1UHCA

Solution structure of rsgi ruh-002, a sh3 domain of kiaa1010 protein [homo sapiens]
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
b'GSSGSSGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1010 protein
publication title Solution Structure of RSGI RUH-002, a SH3 Domain of KIAA1010 protein [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 7
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2003-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uhcA00
1EFNA 1AWXA 2O9VA 1RLQC 2H8HA 2HSPA 2PTKA 4RTVA 2JS0A 2MOXA 2X3XD 2EKHA 1WFWA 3ZL7C 1JO8A 1X69A 3VRZA 2ED0A 3C0CA 1RLPC 1PRLC 3I35A 2A37A 2JW4A 4JZ4A 3GBQA 2CT3A 4ESRA 2C0IA 4IIOA 1X43A 2DBKA 4ORZA 2B86A 2LJ1A 3EG2A 3UA6A 1PKSA 1JXOA 4CC4B 2YSQA 1GL5A 3SHWA 3I9QA 1AWJA 1I1JA 4F16A 2AZVA 2DX1A 2F2VA 5FW9A 1QCFA 4AFUC 1VYVA 1YP5A 2HEQA 2GTOA 2GBQA 1AZEA 2KEAA 1PHTA 1SHFA 3UF4A 1YWPA 2RQVA 5IHKA 3M0PA 2RQRA 1V1CA 4J9DA 2JS2A 1UTIA 1B3QA 2GNCA 1SRMA 1HD3A 1NG2A 2K3BA 3EHQA 3H0FA 1QLYA 1U5SA 1W70A 1UDLA 2D1XA 2LJ0A 1VYTA 4LUEA 4HVVA 1Z9QA 4RTUA 2D8HA 1X27A 2AKLA 3EG1A 2EQIA 2ED1A 2V1QA 2JMAA 1WA7A 1ARKA 3FJ5A 1W6XA 2DJQA 4AG2C 2GQIA 3H0IA 5IHIA 2LZ6B 4J9BA 3REBB 1PWTA 1MV0B 2MCNA 3TSWA 2AKKA 2DL7A 2KT1A 1BK2A 3M0UA 4R0KA 5FWBA 1JU5C 2JMCA 2J6KA 4HVUA 3U23A 3I5SA 2CH4A 4CC2A 2NWMA 2BTTA 4GLMA 2JT4A 3UATA 4CC3A 2KRNA 1M3BA 4Y92A 2KGTA 3A98A 1ABOA 2YUNA 2KROA 1WIEA 4LNPA 3JV3A 2KR3A 2RQTA 1WXTA 4JJCA 1B07A 1S1NA 3CQTA 3KFVA 1KFZA 2EYZA 2LJ3A 4FSSA 2BZ8A 2RMOA 2JM9A 4J9FA 1GCQA 1UECA 1ZUKA 1QKXA 1NLPC 3M0TA 1T0HA 1JQQA 1KJWA 2VVKA 2BZXA 1QWFA 1JXMA 1CSKA 2CUBA 3QWXX 3NMZC 2JTEA 2JM8A 3QWYA 1RI9A 2EPDA 2K7AA 1HSQA 3VS3A 1AZGB 1U3OA 5IXFA 2K9GA 2RPNA 3RNJA 1AOJA 1PRMC 4AG1C 4HCKA 1ZUYA 1E7OA 1SSHA 4J9EA 1UJYA 2OI3A 1Z9ZA 1G2BA 2L3QA 1J3TA 2O2OA 2RNAA 2PNIA 1H92A 1AWOA 1I07A 2J6FA 1GRIA 1ZLMA 2EVRA 1T3SA 1JEGA 1Y57A 2DYBA 5I11A 1E6HA 1BB9A 4M4ZA 1NEGA 1GFDA 1ZBJA 3VS7A 1I0CA 3ULRB 4AFZC 4DEXA 3M0RA 1A0NB 1GBQA 4X1VA 1M3AA 1LCKA 4RTXA 1OOTA 2HDAA 2DILA 1N5ZA 3TVTA 2HBWA 2K6DA 1H3HA 4WCIA 3PVQA 5HCKA 2NUZA 3NHNA 3I5RA 2KRSA 2W10A 1T3LA 1SRLA 3EHRA 1UE9A 2XMFA 3IQLA 2RN8A 2FPFA 2SRCA 2LX7A 2DRMA 1BBZA 2ECZA 2YUPA 1K0SA 2DNUA 2PZ1A 3EGUA 2M0YA 2ENMA 2DMOA 1KIKA 4J9GA 1NLOC 2AK5A 2F2XA 1U06A 1M3CA 2DM1A 4EIKA 2O88A 1G83A 2OJ2A 2CSIA 4HVWA 2G6FX 1WDXA 5I22A 1OV3A 2DL4A 2DL3A 1M8MA 3TSZA 2A28A 2EYXA 5IHNA 2RF0A 4RTTA 4JJDA 2CSQA 4GBQA 1WI7A 2FRYA 2YUQA 4J9IA 2EW3A 4DEYA 4JZ3A 4QT7A 1FMKA 1Y0MA 2K2MA 1YCSB 3VS1A 2EGCA 1HJDA 2YUOA 2ESWA 4AFQC 1VA7A 4A63B 2LP5A 1M27C 2ROLA 2KXCA 1KSWA 2E5KA 1AD5A 4Z8AA 2QDLA 2I0NA 2FRWA 5L23A 4JJBA 2KXDA 2YDLA 3UA7A 3VRYA 2DRKA 1WLPB 2L2PA 4OMPA 1AWWA 2D0NA 2KYMA 2SEMA 2CDTA 5GJVB 2MIOA 1GCQC 2A08A 4Z88A 4F17A 4F14A 1GCPA 2EGAA 2LMJA 2YT6A 2KT8A 2CREA 2W0ZA 1ZUUA 3M0SA 2GTJA 2FPEA 1UHFA 2LCSA 1YNZA 1BU1A 2V1RA 1UG1A 2HCKA 2JXBA 1WX6A 3EG0A 2DLPA 1K1ZA 1YWOA 2EBPA 2P4RA 4D8DA 5GJWB 4KRTA 3H41A 3R6NA 3RBBB 2J7IA 1UFFA 2ROTA 4CC7A 2J06A 2L3PA 1AVZC 1X2QA 2DL5A 2KE9A 1WXUA 1RUWA 2LQNA 2FEIA 3REAB 2K79A 2EGEA 4J9HA 2DE0X 4RTWA 2M51A 1GBRA 2J05A 1SHGA 2CT4A 2ABLA 1MUZA 4OMOA 1ABQA 1TUDA 1K9AA 3THKA 3VS0A 2DL8A 1CKAA 1K4US 2VWFA 1OPLA 4J9CA 1CKBA 3NGPA 1FYNA 2X3WD 2KYBA 1XOVA 1UUEA 1UHCA 1ZSGA 2DF6A 3M0QA 1NYFA 4D8KA 4HXJA 3O5ZA 2KRMA 1H8KA 2DBMA 5EC7A 1NM7A 4RTYA 1X2KA 3NPFA 2IIMA 2FPDA 1ZX6A 2CH4W 2DVJA 3SEMA 2C0TA 4OMMA 4E6RA 4LE9A 5IXBA 2L0AA 2C0OA 3VS5A 2GGRA 5IH2A 3PVLA 4OMQA 4RTZA 1WXBA 2O31A 5ECAA 2F2WA 1QKWA 1SEMA 4IIMA 1MV3A 1VYUA 2L3SA 4Z89A 3VS2A 1YN8A 4LN2A 4RUGA 1PKTA 1T0JA 1E6GA 2OAWA 1OEBA 1GFCA 4OMNA 2D8JA 2LNHB 4JPBW 1PNJA 4LUDA 3VS4A 1QWEA 2DA9A 4ZNXA 1SPKA 1NEBA 1UGVA 2O9SA 2RQUA 1W1FA 2J6OA 1UJ0A 3EG3A 1TUCA 2A36A 2LQWA 2VKNA 2CUDA 4AFSC 1WYXA 1AEYA 2BZYA 4OMLA 1IO6A 2EYWA 2AZSA 1NYGA 2RQWA 2FG0A 1X6GA 5FWCA 3LH5A 2EYYA 1TG0A 1K0XA 2FO0A 2KNBB 1K76A 3PE0A 1OPKA 3H0HA 2KBTA 3VS6A 1M30A 1X6BA 4K11A
chains in the Genus database with same CATH superfamily
2JJ9A 4J83A 3UT1A 2O9VA 1RLQC 5KE3A 1ZQ1A 2H8HA 2P0QA 3QHSA 5LJ5d 2XU8A 2MOXA 2V8IA 4QQDA 3CCVT 2DERA 3CBOA 4CI0C 4ZGJB 4C5IA 2EFIA 2ED0A 3C0CA 1RLPC 3CBMA 2A37A 2JW4A 4IIOA 4ORZA 3EG2A 4BB7A 3A8MB 1UGSB 4QKUA 2PVGB 4CC4B 3EFOB 3M58A 3CCEA 4J7FA 1VQNT 2KSSA 3H9NA 2AZVA 1YJ9Q 1IGUA 1WPYA 5FW9A 1QCFA 1VYVA 3FRNA 1M2VA 2IVWA 1AZEA 3DLLA 2EYQA 3PNWC 4DA4A 1SHFA 1N8RC 1YWPA 1JJ2S 2RHXA 1UTIA 4F7UE 4C0GA 2CP7A 4C0FA 3CCJA 1I8FA 1NG2A 3JB9I 5D7UA 3H0FA 5D6XA 2XG8D 3PT9A 4PJMA 3QJYA 1BCOA 1VYTA 1TXQA 3UPUA 4RTUA 2EQUA 2QGGA 2ED1A 1VQ7Q 1WNLA 5GANg 2DFUA 2DJQA 5A0GA 3JSCA 1MGQA 1PWTA 1HYOA 5D6YA 4E7IA 2OAUA 2COWA 4A4HA 5FWBA 3HPWA 2KAFA 4M7DB 2M16A 3I55Q 3U23A 4JS4A 1PD1A 5FU6B 3GOXA 4A4KA 3MEVA 3VYHB 4CC3A 2EQMA 4Y92A 1M3BA 4M7AB 2KGTA 2MF2A 3FC3A 2K2VA 3LH0A 2YLCA 2P4TA 3PFSA 1M5Q1 3L2QA 4LNPA 3CC4Q 2CS7A 4M7DC 2DK3A 3EH2A 3SFMA 3QO3A 3SWNA 2DXTA 2HL5C 2X51A 3CQTA 3CCQT 1C0MA 4IUUA 3OYMA 4M7AC 4A53A 4FYXB 5GAOq 6AT1B 2EYZA 3GPLA 4FSSA 2RMOA 2JM9A 4J9FA 5GAN5 4M7DD 1PM3A 1ZUKA 3O8VA 5CQYA 1N9RA 2JVVA 3JCMX 1IB8A 2E64A 3EAEA 3E9FA 3L2RA 1D1BA 1CSKA 1X6OA 2EPDA 2R58A 1KQSP 2E12A 1Q95G 2EJGA 4JLIA 3NFCA 1G3SA 1SSHA 3EGDA 3FDRA 5KCOA 4C92B 3MEAA 3G6ET 2LCLA 1M1GA 1VQ4T 2PU9B 1O75A 2RNAA 2XI9A 3MP1A 1H92A 3OW2S 1K8AR 2J6FA 1GRIA 2DZ9A 1ZLMA 1YJ9A 2L8DA 4N0AC 2EVRA 4PJOA 4WF2A 5KE2A 4XTXA 1E6HA 1GFDA 1ZBJA 1I0CA 4ANJA 4DEXA 4C92C 2KQWA 3ZBDA 1A0NB 2FVUA 2XK0A 1M3AA 1LCKA 3RKXA 5IT9E 1OOTA 2R5AA 4BI3A 4C8QF 3TVTA 2HBWA 4B6MA 1F1BB 5GAOr 4PFPA 3I5RA 1VQ9T 1KQ2A 1UE9A 4M75F 3IQLA 1LPLA 2RN8A 5KYWA 3L2ZA 2WSEE 2LX7A 3RERA 1QP3A 1VQ7A 2PZ1A 3CBPA 4RG8A 2XKOC 4J9GA 2NUTB 4ZTJA 4E7KA 4DQ2A 2FZCB 1IRXA 2CZ0B 5HK0A 1QW1A 5I22A 1WHGA 2DL4A 4C92E 4JJDA 1WI7A 5I2MA 3I55A 2QASA 3CPFA 4DEYA 3MKDA 1VQ8T 3CCMQ 4JZ3A 2M0OA 4PFZA 1Y0MA 2K2MA 2VXFA 5KYXB 2EGCA 4L59A 2PVDB 3NTKA 4C8QB 4RCCA 1D3BB 1VA7A 1TSFA 4IUQA 2X35A 4QQ6A 3S3OA 2ROLA 4F04B 2HL3A 2KXCA 3E2UA 5KCHA 1VQOQ 1VOMA 4Z8AA 1G3TA 4M75B 2VASA 3L1AA 1K8AC 5GAMj 5FRMA 5GMKl 4BACA 2KXDA 2NLUA 5LJ3h 4C8QC 1QP2A 2KYMA 1QMCA 3QSUA 3KXTA 2RD1A 5GJVB 2MIOA 2V26A 1GCQC 4R56A 1KQSA 2XIDA 4F17A 4M75C 2EGAA 3LX7A 4PKCC 5DY9A 1Q86U 3M0SA 4PL6A 5I21A 4M78B 1BKBA 2JUFA 4KULA 1YNZA 2V1RA 4ZN1A 1UG1A 1K9MR 1NPRA 2JXBA 3HRUA 1K1ZA 3I56Q 4D8DA 2AIRB 4RG2A 5A0LA 2ROTA 2FYKA 2L3PA 2DL5A 2FZKB 1R8OB 1NZ9A 1WXUA 4M77G 3WVEB 3A8OB 3GNFB 3REAB 3JCMc 4ZGEB 2J05A 4M78C 1MUZA 2QA4T 5GMKi 2OTLQ 4PFOA 1CKAA 1N6AA 1OPLA 4C8QE 2LQKA 1CKBA 3NGPA 3CC4T 1QVFS 1XQHA 2L89A 1UUEA 3G4SQ 1VQ5T 3EFOA 1OU8A 2B8AA 5GAN8 3OYCA 4M75E 2DF6A 4KUDK 4M78D 5AYFA 3O5ZA 1H8KA 1UGRB 2QQBA 5EC7A 1NM7A 3CD6T 2PUOB 4RTYA 5LJ5f 2RM4A 3V8JA 3NPFA 2IIMA 5GAN3 2FPDA 3QPHA 2CH4W 1YHQA 4E6RA 5CVIA 3UDCA 3CCVQ 1H3ZA 2M1HA 1C6VX 3TCJA 3CMAT 4OB0B 4E7ZA 1HXDA 1BYMA 3FJPA 2F2WA 2L3SA 2X4YA 3CC2T 1Y96B 1KK7A 2OAWA 5LJ3j 2LRQA 3HKSA 1Q7YR 4OMNA 4HKEA 1LJOA 4PJOF 1QWEA 4ZNXA 1K9MC 3CCMA 1SPKA 1G3WA 1UGVA 1W2BS 3VU3C 4M7DA 3C4SA 1TUCA 1BIAA 3GNGA 2CUDA 2OTJT 2QG9B 1WYXA 2XD0A 2EQJA 2EYWA 1VQOA 5IAYA 4JRQA 2RQWA 4M7AA 4BDYA 2FB7A 4F7UG 1TG0A 1K0XA 4NOYA 3OY9A 1IREB 3ZFJA 4L5GA 3N5BB 2X9HA 3URGA 2XDBA 3VS6A 1X6BA 1EFNA 1VQPA 2HSPA 5FU7B 2COYA 4MMKA 2X3XD 3NTIA 1WFWA 1M1FA 3JCMe 3ZL7C 1QVGP 3G71T 3L42A 2CT3A 2C0IA 3I56A 1X43A 1UB4A 5FU7C 1EZZB 4BE2A 3SHWA 3M54A 4FW2A 3I9QA 1AWJA 4FT4A 4N0AA 4F16A 2DX1A 2F2VA 3V7CA 2VV5A 1YP5A 2KVQG 2OTLA 2GBQA 2YRVA 4C92A 8ATCB 3BDLA 3QDFA 3CCQQ 3A5ZB 3G4SA 1Q7YC 5IHKA 3LGLA 3OYYA 4PJJA 2DXUA 2K57A 1B3QA 2JZ2A 2GNCA 1SRMA 1HD3A 2E70A 2DEUA 3M57A 4IUVA 1D0ZA 1U5SA 2QK0A 3OYLA 2LJ0A 1B34B 4HVVA 2ZCFB 1Z9QA 3T9NA 1JRIA 4OB3B 2D8HA 1X27A 3CCLT 1JJ2P 2EQIA 5HK3A 3JCMd 3CCVA 5GANh 1N9SA 1WA7A 1ARKA 3FJ5A 4M77D 1W6XA 2VXEA 3V7RA 4PJOE 1PCXA 3QUIA 4C5HA 1Q82U 1MV0B 4XK8E 3TSWA 4XTZA 2AKKA 1FXXA 2DXBA 3G6EQ 1SF9A 3X25B 1VQ4Q 1WHLA 3I5SA 4CC2A 3C95A 2NWMA 2HAXA 1VQNA 3TEEA 2RJFA 4GLMA 2XHCA 2A7YA 2NUTA 3UATA 3A98A 1ABOA 2WACA 3JCMW 2YUNA 3P8HA 1WIEA 3JV3A 2RA2A 3BDUA 1BIBA 2KR3A 3X26B 4J8OA 2ZPHB 4ATOA 3BE3A 2HNIA 4JJCA 3R6OA 2P0KA 3QZ9B 2AT1B 5KYXA 1VQKT 4B9XA 3RIRA 1KHCA 4C8QA 1D3BA 1VQ9Q 3HSBA 3CCUT 1RADB 1OULA 1GCQA 1QKXA 4YTLA 3OYHA 4M75A 3JB9G 1RAEB 1QVGA 1VQ6T 3M0TA 4E7SA 3M59A 3JB9H 2ZPGB 1YIJT 2BIVA 2DAQA 2DTHA 5LJ5h 2KMTA 3NMZC 3OMGA 4Y28E 1RI9A 1MNEA 1U3OA 5IXFA 2RPNA 2LX9A 3GP8A 2CZ7B 3HHTB 4J9EA 2OI3A 3F70A 1XTDA 2L3QA 1VQ8Q 2O2OA 4M78A 1ZA1B 2QEXT 2DEQA 2RK1A 3DLMA 4M7DF 1JEGA 5GANj 3OSVA 1K73U 2DYBA 5I11A 5J26A 5CAIA 2RJCA 2HKQB 4KT0E 4LDUA 4M7AF 3V8LA 2JTMA 3JCMV 3M0RA 2GFUA 3CCQA 3OW2P 4JUVA 2PQWA 4EMGA 1YFNA 5C6SA 3DKMA 5AT1B 2K6DA 1NJIU 1IXDA 5IN1A 5HCKA 2Y90A 2LVMA 2KRSA 1AHJB 2W10A 3CXCS 1SRLA 3MO8A 3QZ5B 2FPFA 2SRCA 2DRMA 3C94A 4E7LA 2YUPA 4J6WA 1NBEB 5CIUA 2DNUA 3OYJA 3OYGA 2ENMA 2AK5A 4C5EA 2O88A 3G7ZA 2OJ2A 3PIOA 2CSIA 4HVWA 3X28B 1WDXA 2HQXA 2DL3A 3G6EA 2HMAA 4QVCA 2EYXA 3QIIA 1VQ4A 2E6NA 1WJRA 4ELYC 3DB4A 2FRYA 4J9IA 2EW3A 1WZOA 2QA4Q 1VQMT 3M55A 5GAMe 2E41A 1FMKA 1VIFA 3VS1A 1JB0E 2E3HA 2XDDA 4C92F 2YUOA 3OQ5A 1Y96A 3RMSA 2ESWA 4AFQC 1IHWA 1VQ5Q 4RMOA 5FU6C 1OI1A 1KSWA 2E5KA 3OB9A 1AD5A 1MMNA 4UC4A 5J39A 4JRKA 2FRWA 2K4YA 2MK5A 3JAME 3CD6Q 2Y4XA 3VKIA 3VYGA 1R77A 2L5QA 2SEMA 1VQ9A 4GLKA 2CDTA 2F5KA 2CP0A 1VQLT 4A4EA 2A08A 3CMAQ 5LJ5g 2D6FA 1BCMA 1GCPA 3OYIA 2QQAA 1YJNT 5CKDA 5GAOm 3OYNA 2GTJA 1JBMA 3CC2Q 1BU1A 4ZGDB 1M2OA 9ATCB 5GAN4 4M7DE 1Q81U 2DPPB 1G3YA 4JDSA 3R6NA 3RBBB 2J7IA 4CC7A 1AVZC 5GAMd 4M7AE 1RUWA 1PC0A 2CP6A 1VQ8A 3AHUA 2M51A 2HD0A 1GBRA 2CT4A 2DD5A 2ABLA 2DETA 5GMKh 1K9AA 4Y91A 2LQ8A 4JJNK 2K5LA 4LD6A 3OW2A 2OTJQ 3HTRA 4R55A 1TU0B 4WTOB 1S72T 1YITT 2CZ1B 3EH1A 3JB9D 4ME7A 4D8KA 3INZA 3J81E 3RMQA 3RKWA 4HT9A 4IKFA 1WHJA 4LDYA 5L8RE 2DVJA 1EIFA 3HRSA 4OMMA 2L0AA 2C0OA 3FLGA 3VS5A 1SKUB 2KK4A 1Y07A 3CMET 2EKOA 3PVLA 4OMQA 4BE0A 1KC8U 5CKFA 4OP0A 4FL6A 3G71Q 4DOWA 2FL7A 3S3NA 3X24B 1MV3A 1B34A 1Q86R 1YN8A 3WVDB 4RUGA 2KI7A 1PKTA 4LDWA 4M78F 2RHYA 1M90U 1X75C 2H3EB 3VS4A 2QA4A 2ZPFB 4E7HA 1NEBA 2V8KA 2J6OA 3CC4A 1ZSZB 1UEBA 1ZA2B 3ZEHA 5CQXA 3EG3A 1FMVA 1YJWT 2A36A 2VKNA 1VQ5A 1KC8C 2CP3A 2P84A 3CD6A 8AT1B 4II1A 2E3IA 2EYYA 2DD4A 3MEUA 3X20B 1K76A 1W2BP 3JCMf 3BFMA 3CC7T 1ZSZC 2KBTA 5LJ3d 3CCLQ 5GMKj 5A2QE 2CYZB 3G1JA 3M56A 1D09B 3JB9J 1TH7A 3CMAA 1C1AA 2VGMA 4RTVA 3QBYA 2EKHA 4FYYB 4V2SA 1RABB 3RDVA 1JO8A 1X69A 3E1SA 1RI0A 1N27A 1LOJA 4PJOG 3CC2A 4L6V5 3MHXA 2DXCA 1YI2T 2HBPA 3GBQA 2H3JA 4ESRA 2OX7A 5GAN7 3OBYA 2K3XA 2QXFA 2LJ1A 1UGPB 3UA6A 1PKSA 2VB6A 3GIBA 4HA8A 2YSQA 1GL5A 1RACB 3BW1A 3CPWS 4OF1A 2HEQA 2GTOA 2K5IA 2ZPEB 3CCRT 1Q86C 2LDMA 2KEAA 1PHTA 2QAZA 4XU0A 2OTJA 4KBMB 3UF4A 1BI1A 3L2VA 3SB2A 2FHDA 4EDUA 2RQRA 1VQKQ 4J9DA 2JS2A 4FIBA 2VUBA 3A1PA 2K3BA 3CCUQ 4E2FB 3EHQA 3P8DA 3EGXB 3A8GB 1W70A 4KGZB 3S6WA 1VQ6Q 4LUEA 1QCNA 1G8XA 1YIJQ 1I5OB 2V1QA 4M78E 2JMAA 1WGSA 3OYEA 4AG2C 3ER0A 3JRZA 3OMCA 3G71A 5IHIA 2LZ6B 4DBRA 2MCNA 4DBFA 1RAGB 1BK2A 3M0UA 4R0KA 2GFAA 2EJFA 2ZZDA 3CCST 3VUBA 4HVUA 4XTYA 2QEXQ 1R0BG 2BE9B 2CH4A 3P8BB 2BTTA 1IGQA 1KD1U 3JCMJ 3J80E 2RJDA 3QYHB 1TS9A 2DIGA 3QJ6A 1WXTA 1B07A 4C5GA 2QQ9A 3TU4K 4J5YA 2VYTA 2MWPA 4C0DB 1MHNA 1NPPA 3GLXA 3JCMQ 2BZ8A 4JLGA 3OYAA 1UECA 2DIQA 2E4HA 3CEYA 1M1KU 3CCLA 2X4WA 1T0HA 2YHTA 3HFNA 2DZCA 4BD3A 1D0XA 5KYYB 1JXMA 3QWXX 1YHQT 2YXYA 3JCMP 2JTEA 3PTAA 3QWYA 3VS3A 5GANe 2QYZA 2EJ9A 2LCCA 3RNJA 3HP9A 1I5LA 1PRMC 2IPOB 3LWIA 4J6YA 1UJYA 2ZGWA 3EFSA 1G2BA 4MDWA 1VQMQ 1Q82R 1J3TA 2C06A 4M77B 4N4IA 2PNIA 1D1CA 3D7SB 2LT4A 1I07A 4FW1A 2BUDA 3VUZA 4P5NA 1MMAA 1B7TA 1BB9A 4O6JA 5CKBA 1NEGA 3TREA 4IUPA 4AFZC 1GBQA 4M77C 4X1VA 1QVPA 2RHZA 4OGEA 1VQKA 4RTXA 3RESA 3H8ZA 2HZYA 3EG9B 3CCUA 4WCIA 3MCAB 3OS0A 4MZTA 4QVZA 3RKYA 1VQLQ 5I2SA 3NHNA 4LD9K 2O4XB 4KGXB 1T3LA 2AHJB 1PD0A 2A0FB 2XMFA 4Q5WA 1YJNQ 1RL2A 4AMCA 1BBZA 2EQKA 2M9UA 3QDRB 5GANd 3EGUA 1ACMB 3OBWA 4E7JA 4QQGA 4VUBA 5GAMf 3HFOA 3LLRA 1U06A 1M3CA 2DM1A 1G83A 2D9TA 4M7DG 3CXCP 1OV3A 2I2LA 3QG1A 3LWHA 2CSQA 4GBQA 4M77E 2V8JA 2QEXA 4M7AG 5KYUB 3ME9A 4N4HA 1YCSB 5M9OA 1S72Q 1YITQ 2LC4A 4PLLA 4A63B 1Q82C 2RO0A 3FB9A 4MZMA 1BI0A 2G3RA 2RI2A 2RB6A 1K73R 2I0NA 2ZAEA 4XTVA 2RJEA 4FYVB 4JJBA 1ZSZA 4F7UB 2LTOA 3UA7A 3WXMB 3FIFA 4CRIA 1WJQA 4NS5A 4OMPA 1AWWA 4GY5A 1P92A 1FMWA 3CMEQ 2P0PA 3LW5E 1IHVA 4F14A 1NJIR 1MNDA 2LMJA 1LVKA 2YT6A 1H641 3OYDA 2W0ZA 1ZUUA 2LT1A 2MAMA 2FPEA 1UHFA 2LCSA 4LDVA 2PVOB 4DBHA 1N8RU 4LDXA 2DLPA 1YWOA 1SSFA 2P4RA 5GJWB 4KRTA 4C92G 1UFFA 2J06A 1X2QA 2KE9A 5FROA 1KG1A 1VQMA 2EGEA 2CP5A 2DE0X 4RTWA 1OQKA 1SHGA 3OYFA 1R0CB 3Q1JA 2NUPB 4BI4A 3THKA 2E10A 4XTWA 3VS0A 1YJWQ 3MP8A 2MWOA 1K4US 2VWFA 4J9CA 4PJNA 1FYNA 2R57A 2X3WD 1XOVA 2CGHA 2MPXC 1UHCA 1ZSGA 3OA6A 1XJWB 1JJ2A 3M0QA 1NYFA 5LJ3f 5LL6S 4N4GA 5HKCA 2Y4YA 2QTXA 3CC7Q 2YRDA 4PNOA 2HQEA 4X34A 1X2KA 4FYWB 3E19A 1VQLA 1ZX6A 4ZN3A 4EMKB 1PSFA 2RI5A 5GMKm 3JCMg 1K73C 3TQ7P 5CR2A 4FM4B 2JN0A 1YJNA 3BY7A 5IH2A 1XNIA 3CXCA 4RTZA 4A4GA 1V29B 1WXBA 3EGXA 4FT2A 4X9DA 2YWWA 2O31A 1YI2Q 5ECAA 4NL2A 4JRIA 3V8KA 1SEMA 4OGCA 4Z89A 4D6WA 1G5VA 3MP6A 3VS2A 3MEWA 4LN2A 4EMKC 3JB9F 1T0JA 1NJIC 5DLQE 5D6WA 2DTOA 1Q81R 4C0ZA 2D8JA 1BI3A 2LNHB 3QXEB 4JPBW 3CCET 1PNJA 5HY6A 3L2UA 5LJ5j 4C8QG 3CCRQ 3KUFA 1M8VA 2GF7A 1D0YA 2RQUA 1W1FA 1UJ0A 2K3YA 1SG5A 5J3BA 5GMKe 1YITA 1S72A 4HT8A 2QI2A 1AEYA 4M75G 4ELZC 1YBYA 1IO6A 4E47A 3PGGA 4XU1A 3PMTA 4Z02A 1X6GA 5FWCA 1RAAB 2DJZA 3CCJT 3LH5A 2FO0A 2KNBB 3PE0A 3H0HA 4BY6B 1AWXA 2NYSA 2MI6A 4EMHA 2CZ6B 2PTKA 4XQ3A 3CMEA 2JS0A 4M78G 1QCOA 5EG2A 2ZPIB 4M7AD 3UWNA 3VRZA 2LNVA 3I35A 1PRLC 2L3RA 4JZ4A 4KH1B 1KC8R 4BY6C 3CCSQ 2DBKA 1TTHB 2DYIA 3JCMb 2B86A 5CKEA 4A4FA 1V76A 1JXOA 2DKGA 5KYYA 3SDZA 2ZPBB 1DJ7B 5GAMh 4KUIA 2QTVA 1M4ZA 3OYBA 1I1JA 2Z0WA 3VJPA 4AFUC 3RUXA 3QKJA 1I81A 1WQ7A 1YJWA 1MMGA 2FZGB 4MDXA 1M90R 4O5VA 4XAXB 4M77A 2RQVA 5KH6A 1Q81C 3M0PA 1V1CA 3CPWP 5DLOA 1QVFP 3HRTA 2GQVA 3MJXA 2PUKB 3CC7A 1QLYA 5LJ3e 1UDLA 2D1XA 4JRPA 3META 1RAHB 3LYIA 3OSSC 1Y71A 2AKLA 4HCZA 3EG1A 4PJLA 1YHQQ 4C92D 4FCYA 3EG9A 1FX7A 2GQIA 3H0IA 2E1HA 4BUGA 4J9BA 3REBB 4J7IA 2K5FA 2O4XA 1YI2A 3ASKA 1TOVA 2DL7A 1K8AU 2KT1A 1WHKA 1JU5C 2JMCA 2J6KA 2O01E 2ATCB 2JT4A 2WSCE 2X4XA 2KRNA 2A3LA 2HQHA 4J6XA 1UGQB 1YJ9T 3CCRA 3DB3A 3A8HB 5CK9A 2KROA 2QQSA 4PK4A 2RQTA 1S1NA 3M53A 5KYUA 2QGFB 1FWZA 2QDYB 3M4YA 3QYGB 4XTUA 3OS2A 3KFVA 4OB2B 1KFZA 1M90C 2LJ3A 1KQSS 5GANf 1RAFB 1NLPC 4OVAA 2JNGA 4BE1A 1IZ6A 1JQQA 1AT1B 1RAIB 1VQPQ 1KJWA 2VVKA 3M9QA 2BZXA 1QWFA 2CUBA 4F7UA 1VQ7T 2JM8A 3V7SA 2K7AA 2KY9A 1HSQA 1AZGB 2K9GA 1AOJA 4AG1C 2CP2A 4C8QD 4HCKA 1M2VB 1ZUYA 1E7OA 2RHIA 2QQRA 3CCSA 1M9SA 5GAMg 2RK2A 1Z9ZA 2R5MA 2E65A 5GAN2 1U8RA 4M75D 3I55T 1AWOA 4TVRA 4MMLA 3GF5A 3C12A 1T3SA 5FRNA 1Y57A 4KGVB 3CPWA 1EX4A 4BDZA 1QVFA 1HK9A 4M4ZA 2XDPA 3VS7A 3ULRB 2HKNA 1NE8A 1KD1R 5CCAA 2F5TX 1TWBA 1OZ2A 3A8LB 1WHHA 2NUPA 3E9GA 2HDAA 2DVEA 2DILA 4ZTFA 1GXIE 1H3HA 1KHIA 3PVQA 5GAOl 1D1AA 2DO3A 2NUZA 3EHRA 4QVDA 1K9MU 1PSEA 2ECZA 1K0SA 2GCXA 3PIPA 2M0YA 1M1KR 2DMOA 2EAYA 1KIKA 1NLOC 2F2XA 4EIKA 2RI3A 4MZPA 4EMKA 2G6FX 1OYXA 1M8MA 2YRCA 3TSZA 2A28A 5IHNA 2RF0A 4RTTA 1OZ3A 2YUQA 4HCCA 3SWNB 3M4GA 1OX9A 2X4JA 4KH0B 5DM7R 1VQNQ 4QT7A 3J7AF 2E6ZA 3H6ZA 1O9SA 1HJDA 2MMPA 2D0QB 2DTIA 1W2BA 4M77F 2LP5A 1M27C 2JTFA 3OYKA 2MYSA 4BI8B 4RKUE 1VUBA 2QDLA 3SWNC 1WJSA 1VIEA 3RR6A 5L23A 3KBGA 2YDLA 5GAOp 3VRYA 5LJ3g 1X01A 1WLPB 2DRKA 2L2PA 5A0DA 4A54A 2D0NA 2JOYA 1YCYA 4QW2A 1KD1C 4FSXA 4Z88A 4XU2A 7AT1B 3EGDB 1W4SA 5GAOn 4FU6A 4C0DC 4HCBA 2IG0A 2KT8A 3L2WA 1ZBXA 2CREA 4JS5A 5GAN6 4X9CA 2HCKA 2HSEB 1WX6A 3EG0A 3SD4A 1Q7YU 2EBPA 4PJOB 3MPUB 1KQ1A 3H41A 1ZHIA 1QQJA 2F1LA 4LXCA 2XICA 1LNXA 3CCEQ 3AT1B 5CO7A 2LQNA 2FEIA 2K79A 4J9HA 1M1KC 1U1TA 1U1SA 2WSFE 1OU9A 1PG5B 4OMOA 1ABQA 1TUDA 3CCMT 2DL8A 2EWNA 4OMFB 2M02A 4PJOC 2KYBA 3M5AA 2YLBA 3HL8A 1WQWA 1VQOT 3CCJQ 4OB1B 5KYWB 4HXJA 4PLIA 2KRMA 4RCBA 3PMIA 2DBMA 3OS5A 4PJOD 1VQ6A 3EFRA 1YIJA 3SEMA 2C0TA 4LE9A 5IXBA 1VQPT 3JCMh 4DBQA 4NL3A 4AT1B 4F7UF 3S3MA 2GGRA 1WHMA 4IURA 5LJ5e 4B9WA 1QKWA 4IIMA 1VYUA 2VC8A 1MMDA 1OX8A 2BKDN 3I56T 2BE7D 1E6GA 4EPCA 1N8RR 2COZA 1OEBA 1GFCA 4DOVA 4LUDA 2DA9A 1TUGB 2CKKA 2F69A 2O9SA 4XU3A 2VGNA 3NTHA 3FEOA 2OTLT 1I4K1 1BI2A 2LQWA 4AFSC 5KYNA 2BZYA 4OMLA 3OS1A 5CKHA 3G4ST 2AZSA 2EIFA 1NYGA 2FG0A 3VV0A 2E5QA 5C0MA 4IUTA 1Y7XA 2RHUA 2KDSA 5FLXE 1OPKA 3LGFA 1QVGS 2RH2A 1M30A 1N5ZA 4K11A
chains in the Genus database with same CATH topology
1EFNA 1AWXA 2O9VA 1RLQC 2H8HA 2HSPA 2PTKA 4RTVA 2JS0A 2MOXA 2X3XD 2EKHA 1WFWA 3ZL7C 1JO8A 1X69A 3VRZA 2ED0A 3C0CA 1RLPC 1PRLC 3I35A 2A37A 2JW4A 4JZ4A 3GBQA 2CT3A 4ESRA 2C0IA 4IIOA 1X43A 2DBKA 4ORZA 2B86A 2LJ1A 3EG2A 3UA6A 1PKSA 1JXOA 4CC4B 2YSQA 1GL5A 3SHWA 3I9QA 1AWJA 1I1JA 4F16A 2AZVA 2DX1A 2F2VA 5FW9A 1QCFA 4AFUC 1VYVA 1YP5A 2HEQA 2GTOA 2GBQA 1AZEA 2KEAA 1PHTA 1SHFA 3UF4A 1YWPA 2RQVA 5IHKA 3M0PA 2RQRA 1V1CA 4J9DA 2JS2A 1UTIA 1B3QA 2GNCA 1SRMA 1HD3A 1NG2A 2K3BA 3EHQA 3H0FA 1QLYA 1U5SA 1W70A 1UDLA 2D1XA 2LJ0A 1VYTA 4LUEA 4HVVA 1Z9QA 4RTUA 2D8HA 1X27A 2AKLA 3EG1A 2EQIA 2ED1A 2V1QA 2JMAA 1WA7A 1ARKA 3FJ5A 1W6XA 2DJQA 4AG2C 2GQIA 3H0IA 5IHIA 2LZ6B 4J9BA 3REBB 1PWTA 1MV0B 2MCNA 3TSWA 2AKKA 2DL7A 2KT1A 1BK2A 3M0UA 4R0KA 5FWBA 1JU5C 2JMCA 2J6KA 4HVUA 3U23A 3I5SA 2CH4A 4CC2A 2NWMA 2BTTA 4GLMA 2JT4A 3UATA 4CC3A 2KRNA 1M3BA 4Y92A 2KGTA 3A98A 1ABOA 2YUNA 2KROA 1WIEA 4LNPA 3JV3A 2KR3A 2RQTA 1WXTA 4JJCA 1B07A 1S1NA 3CQTA 3KFVA 1KFZA 2EYZA 2LJ3A 4FSSA 2BZ8A 2RMOA 2JM9A 4J9FA 1GCQA 1UECA 1ZUKA 1QKXA 1NLPC 3M0TA 1T0HA 1JQQA 1KJWA 2VVKA 2BZXA 1QWFA 1JXMA 1CSKA 2CUBA 3QWXX 3NMZC 2JTEA 2JM8A 3QWYA 1RI9A 2EPDA 2K7AA 1HSQA 3VS3A 1AZGB 1U3OA 5IXFA 2K9GA 2RPNA 3RNJA 1AOJA 1PRMC 4AG1C 4HCKA 1ZUYA 1E7OA 1SSHA 4J9EA 1UJYA 2OI3A 1Z9ZA 1G2BA 2L3QA 1J3TA 2O2OA 2RNAA 2PNIA 1H92A 1AWOA 1I07A 2J6FA 1GRIA 1ZLMA 2EVRA 1T3SA 1JEGA 1Y57A 2DYBA 5I11A 1E6HA 1BB9A 4M4ZA 1NEGA 1GFDA 1ZBJA 3VS7A 1I0CA 3ULRB 4AFZC 4DEXA 3M0RA 1A0NB 1GBQA 4X1VA 1M3AA 1LCKA 4RTXA 1OOTA 2HDAA 2DILA 1N5ZA 3TVTA 2HBWA 2K6DA 1H3HA 4WCIA 3PVQA 5HCKA 2NUZA 3NHNA 3I5RA 2KRSA 2W10A 1T3LA 1SRLA 3EHRA 1UE9A 2XMFA 3IQLA 2RN8A 2FPFA 2SRCA 2LX7A 2DRMA 1BBZA 2ECZA 2YUPA 1K0SA 2DNUA 2PZ1A 3EGUA 2M0YA 2ENMA 2DMOA 1KIKA 4J9GA 1NLOC 2AK5A 2F2XA 1U06A 1M3CA 2DM1A 4EIKA 2O88A 1G83A 2OJ2A 2CSIA 4HVWA 2G6FX 1WDXA 5I22A 1OV3A 2DL4A 2DL3A 1M8MA 3TSZA 2A28A 2EYXA 5IHNA 2RF0A 4RTTA 4JJDA 2CSQA 4GBQA 1WI7A 2FRYA 2YUQA 4J9IA 2EW3A 4DEYA 4JZ3A 4QT7A 1FMKA 1Y0MA 2K2MA 1YCSB 3VS1A 2EGCA 1HJDA 2YUOA 2ESWA 4AFQC 1VA7A 4A63B 2LP5A 1M27C 2ROLA 2KXCA 1KSWA 2E5KA 1AD5A 4Z8AA 2QDLA 2I0NA 2FRWA 5L23A 4JJBA 2KXDA 2YDLA 3UA7A 3VRYA 2DRKA 1WLPB 2L2PA 4OMPA 1AWWA 2D0NA 2KYMA 2SEMA 2CDTA 5GJVB 2MIOA 1GCQC 2A08A 4Z88A 4F17A 4F14A 1GCPA 2EGAA 2LMJA 2YT6A 2KT8A 2CREA 2W0ZA 1ZUUA 3M0SA 2GTJA 2FPEA 1UHFA 2LCSA 1YNZA 1BU1A 2V1RA 1UG1A 2HCKA 2JXBA 1WX6A 3EG0A 2DLPA 1K1ZA 1YWOA 2EBPA 2P4RA 4D8DA 5GJWB 4KRTA 3H41A 3R6NA 3RBBB 2J7IA 1UFFA 2ROTA 4CC7A 2J06A 2L3PA 1AVZC 1X2QA 2DL5A 2KE9A 1WXUA 1RUWA 2LQNA 2FEIA 3REAB 2K79A 2EGEA 4J9HA 2DE0X 4RTWA 2M51A 1GBRA 2J05A 1SHGA 2CT4A 2ABLA 1MUZA 4OMOA 1ABQA 1TUDA 1K9AA 3THKA 3VS0A 2DL8A 1CKAA 1K4US 2VWFA 1OPLA 4J9CA 1CKBA 3NGPA 1FYNA 2X3WD 2KYBA 1XOVA 1UUEA 1UHCA 1ZSGA 2DF6A 3M0QA 1NYFA 4D8KA 4HXJA 3O5ZA 2KRMA 1H8KA 2DBMA 5EC7A 1NM7A 4RTYA 1X2KA 3NPFA 2IIMA 2FPDA 1ZX6A 2CH4W 2DVJA 3SEMA 2C0TA 4OMMA 4E6RA 4LE9A 5IXBA 2L0AA 2C0OA 3VS5A 2GGRA 5IH2A 3PVLA 4OMQA 4RTZA 1WXBA 2O31A 5ECAA 2F2WA 1QKWA 1SEMA 4IIMA 1MV3A 1VYUA 2L3SA 4Z89A 3VS2A 1YN8A 4LN2A 4RUGA 1PKTA 1T0JA 1E6GA 2OAWA 1OEBA 1GFCA 4OMNA 2D8JA 2LNHB 4JPBW 1PNJA 4LUDA 3VS4A 1QWEA 2DA9A 4ZNXA 1SPKA 1NEBA 1UGVA 2O9SA 2RQUA 1W1FA 2J6OA 1UJ0A 3EG3A 1TUCA 2A36A 2LQWA 2VKNA 2CUDA 4AFSC 1WYXA 1AEYA 2BZYA 4OMLA 1IO6A 2EYWA 2AZSA 1NYGA 2RQWA 2FG0A 1X6GA 5FWCA 3LH5A 2EYYA 1TG0A 1K0XA 2FO0A 2KNBB 1K76A 3PE0A 1OPKA 3H0HA 2KBTA 3VS6A 1M30A 1X6BA 4K11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFN A;  1AWX A;  2O9V A;  1RLQ C;  2H8H A;  2HSP A;  2PTK A;  4RTV A;  2JS0 A;  2MOX A;  2X3X D;  2EKH A;  1WFW A;  3ZL7 C;  1JO8 A;  1X69 A;  3VRZ A;  2ED0 A;  3C0C A;  1RLP C;  1PRL C;  3I35 A;  2A37 A;  2JW4 A;  4JZ4 A;  3GBQ A;  2CT3 A;  4ESR A;  2C0I A;  4IIO A;  1X43 A;  2DBK A;  4ORZ A;  2B86 A;  2LJ1 A;  3EG2 A;  3UA6 A;  1PKS A;  1JXO A;  4CC4 B;  2YSQ A;  1GL5 A;  3SHW A;  3I9Q A;  1AWJ A;  1I1J A;  4F16 A;  2AZV A;  2DX1 A;  2F2V A;  5FW9 A;  1QCF A;  4AFU C;  1VYV A;  1YP5 A;  2HEQ A;  2GTO A;  2GBQ A;  1AZE A;  2KEA A;  1PHT A;  1SHF A;  3UF4 A;  1YWP A;  2RQV A;  5IHK A;  3M0P A;  2RQR A;  1V1C A;  4J9D A;  2JS2 A;  1UTI A;  1B3Q A;  2GNC A;  1SRM A;  1HD3 A;  1NG2 A;  2K3B A;  3EHQ A;  3H0F A;  1QLY A;  1U5S A;  1W70 A;  1UDL A;  2D1X A;  2LJ0 A;  1VYT A;  4LUE A;  4HVV A;  1Z9Q A;  4RTU A;  2D8H A;  1X27 A;  2AKL A;  3EG1 A;  2EQI A;  2ED1 A;  2V1Q A;  2JMA A;  1WA7 A;  1ARK A;  3FJ5 A;  1W6X A;  2DJQ A;  4AG2 C;  2GQI A;  3H0I A;  5IHI A;  2LZ6 B;  4J9B A;  3REB B;  1PWT A;  1MV0 B;  2MCN A;  3TSW A;  2AKK A;  2DL7 A;  2KT1 A;  1BK2 A;  3M0U A;  4R0K A;  5FWB A;  1JU5 C;  2JMC A;  2J6K A;  4HVU A;  3U23 A;  3I5S A;  2CH4 A;  4CC2 A;  2NWM A;  2BTT A;  4GLM A;  2JT4 A;  3UAT A;  4CC3 A;  2KRN A;  1M3B A;  4Y92 A;  2KGT A;  3A98 A;  1ABO A;  2YUN A;  2KRO A;  1WIE A;  4LNP A;  3JV3 A;  2KR3 A;  2RQT A;  1WXT A;  4JJC A;  1B07 A;  1S1N A;  3CQT A;  3KFV A;  1KFZ A;  2EYZ A;  2LJ3 A;  4FSS A;  2BZ8 A;  2RMO A;  2JM9 A;  4J9F A;  1GCQ A;  1UEC A;  1ZUK A;  1QKX A;  1NLP C;  3M0T A;  1T0H A;  1JQQ A;  1KJW A;  2VVK A;  2BZX A;  1QWF A;  1JXM A;  1CSK A;  2CUB A;  3QWX X;  3NMZ C;  2JTE A;  2JM8 A;  3QWY A;  1RI9 A;  2EPD A;  2K7A A;  1HSQ A;  3VS3 A;  1AZG B;  1U3O A;  5IXF A;  2K9G A;  2RPN A;  3RNJ A;  1AOJ A;  1PRM C;  4AG1 C;  4HCK A;  1ZUY A;  1E7O A;  1SSH A;  4J9E A;  1UJY A;  2OI3 A;  1Z9Z A;  1G2B A;  2L3Q A;  1J3T A;  2O2O A;  2RNA A;  2PNI A;  1H92 A;  1AWO A;  1I07 A;  2J6F A;  1GRI A;  1ZLM A;  2EVR A;  1T3S A;  1JEG A;  1Y57 A;  2DYB A;  5I11 A;  1E6H A;  1BB9 A;  4M4Z A;  1NEG A;  1GFD A;  1ZBJ A;  3VS7 A;  1I0C A;  3ULR B;  4AFZ C;  4DEX A;  3M0R A;  1A0N B;  1GBQ A;  4X1V A;  1M3A A;  1LCK A;  4RTX A;  1OOT A;  2HDA A;  2DIL A;  1N5Z A;  3TVT A;  2HBW A;  2K6D A;  1H3H A;  4WCI A;  3PVQ A;  5HCK A;  2NUZ A;  3NHN A;  3I5R A;  2KRS A;  2W10 A;  1T3L A;  1SRL A;  3EHR A;  1UE9 A;  2XMF A;  3IQL A;  2RN8 A;  2FPF A;  2SRC A;  2LX7 A;  2DRM A;  1BBZ A;  2ECZ A;  2YUP A;  1K0S A;  2DNU A;  2PZ1 A;  3EGU A;  2M0Y A;  2ENM A;  2DMO A;  1KIK A;  4J9G A;  1NLO C;  2AK5 A;  2F2X A;  1U06 A;  1M3C A;  2DM1 A;  4EIK A;  2O88 A;  1G83 A;  2OJ2 A;  2CSI A;  4HVW A;  2G6F X;  1WDX A;  5I22 A;  1OV3 A;  2DL4 A;  2DL3 A;  1M8M A;  3TSZ A;  2A28 A;  2EYX A;  5IHN A;  2RF0 A;  4RTT A;  4JJD A;  2CSQ A;  4GBQ A;  1WI7 A;  2FRY A;  2YUQ A;  4J9I A;  2EW3 A;  4DEY A;  4JZ3 A;  4QT7 A;  1FMK A;  1Y0M A;  2K2M A;  1YCS B;  3VS1 A;  2EGC A;  1HJD A;  2YUO A;  2ESW A;  4AFQ C;  1VA7 A;  4A63 B;  2LP5 A;  1M27 C;  2ROL A;  2KXC A;  1KSW A;  2E5K A;  1AD5 A;  4Z8A A;  2QDL A;  2I0N A;  2FRW A;  5L23 A;  4JJB A;  2KXD A;  2YDL A;  3UA7 A;  3VRY A;  2DRK A;  1WLP B;  2L2P A;  4OMP A;  1AWW A;  2D0N A;  2KYM A;  2SEM A;  2CDT A;  5GJV B;  2MIO A;  1GCQ C;  2A08 A;  4Z88 A;  4F17 A;  4F14 A;  1GCP A;  2EGA A;  2LMJ A;  2YT6 A;  2KT8 A;  2CRE A;  2W0Z A;  1ZUU A;  3M0S A;  2GTJ A;  2FPE A;  1UHF A;  2LCS A;  1YNZ A;  1BU1 A;  2V1R A;  1UG1 A;  2HCK A;  2JXB A;  1WX6 A;  3EG0 A;  2DLP A;  1K1Z A;  1YWO A;  2EBP A;  2P4R A;  4D8D A;  5GJW B;  4KRT A;  3H41 A;  3R6N A;  3RBB B;  2J7I A;  1UFF A;  2ROT A;  4CC7 A;  2J06 A;  2L3P A;  1AVZ C;  1X2Q A;  2DL5 A;  2KE9 A;  1WXU A;  1RUW A;  2LQN A;  2FEI A;  3REA B;  2K79 A;  2EGE A;  4J9H A;  2DE0 X;  4RTW A;  2M51 A;  1GBR A;  2J05 A;  1SHG A;  2CT4 A;  2ABL A;  1MUZ A;  4OMO A;  1ABQ A;  1TUD A;  1K9A A;  3THK A;  3VS0 A;  2DL8 A;  1CKA A;  1K4U S;  2VWF A;  1OPL A;  4J9C A;  1CKB A;  3NGP A;  1FYN A;  2X3W D;  2KYB A;  1XOV A;  1UUE A;  1UHC A;  1ZSG A;  2DF6 A;  3M0Q A;  1NYF A;  4D8K A;  4HXJ A;  3O5Z A;  2KRM A;  1H8K A;  2DBM A;  5EC7 A;  1NM7 A;  4RTY A;  1X2K A;  3NPF A;  2IIM A;  2FPD A;  1ZX6 A;  2CH4 W;  2DVJ A;  3SEM A;  2C0T A;  4OMM A;  4E6R A;  4LE9 A;  5IXB A;  2L0A A;  2C0O A;  3VS5 A;  2GGR A;  5IH2 A;  3PVL A;  4OMQ A;  4RTZ A;  1WXB A;  2O31 A;  5ECA A;  2F2W A;  1QKW A;  1SEM A;  4IIM A;  1MV3 A;  1VYU A;  2L3S A;  4Z89 A;  3VS2 A;  1YN8 A;  4LN2 A;  4RUG A;  1PKT A;  1T0J A;  1E6G A;  2OAW A;  1OEB A;  1GFC A;  4OMN A;  2D8J A;  2LNH B;  4JPB W;  1PNJ A;  4LUD A;  3VS4 A;  1QWE A;  2DA9 A;  4ZNX A;  1SPK A;  1NEB A;  1UGV A;  2O9S A;  2RQU A;  1W1F A;  2J6O A;  1UJ0 A;  3EG3 A;  1TUC A;  2A36 A;  2LQW A;  2VKN A;  2CUD A;  4AFS C;  1WYX A;  1AEY A;  2BZY A;  4OML A;  1IO6 A;  2EYW A;  2AZS A;  1NYG A;  2RQW A;  2FG0 A;  1X6G A;  5FWC A;  3LH5 A;  2EYY A;  1TG0 A;  1K0X A;  2FO0 A;  2KNB B;  1K76 A;  3PE0 A;  1OPK A;  3H0H A;  2KBT A;  3VS6 A;  1M30 A;  1X6B A;  4K11 A; 
#chains in the Genus database with same CATH topology
 2JJ9 A;  4J83 A;  3UT1 A;  2O9V A;  1RLQ C;  5KE3 A;  1ZQ1 A;  2H8H A;  2P0Q A;  3QHS A;  5LJ5 d;  2XU8 A;  2MOX A;  2V8I A;  4QQD A;  3CCV T;  2DER A;  3CBO A;  4CI0 C;  4ZGJ B;  4C5I A;  2EFI A;  2ED0 A;  3C0C A;  1RLP C;  3CBM A;  2A37 A;  2JW4 A;  4IIO A;  4ORZ A;  3EG2 A;  4BB7 A;  3A8M B;  1UGS B;  4QKU A;  2PVG B;  4CC4 B;  3EFO B;  3M58 A;  3CCE A;  4J7F A;  1VQN T;  2KSS A;  3H9N A;  2AZV A;  1YJ9 Q;  1IGU A;  1WPY A;  5FW9 A;  1QCF A;  1VYV A;  3FRN A;  1M2V A;  2IVW A;  1AZE A;  3DLL A;  2EYQ A;  3PNW C;  4DA4 A;  1SHF A;  1N8R C;  1YWP A;  1JJ2 S;  2RHX A;  1UTI A;  4F7U E;  4C0G A;  2CP7 A;  4C0F A;  3CCJ A;  1I8F A;  1NG2 A;  3JB9 I;  5D7U A;  3H0F A;  5D6X A;  2XG8 D;  3PT9 A;  4PJM A;  3QJY A;  1BCO A;  1VYT A;  1TXQ A;  3UPU A;  4RTU A;  2EQU A;  2QGG A;  2ED1 A;  1VQ7 Q;  1WNL A;  5GAN g;  2DFU A;  2DJQ A;  5A0G A;  3JSC A;  1MGQ A;  1PWT A;  1HYO A;  5D6Y A;  4E7I A;  2OAU A;  2COW A;  4A4H A;  5FWB A;  3HPW A;  2KAF A;  4M7D B;  2M16 A;  3I55 Q;  3U23 A;  4JS4 A;  1PD1 A;  5FU6 B;  3GOX A;  4A4K A;  3MEV A;  3VYH B;  4CC3 A;  2EQM A;  4Y92 A;  1M3B A;  4M7A B;  2KGT A;  2MF2 A;  3FC3 A;  2K2V A;  3LH0 A;  2YLC A;  2P4T A;  3PFS A;  1M5Q 1;  3L2Q A;  4LNP A;  3CC4 Q;  2CS7 A;  4M7D C;  2DK3 A;  3EH2 A;  3SFM A;  3QO3 A;  3SWN A;  2DXT A;  2HL5 C;  2X51 A;  3CQT A;  3CCQ T;  1C0M A;  4IUU A;  3OYM A;  4M7A C;  4A53 A;  4FYX B;  5GAO q;  6AT1 B;  2EYZ A;  3GPL A;  4FSS A;  2RMO A;  2JM9 A;  4J9F A;  5GAN 5;  4M7D D;  1PM3 A;  1ZUK A;  3O8V A;  5CQY A;  1N9R A;  2JVV A;  3JCM X;  1IB8 A;  2E64 A;  3EAE A;  3E9F A;  3L2R A;  1D1B A;  1CSK A;  1X6O A;  2EPD A;  2R58 A;  1KQS P;  2E12 A;  1Q95 G;  2EJG A;  4JLI A;  3NFC A;  1G3S A;  1SSH A;  3EGD A;  3FDR A;  5KCO A;  4C92 B;  3MEA A;  3G6E T;  2LCL A;  1M1G A;  1VQ4 T;  2PU9 B;  1O75 A;  2RNA A;  2XI9 A;  3MP1 A;  1H92 A;  3OW2 S;  1K8A R;  2J6F A;  1GRI A;  2DZ9 A;  1ZLM A;  1YJ9 A;  2L8D A;  4N0A C;  2EVR A;  4PJO A;  4WF2 A;  5KE2 A;  4XTX A;  1E6H A;  1GFD A;  1ZBJ A;  1I0C A;  4ANJ A;  4DEX A;  4C92 C;  2KQW A;  3ZBD A;  1A0N B;  2FVU A;  2XK0 A;  1M3A A;  1LCK A;  3RKX A;  5IT9 E;  1OOT A;  2R5A A;  4BI3 A;  4C8Q F;  3TVT A;  2HBW A;  4B6M A;  1F1B B;  5GAO r;  4PFP A;  3I5R A;  1VQ9 T;  1KQ2 A;  1UE9 A;  4M75 F;  3IQL A;  1LPL A;  2RN8 A;  5KYW A;  3L2Z A;  2WSE E;  2LX7 A;  3RER A;  1QP3 A;  1VQ7 A;  2PZ1 A;  3CBP A;  4RG8 A;  2XKO C;  4J9G A;  2NUT B;  4ZTJ A;  4E7K A;  4DQ2 A;  2FZC B;  1IRX A;  2CZ0 B;  5HK0 A;  1QW1 A;  5I22 A;  1WHG A;  2DL4 A;  4C92 E;  4JJD A;  1WI7 A;  5I2M A;  3I55 A;  2QAS A;  3CPF A;  4DEY A;  3MKD A;  1VQ8 T;  3CCM Q;  4JZ3 A;  2M0O A;  4PFZ A;  1Y0M A;  2K2M A;  2VXF A;  5KYX B;  2EGC A;  4L59 A;  2PVD B;  3NTK A;  4C8Q B;  4RCC A;  1D3B B;  1VA7 A;  1TSF A;  4IUQ A;  2X35 A;  4QQ6 A;  3S3O A;  2ROL A;  4F04 B;  2HL3 A;  2KXC A;  3E2U A;  5KCH A;  1VQO Q;  1VOM A;  4Z8A A;  1G3T A;  4M75 B;  2VAS A;  3L1A A;  1K8A C;  5GAM j;  5FRM A;  5GMK l;  4BAC A;  2KXD A;  2NLU A;  5LJ3 h;  4C8Q C;  1QP2 A;  2KYM A;  1QMC A;  3QSU A;  3KXT A;  2RD1 A;  5GJV B;  2MIO A;  2V26 A;  1GCQ C;  4R56 A;  1KQS A;  2XID A;  4F17 A;  4M75 C;  2EGA A;  3LX7 A;  4PKC C;  5DY9 A;  1Q86 U;  3M0S A;  4PL6 A;  5I21 A;  4M78 B;  1BKB A;  2JUF A;  4KUL A;  1YNZ A;  2V1R A;  4ZN1 A;  1UG1 A;  1K9M R;  1NPR A;  2JXB A;  3HRU A;  1K1Z A;  3I56 Q;  4D8D A;  2AIR B;  4RG2 A;  5A0L A;  2ROT A;  2FYK A;  2L3P A;  2DL5 A;  2FZK B;  1R8O B;  1NZ9 A;  1WXU A;  4M77 G;  3WVE B;  3A8O B;  3GNF B;  3REA B;  3JCM c;  4ZGE B;  2J05 A;  4M78 C;  1MUZ A;  2QA4 T;  5GMK i;  2OTL Q;  4PFO A;  1CKA A;  1N6A A;  1OPL A;  4C8Q E;  2LQK A;  1CKB A;  3NGP A;  3CC4 T;  1QVF S;  1XQH A;  2L89 A;  1UUE A;  3G4S Q;  1VQ5 T;  3EFO A;  1OU8 A;  2B8A A;  5GAN 8;  3OYC A;  4M75 E;  2DF6 A;  4KUD K;  4M78 D;  5AYF A;  3O5Z A;  1H8K A;  1UGR B;  2QQB A;  5EC7 A;  1NM7 A;  3CD6 T;  2PUO B;  4RTY A;  5LJ5 f;  2RM4 A;  3V8J A;  3NPF A;  2IIM A;  5GAN 3;  2FPD A;  3QPH A;  2CH4 W;  1YHQ A;  4E6R A;  5CVI A;  3UDC A;  3CCV Q;  1H3Z A;  2M1H A;  1C6V X;  3TCJ A;  3CMA T;  4OB0 B;  4E7Z A;  1HXD A;  1BYM A;  3FJP A;  2F2W A;  2L3S A;  2X4Y A;  3CC2 T;  1Y96 B;  1KK7 A;  2OAW A;  5LJ3 j;  2LRQ A;  3HKS A;  1Q7Y R;  4OMN A;  4HKE A;  1LJO A;  4PJO F;  1QWE A;  4ZNX A;  1K9M C;  3CCM A;  1SPK A;  1G3W A;  1UGV A;  1W2B S;  3VU3 C;  4M7D A;  3C4S A;  1TUC A;  1BIA A;  3GNG A;  2CUD A;  2OTJ T;  2QG9 B;  1WYX A;  2XD0 A;  2EQJ A;  2EYW A;  1VQO A;  5IAY A;  4JRQ A;  2RQW A;  4M7A A;  4BDY A;  2FB7 A;  4F7U G;  1TG0 A;  1K0X A;  4NOY A;  3OY9 A;  1IRE B;  3ZFJ A;  4L5G A;  3N5B B;  2X9H A;  3URG A;  2XDB A;  3VS6 A;  1X6B A;  1EFN A;  1VQP A;  2HSP A;  5FU7 B;  2COY A;  4MMK A;  2X3X D;  3NTI A;  1WFW A;  1M1F A;  3JCM e;  3ZL7 C;  1QVG P;  3G71 T;  3L42 A;  2CT3 A;  2C0I A;  3I56 A;  1X43 A;  1UB4 A;  5FU7 C;  1EZZ B;  4BE2 A;  3SHW A;  3M54 A;  4FW2 A;  3I9Q A;  1AWJ A;  4FT4 A;  4N0A A;  4F16 A;  2DX1 A;  2F2V A;  3V7C A;  2VV5 A;  1YP5 A;  2KVQ G;  2OTL A;  2GBQ A;  2YRV A;  4C92 A;  8ATC B;  3BDL A;  3QDF A;  3CCQ Q;  3A5Z B;  3G4S A;  1Q7Y C;  5IHK A;  3LGL A;  3OYY A;  4PJJ A;  2DXU A;  2K57 A;  1B3Q A;  2JZ2 A;  2GNC A;  1SRM A;  1HD3 A;  2E70 A;  2DEU A;  3M57 A;  4IUV A;  1D0Z A;  1U5S A;  2QK0 A;  3OYL A;  2LJ0 A;  1B34 B;  4HVV A;  2ZCF B;  1Z9Q A;  3T9N A;  1JRI A;  4OB3 B;  2D8H A;  1X27 A;  3CCL T;  1JJ2 P;  2EQI A;  5HK3 A;  3JCM d;  3CCV A;  5GAN h;  1N9S A;  1WA7 A;  1ARK A;  3FJ5 A;  4M77 D;  1W6X A;  2VXE A;  3V7R A;  4PJO E;  1PCX A;  3QUI A;  4C5H A;  1Q82 U;  1MV0 B;  4XK8 E;  3TSW A;  4XTZ A;  2AKK A;  1FXX A;  2DXB A;  3G6E Q;  1SF9 A;  3X25 B;  1VQ4 Q;  1WHL A;  3I5S A;  4CC2 A;  3C95 A;  2NWM A;  2HAX A;  1VQN A;  3TEE A;  2RJF A;  4GLM A;  2XHC A;  2A7Y A;  2NUT A;  3UAT A;  3A98 A;  1ABO A;  2WAC A;  3JCM W;  2YUN A;  3P8H A;  1WIE A;  3JV3 A;  2RA2 A;  3BDU A;  1BIB A;  2KR3 A;  3X26 B;  4J8O A;  2ZPH B;  4ATO A;  3BE3 A;  2HNI A;  4JJC A;  3R6O A;  2P0K A;  3QZ9 B;  2AT1 B;  5KYX A;  1VQK T;  4B9X A;  3RIR A;  1KHC A;  4C8Q A;  1D3B A;  1VQ9 Q;  3HSB A;  3CCU T;  1RAD B;  1OUL A;  1GCQ A;  1QKX A;  4YTL A;  3OYH A;  4M75 A;  3JB9 G;  1RAE B;  1QVG A;  1VQ6 T;  3M0T A;  4E7S A;  3M59 A;  3JB9 H;  2ZPG B;  1YIJ T;  2BIV A;  2DAQ A;  2DTH A;  5LJ5 h;  2KMT A;  3NMZ C;  3OMG A;  4Y28 E;  1RI9 A;  1MNE A;  1U3O A;  5IXF A;  2RPN A;  2LX9 A;  3GP8 A;  2CZ7 B;  3HHT B;  4J9E A;  2OI3 A;  3F70 A;  1XTD A;  2L3Q A;  1VQ8 Q;  2O2O A;  4M78 A;  1ZA1 B;  2QEX T;  2DEQ A;  2RK1 A;  3DLM A;  4M7D F;  1JEG A;  5GAN j;  3OSV A;  1K73 U;  2DYB A;  5I11 A;  5J26 A;  5CAI A;  2RJC A;  2HKQ B;  4KT0 E;  4LDU A;  4M7A F;  3V8L A;  2JTM A;  3JCM V;  3M0R A;  2GFU A;  3CCQ A;  3OW2 P;  4JUV A;  2PQW A;  4EMG A;  1YFN A;  5C6S A;  3DKM A;  5AT1 B;  2K6D A;  1NJI U;  1IXD A;  5IN1 A;  5HCK A;  2Y90 A;  2LVM A;  2KRS A;  1AHJ B;  2W10 A;  3CXC S;  1SRL A;  3MO8 A;  3QZ5 B;  2FPF A;  2SRC A;  2DRM A;  3C94 A;  4E7L A;  2YUP A;  4J6W A;  1NBE B;  5CIU A;  2DNU A;  3OYJ A;  3OYG A;  2ENM A;  2AK5 A;  4C5E A;  2O88 A;  3G7Z A;  2OJ2 A;  3PIO A;  2CSI A;  4HVW A;  3X28 B;  1WDX A;  2HQX A;  2DL3 A;  3G6E A;  2HMA A;  4QVC A;  2EYX A;  3QII A;  1VQ4 A;  2E6N A;  1WJR A;  4ELY C;  3DB4 A;  2FRY A;  4J9I A;  2EW3 A;  1WZO A;  2QA4 Q;  1VQM T;  3M55 A;  5GAM e;  2E41 A;  1FMK A;  1VIF A;  3VS1 A;  1JB0 E;  2E3H A;  2XDD A;  4C92 F;  2YUO A;  3OQ5 A;  1Y96 A;  3RMS A;  2ESW A;  4AFQ C;  1IHW A;  1VQ5 Q;  4RMO A;  5FU6 C;  1OI1 A;  1KSW A;  2E5K A;  3OB9 A;  1AD5 A;  1MMN A;  4UC4 A;  5J39 A;  4JRK A;  2FRW A;  2K4Y A;  2MK5 A;  3JAM E;  3CD6 Q;  2Y4X A;  3VKI A;  3VYG A;  1R77 A;  2L5Q A;  2SEM A;  1VQ9 A;  4GLK A;  2CDT A;  2F5K A;  2CP0 A;  1VQL T;  4A4E A;  2A08 A;  3CMA Q;  5LJ5 g;  2D6F A;  1BCM A;  1GCP A;  3OYI A;  2QQA A;  1YJN T;  5CKD A;  5GAO m;  3OYN A;  2GTJ A;  1JBM A;  3CC2 Q;  1BU1 A;  4ZGD B;  1M2O A;  9ATC B;  5GAN 4;  4M7D E;  1Q81 U;  2DPP B;  1G3Y A;  4JDS A;  3R6N A;  3RBB B;  2J7I A;  4CC7 A;  1AVZ C;  5GAM d;  4M7A E;  1RUW A;  1PC0 A;  2CP6 A;  1VQ8 A;  3AHU A;  2M51 A;  2HD0 A;  1GBR A;  2CT4 A;  2DD5 A;  2ABL A;  2DET A;  5GMK h;  1K9A A;  4Y91 A;  2LQ8 A;  4JJN K;  2K5L A;  4LD6 A;  3OW2 A;  2OTJ Q;  3HTR A;  4R55 A;  1TU0 B;  4WTO B;  1S72 T;  1YIT T;  2CZ1 B;  3EH1 A;  3JB9 D;  4ME7 A;  4D8K A;  3INZ A;  3J81 E;  3RMQ A;  3RKW A;  4HT9 A;  4IKF A;  1WHJ A;  4LDY A;  5L8R E;  2DVJ A;  1EIF A;  3HRS A;  4OMM A;  2L0A A;  2C0O A;  3FLG A;  3VS5 A;  1SKU B;  2KK4 A;  1Y07 A;  3CME T;  2EKO A;  3PVL A;  4OMQ A;  4BE0 A;  1KC8 U;  5CKF A;  4OP0 A;  4FL6 A;  3G71 Q;  4DOW A;  2FL7 A;  3S3N A;  3X24 B;  1MV3 A;  1B34 A;  1Q86 R;  1YN8 A;  3WVD B;  4RUG A;  2KI7 A;  1PKT A;  4LDW A;  4M78 F;  2RHY A;  1M90 U;  1X75 C;  2H3E B;  3VS4 A;  2QA4 A;  2ZPF B;  4E7H A;  1NEB A;  2V8K A;  2J6O A;  3CC4 A;  1ZSZ B;  1UEB A;  1ZA2 B;  3ZEH A;  5CQX A;  3EG3 A;  1FMV A;  1YJW T;  2A36 A;  2VKN A;  1VQ5 A;  1KC8 C;  2CP3 A;  2P84 A;  3CD6 A;  8AT1 B;  4II1 A;  2E3I A;  2EYY A;  2DD4 A;  3MEU A;  3X20 B;  1K76 A;  1W2B P;  3JCM f;  3BFM A;  3CC7 T;  1ZSZ C;  2KBT A;  5LJ3 d;  3CCL Q;  5GMK j;  5A2Q E;  2CYZ B;  3G1J A;  3M56 A;  1D09 B;  3JB9 J;  1TH7 A;  3CMA A;  1C1A A;  2VGM A;  4RTV A;  3QBY A;  2EKH A;  4FYY B;  4V2S A;  1RAB B;  3RDV A;  1JO8 A;  1X69 A;  3E1S A;  1RI0 A;  1N27 A;  1LOJ A;  4PJO G;  3CC2 A;  4L6V 5;  3MHX A;  2DXC A;  1YI2 T;  2HBP A;  3GBQ A;  2H3J A;  4ESR A;  2OX7 A;  5GAN 7;  3OBY A;  2K3X A;  2QXF A;  2LJ1 A;  1UGP B;  3UA6 A;  1PKS A;  2VB6 A;  3GIB A;  4HA8 A;  2YSQ A;  1GL5 A;  1RAC B;  3BW1 A;  3CPW S;  4OF1 A;  2HEQ A;  2GTO A;  2K5I A;  2ZPE B;  3CCR T;  1Q86 C;  2LDM A;  2KEA A;  1PHT A;  2QAZ A;  4XU0 A;  2OTJ A;  4KBM B;  3UF4 A;  1BI1 A;  3L2V A;  3SB2 A;  2FHD A;  4EDU A;  2RQR A;  1VQK Q;  4J9D A;  2JS2 A;  4FIB A;  2VUB A;  3A1P A;  2K3B A;  3CCU Q;  4E2F B;  3EHQ A;  3P8D A;  3EGX B;  3A8G B;  1W70 A;  4KGZ B;  3S6W A;  1VQ6 Q;  4LUE A;  1QCN A;  1G8X A;  1YIJ Q;  1I5O B;  2V1Q A;  4M78 E;  2JMA A;  1WGS A;  3OYE A;  4AG2 C;  3ER0 A;  3JRZ A;  3OMC A;  3G71 A;  5IHI A;  2LZ6 B;  4DBR A;  2MCN A;  4DBF A;  1RAG B;  1BK2 A;  3M0U A;  4R0K A;  2GFA A;  2EJF A;  2ZZD A;  3CCS T;  3VUB A;  4HVU A;  4XTY A;  2QEX Q;  1R0B G;  2BE9 B;  2CH4 A;  3P8B B;  2BTT A;  1IGQ A;  1KD1 U;  3JCM J;  3J80 E;  2RJD A;  3QYH B;  1TS9 A;  2DIG A;  3QJ6 A;  1WXT A;  1B07 A;  4C5G A;  2QQ9 A;  3TU4 K;  4J5Y A;  2VYT A;  2MWP A;  4C0D B;  1MHN A;  1NPP A;  3GLX A;  3JCM Q;  2BZ8 A;  4JLG A;  3OYA A;  1UEC A;  2DIQ A;  2E4H A;  3CEY A;  1M1K U;  3CCL A;  2X4W A;  1T0H A;  2YHT A;  3HFN A;  2DZC A;  4BD3 A;  1D0X A;  5KYY B;  1JXM A;  3QWX X;  1YHQ T;  2YXY A;  3JCM P;  2JTE A;  3PTA A;  3QWY A;  3VS3 A;  5GAN e;  2QYZ A;  2EJ9 A;  2LCC A;  3RNJ A;  3HP9 A;  1I5L A;  1PRM C;  2IPO B;  3LWI A;  4J6Y A;  1UJY A;  2ZGW A;  3EFS A;  1G2B A;  4MDW A;  1VQM Q;  1Q82 R;  1J3T A;  2C06 A;  4M77 B;  4N4I A;  2PNI A;  1D1C A;  3D7S B;  2LT4 A;  1I07 A;  4FW1 A;  2BUD A;  3VUZ A;  4P5N A;  1MMA A;  1B7T A;  1BB9 A;  4O6J A;  5CKB A;  1NEG A;  3TRE A;  4IUP A;  4AFZ C;  1GBQ A;  4M77 C;  4X1V A;  1QVP A;  2RHZ A;  4OGE A;  1VQK A;  4RTX A;  3RES A;  3H8Z A;  2HZY A;  3EG9 B;  3CCU A;  4WCI A;  3MCA B;  3OS0 A;  4MZT A;  4QVZ A;  3RKY A;  1VQL Q;  5I2S A;  3NHN A;  4LD9 K;  2O4X B;  4KGX B;  1T3L A;  2AHJ B;  1PD0 A;  2A0F B;  2XMF A;  4Q5W A;  1YJN Q;  1RL2 A;  4AMC A;  1BBZ A;  2EQK A;  2M9U A;  3QDR B;  5GAN d;  3EGU A;  1ACM B;  3OBW A;  4E7J A;  4QQG A;  4VUB A;  5GAM f;  3HFO A;  3LLR A;  1U06 A;  1M3C A;  2DM1 A;  1G83 A;  2D9T A;  4M7D G;  3CXC P;  1OV3 A;  2I2L A;  3QG1 A;  3LWH A;  2CSQ A;  4GBQ A;  4M77 E;  2V8J A;  2QEX A;  4M7A G;  5KYU B;  3ME9 A;  4N4H A;  1YCS B;  5M9O A;  1S72 Q;  1YIT Q;  2LC4 A;  4PLL A;  4A63 B;  1Q82 C;  2RO0 A;  3FB9 A;  4MZM A;  1BI0 A;  2G3R A;  2RI2 A;  2RB6 A;  1K73 R;  2I0N A;  2ZAE A;  4XTV A;  2RJE A;  4FYV B;  4JJB A;  1ZSZ A;  4F7U B;  2LTO A;  3UA7 A;  3WXM B;  3FIF A;  4CRI A;  1WJQ A;  4NS5 A;  4OMP A;  1AWW A;  4GY5 A;  1P92 A;  1FMW A;  3CME Q;  2P0P A;  3LW5 E;  1IHV A;  4F14 A;  1NJI R;  1MND A;  2LMJ A;  1LVK A;  2YT6 A;  1H64 1;  3OYD A;  2W0Z A;  1ZUU A;  2LT1 A;  2MAM A;  2FPE A;  1UHF A;  2LCS A;  4LDV A;  2PVO B;  4DBH A;  1N8R U;  4LDX A;  2DLP A;  1YWO A;  1SSF A;  2P4R A;  5GJW B;  4KRT A;  4C92 G;  1UFF A;  2J06 A;  1X2Q A;  2KE9 A;  5FRO A;  1KG1 A;  1VQM A;  2EGE A;  2CP5 A;  2DE0 X;  4RTW A;  1OQK A;  1SHG A;  3OYF A;  1R0C B;  3Q1J A;  2NUP B;  4BI4 A;  3THK A;  2E10 A;  4XTW A;  3VS0 A;  1YJW Q;  3MP8 A;  2MWO A;  1K4U S;  2VWF A;  4J9C A;  4PJN A;  1FYN A;  2R57 A;  2X3W D;  1XOV A;  2CGH A;  2MPX C;  1UHC A;  1ZSG A;  3OA6 A;  1XJW B;  1JJ2 A;  3M0Q A;  1NYF A;  5LJ3 f;  5LL6 S;  4N4G A;  5HKC A;  2Y4Y A;  2QTX A;  3CC7 Q;  2YRD A;  4PNO A;  2HQE A;  4X34 A;  1X2K A;  4FYW B;  3E19 A;  1VQL A;  1ZX6 A;  4ZN3 A;  4EMK B;  1PSF A;  2RI5 A;  5GMK m;  3JCM g;  1K73 C;  3TQ7 P;  5CR2 A;  4FM4 B;  2JN0 A;  1YJN A;  3BY7 A;  5IH2 A;  1XNI A;  3CXC A;  4RTZ A;  4A4G A;  1V29 B;  1WXB A;  3EGX A;  4FT2 A;  4X9D A;  2YWW A;  2O31 A;  1YI2 Q;  5ECA A;  4NL2 A;  4JRI A;  3V8K A;  1SEM A;  4OGC A;  4Z89 A;  4D6W A;  1G5V A;  3MP6 A;  3VS2 A;  3MEW A;  4LN2 A;  4EMK C;  3JB9 F;  1T0J A;  1NJI C;  5DLQ E;  5D6W A;  2DTO A;  1Q81 R;  4C0Z A;  2D8J A;  1BI3 A;  2LNH B;  3QXE B;  4JPB W;  3CCE T;  1PNJ A;  5HY6 A;  3L2U A;  5LJ5 j;  4C8Q G;  3CCR Q;  3KUF A;  1M8V A;  2GF7 A;  1D0Y A;  2RQU A;  1W1F A;  1UJ0 A;  2K3Y A;  1SG5 A;  5J3B A;  5GMK e;  1YIT A;  1S72 A;  4HT8 A;  2QI2 A;  1AEY A;  4M75 G;  4ELZ C;  1YBY A;  1IO6 A;  4E47 A;  3PGG A;  4XU1 A;  3PMT A;  4Z02 A;  1X6G A;  5FWC A;  1RAA B;  2DJZ A;  3CCJ T;  3LH5 A;  2FO0 A;  2KNB B;  3PE0 A;  3H0H A;  4BY6 B;  1AWX A;  2NYS A;  2MI6 A;  4EMH A;  2CZ6 B;  2PTK A;  4XQ3 A;  3CME A;  2JS0 A;  4M78 G;  1QCO A;  5EG2 A;  2ZPI B;  4M7A D;  3UWN A;  3VRZ A;  2LNV A;  3I35 A;  1PRL C;  2L3R A;  4JZ4 A;  4KH1 B;  1KC8 R;  4BY6 C;  3CCS Q;  2DBK A;  1TTH B;  2DYI A;  3JCM b;  2B86 A;  5CKE A;  4A4F A;  1V76 A;  1JXO A;  2DKG A;  5KYY A;  3SDZ A;  2ZPB B;  1DJ7 B;  5GAM h;  4KUI A;  2QTV A;  1M4Z A;  3OYB A;  1I1J A;  2Z0W A;  3VJP A;  4AFU C;  3RUX A;  3QKJ A;  1I81 A;  1WQ7 A;  1YJW A;  1MMG A;  2FZG B;  4MDX A;  1M90 R;  4O5V A;  4XAX B;  4M77 A;  2RQV A;  5KH6 A;  1Q81 C;  3M0P A;  1V1C A;  3CPW P;  5DLO A;  1QVF P;  3HRT A;  2GQV A;  3MJX A;  2PUK B;  3CC7 A;  1QLY A;  5LJ3 e;  1UDL A;  2D1X A;  4JRP A;  3MET A;  1RAH B;  3LYI A;  3OSS C;  1Y71 A;  2AKL A;  4HCZ A;  3EG1 A;  4PJL A;  1YHQ Q;  4C92 D;  4FCY A;  3EG9 A;  1FX7 A;  2GQI A;  3H0I A;  2E1H A;  4BUG A;  4J9B A;  3REB B;  4J7I A;  2K5F A;  2O4X A;  1YI2 A;  3ASK A;  1TOV A;  2DL7 A;  1K8A U;  2KT1 A;  1WHK A;  1JU5 C;  2JMC A;  2J6K A;  2O01 E;  2ATC B;  2JT4 A;  2WSC E;  2X4X A;  2KRN A;  2A3L A;  2HQH A;  4J6X A;  1UGQ B;  1YJ9 T;  3CCR A;  3DB3 A;  3A8H B;  5CK9 A;  2KRO A;  2QQS A;  4PK4 A;  2RQT A;  1S1N A;  3M53 A;  5KYU A;  2QGF B;  1FWZ A;  2QDY B;  3M4Y A;  3QYG B;  4XTU A;  3OS2 A;  3KFV A;  4OB2 B;  1KFZ A;  1M90 C;  2LJ3 A;  1KQS S;  5GAN f;  1RAF B;  1NLP C;  4OVA A;  2JNG A;  4BE1 A;  1IZ6 A;  1JQQ A;  1AT1 B;  1RAI B;  1VQP Q;  1KJW A;  2VVK A;  3M9Q A;  2BZX A;  1QWF A;  2CUB A;  4F7U A;  1VQ7 T;  2JM8 A;  3V7S A;  2K7A A;  2KY9 A;  1HSQ A;  1AZG B;  2K9G A;  1AOJ A;  4AG1 C;  2CP2 A;  4C8Q D;  4HCK A;  1M2V B;  1ZUY A;  1E7O A;  2RHI A;  2QQR A;  3CCS A;  1M9S A;  5GAM g;  2RK2 A;  1Z9Z A;  2R5M A;  2E65 A;  5GAN 2;  1U8R A;  4M75 D;  3I55 T;  1AWO A;  4TVR A;  4MML A;  3GF5 A;  3C12 A;  1T3S A;  5FRN A;  1Y57 A;  4KGV B;  3CPW A;  1EX4 A;  4BDZ A;  1QVF A;  1HK9 A;  4M4Z A;  2XDP A;  3VS7 A;  3ULR B;  2HKN A;  1NE8 A;  1KD1 R;  5CCA A;  2F5T X;  1TWB A;  1OZ2 A;  3A8L B;  1WHH A;  2NUP A;  3E9G A;  2HDA A;  2DVE A;  2DIL A;  4ZTF A;  1GXI E;  1H3H A;  1KHI A;  3PVQ A;  5GAO l;  1D1A A;  2DO3 A;  2NUZ A;  3EHR A;  4QVD A;  1K9M U;  1PSE A;  2ECZ A;  1K0S A;  2GCX A;  3PIP A;  2M0Y A;  1M1K R;  2DMO A;  2EAY A;  1KIK A;  1NLO C;  2F2X A;  4EIK A;  2RI3 A;  4MZP A;  4EMK A;  2G6F X;  1OYX A;  1M8M A;  2YRC A;  3TSZ A;  2A28 A;  5IHN A;  2RF0 A;  4RTT A;  1OZ3 A;  2YUQ A;  4HCC A;  3SWN B;  3M4G A;  1OX9 A;  2X4J A;  4KH0 B;  5DM7 R;  1VQN Q;  4QT7 A;  3J7A F;  2E6Z A;  3H6Z A;  1O9S A;  1HJD A;  2MMP A;  2D0Q B;  2DTI A;  1W2B A;  4M77 F;  2LP5 A;  1M27 C;  2JTF A;  3OYK A;  2MYS A;  4BI8 B;  4RKU E;  1VUB A;  2QDL A;  3SWN C;  1WJS A;  1VIE A;  3RR6 A;  5L23 A;  3KBG A;  2YDL A;  5GAO p;  3VRY A;  5LJ3 g;  1X01 A;  1WLP B;  2DRK A;  2L2P A;  5A0D A;  4A54 A;  2D0N A;  2JOY A;  1YCY A;  4QW2 A;  1KD1 C;  4FSX A;  4Z88 A;  4XU2 A;  7AT1 B;  3EGD B;  1W4S A;  5GAO n;  4FU6 A;  4C0D C;  4HCB A;  2IG0 A;  2KT8 A;  3L2W A;  1ZBX A;  2CRE A;  4JS5 A;  5GAN 6;  4X9C A;  2HCK A;  2HSE B;  1WX6 A;  3EG0 A;  3SD4 A;  1Q7Y U;  2EBP A;  4PJO B;  3MPU B;  1KQ1 A;  3H41 A;  1ZHI A;  1QQJ A;  2F1L A;  4LXC A;  2XIC A;  1LNX A;  3CCE Q;  3AT1 B;  5CO7 A;  2LQN A;  2FEI A;  2K79 A;  4J9H A;  1M1K C;  1U1T A;  1U1S A;  2WSF E;  1OU9 A;  1PG5 B;  4OMO A;  1ABQ A;  1TUD A;  3CCM T;  2DL8 A;  2EWN A;  4OMF B;  2M02 A;  4PJO C;  2KYB A;  3M5A A;  2YLB A;  3HL8 A;  1WQW A;  1VQO T;  3CCJ Q;  4OB1 B;  5KYW B;  4HXJ A;  4PLI A;  2KRM A;  4RCB A;  3PMI A;  2DBM A;  3OS5 A;  4PJO D;  1VQ6 A;  3EFR A;  1YIJ A;  3SEM A;  2C0T A;  4LE9 A;  5IXB A;  1VQP T;  3JCM h;  4DBQ A;  4NL3 A;  4AT1 B;  4F7U F;  3S3M A;  2GGR A;  1WHM A;  4IUR A;  5LJ5 e;  4B9W A;  1QKW A;  4IIM A;  1VYU A;  2VC8 A;  1MMD A;  1OX8 A;  2BKD N;  3I56 T;  2BE7 D;  1E6G A;  4EPC A;  1N8R R;  2COZ A;  1OEB A;  1GFC A;  4DOV A;  4LUD A;  2DA9 A;  1TUG B;  2CKK A;  2F69 A;  2O9S A;  4XU3 A;  2VGN A;  3NTH A;  3FEO A;  2OTL T;  1I4K 1;  1BI2 A;  2LQW A;  4AFS C;  5KYN A;  2BZY A;  4OML A;  3OS1 A;  5CKH A;  3G4S T;  2AZS A;  2EIF A;  1NYG A;  2FG0 A;  3VV0 A;  2E5Q A;  5C0M A;  4IUT A;  1Y7X A;  2RHU A;  2KDS A;  5FLX E;  1OPK A;  3LGF A;  1QVG S;  2RH2 A;  1M30 A;  1N5Z A;  4K11 A; 
#chains in the Genus database with same CATH homology
 1EFN A;  1AWX A;  2O9V A;  1RLQ C;  2H8H A;  2HSP A;  2PTK A;  4RTV A;  2JS0 A;  2MOX A;  2X3X D;  2EKH A;  1WFW A;  3ZL7 C;  1JO8 A;  1X69 A;  3VRZ A;  2ED0 A;  3C0C A;  1RLP C;  1PRL C;  3I35 A;  2A37 A;  2JW4 A;  4JZ4 A;  3GBQ A;  2CT3 A;  4ESR A;  2C0I A;  4IIO A;  1X43 A;  2DBK A;  4ORZ A;  2B86 A;  2LJ1 A;  3EG2 A;  3UA6 A;  1PKS A;  1JXO A;  4CC4 B;  2YSQ A;  1GL5 A;  3SHW A;  3I9Q A;  1AWJ A;  1I1J A;  4F16 A;  2AZV A;  2DX1 A;  2F2V A;  5FW9 A;  1QCF A;  4AFU C;  1VYV A;  1YP5 A;  2HEQ A;  2GTO A;  2GBQ A;  1AZE A;  2KEA A;  1PHT A;  1SHF A;  3UF4 A;  1YWP A;  2RQV A;  5IHK A;  3M0P A;  2RQR A;  1V1C A;  4J9D A;  2JS2 A;  1UTI A;  1B3Q A;  2GNC A;  1SRM A;  1HD3 A;  1NG2 A;  2K3B A;  3EHQ A;  3H0F A;  1QLY A;  1U5S A;  1W70 A;  1UDL A;  2D1X A;  2LJ0 A;  1VYT A;  4LUE A;  4HVV A;  1Z9Q A;  4RTU A;  2D8H A;  1X27 A;  2AKL A;  3EG1 A;  2EQI A;  2ED1 A;  2V1Q A;  2JMA A;  1WA7 A;  1ARK A;  3FJ5 A;  1W6X A;  2DJQ A;  4AG2 C;  2GQI A;  3H0I A;  5IHI A;  2LZ6 B;  4J9B A;  3REB B;  1PWT A;  1MV0 B;  2MCN A;  3TSW A;  2AKK A;  2DL7 A;  2KT1 A;  1BK2 A;  3M0U A;  4R0K A;  5FWB A;  1JU5 C;  2JMC A;  2J6K A;  4HVU A;  3U23 A;  3I5S A;  2CH4 A;  4CC2 A;  2NWM A;  2BTT A;  4GLM A;  2JT4 A;  3UAT A;  4CC3 A;  2KRN A;  1M3B A;  4Y92 A;  2KGT A;  3A98 A;  1ABO A;  2YUN A;  2KRO A;  1WIE A;  4LNP A;  3JV3 A;  2KR3 A;  2RQT A;  1WXT A;  4JJC A;  1B07 A;  1S1N A;  3CQT A;  3KFV A;  1KFZ A;  2EYZ A;  2LJ3 A;  4FSS A;  2BZ8 A;  2RMO A;  2JM9 A;  4J9F A;  1GCQ A;  1UEC A;  1ZUK A;  1QKX A;  1NLP C;  3M0T A;  1T0H A;  1JQQ A;  1KJW A;  2VVK A;  2BZX A;  1QWF A;  1JXM A;  1CSK A;  2CUB A;  3QWX X;  3NMZ C;  2JTE A;  2JM8 A;  3QWY A;  1RI9 A;  2EPD A;  2K7A A;  1HSQ A;  3VS3 A;  1AZG B;  1U3O A;  5IXF A;  2K9G A;  2RPN A;  3RNJ A;  1AOJ A;  1PRM C;  4AG1 C;  4HCK A;  1ZUY A;  1E7O A;  1SSH A;  4J9E A;  1UJY A;  2OI3 A;  1Z9Z A;  1G2B A;  2L3Q A;  1J3T A;  2O2O A;  2RNA A;  2PNI A;  1H92 A;  1AWO A;  1I07 A;  2J6F A;  1GRI A;  1ZLM A;  2EVR A;  1T3S A;  1JEG A;  1Y57 A;  2DYB A;  5I11 A;  1E6H A;  1BB9 A;  4M4Z A;  1NEG A;  1GFD A;  1ZBJ A;  3VS7 A;  1I0C A;  3ULR B;  4AFZ C;  4DEX A;  3M0R A;  1A0N B;  1GBQ A;  4X1V A;  1M3A A;  1LCK A;  4RTX A;  1OOT A;  2HDA A;  2DIL A;  1N5Z A;  3TVT A;  2HBW A;  2K6D A;  1H3H A;  4WCI A;  3PVQ A;  5HCK A;  2NUZ A;  3NHN A;  3I5R A;  2KRS A;  2W10 A;  1T3L A;  1SRL A;  3EHR A;  1UE9 A;  2XMF A;  3IQL A;  2RN8 A;  2FPF A;  2SRC A;  2LX7 A;  2DRM A;  1BBZ A;  2ECZ A;  2YUP A;  1K0S A;  2DNU A;  2PZ1 A;  3EGU A;  2M0Y A;  2ENM A;  2DMO A;  1KIK A;  4J9G A;  1NLO C;  2AK5 A;  2F2X A;  1U06 A;  1M3C A;  2DM1 A;  4EIK A;  2O88 A;  1G83 A;  2OJ2 A;  2CSI A;  4HVW A;  2G6F X;  1WDX A;  5I22 A;  1OV3 A;  2DL4 A;  2DL3 A;  1M8M A;  3TSZ A;  2A28 A;  2EYX A;  5IHN A;  2RF0 A;  4RTT A;  4JJD A;  2CSQ A;  4GBQ A;  1WI7 A;  2FRY A;  2YUQ A;  4J9I A;  2EW3 A;  4DEY A;  4JZ3 A;  4QT7 A;  1FMK A;  1Y0M A;  2K2M A;  1YCS B;  3VS1 A;  2EGC A;  1HJD A;  2YUO A;  2ESW A;  4AFQ C;  1VA7 A;  4A63 B;  2LP5 A;  1M27 C;  2ROL A;  2KXC A;  1KSW A;  2E5K A;  1AD5 A;  4Z8A A;  2QDL A;  2I0N A;  2FRW A;  5L23 A;  4JJB A;  2KXD A;  2YDL A;  3UA7 A;  3VRY A;  2DRK A;  1WLP B;  2L2P A;  4OMP A;  1AWW A;  2D0N A;  2KYM A;  2SEM A;  2CDT A;  5GJV B;  2MIO A;  1GCQ C;  2A08 A;  4Z88 A;  4F17 A;  4F14 A;  1GCP A;  2EGA A;  2LMJ A;  2YT6 A;  2KT8 A;  2CRE A;  2W0Z A;  1ZUU A;  3M0S A;  2GTJ A;  2FPE A;  1UHF A;  2LCS A;  1YNZ A;  1BU1 A;  2V1R A;  1UG1 A;  2HCK A;  2JXB A;  1WX6 A;  3EG0 A;  2DLP A;  1K1Z A;  1YWO A;  2EBP A;  2P4R A;  4D8D A;  5GJW B;  4KRT A;  3H41 A;  3R6N A;  3RBB B;  2J7I A;  1UFF A;  2ROT A;  4CC7 A;  2J06 A;  2L3P A;  1AVZ C;  1X2Q A;  2DL5 A;  2KE9 A;  1WXU A;  1RUW A;  2LQN A;  2FEI A;  3REA B;  2K79 A;  2EGE A;  4J9H A;  2DE0 X;  4RTW A;  2M51 A;  1GBR A;  2J05 A;  1SHG A;  2CT4 A;  2ABL A;  1MUZ A;  4OMO A;  1ABQ A;  1TUD A;  1K9A A;  3THK A;  3VS0 A;  2DL8 A;  1CKA A;  1K4U S;  2VWF A;  1OPL A;  4J9C A;  1CKB A;  3NGP A;  1FYN A;  2X3W D;  2KYB A;  1XOV A;  1UUE A;  1UHC A;  1ZSG A;  2DF6 A;  3M0Q A;  1NYF A;  4D8K A;  4HXJ A;  3O5Z A;  2KRM A;  1H8K A;  2DBM A;  5EC7 A;  1NM7 A;  4RTY A;  1X2K A;  3NPF A;  2IIM A;  2FPD A;  1ZX6 A;  2CH4 W;  2DVJ A;  3SEM A;  2C0T A;  4OMM A;  4E6R A;  4LE9 A;  5IXB A;  2L0A A;  2C0O A;  3VS5 A;  2GGR A;  5IH2 A;  3PVL A;  4OMQ A;  4RTZ A;  1WXB A;  2O31 A;  5ECA A;  2F2W A;  1QKW A;  1SEM A;  4IIM A;  1MV3 A;  1VYU A;  2L3S A;  4Z89 A;  3VS2 A;  1YN8 A;  4LN2 A;  4RUG A;  1PKT A;  1T0J A;  1E6G A;  2OAW A;  1OEB A;  1GFC A;  4OMN A;  2D8J A;  2LNH B;  4JPB W;  1PNJ A;  4LUD A;  3VS4 A;  1QWE A;  2DA9 A;  4ZNX A;  1SPK A;  1NEB A;  1UGV A;  2O9S A;  2RQU A;  1W1F A;  2J6O A;  1UJ0 A;  3EG3 A;  1TUC A;  2A36 A;  2LQW A;  2VKN A;  2CUD A;  4AFS C;  1WYX A;  1AEY A;  2BZY A;  4OML A;  1IO6 A;  2EYW A;  2AZS A;  1NYG A;  2RQW A;  2FG0 A;  1X6G A;  5FWC A;  3LH5 A;  2EYY A;  1TG0 A;  1K0X A;  2FO0 A;  2KNB B;  1K76 A;  3PE0 A;  1OPK A;  3H0H A;  2KBT A;  3VS6 A;  1M30 A;  1X6B A;  4K11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...