1BB9A

Crystal structure of the sh3 domain from rat amphiphysin 2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
TTGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords AMPHIPHYSIN 2
publication title Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1998-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bb9A00
1NYFA 2SRCA 2JTEA 5GJVB 1H8KA 2EYYA 1KIKA 3EHRA 1X6GA 1BU1A 2K7AA 1K0SA 1UJ0A 1ZUUA 1JU5C 2ENMA 1I1JA 2C0OA 2MIOA 2EGCA 1TUCA 2I0NA 2DL3A 3LH5A 2DA9A 3NHNA 4AFUC 1BB9A 1M3AA 3QWYA 2EYZA 3UATA 1YNZA 3KFVA 2P4RA 1OPLA 3R6NA 1K9AA 5IXBA 3H41A 2DVJA 1G83A 4A63B 2W10A 2DX1A 2RN8A 1Y57A 1LCKA 2O9SA 2LNHB 4RTXA 5IHKA 2EBPA 4LUEA 3VS6A 2EQIA 1UJYA 1Z9ZA 2J05A 3EGUA 4J9BA 2O2OA 1QWFA 2KNBB 3VS0A 2MOXA 1TUDA 2KEAA 4HCKA 4LNPA 1B07A 4WCIA 2GNCA 2JW4A 1UHCA 1YN8A 2O31A 2GBQA 2V1QA 4J9DA 4J9GA 3UA7A 1OEBA 2DMOA 5FWBA 2DRKA 3U23A 1UE9A 2DF6A 1KSWA 2ED0A 2J06A 3M0UA 2JM9A 2DBMA 1AEYA 4OMPA 1B3QA 3PVQA 1T3SA 2LQNA 3H0FA 2RNAA 4AFSC 1GRIA 2ABLA 4IIOA 1PNJA 4RTVA 1T3LA 1IO6A 2J6KA 4AFZC 5IH2A 2YDLA 3C0CA 3VS1A 1OV3A 1QLYA 2FRWA 1UECA 1X43A 1FYNA 2EW3A 1HSQA 2DJQA 1QKWA 3SHWA 1AWWA 1PRLC 2D8JA 4RTYA 3O5ZA 3ZL7C 4M4ZA 4F16A 3RBBB 5IHNA 4AG1C 4DEYA 1SHGA 2OI3A 4F17A 2HDAA 1M30A 2VVKA 2AZSA 4JJCA 1AWJA 1VA7A 5EC7A 1WA7A 2DYBA 2L3PA 2M0YA 1SPKA 1MV3A 1ZUYA 2JS0A 3M0SA 4K11A 3VS5A 1HJDA 1W1FA 2RPNA 2DL8A 5L23A 2DRMA 2FPDA 2KYMA 3H0HA 2AKLA 1XOVA 1UGVA 1RLPC 2KXCA 3EHQA 1M8MA 1CSKA 1AOJA 1K76A 4KRTA 3EG3A 4D8DA 2GGRA 4JPBW 1KJWA 3VRYA 2YUOA 1JEGA 2KXDA 1BK2A 1WDXA 2AKKA 2IIMA 1JXOA 1NM7A 4D8KA 1YWOA 1RI9A 2CUDA 2XMFA 2YUNA 1JQQA 5ECAA 4CC4B 4X1VA 4AFQC 5GJWB 1AZEA 4OMOA 4OMQA 2OJ2A 2YUPA 1EFNA 1VYVA 2FG0A 2KT1A 1VYTA 1T0JA 3VS3A 2FRYA 1ZLMA 2KGTA 2KT8A 1UDLA 2YT6A 4Z89A 2KRSA 4JJBA 1U3OA 1J3TA 2J6FA 3REBB 2HBWA 2D8HA 4RTUA 1T0HA 4Z88A 3IQLA 1MV0B 2QDLA 2AK5A 2ED1A 4ZNXA 1PHTA 2E5KA 1NLPC 1YP5A 2FPFA 3TSWA 2HSPA 4EIKA 5IXFA 1HD3A 2G6FX 2RF0A 3I5SA 4RTZA 2KROA 1UHFA 1PKTA 3I5RA 2DL7A 3A98A 1SEMA 4LN2A 1ZBJA 2BZ8A 4LUDA 1SRLA 3NPFA 4Y92A 2RMOA 1CKAA 1I07A 2AZVA 2NUZA 4IIMA 2LMJA 1K1ZA 1RUWA 2CH4W 2K3BA 2A37A 1VYUA 2NWMA 1WFWA 1SRMA 2K6DA 3QWXX 2EGAA 1WI7A 2KR3A 1MUZA 1GCQC 2M51A 1A0NB 1RLQC 4GBQA 1ABOA 2GTOA 1WYXA 5FW9A 2GQIA 2L3QA 2A28A 1KFZA 1WXTA 5I22A 1K4US 1WIEA 3M0TA 5I11A 1GCQA 3TSZA 1YWPA 1W70A 2RQRA 5HCKA 1AWXA 2CUBA 1NEBA 2V1RA 2DM1A 2CDTA 4HVUA 4J9CA 2SEMA 4R0KA 4J9HA 1H3HA 1I0CA 2FO0A 2X3WD 1X2KA 1NG2A 1M3CA 2D1XA 5FWCA 1ZUKA 2J7IA 3EG1A 3SEMA 4HVVA 2CSIA 4GLMA 2DILA 2A08A 1WXBA 2X3XD 2HEQA 1GL5A 2C0IA 2DLPA 2VWFA 2RQUA 4RTWA 3TVTA 1TG0A 2L3SA 4CC2A 1QCFA 1AZGB 2EGEA 1ZX6A 4RTTA 2FEIA 1NYGA 4E6RA 2CT3A 2W0ZA 2J6OA 1OOTA 1WX6A 1UUEA 2A36A 3FJ5A 3RNJA 2RQTA 3UF4A 4F14A 1GFDA 2LQWA 2L2PA 1OPKA 1NLOC 1X27A 2VKNA 4Z8AA 1E6HA 1M3BA 3NGPA 2LP5A 2EPDA 1H92A 1PWTA 2KYBA 2F2WA 2PNIA 3H0IA 2JXBA 2DBKA 1BBZA 3UA6A 2EKHA 4RUGA 1E7OA 2CT4A 2CH4A 2KRNA 4CC7A 2CREA 4DEXA 2K79A 4JZ4A 1X69A 1S1NA 3PVLA 2K2MA 1UTIA 2DE0X 2DL4A 2KRMA 4OMNA 2JMAA 3VRZA 2H8HA 1AD5A 2BZXA 4OMLA 2YUQA 2LX7A 2JT4A 1CKBA 1FMKA 2ECZA 1GFCA 1GBQA 4FSSA 4J9FA 1QKXA 4J9IA 2B86A 1AVZC 4CC3A 3NMZC 3PE0A 2ESWA 3EG0A 4ESRA 1V1CA 1PRMC 1U5SA 1Y0MA 2RQWA 1JO8A 3M0PA 3JV3A 1JXMA 2CSQA 1UG1A 3ULRB 3GBQA 1WLPB 2JMCA 1PKSA 2YSQA 2EYXA 4HXJA 2DL5A 1E6GA 3EG2A 1SHFA 4HVWA 1ABQA 2OAWA 2MCNA 2BTTA 2O9VA 1SSHA 1UFFA 2F2VA 2LCSA 2LJ1A 2LJ3A 2C0TA 2PZ1A 2O88A 2ROTA 3M0QA 3VS2A 2LZ6B 1G2BA 3I9QA 5IHIA 2LJ0A 2JS2A 4AG2C 2DNUA 1AWOA 1WXUA 2EYWA 2FPEA 1W6XA 2L0AA 1X6BA 1YCSB 3VS4A 1GBRA 2RQVA 1M27C 1N5ZA 2K9GA 1Z9QA 2F2XA 4QT7A 1ARKA 2D0NA 1K0XA 1NEGA 4OMMA 3I35A 2HCKA 3THKA 2BZYA 2KE9A 1X2QA 3CQTA 2EVRA 2JM8A 4JZ3A 1QWEA 4ORZA 4LE9A 3REAB 3M0RA 1ZSGA 2PTKA 4J9EA 1U06A 2GTJA 2ROLA 4JJDA 2KBTA 1GCPA 3VS7A
chains in the Genus database with same CATH superfamily
1NYFA 5GANf 2JTEA 5GAN8 3CCQQ 3EHRA 1X6GA 1BU1A 3UPUA 3DLLA 3BY7A 3QZ9B 4N4IA 3PTAA 4DQ2A 3GPLA 2I0NA 1M90R 5KH6A 2KAFA 5DM7R 3CMEQ 4PJOA 4DOWA 5IN1A 1OPLA 3VU3C 4O6JA 3LW5E 3R6NA 3G71A 5IXBA 1G83A 2RHYA 2DX1A 4M7AF 2RN8A 4X34A 2KY9A 1RAHB 1IGUA 2EBPA 3VS6A 2EQIA 3OSVA 2P0KA 3MP8A 1Z9ZA 1W2BA 1QWFA 1WZOA 3MP1A 3VS0A 2MOXA 1TUDA 2KEAA 5LJ3j 3N5BB 5KYNA 4LNPA 1WHMA 1B07A 2DD4A 4BE1A 2RJEA 2KDSA 5FU7C 5GAMf 2OTLT 3DB3A 4C0GA 3EAEA 4FW2A 1HYOA 5GAOr 1OEBA 1OU8A 5FWBA 5GMKi 3EGXB 1YJWQ 1UE9A 1KSWA 1NBEB 4ZGJB 4BE2A 3QO3A 2JM9A 5KYYA 4KGXB 3CMAA 3M58A 1TTHB 4Y28E 2V26A 5A0DA 3PVQA 2VUBA 2QEXT 3E1SA 5GAOp 1T3LA 5IH2A 2FL7A 4HCZA 2YDLA 1I5LA 2KQWA 1M1KR 1G8XA 2FRWA 4EMKB 3QSUA 1KK7A 1HSQA 2O01E 4ZGDB 4FYWB 2IPOB 1AWWA 2XDBA 2RHZA 1U1TA 2HNIA 3UDCA 1U1SA 4E47A 1VQ9T 1VQ5Q 5IHNA 3QIIA 4JRQA 4F17A 2VVKA 1SF9A 2AZSA 2YLCA 3G7ZA 4JJCA 1VA7A 1WA7A 4F7UF 4J6WA 1SPKA 5GAOq 2X35A 4J7FA 5LJ3e 3QYHB 2E65A 3OS1A 4K11A 3VKIA 4WF2A 1SSFA 1W2BP 4A53A 1XOVA 2CP5A 1YBYA 3CBOA 4DBRA 5GAOn 4GY5A 3HPWA 1UEBA 1VQLT 1K76A 4KRTA 1PG5B 3EG3A 3G6ET 5GMKl 2ZPHB 4D8DA 2GGRA 5CKHA 4BACA 5CK9A 1KJWA 4QQDA 1N27A 3M53A 4B9XA 3VRYA 4XTWA 3OSSC 2KXDA 1BK2A 1WDXA 4PK4A 2K3YA 2IIMA 1G3YA 4D8KA 1YWOA 3H9NA 4PJNA 1KC8U 4OB3B 1IHWA 5ECAA 4CC4B 4N4GA 2RHIA 2LCCA 3DB4A 3HFOA 2FG0A 4M78C 4M78D 3VS3A 1UGPB 2QEXA 3E9FA 4M7AC 4M7AD 1ZLMA 3MEUA 3PNWC 3OYDA 4Z89A 1ZQ1A 4JS4A 2OTLQ 2E3IA 5LJ5h 2RI5A 3REBB 3JCMd 4Z88A 2X4XA 3CCMT 1Q86R 2EQJA 1XJWB 5LL6S 4C5EA 1D1CA 5LJ5d 4IUTA 1BIAA 2Z0WA 2HSPA 3QBYA 2P0PA 3VYHB 2KROA 4FYXB 1UHFA 1VQ9A 2DL7A 3A98A 2BZ8A 4LUDA 2HQEA 2XIDA 1BI3A 3NPFA 4BE0A 2K57A 2QA4T 2LMJA 2DXUA 5KYUB 2K3BA 2NWMA 4M7DA 2CP6A 2QQ9A 2X9HA 2KK4A 3AT1B 2EGAA 2KR3A 1GCQC 1RLQC 1KQ1A 1ABOA 3SFMA 2XK0A 1YITT 1D09B 2GQIA 2WSEE 1Y7XA 1VUBA 3L2VA 1KFZA 4EMHA 4IKFA 1QVPA 1VQLA 3G6EA 1VQ8Q 4XTXA 1NPPA 2EJGA 5HCKA 3EH1A 1AWXA 2V1RA 1OZ2A 4DOVA 3TREA 1WGSA 2Y4XA 4J9CA 4PJOG 4BI3A 4C0ZA 2XG8D 4PJOB 1X2KA 1NG2A 4KBMB 1VQOT 1M3CA 3CC7Q 3HTRA 2H3JA 1VQLQ 3EG1A 3G6EQ 5GANd 4MZTA 2VWFA 4RTWA 3PGGA 1D1AA 3L42A 2L3SA 4BY6B 4DA4A 4XQ3A 1XNIA 4E6RA 2CT3A 3H6ZA 1WX6A 1UUEA 3UF4A 2RQTA 4M75F 2LQWA 1OPKA 4FL6A 2OTJT 1X27A 1E6HA 1M3BA 4A4HA 3NGPA 2QQAA 2ZCFB 5GAOl 1PWTA 2KYBA 3CCMQ 4MMKA 5FLXE 5KYYB 3JB9G 2RM4A 4HKEA 2DBKA 1M2VB 5IT9E 5CAIA 3EGDA 1OULA 1K8AR 1UGRB 2WSFE 1Q81U 2JZ2A 2DJZA 2K2MA 2IVWA 3QKJA 1YITA 3AHUA 2Y4YA 5KYWA 5GAMd 4OMLA 2LX7A 2JT4A 4N0AA 2ECZA 1VQMT 4XTUA 2HQHA 2QA4Q 2KMTA 4FSSA 3URGA 4J9FA 1QKXA 2LRQA 3RKYA 2QG9B 2B86A 1TUGB 1AVZC 4CC3A 1VQKA 4ESRA 1FXXA 3RDVA 2RQWA 4M77A 1IXDA 3JV3A 2DIQA 1YITQ 1H641 2CSQA 3GBQA 1WLPB 3S3NA 2YSQA 2EYXA 2ZZDA 8AT1B 1IREB 3JB9J 2MCNA 2K3XA 4IUUA 1DJ7B 2BTTA 2O9VA 2XDPA 2O4XA 1GXIE 2F2VA 2C0TA 4HA8A 1KC8C 1RACB 2ROTA 4B6MA 1I5OB 4QQ6A 1HXDA 1G3WA 2LZ6B 3JCMe 1VQOQ 5HKCA 3I9QA 3V7RA 2LJ0A 2JS2A 2VB6A 4AG2C 2BKDN 3C4SA 2LT4A 3E19A 2A0FB 1YCSB 4EDUA 3A8OB 2RJFA 2RQVA 4TVRA 1N5ZA 2E10A 3HRUA 4Y91A 1V76A 1Z9QA 4ATOA 4C8QA 2CZ1B 3G1JA 1YIJT 1K0XA 4L5GA 4OMMA 3CD6A 3I35A 2BZYA 2PUKB 2E64A 2RI3A 1W2BS 1VQ6A 1KQSP 1X2QA 4LDWA 1OI1A 2CZ0B 4ME7A 2OTJQ 4FW1A 3UT1A 3RKXA 1TS9A 4J9EA 5KCHA 3OMGA 5KCOA 1GCPA 4OMQA 4C92F 2CP2A 3CCSQ 1PSFA 4ZTJA 1RAFB 2K7AA 4E7HA 1K0SA 4OB0B 1K9MC 3OS5A 2ENMA 3MEWA 4ZGEB 2XDDA 1XTDA 2DFUA 4J7IA 2HAXA 2EGCA 2FB7A 3QPHA 2DA9A 1JB0E 1OX8A 1M3AA 4M7DG 1VQMQ 2RB6A 4M7DB 1YNZA 5A0GA 4JJNK 1PSEA 5IAYA 3L2QA 3CEYA 3NTKA 1M4ZA 3H41A 2DVJA 4A63B 2W10A 1LCKA 2O9SA 1LJOA 1N9RA 3A8HB 1RADB 4LUEA 1WQWA 3CMET 1MNDA 3EH2A 1M2OA 4J9BA 5GANe 2O2OA 1KC8R 1F1BB 4HCKA 2PQWA 5LJ3h 4LDVA 1I81A 4WCIA 3CCET 2GNCA 2ZPFB 4M7AE 5LJ3d 2V1QA 3OYHA 3L1AA 3LX7A 4J9DA 2VGNA 4J9GA 1YIJA 1HK9A 1N9SA 3UA7A 2DMOA 3U23A 3RMSA 2DF6A 2R5MA 2ED0A 3M0UA 3M57A 3OYBA 3MEVA 1T3SA 3WVDB 3GLXA 7AT1B 2RNAA 1TH7A 4NL2A 2FZKB 1WHLA 1YIJQ 1PCXA 1UECA 1X43A 3ME9A 3FEOA 4KGZB 2DERA 2D0QB 4E7ZA 2DXBA 3SHWA 3M4GA 5GAMe 1YJ9A 2D9TA 3OYCA 2HD0A 4QVCA 1Q81C 4RTYA 4M4ZA 4F16A 2RK1A 3V8LA 1KG1A 1B7TA 1K9MR 4DEYA 2OI3A 3CCQA 4PFZA 1D3BB 4OB2B 2QQSA 2NUTA 2BIVA 1AWJA 2L3PA 3JB9I 2QXFA 4BD3A 5D6YA 3OW2P 3QDFA 3VS5A 2CS7A 3OS2A 4J8OA 5KYWB 2OAUA 1BI0A 3CMEA 3C95A 2DL8A 2DRMA 3H0HA 3CCUT 2AKLA 4C92C 4C92D 4EMKC 2CZ6B 3OBYA 3EHQA 1IHVA 3M9QA 4F7UE 3CCRT 4C5HA 4NOYA 4M77G 5AYFA 4M77B 2FZCB 2MF2A 4C5GA 1RI9A 2CUDA 2XMFA 2L89A 1JQQA 5GAN5 5GJWB 5FU6C 3V8JA 4Z02A 3L2ZA 4AMCA 4PJOF 2RHUA 5HK3A 2KT1A 1T0JA 2FRYA 2O4XB 3OYAA 3CCEQ 3QG1A 3PIPA 2KT8A 1UDLA 2VYTA 2CGHA 2DO3A 1YJWA 2KRSA 2RH2A 1U3OA 1FX7A 3MHXA 4PLLA 4RTUA 1T0HA 1MV0B 2L8DA 4FYYB 4M78A 1M5Q1 4M7AA 1PHTA 5A0LA 2E5KA 2MAMA 2DYIA 4E7KA 2FPFA 3TSWA 5LJ5g 3A8LB 4C0DB 4EIKA 4B9WA 2NUPA 2RF0A 1VIFA 1C1AA 4C8QG 1PKTA 2CP0A 4C8QB 1SEMA 1V29B 2DKGA 4LD9K 3JCMc 4UC4A 4Y92A 1M2VA 3FIFA 1O9SA 2AZVA 2DD5A 3TQ7P 1RAAB 5CKBA 2MI6A 1VQ5A 1VYUA 3RIRA 2EWNA 1ZA2B 4OB1B 4ZN1A 3QWXX 1YHQT 5CO7A 2VXEA 1WI7A 1A0NB 2GTOA 3CCUA 5FW9A 3JCMV 1BI1A 4RMOA 1YI2T 5I22A 1SKUB 3CCRA 3M0TA 1TOVA 1GCQA 3TSZA 4D6WA 3JCMb 1YWPA 2CUBA 1NEBA 1EZZB 2RO0A 2CDTA 3P8DA 4XU2A 2SEMA 4R0KA 1KQSS 3CCUQ 4HCBA 1H3HA 2DEUA 1VQ8T 3KXTA 2FO0A 1AT1B 3CCRQ 2J7IA 1QVFP 1OX9A 3SD4A 4GLMA 2MWOA 3CC2Q 4ZN3A 2CKKA 4F7UA 2C0IA 3OQ5A 2RQUA 3TVTA 2YXYA 1TG0A 2NLUA 3OYLA 4CC2A 3CC7T 1IZ6A 3OS0A 1AZGB 2OTLA 2EGEA 1QVGP 2LNVA 5D6WA 3RNJA 4F14A 3BE3A 2QGGA 2JTMA 3LH0A 3V8KA 3LYIA 3CXCA 2COYA 3F70A 2Y90A 3M55A 2COWA 1BIBA 2EPDA 2CZ7B 2F2WA 5FU7B 4PJOC 3JCMh 4E7IA 2YRDA 1BBZA 3UA6A 2DTOA 2VXFA 2CT4A 3OYYA 4PFOA 3HHTB 5GMKm 1G5VA 4AT1B 3J80E 2CREA 1ZA1B 2K79A 4M75E 1YHQA 1D1BA 3OYGA 1VQNT 1X69A 1S1NA 3PVLA 3QJYA 1QMCA 2DL4A 1D0XA 3VRZA 5C0MA 2H8HA 1AD5A 1RI0A 2BZXA 2YUQA 1VOMA 4QKUA 1CKBA 4BDYA 3SWNC 2YLBA 1GFCA 4A4FA 4J9IA 1YJNT 4E2FB 3JCMW 2F5TX 1YHQQ 1K73U 2M02A 2JJ9A 1PRMC 3S3OA 1JO8A 3M0PA 3I55Q 2NUTB 2K5FA 1JXMA 1VQ8A 1UG1A 1ZHIA 1YI2Q 2JMCA 1PKSA 5KE3A 3CCLQ 4HXJA 2QTXA 2DL5A 3EG2A 4M7DF 4HVWA 2QAZA 1TWBA 3VYGA 1Y71A 1SSHA 3FC3A 1UFFA 1M1GA 3CC7A 2K5IA 2PZ1A 2O88A 4OF1A 3NFCA 3GF5A 2EIFA 1Q7YU 3OYEA 3RUXA 1NJIU 5IHIA 1PD1A 2LQ8A 3CXCP 1TU0B 2V8JA 3VS4A 3JCMX 1M27C 2EQKA 4JLGA 5GANh 3OW2S 1ARKA 3CC4T 5J39A 3THKA 5DLOA 3CCMA 3A5ZB 2KVQG 1RAIB 2QYZA 2GF7A 2JM8A 4M78G 1QWEA 4M7AG 4LE9A 1MNEA 3CPWS 4M78B 4M7AB 2DZ9A 4QVZA 4MDXA 2XI9A 1U06A 2ROLA 2X51A 1NYGA 2NUPB 3VS7A 2M1HA 1OU9A 3OYNA 2SRCA 5GJVB 1YJNA 1H8KA 1KIKA 2LTOA 3L2WA 4KT0E 2RJDA 1VQNQ 3T9NA 2QA4A 2MIOA 3P8BB 4QW2A 2RA2A 3CCST 1D3BA 1FMWA 2DL3A 3LH5A 3MEAA 3V7CA 4AFUC 4J6YA 4PFPA 1S72Q 1SG5A 4KUIA 2EYZA 2YHTA 5GAMh 2VASA 4C92E 1KQSA 3KFVA 1MGQA 4VUBA 1YJNQ 2HZYA 3EFSA 1Y57A 3KBGA 2LNHB 5IHKA 3JCMQ 2MPXC 2X4YA 1UJYA 4BI4A 4Q5WA 8ATCB 5AT1B 4EMGA 2J05A 4BUGA 2XHCA 4PLIA 1MHNA 2KNBB 5CVIA 4OVAA 1WJRA 3OYJA 1M1FA 4KH0B 4R56A 3H8ZA 2JW4A 2LDMA 1JRIA 1UHCA 3JB9H 2DAQA 2GBQA 4M77F 1VQOA 3GP8A 1KD1U 2R5AA 1QCNA 2LX9A 4FT4A 4M7DC 2HKNA 5CKFA 1AEYA 4F7UG 2BE7D 4OMPA 3FB9A 1B3QA 3H0FA 2MYSA 4F7UB 3OYFA 1GRIA 4IIOA 4XK8E 3VV0A 5KYXA 1TSFA 5M9OA 4E7LA 1IO6A 1G3TA 4JUVA 3VS1A 1QLYA 4XTZA 3CC4Q 2EW3A 5CR2A 5D6XA 2OTJA 2COZA 4N4HA 3JCMP 5CKEA 2KSSA 3ZL7C 3HKSA 4XU1A 3RR6A 3RBBB 3LGLA 3HL8A 3CCSA 2EAYA 4C8QF 1SHGA 1QVFS 2HBPA 1I4K1 2HDAA 3OB9A 4OP0A 5EC7A 2PVOB 4OGCA 2L3RA 3HFNA 1R0BG 2F1LA 1K73C 1VQMA 1QVGS 2RPNA 1WHGA 4QQGA 2FPDA 2KYMA 4M75D 4M75C 1R0CB 2NYSA 4XTYA 4A4KA 1UB4A 1VQ7T 4JRPA 1M8MA 1CSKA 2R57A 3DLMA 4BDZA 5GAN3 1WJQA 4JPBW 4MDWA 1JEGA 2ATCB 3ASKA 2QDYB 2YUNA 2HL3A 6AT1B 1Q86U 1Q7YC 1AZEA 1QQJA 4OMOA 4PNOA 1NJIC 2OJ2A 1EFNA 4PKCC 3OW2A 1VYTA 3BDLA 2DETA 2RHXA 3OBWA 4JJBA 1ZSZC 4N0AC 2HBWA 5HY6A 4KULA 3IQLA 2QDLA 2AK5A 3JAME 1IB8A 2ED1A 2WACA 3MP6A 2E5QA 4ZNXA 4C0FA 2CP3A 1NLPC 1QW1A 3CPWA 4PJOE 1RL2A 2QQRA 5IXFA 2G6FX 4HCCA 4XU0A 3RKWA 3I5SA 4RCCA 4RTZA 4OGEA 1H3ZA 1N8RU 3I5RA 2I2LA 5DLQE 1RAEB 2P4TA 3CCJT 1ZBJA 4ZTFA 1I07A 5LJ5f 2A7YA 1K1ZA 1RUWA 2EJ9A 2K4YA 5A2QE 1WFWA 2K6DA 1WHHA 4CI0C 1Q82U 9ATCB 4KH1B 4GBQA 1QCOA 1VQPQ 2L3QA 3KUFA 3CXCS 3G71T 2A28A 4FCYA 1WNLA 1WXTA 1K4US 2KI7A 1WIEA 1VQ7A 2X4WA 4LD6A 4C0DC 5GAN2 3O8VA 4WTOB 1W70A 2DXCA 2BE9B 5GMKj 3CPFA 1O75A 3HSBA 4J9HA 3SB2A 1I0CA 4QVDA 2X3WD 4FU6A 5J3BA 1VQ7Q 3DKMA 5FRNA 1Q7YR 2D1XA 5FWCA 1ZUKA 5C6SA 3Q1JA 3SEMA 4LDYA 2DILA 2AT1B 1X75C 2DK3A 1X01A 1ZBXA 2JVVA 1KD1C 4IUVA 3A1PA 4F04B 3CPWP 4J83A 2E70A 2IG0A 3CCEA 1Y07A 4RTTA 3EG9A 2PVGB 3CC2T 2W0ZA 1OOTA 3PMTA 1PD0A 2A36A 3FJ5A 1GFDA 1K8AU 1NLOC 4J6XA 3JCMJ 3CCJA 2VKNA 4Z8AA 5I2MA 4KUDK 2LP5A 1H92A 2PNIA 5GAN6 2JXBA 3INZA 1C6VX 4RUGA 2DPPB 1E7OA 1QVFA 1VQ4Q 5KYXB 5DY9A 3JCMg 4IURA 4GLKA 2DE0X 2KRMA 4OMNA 4ELZC 2X4JA 3G4ST 3CCJQ 4M78F 5GMKe 2MMPA 2EQUA 1FMKA 1QVGA 1JJ2A 1Q81R 5CQXA 3MO8A 3NMZC 3PE0A 2ESWA 1Y96A 5CKDA 3EG0A 5FRMA 1V1CA 4PJJA 3SWNA 3R6OA 1U5SA 4FYVB 3G71Q 3JB9F 4MZPA 3ULRB 3LWHA 2K5LA 3TCJA 3QXEB 1WJSA 1SHFA 3VUZA 3X25B 2OAWA 1RABB 3I55T 2V8IA 4FT2A 1KHIA 3WVEB 1UGQB 3CCLT 3X28B 5HK0A 1KD1R 1Q86C 1EIFA 3CC2A 3VS2A 1G2BA 4C92G 3MPUB 2DNUA 2ZAEA 4C92B 4M7DE 1WXUA 2JOYA 2FPEA 1W6XA 4EPCA 4JRIA 1QP3A 1X6BA 3OA6A 2E12A 1B34A 1GBRA 3CMAQ 2K9GA 1OZ3A 2F2XA 4QT7A 2D0NA 4X9DA 3HRSA 2OX7A 3M56A 2LT1A 3X26B 2C06A 2HCKA 3LLRA 3CQTA 3V7SA 5GANg 3M59A 5FU6B 2EVRA 1N8RC 4JZ3A 1KHCA 4LXCA 3REAB 3G4SA 1M8VA 1FWZA 2QTVA 4YTLA 2GTJA 1JJ2P 2EYYA 1NE8A 1OYXA 3FJPA 2LQKA 1Q82C 1UJ0A 2WSCE 4FIBA 1ZUUA 1JU5C 4PJOD 2DZCA 1I8FA 1I1JA 2C0OA 4R55A 4IUPA 3G4SQ 1TUCA 2RI2A 1ACMB 4IUQA 3NHNA 4DBFA 1X6OA 4MZMA 1BB9A 3QWYA 2VV5A 3VUBA 1XQHA 3UATA 4BI8B 3EFOA 3P8HA 1OQKA 4CRIA 2P4RA 3QYGB 3I55A 3TU4K 1K9AA 2EFIA 4BY6C 1YI2A 3A8MB 4XTVA 1S72T 4RTXA 3CCLA 5GAMg 1PC0A 2PUOB 3S6WA 4E7SA 3EGUA 2PU9B 4P5NA 2QGFB 2F5KA 1G3SA 4II1A 1YN8A 2O31A 3JB9D 3S3MA 2QEXQ 4XU3A 2E6ZA 2DRKA 1YCYA 2J06A 3ZEHA 2DBMA 3MKDA 4A54A 1BYMA 2LQNA 3RMQA 3NTIA 4AFSC 1K8AC 2ABLA 5LJ3f 2QK0A 1PNJA 1PM3A 3MCAB 4RTVA 1N8RR 2J6KA 4AFZC 4M77E 3C0CA 1K9MU 1OV3A 3FDRA 3EG9B 1VQ9Q 4O5VA 1FYNA 2DJQA 3J7AF 1QKWA 2P0QA 1PRLC 1N6AA 2D8JA 4FM4B 3O5ZA 3RESA 2QQBA 3CBMA 2DEQA 3D7SB 1Q82R 1UGSB 3J81E 4RG2A 4AG1C 3ER0A 3HRTA 3PFSA 5CCAA 1VQKT 1M30A 2EYQA 1VQNA 2E3HA 4ELYC 2ZGWA 2DYBA 2F69A 2HMAA 2M0YA 1MV3A 2VGMA 1ZUYA 2JS0A 3CBPA 4KGVB 3M0SA 1HJDA 1S72A 2XU8A 2ZPBB 1M90U 1W1FA 1FMVA 3FRNA 3BW1A 4PL6A 4C8QE 5L23A 3C12A 2GFAA 3X24B 3L2UA 1UGVA 1RLPC 3C94A 1BKBA 3ZFJA 2KXCA 2E4HA 1AOJA 1Y96B 5GAN7 4FSXA 4M75A 3SWNB 1WQ7A 2YUOA 1M9SA 2AKKA 1JXOA 2E1HA 4MMLA 1NM7A 1MMNA 4JS5A 1R77A 2RJCA 4X1VA 4A4GA 4AFQC 2FVUA 3LWIA 2YRVA 4BB7A 2YUPA 1VYVA 1W4SA 2QASA 2VC8A 3OMCA 3CCVT 1JBMA 3SDZA 1KQ2A 2KGTA 2YT6A 3CD6T 5GAOm 1J3TA 2J6FA 2QI2A 5LJ5j 2D8HA 1VQ6T 2JTFA 2RD1A 2M9UA 2YRCA 2V8KA 4RCBA 5I21A 1YP5A 1ZSZA 1HD3A 1B34B 1VIEA 1AHJB 5LJ3g 4OMFB 2DTHA 2CYZB 3CC4A 2JNGA 4LN2A 4M7DD 1M1KU 3LGFA 1SRLA 2BUDA 2RMOA 1CKAA 2NUZA 4IIMA 2CH4W 2JUFA 4JLIA 2A37A 2L5QA 3RERA 3PIOA 1SRMA 1EX4A 3BDUA 4V2SA 2M51A 2EQMA 1MUZA 3EFRA 5FROA 3BFMA 1WYXA 1BCMA 1LPLA 1VQKQ 4DBHA 4J5YA 2EKOA 4JRKA 5I11A 1NPRA 2M0OA 4HT8A 2EJFA 1VQPT 2JN0A 2RQRA 2RK2A 2LCLA 1MMAA 2CP7A 2DM1A 5GMKh 3JSCA 1RAGB 3PMIA 5LJ5e 4HVUA 3EFOB 1BCOA 1D0ZA 3NTHA 5EG2A 2PVDB 2GQVA 4DBQA 4HT9A 5GANj 3META 3EGXA 3QJ6A 3CCVA 5CQYA 3I56T 4HVVA 3GIBA 2CSIA 2A08A 1WXBA 2AHJB 1JJ2S 2X3XD 2HEQA 3JRZA 3PT9A 3M5AA 3FLGA 3QHSA 1GL5A 2LC4A 2DLPA 1QP2A 1BI2A 1Q95G 1QCFA 2MK5A 3QZ5B 2HL5C 1ZX6A 2FEIA 4C92A 4ANJA 4EMKA 2J6OA 2A3LA 1P92A 2DXTA 2P84A 3CCVQ 2FYKA 2D6FA 2ZPIB 1WHKA 2FHDA 3CD6Q 2L2PA 5D7UA 5L8RE 4A4EA 2E6NA 4C5IA 1YJ9T 1VQ6Q 3GNFB 3H0IA 3M4YA 2M16A 2XICA 1TXQA 2EKHA 1WHJA 2E41A 2CH4A 1C0MA 1LOJA 3QDRB 3CCQT 2KRNA 4RKUE 5CIUA 4CC7A 4DEXA 5GAMj 4JZ4A 1UTIA 4JDSA 2JMAA 4XAXB 3E2UA 2AIRB 2LVMA 4PJMA 3X20B 1VQ4T 1D0YA 1LNXA 4M77C 4M77D 1GBQA 1NZ9A 1R8OB 5KE2A 1VQPA 3VJPA 3GOXA 4L6V5 3JCMf 3L2RA 2XD0A 3OYIA 1U8RA 1IGQA 3QUIA 1M90C 1Y0MA 4M78E 4NL3A 4X9CA 1MMDA 2HQXA 3OYKA 2ZPGB 4RG8A 3I56A 3E9GA 1E6GA 2GCXA 1ABQA 5I2SA 5J26A 1K73R 1WPYA 2B8AA 2LCSA 2LJ1A 2LJ3A 3OYMA 3OY9A 2DTIA 1YJWT 2H3EB 3M0QA 1IRXA 4M75G 3HP9A 4C8QC 4C8QD 4M75B 4NS5A 1AWOA 3I56Q 2EYWA 2FZGB 1LVKA 2L0AA 3GNGA 2DIGA 4LDUA 3A8GB 2GFUA 2G3RA 4PJLA 1NEGA 1NJIR 3MJXA 1YFNA 3TEEA 1MMGA 3CMAT 3WXMB 2KE9A 2HSEB 3EGDB 5KYUA 4E7JA 2R58A 2XKOC 3UWNA 2DVEA 2ZPEB 4ORZA 4LDXA 2HKQB 1VQ5T 3M54A 1YJ9Q 1M1KC 3M0RA 3ZBDA 1VQ4A 2MWPA 4L59A 1ZSGA 2PTKA 5GAN4 1ZSZB 4JJDA 2K2VA 2KBTA 2YWWA
chains in the Genus database with same CATH topology
1NYFA 2SRCA 2JTEA 5GJVB 1H8KA 2EYYA 1KIKA 3EHRA 1X6GA 1BU1A 2K7AA 1K0SA 1UJ0A 1ZUUA 1JU5C 2ENMA 1I1JA 2C0OA 2MIOA 2EGCA 1TUCA 2I0NA 2DL3A 3LH5A 2DA9A 3NHNA 4AFUC 1BB9A 1M3AA 3QWYA 2EYZA 3UATA 1YNZA 3KFVA 2P4RA 1OPLA 3R6NA 1K9AA 5IXBA 3H41A 2DVJA 1G83A 4A63B 2W10A 2DX1A 2RN8A 1Y57A 1LCKA 2O9SA 2LNHB 4RTXA 5IHKA 2EBPA 4LUEA 3VS6A 2EQIA 1UJYA 1Z9ZA 2J05A 3EGUA 4J9BA 2O2OA 1QWFA 2KNBB 3VS0A 2MOXA 1TUDA 2KEAA 4HCKA 4LNPA 1B07A 4WCIA 2GNCA 2JW4A 1UHCA 1YN8A 2O31A 2GBQA 2V1QA 4J9DA 4J9GA 3UA7A 1OEBA 2DMOA 5FWBA 2DRKA 3U23A 1UE9A 2DF6A 1KSWA 2ED0A 2J06A 3M0UA 2JM9A 2DBMA 1AEYA 4OMPA 1B3QA 3PVQA 1T3SA 2LQNA 3H0FA 2RNAA 4AFSC 1GRIA 2ABLA 4IIOA 1PNJA 4RTVA 1T3LA 1IO6A 2J6KA 4AFZC 5IH2A 2YDLA 3C0CA 3VS1A 1OV3A 1QLYA 2FRWA 1UECA 1X43A 1FYNA 2EW3A 1HSQA 2DJQA 1QKWA 3SHWA 1AWWA 1PRLC 2D8JA 4RTYA 3O5ZA 3ZL7C 4M4ZA 4F16A 3RBBB 5IHNA 4AG1C 4DEYA 1SHGA 2OI3A 4F17A 2HDAA 1M30A 2VVKA 2AZSA 4JJCA 1AWJA 1VA7A 5EC7A 1WA7A 2DYBA 2L3PA 2M0YA 1SPKA 1MV3A 1ZUYA 2JS0A 3M0SA 4K11A 3VS5A 1HJDA 1W1FA 2RPNA 2DL8A 5L23A 2DRMA 2FPDA 2KYMA 3H0HA 2AKLA 1XOVA 1UGVA 1RLPC 2KXCA 3EHQA 1M8MA 1CSKA 1AOJA 1K76A 4KRTA 3EG3A 4D8DA 2GGRA 4JPBW 1KJWA 3VRYA 2YUOA 1JEGA 2KXDA 1BK2A 1WDXA 2AKKA 2IIMA 1JXOA 1NM7A 4D8KA 1YWOA 1RI9A 2CUDA 2XMFA 2YUNA 1JQQA 5ECAA 4CC4B 4X1VA 4AFQC 5GJWB 1AZEA 4OMOA 4OMQA 2OJ2A 2YUPA 1EFNA 1VYVA 2FG0A 2KT1A 1VYTA 1T0JA 3VS3A 2FRYA 1ZLMA 2KGTA 2KT8A 1UDLA 2YT6A 4Z89A 2KRSA 4JJBA 1U3OA 1J3TA 2J6FA 3REBB 2HBWA 2D8HA 4RTUA 1T0HA 4Z88A 3IQLA 1MV0B 2QDLA 2AK5A 2ED1A 4ZNXA 1PHTA 2E5KA 1NLPC 1YP5A 2FPFA 3TSWA 2HSPA 4EIKA 5IXFA 1HD3A 2G6FX 2RF0A 3I5SA 4RTZA 2KROA 1UHFA 1PKTA 3I5RA 2DL7A 3A98A 1SEMA 4LN2A 1ZBJA 2BZ8A 4LUDA 1SRLA 3NPFA 4Y92A 2RMOA 1CKAA 1I07A 2AZVA 2NUZA 4IIMA 2LMJA 1K1ZA 1RUWA 2CH4W 2K3BA 2A37A 1VYUA 2NWMA 1WFWA 1SRMA 2K6DA 3QWXX 2EGAA 1WI7A 2KR3A 1MUZA 1GCQC 2M51A 1A0NB 1RLQC 4GBQA 1ABOA 2GTOA 1WYXA 5FW9A 2GQIA 2L3QA 2A28A 1KFZA 1WXTA 5I22A 1K4US 1WIEA 3M0TA 5I11A 1GCQA 3TSZA 1YWPA 1W70A 2RQRA 5HCKA 1AWXA 2CUBA 1NEBA 2V1RA 2DM1A 2CDTA 4HVUA 4J9CA 2SEMA 4R0KA 4J9HA 1H3HA 1I0CA 2FO0A 2X3WD 1X2KA 1NG2A 1M3CA 2D1XA 5FWCA 1ZUKA 2J7IA 3EG1A 3SEMA 4HVVA 2CSIA 4GLMA 2DILA 2A08A 1WXBA 2X3XD 2HEQA 1GL5A 2C0IA 2DLPA 2VWFA 2RQUA 4RTWA 3TVTA 1TG0A 2L3SA 4CC2A 1QCFA 1AZGB 2EGEA 1ZX6A 4RTTA 2FEIA 1NYGA 4E6RA 2CT3A 2W0ZA 2J6OA 1OOTA 1WX6A 1UUEA 2A36A 3FJ5A 3RNJA 2RQTA 3UF4A 4F14A 1GFDA 2LQWA 2L2PA 1OPKA 1NLOC 1X27A 2VKNA 4Z8AA 1E6HA 1M3BA 3NGPA 2LP5A 2EPDA 1H92A 1PWTA 2KYBA 2F2WA 2PNIA 3H0IA 2JXBA 2DBKA 1BBZA 3UA6A 2EKHA 4RUGA 1E7OA 2CT4A 2CH4A 2KRNA 4CC7A 2CREA 4DEXA 2K79A 4JZ4A 1X69A 1S1NA 3PVLA 2K2MA 1UTIA 2DE0X 2DL4A 2KRMA 4OMNA 2JMAA 3VRZA 2H8HA 1AD5A 2BZXA 4OMLA 2YUQA 2LX7A 2JT4A 1CKBA 1FMKA 2ECZA 1GFCA 1GBQA 4FSSA 4J9FA 1QKXA 4J9IA 2B86A 1AVZC 4CC3A 3NMZC 3PE0A 2ESWA 3EG0A 4ESRA 1V1CA 1PRMC 1U5SA 1Y0MA 2RQWA 1JO8A 3M0PA 3JV3A 1JXMA 2CSQA 1UG1A 3ULRB 3GBQA 1WLPB 2JMCA 1PKSA 2YSQA 2EYXA 4HXJA 2DL5A 1E6GA 3EG2A 1SHFA 4HVWA 1ABQA 2OAWA 2MCNA 2BTTA 2O9VA 1SSHA 1UFFA 2F2VA 2LCSA 2LJ1A 2LJ3A 2C0TA 2PZ1A 2O88A 2ROTA 3M0QA 3VS2A 2LZ6B 1G2BA 3I9QA 5IHIA 2LJ0A 2JS2A 4AG2C 2DNUA 1AWOA 1WXUA 2EYWA 2FPEA 1W6XA 2L0AA 1X6BA 1YCSB 3VS4A 1GBRA 2RQVA 1M27C 1N5ZA 2K9GA 1Z9QA 2F2XA 4QT7A 1ARKA 2D0NA 1K0XA 1NEGA 4OMMA 3I35A 2HCKA 3THKA 2BZYA 2KE9A 1X2QA 3CQTA 2EVRA 2JM8A 4JZ3A 1QWEA 4ORZA 4LE9A 3REAB 3M0RA 1ZSGA 2PTKA 4J9EA 1U06A 2GTJA 2ROLA 4JJDA 2KBTA 1GCPA 3VS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYF A;  2SRC A;  2JTE A;  5GJV B;  1H8K A;  2EYY A;  1KIK A;  3EHR A;  1X6G A;  1BU1 A;  2K7A A;  1K0S A;  1UJ0 A;  1ZUU A;  1JU5 C;  2ENM A;  1I1J A;  2C0O A;  2MIO A;  2EGC A;  1TUC A;  2I0N A;  2DL3 A;  3LH5 A;  2DA9 A;  3NHN A;  4AFU C;  1BB9 A;  1M3A A;  3QWY A;  2EYZ A;  3UAT A;  1YNZ A;  3KFV A;  2P4R A;  1OPL A;  3R6N A;  1K9A A;  5IXB A;  3H41 A;  2DVJ A;  1G83 A;  4A63 B;  2W10 A;  2DX1 A;  2RN8 A;  1Y57 A;  1LCK A;  2O9S A;  2LNH B;  4RTX A;  5IHK A;  2EBP A;  4LUE A;  3VS6 A;  2EQI A;  1UJY A;  1Z9Z A;  2J05 A;  3EGU A;  4J9B A;  2O2O A;  1QWF A;  2KNB B;  3VS0 A;  2MOX A;  1TUD A;  2KEA A;  4HCK A;  4LNP A;  1B07 A;  4WCI A;  2GNC A;  2JW4 A;  1UHC A;  1YN8 A;  2O31 A;  2GBQ A;  2V1Q A;  4J9D A;  4J9G A;  3UA7 A;  1OEB A;  2DMO A;  5FWB A;  2DRK A;  3U23 A;  1UE9 A;  2DF6 A;  1KSW A;  2ED0 A;  2J06 A;  3M0U A;  2JM9 A;  2DBM A;  1AEY A;  4OMP A;  1B3Q A;  3PVQ A;  1T3S A;  2LQN A;  3H0F A;  2RNA A;  4AFS C;  1GRI A;  2ABL A;  4IIO A;  1PNJ A;  4RTV A;  1T3L A;  1IO6 A;  2J6K A;  4AFZ C;  5IH2 A;  2YDL A;  3C0C A;  3VS1 A;  1OV3 A;  1QLY A;  2FRW A;  1UEC A;  1X43 A;  1FYN A;  2EW3 A;  1HSQ A;  2DJQ A;  1QKW A;  3SHW A;  1AWW A;  1PRL C;  2D8J A;  4RTY A;  3O5Z A;  3ZL7 C;  4M4Z A;  4F16 A;  3RBB B;  5IHN A;  4AG1 C;  4DEY A;  1SHG A;  2OI3 A;  4F17 A;  2HDA A;  1M30 A;  2VVK A;  2AZS A;  4JJC A;  1AWJ A;  1VA7 A;  5EC7 A;  1WA7 A;  2DYB A;  2L3P A;  2M0Y A;  1SPK A;  1MV3 A;  1ZUY A;  2JS0 A;  3M0S A;  4K11 A;  3VS5 A;  1HJD A;  1W1F A;  2RPN A;  2DL8 A;  5L23 A;  2DRM A;  2FPD A;  2KYM A;  3H0H A;  2AKL A;  1XOV A;  1UGV A;  1RLP C;  2KXC A;  3EHQ A;  1M8M A;  1CSK A;  1AOJ A;  1K76 A;  4KRT A;  3EG3 A;  4D8D A;  2GGR A;  4JPB W;  1KJW A;  3VRY A;  2YUO A;  1JEG A;  2KXD A;  1BK2 A;  1WDX A;  2AKK A;  2IIM A;  1JXO A;  1NM7 A;  4D8K A;  1YWO A;  1RI9 A;  2CUD A;  2XMF A;  2YUN A;  1JQQ A;  5ECA A;  4CC4 B;  4X1V A;  4AFQ C;  5GJW B;  1AZE A;  4OMO A;  4OMQ A;  2OJ2 A;  2YUP A;  1EFN A;  1VYV A;  2FG0 A;  2KT1 A;  1VYT A;  1T0J A;  3VS3 A;  2FRY A;  1ZLM A;  2KGT A;  2KT8 A;  1UDL A;  2YT6 A;  4Z89 A;  2KRS A;  4JJB A;  1U3O A;  1J3T A;  2J6F A;  3REB B;  2HBW A;  2D8H A;  4RTU A;  1T0H A;  4Z88 A;  3IQL A;  1MV0 B;  2QDL A;  2AK5 A;  2ED1 A;  4ZNX A;  1PHT A;  2E5K A;  1NLP C;  1YP5 A;  2FPF A;  3TSW A;  2HSP A;  4EIK A;  5IXF A;  1HD3 A;  2G6F X;  2RF0 A;  3I5S A;  4RTZ A;  2KRO A;  1UHF A;  1PKT A;  3I5R A;  2DL7 A;  3A98 A;  1SEM A;  4LN2 A;  1ZBJ A;  2BZ8 A;  4LUD A;  1SRL A;  3NPF A;  4Y92 A;  2RMO A;  1CKA A;  1I07 A;  2AZV A;  2NUZ A;  4IIM A;  2LMJ A;  1K1Z A;  1RUW A;  2CH4 W;  2K3B A;  2A37 A;  1VYU A;  2NWM A;  1WFW A;  1SRM A;  2K6D A;  3QWX X;  2EGA A;  1WI7 A;  2KR3 A;  1MUZ A;  1GCQ C;  2M51 A;  1A0N B;  1RLQ C;  4GBQ A;  1ABO A;  2GTO A;  1WYX A;  5FW9 A;  2GQI A;  2L3Q A;  2A28 A;  1KFZ A;  1WXT A;  5I22 A;  1K4U S;  1WIE A;  3M0T A;  5I11 A;  1GCQ A;  3TSZ A;  1YWP A;  1W70 A;  2RQR A;  5HCK A;  1AWX A;  2CUB A;  1NEB A;  2V1R A;  2DM1 A;  2CDT A;  4HVU A;  4J9C A;  2SEM A;  4R0K A;  4J9H A;  1H3H A;  1I0C A;  2FO0 A;  2X3W D;  1X2K A;  1NG2 A;  1M3C A;  2D1X A;  5FWC A;  1ZUK A;  2J7I A;  3EG1 A;  3SEM A;  4HVV A;  2CSI A;  4GLM A;  2DIL A;  2A08 A;  1WXB A;  2X3X D;  2HEQ A;  1GL5 A;  2C0I A;  2DLP A;  2VWF A;  2RQU A;  4RTW A;  3TVT A;  1TG0 A;  2L3S A;  4CC2 A;  1QCF A;  1AZG B;  2EGE A;  1ZX6 A;  4RTT A;  2FEI A;  1NYG A;  4E6R A;  2CT3 A;  2W0Z A;  2J6O A;  1OOT A;  1WX6 A;  1UUE A;  2A36 A;  3FJ5 A;  3RNJ A;  2RQT A;  3UF4 A;  4F14 A;  1GFD A;  2LQW A;  2L2P A;  1OPK A;  1NLO C;  1X27 A;  2VKN A;  4Z8A A;  1E6H A;  1M3B A;  3NGP A;  2LP5 A;  2EPD A;  1H92 A;  1PWT A;  2KYB A;  2F2W A;  2PNI A;  3H0I A;  2JXB A;  2DBK A;  1BBZ A;  3UA6 A;  2EKH A;  4RUG A;  1E7O A;  2CT4 A;  2CH4 A;  2KRN A;  4CC7 A;  2CRE A;  4DEX A;  2K79 A;  4JZ4 A;  1X69 A;  1S1N A;  3PVL A;  2K2M A;  1UTI A;  2DE0 X;  2DL4 A;  2KRM A;  4OMN A;  2JMA A;  3VRZ A;  2H8H A;  1AD5 A;  2BZX A;  4OML A;  2YUQ A;  2LX7 A;  2JT4 A;  1CKB A;  1FMK A;  2ECZ A;  1GFC A;  1GBQ A;  4FSS A;  4J9F A;  1QKX A;  4J9I A;  2B86 A;  1AVZ C;  4CC3 A;  3NMZ C;  3PE0 A;  2ESW A;  3EG0 A;  4ESR A;  1V1C A;  1PRM C;  1U5S A;  1Y0M A;  2RQW A;  1JO8 A;  3M0P A;  3JV3 A;  1JXM A;  2CSQ A;  1UG1 A;  3ULR B;  3GBQ A;  1WLP B;  2JMC A;  1PKS A;  2YSQ A;  2EYX A;  4HXJ A;  2DL5 A;  1E6G A;  3EG2 A;  1SHF A;  4HVW A;  1ABQ A;  2OAW A;  2MCN A;  2BTT A;  2O9V A;  1SSH A;  1UFF A;  2F2V A;  2LCS A;  2LJ1 A;  2LJ3 A;  2C0T A;  2PZ1 A;  2O88 A;  2ROT A;  3M0Q A;  3VS2 A;  2LZ6 B;  1G2B A;  3I9Q A;  5IHI A;  2LJ0 A;  2JS2 A;  4AG2 C;  2DNU A;  1AWO A;  1WXU A;  2EYW A;  2FPE A;  1W6X A;  2L0A A;  1X6B A;  1YCS B;  3VS4 A;  1GBR A;  2RQV A;  1M27 C;  1N5Z A;  2K9G A;  1Z9Q A;  2F2X A;  4QT7 A;  1ARK A;  2D0N A;  1K0X A;  1NEG A;  4OMM A;  3I35 A;  2HCK A;  3THK A;  2BZY A;  2KE9 A;  1X2Q A;  3CQT A;  2EVR A;  2JM8 A;  4JZ3 A;  1QWE A;  4ORZ A;  4LE9 A;  3REA B;  3M0R A;  1ZSG A;  2PTK A;  4J9E A;  1U06 A;  2GTJ A;  2ROL A;  4JJD A;  2KBT A;  1GCP A;  3VS7 A; 
#chains in the Genus database with same CATH topology
 1NYF A;  5GAN f;  2JTE A;  5GAN 8;  3CCQ Q;  3EHR A;  1X6G A;  1BU1 A;  3UPU A;  3DLL A;  3BY7 A;  3QZ9 B;  4N4I A;  3PTA A;  4DQ2 A;  3GPL A;  2I0N A;  1M90 R;  5KH6 A;  2KAF A;  5DM7 R;  3CME Q;  4PJO A;  4DOW A;  5IN1 A;  1OPL A;  3VU3 C;  4O6J A;  3LW5 E;  3R6N A;  3G71 A;  5IXB A;  1G83 A;  2RHY A;  2DX1 A;  4M7A F;  2RN8 A;  4X34 A;  2KY9 A;  1RAH B;  1IGU A;  2EBP A;  3VS6 A;  2EQI A;  3OSV A;  2P0K A;  3MP8 A;  1Z9Z A;  1W2B A;  1QWF A;  1WZO A;  3MP1 A;  3VS0 A;  2MOX A;  1TUD A;  2KEA A;  5LJ3 j;  3N5B B;  5KYN A;  4LNP A;  1WHM A;  1B07 A;  2DD4 A;  4BE1 A;  2RJE A;  2KDS A;  5FU7 C;  5GAM f;  2OTL T;  3DB3 A;  4C0G A;  3EAE A;  4FW2 A;  1HYO A;  5GAO r;  1OEB A;  1OU8 A;  5FWB A;  5GMK i;  3EGX B;  1YJW Q;  1UE9 A;  1KSW A;  1NBE B;  4ZGJ B;  4BE2 A;  3QO3 A;  2JM9 A;  5KYY A;  4KGX B;  3CMA A;  3M58 A;  1TTH B;  4Y28 E;  2V26 A;  5A0D A;  3PVQ A;  2VUB A;  2QEX T;  3E1S A;  5GAO p;  1T3L A;  5IH2 A;  2FL7 A;  4HCZ A;  2YDL A;  1I5L A;  2KQW A;  1M1K R;  1G8X A;  2FRW A;  4EMK B;  3QSU A;  1KK7 A;  1HSQ A;  2O01 E;  4ZGD B;  4FYW B;  2IPO B;  1AWW A;  2XDB A;  2RHZ A;  1U1T A;  2HNI A;  3UDC A;  1U1S A;  4E47 A;  1VQ9 T;  1VQ5 Q;  5IHN A;  3QII A;  4JRQ A;  4F17 A;  2VVK A;  1SF9 A;  2AZS A;  2YLC A;  3G7Z A;  4JJC A;  1VA7 A;  1WA7 A;  4F7U F;  4J6W A;  1SPK A;  5GAO q;  2X35 A;  4J7F A;  5LJ3 e;  3QYH B;  2E65 A;  3OS1 A;  4K11 A;  3VKI A;  4WF2 A;  1SSF A;  1W2B P;  4A53 A;  1XOV A;  2CP5 A;  1YBY A;  3CBO A;  4DBR A;  5GAO n;  4GY5 A;  3HPW A;  1UEB A;  1VQL T;  1K76 A;  4KRT A;  1PG5 B;  3EG3 A;  3G6E T;  5GMK l;  2ZPH B;  4D8D A;  2GGR A;  5CKH A;  4BAC A;  5CK9 A;  1KJW A;  4QQD A;  1N27 A;  3M53 A;  4B9X A;  3VRY A;  4XTW A;  3OSS C;  2KXD A;  1BK2 A;  1WDX A;  4PK4 A;  2K3Y A;  2IIM A;  1G3Y A;  4D8K A;  1YWO A;  3H9N A;  4PJN A;  1KC8 U;  4OB3 B;  1IHW A;  5ECA A;  4CC4 B;  4N4G A;  2RHI A;  2LCC A;  3DB4 A;  3HFO A;  2FG0 A;  4M78 C;  4M78 D;  3VS3 A;  1UGP B;  2QEX A;  3E9F A;  4M7A C;  4M7A D;  1ZLM A;  3MEU A;  3PNW C;  3OYD A;  4Z89 A;  1ZQ1 A;  4JS4 A;  2OTL Q;  2E3I A;  5LJ5 h;  2RI5 A;  3REB B;  3JCM d;  4Z88 A;  2X4X A;  3CCM T;  1Q86 R;  2EQJ A;  1XJW B;  5LL6 S;  4C5E A;  1D1C A;  5LJ5 d;  4IUT A;  1BIA A;  2Z0W A;  2HSP A;  3QBY A;  2P0P A;  3VYH B;  2KRO A;  4FYX B;  1UHF A;  1VQ9 A;  2DL7 A;  3A98 A;  2BZ8 A;  4LUD A;  2HQE A;  2XID A;  1BI3 A;  3NPF A;  4BE0 A;  2K57 A;  2QA4 T;  2LMJ A;  2DXU A;  5KYU B;  2K3B A;  2NWM A;  4M7D A;  2CP6 A;  2QQ9 A;  2X9H A;  2KK4 A;  3AT1 B;  2EGA A;  2KR3 A;  1GCQ C;  1RLQ C;  1KQ1 A;  1ABO A;  3SFM A;  2XK0 A;  1YIT T;  1D09 B;  2GQI A;  2WSE E;  1Y7X A;  1VUB A;  3L2V A;  1KFZ A;  4EMH A;  4IKF A;  1QVP A;  1VQL A;  3G6E A;  1VQ8 Q;  4XTX A;  1NPP A;  2EJG A;  5HCK A;  3EH1 A;  1AWX A;  2V1R A;  1OZ2 A;  4DOV A;  3TRE A;  1WGS A;  2Y4X A;  4J9C A;  4PJO G;  4BI3 A;  4C0Z A;  2XG8 D;  4PJO B;  1X2K A;  1NG2 A;  4KBM B;  1VQO T;  1M3C A;  3CC7 Q;  3HTR A;  2H3J A;  1VQL Q;  3EG1 A;  3G6E Q;  5GAN d;  4MZT A;  2VWF A;  4RTW A;  3PGG A;  1D1A A;  3L42 A;  2L3S A;  4BY6 B;  4DA4 A;  4XQ3 A;  1XNI A;  4E6R A;  2CT3 A;  3H6Z A;  1WX6 A;  1UUE A;  3UF4 A;  2RQT A;  4M75 F;  2LQW A;  1OPK A;  4FL6 A;  2OTJ T;  1X27 A;  1E6H A;  1M3B A;  4A4H A;  3NGP A;  2QQA A;  2ZCF B;  5GAO l;  1PWT A;  2KYB A;  3CCM Q;  4MMK A;  5FLX E;  5KYY B;  3JB9 G;  2RM4 A;  4HKE A;  2DBK A;  1M2V B;  5IT9 E;  5CAI A;  3EGD A;  1OUL A;  1K8A R;  1UGR B;  2WSF E;  1Q81 U;  2JZ2 A;  2DJZ A;  2K2M A;  2IVW A;  3QKJ A;  1YIT A;  3AHU A;  2Y4Y A;  5KYW A;  5GAM d;  4OML A;  2LX7 A;  2JT4 A;  4N0A A;  2ECZ A;  1VQM T;  4XTU A;  2HQH A;  2QA4 Q;  2KMT A;  4FSS A;  3URG A;  4J9F A;  1QKX A;  2LRQ A;  3RKY A;  2QG9 B;  2B86 A;  1TUG B;  1AVZ C;  4CC3 A;  1VQK A;  4ESR A;  1FXX A;  3RDV A;  2RQW A;  4M77 A;  1IXD A;  3JV3 A;  2DIQ A;  1YIT Q;  1H64 1;  2CSQ A;  3GBQ A;  1WLP B;  3S3N A;  2YSQ A;  2EYX A;  2ZZD A;  8AT1 B;  1IRE B;  3JB9 J;  2MCN A;  2K3X A;  4IUU A;  1DJ7 B;  2BTT A;  2O9V A;  2XDP A;  2O4X A;  1GXI E;  2F2V A;  2C0T A;  4HA8 A;  1KC8 C;  1RAC B;  2ROT A;  4B6M A;  1I5O B;  4QQ6 A;  1HXD A;  1G3W A;  2LZ6 B;  3JCM e;  1VQO Q;  5HKC A;  3I9Q A;  3V7R A;  2LJ0 A;  2JS2 A;  2VB6 A;  4AG2 C;  2BKD N;  3C4S A;  2LT4 A;  3E19 A;  2A0F B;  1YCS B;  4EDU A;  3A8O B;  2RJF A;  2RQV A;  4TVR A;  1N5Z A;  2E10 A;  3HRU A;  4Y91 A;  1V76 A;  1Z9Q A;  4ATO A;  4C8Q A;  2CZ1 B;  3G1J A;  1YIJ T;  1K0X A;  4L5G A;  4OMM A;  3CD6 A;  3I35 A;  2BZY A;  2PUK B;  2E64 A;  2RI3 A;  1W2B S;  1VQ6 A;  1KQS P;  1X2Q A;  4LDW A;  1OI1 A;  2CZ0 B;  4ME7 A;  2OTJ Q;  4FW1 A;  3UT1 A;  3RKX A;  1TS9 A;  4J9E A;  5KCH A;  3OMG A;  5KCO A;  1GCP A;  4OMQ A;  4C92 F;  2CP2 A;  3CCS Q;  1PSF A;  4ZTJ A;  1RAF B;  2K7A A;  4E7H A;  1K0S A;  4OB0 B;  1K9M C;  3OS5 A;  2ENM A;  3MEW A;  4ZGE B;  2XDD A;  1XTD A;  2DFU A;  4J7I A;  2HAX A;  2EGC A;  2FB7 A;  3QPH A;  2DA9 A;  1JB0 E;  1OX8 A;  1M3A A;  4M7D G;  1VQM Q;  2RB6 A;  4M7D B;  1YNZ A;  5A0G A;  4JJN K;  1PSE A;  5IAY A;  3L2Q A;  3CEY A;  3NTK A;  1M4Z A;  3H41 A;  2DVJ A;  4A63 B;  2W10 A;  1LCK A;  2O9S A;  1LJO A;  1N9R A;  3A8H B;  1RAD B;  4LUE A;  1WQW A;  3CME T;  1MND A;  3EH2 A;  1M2O A;  4J9B A;  5GAN e;  2O2O A;  1KC8 R;  1F1B B;  4HCK A;  2PQW A;  5LJ3 h;  4LDV A;  1I81 A;  4WCI A;  3CCE T;  2GNC A;  2ZPF B;  4M7A E;  5LJ3 d;  2V1Q A;  3OYH A;  3L1A A;  3LX7 A;  4J9D A;  2VGN A;  4J9G A;  1YIJ A;  1HK9 A;  1N9S A;  3UA7 A;  2DMO A;  3U23 A;  3RMS A;  2DF6 A;  2R5M A;  2ED0 A;  3M0U A;  3M57 A;  3OYB A;  3MEV A;  1T3S A;  3WVD B;  3GLX A;  7AT1 B;  2RNA A;  1TH7 A;  4NL2 A;  2FZK B;  1WHL A;  1YIJ Q;  1PCX A;  1UEC A;  1X43 A;  3ME9 A;  3FEO A;  4KGZ B;  2DER A;  2D0Q B;  4E7Z A;  2DXB A;  3SHW A;  3M4G A;  5GAM e;  1YJ9 A;  2D9T A;  3OYC A;  2HD0 A;  4QVC A;  1Q81 C;  4RTY A;  4M4Z A;  4F16 A;  2RK1 A;  3V8L A;  1KG1 A;  1B7T A;  1K9M R;  4DEY A;  2OI3 A;  3CCQ A;  4PFZ A;  1D3B B;  4OB2 B;  2QQS A;  2NUT A;  2BIV A;  1AWJ A;  2L3P A;  3JB9 I;  2QXF A;  4BD3 A;  5D6Y A;  3OW2 P;  3QDF A;  3VS5 A;  2CS7 A;  3OS2 A;  4J8O A;  5KYW B;  2OAU A;  1BI0 A;  3CME A;  3C95 A;  2DL8 A;  2DRM A;  3H0H A;  3CCU T;  2AKL A;  4C92 C;  4C92 D;  4EMK C;  2CZ6 B;  3OBY A;  3EHQ A;  1IHV A;  3M9Q A;  4F7U E;  3CCR T;  4C5H A;  4NOY A;  4M77 G;  5AYF A;  4M77 B;  2FZC B;  2MF2 A;  4C5G A;  1RI9 A;  2CUD A;  2XMF A;  2L89 A;  1JQQ A;  5GAN 5;  5GJW B;  5FU6 C;  3V8J A;  4Z02 A;  3L2Z A;  4AMC A;  4PJO F;  2RHU A;  5HK3 A;  2KT1 A;  1T0J A;  2FRY A;  2O4X B;  3OYA A;  3CCE Q;  3QG1 A;  3PIP A;  2KT8 A;  1UDL A;  2VYT A;  2CGH A;  2DO3 A;  1YJW A;  2KRS A;  2RH2 A;  1U3O A;  1FX7 A;  3MHX A;  4PLL A;  4RTU A;  1T0H A;  1MV0 B;  2L8D A;  4FYY B;  4M78 A;  1M5Q 1;  4M7A A;  1PHT A;  5A0L A;  2E5K A;  2MAM A;  2DYI A;  4E7K A;  2FPF A;  3TSW A;  5LJ5 g;  3A8L B;  4C0D B;  4EIK A;  4B9W A;  2NUP A;  2RF0 A;  1VIF A;  1C1A A;  4C8Q G;  1PKT A;  2CP0 A;  4C8Q B;  1SEM A;  1V29 B;  2DKG A;  4LD9 K;  3JCM c;  4UC4 A;  4Y92 A;  1M2V A;  3FIF A;  1O9S A;  2AZV A;  2DD5 A;  3TQ7 P;  1RAA B;  5CKB A;  2MI6 A;  1VQ5 A;  1VYU A;  3RIR A;  2EWN A;  1ZA2 B;  4OB1 B;  4ZN1 A;  3QWX X;  1YHQ T;  5CO7 A;  2VXE A;  1WI7 A;  1A0N B;  2GTO A;  3CCU A;  5FW9 A;  3JCM V;  1BI1 A;  4RMO A;  1YI2 T;  5I22 A;  1SKU B;  3CCR A;  3M0T A;  1TOV A;  1GCQ A;  3TSZ A;  4D6W A;  3JCM b;  1YWP A;  2CUB A;  1NEB A;  1EZZ B;  2RO0 A;  2CDT A;  3P8D A;  4XU2 A;  2SEM A;  4R0K A;  1KQS S;  3CCU Q;  4HCB A;  1H3H A;  2DEU A;  1VQ8 T;  3KXT A;  2FO0 A;  1AT1 B;  3CCR Q;  2J7I A;  1QVF P;  1OX9 A;  3SD4 A;  4GLM A;  2MWO A;  3CC2 Q;  4ZN3 A;  2CKK A;  4F7U A;  2C0I A;  3OQ5 A;  2RQU A;  3TVT A;  2YXY A;  1TG0 A;  2NLU A;  3OYL A;  4CC2 A;  3CC7 T;  1IZ6 A;  3OS0 A;  1AZG B;  2OTL A;  2EGE A;  1QVG P;  2LNV A;  5D6W A;  3RNJ A;  4F14 A;  3BE3 A;  2QGG A;  2JTM A;  3LH0 A;  3V8K A;  3LYI A;  3CXC A;  2COY A;  3F70 A;  2Y90 A;  3M55 A;  2COW A;  1BIB A;  2EPD A;  2CZ7 B;  2F2W A;  5FU7 B;  4PJO C;  3JCM h;  4E7I A;  2YRD A;  1BBZ A;  3UA6 A;  2DTO A;  2VXF A;  2CT4 A;  3OYY A;  4PFO A;  3HHT B;  5GMK m;  1G5V A;  4AT1 B;  3J80 E;  2CRE A;  1ZA1 B;  2K79 A;  4M75 E;  1YHQ A;  1D1B A;  3OYG A;  1VQN T;  1X69 A;  1S1N A;  3PVL A;  3QJY A;  1QMC A;  2DL4 A;  1D0X A;  3VRZ A;  5C0M A;  2H8H A;  1AD5 A;  1RI0 A;  2BZX A;  2YUQ A;  1VOM A;  4QKU A;  1CKB A;  4BDY A;  3SWN C;  2YLB A;  1GFC A;  4A4F A;  4J9I A;  1YJN T;  4E2F B;  3JCM W;  2F5T X;  1YHQ Q;  1K73 U;  2M02 A;  2JJ9 A;  1PRM C;  3S3O A;  1JO8 A;  3M0P A;  3I55 Q;  2NUT B;  2K5F A;  1JXM A;  1VQ8 A;  1UG1 A;  1ZHI A;  1YI2 Q;  2JMC A;  1PKS A;  5KE3 A;  3CCL Q;  4HXJ A;  2QTX A;  2DL5 A;  3EG2 A;  4M7D F;  4HVW A;  2QAZ A;  1TWB A;  3VYG A;  1Y71 A;  1SSH A;  3FC3 A;  1UFF A;  1M1G A;  3CC7 A;  2K5I A;  2PZ1 A;  2O88 A;  4OF1 A;  3NFC A;  3GF5 A;  2EIF A;  1Q7Y U;  3OYE A;  3RUX A;  1NJI U;  5IHI A;  1PD1 A;  2LQ8 A;  3CXC P;  1TU0 B;  2V8J A;  3VS4 A;  3JCM X;  1M27 C;  2EQK A;  4JLG A;  5GAN h;  3OW2 S;  1ARK A;  3CC4 T;  5J39 A;  3THK A;  5DLO A;  3CCM A;  3A5Z B;  2KVQ G;  1RAI B;  2QYZ A;  2GF7 A;  2JM8 A;  4M78 G;  1QWE A;  4M7A G;  4LE9 A;  1MNE A;  3CPW S;  4M78 B;  4M7A B;  2DZ9 A;  4QVZ A;  4MDX A;  2XI9 A;  1U06 A;  2ROL A;  2X51 A;  1NYG A;  2NUP B;  3VS7 A;  2M1H A;  1OU9 A;  3OYN A;  2SRC A;  5GJV B;  1YJN A;  1H8K A;  1KIK A;  2LTO A;  3L2W A;  4KT0 E;  2RJD A;  1VQN Q;  3T9N A;  2QA4 A;  2MIO A;  3P8B B;  4QW2 A;  2RA2 A;  3CCS T;  1D3B A;  1FMW A;  2DL3 A;  3LH5 A;  3MEA A;  3V7C A;  4AFU C;  4J6Y A;  4PFP A;  1S72 Q;  1SG5 A;  4KUI A;  2EYZ A;  2YHT A;  5GAM h;  2VAS A;  4C92 E;  1KQS A;  3KFV A;  1MGQ A;  4VUB A;  1YJN Q;  2HZY A;  3EFS A;  1Y57 A;  3KBG A;  2LNH B;  5IHK A;  3JCM Q;  2MPX C;  2X4Y A;  1UJY A;  4BI4 A;  4Q5W A;  8ATC B;  5AT1 B;  4EMG A;  2J05 A;  4BUG A;  2XHC A;  4PLI A;  1MHN A;  2KNB B;  5CVI A;  4OVA A;  1WJR A;  3OYJ A;  1M1F A;  4KH0 B;  4R56 A;  3H8Z A;  2JW4 A;  2LDM A;  1JRI A;  1UHC A;  3JB9 H;  2DAQ A;  2GBQ A;  4M77 F;  1VQO A;  3GP8 A;  1KD1 U;  2R5A A;  1QCN A;  2LX9 A;  4FT4 A;  4M7D C;  2HKN A;  5CKF A;  1AEY A;  4F7U G;  2BE7 D;  4OMP A;  3FB9 A;  1B3Q A;  3H0F A;  2MYS A;  4F7U B;  3OYF A;  1GRI A;  4IIO A;  4XK8 E;  3VV0 A;  5KYX A;  1TSF A;  5M9O A;  4E7L A;  1IO6 A;  1G3T A;  4JUV A;  3VS1 A;  1QLY A;  4XTZ A;  3CC4 Q;  2EW3 A;  5CR2 A;  5D6X A;  2OTJ A;  2COZ A;  4N4H A;  3JCM P;  5CKE A;  2KSS A;  3ZL7 C;  3HKS A;  4XU1 A;  3RR6 A;  3RBB B;  3LGL A;  3HL8 A;  3CCS A;  2EAY A;  4C8Q F;  1SHG A;  1QVF S;  2HBP A;  1I4K 1;  2HDA A;  3OB9 A;  4OP0 A;  5EC7 A;  2PVO B;  4OGC A;  2L3R A;  3HFN A;  1R0B G;  2F1L A;  1K73 C;  1VQM A;  1QVG S;  2RPN A;  1WHG A;  4QQG A;  2FPD A;  2KYM A;  4M75 D;  4M75 C;  1R0C B;  2NYS A;  4XTY A;  4A4K A;  1UB4 A;  1VQ7 T;  4JRP A;  1M8M A;  1CSK A;  2R57 A;  3DLM A;  4BDZ A;  5GAN 3;  1WJQ A;  4JPB W;  4MDW A;  1JEG A;  2ATC B;  3ASK A;  2QDY B;  2YUN A;  2HL3 A;  6AT1 B;  1Q86 U;  1Q7Y C;  1AZE A;  1QQJ A;  4OMO A;  4PNO A;  1NJI C;  2OJ2 A;  1EFN A;  4PKC C;  3OW2 A;  1VYT A;  3BDL A;  2DET A;  2RHX A;  3OBW A;  4JJB A;  1ZSZ C;  4N0A C;  2HBW A;  5HY6 A;  4KUL A;  3IQL A;  2QDL A;  2AK5 A;  3JAM E;  1IB8 A;  2ED1 A;  2WAC A;  3MP6 A;  2E5Q A;  4ZNX A;  4C0F A;  2CP3 A;  1NLP C;  1QW1 A;  3CPW A;  4PJO E;  1RL2 A;  2QQR A;  5IXF A;  2G6F X;  4HCC A;  4XU0 A;  3RKW A;  3I5S A;  4RCC A;  4RTZ A;  4OGE A;  1H3Z A;  1N8R U;  3I5R A;  2I2L A;  5DLQ E;  1RAE B;  2P4T A;  3CCJ T;  1ZBJ A;  4ZTF A;  1I07 A;  5LJ5 f;  2A7Y A;  1K1Z A;  1RUW A;  2EJ9 A;  2K4Y A;  5A2Q E;  1WFW A;  2K6D A;  1WHH A;  4CI0 C;  1Q82 U;  9ATC B;  4KH1 B;  4GBQ A;  1QCO A;  1VQP Q;  2L3Q A;  3KUF A;  3CXC S;  3G71 T;  2A28 A;  4FCY A;  1WNL A;  1WXT A;  1K4U S;  2KI7 A;  1WIE A;  1VQ7 A;  2X4W A;  4LD6 A;  4C0D C;  5GAN 2;  3O8V A;  4WTO B;  1W70 A;  2DXC A;  2BE9 B;  5GMK j;  3CPF A;  1O75 A;  3HSB A;  4J9H A;  3SB2 A;  1I0C A;  4QVD A;  2X3W D;  4FU6 A;  5J3B A;  1VQ7 Q;  3DKM A;  5FRN A;  1Q7Y R;  2D1X A;  5FWC A;  1ZUK A;  5C6S A;  3Q1J A;  3SEM A;  4LDY A;  2DIL A;  2AT1 B;  1X75 C;  2DK3 A;  1X01 A;  1ZBX A;  2JVV A;  1KD1 C;  4IUV A;  3A1P A;  4F04 B;  3CPW P;  4J83 A;  2E70 A;  2IG0 A;  3CCE A;  1Y07 A;  4RTT A;  3EG9 A;  2PVG B;  3CC2 T;  2W0Z A;  1OOT A;  3PMT A;  1PD0 A;  2A36 A;  3FJ5 A;  1GFD A;  1K8A U;  1NLO C;  4J6X A;  3JCM J;  3CCJ A;  2VKN A;  4Z8A A;  5I2M A;  4KUD K;  2LP5 A;  1H92 A;  2PNI A;  5GAN 6;  2JXB A;  3INZ A;  1C6V X;  4RUG A;  2DPP B;  1E7O A;  1QVF A;  1VQ4 Q;  5KYX B;  5DY9 A;  3JCM g;  4IUR A;  4GLK A;  2DE0 X;  2KRM A;  4OMN A;  4ELZ C;  2X4J A;  3G4S T;  3CCJ Q;  4M78 F;  5GMK e;  2MMP A;  2EQU A;  1FMK A;  1QVG A;  1JJ2 A;  1Q81 R;  5CQX A;  3MO8 A;  3NMZ C;  3PE0 A;  2ESW A;  1Y96 A;  5CKD A;  3EG0 A;  5FRM A;  1V1C A;  4PJJ A;  3SWN A;  3R6O A;  1U5S A;  4FYV B;  3G71 Q;  3JB9 F;  4MZP A;  3ULR B;  3LWH A;  2K5L A;  3TCJ A;  3QXE B;  1WJS A;  1SHF A;  3VUZ A;  3X25 B;  2OAW A;  1RAB B;  3I55 T;  2V8I A;  4FT2 A;  1KHI A;  3WVE B;  1UGQ B;  3CCL T;  3X28 B;  5HK0 A;  1KD1 R;  1Q86 C;  1EIF A;  3CC2 A;  3VS2 A;  1G2B A;  4C92 G;  3MPU B;  2DNU A;  2ZAE A;  4C92 B;  4M7D E;  1WXU A;  2JOY A;  2FPE A;  1W6X A;  4EPC A;  4JRI A;  1QP3 A;  1X6B A;  3OA6 A;  2E12 A;  1B34 A;  1GBR A;  3CMA Q;  2K9G A;  1OZ3 A;  2F2X A;  4QT7 A;  2D0N A;  4X9D A;  3HRS A;  2OX7 A;  3M56 A;  2LT1 A;  3X26 B;  2C06 A;  2HCK A;  3LLR A;  3CQT A;  3V7S A;  5GAN g;  3M59 A;  5FU6 B;  2EVR A;  1N8R C;  4JZ3 A;  1KHC A;  4LXC A;  3REA B;  3G4S A;  1M8V A;  1FWZ A;  2QTV A;  4YTL A;  2GTJ A;  1JJ2 P;  2EYY A;  1NE8 A;  1OYX A;  3FJP A;  2LQK A;  1Q82 C;  1UJ0 A;  2WSC E;  4FIB A;  1ZUU A;  1JU5 C;  4PJO D;  2DZC A;  1I8F A;  1I1J A;  2C0O A;  4R55 A;  4IUP A;  3G4S Q;  1TUC A;  2RI2 A;  1ACM B;  4IUQ A;  3NHN A;  4DBF A;  1X6O A;  4MZM A;  1BB9 A;  3QWY A;  2VV5 A;  3VUB A;  1XQH A;  3UAT A;  4BI8 B;  3EFO A;  3P8H A;  1OQK A;  4CRI A;  2P4R A;  3QYG B;  3I55 A;  3TU4 K;  1K9A A;  2EFI A;  4BY6 C;  1YI2 A;  3A8M B;  4XTV A;  1S72 T;  4RTX A;  3CCL A;  5GAM g;  1PC0 A;  2PUO B;  3S6W A;  4E7S A;  3EGU A;  2PU9 B;  4P5N A;  2QGF B;  2F5K A;  1G3S A;  4II1 A;  1YN8 A;  2O31 A;  3JB9 D;  3S3M A;  2QEX Q;  4XU3 A;  2E6Z A;  2DRK A;  1YCY A;  2J06 A;  3ZEH A;  2DBM A;  3MKD A;  4A54 A;  1BYM A;  2LQN A;  3RMQ A;  3NTI A;  4AFS C;  1K8A C;  2ABL A;  5LJ3 f;  2QK0 A;  1PNJ A;  1PM3 A;  3MCA B;  4RTV A;  1N8R R;  2J6K A;  4AFZ C;  4M77 E;  3C0C A;  1K9M U;  1OV3 A;  3FDR A;  3EG9 B;  1VQ9 Q;  4O5V A;  1FYN A;  2DJQ A;  3J7A F;  1QKW A;  2P0Q A;  1PRL C;  1N6A A;  2D8J A;  4FM4 B;  3O5Z A;  3RES A;  2QQB A;  3CBM A;  2DEQ A;  3D7S B;  1Q82 R;  1UGS B;  3J81 E;  4RG2 A;  4AG1 C;  3ER0 A;  3HRT A;  3PFS A;  5CCA A;  1VQK T;  1M30 A;  2EYQ A;  1VQN A;  2E3H A;  4ELY C;  2ZGW A;  2DYB A;  2F69 A;  2HMA A;  2M0Y A;  1MV3 A;  2VGM A;  1ZUY A;  2JS0 A;  3CBP A;  4KGV B;  3M0S A;  1HJD A;  1S72 A;  2XU8 A;  2ZPB B;  1M90 U;  1W1F A;  1FMV A;  3FRN A;  3BW1 A;  4PL6 A;  4C8Q E;  5L23 A;  3C12 A;  2GFA A;  3X24 B;  3L2U A;  1UGV A;  1RLP C;  3C94 A;  1BKB A;  3ZFJ A;  2KXC A;  2E4H A;  1AOJ A;  1Y96 B;  5GAN 7;  4FSX A;  4M75 A;  3SWN B;  1WQ7 A;  2YUO A;  1M9S A;  2AKK A;  1JXO A;  2E1H A;  4MML A;  1NM7 A;  1MMN A;  4JS5 A;  1R77 A;  2RJC A;  4X1V A;  4A4G A;  4AFQ C;  2FVU A;  3LWI A;  2YRV A;  4BB7 A;  2YUP A;  1VYV A;  1W4S A;  2QAS A;  2VC8 A;  3OMC A;  3CCV T;  1JBM A;  3SDZ A;  1KQ2 A;  2KGT A;  2YT6 A;  3CD6 T;  5GAO m;  1J3T A;  2J6F A;  2QI2 A;  5LJ5 j;  2D8H A;  1VQ6 T;  2JTF A;  2RD1 A;  2M9U A;  2YRC A;  2V8K A;  4RCB A;  5I21 A;  1YP5 A;  1ZSZ A;  1HD3 A;  1B34 B;  1VIE A;  1AHJ B;  5LJ3 g;  4OMF B;  2DTH A;  2CYZ B;  3CC4 A;  2JNG A;  4LN2 A;  4M7D D;  1M1K U;  3LGF A;  1SRL A;  2BUD A;  2RMO A;  1CKA A;  2NUZ A;  4IIM A;  2CH4 W;  2JUF A;  4JLI A;  2A37 A;  2L5Q A;  3RER A;  3PIO A;  1SRM A;  1EX4 A;  3BDU A;  4V2S A;  2M51 A;  2EQM A;  1MUZ A;  3EFR A;  5FRO A;  3BFM A;  1WYX A;  1BCM A;  1LPL A;  1VQK Q;  4DBH A;  4J5Y A;  2EKO A;  4JRK A;  5I11 A;  1NPR A;  2M0O A;  4HT8 A;  2EJF A;  1VQP T;  2JN0 A;  2RQR A;  2RK2 A;  2LCL A;  1MMA A;  2CP7 A;  2DM1 A;  5GMK h;  3JSC A;  1RAG B;  3PMI A;  5LJ5 e;  4HVU A;  3EFO B;  1BCO A;  1D0Z A;  3NTH A;  5EG2 A;  2PVD B;  2GQV A;  4DBQ A;  4HT9 A;  5GAN j;  3MET A;  3EGX A;  3QJ6 A;  3CCV A;  5CQY A;  3I56 T;  4HVV A;  3GIB A;  2CSI A;  2A08 A;  1WXB A;  2AHJ B;  1JJ2 S;  2X3X D;  2HEQ A;  3JRZ A;  3PT9 A;  3M5A A;  3FLG A;  3QHS A;  1GL5 A;  2LC4 A;  2DLP A;  1QP2 A;  1BI2 A;  1Q95 G;  1QCF A;  2MK5 A;  3QZ5 B;  2HL5 C;  1ZX6 A;  2FEI A;  4C92 A;  4ANJ A;  4EMK A;  2J6O A;  2A3L A;  1P92 A;  2DXT A;  2P84 A;  3CCV Q;  2FYK A;  2D6F A;  2ZPI B;  1WHK A;  2FHD A;  3CD6 Q;  2L2P A;  5D7U A;  5L8R E;  4A4E A;  2E6N A;  4C5I A;  1YJ9 T;  1VQ6 Q;  3GNF B;  3H0I A;  3M4Y A;  2M16 A;  2XIC A;  1TXQ A;  2EKH A;  1WHJ A;  2E41 A;  2CH4 A;  1C0M A;  1LOJ A;  3QDR B;  3CCQ T;  2KRN A;  4RKU E;  5CIU A;  4CC7 A;  4DEX A;  5GAM j;  4JZ4 A;  1UTI A;  4JDS A;  2JMA A;  4XAX B;  3E2U A;  2AIR B;  2LVM A;  4PJM A;  3X20 B;  1VQ4 T;  1D0Y A;  1LNX A;  4M77 C;  4M77 D;  1GBQ A;  1NZ9 A;  1R8O B;  5KE2 A;  1VQP A;  3VJP A;  3GOX A;  4L6V 5;  3JCM f;  3L2R A;  2XD0 A;  3OYI A;  1U8R A;  1IGQ A;  3QUI A;  1M90 C;  1Y0M A;  4M78 E;  4NL3 A;  4X9C A;  1MMD A;  2HQX A;  3OYK A;  2ZPG B;  4RG8 A;  3I56 A;  3E9G A;  1E6G A;  2GCX A;  1ABQ A;  5I2S A;  5J26 A;  1K73 R;  1WPY A;  2B8A A;  2LCS A;  2LJ1 A;  2LJ3 A;  3OYM A;  3OY9 A;  2DTI A;  1YJW T;  2H3E B;  3M0Q A;  1IRX A;  4M75 G;  3HP9 A;  4C8Q C;  4C8Q D;  4M75 B;  4NS5 A;  1AWO A;  3I56 Q;  2EYW A;  2FZG B;  1LVK A;  2L0A A;  3GNG A;  2DIG A;  4LDU A;  3A8G B;  2GFU A;  2G3R A;  4PJL A;  1NEG A;  1NJI R;  3MJX A;  1YFN A;  3TEE A;  1MMG A;  3CMA T;  3WXM B;  2KE9 A;  2HSE B;  3EGD B;  5KYU A;  4E7J A;  2R58 A;  2XKO C;  3UWN A;  2DVE A;  2ZPE B;  4ORZ A;  4LDX A;  2HKQ B;  1VQ5 T;  3M54 A;  1YJ9 Q;  1M1K C;  3M0R A;  3ZBD A;  1VQ4 A;  2MWP A;  4L59 A;  1ZSG A;  2PTK A;  5GAN 4;  1ZSZ B;  4JJD A;  2K2V A;  2KBT A;  2YWW A; 
#chains in the Genus database with same CATH homology
 1NYF A;  2SRC A;  2JTE A;  5GJV B;  1H8K A;  2EYY A;  1KIK A;  3EHR A;  1X6G A;  1BU1 A;  2K7A A;  1K0S A;  1UJ0 A;  1ZUU A;  1JU5 C;  2ENM A;  1I1J A;  2C0O A;  2MIO A;  2EGC A;  1TUC A;  2I0N A;  2DL3 A;  3LH5 A;  2DA9 A;  3NHN A;  4AFU C;  1BB9 A;  1M3A A;  3QWY A;  2EYZ A;  3UAT A;  1YNZ A;  3KFV A;  2P4R A;  1OPL A;  3R6N A;  1K9A A;  5IXB A;  3H41 A;  2DVJ A;  1G83 A;  4A63 B;  2W10 A;  2DX1 A;  2RN8 A;  1Y57 A;  1LCK A;  2O9S A;  2LNH B;  4RTX A;  5IHK A;  2EBP A;  4LUE A;  3VS6 A;  2EQI A;  1UJY A;  1Z9Z A;  2J05 A;  3EGU A;  4J9B A;  2O2O A;  1QWF A;  2KNB B;  3VS0 A;  2MOX A;  1TUD A;  2KEA A;  4HCK A;  4LNP A;  1B07 A;  4WCI A;  2GNC A;  2JW4 A;  1UHC A;  1YN8 A;  2O31 A;  2GBQ A;  2V1Q A;  4J9D A;  4J9G A;  3UA7 A;  1OEB A;  2DMO A;  5FWB A;  2DRK A;  3U23 A;  1UE9 A;  2DF6 A;  1KSW A;  2ED0 A;  2J06 A;  3M0U A;  2JM9 A;  2DBM A;  1AEY A;  4OMP A;  1B3Q A;  3PVQ A;  1T3S A;  2LQN A;  3H0F A;  2RNA A;  4AFS C;  1GRI A;  2ABL A;  4IIO A;  1PNJ A;  4RTV A;  1T3L A;  1IO6 A;  2J6K A;  4AFZ C;  5IH2 A;  2YDL A;  3C0C A;  3VS1 A;  1OV3 A;  1QLY A;  2FRW A;  1UEC A;  1X43 A;  1FYN A;  2EW3 A;  1HSQ A;  2DJQ A;  1QKW A;  3SHW A;  1AWW A;  1PRL C;  2D8J A;  4RTY A;  3O5Z A;  3ZL7 C;  4M4Z A;  4F16 A;  3RBB B;  5IHN A;  4AG1 C;  4DEY A;  1SHG A;  2OI3 A;  4F17 A;  2HDA A;  1M30 A;  2VVK A;  2AZS A;  4JJC A;  1AWJ A;  1VA7 A;  5EC7 A;  1WA7 A;  2DYB A;  2L3P A;  2M0Y A;  1SPK A;  1MV3 A;  1ZUY A;  2JS0 A;  3M0S A;  4K11 A;  3VS5 A;  1HJD A;  1W1F A;  2RPN A;  2DL8 A;  5L23 A;  2DRM A;  2FPD A;  2KYM A;  3H0H A;  2AKL A;  1XOV A;  1UGV A;  1RLP C;  2KXC A;  3EHQ A;  1M8M A;  1CSK A;  1AOJ A;  1K76 A;  4KRT A;  3EG3 A;  4D8D A;  2GGR A;  4JPB W;  1KJW A;  3VRY A;  2YUO A;  1JEG A;  2KXD A;  1BK2 A;  1WDX A;  2AKK A;  2IIM A;  1JXO A;  1NM7 A;  4D8K A;  1YWO A;  1RI9 A;  2CUD A;  2XMF A;  2YUN A;  1JQQ A;  5ECA A;  4CC4 B;  4X1V A;  4AFQ C;  5GJW B;  1AZE A;  4OMO A;  4OMQ A;  2OJ2 A;  2YUP A;  1EFN A;  1VYV A;  2FG0 A;  2KT1 A;  1VYT A;  1T0J A;  3VS3 A;  2FRY A;  1ZLM A;  2KGT A;  2KT8 A;  1UDL A;  2YT6 A;  4Z89 A;  2KRS A;  4JJB A;  1U3O A;  1J3T A;  2J6F A;  3REB B;  2HBW A;  2D8H A;  4RTU A;  1T0H A;  4Z88 A;  3IQL A;  1MV0 B;  2QDL A;  2AK5 A;  2ED1 A;  4ZNX A;  1PHT A;  2E5K A;  1NLP C;  1YP5 A;  2FPF A;  3TSW A;  2HSP A;  4EIK A;  5IXF A;  1HD3 A;  2G6F X;  2RF0 A;  3I5S A;  4RTZ A;  2KRO A;  1UHF A;  1PKT A;  3I5R A;  2DL7 A;  3A98 A;  1SEM A;  4LN2 A;  1ZBJ A;  2BZ8 A;  4LUD A;  1SRL A;  3NPF A;  4Y92 A;  2RMO A;  1CKA A;  1I07 A;  2AZV A;  2NUZ A;  4IIM A;  2LMJ A;  1K1Z A;  1RUW A;  2CH4 W;  2K3B A;  2A37 A;  1VYU A;  2NWM A;  1WFW A;  1SRM A;  2K6D A;  3QWX X;  2EGA A;  1WI7 A;  2KR3 A;  1MUZ A;  1GCQ C;  2M51 A;  1A0N B;  1RLQ C;  4GBQ A;  1ABO A;  2GTO A;  1WYX A;  5FW9 A;  2GQI A;  2L3Q A;  2A28 A;  1KFZ A;  1WXT A;  5I22 A;  1K4U S;  1WIE A;  3M0T A;  5I11 A;  1GCQ A;  3TSZ A;  1YWP A;  1W70 A;  2RQR A;  5HCK A;  1AWX A;  2CUB A;  1NEB A;  2V1R A;  2DM1 A;  2CDT A;  4HVU A;  4J9C A;  2SEM A;  4R0K A;  4J9H A;  1H3H A;  1I0C A;  2FO0 A;  2X3W D;  1X2K A;  1NG2 A;  1M3C A;  2D1X A;  5FWC A;  1ZUK A;  2J7I A;  3EG1 A;  3SEM A;  4HVV A;  2CSI A;  4GLM A;  2DIL A;  2A08 A;  1WXB A;  2X3X D;  2HEQ A;  1GL5 A;  2C0I A;  2DLP A;  2VWF A;  2RQU A;  4RTW A;  3TVT A;  1TG0 A;  2L3S A;  4CC2 A;  1QCF A;  1AZG B;  2EGE A;  1ZX6 A;  4RTT A;  2FEI A;  1NYG A;  4E6R A;  2CT3 A;  2W0Z A;  2J6O A;  1OOT A;  1WX6 A;  1UUE A;  2A36 A;  3FJ5 A;  3RNJ A;  2RQT A;  3UF4 A;  4F14 A;  1GFD A;  2LQW A;  2L2P A;  1OPK A;  1NLO C;  1X27 A;  2VKN A;  4Z8A A;  1E6H A;  1M3B A;  3NGP A;  2LP5 A;  2EPD A;  1H92 A;  1PWT A;  2KYB A;  2F2W A;  2PNI A;  3H0I A;  2JXB A;  2DBK A;  1BBZ A;  3UA6 A;  2EKH A;  4RUG A;  1E7O A;  2CT4 A;  2CH4 A;  2KRN A;  4CC7 A;  2CRE A;  4DEX A;  2K79 A;  4JZ4 A;  1X69 A;  1S1N A;  3PVL A;  2K2M A;  1UTI A;  2DE0 X;  2DL4 A;  2KRM A;  4OMN A;  2JMA A;  3VRZ A;  2H8H A;  1AD5 A;  2BZX A;  4OML A;  2YUQ A;  2LX7 A;  2JT4 A;  1CKB A;  1FMK A;  2ECZ A;  1GFC A;  1GBQ A;  4FSS A;  4J9F A;  1QKX A;  4J9I A;  2B86 A;  1AVZ C;  4CC3 A;  3NMZ C;  3PE0 A;  2ESW A;  3EG0 A;  4ESR A;  1V1C A;  1PRM C;  1U5S A;  1Y0M A;  2RQW A;  1JO8 A;  3M0P A;  3JV3 A;  1JXM A;  2CSQ A;  1UG1 A;  3ULR B;  3GBQ A;  1WLP B;  2JMC A;  1PKS A;  2YSQ A;  2EYX A;  4HXJ A;  2DL5 A;  1E6G A;  3EG2 A;  1SHF A;  4HVW A;  1ABQ A;  2OAW A;  2MCN A;  2BTT A;  2O9V A;  1SSH A;  1UFF A;  2F2V A;  2LCS A;  2LJ1 A;  2LJ3 A;  2C0T A;  2PZ1 A;  2O88 A;  2ROT A;  3M0Q A;  3VS2 A;  2LZ6 B;  1G2B A;  3I9Q A;  5IHI A;  2LJ0 A;  2JS2 A;  4AG2 C;  2DNU A;  1AWO A;  1WXU A;  2EYW A;  2FPE A;  1W6X A;  2L0A A;  1X6B A;  1YCS B;  3VS4 A;  1GBR A;  2RQV A;  1M27 C;  1N5Z A;  2K9G A;  1Z9Q A;  2F2X A;  4QT7 A;  1ARK A;  2D0N A;  1K0X A;  1NEG A;  4OMM A;  3I35 A;  2HCK A;  3THK A;  2BZY A;  2KE9 A;  1X2Q A;  3CQT A;  2EVR A;  2JM8 A;  4JZ3 A;  1QWE A;  4ORZ A;  4LE9 A;  3REA B;  3M0R A;  1ZSG A;  2PTK A;  4J9E A;  1U06 A;  2GTJ A;  2ROL A;  4JJD A;  2KBT A;  1GCP A;  3VS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...