 A;  2E64 A;  3GLX A;  5KYY B;  1SRL A;  3EAE A;  3LX7 A;  3L2V A;  1XNI A;  1VQK T;  4LDU A;  3A8O B;  2RHZ A;  1M4Z A;  2MPX C;  3EHR A;  2RQV A;  3L2Z A;  2LP5 A;  1UGV A;  1NYF A;  1VIF A;  3OYL A;  3LGF A;  4JJD A;  1VYU A;  4JPB W;  4KH1 B; 
#chains in the Genus database with same CATH homology
 3JCM X;  2E70 A;  1WGS A;  3CME T;  4BDZ A;  5GAN 8;  2KMT A;  3MEA A;  3SWN A;  2YLC A;  2DEQ A;  4N4H A;  1G3Y A;  2DAQ A;  4BB7 A;  4J7I A;  5A0D A;  3H8Z A;  2ZGW A;  4M7A E;  4OB1 B;  4M78 C;  5LL6 S;  3OYH A;  2M1H A;  3LW5 E;  4X34 A;  4OMF B;  3EFR A;  2DIG A;  1K8A U;  2DJZ A;  2X4X A;  3OS1 A;  4PJO F;  3HFN A;  3P8D A;  1BI0 A;  3CBP A;  3ME9 A;  4FL6 A;  4XTX A;  4RCB A;  3VUZ A;  4D6W A;  2HNI A;  3VU3 C;  1PSE A;  5D6W A;  3JB9 I;  3OYB A;  2WSC E;  3QHS A;  2EJG A;  4XTU A;  2JTF A;  2LTO A;  2Y90 A;  3URG A;  3QJ6 A;  1JB0 E;  2AHJ B;  1U8R A;  5GMK h;  3JCM P;  1YCY A;  2YLB A;  3MCA B;  3JCM W;  3L42 A;  1M5Q 1;  3FDR A;  4UC4 A;  3SWN B;  4F7U A;  2MWO A;  3PNW C;  4OP0 A;  3TCJ A;  3V8L A;  1KD1 C;  4E7J A;  2PUK B;  2WSF E;  3FC3 A;  4LDY A;  4BE0 A;  1VQ7 A;  3PGG A;  3PT9 A;  3L2W A;  3CEY A;  2NLU A;  2EFI A;  4BY6 B;  4M75 C;  3JCM Q;  4XK8 E;  3JAM E;  5DLO A;  1N6A A;  3INZ A;  2QI2 A;  3QZ5 B;  4XU1 A;  2E6Z A;  3OYI A;  2DO3 A;  3FJP A;  4M7D C;  2LT4 A;  2QQ9 A;  5CVI A;  4YTL A;  3UPU A;  2LDM A;  1VQ7 T;  4C92 E;  3QPH A;  1VQP T;  2DD4 A;  1H3Z A;  5LJ3 g;  3QG1 A;  3JB9 J;  3M54 A;  4M77 E;  3CPW A;  3HKS A;  4PJO A;  1Q81 C;  4BI8 B;  1ZBX A;  2L5Q A;  2GQV A;  5LJ3 d;  3OYD A;  2ZPH B;  2X4Y A;  2ZZD A;  4DQ2 A;  3OYM A;  2HD0 A;  1YJ9 T;  1LNX A;  2LQK A;  3LLR A;  3NTK A;  4M7A C;  1X6O A;  4KUI A;  3SFM A;  2QTX A;  4LDV A;  5LJ5 g;  2E1H A;  3GP8 A;  1QW1 A;  4C0Z A;  1M1F A;  3VJP A;  4C8Q F;  2VXF A;  3MP6 A;  2VV5 A;  4N4I A;  5LJ5 d;  3OW2 S;  2OTJ T;  2BUD A;  2CZ7 B;  3V8K A;  4A4F A;  2DIQ A;  3ZFJ A;  2K5I A;  5GAN 2;  4ZGE B;  1U1S A;  4GLK A;  4ELZ C;  4MMK A;  1HK9 A;  1NJI C;  4OB3 B;  2PU9 B;  4PLI A;  4Q5W A;  4A4K A;  4C0F A;  1N9R A;  4EMK A;  5GAN 3;  2GCX A;  3M58 A;  4M78 G;  3VV0 A;  2XDD A;  4HKE A;  2A3L A;  3X25 B;  3UDC A;  2YRV A;  4IKF A;  4O5V A;  1WPY A;  3M55 A;  2VGN A;  2CKK A;  1YJW A;  3C4S A;  2KQW A;  4J83 A;  3LH0 A;  4PJO E;  2RJD A;  1QVF A;  2RJF A;  3OQ5 A;  4BE2 A;  3CCQ A;  1QVG A;  2K57 A;  3CC2 T;  3JCM b;  3HRU A;  3V7S A;  4DOV A;  1Q86 U;  2A7Y A;  4A4E A;  2DZ9 A;  3CC7 T;  2ZPB B;  1K9M C;  2F5K A;  2XKO C;  2QA4 T;  3NTI A;  5GAM j;  2RK2 A;  3RMQ A;  1FWZ A;  5KH6 A;  5IT9 E;  1VQ6 A;  3CCQ T;  3M53 A;  3OBY A;  5GAM e;  5I21 A;  3PIP A;  4RG8 A;  4JRP A;  4C92 C;  2QXF A;  3VYH B;  2MMP A;  2L3R A;  4II1 A;  4HT9 A;  4C8Q A;  3S3O A;  5EG2 A;  3JCM e;  4M77 C;  4MML A;  2JUF A;  4M78 B;  4QQ6 A;  2FVU A;  3A5Z B;  3FEO A;  4C5H A;  1G3W A;  3M59 A;  4N0A C;  3OYN A;  3G6E A;  3RKY A;  2C06 A;  1VQ6 T;  5AYF A;  4M7D G;  2WSE E;  1I5L A;  3ASK A;  5KE2 A;  2E10 A;  2FYK A;  2VUB A;  2EJF A;  1KHC A;  3OYF A;  1W2B S;  1Y96 A;  5HY6 A;  4LD9 K;  3UWN A;  3CBM A;  1VQ5 A;  3QZ9 B;  3QXE B;  5CKD A;  2KY9 A;  1M8V A;  3CME A;  3OA6 A;  4M78 D;  4KUD K;  4EMH A;  1FX7 A;  1Q82 C;  4P5N A;  1I4K 1;  5CKF A;  4M7A G;  2RO0 A;  3FB9 A;  2EWN A;  3GPL A;  2HQX A;  4C8Q B;  2QQR A;  2PVO B;  4RG2 A;  4J6W A;  1VQ5 T;  3GNG A;  5FU7 C;  4JS5 A;  1JJ2 S;  4LDW A;  2DZC A;  5GMK i;  5A2Q E;  1BIA A;  3CCE A;  3RER A;  2F69 A;  4PL6 A;  2QQA A;  2V8J A;  4JLG A;  3SDZ A;  2RHY A;  4M75 B;  3F70 A;  2DVE A;  1XQH A;  1NE8 A;  1YJN A;  4OB0 B;  4ZTJ A;  1Q86 C;  1PSF A;  4RCC A;  4PKC C;  1U1T A;  3HL8 A;  5GAM h;  5GAN 5;  1YBY A;  3P8B B;  3RIR A;  3OB9 A;  4BAC A;  5C0M A;  1Y96 B;  4O6J A;  2M16 A;  5KE3 A;  1BI1 A;  4C8Q D;  4C5E A;  3CCE T;  2VYT A;  1VQO A;  2DXB A;  2ZPG B;  2FB7 A;  4KUL A;  3T9N A;  1X01 A;  4C0D B;  3QDR B;  5GAN j;  2JZ2 A;  1YJN T;  5DLQ E;  2V8K A;  3R6O A;  5GAN e;  3CCR A;  2E41 A;  4M75 D;  2DXT A;  3S3M A;  2EIF A;  1HXD A;  4CI0 C;  2D6F A;  3M4G A;  4KBM B;  3WVD B;  2RK1 A;  2YHT A;  4J8O A;  5GAM f;  1VQO T;  5GAO n;  2XD0 A;  5M9O A;  1VQ4 A;  2QDY B;  3CPF A;  3E9F A;  1N8R C;  2P0K A;  3JSC A;  3JCM f;  3JCM V;  3CCR T;  2LCC A;  3A8G B;  4FU6 A;  3DB3 A;  4PNO A;  5GMK l;  2QEX T;  3CCV A;  4C92 G;  3CXC S;  2DTH A;  4MZP A;  4HCC A;  1W4S A;  1VQP A;  1M1K U;  2LT1 A;  4M77 G;  2K3Y A;  3CCL T;  5DM7 R;  4M78 F;  4FSX A;  4L5G A;  1KQ1 A;  2CZ0 B;  2O4X B;  2E6N A;  3WXM B;  1VQ4 T;  5FU6 C;  4XTY A;  3KXT A;  1ZHI A;  2ZCF B;  2X4W A;  3CCV T;  1YJ9 A;  3GIB A;  1KQS S;  3HP9 A;  3J81 E;  1QP3 A;  3OBW A;  3VUB A;  5CR2 A;  2DXC A;  4E7K A;  1H64 1;  4OB2 B;  1WJR A;  2OTJ A;  1NPR A;  1W2B A;  1UEB A;  3MET A;  4NS5 A;  2K3X A;  4JRQ A;  3MP1 A;  5J39 A;  2OAU A;  4VUB A;  3QKJ A;  3G4S A;  3HFO A;  3OYJ A;  1YIT T;  2GF7 A;  3QII A;  4ZGD B;  1OZ3 A;  1BI3 A;  5GAO r;  4F7U E;  5LJ3 e;  4IUV A;  1LOJ A;  5GAN h;  3OY9 A;  1K8A C;  2IG0 A;  2LX9 A;  4C92 B;  3CD6 T;  4LDX A;  1UGS B;  3V7C A;  4Z02 A;  5GAO p;  2RH2 A;  1M9S A;  3MEV A;  3OYK A;  2XK0 A;  2XG8 D;  2X4J A;  3UT1 A;  3G4S T;  3S6W A;  4ZN1 A;  3CMA A;  4PJO G;  3HPW A;  1VQL A;  4M75 F;  3E19 A;  3CCS T;  3JCM c;  4E47 A;  5LJ5 e;  3CC2 A;  5HKC A;  3WVE B;  4M7D F;  4M78 A;  4J6Y A;  5CKB A;  3CC7 A;  5HK3 A;  1VUB A;  3G7Z A;  3TU4 K;  4QVZ A;  4C92 D;  2XDP A;  2QA4 A;  4J5Y A;  5GAN 6;  4FT2 A;  5GAN f;  1VQL T;  2KVQ G;  2Y4X A;  3CC4 A;  3CMA T;  2B8A A;  3FRN A;  4DA4 A;  2JTM A;  3SWN C;  5GAO q;  1WNL A;  2DTI A;  2HQE A;  5CKH A;  2XIC A;  1G3S A;  2F5T X;  5D6Y A;  1RI0 A;  1YIJ T;  4PLL A;  3LYI A;  1KC8 U;  5L8R E;  2RD1 A;  3E9G A;  4J7F A;  1K73 U;  4A4H A;  3LWI A;  2JN0 A;  1OZ2 A;  2KSS A;  3CC4 T;  3L1A A;  4XU3 A;  1Q7Y U;  1M1G A;  2LCL A;  2RHX A;  4BY6 C;  3V7R A;  2RHI A;  2BIV A;  4B9W A;  5GAN 4;  1UGR B;  1XTD A;  2XDB A;  2PVG B;  1BI2 A;  3TEE A;  4NL2 A;  3A8M B;  3DKM A;  5CKE A;  3CCU A;  3OYC A;  5D6X A;  2VC8 A;  4ELY C;  2X35 A;  5CQY A;  3DB4 A;  5GAM g;  4JJN K;  4TVR A;  4DOW A;  3BFM A;  1O75 A;  4M75 A;  3X28 B;  1D3B A;  2EQU A;  2K4Y A;  3QBY A;  5GAM d;  2E12 A;  2MWP A;  3OYA A;  2FHD A;  1VQN A;  4M7D A;  1M90 U;  3ZEH A;  3L2R A;  1BYM A;  2RI3 A;  4QQG A;  3GF5 A;  2EJ9 A;  4QQD A;  1X75 C;  2VGM A;  3CCU T;  1VQ9 A;  3CCM A;  3OMC A;  3QYG B;  4IUT A;  1YHQ A;  4OGE A;  1AHJ B;  2CS7 A;  2V8I A;  4LD6 A;  4BI3 A;  3QSU A;  5LJ3 f;  1WJQ A;  3OMG A;  3RKX A;  1VQN T;  5KCO A;  1I8F A;  5CIU A;  5FRO A;  1S72 T;  2R57 A;  5GMK m;  1VQ9 T;  3SD4 A;  3CCM T;  3OS0 A;  4C92 F;  3GOX A;  1YHQ T;  3J80 E;  2PQW A;  4JRI A;  4C8Q E;  3JB9 G;  2XHC A;  5GMK e;  2DTO A;  2M0O A;  2ZPE B;  4M77 F;  4EDU A;  5LJ5 f;  2Y4Y A;  3CPW S;  5CQX A;  3OW2 A;  1KD1 U;  2MI6 A;  4PJO C;  2CYZ B;  3H6Z A;  3RES A;  1D3B B;  1OI1 A;  3Q1J A;  4BD3 A;  3OYG A;  1DJ7 B;  4JDS A;  2JOY A;  5FU6 B;  5I2S A;  5GAO l;  4M75 E;  4KT0 E;  1MGQ A;  4M7D B;  2P0P A;  1KC8 C;  4IUQ A;  3X20 B;  1TH7 A;  3JCM h;  4ATO A;  2O4X A;  3OYY A;  2XU8 A;  3HSB A;  2HAX A;  3M57 A;  4X9C A;  1Q7Y C;  5GAN 7;  1QP2 A;  2EQM A;  1B34 B;  2BKD N;  3VKI A;  4JUV A;  5J26 A;  4HA8 A;  3OS2 A;  3RMS A;  4J6X A;  2M9U A;  1MHN A;  3KUF A;  3EFS A;  4NL3 A;  3E1S A;  2QEX A;  4ME7 A;  1Q81 U;  3JCM J;  1BKB A;  3M5A A;  4M7A B;  3PTA A;  3L2Q A;  2K5F A;  4A54 A;  1VQ8 A;  4EMK C;  1JBM A;  2PVD B;  4M7D D;  3CCL A;  1R8O B;  4XTZ A;  2JNG A;  3OSV A;  3QYH B;  1YI2 A;  5FRM A;  1VIE A;  2D0Q B;  3HHT B;  5GAN g;  1OYX A;  4CRI A;  4BE1 A;  1Y07 A;  5GAN d;  4E7I A;  1M90 C;  2OTL A;  3VYG A;  4FM4 B;  4GY5 A;  5J3B A;  3BY7 A;  1V29 B;  2RM4 A;  4C92 A;  1UGQ B;  4ZN3 A;  1VQ8 T;  1QVF S;  3I56 A;  1QVG S;  2DXU A;  4M7A D;  1YI2 T;  5IAY A;  2VXE A;  4M77 A;  2KK4 A;  3HRT A;  1WQW A;  1NJI U;  4EPC A;  3I55 A;  4HCB A;  4OF1 A;  3PMI A;  5FRN A;  2MAM A;  2LNV A;  2R5A A;  2KAF A;  1UB4 A;  4N0A A;  3JB9 H;  4L6V 5;  2QQS A;  3BW1 A;  2OTL T;  3QJY A;  5IN1 A;  1QVP A;  1EIF A;  3JB9 D;  4FT4 A;  2LQ8 A;  4C5I A;  4BDY A;  4F7U G;  1YIT A;  3I56 T;  3QO3 A;  1XOV A;  4XAX B;  3CD6 A;  5A0L A;  4C8Q C;  3I55 T;  2MF2 A;  1Y71 A;  2DK3 A;  4FIB A;  4MZM A;  3MHX A;  2EYQ A;  3MO8 A;  3QUI A;  2LRQ A;  2DD5 A;  2R58 A;  3L2U A;  5LJ3 j;  3ZBD A;  4C5G A;  3X26 B;  3CCS A;  3RUX A;  4JRK A;  2P0Q A;  3BDL A;  1K9M U;  5I2M A;  3OYE A;  5CCA A;  3KBG A;  4MDX A;  2DKG A;  1IRE B;  4HT8 A;  1KQ2 A;  2RI5 A;  2HBP A;  2WAC A;  2LVM A;  3X24 B;  1GXI E;  4M77 B;  1RL2 A;  1I81 A;  1JJ2 A;  1WJS A;  5LJ5 j;  3M4Y A;  5FLX E;  3NFC A;  2H3J A;  3NTH A;  4XTW A;  4Y28 E;  3O8V A;  3JRZ A;  2CZ6 B;  4JLI A;  3N5B B;  3V8J A;  4C0D C;  3TRE A;  1O9S A;  2XI9 A;  2XID A;  3BDU A;  1YIJ A;  2K5L A;  1G3T A;  5HK0 A;  4F7U B;  4RMO A;  2CZ1 B;  2O01 E;  1N27 A;  1KHI A;  3MEU A;  4OGC A;  4WF2 A;  4QVC A;  1ZQ1 A;  3C12 A;  3SB2 A;  4M77 D;  1SSF A;  2RHU A;  3RKW A;  3M9Q A;  2EQK A;  3G71 A;  2GFA A;  1M1K C;  3OS5 A;  2EKO A;  2EQJ A;  4IUR A;  4M7A F;  4MDW A;  4IUP A;  1KG1 A;  2ZPF B;  2E5Q A;  4ZGJ B;  4MZT A;  4E7L A;  1Q82 U;  2E65 A;  1Y7X A;  2K2V A;  5FU7 B;  4A53 A;  3J7A F;  3GNF B;  3CCJ A;  3JB9 F;  3PIO A;  1G5V A;  3G71 T;  4EMG A;  4X9D A;  5CO7 A;  5DY9 A;  4L59 A;  4PJO B;  1VQM A;  3OSS C;  1P92 A;  3C94 A;  2PUO B;  4R55 A;  2RJE A;  3A8L B;  3CXC A;  4A4G A;  5LJ3 h;  5GAO m;  4IUU A;  4JS4 A;  2RJC A;  2I2L A;  4C0G A;  3DLM A;  4M78 E;  1UGP B;  4R56 A;  2FL7 A;  3CCJ T;  4XU0 A;  2IVW A;  1JRI A;  3JCM g;  2P4T A;  1VQM T;  3ER0 A;  2EAY A;  3MEW A;  1S72 A;  1YJW T;  3JCM d;  1LJO A;  1KQS A;  5LJ5 h;  4HCZ A;  2KDS A;  4PJO D;  3PMT A;  4OVA A;  4V2S A;  3FIF A;  5KCH A;  4C8Q G;  1B34 A;  4EMK B;  5CAI A;  1BIB A;  5CK9 A;  4ZTF A;  2CGH A;  4XQ3 A;  2D9T A;  5A0G A;  1NPP A;  2QQB A;  3A8H B;  4N4G A;  4E7H A;  3S3N A;  3FLG A;  1VQK A;  4B9X A;  1NZ9 A;  2RB6 A;  4QVD A;  4M7A A;  1IZ6 A;  2R5M A;  2RI2 A;  2G3R A;  3M56 A;  2E64 A;  4M75 G;  2JVV A;  4NOY A;  4BI4 A;  3GLX A;  5GMK j;  2L89 A;  3EAE A;  4XTV A;  4BUG A;  1N8R U;  3AHU A;  3DLL A;  3CBO A;  2LC4 A;  3LWH A;  3LX7 A;  1FXX A;  4QW2 A;  3L2V A;  1N9S A;  1XNI A;  3HRS A;  1VQK T;  3LGL A;  4XU2 A;  2DPP B;  3G6E T;  2RA2 A;  4LDU A;  3MP8 A;  3A8O B;  2RHZ A;  1M4Z A;  4RKU E;  1K73 C;  3L2Z A;  4F7U F;  4M7D E;  4Y91 A;  3OYL A;  1VIF A;  2ZPI B;  5C6S A;  3LGF A;  3P8H A;  1WQ7 A;  3PFS A;  3C95 A;  2GFU A;  2L8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...