1TG0A

0.97-a structure of the sh3 domain of bbc1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin tail region-interacting protein MTI1
publication title Saccharomyces cerevisiae SH3 domain structural genomics
rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tg0A00
1SHGA 1OOTA 2J05A 2J06A 2EBPA 1X6BA 2L3SA 2M0YA 2CH4W 4HXJA 5GJVB 1AVZC 2B86A 2CUBA 2GNCA 2JTEA 2VKNA 2XMFA 1WA7A 2DA9A 2EGAA 4Z88A 1OPLA 1GFDA 2RQVA 1WLPB 2M51A 3VS7A 3EG2A 4ZNXA 3VS0A 4HVUA 2I0NA 2BZ8A 1OPKA 4JZ3A 4JPBW 2DRMA 2DL7A 4Y92A 1W70A 1PNJA 4GLMA 2AK5A 3RNJA 1ZBJA 2X3WD 2AZVA 4CC4B 2JXBA 1AOJA 1YP5A 5IXBA 1XOVA 1B07A 1QWFA 3VS3A 4CC3A 2OJ2A 4A63B 2KNBB 1NM7A 2GBQA 2BTTA 1U3OA 1NLOC 2O9SA 1T0JA 2DM1A 4J9CA 1NEGA 1KSWA 3VS1A 1BU1A 1H8KA 1ZSGA 1WIEA 2VWFA 1GCQC 2EVRA 2F2XA 4RTUA 2DL5A 2FPFA 1NG2A 1QCFA 4OMQA 2EW3A 2KXCA 2EYWA 1E7OA 3UF4A 5IHKA 1SSHA 1PKTA 2EKHA 1AWWA 1U06A 3TSWA 3PE0A 1SRLA 1WXBA 4JJCA 3C0CA 1RLQC 1GRIA 1FMKA 2K7AA 3EG0A 4AFUC 1VYTA 4F14A 1M27C 2VVKA 1G83A 2DNUA 3EG1A 2DYBA 3THKA 5FW9A 2K6DA 1CKBA 1GBQA 5IXFA 3I35A 1HD3A 2QDLA 1SHFA 3H0HA 2CSQA 4FSSA 2F2WA 2JMCA 1RLPC 2KYMA 2SRCA 1Y57A 1NYGA 3QWXX 5FWBA 2FEIA 1M3CA 5GJWB 1WXUA 1T3LA 1UGVA 5IHNA 2LQWA 3M0UA 4AG2C 2RMOA 1K0SA 2PNIA 2DMOA 3UATA 2C0TA 2KEAA 2CH4A 1NEBA 2K3BA 2DL8A 1H3HA 2CT4A 1RUWA 4Z89A 2GTOA 2DE0X 2KYBA 3M0PA 3VS6A 1KFZA 2W0ZA 1M3AA 3VS5A 2HBWA 4J9IA 2E5KA 2HDAA 1NLPC 3REBB 2KR3A 2YUNA 2NUZA 1M8MA 2C0OA 2EQIA 2K9GA 4ORZA 2BZXA 1E6GA 1G2BA 1PHTA 1YCSB 4RTTA 5L23A 4HVVA 2J7IA 4F16A 1E6HA 1CKAA 2O2OA 2JMAA 3EHRA 2DVJA 1TG0A 4J9FA 3VRYA 5EC7A 2JW4A 3ZL7C 2RQTA 3I5RA 2A08A 1AD5A 1X2KA 4JJDA 3UA6A 1N5ZA 4D8KA 2CSIA 2D8HA 3NGPA 2O88A 1IO6A 2EPDA 3H0FA 3U23A 2LJ3A 4KRTA 3FJ5A 2A28A 3REAB 4AFQC 3JV3A 1GBRA 2OAWA 2KROA 1AWOA 2YUOA 5I11A 4WCIA 2KT1A 2LP5A 2ESWA 2HEQA 1KIKA 2F2VA 3NPFA 3PVQA 2LJ0A 2RNAA 2EGEA 4IIOA 1LCKA 3NMZC 2YUQA 4GBQA 1YN8A 2EYYA 2LQNA 1JO8A 2ABLA 4JJBA 1K0XA 1ABOA 3SHWA 1SEMA 3H0IA 3UA7A 3EG3A 3I9QA 4HVWA 3KFVA 1U5SA 2DX1A 1SPKA 4AFSC 1BK2A 1T3SA 3GBQA 5HCKA 2ECZA 2KBTA 1OEBA 4F17A 2JS2A 1H92A 1QKWA 1CSKA 3LH5A 4DEXA 1AEYA 3M0QA 1GL5A 2AKLA 2ROTA 2FPEA 2P4RA 4X1VA 1K1ZA 4JZ4A 2MOXA 1X2QA 5FWCA 2DLPA 2EYZA 1WDXA 4M4ZA 3M0RA 4R0KA 2OI3A 1X6GA 1WFWA 1UJYA 3M0SA 2PZ1A 2H8HA 1GFCA 1UTIA 4HCKA 1M30A 2FRYA 5ECAA 1WX6A 1B3QA 1UDLA 2CREA 2YSQA 4RTYA 1ZLMA 4DEYA 4J9DA 1RI9A 1M3BA 4ESRA 1W1FA 4EIKA 2V1RA 2A37A 2DL3A 1I07A 2ENMA 2K2MA 3TSZA 4OMNA 4CC2A 1YWOA 2J6KA 4LUDA 2LNHB 2KXDA 1WI7A 1VA7A 1K76A 1SRMA 2D8JA 2MIOA 2KRMA 2O9VA 3I5SA 4QT7A 4Z8AA 1HSQA 2L2PA 4J9GA 2JT4A 2W10A 2FRWA 2CUDA 2L3QA 1OV3A 3EGUA 1X27A 2DBKA 3PVLA 1QWEA 1WYXA 3H41A 1VYVA 2ED1A 1V1CA 1GCQA 2C0IA 2V1QA 4K11A 1Y0MA 4LNPA 2GTJA 1UHCA 1S1NA 1PKSA 1ZX6A 2RF0A 1MV0B 2LJ1A 2KRNA 2LX7A 1FYNA 1PRMC 2JM8A 4OMPA 2KRSA 5IH2A 2L0AA 1BBZA 2KGTA 1JEGA 3IQLA 2RPNA 2A36A 2X3XD 2MCNA 1J3TA 1UECA 1AWJA 2J6FA 1GCPA 4E6RA 1TUCA 1K4US 2KT8A 2RN8A 2LCSA 1PWTA 2RQUA 2YDLA 2LMJA 1UFFA 4J9HA 2G6FX 4OMLA 1JXMA 3VS2A 4OMOA 2LZ6B 1VYUA 1W6XA 2EYXA 4RTXA 1WXTA 4IIMA 3RBBB 4AG1C 2RQRA 3SEMA 5I22A 4J9BA 4D8DA 4RTVA 2ROLA 2D0NA 2HCKA 2RQWA 2EGCA 2AZSA 2CDTA 2IIMA 2D1XA 1AWXA 2DJQA 2ED0A 3NHNA 2YUPA 2YT6A 2O31A 4LN2A 1TUDA 2L3PA 1UE9A 2JM9A 1A0NB 1MV3A 1I1JA 1NYFA 4LUEA 4RTWA 1ZUKA 1JQQA 2SEMA 4LE9A 4J9EA 2DBMA 2FPDA 1YNZA 2DILA 3EHQA 2KE9A 5IHIA 1MUZA 3VS4A 1EFNA 1ABQA 3A98A 1Z9ZA 2DL4A 1X69A 2NWMA 1QKXA 1ZUYA 1Z9QA 1UHFA 2DF6A 1AZEA 2CT3A 1JXOA 3M0TA 1ARKA 3O5ZA 1K9AA 1ZUUA 2GQIA 4AFZC 2PTKA 4OMMA 1JU5C 2AKKA 2FG0A 4RTZA 3R6NA 1UUEA 1I0CA 2BZYA 1HJDA 2K79A 1T0HA 1QLYA 1AZGB 2HSPA 3ULRB 2GGRA 1YWPA 4RUGA 1PRLC 2FO0A 2DRKA 1KJWA 3TVTA 3VRZA 4CC7A 3CQTA 1UG1A 1UJ0A 1X43A 2J6OA 2JS0A 1BB9A 3QWYA
chains in the Genus database with same CATH superfamily
2AHJB 2RJDA 2J06A 3MPUB 1S72Q 3MEVA 2L3SA 1PCXA 1QP3A 3PMIA 3V7CA 5FRNA 1GFDA 1KC8R 3HRSA 3VS7A 3OMGA 4FT4A 3FRNA 4ZNXA 7AT1B 2FZCB 3CCEQ 2DRMA 3L2VA 4PJOD 2KI7A 2B8AA 4E7SA 4HT9A 2DETA 2E6NA 4M7DC 4M7DB 1BI0A 1V29B 2L89A 1M8VA 2XK0A 3VYHB 4PK4A 5GMKl 5GAMe 2L3RA 1ZA1B 1VQ8T 1YP5A 5IXBA 2E70A 4N0AC 1B07A 1M2VB 2RHUA 3QKJA 2KNBB 1IHWA 2BTTA 1NLOC 2O9SA 4D6WA 3FDRA 1T0JA 5LJ5j 4PJOE 5GAOq 3VS1A 1Q7YR 2BE9B 3CCRA 4Z02A 1U1TA 5L8RE 2F2XA 1VUBA 5CK9A 2FPFA 1NG2A 3CC7Q 4E7JA 4OMQA 4M7DD 2EW3A 2KXCA 3OYNA 1S72A 1PKTA 1R77A 3JB9F 2O4XA 3UWNA 1SRLA 3AHUA 3C0CA 1RAEB 1GRIA 1BIBA 2GQVA 3EG0A 3M4GA 3RDVA 2V26A 2CZ0B 4OB3B 3UT1A 1JJ2P 3EG1A 4ZN3A 2DYBA 2WSFE 1CKBA 3M58A 2RJFA 3CCEA 4QQDA 1SHFA 3H0HA 2CSQA 3WVDB 2JMCA 1ZQ1A 4M7DE 3QWXX 1KQ1A 1Y57A 3OYAA 5FWBA 3I56A 1UGVA 2DO3A 3M0UA 2P0PA 1N8RR 2V8IA 1I4K1 2F1LA 4C0DB 4E7ZA 1W2BA 2FZGB 3UATA 2C0TA 2KEAA 1NEBA 2VXEA 2DL8A 4B9WA 5J39A 5KYXA 3G6ET 1QVFP 2Y4YA 1H3HA 2CZ7B 3GP8A 1VIEA 2FVUA 1Q82C 3M0PA 2X4JA 2W0ZA 1M3AA 4EMHA 4J9IA 1Q81U 2QQSA 2PUOB 1O9SA 2NUZA 2C0OA 4B6MA 3RERA 2LRQA 4BD3A 2O4XB 4JLGA 2QA4Q 2KDSA 4ME7A 3CC7A 1OZ2A 4JUVA 2J7IA 1CKAA 3CBPA 1TXQA 1TG0A 4J9FA 2QAZA 5EC7A 3D7SB 1WJRA 3ZL7C 2RA2A 1AD5A 1D1AA 3OW2A 5GMKh 2QEXT 2D8HA 4C0FA 2O88A 4BACA 1OULA 3U23A 2HSEB 3REAB 2DYIA 3FJPA 3CPWP 4VUBA 3OYMA 4AFQC 2VXFA 3J81E 3JV3A 1K9MR 3JCMP 2YUOA 5I11A 3OYYA 4M7DF 2F2VA 3NPFA 4PFOA 2EGEA 1WHMA 3NMZC 3OYDA 2DZ9A 1HYOA 4FL6A 4JDSA 5LJ3j 1D1CA 1VQ9T 2EYYA 4JJBA 1ABOA 3SHWA 3A8GB 4XU1A 2DPPB 3EGXA 3UA7A 2XDPA 3HKSA 3I9QA 2KQWA 3MCAB 5CKFA 2M0OA 5D6WA 4C5GA 2FZKB 3GBQA 4KH0B 2ECZA 1Y07A 2KBTA 1H92A 4LD6A 5CKDA 4MZMA 3R6OA 3JB9G 4XTWA 2LCCA 3M0QA 1YI2T 4X34A 3CMEQ 3QYHB 2DTHA 2OTLT 2EYZA 2L8DA 4HKEA 1I81A 2HBPA 5EG2A 1X6GA 2H8HA 4HCKA 1N8RC 4BI3A 2CREA 1ZLMA 2XIDA 3QZ5B 4J9DA 3LLRA 5KYUA 1Y71A 3EFOA 3GLXA 3M53A 2V1RA 5FLXE 2K5LA 2K2MA 3EGXB 3MEWA 3HSBA 4KUIA 4CC2A 2J6KA 4N4HA 1M2OA 5HK0A 2LNHB 1YCYA 4J7IA 2BKDN 2O9VA 3I5SA 4QT7A 2MMPA 2L2PA 4AMCA 3META 3CMAQ 2E6ZA 1WJQA 1WGSA 2JT4A 2W10A 4PJOG 2CUDA 3EGUA 2R58A 1BI3A 4EPCA 3H41A 3CCUA 1SKUB 4MMLA 1V1CA 3QYGB 4OP0A 4IURA 5GAOp 2XU8A 1FXXA 4LNPA 2HL3A 5HKCA 5D7UA 1S1NA 1PKSA 3CCJQ 2RF0A 2QXFA 3GNGA 2PQWA 2JM8A 1FMWA 4OMPA 2KRSA 2R57A 2WACA 5FU6C 1BBZA 2RPNA 3RKXA 5KYUB 3EFOB 1YJWT 1UECA 1VQ5T 3OSVA 1BYMA 1TUCA 4RG8A 4BDYA 2KT8A 5LJ5e 4JRQA 1PWTA 4ZGEB 2MI6A 3S3OA 1M90U 4M7DG 2XDDA 4J9HA 4A53A 3V7SA 4OMOA 3PIOA 4FW1A 4NOYA 2IPOB 4L6V5 1MMNA 4IIMA 1Y96A 1RAHB 3SWNB 4DQ2A 3J80E 3RBBB 3A1PA 3CD6A 3CC2T 1PSEA 3V7RA 4D8DA 2RQWA 3GIBA 1WHJA 2ZGWA 2EGCA 3CMAA 3OYBA 1KG1A 3JCMb 1G3SA 1VQNA 4PKCC 5GAOm 2YLCA 4EMGA 5IN1A 1BI1A 2O31A 1TTHB 2L3PA 3OYIA 1IREB 1MV3A 3JB9H 3DB4A 2KSSA 2LDMA 1NYFA 4LUEA 4RTWA 3OYCA 3OS1A 1SSFA 1JQQA 4A4HA 2PU9B 3CCJA 4PJMA 1YNZA 4A4EA 1MUZA 3VS4A 2DL4A 1ZUYA 2DF6A 4PLIA 3J7AF 3X26B 1ARKA 2X4YA 3RESA 3R6NA 5FU7C 2BZYA 1UEBA 3O8VA 1VQOT 1Y96B 3S3NA 5FRMA 1SF9A 4M75A 4F7UF 2HSPA 2NUTA 3C94A 4JLIA 3JCMX 1YHQA 2CP3A 1Q95G 2DTIA 1D3BA 4C5EA 1UJ0A 4M78A 1X43A 2J6OA 4FYVB 4QKUA 3VYGA 2COYA 4JRKA 2HAXA 1LPLA 4IUTA 2EBPA 2AT1B 1WPYA 2QQBA 2CH4W 2A0FB 4HXJA 1DJ7B 5GJVB 8ATCB 2CUBA 2GNCA 2JTEA 2XMFA 1WA7A 2DA9A 3WXMB 4M7AC 1OX8A 1R0BG 3CCQT 2RQVA 3CXCS 3VS0A 2DEQA 4EMKA 1VQKQ 2I0NA 4HCBA 1B34A 3M55A 1OPKA 4JZ3A 1RAGB 3CCST 2R5AA 3HPWA 5LJ3e 4Y91A 4C8QA 1PM3A 1PNJA 2XKOC 2AK5A 3EGDA 1N9SA 3G71Q 2KVQG 1OZ3A 1ACMB 1C6VX 5C6SA 1OI1A 4M77A 2AZVA 2DD5A 2DKGA 3KUFA 4M75B 2NUTB 1XOVA 4M7AD 3H9NA 2EQUA 1OX9A 1QWFA 3M9QA 5GAOr 1D3BB 2OJ2A 3DLMA 4A63B 5J26A 1NM7A 4M78B 5GANd 4ELZC 5KYNA 1NEGA 2EIFA 1BU1A 2VWFA 1GCQC 2E3HA 4RTUA 2P84A 5GANg 2CP0A 2JOYA 4PLLA 2EYWA 3OMCA 1SSHA 2EKHA 4NS5A 1AWWA 3PE0A 4JJCA 1VQ4T 4M7AE 3EAEA 4EMKB 1Q82U 1FMKA 2K7AA 3L2QA 1M1FA 1B34B 1M1GA 1RAAB 1VYTA 2M1HA 3CPFA 2KY9A 1G83A 4C8QB 4M78D 3EGDB 4PFZA 1GBQA 1VQKA 3I35A 2QDLA 2Z0WA 4M77B 2F2WA 1RLPC 5GANh 3MHXA 5GJWB 2WSCE 2C06A 3C4SA 2NYSA 5IHNA 1TS9A 2LQWA 3FLGA 2XDBA 1WHLA 5DM7R 2RMOA 4M75E 2DMOA 2HMAA 1WQWA 1M1KR 3N5BB 4WF2A 4RCBA 4PJOC 1IGUA 1H641 1PD1A 2CT4A 5AT1B 1M9SA 2EJGA 4M78E 1NBEB 2RHYA 3E9GA 1TOVA 3VS5A 1QMCA 2DEUA 1NJIR 3V8KA 2YUNA 5J3BA 5I2SA 2EQIA 1P92A 2K9GA 3ASKA 3TU4K 4M77D 4L59A 1PHTA 4BUGA 4F16A 1W2BP 1E6HA 1VIFA 2DVJA 3QIIA 5GAMd 2E65A 2DD4A 3I5RA 4E7KA 3VKIA 4M7AF 2Y4XA 1N5ZA 3BW1A 3NTHA 4D8KA 2CSIA 3CCVQ 4C8QE 5GAMg 3I56Q 3HTRA 3H0FA 4KRTA 1KHIA 2RM4A 3VJPA 5C0MA 1IZ6A 5HK3A 4M77E 3QDFA 3C12A 1PD0A 1R0CB 2LJ0A 2RNAA 4IIOA 4IUVA 2ZPHB 2YUQA 3OW2P 2XI9A 4GBQA 3E1SA 1D1BA 3LW5E 2LQNA 1JO8A 1K0XA 3SDZA 4RKUE 3H0IA 2P4TA 3CCRT 1N8RU 1ZSZA 4HVWA 2DXBA 3KFVA 5GAMh 2DX1A 2FYKA 1SPKA 2E12A 2DFUA 1BK2A 2RI3A 1S72T 1UB4A 4E7LA 3CCMQ 3OYLA 2EYQA 5KE2A 4PFPA 2P0QA 1CSKA 1D0YA 2LNVA 2OTJQ 4DBFA 1GL5A 2MWPA 1HK9A 5CKEA 2YXYA 3JCMg 2MOXA 3TREA 1X01A 4FYYB 3KXTA 1WDXA 4M4ZA 1OQKA 3M0RA 4OB2B 4R0KA 3CCET 2OI3A 1G5VA 5GAOl 1TU0B 2JJ9A 1QCNA 3JCMe 3M0SA 2PZ1A 2PVGB 1GFCA 3CCVA 3HP9A 3I56T 1IGQA 5ECAA 3RKYA 1Q86R 1B3QA 2YSQA 4R55A 5DY9A 1VQLQ 3HHTB 4C0DC 2RD1A 4C92A 5KYYA 2I2LA 1KD1R 5DLQE 3RKWA 2KMTA 1NJIC 2ENMA 1ZSZB 4FYXB 1UGPB 1YWOA 1I5OB 4LUDA 3QG1A 1K76A 2D8JA 1K73U 3DKMA 4MZTA 4PJOF 1KC8C 4BE2A 4J9GA 2R5MA 4ELYC 5GAOn 1RACB 3X24B 3CC7T 1RABB 4J83A 3SFMA 3CCMA 1WYXA 2QQRA 1B7TA 1VYVA 4LDUA 2V1QA 2C0IA 4Q5WA 2LT1A 2OTJA 5D6YA 4B9XA 1WNLA 1Y0MA 2DIGA 1LNXA 4IUPA 1ZX6A 4M7AG 2YWWA 1MV0B 2KRNA 2LX7A 1FYNA 2GFUA 3QO3A 2L0AA 2K5FA 1JEGA 1UGRB 3QHSA 2A36A 4C92B 5KYYB 2M02A 2MCNA 4E2FB 3HFNA 2RHXA 1AWJA 2BUDA 1GCPA 4RG2A 4LD9K 5A0GA 2LCSA 1VQLA 1Q7YC 2JN0A 3M57A 2LMJA 1UFFA 2G6FX 4DBHA 4OMLA 1JXMA 2ZZDA 3S3MA 3PIPA 4QVZA 2E3IA 2LX9A 1W6XA 3RMSA 1WXTA 4M75G 5CVIA 2OX7A 4AG1C 2RQRA 5I22A 4J9BA 4PJLA 5GAN2 2IG0A 4RTVA 2VGMA 3ME9A 2D0NA 4M78G 3CCUQ 1VQ9A 2L5QA 2QA4T 4KULA 2CDTA 2IIMA 3DB3A 2D1XA 4C92D 4KH1B 2O01E 2ED0A 4II1A 4E47A 5IT9E 2DJZA 2RK1A 2YUPA 2EQJA 2QK0A 2YLBA 2HNIA 2JM9A 5KCOA 1Q86C 3Q1JA 2RI2A 1ZUKA 2SEMA 1PG5B 4NL2A 4J9EA 1YI2A 2DBMA 1KD1C 2HQHA 4LXCA 4C8QG 3A98A 1Z9ZA 1X69A 4C92E 1QKXA 1ZA2B 2MWOA 3FB9A 3M0TA 3O5ZA 1LOJA 4AFZC 2PTKA 4OMMA 4BE1A 2FG0A 4RTZA 4M77G 1UUEA 2FL7A 1TWBA 5DLOA 3CD6Q 2NLUA 1AZGB 4A54A 2GGRA 1YWPA 4RUGA 3SWNA 3TVTA 1VQNQ 4XTXA 3QWYA 3A8LB 4XTUA 4IUQA 3OB9A 1OOTA 1G8XA 2EFIA 5KCHA 2QYZA 3CC4Q 2M0YA 2B86A 3CMET 3CPWA 5LJ5d 1K9MC 1WLPB 1HXDA 3EG2A 4AT1B 5I2MA 4HVUA 5LJ5g 1WJSA 2BZ8A 2E10A 4JPBW 2DL7A 2F5KA 3G4SQ 1YITQ 1VQPQ 4Y92A 3S6WA 2CP5A 1W70A 4GLMA 3L1AA 5GMKm 1VQ6Q 2VGNA 5CQYA 3CCLQ 1AHJB 3CXCA 3UDCA 1JJ2S 1LVKA 4WTOB 3M5AA 2LC4A 1N9RA 1YHQQ 2JXBA 1AOJA 1EX4A 1YJWA 2COZA 2D9TA 3SWNC 2X4XA 3CD6T 3QPHA 2V8KA 2XHCA 2GBQA 1U3OA 3PT9A 5LJ5h 4J9CA 3CMAT 1KHCA 4JRIA 1WHGA 1VQNT 1RL2A 1YBYA 2EVRA 3LYIA 2DL5A 1QVFS 1UGQB 4KGVB 2EJFA 1KK7A 3CC4A 3OBWA 4GLKA 1WXBA 3GF5A 1TUGB 3QZ9B 1G3TA 1YJ9A 3CCJT 2GFAA 4FT2A 1BIAA 3NTKA 4F14A 1M27C 2VVKA 3SD4A 4F04B 4RCCA 5FW9A 5GAN3 2LQKA 2LQ8A 4DA4A 3TEEA 2GF7A 3G4SA 1YITA 1V76A 4R56A 1VQPA 1C0MA 2SRCA 1NYGA 2FEIA 1M90R 3G1JA 1VQ6A 3CCLA 2X35A 3EH2A 1K8AR 4XQ3A 2PNIA 2QGGA 3CPWS 3ER0A 4C5HA 1RUWA 3HL8A 4Z89A 3QJ6A 2GTOA 2KYBA 1KFZA 1YIJQ 2ZAEA 3PGGA 2K2VA 2KR3A 2DXUA 4C0GA 4MMKA 2RJEA 3L2WA 1M8MA 5LJ3d 5KYWA 4ORZA 1XQHA 3QDRB 1E6GA 3PTAA 1YFNA 1YCSB 4RTTA 5L23A 4HVVA 2JMAA 3EHRA 3VRYA 5LJ3g 4FYWB 1KQSA 2A08A 2Y90A 1QVGA 1U8RA 5GMKj 3OYFA 3UA6A 2E64A 1IO6A 2LJ3A 3RR6A 3FJ5A 2A28A 1YJNQ 3JCMJ 1GBRA 4IKFA 2KROA 1AWOA 4M75C 3VUZA 5M9OA 4C92G 3JAME 2COWA 2HEQA 1D0ZA 1KIKA 3PVQA 4ZN1A 1G3WA 5LJ3h 2VB6A 4M78C 4FSXA 1VQMQ 4TVRA 1YN8A 2ZPGB 1TSFA 3E9FA 1NPRA 2DXTA 3MEUA 3EG3A 2QG9B 4BI8B 3X28B 1U5SA 5KYWB 2K3XA 4DBQA 4XTZA 1YIJA 3I55A 5HCKA 2A3LA 3OYKA 1OEBA 4F17A 1MGQA 2JS2A 4OF1A 4OGEA 3AT1B 4MDXA 4DEXA 1NJIU 2QTVA 1IXDA 1F1BB 4M75D 4EMKC 2JTMA 1AEYA 3CBMA 2ROTA 2FPEA 4X1VA 2VC8A 1K1ZA 4C8QC 1X2QA 1X6OA 5FWCA 3VUBA 2DLPA 1VQKT 1KC8U 1BCMA 3KBGA 3ZEHA 3WVEB 1WFWA 5I21A 4M77C 4J6WA 1VQ4A 4BY6B 1K8AC 2HL5C 3G71T 2DZCA 2G3RA 3M4YA 1WX6A 1LJOA 3OYJA 1N6AA 2PVDB 4DEYA 1YJNA 4J6XA 2D0QB 4OGCA 2M16A 3OYGA 2X4WA 4EIKA 4XK8E 5CO7A 4XTVA 3C95A 4PNOA 1IRXA 3URGA 4HCCA 2DL3A 2QQAA 1VQ8Q 3TSZA 1VQ7A 4DBRA 4OMNA 5AYFA 2DAQA 4C8QD 1G3YA 1VQMA 1KQSS 2ZPEB 2KXDA 1QVGS 1WI7A 2RHZA 1SRMA 2MIOA 3A5ZB 2FHDA 1M5Q1 4E7IA 1HSQA 4N0AA 3L2ZA 1NZ9A 2FRWA 1Q7YU 2HD0A 1X27A 2DBKA 1QWEA 3QXEB 5GANf 3LWHA 1Q82R 2KAFA 2FB7A 3OBYA 2K5IA 2GTJA 1UHCA 3A8HB 1N27A 2F69A 3OQ5A 1O75A 2DIQA 2LJ1A 4CRIA 1PRMC 3PMTA 2YHTA 1QP2A 5IH2A 1BCOA 2KGTA 3MP6A 1JRIA 3JB9J 3IQLA 2X3XD 1QW1A 2K3YA 2J6FA 3LWIA 1K4US 2EWNA 5LL6S 2YDLA 2YRCA 1Q86U 2EAYA 4KGXB 4M75F 2H3EB 2EJ9A 1VYUA 2VYTA 4RTXA 1M4ZA 1KD1U 1VQ8A 1X75C 3G6EQ 3E2UA 1NPPA 3HRUA 4KT0E 4M78F 4N4IA 3VV0A 3SEMA 2LTOA 2VASA 3FIFA 3H6ZA 3JCMd 4HT8A 5GAN4 4C0ZA 1AWXA 2HZYA 5GAN7 3X25B 1UE9A 3CCVT 3JCMV 2ZPBB 3EG9A 2DVEA 3JB9I 4LE9A 1I8FA 4C8QF 2FPDA 2QEXQ 4UC4A 2NUPA 1M1KC 2DILA 1ABQA 5GAMf 2NWMA 3P8BB 4ZGDB 2CT3A 3JCMc 1AZEA 4M77F 1JXOA 2VUBA 3RIRA 1K9AA 2JUFA 3M59A 4A4KA 4BE0A 1JU5C 2AKKA 3MEAA 1K9MU 4MDWA 1ZSZC 2RB6A 1QVPA 2XICA 2IVWA 3JCMh 2K79A 1RI0A 3HRTA 3V8JA 4O6JA 3BFMA 1QLYA 3OSSC 2DTOA 3ULRB 1VQ9Q 2OAUA 1XTDA 4KUDK 2DRKA 3BY7A 1KJWA 4N4GA 4CC7A 3G6EA 3CQTA 2CGHA 4J7FA 2JS0A 3CCMT 1SHGA 5GMKe 2J05A 4ZGJB 2K57A 1X6BA 3A8MB 2OTJT 4DOWA 5KH6A 5CKHA 1H3ZA 1AVZC 2VKNA 2JNGA 3NTIA 2MYSA 1FX7A 2EGAA 4JJNK 4Z88A 1YI2Q 1OPLA 3EG9B 2M51A 2MAMA 4HA8A 2NUPB 2OTLQ 3JCMf 4C92C 3TQ7P 1QQJA 4J6YA 3V8LA 2EKOA 4E7HA 5CQXA 3OS2A 3CEYA 2X9HA 2QEXA 4ZTFA 1VQLT 4MZPA 4PJJA 2CP7A 2A7YA 1GXIE 3RNJA 1BKBA 4Y28E 5IAYA 2YRDA 1ZBJA 1OYXA 2X3WD 3PFSA 3OA6A 2M9UA 4CC4B 1JBMA 1Q81R 4OMFB 3VS3A 4CC3A 4IUUA 1FWZA 5KYXB 2XD0A 1K73R 3LGFA 4F7UA 1JJ2A 2DM1A 1KSWA 1H8KA 1ZSGA 1WIEA 2XG8D 4RMOA 2CP2A 2RO0A 1NE8A 3CXCP 1AT1B 3GPLA 5KE3A 1QCFA 3JCMQ 3BE3A 1D09B 3MP1A 1E7OA 3UF4A 3HFOA 4YTLA 5IHKA 1MHNA 1U06A 3TSWA 3FC3A 4LDWA 1RLQC 2EQKA 4LDVA 2QA4A 3L2UA 4AFUC 1QVFA 4QQGA 2DNUA 2BE7D 3ZBDA 3THKA 2YRVA 1W2BS 2K6DA 5IXFA 2OTLA 1TH7A 1HD3A 3QBYA 3H8ZA 1SG5A 3G7ZA 4FSSA 4XU0A 2KYMA 1I5LA 1MMAA 2PVOB 5GANj 1YJWQ 3LX7A 1M3CA 3QUIA 1VQ5Q 1WXUA 1T3LA 4J8OA 4AG2C 1K0SA 2VV5A 2CH4A 2AIRB 2K3BA 4F7UB 4C5IA 1RADB 3BDLA 4XU2A 4QW2A 2DE0X 2CS7A 3VS6A 1EZZB 5FROA 3MJXA 4KGZB 2HBWA 2E5KA 3CCUT 3OS5A 1VOMA 1RAIB 2HDAA 1NLPC 5GAN8 3REBB 1C1AA 3OW2S 2HQXA 3CC2Q 3UPUA 4EDUA 4ATOA 4DOVA 2QI2A 2GCXA 1YJ9Q 2BZXA 3PNWC 1G2BA 1W4SA 2KK4A 2ATCB 2QTXA 2O2OA 5CIUA 2H3JA 1BI2A 2D6FA 3MKDA 2JW4A 2RQTA 1X2KA 2DK3A 4JJDA 5GMKi 3CMEA 3NGPA 2EPDA 2HKNA 2RH2A 3MO8A 4FM4B 4LDYA 4PJNA 2RJCA 5FU6B 4C92F 1Q81C 2OAWA 1K73C 1FMVA 2QASA 4WCIA 2KT1A 2LP5A 3ZFJA 2ESWA 3RMQA 1D0XA 1VQ5A 9ATCB 1KQSP 1WZOA 1LCKA 2MK5A 3MP8A 1QVGP 4J5YA 4P5NA 4F7UE 5CR2A 2ABLA 4GY5A 1VQOQ 1SEMA 1K8AU 2E5QA 3LGLA 4X9CA 1JB0E 1WHKA 5GAMj 4OVAA 4AFSC 3INZA 1T3SA 3CC4T 4QVCA 3CC2A 1QKWA 3LH5A 1OU9A 3OYEA 1YJ9T 3VU3C 2AKLA 2P4RA 4JZ4A 3CCQQ 2X51A 4O5VA 1R8OB 3JRZA 2PUKB 4QVDA 3G4ST 1YITT 1VQPT 4M7AA 4LDXA 4OB1B 1UJYA 1UTIA 4PL6A 1M30A 2FRYA 3CCSQ 1VQ6T 5LJ5f 3CCLT 1UDLA 4RTYA 3DLLA 1PSFA 3NFCA 3QJYA 1RI9A 1M3BA 2LVMA 1WQ7A 1KQ2A 4ESRA 1W1FA 1YHQT 5HY6A 2A37A 1ZBXA 1I07A 8AT1B 4HCZA 5FU7B 6AT1B 3F70A 3OYHA 3I55Q 4A4FA 2LT4A 3TCJA 1VA7A 4FW2A 1VQOA 2ZCFB 1ZHIA 2KRMA 3OS0A 1RAFB 3EFSA 4Z8AA 3X20B 2BIVA 4FCYA 2L3QA 2P0KA 1UGSB 1OV3A 2QQ9A 3PVLA 4XTYA 3T9NA 2QGFB 3GOXA 2LCLA 2ED1A 1GCQA 2E41A 4XAXB 4K11A 4BB7A 4A4GA 5A2QE 2HQEA 1VQ4Q 4M7AB 4JRPA 3CCQA 3GNFB 5CKBA 1IHVA 4JS5A 3P8HA 1PC0A 4QQ6A 1J3TA 3CBOA 3CCSA 2CYZB 2CZ6B 2V8JA 1VQ7Q 4E6RA 1MMDA 2RN8A 3JCMW 1OU8A 5CCAA 4ANJA 2RQUA 3L42A 4JS4A 3VS2A 2LZ6B 2ZPIB 2EYXA 1M1KU 1IB8A 1YIJT 3I55T 2RK2A 2CP6A 3M56A 2MPXC 4ZTJA 1XNIA 2RHIA 3BDUA 2QDYB 5A0LA 3OY9A 2ROLA 4PJOA 2HCKA 4CI0C 2CKKA 3FEOA 4L5GA 2AZSA 2JVVA 3E19A 3EH1A 2E4HA 5D6XA 2DJQA 1WHHA 2WSEE 3NHNA 2YT6A 4LN2A 2E1HA 4OB0B 1TUDA 3EFRA 4NL3A 4FU6A 4FIBA 1A0NB 1M90C 5GANe 5GAN5 3A8OB 4V2SA 1I1JA 1MNDA 2JTFA 5LJ3f 1Y7XA 4BY6C 4XU3A 4BI4A 3P8DA 2DXCA 3SB2A 1YJNT 4KBMB 3EHQA 5CAIA 2KE9A 5IHIA 3QSUA 1EFNA 2RI5A 1Z9QA 5A0DA 1UHFA 1XJWB 3JB9D 1ZUUA 2GQIA 3LH0A 4BDZA 4M7DA 1VQ7T 1EIFA 1QCOA 3M54A 1I0CA 1VQMT 3G71A 1HJDA 3JSCA 5GAN6 1T0HA 2JZ2A 2DERA 4X9DA 2F5TX 1MNEA 2CZ1B 2K4YA 2MF2A 2ZPFB 1PRLC 2FO0A 3L2RA 1M2VA 3VRZA 4F7UG 4PJOB 3CCRQ 1MMGA 1UG1A 2EQMA 1BB9A 3RUXA 1U1SA 2HKQB
chains in the Genus database with same CATH topology
1SHGA 1OOTA 2J05A 2J06A 2EBPA 1X6BA 2L3SA 2M0YA 2CH4W 4HXJA 5GJVB 1AVZC 2B86A 2CUBA 2GNCA 2JTEA 2VKNA 2XMFA 1WA7A 2DA9A 2EGAA 4Z88A 1OPLA 1GFDA 2RQVA 1WLPB 2M51A 3VS7A 3EG2A 4ZNXA 3VS0A 4HVUA 2I0NA 2BZ8A 1OPKA 4JZ3A 4JPBW 2DRMA 2DL7A 4Y92A 1W70A 1PNJA 4GLMA 2AK5A 3RNJA 1ZBJA 2X3WD 2AZVA 4CC4B 2JXBA 1AOJA 1YP5A 5IXBA 1XOVA 1B07A 1QWFA 3VS3A 4CC3A 2OJ2A 4A63B 2KNBB 1NM7A 2GBQA 2BTTA 1U3OA 1NLOC 2O9SA 1T0JA 2DM1A 4J9CA 1NEGA 1KSWA 3VS1A 1BU1A 1H8KA 1ZSGA 1WIEA 2VWFA 1GCQC 2EVRA 2F2XA 4RTUA 2DL5A 2FPFA 1NG2A 1QCFA 4OMQA 2EW3A 2KXCA 2EYWA 1E7OA 3UF4A 5IHKA 1SSHA 1PKTA 2EKHA 1AWWA 1U06A 3TSWA 3PE0A 1SRLA 1WXBA 4JJCA 3C0CA 1RLQC 1GRIA 1FMKA 2K7AA 3EG0A 4AFUC 1VYTA 4F14A 1M27C 2VVKA 1G83A 2DNUA 3EG1A 2DYBA 3THKA 5FW9A 2K6DA 1CKBA 1GBQA 5IXFA 3I35A 1HD3A 2QDLA 1SHFA 3H0HA 2CSQA 4FSSA 2F2WA 2JMCA 1RLPC 2KYMA 2SRCA 1Y57A 1NYGA 3QWXX 5FWBA 2FEIA 1M3CA 5GJWB 1WXUA 1T3LA 1UGVA 5IHNA 2LQWA 3M0UA 4AG2C 2RMOA 1K0SA 2PNIA 2DMOA 3UATA 2C0TA 2KEAA 2CH4A 1NEBA 2K3BA 2DL8A 1H3HA 2CT4A 1RUWA 4Z89A 2GTOA 2DE0X 2KYBA 3M0PA 3VS6A 1KFZA 2W0ZA 1M3AA 3VS5A 2HBWA 4J9IA 2E5KA 2HDAA 1NLPC 3REBB 2KR3A 2YUNA 2NUZA 1M8MA 2C0OA 2EQIA 2K9GA 4ORZA 2BZXA 1E6GA 1G2BA 1PHTA 1YCSB 4RTTA 5L23A 4HVVA 2J7IA 4F16A 1E6HA 1CKAA 2O2OA 2JMAA 3EHRA 2DVJA 1TG0A 4J9FA 3VRYA 5EC7A 2JW4A 3ZL7C 2RQTA 3I5RA 2A08A 1AD5A 1X2KA 4JJDA 3UA6A 1N5ZA 4D8KA 2CSIA 2D8HA 3NGPA 2O88A 1IO6A 2EPDA 3H0FA 3U23A 2LJ3A 4KRTA 3FJ5A 2A28A 3REAB 4AFQC 3JV3A 1GBRA 2OAWA 2KROA 1AWOA 2YUOA 5I11A 4WCIA 2KT1A 2LP5A 2ESWA 2HEQA 1KIKA 2F2VA 3NPFA 3PVQA 2LJ0A 2RNAA 2EGEA 4IIOA 1LCKA 3NMZC 2YUQA 4GBQA 1YN8A 2EYYA 2LQNA 1JO8A 2ABLA 4JJBA 1K0XA 1ABOA 3SHWA 1SEMA 3H0IA 3UA7A 3EG3A 3I9QA 4HVWA 3KFVA 1U5SA 2DX1A 1SPKA 4AFSC 1BK2A 1T3SA 3GBQA 5HCKA 2ECZA 2KBTA 1OEBA 4F17A 2JS2A 1H92A 1QKWA 1CSKA 3LH5A 4DEXA 1AEYA 3M0QA 1GL5A 2AKLA 2ROTA 2FPEA 2P4RA 4X1VA 1K1ZA 4JZ4A 2MOXA 1X2QA 5FWCA 2DLPA 2EYZA 1WDXA 4M4ZA 3M0RA 4R0KA 2OI3A 1X6GA 1WFWA 1UJYA 3M0SA 2PZ1A 2H8HA 1GFCA 1UTIA 4HCKA 1M30A 2FRYA 5ECAA 1WX6A 1B3QA 1UDLA 2CREA 2YSQA 4RTYA 1ZLMA 4DEYA 4J9DA 1RI9A 1M3BA 4ESRA 1W1FA 4EIKA 2V1RA 2A37A 2DL3A 1I07A 2ENMA 2K2MA 3TSZA 4OMNA 4CC2A 1YWOA 2J6KA 4LUDA 2LNHB 2KXDA 1WI7A 1VA7A 1K76A 1SRMA 2D8JA 2MIOA 2KRMA 2O9VA 3I5SA 4QT7A 4Z8AA 1HSQA 2L2PA 4J9GA 2JT4A 2W10A 2FRWA 2CUDA 2L3QA 1OV3A 3EGUA 1X27A 2DBKA 3PVLA 1QWEA 1WYXA 3H41A 1VYVA 2ED1A 1V1CA 1GCQA 2C0IA 2V1QA 4K11A 1Y0MA 4LNPA 2GTJA 1UHCA 1S1NA 1PKSA 1ZX6A 2RF0A 1MV0B 2LJ1A 2KRNA 2LX7A 1FYNA 1PRMC 2JM8A 4OMPA 2KRSA 5IH2A 2L0AA 1BBZA 2KGTA 1JEGA 3IQLA 2RPNA 2A36A 2X3XD 2MCNA 1J3TA 1UECA 1AWJA 2J6FA 1GCPA 4E6RA 1TUCA 1K4US 2KT8A 2RN8A 2LCSA 1PWTA 2RQUA 2YDLA 2LMJA 1UFFA 4J9HA 2G6FX 4OMLA 1JXMA 3VS2A 4OMOA 2LZ6B 1VYUA 1W6XA 2EYXA 4RTXA 1WXTA 4IIMA 3RBBB 4AG1C 2RQRA 3SEMA 5I22A 4J9BA 4D8DA 4RTVA 2ROLA 2D0NA 2HCKA 2RQWA 2EGCA 2AZSA 2CDTA 2IIMA 2D1XA 1AWXA 2DJQA 2ED0A 3NHNA 2YUPA 2YT6A 2O31A 4LN2A 1TUDA 2L3PA 1UE9A 2JM9A 1A0NB 1MV3A 1I1JA 1NYFA 4LUEA 4RTWA 1ZUKA 1JQQA 2SEMA 4LE9A 4J9EA 2DBMA 2FPDA 1YNZA 2DILA 3EHQA 2KE9A 5IHIA 1MUZA 3VS4A 1EFNA 1ABQA 3A98A 1Z9ZA 2DL4A 1X69A 2NWMA 1QKXA 1ZUYA 1Z9QA 1UHFA 2DF6A 1AZEA 2CT3A 1JXOA 3M0TA 1ARKA 3O5ZA 1K9AA 1ZUUA 2GQIA 4AFZC 2PTKA 4OMMA 1JU5C 2AKKA 2FG0A 4RTZA 3R6NA 1UUEA 1I0CA 2BZYA 1HJDA 2K79A 1T0HA 1QLYA 1AZGB 2HSPA 3ULRB 2GGRA 1YWPA 4RUGA 1PRLC 2FO0A 2DRKA 1KJWA 3TVTA 3VRZA 4CC7A 3CQTA 1UG1A 1UJ0A 1X43A 2J6OA 2JS0A 1BB9A 3QWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHG A;  1OOT A;  2J05 A;  2J06 A;  2EBP A;  1X6B A;  2L3S A;  2M0Y A;  2CH4 W;  4HXJ A;  5GJV B;  1AVZ C;  2B86 A;  2CUB A;  2GNC A;  2JTE A;  2VKN A;  2XMF A;  1WA7 A;  2DA9 A;  2EGA A;  4Z88 A;  1OPL A;  1GFD A;  2RQV A;  1WLP B;  2M51 A;  3VS7 A;  3EG2 A;  4ZNX A;  3VS0 A;  4HVU A;  2I0N A;  2BZ8 A;  1OPK A;  4JZ3 A;  4JPB W;  2DRM A;  2DL7 A;  4Y92 A;  1W70 A;  1PNJ A;  4GLM A;  2AK5 A;  3RNJ A;  1ZBJ A;  2X3W D;  2AZV A;  4CC4 B;  2JXB A;  1AOJ A;  1YP5 A;  5IXB A;  1XOV A;  1B07 A;  1QWF A;  3VS3 A;  4CC3 A;  2OJ2 A;  4A63 B;  2KNB B;  1NM7 A;  2GBQ A;  2BTT A;  1U3O A;  1NLO C;  2O9S A;  1T0J A;  2DM1 A;  4J9C A;  1NEG A;  1KSW A;  3VS1 A;  1BU1 A;  1H8K A;  1ZSG A;  1WIE A;  2VWF A;  1GCQ C;  2EVR A;  2F2X A;  4RTU A;  2DL5 A;  2FPF A;  1NG2 A;  1QCF A;  4OMQ A;  2EW3 A;  2KXC A;  2EYW A;  1E7O A;  3UF4 A;  5IHK A;  1SSH A;  1PKT A;  2EKH A;  1AWW A;  1U06 A;  3TSW A;  3PE0 A;  1SRL A;  1WXB A;  4JJC A;  3C0C A;  1RLQ C;  1GRI A;  1FMK A;  2K7A A;  3EG0 A;  4AFU C;  1VYT A;  4F14 A;  1M27 C;  2VVK A;  1G83 A;  2DNU A;  3EG1 A;  2DYB A;  3THK A;  5FW9 A;  2K6D A;  1CKB A;  1GBQ A;  5IXF A;  3I35 A;  1HD3 A;  2QDL A;  1SHF A;  3H0H A;  2CSQ A;  4FSS A;  2F2W A;  2JMC A;  1RLP C;  2KYM A;  2SRC A;  1Y57 A;  1NYG A;  3QWX X;  5FWB A;  2FEI A;  1M3C A;  5GJW B;  1WXU A;  1T3L A;  1UGV A;  5IHN A;  2LQW A;  3M0U A;  4AG2 C;  2RMO A;  1K0S A;  2PNI A;  2DMO A;  3UAT A;  2C0T A;  2KEA A;  2CH4 A;  1NEB A;  2K3B A;  2DL8 A;  1H3H A;  2CT4 A;  1RUW A;  4Z89 A;  2GTO A;  2DE0 X;  2KYB A;  3M0P A;  3VS6 A;  1KFZ A;  2W0Z A;  1M3A A;  3VS5 A;  2HBW A;  4J9I A;  2E5K A;  2HDA A;  1NLP C;  3REB B;  2KR3 A;  2YUN A;  2NUZ A;  1M8M A;  2C0O A;  2EQI A;  2K9G A;  4ORZ A;  2BZX A;  1E6G A;  1G2B A;  1PHT A;  1YCS B;  4RTT A;  5L23 A;  4HVV A;  2J7I A;  4F16 A;  1E6H A;  1CKA A;  2O2O A;  2JMA A;  3EHR A;  2DVJ A;  1TG0 A;  4J9F A;  3VRY A;  5EC7 A;  2JW4 A;  3ZL7 C;  2RQT A;  3I5R A;  2A08 A;  1AD5 A;  1X2K A;  4JJD A;  3UA6 A;  1N5Z A;  4D8K A;  2CSI A;  2D8H A;  3NGP A;  2O88 A;  1IO6 A;  2EPD A;  3H0F A;  3U23 A;  2LJ3 A;  4KRT A;  3FJ5 A;  2A28 A;  3REA B;  4AFQ C;  3JV3 A;  1GBR A;  2OAW A;  2KRO A;  1AWO A;  2YUO A;  5I11 A;  4WCI A;  2KT1 A;  2LP5 A;  2ESW A;  2HEQ A;  1KIK A;  2F2V A;  3NPF A;  3PVQ A;  2LJ0 A;  2RNA A;  2EGE A;  4IIO A;  1LCK A;  3NMZ C;  2YUQ A;  4GBQ A;  1YN8 A;  2EYY A;  2LQN A;  1JO8 A;  2ABL A;  4JJB A;  1K0X A;  1ABO A;  3SHW A;  1SEM A;  3H0I A;  3UA7 A;  3EG3 A;  3I9Q A;  4HVW A;  3KFV A;  1U5S A;  2DX1 A;  1SPK A;  4AFS C;  1BK2 A;  1T3S A;  3GBQ A;  5HCK A;  2ECZ A;  2KBT A;  1OEB A;  4F17 A;  2JS2 A;  1H92 A;  1QKW A;  1CSK A;  3LH5 A;  4DEX A;  1AEY A;  3M0Q A;  1GL5 A;  2AKL A;  2ROT A;  2FPE A;  2P4R A;  4X1V A;  1K1Z A;  4JZ4 A;  2MOX A;  1X2Q A;  5FWC A;  2DLP A;  2EYZ A;  1WDX A;  4M4Z A;  3M0R A;  4R0K A;  2OI3 A;  1X6G A;  1WFW A;  1UJY A;  3M0S A;  2PZ1 A;  2H8H A;  1GFC A;  1UTI A;  4HCK A;  1M30 A;  2FRY A;  5ECA A;  1WX6 A;  1B3Q A;  1UDL A;  2CRE A;  2YSQ A;  4RTY A;  1ZLM A;  4DEY A;  4J9D A;  1RI9 A;  1M3B A;  4ESR A;  1W1F A;  4EIK A;  2V1R A;  2A37 A;  2DL3 A;  1I07 A;  2ENM A;  2K2M A;  3TSZ A;  4OMN A;  4CC2 A;  1YWO A;  2J6K A;  4LUD A;  2LNH B;  2KXD A;  1WI7 A;  1VA7 A;  1K76 A;  1SRM A;  2D8J A;  2MIO A;  2KRM A;  2O9V A;  3I5S A;  4QT7 A;  4Z8A A;  1HSQ A;  2L2P A;  4J9G A;  2JT4 A;  2W10 A;  2FRW A;  2CUD A;  2L3Q A;  1OV3 A;  3EGU A;  1X27 A;  2DBK A;  3PVL A;  1QWE A;  1WYX A;  3H41 A;  1VYV A;  2ED1 A;  1V1C A;  1GCQ A;  2C0I A;  2V1Q A;  4K11 A;  1Y0M A;  4LNP A;  2GTJ A;  1UHC A;  1S1N A;  1PKS A;  1ZX6 A;  2RF0 A;  1MV0 B;  2LJ1 A;  2KRN A;  2LX7 A;  1FYN A;  1PRM C;  2JM8 A;  4OMP A;  2KRS A;  5IH2 A;  2L0A A;  1BBZ A;  2KGT A;  1JEG A;  3IQL A;  2RPN A;  2A36 A;  2X3X D;  2MCN A;  1J3T A;  1UEC A;  1AWJ A;  2J6F A;  1GCP A;  4E6R A;  1TUC A;  1K4U S;  2KT8 A;  2RN8 A;  2LCS A;  1PWT A;  2RQU A;  2YDL A;  2LMJ A;  1UFF A;  4J9H A;  2G6F X;  4OML A;  1JXM A;  3VS2 A;  4OMO A;  2LZ6 B;  1VYU A;  1W6X A;  2EYX A;  4RTX A;  1WXT A;  4IIM A;  3RBB B;  4AG1 C;  2RQR A;  3SEM A;  5I22 A;  4J9B A;  4D8D A;  4RTV A;  2ROL A;  2D0N A;  2HCK A;  2RQW A;  2EGC A;  2AZS A;  2CDT A;  2IIM A;  2D1X A;  1AWX A;  2DJQ A;  2ED0 A;  3NHN A;  2YUP A;  2YT6 A;  2O31 A;  4LN2 A;  1TUD A;  2L3P A;  1UE9 A;  2JM9 A;  1A0N B;  1MV3 A;  1I1J A;  1NYF A;  4LUE A;  4RTW A;  1ZUK A;  1JQQ A;  2SEM A;  4LE9 A;  4J9E A;  2DBM A;  2FPD A;  1YNZ A;  2DIL A;  3EHQ A;  2KE9 A;  5IHI A;  1MUZ A;  3VS4 A;  1EFN A;  1ABQ A;  3A98 A;  1Z9Z A;  2DL4 A;  1X69 A;  2NWM A;  1QKX A;  1ZUY A;  1Z9Q A;  1UHF A;  2DF6 A;  1AZE A;  2CT3 A;  1JXO A;  3M0T A;  1ARK A;  3O5Z A;  1K9A A;  1ZUU A;  2GQI A;  4AFZ C;  2PTK A;  4OMM A;  1JU5 C;  2AKK A;  2FG0 A;  4RTZ A;  3R6N A;  1UUE A;  1I0C A;  2BZY A;  1HJD A;  2K79 A;  1T0H A;  1QLY A;  1AZG B;  2HSP A;  3ULR B;  2GGR A;  1YWP A;  4RUG A;  1PRL C;  2FO0 A;  2DRK A;  1KJW A;  3TVT A;  3VRZ A;  4CC7 A;  3CQT A;  1UG1 A;  1UJ0 A;  1X43 A;  2J6O A;  2JS0 A;  1BB9 A;  3QWY A; 
#chains in the Genus database with same CATH topology
 2AHJ B;  2RJD A;  2J06 A;  3MPU B;  1S72 Q;  3MEV A;  2L3S A;  1PCX A;  1QP3 A;  3PMI A;  3V7C A;  5FRN A;  1GFD A;  1KC8 R;  3HRS A;  3VS7 A;  3OMG A;  4FT4 A;  3FRN A;  4ZNX A;  7AT1 B;  2FZC B;  3CCE Q;  2DRM A;  3L2V A;  4PJO D;  2KI7 A;  2B8A A;  4E7S A;  4HT9 A;  2DET A;  2E6N A;  4M7D C;  4M7D B;  1BI0 A;  1V29 B;  2L89 A;  1M8V A;  2XK0 A;  3VYH B;  4PK4 A;  5GMK l;  5GAM e;  2L3R A;  1ZA1 B;  1VQ8 T;  1YP5 A;  5IXB A;  2E70 A;  4N0A C;  1B07 A;  1M2V B;  2RHU A;  3QKJ A;  2KNB B;  1IHW A;  2BTT A;  1NLO C;  2O9S A;  4D6W A;  3FDR A;  1T0J A;  5LJ5 j;  4PJO E;  5GAO q;  3VS1 A;  1Q7Y R;  2BE9 B;  3CCR A;  4Z02 A;  1U1T A;  5L8R E;  2F2X A;  1VUB A;  5CK9 A;  2FPF A;  1NG2 A;  3CC7 Q;  4E7J A;  4OMQ A;  4M7D D;  2EW3 A;  2KXC A;  3OYN A;  1S72 A;  1PKT A;  1R77 A;  3JB9 F;  2O4X A;  3UWN A;  1SRL A;  3AHU A;  3C0C A;  1RAE B;  1GRI A;  1BIB A;  2GQV A;  3EG0 A;  3M4G A;  3RDV A;  2V26 A;  2CZ0 B;  4OB3 B;  3UT1 A;  1JJ2 P;  3EG1 A;  4ZN3 A;  2DYB A;  2WSF E;  1CKB A;  3M58 A;  2RJF A;  3CCE A;  4QQD A;  1SHF A;  3H0H A;  2CSQ A;  3WVD B;  2JMC A;  1ZQ1 A;  4M7D E;  3QWX X;  1KQ1 A;  1Y57 A;  3OYA A;  5FWB A;  3I56 A;  1UGV A;  2DO3 A;  3M0U A;  2P0P A;  1N8R R;  2V8I A;  1I4K 1;  2F1L A;  4C0D B;  4E7Z A;  1W2B A;  2FZG B;  3UAT A;  2C0T A;  2KEA A;  1NEB A;  2VXE A;  2DL8 A;  4B9W A;  5J39 A;  5KYX A;  3G6E T;  1QVF P;  2Y4Y A;  1H3H A;  2CZ7 B;  3GP8 A;  1VIE A;  2FVU A;  1Q82 C;  3M0P A;  2X4J A;  2W0Z A;  1M3A A;  4EMH A;  4J9I A;  1Q81 U;  2QQS A;  2PUO B;  1O9S A;  2NUZ A;  2C0O A;  4B6M A;  3RER A;  2LRQ A;  4BD3 A;  2O4X B;  4JLG A;  2QA4 Q;  2KDS A;  4ME7 A;  3CC7 A;  1OZ2 A;  4JUV A;  2J7I A;  1CKA A;  3CBP A;  1TXQ A;  1TG0 A;  4J9F A;  2QAZ A;  5EC7 A;  3D7S B;  1WJR A;  3ZL7 C;  2RA2 A;  1AD5 A;  1D1A A;  3OW2 A;  5GMK h;  2QEX T;  2D8H A;  4C0F A;  2O88 A;  4BAC A;  1OUL A;  3U23 A;  2HSE B;  3REA B;  2DYI A;  3FJP A;  3CPW P;  4VUB A;  3OYM A;  4AFQ C;  2VXF A;  3J81 E;  3JV3 A;  1K9M R;  3JCM P;  2YUO A;  5I11 A;  3OYY A;  4M7D F;  2F2V A;  3NPF A;  4PFO A;  2EGE A;  1WHM A;  3NMZ C;  3OYD A;  2DZ9 A;  1HYO A;  4FL6 A;  4JDS A;  5LJ3 j;  1D1C A;  1VQ9 T;  2EYY A;  4JJB A;  1ABO A;  3SHW A;  3A8G B;  4XU1 A;  2DPP B;  3EGX A;  3UA7 A;  2XDP A;  3HKS A;  3I9Q A;  2KQW A;  3MCA B;  5CKF A;  2M0O A;  5D6W A;  4C5G A;  2FZK B;  3GBQ A;  4KH0 B;  2ECZ A;  1Y07 A;  2KBT A;  1H92 A;  4LD6 A;  5CKD A;  4MZM A;  3R6O A;  3JB9 G;  4XTW A;  2LCC A;  3M0Q A;  1YI2 T;  4X34 A;  3CME Q;  3QYH B;  2DTH A;  2OTL T;  2EYZ A;  2L8D A;  4HKE A;  1I81 A;  2HBP A;  5EG2 A;  1X6G A;  2H8H A;  4HCK A;  1N8R C;  4BI3 A;  2CRE A;  1ZLM A;  2XID A;  3QZ5 B;  4J9D A;  3LLR A;  5KYU A;  1Y71 A;  3EFO A;  3GLX A;  3M53 A;  2V1R A;  5FLX E;  2K5L A;  2K2M A;  3EGX B;  3MEW A;  3HSB A;  4KUI A;  4CC2 A;  2J6K A;  4N4H A;  1M2O A;  5HK0 A;  2LNH B;  1YCY A;  4J7I A;  2BKD N;  2O9V A;  3I5S A;  4QT7 A;  2MMP A;  2L2P A;  4AMC A;  3MET A;  3CMA Q;  2E6Z A;  1WJQ A;  1WGS A;  2JT4 A;  2W10 A;  4PJO G;  2CUD A;  3EGU A;  2R58 A;  1BI3 A;  4EPC A;  3H41 A;  3CCU A;  1SKU B;  4MML A;  1V1C A;  3QYG B;  4OP0 A;  4IUR A;  5GAO p;  2XU8 A;  1FXX A;  4LNP A;  2HL3 A;  5HKC A;  5D7U A;  1S1N A;  1PKS A;  3CCJ Q;  2RF0 A;  2QXF A;  3GNG A;  2PQW A;  2JM8 A;  1FMW A;  4OMP A;  2KRS A;  2R57 A;  2WAC A;  5FU6 C;  1BBZ A;  2RPN A;  3RKX A;  5KYU B;  3EFO B;  1YJW T;  1UEC A;  1VQ5 T;  3OSV A;  1BYM A;  1TUC A;  4RG8 A;  4BDY A;  2KT8 A;  5LJ5 e;  4JRQ A;  1PWT A;  4ZGE B;  2MI6 A;  3S3O A;  1M90 U;  4M7D G;  2XDD A;  4J9H A;  4A53 A;  3V7S A;  4OMO A;  3PIO A;  4FW1 A;  4NOY A;  2IPO B;  4L6V 5;  1MMN A;  4IIM A;  1Y96 A;  1RAH B;  3SWN B;  4DQ2 A;  3J80 E;  3RBB B;  3A1P A;  3CD6 A;  3CC2 T;  1PSE A;  3V7R A;  4D8D A;  2RQW A;  3GIB A;  1WHJ A;  2ZGW A;  2EGC A;  3CMA A;  3OYB A;  1KG1 A;  3JCM b;  1G3S A;  1VQN A;  4PKC C;  5GAO m;  2YLC A;  4EMG A;  5IN1 A;  1BI1 A;  2O31 A;  1TTH B;  2L3P A;  3OYI A;  1IRE B;  1MV3 A;  3JB9 H;  3DB4 A;  2KSS A;  2LDM A;  1NYF A;  4LUE A;  4RTW A;  3OYC A;  3OS1 A;  1SSF A;  1JQQ A;  4A4H A;  2PU9 B;  3CCJ A;  4PJM A;  1YNZ A;  4A4E A;  1MUZ A;  3VS4 A;  2DL4 A;  1ZUY A;  2DF6 A;  4PLI A;  3J7A F;  3X26 B;  1ARK A;  2X4Y A;  3RES A;  3R6N A;  5FU7 C;  2BZY A;  1UEB A;  3O8V A;  1VQO T;  1Y96 B;  3S3N A;  5FRM A;  1SF9 A;  4M75 A;  4F7U F;  2HSP A;  2NUT A;  3C94 A;  4JLI A;  3JCM X;  1YHQ A;  2CP3 A;  1Q95 G;  2DTI A;  1D3B A;  4C5E A;  1UJ0 A;  4M78 A;  1X43 A;  2J6O A;  4FYV B;  4QKU A;  3VYG A;  2COY A;  4JRK A;  2HAX A;  1LPL A;  4IUT A;  2EBP A;  2AT1 B;  1WPY A;  2QQB A;  2CH4 W;  2A0F B;  4HXJ A;  1DJ7 B;  5GJV B;  8ATC B;  2CUB A;  2GNC A;  2JTE A;  2XMF A;  1WA7 A;  2DA9 A;  3WXM B;  4M7A C;  1OX8 A;  1R0B G;  3CCQ T;  2RQV A;  3CXC S;  3VS0 A;  2DEQ A;  4EMK A;  1VQK Q;  2I0N A;  4HCB A;  1B34 A;  3M55 A;  1OPK A;  4JZ3 A;  1RAG B;  3CCS T;  2R5A A;  3HPW A;  5LJ3 e;  4Y91 A;  4C8Q A;  1PM3 A;  1PNJ A;  2XKO C;  2AK5 A;  3EGD A;  1N9S A;  3G71 Q;  2KVQ G;  1OZ3 A;  1ACM B;  1C6V X;  5C6S A;  1OI1 A;  4M77 A;  2AZV A;  2DD5 A;  2DKG A;  3KUF A;  4M75 B;  2NUT B;  1XOV A;  4M7A D;  3H9N A;  2EQU A;  1OX9 A;  1QWF A;  3M9Q A;  5GAO r;  1D3B B;  2OJ2 A;  3DLM A;  4A63 B;  5J26 A;  1NM7 A;  4M78 B;  5GAN d;  4ELZ C;  5KYN A;  1NEG A;  2EIF A;  1BU1 A;  2VWF A;  1GCQ C;  2E3H A;  4RTU A;  2P84 A;  5GAN g;  2CP0 A;  2JOY A;  4PLL A;  2EYW A;  3OMC A;  1SSH A;  2EKH A;  4NS5 A;  1AWW A;  3PE0 A;  4JJC A;  1VQ4 T;  4M7A E;  3EAE A;  4EMK B;  1Q82 U;  1FMK A;  2K7A A;  3L2Q A;  1M1F A;  1B34 B;  1M1G A;  1RAA B;  1VYT A;  2M1H A;  3CPF A;  2KY9 A;  1G83 A;  4C8Q B;  4M78 D;  3EGD B;  4PFZ A;  1GBQ A;  1VQK A;  3I35 A;  2QDL A;  2Z0W A;  4M77 B;  2F2W A;  1RLP C;  5GAN h;  3MHX A;  5GJW B;  2WSC E;  2C06 A;  3C4S A;  2NYS A;  5IHN A;  1TS9 A;  2LQW A;  3FLG A;  2XDB A;  1WHL A;  5DM7 R;  2RMO A;  4M75 E;  2DMO A;  2HMA A;  1WQW A;  1M1K R;  3N5B B;  4WF2 A;  4RCB A;  4PJO C;  1IGU A;  1H64 1;  1PD1 A;  2CT4 A;  5AT1 B;  1M9S A;  2EJG A;  4M78 E;  1NBE B;  2RHY A;  3E9G A;  1TOV A;  3VS5 A;  1QMC A;  2DEU A;  1NJI R;  3V8K A;  2YUN A;  5J3B A;  5I2S A;  2EQI A;  1P92 A;  2K9G A;  3ASK A;  3TU4 K;  4M77 D;  4L59 A;  1PHT A;  4BUG A;  4F16 A;  1W2B P;  1E6H A;  1VIF A;  2DVJ A;  3QII A;  5GAM d;  2E65 A;  2DD4 A;  3I5R A;  4E7K A;  3VKI A;  4M7A F;  2Y4X A;  1N5Z A;  3BW1 A;  3NTH A;  4D8K A;  2CSI A;  3CCV Q;  4C8Q E;  5GAM g;  3I56 Q;  3HTR A;  3H0F A;  4KRT A;  1KHI A;  2RM4 A;  3VJP A;  5C0M A;  1IZ6 A;  5HK3 A;  4M77 E;  3QDF A;  3C12 A;  1PD0 A;  1R0C B;  2LJ0 A;  2RNA A;  4IIO A;  4IUV A;  2ZPH B;  2YUQ A;  3OW2 P;  2XI9 A;  4GBQ A;  3E1S A;  1D1B A;  3LW5 E;  2LQN A;  1JO8 A;  1K0X A;  3SDZ A;  4RKU E;  3H0I A;  2P4T A;  3CCR T;  1N8R U;  1ZSZ A;  4HVW A;  2DXB A;  3KFV A;  5GAM h;  2DX1 A;  2FYK A;  1SPK A;  2E12 A;  2DFU A;  1BK2 A;  2RI3 A;  1S72 T;  1UB4 A;  4E7L A;  3CCM Q;  3OYL A;  2EYQ A;  5KE2 A;  4PFP A;  2P0Q A;  1CSK A;  1D0Y A;  2LNV A;  2OTJ Q;  4DBF A;  1GL5 A;  2MWP A;  1HK9 A;  5CKE A;  2YXY A;  3JCM g;  2MOX A;  3TRE A;  1X01 A;  4FYY B;  3KXT A;  1WDX A;  4M4Z A;  1OQK A;  3M0R A;  4OB2 B;  4R0K A;  3CCE T;  2OI3 A;  1G5V A;  5GAO l;  1TU0 B;  2JJ9 A;  1QCN A;  3JCM e;  3M0S A;  2PZ1 A;  2PVG B;  1GFC A;  3CCV A;  3HP9 A;  3I56 T;  1IGQ A;  5ECA A;  3RKY A;  1Q86 R;  1B3Q A;  2YSQ A;  4R55 A;  5DY9 A;  1VQL Q;  3HHT B;  4C0D C;  2RD1 A;  4C92 A;  5KYY A;  2I2L A;  1KD1 R;  5DLQ E;  3RKW A;  2KMT A;  1NJI C;  2ENM A;  1ZSZ B;  4FYX B;  1UGP B;  1YWO A;  1I5O B;  4LUD A;  3QG1 A;  1K76 A;  2D8J A;  1K73 U;  3DKM A;  4MZT A;  4PJO F;  1KC8 C;  4BE2 A;  4J9G A;  2R5M A;  4ELY C;  5GAO n;  1RAC B;  3X24 B;  3CC7 T;  1RAB B;  4J83 A;  3SFM A;  3CCM A;  1WYX A;  2QQR A;  1B7T A;  1VYV A;  4LDU A;  2V1Q A;  2C0I A;  4Q5W A;  2LT1 A;  2OTJ A;  5D6Y A;  4B9X A;  1WNL A;  1Y0M A;  2DIG A;  1LNX A;  4IUP A;  1ZX6 A;  4M7A G;  2YWW A;  1MV0 B;  2KRN A;  2LX7 A;  1FYN A;  2GFU A;  3QO3 A;  2L0A A;  2K5F A;  1JEG A;  1UGR B;  3QHS A;  2A36 A;  4C92 B;  5KYY B;  2M02 A;  2MCN A;  4E2F B;  3HFN A;  2RHX A;  1AWJ A;  2BUD A;  1GCP A;  4RG2 A;  4LD9 K;  5A0G A;  2LCS A;  1VQL A;  1Q7Y C;  2JN0 A;  3M57 A;  2LMJ A;  1UFF A;  2G6F X;  4DBH A;  4OML A;  1JXM A;  2ZZD A;  3S3M A;  3PIP A;  4QVZ A;  2E3I A;  2LX9 A;  1W6X A;  3RMS A;  1WXT A;  4M75 G;  5CVI A;  2OX7 A;  4AG1 C;  2RQR A;  5I22 A;  4J9B A;  4PJL A;  5GAN 2;  2IG0 A;  4RTV A;  2VGM A;  3ME9 A;  2D0N A;  4M78 G;  3CCU Q;  1VQ9 A;  2L5Q A;  2QA4 T;  4KUL A;  2CDT A;  2IIM A;  3DB3 A;  2D1X A;  4C92 D;  4KH1 B;  2O01 E;  2ED0 A;  4II1 A;  4E47 A;  5IT9 E;  2DJZ A;  2RK1 A;  2YUP A;  2EQJ A;  2QK0 A;  2YLB A;  2HNI A;  2JM9 A;  5KCO A;  1Q86 C;  3Q1J A;  2RI2 A;  1ZUK A;  2SEM A;  1PG5 B;  4NL2 A;  4J9E A;  1YI2 A;  2DBM A;  1KD1 C;  2HQH A;  4LXC A;  4C8Q G;  3A98 A;  1Z9Z A;  1X69 A;  4C92 E;  1QKX A;  1ZA2 B;  2MWO A;  3FB9 A;  3M0T A;  3O5Z A;  1LOJ A;  4AFZ C;  2PTK A;  4OMM A;  4BE1 A;  2FG0 A;  4RTZ A;  4M77 G;  1UUE A;  2FL7 A;  1TWB A;  5DLO A;  3CD6 Q;  2NLU A;  1AZG B;  4A54 A;  2GGR A;  1YWP A;  4RUG A;  3SWN A;  3TVT A;  1VQN Q;  4XTX A;  3QWY A;  3A8L B;  4XTU A;  4IUQ A;  3OB9 A;  1OOT A;  1G8X A;  2EFI A;  5KCH A;  2QYZ A;  3CC4 Q;  2M0Y A;  2B86 A;  3CME T;  3CPW A;  5LJ5 d;  1K9M C;  1WLP B;  1HXD A;  3EG2 A;  4AT1 B;  5I2M A;  4HVU A;  5LJ5 g;  1WJS A;  2BZ8 A;  2E10 A;  4JPB W;  2DL7 A;  2F5K A;  3G4S Q;  1YIT Q;  1VQP Q;  4Y92 A;  3S6W A;  2CP5 A;  1W70 A;  4GLM A;  3L1A A;  5GMK m;  1VQ6 Q;  2VGN A;  5CQY A;  3CCL Q;  1AHJ B;  3CXC A;  3UDC A;  1JJ2 S;  1LVK A;  4WTO B;  3M5A A;  2LC4 A;  1N9R A;  1YHQ Q;  2JXB A;  1AOJ A;  1EX4 A;  1YJW A;  2COZ A;  2D9T A;  3SWN C;  2X4X A;  3CD6 T;  3QPH A;  2V8K A;  2XHC A;  2GBQ A;  1U3O A;  3PT9 A;  5LJ5 h;  4J9C A;  3CMA T;  1KHC A;  4JRI A;  1WHG A;  1VQN T;  1RL2 A;  1YBY A;  2EVR A;  3LYI A;  2DL5 A;  1QVF S;  1UGQ B;  4KGV B;  2EJF A;  1KK7 A;  3CC4 A;  3OBW A;  4GLK A;  1WXB A;  3GF5 A;  1TUG B;  3QZ9 B;  1G3T A;  1YJ9 A;  3CCJ T;  2GFA A;  4FT2 A;  1BIA A;  3NTK A;  4F14 A;  1M27 C;  2VVK A;  3SD4 A;  4F04 B;  4RCC A;  5FW9 A;  5GAN 3;  2LQK A;  2LQ8 A;  4DA4 A;  3TEE A;  2GF7 A;  3G4S A;  1YIT A;  1V76 A;  4R56 A;  1VQP A;  1C0M A;  2SRC A;  1NYG A;  2FEI A;  1M90 R;  3G1J A;  1VQ6 A;  3CCL A;  2X35 A;  3EH2 A;  1K8A R;  4XQ3 A;  2PNI A;  2QGG A;  3CPW S;  3ER0 A;  4C5H A;  1RUW A;  3HL8 A;  4Z89 A;  3QJ6 A;  2GTO A;  2KYB A;  1KFZ A;  1YIJ Q;  2ZAE A;  3PGG A;  2K2V A;  2KR3 A;  2DXU A;  4C0G A;  4MMK A;  2RJE A;  3L2W A;  1M8M A;  5LJ3 d;  5KYW A;  4ORZ A;  1XQH A;  3QDR B;  1E6G A;  3PTA A;  1YFN A;  1YCS B;  4RTT A;  5L23 A;  4HVV A;  2JMA A;  3EHR A;  3VRY A;  5LJ3 g;  4FYW B;  1KQS A;  2A08 A;  2Y90 A;  1QVG A;  1U8R A;  5GMK j;  3OYF A;  3UA6 A;  2E64 A;  1IO6 A;  2LJ3 A;  3RR6 A;  3FJ5 A;  2A28 A;  1YJN Q;  3JCM J;  1GBR A;  4IKF A;  2KRO A;  1AWO A;  4M75 C;  3VUZ A;  5M9O A;  4C92 G;  3JAM E;  2COW A;  2HEQ A;  1D0Z A;  1KIK A;  3PVQ A;  4ZN1 A;  1G3W A;  5LJ3 h;  2VB6 A;  4M78 C;  4FSX A;  1VQM Q;  4TVR A;  1YN8 A;  2ZPG B;  1TSF A;  3E9F A;  1NPR A;  2DXT A;  3MEU A;  3EG3 A;  2QG9 B;  4BI8 B;  3X28 B;  1U5S A;  5KYW B;  2K3X A;  4DBQ A;  4XTZ A;  1YIJ A;  3I55 A;  5HCK A;  2A3L A;  3OYK A;  1OEB A;  4F17 A;  1MGQ A;  2JS2 A;  4OF1 A;  4OGE A;  3AT1 B;  4MDX A;  4DEX A;  1NJI U;  2QTV A;  1IXD A;  1F1B B;  4M75 D;  4EMK C;  2JTM A;  1AEY A;  3CBM A;  2ROT A;  2FPE A;  4X1V A;  2VC8 A;  1K1Z A;  4C8Q C;  1X2Q A;  1X6O A;  5FWC A;  3VUB A;  2DLP A;  1VQK T;  1KC8 U;  1BCM A;  3KBG A;  3ZEH A;  3WVE B;  1WFW A;  5I21 A;  4M77 C;  4J6W A;  1VQ4 A;  4BY6 B;  1K8A C;  2HL5 C;  3G71 T;  2DZC A;  2G3R A;  3M4Y A;  1WX6 A;  1LJO A;  3OYJ A;  1N6A A;  2PVD B;  4DEY A;  1YJN A;  4J6X A;  2D0Q B;  4OGC A;  2M16 A;  3OYG A;  2X4W A;  4EIK A;  4XK8 E;  5CO7 A;  4XTV A;  3C95 A;  4PNO A;  1IRX A;  3URG A;  4HCC A;  2DL3 A;  2QQA A;  1VQ8 Q;  3TSZ A;  1VQ7 A;  4DBR A;  4OMN A;  5AYF A;  2DAQ A;  4C8Q D;  1G3Y A;  1VQM A;  1KQS S;  2ZPE B;  2KXD A;  1QVG S;  1WI7 A;  2RHZ A;  1SRM A;  2MIO A;  3A5Z B;  2FHD A;  1M5Q 1;  4E7I A;  1HSQ A;  4N0A A;  3L2Z A;  1NZ9 A;  2FRW A;  1Q7Y U;  2HD0 A;  1X27 A;  2DBK A;  1QWE A;  3QXE B;  5GAN f;  3LWH A;  1Q82 R;  2KAF A;  2FB7 A;  3OBY A;  2K5I A;  2GTJ A;  1UHC A;  3A8H B;  1N27 A;  2F69 A;  3OQ5 A;  1O75 A;  2DIQ A;  2LJ1 A;  4CRI A;  1PRM C;  3PMT A;  2YHT A;  1QP2 A;  5IH2 A;  1BCO A;  2KGT A;  3MP6 A;  1JRI A;  3JB9 J;  3IQL A;  2X3X D;  1QW1 A;  2K3Y A;  2J6F A;  3LWI A;  1K4U S;  2EWN A;  5LL6 S;  2YDL A;  2YRC A;  1Q86 U;  2EAY A;  4KGX B;  4M75 F;  2H3E B;  2EJ9 A;  1VYU A;  2VYT A;  4RTX A;  1M4Z A;  1KD1 U;  1VQ8 A;  1X75 C;  3G6E Q;  3E2U A;  1NPP A;  3HRU A;  4KT0 E;  4M78 F;  4N4I A;  3VV0 A;  3SEM A;  2LTO A;  2VAS A;  3FIF A;  3H6Z A;  3JCM d;  4HT8 A;  5GAN 4;  4C0Z A;  1AWX A;  2HZY A;  5GAN 7;  3X25 B;  1UE9 A;  3CCV T;  3JCM V;  2ZPB B;  3EG9 A;  2DVE A;  3JB9 I;  4LE9 A;  1I8F A;  4C8Q F;  2FPD A;  2QEX Q;  4UC4 A;  2NUP A;  1M1K C;  2DIL A;  1ABQ A;  5GAM f;  2NWM A;  3P8B B;  4ZGD B;  2CT3 A;  3JCM c;  1AZE A;  4M77 F;  1JXO A;  2VUB A;  3RIR A;  1K9A A;  2JUF A;  3M59 A;  4A4K A;  4BE0 A;  1JU5 C;  2AKK A;  3MEA A;  1K9M U;  4MDW A;  1ZSZ C;  2RB6 A;  1QVP A;  2XIC A;  2IVW A;  3JCM h;  2K79 A;  1RI0 A;  3HRT A;  3V8J A;  4O6J A;  3BFM A;  1QLY A;  3OSS C;  2DTO A;  3ULR B;  1VQ9 Q;  2OAU A;  1XTD A;  4KUD K;  2DRK A;  3BY7 A;  1KJW A;  4N4G A;  4CC7 A;  3G6E A;  3CQT A;  2CGH A;  4J7F A;  2JS0 A;  3CCM T;  1SHG A;  5GMK e;  2J05 A;  4ZGJ B;  2K57 A;  1X6B A;  3A8M B;  2OTJ T;  4DOW A;  5KH6 A;  5CKH A;  1H3Z A;  1AVZ C;  2VKN A;  2JNG A;  3NTI A;  2MYS A;  1FX7 A;  2EGA A;  4JJN K;  4Z88 A;  1YI2 Q;  1OPL A;  3EG9 B;  2M51 A;  2MAM A;  4HA8 A;  2NUP B;  2OTL Q;  3JCM f;  4C92 C;  3TQ7 P;  1QQJ A;  4J6Y A;  3V8L A;  2EKO A;  4E7H A;  5CQX A;  3OS2 A;  3CEY A;  2X9H A;  2QEX A;  4ZTF A;  1VQL T;  4MZP A;  4PJJ A;  2CP7 A;  2A7Y A;  1GXI E;  3RNJ A;  1BKB A;  4Y28 E;  5IAY A;  2YRD A;  1ZBJ A;  1OYX A;  2X3W D;  3PFS A;  3OA6 A;  2M9U A;  4CC4 B;  1JBM A;  1Q81 R;  4OMF B;  3VS3 A;  4CC3 A;  4IUU A;  1FWZ A;  5KYX B;  2XD0 A;  1K73 R;  3LGF A;  4F7U A;  1JJ2 A;  2DM1 A;  1KSW A;  1H8K A;  1ZSG A;  1WIE A;  2XG8 D;  4RMO A;  2CP2 A;  2RO0 A;  1NE8 A;  3CXC P;  1AT1 B;  3GPL A;  5KE3 A;  1QCF A;  3JCM Q;  3BE3 A;  1D09 B;  3MP1 A;  1E7O A;  3UF4 A;  3HFO A;  4YTL A;  5IHK A;  1MHN A;  1U06 A;  3TSW A;  3FC3 A;  4LDW A;  1RLQ C;  2EQK A;  4LDV A;  2QA4 A;  3L2U A;  4AFU C;  1QVF A;  4QQG A;  2DNU A;  2BE7 D;  3ZBD A;  3THK A;  2YRV A;  1W2B S;  2K6D A;  5IXF A;  2OTL A;  1TH7 A;  1HD3 A;  3QBY A;  3H8Z A;  1SG5 A;  3G7Z A;  4FSS A;  4XU0 A;  2KYM A;  1I5L A;  1MMA A;  2PVO B;  5GAN j;  1YJW Q;  3LX7 A;  1M3C A;  3QUI A;  1VQ5 Q;  1WXU A;  1T3L A;  4J8O A;  4AG2 C;  1K0S A;  2VV5 A;  2CH4 A;  2AIR B;  2K3B A;  4F7U B;  4C5I A;  1RAD B;  3BDL A;  4XU2 A;  4QW2 A;  2DE0 X;  2CS7 A;  3VS6 A;  1EZZ B;  5FRO A;  3MJX A;  4KGZ B;  2HBW A;  2E5K A;  3CCU T;  3OS5 A;  1VOM A;  1RAI B;  2HDA A;  1NLP C;  5GAN 8;  3REB B;  1C1A A;  3OW2 S;  2HQX A;  3CC2 Q;  3UPU A;  4EDU A;  4ATO A;  4DOV A;  2QI2 A;  2GCX A;  1YJ9 Q;  2BZX A;  3PNW C;  1G2B A;  1W4S A;  2KK4 A;  2ATC B;  2QTX A;  2O2O A;  5CIU A;  2H3J A;  1BI2 A;  2D6F A;  3MKD A;  2JW4 A;  2RQT A;  1X2K A;  2DK3 A;  4JJD A;  5GMK i;  3CME A;  3NGP A;  2EPD A;  2HKN A;  2RH2 A;  3MO8 A;  4FM4 B;  4LDY A;  4PJN A;  2RJC A;  5FU6 B;  4C92 F;  1Q81 C;  2OAW A;  1K73 C;  1FMV A;  2QAS A;  4WCI A;  2KT1 A;  2LP5 A;  3ZFJ A;  2ESW A;  3RMQ A;  1D0X A;  1VQ5 A;  9ATC B;  1KQS P;  1WZO A;  1LCK A;  2MK5 A;  3MP8 A;  1QVG P;  4J5Y A;  4P5N A;  4F7U E;  5CR2 A;  2ABL A;  4GY5 A;  1VQO Q;  1SEM A;  1K8A U;  2E5Q A;  3LGL A;  4X9C A;  1JB0 E;  1WHK A;  5GAM j;  4OVA A;  4AFS C;  3INZ A;  1T3S A;  3CC4 T;  4QVC A;  3CC2 A;  1QKW A;  3LH5 A;  1OU9 A;  3OYE A;  1YJ9 T;  3VU3 C;  2AKL A;  2P4R A;  4JZ4 A;  3CCQ Q;  2X51 A;  4O5V A;  1R8O B;  3JRZ A;  2PUK B;  4QVD A;  3G4S T;  1YIT T;  1VQP T;  4M7A A;  4LDX A;  4OB1 B;  1UJY A;  1UTI A;  4PL6 A;  1M30 A;  2FRY A;  3CCS Q;  1VQ6 T;  5LJ5 f;  3CCL T;  1UDL A;  4RTY A;  3DLL A;  1PSF A;  3NFC A;  3QJY A;  1RI9 A;  1M3B A;  2LVM A;  1WQ7 A;  1KQ2 A;  4ESR A;  1W1F A;  1YHQ T;  5HY6 A;  2A37 A;  1ZBX A;  1I07 A;  8AT1 B;  4HCZ A;  5FU7 B;  6AT1 B;  3F70 A;  3OYH A;  3I55 Q;  4A4F A;  2LT4 A;  3TCJ A;  1VA7 A;  4FW2 A;  1VQO A;  2ZCF B;  1ZHI A;  2KRM A;  3OS0 A;  1RAF B;  3EFS A;  4Z8A A;  3X20 B;  2BIV A;  4FCY A;  2L3Q A;  2P0K A;  1UGS B;  1OV3 A;  2QQ9 A;  3PVL A;  4XTY A;  3T9N A;  2QGF B;  3GOX A;  2LCL A;  2ED1 A;  1GCQ A;  2E41 A;  4XAX B;  4K11 A;  4BB7 A;  4A4G A;  5A2Q E;  2HQE A;  1VQ4 Q;  4M7A B;  4JRP A;  3CCQ A;  3GNF B;  5CKB A;  1IHV A;  4JS5 A;  3P8H A;  1PC0 A;  4QQ6 A;  1J3T A;  3CBO A;  3CCS A;  2CYZ B;  2CZ6 B;  2V8J A;  1VQ7 Q;  4E6R A;  1MMD A;  2RN8 A;  3JCM W;  1OU8 A;  5CCA A;  4ANJ A;  2RQU A;  3L42 A;  4JS4 A;  3VS2 A;  2LZ6 B;  2ZPI B;  2EYX A;  1M1K U;  1IB8 A;  1YIJ T;  3I55 T;  2RK2 A;  2CP6 A;  3M56 A;  2MPX C;  4ZTJ A;  1XNI A;  2RHI A;  3BDU A;  2QDY B;  5A0L A;  3OY9 A;  2ROL A;  4PJO A;  2HCK A;  4CI0 C;  2CKK A;  3FEO A;  4L5G A;  2AZS A;  2JVV A;  3E19 A;  3EH1 A;  2E4H A;  5D6X A;  2DJQ A;  1WHH A;  2WSE E;  3NHN A;  2YT6 A;  4LN2 A;  2E1H A;  4OB0 B;  1TUD A;  3EFR A;  4NL3 A;  4FU6 A;  4FIB A;  1A0N B;  1M90 C;  5GAN e;  5GAN 5;  3A8O B;  4V2S A;  1I1J A;  1MND A;  2JTF A;  5LJ3 f;  1Y7X A;  4BY6 C;  4XU3 A;  4BI4 A;  3P8D A;  2DXC A;  3SB2 A;  1YJN T;  4KBM B;  3EHQ A;  5CAI A;  2KE9 A;  5IHI A;  3QSU A;  1EFN A;  2RI5 A;  1Z9Q A;  5A0D A;  1UHF A;  1XJW B;  3JB9 D;  1ZUU A;  2GQI A;  3LH0 A;  4BDZ A;  4M7D A;  1VQ7 T;  1EIF A;  1QCO A;  3M54 A;  1I0C A;  1VQM T;  3G71 A;  1HJD A;  3JSC A;  5GAN 6;  1T0H A;  2JZ2 A;  2DER A;  4X9D A;  2F5T X;  1MNE A;  2CZ1 B;  2K4Y A;  2MF2 A;  2ZPF B;  1PRL C;  2FO0 A;  3L2R A;  1M2V A;  3VRZ A;  4F7U G;  4PJO B;  3CCR Q;  1MMG A;  1UG1 A;  2EQM A;  1BB9 A;  3RUX A;  1U1S A;  2HKQ B; 
#chains in the Genus database with same CATH homology
 1SHG A;  1OOT A;  2J05 A;  2J06 A;  2EBP A;  1X6B A;  2L3S A;  2M0Y A;  2CH4 W;  4HXJ A;  5GJV B;  1AVZ C;  2B86 A;  2CUB A;  2GNC A;  2JTE A;  2VKN A;  2XMF A;  1WA7 A;  2DA9 A;  2EGA A;  4Z88 A;  1OPL A;  1GFD A;  2RQV A;  1WLP B;  2M51 A;  3VS7 A;  3EG2 A;  4ZNX A;  3VS0 A;  4HVU A;  2I0N A;  2BZ8 A;  1OPK A;  4JZ3 A;  4JPB W;  2DRM A;  2DL7 A;  4Y92 A;  1W70 A;  1PNJ A;  4GLM A;  2AK5 A;  3RNJ A;  1ZBJ A;  2X3W D;  2AZV A;  4CC4 B;  2JXB A;  1AOJ A;  1YP5 A;  5IXB A;  1XOV A;  1B07 A;  1QWF A;  3VS3 A;  4CC3 A;  2OJ2 A;  4A63 B;  2KNB B;  1NM7 A;  2GBQ A;  2BTT A;  1U3O A;  1NLO C;  2O9S A;  1T0J A;  2DM1 A;  4J9C A;  1NEG A;  1KSW A;  3VS1 A;  1BU1 A;  1H8K A;  1ZSG A;  1WIE A;  2VWF A;  1GCQ C;  2EVR A;  2F2X A;  4RTU A;  2DL5 A;  2FPF A;  1NG2 A;  1QCF A;  4OMQ A;  2EW3 A;  2KXC A;  2EYW A;  1E7O A;  3UF4 A;  5IHK A;  1SSH A;  1PKT A;  2EKH A;  1AWW A;  1U06 A;  3TSW A;  3PE0 A;  1SRL A;  1WXB A;  4JJC A;  3C0C A;  1RLQ C;  1GRI A;  1FMK A;  2K7A A;  3EG0 A;  4AFU C;  1VYT A;  4F14 A;  1M27 C;  2VVK A;  1G83 A;  2DNU A;  3EG1 A;  2DYB A;  3THK A;  5FW9 A;  2K6D A;  1CKB A;  1GBQ A;  5IXF A;  3I35 A;  1HD3 A;  2QDL A;  1SHF A;  3H0H A;  2CSQ A;  4FSS A;  2F2W A;  2JMC A;  1RLP C;  2KYM A;  2SRC A;  1Y57 A;  1NYG A;  3QWX X;  5FWB A;  2FEI A;  1M3C A;  5GJW B;  1WXU A;  1T3L A;  1UGV A;  5IHN A;  2LQW A;  3M0U A;  4AG2 C;  2RMO A;  1K0S A;  2PNI A;  2DMO A;  3UAT A;  2C0T A;  2KEA A;  2CH4 A;  1NEB A;  2K3B A;  2DL8 A;  1H3H A;  2CT4 A;  1RUW A;  4Z89 A;  2GTO A;  2DE0 X;  2KYB A;  3M0P A;  3VS6 A;  1KFZ A;  2W0Z A;  1M3A A;  3VS5 A;  2HBW A;  4J9I A;  2E5K A;  2HDA A;  1NLP C;  3REB B;  2KR3 A;  2YUN A;  2NUZ A;  1M8M A;  2C0O A;  2EQI A;  2K9G A;  4ORZ A;  2BZX A;  1E6G A;  1G2B A;  1PHT A;  1YCS B;  4RTT A;  5L23 A;  4HVV A;  2J7I A;  4F16 A;  1E6H A;  1CKA A;  2O2O A;  2JMA A;  3EHR A;  2DVJ A;  1TG0 A;  4J9F A;  3VRY A;  5EC7 A;  2JW4 A;  3ZL7 C;  2RQT A;  3I5R A;  2A08 A;  1AD5 A;  1X2K A;  4JJD A;  3UA6 A;  1N5Z A;  4D8K A;  2CSI A;  2D8H A;  3NGP A;  2O88 A;  1IO6 A;  2EPD A;  3H0F A;  3U23 A;  2LJ3 A;  4KRT A;  3FJ5 A;  2A28 A;  3REA B;  4AFQ C;  3JV3 A;  1GBR A;  2OAW A;  2KRO A;  1AWO A;  2YUO A;  5I11 A;  4WCI A;  2KT1 A;  2LP5 A;  2ESW A;  2HEQ A;  1KIK A;  2F2V A;  3NPF A;  3PVQ A;  2LJ0 A;  2RNA A;  2EGE A;  4IIO A;  1LCK A;  3NMZ C;  2YUQ A;  4GBQ A;  1YN8 A;  2EYY A;  2LQN A;  1JO8 A;  2ABL A;  4JJB A;  1K0X A;  1ABO A;  3SHW A;  1SEM A;  3H0I A;  3UA7 A;  3EG3 A;  3I9Q A;  4HVW A;  3KFV A;  1U5S A;  2DX1 A;  1SPK A;  4AFS C;  1BK2 A;  1T3S A;  3GBQ A;  5HCK A;  2ECZ A;  2KBT A;  1OEB A;  4F17 A;  2JS2 A;  1H92 A;  1QKW A;  1CSK A;  3LH5 A;  4DEX A;  1AEY A;  3M0Q A;  1GL5 A;  2AKL A;  2ROT A;  2FPE A;  2P4R A;  4X1V A;  1K1Z A;  4JZ4 A;  2MOX A;  1X2Q A;  5FWC A;  2DLP A;  2EYZ A;  1WDX A;  4M4Z A;  3M0R A;  4R0K A;  2OI3 A;  1X6G A;  1WFW A;  1UJY A;  3M0S A;  2PZ1 A;  2H8H A;  1GFC A;  1UTI A;  4HCK A;  1M30 A;  2FRY A;  5ECA A;  1WX6 A;  1B3Q A;  1UDL A;  2CRE A;  2YSQ A;  4RTY A;  1ZLM A;  4DEY A;  4J9D A;  1RI9 A;  1M3B A;  4ESR A;  1W1F A;  4EIK A;  2V1R A;  2A37 A;  2DL3 A;  1I07 A;  2ENM A;  2K2M A;  3TSZ A;  4OMN A;  4CC2 A;  1YWO A;  2J6K A;  4LUD A;  2LNH B;  2KXD A;  1WI7 A;  1VA7 A;  1K76 A;  1SRM A;  2D8J A;  2MIO A;  2KRM A;  2O9V A;  3I5S A;  4QT7 A;  4Z8A A;  1HSQ A;  2L2P A;  4J9G A;  2JT4 A;  2W10 A;  2FRW A;  2CUD A;  2L3Q A;  1OV3 A;  3EGU A;  1X27 A;  2DBK A;  3PVL A;  1QWE A;  1WYX A;  3H41 A;  1VYV A;  2ED1 A;  1V1C A;  1GCQ A;  2C0I A;  2V1Q A;  4K11 A;  1Y0M A;  4LNP A;  2GTJ A;  1UHC A;  1S1N A;  1PKS A;  1ZX6 A;  2RF0 A;  1MV0 B;  2LJ1 A;  2KRN A;  2LX7 A;  1FYN A;  1PRM C;  2JM8 A;  4OMP A;  2KRS A;  5IH2 A;  2L0A A;  1BBZ A;  2KGT A;  1JEG A;  3IQL A;  2RPN A;  2A36 A;  2X3X D;  2MCN A;  1J3T A;  1UEC A;  1AWJ A;  2J6F A;  1GCP A;  4E6R A;  1TUC A;  1K4U S;  2KT8 A;  2RN8 A;  2LCS A;  1PWT A;  2RQU A;  2YDL A;  2LMJ A;  1UFF A;  4J9H A;  2G6F X;  4OML A;  1JXM A;  3VS2 A;  4OMO A;  2LZ6 B;  1VYU A;  1W6X A;  2EYX A;  4RTX A;  1WXT A;  4IIM A;  3RBB B;  4AG1 C;  2RQR A;  3SEM A;  5I22 A;  4J9B A;  4D8D A;  4RTV A;  2ROL A;  2D0N A;  2HCK A;  2RQW A;  2EGC A;  2AZS A;  2CDT A;  2IIM A;  2D1X A;  1AWX A;  2DJQ A;  2ED0 A;  3NHN A;  2YUP A;  2YT6 A;  2O31 A;  4LN2 A;  1TUD A;  2L3P A;  1UE9 A;  2JM9 A;  1A0N B;  1MV3 A;  1I1J A;  1NYF A;  4LUE A;  4RTW A;  1ZUK A;  1JQQ A;  2SEM A;  4LE9 A;  4J9E A;  2DBM A;  2FPD A;  1YNZ A;  2DIL A;  3EHQ A;  2KE9 A;  5IHI A;  1MUZ A;  3VS4 A;  1EFN A;  1ABQ A;  3A98 A;  1Z9Z A;  2DL4 A;  1X69 A;  2NWM A;  1QKX A;  1ZUY A;  1Z9Q A;  1UHF A;  2DF6 A;  1AZE A;  2CT3 A;  1JXO A;  3M0T A;  1ARK A;  3O5Z A;  1K9A A;  1ZUU A;  2GQI A;  4AFZ C;  2PTK A;  4OMM A;  1JU5 C;  2AKK A;  2FG0 A;  4RTZ A;  3R6N A;  1UUE A;  1I0C A;  2BZY A;  1HJD A;  2K79 A;  1T0H A;  1QLY A;  1AZG B;  2HSP A;  3ULR B;  2GGR A;  1YWP A;  4RUG A;  1PRL C;  2FO0 A;  2DRK A;  1KJW A;  3TVT A;  3VRZ A;  4CC7 A;  3CQT A;  1UG1 A;  1UJ0 A;  1X43 A;  2J6O A;  2JS0 A;  1BB9 A;  3QWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...