1UHCA

Solution structure of rsgi ruh-002, a sh3 domain of kiaa1010 protein [homo sapiens]
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
GSSGSSGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA1010 protein
publication title Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]
rcsb
source organism Homo sapiens
total genus 7
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2003-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uhcA00
1M30A 2EQIA 1WX6A 2CDTA 3EG3A 4Z88A 1A0NB 2HCKA 3VS7A 4J9EA 2DLPA 1YNZA 2VVKA 4OMQA 3UF4A 3VRZA 2C0IA 2GTOA 1YWPA 2FPFA 2KGTA 2RQVA 5FWBA 2IIMA 2A28A 1VA7A 2GGRA 4Y92A 2KE9A 2EYZA 1ABOA 2D0NA 3CQTA 4RTYA 1ARKA 2FRWA 4OMOA 4K11A 1QWEA 1WFWA 1WXUA 2HDAA 2KR3A 4HVUA 1VYTA 1ZUYA 1VYUA 1H8KA 4LUEA 2J6FA 3M0QA 4AG1C 1ZX6A 2KT8A 1QLYA 2K79A 1YCSB 1GCQA 3O5ZA 2KROA 2BTTA 3M0UA 2JM9A 2L3PA 4DEXA 1MV3A 2JT4A 3H0FA 2DJQA 2JM8A 2MOXA 4J9FA 1PKSA 3H41A 1S1NA 1TUCA 4JJCA 4FSSA 5GJWB 2KRNA 2LCSA 2A08A 2ROTA 2V1RA 2YT6A 3R6NA 1RLQC 2M51A 3EGUA 3EHQA 2MIOA 3H0HA 3UA6A 1QKWA 1SSHA 3VRYA 1UJYA 3REBB 1UFFA 1M3AA 4J9CA 1WA7A 3SEMA 2EKHA 2CH4W 3VS4A 1OPKA 4RTWA 5ECAA 1SHGA 4ESRA 2LQNA 1KFZA 2LMJA 1YN8A 2RN8A 1MUZA 2D8HA 3M0TA 2C0TA 2ABLA 2DE0X 1KIKA 3TSWA 2LZ6B 3NMZC 2X3WD 2K3BA 1Z9QA 4LNPA 4OMNA 2O2OA 1UECA 2DM1A 2JW4A 4CC7A 3ZL7C 2DL3A 2BZXA 2EYXA 2FG0A 2J06A 1WIEA 2ROLA 2O31A 1UJ0A 2HBWA 1I1JA 1MV0B 2OJ2A 2EGCA 2A37A 2GQIA 1NLOC 2CSIA 2D1XA 1SHFA 5I11A 1OEBA 2ENMA 1HJDA 1WLPB 1CKAA 5I22A 1AEYA 2J7IA 1CKBA 4ZNXA 3EG2A 1YP5A 2LNHB 5IHIA 3I9QA 2EBPA 3NHNA 1T3SA 2EPDA 1UTIA 4LE9A 4RTZA 1BK2A 4JPBW 4D8DA 2LP5A 4IIOA 4CC4B 3NPFA 1ZUKA 4J9HA 3FJ5A 3REAB 2DL7A 3UATA 2CREA 4RTXA 1QCFA 2G6FX 4HXJA 2D8JA 3TSZA 3RBBB 2AKLA 1ZUUA 2F2XA 2X3XD 1U5SA 2CSQA 2EGEA 1V1CA 2DNUA 1XOVA 1W70A 1SRLA 1NYGA 5IXBA 2AKKA 2K9GA 2CH4A 2KXCA 1NEGA 1CSKA 2GNCA 1OOTA 2KNBB 2KEAA 1I07A 2J05A 2KRMA 3M0SA 3VS1A 3VS6A 4GBQA 2AK5A 1E7OA 4EIKA 4RTTA 3I35A 2MCNA 2HSPA 1YWOA 2RPNA 1BB9A 1AZGB 1LCKA 4QT7A 2EGAA 2E5KA 3KFVA 2DILA 2ED1A 2RMOA 1AWXA 1X2QA 2DL5A 2W10A 3PE0A 2B86A 2CT3A 1AD5A 2KRSA 2YUNA 1KSWA 2F2VA 1U3OA 1I0CA 2JS0A 4AFQC 2EYWA 2DRKA 1WDXA 2O88A 2AZSA 1AOJA 2YDLA 2ED0A 2P4RA 2YUPA 1X27A 2BZ8A 3PVQA 4HVVA 2J6OA 1JEGA 2JXBA 1OPLA 2K6DA 1GL5A 3IQLA 4KRTA 2OAWA 1J3TA 1K0SA 2DBMA 1AVZC 1GFDA 2SEMA 4R0KA 2DBKA 2BZYA 2L3SA 2RNAA 1FYNA 1T0HA 1HD3A 2FPDA 1PWTA 2JTEA 1Y0MA 2DL4A 1AWWA 1RLPC 1JXOA 1T0JA 4WCIA 1UHCA 4LN2A 4CC2A 1KJWA 2EVRA 1W6XA 4F17A 4DEYA 2LX7A 1Z9ZA 2LQWA 2LJ1A 3QWYA 2GBQA 3ULRB 1HSQA 2EW3A 4Z8AA 2QDLA 1X2KA 4J9BA 4F16A 2AZVA 1PNJA 2KYMA 5FW9A 1W1FA 1GCPA 1NLPC 1PRMC 2A36A 4RUGA 3M0RA 3JV3A 3UA7A 2KBTA 3VS3A 1M3CA 2KT1A 4RTUA 4J9GA 1WYXA 4HCKA 2W0ZA 3I5RA 2RQTA 4J9DA 1K76A 4D8KA 2CUDA 2PTKA 2YSQA 3VS5A 1UDLA 4M4ZA 2DYBA 1NG2A 2FO0A 1X6GA 1JU5C 2L3QA 1SRMA 2RQUA 1GBQA 2DA9A 3A98A 5L23A 1GFCA 4ORZA 1AWOA 2FPEA 1E6GA 1GCQC 2DVJA 1RI9A 1BU1A 1TG0A 2NUZA 4CC3A 4Z89A 1QKXA 3SHWA 1WI7A 2YUOA 1T3LA 4AG2C 1JQQA 2FRYA 2ECZA 1UUEA 1ZLMA 4E6RA 4F14A 3EG0A 1E6HA 1ZBJA 3C0CA 2JMCA 1B3QA 3U23A 3NGPA 3RNJA 1X69A 2LJ0A 2PZ1A 1ABQA 2JS2A 1AZEA 2RF0A 1UG1A 1X43A 2CUBA 1JXMA 1WXTA 3THKA 3VS0A 1AWJA 2RQWA 1X6BA 1JO8A 2FEIA 1UE9A 2H8HA 3LH5A 1PHTA 2HEQA 4J9IA 5IHNA 2XMFA 4IIMA 1NYFA 4OMPA 1G2BA 1M27C 3PVLA 1K9AA 2EYYA 4JZ3A 1M3BA 1M8MA 1SPKA 2O9SA 2M0YA 1WXBA 2I0NA 2F2WA 1VYVA 1Y57A 2J6KA 2L0AA 1RUWA 2KXDA 3M0PA 2SRCA 3I5SA 1G83A 2VWFA 2YUQA 4X1VA 3TVTA 4JZ4A 1EFNA 1BBZA 2OI3A 5GJVB 1GRIA 2K2MA 2DX1A 4AFUC 2KYBA 3GBQA 2PNIA 4JJDA 2JMAA 5HCKA 4RTVA 1K0XA 1ZSGA 2V1QA 1FMKA 3VS2A 4LUDA 1K1ZA 1U06A 4GLMA 5IHKA 1QWFA 2DRMA 4OMMA 5IXFA 2DF6A 2K7AA 3EG1A 1NM7A 1PKTA 1H3HA 4AFSC 3QWXX 1UGVA 2DL8A 1TUDA 1UHFA 1IO6A 2NWMA 2RQRA 3H0IA 1N5ZA 4HVWA 4OMLA 1NEBA 3EHRA 1OV3A 5IH2A 1B07A 4A63B 4JJBA 2C0OA 1PRLC 2CT4A 5EC7A 2LJ3A 2GTJA 1SEMA 1GBRA 2O9VA 5FWCA 2L2PA 2ESWA 2DMOA 2VKNA 1H92A 4AFZC 1K4US
chains in the Genus database with same CATH superfamily
1G3SA 3M58A 4Z88A 2KSSA 1I5OB 1YNZA 3PMIA 1QVFS 2VVKA 3FDRA 4OMQA 4RG2A 2GTOA 3CMAA 1YWPA 2OX7A 3AHUA 2YLCA 3JB9J 3UWNA 5FWBA 2IIMA 3OQ5A 3I55A 1YJNT 2A28A 1ABOA 4FCYA 1VUBA 2PVDB 1K73U 2FRWA 1IGUA 1VOMA 1QWEA 1PD1A 3S3OA 3HRUA 3X20B 1VQ7Q 4BE1A 2LVMA 2OTLA 4M77D 3A8OB 4M78C 4AG1C 2L89A 4M7AF 2HMAA 1YIJQ 1QQJA 2DIGA 3M0UA 2CZ7B 3Q1JA 4J7IA 2DEQA 2JM8A 5CK9A 1SF9A 2ROTA 4M77B 1MMGA 2E6ZA 2O4XB 3EGUA 3UA6A 5HY6A 3OMCA 2KDSA 3MCAB 5CO7A 2HBPA 5GAOp 3REBB 5IAYA 3VUZA 3JRZA 1QVPA 3BE3A 1KD1C 3CMAT 2E3IA 3OW2A 3VS4A 3I55T 1SHGA 5EG2A 2K5FA 4GLKA 3PIOA 2DEUA 2QA4Q 1WHLA 4F7UA 2P4TA 4PJNA 4M78G 2ZPIB 1Q82C 3X28B 1M1FA 4C0ZA 3VJPA 4EMGA 4J8OA 4LNPA 3JCMP 1KC8C 3JCMX 4QQ6A 3G6EA 3CCSA 2O2OA 1UECA 2DM1A 5LJ3d 1YJNQ 3CBMA 2DL3A 2FG0A 2J06A 1WIEA 2Y90A 2HBWA 1I1JA 3PGGA 2EGCA 1M90C 4AMCA 2X4JA 4OGCA 1NLOC 2CSIA 3MEAA 2D9TA 2F5TX 3DB4A 1D0YA 3RUXA 1ZSZC 2YXYA 4A54A 3OS0A 3QO3A 1HJDA 1WLPB 1CKAA 2J7IA 3JCMW 1OX9A 4KT0E 5GANj 2NYSA 4PJOF 2EQUA 4M7AB 4LE9A 1IB8A 1UEBA 4RTZA 5J3BA 1D09B 2HSEB 4IIOA 4CC4B 1RAFB 2X51A 1ZUKA 2DFUA 4J9HA 3OBWA 1XQHA 2RHIA 1BIBA 3HRSA 3TSZA 3CCUA 3CMAQ 4IKFA 4OB2B 3CCST 2BE7D 2F2XA 3I55Q 4Y28E 2CSQA 2EGEA 2H3JA 2DNUA 4ZTJA 5FU6B 1XOVA 4M75E 4XTXA 1UGSB 4OVAA 2BUDA 1NYGA 4WF2A 5IXBA 2JTMA 2E3HA 2AKKA 3CEYA 1Q7YU 1RABB 2GNCA 2KEAA 4J6XA 5D6WA 2J05A 4XU1A 3V7CA 3VS1A 3ZEHA 2AK5A 4OF1A 2DPPB 4M7DE 2NUPB 3VU3C 3INZA 1LCKA 5GAN7 3KFVA 2HAXA 2W10A 1Q86R 2RB6A 3L2WA 2KRSA 3MHXA 3NTHA 2KQWA 3CCUT 5L8RE 2MK5A 5FU7C 5GAN3 2EYWA 5A0DA 4PJOD 1WDXA 3OMGA 1VQLT 2QQRA 2VGMA 3C4SA 3PFSA 3OYCA 2HQHA 1XTDA 3QBYA 3EG9A 5CKFA 4E7IA 1OPLA 2K6DA 4JRIA 2WSEE 2CKKA 3IQLA 1QW1A 4X34A 3V7RA 1K0SA 2ZGWA 4M78F 4F04B 2F69A 2DBKA 2L3SA 3V8JA 5C0MA 1PWTA 1IHVA 1JJ2A 1Y0MA 1RLPC 2YLBA 1BI2A 3OBYA 3CCSQ 2DIQA 4DEYA 3OSVA 4A4GA 1K73R 2LX7A 2LJ1A 3P8BB 1WJQA 2QDLA 4FT4A 1R0CB 1N8RR 3KBGA 4E2FB 3FB9A 2LX9A 1NLPC 4ZGEB 2DVEA 4CRIA 1QCNA 5HK0A 3JV3A 1NJIR 1UGPB 3EH1A 2X35A 5CVIA 2KT1A 2HZYA 4PJMA 5I2SA 2K4YA 2W0ZA 3I5RA 2HQXA 4O6JA 1K76A 1U1SA 2CUDA 2PTKA 2YSQA 2MI6A 5C6SA 4C8QE 2AHJB 2DXTA 3M53A 4M77C 1BI1A 5FRNA 2FO0A 1RAHB 2EWNA 4FYVB 1GBQA 3A98A 5L23A 5GANf 1AWOA 2VV5A 1GCQC 2ZZDA 3MO8A 4B9XA 3ZBDA 3CCUQ 3OYHA 4JUVA 2DXUA 5GAOq 2QGFB 1QKXA 1VQLQ 1F1BB 1JRIA 1WI7A 4Y91A 2R58A 1UUEA 4E6RA 3V8LA 3RKWA 3EG0A 1E6HA 4DBRA 1KQSA 3NGPA 3HSBA 2RI3A 1WHHA 2BIVA 3FIFA 4EMKA 2CUBA 1WXTA 3GOXA 4RCCA 3OYJA 2RQWA 4C92F 3LH5A 4KH1B 2LDMA 4M78B 2HKNA 1G2BA 4MDWA 1ZHIA 2FL7A 3OW2P 4E47A 1EZZB 2F2WA 2I0NA 1Y57A 2SRCA 1O9SA 2YUQA 1BBZA 1BYMA 4AFUC 2KYBA 5J39A 1WHMA 4ZGJB 3E2UA 1YHQA 2PNIA 2DK3A 5KYYA 5HCKA 2K5LA 1ZSGA 3OW2S 3GNGA 2V1QA 2NUTB 3VS2A 1WHGA 5LJ5j 5IXFA 1NM7A 1RACB 2Y4XA 4FW2A 4HCCA 3QWXX 4FM4B 1TUDA 1UHFA 2RQRA 3DB3A 2DXCA 4HVWA 1JB0E 1B07A 1OZ2A 1S72T 2LJ3A 5HK3A 1Q7YR 1ACMB 4MMKA 1M5Q1 1BIAA 6AT1B 5GAN8 2CDTA 4C92D 1R77A 3VS7A 2CP7A 4J9EA 1WQ7A 3UF4A 2IVWA 3VRZA 4J5YA 5GAN5 1Y71A 3FLGA 3H8ZA 3WVEB 1QP2A 2KGTA 4JJNK 4QQGA 3M59A 2GGRA 4Y92A 2KE9A 1FXXA 2MMPA 3UPUA 3CQTA 3FEOA 3CCVA 1ARKA 4OMOA 4K11A 2HQEA 2HDAA 2GFUA 1M1KU 2KR3A 4PL6A 4HVUA 5A0LA 1MMAA 4XU0A 1XJWB 2COWA 4LUEA 3V8KA 1H8KA 4M7AE 2J6FA 1B7TA 3HKSA 1ZX6A 3CPWA 2K79A 1YCSB 4JS5A 2KROA 2BTTA 2EJFA 2LTOA 4JRKA 4PK4A 1Y96A 2DJQA 2MOXA 3OYBA 3H41A 1S1NA 2COZA 1FX7A 4FSSA 5GJWB 2KRNA 1PG5B 2PVOB 2YT6A 3PMTA 1Q86C 3EHQA 2MIOA 4FW1A 1QKWA 1OQKA 1H3ZA 4PJOC 3CC7A 2E70A 4J9CA 3QPHA 1EX4A 2QQSA 1NE8A 3SEMA 5HKCA 2EKHA 1S72Q 4RTWA 3OS1A 5KYWA 2MF2A 3GIBA 1BI3A 2LQNA 4HKEA 3DLMA 2JZ2A 1KFZA 3L2VA 2RN8A 1U1TA 3OYDA 3BDLA 1W4SA 2MYSA 2BKDN 2ABLA 5KYUB 2K57A 2DAQA 1RAGB 4A4KA 3TSWA 5D7UA 3NMZC 3GNFB 1VQOA 2K3BA 1M1GA 3JCMQ 2DETA 1K73C 4OMNA 2CS7A 4MZPA 4KGVB 2XD0A 4OB1B 2EJ9A 2RI2A 2EYXA 3RKXA 1VQKT 2OTJA 4LDVA 3JB9I 1OX8A 1MV0B 3M4GA 3BDUA 5FU7B 1LOJA 4BDZA 4FYXB 4E7LA 1NJIC 3JCMe 2R5MA 4M75A 4PJOG 2D1XA 5I11A 2KK4A 2ENMA 4IUTA 2XDPA 3EGDA 3JCMh 4ZNXA 2LNHB 5IHIA 1TXQA 1JJ2S 5LJ5f 4MMLA 2LT1A 2EBPA 1T3SA 4FYYB 2M16A 2CP0A 2E1HA 4M7DA 4LD6A 4A53A 3QIIA 5LJ5g 1B34A 3FJ5A 4ZN3A 2DL7A 3HP9A 4XK8E 5FLXE 1QP3A 3UT1A 3CCJA 4A4HA 2D8JA 5GANd 1RAEB 1N8RU 3QHSA 4B9WA 2AKLA 4FIBA 3HHTB 4XTWA 4QVDA 3OYMA 2X3XD 1V1CA 1RAIB 3CBOA 1NJIU 4IUUA 1YITT 1LPLA 3EGXB 2PQWA 4FT2A 1HK9A 2BE9B 2K9GA 3OYNA 5DY9A 1KQSP 3G71T 1EIFA 4GBQA 1MNEA 4EIKA 2MCNA 3PIPA 4P5NA 2AIRB 1VQKQ 4LDXA 1AZGB 4QT7A 1V76A 4JRQA 2E5KA 3CC4A 2DILA 1WJRA 2DO3A 1VQNA 4ZTFA 4ELZC 1KQSS 1VIFA 4OP0A 1AD5A 1KSWA 3CCJT 3M56A 2CP6A 2DYIA 3S3MA 1KG1A 2JS0A 1VQ9A 2OTLT 3SD4A 4JDSA 2ED0A 1TTHB 1X27A 3L42A 2LCCA 4BI4A 3CBPA 3PVQA 4HVVA 2CYZB 2L3RA 1JEGA 4BE2A 1LVKA 1NPPA 4M78E 3X25B 4C8QA 2DBMA 1AVZC 4JLIA 5GAOn 3SWNA 3OYAA 2RNAA 3LYIA 3MP8A 2DD4A 3QDFA 2DL4A 1AWWA 1T0JA 4CC2A 1W6XA 2FHDA 4YTLA 3RESA 2QQ9A 4F17A 1Q81U 1Q7YC 1K8AU 2GBQA 3CCMA 5GAMg 1M1KR 1HSQA 2XKOC 2MWOA 1YITQ 4KH0B 3CC4T 2KYMA 1VQNT 4Z02A 4C92C 4V2SA 2RHUA 3JAME 4RUGA 3ME9A 2FZGB 3UA7A 2R57A 2KBTA 3VS3A 3G71Q 1M2OA 1WYXA 1OU9A 1VQ9T 2RQTA 4J9DA 4KUIA 4D8KA 3TQ7P 2E5QA 4X9CA 1UDLA 4M4ZA 1R8OB 4N4GA 1NG2A 3G6ET 2L3QA 1G8XA 4N0AA 4LD9K 1SRMA 3A5ZB 1E6GA 2DVJA 3CCJQ 5CIUA 1RI9A 1BU1A 4FU6A 4CC3A 3HFNA 3HL8A 4QW2A 4Z89A 2OTLQ 3SHWA 1M2VB 3CPWP 2O4XA 2YUOA 3QZ9B 4LDUA 1JQQA 3CCMT 4BB7A 2ECZA 4LDYA 4DBQA 1IXDA 2RHYA 4DOWA 2KAFA 2COYA 5DM7R 2RHZA 1ZLMA 4C0DB 4C92G 2KVQG 2JMCA 1B3QA 3U23A 1X69A 2JS2A 3A8GB 4PNOA 5CCAA 2RF0A 1X43A 1JXMA 3E9FA 3THKA 9ATCB 1AWJA 3CPWS 4XAXB 2H8HA 1KQ2A 5IT9E 2HEQA 2YRCA 4J9IA 2XMFA 4IIMA 1IHWA 2JTFA 1AHJB 3G1JA 3SB2A 1M27C 1OYXA 3PVLA 2EYYA 5LJ5e 3CC4Q 1AT1B 1VQNQ 1M8MA 1SSFA 1QVGP 3HPWA 2J6KA 2VB6A 4X1VA 5LJ5h 3TVTA 4JZ4A 1YJWA 4RKUE 5GJVB 1H641 1VQ8A 1UGRB 1VQ9Q 1NPRA 4C5EA 4XU2A 3S6WA 4RTVA 5FROA 4PJOB 2IG0A 4BACA 4PLLA 2VASA 1UGQB 3I56A 1QVGS 3G6EQ 1U06A 4GLMA 1D0XA 3CMEA 2K7AA 2QEXA 3MP6A 1PKTA 3CXCP 4M7AA 2A3LA 2DL8A 2NWMA 2RD1A 2PU9B 2XDDA 1NEBA 4II1A 4IUVA 4JJBA 2C0OA 1PRLC 4OB3B 5EC7A 2QI2A 3CCMQ 1MGQA 1IZ6A 3QYGB 1OULA 1SEMA 2H3EB 4F7UG 1GBRA 2O9VA 1OU8A 2ESWA 2DMOA 2QGGA 4AFZC 1BCOA 3CXCS 4XTZA 2EQIA 4PFPA 2HL5C 3ASKA 1YJWT 3OS2A 2DLPA 3A1PA 5GAN6 3BW1A 3QUIA 2FPFA 2EAYA 1HYOA 3N5BB 1M9SA 2D0NA 2LQ8A 2KMTA 4RTYA 5A0GA 2JVVA 5D6XA 1TWBA 1VYUA 2M0OA 2KT8A 2NUPA 2LC4A 1G3YA 3JCMf 1D3BB 1QLYA 3CCLA 1SKUB 2JM9A 3RIRA 4M75F 2D6FA 1LJOA 5GAMe 4TVRA 3CCEA 3H0FA 4J9FA 8AT1B 4J7FA 3JCMg 4JJCA 3URGA 4PJLA 2LCSA 3X26B 5GAMh 2PVGB 1KK7A 3R6NA 4DOVA 5KE2A 5GAOr 4AT1B 2M51A 2RJCA 3E1SA 4LXCA 1SSHA 3VRYA 4WTOB 1UJYA 2VXFA 1UFFA 3M54A 3HRTA 2LNVA 4JLGA 5KYXA 1M3AA 2K3YA 4N4HA 2EKOA 2ATCB 1N6AA 2CGHA 4J6WA 1TU0B 1Q81R 1K8AR 1OPKA 5ECAA 3PT9A 4M77E 3QYHB 5GAOl 3V7SA 3H9NA 5CKDA 3M55A 3E9GA 2LMJA 1YN8A 1MUZA 1WZOA 2ZPFB 2M1HA 2C0TA 3OS5A 2E41A 4FYWB 4OMFB 3CCQA 1YJWQ 4EMHA 2XG8D 1Z9QA 3CCLT 3WXMB 1M1KC 3CCET 2JW4A 4CC7A 2RJFA 2BZXA 1K9MR 2ROLA 1UJ0A 3VKIA 8ATCB 2GFAA 1HXDA 2DTOA 2A37A 3EFOB 4QVCA 5I2MA 1SHFA 1M8VA 1VQMA 1OEBA 4XU3A 4XTYA 4M75D 5I22A 1AEYA 5CQXA 1UB4A 1CKBA 5LJ3g 5GAN2 3VUBA 1YFNA 2X9HA 3MEUA 2M02A 1U8RA 1VQPA 1UTIA 5CKEA 4F7UF 1YHQT 1BK2A 4JPBW 4C0DC 4D8DA 2LP5A 1OI1A 1ZA1B 2C06A 3QJ6A 4M7DD 4XTUA 3REAB 1PSFA 3CC2A 4NL2A 2X4WA 4RTXA 2G6FX 4C8QF 3RDVA 3RBBB 4C92B 1YCYA 4E7HA 2VUBA 1BKBA 1W2BP 1I5LA 1SRLA 1YIJA 1QCOA 5KE3A 2G3RA 5GMKi 2CH4A 4DBHA 1NEGA 3M4YA 1CSKA 2KNBB 3QXEB 4M78A 4EMKC 1WPYA 1I07A 2KRMA 4HCZA 4PFOA 7AT1B 2E64A 3CCLQ 2FB7A 1PCXA 2RK1A 3HFOA 3CCEQ 4RTTA 3I35A 2HSPA 4Q5WA 1VQPT 1BB9A 2QG9B 5KYNA 2KY9A 3KXTA 4C0FA 2RMOA 1AWXA 1X2QA 1QVGA 2DL5A 4A4FA 3LGFA 5GAMj 1FMVA 3CCVT 2K5IA 3CC2T 2B86A 2CT3A 1C6VX 1D1BA 3OYIA 2YUNA 2F2VA 2QTVA 1U3OA 4QVZA 3QZ5B 3PNWC 2O88A 2FVUA 2XDBA 2YDLA 1WGSA 2YUPA 2LQKA 5IN1A 2BZ8A 1YHQQ 2O01E 1GL5A 2JJ9A 2RK2A 4KRTA 2OAWA 3OSSC 2CZ6B 1GFDA 2LT4A 1N8RC 3CCQQ 3EH2A 2BZYA 1V29B 4C8QD 1T0HA 3MEVA 1HD3A 2FPDA 3C12A 3CXCA 3OB9A 2JTEA 3MJXA 2KI7A 4F7UB 1JXOA 1ZBXA 2CP3A 4LN2A 1NZ9A 3LWHA 1KJWA 4C5GA 2EVRA 2K2VA 3BY7A 1OZ3A 4ELYC 3CC7T 3ULRB 3M57A 4J9BA 4QQDA 1X2KA 4L6V5 4NS5A 4F16A 5GMKh 1O75A 1PNJA 2E12A 2EQKA 3VYGA 4PJOE 3OYFA 1GCPA 1QVFP 2A36A 2EQJA 3M0RA 5GMKm 1ZSZA 4J83A 4J9GA 2E4HA 2EYQA 4HCKA 4VUBA 4OGEA 2JNGA 4HT8A 2PUKB 5AT1B 1VQOT 1VQPQ 2DYBA 3RKYA 1D1CA 3JSCA 2XI9A 3EFRA 3BFMA 1X6GA 1RI0A 2RQUA 2P0PA 3CCVQ 3CC2Q 3JB9F 3LWIA 2FPEA 2OTJT 3M9QA 1VIEA 3LGLA 1TG0A 4XQ3A 2NUZA 3CD6A 3JCMd 1KQ1A 1NBEB 2RHXA 3M5AA 3TCJA 3TEEA 1TUGB 1T3LA 4AG2C 3DKMA 5M9OA 3DLLA 4F14A 4C5HA 2EQMA 3NFCA 3C0CA 3G7ZA 3R6OA 3RNJA 1ABQA 3A8LB 3AT1B 2MAMA 5LJ3e 3D7SB 4HCBA 1UG1A 1Q81C 3QKJA 3VS0A 1K8AC 2X4XA 2FEIA 1JO8A 1UE9A 1WJSA 1PHTA 2ZPEB 5LJ3h 1N27A 4OMPA 3CC7Q 5KYUA 4DA4A 2E10A 4JZ3A 1SPKA 4CI0C 2O9SA 4HA8A 2QQBA 2V26A 2HD0A 3RMQA 3I5SA 4QKUA 1G83A 2VXEA 1GRIA 1TOVA 2DX1A 3EFSA 4FSXA 2I2LA 3CD6T 4EPCA 4JJDA 2YRVA 1PM3A 1K9MC 1XNIA 1K0XA 1VQOQ 5GAMf 2ZPBB 3TREA 3OA6A 4IUPA 3JB9D 3WVDB 4BY6C 4M75C 1QWFA 2DRMA 4ME7A 3EG1A 1MMDA 1VQ5A 2OTJQ 4BI3A 1YJ9A 3GPLA 3EG9B 1OV3A 3A8HB 4M7AD 1PD0A 3S3NA 3MP1A 4L59A 3C94A 2CT4A 5CKBA 2WSCE 1KD1U 2L5QA 2QASA 4M7DC 1WQWA 4R56A 2L2PA 1H92A 2XU8A 3LX7A 1K4US 5GMKj 1M30A 4EDUA 1WX6A 2ZAEA 3EG3A 3JCMJ 1A0NB 4HT9A 2HCKA 1K9MU 2P0QA 2C0IA 3EGXA 1Q82U 1ZQ1A 3ER0A 4KULA 2RQVA 2WACA 4DQ2A 1VA7A 1RAAB 3UDCA 1KC8U 2EYZA 2YRDA 3VV0A 3QSUA 1WHJA 1Q95G 1WFWA 3JCMV 1W2BA 1WXUA 4BDYA 2B8AA 4M77A 4M75G 1VYTA 1VQ6A 2RH2A 2RJDA 3MKDA 3NTIA 1ZUYA 2WSFE 1VQLA 3M0QA 1VQ5T 4KBMB 1YJ9T 3QDRB 1GCQA 3O5ZA 1M90U 3CD6Q 4MZTA 1C0MA 2L3PA 2L8DA 4DEXA 1MV3A 3RMSA 2JT4A 4J6YA 1BCMA 2P0KA 5I21A 1PKSA 1TUCA 4M7DG 2DZ9A 4C92E 1YBYA 2CP2A 2A08A 1IREB 2V1RA 1RLQC 3FRNA 3META 3H0HA 5LL6S 5KH6A 4R55A 3TU4K 1WA7A 2GQVA 1IRXA 1ZA2B 5KCHA 2CH4W 4KUDK 3QG1A 2OAUA 4N4IA 1X75C 4EMKB 2R5AA 4JRPA 2JN0A 4BI8B 4ESRA 5LJ3j 3MEWA 4PLIA 1YI2A 4C8QC 1VQ6T 2D8HA 3M0TA 2HKQB 1C1AA 3SWNC 3OY9A 3EAEA 2DE0X 1KIKA 2LZ6B 2XIDA 5KYXB 2X3WD 1KHCA 3A8MB 3ZL7C 3OYLA 1GXIE 4MZMA 2O31A 2RM4A 2V8IA 3SDZA 5J26A 2OJ2A 2EFIA 5KYYB 2MPXC 3T9NA 3OYKA 5D6YA 2GQIA 4BE0A 4O5VA 1QVFA 1DJ7B 1VQ5Q 1YJ9Q 5LJ5d 1D0ZA 3JCMc 2RO0A 1WNLA 3EG2A 1YP5A 3X24B 2RJEA 3I9QA 3CCRA 4DBFA 4F7UE 4E7JA 4RMOA 3NHNA 4ZGDB 2EPDA 1I81A 2ZPHB 1VQ8T 2QXFA 3F70A 1X6OA 3J81E 4C8QG 3JB9H 4XTVA 1YI2T 3NPFA 4N0AC 1M2VA 3UATA 2CREA 3GP8A 3I56T 1MNDA 1X01A 3O8VA 3NTKA 1QCFA 4HXJA 3CMET 2XHCA 4L5GA 1ZUUA 1LNXA 2QEXT 1U5SA 1FWZA 4PKCC 3G4SA 4NOYA 5DLQE 1W70A 3PTAA 1VQ6Q 3C95A 2KXCA 2X4YA 1OOTA 2YWWA 5GANg 4MDXA 3M0SA 3VS6A 3L2ZA 3OYGA 2F1LA 1Y07A 4M78D 3L1AA 1E7OA 3LW5E 1PSEA 1R0BG 1Y7XA 3CCRT 5KCOA 5DLOA 4M7DF 5FRMA 1YWOA 2RPNA 2LRQA 2EGAA 5CKHA 4D6WA 2A0FB 2ED1A 1FMWA 1WHKA 1Y96B 2JUFA 2QTXA 3PE0A 2QDYB 2CZ1B 1S72A 4PJOA 2E6NA 1N9SA 1I0CA 2QAZA 1D1AA 4M77G 4AFQC 2FYKA 2DRKA 2YHTA 3L2QA 2AZSA 1AOJA 1KD1R 2P4RA 3J80E 3G4ST 1VQ8Q 3H6ZA 2J6OA 2JXBA 5GAMd 1VQ4A 1YI2Q 1J3TA 5KYWB 2SEMA 2V8JA 4R0KA 1FYNA 3I56Q 4M7AC 1Q82R 4KGXB 2D0QB 2VC8A 5LJ3f 4WCIA 3CMEQ 1UHCA 3P8HA 2XK0A 2K3XA 5A2QE 2GCXA 1KC8R 2QEXQ 1JBMA 3QJYA 3FJPA 1Z9ZA 2LQWA 3QWYA 2Z0WA 1G3WA 5CAIA 2EW3A 4C5IA 4Z8AA 4C0GA 2AZVA 3OYYA 5FW9A 4B6MA 4PJJA 1W1FA 4ATOA 1TSFA 1PRMC 3HTRA 4FL6A 2CZ0B 1M4ZA 1M90R 5GAN4 2M9UA 1M3CA 4RTUA 5FU6C 2MWPA 5GMKl 4BY6B 2E65A 4M75B 2IPOB 1KHIA 3E19A 3CCRQ 3JB9G 3CCQT 1TS9A 3VS5A 1TH7A 3EGDB 1D3BA 4NL3A 1VQ7A 2DERA 2DKGA 1VQ4T 4BD3A 1JU5C 4IUQA 2RI5A 4A4EA 2DA9A 4UC4A 1GFCA 4ORZA 1ZSZB 4M7AG 5AYFA 2PUOB 4M7DB 3VYHB 1B34B 2EJGA 3MPUB 1VQMT 3G4SQ 2FRYA 2XICA 2F5KA 1ZBJA 2QK0A 4PFZA 1W2BS 2LJ0A 2PZ1A 1AZEA 3OYEA 3CPFA 2FZKB 4RCBA 1VQKA 1N9RA 1X6BA 1MMNA 4BUGA 4OB0B 2P84A 5IHNA 3FC3A 1NYFA 2NLUA 2DTIA 2GF7A 2NUTA 1K9AA 1VQ7T 1M3BA 1RL2A 2EIFA 2QA4A 3ZFJA 2LCLA 1I8FA 2FZCB 2M0YA 1WXBA 2L0AA 1VYVA 5GAOm 4ZN1A 1RUWA 2KXDA 3M0PA 1G5VA 1SG5A 4E7KA 2VWFA 1EFNA 2DTHA 2DXBA 3J7AF 2OI3A 1RADB 1YIJT 2K2MA 1P92A 4GY5A 4M77F 2VGNA 3GBQA 2DD5A 2JMAA 1IGQA 2HNIA 1G3TA 1YJNA 3EFOA 3LLRA 4IURA 3RERA 2DJZA 2Y4YA 1FMKA 3L2RA 2QQAA 4LUDA 1K1ZA 4JS4A 1VQ4Q 5CQYA 4E7ZA 3GF5A 5GMKe 3LH0A 1PC0A 5GANe 5IHKA 2DZCA 4OMMA 2JOYA 2DF6A 2ZPGB 3JCMb 2RA2A 2QYZA 3KUFA 4X9DA 3P8DA 1H3HA 1JJ2P 2ZCFB 4AFSC 4E7SA 3SFMA 1Q86U 5GANh 1UGVA 1IO6A 3H0IA 1YITA 4OMLA 1N5ZA 4C8QB 3EHRA 4ANJA 5IH2A 2HL3A 2V8KA 1BI0A 4RG8A 2CP5A 3SWNB 4A63B 3L2UA 1VQMQ 2A7YA 2VYTA 1I4K1 2GTJA 1MHNA 5FWCA 1QMCA 2AT1B 3G71A 2QA4T 2VKNA 4LDWA 4KGZB 5CR2A 4C92A 3GLXA 3RR6A
chains in the Genus database with same CATH topology
1M30A 2EQIA 1WX6A 2CDTA 3EG3A 4Z88A 1A0NB 2HCKA 3VS7A 4J9EA 2DLPA 1YNZA 2VVKA 4OMQA 3UF4A 3VRZA 2C0IA 2GTOA 1YWPA 2FPFA 2KGTA 2RQVA 5FWBA 2IIMA 2A28A 1VA7A 2GGRA 4Y92A 2KE9A 2EYZA 1ABOA 2D0NA 3CQTA 4RTYA 1ARKA 2FRWA 4OMOA 4K11A 1QWEA 1WFWA 1WXUA 2HDAA 2KR3A 4HVUA 1VYTA 1ZUYA 1VYUA 1H8KA 4LUEA 2J6FA 3M0QA 4AG1C 1ZX6A 2KT8A 1QLYA 2K79A 1YCSB 1GCQA 3O5ZA 2KROA 2BTTA 3M0UA 2JM9A 2L3PA 4DEXA 1MV3A 2JT4A 3H0FA 2DJQA 2JM8A 2MOXA 4J9FA 1PKSA 3H41A 1S1NA 1TUCA 4JJCA 4FSSA 5GJWB 2KRNA 2LCSA 2A08A 2ROTA 2V1RA 2YT6A 3R6NA 1RLQC 2M51A 3EGUA 3EHQA 2MIOA 3H0HA 3UA6A 1QKWA 1SSHA 3VRYA 1UJYA 3REBB 1UFFA 1M3AA 4J9CA 1WA7A 3SEMA 2EKHA 2CH4W 3VS4A 1OPKA 4RTWA 5ECAA 1SHGA 4ESRA 2LQNA 1KFZA 2LMJA 1YN8A 2RN8A 1MUZA 2D8HA 3M0TA 2C0TA 2ABLA 2DE0X 1KIKA 3TSWA 2LZ6B 3NMZC 2X3WD 2K3BA 1Z9QA 4LNPA 4OMNA 2O2OA 1UECA 2DM1A 2JW4A 4CC7A 3ZL7C 2DL3A 2BZXA 2EYXA 2FG0A 2J06A 1WIEA 2ROLA 2O31A 1UJ0A 2HBWA 1I1JA 1MV0B 2OJ2A 2EGCA 2A37A 2GQIA 1NLOC 2CSIA 2D1XA 1SHFA 5I11A 1OEBA 2ENMA 1HJDA 1WLPB 1CKAA 5I22A 1AEYA 2J7IA 1CKBA 4ZNXA 3EG2A 1YP5A 2LNHB 5IHIA 3I9QA 2EBPA 3NHNA 1T3SA 2EPDA 1UTIA 4LE9A 4RTZA 1BK2A 4JPBW 4D8DA 2LP5A 4IIOA 4CC4B 3NPFA 1ZUKA 4J9HA 3FJ5A 3REAB 2DL7A 3UATA 2CREA 4RTXA 1QCFA 2G6FX 4HXJA 2D8JA 3TSZA 3RBBB 2AKLA 1ZUUA 2F2XA 2X3XD 1U5SA 2CSQA 2EGEA 1V1CA 2DNUA 1XOVA 1W70A 1SRLA 1NYGA 5IXBA 2AKKA 2K9GA 2CH4A 2KXCA 1NEGA 1CSKA 2GNCA 1OOTA 2KNBB 2KEAA 1I07A 2J05A 2KRMA 3M0SA 3VS1A 3VS6A 4GBQA 2AK5A 1E7OA 4EIKA 4RTTA 3I35A 2MCNA 2HSPA 1YWOA 2RPNA 1BB9A 1AZGB 1LCKA 4QT7A 2EGAA 2E5KA 3KFVA 2DILA 2ED1A 2RMOA 1AWXA 1X2QA 2DL5A 2W10A 3PE0A 2B86A 2CT3A 1AD5A 2KRSA 2YUNA 1KSWA 2F2VA 1U3OA 1I0CA 2JS0A 4AFQC 2EYWA 2DRKA 1WDXA 2O88A 2AZSA 1AOJA 2YDLA 2ED0A 2P4RA 2YUPA 1X27A 2BZ8A 3PVQA 4HVVA 2J6OA 1JEGA 2JXBA 1OPLA 2K6DA 1GL5A 3IQLA 4KRTA 2OAWA 1J3TA 1K0SA 2DBMA 1AVZC 1GFDA 2SEMA 4R0KA 2DBKA 2BZYA 2L3SA 2RNAA 1FYNA 1T0HA 1HD3A 2FPDA 1PWTA 2JTEA 1Y0MA 2DL4A 1AWWA 1RLPC 1JXOA 1T0JA 4WCIA 1UHCA 4LN2A 4CC2A 1KJWA 2EVRA 1W6XA 4F17A 4DEYA 2LX7A 1Z9ZA 2LQWA 2LJ1A 3QWYA 2GBQA 3ULRB 1HSQA 2EW3A 4Z8AA 2QDLA 1X2KA 4J9BA 4F16A 2AZVA 1PNJA 2KYMA 5FW9A 1W1FA 1GCPA 1NLPC 1PRMC 2A36A 4RUGA 3M0RA 3JV3A 3UA7A 2KBTA 3VS3A 1M3CA 2KT1A 4RTUA 4J9GA 1WYXA 4HCKA 2W0ZA 3I5RA 2RQTA 4J9DA 1K76A 4D8KA 2CUDA 2PTKA 2YSQA 3VS5A 1UDLA 4M4ZA 2DYBA 1NG2A 2FO0A 1X6GA 1JU5C 2L3QA 1SRMA 2RQUA 1GBQA 2DA9A 3A98A 5L23A 1GFCA 4ORZA 1AWOA 2FPEA 1E6GA 1GCQC 2DVJA 1RI9A 1BU1A 1TG0A 2NUZA 4CC3A 4Z89A 1QKXA 3SHWA 1WI7A 2YUOA 1T3LA 4AG2C 1JQQA 2FRYA 2ECZA 1UUEA 1ZLMA 4E6RA 4F14A 3EG0A 1E6HA 1ZBJA 3C0CA 2JMCA 1B3QA 3U23A 3NGPA 3RNJA 1X69A 2LJ0A 2PZ1A 1ABQA 2JS2A 1AZEA 2RF0A 1UG1A 1X43A 2CUBA 1JXMA 1WXTA 3THKA 3VS0A 1AWJA 2RQWA 1X6BA 1JO8A 2FEIA 1UE9A 2H8HA 3LH5A 1PHTA 2HEQA 4J9IA 5IHNA 2XMFA 4IIMA 1NYFA 4OMPA 1G2BA 1M27C 3PVLA 1K9AA 2EYYA 4JZ3A 1M3BA 1M8MA 1SPKA 2O9SA 2M0YA 1WXBA 2I0NA 2F2WA 1VYVA 1Y57A 2J6KA 2L0AA 1RUWA 2KXDA 3M0PA 2SRCA 3I5SA 1G83A 2VWFA 2YUQA 4X1VA 3TVTA 4JZ4A 1EFNA 1BBZA 2OI3A 5GJVB 1GRIA 2K2MA 2DX1A 4AFUC 2KYBA 3GBQA 2PNIA 4JJDA 2JMAA 5HCKA 4RTVA 1K0XA 1ZSGA 2V1QA 1FMKA 3VS2A 4LUDA 1K1ZA 1U06A 4GLMA 5IHKA 1QWFA 2DRMA 4OMMA 5IXFA 2DF6A 2K7AA 3EG1A 1NM7A 1PKTA 1H3HA 4AFSC 3QWXX 1UGVA 2DL8A 1TUDA 1UHFA 1IO6A 2NWMA 2RQRA 3H0IA 1N5ZA 4HVWA 4OMLA 1NEBA 3EHRA 1OV3A 5IH2A 1B07A 4A63B 4JJBA 2C0OA 1PRLC 2CT4A 5EC7A 2LJ3A 2GTJA 1SEMA 1GBRA 2O9VA 5FWCA 2L2PA 2ESWA 2DMOA 2VKNA 1H92A 4AFZC 1K4US
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M30 A;  2EQI A;  1WX6 A;  2CDT A;  3EG3 A;  4Z88 A;  1A0N B;  2HCK A;  3VS7 A;  4J9E A;  2DLP A;  1YNZ A;  2VVK A;  4OMQ A;  3UF4 A;  3VRZ A;  2C0I A;  2GTO A;  1YWP A;  2FPF A;  2KGT A;  2RQV A;  5FWB A;  2IIM A;  2A28 A;  1VA7 A;  2GGR A;  4Y92 A;  2KE9 A;  2EYZ A;  1ABO A;  2D0N A;  3CQT A;  4RTY A;  1ARK A;  2FRW A;  4OMO A;  4K11 A;  1QWE A;  1WFW A;  1WXU A;  2HDA A;  2KR3 A;  4HVU A;  1VYT A;  1ZUY A;  1VYU A;  1H8K A;  4LUE A;  2J6F A;  3M0Q A;  4AG1 C;  1ZX6 A;  2KT8 A;  1QLY A;  2K79 A;  1YCS B;  1GCQ A;  3O5Z A;  2KRO A;  2BTT A;  3M0U A;  2JM9 A;  2L3P A;  4DEX A;  1MV3 A;  2JT4 A;  3H0F A;  2DJQ A;  2JM8 A;  2MOX A;  4J9F A;  1PKS A;  3H41 A;  1S1N A;  1TUC A;  4JJC A;  4FSS A;  5GJW B;  2KRN A;  2LCS A;  2A08 A;  2ROT A;  2V1R A;  2YT6 A;  3R6N A;  1RLQ C;  2M51 A;  3EGU A;  3EHQ A;  2MIO A;  3H0H A;  3UA6 A;  1QKW A;  1SSH A;  3VRY A;  1UJY A;  3REB B;  1UFF A;  1M3A A;  4J9C A;  1WA7 A;  3SEM A;  2EKH A;  2CH4 W;  3VS4 A;  1OPK A;  4RTW A;  5ECA A;  1SHG A;  4ESR A;  2LQN A;  1KFZ A;  2LMJ A;  1YN8 A;  2RN8 A;  1MUZ A;  2D8H A;  3M0T A;  2C0T A;  2ABL A;  2DE0 X;  1KIK A;  3TSW A;  2LZ6 B;  3NMZ C;  2X3W D;  2K3B A;  1Z9Q A;  4LNP A;  4OMN A;  2O2O A;  1UEC A;  2DM1 A;  2JW4 A;  4CC7 A;  3ZL7 C;  2DL3 A;  2BZX A;  2EYX A;  2FG0 A;  2J06 A;  1WIE A;  2ROL A;  2O31 A;  1UJ0 A;  2HBW A;  1I1J A;  1MV0 B;  2OJ2 A;  2EGC A;  2A37 A;  2GQI A;  1NLO C;  2CSI A;  2D1X A;  1SHF A;  5I11 A;  1OEB A;  2ENM A;  1HJD A;  1WLP B;  1CKA A;  5I22 A;  1AEY A;  2J7I A;  1CKB A;  4ZNX A;  3EG2 A;  1YP5 A;  2LNH B;  5IHI A;  3I9Q A;  2EBP A;  3NHN A;  1T3S A;  2EPD A;  1UTI A;  4LE9 A;  4RTZ A;  1BK2 A;  4JPB W;  4D8D A;  2LP5 A;  4IIO A;  4CC4 B;  3NPF A;  1ZUK A;  4J9H A;  3FJ5 A;  3REA B;  2DL7 A;  3UAT A;  2CRE A;  4RTX A;  1QCF A;  2G6F X;  4HXJ A;  2D8J A;  3TSZ A;  3RBB B;  2AKL A;  1ZUU A;  2F2X A;  2X3X D;  1U5S A;  2CSQ A;  2EGE A;  1V1C A;  2DNU A;  1XOV A;  1W70 A;  1SRL A;  1NYG A;  5IXB A;  2AKK A;  2K9G A;  2CH4 A;  2KXC A;  1NEG A;  1CSK A;  2GNC A;  1OOT A;  2KNB B;  2KEA A;  1I07 A;  2J05 A;  2KRM A;  3M0S A;  3VS1 A;  3VS6 A;  4GBQ A;  2AK5 A;  1E7O A;  4EIK A;  4RTT A;  3I35 A;  2MCN A;  2HSP A;  1YWO A;  2RPN A;  1BB9 A;  1AZG B;  1LCK A;  4QT7 A;  2EGA A;  2E5K A;  3KFV A;  2DIL A;  2ED1 A;  2RMO A;  1AWX A;  1X2Q A;  2DL5 A;  2W10 A;  3PE0 A;  2B86 A;  2CT3 A;  1AD5 A;  2KRS A;  2YUN A;  1KSW A;  2F2V A;  1U3O A;  1I0C A;  2JS0 A;  4AFQ C;  2EYW A;  2DRK A;  1WDX A;  2O88 A;  2AZS A;  1AOJ A;  2YDL A;  2ED0 A;  2P4R A;  2YUP A;  1X27 A;  2BZ8 A;  3PVQ A;  4HVV A;  2J6O A;  1JEG A;  2JXB A;  1OPL A;  2K6D A;  1GL5 A;  3IQL A;  4KRT A;  2OAW A;  1J3T A;  1K0S A;  2DBM A;  1AVZ C;  1GFD A;  2SEM A;  4R0K A;  2DBK A;  2BZY A;  2L3S A;  2RNA A;  1FYN A;  1T0H A;  1HD3 A;  2FPD A;  1PWT A;  2JTE A;  1Y0M A;  2DL4 A;  1AWW A;  1RLP C;  1JXO A;  1T0J A;  4WCI A;  1UHC A;  4LN2 A;  4CC2 A;  1KJW A;  2EVR A;  1W6X A;  4F17 A;  4DEY A;  2LX7 A;  1Z9Z A;  2LQW A;  2LJ1 A;  3QWY A;  2GBQ A;  3ULR B;  1HSQ A;  2EW3 A;  4Z8A A;  2QDL A;  1X2K A;  4J9B A;  4F16 A;  2AZV A;  1PNJ A;  2KYM A;  5FW9 A;  1W1F A;  1GCP A;  1NLP C;  1PRM C;  2A36 A;  4RUG A;  3M0R A;  3JV3 A;  3UA7 A;  2KBT A;  3VS3 A;  1M3C A;  2KT1 A;  4RTU A;  4J9G A;  1WYX A;  4HCK A;  2W0Z A;  3I5R A;  2RQT A;  4J9D A;  1K76 A;  4D8K A;  2CUD A;  2PTK A;  2YSQ A;  3VS5 A;  1UDL A;  4M4Z A;  2DYB A;  1NG2 A;  2FO0 A;  1X6G A;  1JU5 C;  2L3Q A;  1SRM A;  2RQU A;  1GBQ A;  2DA9 A;  3A98 A;  5L23 A;  1GFC A;  4ORZ A;  1AWO A;  2FPE A;  1E6G A;  1GCQ C;  2DVJ A;  1RI9 A;  1BU1 A;  1TG0 A;  2NUZ A;  4CC3 A;  4Z89 A;  1QKX A;  3SHW A;  1WI7 A;  2YUO A;  1T3L A;  4AG2 C;  1JQQ A;  2FRY A;  2ECZ A;  1UUE A;  1ZLM A;  4E6R A;  4F14 A;  3EG0 A;  1E6H A;  1ZBJ A;  3C0C A;  2JMC A;  1B3Q A;  3U23 A;  3NGP A;  3RNJ A;  1X69 A;  2LJ0 A;  2PZ1 A;  1ABQ A;  2JS2 A;  1AZE A;  2RF0 A;  1UG1 A;  1X43 A;  2CUB A;  1JXM A;  1WXT A;  3THK A;  3VS0 A;  1AWJ A;  2RQW A;  1X6B A;  1JO8 A;  2FEI A;  1UE9 A;  2H8H A;  3LH5 A;  1PHT A;  2HEQ A;  4J9I A;  5IHN A;  2XMF A;  4IIM A;  1NYF A;  4OMP A;  1G2B A;  1M27 C;  3PVL A;  1K9A A;  2EYY A;  4JZ3 A;  1M3B A;  1M8M A;  1SPK A;  2O9S A;  2M0Y A;  1WXB A;  2I0N A;  2F2W A;  1VYV A;  1Y57 A;  2J6K A;  2L0A A;  1RUW A;  2KXD A;  3M0P A;  2SRC A;  3I5S A;  1G83 A;  2VWF A;  2YUQ A;  4X1V A;  3TVT A;  4JZ4 A;  1EFN A;  1BBZ A;  2OI3 A;  5GJV B;  1GRI A;  2K2M A;  2DX1 A;  4AFU C;  2KYB A;  3GBQ A;  2PNI A;  4JJD A;  2JMA A;  5HCK A;  4RTV A;  1K0X A;  1ZSG A;  2V1Q A;  1FMK A;  3VS2 A;  4LUD A;  1K1Z A;  1U06 A;  4GLM A;  5IHK A;  1QWF A;  2DRM A;  4OMM A;  5IXF A;  2DF6 A;  2K7A A;  3EG1 A;  1NM7 A;  1PKT A;  1H3H A;  4AFS C;  3QWX X;  1UGV A;  2DL8 A;  1TUD A;  1UHF A;  1IO6 A;  2NWM A;  2RQR A;  3H0I A;  1N5Z A;  4HVW A;  4OML A;  1NEB A;  3EHR A;  1OV3 A;  5IH2 A;  1B07 A;  4A63 B;  4JJB A;  2C0O A;  1PRL C;  2CT4 A;  5EC7 A;  2LJ3 A;  2GTJ A;  1SEM A;  1GBR A;  2O9V A;  5FWC A;  2L2P A;  2ESW A;  2DMO A;  2VKN A;  1H92 A;  4AFZ C;  1K4U S; 
#chains in the Genus database with same CATH topology
 1G3S A;  3M58 A;  4Z88 A;  2KSS A;  1I5O B;  1YNZ A;  3PMI A;  1QVF S;  2VVK A;  3FDR A;  4OMQ A;  4RG2 A;  2GTO A;  3CMA A;  1YWP A;  2OX7 A;  3AHU A;  2YLC A;  3JB9 J;  3UWN A;  5FWB A;  2IIM A;  3OQ5 A;  3I55 A;  1YJN T;  2A28 A;  1ABO A;  4FCY A;  1VUB A;  2PVD B;  1K73 U;  2FRW A;  1IGU A;  1VOM A;  1QWE A;  1PD1 A;  3S3O A;  3HRU A;  3X20 B;  1VQ7 Q;  4BE1 A;  2LVM A;  2OTL A;  4M77 D;  3A8O B;  4M78 C;  4AG1 C;  2L89 A;  4M7A F;  2HMA A;  1YIJ Q;  1QQJ A;  2DIG A;  3M0U A;  2CZ7 B;  3Q1J A;  4J7I A;  2DEQ A;  2JM8 A;  5CK9 A;  1SF9 A;  2ROT A;  4M77 B;  1MMG A;  2E6Z A;  2O4X B;  3EGU A;  3UA6 A;  5HY6 A;  3OMC A;  2KDS A;  3MCA B;  5CO7 A;  2HBP A;  5GAO p;  3REB B;  5IAY A;  3VUZ A;  3JRZ A;  1QVP A;  3BE3 A;  1KD1 C;  3CMA T;  2E3I A;  3OW2 A;  3VS4 A;  3I55 T;  1SHG A;  5EG2 A;  2K5F A;  4GLK A;  3PIO A;  2DEU A;  2QA4 Q;  1WHL A;  4F7U A;  2P4T A;  4PJN A;  4M78 G;  2ZPI B;  1Q82 C;  3X28 B;  1M1F A;  4C0Z A;  3VJP A;  4EMG A;  4J8O A;  4LNP A;  3JCM P;  1KC8 C;  3JCM X;  4QQ6 A;  3G6E A;  3CCS A;  2O2O A;  1UEC A;  2DM1 A;  5LJ3 d;  1YJN Q;  3CBM A;  2DL3 A;  2FG0 A;  2J06 A;  1WIE A;  2Y90 A;  2HBW A;  1I1J A;  3PGG A;  2EGC A;  1M90 C;  4AMC A;  2X4J A;  4OGC A;  1NLO C;  2CSI A;  3MEA A;  2D9T A;  2F5T X;  3DB4 A;  1D0Y A;  3RUX A;  1ZSZ C;  2YXY A;  4A54 A;  3OS0 A;  3QO3 A;  1HJD A;  1WLP B;  1CKA A;  2J7I A;  3JCM W;  1OX9 A;  4KT0 E;  5GAN j;  2NYS A;  4PJO F;  2EQU A;  4M7A B;  4LE9 A;  1IB8 A;  1UEB A;  4RTZ A;  5J3B A;  1D09 B;  2HSE B;  4IIO A;  4CC4 B;  1RAF B;  2X51 A;  1ZUK A;  2DFU A;  4J9H A;  3OBW A;  1XQH A;  2RHI A;  1BIB A;  3HRS A;  3TSZ A;  3CCU A;  3CMA Q;  4IKF A;  4OB2 B;  3CCS T;  2BE7 D;  2F2X A;  3I55 Q;  4Y28 E;  2CSQ A;  2EGE A;  2H3J A;  2DNU A;  4ZTJ A;  5FU6 B;  1XOV A;  4M75 E;  4XTX A;  1UGS B;  4OVA A;  2BUD A;  1NYG A;  4WF2 A;  5IXB A;  2JTM A;  2E3H A;  2AKK A;  3CEY A;  1Q7Y U;  1RAB B;  2GNC A;  2KEA A;  4J6X A;  5D6W A;  2J05 A;  4XU1 A;  3V7C A;  3VS1 A;  3ZEH A;  2AK5 A;  4OF1 A;  2DPP B;  4M7D E;  2NUP B;  3VU3 C;  3INZ A;  1LCK A;  5GAN 7;  3KFV A;  2HAX A;  2W10 A;  1Q86 R;  2RB6 A;  3L2W A;  2KRS A;  3MHX A;  3NTH A;  2KQW A;  3CCU T;  5L8R E;  2MK5 A;  5FU7 C;  5GAN 3;  2EYW A;  5A0D A;  4PJO D;  1WDX A;  3OMG A;  1VQL T;  2QQR A;  2VGM A;  3C4S A;  3PFS A;  3OYC A;  2HQH A;  1XTD A;  3QBY A;  3EG9 A;  5CKF A;  4E7I A;  1OPL A;  2K6D A;  4JRI A;  2WSE E;  2CKK A;  3IQL A;  1QW1 A;  4X34 A;  3V7R A;  1K0S A;  2ZGW A;  4M78 F;  4F04 B;  2F69 A;  2DBK A;  2L3S A;  3V8J A;  5C0M A;  1PWT A;  1IHV A;  1JJ2 A;  1Y0M A;  1RLP C;  2YLB A;  1BI2 A;  3OBY A;  3CCS Q;  2DIQ A;  4DEY A;  3OSV A;  4A4G A;  1K73 R;  2LX7 A;  2LJ1 A;  3P8B B;  1WJQ A;  2QDL A;  4FT4 A;  1R0C B;  1N8R R;  3KBG A;  4E2F B;  3FB9 A;  2LX9 A;  1NLP C;  4ZGE B;  2DVE A;  4CRI A;  1QCN A;  5HK0 A;  3JV3 A;  1NJI R;  1UGP B;  3EH1 A;  2X35 A;  5CVI A;  2KT1 A;  2HZY A;  4PJM A;  5I2S A;  2K4Y A;  2W0Z A;  3I5R A;  2HQX A;  4O6J A;  1K76 A;  1U1S A;  2CUD A;  2PTK A;  2YSQ A;  2MI6 A;  5C6S A;  4C8Q E;  2AHJ B;  2DXT A;  3M53 A;  4M77 C;  1BI1 A;  5FRN A;  2FO0 A;  1RAH B;  2EWN A;  4FYV B;  1GBQ A;  3A98 A;  5L23 A;  5GAN f;  1AWO A;  2VV5 A;  1GCQ C;  2ZZD A;  3MO8 A;  4B9X A;  3ZBD A;  3CCU Q;  3OYH A;  4JUV A;  2DXU A;  5GAO q;  2QGF B;  1QKX A;  1VQL Q;  1F1B B;  1JRI A;  1WI7 A;  4Y91 A;  2R58 A;  1UUE A;  4E6R A;  3V8L A;  3RKW A;  3EG0 A;  1E6H A;  4DBR A;  1KQS A;  3NGP A;  3HSB A;  2RI3 A;  1WHH A;  2BIV A;  3FIF A;  4EMK A;  2CUB A;  1WXT A;  3GOX A;  4RCC A;  3OYJ A;  2RQW A;  4C92 F;  3LH5 A;  4KH1 B;  2LDM A;  4M78 B;  2HKN A;  1G2B A;  4MDW A;  1ZHI A;  2FL7 A;  3OW2 P;  4E47 A;  1EZZ B;  2F2W A;  2I0N A;  1Y57 A;  2SRC A;  1O9S A;  2YUQ A;  1BBZ A;  1BYM A;  4AFU C;  2KYB A;  5J39 A;  1WHM A;  4ZGJ B;  3E2U A;  1YHQ A;  2PNI A;  2DK3 A;  5KYY A;  5HCK A;  2K5L A;  1ZSG A;  3OW2 S;  3GNG A;  2V1Q A;  2NUT B;  3VS2 A;  1WHG A;  5LJ5 j;  5IXF A;  1NM7 A;  1RAC B;  2Y4X A;  4FW2 A;  4HCC A;  3QWX X;  4FM4 B;  1TUD A;  1UHF A;  2RQR A;  3DB3 A;  2DXC A;  4HVW A;  1JB0 E;  1B07 A;  1OZ2 A;  1S72 T;  2LJ3 A;  5HK3 A;  1Q7Y R;  1ACM B;  4MMK A;  1M5Q 1;  1BIA A;  6AT1 B;  5GAN 8;  2CDT A;  4C92 D;  1R77 A;  3VS7 A;  2CP7 A;  4J9E A;  1WQ7 A;  3UF4 A;  2IVW A;  3VRZ A;  4J5Y A;  5GAN 5;  1Y71 A;  3FLG A;  3H8Z A;  3WVE B;  1QP2 A;  2KGT A;  4JJN K;  4QQG A;  3M59 A;  2GGR A;  4Y92 A;  2KE9 A;  1FXX A;  2MMP A;  3UPU A;  3CQT A;  3FEO A;  3CCV A;  1ARK A;  4OMO A;  4K11 A;  2HQE A;  2HDA A;  2GFU A;  1M1K U;  2KR3 A;  4PL6 A;  4HVU A;  5A0L A;  1MMA A;  4XU0 A;  1XJW B;  2COW A;  4LUE A;  3V8K A;  1H8K A;  4M7A E;  2J6F A;  1B7T A;  3HKS A;  1ZX6 A;  3CPW A;  2K79 A;  1YCS B;  4JS5 A;  2KRO A;  2BTT A;  2EJF A;  2LTO A;  4JRK A;  4PK4 A;  1Y96 A;  2DJQ A;  2MOX A;  3OYB A;  3H41 A;  1S1N A;  2COZ A;  1FX7 A;  4FSS A;  5GJW B;  2KRN A;  1PG5 B;  2PVO B;  2YT6 A;  3PMT A;  1Q86 C;  3EHQ A;  2MIO A;  4FW1 A;  1QKW A;  1OQK A;  1H3Z A;  4PJO C;  3CC7 A;  2E70 A;  4J9C A;  3QPH A;  1EX4 A;  2QQS A;  1NE8 A;  3SEM A;  5HKC A;  2EKH A;  1S72 Q;  4RTW A;  3OS1 A;  5KYW A;  2MF2 A;  3GIB A;  1BI3 A;  2LQN A;  4HKE A;  3DLM A;  2JZ2 A;  1KFZ A;  3L2V A;  2RN8 A;  1U1T A;  3OYD A;  3BDL A;  1W4S A;  2MYS A;  2BKD N;  2ABL A;  5KYU B;  2K57 A;  2DAQ A;  1RAG B;  4A4K A;  3TSW A;  5D7U A;  3NMZ C;  3GNF B;  1VQO A;  2K3B A;  1M1G A;  3JCM Q;  2DET A;  1K73 C;  4OMN A;  2CS7 A;  4MZP A;  4KGV B;  2XD0 A;  4OB1 B;  2EJ9 A;  2RI2 A;  2EYX A;  3RKX A;  1VQK T;  2OTJ A;  4LDV A;  3JB9 I;  1OX8 A;  1MV0 B;  3M4G A;  3BDU A;  5FU7 B;  1LOJ A;  4BDZ A;  4FYX B;  4E7L A;  1NJI C;  3JCM e;  2R5M A;  4M75 A;  4PJO G;  2D1X A;  5I11 A;  2KK4 A;  2ENM A;  4IUT A;  2XDP A;  3EGD A;  3JCM h;  4ZNX A;  2LNH B;  5IHI A;  1TXQ A;  1JJ2 S;  5LJ5 f;  4MML A;  2LT1 A;  2EBP A;  1T3S A;  4FYY B;  2M16 A;  2CP0 A;  2E1H A;  4M7D A;  4LD6 A;  4A53 A;  3QII A;  5LJ5 g;  1B34 A;  3FJ5 A;  4ZN3 A;  2DL7 A;  3HP9 A;  4XK8 E;  5FLX E;  1QP3 A;  3UT1 A;  3CCJ A;  4A4H A;  2D8J A;  5GAN d;  1RAE B;  1N8R U;  3QHS A;  4B9W A;  2AKL A;  4FIB A;  3HHT B;  4XTW A;  4QVD A;  3OYM A;  2X3X D;  1V1C A;  1RAI B;  3CBO A;  1NJI U;  4IUU A;  1YIT T;  1LPL A;  3EGX B;  2PQW A;  4FT2 A;  1HK9 A;  2BE9 B;  2K9G A;  3OYN A;  5DY9 A;  1KQS P;  3G71 T;  1EIF A;  4GBQ A;  1MNE A;  4EIK A;  2MCN A;  3PIP A;  4P5N A;  2AIR B;  1VQK Q;  4LDX A;  1AZG B;  4QT7 A;  1V76 A;  4JRQ A;  2E5K A;  3CC4 A;  2DIL A;  1WJR A;  2DO3 A;  1VQN A;  4ZTF A;  4ELZ C;  1KQS S;  1VIF A;  4OP0 A;  1AD5 A;  1KSW A;  3CCJ T;  3M56 A;  2CP6 A;  2DYI A;  3S3M A;  1KG1 A;  2JS0 A;  1VQ9 A;  2OTL T;  3SD4 A;  4JDS A;  2ED0 A;  1TTH B;  1X27 A;  3L42 A;  2LCC A;  4BI4 A;  3CBP A;  3PVQ A;  4HVV A;  2CYZ B;  2L3R A;  1JEG A;  4BE2 A;  1LVK A;  1NPP A;  4M78 E;  3X25 B;  4C8Q A;  2DBM A;  1AVZ C;  4JLI A;  5GAO n;  3SWN A;  3OYA A;  2RNA A;  3LYI A;  3MP8 A;  2DD4 A;  3QDF A;  2DL4 A;  1AWW A;  1T0J A;  4CC2 A;  1W6X A;  2FHD A;  4YTL A;  3RES A;  2QQ9 A;  4F17 A;  1Q81 U;  1Q7Y C;  1K8A U;  2GBQ A;  3CCM A;  5GAM g;  1M1K R;  1HSQ A;  2XKO C;  2MWO A;  1YIT Q;  4KH0 B;  3CC4 T;  2KYM A;  1VQN T;  4Z02 A;  4C92 C;  4V2S A;  2RHU A;  3JAM E;  4RUG A;  3ME9 A;  2FZG B;  3UA7 A;  2R57 A;  2KBT A;  3VS3 A;  3G71 Q;  1M2O A;  1WYX A;  1OU9 A;  1VQ9 T;  2RQT A;  4J9D A;  4KUI A;  4D8K A;  3TQ7 P;  2E5Q A;  4X9C A;  1UDL A;  4M4Z A;  1R8O B;  4N4G A;  1NG2 A;  3G6E T;  2L3Q A;  1G8X A;  4N0A A;  4LD9 K;  1SRM A;  3A5Z B;  1E6G A;  2DVJ A;  3CCJ Q;  5CIU A;  1RI9 A;  1BU1 A;  4FU6 A;  4CC3 A;  3HFN A;  3HL8 A;  4QW2 A;  4Z89 A;  2OTL Q;  3SHW A;  1M2V B;  3CPW P;  2O4X A;  2YUO A;  3QZ9 B;  4LDU A;  1JQQ A;  3CCM T;  4BB7 A;  2ECZ A;  4LDY A;  4DBQ A;  1IXD A;  2RHY A;  4DOW A;  2KAF A;  2COY A;  5DM7 R;  2RHZ A;  1ZLM A;  4C0D B;  4C92 G;  2KVQ G;  2JMC A;  1B3Q A;  3U23 A;  1X69 A;  2JS2 A;  3A8G B;  4PNO A;  5CCA A;  2RF0 A;  1X43 A;  1JXM A;  3E9F A;  3THK A;  9ATC B;  1AWJ A;  3CPW S;  4XAX B;  2H8H A;  1KQ2 A;  5IT9 E;  2HEQ A;  2YRC A;  4J9I A;  2XMF A;  4IIM A;  1IHW A;  2JTF A;  1AHJ B;  3G1J A;  3SB2 A;  1M27 C;  1OYX A;  3PVL A;  2EYY A;  5LJ5 e;  3CC4 Q;  1AT1 B;  1VQN Q;  1M8M A;  1SSF A;  1QVG P;  3HPW A;  2J6K A;  2VB6 A;  4X1V A;  5LJ5 h;  3TVT A;  4JZ4 A;  1YJW A;  4RKU E;  5GJV B;  1H64 1;  1VQ8 A;  1UGR B;  1VQ9 Q;  1NPR A;  4C5E A;  4XU2 A;  3S6W A;  4RTV A;  5FRO A;  4PJO B;  2IG0 A;  4BAC A;  4PLL A;  2VAS A;  1UGQ B;  3I56 A;  1QVG S;  3G6E Q;  1U06 A;  4GLM A;  1D0X A;  3CME A;  2K7A A;  2QEX A;  3MP6 A;  1PKT A;  3CXC P;  4M7A A;  2A3L A;  2DL8 A;  2NWM A;  2RD1 A;  2PU9 B;  2XDD A;  1NEB A;  4II1 A;  4IUV A;  4JJB A;  2C0O A;  1PRL C;  4OB3 B;  5EC7 A;  2QI2 A;  3CCM Q;  1MGQ A;  1IZ6 A;  3QYG B;  1OUL A;  1SEM A;  2H3E B;  4F7U G;  1GBR A;  2O9V A;  1OU8 A;  2ESW A;  2DMO A;  2QGG A;  4AFZ C;  1BCO A;  3CXC S;  4XTZ A;  2EQI A;  4PFP A;  2HL5 C;  3ASK A;  1YJW T;  3OS2 A;  2DLP A;  3A1P A;  5GAN 6;  3BW1 A;  3QUI A;  2FPF A;  2EAY A;  1HYO A;  3N5B B;  1M9S A;  2D0N A;  2LQ8 A;  2KMT A;  4RTY A;  5A0G A;  2JVV A;  5D6X A;  1TWB A;  1VYU A;  2M0O A;  2KT8 A;  2NUP A;  2LC4 A;  1G3Y A;  3JCM f;  1D3B B;  1QLY A;  3CCL A;  1SKU B;  2JM9 A;  3RIR A;  4M75 F;  2D6F A;  1LJO A;  5GAM e;  4TVR A;  3CCE A;  3H0F A;  4J9F A;  8AT1 B;  4J7F A;  3JCM g;  4JJC A;  3URG A;  4PJL A;  2LCS A;  3X26 B;  5GAM h;  2PVG B;  1KK7 A;  3R6N A;  4DOV A;  5KE2 A;  5GAO r;  4AT1 B;  2M51 A;  2RJC A;  3E1S A;  4LXC A;  1SSH A;  3VRY A;  4WTO B;  1UJY A;  2VXF A;  1UFF A;  3M54 A;  3HRT A;  2LNV A;  4JLG A;  5KYX A;  1M3A A;  2K3Y A;  4N4H A;  2EKO A;  2ATC B;  1N6A A;  2CGH A;  4J6W A;  1TU0 B;  1Q81 R;  1K8A R;  1OPK A;  5ECA A;  3PT9 A;  4M77 E;  3QYH B;  5GAO l;  3V7S A;  3H9N A;  5CKD A;  3M55 A;  3E9G A;  2LMJ A;  1YN8 A;  1MUZ A;  1WZO A;  2ZPF B;  2M1H A;  2C0T A;  3OS5 A;  2E41 A;  4FYW B;  4OMF B;  3CCQ A;  1YJW Q;  4EMH A;  2XG8 D;  1Z9Q A;  3CCL T;  3WXM B;  1M1K C;  3CCE T;  2JW4 A;  4CC7 A;  2RJF A;  2BZX A;  1K9M R;  2ROL A;  1UJ0 A;  3VKI A;  8ATC B;  2GFA A;  1HXD A;  2DTO A;  2A37 A;  3EFO B;  4QVC A;  5I2M A;  1SHF A;  1M8V A;  1VQM A;  1OEB A;  4XU3 A;  4XTY A;  4M75 D;  5I22 A;  1AEY A;  5CQX A;  1UB4 A;  1CKB A;  5LJ3 g;  5GAN 2;  3VUB A;  1YFN A;  2X9H A;  3MEU A;  2M02 A;  1U8R A;  1VQP A;  1UTI A;  5CKE A;  4F7U F;  1YHQ T;  1BK2 A;  4JPB W;  4C0D C;  4D8D A;  2LP5 A;  1OI1 A;  1ZA1 B;  2C06 A;  3QJ6 A;  4M7D D;  4XTU A;  3REA B;  1PSF A;  3CC2 A;  4NL2 A;  2X4W A;  4RTX A;  2G6F X;  4C8Q F;  3RDV A;  3RBB B;  4C92 B;  1YCY A;  4E7H A;  2VUB A;  1BKB A;  1W2B P;  1I5L A;  1SRL A;  1YIJ A;  1QCO A;  5KE3 A;  2G3R A;  5GMK i;  2CH4 A;  4DBH A;  1NEG A;  3M4Y A;  1CSK A;  2KNB B;  3QXE B;  4M78 A;  4EMK C;  1WPY A;  1I07 A;  2KRM A;  4HCZ A;  4PFO A;  7AT1 B;  2E64 A;  3CCL Q;  2FB7 A;  1PCX A;  2RK1 A;  3HFO A;  3CCE Q;  4RTT A;  3I35 A;  2HSP A;  4Q5W A;  1VQP T;  1BB9 A;  2QG9 B;  5KYN A;  2KY9 A;  3KXT A;  4C0F A;  2RMO A;  1AWX A;  1X2Q A;  1QVG A;  2DL5 A;  4A4F A;  3LGF A;  5GAM j;  1FMV A;  3CCV T;  2K5I A;  3CC2 T;  2B86 A;  2CT3 A;  1C6V X;  1D1B A;  3OYI A;  2YUN A;  2F2V A;  2QTV A;  1U3O A;  4QVZ A;  3QZ5 B;  3PNW C;  2O88 A;  2FVU A;  2XDB A;  2YDL A;  1WGS A;  2YUP A;  2LQK A;  5IN1 A;  2BZ8 A;  1YHQ Q;  2O01 E;  1GL5 A;  2JJ9 A;  2RK2 A;  4KRT A;  2OAW A;  3OSS C;  2CZ6 B;  1GFD A;  2LT4 A;  1N8R C;  3CCQ Q;  3EH2 A;  2BZY A;  1V29 B;  4C8Q D;  1T0H A;  3MEV A;  1HD3 A;  2FPD A;  3C12 A;  3CXC A;  3OB9 A;  2JTE A;  3MJX A;  2KI7 A;  4F7U B;  1JXO A;  1ZBX A;  2CP3 A;  4LN2 A;  1NZ9 A;  3LWH A;  1KJW A;  4C5G A;  2EVR A;  2K2V A;  3BY7 A;  1OZ3 A;  4ELY C;  3CC7 T;  3ULR B;  3M57 A;  4J9B A;  4QQD A;  1X2K A;  4L6V 5;  4NS5 A;  4F16 A;  5GMK h;  1O75 A;  1PNJ A;  2E12 A;  2EQK A;  3VYG A;  4PJO E;  3OYF A;  1GCP A;  1QVF P;  2A36 A;  2EQJ A;  3M0R A;  5GMK m;  1ZSZ A;  4J83 A;  4J9G A;  2E4H A;  2EYQ A;  4HCK A;  4VUB A;  4OGE A;  2JNG A;  4HT8 A;  2PUK B;  5AT1 B;  1VQO T;  1VQP Q;  2DYB A;  3RKY A;  1D1C A;  3JSC A;  2XI9 A;  3EFR A;  3BFM A;  1X6G A;  1RI0 A;  2RQU A;  2P0P A;  3CCV Q;  3CC2 Q;  3JB9 F;  3LWI A;  2FPE A;  2OTJ T;  3M9Q A;  1VIE A;  3LGL A;  1TG0 A;  4XQ3 A;  2NUZ A;  3CD6 A;  3JCM d;  1KQ1 A;  1NBE B;  2RHX A;  3M5A A;  3TCJ A;  3TEE A;  1TUG B;  1T3L A;  4AG2 C;  3DKM A;  5M9O A;  3DLL A;  4F14 A;  4C5H A;  2EQM A;  3NFC A;  3C0C A;  3G7Z A;  3R6O A;  3RNJ A;  1ABQ A;  3A8L B;  3AT1 B;  2MAM A;  5LJ3 e;  3D7S B;  4HCB A;  1UG1 A;  1Q81 C;  3QKJ A;  3VS0 A;  1K8A C;  2X4X A;  2FEI A;  1JO8 A;  1UE9 A;  1WJS A;  1PHT A;  2ZPE B;  5LJ3 h;  1N27 A;  4OMP A;  3CC7 Q;  5KYU A;  4DA4 A;  2E10 A;  4JZ3 A;  1SPK A;  4CI0 C;  2O9S A;  4HA8 A;  2QQB A;  2V26 A;  2HD0 A;  3RMQ A;  3I5S A;  4QKU A;  1G83 A;  2VXE A;  1GRI A;  1TOV A;  2DX1 A;  3EFS A;  4FSX A;  2I2L A;  3CD6 T;  4EPC A;  4JJD A;  2YRV A;  1PM3 A;  1K9M C;  1XNI A;  1K0X A;  1VQO Q;  5GAM f;  2ZPB B;  3TRE A;  3OA6 A;  4IUP A;  3JB9 D;  3WVD B;  4BY6 C;  4M75 C;  1QWF A;  2DRM A;  4ME7 A;  3EG1 A;  1MMD A;  1VQ5 A;  2OTJ Q;  4BI3 A;  1YJ9 A;  3GPL A;  3EG9 B;  1OV3 A;  3A8H B;  4M7A D;  1PD0 A;  3S3N A;  3MP1 A;  4L59 A;  3C94 A;  2CT4 A;  5CKB A;  2WSC E;  1KD1 U;  2L5Q A;  2QAS A;  4M7D C;  1WQW A;  4R56 A;  2L2P A;  1H92 A;  2XU8 A;  3LX7 A;  1K4U S;  5GMK j;  1M30 A;  4EDU A;  1WX6 A;  2ZAE A;  3EG3 A;  3JCM J;  1A0N B;  4HT9 A;  2HCK A;  1K9M U;  2P0Q A;  2C0I A;  3EGX A;  1Q82 U;  1ZQ1 A;  3ER0 A;  4KUL A;  2RQV A;  2WAC A;  4DQ2 A;  1VA7 A;  1RAA B;  3UDC A;  1KC8 U;  2EYZ A;  2YRD A;  3VV0 A;  3QSU A;  1WHJ A;  1Q95 G;  1WFW A;  3JCM V;  1W2B A;  1WXU A;  4BDY A;  2B8A A;  4M77 A;  4M75 G;  1VYT A;  1VQ6 A;  2RH2 A;  2RJD A;  3MKD A;  3NTI A;  1ZUY A;  2WSF E;  1VQL A;  3M0Q A;  1VQ5 T;  4KBM B;  1YJ9 T;  3QDR B;  1GCQ A;  3O5Z A;  1M90 U;  3CD6 Q;  4MZT A;  1C0M A;  2L3P A;  2L8D A;  4DEX A;  1MV3 A;  3RMS A;  2JT4 A;  4J6Y A;  1BCM A;  2P0K A;  5I21 A;  1PKS A;  1TUC A;  4M7D G;  2DZ9 A;  4C92 E;  1YBY A;  2CP2 A;  2A08 A;  1IRE B;  2V1R A;  1RLQ C;  3FRN A;  3MET A;  3H0H A;  5LL6 S;  5KH6 A;  4R55 A;  3TU4 K;  1WA7 A;  2GQV A;  1IRX A;  1ZA2 B;  5KCH A;  2CH4 W;  4KUD K;  3QG1 A;  2OAU A;  4N4I A;  1X75 C;  4EMK B;  2R5A A;  4JRP A;  2JN0 A;  4BI8 B;  4ESR A;  5LJ3 j;  3MEW A;  4PLI A;  1YI2 A;  4C8Q C;  1VQ6 T;  2D8H A;  3M0T A;  2HKQ B;  1C1A A;  3SWN C;  3OY9 A;  3EAE A;  2DE0 X;  1KIK A;  2LZ6 B;  2XID A;  5KYX B;  2X3W D;  1KHC A;  3A8M B;  3ZL7 C;  3OYL A;  1GXI E;  4MZM A;  2O31 A;  2RM4 A;  2V8I A;  3SDZ A;  5J26 A;  2OJ2 A;  2EFI A;  5KYY B;  2MPX C;  3T9N A;  3OYK A;  5D6Y A;  2GQI A;  4BE0 A;  4O5V A;  1QVF A;  1DJ7 B;  1VQ5 Q;  1YJ9 Q;  5LJ5 d;  1D0Z A;  3JCM c;  2RO0 A;  1WNL A;  3EG2 A;  1YP5 A;  3X24 B;  2RJE A;  3I9Q A;  3CCR A;  4DBF A;  4F7U E;  4E7J A;  4RMO A;  3NHN A;  4ZGD B;  2EPD A;  1I81 A;  2ZPH B;  1VQ8 T;  2QXF A;  3F70 A;  1X6O A;  3J81 E;  4C8Q G;  3JB9 H;  4XTV A;  1YI2 T;  3NPF A;  4N0A C;  1M2V A;  3UAT A;  2CRE A;  3GP8 A;  3I56 T;  1MND A;  1X01 A;  3O8V A;  3NTK A;  1QCF A;  4HXJ A;  3CME T;  2XHC A;  4L5G A;  1ZUU A;  1LNX A;  2QEX T;  1U5S A;  1FWZ A;  4PKC C;  3G4S A;  4NOY A;  5DLQ E;  1W70 A;  3PTA A;  1VQ6 Q;  3C95 A;  2KXC A;  2X4Y A;  1OOT A;  2YWW A;  5GAN g;  4MDX A;  3M0S A;  3VS6 A;  3L2Z A;  3OYG A;  2F1L A;  1Y07 A;  4M78 D;  3L1A A;  1E7O A;  3LW5 E;  1PSE A;  1R0B G;  1Y7X A;  3CCR T;  5KCO A;  5DLO A;  4M7D F;  5FRM A;  1YWO A;  2RPN A;  2LRQ A;  2EGA A;  5CKH A;  4D6W A;  2A0F B;  2ED1 A;  1FMW A;  1WHK A;  1Y96 B;  2JUF A;  2QTX A;  3PE0 A;  2QDY B;  2CZ1 B;  1S72 A;  4PJO A;  2E6N A;  1N9S A;  1I0C A;  2QAZ A;  1D1A A;  4M77 G;  4AFQ C;  2FYK A;  2DRK A;  2YHT A;  3L2Q A;  2AZS A;  1AOJ A;  1KD1 R;  2P4R A;  3J80 E;  3G4S T;  1VQ8 Q;  3H6Z A;  2J6O A;  2JXB A;  5GAM d;  1VQ4 A;  1YI2 Q;  1J3T A;  5KYW B;  2SEM A;  2V8J A;  4R0K A;  1FYN A;  3I56 Q;  4M7A C;  1Q82 R;  4KGX B;  2D0Q B;  2VC8 A;  5LJ3 f;  4WCI A;  3CME Q;  1UHC A;  3P8H A;  2XK0 A;  2K3X A;  5A2Q E;  2GCX A;  1KC8 R;  2QEX Q;  1JBM A;  3QJY A;  3FJP A;  1Z9Z A;  2LQW A;  3QWY A;  2Z0W A;  1G3W A;  5CAI A;  2EW3 A;  4C5I A;  4Z8A A;  4C0G A;  2AZV A;  3OYY A;  5FW9 A;  4B6M A;  4PJJ A;  1W1F A;  4ATO A;  1TSF A;  1PRM C;  3HTR A;  4FL6 A;  2CZ0 B;  1M4Z A;  1M90 R;  5GAN 4;  2M9U A;  1M3C A;  4RTU A;  5FU6 C;  2MWP A;  5GMK l;  4BY6 B;  2E65 A;  4M75 B;  2IPO B;  1KHI A;  3E19 A;  3CCR Q;  3JB9 G;  3CCQ T;  1TS9 A;  3VS5 A;  1TH7 A;  3EGD B;  1D3B A;  4NL3 A;  1VQ7 A;  2DER A;  2DKG A;  1VQ4 T;  4BD3 A;  1JU5 C;  4IUQ A;  2RI5 A;  4A4E A;  2DA9 A;  4UC4 A;  1GFC A;  4ORZ A;  1ZSZ B;  4M7A G;  5AYF A;  2PUO B;  4M7D B;  3VYH B;  1B34 B;  2EJG A;  3MPU B;  1VQM T;  3G4S Q;  2FRY A;  2XIC A;  2F5K A;  1ZBJ A;  2QK0 A;  4PFZ A;  1W2B S;  2LJ0 A;  2PZ1 A;  1AZE A;  3OYE A;  3CPF A;  2FZK B;  4RCB A;  1VQK A;  1N9R A;  1X6B A;  1MMN A;  4BUG A;  4OB0 B;  2P84 A;  5IHN A;  3FC3 A;  1NYF A;  2NLU A;  2DTI A;  2GF7 A;  2NUT A;  1K9A A;  1VQ7 T;  1M3B A;  1RL2 A;  2EIF A;  2QA4 A;  3ZFJ A;  2LCL A;  1I8F A;  2FZC B;  2M0Y A;  1WXB A;  2L0A A;  1VYV A;  5GAO m;  4ZN1 A;  1RUW A;  2KXD A;  3M0P A;  1G5V A;  1SG5 A;  4E7K A;  2VWF A;  1EFN A;  2DTH A;  2DXB A;  3J7A F;  2OI3 A;  1RAD B;  1YIJ T;  2K2M A;  1P92 A;  4GY5 A;  4M77 F;  2VGN A;  3GBQ A;  2DD5 A;  2JMA A;  1IGQ A;  2HNI A;  1G3T A;  1YJN A;  3EFO A;  3LLR A;  4IUR A;  3RER A;  2DJZ A;  2Y4Y A;  1FMK A;  3L2R A;  2QQA A;  4LUD A;  1K1Z A;  4JS4 A;  1VQ4 Q;  5CQY A;  4E7Z A;  3GF5 A;  5GMK e;  3LH0 A;  1PC0 A;  5GAN e;  5IHK A;  2DZC A;  4OMM A;  2JOY A;  2DF6 A;  2ZPG B;  3JCM b;  2RA2 A;  2QYZ A;  3KUF A;  4X9D A;  3P8D A;  1H3H A;  1JJ2 P;  2ZCF B;  4AFS C;  4E7S A;  3SFM A;  1Q86 U;  5GAN h;  1UGV A;  1IO6 A;  3H0I A;  1YIT A;  4OML A;  1N5Z A;  4C8Q B;  3EHR A;  4ANJ A;  5IH2 A;  2HL3 A;  2V8K A;  1BI0 A;  4RG8 A;  2CP5 A;  3SWN B;  4A63 B;  3L2U A;  1VQM Q;  2A7Y A;  2VYT A;  1I4K 1;  2GTJ A;  1MHN A;  5FWC A;  1QMC A;  2AT1 B;  3G71 A;  2QA4 T;  2VKN A;  4LDW A;  4KGZ B;  5CR2 A;  4C92 A;  3GLX A;  3RR6 A; 
#chains in the Genus database with same CATH homology
 1M30 A;  2EQI A;  1WX6 A;  2CDT A;  3EG3 A;  4Z88 A;  1A0N B;  2HCK A;  3VS7 A;  4J9E A;  2DLP A;  1YNZ A;  2VVK A;  4OMQ A;  3UF4 A;  3VRZ A;  2C0I A;  2GTO A;  1YWP A;  2FPF A;  2KGT A;  2RQV A;  5FWB A;  2IIM A;  2A28 A;  1VA7 A;  2GGR A;  4Y92 A;  2KE9 A;  2EYZ A;  1ABO A;  2D0N A;  3CQT A;  4RTY A;  1ARK A;  2FRW A;  4OMO A;  4K11 A;  1QWE A;  1WFW A;  1WXU A;  2HDA A;  2KR3 A;  4HVU A;  1VYT A;  1ZUY A;  1VYU A;  1H8K A;  4LUE A;  2J6F A;  3M0Q A;  4AG1 C;  1ZX6 A;  2KT8 A;  1QLY A;  2K79 A;  1YCS B;  1GCQ A;  3O5Z A;  2KRO A;  2BTT A;  3M0U A;  2JM9 A;  2L3P A;  4DEX A;  1MV3 A;  2JT4 A;  3H0F A;  2DJQ A;  2JM8 A;  2MOX A;  4J9F A;  1PKS A;  3H41 A;  1S1N A;  1TUC A;  4JJC A;  4FSS A;  5GJW B;  2KRN A;  2LCS A;  2A08 A;  2ROT A;  2V1R A;  2YT6 A;  3R6N A;  1RLQ C;  2M51 A;  3EGU A;  3EHQ A;  2MIO A;  3H0H A;  3UA6 A;  1QKW A;  1SSH A;  3VRY A;  1UJY A;  3REB B;  1UFF A;  1M3A A;  4J9C A;  1WA7 A;  3SEM A;  2EKH A;  2CH4 W;  3VS4 A;  1OPK A;  4RTW A;  5ECA A;  1SHG A;  4ESR A;  2LQN A;  1KFZ A;  2LMJ A;  1YN8 A;  2RN8 A;  1MUZ A;  2D8H A;  3M0T A;  2C0T A;  2ABL A;  2DE0 X;  1KIK A;  3TSW A;  2LZ6 B;  3NMZ C;  2X3W D;  2K3B A;  1Z9Q A;  4LNP A;  4OMN A;  2O2O A;  1UEC A;  2DM1 A;  2JW4 A;  4CC7 A;  3ZL7 C;  2DL3 A;  2BZX A;  2EYX A;  2FG0 A;  2J06 A;  1WIE A;  2ROL A;  2O31 A;  1UJ0 A;  2HBW A;  1I1J A;  1MV0 B;  2OJ2 A;  2EGC A;  2A37 A;  2GQI A;  1NLO C;  2CSI A;  2D1X A;  1SHF A;  5I11 A;  1OEB A;  2ENM A;  1HJD A;  1WLP B;  1CKA A;  5I22 A;  1AEY A;  2J7I A;  1CKB A;  4ZNX A;  3EG2 A;  1YP5 A;  2LNH B;  5IHI A;  3I9Q A;  2EBP A;  3NHN A;  1T3S A;  2EPD A;  1UTI A;  4LE9 A;  4RTZ A;  1BK2 A;  4JPB W;  4D8D A;  2LP5 A;  4IIO A;  4CC4 B;  3NPF A;  1ZUK A;  4J9H A;  3FJ5 A;  3REA B;  2DL7 A;  3UAT A;  2CRE A;  4RTX A;  1QCF A;  2G6F X;  4HXJ A;  2D8J A;  3TSZ A;  3RBB B;  2AKL A;  1ZUU A;  2F2X A;  2X3X D;  1U5S A;  2CSQ A;  2EGE A;  1V1C A;  2DNU A;  1XOV A;  1W70 A;  1SRL A;  1NYG A;  5IXB A;  2AKK A;  2K9G A;  2CH4 A;  2KXC A;  1NEG A;  1CSK A;  2GNC A;  1OOT A;  2KNB B;  2KEA A;  1I07 A;  2J05 A;  2KRM A;  3M0S A;  3VS1 A;  3VS6 A;  4GBQ A;  2AK5 A;  1E7O A;  4EIK A;  4RTT A;  3I35 A;  2MCN A;  2HSP A;  1YWO A;  2RPN A;  1BB9 A;  1AZG B;  1LCK A;  4QT7 A;  2EGA A;  2E5K A;  3KFV A;  2DIL A;  2ED1 A;  2RMO A;  1AWX A;  1X2Q A;  2DL5 A;  2W10 A;  3PE0 A;  2B86 A;  2CT3 A;  1AD5 A;  2KRS A;  2YUN A;  1KSW A;  2F2V A;  1U3O A;  1I0C A;  2JS0 A;  4AFQ C;  2EYW A;  2DRK A;  1WDX A;  2O88 A;  2AZS A;  1AOJ A;  2YDL A;  2ED0 A;  2P4R A;  2YUP A;  1X27 A;  2BZ8 A;  3PVQ A;  4HVV A;  2J6O A;  1JEG A;  2JXB A;  1OPL A;  2K6D A;  1GL5 A;  3IQL A;  4KRT A;  2OAW A;  1J3T A;  1K0S A;  2DBM A;  1AVZ C;  1GFD A;  2SEM A;  4R0K A;  2DBK A;  2BZY A;  2L3S A;  2RNA A;  1FYN A;  1T0H A;  1HD3 A;  2FPD A;  1PWT A;  2JTE A;  1Y0M A;  2DL4 A;  1AWW A;  1RLP C;  1JXO A;  1T0J A;  4WCI A;  1UHC A;  4LN2 A;  4CC2 A;  1KJW A;  2EVR A;  1W6X A;  4F17 A;  4DEY A;  2LX7 A;  1Z9Z A;  2LQW A;  2LJ1 A;  3QWY A;  2GBQ A;  3ULR B;  1HSQ A;  2EW3 A;  4Z8A A;  2QDL A;  1X2K A;  4J9B A;  4F16 A;  2AZV A;  1PNJ A;  2KYM A;  5FW9 A;  1W1F A;  1GCP A;  1NLP C;  1PRM C;  2A36 A;  4RUG A;  3M0R A;  3JV3 A;  3UA7 A;  2KBT A;  3VS3 A;  1M3C A;  2KT1 A;  4RTU A;  4J9G A;  1WYX A;  4HCK A;  2W0Z A;  3I5R A;  2RQT A;  4J9D A;  1K76 A;  4D8K A;  2CUD A;  2PTK A;  2YSQ A;  3VS5 A;  1UDL A;  4M4Z A;  2DYB A;  1NG2 A;  2FO0 A;  1X6G A;  1JU5 C;  2L3Q A;  1SRM A;  2RQU A;  1GBQ A;  2DA9 A;  3A98 A;  5L23 A;  1GFC A;  4ORZ A;  1AWO A;  2FPE A;  1E6G A;  1GCQ C;  2DVJ A;  1RI9 A;  1BU1 A;  1TG0 A;  2NUZ A;  4CC3 A;  4Z89 A;  1QKX A;  3SHW A;  1WI7 A;  2YUO A;  1T3L A;  4AG2 C;  1JQQ A;  2FRY A;  2ECZ A;  1UUE A;  1ZLM A;  4E6R A;  4F14 A;  3EG0 A;  1E6H A;  1ZBJ A;  3C0C A;  2JMC A;  1B3Q A;  3U23 A;  3NGP A;  3RNJ A;  1X69 A;  2LJ0 A;  2PZ1 A;  1ABQ A;  2JS2 A;  1AZE A;  2RF0 A;  1UG1 A;  1X43 A;  2CUB A;  1JXM A;  1WXT A;  3THK A;  3VS0 A;  1AWJ A;  2RQW A;  1X6B A;  1JO8 A;  2FEI A;  1UE9 A;  2H8H A;  3LH5 A;  1PHT A;  2HEQ A;  4J9I A;  5IHN A;  2XMF A;  4IIM A;  1NYF A;  4OMP A;  1G2B A;  1M27 C;  3PVL A;  1K9A A;  2EYY A;  4JZ3 A;  1M3B A;  1M8M A;  1SPK A;  2O9S A;  2M0Y A;  1WXB A;  2I0N A;  2F2W A;  1VYV A;  1Y57 A;  2J6K A;  2L0A A;  1RUW A;  2KXD A;  3M0P A;  2SRC A;  3I5S A;  1G83 A;  2VWF A;  2YUQ A;  4X1V A;  3TVT A;  4JZ4 A;  1EFN A;  1BBZ A;  2OI3 A;  5GJV B;  1GRI A;  2K2M A;  2DX1 A;  4AFU C;  2KYB A;  3GBQ A;  2PNI A;  4JJD A;  2JMA A;  5HCK A;  4RTV A;  1K0X A;  1ZSG A;  2V1Q A;  1FMK A;  3VS2 A;  4LUD A;  1K1Z A;  1U06 A;  4GLM A;  5IHK A;  1QWF A;  2DRM A;  4OMM A;  5IXF A;  2DF6 A;  2K7A A;  3EG1 A;  1NM7 A;  1PKT A;  1H3H A;  4AFS C;  3QWX X;  1UGV A;  2DL8 A;  1TUD A;  1UHF A;  1IO6 A;  2NWM A;  2RQR A;  3H0I A;  1N5Z A;  4HVW A;  4OML A;  1NEB A;  3EHR A;  1OV3 A;  5IH2 A;  1B07 A;  4A63 B;  4JJB A;  2C0O A;  1PRL C;  2CT4 A;  5EC7 A;  2LJ3 A;  2GTJ A;  1SEM A;  1GBR A;  2O9V A;  5FWC A;  2L2P A;  2ESW A;  2DMO A;  2VKN A;  1H92 A;  4AFZ C;  1K4U S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...