1UHCA

Solution structure of rsgi ruh-002, a sh3 domain of kiaa1010 protein [homo sapiens]
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
GSSGSSGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1010 protein
publication title Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 7
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2003-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uhcA00
2MOXA 1GBRA 2NUZA 1OV3A 1CKAA 1WXTA 5HCKA 1BBZA 2D0NA 3M0SA 1LCKA 4RTVA 3UA7A 4FSSA 2KT1A 2LJ3A 1WDXA 2FPFA 1H8KA 1VYTA 4J9EA 2JXBA 1Y57A 1RI9A 2C0TA 2D8JA 2DRKA 2JS0A 1KFZA 2J6KA 1NEGA 2YUQA 2VWFA 1ZBJA 2YT6A 4D8DA 2K2MA 2D1XA 1JQQA 1WI7A 1ZUYA 2YSQA 3M0QA 2H8HA 4J9DA 1M30A 4R0KA 1XOVA 2DNUA 3JV3A 4J9BA 2ROTA 2AZSA 2P4RA 4CC7A 1YWOA 2M0YA 1SRLA 4JZ3A 3VS2A 5IHKA 1UE9A 2SRCA 1W1FA 2DVJA 3U23A 2NWMA 2A08A 2O31A 1T0JA 1UG1A 1NG2A 1QKWA 2LMJA 4OMLA 1W70A 1K0XA 4QT7A 4RTUA 2JS2A 1AWJA 3H0HA 4OMNA 3REBB 2DA9A 2ECZA 2LCSA 1BK2A 3VS6A 1AWOA 2HBWA 1YWPA 1KSWA 2EW3A 2V1RA 1AWXA 3PVQA 4ZNXA 1OOTA 2KYBA 2G6FX 2ABLA 1UHCA 3VRZA 2LX7A 3IQLA 1PHTA 1TG0A 2FO0A 2DL8A 4RUGA 1TUCA 2EGCA 4AG1C 4AFUC 2DL5A 2OI3A 4GLMA 1NEBA 2RQTA 3QWXX 3GBQA 3H0FA 2AKKA 2AZVA 2BZXA 1TUDA 1SSHA 2KXCA 1QCFA 1M27C 4DEYA 4EIKA 1UJ0A 1QWEA 2A28A 1OPKA 2LQWA 1MV3A 1OEBA 3NPFA 4GBQA 1H92A 1B3QA 1T0HA 1MV0B 2PNIA 2CUDA 2JTEA 1M3AA 1U06A 4OMOA 3VS0A 2DJQA 4IIMA 3VS7A 2D8HA 2GGRA 2GNCA 4ESRA 2AK5A 4HXJA 1X69A 2CH4W 1WA7A 2K6DA 1AD5A 1NYGA 2ROLA 3PE0A 1UFFA 2EQIA 3TVTA 4AFZC 1S1NA 1T3LA 1CSKA 2EBPA 3TSZA 1I1JA 1RUWA 2C0OA 2CH4A 1X6BA 2HDAA 2CDTA 3VS5A 1JU5C 2O9VA 2CREA 5FW9A 2CT3A 1KIKA 4LUEA 1K9AA 1E6HA 3EG0A 2DL4A 2XMFA 1UGVA 1GFCA 1E7OA 2O2OA 1WXBA 2CT4A 2KEAA 2RQUA 3UA6A 2YDLA 4RTTA 1YN8A 5L23A 1CKBA 1ZUKA 4KRTA 1Y0MA 1WFWA 2DRMA 1A0NB 4J9IA 2DX1A 1H3HA 2SEMA 2CUBA 3R6NA 1UHFA 1YP5A 3H41A 1FMKA 4J9CA 2JT4A 2DBMA 1M8MA 1YNZA 3QWYA 2YUOA 5ECAA 3A98A 1NYFA 1PRMC 3UATA 2JMCA 4F16A 2L3QA 1BU1A 1FYNA 3NHNA 1GBQA 2O88A 1ZUUA 2CSQA 1M3CA 4HVWA 3SEMA 3EG3A 1X27A 2GTJA 4J9FA 1EFNA 2L3SA 2RQWA 3I9QA 3M0UA 2MCNA 5IXBA 5EC7A 4RTZA 4CC3A 4AFSC 4F17A 3EG1A 1I07A 3FJ5A 2GQIA 2YUNA 5IH2A 2ED0A 1UTIA 3TSWA 3EHRA 2EGAA 1AVZC 1ZSGA 2EPDA 4X1VA 1VYVA 2EYWA 1GFDA 2HSPA 2RN8A 2RPNA 1UDLA 2K79A 2E5KA 2X3WD 5FWCA 2B86A 4IIOA 4OMQA 4RTXA 1HJDA 1SPKA 3THKA 3RNJA 1GCQC 2JW4A 3M0RA 2RQRA 1JXOA 1VA7A 2LNHB 2EYYA 3O5ZA 4J9HA 1AZEA 4J9GA 2FEIA 2LQNA 2J05A 1GCQA 2GTOA 4Z88A 1BB9A 1IO6A 4LNPA 2BZ8A 1WXUA 2O9SA 2EGEA 1JXMA 2FPEA 4CC2A 1YCSB 2VVKA 4Z89A 2CSIA 1WX6A 1NLPC 1HD3A 2RMOA 2RNAA 5IXFA 3PVLA 2DBKA 4HVVA 4D8KA 4HVUA 4WCIA 4F14A 2KGTA 3REAB 3UF4A 1QLYA 1K0SA 2DL7A 2A37A 4JZ4A 1GCPA 2J6FA 1AZGB 4Z8AA 1WIEA 4LN2A 2KXDA 1V1CA 2EKHA 2K7AA 3I5SA 2X3XD 2KRSA 4OMMA 5IHNA 2LP5A 1T3SA 1NLOC 2V1QA 5I22A 4HCKA 2J6OA 2KRMA 1UECA 2LZ6B 1N5ZA 3EHQA 2RQVA 1HSQA 1WYXA 1VYUA 1Z9QA 2K3BA 5GJVB 1ABOA 4DEXA 3EG2A 2HEQA 1M3BA 1PKTA 2JMAA 1J3TA 1KJWA 4E6RA 1NM7A 3C0CA 2OJ2A 1AOJA 1U5SA 2AKLA 4OMPA 2F2XA 3CQTA 2L3PA 2EYXA 1QKXA 1UUEA 2FRWA 4M4ZA 1E6GA 3VS4A 2KE9A 3SHWA 4JPBW 2KRNA 1SHFA 3M0PA 1G83A 3VS1A 1ABQA 2RF0A 1AWWA 1QWFA 3M0TA 2A36A 2JM9A 2LJ1A 5IHIA 4A63B 2W10A 1W6XA 4RTWA 4AG2C 2KT8A 2K9GA 2F2VA 1RLPC 4ORZA 1OPLA 2ED1A 4LUDA 4Y92A 2C0IA 4JJCA 2KYMA 5FWBA 2ESWA 2KNBB 1JEGA 1U3OA 2KR3A 3I5RA 5I11A 3H0IA 3VRYA 1ZLMA 2FG0A 2QDLA 4LE9A 2FPDA 2W0ZA 2VKNA 1K1ZA 1SEMA 1X2KA 2MIOA 3RBBB 1JO8A 1ZX6A 2YUPA 3NMZC 3ULRB 1X6GA 1RLQC 2J7IA 2EVRA 3EGUA 2DE0X 2EYZA 2DLPA 3ZL7C 2HCKA 1UJYA 2DMOA 3I35A 4RTYA 1SRMA 2ENMA 2FRYA 4K11A 2DILA 5GJWB 1SHGA 1PKSA 1B07A 2DL3A 2L0AA 1Z9ZA 1PWTA 2JM8A 1X43A 2KBTA 2PTKA 3VS3A 1PNJA 2KROA 1I0CA 2BZYA 1WLPB 2LJ0A 4JJDA 2OAWA 4CC4B 1PRLC 2M51A 1X2QA 4AFQC 1ARKA 2I0NA 1G2BA 1K4US 2IIMA 1MUZA 2BTTA 1GL5A 1K76A 2PZ1A 3NGPA 2F2WA 3KFVA 4JJBA 1GRIA 1AEYA 2DYBA 2J06A 2DF6A 2L2PA 2DM1A 2GBQA 3LH5A
chains in the Genus database with same CATH superfamily
4ELYC 2NUZA 1OV3A 5KCHA 1WHGA 1G3TA 3ZBDA 1BBZA 2K3XA 4XU0A 2DZ9A 4C92A 1YJNQ 1LCKA 1I5OB 2P0KA 1ZA2B 1YHQT 2LJ3A 1OX8A 5GMKj 4XQ3A 4LDWA 2E5QA 4J9EA 2L8DA 2C0TA 2D8JA 3JCMb 1KFZA 1NEGA 4LDUA 2YT6A 5GAN7 2K2MA 4M77B 3JCMe 1ZUYA 1WI7A 3F70A 3META 5CO7A 2QA4Q 2DIGA 3CD6Q 1IREB 1WHMA 1YJ9T 1G3YA 1S72A 5FLXE 3P8DA 3SFMA 2ROTA 2R5AA 1N27A 1WQ7A 4OB0B 2AZSA 3ME9A 5GMKl 3I55Q 4JZ3A 5IHKA 3UT1A 2NWMA 3H8ZA 2GCXA 3MEWA 1NG2A 1QKWA 2V8KA 1K0XA 4KT0E 1VQ7A 1AWJA 3H0HA 4C92G 3REBB 2ECZA 2JTFA 4GY5A 3KXTA 3G71T 2PU9B 2HBWA 5CCAA 1JJ2P 4EMKB 4ZNXA 1B34B 4M7DC 3L2VA 2MWOA 3WXMB 1C6VX 3JCMd 2LX7A 3IQLA 3SWNC 1PHTA 2FVUA 2EWNA 4AG1C 1U8RA 1NPPA 2DL5A 4A4HA 3RDVA 1NEBA 3E19A 4JRPA 4XK8E 1KQSP 3VYHB 3QWXX 2HBPA 3GBQA 2AKKA 2AZVA 2BZXA 2VC8A 4N4IA 2QQSA 1QCFA 4DEYA 3EG9B 1VQ4Q 3GF5A 4C5GA 3CCMA 1UJ0A 1QWEA 5CKBA 3QIIA 2EJGA 3AHUA 3M4YA 4IKFA 1OEBA 4ME7A 1D0XA 1PG5B 2DKGA 1QP2A 1B3QA 2MF2A 2JTMA 5GAN4 4PJOD 2PNIA 9ATCB 2DYIA 1M3AA 4C5EA 5LJ5f 2D8HA 2GNCA 5LL6S 4BI8B 4FYWB 1X69A 3CCET 3OS2A 1WA7A 1BCMA 2DERA 5CR2A 2XG8D 1D0ZA 2RHIA 4BI4A 5GAN6 2OTLT 4DBRA 3OYFA 2E4HA 1CSKA 1YCYA 3HFOA 1I1JA 1H641 4E7KA 2RI2A 3QO3A 2XICA 4X9DA 3V8JA 5D7UA 4J7FA 3CCSQ 1TTHB 1D1AA 2CT3A 2NUTB 5GAN3 2HKQB 2M0OA 3CCJT 4XTYA 3LW5E 5A0DA 1GFCA 3I56A 4C92B 1RAAB 1I81A 2XK0A 1NJIR 1VUBA 5J39A 2FHDA 3OYMA 4RTTA 3OYYA 1CKBA 2DRMA 4KBMB 4HCBA 2DX1A 2SEMA 4FT2A 3R6NA 3VUBA 1QVFS 3H41A 4XTZA 2DBMA 2LCLA 1ZSZC 4A53A 1P92A 1UGPB 1O9SA 3CMAQ 2HNIA 4M75E 2E10A 2LTOA 5CKDA 3EFSA 5GAMf 2C06A 2O88A 2CSQA 3EG3A 4M75F 1X27A 1VQ5T 3M0UA 1KHIA 3DLMA 4QVDA 5IAYA 1N9SA 4RTZA 1NBEB 2DO3A 3TEEA 2KAFA 1K8AR 1I07A 1JBMA 2GQIA 5IH2A 5KYWA 4XAXB 3EHRA 1AVZC 1ZSGA 1LNXA 3PFSA 3R6OA 2QQ9A 5KYYA 1Y96A 2HSPA 3C94A 5FWCA 2O4XA 4N0AA 1C0MA 2BKDN 2RQRA 1JXOA 2RA2A 1VQ8A 1D3BA 1AZEA 2DK3A 4J9GA 1VQMT 4PJOC 1KD1C 2BZ8A 4DOVA 2HL3A 2E64A 3CBMA 2FPEA 3A5ZB 2PUOB 4Y28E 3MEAA 3UPUA 5IXFA 3V8KA 4HVVA 5CAIA 1OX9A 4RCCA 2KGTA 1VQLQ 1V76A 4M78E 4JZ4A 4JDSA 5LJ3f 2J6FA 4OMFB 4L6V5 2JJ9A 3OYEA 1OQKA 3OW2S 2X3XD 2ZPGB 1K9MR 4M78F 2LP5A 1T3SA 1NLOC 2V1QA 2LZ6B 3MP8A 2YRVA 1HSQA 3OYNA 2E6ZA 2F5TX 3OYLA 2HEQA 1M3BA 1PKTA 1Q82C 1Q86R 1J3TA 1KJWA 4LXCA 1AOJA 5HY6A 3GP8A 1S72Q 1WZOA 3CC4A 1NJIC 4OMPA 3CQTA 2EYXA 2DZCA 4M4ZA 2OTLQ 3QYGB 4BUGA 3A8MB 2CKKA 1NZ9A 3QDRB 3QJYA 2FZGB 1ABQA 2ZPBB 4L5GA 1LJOA 3OBWA 1YITT 3PIOA 3V7CA 1PCXA 4A63B 1W6XA 4RTWA 2RB6A 3SD4A 5GANf 1OULA 3V8LA 4ORZA 1KQ1A 4LUDA 1XJWB 2QYZA 3UDCA 5HK0A 2RO0A 3CCJQ 3HFNA 4RG2A 3H0IA 2FB7A 1ZLMA 2FG0A 2QDLA 3G4SA 2DEUA 1Q82U 1K1ZA 2X4XA 4L59A 2E41A 2O01E 1X2KA 2RH2A 1G5VA 1JO8A 2YXYA 3PT9A 2YUPA 3GOXA 2LCCA 3M5AA 1X6GA 1NJIU 1N6AA 2QAZA 4OB1B 2WSEE 1YI2T 4KGZB 2CZ6B 4TVRA 2F69A 2VB6A 1UJYA 2EQMA 1VQNT 1SRMA 1TWBA 2ENMA 2V8IA 1JB0E 3JB9D 2FRYA 4K11A 4HKEA 5C0MA 1VQ7Q 3FJPA 1QP3A 1IB8A 5GJWB 1QVGP 4M7DA 1B07A 2RJDA 2L0AA 2RK1A 1YJNT 1X43A 3MKDA 5KYWB 1I0CA 3C95A 1X2QA 1Q7YR 4Z02A 3MPUB 1OU8A 1G2BA 1K4US 2IIMA 5KYYB 1Y96B 1RACB 4OGCA 1HXDA 1GL5A 1K8AU 1W2BA 2O4XB 2GFAA 1VQ6A 1AEYA 2L2PA 2DM1A 4FYVB 4XTWA 3FIFA 2E1HA 3CCMQ 1M1FA 1D3BB 1WXTA 3CD6T 2Z0WA 5HCKA 4ZN1A 2P84A 2D0NA 2LVMA 3VYGA 3RKXA 4KULA 3OYHA 3I55T 5FRNA 1WDXA 3CPWP 1Q86C 1KC8R 5CKFA 4C0DC 1EX4A 4BI3A 4ZGJB 4M7AD 2FZCB 2HMAA 4JUVA 1WJQA 2YUQA 2VWFA 3M54A 4D8DA 2RHYA 1JQQA 1M1KR 3HPWA 2Y4XA 1U1SA 5KYUA 1C1AA 2RM4A 4J9DA 4CRIA 4II1A 4R0KA 4RCBA 1XOVA 4C8QD 3JV3A 2E6NA 3RUXA 4J9BA 3QDFA 1BI0A 4KUIA 3UWNA 4KH0B 2CGHA 3EFRA 4JLIA 1UE9A 3U23A 5DLOA 4MDXA 2A08A 1T0JA 2EYQA 3M4GA 3L2ZA 2LMJA 4QT7A 3I56Q 2DXBA 4RTUA 1VQ4T 3TCJA 2JS2A 4E7IA 1Q86U 2COWA 1FX7A 4OMNA 2DA9A 2NUPA 1ZHIA 1ZSZA 1AWOA 2HD0A 4M7DF 3OYIA 1YITQ 2QDYB 1IGUA 2V1RA 5KE3A 2MMPA 3OSSC 3PVQA 1VQKA 4MZPA 2OAUA 3VRZA 3CCRA 1LOJA 4MZMA 3JCMg 5FROA 1TG0A 3INZA 4AFUC 4GLMA 3URGA 1ACMB 1SSHA 1TS9A 2E3IA 1M27C 3L2RA 3GNGA 4Q5WA 1OPKA 1MV3A 1Q7YC 3PMTA 2YRDA 4GBQA 1M9SA 1B7TA 3BDUA 3CCST 4ZTFA 2XI9A 1U06A 2LQ8A 3VS0A 4QQ6A 4IIMA 1BIBA 4XTXA 1VQ6T 1D1CA 1KG1A 4M7DB 1PD0A 4ESRA 2EFIA 2X35A 4M77D 2K6DA 3J7AF 1NYGA 4FCYA 2ROLA 3T9NA 2PQWA 3CCUA 2EQIA 1R0CB 3TVTA 3CCLT 1R0BG 3TSZA 3X25B 2C0OA 3MEUA 1YJWA 2XD0A 1X6BA 2PVDB 3TU4K 3GNFB 5D6WA 4HCZA 1VOMA 2O9VA 3OS5A 5FW9A 3CMAT 1IHWA 3M55A 3CXCP 1M1KC 2E12A 4LUEA 1Q7YU 4JLGA 1RAHB 1SSFA 3RIRA 2XMFA 2H3EB 4PJMA 2RQUA 3OB9A 3QG1A 1KK7A 4C8QC 3OYBA 1YN8A 2ZAEA 1ZUKA 2DEQA 3CMEA 4J6XA 1WFWA 4J9IA 2JN0A 4PFOA 4BACA 4C5IA 1YP5A 1FMKA 2JNGA 2K57A 1M8MA 3QWYA 4VUBA 5GAOm 1PRMC 3UATA 3M57A 3E9FA 4OVAA 1GBQA 5KYUB 4HVWA 3PMIA 5GAN5 4X9CA 1MNDA 2GTJA 1SKUB 1RADB 4J9FA 3I9QA 3X24B 5EC7A 2H3JA 1LPLA 2ZGWA 3M9QA 3EG1A 3G6EA 2YUNA 5LJ5g 2LX9A 1M1KU 1VQKT 2ED0A 2DD4A 4FM4B 4M75A 3TSWA 2EGAA 1TSFA 2EPDA 2CS7A 4UC4A 4X1VA 2R57A 1VYVA 4C0FA 2RN8A 4FYXB 2GFUA 1VQLT 2IVWA 1DJ7B 1Y7XA 2B86A 5GAOr 3G4SQ 2NUPB 3HSBA 4RTXA 3JCMQ 4J5YA 2JVVA 1SPKA 4PJOE 1HJDA 1ZSZB 3THKA 1GCQC 2M02A 2KK4A 2EYYA 2DAQA 3O5ZA 3BW1A 4PJOF 1JJ2A 2NUTA 2FEIA 4HT8A 4Z88A 1W4SA 3A8LB 2OTJA 1WXUA 2L3RA 2EGEA 1YCSB 3FEOA 1S72T 1HD3A 4OB3B 2DBKA 4M77C 4D8KA 1KQSA 3JB9J 4ATOA 3UF4A 5A0GA 2XKOC 3GIBA 3CBOA 4QW2A 2K5IA 1GCPA 4C92D 3JSCA 2JZ2A 1V1CA 4RG8A 3QZ9B 5KYXA 2QGFB 2KRSA 5IHNA 3OMGA 4LD9K 4HCKA 1N9RA 2XHCA 3E1SA 4M75G 1UECA 3X26B 3HHTB 4BE0A 3J81E 2DVEA 1VYUA 1Z9QA 1M8VA 5GAMg 5LJ5e 1ABOA 1RAGB 3EG2A 4DEXA 1VQ6Q 3JCMh 5KYNA 1NPRA 4M78A 3C0CA 3SDZA 4ZGDB 1U5SA 2AKLA 3HL8A 2FRWA 3CC7A 1E6GA 3VS4A 2KE9A 3SHWA 3CCLQ 2KRNA 1QW1A 4EMKC 1K73R 3VS1A 2QEXA 3M0TA 4PJJA 4E7LA 2PUKB 2XDPA 2JM9A 3ZFJA 1GXIE 2YRCA 2W10A 3V7SA 4AG2C 2DJZA 2KT8A 2F2VA 3S3NA 3JCMW 4Y92A 1LVKA 4JJCA 1VQ7T 3OBYA 2HAXA 4O6JA 4DQ2A 1JEGA 3I5RA 3CBPA 3VRYA 4QQGA 5LJ5d 2W0ZA 1G8XA 1BI3A 1QMCA 1SEMA 2QXFA 2EJFA 3RBBB 4LDYA 4AT1B 4N4GA 2DD5A 2XDBA 1RAFB 3ULRB 4A4KA 4M78G 3LWHA 2EVRA 4FT4A 3EGUA 3PNWC 5GAMe 2XU8A 5CVIA 3CCMT 1R8OB 1PKSA 4BDYA 1IRXA 2DL3A 2G3RA 2A0FB 2JM8A 2M1HA 2WACA 1PNJA 3RMSA 1VQKQ 4A4EA 4M75B 3H6ZA 1W2BS 4AFQC 5KE2A 1BI1A 2I0NA 3CCRQ 2FL7A 2RHXA 4E7JA 2RI5A 1MMGA 2MI6A 1MUZA 2BTTA 2KMTA 5KH6A 3EH1A 1RI0A 5FU7C 3MEVA 4KH1B 5AT1B 1UB4A 2DF6A 4HA8A 4C92C 1D1BA 3MHXA 3LH5A 4DOWA 2MOXA 1GBRA 1NE8A 3LX7A 2YLCA 1XQHA 1XTDA 2VV5A 5GAMd 5GANg 3S3MA 5GAOp 4J6YA 4RTVA 5GMKi 2QTXA 4FSSA 5LJ5h 4NS5A 2QA4A 2AIRB 2LRQA 5GMKm 2JXBA 2CZ1B 2EAYA 3LGFA 1IXDA 1Y57A 1RI9A 2DRKA 1QQJA 3JCMc 2QK0A 2J6KA 1FMWA 4R56A 1WHKA 3I56T 4A4GA 2XDDA 3VUZA 3CCQA 1QVFP 5LJ3e 4XU2A 2RJEA 1QVPA 4PKCC 4MDWA 3CCUQ 2YSQA 3M0QA 1K73C 5KYXB 4J7IA 4B9WA 4E7SA 1M30A 1VQOA 2QQRA 3BE3A 1YJWQ 4DBHA 2MPXC 1MMDA 1U1TA 1OZ3A 4C5HA 1YWOA 2M0YA 4CC7A 4FW2A 4M78B 1KHCA 3VS2A 5GAN8 4JS5A 2SRCA 4R55A 2O31A 2V8JA 4F7UE 4OMLA 2CP2A 2XIDA 4C0DB 1K8AC 4FL6A 1MNEA 2EJ9A 4F7UF 2QI2A 3CMEQ 1VQ9A 3VS6A 2YHTA 5EG2A 5GAN2 4FIBA 1ZA1B 1AWXA 5LJ3d 1YIJA 5GANe 3QYHB 3JB9F 5GAMh 4FU6A 5I2MA 2DL8A 4RUGA 1K73U 2EGCA 3N5BB 1UGSB 2OI3A 3WVEB 2BE9B 2VUBA 5GAOl 4YTLA 5L8RE 3SWNA 1Q81R 2RQTA 3H0FA 1VQ8T 1TUDA 2KXCA 3AT1B 3NTKA 2A28A 2LQWA 3G6EQ 4A54A 2PVOB 1I5LA 1JRIA 1QCNA 1WHLA 3A8GB 1H92A 1VQPA 2VGNA 5M9OA 3MO8A 4J83A 3CCVA 3HKSA 1AHJB 3OW2P 2CUDA 4IUUA 3M59A 2ZPEB 4FSXA 3VS7A 2GGRA 2P0QA 1K9MC 4NL2A 1SG5A 2CP0A 1QVGA 5GANd 2KDSA 1AT1B 4PLIA 5FU6C 5C6SA 3CC2A 4M7AE 4A4FA 3A8OB 3PGGA 1S1NA 4AMCA 2EBPA 2OTJQ 1RUWA 2CH4A 1TUGB 1Q95G 2CDTA 1MMNA 4EDUA 4IUVA 1YHQA 4M7DG 2CREA 3CC4T 5LJ3h 1KIKA 4C8QE 4E47A 4EPCA 5KCOA 3EG0A 2DL4A 3L2WA 4WTOB 1IGQA 2CZ7B 4C8QF 1UGVA 1E7OA 1WXBA 3UA6A 2YDLA 4ZN3A 5GAOn 2KVQG 4LDVA 4KRTA 4JRKA 1Y0MA 2RJFA 3OSVA 1A0NB 1YBYA 3OQ5A 1H3HA 3L2QA 4OF1A 5IN1A 3CPWA 1K9MU 1VIEA 1UHFA 3L2UA 1YJ9A 2JT4A 3BFMA 1YNZA 2YUOA 5ECAA 3A98A 3EGDA 3WVDB 4F16A 2L3QA 3G4ST 2D6FA 3NHNA 3CC7Q 1M3CA 2HQXA 2K4YA 1D0YA 1WPYA 2L3SA 2RQWA 2MCNA 1N8RR 2QEXQ 4CC3A 2E3HA 4F17A 2RK2A 3HRSA 5GANh 2LDMA 1UTIA 2QQAA 3G71A 2RI3A 3HTRA 4N0AC 2P4TA 1KQ2A 1Q81C 1GFDA 1EIFA 1RAEB 3EH2A 1WJRA 2K79A 1QCOA 2ZCFB 3OYKA 3RERA 3QUIA 3QZ5B 1JJ2S 2JW4A 2X4JA 4QQDA 2CP3A 3QPHA 4J9HA 1RL2A 4DA4A 2LQNA 3FDRA 3RR6A 2A7YA 4LNPA 4M77E 3BDLA 1KQSS 1JXMA 4IUQA 5DM7R 4MMLA 3DLLA 1WX6A 2QQBA 3NTIA 4M77F 4PJOA 1NLPC 2GQVA 2RNAA 3SWNB 1TH7A 2HQHA 4EMGA 1RABB 4ANJA 4HVUA 4WCIA 1VQ8Q 4F14A 3S3OA 1K0SA 2DL7A 3C4SA 5GMKe 4KUDK 1BI2A 1AZGB 4Z8AA 1WIEA 3A8HB 4LN2A 3OY9A 1KC8C 5CQYA 2EKHA 3CCEA 2K7AA 3JCMf 4M7AC 3Q1JA 4O5VA 4OMMA 5I22A 2FYKA 1Q81U 2EQJA 4RMOA 2KRMA 3EHQA 3NTHA 2RQVA 8AT1B 2OTLA 1WYXA 3ER0A 4MZTA 1PC0A 2JMAA 4E6RA 2OJ2A 3SB2A 2VXEA 3JCMV 8ATCB 2DTIA 3DKMA 4C0ZA 5A2QE 2F2XA 3JB9H 3J80E 1UUEA 2AHJB 3G7ZA 2KY9A 3CPFA 3CCJA 4C0GA 1SHFA 5CK9A 1IZ6A 2RF0A 1XNIA 1AWWA 2PVGB 4PJOG 2IG0A 2LJ1A 3CC4Q 4OGEA 2K9GA 1RLPC 1I8FA 1KC8U 3CXCA 3CCQQ 3KUFA 2CP5A 2KYMA 5FWBA 3LLRA 3G1JA 1WHJA 3VU3C 4PJLA 1U3OA 1UGQB 2BUDA 2KR3A 4BY6C 1N8RC 1VQOQ 4NL3A 4PFZA 3GLXA 2MIOA 1VQ5A 3CCRT 1ZX6A 3FRNA 3NMZC 1X01A 3OMCA 2ZZDA 2DPPB 3EGDB 1RLQC 2CP6A 2DE0X 2KSSA 2DLPA 2VGMA 3I35A 3OS1A 3NFCA 1TOVA 2DILA 3DB4A 5FRMA 1TU0B 3LYIA 5D6YA 4BE1A 1SHGA 2CP7A 2GF7A 1VQ9Q 1Y07A 1PM3A 3VS3A 2PTKA 1YIJQ 1F1BB 5HK3A 1PRLC 3MJXA 4DBFA 2V26A 4C92E 1VQMA 1N8RU 2B8AA 5IT9E 4HCCA 3NGPA 2PZ1A 2F2WA 3KFVA 4JJBA 4C92F 1KD1R 2X51A 3RKWA 4E7HA 5GMKh 3CCUT 5J3BA 4JJNK 1FXXA 2QG9B 1CKAA 1YJWT 3M0SA 5CKEA 2A3LA 2X4YA 1VQPQ 3GPLA 4OB2B 3CCVQ 3UA7A 2KT1A 2FPFA 1H8KA 1VYTA 4PJOB 5CQXA 4D6WA 2JUFA 2JS0A 2LT1A 2COYA 3S6WA 3QSUA 1ZBJA 5DLQE 3QBYA 3QHSA 3CC2Q 2D1XA 3FB9A 4Y91A 5LJ5j 3HP9A 3CMET 1Q82R 2MWPA 2H8HA 5FU7B 2K5LA 4PJNA 5I21A 3QXEB 3JRZA 1HYOA 2DNUA 4MMKA 2IPOB 2LT4A 1X75C 3RESA 4JRIA 2P4RA 4ZGEB 3TREA 1YHQQ 1SRLA 1WGSA 7AT1B 1W1FA 2DVJA 1YITA 1M2OA 1UG1A 2COZA 1W70A 4WF2A 1VIFA 5HKCA 3EGXA 3G6ET 2LCSA 1BK2A 1YWPA 1M1GA 1KSWA 2BIVA 4E7ZA 2EW3A 4M75D 1OI1A 1YJ9Q 1BIAA 1M2VA 1OOTA 2KYBA 5LJ3g 2G6FX 2ABLA 4ELZC 1UHCA 4IUPA 4F7UA 2FO0A 1TUCA 4BDZA 1WQWA 3OA6A 2EKOA 1YI2A 2ZPHB 3JCMJ 2P0PA 2NYSA 4BD3A 1VQNA 1UGRB 3VKIA 4OP0A 5GAMj 4EIKA 2AT1B 3MP6A 2OTJT 3G71Q 3V7RA 1OZ2A 4KGVB 3NPFA 1YJNA 3M58A 2DTHA 3HRTA 3LGLA 3EFOA 1T0HA 2L5QA 1MV0B 4GLKA 3QKJA 1QVGS 2JTEA 2E70A 4OMOA 2DJQA 4PL6A 2DXUA 2AK5A 4HXJA 4EMHA 2CH4W 2CZ0B 1AD5A 4FW1A 3ASKA 3PE0A 1I4K1 4CI0C 1UFFA 2HL5C 2LC4A 1YFNA 3JAME 4HT9A 4AFZC 1T3LA 4QVCA 3CD6A 1PD1A 4F7UG 1MGQA 2HDAA 4BE2A 3VS5A 4M78D 1D09B 4NOYA 2JOYA 4PNOA 1JU5C 2L89A 2EQKA 3I55A 2KQWA 1M90R 3OS0A 4M7AA 2VASA 3OYAA 1M5Q1 3CC7T 1EZZB 4XU3A 2RHUA 3JB9G 2VXFA 1K9AA 1E6HA 4FYYB 3JB9I 3CCEQ 2VYTA 2FZKB 3VJPA 3CPWS 4JRQA 2LNVA 2O2OA 2KEAA 2CT4A 4N4HA 4PK4A 2QEXT 3JCMX 4KGXB 3JCMP 1KD1U 5L23A 3PTAA 4V2SA 5LJ3j 3C12A 2CUBA 5FU6B 3D7SB 2R5MA 2E65A 4C8QA 2HKNA 3FLGA 4J9CA 1H3ZA 3BY7A 3LH0A 1NYFA 1O75A 2K3YA 3M56A 1QVFA 2DXCA 2JMCA 1BU1A 1FYNA 2D0QB 3TQ7P 2K5FA 1ZUUA 5GAOq 3SEMA 3CEYA 1BKBA 5I2SA 1EFNA 2ATCB 4LD6A 5IXBA 2EQUA 4LDXA 4M75C 2K2VA 1MMAA 1VQ4A 1WJSA 4AFSC 3FJ5A 2RHZA 3P8BB 3E9GA 2NLUA 4IURA 2MK5A 4M7AG 2X9HA 1HK9A 3M53A 3E2UA 1PSFA 2EYWA 1M4ZA 1W2BP 2RPNA 1UDLA 2E5KA 2X3WD 1WNLA 5GANj 3EGXB 4IIOA 4OMQA 4P5NA 4PLLA 3RNJA 3M0RA 1OU9A 1VA7A 2LNHB 2QTVA 1Y71A 1ZBXA 1VQ5Q 1M2VB 4C8QG 4F7UB 2WSFE 6AT1B 2J05A 1GCQA 2X4WA 2GTOA 1BB9A 2F5KA 1G3SA 1IO6A 2O9SA 1WHHA 3X28B 1BYMA 2DXTA 1G3WA 4CC2A 2YLBA 2VVKA 4Z89A 1R77A 2CSIA 4B6MA 1FWZA 5J26A 2RMOA 3CCSA 3H9NA 3PVLA 2DFUA 2M16A 4XTVA 3REAB 4QKUA 1QLYA 2A37A 1MHNA 2DETA 4M7AF 5A0LA 2KXDA 5DY9A 4M77A 3P8HA 3I5SA 1PSEA 3ZEHA 1FMVA 2QA4T 2I2LA 3KBGA 3EFOB 3L1AA 2J6OA 1N5ZA 4M78C 3OYDA 3QJ6A 1OYXA 3X20B 3CCLA 1VQMQ 1M90C 2K3BA 3OW2A 5GJVB 3CCQT 3FC3A 2Y4YA 3OYGA 1NM7A 2HZYA 2YWWA 3CMAA 1ZQ1A 2L3PA 1QKXA 1X6OA 1VQOT 4BB7A 3A1PA 3VV0A 4JPBW 3HRUA 3M0PA 2D9TA 1G83A 1QWFA 2A36A 4DBQA 3CXCS 5D6XA 4EMKA 4J8OA 4M7AB 4ZTJA 5IHIA 1B34A 4PFPA 2MYSA 1OPLA 2ED1A 4XU1A 2C0IA 2ESWA 2KNBB 2ZPIB 1VQ9T 5CIUA 4M77G 5I11A 3O8VA 3MCAB 1M90U 3EAEA 4LE9A 2FPDA 2M9UA 4XTUA 2RJCA 2VKNA 1YIJT 3MP1A 3EG9A 4C8QB 4M7DE 2KI7A 2DTOA 3OYCA 3PIPA 1TXQA 2ZPFB 2J7IA 4M7DD 2Y90A 2MAMA 2EYZA 1BCOA 4X34A 3ZL7C 2HCKA 5AYFA 4B9XA 2DMOA 1UEBA 4RTYA 5CKHA 1IHVA 2QASA 2HQEA 2DIQA 2RD1A 1Z9ZA 1VQLA 2WSCE 1PWTA 4IUTA 4RKUE 2KBTA 2EIFA 4F04B 1VQPT 2F1LA 2KROA 3CCVT 2BZYA 3RKYA 1WLPB 2LJ0A 3RMQA 4JJDA 1V29B 2OAWA 4CC4B 4BY6B 3LWIA 2M51A 1ARKA 2HSEB 1SF9A 4JS4A 2BE7D 4E2FB 2QGGA 1RAIB 4QVZA 3L42A 2OX7A 3DB3A 1K76A 2LQKA 3OYJA 1YI2Q 1GRIA 3CC2T 2DYBA 2J06A 2R58A 1VQNQ 4J6WA 2CYZB 2GBQA
chains in the Genus database with same CATH topology
2MOXA 1GBRA 2NUZA 1OV3A 1CKAA 1WXTA 5HCKA 1BBZA 2D0NA 3M0SA 1LCKA 4RTVA 3UA7A 4FSSA 2KT1A 2LJ3A 1WDXA 2FPFA 1H8KA 1VYTA 4J9EA 2JXBA 1Y57A 1RI9A 2C0TA 2D8JA 2DRKA 2JS0A 1KFZA 2J6KA 1NEGA 2YUQA 2VWFA 1ZBJA 2YT6A 4D8DA 2K2MA 2D1XA 1JQQA 1WI7A 1ZUYA 2YSQA 3M0QA 2H8HA 4J9DA 1M30A 4R0KA 1XOVA 2DNUA 3JV3A 4J9BA 2ROTA 2AZSA 2P4RA 4CC7A 1YWOA 2M0YA 1SRLA 4JZ3A 3VS2A 5IHKA 1UE9A 2SRCA 1W1FA 2DVJA 3U23A 2NWMA 2A08A 2O31A 1T0JA 1UG1A 1NG2A 1QKWA 2LMJA 4OMLA 1W70A 1K0XA 4QT7A 4RTUA 2JS2A 1AWJA 3H0HA 4OMNA 3REBB 2DA9A 2ECZA 2LCSA 1BK2A 3VS6A 1AWOA 2HBWA 1YWPA 1KSWA 2EW3A 2V1RA 1AWXA 3PVQA 4ZNXA 1OOTA 2KYBA 2G6FX 2ABLA 1UHCA 3VRZA 2LX7A 3IQLA 1PHTA 1TG0A 2FO0A 2DL8A 4RUGA 1TUCA 2EGCA 4AG1C 4AFUC 2DL5A 2OI3A 4GLMA 1NEBA 2RQTA 3QWXX 3GBQA 3H0FA 2AKKA 2AZVA 2BZXA 1TUDA 1SSHA 2KXCA 1QCFA 1M27C 4DEYA 4EIKA 1UJ0A 1QWEA 2A28A 1OPKA 2LQWA 1MV3A 1OEBA 3NPFA 4GBQA 1H92A 1B3QA 1T0HA 1MV0B 2PNIA 2CUDA 2JTEA 1M3AA 1U06A 4OMOA 3VS0A 2DJQA 4IIMA 3VS7A 2D8HA 2GGRA 2GNCA 4ESRA 2AK5A 4HXJA 1X69A 2CH4W 1WA7A 2K6DA 1AD5A 1NYGA 2ROLA 3PE0A 1UFFA 2EQIA 3TVTA 4AFZC 1S1NA 1T3LA 1CSKA 2EBPA 3TSZA 1I1JA 1RUWA 2C0OA 2CH4A 1X6BA 2HDAA 2CDTA 3VS5A 1JU5C 2O9VA 2CREA 5FW9A 2CT3A 1KIKA 4LUEA 1K9AA 1E6HA 3EG0A 2DL4A 2XMFA 1UGVA 1GFCA 1E7OA 2O2OA 1WXBA 2CT4A 2KEAA 2RQUA 3UA6A 2YDLA 4RTTA 1YN8A 5L23A 1CKBA 1ZUKA 4KRTA 1Y0MA 1WFWA 2DRMA 1A0NB 4J9IA 2DX1A 1H3HA 2SEMA 2CUBA 3R6NA 1UHFA 1YP5A 3H41A 1FMKA 4J9CA 2JT4A 2DBMA 1M8MA 1YNZA 3QWYA 2YUOA 5ECAA 3A98A 1NYFA 1PRMC 3UATA 2JMCA 4F16A 2L3QA 1BU1A 1FYNA 3NHNA 1GBQA 2O88A 1ZUUA 2CSQA 1M3CA 4HVWA 3SEMA 3EG3A 1X27A 2GTJA 4J9FA 1EFNA 2L3SA 2RQWA 3I9QA 3M0UA 2MCNA 5IXBA 5EC7A 4RTZA 4CC3A 4AFSC 4F17A 3EG1A 1I07A 3FJ5A 2GQIA 2YUNA 5IH2A 2ED0A 1UTIA 3TSWA 3EHRA 2EGAA 1AVZC 1ZSGA 2EPDA 4X1VA 1VYVA 2EYWA 1GFDA 2HSPA 2RN8A 2RPNA 1UDLA 2K79A 2E5KA 2X3WD 5FWCA 2B86A 4IIOA 4OMQA 4RTXA 1HJDA 1SPKA 3THKA 3RNJA 1GCQC 2JW4A 3M0RA 2RQRA 1JXOA 1VA7A 2LNHB 2EYYA 3O5ZA 4J9HA 1AZEA 4J9GA 2FEIA 2LQNA 2J05A 1GCQA 2GTOA 4Z88A 1BB9A 1IO6A 4LNPA 2BZ8A 1WXUA 2O9SA 2EGEA 1JXMA 2FPEA 4CC2A 1YCSB 2VVKA 4Z89A 2CSIA 1WX6A 1NLPC 1HD3A 2RMOA 2RNAA 5IXFA 3PVLA 2DBKA 4HVVA 4D8KA 4HVUA 4WCIA 4F14A 2KGTA 3REAB 3UF4A 1QLYA 1K0SA 2DL7A 2A37A 4JZ4A 1GCPA 2J6FA 1AZGB 4Z8AA 1WIEA 4LN2A 2KXDA 1V1CA 2EKHA 2K7AA 3I5SA 2X3XD 2KRSA 4OMMA 5IHNA 2LP5A 1T3SA 1NLOC 2V1QA 5I22A 4HCKA 2J6OA 2KRMA 1UECA 2LZ6B 1N5ZA 3EHQA 2RQVA 1HSQA 1WYXA 1VYUA 1Z9QA 2K3BA 5GJVB 1ABOA 4DEXA 3EG2A 2HEQA 1M3BA 1PKTA 2JMAA 1J3TA 1KJWA 4E6RA 1NM7A 3C0CA 2OJ2A 1AOJA 1U5SA 2AKLA 4OMPA 2F2XA 3CQTA 2L3PA 2EYXA 1QKXA 1UUEA 2FRWA 4M4ZA 1E6GA 3VS4A 2KE9A 3SHWA 4JPBW 2KRNA 1SHFA 3M0PA 1G83A 3VS1A 1ABQA 2RF0A 1AWWA 1QWFA 3M0TA 2A36A 2JM9A 2LJ1A 5IHIA 4A63B 2W10A 1W6XA 4RTWA 4AG2C 2KT8A 2K9GA 2F2VA 1RLPC 4ORZA 1OPLA 2ED1A 4LUDA 4Y92A 2C0IA 4JJCA 2KYMA 5FWBA 2ESWA 2KNBB 1JEGA 1U3OA 2KR3A 3I5RA 5I11A 3H0IA 3VRYA 1ZLMA 2FG0A 2QDLA 4LE9A 2FPDA 2W0ZA 2VKNA 1K1ZA 1SEMA 1X2KA 2MIOA 3RBBB 1JO8A 1ZX6A 2YUPA 3NMZC 3ULRB 1X6GA 1RLQC 2J7IA 2EVRA 3EGUA 2DE0X 2EYZA 2DLPA 3ZL7C 2HCKA 1UJYA 2DMOA 3I35A 4RTYA 1SRMA 2ENMA 2FRYA 4K11A 2DILA 5GJWB 1SHGA 1PKSA 1B07A 2DL3A 2L0AA 1Z9ZA 1PWTA 2JM8A 1X43A 2KBTA 2PTKA 3VS3A 1PNJA 2KROA 1I0CA 2BZYA 1WLPB 2LJ0A 4JJDA 2OAWA 4CC4B 1PRLC 2M51A 1X2QA 4AFQC 1ARKA 2I0NA 1G2BA 1K4US 2IIMA 1MUZA 2BTTA 1GL5A 1K76A 2PZ1A 3NGPA 2F2WA 3KFVA 4JJBA 1GRIA 1AEYA 2DYBA 2J06A 2DF6A 2L2PA 2DM1A 2GBQA 3LH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOX A;  1GBR A;  2NUZ A;  1OV3 A;  1CKA A;  1WXT A;  5HCK A;  1BBZ A;  2D0N A;  3M0S A;  1LCK A;  4RTV A;  3UA7 A;  4FSS A;  2KT1 A;  2LJ3 A;  1WDX A;  2FPF A;  1H8K A;  1VYT A;  4J9E A;  2JXB A;  1Y57 A;  1RI9 A;  2C0T A;  2D8J A;  2DRK A;  2JS0 A;  1KFZ A;  2J6K A;  1NEG A;  2YUQ A;  2VWF A;  1ZBJ A;  2YT6 A;  4D8D A;  2K2M A;  2D1X A;  1JQQ A;  1WI7 A;  1ZUY A;  2YSQ A;  3M0Q A;  2H8H A;  4J9D A;  1M30 A;  4R0K A;  1XOV A;  2DNU A;  3JV3 A;  4J9B A;  2ROT A;  2AZS A;  2P4R A;  4CC7 A;  1YWO A;  2M0Y A;  1SRL A;  4JZ3 A;  3VS2 A;  5IHK A;  1UE9 A;  2SRC A;  1W1F A;  2DVJ A;  3U23 A;  2NWM A;  2A08 A;  2O31 A;  1T0J A;  1UG1 A;  1NG2 A;  1QKW A;  2LMJ A;  4OML A;  1W70 A;  1K0X A;  4QT7 A;  4RTU A;  2JS2 A;  1AWJ A;  3H0H A;  4OMN A;  3REB B;  2DA9 A;  2ECZ A;  2LCS A;  1BK2 A;  3VS6 A;  1AWO A;  2HBW A;  1YWP A;  1KSW A;  2EW3 A;  2V1R A;  1AWX A;  3PVQ A;  4ZNX A;  1OOT A;  2KYB A;  2G6F X;  2ABL A;  1UHC A;  3VRZ A;  2LX7 A;  3IQL A;  1PHT A;  1TG0 A;  2FO0 A;  2DL8 A;  4RUG A;  1TUC A;  2EGC A;  4AG1 C;  4AFU C;  2DL5 A;  2OI3 A;  4GLM A;  1NEB A;  2RQT A;  3QWX X;  3GBQ A;  3H0F A;  2AKK A;  2AZV A;  2BZX A;  1TUD A;  1SSH A;  2KXC A;  1QCF A;  1M27 C;  4DEY A;  4EIK A;  1UJ0 A;  1QWE A;  2A28 A;  1OPK A;  2LQW A;  1MV3 A;  1OEB A;  3NPF A;  4GBQ A;  1H92 A;  1B3Q A;  1T0H A;  1MV0 B;  2PNI A;  2CUD A;  2JTE A;  1M3A A;  1U06 A;  4OMO A;  3VS0 A;  2DJQ A;  4IIM A;  3VS7 A;  2D8H A;  2GGR A;  2GNC A;  4ESR A;  2AK5 A;  4HXJ A;  1X69 A;  2CH4 W;  1WA7 A;  2K6D A;  1AD5 A;  1NYG A;  2ROL A;  3PE0 A;  1UFF A;  2EQI A;  3TVT A;  4AFZ C;  1S1N A;  1T3L A;  1CSK A;  2EBP A;  3TSZ A;  1I1J A;  1RUW A;  2C0O A;  2CH4 A;  1X6B A;  2HDA A;  2CDT A;  3VS5 A;  1JU5 C;  2O9V A;  2CRE A;  5FW9 A;  2CT3 A;  1KIK A;  4LUE A;  1K9A A;  1E6H A;  3EG0 A;  2DL4 A;  2XMF A;  1UGV A;  1GFC A;  1E7O A;  2O2O A;  1WXB A;  2CT4 A;  2KEA A;  2RQU A;  3UA6 A;  2YDL A;  4RTT A;  1YN8 A;  5L23 A;  1CKB A;  1ZUK A;  4KRT A;  1Y0M A;  1WFW A;  2DRM A;  1A0N B;  4J9I A;  2DX1 A;  1H3H A;  2SEM A;  2CUB A;  3R6N A;  1UHF A;  1YP5 A;  3H41 A;  1FMK A;  4J9C A;  2JT4 A;  2DBM A;  1M8M A;  1YNZ A;  3QWY A;  2YUO A;  5ECA A;  3A98 A;  1NYF A;  1PRM C;  3UAT A;  2JMC A;  4F16 A;  2L3Q A;  1BU1 A;  1FYN A;  3NHN A;  1GBQ A;  2O88 A;  1ZUU A;  2CSQ A;  1M3C A;  4HVW A;  3SEM A;  3EG3 A;  1X27 A;  2GTJ A;  4J9F A;  1EFN A;  2L3S A;  2RQW A;  3I9Q A;  3M0U A;  2MCN A;  5IXB A;  5EC7 A;  4RTZ A;  4CC3 A;  4AFS C;  4F17 A;  3EG1 A;  1I07 A;  3FJ5 A;  2GQI A;  2YUN A;  5IH2 A;  2ED0 A;  1UTI A;  3TSW A;  3EHR A;  2EGA A;  1AVZ C;  1ZSG A;  2EPD A;  4X1V A;  1VYV A;  2EYW A;  1GFD A;  2HSP A;  2RN8 A;  2RPN A;  1UDL A;  2K79 A;  2E5K A;  2X3W D;  5FWC A;  2B86 A;  4IIO A;  4OMQ A;  4RTX A;  1HJD A;  1SPK A;  3THK A;  3RNJ A;  1GCQ C;  2JW4 A;  3M0R A;  2RQR A;  1JXO A;  1VA7 A;  2LNH B;  2EYY A;  3O5Z A;  4J9H A;  1AZE A;  4J9G A;  2FEI A;  2LQN A;  2J05 A;  1GCQ A;  2GTO A;  4Z88 A;  1BB9 A;  1IO6 A;  4LNP A;  2BZ8 A;  1WXU A;  2O9S A;  2EGE A;  1JXM A;  2FPE A;  4CC2 A;  1YCS B;  2VVK A;  4Z89 A;  2CSI A;  1WX6 A;  1NLP C;  1HD3 A;  2RMO A;  2RNA A;  5IXF A;  3PVL A;  2DBK A;  4HVV A;  4D8K A;  4HVU A;  4WCI A;  4F14 A;  2KGT A;  3REA B;  3UF4 A;  1QLY A;  1K0S A;  2DL7 A;  2A37 A;  4JZ4 A;  1GCP A;  2J6F A;  1AZG B;  4Z8A A;  1WIE A;  4LN2 A;  2KXD A;  1V1C A;  2EKH A;  2K7A A;  3I5S A;  2X3X D;  2KRS A;  4OMM A;  5IHN A;  2LP5 A;  1T3S A;  1NLO C;  2V1Q A;  5I22 A;  4HCK A;  2J6O A;  2KRM A;  1UEC A;  2LZ6 B;  1N5Z A;  3EHQ A;  2RQV A;  1HSQ A;  1WYX A;  1VYU A;  1Z9Q A;  2K3B A;  5GJV B;  1ABO A;  4DEX A;  3EG2 A;  2HEQ A;  1M3B A;  1PKT A;  2JMA A;  1J3T A;  1KJW A;  4E6R A;  1NM7 A;  3C0C A;  2OJ2 A;  1AOJ A;  1U5S A;  2AKL A;  4OMP A;  2F2X A;  3CQT A;  2L3P A;  2EYX A;  1QKX A;  1UUE A;  2FRW A;  4M4Z A;  1E6G A;  3VS4 A;  2KE9 A;  3SHW A;  4JPB W;  2KRN A;  1SHF A;  3M0P A;  1G83 A;  3VS1 A;  1ABQ A;  2RF0 A;  1AWW A;  1QWF A;  3M0T A;  2A36 A;  2JM9 A;  2LJ1 A;  5IHI A;  4A63 B;  2W10 A;  1W6X A;  4RTW A;  4AG2 C;  2KT8 A;  2K9G A;  2F2V A;  1RLP C;  4ORZ A;  1OPL A;  2ED1 A;  4LUD A;  4Y92 A;  2C0I A;  4JJC A;  2KYM A;  5FWB A;  2ESW A;  2KNB B;  1JEG A;  1U3O A;  2KR3 A;  3I5R A;  5I11 A;  3H0I A;  3VRY A;  1ZLM A;  2FG0 A;  2QDL A;  4LE9 A;  2FPD A;  2W0Z A;  2VKN A;  1K1Z A;  1SEM A;  1X2K A;  2MIO A;  3RBB B;  1JO8 A;  1ZX6 A;  2YUP A;  3NMZ C;  3ULR B;  1X6G A;  1RLQ C;  2J7I A;  2EVR A;  3EGU A;  2DE0 X;  2EYZ A;  2DLP A;  3ZL7 C;  2HCK A;  1UJY A;  2DMO A;  3I35 A;  4RTY A;  1SRM A;  2ENM A;  2FRY A;  4K11 A;  2DIL A;  5GJW B;  1SHG A;  1PKS A;  1B07 A;  2DL3 A;  2L0A A;  1Z9Z A;  1PWT A;  2JM8 A;  1X43 A;  2KBT A;  2PTK A;  3VS3 A;  1PNJ A;  2KRO A;  1I0C A;  2BZY A;  1WLP B;  2LJ0 A;  4JJD A;  2OAW A;  4CC4 B;  1PRL C;  2M51 A;  1X2Q A;  4AFQ C;  1ARK A;  2I0N A;  1G2B A;  1K4U S;  2IIM A;  1MUZ A;  2BTT A;  1GL5 A;  1K76 A;  2PZ1 A;  3NGP A;  2F2W A;  3KFV A;  4JJB A;  1GRI A;  1AEY A;  2DYB A;  2J06 A;  2DF6 A;  2L2P A;  2DM1 A;  2GBQ A;  3LH5 A; 
#chains in the Genus database with same CATH topology
 4ELY C;  2NUZ A;  1OV3 A;  5KCH A;  1WHG A;  1G3T A;  3ZBD A;  1BBZ A;  2K3X A;  4XU0 A;  2DZ9 A;  4C92 A;  1YJN Q;  1LCK A;  1I5O B;  2P0K A;  1ZA2 B;  1YHQ T;  2LJ3 A;  1OX8 A;  5GMK j;  4XQ3 A;  4LDW A;  2E5Q A;  4J9E A;  2L8D A;  2C0T A;  2D8J A;  3JCM b;  1KFZ A;  1NEG A;  4LDU A;  2YT6 A;  5GAN 7;  2K2M A;  4M77 B;  3JCM e;  1ZUY A;  1WI7 A;  3F70 A;  3MET A;  5CO7 A;  2QA4 Q;  2DIG A;  3CD6 Q;  1IRE B;  1WHM A;  1YJ9 T;  1G3Y A;  1S72 A;  5FLX E;  3P8D A;  3SFM A;  2ROT A;  2R5A A;  1N27 A;  1WQ7 A;  4OB0 B;  2AZS A;  3ME9 A;  5GMK l;  3I55 Q;  4JZ3 A;  5IHK A;  3UT1 A;  2NWM A;  3H8Z A;  2GCX A;  3MEW A;  1NG2 A;  1QKW A;  2V8K A;  1K0X A;  4KT0 E;  1VQ7 A;  1AWJ A;  3H0H A;  4C92 G;  3REB B;  2ECZ A;  2JTF A;  4GY5 A;  3KXT A;  3G71 T;  2PU9 B;  2HBW A;  5CCA A;  1JJ2 P;  4EMK B;  4ZNX A;  1B34 B;  4M7D C;  3L2V A;  2MWO A;  3WXM B;  1C6V X;  3JCM d;  2LX7 A;  3IQL A;  3SWN C;  1PHT A;  2FVU A;  2EWN A;  4AG1 C;  1U8R A;  1NPP A;  2DL5 A;  4A4H A;  3RDV A;  1NEB A;  3E19 A;  4JRP A;  4XK8 E;  1KQS P;  3VYH B;  3QWX X;  2HBP A;  3GBQ A;  2AKK A;  2AZV A;  2BZX A;  2VC8 A;  4N4I A;  2QQS A;  1QCF A;  4DEY A;  3EG9 B;  1VQ4 Q;  3GF5 A;  4C5G A;  3CCM A;  1UJ0 A;  1QWE A;  5CKB A;  3QII A;  2EJG A;  3AHU A;  3M4Y A;  4IKF A;  1OEB A;  4ME7 A;  1D0X A;  1PG5 B;  2DKG A;  1QP2 A;  1B3Q A;  2MF2 A;  2JTM A;  5GAN 4;  4PJO D;  2PNI A;  9ATC B;  2DYI A;  1M3A A;  4C5E A;  5LJ5 f;  2D8H A;  2GNC A;  5LL6 S;  4BI8 B;  4FYW B;  1X69 A;  3CCE T;  3OS2 A;  1WA7 A;  1BCM A;  2DER A;  5CR2 A;  2XG8 D;  1D0Z A;  2RHI A;  4BI4 A;  5GAN 6;  2OTL T;  4DBR A;  3OYF A;  2E4H A;  1CSK A;  1YCY A;  3HFO A;  1I1J A;  1H64 1;  4E7K A;  2RI2 A;  3QO3 A;  2XIC A;  4X9D A;  3V8J A;  5D7U A;  4J7F A;  3CCS Q;  1TTH B;  1D1A A;  2CT3 A;  2NUT B;  5GAN 3;  2HKQ B;  2M0O A;  3CCJ T;  4XTY A;  3LW5 E;  5A0D A;  1GFC A;  3I56 A;  4C92 B;  1RAA B;  1I81 A;  2XK0 A;  1NJI R;  1VUB A;  5J39 A;  2FHD A;  3OYM A;  4RTT A;  3OYY A;  1CKB A;  2DRM A;  4KBM B;  4HCB A;  2DX1 A;  2SEM A;  4FT2 A;  3R6N A;  3VUB A;  1QVF S;  3H41 A;  4XTZ A;  2DBM A;  2LCL A;  1ZSZ C;  4A53 A;  1P92 A;  1UGP B;  1O9S A;  3CMA Q;  2HNI A;  4M75 E;  2E10 A;  2LTO A;  5CKD A;  3EFS A;  5GAM f;  2C06 A;  2O88 A;  2CSQ A;  3EG3 A;  4M75 F;  1X27 A;  1VQ5 T;  3M0U A;  1KHI A;  3DLM A;  4QVD A;  5IAY A;  1N9S A;  4RTZ A;  1NBE B;  2DO3 A;  3TEE A;  2KAF A;  1K8A R;  1I07 A;  1JBM A;  2GQI A;  5IH2 A;  5KYW A;  4XAX B;  3EHR A;  1AVZ C;  1ZSG A;  1LNX A;  3PFS A;  3R6O A;  2QQ9 A;  5KYY A;  1Y96 A;  2HSP A;  3C94 A;  5FWC A;  2O4X A;  4N0A A;  1C0M A;  2BKD N;  2RQR A;  1JXO A;  2RA2 A;  1VQ8 A;  1D3B A;  1AZE A;  2DK3 A;  4J9G A;  1VQM T;  4PJO C;  1KD1 C;  2BZ8 A;  4DOV A;  2HL3 A;  2E64 A;  3CBM A;  2FPE A;  3A5Z B;  2PUO B;  4Y28 E;  3MEA A;  3UPU A;  5IXF A;  3V8K A;  4HVV A;  5CAI A;  1OX9 A;  4RCC A;  2KGT A;  1VQL Q;  1V76 A;  4M78 E;  4JZ4 A;  4JDS A;  5LJ3 f;  2J6F A;  4OMF B;  4L6V 5;  2JJ9 A;  3OYE A;  1OQK A;  3OW2 S;  2X3X D;  2ZPG B;  1K9M R;  4M78 F;  2LP5 A;  1T3S A;  1NLO C;  2V1Q A;  2LZ6 B;  3MP8 A;  2YRV A;  1HSQ A;  3OYN A;  2E6Z A;  2F5T X;  3OYL A;  2HEQ A;  1M3B A;  1PKT A;  1Q82 C;  1Q86 R;  1J3T A;  1KJW A;  4LXC A;  1AOJ A;  5HY6 A;  3GP8 A;  1S72 Q;  1WZO A;  3CC4 A;  1NJI C;  4OMP A;  3CQT A;  2EYX A;  2DZC A;  4M4Z A;  2OTL Q;  3QYG B;  4BUG A;  3A8M B;  2CKK A;  1NZ9 A;  3QDR B;  3QJY A;  2FZG B;  1ABQ A;  2ZPB B;  4L5G A;  1LJO A;  3OBW A;  1YIT T;  3PIO A;  3V7C A;  1PCX A;  4A63 B;  1W6X A;  4RTW A;  2RB6 A;  3SD4 A;  5GAN f;  1OUL A;  3V8L A;  4ORZ A;  1KQ1 A;  4LUD A;  1XJW B;  2QYZ A;  3UDC A;  5HK0 A;  2RO0 A;  3CCJ Q;  3HFN A;  4RG2 A;  3H0I A;  2FB7 A;  1ZLM A;  2FG0 A;  2QDL A;  3G4S A;  2DEU A;  1Q82 U;  1K1Z A;  2X4X A;  4L59 A;  2E41 A;  2O01 E;  1X2K A;  2RH2 A;  1G5V A;  1JO8 A;  2YXY A;  3PT9 A;  2YUP A;  3GOX A;  2LCC A;  3M5A A;  1X6G A;  1NJI U;  1N6A A;  2QAZ A;  4OB1 B;  2WSE E;  1YI2 T;  4KGZ B;  2CZ6 B;  4TVR A;  2F69 A;  2VB6 A;  1UJY A;  2EQM A;  1VQN T;  1SRM A;  1TWB A;  2ENM A;  2V8I A;  1JB0 E;  3JB9 D;  2FRY A;  4K11 A;  4HKE A;  5C0M A;  1VQ7 Q;  3FJP A;  1QP3 A;  1IB8 A;  5GJW B;  1QVG P;  4M7D A;  1B07 A;  2RJD A;  2L0A A;  2RK1 A;  1YJN T;  1X43 A;  3MKD A;  5KYW B;  1I0C A;  3C95 A;  1X2Q A;  1Q7Y R;  4Z02 A;  3MPU B;  1OU8 A;  1G2B A;  1K4U S;  2IIM A;  5KYY B;  1Y96 B;  1RAC B;  4OGC A;  1HXD A;  1GL5 A;  1K8A U;  1W2B A;  2O4X B;  2GFA A;  1VQ6 A;  1AEY A;  2L2P A;  2DM1 A;  4FYV B;  4XTW A;  3FIF A;  2E1H A;  3CCM Q;  1M1F A;  1D3B B;  1WXT A;  3CD6 T;  2Z0W A;  5HCK A;  4ZN1 A;  2P84 A;  2D0N A;  2LVM A;  3VYG A;  3RKX A;  4KUL A;  3OYH A;  3I55 T;  5FRN A;  1WDX A;  3CPW P;  1Q86 C;  1KC8 R;  5CKF A;  4C0D C;  1EX4 A;  4BI3 A;  4ZGJ B;  4M7A D;  2FZC B;  2HMA A;  4JUV A;  1WJQ A;  2YUQ A;  2VWF A;  3M54 A;  4D8D A;  2RHY A;  1JQQ A;  1M1K R;  3HPW A;  2Y4X A;  1U1S A;  5KYU A;  1C1A A;  2RM4 A;  4J9D A;  4CRI A;  4II1 A;  4R0K A;  4RCB A;  1XOV A;  4C8Q D;  3JV3 A;  2E6N A;  3RUX A;  4J9B A;  3QDF A;  1BI0 A;  4KUI A;  3UWN A;  4KH0 B;  2CGH A;  3EFR A;  4JLI A;  1UE9 A;  3U23 A;  5DLO A;  4MDX A;  2A08 A;  1T0J A;  2EYQ A;  3M4G A;  3L2Z A;  2LMJ A;  4QT7 A;  3I56 Q;  2DXB A;  4RTU A;  1VQ4 T;  3TCJ A;  2JS2 A;  4E7I A;  1Q86 U;  2COW A;  1FX7 A;  4OMN A;  2DA9 A;  2NUP A;  1ZHI A;  1ZSZ A;  1AWO A;  2HD0 A;  4M7D F;  3OYI A;  1YIT Q;  2QDY B;  1IGU A;  2V1R A;  5KE3 A;  2MMP A;  3OSS C;  3PVQ A;  1VQK A;  4MZP A;  2OAU A;  3VRZ A;  3CCR A;  1LOJ A;  4MZM A;  3JCM g;  5FRO A;  1TG0 A;  3INZ A;  4AFU C;  4GLM A;  3URG A;  1ACM B;  1SSH A;  1TS9 A;  2E3I A;  1M27 C;  3L2R A;  3GNG A;  4Q5W A;  1OPK A;  1MV3 A;  1Q7Y C;  3PMT A;  2YRD A;  4GBQ A;  1M9S A;  1B7T A;  3BDU A;  3CCS T;  4ZTF A;  2XI9 A;  1U06 A;  2LQ8 A;  3VS0 A;  4QQ6 A;  4IIM A;  1BIB A;  4XTX A;  1VQ6 T;  1D1C A;  1KG1 A;  4M7D B;  1PD0 A;  4ESR A;  2EFI A;  2X35 A;  4M77 D;  2K6D A;  3J7A F;  1NYG A;  4FCY A;  2ROL A;  3T9N A;  2PQW A;  3CCU A;  2EQI A;  1R0C B;  3TVT A;  3CCL T;  1R0B G;  3TSZ A;  3X25 B;  2C0O A;  3MEU A;  1YJW A;  2XD0 A;  1X6B A;  2PVD B;  3TU4 K;  3GNF B;  5D6W A;  4HCZ A;  1VOM A;  2O9V A;  3OS5 A;  5FW9 A;  3CMA T;  1IHW A;  3M55 A;  3CXC P;  1M1K C;  2E12 A;  4LUE A;  1Q7Y U;  4JLG A;  1RAH B;  1SSF A;  3RIR A;  2XMF A;  2H3E B;  4PJM A;  2RQU A;  3OB9 A;  3QG1 A;  1KK7 A;  4C8Q C;  3OYB A;  1YN8 A;  2ZAE A;  1ZUK A;  2DEQ A;  3CME A;  4J6X A;  1WFW A;  4J9I A;  2JN0 A;  4PFO A;  4BAC A;  4C5I A;  1YP5 A;  1FMK A;  2JNG A;  2K57 A;  1M8M A;  3QWY A;  4VUB A;  5GAO m;  1PRM C;  3UAT A;  3M57 A;  3E9F A;  4OVA A;  1GBQ A;  5KYU B;  4HVW A;  3PMI A;  5GAN 5;  4X9C A;  1MND A;  2GTJ A;  1SKU B;  1RAD B;  4J9F A;  3I9Q A;  3X24 B;  5EC7 A;  2H3J A;  1LPL A;  2ZGW A;  3M9Q A;  3EG1 A;  3G6E A;  2YUN A;  5LJ5 g;  2LX9 A;  1M1K U;  1VQK T;  2ED0 A;  2DD4 A;  4FM4 B;  4M75 A;  3TSW A;  2EGA A;  1TSF A;  2EPD A;  2CS7 A;  4UC4 A;  4X1V A;  2R57 A;  1VYV A;  4C0F A;  2RN8 A;  4FYX B;  2GFU A;  1VQL T;  2IVW A;  1DJ7 B;  1Y7X A;  2B86 A;  5GAO r;  3G4S Q;  2NUP B;  3HSB A;  4RTX A;  3JCM Q;  4J5Y A;  2JVV A;  1SPK A;  4PJO E;  1HJD A;  1ZSZ B;  3THK A;  1GCQ C;  2M02 A;  2KK4 A;  2EYY A;  2DAQ A;  3O5Z A;  3BW1 A;  4PJO F;  1JJ2 A;  2NUT A;  2FEI A;  4HT8 A;  4Z88 A;  1W4S A;  3A8L B;  2OTJ A;  1WXU A;  2L3R A;  2EGE A;  1YCS B;  3FEO A;  1S72 T;  1HD3 A;  4OB3 B;  2DBK A;  4M77 C;  4D8K A;  1KQS A;  3JB9 J;  4ATO A;  3UF4 A;  5A0G A;  2XKO C;  3GIB A;  3CBO A;  4QW2 A;  2K5I A;  1GCP A;  4C92 D;  3JSC A;  2JZ2 A;  1V1C A;  4RG8 A;  3QZ9 B;  5KYX A;  2QGF B;  2KRS A;  5IHN A;  3OMG A;  4LD9 K;  4HCK A;  1N9R A;  2XHC A;  3E1S A;  4M75 G;  1UEC A;  3X26 B;  3HHT B;  4BE0 A;  3J81 E;  2DVE A;  1VYU A;  1Z9Q A;  1M8V A;  5GAM g;  5LJ5 e;  1ABO A;  1RAG B;  3EG2 A;  4DEX A;  1VQ6 Q;  3JCM h;  5KYN A;  1NPR A;  4M78 A;  3C0C A;  3SDZ A;  4ZGD B;  1U5S A;  2AKL A;  3HL8 A;  2FRW A;  3CC7 A;  1E6G A;  3VS4 A;  2KE9 A;  3SHW A;  3CCL Q;  2KRN A;  1QW1 A;  4EMK C;  1K73 R;  3VS1 A;  2QEX A;  3M0T A;  4PJJ A;  4E7L A;  2PUK B;  2XDP A;  2JM9 A;  3ZFJ A;  1GXI E;  2YRC A;  2W10 A;  3V7S A;  4AG2 C;  2DJZ A;  2KT8 A;  2F2V A;  3S3N A;  3JCM W;  4Y92 A;  1LVK A;  4JJC A;  1VQ7 T;  3OBY A;  2HAX A;  4O6J A;  4DQ2 A;  1JEG A;  3I5R A;  3CBP A;  3VRY A;  4QQG A;  5LJ5 d;  2W0Z A;  1G8X A;  1BI3 A;  1QMC A;  1SEM A;  2QXF A;  2EJF A;  3RBB B;  4LDY A;  4AT1 B;  4N4G A;  2DD5 A;  2XDB A;  1RAF B;  3ULR B;  4A4K A;  4M78 G;  3LWH A;  2EVR A;  4FT4 A;  3EGU A;  3PNW C;  5GAM e;  2XU8 A;  5CVI A;  3CCM T;  1R8O B;  1PKS A;  4BDY A;  1IRX A;  2DL3 A;  2G3R A;  2A0F B;  2JM8 A;  2M1H A;  2WAC A;  1PNJ A;  3RMS A;  1VQK Q;  4A4E A;  4M75 B;  3H6Z A;  1W2B S;  4AFQ C;  5KE2 A;  1BI1 A;  2I0N A;  3CCR Q;  2FL7 A;  2RHX A;  4E7J A;  2RI5 A;  1MMG A;  2MI6 A;  1MUZ A;  2BTT A;  2KMT A;  5KH6 A;  3EH1 A;  1RI0 A;  5FU7 C;  3MEV A;  4KH1 B;  5AT1 B;  1UB4 A;  2DF6 A;  4HA8 A;  4C92 C;  1D1B A;  3MHX A;  3LH5 A;  4DOW A;  2MOX A;  1GBR A;  1NE8 A;  3LX7 A;  2YLC A;  1XQH A;  1XTD A;  2VV5 A;  5GAM d;  5GAN g;  3S3M A;  5GAO p;  4J6Y A;  4RTV A;  5GMK i;  2QTX A;  4FSS A;  5LJ5 h;  4NS5 A;  2QA4 A;  2AIR B;  2LRQ A;  5GMK m;  2JXB A;  2CZ1 B;  2EAY A;  3LGF A;  1IXD A;  1Y57 A;  1RI9 A;  2DRK A;  1QQJ A;  3JCM c;  2QK0 A;  2J6K A;  1FMW A;  4R56 A;  1WHK A;  3I56 T;  4A4G A;  2XDD A;  3VUZ A;  3CCQ A;  1QVF P;  5LJ3 e;  4XU2 A;  2RJE A;  1QVP A;  4PKC C;  4MDW A;  3CCU Q;  2YSQ A;  3M0Q A;  1K73 C;  5KYX B;  4J7I A;  4B9W A;  4E7S A;  1M30 A;  1VQO A;  2QQR A;  3BE3 A;  1YJW Q;  4DBH A;  2MPX C;  1MMD A;  1U1T A;  1OZ3 A;  4C5H A;  1YWO A;  2M0Y A;  4CC7 A;  4FW2 A;  4M78 B;  1KHC A;  3VS2 A;  5GAN 8;  4JS5 A;  2SRC A;  4R55 A;  2O31 A;  2V8J A;  4F7U E;  4OML A;  2CP2 A;  2XID A;  4C0D B;  1K8A C;  4FL6 A;  1MNE A;  2EJ9 A;  4F7U F;  2QI2 A;  3CME Q;  1VQ9 A;  3VS6 A;  2YHT A;  5EG2 A;  5GAN 2;  4FIB A;  1ZA1 B;  1AWX A;  5LJ3 d;  1YIJ A;  5GAN e;  3QYH B;  3JB9 F;  5GAM h;  4FU6 A;  5I2M A;  2DL8 A;  4RUG A;  1K73 U;  2EGC A;  3N5B B;  1UGS B;  2OI3 A;  3WVE B;  2BE9 B;  2VUB A;  5GAO l;  4YTL A;  5L8R E;  3SWN A;  1Q81 R;  2RQT A;  3H0F A;  1VQ8 T;  1TUD A;  2KXC A;  3AT1 B;  3NTK A;  2A28 A;  2LQW A;  3G6E Q;  4A54 A;  2PVO B;  1I5L A;  1JRI A;  1QCN A;  1WHL A;  3A8G B;  1H92 A;  1VQP A;  2VGN A;  5M9O A;  3MO8 A;  4J83 A;  3CCV A;  3HKS A;  1AHJ B;  3OW2 P;  2CUD A;  4IUU A;  3M59 A;  2ZPE B;  4FSX A;  3VS7 A;  2GGR A;  2P0Q A;  1K9M C;  4NL2 A;  1SG5 A;  2CP0 A;  1QVG A;  5GAN d;  2KDS A;  1AT1 B;  4PLI A;  5FU6 C;  5C6S A;  3CC2 A;  4M7A E;  4A4F A;  3A8O B;  3PGG A;  1S1N A;  4AMC A;  2EBP A;  2OTJ Q;  1RUW A;  2CH4 A;  1TUG B;  1Q95 G;  2CDT A;  1MMN A;  4EDU A;  4IUV A;  1YHQ A;  4M7D G;  2CRE A;  3CC4 T;  5LJ3 h;  1KIK A;  4C8Q E;  4E47 A;  4EPC A;  5KCO A;  3EG0 A;  2DL4 A;  3L2W A;  4WTO B;  1IGQ A;  2CZ7 B;  4C8Q F;  1UGV A;  1E7O A;  1WXB A;  3UA6 A;  2YDL A;  4ZN3 A;  5GAO n;  2KVQ G;  4LDV A;  4KRT A;  4JRK A;  1Y0M A;  2RJF A;  3OSV A;  1A0N B;  1YBY A;  3OQ5 A;  1H3H A;  3L2Q A;  4OF1 A;  5IN1 A;  3CPW A;  1K9M U;  1VIE A;  1UHF A;  3L2U A;  1YJ9 A;  2JT4 A;  3BFM A;  1YNZ A;  2YUO A;  5ECA A;  3A98 A;  3EGD A;  3WVD B;  4F16 A;  2L3Q A;  3G4S T;  2D6F A;  3NHN A;  3CC7 Q;  1M3C A;  2HQX A;  2K4Y A;  1D0Y A;  1WPY A;  2L3S A;  2RQW A;  2MCN A;  1N8R R;  2QEX Q;  4CC3 A;  2E3H A;  4F17 A;  2RK2 A;  3HRS A;  5GAN h;  2LDM A;  1UTI A;  2QQA A;  3G71 A;  2RI3 A;  3HTR A;  4N0A C;  2P4T A;  1KQ2 A;  1Q81 C;  1GFD A;  1EIF A;  1RAE B;  3EH2 A;  1WJR A;  2K79 A;  1QCO A;  2ZCF B;  3OYK A;  3RER A;  3QUI A;  3QZ5 B;  1JJ2 S;  2JW4 A;  2X4J A;  4QQD A;  2CP3 A;  3QPH A;  4J9H A;  1RL2 A;  4DA4 A;  2LQN A;  3FDR A;  3RR6 A;  2A7Y A;  4LNP A;  4M77 E;  3BDL A;  1KQS S;  1JXM A;  4IUQ A;  5DM7 R;  4MML A;  3DLL A;  1WX6 A;  2QQB A;  3NTI A;  4M77 F;  4PJO A;  1NLP C;  2GQV A;  2RNA A;  3SWN B;  1TH7 A;  2HQH A;  4EMG A;  1RAB B;  4ANJ A;  4HVU A;  4WCI A;  1VQ8 Q;  4F14 A;  3S3O A;  1K0S A;  2DL7 A;  3C4S A;  5GMK e;  4KUD K;  1BI2 A;  1AZG B;  4Z8A A;  1WIE A;  3A8H B;  4LN2 A;  3OY9 A;  1KC8 C;  5CQY A;  2EKH A;  3CCE A;  2K7A A;  3JCM f;  4M7A C;  3Q1J A;  4O5V A;  4OMM A;  5I22 A;  2FYK A;  1Q81 U;  2EQJ A;  4RMO A;  2KRM A;  3EHQ A;  3NTH A;  2RQV A;  8AT1 B;  2OTL A;  1WYX A;  3ER0 A;  4MZT A;  1PC0 A;  2JMA A;  4E6R A;  2OJ2 A;  3SB2 A;  2VXE A;  3JCM V;  8ATC B;  2DTI A;  3DKM A;  4C0Z A;  5A2Q E;  2F2X A;  3JB9 H;  3J80 E;  1UUE A;  2AHJ B;  3G7Z A;  2KY9 A;  3CPF A;  3CCJ A;  4C0G A;  1SHF A;  5CK9 A;  1IZ6 A;  2RF0 A;  1XNI A;  1AWW A;  2PVG B;  4PJO G;  2IG0 A;  2LJ1 A;  3CC4 Q;  4OGE A;  2K9G A;  1RLP C;  1I8F A;  1KC8 U;  3CXC A;  3CCQ Q;  3KUF A;  2CP5 A;  2KYM A;  5FWB A;  3LLR A;  3G1J A;  1WHJ A;  3VU3 C;  4PJL A;  1U3O A;  1UGQ B;  2BUD A;  2KR3 A;  4BY6 C;  1N8R C;  1VQO Q;  4NL3 A;  4PFZ A;  3GLX A;  2MIO A;  1VQ5 A;  3CCR T;  1ZX6 A;  3FRN A;  3NMZ C;  1X01 A;  3OMC A;  2ZZD A;  2DPP B;  3EGD B;  1RLQ C;  2CP6 A;  2DE0 X;  2KSS A;  2DLP A;  2VGM A;  3I35 A;  3OS1 A;  3NFC A;  1TOV A;  2DIL A;  3DB4 A;  5FRM A;  1TU0 B;  3LYI A;  5D6Y A;  4BE1 A;  1SHG A;  2CP7 A;  2GF7 A;  1VQ9 Q;  1Y07 A;  1PM3 A;  3VS3 A;  2PTK A;  1YIJ Q;  1F1B B;  5HK3 A;  1PRL C;  3MJX A;  4DBF A;  2V26 A;  4C92 E;  1VQM A;  1N8R U;  2B8A A;  5IT9 E;  4HCC A;  3NGP A;  2PZ1 A;  2F2W A;  3KFV A;  4JJB A;  4C92 F;  1KD1 R;  2X51 A;  3RKW A;  4E7H A;  5GMK h;  3CCU T;  5J3B A;  4JJN K;  1FXX A;  2QG9 B;  1CKA A;  1YJW T;  3M0S A;  5CKE A;  2A3L A;  2X4Y A;  1VQP Q;  3GPL A;  4OB2 B;  3CCV Q;  3UA7 A;  2KT1 A;  2FPF A;  1H8K A;  1VYT A;  4PJO B;  5CQX A;  4D6W A;  2JUF A;  2JS0 A;  2LT1 A;  2COY A;  3S6W A;  3QSU A;  1ZBJ A;  5DLQ E;  3QBY A;  3QHS A;  3CC2 Q;  2D1X A;  3FB9 A;  4Y91 A;  5LJ5 j;  3HP9 A;  3CME T;  1Q82 R;  2MWP A;  2H8H A;  5FU7 B;  2K5L A;  4PJN A;  5I21 A;  3QXE B;  3JRZ A;  1HYO A;  2DNU A;  4MMK A;  2IPO B;  2LT4 A;  1X75 C;  3RES A;  4JRI A;  2P4R A;  4ZGE B;  3TRE A;  1YHQ Q;  1SRL A;  1WGS A;  7AT1 B;  1W1F A;  2DVJ A;  1YIT A;  1M2O A;  1UG1 A;  2COZ A;  1W70 A;  4WF2 A;  1VIF A;  5HKC A;  3EGX A;  3G6E T;  2LCS A;  1BK2 A;  1YWP A;  1M1G A;  1KSW A;  2BIV A;  4E7Z A;  2EW3 A;  4M75 D;  1OI1 A;  1YJ9 Q;  1BIA A;  1M2V A;  1OOT A;  2KYB A;  5LJ3 g;  2G6F X;  2ABL A;  4ELZ C;  1UHC A;  4IUP A;  4F7U A;  2FO0 A;  1TUC A;  4BDZ A;  1WQW A;  3OA6 A;  2EKO A;  1YI2 A;  2ZPH B;  3JCM J;  2P0P A;  2NYS A;  4BD3 A;  1VQN A;  1UGR B;  3VKI A;  4OP0 A;  5GAM j;  4EIK A;  2AT1 B;  3MP6 A;  2OTJ T;  3G71 Q;  3V7R A;  1OZ2 A;  4KGV B;  3NPF A;  1YJN A;  3M58 A;  2DTH A;  3HRT A;  3LGL A;  3EFO A;  1T0H A;  2L5Q A;  1MV0 B;  4GLK A;  3QKJ A;  1QVG S;  2JTE A;  2E70 A;  4OMO A;  2DJQ A;  4PL6 A;  2DXU A;  2AK5 A;  4HXJ A;  4EMH A;  2CH4 W;  2CZ0 B;  1AD5 A;  4FW1 A;  3ASK A;  3PE0 A;  1I4K 1;  4CI0 C;  1UFF A;  2HL5 C;  2LC4 A;  1YFN A;  3JAM E;  4HT9 A;  4AFZ C;  1T3L A;  4QVC A;  3CD6 A;  1PD1 A;  4F7U G;  1MGQ A;  2HDA A;  4BE2 A;  3VS5 A;  4M78 D;  1D09 B;  4NOY A;  2JOY A;  4PNO A;  1JU5 C;  2L89 A;  2EQK A;  3I55 A;  2KQW A;  1M90 R;  3OS0 A;  4M7A A;  2VAS A;  3OYA A;  1M5Q 1;  3CC7 T;  1EZZ B;  4XU3 A;  2RHU A;  3JB9 G;  2VXF A;  1K9A A;  1E6H A;  4FYY B;  3JB9 I;  3CCE Q;  2VYT A;  2FZK B;  3VJP A;  3CPW S;  4JRQ A;  2LNV A;  2O2O A;  2KEA A;  2CT4 A;  4N4H A;  4PK4 A;  2QEX T;  3JCM X;  4KGX B;  3JCM P;  1KD1 U;  5L23 A;  3PTA A;  4V2S A;  5LJ3 j;  3C12 A;  2CUB A;  5FU6 B;  3D7S B;  2R5M A;  2E65 A;  4C8Q A;  2HKN A;  3FLG A;  4J9C A;  1H3Z A;  3BY7 A;  3LH0 A;  1NYF A;  1O75 A;  2K3Y A;  3M56 A;  1QVF A;  2DXC A;  2JMC A;  1BU1 A;  1FYN A;  2D0Q B;  3TQ7 P;  2K5F A;  1ZUU A;  5GAO q;  3SEM A;  3CEY A;  1BKB A;  5I2S A;  1EFN A;  2ATC B;  4LD6 A;  5IXB A;  2EQU A;  4LDX A;  4M75 C;  2K2V A;  1MMA A;  1VQ4 A;  1WJS A;  4AFS C;  3FJ5 A;  2RHZ A;  3P8B B;  3E9G A;  2NLU A;  4IUR A;  2MK5 A;  4M7A G;  2X9H A;  1HK9 A;  3M53 A;  3E2U A;  1PSF A;  2EYW A;  1M4Z A;  1W2B P;  2RPN A;  1UDL A;  2E5K A;  2X3W D;  1WNL A;  5GAN j;  3EGX B;  4IIO A;  4OMQ A;  4P5N A;  4PLL A;  3RNJ A;  3M0R A;  1OU9 A;  1VA7 A;  2LNH B;  2QTV A;  1Y71 A;  1ZBX A;  1VQ5 Q;  1M2V B;  4C8Q G;  4F7U B;  2WSF E;  6AT1 B;  2J05 A;  1GCQ A;  2X4W A;  2GTO A;  1BB9 A;  2F5K A;  1G3S A;  1IO6 A;  2O9S A;  1WHH A;  3X28 B;  1BYM A;  2DXT A;  1G3W A;  4CC2 A;  2YLB A;  2VVK A;  4Z89 A;  1R77 A;  2CSI A;  4B6M A;  1FWZ A;  5J26 A;  2RMO A;  3CCS A;  3H9N A;  3PVL A;  2DFU A;  2M16 A;  4XTV A;  3REA B;  4QKU A;  1QLY A;  2A37 A;  1MHN A;  2DET A;  4M7A F;  5A0L A;  2KXD A;  5DY9 A;  4M77 A;  3P8H A;  3I5S A;  1PSE A;  3ZEH A;  1FMV A;  2QA4 T;  2I2L A;  3KBG A;  3EFO B;  3L1A A;  2J6O A;  1N5Z A;  4M78 C;  3OYD A;  3QJ6 A;  1OYX A;  3X20 B;  3CCL A;  1VQM Q;  1M90 C;  2K3B A;  3OW2 A;  5GJV B;  3CCQ T;  3FC3 A;  2Y4Y A;  3OYG A;  1NM7 A;  2HZY A;  2YWW A;  3CMA A;  1ZQ1 A;  2L3P A;  1QKX A;  1X6O A;  1VQO T;  4BB7 A;  3A1P A;  3VV0 A;  4JPB W;  3HRU A;  3M0P A;  2D9T A;  1G83 A;  1QWF A;  2A36 A;  4DBQ A;  3CXC S;  5D6X A;  4EMK A;  4J8O A;  4M7A B;  4ZTJ A;  5IHI A;  1B34 A;  4PFP A;  2MYS A;  1OPL A;  2ED1 A;  4XU1 A;  2C0I A;  2ESW A;  2KNB B;  2ZPI B;  1VQ9 T;  5CIU A;  4M77 G;  5I11 A;  3O8V A;  3MCA B;  1M90 U;  3EAE A;  4LE9 A;  2FPD A;  2M9U A;  4XTU A;  2RJC A;  2VKN A;  1YIJ T;  3MP1 A;  3EG9 A;  4C8Q B;  4M7D E;  2KI7 A;  2DTO A;  3OYC A;  3PIP A;  1TXQ A;  2ZPF B;  2J7I A;  4M7D D;  2Y90 A;  2MAM A;  2EYZ A;  1BCO A;  4X34 A;  3ZL7 C;  2HCK A;  5AYF A;  4B9X A;  2DMO A;  1UEB A;  4RTY A;  5CKH A;  1IHV A;  2QAS A;  2HQE A;  2DIQ A;  2RD1 A;  1Z9Z A;  1VQL A;  2WSC E;  1PWT A;  4IUT A;  4RKU E;  2KBT A;  2EIF A;  4F04 B;  1VQP T;  2F1L A;  2KRO A;  3CCV T;  2BZY A;  3RKY A;  1WLP B;  2LJ0 A;  3RMQ A;  4JJD A;  1V29 B;  2OAW A;  4CC4 B;  4BY6 B;  3LWI A;  2M51 A;  1ARK A;  2HSE B;  1SF9 A;  4JS4 A;  2BE7 D;  4E2F B;  2QGG A;  1RAI B;  4QVZ A;  3L42 A;  2OX7 A;  3DB3 A;  1K76 A;  2LQK A;  3OYJ A;  1YI2 Q;  1GRI A;  3CC2 T;  2DYB A;  2J06 A;  2R58 A;  1VQN Q;  4J6W A;  2CYZ B;  2GBQ A; 
#chains in the Genus database with same CATH homology
 2MOX A;  1GBR A;  2NUZ A;  1OV3 A;  1CKA A;  1WXT A;  5HCK A;  1BBZ A;  2D0N A;  3M0S A;  1LCK A;  4RTV A;  3UA7 A;  4FSS A;  2KT1 A;  2LJ3 A;  1WDX A;  2FPF A;  1H8K A;  1VYT A;  4J9E A;  2JXB A;  1Y57 A;  1RI9 A;  2C0T A;  2D8J A;  2DRK A;  2JS0 A;  1KFZ A;  2J6K A;  1NEG A;  2YUQ A;  2VWF A;  1ZBJ A;  2YT6 A;  4D8D A;  2K2M A;  2D1X A;  1JQQ A;  1WI7 A;  1ZUY A;  2YSQ A;  3M0Q A;  2H8H A;  4J9D A;  1M30 A;  4R0K A;  1XOV A;  2DNU A;  3JV3 A;  4J9B A;  2ROT A;  2AZS A;  2P4R A;  4CC7 A;  1YWO A;  2M0Y A;  1SRL A;  4JZ3 A;  3VS2 A;  5IHK A;  1UE9 A;  2SRC A;  1W1F A;  2DVJ A;  3U23 A;  2NWM A;  2A08 A;  2O31 A;  1T0J A;  1UG1 A;  1NG2 A;  1QKW A;  2LMJ A;  4OML A;  1W70 A;  1K0X A;  4QT7 A;  4RTU A;  2JS2 A;  1AWJ A;  3H0H A;  4OMN A;  3REB B;  2DA9 A;  2ECZ A;  2LCS A;  1BK2 A;  3VS6 A;  1AWO A;  2HBW A;  1YWP A;  1KSW A;  2EW3 A;  2V1R A;  1AWX A;  3PVQ A;  4ZNX A;  1OOT A;  2KYB A;  2G6F X;  2ABL A;  1UHC A;  3VRZ A;  2LX7 A;  3IQL A;  1PHT A;  1TG0 A;  2FO0 A;  2DL8 A;  4RUG A;  1TUC A;  2EGC A;  4AG1 C;  4AFU C;  2DL5 A;  2OI3 A;  4GLM A;  1NEB A;  2RQT A;  3QWX X;  3GBQ A;  3H0F A;  2AKK A;  2AZV A;  2BZX A;  1TUD A;  1SSH A;  2KXC A;  1QCF A;  1M27 C;  4DEY A;  4EIK A;  1UJ0 A;  1QWE A;  2A28 A;  1OPK A;  2LQW A;  1MV3 A;  1OEB A;  3NPF A;  4GBQ A;  1H92 A;  1B3Q A;  1T0H A;  1MV0 B;  2PNI A;  2CUD A;  2JTE A;  1M3A A;  1U06 A;  4OMO A;  3VS0 A;  2DJQ A;  4IIM A;  3VS7 A;  2D8H A;  2GGR A;  2GNC A;  4ESR A;  2AK5 A;  4HXJ A;  1X69 A;  2CH4 W;  1WA7 A;  2K6D A;  1AD5 A;  1NYG A;  2ROL A;  3PE0 A;  1UFF A;  2EQI A;  3TVT A;  4AFZ C;  1S1N A;  1T3L A;  1CSK A;  2EBP A;  3TSZ A;  1I1J A;  1RUW A;  2C0O A;  2CH4 A;  1X6B A;  2HDA A;  2CDT A;  3VS5 A;  1JU5 C;  2O9V A;  2CRE A;  5FW9 A;  2CT3 A;  1KIK A;  4LUE A;  1K9A A;  1E6H A;  3EG0 A;  2DL4 A;  2XMF A;  1UGV A;  1GFC A;  1E7O A;  2O2O A;  1WXB A;  2CT4 A;  2KEA A;  2RQU A;  3UA6 A;  2YDL A;  4RTT A;  1YN8 A;  5L23 A;  1CKB A;  1ZUK A;  4KRT A;  1Y0M A;  1WFW A;  2DRM A;  1A0N B;  4J9I A;  2DX1 A;  1H3H A;  2SEM A;  2CUB A;  3R6N A;  1UHF A;  1YP5 A;  3H41 A;  1FMK A;  4J9C A;  2JT4 A;  2DBM A;  1M8M A;  1YNZ A;  3QWY A;  2YUO A;  5ECA A;  3A98 A;  1NYF A;  1PRM C;  3UAT A;  2JMC A;  4F16 A;  2L3Q A;  1BU1 A;  1FYN A;  3NHN A;  1GBQ A;  2O88 A;  1ZUU A;  2CSQ A;  1M3C A;  4HVW A;  3SEM A;  3EG3 A;  1X27 A;  2GTJ A;  4J9F A;  1EFN A;  2L3S A;  2RQW A;  3I9Q A;  3M0U A;  2MCN A;  5IXB A;  5EC7 A;  4RTZ A;  4CC3 A;  4AFS C;  4F17 A;  3EG1 A;  1I07 A;  3FJ5 A;  2GQI A;  2YUN A;  5IH2 A;  2ED0 A;  1UTI A;  3TSW A;  3EHR A;  2EGA A;  1AVZ C;  1ZSG A;  2EPD A;  4X1V A;  1VYV A;  2EYW A;  1GFD A;  2HSP A;  2RN8 A;  2RPN A;  1UDL A;  2K79 A;  2E5K A;  2X3W D;  5FWC A;  2B86 A;  4IIO A;  4OMQ A;  4RTX A;  1HJD A;  1SPK A;  3THK A;  3RNJ A;  1GCQ C;  2JW4 A;  3M0R A;  2RQR A;  1JXO A;  1VA7 A;  2LNH B;  2EYY A;  3O5Z A;  4J9H A;  1AZE A;  4J9G A;  2FEI A;  2LQN A;  2J05 A;  1GCQ A;  2GTO A;  4Z88 A;  1BB9 A;  1IO6 A;  4LNP A;  2BZ8 A;  1WXU A;  2O9S A;  2EGE A;  1JXM A;  2FPE A;  4CC2 A;  1YCS B;  2VVK A;  4Z89 A;  2CSI A;  1WX6 A;  1NLP C;  1HD3 A;  2RMO A;  2RNA A;  5IXF A;  3PVL A;  2DBK A;  4HVV A;  4D8K A;  4HVU A;  4WCI A;  4F14 A;  2KGT A;  3REA B;  3UF4 A;  1QLY A;  1K0S A;  2DL7 A;  2A37 A;  4JZ4 A;  1GCP A;  2J6F A;  1AZG B;  4Z8A A;  1WIE A;  4LN2 A;  2KXD A;  1V1C A;  2EKH A;  2K7A A;  3I5S A;  2X3X D;  2KRS A;  4OMM A;  5IHN A;  2LP5 A;  1T3S A;  1NLO C;  2V1Q A;  5I22 A;  4HCK A;  2J6O A;  2KRM A;  1UEC A;  2LZ6 B;  1N5Z A;  3EHQ A;  2RQV A;  1HSQ A;  1WYX A;  1VYU A;  1Z9Q A;  2K3B A;  5GJV B;  1ABO A;  4DEX A;  3EG2 A;  2HEQ A;  1M3B A;  1PKT A;  2JMA A;  1J3T A;  1KJW A;  4E6R A;  1NM7 A;  3C0C A;  2OJ2 A;  1AOJ A;  1U5S A;  2AKL A;  4OMP A;  2F2X A;  3CQT A;  2L3P A;  2EYX A;  1QKX A;  1UUE A;  2FRW A;  4M4Z A;  1E6G A;  3VS4 A;  2KE9 A;  3SHW A;  4JPB W;  2KRN A;  1SHF A;  3M0P A;  1G83 A;  3VS1 A;  1ABQ A;  2RF0 A;  1AWW A;  1QWF A;  3M0T A;  2A36 A;  2JM9 A;  2LJ1 A;  5IHI A;  4A63 B;  2W10 A;  1W6X A;  4RTW A;  4AG2 C;  2KT8 A;  2K9G A;  2F2V A;  1RLP C;  4ORZ A;  1OPL A;  2ED1 A;  4LUD A;  4Y92 A;  2C0I A;  4JJC A;  2KYM A;  5FWB A;  2ESW A;  2KNB B;  1JEG A;  1U3O A;  2KR3 A;  3I5R A;  5I11 A;  3H0I A;  3VRY A;  1ZLM A;  2FG0 A;  2QDL A;  4LE9 A;  2FPD A;  2W0Z A;  2VKN A;  1K1Z A;  1SEM A;  1X2K A;  2MIO A;  3RBB B;  1JO8 A;  1ZX6 A;  2YUP A;  3NMZ C;  3ULR B;  1X6G A;  1RLQ C;  2J7I A;  2EVR A;  3EGU A;  2DE0 X;  2EYZ A;  2DLP A;  3ZL7 C;  2HCK A;  1UJY A;  2DMO A;  3I35 A;  4RTY A;  1SRM A;  2ENM A;  2FRY A;  4K11 A;  2DIL A;  5GJW B;  1SHG A;  1PKS A;  1B07 A;  2DL3 A;  2L0A A;  1Z9Z A;  1PWT A;  2JM8 A;  1X43 A;  2KBT A;  2PTK A;  3VS3 A;  1PNJ A;  2KRO A;  1I0C A;  2BZY A;  1WLP B;  2LJ0 A;  4JJD A;  2OAW A;  4CC4 B;  1PRL C;  2M51 A;  1X2Q A;  4AFQ C;  1ARK A;  2I0N A;  1G2B A;  1K4U S;  2IIM A;  1MUZ A;  2BTT A;  1GL5 A;  1K76 A;  2PZ1 A;  3NGP A;  2F2W A;  3KFV A;  4JJB A;  1GRI A;  1AEY A;  2DYB A;  2J06 A;  2DF6 A;  2L2P A;  2DM1 A;  2GBQ A;  3LH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...