1TG0A

0.97-a structure of the sh3 domain of bbc1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Saccharomyces cerevisiae SH3 domain structural genomics
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin tail region-interacting protein MTI1
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tg0A00
2DRKA 3THKA 1SPKA 1X2KA 2J6OA 1AZEA 2FG0A 1UGVA 1NYFA 1GL5A 2JMAA 1UTIA 2A08A 4OMNA 1WA7A 4ESRA 2OJ2A 1WI7A 2A28A 4LUDA 2KR3A 3EG3A 4J9FA 1QWEA 1KIKA 1B07A 1SSHA 2IIMA 2J6FA 2JMCA 3H0HA 2KT8A 1QKWA 1PHTA 1SRLA 1UHCA 1BU1A 2DM1A 2JXBA 2W10A 4RTWA 2RN8A 1WIEA 2W0ZA 5L23A 1G2BA 2DMOA 2DNUA 1YNZA 2MIOA 2DF6A 2F2VA 4J9CA 2AKLA 4CC7A 1CSKA 4J9DA 4LNPA 2V1RA 2KE9A 4D8DA 4M4ZA 3VS7A 4CC4B 1WYXA 4JZ3A 4ZNXA 1ZUKA 2J05A 4HVUA 4HVWA 1TUCA 2AKKA 2O88A 1ZUYA 2YUPA 2D8JA 1OV3A 2CSQA 2KBTA 2LQWA 5IXFA 1X6BA 3CQTA 4K11A 4AFUC 2RQWA 1PRMC 2D0NA 1M8MA 2ROLA 4OMOA 1UE9A 3I35A 3NGPA 2HEQA 2KROA 2ENMA 3I9QA 2CSIA 1GBQA 1HJDA 5I11A 2HCKA 1KJWA 1K1ZA 1U06A 4OMLA 3M0RA 2M51A 4J9BA 2OI3A 3UATA 2DL7A 1NEBA 2ED1A 2LNHB 1B3QA 3JV3A 1ABQA 1W6XA 1V1CA 1ZLMA 5IHNA 4RUGA 1OOTA 2C0IA 1CKBA 1W1FA 1K0XA 2I0NA 4RTTA 2EGAA 4AFSC 1MV0B 4OMPA 2PZ1A 2ED0A 4R0KA 4GBQA 2BZ8A 1PNJA 2CT3A 2GQIA 2FPDA 2LMJA 2JM9A 2JT4A 1WXBA 1AOJA 2F2WA 2L3QA 1NYGA 1HD3A 1K9AA 2EVRA 2DBMA 2SRCA 4JPBW 1S1NA 2FPEA 3UF4A 3M0UA 2DA9A 3H41A 2M0YA 2RNAA 2DL4A 3C0CA 2JS0A 1UG1A 3VS6A 1X27A 2DX1A 1GFDA 1ZSGA 2J7IA 1IO6A 3REAB 2C0TA 2K7AA 1OEBA 3EHRA 2JS2A 2KT1A 2DL8A 2O2OA 4DEYA 2L3SA 2XMFA 3I5SA 2CREA 3NPFA 5HCKA 1U5SA 4HVVA 2EYZA 3NHNA 1AD5A 2DVJA 4JZ4A 2K79A 2L0AA 4E6RA 1AZGB 1E6HA 1BB9A 2PNIA 1K0SA 1UDLA 1W70A 1QKXA 2VWFA 2EQIA 4JJCA 3R6NA 1M3BA 1WFWA 2ESWA 2FRWA 1I1JA 3REBB 1GCQA 3EG2A 2GTJA 4AG1C 3VRZA 2VKNA 1J3TA 1H3HA 2SEMA 5I22A 1XOVA 2FO0A 1K4US 2LQNA 1PKTA 2V1QA 1YCSB 3SEMA 2KEAA 2BTTA 3UA6A 3IQLA 2K3BA 1ZX6A 2KRSA 1PWTA 3SHWA 4Z89A 2FEIA 2YDLA 2DLPA 3FJ5A 4J9IA 2JM8A 1E7OA 4J9HA 2CDTA 1JXOA 4OMMA 3VS5A 3TVTA 2FPFA 1VYUA 2CT4A 5FWBA 3VS3A 2AK5A 2CUDA 1WXUA 3VS2A 1BBZA 1SHGA 2KNBB 1T3SA 2KRNA 2CH4W 1BK2A 1SHFA 2L3PA 3PE0A 2H8HA 3H0FA 4RTZA 1Z9QA 1X6GA 3UA7A 1JQQA 5FWCA 2LJ0A 5EC7A 2L2PA 2KYMA 4ORZA 1MUZA 1H8KA 4J9GA 3VS0A 4AFQC 4RTVA 1KSWA 2G6FX 1YWPA 1T0HA 4CC2A 2QDLA 2YUQA 2EKHA 1UFFA 1U3OA 2AZVA 2VVKA 3LH5A 4WCIA 1YP5A 1UUEA 1NEGA 1CKAA 2EW3A 2DL5A 4X1VA 4RTXA 1Z9ZA 2JW4A 2EGCA 3QWYA 1GBRA 2LCSA 1ABOA 3A98A 2D1XA 2EYWA 2KYBA 2YSQA 4QT7A 5IXBA 1ARKA 2BZYA 2GNCA 1VA7A 1UJYA 2RPNA 2ROTA 2KXCA 1M30A 5GJVB 2KGTA 4AFZC 2RQVA 3M0QA 2YUNA 1I0CA 1RI9A 2GBQA 2B86A 2CUBA 1PRLC 3EGUA 2LX7A 3GBQA 1RLQC 1VYTA 1AWJA 1UJ0A 1Y57A 2O9VA 1T3LA 1QCFA 1NLOC 3U23A 1RUWA 1LCKA 1TUDA 1H92A 4EIKA 4JJDA 1AEYA 2ECZA 1GRIA 1Y0MA 1HSQA 3RBBB 2MCNA 1NG2A 4AG2C 4Y92A 2C0OA 2D8HA 5FW9A 2BZXA 1X69A 1GCPA 1WLPB 4Z8AA 3PVLA 5ECAA 1X2QA 2DBKA 1VYVA 2O31A 2GGRA 1WX6A 3EHQA 3M0SA 1WDXA 4HXJA 1UECA 2DILA 1T0JA 2E5KA 2DRMA 2DE0X 4OMQA 4FSSA 1TG0A 2RF0A 1M27C 2HBWA 2P4RA 2LJ3A 2NUZA 1MV3A 1AVZC 2A37A 1FYNA 1GCQC 3TSWA 1NM7A 4J9EA 3VS4A 1QWFA 2HSPA 4DEXA 1AWWA 1WXTA 2K9GA 4Z88A 2OAWA 2RQRA 2LZ6B 3O5ZA 2LP5A 2NWMA 3QWXX 5IHKA 5IH2A 1JXMA 1NLPC 1K76A 3PVQA 2RMOA 1FMKA 2A36A 3M0TA 1M3AA 1JU5C 2LJ1A 4KRTA 3VS1A 5GJWB 1A0NB 2X3XD 2AZSA 4GLMA 2DL3A 3TSZA 4D8KA 2RQUA 1AWXA 1EFNA 2KXDA 2PTKA 3ZL7C 1AWOA 4RTUA 1E6GA 2YT6A 1JO8A 2K6DA 4IIOA 1KFZA 3I5RA 3KFVA 2EBPA 2O9SA 1PKSA 2EYYA 4JJBA 2F2XA 2DYBA 2EGEA 1YN8A 1QLYA 2YUOA 4F17A 3EG0A 1M3CA 4LUEA 1SRMA 1YWOA 2EYXA 1UHFA 1I07A 1SEMA 1G83A 2FRYA 5IHIA 3H0IA 4F16A 2X3WD 2J6KA 2HDAA 4F14A 3VRYA 3NMZC 2RQTA 2CH4A 3M0PA 2EPDA 4CC3A 3RNJA 1JEGA 2KRMA 4RTYA 2J06A 1GFCA 2GTOA 1X43A 3EG1A 1OPKA 4IIMA 1ZBJA 2MOXA 3ULRB 4LE9A 1N5ZA 2K2MA 4A63B 1RLPC 4LN2A 2DJQA 1OPLA 1ZUUA 2JTEA 4HCKA 2ABLA
chains in the Genus database with same CATH superfamily
1X2KA 1AZEA 1UGVA 3L2ZA 5D7UA 4M77E 2RO0A 3MCAB 2DD5A 2P4TA 1WA7A 4XQ3A 1YI2A 1F1BB 4QW2A 5HK3A 2VV5A 2BE9B 2CZ6B 1SSHA 2IIMA 3H0HA 1QCOA 2DEUA 1S72A 4BE2A 5GAOr 1S72T 1QKWA 2HQEA 3OA6A 2KMTA 2NLUA 1LPLA 2JXBA 2W10A 1WHLA 4RTWA 1WIEA 4ZGDB 5L23A 2E3IA 2XG8D 1VIFA 2K2VA 2QYZA 3CCLQ 3QYHB 5GAN3 3MP1A 4LNPA 4MMLA 2V1RA 3R6OA 4XTVA 3M5AA 2NUPB 4PJJA 2VXEA 1JB0E 4CC4B 1WYXA 2LNVA 1ZUKA 4F7UF 3CBMA 4XTYA 4RG8A 1K9MU 4F7UB 4KUIA 3L2VA 2EKOA 2YUPA 2D8JA 4KGZB 2CSQA 2KBTA 2ZPFB 4RCBA 3CQTA 1QW1A 2YXYA 2MWOA 4AFUC 4AT1B 1UE9A 4LXCA 3NGPA 3V7CA 1NJIU 2KROA 4JRIA 2VXFA 2RB6A 3H6ZA 2RJEA 1LOJA 1RACB 1U06A 2M51A 5M9OA 2DD4A 1QVGS 4WTOB 1G3WA 4OP0A 1NEBA 2WACA 3V8KA 4C92F 2KDSA 2CP5A 1ZLMA 3TU4K 3CCRT 1M90C 3ZFJA 3JB9G 3V8LA 3RIRA 2C0IA 1VQ6A 2ZZDA 1W1FA 1K0XA 2I0NA 2CGHA 3QPHA 1HK9A 1QVGA 3E9FA 4ZN3A 4KUDK 4M78B 3CCUT 1WXBA 3CMET 3M9QA 2L3QA 4M78F 1HYOA 1K9AA 4QVCA 3I55Q 1Q7YC 2HAXA 2SRCA 1LJOA 3CCVA 3M0UA 2QTVA 3EG9B 4J6WA 5LJ5d 3C0CA 3EFOB 3C4SA 4N4IA 2ZPGB 1VQ4A 5GAN8 3OYNA 1ZSGA 4LD9K 1VQLT 2OTJA 1RAAB 1YJ9T 2VC8A 1OEBA 1IZ6A 4IUPA 1G3YA 2FB7A 2L3SA 4ZGEB 3I5SA 2CREA 5HCKA 2JZ2A 2RI5A 3CCJA 1V29B 4EPCA 2DVJA 4JZ4A 2L0AA 4D6WA 4E6RA 1AZGB 1RAGB 4Y28E 1KK7A 2QQAA 3EAEA 1W70A 2FL7A 4PJOB 4M75A 4C92D 2EQIA 1WFWA 2ESWA 4DBFA 1GCQA 1EX4A 4ELZC 4AG1C 2COYA 3VRZA 3VV0A 4ATOA 1J3TA 1XOVA 1VQKT 2D0QB 4HKEA 3CCLT 2MI6A 1Y07A 3JCMd 4CRIA 4C0DC 4JJNK 3OW2S 3LYIA 1QQJA 3UA6A 1FXXA 3BY7A 4JLIA 2FEIA 2DLPA 3DLMA 2CZ7B 1FX7A 2RHIA 1N8RU 4PFPA 1G3TA 1VYUA 2BE7D 3TEEA 2AK5A 1WXUA 3P8BB 4O5VA 1BCOA 3V7SA 1MMNA 2CH4W 5CQXA 2L3PA 1JJ2S 2R57A 4RTZA 3OSSC 3S3NA 4PFOA 2L2PA 2A0FB 3HL8A 3LW5E 1BYMA 4AFQC 1B34B 2YUQA 3GLXA 5LJ3d 4JRQA 2O4XA 3A5ZB 1U3OA 3CEYA 3OYCA 1M90U 3LH5A 4FYYB 5LJ5j 4R55A 3HRUA 3JCMb 1YJWT 1CKAA 1YJWA 3RKYA 3G71A 2EGCA 1KQ1A 2LCSA 5IXBA 5AYFA 1VA7A 1UJYA 3OYIA 3CCRA 3EGDB 2KXCA 1FMVA 5GJVB 3QO3A 1VUBA 3N5BB 3HPWA 3M0QA 1Y96B 1SF9A 1I0CA 2DXCA 4M75G 4DA4A 5D6XA 4QVDA 5CAIA 1PRLC 3QHSA 5GAN7 1MHNA 5KYUA 2XICA 3CC2T 1VYTA 3U23A 2KI7A 4FT4A 3BDUA 3OS0A 1TUDA 2FVUA 3WXMB 2P0KA 4PK4A 1D1CA 4A4GA 1KQ2A 2BZXA 4EDUA 2LDMA 3OBYA 1D09B 4C92C 3PVLA 2LRQA 4BD3A 1OULA 1VQ4Q 5LJ3g 3MKDA 1VOMA 5GMKj 1QP3A 4RG2A 5HY6A 5FRMA 1TG0A 2HBWA 4E7HA 2LJ3A 3DKMA 1MV3A 1UGSB 4II1A 2VGNA 5LJ5e 4M7DA 2H3JA 1Q81C 3E9GA 4KBMB 2HL5C 3VS4A 4PNOA 4F7UG 4OMFB 3OYBA 1K73R 8AT1B 1OU9A 3JCMW 1WJSA 2MYSA 5J26A 4X34A 5IHKA 3TCJA 3URGA 1U8RA 2LVMA 3M0TA 1Y71A 2DO3A 3PGGA 3PMIA 4M78E 2AZSA 4E7SA 4N0AC 2DL3A 3TSZA 4D8KA 2CKKA 3OS5A 1KD1R 4M7DD 3PFSA 2RI3A 3I56T 1Q7YU 1E6GA 2K6DA 1VQ4T 2RA2A 3SD4A 3JB9I 4QQ6A 1U1SA 1MNDA 2RHZA 4JJBA 1VQ6T 2L5QA 5GAN4 3EFRA 2E41A 5KYUB 1YN8A 2YUOA 2JOYA 1TWBA 3G6ET 1I81A 1M3CA 1SRMA 1YWOA 3V8JA 1O9SA 1UHFA 2FRYA 4C92E 1OX8A 3H0IA 2X3WD 1XNIA 2YHTA 1IHVA 1VQNA 5EG2A 3VRYA 3C12A 3OYJA 3JCMP 3JCMV 3M0PA 2EPDA 4CC3A 1OQKA 2QQ9A 1KG1A 4JDSA 5CKFA 1JEGA 5DLQE 4C8QB 5C0MA 1BI2A 3JB9F 1PD0A 5GAN6 3WVDB 1N5ZA 1N9SA 4LN2A 4OB1B 1ZUUA 1PC0A 2K3YA 1UEBA 3LGFA 4BY6C 3CCSA 4ZTJA 1SSFA 4OF1A 2DRKA 2DZCA 2DIQA 2E3HA 4M7AC 1M8VA 1MMAA 5DY9A 1GL5A 4N4GA 2JUFA 1VIEA 4M77C 1UTIA 4DOVA 4KGXB 2A08A 4OMNA 3A8MB 4OVAA 1H3ZA 3GIBA 1WI7A 2A28A 3EG3A 4J9FA 1W2BP 1QWEA 3RUXA 3CC2A 3HKSA 1YI2Q 3MEVA 2J6FA 4OB2B 3HSBA 3L42A 2KT8A 1SRLA 5CVIA 1G2BA 3PT9A 4J9CA 2CZ1B 5D6YA 2CP3A 3SFMA 2E1HA 3CD6Q 5GAMf 5GMKm 1QMCA 1I8FA 2GFUA 2DXTA 3P8DA 1D0YA 4M7AG 1RAFB 4J6YA 4E7KA 1K9MR 3JCMf 5GAMj 4HVUA 4HVWA 1TUCA 2RH2A 1YHQT 2O88A 3LH0A 1TU0B 3ASKA 3X20B 1HXDA 2LQWA 1X6BA 1H641 1M8MA 4A54A 5GAOp 4A4KA 1PSFA 2HEQA 3CCEQ 4AMCA 2KAFA 1UB4A 3KUFA 1YI2T 1HJDA 2RHUA 1K1ZA 2GF7A 1BIBA 3M0RA 4A4HA 2RM4A 4FYWB 4HT9A 4IUQA 2WSCE 2QAZA 1YITA 4J8OA 2ED1A 3NFCA 1B3QA 2D9TA 1ABQA 1W6XA 1WQ7A 4A4FA 2LTOA 1PSEA 3RR6A 4XTWA 1P92A 3A1PA 2QGFB 4J5YA 3CCMT 3OMGA 3CC4A 2PZ1A 2ED0A 3FRNA 5LL6S 4PL6A 4JS4A 4RCCA 4DBHA 2R5MA 2CT3A 2JM9A 4M7DG 1KD1U 1IRXA 2F2WA 4C92A 1HD3A 2ZPEB 4KT0E 2EVRA 2XDPA 2K5FA 3MEUA 2F5TX 4IUVA 1QVGP 2XHCA 3CPWP 2DA9A 2X4WA 2DL4A 1I5OB 2JS0A 2P84A 1K9MC 1UG1A 2YRCA 3HHTB 1X27A 2DX1A 2DYIA 3M4GA 4NL3A 3EFSA 3FDRA 3D7SB 3BE3A 2HSEB 3EH1A 3CCQQ 2PUKB 2XDDA 1Q86U 2XMFA 2BIVA 3NPFA 2ZPHB 3C95A 4HVVA 2EYZA 3NHNA 1AD5A 4FSXA 2K79A 2MAMA 1YBYA 2VUBA 4QQGA 3G4SQ 5IT9E 3PIOA 1E6HA 2V8KA 3HRTA 3LGLA 4IUUA 3OMCA 4BUGA 4B9WA 3JCMX 3INZA 1QKXA 2H3EB 2XI9A 2PVDB 1I1JA 1M2OA 3EG2A 5HKCA 2QDYB 2VKNA 2DTHA 5GAOn 3H8ZA 3CC7T 2FO0A 5KYYB 2LQNA 4BE0A 4M7AE 2V1QA 2KQWA 3NTIA 4V2SA 3DB4A 4EMKB 2KEAA 2BTTA 3UT1A 4LD6A 2K3BA 3PMTA 2A7YA 2XIDA 3T9NA 3CCUQ 3H9NA 3J7AF 1PCXA 2JM8A 3OS1A 2CDTA 1RAIB 4FYVB 1NE8A 2E6ZA 5FWBA 4FCYA 3VS3A 2RK2A 5KYWB 1BBZA 1T3SA 2K4YA 1SHFA 1Q7YR 3PE0A 1K8AU 2QK0A 4J7IA 2E5QA 2JN0A 2RJFA 2ZPIB 3QSUA 2NYSA 1H8KA 4J9GA 2WSFE 2OTLQ 4RTVA 1UGPB 1KQSP 3CBOA 3CMEQ 2QDLA 2FYKA 2EFIA 1UFFA 1IGUA 1WQWA 2DPPB 3EH2A 4ME7A 3ZBDA 1K73U 1VQ8Q 3OYDA 1YP5A 1M9SA 2EW3A 2HQXA 1VQ9Q 1YITT 2JW4A 1ABOA 2EYWA 2KYBA 4QT7A 4XK8E 3OS2A 1YITQ 4PJNA 2ROTA 3LX7A 5CKDA 4Q5WA 3LWIA 1M1FA 2KGTA 4AFZC 3S6WA 3OYLA 2K5LA 5GAMg 2XU8A 2B86A 3EGUA 2LX7A 4KGVB 2R5AA 5I2SA 4M77D 4HCBA 3SWNB 1X6OA 1VQ9A 1AWJA 4PFZA 1QCFA 1W4SA 3CMAQ 4EIKA 3AHUA 2HKNA 1AEYA 3CC7A 1GRIA 3A8GB 1HSQA 2FZCB 4KULA 2HNIA 1WZOA 2Y90A 2HL3A 3GF5A 5FW9A 4FL6A 1GCPA 4LDYA 1R77A 2YRVA 1G3SA 2A3LA 1X2QA 3SDZA 5KYXB 1YFNA 4C0ZA 1WX6A 3EHQA 1UECA 4IKFA 5GANe 2A37A 1AVZC 2Y4YA 1LVKA 3GOXA 2DKGA 4RMOA 1Y96A 1AWWA 3CCJQ 2K9GA 2PVGB 4E47A 3M55A 3CCJT 2L3RA 3OW2P 1Q82R 1NLPC 2OTJQ 1FMKA 1O75A 1OX9A 1M3AA 1ZHIA 3RKWA 2LJ1A 2YRDA 1VQOQ 1D1AA 2PVOB 3JCMQ 3E19A 3VS1A 1A0NB 1XTDA 2X3XD 4C92G 4M78C 3JCMg 2LC4A 3OYEA 3RMSA 1AWXA 1OI1A 5FU7B 1ACMB 5GAOq 2KXDA 1WHKA 2ZAEA 2CS7A 4LDXA 2F1LA 2PU9B 1X01A 2F2XA 2EGEA 1U1TA 1WHGA 2QGGA 1QLYA 2XK0A 4RKUE 4F17A 3QZ9B 3EG0A 4M75E 1NZ9A 1I07A 5LJ3f 3C94A 4F16A 5AT1B 3JCMJ 2QA4T 1PM3A 3MP6A 2CH4A 3S3MA 2O01E 1JRIA 2J06A 1VQNQ 2GTOA 3TREA 1X43A 1KQSS 2EIFA 1ZBJA 3L2RA 5GANh 4XTXA 2DJQA 3GNGA 3NTKA 1KHCA 4C8QG 1OZ3A 4M77A 2JTEA 2DTIA 5CR2A 1Q95G 4HCKA 2RI2A 1BI0A 4UC4A 2LQKA 2J6OA 4E7ZA 2AT1B 1W2BS 3CCSQ 3HFNA 2JMAA 2X4XA 2OJ2A 5KE3A 4FYXB 2VASA 2KR3A 5D6WA 5IAYA 1KIKA 1Q81U 3CPWA 1B07A 2C06A 4M7DC 2JVVA 2QEXA 1IHWA 4PKCC 3FJPA 3FB9A 2E12A 3GNFB 2DEQA 4F7UA 3CPFA 3JRZA 3OYGA 4M78A 2RN8A 1MMGA 2W0ZA 3CXCP 1YHQA 1XJWB 2DNUA 1V76A 1YNZA 2MIOA 2YWWA 2AKLA 1M1KC 4CC7A 1CSKA 5GAOl 1VQKQ 4CI0C 4M7DB 1S72Q 3ZEHA 3BDLA 3VS7A 3ER0A 1R8OB 3HFOA 4ZNXA 2AKKA 4HCZA 1AHJB 2CP6A 2EJ9A 2X51A 1BIAA 3CCST 2DVEA 4K11A 2LT4A 2RJCA 2D0NA 2ROLA 4XU0A 3I35A 1KD1C 4EMKC 3VUBA 5J3BA 2ENMA 1M90R 3I9QA 1GBQA 5I11A 5GAMh 5GAN2 4BY6B 3EGXB 5LJ5f 3OY9A 4OB0B 1IXDA 3MHXA 2DL7A 2K3XA 3G4ST 3L1AA 1MNEA 3QIIA 3I55T 3JV3A 1V1CA 2FHDA 5IHNA 4RUGA 4XU1A 1OOTA 3CD6A 3G71T 3CXCA 4HT8A 3I55A 2E65A 3OYHA 3BFMA 2MMPA 1MV0B 1N8RR 1VQ8A 2V26A 2VB6A 4R0KA 4C8QE 4GBQA 2BZ8A 1PNJA 5FU7C 5J39A 2EYQA 5LJ3j 2IG0A 3CBPA 2HBPA 5I21A 5GANg 2LMJA 2JT4A 3L2WA 1WHMA 4B9XA 1VQKA 2P0PA 2FZGB 5C6SA 4M7AA 2WSEE 4JPBW 1S1NA 1VQMT 1VQ9T 2EAYA 4E7IA 4Y91A 1YIJA 3H41A 2M0YA 2RNAA 2YLBA 4NOYA 1QP2A 3PNWC 4BI3A 1IB8A 2KSSA 1GFDA 4PJOA 2QEXT 1IO6A 3MJXA 3EHRA 2KT1A 1M2VB 2PQWA 2DL8A 3M56A 3VU3C 2O2OA 4DEYA 3M54A 2QQRA 1C1AA 4PLLA 1QVPA 2AHJB 3I56A 3M59A 4M77F 4MZPA 2LX9A 1IGQA 1VQ7T 5GAMe 3CMAT 2OAUA 3EFOA 3CCVQ 4M75C 1UDLA 3TQ7P 3VYHB 2VWFA 3JB9D 3R6NA 1M3BA 3META 4J7FA 2MPXC 4DBQA 1SG5A 2GTJA 3OQ5A 2SEMA 5I22A 3RESA 2M16A 1K4US 4J83A 4C5HA 3SWNC 4C92B 1OZ2A 4PJOD 3JCMh 4FU6A 1EZZB 3WVEB 4E2FB 3IQLA 2XD0A 1Q86R 2M1HA 4NL2A 1PWTA 3SHWA 4Z89A 9ATCB 1D3BA 3MEWA 5CO7A 1ZBXA 1BI3A 1X75C 4J9IA 4M77G 3VS5A 4TVRA 3TVTA 1YJNQ 1JJ2P 2CT4A 4OGCA 2CUDA 2K57A 4BACA 4FW2A 1SHGA 3GPLA 2KRNA 1M1KR 1QVFS 1BK2A 2MWPA 2H8HA 2V8JA 3H0FA 1KQSA 3CCET 4M7AD 4KH0B 4M75F 1JQQA 3M53A 2LJ0A 6AT1B 2KYMA 2MF2A 1MUZA 1R0CB 4N0AA 4HA8A 5FU6C 4BE1A 4C5EA 1YJWQ 1YWPA 5CK9A 4HCCA 4JRKA 3HRSA 2QG9B 3VJPA 1TXQA 3EGXA 2VVKA 3FIFA 1M2VA 3OBWA 4ZN1A 1NEGA 2OTLT 2FZKB 2CP7A 3CD6T 5IN1A 1YIJT 2DAQA 5KYYA 3QWYA 3M4YA 2D1XA 2YSQA 2JNGA 2BZYA 4OB3B 4C5GA 2RPNA 5FU6B 3F70A 1M30A 2QXFA 4JLGA 3QBYA 1WGSA 4JS5A 3CCUA 3DLLA 2RQVA 5KYWA 4O6JA 1RI9A 2GBQA 4A4EA 2CUBA 1FMWA 2RHYA 3GBQA 1RLQC 4LDWA 4M7AB 1UJ0A 1Y57A 4LDVA 2O9VA 1T3LA 5LJ5g 1VQPA 3J81E 3QKJA 3CCQA 2DETA 1UGQB 5A0GA 3HP9A 1VQ5T 5GAOm 5CKBA 2C0OA 4L6V5 2QASA 3QUIA 4Z8AA 2E6NA 4C8QC 3G4SA 2DBKA 2O31A 2GGRA 4X9CA 1T0JA 1VQ7A 3AT1B 2E5KA 2DRMA 2DE0X 1WJRA 2NUTB 4OMQA 1Q82C 2RF0A 4DQ2A 2P4RA 2NUZA 4PJOC 2EJGA 1B7TA 3QXEB 1AT1B 1FYNA 1G8XA 1LNXA 3TSWA 1B34A 1NM7A 3RDVA 3CPWS 3JB9H 2L8DA 2HSPA 4DEXA 2O4XB 1WXTA 4BB7A 2RQRA 2QQSA 1D0ZA 2LZ6B 3O5ZA 2LP5A 3QJYA 1VQ6Q 3VYGA 1JXMA 3CXCS 3UPUA 2RMOA 2A36A 3OYKA 1K73C 3E2UA 1TUGB 5GJWB 2E64A 4GLMA 2RQUA 1EFNA 4MZTA 2DXBA 3PTAA 2M9UA 2QQBA 2EQMA 2P0QA 2PTKA 3ZL7C 4RTUA 4PJOE 1BKBA 2YT6A 1IREB 1JO8A 5CIUA 1RABB 2QI2A 2DIGA 3I5RA 2O9SA 3QDRB 4PJOG 1TTHB 1OYXA 2M0OA 3OSVA 3OYFA 4LUEA 2EYXA 3J80E 4ELYC 1G83A 4F04B 5IHIA 1NPPA 2EQKA 1N8RC 2JTMA 2CP2A 5GMKi 2IVWA 2BKDN 5HK0A 4F14A 1VQPT 2RJDA 2RQTA 3CC2Q 2I2LA 3RNJA 1VQMA 3OYAA 1GFCA 4ZGJB 3EG1A 3MEAA 3ME9A 4IIMA 2EQUA 3ULRB 4LE9A 4A63B 1OPLA 3SB2A 1WHHA 1OU8A 5GAN5 2ABLA 1D0XA 3THKA 4EMHA 1SPKA 1YIJQ 5A0DA 2FG0A 3EG9A 1NYFA 2LT1A 4E7JA 1D3BB 4ESRA 1RI0A 2COZA 3M57A 2X4YA 4LUDA 2HMAA 4EMGA 1TH7A 3CMEA 2JMCA 3FC3A 1Q82U 1YJ9Q 3I56Q 1PHTA 1UHCA 1BU1A 2DM1A 2X4JA 2Y4XA 2X35A 2DMOA 2DF6A 3CCEA 2F2VA 4C5IA 4FIBA 2HD0A 3FEOA 4J9DA 1YHQQ 2KE9A 4D8DA 3G1JA 4M4ZA 4IURA 3G6EA 1KC8R 4YTLA 4JZ3A 1D1BA 4MZMA 4PJMA 2J05A 2LCCA 4M77B 2OX7A 5KH6A 4BDYA 4M7DE 2CZ0B 3HTRA 1ZUYA 1OV3A 1TSFA 1G5VA 4M78D 5IXFA 5CCAA 5KE2A 1M1GA 2RD1A 2RQWA 1PRMC 4OMOA 1VQ5Q 1VQ7Q 4N4HA 2MK5A 4C8QA 2HQHA 3G6EQ 4PJOF 3Q1JA 3JAME 2CSIA 2EQJA 2XDBA 4C8QF 2HCKA 2RK1A 1KJWA 4XU2A 5GANj 4OMLA 2QEXQ 4J9BA 5CKEA 4OGEA 2PUOB 3A8HB 2ZCFB 2OI3A 3UATA 3X28B 4C0DB 1VQPQ 4M75D 2LNHB 4L59A 1ZA1B 1NJIC 2KY9A 1PD1A 3L2UA 1CKBA 4WF2A 1RAEB 4RTTA 2EGAA 4AFSC 2HZYA 4OMPA 1YJNT 2ZGWA 4C0FA 2IPOB 4BI8B 4M75B 2D6FA 3UWNA 3BW1A 2GQIA 2FPDA 4P5NA 2NUTA 2Z0WA 1AOJA 4ANJA 1NYGA 2DBMA 8ATCB 2FPEA 3UF4A 2HKQB 4VUBA 4QVZA 3CCMA 4M78G 5A0LA 3LWHA 1WJQA 3VS6A 3QDFA 1M1KU 5I2MA 2X9HA 1VQLA 2OTJT 2J7IA 1K8AR 2XKOC 3REAB 2C0TA 2K7AA 4QQDA 2JS2A 3QJ6A 5CQYA 1U5SA 4GY5A 1XQHA 1ZSZC 1W2BA 1BI1A 2DFUA 1JJ2A 1BB9A 1ZQ1A 2GCXA 5CKHA 2PNIA 4C8QD 1K0SA 3QYGB 2AIRB 3JCMe 1ZSZA 4JJCA 4BDZA 1DJ7B 2FRWA 3REBB 3M58A 4C0GA 1H3HA 1R0BG 1KC8U 3G71Q 1PKTA 4FM4B 3SWNA 5DM7R 1YCSB 3OW2A 3EGDA 1QVFA 3JSCA 4FT2A 3SEMA 3S3OA 4PLIA 3CCRQ 2QTXA 3QG1A 1ZX6A 2CYZB 2KRSA 5KYNA 4FW1A 4X9DA 3OYYA 2YDLA 4MDWA 3FJ5A 1E7OA 4J9HA 4OMMA 1JXOA 2FPFA 2K5IA 2LQ8A 3VS2A 3DB3A 2KNBB 4LDUA 3CCMQ 2G3RA 4XU3A 1Z9QA 4JUVA 4E7LA 1X6GA 3MP8A 3UA7A 4L5GA 5FWCA 4EMKA 3A8OB 3CCLA 2KK4A 5EC7A 2F5KA 4ORZA 3JB9J 3NTHA 3X26B 3VS0A 1QCNA 2B8AA 1KSWA 2G6FX 5DLOA 1T0HA 4CC2A 3OYMA 4ZTFA 2EKHA 5FLXE 1MGQA 2QA4A 4QKUA 1JBMA 4PJLA 1M5Q1 4M7DF 2AZVA 5GMKl 4WCIA 1N27A 1TOVA 3V7RA 2GFAA 3CMAA 1UUEA 2COWA 3GP8A 2DL5A 2GQVA 3X24B 2VYTA 4X1VA 4GLKA 4RTXA 1Z9ZA 1PG5B 3RMQA 1GBRA 3A98A 5LJ3e 5GMKe 3CC4T 1ARKA 2GNCA 1WPYA 1N9RA 1VQOT 2EWNA 1WHJA 3RKXA 3CC7Q 2E70A 2YUNA 4IUTA 5GANd 2M02A 1YJNA 1I4K1 3FLGA 2CP0A 1NJIR 4BI4A 3CCVT 1C0MA 2DJZA 3LLRA 2KVQG 4Z02A 1NLOC 2RHXA 3L2QA 1RUWA 1K8AC 1LCKA 2DERA 4MDXA 4NS5A 1H92A 4XTUA 4M7AF 4JJDA 2ECZA 4KH1B 1Y0MA 2ATCB 3VKIA 3RBBB 1C6VX 4JRPA 2MCNA 1NG2A 4AG2C 4Y92A 1ZA2B 2E4HA 2D8HA 3KXTA 1NPRA 1KHIA 1X69A 5FRNA 2DXUA 2NUPA 1WLPB 1QVFP 1RL2A 3PIPA 1RADB 1GXIE 5ECAA 1YJ9A 1VYVA 3M0SA 1WDXA 4HXJA 3RERA 2DILA 5L8RE 4FSSA 1M27C 1VQMQ 5GANf 1GCQC 3MPUB 1YCYA 2LCLA 1I5LA 3UDCA 3JCMc 2OTLA 3E1SA 4R56A 1Q86C 2V8IA 4J9EA 1QWFA 1KC8C 1ZSZB 4Z88A 2OAWA 1WNLA 3P8HA 4F7UE 3MO8A 2NWMA 2DK3A 1Q81R 3QWXX 1VQ8T 3X25B 3O8VA 5IH2A 5LJ3h 3A8LB 1K76A 5GMKh 4XAXB 5GAMd 5LJ5h 3PVQA 3VUZA 4DOWA 1JU5C 3OB9A 4KRTA 4B6MA 2JTFA 2BUDA 2DZ9A 1SKUB 2F69A 5KCOA 1AWOA 2JJ9A 4A53A 2VGMA 7AT1B 4IIOA 5A2QE 1KFZA 3QZ5B 2E10A 3KBGA 1VQOA 3KFVA 2EBPA 1VQ5A 1VQLQ 2EJFA 1PKSA 2EYYA 1Y7XA 4MMKA 2DYBA 3CCQT 1RAHB 1VQNT 1UGRB 2YLCA 1SEMA 4XTZA 2DTOA 1MMDA 3CC4Q 2L89A 2J6KA 2HDAA 3NMZC 2KRMA 4RTYA 1BCMA 5KYXA 1OPKA 1EIFA 2MOXA 2K2MA 1RLPC 3G7ZA 4J6XA 1TS9A 1NBEB 2ZPBB 5FROA 2R58A 1M4ZA 1N6AA 2QA4Q 4DBRA 1FWZA 5KCHA
chains in the Genus database with same CATH topology
2DRKA 3THKA 1SPKA 1X2KA 2J6OA 1AZEA 2FG0A 1UGVA 1NYFA 1GL5A 2JMAA 1UTIA 2A08A 4OMNA 1WA7A 4ESRA 2OJ2A 1WI7A 2A28A 4LUDA 2KR3A 3EG3A 4J9FA 1QWEA 1KIKA 1B07A 1SSHA 2IIMA 2J6FA 2JMCA 3H0HA 2KT8A 1QKWA 1PHTA 1SRLA 1UHCA 1BU1A 2DM1A 2JXBA 2W10A 4RTWA 2RN8A 1WIEA 2W0ZA 5L23A 1G2BA 2DMOA 2DNUA 1YNZA 2MIOA 2DF6A 2F2VA 4J9CA 2AKLA 4CC7A 1CSKA 4J9DA 4LNPA 2V1RA 2KE9A 4D8DA 4M4ZA 3VS7A 4CC4B 1WYXA 4JZ3A 4ZNXA 1ZUKA 2J05A 4HVUA 4HVWA 1TUCA 2AKKA 2O88A 1ZUYA 2YUPA 2D8JA 1OV3A 2CSQA 2KBTA 2LQWA 5IXFA 1X6BA 3CQTA 4K11A 4AFUC 2RQWA 1PRMC 2D0NA 1M8MA 2ROLA 4OMOA 1UE9A 3I35A 3NGPA 2HEQA 2KROA 2ENMA 3I9QA 2CSIA 1GBQA 1HJDA 5I11A 2HCKA 1KJWA 1K1ZA 1U06A 4OMLA 3M0RA 2M51A 4J9BA 2OI3A 3UATA 2DL7A 1NEBA 2ED1A 2LNHB 1B3QA 3JV3A 1ABQA 1W6XA 1V1CA 1ZLMA 5IHNA 4RUGA 1OOTA 2C0IA 1CKBA 1W1FA 1K0XA 2I0NA 4RTTA 2EGAA 4AFSC 1MV0B 4OMPA 2PZ1A 2ED0A 4R0KA 4GBQA 2BZ8A 1PNJA 2CT3A 2GQIA 2FPDA 2LMJA 2JM9A 2JT4A 1WXBA 1AOJA 2F2WA 2L3QA 1NYGA 1HD3A 1K9AA 2EVRA 2DBMA 2SRCA 4JPBW 1S1NA 2FPEA 3UF4A 3M0UA 2DA9A 3H41A 2M0YA 2RNAA 2DL4A 3C0CA 2JS0A 1UG1A 3VS6A 1X27A 2DX1A 1GFDA 1ZSGA 2J7IA 1IO6A 3REAB 2C0TA 2K7AA 1OEBA 3EHRA 2JS2A 2KT1A 2DL8A 2O2OA 4DEYA 2L3SA 2XMFA 3I5SA 2CREA 3NPFA 5HCKA 1U5SA 4HVVA 2EYZA 3NHNA 1AD5A 2DVJA 4JZ4A 2K79A 2L0AA 4E6RA 1AZGB 1E6HA 1BB9A 2PNIA 1K0SA 1UDLA 1W70A 1QKXA 2VWFA 2EQIA 4JJCA 3R6NA 1M3BA 1WFWA 2ESWA 2FRWA 1I1JA 3REBB 1GCQA 3EG2A 2GTJA 4AG1C 3VRZA 2VKNA 1J3TA 1H3HA 2SEMA 5I22A 1XOVA 2FO0A 1K4US 2LQNA 1PKTA 2V1QA 1YCSB 3SEMA 2KEAA 2BTTA 3UA6A 3IQLA 2K3BA 1ZX6A 2KRSA 1PWTA 3SHWA 4Z89A 2FEIA 2YDLA 2DLPA 3FJ5A 4J9IA 2JM8A 1E7OA 4J9HA 2CDTA 1JXOA 4OMMA 3VS5A 3TVTA 2FPFA 1VYUA 2CT4A 5FWBA 3VS3A 2AK5A 2CUDA 1WXUA 3VS2A 1BBZA 1SHGA 2KNBB 1T3SA 2KRNA 2CH4W 1BK2A 1SHFA 2L3PA 3PE0A 2H8HA 3H0FA 4RTZA 1Z9QA 1X6GA 3UA7A 1JQQA 5FWCA 2LJ0A 5EC7A 2L2PA 2KYMA 4ORZA 1MUZA 1H8KA 4J9GA 3VS0A 4AFQC 4RTVA 1KSWA 2G6FX 1YWPA 1T0HA 4CC2A 2QDLA 2YUQA 2EKHA 1UFFA 1U3OA 2AZVA 2VVKA 3LH5A 4WCIA 1YP5A 1UUEA 1NEGA 1CKAA 2EW3A 2DL5A 4X1VA 4RTXA 1Z9ZA 2JW4A 2EGCA 3QWYA 1GBRA 2LCSA 1ABOA 3A98A 2D1XA 2EYWA 2KYBA 2YSQA 4QT7A 5IXBA 1ARKA 2BZYA 2GNCA 1VA7A 1UJYA 2RPNA 2ROTA 2KXCA 1M30A 5GJVB 2KGTA 4AFZC 2RQVA 3M0QA 2YUNA 1I0CA 1RI9A 2GBQA 2B86A 2CUBA 1PRLC 3EGUA 2LX7A 3GBQA 1RLQC 1VYTA 1AWJA 1UJ0A 1Y57A 2O9VA 1T3LA 1QCFA 1NLOC 3U23A 1RUWA 1LCKA 1TUDA 1H92A 4EIKA 4JJDA 1AEYA 2ECZA 1GRIA 1Y0MA 1HSQA 3RBBB 2MCNA 1NG2A 4AG2C 4Y92A 2C0OA 2D8HA 5FW9A 2BZXA 1X69A 1GCPA 1WLPB 4Z8AA 3PVLA 5ECAA 1X2QA 2DBKA 1VYVA 2O31A 2GGRA 1WX6A 3EHQA 3M0SA 1WDXA 4HXJA 1UECA 2DILA 1T0JA 2E5KA 2DRMA 2DE0X 4OMQA 4FSSA 1TG0A 2RF0A 1M27C 2HBWA 2P4RA 2LJ3A 2NUZA 1MV3A 1AVZC 2A37A 1FYNA 1GCQC 3TSWA 1NM7A 4J9EA 3VS4A 1QWFA 2HSPA 4DEXA 1AWWA 1WXTA 2K9GA 4Z88A 2OAWA 2RQRA 2LZ6B 3O5ZA 2LP5A 2NWMA 3QWXX 5IHKA 5IH2A 1JXMA 1NLPC 1K76A 3PVQA 2RMOA 1FMKA 2A36A 3M0TA 1M3AA 1JU5C 2LJ1A 4KRTA 3VS1A 5GJWB 1A0NB 2X3XD 2AZSA 4GLMA 2DL3A 3TSZA 4D8KA 2RQUA 1AWXA 1EFNA 2KXDA 2PTKA 3ZL7C 1AWOA 4RTUA 1E6GA 2YT6A 1JO8A 2K6DA 4IIOA 1KFZA 3I5RA 3KFVA 2EBPA 2O9SA 1PKSA 2EYYA 4JJBA 2F2XA 2DYBA 2EGEA 1YN8A 1QLYA 2YUOA 4F17A 3EG0A 1M3CA 4LUEA 1SRMA 1YWOA 2EYXA 1UHFA 1I07A 1SEMA 1G83A 2FRYA 5IHIA 3H0IA 4F16A 2X3WD 2J6KA 2HDAA 4F14A 3VRYA 3NMZC 2RQTA 2CH4A 3M0PA 2EPDA 4CC3A 3RNJA 1JEGA 2KRMA 4RTYA 2J06A 1GFCA 2GTOA 1X43A 3EG1A 1OPKA 4IIMA 1ZBJA 2MOXA 3ULRB 4LE9A 1N5ZA 2K2MA 4A63B 1RLPC 4LN2A 2DJQA 1OPLA 1ZUUA 2JTEA 4HCKA 2ABLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRK A;  3THK A;  1SPK A;  1X2K A;  2J6O A;  1AZE A;  2FG0 A;  1UGV A;  1NYF A;  1GL5 A;  2JMA A;  1UTI A;  2A08 A;  4OMN A;  1WA7 A;  4ESR A;  2OJ2 A;  1WI7 A;  2A28 A;  4LUD A;  2KR3 A;  3EG3 A;  4J9F A;  1QWE A;  1KIK A;  1B07 A;  1SSH A;  2IIM A;  2J6F A;  2JMC A;  3H0H A;  2KT8 A;  1QKW A;  1PHT A;  1SRL A;  1UHC A;  1BU1 A;  2DM1 A;  2JXB A;  2W10 A;  4RTW A;  2RN8 A;  1WIE A;  2W0Z A;  5L23 A;  1G2B A;  2DMO A;  2DNU A;  1YNZ A;  2MIO A;  2DF6 A;  2F2V A;  4J9C A;  2AKL A;  4CC7 A;  1CSK A;  4J9D A;  4LNP A;  2V1R A;  2KE9 A;  4D8D A;  4M4Z A;  3VS7 A;  4CC4 B;  1WYX A;  4JZ3 A;  4ZNX A;  1ZUK A;  2J05 A;  4HVU A;  4HVW A;  1TUC A;  2AKK A;  2O88 A;  1ZUY A;  2YUP A;  2D8J A;  1OV3 A;  2CSQ A;  2KBT A;  2LQW A;  5IXF A;  1X6B A;  3CQT A;  4K11 A;  4AFU C;  2RQW A;  1PRM C;  2D0N A;  1M8M A;  2ROL A;  4OMO A;  1UE9 A;  3I35 A;  3NGP A;  2HEQ A;  2KRO A;  2ENM A;  3I9Q A;  2CSI A;  1GBQ A;  1HJD A;  5I11 A;  2HCK A;  1KJW A;  1K1Z A;  1U06 A;  4OML A;  3M0R A;  2M51 A;  4J9B A;  2OI3 A;  3UAT A;  2DL7 A;  1NEB A;  2ED1 A;  2LNH B;  1B3Q A;  3JV3 A;  1ABQ A;  1W6X A;  1V1C A;  1ZLM A;  5IHN A;  4RUG A;  1OOT A;  2C0I A;  1CKB A;  1W1F A;  1K0X A;  2I0N A;  4RTT A;  2EGA A;  4AFS C;  1MV0 B;  4OMP A;  2PZ1 A;  2ED0 A;  4R0K A;  4GBQ A;  2BZ8 A;  1PNJ A;  2CT3 A;  2GQI A;  2FPD A;  2LMJ A;  2JM9 A;  2JT4 A;  1WXB A;  1AOJ A;  2F2W A;  2L3Q A;  1NYG A;  1HD3 A;  1K9A A;  2EVR A;  2DBM A;  2SRC A;  4JPB W;  1S1N A;  2FPE A;  3UF4 A;  3M0U A;  2DA9 A;  3H41 A;  2M0Y A;  2RNA A;  2DL4 A;  3C0C A;  2JS0 A;  1UG1 A;  3VS6 A;  1X27 A;  2DX1 A;  1GFD A;  1ZSG A;  2J7I A;  1IO6 A;  3REA B;  2C0T A;  2K7A A;  1OEB A;  3EHR A;  2JS2 A;  2KT1 A;  2DL8 A;  2O2O A;  4DEY A;  2L3S A;  2XMF A;  3I5S A;  2CRE A;  3NPF A;  5HCK A;  1U5S A;  4HVV A;  2EYZ A;  3NHN A;  1AD5 A;  2DVJ A;  4JZ4 A;  2K79 A;  2L0A A;  4E6R A;  1AZG B;  1E6H A;  1BB9 A;  2PNI A;  1K0S A;  1UDL A;  1W70 A;  1QKX A;  2VWF A;  2EQI A;  4JJC A;  3R6N A;  1M3B A;  1WFW A;  2ESW A;  2FRW A;  1I1J A;  3REB B;  1GCQ A;  3EG2 A;  2GTJ A;  4AG1 C;  3VRZ A;  2VKN A;  1J3T A;  1H3H A;  2SEM A;  5I22 A;  1XOV A;  2FO0 A;  1K4U S;  2LQN A;  1PKT A;  2V1Q A;  1YCS B;  3SEM A;  2KEA A;  2BTT A;  3UA6 A;  3IQL A;  2K3B A;  1ZX6 A;  2KRS A;  1PWT A;  3SHW A;  4Z89 A;  2FEI A;  2YDL A;  2DLP A;  3FJ5 A;  4J9I A;  2JM8 A;  1E7O A;  4J9H A;  2CDT A;  1JXO A;  4OMM A;  3VS5 A;  3TVT A;  2FPF A;  1VYU A;  2CT4 A;  5FWB A;  3VS3 A;  2AK5 A;  2CUD A;  1WXU A;  3VS2 A;  1BBZ A;  1SHG A;  2KNB B;  1T3S A;  2KRN A;  2CH4 W;  1BK2 A;  1SHF A;  2L3P A;  3PE0 A;  2H8H A;  3H0F A;  4RTZ A;  1Z9Q A;  1X6G A;  3UA7 A;  1JQQ A;  5FWC A;  2LJ0 A;  5EC7 A;  2L2P A;  2KYM A;  4ORZ A;  1MUZ A;  1H8K A;  4J9G A;  3VS0 A;  4AFQ C;  4RTV A;  1KSW A;  2G6F X;  1YWP A;  1T0H A;  4CC2 A;  2QDL A;  2YUQ A;  2EKH A;  1UFF A;  1U3O A;  2AZV A;  2VVK A;  3LH5 A;  4WCI A;  1YP5 A;  1UUE A;  1NEG A;  1CKA A;  2EW3 A;  2DL5 A;  4X1V A;  4RTX A;  1Z9Z A;  2JW4 A;  2EGC A;  3QWY A;  1GBR A;  2LCS A;  1ABO A;  3A98 A;  2D1X A;  2EYW A;  2KYB A;  2YSQ A;  4QT7 A;  5IXB A;  1ARK A;  2BZY A;  2GNC A;  1VA7 A;  1UJY A;  2RPN A;  2ROT A;  2KXC A;  1M30 A;  5GJV B;  2KGT A;  4AFZ C;  2RQV A;  3M0Q A;  2YUN A;  1I0C A;  1RI9 A;  2GBQ A;  2B86 A;  2CUB A;  1PRL C;  3EGU A;  2LX7 A;  3GBQ A;  1RLQ C;  1VYT A;  1AWJ A;  1UJ0 A;  1Y57 A;  2O9V A;  1T3L A;  1QCF A;  1NLO C;  3U23 A;  1RUW A;  1LCK A;  1TUD A;  1H92 A;  4EIK A;  4JJD A;  1AEY A;  2ECZ A;  1GRI A;  1Y0M A;  1HSQ A;  3RBB B;  2MCN A;  1NG2 A;  4AG2 C;  4Y92 A;  2C0O A;  2D8H A;  5FW9 A;  2BZX A;  1X69 A;  1GCP A;  1WLP B;  4Z8A A;  3PVL A;  5ECA A;  1X2Q A;  2DBK A;  1VYV A;  2O31 A;  2GGR A;  1WX6 A;  3EHQ A;  3M0S A;  1WDX A;  4HXJ A;  1UEC A;  2DIL A;  1T0J A;  2E5K A;  2DRM A;  2DE0 X;  4OMQ A;  4FSS A;  1TG0 A;  2RF0 A;  1M27 C;  2HBW A;  2P4R A;  2LJ3 A;  2NUZ A;  1MV3 A;  1AVZ C;  2A37 A;  1FYN A;  1GCQ C;  3TSW A;  1NM7 A;  4J9E A;  3VS4 A;  1QWF A;  2HSP A;  4DEX A;  1AWW A;  1WXT A;  2K9G A;  4Z88 A;  2OAW A;  2RQR A;  2LZ6 B;  3O5Z A;  2LP5 A;  2NWM A;  3QWX X;  5IHK A;  5IH2 A;  1JXM A;  1NLP C;  1K76 A;  3PVQ A;  2RMO A;  1FMK A;  2A36 A;  3M0T A;  1M3A A;  1JU5 C;  2LJ1 A;  4KRT A;  3VS1 A;  5GJW B;  1A0N B;  2X3X D;  2AZS A;  4GLM A;  2DL3 A;  3TSZ A;  4D8K A;  2RQU A;  1AWX A;  1EFN A;  2KXD A;  2PTK A;  3ZL7 C;  1AWO A;  4RTU A;  1E6G A;  2YT6 A;  1JO8 A;  2K6D A;  4IIO A;  1KFZ A;  3I5R A;  3KFV A;  2EBP A;  2O9S A;  1PKS A;  2EYY A;  4JJB A;  2F2X A;  2DYB A;  2EGE A;  1YN8 A;  1QLY A;  2YUO A;  4F17 A;  3EG0 A;  1M3C A;  4LUE A;  1SRM A;  1YWO A;  2EYX A;  1UHF A;  1I07 A;  1SEM A;  1G83 A;  2FRY A;  5IHI A;  3H0I A;  4F16 A;  2X3W D;  2J6K A;  2HDA A;  4F14 A;  3VRY A;  3NMZ C;  2RQT A;  2CH4 A;  3M0P A;  2EPD A;  4CC3 A;  3RNJ A;  1JEG A;  2KRM A;  4RTY A;  2J06 A;  1GFC A;  2GTO A;  1X43 A;  3EG1 A;  1OPK A;  4IIM A;  1ZBJ A;  2MOX A;  3ULR B;  4LE9 A;  1N5Z A;  2K2M A;  4A63 B;  1RLP C;  4LN2 A;  2DJQ A;  1OPL A;  1ZUU A;  2JTE A;  4HCK A;  2ABL A; 
#chains in the Genus database with same CATH topology
 1X2K A;  1AZE A;  1UGV A;  3L2Z A;  5D7U A;  4M77 E;  2RO0 A;  3MCA B;  2DD5 A;  2P4T A;  1WA7 A;  4XQ3 A;  1YI2 A;  1F1B B;  4QW2 A;  5HK3 A;  2VV5 A;  2BE9 B;  2CZ6 B;  1SSH A;  2IIM A;  3H0H A;  1QCO A;  2DEU A;  1S72 A;  4BE2 A;  5GAO r;  1S72 T;  1QKW A;  2HQE A;  3OA6 A;  2KMT A;  2NLU A;  1LPL A;  2JXB A;  2W10 A;  1WHL A;  4RTW A;  1WIE A;  4ZGD B;  5L23 A;  2E3I A;  2XG8 D;  1VIF A;  2K2V A;  2QYZ A;  3CCL Q;  3QYH B;  5GAN 3;  3MP1 A;  4LNP A;  4MML A;  2V1R A;  3R6O A;  4XTV A;  3M5A A;  2NUP B;  4PJJ A;  2VXE A;  1JB0 E;  4CC4 B;  1WYX A;  2LNV A;  1ZUK A;  4F7U F;  3CBM A;  4XTY A;  4RG8 A;  1K9M U;  4F7U B;  4KUI A;  3L2V A;  2EKO A;  2YUP A;  2D8J A;  4KGZ B;  2CSQ A;  2KBT A;  2ZPF B;  4RCB A;  3CQT A;  1QW1 A;  2YXY A;  2MWO A;  4AFU C;  4AT1 B;  1UE9 A;  4LXC A;  3NGP A;  3V7C A;  1NJI U;  2KRO A;  4JRI A;  2VXF A;  2RB6 A;  3H6Z A;  2RJE A;  1LOJ A;  1RAC B;  1U06 A;  2M51 A;  5M9O A;  2DD4 A;  1QVG S;  4WTO B;  1G3W A;  4OP0 A;  1NEB A;  2WAC A;  3V8K A;  4C92 F;  2KDS A;  2CP5 A;  1ZLM A;  3TU4 K;  3CCR T;  1M90 C;  3ZFJ A;  3JB9 G;  3V8L A;  3RIR A;  2C0I A;  1VQ6 A;  2ZZD A;  1W1F A;  1K0X A;  2I0N A;  2CGH A;  3QPH A;  1HK9 A;  1QVG A;  3E9F A;  4ZN3 A;  4KUD K;  4M78 B;  3CCU T;  1WXB A;  3CME T;  3M9Q A;  2L3Q A;  4M78 F;  1HYO A;  1K9A A;  4QVC A;  3I55 Q;  1Q7Y C;  2HAX A;  2SRC A;  1LJO A;  3CCV A;  3M0U A;  2QTV A;  3EG9 B;  4J6W A;  5LJ5 d;  3C0C A;  3EFO B;  3C4S A;  4N4I A;  2ZPG B;  1VQ4 A;  5GAN 8;  3OYN A;  1ZSG A;  4LD9 K;  1VQL T;  2OTJ A;  1RAA B;  1YJ9 T;  2VC8 A;  1OEB A;  1IZ6 A;  4IUP A;  1G3Y A;  2FB7 A;  2L3S A;  4ZGE B;  3I5S A;  2CRE A;  5HCK A;  2JZ2 A;  2RI5 A;  3CCJ A;  1V29 B;  4EPC A;  2DVJ A;  4JZ4 A;  2L0A A;  4D6W A;  4E6R A;  1AZG B;  1RAG B;  4Y28 E;  1KK7 A;  2QQA A;  3EAE A;  1W70 A;  2FL7 A;  4PJO B;  4M75 A;  4C92 D;  2EQI A;  1WFW A;  2ESW A;  4DBF A;  1GCQ A;  1EX4 A;  4ELZ C;  4AG1 C;  2COY A;  3VRZ A;  3VV0 A;  4ATO A;  1J3T A;  1XOV A;  1VQK T;  2D0Q B;  4HKE A;  3CCL T;  2MI6 A;  1Y07 A;  3JCM d;  4CRI A;  4C0D C;  4JJN K;  3OW2 S;  3LYI A;  1QQJ A;  3UA6 A;  1FXX A;  3BY7 A;  4JLI A;  2FEI A;  2DLP A;  3DLM A;  2CZ7 B;  1FX7 A;  2RHI A;  1N8R U;  4PFP A;  1G3T A;  1VYU A;  2BE7 D;  3TEE A;  2AK5 A;  1WXU A;  3P8B B;  4O5V A;  1BCO A;  3V7S A;  1MMN A;  2CH4 W;  5CQX A;  2L3P A;  1JJ2 S;  2R57 A;  4RTZ A;  3OSS C;  3S3N A;  4PFO A;  2L2P A;  2A0F B;  3HL8 A;  3LW5 E;  1BYM A;  4AFQ C;  1B34 B;  2YUQ A;  3GLX A;  5LJ3 d;  4JRQ A;  2O4X A;  3A5Z B;  1U3O A;  3CEY A;  3OYC A;  1M90 U;  3LH5 A;  4FYY B;  5LJ5 j;  4R55 A;  3HRU A;  3JCM b;  1YJW T;  1CKA A;  1YJW A;  3RKY A;  3G71 A;  2EGC A;  1KQ1 A;  2LCS A;  5IXB A;  5AYF A;  1VA7 A;  1UJY A;  3OYI A;  3CCR A;  3EGD B;  2KXC A;  1FMV A;  5GJV B;  3QO3 A;  1VUB A;  3N5B B;  3HPW A;  3M0Q A;  1Y96 B;  1SF9 A;  1I0C A;  2DXC A;  4M75 G;  4DA4 A;  5D6X A;  4QVD A;  5CAI A;  1PRL C;  3QHS A;  5GAN 7;  1MHN A;  5KYU A;  2XIC A;  3CC2 T;  1VYT A;  3U23 A;  2KI7 A;  4FT4 A;  3BDU A;  3OS0 A;  1TUD A;  2FVU A;  3WXM B;  2P0K A;  4PK4 A;  1D1C A;  4A4G A;  1KQ2 A;  2BZX A;  4EDU A;  2LDM A;  3OBY A;  1D09 B;  4C92 C;  3PVL A;  2LRQ A;  4BD3 A;  1OUL A;  1VQ4 Q;  5LJ3 g;  3MKD A;  1VOM A;  5GMK j;  1QP3 A;  4RG2 A;  5HY6 A;  5FRM A;  1TG0 A;  2HBW A;  4E7H A;  2LJ3 A;  3DKM A;  1MV3 A;  1UGS B;  4II1 A;  2VGN A;  5LJ5 e;  4M7D A;  2H3J A;  1Q81 C;  3E9G A;  4KBM B;  2HL5 C;  3VS4 A;  4PNO A;  4F7U G;  4OMF B;  3OYB A;  1K73 R;  8AT1 B;  1OU9 A;  3JCM W;  1WJS A;  2MYS A;  5J26 A;  4X34 A;  5IHK A;  3TCJ A;  3URG A;  1U8R A;  2LVM A;  3M0T A;  1Y71 A;  2DO3 A;  3PGG A;  3PMI A;  4M78 E;  2AZS A;  4E7S A;  4N0A C;  2DL3 A;  3TSZ A;  4D8K A;  2CKK A;  3OS5 A;  1KD1 R;  4M7D D;  3PFS A;  2RI3 A;  3I56 T;  1Q7Y U;  1E6G A;  2K6D A;  1VQ4 T;  2RA2 A;  3SD4 A;  3JB9 I;  4QQ6 A;  1U1S A;  1MND A;  2RHZ A;  4JJB A;  1VQ6 T;  2L5Q A;  5GAN 4;  3EFR A;  2E41 A;  5KYU B;  1YN8 A;  2YUO A;  2JOY A;  1TWB A;  3G6E T;  1I81 A;  1M3C A;  1SRM A;  1YWO A;  3V8J A;  1O9S A;  1UHF A;  2FRY A;  4C92 E;  1OX8 A;  3H0I A;  2X3W D;  1XNI A;  2YHT A;  1IHV A;  1VQN A;  5EG2 A;  3VRY A;  3C12 A;  3OYJ A;  3JCM P;  3JCM V;  3M0P A;  2EPD A;  4CC3 A;  1OQK A;  2QQ9 A;  1KG1 A;  4JDS A;  5CKF A;  1JEG A;  5DLQ E;  4C8Q B;  5C0M A;  1BI2 A;  3JB9 F;  1PD0 A;  5GAN 6;  3WVD B;  1N5Z A;  1N9S A;  4LN2 A;  4OB1 B;  1ZUU A;  1PC0 A;  2K3Y A;  1UEB A;  3LGF A;  4BY6 C;  3CCS A;  4ZTJ A;  1SSF A;  4OF1 A;  2DRK A;  2DZC A;  2DIQ A;  2E3H A;  4M7A C;  1M8V A;  1MMA A;  5DY9 A;  1GL5 A;  4N4G A;  2JUF A;  1VIE A;  4M77 C;  1UTI A;  4DOV A;  4KGX B;  2A08 A;  4OMN A;  3A8M B;  4OVA A;  1H3Z A;  3GIB A;  1WI7 A;  2A28 A;  3EG3 A;  4J9F A;  1W2B P;  1QWE A;  3RUX A;  3CC2 A;  3HKS A;  1YI2 Q;  3MEV A;  2J6F A;  4OB2 B;  3HSB A;  3L42 A;  2KT8 A;  1SRL A;  5CVI A;  1G2B A;  3PT9 A;  4J9C A;  2CZ1 B;  5D6Y A;  2CP3 A;  3SFM A;  2E1H A;  3CD6 Q;  5GAM f;  5GMK m;  1QMC A;  1I8F A;  2GFU A;  2DXT A;  3P8D A;  1D0Y A;  4M7A G;  1RAF B;  4J6Y A;  4E7K A;  1K9M R;  3JCM f;  5GAM j;  4HVU A;  4HVW A;  1TUC A;  2RH2 A;  1YHQ T;  2O88 A;  3LH0 A;  1TU0 B;  3ASK A;  3X20 B;  1HXD A;  2LQW A;  1X6B A;  1H64 1;  1M8M A;  4A54 A;  5GAO p;  4A4K A;  1PSF A;  2HEQ A;  3CCE Q;  4AMC A;  2KAF A;  1UB4 A;  3KUF A;  1YI2 T;  1HJD A;  2RHU A;  1K1Z A;  2GF7 A;  1BIB A;  3M0R A;  4A4H A;  2RM4 A;  4FYW B;  4HT9 A;  4IUQ A;  2WSC E;  2QAZ A;  1YIT A;  4J8O A;  2ED1 A;  3NFC A;  1B3Q A;  2D9T A;  1ABQ A;  1W6X A;  1WQ7 A;  4A4F A;  2LTO A;  1PSE A;  3RR6 A;  4XTW A;  1P92 A;  3A1P A;  2QGF B;  4J5Y A;  3CCM T;  3OMG A;  3CC4 A;  2PZ1 A;  2ED0 A;  3FRN A;  5LL6 S;  4PL6 A;  4JS4 A;  4RCC A;  4DBH A;  2R5M A;  2CT3 A;  2JM9 A;  4M7D G;  1KD1 U;  1IRX A;  2F2W A;  4C92 A;  1HD3 A;  2ZPE B;  4KT0 E;  2EVR A;  2XDP A;  2K5F A;  3MEU A;  2F5T X;  4IUV A;  1QVG P;  2XHC A;  3CPW P;  2DA9 A;  2X4W A;  2DL4 A;  1I5O B;  2JS0 A;  2P84 A;  1K9M C;  1UG1 A;  2YRC A;  3HHT B;  1X27 A;  2DX1 A;  2DYI A;  3M4G A;  4NL3 A;  3EFS A;  3FDR A;  3D7S B;  3BE3 A;  2HSE B;  3EH1 A;  3CCQ Q;  2PUK B;  2XDD A;  1Q86 U;  2XMF A;  2BIV A;  3NPF A;  2ZPH B;  3C95 A;  4HVV A;  2EYZ A;  3NHN A;  1AD5 A;  4FSX A;  2K79 A;  2MAM A;  1YBY A;  2VUB A;  4QQG A;  3G4S Q;  5IT9 E;  3PIO A;  1E6H A;  2V8K A;  3HRT A;  3LGL A;  4IUU A;  3OMC A;  4BUG A;  4B9W A;  3JCM X;  3INZ A;  1QKX A;  2H3E B;  2XI9 A;  2PVD B;  1I1J A;  1M2O A;  3EG2 A;  5HKC A;  2QDY B;  2VKN A;  2DTH A;  5GAO n;  3H8Z A;  3CC7 T;  2FO0 A;  5KYY B;  2LQN A;  4BE0 A;  4M7A E;  2V1Q A;  2KQW A;  3NTI A;  4V2S A;  3DB4 A;  4EMK B;  2KEA A;  2BTT A;  3UT1 A;  4LD6 A;  2K3B A;  3PMT A;  2A7Y A;  2XID A;  3T9N A;  3CCU Q;  3H9N A;  3J7A F;  1PCX A;  2JM8 A;  3OS1 A;  2CDT A;  1RAI B;  4FYV B;  1NE8 A;  2E6Z A;  5FWB A;  4FCY A;  3VS3 A;  2RK2 A;  5KYW B;  1BBZ A;  1T3S A;  2K4Y A;  1SHF A;  1Q7Y R;  3PE0 A;  1K8A U;  2QK0 A;  4J7I A;  2E5Q A;  2JN0 A;  2RJF A;  2ZPI B;  3QSU A;  2NYS A;  1H8K A;  4J9G A;  2WSF E;  2OTL Q;  4RTV A;  1UGP B;  1KQS P;  3CBO A;  3CME Q;  2QDL A;  2FYK A;  2EFI A;  1UFF A;  1IGU A;  1WQW A;  2DPP B;  3EH2 A;  4ME7 A;  3ZBD A;  1K73 U;  1VQ8 Q;  3OYD A;  1YP5 A;  1M9S A;  2EW3 A;  2HQX A;  1VQ9 Q;  1YIT T;  2JW4 A;  1ABO A;  2EYW A;  2KYB A;  4QT7 A;  4XK8 E;  3OS2 A;  1YIT Q;  4PJN A;  2ROT A;  3LX7 A;  5CKD A;  4Q5W A;  3LWI A;  1M1F A;  2KGT A;  4AFZ C;  3S6W A;  3OYL A;  2K5L A;  5GAM g;  2XU8 A;  2B86 A;  3EGU A;  2LX7 A;  4KGV B;  2R5A A;  5I2S A;  4M77 D;  4HCB A;  3SWN B;  1X6O A;  1VQ9 A;  1AWJ A;  4PFZ A;  1QCF A;  1W4S A;  3CMA Q;  4EIK A;  3AHU A;  2HKN A;  1AEY A;  3CC7 A;  1GRI A;  3A8G B;  1HSQ A;  2FZC B;  4KUL A;  2HNI A;  1WZO A;  2Y90 A;  2HL3 A;  3GF5 A;  5FW9 A;  4FL6 A;  1GCP A;  4LDY A;  1R77 A;  2YRV A;  1G3S A;  2A3L A;  1X2Q A;  3SDZ A;  5KYX B;  1YFN A;  4C0Z A;  1WX6 A;  3EHQ A;  1UEC A;  4IKF A;  5GAN e;  2A37 A;  1AVZ C;  2Y4Y A;  1LVK A;  3GOX A;  2DKG A;  4RMO A;  1Y96 A;  1AWW A;  3CCJ Q;  2K9G A;  2PVG B;  4E47 A;  3M55 A;  3CCJ T;  2L3R A;  3OW2 P;  1Q82 R;  1NLP C;  2OTJ Q;  1FMK A;  1O75 A;  1OX9 A;  1M3A A;  1ZHI A;  3RKW A;  2LJ1 A;  2YRD A;  1VQO Q;  1D1A A;  2PVO B;  3JCM Q;  3E19 A;  3VS1 A;  1A0N B;  1XTD A;  2X3X D;  4C92 G;  4M78 C;  3JCM g;  2LC4 A;  3OYE A;  3RMS A;  1AWX A;  1OI1 A;  5FU7 B;  1ACM B;  5GAO q;  2KXD A;  1WHK A;  2ZAE A;  2CS7 A;  4LDX A;  2F1L A;  2PU9 B;  1X01 A;  2F2X A;  2EGE A;  1U1T A;  1WHG A;  2QGG A;  1QLY A;  2XK0 A;  4RKU E;  4F17 A;  3QZ9 B;  3EG0 A;  4M75 E;  1NZ9 A;  1I07 A;  5LJ3 f;  3C94 A;  4F16 A;  5AT1 B;  3JCM J;  2QA4 T;  1PM3 A;  3MP6 A;  2CH4 A;  3S3M A;  2O01 E;  1JRI A;  2J06 A;  1VQN Q;  2GTO A;  3TRE A;  1X43 A;  1KQS S;  2EIF A;  1ZBJ A;  3L2R A;  5GAN h;  4XTX A;  2DJQ A;  3GNG A;  3NTK A;  1KHC A;  4C8Q G;  1OZ3 A;  4M77 A;  2JTE A;  2DTI A;  5CR2 A;  1Q95 G;  4HCK A;  2RI2 A;  1BI0 A;  4UC4 A;  2LQK A;  2J6O A;  4E7Z A;  2AT1 B;  1W2B S;  3CCS Q;  3HFN A;  2JMA A;  2X4X A;  2OJ2 A;  5KE3 A;  4FYX B;  2VAS A;  2KR3 A;  5D6W A;  5IAY A;  1KIK A;  1Q81 U;  3CPW A;  1B07 A;  2C06 A;  4M7D C;  2JVV A;  2QEX A;  1IHW A;  4PKC C;  3FJP A;  3FB9 A;  2E12 A;  3GNF B;  2DEQ A;  4F7U A;  3CPF A;  3JRZ A;  3OYG A;  4M78 A;  2RN8 A;  1MMG A;  2W0Z A;  3CXC P;  1YHQ A;  1XJW B;  2DNU A;  1V76 A;  1YNZ A;  2MIO A;  2YWW A;  2AKL A;  1M1K C;  4CC7 A;  1CSK A;  5GAO l;  1VQK Q;  4CI0 C;  4M7D B;  1S72 Q;  3ZEH A;  3BDL A;  3VS7 A;  3ER0 A;  1R8O B;  3HFO A;  4ZNX A;  2AKK A;  4HCZ A;  1AHJ B;  2CP6 A;  2EJ9 A;  2X51 A;  1BIA A;  3CCS T;  2DVE A;  4K11 A;  2LT4 A;  2RJC A;  2D0N A;  2ROL A;  4XU0 A;  3I35 A;  1KD1 C;  4EMK C;  3VUB A;  5J3B A;  2ENM A;  1M90 R;  3I9Q A;  1GBQ A;  5I11 A;  5GAM h;  5GAN 2;  4BY6 B;  3EGX B;  5LJ5 f;  3OY9 A;  4OB0 B;  1IXD A;  3MHX A;  2DL7 A;  2K3X A;  3G4S T;  3L1A A;  1MNE A;  3QII A;  3I55 T;  3JV3 A;  1V1C A;  2FHD A;  5IHN A;  4RUG A;  4XU1 A;  1OOT A;  3CD6 A;  3G71 T;  3CXC A;  4HT8 A;  3I55 A;  2E65 A;  3OYH A;  3BFM A;  2MMP A;  1MV0 B;  1N8R R;  1VQ8 A;  2V26 A;  2VB6 A;  4R0K A;  4C8Q E;  4GBQ A;  2BZ8 A;  1PNJ A;  5FU7 C;  5J39 A;  2EYQ A;  5LJ3 j;  2IG0 A;  3CBP A;  2HBP A;  5I21 A;  5GAN g;  2LMJ A;  2JT4 A;  3L2W A;  1WHM A;  4B9X A;  1VQK A;  2P0P A;  2FZG B;  5C6S A;  4M7A A;  2WSE E;  4JPB W;  1S1N A;  1VQM T;  1VQ9 T;  2EAY A;  4E7I A;  4Y91 A;  1YIJ A;  3H41 A;  2M0Y A;  2RNA A;  2YLB A;  4NOY A;  1QP2 A;  3PNW C;  4BI3 A;  1IB8 A;  2KSS A;  1GFD A;  4PJO A;  2QEX T;  1IO6 A;  3MJX A;  3EHR A;  2KT1 A;  1M2V B;  2PQW A;  2DL8 A;  3M56 A;  3VU3 C;  2O2O A;  4DEY A;  3M54 A;  2QQR A;  1C1A A;  4PLL A;  1QVP A;  2AHJ B;  3I56 A;  3M59 A;  4M77 F;  4MZP A;  2LX9 A;  1IGQ A;  1VQ7 T;  5GAM e;  3CMA T;  2OAU A;  3EFO A;  3CCV Q;  4M75 C;  1UDL A;  3TQ7 P;  3VYH B;  2VWF A;  3JB9 D;  3R6N A;  1M3B A;  3MET A;  4J7F A;  2MPX C;  4DBQ A;  1SG5 A;  2GTJ A;  3OQ5 A;  2SEM A;  5I22 A;  3RES A;  2M16 A;  1K4U S;  4J83 A;  4C5H A;  3SWN C;  4C92 B;  1OZ2 A;  4PJO D;  3JCM h;  4FU6 A;  1EZZ B;  3WVE B;  4E2F B;  3IQL A;  2XD0 A;  1Q86 R;  2M1H A;  4NL2 A;  1PWT A;  3SHW A;  4Z89 A;  9ATC B;  1D3B A;  3MEW A;  5CO7 A;  1ZBX A;  1BI3 A;  1X75 C;  4J9I A;  4M77 G;  3VS5 A;  4TVR A;  3TVT A;  1YJN Q;  1JJ2 P;  2CT4 A;  4OGC A;  2CUD A;  2K57 A;  4BAC A;  4FW2 A;  1SHG A;  3GPL A;  2KRN A;  1M1K R;  1QVF S;  1BK2 A;  2MWP A;  2H8H A;  2V8J A;  3H0F A;  1KQS A;  3CCE T;  4M7A D;  4KH0 B;  4M75 F;  1JQQ A;  3M53 A;  2LJ0 A;  6AT1 B;  2KYM A;  2MF2 A;  1MUZ A;  1R0C B;  4N0A A;  4HA8 A;  5FU6 C;  4BE1 A;  4C5E A;  1YJW Q;  1YWP A;  5CK9 A;  4HCC A;  4JRK A;  3HRS A;  2QG9 B;  3VJP A;  1TXQ A;  3EGX A;  2VVK A;  3FIF A;  1M2V A;  3OBW A;  4ZN1 A;  1NEG A;  2OTL T;  2FZK B;  2CP7 A;  3CD6 T;  5IN1 A;  1YIJ T;  2DAQ A;  5KYY A;  3QWY A;  3M4Y A;  2D1X A;  2YSQ A;  2JNG A;  2BZY A;  4OB3 B;  4C5G A;  2RPN A;  5FU6 B;  3F70 A;  1M30 A;  2QXF A;  4JLG A;  3QBY A;  1WGS A;  4JS5 A;  3CCU A;  3DLL A;  2RQV A;  5KYW A;  4O6J A;  1RI9 A;  2GBQ A;  4A4E A;  2CUB A;  1FMW A;  2RHY A;  3GBQ A;  1RLQ C;  4LDW A;  4M7A B;  1UJ0 A;  1Y57 A;  4LDV A;  2O9V A;  1T3L A;  5LJ5 g;  1VQP A;  3J81 E;  3QKJ A;  3CCQ A;  2DET A;  1UGQ B;  5A0G A;  3HP9 A;  1VQ5 T;  5GAO m;  5CKB A;  2C0O A;  4L6V 5;  2QAS A;  3QUI A;  4Z8A A;  2E6N A;  4C8Q C;  3G4S A;  2DBK A;  2O31 A;  2GGR A;  4X9C A;  1T0J A;  1VQ7 A;  3AT1 B;  2E5K A;  2DRM A;  2DE0 X;  1WJR A;  2NUT B;  4OMQ A;  1Q82 C;  2RF0 A;  4DQ2 A;  2P4R A;  2NUZ A;  4PJO C;  2EJG A;  1B7T A;  3QXE B;  1AT1 B;  1FYN A;  1G8X A;  1LNX A;  3TSW A;  1B34 A;  1NM7 A;  3RDV A;  3CPW S;  3JB9 H;  2L8D A;  2HSP A;  4DEX A;  2O4X B;  1WXT A;  4BB7 A;  2RQR A;  2QQS A;  1D0Z A;  2LZ6 B;  3O5Z A;  2LP5 A;  3QJY A;  1VQ6 Q;  3VYG A;  1JXM A;  3CXC S;  3UPU A;  2RMO A;  2A36 A;  3OYK A;  1K73 C;  3E2U A;  1TUG B;  5GJW B;  2E64 A;  4GLM A;  2RQU A;  1EFN A;  4MZT A;  2DXB A;  3PTA A;  2M9U A;  2QQB A;  2EQM A;  2P0Q A;  2PTK A;  3ZL7 C;  4RTU A;  4PJO E;  1BKB A;  2YT6 A;  1IRE B;  1JO8 A;  5CIU A;  1RAB B;  2QI2 A;  2DIG A;  3I5R A;  2O9S A;  3QDR B;  4PJO G;  1TTH B;  1OYX A;  2M0O A;  3OSV A;  3OYF A;  4LUE A;  2EYX A;  3J80 E;  4ELY C;  1G83 A;  4F04 B;  5IHI A;  1NPP A;  2EQK A;  1N8R C;  2JTM A;  2CP2 A;  5GMK i;  2IVW A;  2BKD N;  5HK0 A;  4F14 A;  1VQP T;  2RJD A;  2RQT A;  3CC2 Q;  2I2L A;  3RNJ A;  1VQM A;  3OYA A;  1GFC A;  4ZGJ B;  3EG1 A;  3MEA A;  3ME9 A;  4IIM A;  2EQU A;  3ULR B;  4LE9 A;  4A63 B;  1OPL A;  3SB2 A;  1WHH A;  1OU8 A;  5GAN 5;  2ABL A;  1D0X A;  3THK A;  4EMH A;  1SPK A;  1YIJ Q;  5A0D A;  2FG0 A;  3EG9 A;  1NYF A;  2LT1 A;  4E7J A;  1D3B B;  4ESR A;  1RI0 A;  2COZ A;  3M57 A;  2X4Y A;  4LUD A;  2HMA A;  4EMG A;  1TH7 A;  3CME A;  2JMC A;  3FC3 A;  1Q82 U;  1YJ9 Q;  3I56 Q;  1PHT A;  1UHC A;  1BU1 A;  2DM1 A;  2X4J A;  2Y4X A;  2X35 A;  2DMO A;  2DF6 A;  3CCE A;  2F2V A;  4C5I A;  4FIB A;  2HD0 A;  3FEO A;  4J9D A;  1YHQ Q;  2KE9 A;  4D8D A;  3G1J A;  4M4Z A;  4IUR A;  3G6E A;  1KC8 R;  4YTL A;  4JZ3 A;  1D1B A;  4MZM A;  4PJM A;  2J05 A;  2LCC A;  4M77 B;  2OX7 A;  5KH6 A;  4BDY A;  4M7D E;  2CZ0 B;  3HTR A;  1ZUY A;  1OV3 A;  1TSF A;  1G5V A;  4M78 D;  5IXF A;  5CCA A;  5KE2 A;  1M1G A;  2RD1 A;  2RQW A;  1PRM C;  4OMO A;  1VQ5 Q;  1VQ7 Q;  4N4H A;  2MK5 A;  4C8Q A;  2HQH A;  3G6E Q;  4PJO F;  3Q1J A;  3JAM E;  2CSI A;  2EQJ A;  2XDB A;  4C8Q F;  2HCK A;  2RK1 A;  1KJW A;  4XU2 A;  5GAN j;  4OML A;  2QEX Q;  4J9B A;  5CKE A;  4OGE A;  2PUO B;  3A8H B;  2ZCF B;  2OI3 A;  3UAT A;  3X28 B;  4C0D B;  1VQP Q;  4M75 D;  2LNH B;  4L59 A;  1ZA1 B;  1NJI C;  2KY9 A;  1PD1 A;  3L2U A;  1CKB A;  4WF2 A;  1RAE B;  4RTT A;  2EGA A;  4AFS C;  2HZY A;  4OMP A;  1YJN T;  2ZGW A;  4C0F A;  2IPO B;  4BI8 B;  4M75 B;  2D6F A;  3UWN A;  3BW1 A;  2GQI A;  2FPD A;  4P5N A;  2NUT A;  2Z0W A;  1AOJ A;  4ANJ A;  1NYG A;  2DBM A;  8ATC B;  2FPE A;  3UF4 A;  2HKQ B;  4VUB A;  4QVZ A;  3CCM A;  4M78 G;  5A0L A;  3LWH A;  1WJQ A;  3VS6 A;  3QDF A;  1M1K U;  5I2M A;  2X9H A;  1VQL A;  2OTJ T;  2J7I A;  1K8A R;  2XKO C;  3REA B;  2C0T A;  2K7A A;  4QQD A;  2JS2 A;  3QJ6 A;  5CQY A;  1U5S A;  4GY5 A;  1XQH A;  1ZSZ C;  1W2B A;  1BI1 A;  2DFU A;  1JJ2 A;  1BB9 A;  1ZQ1 A;  2GCX A;  5CKH A;  2PNI A;  4C8Q D;  1K0S A;  3QYG B;  2AIR B;  3JCM e;  1ZSZ A;  4JJC A;  4BDZ A;  1DJ7 B;  2FRW A;  3REB B;  3M58 A;  4C0G A;  1H3H A;  1R0B G;  1KC8 U;  3G71 Q;  1PKT A;  4FM4 B;  3SWN A;  5DM7 R;  1YCS B;  3OW2 A;  3EGD A;  1QVF A;  3JSC A;  4FT2 A;  3SEM A;  3S3O A;  4PLI A;  3CCR Q;  2QTX A;  3QG1 A;  1ZX6 A;  2CYZ B;  2KRS A;  5KYN A;  4FW1 A;  4X9D A;  3OYY A;  2YDL A;  4MDW A;  3FJ5 A;  1E7O A;  4J9H A;  4OMM A;  1JXO A;  2FPF A;  2K5I A;  2LQ8 A;  3VS2 A;  3DB3 A;  2KNB B;  4LDU A;  3CCM Q;  2G3R A;  4XU3 A;  1Z9Q A;  4JUV A;  4E7L A;  1X6G A;  3MP8 A;  3UA7 A;  4L5G A;  5FWC A;  4EMK A;  3A8O B;  3CCL A;  2KK4 A;  5EC7 A;  2F5K A;  4ORZ A;  3JB9 J;  3NTH A;  3X26 B;  3VS0 A;  1QCN A;  2B8A A;  1KSW A;  2G6F X;  5DLO A;  1T0H A;  4CC2 A;  3OYM A;  4ZTF A;  2EKH A;  5FLX E;  1MGQ A;  2QA4 A;  4QKU A;  1JBM A;  4PJL A;  1M5Q 1;  4M7D F;  2AZV A;  5GMK l;  4WCI A;  1N27 A;  1TOV A;  3V7R A;  2GFA A;  3CMA A;  1UUE A;  2COW A;  3GP8 A;  2DL5 A;  2GQV A;  3X24 B;  2VYT A;  4X1V A;  4GLK A;  4RTX A;  1Z9Z A;  1PG5 B;  3RMQ A;  1GBR A;  3A98 A;  5LJ3 e;  5GMK e;  3CC4 T;  1ARK A;  2GNC A;  1WPY A;  1N9R A;  1VQO T;  2EWN A;  1WHJ A;  3RKX A;  3CC7 Q;  2E70 A;  2YUN A;  4IUT A;  5GAN d;  2M02 A;  1YJN A;  1I4K 1;  3FLG A;  2CP0 A;  1NJI R;  4BI4 A;  3CCV T;  1C0M A;  2DJZ A;  3LLR A;  2KVQ G;  4Z02 A;  1NLO C;  2RHX A;  3L2Q A;  1RUW A;  1K8A C;  1LCK A;  2DER A;  4MDX A;  4NS5 A;  1H92 A;  4XTU A;  4M7A F;  4JJD A;  2ECZ A;  4KH1 B;  1Y0M A;  2ATC B;  3VKI A;  3RBB B;  1C6V X;  4JRP A;  2MCN A;  1NG2 A;  4AG2 C;  4Y92 A;  1ZA2 B;  2E4H A;  2D8H A;  3KXT A;  1NPR A;  1KHI A;  1X69 A;  5FRN A;  2DXU A;  2NUP A;  1WLP B;  1QVF P;  1RL2 A;  3PIP A;  1RAD B;  1GXI E;  5ECA A;  1YJ9 A;  1VYV A;  3M0S A;  1WDX A;  4HXJ A;  3RER A;  2DIL A;  5L8R E;  4FSS A;  1M27 C;  1VQM Q;  5GAN f;  1GCQ C;  3MPU B;  1YCY A;  2LCL A;  1I5L A;  3UDC A;  3JCM c;  2OTL A;  3E1S A;  4R56 A;  1Q86 C;  2V8I A;  4J9E A;  1QWF A;  1KC8 C;  1ZSZ B;  4Z88 A;  2OAW A;  1WNL A;  3P8H A;  4F7U E;  3MO8 A;  2NWM A;  2DK3 A;  1Q81 R;  3QWX X;  1VQ8 T;  3X25 B;  3O8V A;  5IH2 A;  5LJ3 h;  3A8L B;  1K76 A;  5GMK h;  4XAX B;  5GAM d;  5LJ5 h;  3PVQ A;  3VUZ A;  4DOW A;  1JU5 C;  3OB9 A;  4KRT A;  4B6M A;  2JTF A;  2BUD A;  2DZ9 A;  1SKU B;  2F69 A;  5KCO A;  1AWO A;  2JJ9 A;  4A53 A;  2VGM A;  7AT1 B;  4IIO A;  5A2Q E;  1KFZ A;  3QZ5 B;  2E10 A;  3KBG A;  1VQO A;  3KFV A;  2EBP A;  1VQ5 A;  1VQL Q;  2EJF A;  1PKS A;  2EYY A;  1Y7X A;  4MMK A;  2DYB A;  3CCQ T;  1RAH B;  1VQN T;  1UGR B;  2YLC A;  1SEM A;  4XTZ A;  2DTO A;  1MMD A;  3CC4 Q;  2L89 A;  2J6K A;  2HDA A;  3NMZ C;  2KRM A;  4RTY A;  1BCM A;  5KYX A;  1OPK A;  1EIF A;  2MOX A;  2K2M A;  1RLP C;  3G7Z A;  4J6X A;  1TS9 A;  1NBE B;  2ZPB B;  5FRO A;  2R58 A;  1M4Z A;  1N6A A;  2QA4 Q;  4DBR A;  1FWZ A;  5KCH A; 
#chains in the Genus database with same CATH homology
 2DRK A;  3THK A;  1SPK A;  1X2K A;  2J6O A;  1AZE A;  2FG0 A;  1UGV A;  1NYF A;  1GL5 A;  2JMA A;  1UTI A;  2A08 A;  4OMN A;  1WA7 A;  4ESR A;  2OJ2 A;  1WI7 A;  2A28 A;  4LUD A;  2KR3 A;  3EG3 A;  4J9F A;  1QWE A;  1KIK A;  1B07 A;  1SSH A;  2IIM A;  2J6F A;  2JMC A;  3H0H A;  2KT8 A;  1QKW A;  1PHT A;  1SRL A;  1UHC A;  1BU1 A;  2DM1 A;  2JXB A;  2W10 A;  4RTW A;  2RN8 A;  1WIE A;  2W0Z A;  5L23 A;  1G2B A;  2DMO A;  2DNU A;  1YNZ A;  2MIO A;  2DF6 A;  2F2V A;  4J9C A;  2AKL A;  4CC7 A;  1CSK A;  4J9D A;  4LNP A;  2V1R A;  2KE9 A;  4D8D A;  4M4Z A;  3VS7 A;  4CC4 B;  1WYX A;  4JZ3 A;  4ZNX A;  1ZUK A;  2J05 A;  4HVU A;  4HVW A;  1TUC A;  2AKK A;  2O88 A;  1ZUY A;  2YUP A;  2D8J A;  1OV3 A;  2CSQ A;  2KBT A;  2LQW A;  5IXF A;  1X6B A;  3CQT A;  4K11 A;  4AFU C;  2RQW A;  1PRM C;  2D0N A;  1M8M A;  2ROL A;  4OMO A;  1UE9 A;  3I35 A;  3NGP A;  2HEQ A;  2KRO A;  2ENM A;  3I9Q A;  2CSI A;  1GBQ A;  1HJD A;  5I11 A;  2HCK A;  1KJW A;  1K1Z A;  1U06 A;  4OML A;  3M0R A;  2M51 A;  4J9B A;  2OI3 A;  3UAT A;  2DL7 A;  1NEB A;  2ED1 A;  2LNH B;  1B3Q A;  3JV3 A;  1ABQ A;  1W6X A;  1V1C A;  1ZLM A;  5IHN A;  4RUG A;  1OOT A;  2C0I A;  1CKB A;  1W1F A;  1K0X A;  2I0N A;  4RTT A;  2EGA A;  4AFS C;  1MV0 B;  4OMP A;  2PZ1 A;  2ED0 A;  4R0K A;  4GBQ A;  2BZ8 A;  1PNJ A;  2CT3 A;  2GQI A;  2FPD A;  2LMJ A;  2JM9 A;  2JT4 A;  1WXB A;  1AOJ A;  2F2W A;  2L3Q A;  1NYG A;  1HD3 A;  1K9A A;  2EVR A;  2DBM A;  2SRC A;  4JPB W;  1S1N A;  2FPE A;  3UF4 A;  3M0U A;  2DA9 A;  3H41 A;  2M0Y A;  2RNA A;  2DL4 A;  3C0C A;  2JS0 A;  1UG1 A;  3VS6 A;  1X27 A;  2DX1 A;  1GFD A;  1ZSG A;  2J7I A;  1IO6 A;  3REA B;  2C0T A;  2K7A A;  1OEB A;  3EHR A;  2JS2 A;  2KT1 A;  2DL8 A;  2O2O A;  4DEY A;  2L3S A;  2XMF A;  3I5S A;  2CRE A;  3NPF A;  5HCK A;  1U5S A;  4HVV A;  2EYZ A;  3NHN A;  1AD5 A;  2DVJ A;  4JZ4 A;  2K79 A;  2L0A A;  4E6R A;  1AZG B;  1E6H A;  1BB9 A;  2PNI A;  1K0S A;  1UDL A;  1W70 A;  1QKX A;  2VWF A;  2EQI A;  4JJC A;  3R6N A;  1M3B A;  1WFW A;  2ESW A;  2FRW A;  1I1J A;  3REB B;  1GCQ A;  3EG2 A;  2GTJ A;  4AG1 C;  3VRZ A;  2VKN A;  1J3T A;  1H3H A;  2SEM A;  5I22 A;  1XOV A;  2FO0 A;  1K4U S;  2LQN A;  1PKT A;  2V1Q A;  1YCS B;  3SEM A;  2KEA A;  2BTT A;  3UA6 A;  3IQL A;  2K3B A;  1ZX6 A;  2KRS A;  1PWT A;  3SHW A;  4Z89 A;  2FEI A;  2YDL A;  2DLP A;  3FJ5 A;  4J9I A;  2JM8 A;  1E7O A;  4J9H A;  2CDT A;  1JXO A;  4OMM A;  3VS5 A;  3TVT A;  2FPF A;  1VYU A;  2CT4 A;  5FWB A;  3VS3 A;  2AK5 A;  2CUD A;  1WXU A;  3VS2 A;  1BBZ A;  1SHG A;  2KNB B;  1T3S A;  2KRN A;  2CH4 W;  1BK2 A;  1SHF A;  2L3P A;  3PE0 A;  2H8H A;  3H0F A;  4RTZ A;  1Z9Q A;  1X6G A;  3UA7 A;  1JQQ A;  5FWC A;  2LJ0 A;  5EC7 A;  2L2P A;  2KYM A;  4ORZ A;  1MUZ A;  1H8K A;  4J9G A;  3VS0 A;  4AFQ C;  4RTV A;  1KSW A;  2G6F X;  1YWP A;  1T0H A;  4CC2 A;  2QDL A;  2YUQ A;  2EKH A;  1UFF A;  1U3O A;  2AZV A;  2VVK A;  3LH5 A;  4WCI A;  1YP5 A;  1UUE A;  1NEG A;  1CKA A;  2EW3 A;  2DL5 A;  4X1V A;  4RTX A;  1Z9Z A;  2JW4 A;  2EGC A;  3QWY A;  1GBR A;  2LCS A;  1ABO A;  3A98 A;  2D1X A;  2EYW A;  2KYB A;  2YSQ A;  4QT7 A;  5IXB A;  1ARK A;  2BZY A;  2GNC A;  1VA7 A;  1UJY A;  2RPN A;  2ROT A;  2KXC A;  1M30 A;  5GJV B;  2KGT A;  4AFZ C;  2RQV A;  3M0Q A;  2YUN A;  1I0C A;  1RI9 A;  2GBQ A;  2B86 A;  2CUB A;  1PRL C;  3EGU A;  2LX7 A;  3GBQ A;  1RLQ C;  1VYT A;  1AWJ A;  1UJ0 A;  1Y57 A;  2O9V A;  1T3L A;  1QCF A;  1NLO C;  3U23 A;  1RUW A;  1LCK A;  1TUD A;  1H92 A;  4EIK A;  4JJD A;  1AEY A;  2ECZ A;  1GRI A;  1Y0M A;  1HSQ A;  3RBB B;  2MCN A;  1NG2 A;  4AG2 C;  4Y92 A;  2C0O A;  2D8H A;  5FW9 A;  2BZX A;  1X69 A;  1GCP A;  1WLP B;  4Z8A A;  3PVL A;  5ECA A;  1X2Q A;  2DBK A;  1VYV A;  2O31 A;  2GGR A;  1WX6 A;  3EHQ A;  3M0S A;  1WDX A;  4HXJ A;  1UEC A;  2DIL A;  1T0J A;  2E5K A;  2DRM A;  2DE0 X;  4OMQ A;  4FSS A;  1TG0 A;  2RF0 A;  1M27 C;  2HBW A;  2P4R A;  2LJ3 A;  2NUZ A;  1MV3 A;  1AVZ C;  2A37 A;  1FYN A;  1GCQ C;  3TSW A;  1NM7 A;  4J9E A;  3VS4 A;  1QWF A;  2HSP A;  4DEX A;  1AWW A;  1WXT A;  2K9G A;  4Z88 A;  2OAW A;  2RQR A;  2LZ6 B;  3O5Z A;  2LP5 A;  2NWM A;  3QWX X;  5IHK A;  5IH2 A;  1JXM A;  1NLP C;  1K76 A;  3PVQ A;  2RMO A;  1FMK A;  2A36 A;  3M0T A;  1M3A A;  1JU5 C;  2LJ1 A;  4KRT A;  3VS1 A;  5GJW B;  1A0N B;  2X3X D;  2AZS A;  4GLM A;  2DL3 A;  3TSZ A;  4D8K A;  2RQU A;  1AWX A;  1EFN A;  2KXD A;  2PTK A;  3ZL7 C;  1AWO A;  4RTU A;  1E6G A;  2YT6 A;  1JO8 A;  2K6D A;  4IIO A;  1KFZ A;  3I5R A;  3KFV A;  2EBP A;  2O9S A;  1PKS A;  2EYY A;  4JJB A;  2F2X A;  2DYB A;  2EGE A;  1YN8 A;  1QLY A;  2YUO A;  4F17 A;  3EG0 A;  1M3C A;  4LUE A;  1SRM A;  1YWO A;  2EYX A;  1UHF A;  1I07 A;  1SEM A;  1G83 A;  2FRY A;  5IHI A;  3H0I A;  4F16 A;  2X3W D;  2J6K A;  2HDA A;  4F14 A;  3VRY A;  3NMZ C;  2RQT A;  2CH4 A;  3M0P A;  2EPD A;  4CC3 A;  3RNJ A;  1JEG A;  2KRM A;  4RTY A;  2J06 A;  1GFC A;  2GTO A;  1X43 A;  3EG1 A;  1OPK A;  4IIM A;  1ZBJ A;  2MOX A;  3ULR B;  4LE9 A;  1N5Z A;  2K2M A;  4A63 B;  1RLP C;  4LN2 A;  2DJQ A;  1OPL A;  1ZUU A;  2JTE A;  4HCK A;  2ABL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...