1TG0A

0.97-a structure of the sh3 domain of bbc1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin tail region-interacting protein MTI1
publication title Saccharomyces cerevisiae SH3 domain structural genomics
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tg0A00
2O2OA 1NEGA 1T0JA 1K9AA 2K9GA 4JPBW 2FG0A 1X2KA 2RN8A 1K76A 2AKKA 1TG0A 2DLPA 4Z8AA 4HVVA 2FPFA 1WIEA 2F2XA 2K2MA 3IQLA 1BBZA 3M0TA 1U06A 4JJBA 3VRZA 2D1XA 5L23A 1ZBJA 1G2BA 4JZ4A 2DE0X 2K7AA 1YNZA 3A98A 1YCSB 2KXCA 2F2VA 2J05A 2YUPA 4OMQA 2ED0A 3VS6A 2HBWA 5FWCA 1KJWA 1AWOA 2K79A 2V1QA 2QDLA 2MIOA 3VS2A 1GCQC 1ZUYA 2BZ8A 2DM1A 1NM7A 3RBBB 2KRNA 4Y92A 1HSQA 2M51A 3EHQA 5IHNA 2SEMA 2A28A 1SSHA 3VS4A 4LUEA 1GCQA 3SEMA 1WYXA 1W70A 4Z89A 2LJ3A 1QKWA 2W10A 2KBTA 4CC2A 2KROA 2JM8A 4M4ZA 4WCIA 1J3TA 2DJQA 1W6XA 4GBQA 2KXDA 1I1JA 2LQNA 1YN8A 4J9DA 2DRKA 2FPEA 4AG2C 4Z88A 2EGAA 2ENMA 1OOTA 1YP5A 3RNJA 1BK2A 2YUNA 2DX1A 1U3OA 2EW3A 2CREA 2A36A 1T3SA 2J6OA 1K1ZA 2W0ZA 1YWOA 1Y0MA 2RQRA 2L3QA 4F16A 2PTKA 2K3BA 1GFCA 4LE9A 3R6NA 4QT7A 2LMJA 2DL3A 2JS0A 1OPLA 2FRYA 2DYBA 1NYGA 2SRCA 2FRWA 2KE9A 1X27A 4E6RA 4OMPA 4J9EA 3H0HA 1UE9A 2JTEA 2DMOA 1PRMC 3SHWA 1MV3A 1SHGA 2YUQA 2E5KA 3M0PA 2GTJA 2ABLA 1PRLC 1M8MA 3REAB 1RLQC 2JW4A 2BZYA 1WX6A 4CC3A 2JMCA 2EYWA 2O88A 1K0SA 2PNIA 2KNBB 2ECZA 1WLPB 2LZ6B 1SRMA 2YDLA 1NEBA 4LUDA 1E6HA 2OAWA 2YT6A 1JU5C 3PVLA 1K0XA 1SPKA 1WXUA 1PWTA 2EYZA 1WA7A 4RTWA 1N5ZA 2EQIA 2ROTA 3LH5A 2L0AA 3H0FA 2EBPA 4J9IA 3I5SA 4RTYA 2GQIA 3THKA 1AZGB 4CC7A 1VYVA 2DNUA 2O31A 3NMZC 2CUDA 4J9HA 2P4RA 1GL5A 4JJDA 3ZL7C 2C0TA 1GBRA 2J06A 2DA9A 1OEBA 4RTVA 3JV3A 1RUWA 2F2WA 1QCFA 2BZXA 4D8DA 2LJ1A 3VS1A 2JXBA 3TVTA 3FJ5A 3KFVA 1AD5A 2DRMA 2JS2A 3NGPA 1FYNA 1QLYA 2BTTA 2C0OA 3H0IA 2ROLA 1PNJA 3M0QA 1ZUKA 1SEMA 1YWPA 2GGRA 3CQTA 2DL8A 2CSIA 1AEYA 2MOXA 2D0NA 3EG1A 2CUBA 2KEAA 2LX7A 4KRTA 2RQTA 1W1FA 3U23A 1ABOA 1X69A 2ED1A 3PE0A 4IIMA 2RMOA 1UFFA 1NYFA 2FPDA 4JJCA 3VS3A 1NG2A 1UJYA 2DL7A 1CSKA 2AZSA 1V1CA 2KR3A 2XMFA 4J9BA 1AVZC 2GNCA 3UATA 1WXBA 4HVUA 2HSPA 1CKAA 2H8HA 1VYUA 3EG3A 1UJ0A 1UUEA 1VA7A 1OV3A 5IH2A 1ZSGA 1B3QA 4LN2A 2O9VA 2RNAA 4LNPA 3I5RA 3UF4A 2EYYA 2LCSA 2YUOA 1X6BA 2DBMA 2EVRA 1U5SA 2KRSA 1IO6A 2NUZA 1RI9A 3H41A 1NLPC 2EPDA 4FSSA 3C0CA 1QWFA 1I0CA 1M3AA 3TSWA 2X3WD 3PVQA 2HEQA 1KFZA 3REBB 1H8KA 1AWXA 4X1VA 1PKSA 1H3HA 5FWBA 1OPKA 2B86A 2G6FX 4HXJA 4RTTA 4D8KA 2RPNA 3GBQA 2MCNA 2LQWA 1Z9QA 2CH4W 2EGCA 2JM9A 2RQUA 4OMOA 2KYMA 2VWFA 2I0NA 2J7IA 1SRLA 3VS7A 2GBQA 1UHFA 3M0UA 2OI3A 1JXOA 2LP5A 2AK5A 2CSQA 1JQQA 2NWMA 5IXBA 3NHNA 2IIMA 4J9GA 1LCKA 2K6DA 1HJDA 5I11A 1EFNA 5IHIA 2J6KA 4ZNXA 3VS0A 4RTXA 1WDXA 3O5ZA 1ZX6A 2FEIA 4AFQC 1VYTA 1UTIA 1E7OA 1BU1A 2KRMA 3UA7A 1M3BA 2AZVA 4AFUC 2ESWA 3TSZA 3EG2A 4CC4B 2J6FA 2CT3A 4RUGA 3M0RA 1UECA 4OMNA 1M27C 1JO8A 1NLOC 1X43A 1Y57A 2X3XD 2A08A 2DL4A 4F17A 3VS5A 1PKTA 1WI7A 5GJWB 2RQWA 2L2PA 5ECAA 1I07A 1S1NA 2JMAA 2CDTA 2OJ2A 4J9FA 4HVWA 2PZ1A 2JT4A 1ZLMA 4R0KA 2VVKA 2KGTA 4JZ3A 1JXMA 1JEGA 1FMKA 1GBQA 1G83A 2LNHB 5I22A 5FW9A 2GTOA 2HDAA 5IHKA 2L3PA 1AWJA 1MV0B 1UG1A 4K11A 4EIKA 1PHTA 4AG1C 1ARKA 4GLMA 3NPFA 1T0HA 2D8JA 1CKBA 4IIOA 2D8HA 3ULRB 1RLPC 1AZEA 2CH4A 3VRYA 5GJVB 2V1RA 3M0SA 1BB9A 5HCKA 2KT1A 2DILA 4HCKA 3QWXX 4F14A 1TUDA 3EG0A 2FO0A 1UHCA 1HD3A 3I9QA 2L3SA 3UA6A 4DEXA 1AOJA 1H92A 1GFDA 1KSWA 1SHFA 3I35A 2YSQA 3EHRA 1XOVA 4ESRA 2VKNA 2DL5A 4RTZA 1UGVA 4RTUA 4OMLA 1WXTA 2M0YA 2C0IA 2KT8A 4AFSC 3EGUA 1M3CA 1ZUUA 1QWEA 2EYXA 2EKHA 5EC7A 2CT4A 2DBKA 2KYBA 1KIKA 1E6GA 2RF0A 1GCPA 2RQVA 2LJ0A 1UDLA 1M30A 1A0NB 2AKLA 1Z9ZA 4OMMA 1X2QA 4J9CA 2DF6A 2O9SA 5IXFA 2A37A 1B07A 2EGEA 4DEYA 2HCKA 1QKXA 3QWYA 2DVJA 4AFZC 1AWWA 1GRIA 4A63B 1ABQA 1MUZA 1TUCA 1X6GA 4ORZA 1T3LA 1K4US 1WFWA
chains in the Genus database with same CATH superfamily
2O2OA 1YHQT 4JPBW 4JJNK 4ZGDB 4JRQA 2RN8A 4BI8B 4JS5A 3HL8A 1QVFP 3LWIA 3QIIA 3HFOA 3HPWA 2F2XA 5GAOq 4D6WA 4C8QB 4DOWA 4XU3A 5GAN4 1U06A 2D1XA 1HXDA 5KE2A 3HKSA 1G2BA 3QG1A 4FYYB 2BIVA 4JZ4A 2DE0X 5DLQE 1YNZA 1BIAA 4FYWB 3X25B 3CCLQ 2ED0A 1KQSA 2JNGA 1VOMA 2R5AA 5FWCA 3RKWA 1KJWA 1AWOA 1X01A 4PLIA 2QDLA 1GCQC 2K5IA 4PJOF 3CCQQ 1ZUYA 3RBBB 4J7IA 3QZ5B 3S3NA 4JRIA 4A4HA 3VS4A 5C0MA 5D7UA 1WYXA 5KYYA 2JUFA 2DVEA 4BUGA 4CC2A 1VQKQ 4HT9A 4GBQA 2LQNA 5LJ5f 5LJ5e 5CR2A 4J9DA 4Z88A 5AYFA 2GFAA 1N6AA 2ENMA 4NL3A 1OOTA 4N0AA 4XU2A 1RABB 3DB3A 2A36A 1YJWT 2VUBA 1N9SA 3BY7A 1R77A 4ATOA 1GFCA 4DBHA 1K8AC 4EMGA 1N27A 4MDWA 2JVVA 4PKCC 3NTIA 2FRYA 2Z0WA 3CCVA 2FRWA 1F1BB 4FT2A 4EPCA 3EGXB 4PFOA 1UE9A 1PRMC 3SHWA 3G71Q 2XDBA 2EJ9A 3OYNA 2MWOA 4C92G 4FU6A 4L6V5 3PT9A 3M0PA 2GTJA 5CKBA 2L5QA 1X6OA 3VJPA 4M77C 2GFUA 5FRNA 1RLQC 4MZMA 1WX6A 1Q7YC 2FYKA 2E65A 1WLPB 2LZ6B 2XKOC 2YDLA 3MP6A 5GANg 1PM3A 5LL6S 4M75E 1E6HA 1JU5C 3PVLA 2ZZDA 1VIFA 1FX7A 4RTWA 1VQ6T 1BCOA 5FROA 3OYAA 3JB9D 3QSUA 3SWNC 4A4GA 1Q82C 1M90R 3I5SA 3CCRT 3CPFA 3RESA 4CC7A 3A8LB 5DLOA 3I56Q 3FLGA 2LCLA 4J9HA 4JJDA 2CS7A 2C0TA 3JRZA 3G6EQ 2JZ2A 1Q7YU 2HMAA 2BUDA 1RUWA 1QCFA 2P84A 3JB9G 2BZXA 4X9CA 5FU7C 2LJ1A 4KT0E 5FU6C 1VQ9T 2RB6A 1IGQA 3KFVA 2JS2A 2XICA 1IGUA 2BTTA 1NBEB 2LDMA 1VQPA 1KC8R 3OS0A 2DL8A 2GF7A 2CSIA 1YITQ 3A8HB 2MOXA 1I5OB 3EG1A 2CUBA 3JSCA 3CCMQ 2CZ6B 1VQNT 4KRTA 2OTJT 5LJ3f 1ABOA 5LJ3e 1X69A 3G4SA 1YJNA 4IIMA 4MZTA 3OYGA 3WXMB 1VQLA 4M77F 1JJ2A 1HK9A 2DL7A 2FL7A 2QGGA 2EYQA 4A4KA 2E6NA 2AZSA 4HVUA 1M2VB 2H3EB 3DLLA 3OYHA 2H8HA 3J7AF 2HKQB 3EG3A 1B3QA 3E9FA 4LN2A 3I5RA 1X6BA 4X9DA 3GIBA 4E7JA 1ZA1B 1XJWB 4P5NA 2EPDA 3QJ6A 4FSSA 2DXTA 2JTMA 4KGVB 4C0DC 2BE9B 1KQ1A 1KFZA 2NUPB 5CAIA 1YHQA 5GAMj 1KG1A 2DXBA 2LQWA 1KD1R 2CH4W 2EGCA 3QJYA 4XU1A 1VQ5Q 1G8XA 4PJOA 3BFMA 1VQOQ 1SRLA 1ZA2B 2GBQA 2OI3A 1H3ZA 3CPWS 2EQMA 5CVIA 5M9OA 4FYVB 3VYHB 2LP5A 1IREB 4M78C 1RAIB 2X9HA 5L8RE 4NOYA 1V29B 1MMDA 2X4JA 3ASKA 1LCKA 2RHYA 1HJDA 2KDSA 3P8HA 4JLIA 3S3OA 3VUZA 2V8KA 3CCUT 3AHUA 4RTXA 2V8JA 1ZX6A 1M1KC 4JRPA 3CPWP 1JB0E 1Y96B 3JCMf 1QCOA 2AZVA 4AFUC 2LT4A 2VXEA 3QHSA 3NTHA 2CZ0B 4OB1B 4CC4B 3LLRA 4M7AC 1ZQ1A 1SF9A 1M27C 2VB6A 1X43A 2HQEA 1Y57A 4PJOD 2DL4A 4MZPA 4EMKA 2WSFE 3QBYA 1PKTA 2RQWA 1G5VA 2QGFB 3INZA 4B6MA 1YJWA 2QEXT 3FDRA 1O75A 4J9FA 2EQJA 4C5IA 3CBMA 2PZ1A 2V8IA 1TH7A 1ZLMA 4C92B 1BI1A 1XTDA 3KXTA 1YI2T 1QP3A 3HRTA 1M1KU 3O8VA 3EH1A 2VVKA 2KGTA 4PFPA 1K73C 2KAFA 1G83A 2LNHB 4RCCA 4PJOG 5GAN8 5KCOA 2GTOA 3HSBA 2HD0A 5IHKA 3JCMb 3OW2S 2HZYA 3FJPA 1UG1A 4K11A 1ZHIA 4OP0A 2P0PA 4PLLA 2O01E 1NE8A 1PHTA 2CYZB 2MAMA 3EGXA 3OYYA 1N9RA 3NPFA 3T9NA 3CCEQ 1WJQA 2RK2A 3BDLA 3I55Q 1VQ4Q 3GPLA 1Q81R 2KI7A 1LVKA 5KYYB 2D8HA 5KH6A 2VASA 1MMNA 2CH4A 4JLGA 2LQKA 4E7IA 2DAQA 4M7DG 1PCXA 2V1RA 3OW2P 1U8RA 5HCKA 4FT4A 3ZBDA 1OQKA 1WPYA 2FO0A 1VQ6A 4QVCA 2M0OA 1FXXA 7AT1B 1H92A 3OY9A 4BE2A 3I35A 1UGPB 4EDUA 2VKNA 3MP8A 3CCRA 1UGVA 4QQ6A 3H9NA 2K3YA 1WXTA 4ZGJB 2M0YA 1C6VX 4AFSC 3OMGA 3EH2A 2E5QA 2EKHA 1RL2A 5EC7A 3MHXA 2HL5C 5J39A 2RF0A 4A53A 5LJ5d 3CCJQ 4R56A 2AKLA 1VQ9A 2DF6A 1UGQB 3CCSQ 4M77A 2EGEA 2E12A 4DEYA 2KK4A 2QDYB 3OBYA 1YIJT 1T3LA 1K4US 1WFWA 3CC2Q 3A5ZB 4QVDA 3UWNA 2MK5A 1NPPA 1K76A 3CC7T 1VQNA 2OTJA 2YRVA 2A7YA 1PC0A 4Z8AA 2KMTA 1BCMA 1RADB 2VYTA 1BYMA 1BBZA 2LTOA 2HNIA 3DB4A 1YJ9T 1GXIE 3VRZA 3MO8A 2YUPA 4OMQA 4ZN3A 2HBPA 2HBWA 2DTIA 2V1QA 3FRNA 1QQJA 4RKUE 2LRQA 4MDXA 5A2QE 2QA4Q 4KH1B 4N4HA 3WVEB 2RO0A 4E2FB 2BZ8A 2KRNA 3EHQA 4M77D 5IHNA 3NFCA 2QYZA 1QVPA 3OQ5A 4Z89A 1WQ7A 2HKNA 2LJ3A 2VV5A 2JM8A 1B34A 1UGRB 2DJQA 3G1JA 1YN8A 1RAGB 4AG2C 1R0BG 1RAAB 4LXCA 5LJ5h 4M77G 1BK2A 3L42A 3LYIA 2YUNA 2KQWA 2LCCA 2J6OA 3BE3A 1K1ZA 3JAME 5A0LA 1Y0MA 2PQWA 4PFZA 2KSSA 4LE9A 3HRUA 4J6YA 3R6NA 4QT7A 5D6WA 2JS0A 1OPLA 2DYBA 1OU8A 3PIPA 4OMPA 5CKDA 3KBGA 3CCUA 1WQWA 5LJ3d 1MV3A 4O6JA 5GAOm 1S72T 1LOJA 1SHGA 3A1PA 2YUQA 2EKOA 2ABLA 3UDCA 1M8MA 1QP2A 2JW4A 5CQXA 3VYGA 1QVFS 5KYXB 3X24B 2CP7A 4BY6C 2ECZA 1Y96A 2C06A 1SRMA 1IHWA 5DM7R 4LUDA 2OAWA 4IKFA 4F04B 1Y71A 4F7UE 4C0ZA 4WTOB 3LH5A 3RDVA 3FIFA 4PJOB 2RI5A 3H0FA 1RAEB 2EBPA 4J9IA 2RH2A 1OZ3A 4LDWA 2QEXA 4QW2A 2R5MA 4WF2A 2GQIA 2JN0A 3THKA 3OA6A 2DNUA 1M90C 1PG5B 1YI2A 3EFOA 2MI6A 4J7FA 1GL5A 3ZL7C 1GBRA 2J06A 4C92A 3SB2A 1OEBA 1ZSZB 3CMEQ 5GANj 3QDRB 2F2WA 2ZCFB 4HKEA 4D8DA 3VS1A 2L8DA 4M7DB 3TVTA 4DBRA 1G3TA 2V26A 3M9QA 4FYXB 4A4EA 2E10A 3NGPA 1FYNA 1QLYA 3CC4T 2ROLA 4C8QE 1NJIR 3M0QA 2M9UA 1ZUKA 1SEMA 3CQTA 1JRIA 2QK0A 2CGHA 2RHZA 1KC8C 3CMAT 5AT1B 1C1AA 2DFUA 1PSFA 1W1FA 1M90U 3JCMP 2ED1A 2ZAEA 4QVZA 3PE0A 2RK1A 2RMOA 5LJ3h 3QO3A 4FIBA 4EMKB 1NYFA 2FPDA 4FM4B 3VS3A 1NG2A 4LDUA 3SFMA 4M7DF 2NLUA 2COWA 1AT1B 4J9BA 2PU9B 3JCMd 3M5AA 1D1BA 2K5LA 4M75C 4C92D 2HSPA 1VQMT 4PK4A 1CKAA 4OGCA 5KCHA 1WHKA 2KY9A 2VGMA 1VA7A 5IH2A 1ZSGA 3QKJA 2O9VA 4LNPA 2EYYA 2NUTA 2E6ZA 2O4XA 2DBMA 1KC8U 1U5SA 5I21A 1IO6A 4M78G 1N8RR 3H41A 1NLPC 3LW5E 4XTYA 2QG9B 1M3AA 2X3WD 2HEQA 1I4K1 1YIJA 4ZGEB 2ZPFB 1H3HA 2DD4A 6AT1B 2DEUA 1OPKA 2B86A 4HXJA 1QVGS 1OZ2A 3CBOA 2LX9A 3CC7A 1VQ8T 3ME9A 2RQUA 3CBPA 4OMOA 2KYMA 2VWFA 2AT1B 2JTFA 2J7IA 4C5EA 3CPWA 2DERA 2E4HA 5LJ5g 1YJ9A 1BI3A 5D6YA 2CSQA 2MWPA 1UEBA 1U1SA 3NHNA 3CCVQ 1M1FA 2ZPIB 3GLXA 2IIMA 1QVGP 2FZKB 4L5GA 5IHIA 3V7SA 2FEIA 1WNLA 3OS2A 1VYTA 4E7HA 3OYEA 4JS4A 1BU1A 2KRMA 4M75F 4M77B 5HK3A 3JCMh 3V7RA 3S6WA 4RUGA 2QQRA 1G3YA 4OMNA 4DOVA 5IN1A 3OYIA 2RI3A 2PVDB 2DJZA 5GJWB 3ZEHA 2L2PA 5ECAA 2FZGB 2OJ2A 5HY6A 4HVWA 2RHIA 2LNVA 5CCAA 2OX7A 4R0KA 4DQ2A 3X28B 4JZ3A 4XU0A 3OW2A 5I22A 5FW9A 1WZOA 1D0XA 5FU7B 5FU6B 4ZTJA 1S72A 4AG1C 4GLMA 4II1A 1TS9A 4ELZC 1VQPQ 2D8JA 4AT1B 5I2MA 1CKBA 4GLKA 1H641 1BIBA 3X26B 2QQ9A 1B34B 2D6FA 2RHXA 4PJMA 2M02A 3FEOA 5GJVB 3G4SQ 3M0SA 1YJNQ 3CD6T 5KYXA 1BB9A 3FB9A 4L59A 1K8AR 3CXCS 1VQLQ 2DILA 4XTZA 3QWXX 1HD3A 3I9QA 4KUDK 2CKKA 2MPXC 2OTLT 4PNOA 3SDZA 4J6XA 2L3SA 3UA6A 5D6XA 2XDPA 5C6SA 2E64A 2R58A 4XTXA 2DETA 1GFDA 4IUPA 1KSWA 2K3XA 2QQSA 2YSQA 1PSEA 1IZ6A 2GQVA 4RTZA 2M1HA 5LJ3g 3A8MB 3TCJA 4A4FA 1QW1A 2CT4A 2DBKA 2KYBA 3CXCP 2RHUA 1MNEA 4OGEA 1Q7YR 4AMCA 2CP3A 4QKUA 2RQVA 5GMKm 1KHCA 1YCYA 1Q81U 2AHJB 2LJ0A 1EX4A 1VQ7T 1A0NB 1Z9ZA 4KUIA 1ZSZA 4OMMA 1B07A 3ER0A 3ZFJA 1SG5A 3NTKA 5CKEA 1AWWA 4M7DA 3CC4A 4PL6A 1G3WA 1MUZA 2NYSA 1YHQQ 1OX9A 5GAN6 4BB7A 1Q82R 2K9GA 1Q95G 1X2KA 3CMAA 2AKKA 1QMCA 1TG0A 2DIGA 2DLPA 3V7CA 5GAMf 4HVVA 5GAMe 1WIEA 2ZPEB 1AHJB 1OULA 1WHMA 2K2MA 3IQLA 2Y4XA 1W2BS 2K5FA 4KULA 3V8JA 3M0TA 5I2SA 2B8AA 4JJBA 1ZBJA 3EFRA 4M78B 2KXCA 1WHGA 1I8FA 3EFOB 3G7ZA 5KYUA 1VQMA 3VS6A 3CCLT 4XQ3A 2K79A 1Q86C 4VUBA 2MIOA 3VS2A 3VU3C 4FW2A 2DXCA 2DM1A 2QTXA 1JBMA 1NM7A 3CCQT 1W2BP 1OI1A 2IVWA 2M51A 2SEMA 3JCMW 2A28A 1SSHA 4LUEA 1GCQA 4M7DD 3SEMA 1TTHB 1W70A 4XTWA 2KBTA 3LGFA 4IUVA 4ANJA 2KROA 4C92E 2E70A 2A0FB 4M4ZA 1V76A 3OBWA 1VQKT 4M78F 1I1JA 2HQXA 2D9TA 1FMVA 2DRKA 4M7AB 3M57A 3JCMg 2DO3A 2ZPHB 1VQ8A 2BKDN 3RMQA 1YJWQ 2DTOA 2DX1A 1K9MC 5KYWB 3TQ7P 1VQMQ 3OYDA 2OAUA 4QQDA 1T3SA 5EG2A 2F69A 3QPHA 5GAN5 1Q86U 2W0ZA 5FRMA 1YWOA 3C94A 2PTKA 3LWHA 2K3BA 5GMKh 2Y4YA 2LMJA 3E19A 5A0GA 3QYHB 4ZN1A 1NYGA 2SRCA 2DEQA 2KE9A 2EFIA 2EAYA 3DKMA 1X27A 4E6RA 1KK7A 4J9EA 3URGA 5A0DA 4M7AF 2JTEA 2NUTB 3G71T 3HFNA 2E5KA 2O4XB 2HL3A 4Y28E 3RR6A 3L2RA 3M53A 1QVFA 3REAB 4V2SA 1IXDA 2E3IA 1K9MU 4CC3A 2EYWA 2O88A 1W4SA 2KNBB 1M9SA 1ZBXA 2F5TX 1NEBA 2CZ7B 1RACB 2MF2A 1VQ6Q 1WXUA 1PWTA 2EYZA 1WJSA 2EQIA 1KHIA 5J3BA 2ROTA 2L0AA 5J26A 3CCRQ 2WSCE 1AZGB 3M59A 3SWNA 2O31A 1M1KR 2LC4A 3I56T 2P4RA 4OVAA 2DA9A 1PD0A 4RTVA 3G6ET 3RMSA 4PJJA 1LNXA 3E2UA 1VQ9Q 2CP0A 3EAEA 2IPOB 2PVOB 3FJ5A 2QQBA 3MEAA 3META 4M75G 2X51A 1I81A 3X20B 3HP9A 3H0IA 2X4YA 1PNJA 1NJIC 3M54A 1VQNQ 2D0NA 2OTJQ 2VC8A 1YITT 1RAFB 3CCMT 2RQTA 3QZ9B 3CD6A 3PTAA 4MMLA 4PJLA 1UFFA 2OTLA 3MPUB 1SKUB 1K73R 1UJYA 4C0FA 2PUOB 1V1CA 4LDVA 4Q5WA 2M16A 2QQAA 4KGZB 1AVZC 2DTHA 1IHVA 3UATA 3QYGB 1MHNA 2K4YA 1LJOA 2QI2A 4BDZA 1OV3A 4CRIA 2RNAA 3C12A 3UF4A 1NJIU 2DXUA 2EVRA 4DA4A 1VQ7A 2PUKB 3PNWC 2NUZA 4J6WA 1RI9A 2XD0A 3C0CA 1UGSB 1WHJA 2RJDA 3PVQA 2KVQG 3R6OA 3REBB 1QVGA 2DD5A 1AWXA 3M56A 3QDFA 5IAYA 2MCNA 3GNGA 8AT1B 4C5HA 3P8BB 1Z9QA 2JM9A 4OB3B 3L2UA 3L2WA 4JRKA 1B7TA 1VQ5T 3LX7A 3VS7A 4B9XA 4C8QC 1VQOT 2L3RA 3M0UA 2FB7A 4ZTFA 2LVMA 4ME7A 2NWMA 1VQ7Q 1N8RU 4BI3A 4Y91A 4J9GA 2XG8D 3CCLA 4M78A 3CCUQ 1EFNA 2X4WA 1M5Q1 3EG9A 3S3MA 1WDXA 1FWZA 3O5ZA 3MEUA 3CCQA 1VUBA 4O5VA 3KUFA 2F5KA 3PMTA 4PJOE 3UA7A 1M3BA 2ESWA 4FSXA 1Y7XA 3TSZA 3EG2A 5LJ5j 3LH0A 2J6FA 2CT3A 4BY6B 4F7UF 4EMKC 2BE7D 3M0RA 2JJ9A 3SD4A 1VQKA 3V8LA 4A54A 3MCAB 3JB9H 4IURA 4LD9K 1NLOC 2X3XD 4F17A 2L89A 1UB4A 2PVGB 1D09B 4M7AA 1U1TA 2QEXQ 3GOXA 1PD1A 4BACA 1I07A 2CP6A 1SSFA 4M7DE 5CQYA 3HRSA 3PMIA 2CDTA 2QAZA 1YI2Q 3JCMV 5KYWA 3MJXA 1HYOA 4C0GA 1X75C 4M78D 1JEGA 3MKDA 1O9SA 1FMKA 4BE0A 1GBQA 5KYUB 3TEEA 3OYLA 2L3PA 4B9WA 2XI9A 1AWJA 2FVUA 4C8QF 5GAN3 4FL6A 5GANf 5GANe 2ZGWA 4EIKA 2MYSA 3G71A 5GAMd 4E7ZA 2DYIA 1NPRA 3OMCA 4R55A 3P8DA 4LD6A 3CCET 3I55T 1VQ4T 2MMPA 3J80E 1I5LA 4KBMB 1RLPC 4BDYA 1BI0A 3MEWA 4J83A 3F70A 3CXCA 2KT1A 3OYJA 2CZ1B 2QXFA 4HCKA 4M7AD 4F14A 2X4XA 4DEXA 1AOJA 2HQHA 2RI2A 1MMAA 2VXFA 2ATCB 2DK3A 2DL5A 1C0MA 4FW1A 1KD1C 4OMLA 4M75B 3MP1A 3I56A 3AT1B 3EGUA 1M3CA 1ZUUA 1QWEA 2EYXA 5HK0A 1D1AA 1KIKA 4M7AG 3G6EA 1GCPA 4UC4A 2G3RA 3CCJT 4C5GA 2EIFA 3L1AA 4J9CA 1TSFA 3PGGA 3CCST 5KE3A 1QKXA 3QWYA 2DVJA 4AFZC 1K8AU 1YIJQ 1TUCA 4ORZA 3N5BB 2HAXA 1NEGA 2YHTA 1T0JA 4KGXB 1EZZB 1K9AA 4OB2B 5LJ3j 3CC2T 2FG0A 3CC7Q 3OYKA 4NL2A 1YITA 1KD1U 4OMFB 3CCMA 3RIRA 1W2BA 2CP2A 2FPFA 5DY9A 3D7SB 2RA2A 5GAMh 1YJ9Q 4HCBA 3QUIA 1R8OB 1QCNA 4BD3A 5L23A 4XTVA 3OSVA 4M77E 1XNIA 2K7AA 2FZCB 3A98A 3SWNB 1YCSB 2F2VA 2J05A 3E1SA 1KQSS 1OX8A 4XTUA 3RUXA 2QA4T 3FC3A 4Y92A 1HSQA 3H8ZA 4XAXB 4NS5A 5GAOl 1Q82U 3JCMJ 5GAN7 2R57A 1M1GA 3TU4K 1QKWA 3OS5A 2W10A 5IT9E 4TVRA 4WCIA 1J3TA 1W6XA 2KXDA 1KQSP 2LQ8A 4IUQA 2FPEA 2P0QA 2A3LA 2EGAA 2JOYA 3EGDA 3WVDB 2COZA 4RG2A 3RNJA 1YP5A 3J81E 4E7LA 1XQHA 1Q81C 3RKYA 1U3OA 1D0YA 2CREA 2EW3A 4X34A 4IUTA 1VQ5A 1M4ZA 2AIRB 2RQRA 2L3QA 4J5YA 4F16A 1VQOA 4MMKA 3A8GB 2K2VA 2DL3A 1G3SA 3GP8A 3L2QA 2DIQA 5CO7A 4F7UA 2IG0A 3H0HA 2DMOA 1S72Q 4Z02A 3LGLA 2LT1A 5CKHA 2X35A 1D0ZA 1PRLC 2BZYA 1R0CB 1OU9A 2JMCA 2RJEA 1K0SA 2PNIA 1D3BB 4DBQA 3Q1JA 3OS1A 5GAOp 2EQUA 2YT6A 2ZPBB 1K0XA 1SPKA 4FCYA 4C0DB 1WA7A 1N5ZA 2E1HA 1LPLA 4CI0C 2DKGA 4C8QA 2RM4A 2YXYA 4RTYA 4C92C 1VYVA 3NMZC 2CUDA 5GMKi 3A8OB 1VIEA 1OYXA 3VKIA 2RJFA 3M55A 2WACA 3JV3A 3JCMe 2H3JA 2YLBA 3CMET 3DLMA 1WHHA 3EG9B 2JXBA 1MNDA 3H6ZA 2XK0A 1AD5A 3JB9I 2DRMA 3CC4Q 4DBFA 4HT8A 2C0OA 3CCEA 4F7UG 2YRCA 5GAN2 3I55A 1YWPA 1VQ4A 2GGRA 4N4IA 3OB9A 3CMAQ 1AEYA 4M78E 3TREA 2KEAA 2LX7A 2QASA 4OF1A 3U23A 5FLXE 3V8KA 4C8QD 4N0AC 1TU0B 3GF5A 5CKFA 2F1LA 4JJCA 2HSEB 3GNFB 3UPUA 1JJ2S 2FHDA 1CSKA 2KR3A 2XMFA 1ACMB 2GNCA 1WXBA 1TUGB 5GAMg 3JCMc 1VYUA 3OYMA 1UJ0A 4HA8A 1DJ7B 1UUEA 3VUBA 4YTLA 4M75A 4C8QG 4M7AE 2LCSA 2YUOA 3C4SA 2EJGA 1YBYA 2YLCA 4IUUA 2KRSA 3CCJA 1TWBA 4C92F 1JJ2P 5CK9A 1RAHB 1IRXA 1KQ2A 1QWFA 1D1CA 3CCSA 1I0CA 3TSWA 5GAOr 2QTVA 1H8KA 2I2LA 1M2OA 4X1VA 1K73U 1PKSA 3CC2A 5FWBA 4E7KA 3BW1A 3QXEB 2G6FX 4RTTA 2XHCA 4D8KA 2RPNA 3GBQA 1VQ8Q 3L2ZA 5GAOn 2P0KA 2D0QB 3UT1A 4OB0B 2I0NA 3JB9J 1UHFA 5GANd 1JXOA 2EJFA 2VGNA 4XK8E 4JDSA 1BI2A 2AK5A 1NZ9A 1JQQA 2ZPGB 3OSSC 5IXBA 4KH0B 4HCCA 3CCVT 4RMOA 4M75D 5HKCA 3VV0A 4RG8A 2K6DA 5I11A 2E3HA 2J6KA 4ZNXA 3VS0A 3M4GA 2QA4A 3JB9F 8ATCB 4E47A 2EQKA 4AFQC 1UTIA 1WGSA 1E7OA 3RERA 1Y07A 3C95A 4QQGA 2WSEE 2RJCA 4GY5A 3OYCA 1UECA 2COYA 3HTRA 1JO8A 4N4GA 4BI4A 1IB8A 3OYFA 2A08A 2K57A 1M8VA 1MGQA 3VS5A 1WI7A 5GMKj 4PJNA 5KYNA 1Q86R 4J8OA 1S1NA 2JMAA 1TOVA 2YRDA 2RD1A 3HHTB 2JT4A 3CEYA 3EFSA 2YWWA 4E7SA 1M2VA 1FMWA 3OYBA 3JCMQ 9ATCB 1JXMA 2DZ9A 2HDAA 2CP5A 3RKXA 1MV0B 5CIUA 5GMKl 1ARKA 3JCMX 5GANh 4HCZA 1T0HA 3L2VA 2GCXA 4IIOA 2XU8A 1VQPT 1K9MR 2NUPA 1MMGA 3ULRB 1AZEA 3VRYA 3CD6Q 1N8RC 3M4YA 5GMKe 3G4ST 1YJNT 3EGDB 3MEVA 1D3BA 4RCBA 4EMHA 2OTLQ 1RI0A 1TUDA 3EG0A 1UHCA 1BKBA 1VQLT 1P92A 2XIDA 4PJOC 4BE1A 2EWNA 2E41A 1SHFA 3EHRA 4LDYA 2XDDA 1XOVA 4ESRA 4RTUA 1YFNA 2C0IA 2KT8A 3M58A 1EIFA 1ZSZC 4ELYC 4F7UB 1E6GA 1WJRA 2P4TA 1TXQA 3CMEA 3PIOA 4M7DC 1UDLA 1M30A 1X2QA 2O9SA 5IXFA 4JUVA 1WHLA 4LDXA 2A37A 2DZCA 3E9GA 3BDUA 2HCKA 2Y90A 2DPPB 1GRIA 4A63B 1ABQA 1X6GA 3PFSA
chains in the Genus database with same CATH topology
2O2OA 1NEGA 1T0JA 1K9AA 2K9GA 4JPBW 2FG0A 1X2KA 2RN8A 1K76A 2AKKA 1TG0A 2DLPA 4Z8AA 4HVVA 2FPFA 1WIEA 2F2XA 2K2MA 3IQLA 1BBZA 3M0TA 1U06A 4JJBA 3VRZA 2D1XA 5L23A 1ZBJA 1G2BA 4JZ4A 2DE0X 2K7AA 1YNZA 3A98A 1YCSB 2KXCA 2F2VA 2J05A 2YUPA 4OMQA 2ED0A 3VS6A 2HBWA 5FWCA 1KJWA 1AWOA 2K79A 2V1QA 2QDLA 2MIOA 3VS2A 1GCQC 1ZUYA 2BZ8A 2DM1A 1NM7A 3RBBB 2KRNA 4Y92A 1HSQA 2M51A 3EHQA 5IHNA 2SEMA 2A28A 1SSHA 3VS4A 4LUEA 1GCQA 3SEMA 1WYXA 1W70A 4Z89A 2LJ3A 1QKWA 2W10A 2KBTA 4CC2A 2KROA 2JM8A 4M4ZA 4WCIA 1J3TA 2DJQA 1W6XA 4GBQA 2KXDA 1I1JA 2LQNA 1YN8A 4J9DA 2DRKA 2FPEA 4AG2C 4Z88A 2EGAA 2ENMA 1OOTA 1YP5A 3RNJA 1BK2A 2YUNA 2DX1A 1U3OA 2EW3A 2CREA 2A36A 1T3SA 2J6OA 1K1ZA 2W0ZA 1YWOA 1Y0MA 2RQRA 2L3QA 4F16A 2PTKA 2K3BA 1GFCA 4LE9A 3R6NA 4QT7A 2LMJA 2DL3A 2JS0A 1OPLA 2FRYA 2DYBA 1NYGA 2SRCA 2FRWA 2KE9A 1X27A 4E6RA 4OMPA 4J9EA 3H0HA 1UE9A 2JTEA 2DMOA 1PRMC 3SHWA 1MV3A 1SHGA 2YUQA 2E5KA 3M0PA 2GTJA 2ABLA 1PRLC 1M8MA 3REAB 1RLQC 2JW4A 2BZYA 1WX6A 4CC3A 2JMCA 2EYWA 2O88A 1K0SA 2PNIA 2KNBB 2ECZA 1WLPB 2LZ6B 1SRMA 2YDLA 1NEBA 4LUDA 1E6HA 2OAWA 2YT6A 1JU5C 3PVLA 1K0XA 1SPKA 1WXUA 1PWTA 2EYZA 1WA7A 4RTWA 1N5ZA 2EQIA 2ROTA 3LH5A 2L0AA 3H0FA 2EBPA 4J9IA 3I5SA 4RTYA 2GQIA 3THKA 1AZGB 4CC7A 1VYVA 2DNUA 2O31A 3NMZC 2CUDA 4J9HA 2P4RA 1GL5A 4JJDA 3ZL7C 2C0TA 1GBRA 2J06A 2DA9A 1OEBA 4RTVA 3JV3A 1RUWA 2F2WA 1QCFA 2BZXA 4D8DA 2LJ1A 3VS1A 2JXBA 3TVTA 3FJ5A 3KFVA 1AD5A 2DRMA 2JS2A 3NGPA 1FYNA 1QLYA 2BTTA 2C0OA 3H0IA 2ROLA 1PNJA 3M0QA 1ZUKA 1SEMA 1YWPA 2GGRA 3CQTA 2DL8A 2CSIA 1AEYA 2MOXA 2D0NA 3EG1A 2CUBA 2KEAA 2LX7A 4KRTA 2RQTA 1W1FA 3U23A 1ABOA 1X69A 2ED1A 3PE0A 4IIMA 2RMOA 1UFFA 1NYFA 2FPDA 4JJCA 3VS3A 1NG2A 1UJYA 2DL7A 1CSKA 2AZSA 1V1CA 2KR3A 2XMFA 4J9BA 1AVZC 2GNCA 3UATA 1WXBA 4HVUA 2HSPA 1CKAA 2H8HA 1VYUA 3EG3A 1UJ0A 1UUEA 1VA7A 1OV3A 5IH2A 1ZSGA 1B3QA 4LN2A 2O9VA 2RNAA 4LNPA 3I5RA 3UF4A 2EYYA 2LCSA 2YUOA 1X6BA 2DBMA 2EVRA 1U5SA 2KRSA 1IO6A 2NUZA 1RI9A 3H41A 1NLPC 2EPDA 4FSSA 3C0CA 1QWFA 1I0CA 1M3AA 3TSWA 2X3WD 3PVQA 2HEQA 1KFZA 3REBB 1H8KA 1AWXA 4X1VA 1PKSA 1H3HA 5FWBA 1OPKA 2B86A 2G6FX 4HXJA 4RTTA 4D8KA 2RPNA 3GBQA 2MCNA 2LQWA 1Z9QA 2CH4W 2EGCA 2JM9A 2RQUA 4OMOA 2KYMA 2VWFA 2I0NA 2J7IA 1SRLA 3VS7A 2GBQA 1UHFA 3M0UA 2OI3A 1JXOA 2LP5A 2AK5A 2CSQA 1JQQA 2NWMA 5IXBA 3NHNA 2IIMA 4J9GA 1LCKA 2K6DA 1HJDA 5I11A 1EFNA 5IHIA 2J6KA 4ZNXA 3VS0A 4RTXA 1WDXA 3O5ZA 1ZX6A 2FEIA 4AFQC 1VYTA 1UTIA 1E7OA 1BU1A 2KRMA 3UA7A 1M3BA 2AZVA 4AFUC 2ESWA 3TSZA 3EG2A 4CC4B 2J6FA 2CT3A 4RUGA 3M0RA 1UECA 4OMNA 1M27C 1JO8A 1NLOC 1X43A 1Y57A 2X3XD 2A08A 2DL4A 4F17A 3VS5A 1PKTA 1WI7A 5GJWB 2RQWA 2L2PA 5ECAA 1I07A 1S1NA 2JMAA 2CDTA 2OJ2A 4J9FA 4HVWA 2PZ1A 2JT4A 1ZLMA 4R0KA 2VVKA 2KGTA 4JZ3A 1JXMA 1JEGA 1FMKA 1GBQA 1G83A 2LNHB 5I22A 5FW9A 2GTOA 2HDAA 5IHKA 2L3PA 1AWJA 1MV0B 1UG1A 4K11A 4EIKA 1PHTA 4AG1C 1ARKA 4GLMA 3NPFA 1T0HA 2D8JA 1CKBA 4IIOA 2D8HA 3ULRB 1RLPC 1AZEA 2CH4A 3VRYA 5GJVB 2V1RA 3M0SA 1BB9A 5HCKA 2KT1A 2DILA 4HCKA 3QWXX 4F14A 1TUDA 3EG0A 2FO0A 1UHCA 1HD3A 3I9QA 2L3SA 3UA6A 4DEXA 1AOJA 1H92A 1GFDA 1KSWA 1SHFA 3I35A 2YSQA 3EHRA 1XOVA 4ESRA 2VKNA 2DL5A 4RTZA 1UGVA 4RTUA 4OMLA 1WXTA 2M0YA 2C0IA 2KT8A 4AFSC 3EGUA 1M3CA 1ZUUA 1QWEA 2EYXA 2EKHA 5EC7A 2CT4A 2DBKA 2KYBA 1KIKA 1E6GA 2RF0A 1GCPA 2RQVA 2LJ0A 1UDLA 1M30A 1A0NB 2AKLA 1Z9ZA 4OMMA 1X2QA 4J9CA 2DF6A 2O9SA 5IXFA 2A37A 1B07A 2EGEA 4DEYA 2HCKA 1QKXA 3QWYA 2DVJA 4AFZC 1AWWA 1GRIA 4A63B 1ABQA 1MUZA 1TUCA 1X6GA 4ORZA 1T3LA 1K4US 1WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2O A;  1NEG A;  1T0J A;  1K9A A;  2K9G A;  4JPB W;  2FG0 A;  1X2K A;  2RN8 A;  1K76 A;  2AKK A;  1TG0 A;  2DLP A;  4Z8A A;  4HVV A;  2FPF A;  1WIE A;  2F2X A;  2K2M A;  3IQL A;  1BBZ A;  3M0T A;  1U06 A;  4JJB A;  3VRZ A;  2D1X A;  5L23 A;  1ZBJ A;  1G2B A;  4JZ4 A;  2DE0 X;  2K7A A;  1YNZ A;  3A98 A;  1YCS B;  2KXC A;  2F2V A;  2J05 A;  2YUP A;  4OMQ A;  2ED0 A;  3VS6 A;  2HBW A;  5FWC A;  1KJW A;  1AWO A;  2K79 A;  2V1Q A;  2QDL A;  2MIO A;  3VS2 A;  1GCQ C;  1ZUY A;  2BZ8 A;  2DM1 A;  1NM7 A;  3RBB B;  2KRN A;  4Y92 A;  1HSQ A;  2M51 A;  3EHQ A;  5IHN A;  2SEM A;  2A28 A;  1SSH A;  3VS4 A;  4LUE A;  1GCQ A;  3SEM A;  1WYX A;  1W70 A;  4Z89 A;  2LJ3 A;  1QKW A;  2W10 A;  2KBT A;  4CC2 A;  2KRO A;  2JM8 A;  4M4Z A;  4WCI A;  1J3T A;  2DJQ A;  1W6X A;  4GBQ A;  2KXD A;  1I1J A;  2LQN A;  1YN8 A;  4J9D A;  2DRK A;  2FPE A;  4AG2 C;  4Z88 A;  2EGA A;  2ENM A;  1OOT A;  1YP5 A;  3RNJ A;  1BK2 A;  2YUN A;  2DX1 A;  1U3O A;  2EW3 A;  2CRE A;  2A36 A;  1T3S A;  2J6O A;  1K1Z A;  2W0Z A;  1YWO A;  1Y0M A;  2RQR A;  2L3Q A;  4F16 A;  2PTK A;  2K3B A;  1GFC A;  4LE9 A;  3R6N A;  4QT7 A;  2LMJ A;  2DL3 A;  2JS0 A;  1OPL A;  2FRY A;  2DYB A;  1NYG A;  2SRC A;  2FRW A;  2KE9 A;  1X27 A;  4E6R A;  4OMP A;  4J9E A;  3H0H A;  1UE9 A;  2JTE A;  2DMO A;  1PRM C;  3SHW A;  1MV3 A;  1SHG A;  2YUQ A;  2E5K A;  3M0P A;  2GTJ A;  2ABL A;  1PRL C;  1M8M A;  3REA B;  1RLQ C;  2JW4 A;  2BZY A;  1WX6 A;  4CC3 A;  2JMC A;  2EYW A;  2O88 A;  1K0S A;  2PNI A;  2KNB B;  2ECZ A;  1WLP B;  2LZ6 B;  1SRM A;  2YDL A;  1NEB A;  4LUD A;  1E6H A;  2OAW A;  2YT6 A;  1JU5 C;  3PVL A;  1K0X A;  1SPK A;  1WXU A;  1PWT A;  2EYZ A;  1WA7 A;  4RTW A;  1N5Z A;  2EQI A;  2ROT A;  3LH5 A;  2L0A A;  3H0F A;  2EBP A;  4J9I A;  3I5S A;  4RTY A;  2GQI A;  3THK A;  1AZG B;  4CC7 A;  1VYV A;  2DNU A;  2O31 A;  3NMZ C;  2CUD A;  4J9H A;  2P4R A;  1GL5 A;  4JJD A;  3ZL7 C;  2C0T A;  1GBR A;  2J06 A;  2DA9 A;  1OEB A;  4RTV A;  3JV3 A;  1RUW A;  2F2W A;  1QCF A;  2BZX A;  4D8D A;  2LJ1 A;  3VS1 A;  2JXB A;  3TVT A;  3FJ5 A;  3KFV A;  1AD5 A;  2DRM A;  2JS2 A;  3NGP A;  1FYN A;  1QLY A;  2BTT A;  2C0O A;  3H0I A;  2ROL A;  1PNJ A;  3M0Q A;  1ZUK A;  1SEM A;  1YWP A;  2GGR A;  3CQT A;  2DL8 A;  2CSI A;  1AEY A;  2MOX A;  2D0N A;  3EG1 A;  2CUB A;  2KEA A;  2LX7 A;  4KRT A;  2RQT A;  1W1F A;  3U23 A;  1ABO A;  1X69 A;  2ED1 A;  3PE0 A;  4IIM A;  2RMO A;  1UFF A;  1NYF A;  2FPD A;  4JJC A;  3VS3 A;  1NG2 A;  1UJY A;  2DL7 A;  1CSK A;  2AZS A;  1V1C A;  2KR3 A;  2XMF A;  4J9B A;  1AVZ C;  2GNC A;  3UAT A;  1WXB A;  4HVU A;  2HSP A;  1CKA A;  2H8H A;  1VYU A;  3EG3 A;  1UJ0 A;  1UUE A;  1VA7 A;  1OV3 A;  5IH2 A;  1ZSG A;  1B3Q A;  4LN2 A;  2O9V A;  2RNA A;  4LNP A;  3I5R A;  3UF4 A;  2EYY A;  2LCS A;  2YUO A;  1X6B A;  2DBM A;  2EVR A;  1U5S A;  2KRS A;  1IO6 A;  2NUZ A;  1RI9 A;  3H41 A;  1NLP C;  2EPD A;  4FSS A;  3C0C A;  1QWF A;  1I0C A;  1M3A A;  3TSW A;  2X3W D;  3PVQ A;  2HEQ A;  1KFZ A;  3REB B;  1H8K A;  1AWX A;  4X1V A;  1PKS A;  1H3H A;  5FWB A;  1OPK A;  2B86 A;  2G6F X;  4HXJ A;  4RTT A;  4D8K A;  2RPN A;  3GBQ A;  2MCN A;  2LQW A;  1Z9Q A;  2CH4 W;  2EGC A;  2JM9 A;  2RQU A;  4OMO A;  2KYM A;  2VWF A;  2I0N A;  2J7I A;  1SRL A;  3VS7 A;  2GBQ A;  1UHF A;  3M0U A;  2OI3 A;  1JXO A;  2LP5 A;  2AK5 A;  2CSQ A;  1JQQ A;  2NWM A;  5IXB A;  3NHN A;  2IIM A;  4J9G A;  1LCK A;  2K6D A;  1HJD A;  5I11 A;  1EFN A;  5IHI A;  2J6K A;  4ZNX A;  3VS0 A;  4RTX A;  1WDX A;  3O5Z A;  1ZX6 A;  2FEI A;  4AFQ C;  1VYT A;  1UTI A;  1E7O A;  1BU1 A;  2KRM A;  3UA7 A;  1M3B A;  2AZV A;  4AFU C;  2ESW A;  3TSZ A;  3EG2 A;  4CC4 B;  2J6F A;  2CT3 A;  4RUG A;  3M0R A;  1UEC A;  4OMN A;  1M27 C;  1JO8 A;  1NLO C;  1X43 A;  1Y57 A;  2X3X D;  2A08 A;  2DL4 A;  4F17 A;  3VS5 A;  1PKT A;  1WI7 A;  5GJW B;  2RQW A;  2L2P A;  5ECA A;  1I07 A;  1S1N A;  2JMA A;  2CDT A;  2OJ2 A;  4J9F A;  4HVW A;  2PZ1 A;  2JT4 A;  1ZLM A;  4R0K A;  2VVK A;  2KGT A;  4JZ3 A;  1JXM A;  1JEG A;  1FMK A;  1GBQ A;  1G83 A;  2LNH B;  5I22 A;  5FW9 A;  2GTO A;  2HDA A;  5IHK A;  2L3P A;  1AWJ A;  1MV0 B;  1UG1 A;  4K11 A;  4EIK A;  1PHT A;  4AG1 C;  1ARK A;  4GLM A;  3NPF A;  1T0H A;  2D8J A;  1CKB A;  4IIO A;  2D8H A;  3ULR B;  1RLP C;  1AZE A;  2CH4 A;  3VRY A;  5GJV B;  2V1R A;  3M0S A;  1BB9 A;  5HCK A;  2KT1 A;  2DIL A;  4HCK A;  3QWX X;  4F14 A;  1TUD A;  3EG0 A;  2FO0 A;  1UHC A;  1HD3 A;  3I9Q A;  2L3S A;  3UA6 A;  4DEX A;  1AOJ A;  1H92 A;  1GFD A;  1KSW A;  1SHF A;  3I35 A;  2YSQ A;  3EHR A;  1XOV A;  4ESR A;  2VKN A;  2DL5 A;  4RTZ A;  1UGV A;  4RTU A;  4OML A;  1WXT A;  2M0Y A;  2C0I A;  2KT8 A;  4AFS C;  3EGU A;  1M3C A;  1ZUU A;  1QWE A;  2EYX A;  2EKH A;  5EC7 A;  2CT4 A;  2DBK A;  2KYB A;  1KIK A;  1E6G A;  2RF0 A;  1GCP A;  2RQV A;  2LJ0 A;  1UDL A;  1M30 A;  1A0N B;  2AKL A;  1Z9Z A;  4OMM A;  1X2Q A;  4J9C A;  2DF6 A;  2O9S A;  5IXF A;  2A37 A;  1B07 A;  2EGE A;  4DEY A;  2HCK A;  1QKX A;  3QWY A;  2DVJ A;  4AFZ C;  1AWW A;  1GRI A;  4A63 B;  1ABQ A;  1MUZ A;  1TUC A;  1X6G A;  4ORZ A;  1T3L A;  1K4U S;  1WFW A; 
#chains in the Genus database with same CATH topology
 2O2O A;  1YHQ T;  4JPB W;  4JJN K;  4ZGD B;  4JRQ A;  2RN8 A;  4BI8 B;  4JS5 A;  3HL8 A;  1QVF P;  3LWI A;  3QII A;  3HFO A;  3HPW A;  2F2X A;  5GAO q;  4D6W A;  4C8Q B;  4DOW A;  4XU3 A;  5GAN 4;  1U06 A;  2D1X A;  1HXD A;  5KE2 A;  3HKS A;  1G2B A;  3QG1 A;  4FYY B;  2BIV A;  4JZ4 A;  2DE0 X;  5DLQ E;  1YNZ A;  1BIA A;  4FYW B;  3X25 B;  3CCL Q;  2ED0 A;  1KQS A;  2JNG A;  1VOM A;  2R5A A;  5FWC A;  3RKW A;  1KJW A;  1AWO A;  1X01 A;  4PLI A;  2QDL A;  1GCQ C;  2K5I A;  4PJO F;  3CCQ Q;  1ZUY A;  3RBB B;  4J7I A;  3QZ5 B;  3S3N A;  4JRI A;  4A4H A;  3VS4 A;  5C0M A;  5D7U A;  1WYX A;  5KYY A;  2JUF A;  2DVE A;  4BUG A;  4CC2 A;  1VQK Q;  4HT9 A;  4GBQ A;  2LQN A;  5LJ5 f;  5LJ5 e;  5CR2 A;  4J9D A;  4Z88 A;  5AYF A;  2GFA A;  1N6A A;  2ENM A;  4NL3 A;  1OOT A;  4N0A A;  4XU2 A;  1RAB B;  3DB3 A;  2A36 A;  1YJW T;  2VUB A;  1N9S A;  3BY7 A;  1R77 A;  4ATO A;  1GFC A;  4DBH A;  1K8A C;  4EMG A;  1N27 A;  4MDW A;  2JVV A;  4PKC C;  3NTI A;  2FRY A;  2Z0W A;  3CCV A;  2FRW A;  1F1B B;  4FT2 A;  4EPC A;  3EGX B;  4PFO A;  1UE9 A;  1PRM C;  3SHW A;  3G71 Q;  2XDB A;  2EJ9 A;  3OYN A;  2MWO A;  4C92 G;  4FU6 A;  4L6V 5;  3PT9 A;  3M0P A;  2GTJ A;  5CKB A;  2L5Q A;  1X6O A;  3VJP A;  4M77 C;  2GFU A;  5FRN A;  1RLQ C;  4MZM A;  1WX6 A;  1Q7Y C;  2FYK A;  2E65 A;  1WLP B;  2LZ6 B;  2XKO C;  2YDL A;  3MP6 A;  5GAN g;  1PM3 A;  5LL6 S;  4M75 E;  1E6H A;  1JU5 C;  3PVL A;  2ZZD A;  1VIF A;  1FX7 A;  4RTW A;  1VQ6 T;  1BCO A;  5FRO A;  3OYA A;  3JB9 D;  3QSU A;  3SWN C;  4A4G A;  1Q82 C;  1M90 R;  3I5S A;  3CCR T;  3CPF A;  3RES A;  4CC7 A;  3A8L B;  5DLO A;  3I56 Q;  3FLG A;  2LCL A;  4J9H A;  4JJD A;  2CS7 A;  2C0T A;  3JRZ A;  3G6E Q;  2JZ2 A;  1Q7Y U;  2HMA A;  2BUD A;  1RUW A;  1QCF A;  2P84 A;  3JB9 G;  2BZX A;  4X9C A;  5FU7 C;  2LJ1 A;  4KT0 E;  5FU6 C;  1VQ9 T;  2RB6 A;  1IGQ A;  3KFV A;  2JS2 A;  2XIC A;  1IGU A;  2BTT A;  1NBE B;  2LDM A;  1VQP A;  1KC8 R;  3OS0 A;  2DL8 A;  2GF7 A;  2CSI A;  1YIT Q;  3A8H B;  2MOX A;  1I5O B;  3EG1 A;  2CUB A;  3JSC A;  3CCM Q;  2CZ6 B;  1VQN T;  4KRT A;  2OTJ T;  5LJ3 f;  1ABO A;  5LJ3 e;  1X69 A;  3G4S A;  1YJN A;  4IIM A;  4MZT A;  3OYG A;  3WXM B;  1VQL A;  4M77 F;  1JJ2 A;  1HK9 A;  2DL7 A;  2FL7 A;  2QGG A;  2EYQ A;  4A4K A;  2E6N A;  2AZS A;  4HVU A;  1M2V B;  2H3E B;  3DLL A;  3OYH A;  2H8H A;  3J7A F;  2HKQ B;  3EG3 A;  1B3Q A;  3E9F A;  4LN2 A;  3I5R A;  1X6B A;  4X9D A;  3GIB A;  4E7J A;  1ZA1 B;  1XJW B;  4P5N A;  2EPD A;  3QJ6 A;  4FSS A;  2DXT A;  2JTM A;  4KGV B;  4C0D C;  2BE9 B;  1KQ1 A;  1KFZ A;  2NUP B;  5CAI A;  1YHQ A;  5GAM j;  1KG1 A;  2DXB A;  2LQW A;  1KD1 R;  2CH4 W;  2EGC A;  3QJY A;  4XU1 A;  1VQ5 Q;  1G8X A;  4PJO A;  3BFM A;  1VQO Q;  1SRL A;  1ZA2 B;  2GBQ A;  2OI3 A;  1H3Z A;  3CPW S;  2EQM A;  5CVI A;  5M9O A;  4FYV B;  3VYH B;  2LP5 A;  1IRE B;  4M78 C;  1RAI B;  2X9H A;  5L8R E;  4NOY A;  1V29 B;  1MMD A;  2X4J A;  3ASK A;  1LCK A;  2RHY A;  1HJD A;  2KDS A;  3P8H A;  4JLI A;  3S3O A;  3VUZ A;  2V8K A;  3CCU T;  3AHU A;  4RTX A;  2V8J A;  1ZX6 A;  1M1K C;  4JRP A;  3CPW P;  1JB0 E;  1Y96 B;  3JCM f;  1QCO A;  2AZV A;  4AFU C;  2LT4 A;  2VXE A;  3QHS A;  3NTH A;  2CZ0 B;  4OB1 B;  4CC4 B;  3LLR A;  4M7A C;  1ZQ1 A;  1SF9 A;  1M27 C;  2VB6 A;  1X43 A;  2HQE A;  1Y57 A;  4PJO D;  2DL4 A;  4MZP A;  4EMK A;  2WSF E;  3QBY A;  1PKT A;  2RQW A;  1G5V A;  2QGF B;  3INZ A;  4B6M A;  1YJW A;  2QEX T;  3FDR A;  1O75 A;  4J9F A;  2EQJ A;  4C5I A;  3CBM A;  2PZ1 A;  2V8I A;  1TH7 A;  1ZLM A;  4C92 B;  1BI1 A;  1XTD A;  3KXT A;  1YI2 T;  1QP3 A;  3HRT A;  1M1K U;  3O8V A;  3EH1 A;  2VVK A;  2KGT A;  4PFP A;  1K73 C;  2KAF A;  1G83 A;  2LNH B;  4RCC A;  4PJO G;  5GAN 8;  5KCO A;  2GTO A;  3HSB A;  2HD0 A;  5IHK A;  3JCM b;  3OW2 S;  2HZY A;  3FJP A;  1UG1 A;  4K11 A;  1ZHI A;  4OP0 A;  2P0P A;  4PLL A;  2O01 E;  1NE8 A;  1PHT A;  2CYZ B;  2MAM A;  3EGX A;  3OYY A;  1N9R A;  3NPF A;  3T9N A;  3CCE Q;  1WJQ A;  2RK2 A;  3BDL A;  3I55 Q;  1VQ4 Q;  3GPL A;  1Q81 R;  2KI7 A;  1LVK A;  5KYY B;  2D8H A;  5KH6 A;  2VAS A;  1MMN A;  2CH4 A;  4JLG A;  2LQK A;  4E7I A;  2DAQ A;  4M7D G;  1PCX A;  2V1R A;  3OW2 P;  1U8R A;  5HCK A;  4FT4 A;  3ZBD A;  1OQK A;  1WPY A;  2FO0 A;  1VQ6 A;  4QVC A;  2M0O A;  1FXX A;  7AT1 B;  1H92 A;  3OY9 A;  4BE2 A;  3I35 A;  1UGP B;  4EDU A;  2VKN A;  3MP8 A;  3CCR A;  1UGV A;  4QQ6 A;  3H9N A;  2K3Y A;  1WXT A;  4ZGJ B;  2M0Y A;  1C6V X;  4AFS C;  3OMG A;  3EH2 A;  2E5Q A;  2EKH A;  1RL2 A;  5EC7 A;  3MHX A;  2HL5 C;  5J39 A;  2RF0 A;  4A53 A;  5LJ5 d;  3CCJ Q;  4R56 A;  2AKL A;  1VQ9 A;  2DF6 A;  1UGQ B;  3CCS Q;  4M77 A;  2EGE A;  2E12 A;  4DEY A;  2KK4 A;  2QDY B;  3OBY A;  1YIJ T;  1T3L A;  1K4U S;  1WFW A;  3CC2 Q;  3A5Z B;  4QVD A;  3UWN A;  2MK5 A;  1NPP A;  1K76 A;  3CC7 T;  1VQN A;  2OTJ A;  2YRV A;  2A7Y A;  1PC0 A;  4Z8A A;  2KMT A;  1BCM A;  1RAD B;  2VYT A;  1BYM A;  1BBZ A;  2LTO A;  2HNI A;  3DB4 A;  1YJ9 T;  1GXI E;  3VRZ A;  3MO8 A;  2YUP A;  4OMQ A;  4ZN3 A;  2HBP A;  2HBW A;  2DTI A;  2V1Q A;  3FRN A;  1QQJ A;  4RKU E;  2LRQ A;  4MDX A;  5A2Q E;  2QA4 Q;  4KH1 B;  4N4H A;  3WVE B;  2RO0 A;  4E2F B;  2BZ8 A;  2KRN A;  3EHQ A;  4M77 D;  5IHN A;  3NFC A;  2QYZ A;  1QVP A;  3OQ5 A;  4Z89 A;  1WQ7 A;  2HKN A;  2LJ3 A;  2VV5 A;  2JM8 A;  1B34 A;  1UGR B;  2DJQ A;  3G1J A;  1YN8 A;  1RAG B;  4AG2 C;  1R0B G;  1RAA B;  4LXC A;  5LJ5 h;  4M77 G;  1BK2 A;  3L42 A;  3LYI A;  2YUN A;  2KQW A;  2LCC A;  2J6O A;  3BE3 A;  1K1Z A;  3JAM E;  5A0L A;  1Y0M A;  2PQW A;  4PFZ A;  2KSS A;  4LE9 A;  3HRU A;  4J6Y A;  3R6N A;  4QT7 A;  5D6W A;  2JS0 A;  1OPL A;  2DYB A;  1OU8 A;  3PIP A;  4OMP A;  5CKD A;  3KBG A;  3CCU A;  1WQW A;  5LJ3 d;  1MV3 A;  4O6J A;  5GAO m;  1S72 T;  1LOJ A;  1SHG A;  3A1P A;  2YUQ A;  2EKO A;  2ABL A;  3UDC A;  1M8M A;  1QP2 A;  2JW4 A;  5CQX A;  3VYG A;  1QVF S;  5KYX B;  3X24 B;  2CP7 A;  4BY6 C;  2ECZ A;  1Y96 A;  2C06 A;  1SRM A;  1IHW A;  5DM7 R;  4LUD A;  2OAW A;  4IKF A;  4F04 B;  1Y71 A;  4F7U E;  4C0Z A;  4WTO B;  3LH5 A;  3RDV A;  3FIF A;  4PJO B;  2RI5 A;  3H0F A;  1RAE B;  2EBP A;  4J9I A;  2RH2 A;  1OZ3 A;  4LDW A;  2QEX A;  4QW2 A;  2R5M A;  4WF2 A;  2GQI A;  2JN0 A;  3THK A;  3OA6 A;  2DNU A;  1M90 C;  1PG5 B;  1YI2 A;  3EFO A;  2MI6 A;  4J7F A;  1GL5 A;  3ZL7 C;  1GBR A;  2J06 A;  4C92 A;  3SB2 A;  1OEB A;  1ZSZ B;  3CME Q;  5GAN j;  3QDR B;  2F2W A;  2ZCF B;  4HKE A;  4D8D A;  3VS1 A;  2L8D A;  4M7D B;  3TVT A;  4DBR A;  1G3T A;  2V26 A;  3M9Q A;  4FYX B;  4A4E A;  2E10 A;  3NGP A;  1FYN A;  1QLY A;  3CC4 T;  2ROL A;  4C8Q E;  1NJI R;  3M0Q A;  2M9U A;  1ZUK A;  1SEM A;  3CQT A;  1JRI A;  2QK0 A;  2CGH A;  2RHZ A;  1KC8 C;  3CMA T;  5AT1 B;  1C1A A;  2DFU A;  1PSF A;  1W1F A;  1M90 U;  3JCM P;  2ED1 A;  2ZAE A;  4QVZ A;  3PE0 A;  2RK1 A;  2RMO A;  5LJ3 h;  3QO3 A;  4FIB A;  4EMK B;  1NYF A;  2FPD A;  4FM4 B;  3VS3 A;  1NG2 A;  4LDU A;  3SFM A;  4M7D F;  2NLU A;  2COW A;  1AT1 B;  4J9B A;  2PU9 B;  3JCM d;  3M5A A;  1D1B A;  2K5L A;  4M75 C;  4C92 D;  2HSP A;  1VQM T;  4PK4 A;  1CKA A;  4OGC A;  5KCH A;  1WHK A;  2KY9 A;  2VGM A;  1VA7 A;  5IH2 A;  1ZSG A;  3QKJ A;  2O9V A;  4LNP A;  2EYY A;  2NUT A;  2E6Z A;  2O4X A;  2DBM A;  1KC8 U;  1U5S A;  5I21 A;  1IO6 A;  4M78 G;  1N8R R;  3H41 A;  1NLP C;  3LW5 E;  4XTY A;  2QG9 B;  1M3A A;  2X3W D;  2HEQ A;  1I4K 1;  1YIJ A;  4ZGE B;  2ZPF B;  1H3H A;  2DD4 A;  6AT1 B;  2DEU A;  1OPK A;  2B86 A;  4HXJ A;  1QVG S;  1OZ2 A;  3CBO A;  2LX9 A;  3CC7 A;  1VQ8 T;  3ME9 A;  2RQU A;  3CBP A;  4OMO A;  2KYM A;  2VWF A;  2AT1 B;  2JTF A;  2J7I A;  4C5E A;  3CPW A;  2DER A;  2E4H A;  5LJ5 g;  1YJ9 A;  1BI3 A;  5D6Y A;  2CSQ A;  2MWP A;  1UEB A;  1U1S A;  3NHN A;  3CCV Q;  1M1F A;  2ZPI B;  3GLX A;  2IIM A;  1QVG P;  2FZK B;  4L5G A;  5IHI A;  3V7S A;  2FEI A;  1WNL A;  3OS2 A;  1VYT A;  4E7H A;  3OYE A;  4JS4 A;  1BU1 A;  2KRM A;  4M75 F;  4M77 B;  5HK3 A;  3JCM h;  3V7R A;  3S6W A;  4RUG A;  2QQR A;  1G3Y A;  4OMN A;  4DOV A;  5IN1 A;  3OYI A;  2RI3 A;  2PVD B;  2DJZ A;  5GJW B;  3ZEH A;  2L2P A;  5ECA A;  2FZG B;  2OJ2 A;  5HY6 A;  4HVW A;  2RHI A;  2LNV A;  5CCA A;  2OX7 A;  4R0K A;  4DQ2 A;  3X28 B;  4JZ3 A;  4XU0 A;  3OW2 A;  5I22 A;  5FW9 A;  1WZO A;  1D0X A;  5FU7 B;  5FU6 B;  4ZTJ A;  1S72 A;  4AG1 C;  4GLM A;  4II1 A;  1TS9 A;  4ELZ C;  1VQP Q;  2D8J A;  4AT1 B;  5I2M A;  1CKB A;  4GLK A;  1H64 1;  1BIB A;  3X26 B;  2QQ9 A;  1B34 B;  2D6F A;  2RHX A;  4PJM A;  2M02 A;  3FEO A;  5GJV B;  3G4S Q;  3M0S A;  1YJN Q;  3CD6 T;  5KYX A;  1BB9 A;  3FB9 A;  4L59 A;  1K8A R;  3CXC S;  1VQL Q;  2DIL A;  4XTZ A;  3QWX X;  1HD3 A;  3I9Q A;  4KUD K;  2CKK A;  2MPX C;  2OTL T;  4PNO A;  3SDZ A;  4J6X A;  2L3S A;  3UA6 A;  5D6X A;  2XDP A;  5C6S A;  2E64 A;  2R58 A;  4XTX A;  2DET A;  1GFD A;  4IUP A;  1KSW A;  2K3X A;  2QQS A;  2YSQ A;  1PSE A;  1IZ6 A;  2GQV A;  4RTZ A;  2M1H A;  5LJ3 g;  3A8M B;  3TCJ A;  4A4F A;  1QW1 A;  2CT4 A;  2DBK A;  2KYB A;  3CXC P;  2RHU A;  1MNE A;  4OGE A;  1Q7Y R;  4AMC A;  2CP3 A;  4QKU A;  2RQV A;  5GMK m;  1KHC A;  1YCY A;  1Q81 U;  2AHJ B;  2LJ0 A;  1EX4 A;  1VQ7 T;  1A0N B;  1Z9Z A;  4KUI A;  1ZSZ A;  4OMM A;  1B07 A;  3ER0 A;  3ZFJ A;  1SG5 A;  3NTK A;  5CKE A;  1AWW A;  4M7D A;  3CC4 A;  4PL6 A;  1G3W A;  1MUZ A;  2NYS A;  1YHQ Q;  1OX9 A;  5GAN 6;  4BB7 A;  1Q82 R;  2K9G A;  1Q95 G;  1X2K A;  3CMA A;  2AKK A;  1QMC A;  1TG0 A;  2DIG A;  2DLP A;  3V7C A;  5GAM f;  4HVV A;  5GAM e;  1WIE A;  2ZPE B;  1AHJ B;  1OUL A;  1WHM A;  2K2M A;  3IQL A;  2Y4X A;  1W2B S;  2K5F A;  4KUL A;  3V8J A;  3M0T A;  5I2S A;  2B8A A;  4JJB A;  1ZBJ A;  3EFR A;  4M78 B;  2KXC A;  1WHG A;  1I8F A;  3EFO B;  3G7Z A;  5KYU A;  1VQM A;  3VS6 A;  3CCL T;  4XQ3 A;  2K79 A;  1Q86 C;  4VUB A;  2MIO A;  3VS2 A;  3VU3 C;  4FW2 A;  2DXC A;  2DM1 A;  2QTX A;  1JBM A;  1NM7 A;  3CCQ T;  1W2B P;  1OI1 A;  2IVW A;  2M51 A;  2SEM A;  3JCM W;  2A28 A;  1SSH A;  4LUE A;  1GCQ A;  4M7D D;  3SEM A;  1TTH B;  1W70 A;  4XTW A;  2KBT A;  3LGF A;  4IUV A;  4ANJ A;  2KRO A;  4C92 E;  2E70 A;  2A0F B;  4M4Z A;  1V76 A;  3OBW A;  1VQK T;  4M78 F;  1I1J A;  2HQX A;  2D9T A;  1FMV A;  2DRK A;  4M7A B;  3M57 A;  3JCM g;  2DO3 A;  2ZPH B;  1VQ8 A;  2BKD N;  3RMQ A;  1YJW Q;  2DTO A;  2DX1 A;  1K9M C;  5KYW B;  3TQ7 P;  1VQM Q;  3OYD A;  2OAU A;  4QQD A;  1T3S A;  5EG2 A;  2F69 A;  3QPH A;  5GAN 5;  1Q86 U;  2W0Z A;  5FRM A;  1YWO A;  3C94 A;  2PTK A;  3LWH A;  2K3B A;  5GMK h;  2Y4Y A;  2LMJ A;  3E19 A;  5A0G A;  3QYH B;  4ZN1 A;  1NYG A;  2SRC A;  2DEQ A;  2KE9 A;  2EFI A;  2EAY A;  3DKM A;  1X27 A;  4E6R A;  1KK7 A;  4J9E A;  3URG A;  5A0D A;  4M7A F;  2JTE A;  2NUT B;  3G71 T;  3HFN A;  2E5K A;  2O4X B;  2HL3 A;  4Y28 E;  3RR6 A;  3L2R A;  3M53 A;  1QVF A;  3REA B;  4V2S A;  1IXD A;  2E3I A;  1K9M U;  4CC3 A;  2EYW A;  2O88 A;  1W4S A;  2KNB B;  1M9S A;  1ZBX A;  2F5T X;  1NEB A;  2CZ7 B;  1RAC B;  2MF2 A;  1VQ6 Q;  1WXU A;  1PWT A;  2EYZ A;  1WJS A;  2EQI A;  1KHI A;  5J3B A;  2ROT A;  2L0A A;  5J26 A;  3CCR Q;  2WSC E;  1AZG B;  3M59 A;  3SWN A;  2O31 A;  1M1K R;  2LC4 A;  3I56 T;  2P4R A;  4OVA A;  2DA9 A;  1PD0 A;  4RTV A;  3G6E T;  3RMS A;  4PJJ A;  1LNX A;  3E2U A;  1VQ9 Q;  2CP0 A;  3EAE A;  2IPO B;  2PVO B;  3FJ5 A;  2QQB A;  3MEA A;  3MET A;  4M75 G;  2X51 A;  1I81 A;  3X20 B;  3HP9 A;  3H0I A;  2X4Y A;  1PNJ A;  1NJI C;  3M54 A;  1VQN Q;  2D0N A;  2OTJ Q;  2VC8 A;  1YIT T;  1RAF B;  3CCM T;  2RQT A;  3QZ9 B;  3CD6 A;  3PTA A;  4MML A;  4PJL A;  1UFF A;  2OTL A;  3MPU B;  1SKU B;  1K73 R;  1UJY A;  4C0F A;  2PUO B;  1V1C A;  4LDV A;  4Q5W A;  2M16 A;  2QQA A;  4KGZ B;  1AVZ C;  2DTH A;  1IHV A;  3UAT A;  3QYG B;  1MHN A;  2K4Y A;  1LJO A;  2QI2 A;  4BDZ A;  1OV3 A;  4CRI A;  2RNA A;  3C12 A;  3UF4 A;  1NJI U;  2DXU A;  2EVR A;  4DA4 A;  1VQ7 A;  2PUK B;  3PNW C;  2NUZ A;  4J6W A;  1RI9 A;  2XD0 A;  3C0C A;  1UGS B;  1WHJ A;  2RJD A;  3PVQ A;  2KVQ G;  3R6O A;  3REB B;  1QVG A;  2DD5 A;  1AWX A;  3M56 A;  3QDF A;  5IAY A;  2MCN A;  3GNG A;  8AT1 B;  4C5H A;  3P8B B;  1Z9Q A;  2JM9 A;  4OB3 B;  3L2U A;  3L2W A;  4JRK A;  1B7T A;  1VQ5 T;  3LX7 A;  3VS7 A;  4B9X A;  4C8Q C;  1VQO T;  2L3R A;  3M0U A;  2FB7 A;  4ZTF A;  2LVM A;  4ME7 A;  2NWM A;  1VQ7 Q;  1N8R U;  4BI3 A;  4Y91 A;  4J9G A;  2XG8 D;  3CCL A;  4M78 A;  3CCU Q;  1EFN A;  2X4W A;  1M5Q 1;  3EG9 A;  3S3M A;  1WDX A;  1FWZ A;  3O5Z A;  3MEU A;  3CCQ A;  1VUB A;  4O5V A;  3KUF A;  2F5K A;  3PMT A;  4PJO E;  3UA7 A;  1M3B A;  2ESW A;  4FSX A;  1Y7X A;  3TSZ A;  3EG2 A;  5LJ5 j;  3LH0 A;  2J6F A;  2CT3 A;  4BY6 B;  4F7U F;  4EMK C;  2BE7 D;  3M0R A;  2JJ9 A;  3SD4 A;  1VQK A;  3V8L A;  4A54 A;  3MCA B;  3JB9 H;  4IUR A;  4LD9 K;  1NLO C;  2X3X D;  4F17 A;  2L89 A;  1UB4 A;  2PVG B;  1D09 B;  4M7A A;  1U1T A;  2QEX Q;  3GOX A;  1PD1 A;  4BAC A;  1I07 A;  2CP6 A;  1SSF A;  4M7D E;  5CQY A;  3HRS A;  3PMI A;  2CDT A;  2QAZ A;  1YI2 Q;  3JCM V;  5KYW A;  3MJX A;  1HYO A;  4C0G A;  1X75 C;  4M78 D;  1JEG A;  3MKD A;  1O9S A;  1FMK A;  4BE0 A;  1GBQ A;  5KYU B;  3TEE A;  3OYL A;  2L3P A;  4B9W A;  2XI9 A;  1AWJ A;  2FVU A;  4C8Q F;  5GAN 3;  4FL6 A;  5GAN f;  5GAN e;  2ZGW A;  4EIK A;  2MYS A;  3G71 A;  5GAM d;  4E7Z A;  2DYI A;  1NPR A;  3OMC A;  4R55 A;  3P8D A;  4LD6 A;  3CCE T;  3I55 T;  1VQ4 T;  2MMP A;  3J80 E;  1I5L A;  4KBM B;  1RLP C;  4BDY A;  1BI0 A;  3MEW A;  4J83 A;  3F70 A;  3CXC A;  2KT1 A;  3OYJ A;  2CZ1 B;  2QXF A;  4HCK A;  4M7A D;  4F14 A;  2X4X A;  4DEX A;  1AOJ A;  2HQH A;  2RI2 A;  1MMA A;  2VXF A;  2ATC B;  2DK3 A;  2DL5 A;  1C0M A;  4FW1 A;  1KD1 C;  4OML A;  4M75 B;  3MP1 A;  3I56 A;  3AT1 B;  3EGU A;  1M3C A;  1ZUU A;  1QWE A;  2EYX A;  5HK0 A;  1D1A A;  1KIK A;  4M7A G;  3G6E A;  1GCP A;  4UC4 A;  2G3R A;  3CCJ T;  4C5G A;  2EIF A;  3L1A A;  4J9C A;  1TSF A;  3PGG A;  3CCS T;  5KE3 A;  1QKX A;  3QWY A;  2DVJ A;  4AFZ C;  1K8A U;  1YIJ Q;  1TUC A;  4ORZ A;  3N5B B;  2HAX A;  1NEG A;  2YHT A;  1T0J A;  4KGX B;  1EZZ B;  1K9A A;  4OB2 B;  5LJ3 j;  3CC2 T;  2FG0 A;  3CC7 Q;  3OYK A;  4NL2 A;  1YIT A;  1KD1 U;  4OMF B;  3CCM A;  3RIR A;  1W2B A;  2CP2 A;  2FPF A;  5DY9 A;  3D7S B;  2RA2 A;  5GAM h;  1YJ9 Q;  4HCB A;  3QUI A;  1R8O B;  1QCN A;  4BD3 A;  5L23 A;  4XTV A;  3OSV A;  4M77 E;  1XNI A;  2K7A A;  2FZC B;  3A98 A;  3SWN B;  1YCS B;  2F2V A;  2J05 A;  3E1S A;  1KQS S;  1OX8 A;  4XTU A;  3RUX A;  2QA4 T;  3FC3 A;  4Y92 A;  1HSQ A;  3H8Z A;  4XAX B;  4NS5 A;  5GAO l;  1Q82 U;  3JCM J;  5GAN 7;  2R57 A;  1M1G A;  3TU4 K;  1QKW A;  3OS5 A;  2W10 A;  5IT9 E;  4TVR A;  4WCI A;  1J3T A;  1W6X A;  2KXD A;  1KQS P;  2LQ8 A;  4IUQ A;  2FPE A;  2P0Q A;  2A3L A;  2EGA A;  2JOY A;  3EGD A;  3WVD B;  2COZ A;  4RG2 A;  3RNJ A;  1YP5 A;  3J81 E;  4E7L A;  1XQH A;  1Q81 C;  3RKY A;  1U3O A;  1D0Y A;  2CRE A;  2EW3 A;  4X34 A;  4IUT A;  1VQ5 A;  1M4Z A;  2AIR B;  2RQR A;  2L3Q A;  4J5Y A;  4F16 A;  1VQO A;  4MMK A;  3A8G B;  2K2V A;  2DL3 A;  1G3S A;  3GP8 A;  3L2Q A;  2DIQ A;  5CO7 A;  4F7U A;  2IG0 A;  3H0H A;  2DMO A;  1S72 Q;  4Z02 A;  3LGL A;  2LT1 A;  5CKH A;  2X35 A;  1D0Z A;  1PRL C;  2BZY A;  1R0C B;  1OU9 A;  2JMC A;  2RJE A;  1K0S A;  2PNI A;  1D3B B;  4DBQ A;  3Q1J A;  3OS1 A;  5GAO p;  2EQU A;  2YT6 A;  2ZPB B;  1K0X A;  1SPK A;  4FCY A;  4C0D B;  1WA7 A;  1N5Z A;  2E1H A;  1LPL A;  4CI0 C;  2DKG A;  4C8Q A;  2RM4 A;  2YXY A;  4RTY A;  4C92 C;  1VYV A;  3NMZ C;  2CUD A;  5GMK i;  3A8O B;  1VIE A;  1OYX A;  3VKI A;  2RJF A;  3M55 A;  2WAC A;  3JV3 A;  3JCM e;  2H3J A;  2YLB A;  3CME T;  3DLM A;  1WHH A;  3EG9 B;  2JXB A;  1MND A;  3H6Z A;  2XK0 A;  1AD5 A;  3JB9 I;  2DRM A;  3CC4 Q;  4DBF A;  4HT8 A;  2C0O A;  3CCE A;  4F7U G;  2YRC A;  5GAN 2;  3I55 A;  1YWP A;  1VQ4 A;  2GGR A;  4N4I A;  3OB9 A;  3CMA Q;  1AEY A;  4M78 E;  3TRE A;  2KEA A;  2LX7 A;  2QAS A;  4OF1 A;  3U23 A;  5FLX E;  3V8K A;  4C8Q D;  4N0A C;  1TU0 B;  3GF5 A;  5CKF A;  2F1L A;  4JJC A;  2HSE B;  3GNF B;  3UPU A;  1JJ2 S;  2FHD A;  1CSK A;  2KR3 A;  2XMF A;  1ACM B;  2GNC A;  1WXB A;  1TUG B;  5GAM g;  3JCM c;  1VYU A;  3OYM A;  1UJ0 A;  4HA8 A;  1DJ7 B;  1UUE A;  3VUB A;  4YTL A;  4M75 A;  4C8Q G;  4M7A E;  2LCS A;  2YUO A;  3C4S A;  2EJG A;  1YBY A;  2YLC A;  4IUU A;  2KRS A;  3CCJ A;  1TWB A;  4C92 F;  1JJ2 P;  5CK9 A;  1RAH B;  1IRX A;  1KQ2 A;  1QWF A;  1D1C A;  3CCS A;  1I0C A;  3TSW A;  5GAO r;  2QTV A;  1H8K A;  2I2L A;  1M2O A;  4X1V A;  1K73 U;  1PKS A;  3CC2 A;  5FWB A;  4E7K A;  3BW1 A;  3QXE B;  2G6F X;  4RTT A;  2XHC A;  4D8K A;  2RPN A;  3GBQ A;  1VQ8 Q;  3L2Z A;  5GAO n;  2P0K A;  2D0Q B;  3UT1 A;  4OB0 B;  2I0N A;  3JB9 J;  1UHF A;  5GAN d;  1JXO A;  2EJF A;  2VGN A;  4XK8 E;  4JDS A;  1BI2 A;  2AK5 A;  1NZ9 A;  1JQQ A;  2ZPG B;  3OSS C;  5IXB A;  4KH0 B;  4HCC A;  3CCV T;  4RMO A;  4M75 D;  5HKC A;  3VV0 A;  4RG8 A;  2K6D A;  5I11 A;  2E3H A;  2J6K A;  4ZNX A;  3VS0 A;  3M4G A;  2QA4 A;  3JB9 F;  8ATC B;  4E47 A;  2EQK A;  4AFQ C;  1UTI A;  1WGS A;  1E7O A;  3RER A;  1Y07 A;  3C95 A;  4QQG A;  2WSE E;  2RJC A;  4GY5 A;  3OYC A;  1UEC A;  2COY A;  3HTR A;  1JO8 A;  4N4G A;  4BI4 A;  1IB8 A;  3OYF A;  2A08 A;  2K57 A;  1M8V A;  1MGQ A;  3VS5 A;  1WI7 A;  5GMK j;  4PJN A;  5KYN A;  1Q86 R;  4J8O A;  1S1N A;  2JMA A;  1TOV A;  2YRD A;  2RD1 A;  3HHT B;  2JT4 A;  3CEY A;  3EFS A;  2YWW A;  4E7S A;  1M2V A;  1FMW A;  3OYB A;  3JCM Q;  9ATC B;  1JXM A;  2DZ9 A;  2HDA A;  2CP5 A;  3RKX A;  1MV0 B;  5CIU A;  5GMK l;  1ARK A;  3JCM X;  5GAN h;  4HCZ A;  1T0H A;  3L2V A;  2GCX A;  4IIO A;  2XU8 A;  1VQP T;  1K9M R;  2NUP A;  1MMG A;  3ULR B;  1AZE A;  3VRY A;  3CD6 Q;  1N8R C;  3M4Y A;  5GMK e;  3G4S T;  1YJN T;  3EGD B;  3MEV A;  1D3B A;  4RCB A;  4EMH A;  2OTL Q;  1RI0 A;  1TUD A;  3EG0 A;  1UHC A;  1BKB A;  1VQL T;  1P92 A;  2XID A;  4PJO C;  4BE1 A;  2EWN A;  2E41 A;  1SHF A;  3EHR A;  4LDY A;  2XDD A;  1XOV A;  4ESR A;  4RTU A;  1YFN A;  2C0I A;  2KT8 A;  3M58 A;  1EIF A;  1ZSZ C;  4ELY C;  4F7U B;  1E6G A;  1WJR A;  2P4T A;  1TXQ A;  3CME A;  3PIO A;  4M7D C;  1UDL A;  1M30 A;  1X2Q A;  2O9S A;  5IXF A;  4JUV A;  1WHL A;  4LDX A;  2A37 A;  2DZC A;  3E9G A;  3BDU A;  2HCK A;  2Y90 A;  2DPP B;  1GRI A;  4A63 B;  1ABQ A;  1X6G A;  3PFS A; 
#chains in the Genus database with same CATH homology
 2O2O A;  1NEG A;  1T0J A;  1K9A A;  2K9G A;  4JPB W;  2FG0 A;  1X2K A;  2RN8 A;  1K76 A;  2AKK A;  1TG0 A;  2DLP A;  4Z8A A;  4HVV A;  2FPF A;  1WIE A;  2F2X A;  2K2M A;  3IQL A;  1BBZ A;  3M0T A;  1U06 A;  4JJB A;  3VRZ A;  2D1X A;  5L23 A;  1ZBJ A;  1G2B A;  4JZ4 A;  2DE0 X;  2K7A A;  1YNZ A;  3A98 A;  1YCS B;  2KXC A;  2F2V A;  2J05 A;  2YUP A;  4OMQ A;  2ED0 A;  3VS6 A;  2HBW A;  5FWC A;  1KJW A;  1AWO A;  2K79 A;  2V1Q A;  2QDL A;  2MIO A;  3VS2 A;  1GCQ C;  1ZUY A;  2BZ8 A;  2DM1 A;  1NM7 A;  3RBB B;  2KRN A;  4Y92 A;  1HSQ A;  2M51 A;  3EHQ A;  5IHN A;  2SEM A;  2A28 A;  1SSH A;  3VS4 A;  4LUE A;  1GCQ A;  3SEM A;  1WYX A;  1W70 A;  4Z89 A;  2LJ3 A;  1QKW A;  2W10 A;  2KBT A;  4CC2 A;  2KRO A;  2JM8 A;  4M4Z A;  4WCI A;  1J3T A;  2DJQ A;  1W6X A;  4GBQ A;  2KXD A;  1I1J A;  2LQN A;  1YN8 A;  4J9D A;  2DRK A;  2FPE A;  4AG2 C;  4Z88 A;  2EGA A;  2ENM A;  1OOT A;  1YP5 A;  3RNJ A;  1BK2 A;  2YUN A;  2DX1 A;  1U3O A;  2EW3 A;  2CRE A;  2A36 A;  1T3S A;  2J6O A;  1K1Z A;  2W0Z A;  1YWO A;  1Y0M A;  2RQR A;  2L3Q A;  4F16 A;  2PTK A;  2K3B A;  1GFC A;  4LE9 A;  3R6N A;  4QT7 A;  2LMJ A;  2DL3 A;  2JS0 A;  1OPL A;  2FRY A;  2DYB A;  1NYG A;  2SRC A;  2FRW A;  2KE9 A;  1X27 A;  4E6R A;  4OMP A;  4J9E A;  3H0H A;  1UE9 A;  2JTE A;  2DMO A;  1PRM C;  3SHW A;  1MV3 A;  1SHG A;  2YUQ A;  2E5K A;  3M0P A;  2GTJ A;  2ABL A;  1PRL C;  1M8M A;  3REA B;  1RLQ C;  2JW4 A;  2BZY A;  1WX6 A;  4CC3 A;  2JMC A;  2EYW A;  2O88 A;  1K0S A;  2PNI A;  2KNB B;  2ECZ A;  1WLP B;  2LZ6 B;  1SRM A;  2YDL A;  1NEB A;  4LUD A;  1E6H A;  2OAW A;  2YT6 A;  1JU5 C;  3PVL A;  1K0X A;  1SPK A;  1WXU A;  1PWT A;  2EYZ A;  1WA7 A;  4RTW A;  1N5Z A;  2EQI A;  2ROT A;  3LH5 A;  2L0A A;  3H0F A;  2EBP A;  4J9I A;  3I5S A;  4RTY A;  2GQI A;  3THK A;  1AZG B;  4CC7 A;  1VYV A;  2DNU A;  2O31 A;  3NMZ C;  2CUD A;  4J9H A;  2P4R A;  1GL5 A;  4JJD A;  3ZL7 C;  2C0T A;  1GBR A;  2J06 A;  2DA9 A;  1OEB A;  4RTV A;  3JV3 A;  1RUW A;  2F2W A;  1QCF A;  2BZX A;  4D8D A;  2LJ1 A;  3VS1 A;  2JXB A;  3TVT A;  3FJ5 A;  3KFV A;  1AD5 A;  2DRM A;  2JS2 A;  3NGP A;  1FYN A;  1QLY A;  2BTT A;  2C0O A;  3H0I A;  2ROL A;  1PNJ A;  3M0Q A;  1ZUK A;  1SEM A;  1YWP A;  2GGR A;  3CQT A;  2DL8 A;  2CSI A;  1AEY A;  2MOX A;  2D0N A;  3EG1 A;  2CUB A;  2KEA A;  2LX7 A;  4KRT A;  2RQT A;  1W1F A;  3U23 A;  1ABO A;  1X69 A;  2ED1 A;  3PE0 A;  4IIM A;  2RMO A;  1UFF A;  1NYF A;  2FPD A;  4JJC A;  3VS3 A;  1NG2 A;  1UJY A;  2DL7 A;  1CSK A;  2AZS A;  1V1C A;  2KR3 A;  2XMF A;  4J9B A;  1AVZ C;  2GNC A;  3UAT A;  1WXB A;  4HVU A;  2HSP A;  1CKA A;  2H8H A;  1VYU A;  3EG3 A;  1UJ0 A;  1UUE A;  1VA7 A;  1OV3 A;  5IH2 A;  1ZSG A;  1B3Q A;  4LN2 A;  2O9V A;  2RNA A;  4LNP A;  3I5R A;  3UF4 A;  2EYY A;  2LCS A;  2YUO A;  1X6B A;  2DBM A;  2EVR A;  1U5S A;  2KRS A;  1IO6 A;  2NUZ A;  1RI9 A;  3H41 A;  1NLP C;  2EPD A;  4FSS A;  3C0C A;  1QWF A;  1I0C A;  1M3A A;  3TSW A;  2X3W D;  3PVQ A;  2HEQ A;  1KFZ A;  3REB B;  1H8K A;  1AWX A;  4X1V A;  1PKS A;  1H3H A;  5FWB A;  1OPK A;  2B86 A;  2G6F X;  4HXJ A;  4RTT A;  4D8K A;  2RPN A;  3GBQ A;  2MCN A;  2LQW A;  1Z9Q A;  2CH4 W;  2EGC A;  2JM9 A;  2RQU A;  4OMO A;  2KYM A;  2VWF A;  2I0N A;  2J7I A;  1SRL A;  3VS7 A;  2GBQ A;  1UHF A;  3M0U A;  2OI3 A;  1JXO A;  2LP5 A;  2AK5 A;  2CSQ A;  1JQQ A;  2NWM A;  5IXB A;  3NHN A;  2IIM A;  4J9G A;  1LCK A;  2K6D A;  1HJD A;  5I11 A;  1EFN A;  5IHI A;  2J6K A;  4ZNX A;  3VS0 A;  4RTX A;  1WDX A;  3O5Z A;  1ZX6 A;  2FEI A;  4AFQ C;  1VYT A;  1UTI A;  1E7O A;  1BU1 A;  2KRM A;  3UA7 A;  1M3B A;  2AZV A;  4AFU C;  2ESW A;  3TSZ A;  3EG2 A;  4CC4 B;  2J6F A;  2CT3 A;  4RUG A;  3M0R A;  1UEC A;  4OMN A;  1M27 C;  1JO8 A;  1NLO C;  1X43 A;  1Y57 A;  2X3X D;  2A08 A;  2DL4 A;  4F17 A;  3VS5 A;  1PKT A;  1WI7 A;  5GJW B;  2RQW A;  2L2P A;  5ECA A;  1I07 A;  1S1N A;  2JMA A;  2CDT A;  2OJ2 A;  4J9F A;  4HVW A;  2PZ1 A;  2JT4 A;  1ZLM A;  4R0K A;  2VVK A;  2KGT A;  4JZ3 A;  1JXM A;  1JEG A;  1FMK A;  1GBQ A;  1G83 A;  2LNH B;  5I22 A;  5FW9 A;  2GTO A;  2HDA A;  5IHK A;  2L3P A;  1AWJ A;  1MV0 B;  1UG1 A;  4K11 A;  4EIK A;  1PHT A;  4AG1 C;  1ARK A;  4GLM A;  3NPF A;  1T0H A;  2D8J A;  1CKB A;  4IIO A;  2D8H A;  3ULR B;  1RLP C;  1AZE A;  2CH4 A;  3VRY A;  5GJV B;  2V1R A;  3M0S A;  1BB9 A;  5HCK A;  2KT1 A;  2DIL A;  4HCK A;  3QWX X;  4F14 A;  1TUD A;  3EG0 A;  2FO0 A;  1UHC A;  1HD3 A;  3I9Q A;  2L3S A;  3UA6 A;  4DEX A;  1AOJ A;  1H92 A;  1GFD A;  1KSW A;  1SHF A;  3I35 A;  2YSQ A;  3EHR A;  1XOV A;  4ESR A;  2VKN A;  2DL5 A;  4RTZ A;  1UGV A;  4RTU A;  4OML A;  1WXT A;  2M0Y A;  2C0I A;  2KT8 A;  4AFS C;  3EGU A;  1M3C A;  1ZUU A;  1QWE A;  2EYX A;  2EKH A;  5EC7 A;  2CT4 A;  2DBK A;  2KYB A;  1KIK A;  1E6G A;  2RF0 A;  1GCP A;  2RQV A;  2LJ0 A;  1UDL A;  1M30 A;  1A0N B;  2AKL A;  1Z9Z A;  4OMM A;  1X2Q A;  4J9C A;  2DF6 A;  2O9S A;  5IXF A;  2A37 A;  1B07 A;  2EGE A;  4DEY A;  2HCK A;  1QKX A;  3QWY A;  2DVJ A;  4AFZ C;  1AWW A;  1GRI A;  4A63 B;  1ABQ A;  1MUZ A;  1TUC A;  1X6G A;  4ORZ A;  1T3L A;  1K4U S;  1WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...