1BB9A

Crystal structure of the sh3 domain from rat amphiphysin 2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
b'TTGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPHIPHYSIN 2
molecule tags Transferase
source organism Rattus norvegicus
publication title Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.
pubmed doi rcsb
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1998-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bb9A00
1GL5A 2DLPA 5GJVB 1NG2A 1GFCA 3TSZA 2AKLA 2FEIA 2VKNA 1K0XA 2CH4A 2DM1A 2DL8A 2GQIA 4LNPA 2F2WA 4RTXA 1HD3A 2DRMA 4Z8AA 2SRCA 1XOVA 2W10A 1H3HA 2YUOA 3NHNA 2LJ0A 2OAWA 2K9GA 5HCKA 1RLQC 4AG2C 1UJYA 3A98A 1JO8A 1SHFA 4AFQC 4GLMA 1E6GA 1BU1A 3KFVA 2YSQA 2KRMA 1U06A 2C0OA 3VRYA 1LCKA 1YN8A 1KFZA 2VWFA 4D8KA 3IQLA 1ABQA 2JS0A 2RQRA 4WCIA 1M3BA 3RBBB 2DNUA 5FWBA 4J9BA 3I9QA 5EC7A 1GCPA 4CC4B 1PRLC 1WDXA 1ZUKA 1U5SA 1UG1A 4K11A 4Z88A 1UUEA 2DE0X 2CH4W 2X3XD 1QWEA 1X27A 3VS2A 4J9HA 4QT7A 4LN2A 1E7OA 2KROA 5IXFA 2KXDA 3SEMA 2L0AA 1TUCA 1AWJA 1X43A 3H41A 1ZLMA 2HCKA 2GTJA 3THKA 1WXBA 1K1ZA 3EG3A 2FPDA 1UECA 2KT8A 2G6FX 1YP5A 1WX6A 1SHGA 2I0NA 2QDLA 2DL7A 1ZBJA 1TG0A 1WLPB 4J9EA 2F2XA 1MV3A 2DILA 1M8MA 2PZ1A 1AWXA 2LJ3A 2RF0A 2GTOA 4HVVA 3ULRB 2DVJA 2YDLA 2DMOA 1MUZA 2CREA 1K4US 1Y0MA 5FW9A 3M0RA 4EIKA 2HEQA 1K76A 3M0PA 4KRTA 1M3CA 1I0CA 3C0CA 4RUGA 2EVRA 1KIKA 1B3QA 3EHQA 5ECAA 1WIEA 2A28A 2LMJA 4HVUA 1X6BA 2CUDA 2EGAA 1CKBA 1UHCA 2RQUA 1UFFA 3NMZC 1S1NA 4LUEA 4ESRA 1NEGA 1VYUA 1G83A 1U3OA 2DX1A 1VA7A 1WXTA 2BZXA 1AWWA 1I1JA 4AFSC 2J6OA 3GBQA 1AVZC 4DEYA 2K2MA 3PVLA 3VS7A 1Z9ZA 3M0TA 1E6HA 2L3SA 4AG1C 2RQVA 1CKAA 3LH5A 2DRKA 1UDLA 1HJDA 2X3WD 1UHFA 2K3BA 2BZ8A 1OPKA 1H8KA 2KYMA 2EGCA 2O2OA 1IO6A 1NYFA 2JM9A 4CC3A 2A08A 2JT4A 4OMPA 1M30A 1GCQC 2F2VA 4HVWA 3UF4A 2KBTA 1GRIA 1AOJA 1UGVA 1WXUA 5IH2A 4A63B 4FSSA 2LCSA 2NUZA 2LQNA 2ESWA 2HBWA 2YUQA 4RTZA 1GBRA 3H0HA 1ARKA 1T3SA 3I5SA 1T3LA 1T0HA 3M0QA 3H0FA 4F14A 1PWTA 3QWYA 2CT4A 2CSQA 2DF6A 4JZ3A 4RTYA 2P4RA 4AFUC 3EG2A 2RNAA 2AK5A 1BB9A 1K9AA 1ZUYA 1VYVA 4JJCA 1ZX6A 1JXMA 2PTKA 4AFZC 2RQTA 1WYXA 2O9SA 2FO0A 2ED1A 2VVKA 1PHTA 1NLPC 4RTTA 1YWOA 2KT1A 2LQWA 2HDAA 4HCKA 4J9CA 1AEYA 1X6GA 2D8HA 2L3QA 3M0SA 3REBB 3UA6A 2JMAA 1JEGA 1HSQA 5I22A 5IXBA 2O9VA 5GJWB 1AD5A 1CSKA 4J9DA 2D0NA 1KJWA 2ABLA 3VRZA 4E6RA 4Y92A 2AKKA 3SHWA 1PKSA 2EBPA 1SRLA 4CC7A 1WFWA 3EGUA 1G2BA 2EYXA 1A0NB 1QCFA 2V1QA 2M0YA 2LNHB 4OMNA 1WI7A 4IIMA 2K7AA 4OMQA 2W0ZA 2K79A 2LZ6B 2ENMA 2ROTA 1AWOA 3EHRA 4DEXA 2OJ2A 4Z89A 1NYGA 1K0SA 1OOTA 4F16A 2JW4A 2J6KA 5FWCA 2MCNA 1J3TA 1NM7A 1M3AA 3EG1A 2EKHA 3REAB 4JJDA 2A36A 2M51A 2CUBA 2E5KA 2J05A 3UA7A 1YCSB 2EGEA 5IHKA 2D1XA 1BK2A 4LUDA 1FMKA 2CT3A 2AZVA 2J7IA 4J9FA 2EYWA 1KSWA 5IHNA 2V1RA 2YT6A 2GGRA 1QKXA 1PRMC 1OEBA 2LP5A 1W70A 3VS5A 4J9GA 1AZEA 1V1CA 1JQQA 4RTVA 5I11A 2NWMA 2GNCA 2DA9A 2KR3A 1WA7A 4OMMA 2XMFA 1OPLA 2DBMA 3UATA 3VS4A 3U23A 2DL4A 2JMCA 1B07A 2O31A 1SPKA 2GBQA 2J6FA 2A37A 1VYTA 4X1VA 3FJ5A 2D8JA 3I35A 1GFDA 3TSWA 2FRWA 1ZSGA 3VS1A 2BTTA 1JXOA 2K6DA 4HXJA 1EFNA 2C0TA 3RNJA 2IIMA 2FRYA 2KRNA 3CQTA 1X2QA 2HSPA 1GCQA 1H92A 1GBQA 4IIOA 1SSHA 2OI3A 1N5ZA 3TVTA 2SEMA 3I5RA 1ABOA 1YWPA 3JV3A 2JS2A 1NLOC 2RQWA 1UJ0A 4J9IA 3NGPA 2AZSA 2EYZA 1Z9QA 2DBKA 2DJQA 2J06A 4GBQA 2FPEA 1PKTA 1MV0B 4OMLA 1W1FA 2KYBA 3H0IA 2KEAA 1BBZA 2DL3A 2DYBA 2PNIA 1T0JA 2YUPA 4ZNXA 1NEBA 2JXBA 2DL5A 2B86A 2ECZA 1RI9A 2RN8A 2JM8A 3R6NA 5L23A 1UTIA 4F17A 2RPNA 2MOXA 2ROLA 2KE9A 1SEMA 2H8HA 3VS6A 1QWFA 4ORZA 4R0KA 2CDTA 3PVQA 2LJ1A 1OV3A 1QKWA 2LX7A 4JJBA 2L2PA 2BZYA 1W6XA 4RTUA 3VS3A 2MIOA 4JPBW 3M0UA 1JU5C 4M4ZA 4LE9A 4RTWA 1YNZA 5IHIA 4CC2A 2JTEA 1TUDA 2FG0A 2KRSA 2RMOA 2O88A 1Y57A 1I07A 1SRMA 2L3PA 2EPDA 4JZ4A 2EYYA 2KNBB 1FYNA 1QLYA 1AZGB 2FPFA 3NPFA 1UE9A 4OMOA 1RUWA 3QWXX 1X2KA 3ZL7C 1RLPC 2CSIA 2YUNA 3EG0A 1X69A 2EW3A 2KXCA 4D8DA 3VS0A 1M27C 2C0IA 2ED0A 1ZUUA 1PNJA 2EQIA 2KGTA 3PE0A 3O5ZA
chains in the Genus database with same CATH superfamily
1GL5A 3CC2A 1HK9A 1NBEB 2K5IA 1M5Q1 1YJWQ 4KT0E 4XAXB 3CD6Q 3OS5A 2JNGA 2DM1A 2DL8A 2ZGWA 4LNPA 1G8XA 5FU6C 1MMDA 1HD3A 2W10A 1C1AA 3DB3A 3PFSA 4M7DF 3HP9A 5KYYA 2QTVA 1M1FA 2F69A 4OGEA 1VQOT 3OYFA 2D0QB 1JO8A 3UWNA 2LDMA 3ZBDA 4AFQC 4R56A 1BU1A 3KFVA 3ZFJA 4XU1A 3VRYA 2MWOA 1LCKA 4M77A 2FB7A 1LJOA 2VWFA 2RQRA 3RBBB 1NJIC 1UGRB 4RCBA 4J9BA 1M1KU 1GCPA 3NTKA 1YBYA 1UUEA 1VQ9T 4KGZB 1VQLA 5GAN6 3VS2A 2MPXC 5KYXA 4LN2A 1ZSZA 5A0LA 4LDYA 3CCVT 1KC8U 1RAFB 3CCLA 3OMCA 4XTUA 2XD0A 1N8RR 3ME9A 2XI9A 5GAOn 1WX6A 2DL7A 1ZBJA 3RKXA 4J9EA 3LH0A 2KK4A 3EG9B 4C8QC 2DIQA 2QA4Q 2LJ3A 1UEBA 2K4YA 4HVVA 2DMOA 4NS5A 4OB0B 3M5AA 2HEQA 1VQ5Q 1TSFA 1V76A 2IPOB 4RUGA 1VQPT 4R55A 1GXIE 4HVUA 1YJNT 1K9MC 1ZSZC 3V7CA 1UFFA 4M77E 2MYSA 5AT1B 5D7UA 3JCMe 3OSSC 2VXEA 1G83A 1Y7XA 4JDSA 3G4SA 1H3ZA 3V8KA 2BIVA 2X4XA 3E1SA 1KQ2A 1VA7A 1AWWA 4XU3A 1Y07A 1I1JA 4OMFB 4ZN3A 3S6WA 3FIFA 2J6OA 2BUDA 2CZ0B 5CKBA 3BE3A 2DEUA 2CP6A 2V26A 4C8QA 1Z9ZA 1E6HA 2L3SA 2XK0A 1CKAA 3MEAA 5GAOq 1Q7YR 1HJDA 2QI2A 1UHFA 3P8BB 1OPKA 4J7IA 1H8KA 3CEYA 1S72T 4JS4A 3HL8A 2EGCA 2O2OA 2JM9A 3Q1JA 3GF5A 1K73U 1M30A 3RERA 1GCQC 1SG5A 2X4WA 4PJOD 1Q82U 2MK5A 4FIBA 1BI2A 1Y71A 1TWBA 2PVDB 1YITT 1HYOA 4EMKB 1EZZB 2R5MA 2LTOA 4FSSA 1IHWA 1KQSS 1OYXA 2VXFA 1QVFS 1BI1A 1D0YA 1FMWA 4MDXA 4RTZA 1I8FA 2FVUA 3I55T 2DJZA 4PLLA 3G7ZA 3I5SA 1NJIU 1T3LA 2X9HA 4OB2B 4F14A 5KCHA 2GFUA 4RTYA 2P4RA 2Y90A 4AFUC 5C6SA 3EG2A 3KXTA 2P0QA 1PSEA 4E7HA 1VYVA 3H6ZA 3VUBA 1ZX6A 1YITA 3MP1A 1VQKT 1KHIA 4A4EA 2WSFE 1IRXA 2BE9B 1Q82C 4Z02A 1OU9A 3M4GA 1YWOA 4M75A 1W2BA 2AT1B 2HDAA 4BI8B 4HCKA 2DEQA 4J9CA 2P0KA 1Y96A 3MEUA 2KSSA 5LJ5g 1JEGA 5KYUA 3FB9A 1CSKA 4J9DA 2RHIA 4E6RA 2EJGA 1KHCA 4ELZC 2EBPA 1VQOA 3PMIA 1SRLA 2X4YA 3EGUA 1G2BA 4KGVB 4F7UB 1A0NB 3R6OA 1QMCA 2D9TA 2L8DA 3QZ5B 4OMNA 4E47A 1C0MA 1EX4A 2WACA 1KD1U 4OMQA 3H8ZA 3J7AF 5LJ5e 1N9RA 5CKEA 2ENMA 1O9SA 2OJ2A 4Z89A 2GCXA 3HPWA 1OOTA 2CP7A 2E4HA 2MCNA 3JCMg 3GP8A 2D6FA 2EKHA 2GFAA 2RM4A 1EIFA 2CUBA 4F7UE 3JSCA 2J05A 3RMSA 3UA7A 1YCSB 5IHKA 3E19A 1B34B 1BK2A 2NUTA 1R77A 4EMGA 5GAMe 3FRNA 2EYWA 5IHNA 3JRZA 4IUPA 3JCMQ 2YLCA 1MMGA 1OEBA 2LP5A 1W70A 3VS5A 2QYZA 4FL6A 1W4SA 4RTVA 4XTZA 4KUDK 5I11A 3CCMA 1VQMA 1Q86C 2DXTA 4OMMA 4DBQA 4RG2A 3UATA 4J8OA 1YITQ 3VS4A 3CCSA 3OYJA 3I56T 3CC4T 3HRSA 1TS9A 5A0DA 1VYTA 3AHUA 1I81A 3PGGA 4M78E 4C92A 8ATCB 3JB9J 1GFDA 5J26A 5GAN7 2BTTA 2MF2A 3CD6T 3OYBA 3JB9D 1MNDA 1M8VA 1Q95G 1X2QA 2DD5A 2HSPA 1GCQA 4FW1A 3EAEA 3I5RA 1VIEA 3BDUA 1YHQA 4J9IA 3NGPA 1Z9QA 4VUBA 2DBKA 2H3JA 3CCUQ 1MV0B 3CCQA 2OTLT 4E2FB 2DL3A 2HKQB 4FW2A 2P4TA 1PSFA 2DL5A 3SB2A 2KVQG 3R6NA 2ECZA 2KI7A 2JM8A 2RN8A 2XDPA 1TU0B 5GMKe 4FU6A 4EPCA 2BE7D 2PU9B 4A54A 4F17A 1FX7A 3I55Q 2H8HA 4MZTA 2LJ1A 1OV3A 1QKWA 3FLGA 4LDUA 4MDWA 1BCOA 4JJBA 1VQ5A 3CMEQ 1YIJA 3QZ9B 4C0FA 3CC7T 3CPWA 4ME7A 1WQWA 2NUPB 5I21A 2MIOA 3G4SQ 4C5GA 4F7UF 4EDUA 1D0XA 4M4ZA 3G1JA 3CCUA 5IHIA 1OX8A 3L2RA 4CC2A 3C95A 2E70A 1YHQQ 1VQ8A 1Y57A 4M7DB 1I07A 5M9OA 4JLGA 2KNBB 5GAMd 1FYNA 2MAMA 1K9MU 2IG0A 3NPFA 4OMOA 1RUWA 2G3RA 4M75C 3QWXX 1ZSZB 3CCMQ 1X2KA 4M78B 1Q81C 2CSIA 4V2SA 1KQSA 1N6AA 3V8JA 4II1A 3VS0A 1VQLT 1M27C 2C0IA 2ED0A 3L2WA 5GAN8 1ZUUA 2KGTA 3UPUA 3M4YA 4M7DC 5CKHA 5KE2A 3NFCA 3CC2T 1GFCA 2V8IA 4M7DE 2AKLA 3JCMP 2ZAEA 2EFIA 1K0XA 3QKJA 3G71A 2HQEA 2EJFA 2SRCA 3OA6A 3OYNA 4PJOG 2B8AA 3A8OB 2EYQA 3NHNA 1N9SA 3MCAB 2LJ0A 3L1AA 3X25B 2FL7A 1RLQC 5I2SA 2WSEE 4CRIA 5CKFA 5FU7B 3CBOA 4GLMA 1M2VA 3VYHB 1U06A 3EGDB 2C0OA 4D8KA 1ABQA 2JS0A 2RJDA 2RI5A 5EC7A 1YJ9Q 1R8OB 3F70A 1D3BA 4PKCC 2CH4W 1QWEA 2OTJT 3CCQT 2PUKB 3QXEB 1E7OA 4NOYA 5IXFA 1Q82R 5LJ3g 3SEMA 1TUCA 3M53A 2HCKA 3PIPA 1W2BP 3THKA 1WXBA 3EG3A 3EFRA 4D6WA 1WHGA 2G6FX 3TU4K 4LDWA 3OYKA 4J5YA 5GANd 1TG0A 1WLPB 2DZ9A 1ACMB 3DLMA 4TVRA 1KC8R 2MMPA 1VUBA 4FSXA 5IAYA 1VQ7T 1FMVA 3P8DA 1MUZA 5L8RE 3EGXB 3JB9I 3RDVA 1JRIA 2DZCA 4EIKA 4KRTA 4M7DG 1I0CA 2EVRA 3L2VA 1B3QA 4M7AD 5ECAA 3GLXA 2LMJA 2K5FA 4IURA 2CUDA 2EQMA 2EGAA 1CKBA 3LWIA 2Z0WA 4ESRA 1NEGA 4M78G 5GAN3 3X20B 1X75C 2DX1A 3A1PA 1Q7YC 2BZXA 2LCLA 2K57A 2HL5C 3M0TA 1TTHB 3VYGA 1OZ2A 4MZPA 4F7UG 3T9NA 3OS1A 1RAEB 4PJLA 2K3BA 4QW2A 4O5VA 5KYXB 1M90C 3FEOA 1QP3A 4J6XA 1IO6A 2A08A 2E1HA 4KULA 4OMPA 3GPLA 2L3RA 4M77F 4BE0A 2KBTA 2HZYA 3A8MB 3PT9A 1VQNQ 1AOJA 1WXUA 4A63B 4N4GA 2EKOA 2LCSA 8AT1B 3MKDA 2HBWA 2YUQA 4HT8A 3H0HA 3I56A 1AHJB 2E6ZA 5GANe 3M0QA 3CCJQ 1PWTA 2CT4A 1S72Q 4M7AA 4JZ3A 1TUGB 3EFSA 2E3HA 2M16A 1VQKQ 4N0AC 2KAFA 1BB9A 1K9AA 1ZUYA 2K5LA 1BIBA 1HXDA 1B34A 2PTKA 3JCMJ 4AFZC 2ED1A 2VVKA 1PHTA 3HHTB 1VQPA 3DB4A 3OYCA 1RL2A 1QVFA 2LQWA 3JB9G 3LW5E 3CBPA 1M90R 3L2UA 2L3QA 1NJIR 4FYXB 4C8QB 2PVGB 2O9VA 1AD5A 1VIFA 3CCVQ 2M02A 1U1SA 2D0NA 2ABLA 3SWNA 3EH1A 3OSVA 4B9WA 4Y92A 1VQMT 2EIFA 3X26B 2VASA 5HK0A 4OGCA 3OYDA 4ZGJB 3GOXA 2EYXA 3CCJA 2V1QA 2R57A 2DFUA 2M0YA 4HT9A 2LNHB 5D6YA 3M54A 4IIMA 2I2LA 4PJJA 5GANj 2LZ6B 4C8QE 4PJOE 2F1LA 2ROTA 1D1AA 3ZEHA 2OTJA 4BI4A 1K0SA 2J6KA 2RHZA 3OYIA 1NM7A 1M3AA 3EG1A 3PMTA 2PQWA 4JJDA 2KMTA 2COYA 2KQWA 4XU0A 3CCLT 3RESA 2OX7A 2AHJB 2CT3A 2AZVA 2XIDA 4IUVA 2J7IA 4J9FA 4LDXA 1IXDA 1KSWA 3P8HA 2GGRA 5GANh 4M78C 4JRIA 2OTLA 4BY6C 3CCRQ 1JJ2P 2CZ1B 4J9GA 4M77D 2GQVA 3TQ7P 2QA4T 4Y91A 1M4ZA 2PVOB 1C6VX 2DYIA 1ZHIA 5EG2A 2DA9A 3CCMT 1WA7A 2COWA 3CCEQ 2XMFA 1VQ4A 2DBMA 1VQNT 3U23A 2LC4A 2QAZA 1B07A 2HNIA 1PD1A 1QVGS 2J6FA 3A8GB 1Q7YU 3DLLA 4X1VA 3FJ5A 1Q81U 2RD1A 3RMQA 1RADB 4C5EA 3VS1A 1XNIA 3OBWA 4HXJA 3OS0A 3RNJA 3TCJA 2IIMA 3WXMB 2YRDA 2R5AA 4C5IA 4DBHA 1GBQA 2E5QA 3GNFB 2OI3A 1N5ZA 5GAOm 1VQ6A 1LPLA 1WJRA 2SEMA 4J83A 1VQ8T 1YWPA 1NLOC 3EFOA 3V8LA 1VQOQ 4MMLA 1VQ4Q 5CQYA 5LJ3e 2XHCA 2VUBA 4E7ZA 2EYZA 2J06A 1XQHA 2RJFA 2FPEA 1YJWA 3JB9H 2KYBA 5CQXA 2KDSA 3V7RA 2DYBA 2PNIA 4QVDA 1T0JA 1NEBA 3RKYA 2B86A 1NPRA 1UTIA 2EQKA 2ROLA 1IZ6A 3RIRA 3S3MA 5DLOA 3OYHA 3CCQQ 1QWFA 3I55A 1NZ9A 3PVQA 4NL3A 4F04B 1W2BS 2XKOC 1QVGA 4M75D 2YHTA 3HSBA 1W6XA 4RTUA 4CI0C 3OW2A 4PL6A 1IB8A 2ZPFB 1VQKA 1I4K1 1M1GA 3G6EQ 4RTWA 2DAQA 2ZPIB 1TUDA 4BDZA 2FG0A 2DVEA 4M7DD 4C92D 2O88A 3CXCP 1KG1A 3RR6A 2EPDA 4JZ4A 2EYYA 4PJNA 3TEEA 1QLYA 4EMKA 4ELYC 2JZ2A 3HTRA 5HY6A 3X28B 3L2QA 3ZL7C 2DTIA 2EW3A 5FLXE 3CCVA 1PNJA 4C92F 3OQ5A 1SSFA 3PE0A 1YJ9A 3O5ZA 3OB9A 1Q86U 5GJVB 1NG2A 4PFPA 3LGLA 1WHKA 1QCOA 2FEIA 2E10A 2VKNA 3JCMX 3JCMd 4QQ6A 1KD1R 2F2WA 4RTXA 2XDDA 2DRMA 2LNVA 4DA4A 3HKSA 1G3TA 2YUOA 2E12A 2OAWA 1Y96B 3QYGB 3FJPA 4AG2C 5KYUB 1UJYA 1BI0A 2LVMA 2YSQA 2KRMA 3LYIA 4BUGA 1KFZA 1VQ6T 3IQLA 2EQUA 2M0OA 4WCIA 1D0ZA 5FWBA 3I9QA 1LVKA 1YI2A 1PRLC 1WDXA 1ZUKA 1UG1A 3CBMA 4K11A 4C8QG 1PD0A 2X3XD 3QUIA 5A2QE 1Q86R 4J9HA 2RH2A 1DJ7B 2L0AA 4KH1B 1X43A 2V8KA 2JUFA 4ZN1A 3ASKA 4BDYA 3CXCA 1VOMA 2KT8A 2I0NA 4FT4A 1I5OB 2RI2A 3JCMW 3L42A 3ER0A 4XQ3A 4AT1B 1P92A 1MV3A 1M8MA 2PZ1A 4BY6B 2VB6A 5LJ5d 1UB4A 2CZ6B 2GTOA 5CK9A 3ULRB 2DVJA 1K8AU 1M1KC 1Y0MA 1RACB 3MEWA 4BI3A 3VU3C 1KIKA 4JRPA 4J6WA 3EHQA 2A28A 4L6V5 5KYWA 4C92C 1X6BA 4P5NA 1UHCA 2RQUA 3BFMA 3D7SB 4O6JA 2ZPBB 3CCET 1TXQA 1VYUA 3QHSA 1U3OA 1VQ7A 2IVWA 2ZPGB 3MPUB 4X9DA 1WXTA 5IT9E 3A8HB 4C0GA 5GAOl 1AVZC 2DERA 4DEYA 2QEXQ 1IHVA 4FCYA 3VS7A 3JCMc 2RQVA 3LH5A 5GMKh 2DRKA 1UDLA 5D6WA 3VKIA 5AYFA 4C92G 3CC4A 1MGQA 2KYMA 1M2OA 1NYFA 1VQ5T 2JT4A 1K73C 2VGNA 2L5QA 2QDYB 4HVWA 4KBMB 1OQKA 1GRIA 2RJEA 3QG1A 5GMKm 5IH2A 1SF9A 2NUZA 3GIBA 2DKGA 4C0DC 3JCMf 2LQNA 2QQSA 5GAN5 3OS2A 4BACA 3E9FA 3JCMh 1T3SA 2HKNA 1T0HA 2K3XA 1R0CB 3H0FA 1UGSB 3BW1A 3META 3EGXA 2RO0A 4OF1A 4E7KA 3QWYA 5GAMh 2CSQA 3G6EA 4BE1A 1QW1A 2RNAA 2XICA 2AK5A 5LJ5h 4JJCA 5GANf 3CCLQ 1AT1B 4M7AF 5LJ5f 4N4HA 2O9SA 1NLPC 3GNGA 2VYTA 2KT1A 2O4XB 4PLIA 1BKBA 4PJOF 4ZGDB 3EH2A 1X6GA 2D8HA 3M0SA 1HSQA 1U1TA 5I22A 5IXBA 3G71T 4PJOB 4UC4A 2COZA 4YTLA 5GMKl 5GJWB 2FYKA 2LCCA 5J39A 3MJXA 5CKDA 3VRZA 3CMAA 4M77B 7AT1B 1JJ2S 5FRMA 4FT2A 1NE8A 1BIAA 3BY7A 4CC7A 2HSEB 1YI2Q 1KC8C 3UT1A 5LL6S 1D1CA 2A0FB 2JN0A 3NTHA 4KH0B 2QQAA 4JS5A 3G71Q 3RKWA 2K79A 1K9MR 2NUTB 5LJ3j 1X6OA 1RABB 4JRKA 1AWOA 2RK1A 3V7SA 2F5TX 2HMAA 3MEVA 2YWWA 4A4HA 9ATCB 2JW4A 4X34A 5FWCA 2Y4XA 1QVFP 2EAYA 4BB7A 3QDRB 1V29B 2DTHA 3S3NA 1BYMA 2ATCB 3O8VA 2EGEA 4LUDA 4N0AA 2E6NA 2V1RA 2YT6A 1FXXA 1WHLA 5LJ3f 1AZEA 1VQ6Q 1V1CA 2JJ9A 3OYLA 3OYMA 1JQQA 4X9CA 3OY9A 2CYZB 2NWMA 2GNCA 1OU8A 3QPHA 4DBFA 1OPLA 2CKKA 1VQLQ 2DL4A 2QTXA 5FROA 4RCCA 1SPKA 2GBQA 4DOVA 2RJCA 2QQBA 4PJMA 3I35A 4WTOB 3TSWA 2FRWA 2CP5A 2DXCA 4MMKA 4LD9K 5GAMg 1JXOA 2K6DA 4FYYB 2C0TA 1WZOA 2FRYA 2KRNA 4QVCA 1Q81R 1H92A 1VQ4T 1SSHA 1ABOA 1QCNA 4OP0A 3CCSQ 1M90U 1YJNA 2H3EB 1TOVA 2AZSA 4KUIA 5GAMj 2QEXA 2DJQA 3DKMA 4GY5A 3H0IA 2HBPA 1BBZA 4QQDA 4DQ2A 2YUPA 4XK8E 4ZNXA 1IGUA 2JXBA 2LT4A 1F1BB 1RI9A 1D1BA 5L23A 2JTMA 2QGGA 2RPNA 5KYYB 2K3YA 2EJ9A 4M7AG 3CCST 3VS6A 2DO3A 4ANJA 2ZPHB 2CDTA 4JJNK 3A5ZB 3CPWS 4HA8A 1RAIB 2VV5A 2FHDA 2LX7A 3HFOA 5CAIA 3M56A 2XU8A 1N27A 4M7DA 2QGFB 2RI3A 4DBRA 1G3SA 4M75B 3VS3A 3HRUA 2FZCB 4JPBW 2R58A 2RA2A 1JU5C 3CPFA 4E7JA 4A53A 1LOJA 4LE9A 5IN1A 3MO8A 2VC8A 4HKEA 3E9GA 3QDFA 2KRSA 3INZA 1BI3A 4M7AC 1SRMA 5GAN2 1QP2A 5CVIA 1PCXA 2MI6A 1WNLA 1XTDA 1UE9A 4ZGEB 2GF7A 3CCEA 1S72A 3WVDB 2NLUA 4RMOA 5KE3A 4Y28E 4AMCA 2ZCFB 3PIOA 1RLPC 2YUNA 4F7UA 1PG5B 4OB3B 4M75E 4Q5WA 1X69A 4D8DA 3FDRA 3EG9A 4M78F 3UDCA 2A7YA 4IUUA 1K8AC 3CCRA 4M7AB 2DLPA 4E7SA 1OULA 5DLQE 4NL2A 3TSZA 2OTJQ 2RHUA 1LNXA 3LX7A 2FZKB 1WHMA 1O75A 2CH4A 5LJ3h 2GQIA 4MZMA 1M2VB 3PNWC 4IUQA 4Z8AA 2QQ9A 1XOVA 1YJWT 1H3HA 4HCCA 1MHNA 2K9GA 5HCKA 4LDVA 3S3OA 5KYWB 2A3LA 3A98A 5KH6A 4M7AE 1SHFA 3QYHB 1E6GA 1VQNA 1UGQB 5GAOr 2WSCE 5KYNA 2YLBA 4C0DB 5DM7R 2E64A 1YN8A 4GLKA 2M1HA 1M3BA 2DNUA 3JAME 2DIGA 4C8QD 4CC4B 5KCOA 1YI2T 1U5SA 4Z88A 4C0ZA 4L5GA 2DE0X 1X27A 1N8RU 4OVAA 4QT7A 3CD6A 2KROA 2KXDA 4LXCA 3N5BB 2RK2A 1AWJA 3H41A 1ZLMA 2GTJA 2JTFA 4E7LA 1K1ZA 1WGSA 1OI1A 4PK4A 2RB6A 4FYVB 2JVVA 1WPYA 2FPDA 1UECA 2HAXA 1YP5A 1SHGA 4PFOA 2QDLA 1BCMA 2F2XA 1R0BG 2DILA 4KGXB 4M75G 1AWXA 1QVGP 3VUZA 2RF0A 4B9XA 3PTAA 1WJSA 2YDLA 2CREA 2FZGB 1K4US 5FW9A 1ZQ1A 3A8LB 3OYYA 3M0RA 4IKFA 1K76A 4IUTA 2DXUA 3M0PA 1M3CA 1YJ9T 3C0CA 2PUOB 2X4JA 1WIEA 4XTVA 2VGMA 4L59A 1K73R 4DOWA 3NMZC 1S1NA 3J80E 1VQPQ 4ZTJA 2DPPB 3FC3A 4LUEA 5CCAA 3G4ST 3G6ET 1QQJA 4HCBA 4AFSC 5GMKj 3CCRT 2EQJA 3GBQA 4N4IA 2XDBA 2K2MA 2O4XA 3PVLA 2CZ7B 2LRQA 4AG1C 2P0PA 3M57A 3LGFA 2HL3A 2X35A 2X3WD 3URGA 1ZA1B 2BZ8A 1YIJQ 3AT1B 4CC3A 3QJYA 2F2VA 5I2MA 3UF4A 3MHXA 3RUXA 1IREB 4FM4B 2QG9B 2BKDN 4PFZA 3E2UA 3EFOB 1UGVA 3CC2Q 3NTIA 1M9SA 2V8JA 1M1KR 2ESWA 1WJQA 1GBRA 3HFNA 4A4GA 1ARKA 2AIRB 2ZPEB 1G3YA 3SWNC 4BD3A 1YIJT 1MMAA 3M55A 3KBGA 2DF6A 1JJ2A 1YJNQ 4EMHA 2P84A 5FU7C 4XTYA 3CCUT 2YXYA 3OYEA 2C06A 2OTLQ 2LX9A 1JXMA 2YRVA 2DK3A 2RQTA 1WYXA 2FO0A 4XTXA 3LWHA 4RTTA 2QASA 1PM3A 1JBMA 3VJPA 4QQGA 2DXBA 1AEYA 2CP3A 2E65A 2CS7A 4XU2A 5FU6B 1G3WA 2JMAA 3REBB 3UA6A 1U8RA 3CMEA 3WVEB 2KY9A 4WF2A 4B6MA 1B7TA 5GANg 1KJWA 4RKUE 1RI0A 1FWZA 3CMAT 4J7FA 4EMKC 2AKKA 5CIUA 4C92B 3SHWA 1PKSA 3JB9F 1WFWA 1D3BB 4RG8A 1QCFA 2XG8D 5CR2A 1VQ9Q 3OYGA 1WQ7A 1KK7A 3QJ6A 1WI7A 1YHQT 4M77G 1WHJA 2K7AA 1N8RC 4J6YA 3CXCS 2W0ZA 1KD1C 3HRTA 4OB1B 2OAUA 2MWPA 5GAMf 3EHRA 3QO3A 4DEXA 5HKCA 2QK0A 4LD6A 3J81E 1NYGA 4F16A 1TH7A 3OW2S 1J3TA 3REAB 3QSUA 2DD4A 2RHXA 2A36A 2M51A 4FYWB 2EWNA 1JB0E 5FRNA 2E5KA 3CC4Q 2D1XA 1YCYA 3OYAA 6AT1B 1FMKA 4M75F 3BDLA 1IGQA 1OX9A 1KQSP 1QKXA 2RHYA 1PRMC 5GAOp 3C4SA 2QEXT 1H641 1X01A 1XJWB 1VQ8Q 2M9UA 5GAN4 4M77C 4BE2A 1G5VA 2QA4A 2K2VA 4ZTFA 2KR3A 2NUPA 2E3IA 3L2ZA 2LQKA 3OMGA 4PJOA 1RAAB 2HD0A 2JMCA 2O31A 2A37A 2L89A 3OW2P 1SKUB 2D8JA 4A4FA 3CPWP 2E41A 1ZSGA 1OZ3A 2LT1A 3M9QA 1PC0A 3C12A 1EFNA 3M58A 3CQTA 4PNOA 1ZA2B 2DETA 1NPPA 4M78A 2Y4YA 4C92E 5C0MA 4IIOA 1MNEA 5A0GA 3TVTA 1MMNA 5DY9A 4JRQA 3LLRA 2DTOA 3C94A 3TREA 3X24B 3JV3A 5J3BA 2JS2A 3CMET 2RQWA 1UJ0A 3H9NA 4JLIA 5LJ3d 1VQMQ 2LQ8A 4GBQA 3CC7A 1PKTA 4PJOC 4OMLA 1W1FA 1WHHA 1YFNA 2KEAA 2F5KA 1VQ9A 4ATOA 2HQXA 1VQ7Q 1ZBXA 2QXFA 1K8AR 5CO7A 4C5HA 2YRCA 3QIIA 4XTWA 3JCMV 2MOXA 3CMAQ 2KE9A 1SEMA 3VV0A 2X51A 3OBYA 4ORZA 4R0KA 3SD4A 2CGHA 2ZZDA 1D09B 2L2PA 4QVZA 2BZYA 3EGDA 1QVPA 3MP6A 3MP8A 3M59A 3M0UA 4QKUA 3CC7Q 1YNZA 2HQHA 4HCZA 2CP2A 2JTEA 2O01E 2RMOA 5HK3A 3CCJT 5D6XA 2NYSA 1RAGB 2JOYA 3QBYA 1KQ1A 5LJ5j 2L3PA 4JUVA 3KUFA 4E7IA 3SWNB 1AZGB 4C8QF 2FPFA 2QQRA 4M78D 2CP0A 1RAHB 3EG0A 1I5LA 3JCMb 2KXCA 3SDZA 3I56Q 4A4KA 1UGPB 5GMKi 3SFMA 2EQIA
chains in the Genus database with same CATH topology
1GL5A 2DLPA 5GJVB 1NG2A 1GFCA 3TSZA 2AKLA 2FEIA 2VKNA 1K0XA 2CH4A 2DM1A 2DL8A 2GQIA 4LNPA 2F2WA 4RTXA 1HD3A 2DRMA 4Z8AA 2SRCA 1XOVA 2W10A 1H3HA 2YUOA 3NHNA 2LJ0A 2OAWA 2K9GA 5HCKA 1RLQC 4AG2C 1UJYA 3A98A 1JO8A 1SHFA 4AFQC 4GLMA 1E6GA 1BU1A 3KFVA 2YSQA 2KRMA 1U06A 2C0OA 3VRYA 1LCKA 1YN8A 1KFZA 2VWFA 4D8KA 3IQLA 1ABQA 2JS0A 2RQRA 4WCIA 1M3BA 3RBBB 2DNUA 5FWBA 4J9BA 3I9QA 5EC7A 1GCPA 4CC4B 1PRLC 1WDXA 1ZUKA 1U5SA 1UG1A 4K11A 4Z88A 1UUEA 2DE0X 2CH4W 2X3XD 1QWEA 1X27A 3VS2A 4J9HA 4QT7A 4LN2A 1E7OA 2KROA 5IXFA 2KXDA 3SEMA 2L0AA 1TUCA 1AWJA 1X43A 3H41A 1ZLMA 2HCKA 2GTJA 3THKA 1WXBA 1K1ZA 3EG3A 2FPDA 1UECA 2KT8A 2G6FX 1YP5A 1WX6A 1SHGA 2I0NA 2QDLA 2DL7A 1ZBJA 1TG0A 1WLPB 4J9EA 2F2XA 1MV3A 2DILA 1M8MA 2PZ1A 1AWXA 2LJ3A 2RF0A 2GTOA 4HVVA 3ULRB 2DVJA 2YDLA 2DMOA 1MUZA 2CREA 1K4US 1Y0MA 5FW9A 3M0RA 4EIKA 2HEQA 1K76A 3M0PA 4KRTA 1M3CA 1I0CA 3C0CA 4RUGA 2EVRA 1KIKA 1B3QA 3EHQA 5ECAA 1WIEA 2A28A 2LMJA 4HVUA 1X6BA 2CUDA 2EGAA 1CKBA 1UHCA 2RQUA 1UFFA 3NMZC 1S1NA 4LUEA 4ESRA 1NEGA 1VYUA 1G83A 1U3OA 2DX1A 1VA7A 1WXTA 2BZXA 1AWWA 1I1JA 4AFSC 2J6OA 3GBQA 1AVZC 4DEYA 2K2MA 3PVLA 3VS7A 1Z9ZA 3M0TA 1E6HA 2L3SA 4AG1C 2RQVA 1CKAA 3LH5A 2DRKA 1UDLA 1HJDA 2X3WD 1UHFA 2K3BA 2BZ8A 1OPKA 1H8KA 2KYMA 2EGCA 2O2OA 1IO6A 1NYFA 2JM9A 4CC3A 2A08A 2JT4A 4OMPA 1M30A 1GCQC 2F2VA 4HVWA 3UF4A 2KBTA 1GRIA 1AOJA 1UGVA 1WXUA 5IH2A 4A63B 4FSSA 2LCSA 2NUZA 2LQNA 2ESWA 2HBWA 2YUQA 4RTZA 1GBRA 3H0HA 1ARKA 1T3SA 3I5SA 1T3LA 1T0HA 3M0QA 3H0FA 4F14A 1PWTA 3QWYA 2CT4A 2CSQA 2DF6A 4JZ3A 4RTYA 2P4RA 4AFUC 3EG2A 2RNAA 2AK5A 1BB9A 1K9AA 1ZUYA 1VYVA 4JJCA 1ZX6A 1JXMA 2PTKA 4AFZC 2RQTA 1WYXA 2O9SA 2FO0A 2ED1A 2VVKA 1PHTA 1NLPC 4RTTA 1YWOA 2KT1A 2LQWA 2HDAA 4HCKA 4J9CA 1AEYA 1X6GA 2D8HA 2L3QA 3M0SA 3REBB 3UA6A 2JMAA 1JEGA 1HSQA 5I22A 5IXBA 2O9VA 5GJWB 1AD5A 1CSKA 4J9DA 2D0NA 1KJWA 2ABLA 3VRZA 4E6RA 4Y92A 2AKKA 3SHWA 1PKSA 2EBPA 1SRLA 4CC7A 1WFWA 3EGUA 1G2BA 2EYXA 1A0NB 1QCFA 2V1QA 2M0YA 2LNHB 4OMNA 1WI7A 4IIMA 2K7AA 4OMQA 2W0ZA 2K79A 2LZ6B 2ENMA 2ROTA 1AWOA 3EHRA 4DEXA 2OJ2A 4Z89A 1NYGA 1K0SA 1OOTA 4F16A 2JW4A 2J6KA 5FWCA 2MCNA 1J3TA 1NM7A 1M3AA 3EG1A 2EKHA 3REAB 4JJDA 2A36A 2M51A 2CUBA 2E5KA 2J05A 3UA7A 1YCSB 2EGEA 5IHKA 2D1XA 1BK2A 4LUDA 1FMKA 2CT3A 2AZVA 2J7IA 4J9FA 2EYWA 1KSWA 5IHNA 2V1RA 2YT6A 2GGRA 1QKXA 1PRMC 1OEBA 2LP5A 1W70A 3VS5A 4J9GA 1AZEA 1V1CA 1JQQA 4RTVA 5I11A 2NWMA 2GNCA 2DA9A 2KR3A 1WA7A 4OMMA 2XMFA 1OPLA 2DBMA 3UATA 3VS4A 3U23A 2DL4A 2JMCA 1B07A 2O31A 1SPKA 2GBQA 2J6FA 2A37A 1VYTA 4X1VA 3FJ5A 2D8JA 3I35A 1GFDA 3TSWA 2FRWA 1ZSGA 3VS1A 2BTTA 1JXOA 2K6DA 4HXJA 1EFNA 2C0TA 3RNJA 2IIMA 2FRYA 2KRNA 3CQTA 1X2QA 2HSPA 1GCQA 1H92A 1GBQA 4IIOA 1SSHA 2OI3A 1N5ZA 3TVTA 2SEMA 3I5RA 1ABOA 1YWPA 3JV3A 2JS2A 1NLOC 2RQWA 1UJ0A 4J9IA 3NGPA 2AZSA 2EYZA 1Z9QA 2DBKA 2DJQA 2J06A 4GBQA 2FPEA 1PKTA 1MV0B 4OMLA 1W1FA 2KYBA 3H0IA 2KEAA 1BBZA 2DL3A 2DYBA 2PNIA 1T0JA 2YUPA 4ZNXA 1NEBA 2JXBA 2DL5A 2B86A 2ECZA 1RI9A 2RN8A 2JM8A 3R6NA 5L23A 1UTIA 4F17A 2RPNA 2MOXA 2ROLA 2KE9A 1SEMA 2H8HA 3VS6A 1QWFA 4ORZA 4R0KA 2CDTA 3PVQA 2LJ1A 1OV3A 1QKWA 2LX7A 4JJBA 2L2PA 2BZYA 1W6XA 4RTUA 3VS3A 2MIOA 4JPBW 3M0UA 1JU5C 4M4ZA 4LE9A 4RTWA 1YNZA 5IHIA 4CC2A 2JTEA 1TUDA 2FG0A 2KRSA 2RMOA 2O88A 1Y57A 1I07A 1SRMA 2L3PA 2EPDA 4JZ4A 2EYYA 2KNBB 1FYNA 1QLYA 1AZGB 2FPFA 3NPFA 1UE9A 4OMOA 1RUWA 3QWXX 1X2KA 3ZL7C 1RLPC 2CSIA 2YUNA 3EG0A 1X69A 2EW3A 2KXCA 4D8DA 3VS0A 1M27C 2C0IA 2ED0A 1ZUUA 1PNJA 2EQIA 2KGTA 3PE0A 3O5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GL5 A;  2DLP A;  5GJV B;  1NG2 A;  1GFC A;  3TSZ A;  2AKL A;  2FEI A;  2VKN A;  1K0X A;  2CH4 A;  2DM1 A;  2DL8 A;  2GQI A;  4LNP A;  2F2W A;  4RTX A;  1HD3 A;  2DRM A;  4Z8A A;  2SRC A;  1XOV A;  2W10 A;  1H3H A;  2YUO A;  3NHN A;  2LJ0 A;  2OAW A;  2K9G A;  5HCK A;  1RLQ C;  4AG2 C;  1UJY A;  3A98 A;  1JO8 A;  1SHF A;  4AFQ C;  4GLM A;  1E6G A;  1BU1 A;  3KFV A;  2YSQ A;  2KRM A;  1U06 A;  2C0O A;  3VRY A;  1LCK A;  1YN8 A;  1KFZ A;  2VWF A;  4D8K A;  3IQL A;  1ABQ A;  2JS0 A;  2RQR A;  4WCI A;  1M3B A;  3RBB B;  2DNU A;  5FWB A;  4J9B A;  3I9Q A;  5EC7 A;  1GCP A;  4CC4 B;  1PRL C;  1WDX A;  1ZUK A;  1U5S A;  1UG1 A;  4K11 A;  4Z88 A;  1UUE A;  2DE0 X;  2CH4 W;  2X3X D;  1QWE A;  1X27 A;  3VS2 A;  4J9H A;  4QT7 A;  4LN2 A;  1E7O A;  2KRO A;  5IXF A;  2KXD A;  3SEM A;  2L0A A;  1TUC A;  1AWJ A;  1X43 A;  3H41 A;  1ZLM A;  2HCK A;  2GTJ A;  3THK A;  1WXB A;  1K1Z A;  3EG3 A;  2FPD A;  1UEC A;  2KT8 A;  2G6F X;  1YP5 A;  1WX6 A;  1SHG A;  2I0N A;  2QDL A;  2DL7 A;  1ZBJ A;  1TG0 A;  1WLP B;  4J9E A;  2F2X A;  1MV3 A;  2DIL A;  1M8M A;  2PZ1 A;  1AWX A;  2LJ3 A;  2RF0 A;  2GTO A;  4HVV A;  3ULR B;  2DVJ A;  2YDL A;  2DMO A;  1MUZ A;  2CRE A;  1K4U S;  1Y0M A;  5FW9 A;  3M0R A;  4EIK A;  2HEQ A;  1K76 A;  3M0P A;  4KRT A;  1M3C A;  1I0C A;  3C0C A;  4RUG A;  2EVR A;  1KIK A;  1B3Q A;  3EHQ A;  5ECA A;  1WIE A;  2A28 A;  2LMJ A;  4HVU A;  1X6B A;  2CUD A;  2EGA A;  1CKB A;  1UHC A;  2RQU A;  1UFF A;  3NMZ C;  1S1N A;  4LUE A;  4ESR A;  1NEG A;  1VYU A;  1G83 A;  1U3O A;  2DX1 A;  1VA7 A;  1WXT A;  2BZX A;  1AWW A;  1I1J A;  4AFS C;  2J6O A;  3GBQ A;  1AVZ C;  4DEY A;  2K2M A;  3PVL A;  3VS7 A;  1Z9Z A;  3M0T A;  1E6H A;  2L3S A;  4AG1 C;  2RQV A;  1CKA A;  3LH5 A;  2DRK A;  1UDL A;  1HJD A;  2X3W D;  1UHF A;  2K3B A;  2BZ8 A;  1OPK A;  1H8K A;  2KYM A;  2EGC A;  2O2O A;  1IO6 A;  1NYF A;  2JM9 A;  4CC3 A;  2A08 A;  2JT4 A;  4OMP A;  1M30 A;  1GCQ C;  2F2V A;  4HVW A;  3UF4 A;  2KBT A;  1GRI A;  1AOJ A;  1UGV A;  1WXU A;  5IH2 A;  4A63 B;  4FSS A;  2LCS A;  2NUZ A;  2LQN A;  2ESW A;  2HBW A;  2YUQ A;  4RTZ A;  1GBR A;  3H0H A;  1ARK A;  1T3S A;  3I5S A;  1T3L A;  1T0H A;  3M0Q A;  3H0F A;  4F14 A;  1PWT A;  3QWY A;  2CT4 A;  2CSQ A;  2DF6 A;  4JZ3 A;  4RTY A;  2P4R A;  4AFU C;  3EG2 A;  2RNA A;  2AK5 A;  1BB9 A;  1K9A A;  1ZUY A;  1VYV A;  4JJC A;  1ZX6 A;  1JXM A;  2PTK A;  4AFZ C;  2RQT A;  1WYX A;  2O9S A;  2FO0 A;  2ED1 A;  2VVK A;  1PHT A;  1NLP C;  4RTT A;  1YWO A;  2KT1 A;  2LQW A;  2HDA A;  4HCK A;  4J9C A;  1AEY A;  1X6G A;  2D8H A;  2L3Q A;  3M0S A;  3REB B;  3UA6 A;  2JMA A;  1JEG A;  1HSQ A;  5I22 A;  5IXB A;  2O9V A;  5GJW B;  1AD5 A;  1CSK A;  4J9D A;  2D0N A;  1KJW A;  2ABL A;  3VRZ A;  4E6R A;  4Y92 A;  2AKK A;  3SHW A;  1PKS A;  2EBP A;  1SRL A;  4CC7 A;  1WFW A;  3EGU A;  1G2B A;  2EYX A;  1A0N B;  1QCF A;  2V1Q A;  2M0Y A;  2LNH B;  4OMN A;  1WI7 A;  4IIM A;  2K7A A;  4OMQ A;  2W0Z A;  2K79 A;  2LZ6 B;  2ENM A;  2ROT A;  1AWO A;  3EHR A;  4DEX A;  2OJ2 A;  4Z89 A;  1NYG A;  1K0S A;  1OOT A;  4F16 A;  2JW4 A;  2J6K A;  5FWC A;  2MCN A;  1J3T A;  1NM7 A;  1M3A A;  3EG1 A;  2EKH A;  3REA B;  4JJD A;  2A36 A;  2M51 A;  2CUB A;  2E5K A;  2J05 A;  3UA7 A;  1YCS B;  2EGE A;  5IHK A;  2D1X A;  1BK2 A;  4LUD A;  1FMK A;  2CT3 A;  2AZV A;  2J7I A;  4J9F A;  2EYW A;  1KSW A;  5IHN A;  2V1R A;  2YT6 A;  2GGR A;  1QKX A;  1PRM C;  1OEB A;  2LP5 A;  1W70 A;  3VS5 A;  4J9G A;  1AZE A;  1V1C A;  1JQQ A;  4RTV A;  5I11 A;  2NWM A;  2GNC A;  2DA9 A;  2KR3 A;  1WA7 A;  4OMM A;  2XMF A;  1OPL A;  2DBM A;  3UAT A;  3VS4 A;  3U23 A;  2DL4 A;  2JMC A;  1B07 A;  2O31 A;  1SPK A;  2GBQ A;  2J6F A;  2A37 A;  1VYT A;  4X1V A;  3FJ5 A;  2D8J A;  3I35 A;  1GFD A;  3TSW A;  2FRW A;  1ZSG A;  3VS1 A;  2BTT A;  1JXO A;  2K6D A;  4HXJ A;  1EFN A;  2C0T A;  3RNJ A;  2IIM A;  2FRY A;  2KRN A;  3CQT A;  1X2Q A;  2HSP A;  1GCQ A;  1H92 A;  1GBQ A;  4IIO A;  1SSH A;  2OI3 A;  1N5Z A;  3TVT A;  2SEM A;  3I5R A;  1ABO A;  1YWP A;  3JV3 A;  2JS2 A;  1NLO C;  2RQW A;  1UJ0 A;  4J9I A;  3NGP A;  2AZS A;  2EYZ A;  1Z9Q A;  2DBK A;  2DJQ A;  2J06 A;  4GBQ A;  2FPE A;  1PKT A;  1MV0 B;  4OML A;  1W1F A;  2KYB A;  3H0I A;  2KEA A;  1BBZ A;  2DL3 A;  2DYB A;  2PNI A;  1T0J A;  2YUP A;  4ZNX A;  1NEB A;  2JXB A;  2DL5 A;  2B86 A;  2ECZ A;  1RI9 A;  2RN8 A;  2JM8 A;  3R6N A;  5L23 A;  1UTI A;  4F17 A;  2RPN A;  2MOX A;  2ROL A;  2KE9 A;  1SEM A;  2H8H A;  3VS6 A;  1QWF A;  4ORZ A;  4R0K A;  2CDT A;  3PVQ A;  2LJ1 A;  1OV3 A;  1QKW A;  2LX7 A;  4JJB A;  2L2P A;  2BZY A;  1W6X A;  4RTU A;  3VS3 A;  2MIO A;  4JPB W;  3M0U A;  1JU5 C;  4M4Z A;  4LE9 A;  4RTW A;  1YNZ A;  5IHI A;  4CC2 A;  2JTE A;  1TUD A;  2FG0 A;  2KRS A;  2RMO A;  2O88 A;  1Y57 A;  1I07 A;  1SRM A;  2L3P A;  2EPD A;  4JZ4 A;  2EYY A;  2KNB B;  1FYN A;  1QLY A;  1AZG B;  2FPF A;  3NPF A;  1UE9 A;  4OMO A;  1RUW A;  3QWX X;  1X2K A;  3ZL7 C;  1RLP C;  2CSI A;  2YUN A;  3EG0 A;  1X69 A;  2EW3 A;  2KXC A;  4D8D A;  3VS0 A;  1M27 C;  2C0I A;  2ED0 A;  1ZUU A;  1PNJ A;  2EQI A;  2KGT A;  3PE0 A;  3O5Z A; 
#chains in the Genus database with same CATH topology
 1GL5 A;  3CC2 A;  1HK9 A;  1NBE B;  2K5I A;  1M5Q 1;  1YJW Q;  4KT0 E;  4XAX B;  3CD6 Q;  3OS5 A;  2JNG A;  2DM1 A;  2DL8 A;  2ZGW A;  4LNP A;  1G8X A;  5FU6 C;  1MMD A;  1HD3 A;  2W10 A;  1C1A A;  3DB3 A;  3PFS A;  4M7D F;  3HP9 A;  5KYY A;  2QTV A;  1M1F A;  2F69 A;  4OGE A;  1VQO T;  3OYF A;  2D0Q B;  1JO8 A;  3UWN A;  2LDM A;  3ZBD A;  4AFQ C;  4R56 A;  1BU1 A;  3KFV A;  3ZFJ A;  4XU1 A;  3VRY A;  2MWO A;  1LCK A;  4M77 A;  2FB7 A;  1LJO A;  2VWF A;  2RQR A;  3RBB B;  1NJI C;  1UGR B;  4RCB A;  4J9B A;  1M1K U;  1GCP A;  3NTK A;  1YBY A;  1UUE A;  1VQ9 T;  4KGZ B;  1VQL A;  5GAN 6;  3VS2 A;  2MPX C;  5KYX A;  4LN2 A;  1ZSZ A;  5A0L A;  4LDY A;  3CCV T;  1KC8 U;  1RAF B;  3CCL A;  3OMC A;  4XTU A;  2XD0 A;  1N8R R;  3ME9 A;  2XI9 A;  5GAO n;  1WX6 A;  2DL7 A;  1ZBJ A;  3RKX A;  4J9E A;  3LH0 A;  2KK4 A;  3EG9 B;  4C8Q C;  2DIQ A;  2QA4 Q;  2LJ3 A;  1UEB A;  2K4Y A;  4HVV A;  2DMO A;  4NS5 A;  4OB0 B;  3M5A A;  2HEQ A;  1VQ5 Q;  1TSF A;  1V76 A;  2IPO B;  4RUG A;  1VQP T;  4R55 A;  1GXI E;  4HVU A;  1YJN T;  1K9M C;  1ZSZ C;  3V7C A;  1UFF A;  4M77 E;  2MYS A;  5AT1 B;  5D7U A;  3JCM e;  3OSS C;  2VXE A;  1G83 A;  1Y7X A;  4JDS A;  3G4S A;  1H3Z A;  3V8K A;  2BIV A;  2X4X A;  3E1S A;  1KQ2 A;  1VA7 A;  1AWW A;  4XU3 A;  1Y07 A;  1I1J A;  4OMF B;  4ZN3 A;  3S6W A;  3FIF A;  2J6O A;  2BUD A;  2CZ0 B;  5CKB A;  3BE3 A;  2DEU A;  2CP6 A;  2V26 A;  4C8Q A;  1Z9Z A;  1E6H A;  2L3S A;  2XK0 A;  1CKA A;  3MEA A;  5GAO q;  1Q7Y R;  1HJD A;  2QI2 A;  1UHF A;  3P8B B;  1OPK A;  4J7I A;  1H8K A;  3CEY A;  1S72 T;  4JS4 A;  3HL8 A;  2EGC A;  2O2O A;  2JM9 A;  3Q1J A;  3GF5 A;  1K73 U;  1M30 A;  3RER A;  1GCQ C;  1SG5 A;  2X4W A;  4PJO D;  1Q82 U;  2MK5 A;  4FIB A;  1BI2 A;  1Y71 A;  1TWB A;  2PVD B;  1YIT T;  1HYO A;  4EMK B;  1EZZ B;  2R5M A;  2LTO A;  4FSS A;  1IHW A;  1KQS S;  1OYX A;  2VXF A;  1QVF S;  1BI1 A;  1D0Y A;  1FMW A;  4MDX A;  4RTZ A;  1I8F A;  2FVU A;  3I55 T;  2DJZ A;  4PLL A;  3G7Z A;  3I5S A;  1NJI U;  1T3L A;  2X9H A;  4OB2 B;  4F14 A;  5KCH A;  2GFU A;  4RTY A;  2P4R A;  2Y90 A;  4AFU C;  5C6S A;  3EG2 A;  3KXT A;  2P0Q A;  1PSE A;  4E7H A;  1VYV A;  3H6Z A;  3VUB A;  1ZX6 A;  1YIT A;  3MP1 A;  1VQK T;  1KHI A;  4A4E A;  2WSF E;  1IRX A;  2BE9 B;  1Q82 C;  4Z02 A;  1OU9 A;  3M4G A;  1YWO A;  4M75 A;  1W2B A;  2AT1 B;  2HDA A;  4BI8 B;  4HCK A;  2DEQ A;  4J9C A;  2P0K A;  1Y96 A;  3MEU A;  2KSS A;  5LJ5 g;  1JEG A;  5KYU A;  3FB9 A;  1CSK A;  4J9D A;  2RHI A;  4E6R A;  2EJG A;  1KHC A;  4ELZ C;  2EBP A;  1VQO A;  3PMI A;  1SRL A;  2X4Y A;  3EGU A;  1G2B A;  4KGV B;  4F7U B;  1A0N B;  3R6O A;  1QMC A;  2D9T A;  2L8D A;  3QZ5 B;  4OMN A;  4E47 A;  1C0M A;  1EX4 A;  2WAC A;  1KD1 U;  4OMQ A;  3H8Z A;  3J7A F;  5LJ5 e;  1N9R A;  5CKE A;  2ENM A;  1O9S A;  2OJ2 A;  4Z89 A;  2GCX A;  3HPW A;  1OOT A;  2CP7 A;  2E4H A;  2MCN A;  3JCM g;  3GP8 A;  2D6F A;  2EKH A;  2GFA A;  2RM4 A;  1EIF A;  2CUB A;  4F7U E;  3JSC A;  2J05 A;  3RMS A;  3UA7 A;  1YCS B;  5IHK A;  3E19 A;  1B34 B;  1BK2 A;  2NUT A;  1R77 A;  4EMG A;  5GAM e;  3FRN A;  2EYW A;  5IHN A;  3JRZ A;  4IUP A;  3JCM Q;  2YLC A;  1MMG A;  1OEB A;  2LP5 A;  1W70 A;  3VS5 A;  2QYZ A;  4FL6 A;  1W4S A;  4RTV A;  4XTZ A;  4KUD K;  5I11 A;  3CCM A;  1VQM A;  1Q86 C;  2DXT A;  4OMM A;  4DBQ A;  4RG2 A;  3UAT A;  4J8O A;  1YIT Q;  3VS4 A;  3CCS A;  3OYJ A;  3I56 T;  3CC4 T;  3HRS A;  1TS9 A;  5A0D A;  1VYT A;  3AHU A;  1I81 A;  3PGG A;  4M78 E;  4C92 A;  8ATC B;  3JB9 J;  1GFD A;  5J26 A;  5GAN 7;  2BTT A;  2MF2 A;  3CD6 T;  3OYB A;  3JB9 D;  1MND A;  1M8V A;  1Q95 G;  1X2Q A;  2DD5 A;  2HSP A;  1GCQ A;  4FW1 A;  3EAE A;  3I5R A;  1VIE A;  3BDU A;  1YHQ A;  4J9I A;  3NGP A;  1Z9Q A;  4VUB A;  2DBK A;  2H3J A;  3CCU Q;  1MV0 B;  3CCQ A;  2OTL T;  4E2F B;  2DL3 A;  2HKQ B;  4FW2 A;  2P4T A;  1PSF A;  2DL5 A;  3SB2 A;  2KVQ G;  3R6N A;  2ECZ A;  2KI7 A;  2JM8 A;  2RN8 A;  2XDP A;  1TU0 B;  5GMK e;  4FU6 A;  4EPC A;  2BE7 D;  2PU9 B;  4A54 A;  4F17 A;  1FX7 A;  3I55 Q;  2H8H A;  4MZT A;  2LJ1 A;  1OV3 A;  1QKW A;  3FLG A;  4LDU A;  4MDW A;  1BCO A;  4JJB A;  1VQ5 A;  3CME Q;  1YIJ A;  3QZ9 B;  4C0F A;  3CC7 T;  3CPW A;  4ME7 A;  1WQW A;  2NUP B;  5I21 A;  2MIO A;  3G4S Q;  4C5G A;  4F7U F;  4EDU A;  1D0X A;  4M4Z A;  3G1J A;  3CCU A;  5IHI A;  1OX8 A;  3L2R A;  4CC2 A;  3C95 A;  2E70 A;  1YHQ Q;  1VQ8 A;  1Y57 A;  4M7D B;  1I07 A;  5M9O A;  4JLG A;  2KNB B;  5GAM d;  1FYN A;  2MAM A;  1K9M U;  2IG0 A;  3NPF A;  4OMO A;  1RUW A;  2G3R A;  4M75 C;  3QWX X;  1ZSZ B;  3CCM Q;  1X2K A;  4M78 B;  1Q81 C;  2CSI A;  4V2S A;  1KQS A;  1N6A A;  3V8J A;  4II1 A;  3VS0 A;  1VQL T;  1M27 C;  2C0I A;  2ED0 A;  3L2W A;  5GAN 8;  1ZUU A;  2KGT A;  3UPU A;  3M4Y A;  4M7D C;  5CKH A;  5KE2 A;  3NFC A;  3CC2 T;  1GFC A;  2V8I A;  4M7D E;  2AKL A;  3JCM P;  2ZAE A;  2EFI A;  1K0X A;  3QKJ A;  3G71 A;  2HQE A;  2EJF A;  2SRC A;  3OA6 A;  3OYN A;  4PJO G;  2B8A A;  3A8O B;  2EYQ A;  3NHN A;  1N9S A;  3MCA B;  2LJ0 A;  3L1A A;  3X25 B;  2FL7 A;  1RLQ C;  5I2S A;  2WSE E;  4CRI A;  5CKF A;  5FU7 B;  3CBO A;  4GLM A;  1M2V A;  3VYH B;  1U06 A;  3EGD B;  2C0O A;  4D8K A;  1ABQ A;  2JS0 A;  2RJD A;  2RI5 A;  5EC7 A;  1YJ9 Q;  1R8O B;  3F70 A;  1D3B A;  4PKC C;  2CH4 W;  1QWE A;  2OTJ T;  3CCQ T;  2PUK B;  3QXE B;  1E7O A;  4NOY A;  5IXF A;  1Q82 R;  5LJ3 g;  3SEM A;  1TUC A;  3M53 A;  2HCK A;  3PIP A;  1W2B P;  3THK A;  1WXB A;  3EG3 A;  3EFR A;  4D6W A;  1WHG A;  2G6F X;  3TU4 K;  4LDW A;  3OYK A;  4J5Y A;  5GAN d;  1TG0 A;  1WLP B;  2DZ9 A;  1ACM B;  3DLM A;  4TVR A;  1KC8 R;  2MMP A;  1VUB A;  4FSX A;  5IAY A;  1VQ7 T;  1FMV A;  3P8D A;  1MUZ A;  5L8R E;  3EGX B;  3JB9 I;  3RDV A;  1JRI A;  2DZC A;  4EIK A;  4KRT A;  4M7D G;  1I0C A;  2EVR A;  3L2V A;  1B3Q A;  4M7A D;  5ECA A;  3GLX A;  2LMJ A;  2K5F A;  4IUR A;  2CUD A;  2EQM A;  2EGA A;  1CKB A;  3LWI A;  2Z0W A;  4ESR A;  1NEG A;  4M78 G;  5GAN 3;  3X20 B;  1X75 C;  2DX1 A;  3A1P A;  1Q7Y C;  2BZX A;  2LCL A;  2K57 A;  2HL5 C;  3M0T A;  1TTH B;  3VYG A;  1OZ2 A;  4MZP A;  4F7U G;  3T9N A;  3OS1 A;  1RAE B;  4PJL A;  2K3B A;  4QW2 A;  4O5V A;  5KYX B;  1M90 C;  3FEO A;  1QP3 A;  4J6X A;  1IO6 A;  2A08 A;  2E1H A;  4KUL A;  4OMP A;  3GPL A;  2L3R A;  4M77 F;  4BE0 A;  2KBT A;  2HZY A;  3A8M B;  3PT9 A;  1VQN Q;  1AOJ A;  1WXU A;  4A63 B;  4N4G A;  2EKO A;  2LCS A;  8AT1 B;  3MKD A;  2HBW A;  2YUQ A;  4HT8 A;  3H0H A;  3I56 A;  1AHJ B;  2E6Z A;  5GAN e;  3M0Q A;  3CCJ Q;  1PWT A;  2CT4 A;  1S72 Q;  4M7A A;  4JZ3 A;  1TUG B;  3EFS A;  2E3H A;  2M16 A;  1VQK Q;  4N0A C;  2KAF A;  1BB9 A;  1K9A A;  1ZUY A;  2K5L A;  1BIB A;  1HXD A;  1B34 A;  2PTK A;  3JCM J;  4AFZ C;  2ED1 A;  2VVK A;  1PHT A;  3HHT B;  1VQP A;  3DB4 A;  3OYC A;  1RL2 A;  1QVF A;  2LQW A;  3JB9 G;  3LW5 E;  3CBP A;  1M90 R;  3L2U A;  2L3Q A;  1NJI R;  4FYX B;  4C8Q B;  2PVG B;  2O9V A;  1AD5 A;  1VIF A;  3CCV Q;  2M02 A;  1U1S A;  2D0N A;  2ABL A;  3SWN A;  3EH1 A;  3OSV A;  4B9W A;  4Y92 A;  1VQM T;  2EIF A;  3X26 B;  2VAS A;  5HK0 A;  4OGC A;  3OYD A;  4ZGJ B;  3GOX A;  2EYX A;  3CCJ A;  2V1Q A;  2R57 A;  2DFU A;  2M0Y A;  4HT9 A;  2LNH B;  5D6Y A;  3M54 A;  4IIM A;  2I2L A;  4PJJ A;  5GAN j;  2LZ6 B;  4C8Q E;  4PJO E;  2F1L A;  2ROT A;  1D1A A;  3ZEH A;  2OTJ A;  4BI4 A;  1K0S A;  2J6K A;  2RHZ A;  3OYI A;  1NM7 A;  1M3A A;  3EG1 A;  3PMT A;  2PQW A;  4JJD A;  2KMT A;  2COY A;  2KQW A;  4XU0 A;  3CCL T;  3RES A;  2OX7 A;  2AHJ B;  2CT3 A;  2AZV A;  2XID A;  4IUV A;  2J7I A;  4J9F A;  4LDX A;  1IXD A;  1KSW A;  3P8H A;  2GGR A;  5GAN h;  4M78 C;  4JRI A;  2OTL A;  4BY6 C;  3CCR Q;  1JJ2 P;  2CZ1 B;  4J9G A;  4M77 D;  2GQV A;  3TQ7 P;  2QA4 T;  4Y91 A;  1M4Z A;  2PVO B;  1C6V X;  2DYI A;  1ZHI A;  5EG2 A;  2DA9 A;  3CCM T;  1WA7 A;  2COW A;  3CCE Q;  2XMF A;  1VQ4 A;  2DBM A;  1VQN T;  3U23 A;  2LC4 A;  2QAZ A;  1B07 A;  2HNI A;  1PD1 A;  1QVG S;  2J6F A;  3A8G B;  1Q7Y U;  3DLL A;  4X1V A;  3FJ5 A;  1Q81 U;  2RD1 A;  3RMQ A;  1RAD B;  4C5E A;  3VS1 A;  1XNI A;  3OBW A;  4HXJ A;  3OS0 A;  3RNJ A;  3TCJ A;  2IIM A;  3WXM B;  2YRD A;  2R5A A;  4C5I A;  4DBH A;  1GBQ A;  2E5Q A;  3GNF B;  2OI3 A;  1N5Z A;  5GAO m;  1VQ6 A;  1LPL A;  1WJR A;  2SEM A;  4J83 A;  1VQ8 T;  1YWP A;  1NLO C;  3EFO A;  3V8L A;  1VQO Q;  4MML A;  1VQ4 Q;  5CQY A;  5LJ3 e;  2XHC A;  2VUB A;  4E7Z A;  2EYZ A;  2J06 A;  1XQH A;  2RJF A;  2FPE A;  1YJW A;  3JB9 H;  2KYB A;  5CQX A;  2KDS A;  3V7R A;  2DYB A;  2PNI A;  4QVD A;  1T0J A;  1NEB A;  3RKY A;  2B86 A;  1NPR A;  1UTI A;  2EQK A;  2ROL A;  1IZ6 A;  3RIR A;  3S3M A;  5DLO A;  3OYH A;  3CCQ Q;  1QWF A;  3I55 A;  1NZ9 A;  3PVQ A;  4NL3 A;  4F04 B;  1W2B S;  2XKO C;  1QVG A;  4M75 D;  2YHT A;  3HSB A;  1W6X A;  4RTU A;  4CI0 C;  3OW2 A;  4PL6 A;  1IB8 A;  2ZPF B;  1VQK A;  1I4K 1;  1M1G A;  3G6E Q;  4RTW A;  2DAQ A;  2ZPI B;  1TUD A;  4BDZ A;  2FG0 A;  2DVE A;  4M7D D;  4C92 D;  2O88 A;  3CXC P;  1KG1 A;  3RR6 A;  2EPD A;  4JZ4 A;  2EYY A;  4PJN A;  3TEE A;  1QLY A;  4EMK A;  4ELY C;  2JZ2 A;  3HTR A;  5HY6 A;  3X28 B;  3L2Q A;  3ZL7 C;  2DTI A;  2EW3 A;  5FLX E;  3CCV A;  1PNJ A;  4C92 F;  3OQ5 A;  1SSF A;  3PE0 A;  1YJ9 A;  3O5Z A;  3OB9 A;  1Q86 U;  5GJV B;  1NG2 A;  4PFP A;  3LGL A;  1WHK A;  1QCO A;  2FEI A;  2E10 A;  2VKN A;  3JCM X;  3JCM d;  4QQ6 A;  1KD1 R;  2F2W A;  4RTX A;  2XDD A;  2DRM A;  2LNV A;  4DA4 A;  3HKS A;  1G3T A;  2YUO A;  2E12 A;  2OAW A;  1Y96 B;  3QYG B;  3FJP A;  4AG2 C;  5KYU B;  1UJY A;  1BI0 A;  2LVM A;  2YSQ A;  2KRM A;  3LYI A;  4BUG A;  1KFZ A;  1VQ6 T;  3IQL A;  2EQU A;  2M0O A;  4WCI A;  1D0Z A;  5FWB A;  3I9Q A;  1LVK A;  1YI2 A;  1PRL C;  1WDX A;  1ZUK A;  1UG1 A;  3CBM A;  4K11 A;  4C8Q G;  1PD0 A;  2X3X D;  3QUI A;  5A2Q E;  1Q86 R;  4J9H A;  2RH2 A;  1DJ7 B;  2L0A A;  4KH1 B;  1X43 A;  2V8K A;  2JUF A;  4ZN1 A;  3ASK A;  4BDY A;  3CXC A;  1VOM A;  2KT8 A;  2I0N A;  4FT4 A;  1I5O B;  2RI2 A;  3JCM W;  3L42 A;  3ER0 A;  4XQ3 A;  4AT1 B;  1P92 A;  1MV3 A;  1M8M A;  2PZ1 A;  4BY6 B;  2VB6 A;  5LJ5 d;  1UB4 A;  2CZ6 B;  2GTO A;  5CK9 A;  3ULR B;  2DVJ A;  1K8A U;  1M1K C;  1Y0M A;  1RAC B;  3MEW A;  4BI3 A;  3VU3 C;  1KIK A;  4JRP A;  4J6W A;  3EHQ A;  2A28 A;  4L6V 5;  5KYW A;  4C92 C;  1X6B A;  4P5N A;  1UHC A;  2RQU A;  3BFM A;  3D7S B;  4O6J A;  2ZPB B;  3CCE T;  1TXQ A;  1VYU A;  3QHS A;  1U3O A;  1VQ7 A;  2IVW A;  2ZPG B;  3MPU B;  4X9D A;  1WXT A;  5IT9 E;  3A8H B;  4C0G A;  5GAO l;  1AVZ C;  2DER A;  4DEY A;  2QEX Q;  1IHV A;  4FCY A;  3VS7 A;  3JCM c;  2RQV A;  3LH5 A;  5GMK h;  2DRK A;  1UDL A;  5D6W A;  3VKI A;  5AYF A;  4C92 G;  3CC4 A;  1MGQ A;  2KYM A;  1M2O A;  1NYF A;  1VQ5 T;  2JT4 A;  1K73 C;  2VGN A;  2L5Q A;  2QDY B;  4HVW A;  4KBM B;  1OQK A;  1GRI A;  2RJE A;  3QG1 A;  5GMK m;  5IH2 A;  1SF9 A;  2NUZ A;  3GIB A;  2DKG A;  4C0D C;  3JCM f;  2LQN A;  2QQS A;  5GAN 5;  3OS2 A;  4BAC A;  3E9F A;  3JCM h;  1T3S A;  2HKN A;  1T0H A;  2K3X A;  1R0C B;  3H0F A;  1UGS B;  3BW1 A;  3MET A;  3EGX A;  2RO0 A;  4OF1 A;  4E7K A;  3QWY A;  5GAM h;  2CSQ A;  3G6E A;  4BE1 A;  1QW1 A;  2RNA A;  2XIC A;  2AK5 A;  5LJ5 h;  4JJC A;  5GAN f;  3CCL Q;  1AT1 B;  4M7A F;  5LJ5 f;  4N4H A;  2O9S A;  1NLP C;  3GNG A;  2VYT A;  2KT1 A;  2O4X B;  4PLI A;  1BKB A;  4PJO F;  4ZGD B;  3EH2 A;  1X6G A;  2D8H A;  3M0S A;  1HSQ A;  1U1T A;  5I22 A;  5IXB A;  3G71 T;  4PJO B;  4UC4 A;  2COZ A;  4YTL A;  5GMK l;  5GJW B;  2FYK A;  2LCC A;  5J39 A;  3MJX A;  5CKD A;  3VRZ A;  3CMA A;  4M77 B;  7AT1 B;  1JJ2 S;  5FRM A;  4FT2 A;  1NE8 A;  1BIA A;  3BY7 A;  4CC7 A;  2HSE B;  1YI2 Q;  1KC8 C;  3UT1 A;  5LL6 S;  1D1C A;  2A0F B;  2JN0 A;  3NTH A;  4KH0 B;  2QQA A;  4JS5 A;  3G71 Q;  3RKW A;  2K79 A;  1K9M R;  2NUT B;  5LJ3 j;  1X6O A;  1RAB B;  4JRK A;  1AWO A;  2RK1 A;  3V7S A;  2F5T X;  2HMA A;  3MEV A;  2YWW A;  4A4H A;  9ATC B;  2JW4 A;  4X34 A;  5FWC A;  2Y4X A;  1QVF P;  2EAY A;  4BB7 A;  3QDR B;  1V29 B;  2DTH A;  3S3N A;  1BYM A;  2ATC B;  3O8V A;  2EGE A;  4LUD A;  4N0A A;  2E6N A;  2V1R A;  2YT6 A;  1FXX A;  1WHL A;  5LJ3 f;  1AZE A;  1VQ6 Q;  1V1C A;  2JJ9 A;  3OYL A;  3OYM A;  1JQQ A;  4X9C A;  3OY9 A;  2CYZ B;  2NWM A;  2GNC A;  1OU8 A;  3QPH A;  4DBF A;  1OPL A;  2CKK A;  1VQL Q;  2DL4 A;  2QTX A;  5FRO A;  4RCC A;  1SPK A;  2GBQ A;  4DOV A;  2RJC A;  2QQB A;  4PJM A;  3I35 A;  4WTO B;  3TSW A;  2FRW A;  2CP5 A;  2DXC A;  4MMK A;  4LD9 K;  5GAM g;  1JXO A;  2K6D A;  4FYY B;  2C0T A;  1WZO A;  2FRY A;  2KRN A;  4QVC A;  1Q81 R;  1H92 A;  1VQ4 T;  1SSH A;  1ABO A;  1QCN A;  4OP0 A;  3CCS Q;  1M90 U;  1YJN A;  2H3E B;  1TOV A;  2AZS A;  4KUI A;  5GAM j;  2QEX A;  2DJQ A;  3DKM A;  4GY5 A;  3H0I A;  2HBP A;  1BBZ A;  4QQD A;  4DQ2 A;  2YUP A;  4XK8 E;  4ZNX A;  1IGU A;  2JXB A;  2LT4 A;  1F1B B;  1RI9 A;  1D1B A;  5L23 A;  2JTM A;  2QGG A;  2RPN A;  5KYY B;  2K3Y A;  2EJ9 A;  4M7A G;  3CCS T;  3VS6 A;  2DO3 A;  4ANJ A;  2ZPH B;  2CDT A;  4JJN K;  3A5Z B;  3CPW S;  4HA8 A;  1RAI B;  2VV5 A;  2FHD A;  2LX7 A;  3HFO A;  5CAI A;  3M56 A;  2XU8 A;  1N27 A;  4M7D A;  2QGF B;  2RI3 A;  4DBR A;  1G3S A;  4M75 B;  3VS3 A;  3HRU A;  2FZC B;  4JPB W;  2R58 A;  2RA2 A;  1JU5 C;  3CPF A;  4E7J A;  4A53 A;  1LOJ A;  4LE9 A;  5IN1 A;  3MO8 A;  2VC8 A;  4HKE A;  3E9G A;  3QDF A;  2KRS A;  3INZ A;  1BI3 A;  4M7A C;  1SRM A;  5GAN 2;  1QP2 A;  5CVI A;  1PCX A;  2MI6 A;  1WNL A;  1XTD A;  1UE9 A;  4ZGE B;  2GF7 A;  3CCE A;  1S72 A;  3WVD B;  2NLU A;  4RMO A;  5KE3 A;  4Y28 E;  4AMC A;  2ZCF B;  3PIO A;  1RLP C;  2YUN A;  4F7U A;  1PG5 B;  4OB3 B;  4M75 E;  4Q5W A;  1X69 A;  4D8D A;  3FDR A;  3EG9 A;  4M78 F;  3UDC A;  2A7Y A;  4IUU A;  1K8A C;  3CCR A;  4M7A B;  2DLP A;  4E7S A;  1OUL A;  5DLQ E;  4NL2 A;  3TSZ A;  2OTJ Q;  2RHU A;  1LNX A;  3LX7 A;  2FZK B;  1WHM A;  1O75 A;  2CH4 A;  5LJ3 h;  2GQI A;  4MZM A;  1M2V B;  3PNW C;  4IUQ A;  4Z8A A;  2QQ9 A;  1XOV A;  1YJW T;  1H3H A;  4HCC A;  1MHN A;  2K9G A;  5HCK A;  4LDV A;  3S3O A;  5KYW B;  2A3L A;  3A98 A;  5KH6 A;  4M7A E;  1SHF A;  3QYH B;  1E6G A;  1VQN A;  1UGQ B;  5GAO r;  2WSC E;  5KYN A;  2YLB A;  4C0D B;  5DM7 R;  2E64 A;  1YN8 A;  4GLK A;  2M1H A;  1M3B A;  2DNU A;  3JAM E;  2DIG A;  4C8Q D;  4CC4 B;  5KCO A;  1YI2 T;  1U5S A;  4Z88 A;  4C0Z A;  4L5G A;  2DE0 X;  1X27 A;  1N8R U;  4OVA A;  4QT7 A;  3CD6 A;  2KRO A;  2KXD A;  4LXC A;  3N5B B;  2RK2 A;  1AWJ A;  3H41 A;  1ZLM A;  2GTJ A;  2JTF A;  4E7L A;  1K1Z A;  1WGS A;  1OI1 A;  4PK4 A;  2RB6 A;  4FYV B;  2JVV A;  1WPY A;  2FPD A;  1UEC A;  2HAX A;  1YP5 A;  1SHG A;  4PFO A;  2QDL A;  1BCM A;  2F2X A;  1R0B G;  2DIL A;  4KGX B;  4M75 G;  1AWX A;  1QVG P;  3VUZ A;  2RF0 A;  4B9X A;  3PTA A;  1WJS A;  2YDL A;  2CRE A;  2FZG B;  1K4U S;  5FW9 A;  1ZQ1 A;  3A8L B;  3OYY A;  3M0R A;  4IKF A;  1K76 A;  4IUT A;  2DXU A;  3M0P A;  1M3C A;  1YJ9 T;  3C0C A;  2PUO B;  2X4J A;  1WIE A;  4XTV A;  2VGM A;  4L59 A;  1K73 R;  4DOW A;  3NMZ C;  1S1N A;  3J80 E;  1VQP Q;  4ZTJ A;  2DPP B;  3FC3 A;  4LUE A;  5CCA A;  3G4S T;  3G6E T;  1QQJ A;  4HCB A;  4AFS C;  5GMK j;  3CCR T;  2EQJ A;  3GBQ A;  4N4I A;  2XDB A;  2K2M A;  2O4X A;  3PVL A;  2CZ7 B;  2LRQ A;  4AG1 C;  2P0P A;  3M57 A;  3LGF A;  2HL3 A;  2X35 A;  2X3W D;  3URG A;  1ZA1 B;  2BZ8 A;  1YIJ Q;  3AT1 B;  4CC3 A;  3QJY A;  2F2V A;  5I2M A;  3UF4 A;  3MHX A;  3RUX A;  1IRE B;  4FM4 B;  2QG9 B;  2BKD N;  4PFZ A;  3E2U A;  3EFO B;  1UGV A;  3CC2 Q;  3NTI A;  1M9S A;  2V8J A;  1M1K R;  2ESW A;  1WJQ A;  1GBR A;  3HFN A;  4A4G A;  1ARK A;  2AIR B;  2ZPE B;  1G3Y A;  3SWN C;  4BD3 A;  1YIJ T;  1MMA A;  3M55 A;  3KBG A;  2DF6 A;  1JJ2 A;  1YJN Q;  4EMH A;  2P84 A;  5FU7 C;  4XTY A;  3CCU T;  2YXY A;  3OYE A;  2C06 A;  2OTL Q;  2LX9 A;  1JXM A;  2YRV A;  2DK3 A;  2RQT A;  1WYX A;  2FO0 A;  4XTX A;  3LWH A;  4RTT A;  2QAS A;  1PM3 A;  1JBM A;  3VJP A;  4QQG A;  2DXB A;  1AEY A;  2CP3 A;  2E65 A;  2CS7 A;  4XU2 A;  5FU6 B;  1G3W A;  2JMA A;  3REB B;  3UA6 A;  1U8R A;  3CME A;  3WVE B;  2KY9 A;  4WF2 A;  4B6M A;  1B7T A;  5GAN g;  1KJW A;  4RKU E;  1RI0 A;  1FWZ A;  3CMA T;  4J7F A;  4EMK C;  2AKK A;  5CIU A;  4C92 B;  3SHW A;  1PKS A;  3JB9 F;  1WFW A;  1D3B B;  4RG8 A;  1QCF A;  2XG8 D;  5CR2 A;  1VQ9 Q;  3OYG A;  1WQ7 A;  1KK7 A;  3QJ6 A;  1WI7 A;  1YHQ T;  4M77 G;  1WHJ A;  2K7A A;  1N8R C;  4J6Y A;  3CXC S;  2W0Z A;  1KD1 C;  3HRT A;  4OB1 B;  2OAU A;  2MWP A;  5GAM f;  3EHR A;  3QO3 A;  4DEX A;  5HKC A;  2QK0 A;  4LD6 A;  3J81 E;  1NYG A;  4F16 A;  1TH7 A;  3OW2 S;  1J3T A;  3REA B;  3QSU A;  2DD4 A;  2RHX A;  2A36 A;  2M51 A;  4FYW B;  2EWN A;  1JB0 E;  5FRN A;  2E5K A;  3CC4 Q;  2D1X A;  1YCY A;  3OYA A;  6AT1 B;  1FMK A;  4M75 F;  3BDL A;  1IGQ A;  1OX9 A;  1KQS P;  1QKX A;  2RHY A;  1PRM C;  5GAO p;  3C4S A;  2QEX T;  1H64 1;  1X01 A;  1XJW B;  1VQ8 Q;  2M9U A;  5GAN 4;  4M77 C;  4BE2 A;  1G5V A;  2QA4 A;  2K2V A;  4ZTF A;  2KR3 A;  2NUP A;  2E3I A;  3L2Z A;  2LQK A;  3OMG A;  4PJO A;  1RAA B;  2HD0 A;  2JMC A;  2O31 A;  2A37 A;  2L89 A;  3OW2 P;  1SKU B;  2D8J A;  4A4F A;  3CPW P;  2E41 A;  1ZSG A;  1OZ3 A;  2LT1 A;  3M9Q A;  1PC0 A;  3C12 A;  1EFN A;  3M58 A;  3CQT A;  4PNO A;  1ZA2 B;  2DET A;  1NPP A;  4M78 A;  2Y4Y A;  4C92 E;  5C0M A;  4IIO A;  1MNE A;  5A0G A;  3TVT A;  1MMN A;  5DY9 A;  4JRQ A;  3LLR A;  2DTO A;  3C94 A;  3TRE A;  3X24 B;  3JV3 A;  5J3B A;  2JS2 A;  3CME T;  2RQW A;  1UJ0 A;  3H9N A;  4JLI A;  5LJ3 d;  1VQM Q;  2LQ8 A;  4GBQ A;  3CC7 A;  1PKT A;  4PJO C;  4OML A;  1W1F A;  1WHH A;  1YFN A;  2KEA A;  2F5K A;  1VQ9 A;  4ATO A;  2HQX A;  1VQ7 Q;  1ZBX A;  2QXF A;  1K8A R;  5CO7 A;  4C5H A;  2YRC A;  3QII A;  4XTW A;  3JCM V;  2MOX A;  3CMA Q;  2KE9 A;  1SEM A;  3VV0 A;  2X51 A;  3OBY A;  4ORZ A;  4R0K A;  3SD4 A;  2CGH A;  2ZZD A;  1D09 B;  2L2P A;  4QVZ A;  2BZY A;  3EGD A;  1QVP A;  3MP6 A;  3MP8 A;  3M59 A;  3M0U A;  4QKU A;  3CC7 Q;  1YNZ A;  2HQH A;  4HCZ A;  2CP2 A;  2JTE A;  2O01 E;  2RMO A;  5HK3 A;  3CCJ T;  5D6X A;  2NYS A;  1RAG B;  2JOY A;  3QBY A;  1KQ1 A;  5LJ5 j;  2L3P A;  4JUV A;  3KUF A;  4E7I A;  3SWN B;  1AZG B;  4C8Q F;  2FPF A;  2QQR A;  4M78 D;  2CP0 A;  1RAH B;  3EG0 A;  1I5L A;  3JCM b;  2KXC A;  3SDZ A;  3I56 Q;  4A4K A;  1UGP B;  5GMK i;  3SFM A;  2EQI A; 
#chains in the Genus database with same CATH homology
 1GL5 A;  2DLP A;  5GJV B;  1NG2 A;  1GFC A;  3TSZ A;  2AKL A;  2FEI A;  2VKN A;  1K0X A;  2CH4 A;  2DM1 A;  2DL8 A;  2GQI A;  4LNP A;  2F2W A;  4RTX A;  1HD3 A;  2DRM A;  4Z8A A;  2SRC A;  1XOV A;  2W10 A;  1H3H A;  2YUO A;  3NHN A;  2LJ0 A;  2OAW A;  2K9G A;  5HCK A;  1RLQ C;  4AG2 C;  1UJY A;  3A98 A;  1JO8 A;  1SHF A;  4AFQ C;  4GLM A;  1E6G A;  1BU1 A;  3KFV A;  2YSQ A;  2KRM A;  1U06 A;  2C0O A;  3VRY A;  1LCK A;  1YN8 A;  1KFZ A;  2VWF A;  4D8K A;  3IQL A;  1ABQ A;  2JS0 A;  2RQR A;  4WCI A;  1M3B A;  3RBB B;  2DNU A;  5FWB A;  4J9B A;  3I9Q A;  5EC7 A;  1GCP A;  4CC4 B;  1PRL C;  1WDX A;  1ZUK A;  1U5S A;  1UG1 A;  4K11 A;  4Z88 A;  1UUE A;  2DE0 X;  2CH4 W;  2X3X D;  1QWE A;  1X27 A;  3VS2 A;  4J9H A;  4QT7 A;  4LN2 A;  1E7O A;  2KRO A;  5IXF A;  2KXD A;  3SEM A;  2L0A A;  1TUC A;  1AWJ A;  1X43 A;  3H41 A;  1ZLM A;  2HCK A;  2GTJ A;  3THK A;  1WXB A;  1K1Z A;  3EG3 A;  2FPD A;  1UEC A;  2KT8 A;  2G6F X;  1YP5 A;  1WX6 A;  1SHG A;  2I0N A;  2QDL A;  2DL7 A;  1ZBJ A;  1TG0 A;  1WLP B;  4J9E A;  2F2X A;  1MV3 A;  2DIL A;  1M8M A;  2PZ1 A;  1AWX A;  2LJ3 A;  2RF0 A;  2GTO A;  4HVV A;  3ULR B;  2DVJ A;  2YDL A;  2DMO A;  1MUZ A;  2CRE A;  1K4U S;  1Y0M A;  5FW9 A;  3M0R A;  4EIK A;  2HEQ A;  1K76 A;  3M0P A;  4KRT A;  1M3C A;  1I0C A;  3C0C A;  4RUG A;  2EVR A;  1KIK A;  1B3Q A;  3EHQ A;  5ECA A;  1WIE A;  2A28 A;  2LMJ A;  4HVU A;  1X6B A;  2CUD A;  2EGA A;  1CKB A;  1UHC A;  2RQU A;  1UFF A;  3NMZ C;  1S1N A;  4LUE A;  4ESR A;  1NEG A;  1VYU A;  1G83 A;  1U3O A;  2DX1 A;  1VA7 A;  1WXT A;  2BZX A;  1AWW A;  1I1J A;  4AFS C;  2J6O A;  3GBQ A;  1AVZ C;  4DEY A;  2K2M A;  3PVL A;  3VS7 A;  1Z9Z A;  3M0T A;  1E6H A;  2L3S A;  4AG1 C;  2RQV A;  1CKA A;  3LH5 A;  2DRK A;  1UDL A;  1HJD A;  2X3W D;  1UHF A;  2K3B A;  2BZ8 A;  1OPK A;  1H8K A;  2KYM A;  2EGC A;  2O2O A;  1IO6 A;  1NYF A;  2JM9 A;  4CC3 A;  2A08 A;  2JT4 A;  4OMP A;  1M30 A;  1GCQ C;  2F2V A;  4HVW A;  3UF4 A;  2KBT A;  1GRI A;  1AOJ A;  1UGV A;  1WXU A;  5IH2 A;  4A63 B;  4FSS A;  2LCS A;  2NUZ A;  2LQN A;  2ESW A;  2HBW A;  2YUQ A;  4RTZ A;  1GBR A;  3H0H A;  1ARK A;  1T3S A;  3I5S A;  1T3L A;  1T0H A;  3M0Q A;  3H0F A;  4F14 A;  1PWT A;  3QWY A;  2CT4 A;  2CSQ A;  2DF6 A;  4JZ3 A;  4RTY A;  2P4R A;  4AFU C;  3EG2 A;  2RNA A;  2AK5 A;  1BB9 A;  1K9A A;  1ZUY A;  1VYV A;  4JJC A;  1ZX6 A;  1JXM A;  2PTK A;  4AFZ C;  2RQT A;  1WYX A;  2O9S A;  2FO0 A;  2ED1 A;  2VVK A;  1PHT A;  1NLP C;  4RTT A;  1YWO A;  2KT1 A;  2LQW A;  2HDA A;  4HCK A;  4J9C A;  1AEY A;  1X6G A;  2D8H A;  2L3Q A;  3M0S A;  3REB B;  3UA6 A;  2JMA A;  1JEG A;  1HSQ A;  5I22 A;  5IXB A;  2O9V A;  5GJW B;  1AD5 A;  1CSK A;  4J9D A;  2D0N A;  1KJW A;  2ABL A;  3VRZ A;  4E6R A;  4Y92 A;  2AKK A;  3SHW A;  1PKS A;  2EBP A;  1SRL A;  4CC7 A;  1WFW A;  3EGU A;  1G2B A;  2EYX A;  1A0N B;  1QCF A;  2V1Q A;  2M0Y A;  2LNH B;  4OMN A;  1WI7 A;  4IIM A;  2K7A A;  4OMQ A;  2W0Z A;  2K79 A;  2LZ6 B;  2ENM A;  2ROT A;  1AWO A;  3EHR A;  4DEX A;  2OJ2 A;  4Z89 A;  1NYG A;  1K0S A;  1OOT A;  4F16 A;  2JW4 A;  2J6K A;  5FWC A;  2MCN A;  1J3T A;  1NM7 A;  1M3A A;  3EG1 A;  2EKH A;  3REA B;  4JJD A;  2A36 A;  2M51 A;  2CUB A;  2E5K A;  2J05 A;  3UA7 A;  1YCS B;  2EGE A;  5IHK A;  2D1X A;  1BK2 A;  4LUD A;  1FMK A;  2CT3 A;  2AZV A;  2J7I A;  4J9F A;  2EYW A;  1KSW A;  5IHN A;  2V1R A;  2YT6 A;  2GGR A;  1QKX A;  1PRM C;  1OEB A;  2LP5 A;  1W70 A;  3VS5 A;  4J9G A;  1AZE A;  1V1C A;  1JQQ A;  4RTV A;  5I11 A;  2NWM A;  2GNC A;  2DA9 A;  2KR3 A;  1WA7 A;  4OMM A;  2XMF A;  1OPL A;  2DBM A;  3UAT A;  3VS4 A;  3U23 A;  2DL4 A;  2JMC A;  1B07 A;  2O31 A;  1SPK A;  2GBQ A;  2J6F A;  2A37 A;  1VYT A;  4X1V A;  3FJ5 A;  2D8J A;  3I35 A;  1GFD A;  3TSW A;  2FRW A;  1ZSG A;  3VS1 A;  2BTT A;  1JXO A;  2K6D A;  4HXJ A;  1EFN A;  2C0T A;  3RNJ A;  2IIM A;  2FRY A;  2KRN A;  3CQT A;  1X2Q A;  2HSP A;  1GCQ A;  1H92 A;  1GBQ A;  4IIO A;  1SSH A;  2OI3 A;  1N5Z A;  3TVT A;  2SEM A;  3I5R A;  1ABO A;  1YWP A;  3JV3 A;  2JS2 A;  1NLO C;  2RQW A;  1UJ0 A;  4J9I A;  3NGP A;  2AZS A;  2EYZ A;  1Z9Q A;  2DBK A;  2DJQ A;  2J06 A;  4GBQ A;  2FPE A;  1PKT A;  1MV0 B;  4OML A;  1W1F A;  2KYB A;  3H0I A;  2KEA A;  1BBZ A;  2DL3 A;  2DYB A;  2PNI A;  1T0J A;  2YUP A;  4ZNX A;  1NEB A;  2JXB A;  2DL5 A;  2B86 A;  2ECZ A;  1RI9 A;  2RN8 A;  2JM8 A;  3R6N A;  5L23 A;  1UTI A;  4F17 A;  2RPN A;  2MOX A;  2ROL A;  2KE9 A;  1SEM A;  2H8H A;  3VS6 A;  1QWF A;  4ORZ A;  4R0K A;  2CDT A;  3PVQ A;  2LJ1 A;  1OV3 A;  1QKW A;  2LX7 A;  4JJB A;  2L2P A;  2BZY A;  1W6X A;  4RTU A;  3VS3 A;  2MIO A;  4JPB W;  3M0U A;  1JU5 C;  4M4Z A;  4LE9 A;  4RTW A;  1YNZ A;  5IHI A;  4CC2 A;  2JTE A;  1TUD A;  2FG0 A;  2KRS A;  2RMO A;  2O88 A;  1Y57 A;  1I07 A;  1SRM A;  2L3P A;  2EPD A;  4JZ4 A;  2EYY A;  2KNB B;  1FYN A;  1QLY A;  1AZG B;  2FPF A;  3NPF A;  1UE9 A;  4OMO A;  1RUW A;  3QWX X;  1X2K A;  3ZL7 C;  1RLP C;  2CSI A;  2YUN A;  3EG0 A;  1X69 A;  2EW3 A;  2KXC A;  4D8D A;  3VS0 A;  1M27 C;  2C0I A;  2ED0 A;  1ZUU A;  1PNJ A;  2EQI A;  2KGT A;  3PE0 A;  3O5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...