1BB9A

Crystal structure of the sh3 domain from rat amphiphysin 2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
83
structure length
83
Chain Sequence
b'TTGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMPHIPHYSIN 2
publication title Crystal structure of the amphiphysin-2 SH3 domain and its role in the prevention of dynamin ring formation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 21
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 1998-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bb9A00
1E6GA 2JTEA 1S1NA 2CH4W 1WXTA 1T3SA 2ROTA 4R0KA 2AK5A 4KRTA 2KT1A 2MOXA 2OAWA 1QCFA 4OMPA 2FEIA 2C0IA 3EHQA 2CT4A 2GGRA 4ZNXA 2K3BA 4AG2C 3PE0A 1OV3A 1I07A 2BZXA 2GTJA 2K79A 2DL7A 4IIMA 1M3AA 4A63B 5IXFA 2DILA 2VVKA 2BTTA 1ABQA 2KEAA 4RTVA 2J6FA 3H0IA 1UHCA 1SHFA 4OMLA 1NYFA 1WXBA 4LN2A 3VS7A 4J9CA 1TUCA 1GRIA 2O9VA 4QT7A 1M3BA 1JXMA 2HCKA 3UA7A 1CKAA 2DF6A 2K6DA 2MCNA 1ZSGA 3UATA 2BZYA 3QWXX 3KFVA 3VRYA 1ZUUA 1UDLA 3UA6A 1AWXA 3REAB 4EIKA 4HVWA 2CSQA 2RN8A 1VYTA 2HSPA 2CREA 2EKHA 3RBBB 2MIOA 3ULRB 2DE0X 2D8JA 1H3HA 1WX6A 2J7IA 2HDAA 2KT8A 2EYXA 4LE9A 4F17A 2LZ6B 2VKNA 1H92A 2DNUA 3M0PA 2YUNA 2K9GA 1OOTA 2O9SA 1Z9QA 4HVVA 4J9BA 4LNPA 5I11A 4AFSC 1YWOA 2JS0A 1WDXA 1AEYA 4OMOA 2GBQA 1NEBA 1YCSB 1AOJA 4Z8AA 4WCIA 3M0QA 4AFQC 2KRSA 4LUDA 2B86A 4F16A 1K0XA 2LJ1A 5I22A 1U06A 1SSHA 4J9EA 4M4ZA 1UTIA 2LJ0A 2ESWA 2YUPA 4JJDA 1AWWA 3VRZA 4AFUC 1WLPB 2YT6A 5IHKA 1AD5A 2CT3A 4F14A 1MV0B 2LQNA 4IIOA 2G6FX 2CUBA 3CQTA 4J9GA 1NLPC 1TUDA 4J9HA 4JZ3A 4DEYA 1I0CA 1SRMA 1UHFA 1XOVA 1N5ZA 3TSZA 1X43A 2EQIA 1X2KA 3SHWA 1X6BA 1GL5A 2JS2A 2EYYA 2ECZA 2V1RA 1GCPA 2KE9A 2ED0A 1NG2A 1W6XA 2EYZA 2RNAA 1QWEA 1WYXA 2D0NA 2KNBB 1MUZA 2AZSA 1HJDA 2EW3A 2A28A 4CC2A 4RTZA 1HD3A 1KIKA 3PVLA 1YWPA 2HEQA 1TG0A 1YN8A 2L2PA 1X6GA 2DM1A 1U5SA 2F2VA 1M3CA 2ENMA 5IHNA 1GFCA 2JMCA 2CH4A 1UJYA 4CC3A 2JM9A 1IO6A 1PRMC 4GBQA 2W0ZA 2DA9A 3QWYA 3R6NA 4OMQA 4HVUA 2LCSA 2FO0A 4D8KA 2YDLA 1JEGA 1UGVA 3EGUA 1GBQA 1GCQA 1WXUA 3VS4A 3THKA 1PNJA 2K2MA 2X3XD 2A36A 4ORZA 2OI3A 4D8DA 2I0NA 4K11A 1AWOA 1W70A 1H8KA 1VYVA 2EYWA 1LCKA 1UE9A 2F2XA 1CKBA 2KR3A 3H41A 3UF4A 2A37A 2RQVA 1AWJA 1ZBJA 2CSIA 2E5KA 1OPLA 2OJ2A 1K4US 2DX1A 2FPDA 1UG1A 2YUQA 2EVRA 3M0SA 1RLPC 2V1QA 2LQWA 2M51A 1NM7A 1SPKA 3EG0A 2BZ8A 3NHNA 4J9FA 4RUGA 2C0OA 3IQLA 2AZVA 2JXBA 2C0TA 1PKTA 4DEXA 2KYMA 2PNIA 2XMFA 3FJ5A 5IXBA 4AG1C 2L3SA 1AZGB 3NPFA 2J6KA 4RTWA 3LH5A 1K9AA 2SRCA 2L0AA 3A98A 3EG2A 5ECAA 2J05A 2DRKA 2QDLA 1QWFA 4RTYA 1UUEA 2AKKA 2KBTA 1HSQA 2DLPA 1T0HA 2LMJA 1ZLMA 1QLYA 3VS1A 1OPKA 3VS3A 3VS5A 4X1VA 1G83A 2H8HA 1KFZA 1MV3A 2SEMA 5FWBA 1WA7A 2O2OA 2ABLA 2EGCA 1T3LA 1W1FA 2NUZA 1Y0MA 2RMOA 3M0RA 2IIMA 4JPBW 4J9DA 4E6RA 4FSSA 3O5ZA 2K7AA 1NLOC 2J06A 4CC4B 1ZUKA 2ROLA 1SRLA 1ZUYA 1UECA 1CSKA 2LP5A 5IHIA 2DVJA 2EBPA 1G2BA 1KSWA 2RQWA 3I35A 2RQUA 3NGPA 4RTTA 1JQQA 1BK2A 3I9QA 5L23A 1YNZA 1RUWA 3I5RA 1U3OA 1ZX6A 2RPNA 2KXCA 1NEGA 2KROA 1GFDA 2X3WD 1FYNA 2D8HA 2JT4A 2KRMA 1KJWA 1PHTA 4CC7A 1QKXA 2F2WA 1SHGA 3PVQA 3REBB 4GLMA 2DYBA 2ED1A 3M0UA 2JM8A 2FRYA 1JU5C 2GQIA 2D1XA 4Y92A 1ABOA 1K76A 1ARKA 2FPEA 2DL8A 2KYBA 2YUOA 1PKSA 2AKLA 3GBQA 4OMNA 2DJQA 1BB9A 2VWFA 4HCKA 4JJCA 2O31A 4JZ4A 1X69A 1K0SA 2JMAA 2DRMA 2YSQA 2GNCA 3VS0A 3NMZC 1Z9ZA 1E7OA 2JW4A 4AFZC 2KXDA 3VS6A 4Z89A 1BU1A 1OEBA 2EGEA 1YP5A 1VYUA 2RQTA 1GBRA 2LJ3A 5HCKA 1M30A 2LNHB 2EGAA 3I5SA 4LUEA 2DL4A 4RTXA 2L3PA 3TVTA 2O88A 1I1JA 2CUDA 1EFNA 3EHRA 1V1CA 1AZEA 2DL3A 3U23A 1WFWA 4J9IA 1T0JA 2DBKA 1UFFA 3RNJA 1JO8A 4JJBA 1PRLC 2FPFA 3JV3A 3SEMA 3VS2A 2EPDA 5FWCA 1JXOA 2J6OA 2GTOA 2RF0A 1Y57A 1B07A 3EG3A 4OMMA 1QKWA 2FG0A 2M0YA 1WIEA 3C0CA 2PTKA 2DMOA 1UJ0A 1PWTA 3EG1A 4RTUA 5GJVB 5EC7A 5FW9A 3H0HA 1M27C 1GCQC 2PZ1A 2LX7A 2KGTA 1K1ZA 1FMKA 1M8MA 1E6HA 2W10A 1X27A 2CDTA 4ESRA 1B3QA 1BBZA 1NYGA 3TSWA 3M0TA 1X2QA 2KRNA 2HBWA 1WI7A 5GJWB 2A08A 2P4RA 3H0FA 1RI9A 5IH2A 4HXJA 2L3QA 1RLQC 2NWMA 1VA7A 1AVZC 1A0NB 2FRWA 3ZL7C 4Z88A 2RQRA 1SEMA 1J3TA 2DBMA 2DL5A
chains in the Genus database with same CATH superfamily
2RI2A 1E6GA 2JTEA 3V7CA 1OZ3A 3JCMQ 2ROTA 1T3SA 5GANd 4C92C 2DTHA 2OAWA 3G6EQ 2E10A 1I8FA 2K3BA 3R6OA 3OS1A 1I07A 5C6SA 2BZXA 2DD5A 1VQ6T 2GTJA 3I55A 2DL7A 1Y96B 2VVKA 5LL6S 1ACMB 1KQ1A 2QGGA 4E2FB 4RMOA 3X25B 4J8OA 3JCMX 4ANJA 3OS2A 1QVFA 2YRDA 2XK0A 3H0IA 1UHCA 4C8QG 2Y90A 3F70A 1WXBA 4KH1B 4J9CA 2M9UA 4QT7A 4KH0B 2K6DA 2MWPA 3UATA 1C0MA 3OB9A 1PCXA 3VRYA 1ZUUA 3X26B 3UA6A 3OYJA 2CSQA 2HAXA 1VIEA 2PQWA 2RN8A 2EKHA 5CO7A 2DE0X 2CP3A 2LNVA 3FIFA 1M5Q1 3CCMT 2EQKA 2M0OA 2LZ6B 4A4FA 1H92A 3L2UA 3ZFJA 3HHTB 1Q86R 1NJIR 1YJWQ 3C4SA 3OYBA 3OS0A 4BACA 1SF9A 4FW2A 2QQBA 3EFRA 2JS0A 1YJNA 2JUFA 1WQ7A 1XTDA 4WCIA 4Z8AA 4AFQC 2KRSA 4LUDA 1U1SA 4JDSA 2B86A 1MMDA 1K0XA 2E41A 3GLXA 2XDPA 2DVEA 1UTIA 1QVGP 5FROA 4BY6C 4LDXA 1VQ9T 2ESWA 2YUPA 5KYUB 3CBMA 4BI4A 4AFUC 3CCRA 1WLPB 2YT6A 1AD5A 4FSXA 4M77A 2AHJB 1LNXA 5KYXB 2WSCE 2CP6A 4J6XA 3P8HA 2RJFA 3OYMA 1M1KR 2D6FA 4JRKA 2X4WA 1X2KA 1Q95G 3DLMA 3EGDB 5GMKl 2DO3A 1HJDA 3ER0A 1VQPA 4CC2A 1YBYA 4PFPA 1WNLA 2OX7A 1X6GA 2F2VA 2ENMA 2DXBA 2LQ8A 1UJYA 2RHYA 3OSVA 2JM9A 2MYSA 2O4XA 1IO6A 3MO8A 1BYMA 1TSFA 4PJNA 1VQLA 3BW1A 3QJYA 4X9CA 2LCSA 3CC7A 4M7AA 3RKXA 4J83A 1GBQA 1WXUA 3VS4A 3CCLQ 5LJ5j 1QVFP 2X4JA 3V7SA 5IAYA 4XK8E 5A0GA 4PJOD 4ORZA 2KSSA 1ZSZB 4K11A 3CCQA 1OU8A 1AWJA 1ZBJA 1WPYA 3INZA 3OQ5A 2E5KA 4M75A 4M77G 5I2MA 2K3YA 1K4US 2DX1A 1UG1A 2YUQA 1JRIA 1KD1C 1M90C 5LJ5h 5KCHA 2LQWA 3BDLA 3V8LA 2BZ8A 1EIFA 2L8DA 3S3MA 3HRTA 3IQLA 2AZVA 3FJ5A 4AG1C 3A8MB 2X4YA 3NPFA 3WXMB 2LT1A 4ZGJB 4PNOA 3M4YA 3GNGA 3I56Q 5ECAA 2DRKA 4RTYA 2AKKA 5LJ3j 3CCVT 3VS3A 3VS5A 5I21A 2CP5A 1MV3A 4XU3A 1KG1A 5FWBA 2EJFA 2PVGB 2EGCA 5GAOn 1T3LA 1JB0E 4FW1A 1WHMA 3JB9H 1W2BA 3QJ6A 5KYYA 3CCSQ 2E3HA 4JPBW 2L3RA 5LJ3h 3LYIA 1Q7YC 1FMVA 4M7AG 4FT4A 1YHQQ 1VQLT 1OQKA 4M7DC 3P8DA 2G3RA 1K9MR 2EBPA 4E47A 1KSWA 3O8VA 1VQMT 1S72A 1X6OA 4PFZA 2A0FB 4M75G 2QAZA 3EGXB 1YITQ 3CCQT 1KD1U 5L23A 1YNZA 1KQSP 1U3OA 3QPHA 1ZX6A 1O75A 5GAN5 1RAIB 5GMKi 4KT0E 5IN1A 4FCYA 5GAN3 2F5TX 1V76A 3RR6A 2QEXT 1FYNA 1YI2A 3CBOA 3OYFA 4CC7A 2F2WA 1SHGA 5FU6B 3PVQA 1M8VA 3LH0A 1G5VA 3CMEQ 2RHZA 4ELZC 1JU5C 2GQIA 4FIBA 4NS5A 1BIBA 4GY5A 4ZTFA 2HD0A 5LJ5d 2EAYA 2KYBA 2YUOA 3OA6A 4MMKA 2DJQA 4J7FA 4LXCA 4HCKA 4JJCA 2O31A 2ZPGB 4JZ4A 4E7SA 1X69A 2JMAA 1K73R 2GNCA 5FLXE 5KE3A 1YJ9T 3Q1JA 3G6EA 2MWOA 1Z9ZA 3GNFB 4M78D 1Q7YU 1E7OA 2JW4A 4XAXB 4Z89A 3FEOA 3OY9A 2EGEA 3QBYA 3TU4K 3HFOA 5HCKA 4C92A 3CC4Q 4LUEA 3CXCA 2HBPA 2O88A 3SWNA 4E7LA 2DTOA 1H3ZA 3EHRA 2DXCA 5KCOA 4OGCA 4FT2A 3DB3A 1U1TA 4JJBA 1PRLC 2CP2A 5LJ3d 4B9XA 3JV3A 1G8XA 2EPDA 4FU6A 3M9QA 2RF0A 1YFNA 4XU0A 4WTOB 1VQ5T 1QKWA 3BDUA 2M0YA 1G3SA 3H9NA 3L2RA 2AIRB 1I4K1 5L8RE 2E6ZA 2EIFA 3FRNA 3QUIA 3EG1A 2GFUA 5EC7A 2K5IA 2DXUA 5FW9A 1YCYA 2COZA 3HTRA 1M27C 1SG5A 4XTWA 1BCOA 2PZ1A 2V26A 1YJWA 1Q86C 4C0FA 4EMKC 2RHIA 2CDTA 1QVFS 4C0DB 3M0TA 2A08A 1RI9A 2X35A 3EG9B 4HXJA 3G4ST 2M16A 1RLQC 1BI0A 2FRWA 3E1SA 2DBMA 2DL5A 3UWNA 4C92G 5DLQE 2R58A 3S3NA 3BE3A 3C95A 4R0KA 2AK5A 4KRTA 5GMKj 2ZPBB 4RCCA 1QCFA 2JTFA 5J26A 3M58A 2LC4A 2GGRA 3FC3A 3RERA 3JB9D 3QKJA 3PE0A 4M7AB 1OV3A 1RAFB 1BKBA 1PM3A 2RK1A 2K79A 2KY9A 3M56A 2QQ9A 2JN0A 3MP1A 1BIAA 1TUGB 3G71Q 1HXDA 2EYQA 5GAMj 4M75B 3PGGA 1SHFA 4OMLA 1NYFA 4BE0A 4PJOB 3OYKA 1TUCA 2CS7A 2CZ7B 2KMTA 1GRIA 5D6WA 1VQ4T 1HK9A 3UA7A 2MCNA 1ZSGA 3HPWA 3QWXX 1OU9A 2AT1B 3S3OA 1WHJA 4GLKA 4C5EA 2DJZA 5GAMh 1Q82R 2O01E 1UDLA 2E70A 4F7UA 1Q86U 4IURA 2MAMA 3CMAQ 2HSPA 2MIOA 2D8JA 4IUVA 1WX6A 1PSEA 2WACA 2OAUA 2J7IA 3G1JA 4LE9A 3MJXA 4QVZA 2VKNA 2DNUA 4D6WA 4C8QD 1WJSA 2R5MA 2K9GA 4BE2A 4PJJA 1OOTA 2D0QB 4BDYA 1QP2A 1TH7A 5FU7C 4HVVA 4LNPA 2IG0A 3CC2Q 5I11A 5KYYB 3CCLA 4AFSC 1WDXA 2GBQA 5CKFA 3VKIA 2BE7D 1AOJA 2RJCA 3TREA 1K8AR 4LDVA 4C5IA 2LJ1A 2ZPFB 2KAFA 4NOYA 1BI2A 1WHGA 1VQ8Q 3EFOB 4JJDA 2R57A 1JJ2A 2WSFE 1AWWA 4HT9A 2VASA 2XDDA 2R5AA 5IHKA 2CT3A 4A4GA 3CD6Q 1MV0B 2G6FX 2E4HA 3QDRB 1I0CA 1SRMA 3TCJA 4F7UG 3SHWA 1KC8C 1X6BA 2NUPB 5LJ3e 1D3BB 2ECZA 2KE9A 2ED0A 5CKEA 1VQKQ 5CQYA 3SWNC 3CCJQ 4KGXB 2D0NA 2KNBB 3CCSA 2A28A 2VV5A 2NUTB 3PVLA 4QQGA 2HEQA 1TG0A 3A8GB 3PIOA 3GF5A 2DM1A 4DBQA 1U5SA 4N0AC 5GAMd 3M59A 3NTKA 2DERA 1UB4A 1QW1A 4CC3A 4LD6A 5AT1B 4V2SA 4QKUA 2DA9A 5GAN8 4MDXA 3R6NA 1B34A 4OMQA 2FO0A 4PLIA 5GAN2 1JEGA 1UGVA 5CAIA 4M7DA 4M78B 3PIPA 1NPRA 1PNJA 4HCZA 2K2MA 2X3XD 2QQRA 2OI3A 1AWOA 1W70A 1R77A 1VYVA 1UE9A 1CKBA 3UF4A 1VQNT 2RQVA 2CSIA 2OTLQ 2OJ2A 3PFSA 4M7AF 2DEUA 2PUOB 3KBGA 3CMEA 1RLPC 3OBWA 2P84A 2RJDA 3CCUQ 2XDBA 2M51A 3EG0A 4PJLA 3JCMe 2DKGA 2EQJA 2HKQB 1KC8U 4PJOE 4J7IA 3JRZA 4RUGA 1PKTA 3HRSA 2RI5A 3M57A 1D1CA 4M75F 2PNIA 2XMFA 1IXDA 4PJOF 3LWIA 1QCOA 2LVMA 4RTWA 3TQ7P 5GAOq 1MNDA 2SRCA 3KXTA 2DLPA 1RACB 1ZLMA 4DBHA 3VS1A 1OPKA 1AHJB 4XTVA 4M77D 2SEMA 5DY9A 3I55T 2L5QA 1TOVA 1W1FA 4OB2B 1K9MU 2DXTA 2QA4Q 3M0RA 1G3TA 3BY7A 4E6RA 4Y91A 4FSSA 1QVPA 4LDYA 4PLLA 2RH2A 1ZUYA 4M7DG 3N5BB 1UECA 2LP5A 1M9SA 3OMCA 5IHIA 2RM4A 2DVJA 1WGSA 4CI0C 5GAN4 4R56A 4OB3B 3M54A 1G2BA 2RQWA 2ATCB 1JJ2P 2LDMA 2E64A 2C06A 2OTJA 1UGSB 1BI3A 1BK2A 3I9QA 1Q81R 1RUWA 1D09B 4OGEA 3GOXA 4IUTA 1IRXA 3CMET 3E2UA 3PMIA 4FYVB 1GFDA 5D6YA 2X3WD 3JCMW 1PHTA 3JCMf 3CXCS 4M7AD 1M1FA 3REBB 4ME7A 1M2VB 1UGPB 4GLMA 2ED1A 2JM8A 3NTIA 1YJNT 5KYWA 1ABOA 1ARKA 3QZ9B 3NTHA 1I5OB 1F1BB 2VYTA 4M75D 2AKLA 2D9TA 3FJPA 1VQ6Q 1BB9A 4EMKA 3J81E 4OP0A 4JRIA 1OYXA 1VQ7A 4XTXA 1D1BA 1D0ZA 5GMKe 5GANe 2QTVA 1ZA1B 3VS6A 1VUBA 1VIFA 3CCRT 5FRMA 2HSEB 3UDCA 6AT1B 4DQ2A 3MEUA 4C8QB 2LJ3A 3S6WA 1M30A 2EGAA 3I5SA 1PD1A 3AT1B 1WJRA 1OX9A 1EFNA 2NYSA 1EX4A 1QCNA 1V1CA 1X01A 2DL3A 1AT1B 4M78E 1N9RA 2DBKA 3RNJA 1JO8A 2EJGA 2Y4YA 2FPFA 3OYAA 3MHXA 3VS2A 2OTJT 3CCMQ 4M78F 2CZ6B 2GTOA 1VQPT 4OMMA 4P5NA 3OYCA 2XG8D 1WIEA 2F5KA 3CMAA 2PTKA 3X20B 1PWTA 2ZPEB 2XKOC 3T9NA 4RTUA 2P0PA 5GJVB 1M1GA 5LJ3g 2GFAA 4X9DA 3JCMJ 1ZBXA 1Y71A 3CC7T 1M8MA 2W10A 4OB1B 4FYXB 1BBZA 1NYGA 3LW5E 3CC2A 1WI7A 3G7ZA 2P4RA 2K2VA 3A1PA 3H0FA 1VQ9Q 3BFMA 2QG9B 4KULA 2NWMA 1VQ7T 5FU6C 1AVZC 1VQOA 2VXFA 2RQRA 2LQKA 1SEMA 4Z02A 3RESA 5GANf 2DEQA 1S1NA 4JUVA 2MOXA 4A4KA 2LRQA 4OMPA 4OVAA 5AYFA 1N8RC 3EHQA 4BI3A 4ZNXA 3RUXA 4AG2C 4M7DB 2WSEE 2F1LA 4IIMA 4A63B 3CD6A 2BTTA 1TXQA 1ABQA 1Y07A 2A3LA 2RI3A 2BUDA 3LX7A 2GCXA 3OW2A 1C6VX 5GAOm 1IZ6A 2J6FA 1Q82U 3RMQA 3QDFA 4EPCA 4LN2A 3VS7A 4KGVB 2DIGA 5IT9E 3MCAB 3KUFA 1YIJQ 3JCMg 1KHCA 1M3BA 1JXMA 2HCKA 1VQKA 4C92D 4A4HA 3CCJA 2BZYA 1MHNA 1R8OB 5C0MA 3JB9F 4O5VA 3J80E 4A4EA 1QMCA 2Z0WA 1Y96A 1AWXA 4EIKA 8ATCB 3L2ZA 2CREA 2V8KA 3RBBB 3ULRB 2HQEA 1H3HA 2MMPA 2HDAA 2KT8A 3LGLA 2HKNA 1WQWA 1JJ2S 3QSUA 2JVVA 1S72T 2QI2A 3M0PA 2KQWA 2YUNA 5GAOp 1JBMA 1OZ2A 2ZZDA 4N0AA 1VQOT 1QQJA 1KHIA 3H6ZA 1YWOA 3M53A 1RABB 2HNIA 1PC0A 1AEYA 4M77B 1N8RU 3M55A 2DIQA 1BCMA 2X4XA 1YI2T 4C0DC 3M0QA 5CQXA 4C8QE 3OYIA 2OTLA 3A5ZB 4RG2A 4JLGA 5I22A 1U06A 4J9EA 2QGFB 3CCUA 3JCMb 4C8QF 1R0CB 1NJIC 1RADB 3CCVQ 5D7UA 3TEEA 4KBMB 1W2BP 3VRZA 3X24B 2P0QA 4F14A 3CPWA 5M9OA 5DLOA 4IIOA 4BB7A 4Y28E 3CQTA 1NLPC 1TUDA 1ZA2B 4J9HA 3SD4A 4DEYA 3G6ET 1FX7A 2DZ9A 1ZQ1A 3TSZA 2EQIA 2K3XA 2JS2A 2EYYA 2O4XB 1VQLQ 2V1RA 1GCPA 2VB6A 3WVDB 2RNAA 1TS9A 1PD0A 5KYUA 4FYYB 5CKDA 2AZSA 1VQMQ 2LX9A 2QA4A 2EW3A 4IKFA 2E3IA 4PJOC 2BKDN 1IGQA 3E9FA 5KYXA 2CZ1B 4XTYA 1YN8A 2L2PA 4BDZA 1RAAB 3CCQQ 1MMAA 1M3CA 1KQ2A 2K5FA 4JLIA 3OYLA 5IHNA 1NBEB 1GXIE 5GANg 1M1KC 1KD1R 1M90R 3RIRA 1PRMC 2DK3A 2QEXQ 4D8KA 1XNIA 4A53A 2NLUA 3EGUA 3OW2P 3PNWC 1Q81C 4B9WA 2A7YA 1FXXA 1WHHA 2XICA 4D8DA 1NJIU 1H8KA 3SDZA 3QHSA 4QVCA 1TWBA 4ZN1A 3JCMP 3H41A 2A37A 4NL2A 2L89A 1YJWT 1SKUB 2YWWA 5HY6A 4M7DF 2CGHA 2MPXC 2EVRA 5CK9A 2PVOB 2V1QA 3L2QA 4JRQA 1NM7A 1YJ9Q 1Y7XA 4N4HA 4ZGEB 2DTIA 3M4GA 3CXCP 4E7IA 2KI7A 2JXBA 4DEXA 3C12A 1Q7YR 4AMCA 5LJ5e 2J6KA 3JCMV 3LWHA 4ZN3A 2FB7A 2YLCA 2L0AA 3V8KA 3MEAA 2VXEA 2F69A 2J05A 2VC8A 4PL6A 3WVEB 1QWFA 2FVUA 8AT1B 3EAEA 1HSQA 4LDWA 1QLYA 3HKSA 3MKDA 5EG2A 4X1VA 1G83A 2H8HA 4QQDA 1QVGA 1WA7A 2CP0A 1M1KU 2NUZA 1Y0MA 4YTLA 1DJ7B 2IIMA 1M2OA 1OX8A 1VQ5Q 3O5ZA 2K7AA 2P4TA 1SRLA 4L5GA 4MZTA 3I56A 3CCEQ 1Q81U 1NZ9A 4EDUA 4M77E 5HK3A 2JNGA 3CCMA 2RQUA 2CKKA 2E1HA 4M77F 4HA8A 4BI8B 3NGPA 4RTTA 2E6NA 5I2SA 2CYZB 3FDRA 3NFCA 4ZTJA 1VOMA 4NL3A 4E7KA 2M1HA 2VUBA 4CRIA 3G4SQ 2RPNA 1C1AA 2KROA 1YHQA 4E7ZA 4M78C 4JJNK 2D8HA 2JT4A 2KRMA 4MDWA 2RA2A 4M7DD 3OYYA 1K9MC 3C94A 2DZCA 3CCLT 1QP3A 2FL7A 3EGXA 2MI6A 5LJ5f 1VQ9A 3VYGA 2FPEA 3HP9A 5CR2A 4C92B 1YITA 3VJPA 3D7SB 4FYWB 3SWNB 2E5QA 3PTAA 4BD3A 1K0SA 4M7AE 2XU8A 2RB6A 2YSQA 2EWNA 3NMZC 3HFNA 1W2BS 4AFZC 2KXDA 1BU1A 4MZMA 1VQ4Q 1IREB 2M02A 4M75E 1WHKA 4PKCC 1I5LA 4RKUE 2DL4A 4RTXA 2L3PA 3EH2A 3TVTA 3I56T 2JJ9A 2COWA 2EKOA 3HRUA 3RMSA 2PUKB 5LJ3f 1UFFA 4B6MA 1K73C 1YIJA 3SEMA 5FWCA 1JXOA 2LCLA 5GAOr 1Y57A 3CCST 1B07A 1BI1A 2FG0A 3DB4A 3C0CA 3CC4A 1RAEB 1YHQT 2GQVA 2JZ2A 1LJOA 1H641 4C0GA 2QXFA 5KE2A 4HCCA 2HL5C 3QYHB 3X28B 3H0HA 5J39A 3OYDA 2YXYA 1FMWA 2LX7A 2KGTA 4J5YA 4PJMA 1FMKA 3OW2S 2H3EB 1YITT 1R0BG 2PU9B 1B3QA 3TSWA 5DM7R 1X2QA 2KRNA 5GAN7 2YLBA 5IH2A 4KUIA 2L3QA 4FM4B 3P8BB 2FZGB 1KQSA 1VA7A 4Z88A 4BY6B 4L6V5 1J3TA 2V8JA 1UGQB 2YRCA 1OI1A 2CH4W 2DAQA 1WXTA 2XD0A 2COYA 3UPUA 2KT1A 3E9GA 2E65A 2LCCA 4OF1A 2FEIA 4C5HA 2XHCA 2C0IA 2CT4A 3CCVA 2X51A 2ZPHB 1ZSZC 3OBYA 3MP8A 3L2VA 4ELYC 1K73U 4LDUA 2BE9B 1M3AA 4F7UB 3EG9A 7AT1B 5IXFA 2DILA 1TU0B 2KEAA 3JCMc 4DA4A 4DOWA 4RTVA 3QXEB 1WJQA 1YIJT 4L59A 4J6YA 4UC4A 3ME9A 2LT4A 3JSCA 4C8QC 3VUZA 2Y4XA 2O9VA 2CP7A 2KK4A 4IUUA 1CKAA 2DF6A 3OMGA 3CEYA 3KFVA 2ZPIB 3CC4T 1RL2A 1VQMA 5CKBA 3PT9A 5LJ5g 3REAB 4XQ3A 4PFOA 4HVWA 2I2LA 1VYTA 5KYNA 2YRVA 2DETA 3G71A 2RO0A 3J7AF 2EYXA 5GAMe 4C92E 4Q5WA 4C0ZA 4F17A 3VYHB 4PJOA 2YHTA 4XTUA 2E12A 4JS4A 4QQ6A 4R55A 1VQNQ 3CPWS 2QK0A 1X75C 2QEXA 2MF2A 1EZZB 4RCBA 2X9HA 4C92F 2O9SA 1D0YA 2EFIA 1Z9QA 4J9BA 4JRPA 2HL3A 3UT1A 1SSFA 1M4ZA 1Q82C 2HQXA 4XTZA 3MEVA 4TVRA 4OMOA 2DD4A 1NEBA 4WF2A 1YCSB 2QQAA 1PSFA 2K5LA 3QO3A 2HZYA 1KC8R 4F16A 5CVIA 2LTOA 1KK7A 1TTHB 1SSHA 4M4ZA 1YJ9A 2KVQG 4O6JA 2LJ0A 3MPUB 3SB2A 3RKWA 2FYKA 3HL8A 3I55Q 4MZPA 2RHXA 2LQNA 2CUBA 4J9GA 2MK5A 1HYOA 4N4GA 4JZ3A 1U8RA 1UHFA 1K8AC 1XOVA 3V7RA 1N5ZA 1X43A 2PVDB 1GL5A 1IHVA 4A54A 4E7JA 2V8IA 1NG2A 1W6XA 2GF7A 1VQ8A 1B34B 2BIVA 2EYZA 2B8AA 2K57A 1QWEA 3EFOA 5HKCA 1WYXA 4PJOG 4ZGDB 1MUZA 3OS5A 1NE8A 1M90U 5A0DA 4F04B 3G71T 2QQSA 4RTZA 1HD3A 3VV0A 1VQ5A 1KIKA 1YWPA 5GAMf 1MNEA 3GP8A 5CKHA 1N6AA 4KUDK 3VUBA 3CCEA 4JS5A 3OSSC 4OMFB 2JTMA 1GFCA 2JMCA 2CH4A 2NUPA 1D3BA 2DPPB 2IVWA 4GBQA 2W0ZA 5J3BA 3QWYA 4HVUA 1RAGB 2RD1A 2RK2A 2EQMA 2YDLA 3CMAT 1MMGA 1GCQA 2NUTA 3THKA 4QVDA 1YJNQ 4DBFA 2A36A 4C5GA 2I0NA 4N4IA 2EYWA 3G4SA 3URGA 1LCKA 3JCMh 5HK0A 1IB8A 1QVGS 2F2XA 2KR3A 3RDVA 3AHUA 4F7UE 1RAHB 3L2WA 1OPLA 2FZKB 2CZ0B 2FPDA 4M77C 3M0SA 1XQHA 3CC2T 4F7UF 1SPKA 1K8AU 4LD9K 1G3WA 3NHNA 3FB9A 4J9FA 4M78A 2C0OA 1I81A 2C0TA 2KYMA 3CCRQ 5IXBA 1LOJA 2L3SA 1AZGB 4X34A 3LH5A 1K9AA 2QYZA 3A8OB 3A98A 3EG2A 1D0XA 2QDLA 1VQ8T 4E7HA 1UUEA 2KBTA 1T0HA 2LMJA 4HT8A 3FLGA 1B7TA 1XJWB 3ZEHA 1KFZA 3QZ5B 1VQ4A 4BE1A 2O2OA 3CD6T 2ABLA 2OTJQ 3CPFA 4EMHA 1OULA 2RMOA 3A8LB 3CCET 1VQPQ 4J9DA 2EQUA 5FRNA 3JB9J 1NLOC 2J06A 4CC4B 1W4SA 1UEBA 1ZUKA 2ROLA 4XU2A 1CSKA 2VGMA 2ZGWA 4M7AC 1VQKT 3H8ZA 1WZOA 3CCJT 3EH1A 3I35A 3DLLA 3CBPA 3QG1A 2QDYB 4RG8A 1D1AA 3CC7Q 5KYWB 5CCAA 2DFUA 1JQQA 4M75C 2ZAEA 3I5RA 4AT1B 4EMKB 2K4YA 1FWZA 4OB0B 1NPPA 2KDSA 2KXCA 4M78G 1NEGA 3A8HB 3OYNA 1VQ7Q 9ATCB 5GANj 4EMGA 1KJWA 2H3JA 3GPLA 3LGFA 1QKXA 3EGDA 3JCMd 4IUPA 1P92A 4IUQA 4PK4A 1G3YA 3OYEA 2DYBA 3M0UA 5D6XA 2FRYA 3V8JA 4VUBA 2XI9A 2D1XA 3QIIA 4MMLA 4Y92A 1PG5B 4BUGA 1K76A 4XU1A 4DOVA 2DL8A 5GMKh 5GANh 1RI0A 1PKSA 1IGUA 2HQHA 3GBQA 4OMNA 1MGQA 2FHDA 2OTLT 2ZCFB 2VWFA 5GAMg 1WHLA 2EJ9A 4M7DE 2FZCB 2DRMA 1IHWA 3CCUT 5GMKm 3VS0A 3ASKA 5A2QE 4HCBA 4HKEA 4II1A 3RKYA 3QYGB 1M2VA 2VGNA 1MMNA 1OEBA 2P0KA 1YP5A 4DBRA 1VYUA 2RQTA 4ATOA 1GBRA 3M5AA 2LNHB 1I1JA 2CUDA 4QW2A 3HSBA 1VQ6A 2IPOB 1AZEA 1O9SA 3U23A 1ZSZA 1WFWA 4J9IA 1T0JA 2XIDA 3ZBDA 5A0LA 5GAN6 2RJEA 2RHUA 1ZHIA 2J6OA 1KQSS 2QA4T 1S72Q 3EG3A 3OYGA 3MP6A 3L1AA 2QTXA 4C8QA 1LPLA 2HMAA 2DYIA 3E19A 3META 3SFMA 2DMOA 1UJ0A 3PMTA 1VQOQ 3MEWA 5FU7B 3OYHA 4FL6A 3JB9G 3LLRA 1YI2Q 5GAOl 1VQNA 1GCQC 1N8RR 3JB9I 4KGZB 1K1ZA 1UGRB 3VU3C 5KH6A 1E6HA 1X27A 3JAME 4ESRA 3EFSA 3GIBA 2QASA 2HBWA 5GJWB 3L42A 1N27A 3CPWP 1LVKA 4J6WA 5CIUA 1A0NB 2JOYA 3ZL7C 1N9SA 3DKMA 1V29B
chains in the Genus database with same CATH topology
1E6GA 2JTEA 1S1NA 2CH4W 1WXTA 1T3SA 2ROTA 4R0KA 2AK5A 4KRTA 2KT1A 2MOXA 2OAWA 1QCFA 4OMPA 2FEIA 2C0IA 3EHQA 2CT4A 2GGRA 4ZNXA 2K3BA 4AG2C 3PE0A 1OV3A 1I07A 2BZXA 2GTJA 2K79A 2DL7A 4IIMA 1M3AA 4A63B 5IXFA 2DILA 2VVKA 2BTTA 1ABQA 2KEAA 4RTVA 2J6FA 3H0IA 1UHCA 1SHFA 4OMLA 1NYFA 1WXBA 4LN2A 3VS7A 4J9CA 1TUCA 1GRIA 2O9VA 4QT7A 1M3BA 1JXMA 2HCKA 3UA7A 1CKAA 2DF6A 2K6DA 2MCNA 1ZSGA 3UATA 2BZYA 3QWXX 3KFVA 3VRYA 1ZUUA 1UDLA 3UA6A 1AWXA 3REAB 4EIKA 4HVWA 2CSQA 2RN8A 1VYTA 2HSPA 2CREA 2EKHA 3RBBB 2MIOA 3ULRB 2DE0X 2D8JA 1H3HA 1WX6A 2J7IA 2HDAA 2KT8A 2EYXA 4LE9A 4F17A 2LZ6B 2VKNA 1H92A 2DNUA 3M0PA 2YUNA 2K9GA 1OOTA 2O9SA 1Z9QA 4HVVA 4J9BA 4LNPA 5I11A 4AFSC 1YWOA 2JS0A 1WDXA 1AEYA 4OMOA 2GBQA 1NEBA 1YCSB 1AOJA 4Z8AA 4WCIA 3M0QA 4AFQC 2KRSA 4LUDA 2B86A 4F16A 1K0XA 2LJ1A 5I22A 1U06A 1SSHA 4J9EA 4M4ZA 1UTIA 2LJ0A 2ESWA 2YUPA 4JJDA 1AWWA 3VRZA 4AFUC 1WLPB 2YT6A 5IHKA 1AD5A 2CT3A 4F14A 1MV0B 2LQNA 4IIOA 2G6FX 2CUBA 3CQTA 4J9GA 1NLPC 1TUDA 4J9HA 4JZ3A 4DEYA 1I0CA 1SRMA 1UHFA 1XOVA 1N5ZA 3TSZA 1X43A 2EQIA 1X2KA 3SHWA 1X6BA 1GL5A 2JS2A 2EYYA 2ECZA 2V1RA 1GCPA 2KE9A 2ED0A 1NG2A 1W6XA 2EYZA 2RNAA 1QWEA 1WYXA 2D0NA 2KNBB 1MUZA 2AZSA 1HJDA 2EW3A 2A28A 4CC2A 4RTZA 1HD3A 1KIKA 3PVLA 1YWPA 2HEQA 1TG0A 1YN8A 2L2PA 1X6GA 2DM1A 1U5SA 2F2VA 1M3CA 2ENMA 5IHNA 1GFCA 2JMCA 2CH4A 1UJYA 4CC3A 2JM9A 1IO6A 1PRMC 4GBQA 2W0ZA 2DA9A 3QWYA 3R6NA 4OMQA 4HVUA 2LCSA 2FO0A 4D8KA 2YDLA 1JEGA 1UGVA 3EGUA 1GBQA 1GCQA 1WXUA 3VS4A 3THKA 1PNJA 2K2MA 2X3XD 2A36A 4ORZA 2OI3A 4D8DA 2I0NA 4K11A 1AWOA 1W70A 1H8KA 1VYVA 2EYWA 1LCKA 1UE9A 2F2XA 1CKBA 2KR3A 3H41A 3UF4A 2A37A 2RQVA 1AWJA 1ZBJA 2CSIA 2E5KA 1OPLA 2OJ2A 1K4US 2DX1A 2FPDA 1UG1A 2YUQA 2EVRA 3M0SA 1RLPC 2V1QA 2LQWA 2M51A 1NM7A 1SPKA 3EG0A 2BZ8A 3NHNA 4J9FA 4RUGA 2C0OA 3IQLA 2AZVA 2JXBA 2C0TA 1PKTA 4DEXA 2KYMA 2PNIA 2XMFA 3FJ5A 5IXBA 4AG1C 2L3SA 1AZGB 3NPFA 2J6KA 4RTWA 3LH5A 1K9AA 2SRCA 2L0AA 3A98A 3EG2A 5ECAA 2J05A 2DRKA 2QDLA 1QWFA 4RTYA 1UUEA 2AKKA 2KBTA 1HSQA 2DLPA 1T0HA 2LMJA 1ZLMA 1QLYA 3VS1A 1OPKA 3VS3A 3VS5A 4X1VA 1G83A 2H8HA 1KFZA 1MV3A 2SEMA 5FWBA 1WA7A 2O2OA 2ABLA 2EGCA 1T3LA 1W1FA 2NUZA 1Y0MA 2RMOA 3M0RA 2IIMA 4JPBW 4J9DA 4E6RA 4FSSA 3O5ZA 2K7AA 1NLOC 2J06A 4CC4B 1ZUKA 2ROLA 1SRLA 1ZUYA 1UECA 1CSKA 2LP5A 5IHIA 2DVJA 2EBPA 1G2BA 1KSWA 2RQWA 3I35A 2RQUA 3NGPA 4RTTA 1JQQA 1BK2A 3I9QA 5L23A 1YNZA 1RUWA 3I5RA 1U3OA 1ZX6A 2RPNA 2KXCA 1NEGA 2KROA 1GFDA 2X3WD 1FYNA 2D8HA 2JT4A 2KRMA 1KJWA 1PHTA 4CC7A 1QKXA 2F2WA 1SHGA 3PVQA 3REBB 4GLMA 2DYBA 2ED1A 3M0UA 2JM8A 2FRYA 1JU5C 2GQIA 2D1XA 4Y92A 1ABOA 1K76A 1ARKA 2FPEA 2DL8A 2KYBA 2YUOA 1PKSA 2AKLA 3GBQA 4OMNA 2DJQA 1BB9A 2VWFA 4HCKA 4JJCA 2O31A 4JZ4A 1X69A 1K0SA 2JMAA 2DRMA 2YSQA 2GNCA 3VS0A 3NMZC 1Z9ZA 1E7OA 2JW4A 4AFZC 2KXDA 3VS6A 4Z89A 1BU1A 1OEBA 2EGEA 1YP5A 1VYUA 2RQTA 1GBRA 2LJ3A 5HCKA 1M30A 2LNHB 2EGAA 3I5SA 4LUEA 2DL4A 4RTXA 2L3PA 3TVTA 2O88A 1I1JA 2CUDA 1EFNA 3EHRA 1V1CA 1AZEA 2DL3A 3U23A 1WFWA 4J9IA 1T0JA 2DBKA 1UFFA 3RNJA 1JO8A 4JJBA 1PRLC 2FPFA 3JV3A 3SEMA 3VS2A 2EPDA 5FWCA 1JXOA 2J6OA 2GTOA 2RF0A 1Y57A 1B07A 3EG3A 4OMMA 1QKWA 2FG0A 2M0YA 1WIEA 3C0CA 2PTKA 2DMOA 1UJ0A 1PWTA 3EG1A 4RTUA 5GJVB 5EC7A 5FW9A 3H0HA 1M27C 1GCQC 2PZ1A 2LX7A 2KGTA 1K1ZA 1FMKA 1M8MA 1E6HA 2W10A 1X27A 2CDTA 4ESRA 1B3QA 1BBZA 1NYGA 3TSWA 3M0TA 1X2QA 2KRNA 2HBWA 1WI7A 5GJWB 2A08A 2P4RA 3H0FA 1RI9A 5IH2A 4HXJA 2L3QA 1RLQC 2NWMA 1VA7A 1AVZC 1A0NB 2FRWA 3ZL7C 4Z88A 2RQRA 1SEMA 1J3TA 2DBMA 2DL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6G A;  2JTE A;  1S1N A;  2CH4 W;  1WXT A;  1T3S A;  2ROT A;  4R0K A;  2AK5 A;  4KRT A;  2KT1 A;  2MOX A;  2OAW A;  1QCF A;  4OMP A;  2FEI A;  2C0I A;  3EHQ A;  2CT4 A;  2GGR A;  4ZNX A;  2K3B A;  4AG2 C;  3PE0 A;  1OV3 A;  1I07 A;  2BZX A;  2GTJ A;  2K79 A;  2DL7 A;  4IIM A;  1M3A A;  4A63 B;  5IXF A;  2DIL A;  2VVK A;  2BTT A;  1ABQ A;  2KEA A;  4RTV A;  2J6F A;  3H0I A;  1UHC A;  1SHF A;  4OML A;  1NYF A;  1WXB A;  4LN2 A;  3VS7 A;  4J9C A;  1TUC A;  1GRI A;  2O9V A;  4QT7 A;  1M3B A;  1JXM A;  2HCK A;  3UA7 A;  1CKA A;  2DF6 A;  2K6D A;  2MCN A;  1ZSG A;  3UAT A;  2BZY A;  3QWX X;  3KFV A;  3VRY A;  1ZUU A;  1UDL A;  3UA6 A;  1AWX A;  3REA B;  4EIK A;  4HVW A;  2CSQ A;  2RN8 A;  1VYT A;  2HSP A;  2CRE A;  2EKH A;  3RBB B;  2MIO A;  3ULR B;  2DE0 X;  2D8J A;  1H3H A;  1WX6 A;  2J7I A;  2HDA A;  2KT8 A;  2EYX A;  4LE9 A;  4F17 A;  2LZ6 B;  2VKN A;  1H92 A;  2DNU A;  3M0P A;  2YUN A;  2K9G A;  1OOT A;  2O9S A;  1Z9Q A;  4HVV A;  4J9B A;  4LNP A;  5I11 A;  4AFS C;  1YWO A;  2JS0 A;  1WDX A;  1AEY A;  4OMO A;  2GBQ A;  1NEB A;  1YCS B;  1AOJ A;  4Z8A A;  4WCI A;  3M0Q A;  4AFQ C;  2KRS A;  4LUD A;  2B86 A;  4F16 A;  1K0X A;  2LJ1 A;  5I22 A;  1U06 A;  1SSH A;  4J9E A;  4M4Z A;  1UTI A;  2LJ0 A;  2ESW A;  2YUP A;  4JJD A;  1AWW A;  3VRZ A;  4AFU C;  1WLP B;  2YT6 A;  5IHK A;  1AD5 A;  2CT3 A;  4F14 A;  1MV0 B;  2LQN A;  4IIO A;  2G6F X;  2CUB A;  3CQT A;  4J9G A;  1NLP C;  1TUD A;  4J9H A;  4JZ3 A;  4DEY A;  1I0C A;  1SRM A;  1UHF A;  1XOV A;  1N5Z A;  3TSZ A;  1X43 A;  2EQI A;  1X2K A;  3SHW A;  1X6B A;  1GL5 A;  2JS2 A;  2EYY A;  2ECZ A;  2V1R A;  1GCP A;  2KE9 A;  2ED0 A;  1NG2 A;  1W6X A;  2EYZ A;  2RNA A;  1QWE A;  1WYX A;  2D0N A;  2KNB B;  1MUZ A;  2AZS A;  1HJD A;  2EW3 A;  2A28 A;  4CC2 A;  4RTZ A;  1HD3 A;  1KIK A;  3PVL A;  1YWP A;  2HEQ A;  1TG0 A;  1YN8 A;  2L2P A;  1X6G A;  2DM1 A;  1U5S A;  2F2V A;  1M3C A;  2ENM A;  5IHN A;  1GFC A;  2JMC A;  2CH4 A;  1UJY A;  4CC3 A;  2JM9 A;  1IO6 A;  1PRM C;  4GBQ A;  2W0Z A;  2DA9 A;  3QWY A;  3R6N A;  4OMQ A;  4HVU A;  2LCS A;  2FO0 A;  4D8K A;  2YDL A;  1JEG A;  1UGV A;  3EGU A;  1GBQ A;  1GCQ A;  1WXU A;  3VS4 A;  3THK A;  1PNJ A;  2K2M A;  2X3X D;  2A36 A;  4ORZ A;  2OI3 A;  4D8D A;  2I0N A;  4K11 A;  1AWO A;  1W70 A;  1H8K A;  1VYV A;  2EYW A;  1LCK A;  1UE9 A;  2F2X A;  1CKB A;  2KR3 A;  3H41 A;  3UF4 A;  2A37 A;  2RQV A;  1AWJ A;  1ZBJ A;  2CSI A;  2E5K A;  1OPL A;  2OJ2 A;  1K4U S;  2DX1 A;  2FPD A;  1UG1 A;  2YUQ A;  2EVR A;  3M0S A;  1RLP C;  2V1Q A;  2LQW A;  2M51 A;  1NM7 A;  1SPK A;  3EG0 A;  2BZ8 A;  3NHN A;  4J9F A;  4RUG A;  2C0O A;  3IQL A;  2AZV A;  2JXB A;  2C0T A;  1PKT A;  4DEX A;  2KYM A;  2PNI A;  2XMF A;  3FJ5 A;  5IXB A;  4AG1 C;  2L3S A;  1AZG B;  3NPF A;  2J6K A;  4RTW A;  3LH5 A;  1K9A A;  2SRC A;  2L0A A;  3A98 A;  3EG2 A;  5ECA A;  2J05 A;  2DRK A;  2QDL A;  1QWF A;  4RTY A;  1UUE A;  2AKK A;  2KBT A;  1HSQ A;  2DLP A;  1T0H A;  2LMJ A;  1ZLM A;  1QLY A;  3VS1 A;  1OPK A;  3VS3 A;  3VS5 A;  4X1V A;  1G83 A;  2H8H A;  1KFZ A;  1MV3 A;  2SEM A;  5FWB A;  1WA7 A;  2O2O A;  2ABL A;  2EGC A;  1T3L A;  1W1F A;  2NUZ A;  1Y0M A;  2RMO A;  3M0R A;  2IIM A;  4JPB W;  4J9D A;  4E6R A;  4FSS A;  3O5Z A;  2K7A A;  1NLO C;  2J06 A;  4CC4 B;  1ZUK A;  2ROL A;  1SRL A;  1ZUY A;  1UEC A;  1CSK A;  2LP5 A;  5IHI A;  2DVJ A;  2EBP A;  1G2B A;  1KSW A;  2RQW A;  3I35 A;  2RQU A;  3NGP A;  4RTT A;  1JQQ A;  1BK2 A;  3I9Q A;  5L23 A;  1YNZ A;  1RUW A;  3I5R A;  1U3O A;  1ZX6 A;  2RPN A;  2KXC A;  1NEG A;  2KRO A;  1GFD A;  2X3W D;  1FYN A;  2D8H A;  2JT4 A;  2KRM A;  1KJW A;  1PHT A;  4CC7 A;  1QKX A;  2F2W A;  1SHG A;  3PVQ A;  3REB B;  4GLM A;  2DYB A;  2ED1 A;  3M0U A;  2JM8 A;  2FRY A;  1JU5 C;  2GQI A;  2D1X A;  4Y92 A;  1ABO A;  1K76 A;  1ARK A;  2FPE A;  2DL8 A;  2KYB A;  2YUO A;  1PKS A;  2AKL A;  3GBQ A;  4OMN A;  2DJQ A;  1BB9 A;  2VWF A;  4HCK A;  4JJC A;  2O31 A;  4JZ4 A;  1X69 A;  1K0S A;  2JMA A;  2DRM A;  2YSQ A;  2GNC A;  3VS0 A;  3NMZ C;  1Z9Z A;  1E7O A;  2JW4 A;  4AFZ C;  2KXD A;  3VS6 A;  4Z89 A;  1BU1 A;  1OEB A;  2EGE A;  1YP5 A;  1VYU A;  2RQT A;  1GBR A;  2LJ3 A;  5HCK A;  1M30 A;  2LNH B;  2EGA A;  3I5S A;  4LUE A;  2DL4 A;  4RTX A;  2L3P A;  3TVT A;  2O88 A;  1I1J A;  2CUD A;  1EFN A;  3EHR A;  1V1C A;  1AZE A;  2DL3 A;  3U23 A;  1WFW A;  4J9I A;  1T0J A;  2DBK A;  1UFF A;  3RNJ A;  1JO8 A;  4JJB A;  1PRL C;  2FPF A;  3JV3 A;  3SEM A;  3VS2 A;  2EPD A;  5FWC A;  1JXO A;  2J6O A;  2GTO A;  2RF0 A;  1Y57 A;  1B07 A;  3EG3 A;  4OMM A;  1QKW A;  2FG0 A;  2M0Y A;  1WIE A;  3C0C A;  2PTK A;  2DMO A;  1UJ0 A;  1PWT A;  3EG1 A;  4RTU A;  5GJV B;  5EC7 A;  5FW9 A;  3H0H A;  1M27 C;  1GCQ C;  2PZ1 A;  2LX7 A;  2KGT A;  1K1Z A;  1FMK A;  1M8M A;  1E6H A;  2W10 A;  1X27 A;  2CDT A;  4ESR A;  1B3Q A;  1BBZ A;  1NYG A;  3TSW A;  3M0T A;  1X2Q A;  2KRN A;  2HBW A;  1WI7 A;  5GJW B;  2A08 A;  2P4R A;  3H0F A;  1RI9 A;  5IH2 A;  4HXJ A;  2L3Q A;  1RLQ C;  2NWM A;  1VA7 A;  1AVZ C;  1A0N B;  2FRW A;  3ZL7 C;  4Z88 A;  2RQR A;  1SEM A;  1J3T A;  2DBM A;  2DL5 A; 
#chains in the Genus database with same CATH topology
 2RI2 A;  1E6G A;  2JTE A;  3V7C A;  1OZ3 A;  3JCM Q;  2ROT A;  1T3S A;  5GAN d;  4C92 C;  2DTH A;  2OAW A;  3G6E Q;  2E10 A;  1I8F A;  2K3B A;  3R6O A;  3OS1 A;  1I07 A;  5C6S A;  2BZX A;  2DD5 A;  1VQ6 T;  2GTJ A;  3I55 A;  2DL7 A;  1Y96 B;  2VVK A;  5LL6 S;  1ACM B;  1KQ1 A;  2QGG A;  4E2F B;  4RMO A;  3X25 B;  4J8O A;  3JCM X;  4ANJ A;  3OS2 A;  1QVF A;  2YRD A;  2XK0 A;  3H0I A;  1UHC A;  4C8Q G;  2Y90 A;  3F70 A;  1WXB A;  4KH1 B;  4J9C A;  2M9U A;  4QT7 A;  4KH0 B;  2K6D A;  2MWP A;  3UAT A;  1C0M A;  3OB9 A;  1PCX A;  3VRY A;  1ZUU A;  3X26 B;  3UA6 A;  3OYJ A;  2CSQ A;  2HAX A;  1VIE A;  2PQW A;  2RN8 A;  2EKH A;  5CO7 A;  2DE0 X;  2CP3 A;  2LNV A;  3FIF A;  1M5Q 1;  3CCM T;  2EQK A;  2M0O A;  2LZ6 B;  4A4F A;  1H92 A;  3L2U A;  3ZFJ A;  3HHT B;  1Q86 R;  1NJI R;  1YJW Q;  3C4S A;  3OYB A;  3OS0 A;  4BAC A;  1SF9 A;  4FW2 A;  2QQB A;  3EFR A;  2JS0 A;  1YJN A;  2JUF A;  1WQ7 A;  1XTD A;  4WCI A;  4Z8A A;  4AFQ C;  2KRS A;  4LUD A;  1U1S A;  4JDS A;  2B86 A;  1MMD A;  1K0X A;  2E41 A;  3GLX A;  2XDP A;  2DVE A;  1UTI A;  1QVG P;  5FRO A;  4BY6 C;  4LDX A;  1VQ9 T;  2ESW A;  2YUP A;  5KYU B;  3CBM A;  4BI4 A;  4AFU C;  3CCR A;  1WLP B;  2YT6 A;  1AD5 A;  4FSX A;  4M77 A;  2AHJ B;  1LNX A;  5KYX B;  2WSC E;  2CP6 A;  4J6X A;  3P8H A;  2RJF A;  3OYM A;  1M1K R;  2D6F A;  4JRK A;  2X4W A;  1X2K A;  1Q95 G;  3DLM A;  3EGD B;  5GMK l;  2DO3 A;  1HJD A;  3ER0 A;  1VQP A;  4CC2 A;  1YBY A;  4PFP A;  1WNL A;  2OX7 A;  1X6G A;  2F2V A;  2ENM A;  2DXB A;  2LQ8 A;  1UJY A;  2RHY A;  3OSV A;  2JM9 A;  2MYS A;  2O4X A;  1IO6 A;  3MO8 A;  1BYM A;  1TSF A;  4PJN A;  1VQL A;  3BW1 A;  3QJY A;  4X9C A;  2LCS A;  3CC7 A;  4M7A A;  3RKX A;  4J83 A;  1GBQ A;  1WXU A;  3VS4 A;  3CCL Q;  5LJ5 j;  1QVF P;  2X4J A;  3V7S A;  5IAY A;  4XK8 E;  5A0G A;  4PJO D;  4ORZ A;  2KSS A;  1ZSZ B;  4K11 A;  3CCQ A;  1OU8 A;  1AWJ A;  1ZBJ A;  1WPY A;  3INZ A;  3OQ5 A;  2E5K A;  4M75 A;  4M77 G;  5I2M A;  2K3Y A;  1K4U S;  2DX1 A;  1UG1 A;  2YUQ A;  1JRI A;  1KD1 C;  1M90 C;  5LJ5 h;  5KCH A;  2LQW A;  3BDL A;  3V8L A;  2BZ8 A;  1EIF A;  2L8D A;  3S3M A;  3HRT A;  3IQL A;  2AZV A;  3FJ5 A;  4AG1 C;  3A8M B;  2X4Y A;  3NPF A;  3WXM B;  2LT1 A;  4ZGJ B;  4PNO A;  3M4Y A;  3GNG A;  3I56 Q;  5ECA A;  2DRK A;  4RTY A;  2AKK A;  5LJ3 j;  3CCV T;  3VS3 A;  3VS5 A;  5I21 A;  2CP5 A;  1MV3 A;  4XU3 A;  1KG1 A;  5FWB A;  2EJF A;  2PVG B;  2EGC A;  5GAO n;  1T3L A;  1JB0 E;  4FW1 A;  1WHM A;  3JB9 H;  1W2B A;  3QJ6 A;  5KYY A;  3CCS Q;  2E3H A;  4JPB W;  2L3R A;  5LJ3 h;  3LYI A;  1Q7Y C;  1FMV A;  4M7A G;  4FT4 A;  1YHQ Q;  1VQL T;  1OQK A;  4M7D C;  3P8D A;  2G3R A;  1K9M R;  2EBP A;  4E47 A;  1KSW A;  3O8V A;  1VQM T;  1S72 A;  1X6O A;  4PFZ A;  2A0F B;  4M75 G;  2QAZ A;  3EGX B;  1YIT Q;  3CCQ T;  1KD1 U;  5L23 A;  1YNZ A;  1KQS P;  1U3O A;  3QPH A;  1ZX6 A;  1O75 A;  5GAN 5;  1RAI B;  5GMK i;  4KT0 E;  5IN1 A;  4FCY A;  5GAN 3;  2F5T X;  1V76 A;  3RR6 A;  2QEX T;  1FYN A;  1YI2 A;  3CBO A;  3OYF A;  4CC7 A;  2F2W A;  1SHG A;  5FU6 B;  3PVQ A;  1M8V A;  3LH0 A;  1G5V A;  3CME Q;  2RHZ A;  4ELZ C;  1JU5 C;  2GQI A;  4FIB A;  4NS5 A;  1BIB A;  4GY5 A;  4ZTF A;  2HD0 A;  5LJ5 d;  2EAY A;  2KYB A;  2YUO A;  3OA6 A;  4MMK A;  2DJQ A;  4J7F A;  4LXC A;  4HCK A;  4JJC A;  2O31 A;  2ZPG B;  4JZ4 A;  4E7S A;  1X69 A;  2JMA A;  1K73 R;  2GNC A;  5FLX E;  5KE3 A;  1YJ9 T;  3Q1J A;  3G6E A;  2MWO A;  1Z9Z A;  3GNF B;  4M78 D;  1Q7Y U;  1E7O A;  2JW4 A;  4XAX B;  4Z89 A;  3FEO A;  3OY9 A;  2EGE A;  3QBY A;  3TU4 K;  3HFO A;  5HCK A;  4C92 A;  3CC4 Q;  4LUE A;  3CXC A;  2HBP A;  2O88 A;  3SWN A;  4E7L A;  2DTO A;  1H3Z A;  3EHR A;  2DXC A;  5KCO A;  4OGC A;  4FT2 A;  3DB3 A;  1U1T A;  4JJB A;  1PRL C;  2CP2 A;  5LJ3 d;  4B9X A;  3JV3 A;  1G8X A;  2EPD A;  4FU6 A;  3M9Q A;  2RF0 A;  1YFN A;  4XU0 A;  4WTO B;  1VQ5 T;  1QKW A;  3BDU A;  2M0Y A;  1G3S A;  3H9N A;  3L2R A;  2AIR B;  1I4K 1;  5L8R E;  2E6Z A;  2EIF A;  3FRN A;  3QUI A;  3EG1 A;  2GFU A;  5EC7 A;  2K5I A;  2DXU A;  5FW9 A;  1YCY A;  2COZ A;  3HTR A;  1M27 C;  1SG5 A;  4XTW A;  1BCO A;  2PZ1 A;  2V26 A;  1YJW A;  1Q86 C;  4C0F A;  4EMK C;  2RHI A;  2CDT A;  1QVF S;  4C0D B;  3M0T A;  2A08 A;  1RI9 A;  2X35 A;  3EG9 B;  4HXJ A;  3G4S T;  2M16 A;  1RLQ C;  1BI0 A;  2FRW A;  3E1S A;  2DBM A;  2DL5 A;  3UWN A;  4C92 G;  5DLQ E;  2R58 A;  3S3N A;  3BE3 A;  3C95 A;  4R0K A;  2AK5 A;  4KRT A;  5GMK j;  2ZPB B;  4RCC A;  1QCF A;  2JTF A;  5J26 A;  3M58 A;  2LC4 A;  2GGR A;  3FC3 A;  3RER A;  3JB9 D;  3QKJ A;  3PE0 A;  4M7A B;  1OV3 A;  1RAF B;  1BKB A;  1PM3 A;  2RK1 A;  2K79 A;  2KY9 A;  3M56 A;  2QQ9 A;  2JN0 A;  3MP1 A;  1BIA A;  1TUG B;  3G71 Q;  1HXD A;  2EYQ A;  5GAM j;  4M75 B;  3PGG A;  1SHF A;  4OML A;  1NYF A;  4BE0 A;  4PJO B;  3OYK A;  1TUC A;  2CS7 A;  2CZ7 B;  2KMT A;  1GRI A;  5D6W A;  1VQ4 T;  1HK9 A;  3UA7 A;  2MCN A;  1ZSG A;  3HPW A;  3QWX X;  1OU9 A;  2AT1 B;  3S3O A;  1WHJ A;  4GLK A;  4C5E A;  2DJZ A;  5GAM h;  1Q82 R;  2O01 E;  1UDL A;  2E70 A;  4F7U A;  1Q86 U;  4IUR A;  2MAM A;  3CMA Q;  2HSP A;  2MIO A;  2D8J A;  4IUV A;  1WX6 A;  1PSE A;  2WAC A;  2OAU A;  2J7I A;  3G1J A;  4LE9 A;  3MJX A;  4QVZ A;  2VKN A;  2DNU A;  4D6W A;  4C8Q D;  1WJS A;  2R5M A;  2K9G A;  4BE2 A;  4PJJ A;  1OOT A;  2D0Q B;  4BDY A;  1QP2 A;  1TH7 A;  5FU7 C;  4HVV A;  4LNP A;  2IG0 A;  3CC2 Q;  5I11 A;  5KYY B;  3CCL A;  4AFS C;  1WDX A;  2GBQ A;  5CKF A;  3VKI A;  2BE7 D;  1AOJ A;  2RJC A;  3TRE A;  1K8A R;  4LDV A;  4C5I A;  2LJ1 A;  2ZPF B;  2KAF A;  4NOY A;  1BI2 A;  1WHG A;  1VQ8 Q;  3EFO B;  4JJD A;  2R57 A;  1JJ2 A;  2WSF E;  1AWW A;  4HT9 A;  2VAS A;  2XDD A;  2R5A A;  5IHK A;  2CT3 A;  4A4G A;  3CD6 Q;  1MV0 B;  2G6F X;  2E4H A;  3QDR B;  1I0C A;  1SRM A;  3TCJ A;  4F7U G;  3SHW A;  1KC8 C;  1X6B A;  2NUP B;  5LJ3 e;  1D3B B;  2ECZ A;  2KE9 A;  2ED0 A;  5CKE A;  1VQK Q;  5CQY A;  3SWN C;  3CCJ Q;  4KGX B;  2D0N A;  2KNB B;  3CCS A;  2A28 A;  2VV5 A;  2NUT B;  3PVL A;  4QQG A;  2HEQ A;  1TG0 A;  3A8G B;  3PIO A;  3GF5 A;  2DM1 A;  4DBQ A;  1U5S A;  4N0A C;  5GAM d;  3M59 A;  3NTK A;  2DER A;  1UB4 A;  1QW1 A;  4CC3 A;  4LD6 A;  5AT1 B;  4V2S A;  4QKU A;  2DA9 A;  5GAN 8;  4MDX A;  3R6N A;  1B34 A;  4OMQ A;  2FO0 A;  4PLI A;  5GAN 2;  1JEG A;  1UGV A;  5CAI A;  4M7D A;  4M78 B;  3PIP A;  1NPR A;  1PNJ A;  4HCZ A;  2K2M A;  2X3X D;  2QQR A;  2OI3 A;  1AWO A;  1W70 A;  1R77 A;  1VYV A;  1UE9 A;  1CKB A;  3UF4 A;  1VQN T;  2RQV A;  2CSI A;  2OTL Q;  2OJ2 A;  3PFS A;  4M7A F;  2DEU A;  2PUO B;  3KBG A;  3CME A;  1RLP C;  3OBW A;  2P84 A;  2RJD A;  3CCU Q;  2XDB A;  2M51 A;  3EG0 A;  4PJL A;  3JCM e;  2DKG A;  2EQJ A;  2HKQ B;  1KC8 U;  4PJO E;  4J7I A;  3JRZ A;  4RUG A;  1PKT A;  3HRS A;  2RI5 A;  3M57 A;  1D1C A;  4M75 F;  2PNI A;  2XMF A;  1IXD A;  4PJO F;  3LWI A;  1QCO A;  2LVM A;  4RTW A;  3TQ7 P;  5GAO q;  1MND A;  2SRC A;  3KXT A;  2DLP A;  1RAC B;  1ZLM A;  4DBH A;  3VS1 A;  1OPK A;  1AHJ B;  4XTV A;  4M77 D;  2SEM A;  5DY9 A;  3I55 T;  2L5Q A;  1TOV A;  1W1F A;  4OB2 B;  1K9M U;  2DXT A;  2QA4 Q;  3M0R A;  1G3T A;  3BY7 A;  4E6R A;  4Y91 A;  4FSS A;  1QVP A;  4LDY A;  4PLL A;  2RH2 A;  1ZUY A;  4M7D G;  3N5B B;  1UEC A;  2LP5 A;  1M9S A;  3OMC A;  5IHI A;  2RM4 A;  2DVJ A;  1WGS A;  4CI0 C;  5GAN 4;  4R56 A;  4OB3 B;  3M54 A;  1G2B A;  2RQW A;  2ATC B;  1JJ2 P;  2LDM A;  2E64 A;  2C06 A;  2OTJ A;  1UGS B;  1BI3 A;  1BK2 A;  3I9Q A;  1Q81 R;  1RUW A;  1D09 B;  4OGE A;  3GOX A;  4IUT A;  1IRX A;  3CME T;  3E2U A;  3PMI A;  4FYV B;  1GFD A;  5D6Y A;  2X3W D;  3JCM W;  1PHT A;  3JCM f;  3CXC S;  4M7A D;  1M1F A;  3REB B;  4ME7 A;  1M2V B;  1UGP B;  4GLM A;  2ED1 A;  2JM8 A;  3NTI A;  1YJN T;  5KYW A;  1ABO A;  1ARK A;  3QZ9 B;  3NTH A;  1I5O B;  1F1B B;  2VYT A;  4M75 D;  2AKL A;  2D9T A;  3FJP A;  1VQ6 Q;  1BB9 A;  4EMK A;  3J81 E;  4OP0 A;  4JRI A;  1OYX A;  1VQ7 A;  4XTX A;  1D1B A;  1D0Z A;  5GMK e;  5GAN e;  2QTV A;  1ZA1 B;  3VS6 A;  1VUB A;  1VIF A;  3CCR T;  5FRM A;  2HSE B;  3UDC A;  6AT1 B;  4DQ2 A;  3MEU A;  4C8Q B;  2LJ3 A;  3S6W A;  1M30 A;  2EGA A;  3I5S A;  1PD1 A;  3AT1 B;  1WJR A;  1OX9 A;  1EFN A;  2NYS A;  1EX4 A;  1QCN A;  1V1C A;  1X01 A;  2DL3 A;  1AT1 B;  4M78 E;  1N9R A;  2DBK A;  3RNJ A;  1JO8 A;  2EJG A;  2Y4Y A;  2FPF A;  3OYA A;  3MHX A;  3VS2 A;  2OTJ T;  3CCM Q;  4M78 F;  2CZ6 B;  2GTO A;  1VQP T;  4OMM A;  4P5N A;  3OYC A;  2XG8 D;  1WIE A;  2F5K A;  3CMA A;  2PTK A;  3X20 B;  1PWT A;  2ZPE B;  2XKO C;  3T9N A;  4RTU A;  2P0P A;  5GJV B;  1M1G A;  5LJ3 g;  2GFA A;  4X9D A;  3JCM J;  1ZBX A;  1Y71 A;  3CC7 T;  1M8M A;  2W10 A;  4OB1 B;  4FYX B;  1BBZ A;  1NYG A;  3LW5 E;  3CC2 A;  1WI7 A;  3G7Z A;  2P4R A;  2K2V A;  3A1P A;  3H0F A;  1VQ9 Q;  3BFM A;  2QG9 B;  4KUL A;  2NWM A;  1VQ7 T;  5FU6 C;  1AVZ C;  1VQO A;  2VXF A;  2RQR A;  2LQK A;  1SEM A;  4Z02 A;  3RES A;  5GAN f;  2DEQ A;  1S1N A;  4JUV A;  2MOX A;  4A4K A;  2LRQ A;  4OMP A;  4OVA A;  5AYF A;  1N8R C;  3EHQ A;  4BI3 A;  4ZNX A;  3RUX A;  4AG2 C;  4M7D B;  2WSE E;  2F1L A;  4IIM A;  4A63 B;  3CD6 A;  2BTT A;  1TXQ A;  1ABQ A;  1Y07 A;  2A3L A;  2RI3 A;  2BUD A;  3LX7 A;  2GCX A;  3OW2 A;  1C6V X;  5GAO m;  1IZ6 A;  2J6F A;  1Q82 U;  3RMQ A;  3QDF A;  4EPC A;  4LN2 A;  3VS7 A;  4KGV B;  2DIG A;  5IT9 E;  3MCA B;  3KUF A;  1YIJ Q;  3JCM g;  1KHC A;  1M3B A;  1JXM A;  2HCK A;  1VQK A;  4C92 D;  4A4H A;  3CCJ A;  2BZY A;  1MHN A;  1R8O B;  5C0M A;  3JB9 F;  4O5V A;  3J80 E;  4A4E A;  1QMC A;  2Z0W A;  1Y96 A;  1AWX A;  4EIK A;  8ATC B;  3L2Z A;  2CRE A;  2V8K A;  3RBB B;  3ULR B;  2HQE A;  1H3H A;  2MMP A;  2HDA A;  2KT8 A;  3LGL A;  2HKN A;  1WQW A;  1JJ2 S;  3QSU A;  2JVV A;  1S72 T;  2QI2 A;  3M0P A;  2KQW A;  2YUN A;  5GAO p;  1JBM A;  1OZ2 A;  2ZZD A;  4N0A A;  1VQO T;  1QQJ A;  1KHI A;  3H6Z A;  1YWO A;  3M53 A;  1RAB B;  2HNI A;  1PC0 A;  1AEY A;  4M77 B;  1N8R U;  3M55 A;  2DIQ A;  1BCM A;  2X4X A;  1YI2 T;  4C0D C;  3M0Q A;  5CQX A;  4C8Q E;  3OYI A;  2OTL A;  3A5Z B;  4RG2 A;  4JLG A;  5I22 A;  1U06 A;  4J9E A;  2QGF B;  3CCU A;  3JCM b;  4C8Q F;  1R0C B;  1NJI C;  1RAD B;  3CCV Q;  5D7U A;  3TEE A;  4KBM B;  1W2B P;  3VRZ A;  3X24 B;  2P0Q A;  4F14 A;  3CPW A;  5M9O A;  5DLO A;  4IIO A;  4BB7 A;  4Y28 E;  3CQT A;  1NLP C;  1TUD A;  1ZA2 B;  4J9H A;  3SD4 A;  4DEY A;  3G6E T;  1FX7 A;  2DZ9 A;  1ZQ1 A;  3TSZ A;  2EQI A;  2K3X A;  2JS2 A;  2EYY A;  2O4X B;  1VQL Q;  2V1R A;  1GCP A;  2VB6 A;  3WVD B;  2RNA A;  1TS9 A;  1PD0 A;  5KYU A;  4FYY B;  5CKD A;  2AZS A;  1VQM Q;  2LX9 A;  2QA4 A;  2EW3 A;  4IKF A;  2E3I A;  4PJO C;  2BKD N;  1IGQ A;  3E9F A;  5KYX A;  2CZ1 B;  4XTY A;  1YN8 A;  2L2P A;  4BDZ A;  1RAA B;  3CCQ Q;  1MMA A;  1M3C A;  1KQ2 A;  2K5F A;  4JLI A;  3OYL A;  5IHN A;  1NBE B;  1GXI E;  5GAN g;  1M1K C;  1KD1 R;  1M90 R;  3RIR A;  1PRM C;  2DK3 A;  2QEX Q;  4D8K A;  1XNI A;  4A53 A;  2NLU A;  3EGU A;  3OW2 P;  3PNW C;  1Q81 C;  4B9W A;  2A7Y A;  1FXX A;  1WHH A;  2XIC A;  4D8D A;  1NJI U;  1H8K A;  3SDZ A;  3QHS A;  4QVC A;  1TWB A;  4ZN1 A;  3JCM P;  3H41 A;  2A37 A;  4NL2 A;  2L89 A;  1YJW T;  1SKU B;  2YWW A;  5HY6 A;  4M7D F;  2CGH A;  2MPX C;  2EVR A;  5CK9 A;  2PVO B;  2V1Q A;  3L2Q A;  4JRQ A;  1NM7 A;  1YJ9 Q;  1Y7X A;  4N4H A;  4ZGE B;  2DTI A;  3M4G A;  3CXC P;  4E7I A;  2KI7 A;  2JXB A;  4DEX A;  3C12 A;  1Q7Y R;  4AMC A;  5LJ5 e;  2J6K A;  3JCM V;  3LWH A;  4ZN3 A;  2FB7 A;  2YLC A;  2L0A A;  3V8K A;  3MEA A;  2VXE A;  2F69 A;  2J05 A;  2VC8 A;  4PL6 A;  3WVE B;  1QWF A;  2FVU A;  8AT1 B;  3EAE A;  1HSQ A;  4LDW A;  1QLY A;  3HKS A;  3MKD A;  5EG2 A;  4X1V A;  1G83 A;  2H8H A;  4QQD A;  1QVG A;  1WA7 A;  2CP0 A;  1M1K U;  2NUZ A;  1Y0M A;  4YTL A;  1DJ7 B;  2IIM A;  1M2O A;  1OX8 A;  1VQ5 Q;  3O5Z A;  2K7A A;  2P4T A;  1SRL A;  4L5G A;  4MZT A;  3I56 A;  3CCE Q;  1Q81 U;  1NZ9 A;  4EDU A;  4M77 E;  5HK3 A;  2JNG A;  3CCM A;  2RQU A;  2CKK A;  2E1H A;  4M77 F;  4HA8 A;  4BI8 B;  3NGP A;  4RTT A;  2E6N A;  5I2S A;  2CYZ B;  3FDR A;  3NFC A;  4ZTJ A;  1VOM A;  4NL3 A;  4E7K A;  2M1H A;  2VUB A;  4CRI A;  3G4S Q;  2RPN A;  1C1A A;  2KRO A;  1YHQ A;  4E7Z A;  4M78 C;  4JJN K;  2D8H A;  2JT4 A;  2KRM A;  4MDW A;  2RA2 A;  4M7D D;  3OYY A;  1K9M C;  3C94 A;  2DZC A;  3CCL T;  1QP3 A;  2FL7 A;  3EGX A;  2MI6 A;  5LJ5 f;  1VQ9 A;  3VYG A;  2FPE A;  3HP9 A;  5CR2 A;  4C92 B;  1YIT A;  3VJP A;  3D7S B;  4FYW B;  3SWN B;  2E5Q A;  3PTA A;  4BD3 A;  1K0S A;  4M7A E;  2XU8 A;  2RB6 A;  2YSQ A;  2EWN A;  3NMZ C;  3HFN A;  1W2B S;  4AFZ C;  2KXD A;  1BU1 A;  4MZM A;  1VQ4 Q;  1IRE B;  2M02 A;  4M75 E;  1WHK A;  4PKC C;  1I5L A;  4RKU E;  2DL4 A;  4RTX A;  2L3P A;  3EH2 A;  3TVT A;  3I56 T;  2JJ9 A;  2COW A;  2EKO A;  3HRU A;  3RMS A;  2PUK B;  5LJ3 f;  1UFF A;  4B6M A;  1K73 C;  1YIJ A;  3SEM A;  5FWC A;  1JXO A;  2LCL A;  5GAO r;  1Y57 A;  3CCS T;  1B07 A;  1BI1 A;  2FG0 A;  3DB4 A;  3C0C A;  3CC4 A;  1RAE B;  1YHQ T;  2GQV A;  2JZ2 A;  1LJO A;  1H64 1;  4C0G A;  2QXF A;  5KE2 A;  4HCC A;  2HL5 C;  3QYH B;  3X28 B;  3H0H A;  5J39 A;  3OYD A;  2YXY A;  1FMW A;  2LX7 A;  2KGT A;  4J5Y A;  4PJM A;  1FMK A;  3OW2 S;  2H3E B;  1YIT T;  1R0B G;  2PU9 B;  1B3Q A;  3TSW A;  5DM7 R;  1X2Q A;  2KRN A;  5GAN 7;  2YLB A;  5IH2 A;  4KUI A;  2L3Q A;  4FM4 B;  3P8B B;  2FZG B;  1KQS A;  1VA7 A;  4Z88 A;  4BY6 B;  4L6V 5;  1J3T A;  2V8J A;  1UGQ B;  2YRC A;  1OI1 A;  2CH4 W;  2DAQ A;  1WXT A;  2XD0 A;  2COY A;  3UPU A;  2KT1 A;  3E9G A;  2E65 A;  2LCC A;  4OF1 A;  2FEI A;  4C5H A;  2XHC A;  2C0I A;  2CT4 A;  3CCV A;  2X51 A;  2ZPH B;  1ZSZ C;  3OBY A;  3MP8 A;  3L2V A;  4ELY C;  1K73 U;  4LDU A;  2BE9 B;  1M3A A;  4F7U B;  3EG9 A;  7AT1 B;  5IXF A;  2DIL A;  1TU0 B;  2KEA A;  3JCM c;  4DA4 A;  4DOW A;  4RTV A;  3QXE B;  1WJQ A;  1YIJ T;  4L59 A;  4J6Y A;  4UC4 A;  3ME9 A;  2LT4 A;  3JSC A;  4C8Q C;  3VUZ A;  2Y4X A;  2O9V A;  2CP7 A;  2KK4 A;  4IUU A;  1CKA A;  2DF6 A;  3OMG A;  3CEY A;  3KFV A;  2ZPI B;  3CC4 T;  1RL2 A;  1VQM A;  5CKB A;  3PT9 A;  5LJ5 g;  3REA B;  4XQ3 A;  4PFO A;  4HVW A;  2I2L A;  1VYT A;  5KYN A;  2YRV A;  2DET A;  3G71 A;  2RO0 A;  3J7A F;  2EYX A;  5GAM e;  4C92 E;  4Q5W A;  4C0Z A;  4F17 A;  3VYH B;  4PJO A;  2YHT A;  4XTU A;  2E12 A;  4JS4 A;  4QQ6 A;  4R55 A;  1VQN Q;  3CPW S;  2QK0 A;  1X75 C;  2QEX A;  2MF2 A;  1EZZ B;  4RCB A;  2X9H A;  4C92 F;  2O9S A;  1D0Y A;  2EFI A;  1Z9Q A;  4J9B A;  4JRP A;  2HL3 A;  3UT1 A;  1SSF A;  1M4Z A;  1Q82 C;  2HQX A;  4XTZ A;  3MEV A;  4TVR A;  4OMO A;  2DD4 A;  1NEB A;  4WF2 A;  1YCS B;  2QQA A;  1PSF A;  2K5L A;  3QO3 A;  2HZY A;  1KC8 R;  4F16 A;  5CVI A;  2LTO A;  1KK7 A;  1TTH B;  1SSH A;  4M4Z A;  1YJ9 A;  2KVQ G;  4O6J A;  2LJ0 A;  3MPU B;  3SB2 A;  3RKW A;  2FYK A;  3HL8 A;  3I55 Q;  4MZP A;  2RHX A;  2LQN A;  2CUB A;  4J9G A;  2MK5 A;  1HYO A;  4N4G A;  4JZ3 A;  1U8R A;  1UHF A;  1K8A C;  1XOV A;  3V7R A;  1N5Z A;  1X43 A;  2PVD B;  1GL5 A;  1IHV A;  4A54 A;  4E7J A;  2V8I A;  1NG2 A;  1W6X A;  2GF7 A;  1VQ8 A;  1B34 B;  2BIV A;  2EYZ A;  2B8A A;  2K57 A;  1QWE A;  3EFO A;  5HKC A;  1WYX A;  4PJO G;  4ZGD B;  1MUZ A;  3OS5 A;  1NE8 A;  1M90 U;  5A0D A;  4F04 B;  3G71 T;  2QQS A;  4RTZ A;  1HD3 A;  3VV0 A;  1VQ5 A;  1KIK A;  1YWP A;  5GAM f;  1MNE A;  3GP8 A;  5CKH A;  1N6A A;  4KUD K;  3VUB A;  3CCE A;  4JS5 A;  3OSS C;  4OMF B;  2JTM A;  1GFC A;  2JMC A;  2CH4 A;  2NUP A;  1D3B A;  2DPP B;  2IVW A;  4GBQ A;  2W0Z A;  5J3B A;  3QWY A;  4HVU A;  1RAG B;  2RD1 A;  2RK2 A;  2EQM A;  2YDL A;  3CMA T;  1MMG A;  1GCQ A;  2NUT A;  3THK A;  4QVD A;  1YJN Q;  4DBF A;  2A36 A;  4C5G A;  2I0N A;  4N4I A;  2EYW A;  3G4S A;  3URG A;  1LCK A;  3JCM h;  5HK0 A;  1IB8 A;  1QVG S;  2F2X A;  2KR3 A;  3RDV A;  3AHU A;  4F7U E;  1RAH B;  3L2W A;  1OPL A;  2FZK B;  2CZ0 B;  2FPD A;  4M77 C;  3M0S A;  1XQH A;  3CC2 T;  4F7U F;  1SPK A;  1K8A U;  4LD9 K;  1G3W A;  3NHN A;  3FB9 A;  4J9F A;  4M78 A;  2C0O A;  1I81 A;  2C0T A;  2KYM A;  3CCR Q;  5IXB A;  1LOJ A;  2L3S A;  1AZG B;  4X34 A;  3LH5 A;  1K9A A;  2QYZ A;  3A8O B;  3A98 A;  3EG2 A;  1D0X A;  2QDL A;  1VQ8 T;  4E7H A;  1UUE A;  2KBT A;  1T0H A;  2LMJ A;  4HT8 A;  3FLG A;  1B7T A;  1XJW B;  3ZEH A;  1KFZ A;  3QZ5 B;  1VQ4 A;  4BE1 A;  2O2O A;  3CD6 T;  2ABL A;  2OTJ Q;  3CPF A;  4EMH A;  1OUL A;  2RMO A;  3A8L B;  3CCE T;  1VQP Q;  4J9D A;  2EQU A;  5FRN A;  3JB9 J;  1NLO C;  2J06 A;  4CC4 B;  1W4S A;  1UEB A;  1ZUK A;  2ROL A;  4XU2 A;  1CSK A;  2VGM A;  2ZGW A;  4M7A C;  1VQK T;  3H8Z A;  1WZO A;  3CCJ T;  3EH1 A;  3I35 A;  3DLL A;  3CBP A;  3QG1 A;  2QDY B;  4RG8 A;  1D1A A;  3CC7 Q;  5KYW B;  5CCA A;  2DFU A;  1JQQ A;  4M75 C;  2ZAE A;  3I5R A;  4AT1 B;  4EMK B;  2K4Y A;  1FWZ A;  4OB0 B;  1NPP A;  2KDS A;  2KXC A;  4M78 G;  1NEG A;  3A8H B;  3OYN A;  1VQ7 Q;  9ATC B;  5GAN j;  4EMG A;  1KJW A;  2H3J A;  3GPL A;  3LGF A;  1QKX A;  3EGD A;  3JCM d;  4IUP A;  1P92 A;  4IUQ A;  4PK4 A;  1G3Y A;  3OYE A;  2DYB A;  3M0U A;  5D6X A;  2FRY A;  3V8J A;  4VUB A;  2XI9 A;  2D1X A;  3QII A;  4MML A;  4Y92 A;  1PG5 B;  4BUG A;  1K76 A;  4XU1 A;  4DOV A;  2DL8 A;  5GMK h;  5GAN h;  1RI0 A;  1PKS A;  1IGU A;  2HQH A;  3GBQ A;  4OMN A;  1MGQ A;  2FHD A;  2OTL T;  2ZCF B;  2VWF A;  5GAM g;  1WHL A;  2EJ9 A;  4M7D E;  2FZC B;  2DRM A;  1IHW A;  3CCU T;  5GMK m;  3VS0 A;  3ASK A;  5A2Q E;  4HCB A;  4HKE A;  4II1 A;  3RKY A;  3QYG B;  1M2V A;  2VGN A;  1MMN A;  1OEB A;  2P0K A;  1YP5 A;  4DBR A;  1VYU A;  2RQT A;  4ATO A;  1GBR A;  3M5A A;  2LNH B;  1I1J A;  2CUD A;  4QW2 A;  3HSB A;  1VQ6 A;  2IPO B;  1AZE A;  1O9S A;  3U23 A;  1ZSZ A;  1WFW A;  4J9I A;  1T0J A;  2XID A;  3ZBD A;  5A0L A;  5GAN 6;  2RJE A;  2RHU A;  1ZHI A;  2J6O A;  1KQS S;  2QA4 T;  1S72 Q;  3EG3 A;  3OYG A;  3MP6 A;  3L1A A;  2QTX A;  4C8Q A;  1LPL A;  2HMA A;  2DYI A;  3E19 A;  3MET A;  3SFM A;  2DMO A;  1UJ0 A;  3PMT A;  1VQO Q;  3MEW A;  5FU7 B;  3OYH A;  4FL6 A;  3JB9 G;  3LLR A;  1YI2 Q;  5GAO l;  1VQN A;  1GCQ C;  1N8R R;  3JB9 I;  4KGZ B;  1K1Z A;  1UGR B;  3VU3 C;  5KH6 A;  1E6H A;  1X27 A;  3JAM E;  4ESR A;  3EFS A;  3GIB A;  2QAS A;  2HBW A;  5GJW B;  3L42 A;  1N27 A;  3CPW P;  1LVK A;  4J6W A;  5CIU A;  1A0N B;  2JOY A;  3ZL7 C;  1N9S A;  3DKM A;  1V29 B; 
#chains in the Genus database with same CATH homology
 1E6G A;  2JTE A;  1S1N A;  2CH4 W;  1WXT A;  1T3S A;  2ROT A;  4R0K A;  2AK5 A;  4KRT A;  2KT1 A;  2MOX A;  2OAW A;  1QCF A;  4OMP A;  2FEI A;  2C0I A;  3EHQ A;  2CT4 A;  2GGR A;  4ZNX A;  2K3B A;  4AG2 C;  3PE0 A;  1OV3 A;  1I07 A;  2BZX A;  2GTJ A;  2K79 A;  2DL7 A;  4IIM A;  1M3A A;  4A63 B;  5IXF A;  2DIL A;  2VVK A;  2BTT A;  1ABQ A;  2KEA A;  4RTV A;  2J6F A;  3H0I A;  1UHC A;  1SHF A;  4OML A;  1NYF A;  1WXB A;  4LN2 A;  3VS7 A;  4J9C A;  1TUC A;  1GRI A;  2O9V A;  4QT7 A;  1M3B A;  1JXM A;  2HCK A;  3UA7 A;  1CKA A;  2DF6 A;  2K6D A;  2MCN A;  1ZSG A;  3UAT A;  2BZY A;  3QWX X;  3KFV A;  3VRY A;  1ZUU A;  1UDL A;  3UA6 A;  1AWX A;  3REA B;  4EIK A;  4HVW A;  2CSQ A;  2RN8 A;  1VYT A;  2HSP A;  2CRE A;  2EKH A;  3RBB B;  2MIO A;  3ULR B;  2DE0 X;  2D8J A;  1H3H A;  1WX6 A;  2J7I A;  2HDA A;  2KT8 A;  2EYX A;  4LE9 A;  4F17 A;  2LZ6 B;  2VKN A;  1H92 A;  2DNU A;  3M0P A;  2YUN A;  2K9G A;  1OOT A;  2O9S A;  1Z9Q A;  4HVV A;  4J9B A;  4LNP A;  5I11 A;  4AFS C;  1YWO A;  2JS0 A;  1WDX A;  1AEY A;  4OMO A;  2GBQ A;  1NEB A;  1YCS B;  1AOJ A;  4Z8A A;  4WCI A;  3M0Q A;  4AFQ C;  2KRS A;  4LUD A;  2B86 A;  4F16 A;  1K0X A;  2LJ1 A;  5I22 A;  1U06 A;  1SSH A;  4J9E A;  4M4Z A;  1UTI A;  2LJ0 A;  2ESW A;  2YUP A;  4JJD A;  1AWW A;  3VRZ A;  4AFU C;  1WLP B;  2YT6 A;  5IHK A;  1AD5 A;  2CT3 A;  4F14 A;  1MV0 B;  2LQN A;  4IIO A;  2G6F X;  2CUB A;  3CQT A;  4J9G A;  1NLP C;  1TUD A;  4J9H A;  4JZ3 A;  4DEY A;  1I0C A;  1SRM A;  1UHF A;  1XOV A;  1N5Z A;  3TSZ A;  1X43 A;  2EQI A;  1X2K A;  3SHW A;  1X6B A;  1GL5 A;  2JS2 A;  2EYY A;  2ECZ A;  2V1R A;  1GCP A;  2KE9 A;  2ED0 A;  1NG2 A;  1W6X A;  2EYZ A;  2RNA A;  1QWE A;  1WYX A;  2D0N A;  2KNB B;  1MUZ A;  2AZS A;  1HJD A;  2EW3 A;  2A28 A;  4CC2 A;  4RTZ A;  1HD3 A;  1KIK A;  3PVL A;  1YWP A;  2HEQ A;  1TG0 A;  1YN8 A;  2L2P A;  1X6G A;  2DM1 A;  1U5S A;  2F2V A;  1M3C A;  2ENM A;  5IHN A;  1GFC A;  2JMC A;  2CH4 A;  1UJY A;  4CC3 A;  2JM9 A;  1IO6 A;  1PRM C;  4GBQ A;  2W0Z A;  2DA9 A;  3QWY A;  3R6N A;  4OMQ A;  4HVU A;  2LCS A;  2FO0 A;  4D8K A;  2YDL A;  1JEG A;  1UGV A;  3EGU A;  1GBQ A;  1GCQ A;  1WXU A;  3VS4 A;  3THK A;  1PNJ A;  2K2M A;  2X3X D;  2A36 A;  4ORZ A;  2OI3 A;  4D8D A;  2I0N A;  4K11 A;  1AWO A;  1W70 A;  1H8K A;  1VYV A;  2EYW A;  1LCK A;  1UE9 A;  2F2X A;  1CKB A;  2KR3 A;  3H41 A;  3UF4 A;  2A37 A;  2RQV A;  1AWJ A;  1ZBJ A;  2CSI A;  2E5K A;  1OPL A;  2OJ2 A;  1K4U S;  2DX1 A;  2FPD A;  1UG1 A;  2YUQ A;  2EVR A;  3M0S A;  1RLP C;  2V1Q A;  2LQW A;  2M51 A;  1NM7 A;  1SPK A;  3EG0 A;  2BZ8 A;  3NHN A;  4J9F A;  4RUG A;  2C0O A;  3IQL A;  2AZV A;  2JXB A;  2C0T A;  1PKT A;  4DEX A;  2KYM A;  2PNI A;  2XMF A;  3FJ5 A;  5IXB A;  4AG1 C;  2L3S A;  1AZG B;  3NPF A;  2J6K A;  4RTW A;  3LH5 A;  1K9A A;  2SRC A;  2L0A A;  3A98 A;  3EG2 A;  5ECA A;  2J05 A;  2DRK A;  2QDL A;  1QWF A;  4RTY A;  1UUE A;  2AKK A;  2KBT A;  1HSQ A;  2DLP A;  1T0H A;  2LMJ A;  1ZLM A;  1QLY A;  3VS1 A;  1OPK A;  3VS3 A;  3VS5 A;  4X1V A;  1G83 A;  2H8H A;  1KFZ A;  1MV3 A;  2SEM A;  5FWB A;  1WA7 A;  2O2O A;  2ABL A;  2EGC A;  1T3L A;  1W1F A;  2NUZ A;  1Y0M A;  2RMO A;  3M0R A;  2IIM A;  4JPB W;  4J9D A;  4E6R A;  4FSS A;  3O5Z A;  2K7A A;  1NLO C;  2J06 A;  4CC4 B;  1ZUK A;  2ROL A;  1SRL A;  1ZUY A;  1UEC A;  1CSK A;  2LP5 A;  5IHI A;  2DVJ A;  2EBP A;  1G2B A;  1KSW A;  2RQW A;  3I35 A;  2RQU A;  3NGP A;  4RTT A;  1JQQ A;  1BK2 A;  3I9Q A;  5L23 A;  1YNZ A;  1RUW A;  3I5R A;  1U3O A;  1ZX6 A;  2RPN A;  2KXC A;  1NEG A;  2KRO A;  1GFD A;  2X3W D;  1FYN A;  2D8H A;  2JT4 A;  2KRM A;  1KJW A;  1PHT A;  4CC7 A;  1QKX A;  2F2W A;  1SHG A;  3PVQ A;  3REB B;  4GLM A;  2DYB A;  2ED1 A;  3M0U A;  2JM8 A;  2FRY A;  1JU5 C;  2GQI A;  2D1X A;  4Y92 A;  1ABO A;  1K76 A;  1ARK A;  2FPE A;  2DL8 A;  2KYB A;  2YUO A;  1PKS A;  2AKL A;  3GBQ A;  4OMN A;  2DJQ A;  1BB9 A;  2VWF A;  4HCK A;  4JJC A;  2O31 A;  4JZ4 A;  1X69 A;  1K0S A;  2JMA A;  2DRM A;  2YSQ A;  2GNC A;  3VS0 A;  3NMZ C;  1Z9Z A;  1E7O A;  2JW4 A;  4AFZ C;  2KXD A;  3VS6 A;  4Z89 A;  1BU1 A;  1OEB A;  2EGE A;  1YP5 A;  1VYU A;  2RQT A;  1GBR A;  2LJ3 A;  5HCK A;  1M30 A;  2LNH B;  2EGA A;  3I5S A;  4LUE A;  2DL4 A;  4RTX A;  2L3P A;  3TVT A;  2O88 A;  1I1J A;  2CUD A;  1EFN A;  3EHR A;  1V1C A;  1AZE A;  2DL3 A;  3U23 A;  1WFW A;  4J9I A;  1T0J A;  2DBK A;  1UFF A;  3RNJ A;  1JO8 A;  4JJB A;  1PRL C;  2FPF A;  3JV3 A;  3SEM A;  3VS2 A;  2EPD A;  5FWC A;  1JXO A;  2J6O A;  2GTO A;  2RF0 A;  1Y57 A;  1B07 A;  3EG3 A;  4OMM A;  1QKW A;  2FG0 A;  2M0Y A;  1WIE A;  3C0C A;  2PTK A;  2DMO A;  1UJ0 A;  1PWT A;  3EG1 A;  4RTU A;  5GJV B;  5EC7 A;  5FW9 A;  3H0H A;  1M27 C;  1GCQ C;  2PZ1 A;  2LX7 A;  2KGT A;  1K1Z A;  1FMK A;  1M8M A;  1E6H A;  2W10 A;  1X27 A;  2CDT A;  4ESR A;  1B3Q A;  1BBZ A;  1NYG A;  3TSW A;  3M0T A;  1X2Q A;  2KRN A;  2HBW A;  1WI7 A;  5GJW B;  2A08 A;  2P4R A;  3H0F A;  1RI9 A;  5IH2 A;  4HXJ A;  2L3Q A;  1RLQ C;  2NWM A;  1VA7 A;  1AVZ C;  1A0N B;  2FRW A;  3ZL7 C;  4Z88 A;  2RQR A;  1SEM A;  1J3T A;  2DBM A;  2DL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...