1TG0A

0.97-a structure of the sh3 domain of bbc1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
66
structure length
66
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin tail region-interacting protein MTI1
publication title Saccharomyces cerevisiae SH3 domain structural genomics
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 15
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1tg0A00
3FJ5A 3EGUA 2EYXA 2FG0A 4AG2C 4QT7A 4AG1C 2DNUA 2E5KA 5FWBA 1GL5A 2VVKA 1HD3A 1PRMC 2EQIA 4RTYA 1PKSA 4HXJA 1GBRA 3H0FA 1T3SA 2DMOA 2JXBA 2D1XA 1IO6A 2EW3A 2HEQA 3VS0A 1X6BA 1UECA 1OPKA 1GFDA 1M27C 1W6XA 2PTKA 1NYGA 3CQTA 2ROTA 2BTTA 1NM7A 2V1QA 1ZUKA 1CKAA 1GCQC 2RQVA 2KGTA 2EPDA 2RQWA 1AWOA 2KRNA 5IHNA 2ESWA 2ABLA 2DL5A 1B07A 1UDLA 2GTOA 2L3QA 2VWFA 4R0KA 1WLPB 2JM9A 4A63B 1OV3A 1UGVA 2YUPA 2JM8A 1UJ0A 2DF6A 2KYMA 1K4US 1UE9A 3EG0A 2K3BA 1JQQA 2HDAA 2O9SA 4F14A 2FO0A 2RQRA 2L2PA 5IHKA 5GJWB 2RNAA 2CH4A 2FEIA 1VA7A 4RTWA 2RMOA 2GBQA 1X2QA 1ZSGA 2LQNA 1WYXA 4HCKA 4D8KA 1N5ZA 2CSIA 2NUZA 2C0IA 3EG3A 1I0CA 1Z9ZA 2RQUA 3I5SA 1SSHA 1I07A 1NEBA 1SRLA 2O31A 2A36A 5FW9A 4E6RA 1T0JA 2YDLA 1KJWA 2M0YA 1KFZA 1BB9A 2SEMA 2CUDA 4Y92A 3UA6A 3LH5A 3M0UA 1NLOC 2EYZA 4OMPA 1X2KA 2PZ1A 1WI7A 2YUQA 1UJYA 1Z9QA 1EFNA 2KBTA 2OI3A 1SHGA 3PVLA 1MV0B 2EVRA 1H92A 2AKKA 4OMQA 1NYFA 2W10A 2ED0A 4HVUA 4AFSC 1T3LA 1YWOA 2EGEA 3RNJA 3ZL7C 2AZSA 1K76A 2B86A 2YUOA 3UATA 1VYTA 2L0AA 1YN8A 5I11A 4F17A 2J06A 1JEGA 1HSQA 2EYYA 4J9FA 4DEYA 1AWXA 1PHTA 4OMLA 2LZ6B 2MCNA 4LE9A 2BZ8A 1K0SA 2BZXA 1WDXA 3M0RA 3ULRB 1X43A 2BZYA 2V1RA 2O88A 1G83A 1X27A 2O2OA 3NMZC 2OAWA 1AWWA 2CUBA 1X69A 2LMJA 1G2BA 3M0SA 1UTIA 2LJ3A 2GQIA 1WX6A 4JJBA 3NPFA 4J9BA 4JZ3A 1ZLMA 1YP5A 2X3WD 2J7IA 2HSPA 1NLPC 4DEXA 4JPBW 1B3QA 1KSWA 2RPNA 1YWPA 2PNIA 2KT1A 2LP5A 2LJ1A 4ZNXA 5HCKA 1AEYA 1GCQA 2A08A 1ABOA 1QLYA 2ENMA 1VYUA 1NEGA 2OJ2A 4HVWA 4J9EA 1CKBA 3VS1A 2K79A 3KFVA 1E6GA 4M4ZA 2G6FX 2AKLA 2J05A 3VS2A 1OEBA 2D0NA 2RF0A 2DJQA 1MV3A 1X6GA 1MUZA 1K9AA 1TUCA 2GGRA 2KXDA 2DE0X 2JTEA 2C0OA 2D8HA 1SPKA 1A0NB 2K9GA 3VS3A 5FWCA 1WXBA 2M51A 1U3OA 5GJVB 2KNBB 2JS0A 5IXFA 3GBQA 5IHIA 1J3TA 2MIOA 2KE9A 4RTUA 1M30A 2NWMA 2GNCA 1U5SA 3EG1A 3REAB 3NHNA 2F2VA 4LUEA 2VKNA 3PVQA 3M0QA 4Z8AA 2JMCA 2AK5A 2HBWA 3VS5A 1ZUYA 2KROA 2K6DA 1JXMA 2LCSA 3VS7A 1UUEA 4CC3A 2ROLA 3SHWA 2JT4A 4JZ4A 1PNJA 1TUDA 2DL7A 1QKWA 3UF4A 2HCKA 1GRIA 2MOXA 1UG1A 2SRCA 1ARKA 1U06A 1M3BA 4CC4B 2L3SA 4ESRA 4CC2A 1AZGB 3VS4A 2A28A 4AFZC 4J9IA 1FMKA 2W0ZA 1SEMA 1KIKA 2YT6A 4J9DA 1RUWA 1OOTA 4Z88A 2ECZA 2LNHB 1TG0A 2J6FA 2IIMA 1M8MA 1GFCA 2DM1A 1AVZC 2O9VA 1I1JA 2KYBA 2DVJA 1JXOA 1H3HA 2DL4A 3TVTA 3C0CA 3O5ZA 4IIMA 4AFQC 2F2XA 2LQWA 4JJCA 2QDLA 1NG2A 2CT3A 4LUDA 2LJ0A 1SHFA 2LX7A 1JO8A 2KRSA 2JMAA 1Y57A 3NGPA 2FRYA 4LNPA 2CSQA 1HJDA 2CH4W 1WXUA 3A98A 1BK2A 3TSWA 1RI9A 3H0IA 1WA7A 4WCIA 3QWYA 3R6NA 2DRKA 4FSSA 4RUGA 2ED1A 2EBPA 1GCPA 2P4RA 1UHCA 1ZUUA 2DBMA 1PWTA 2JW4A 2DLPA 3VRZA 4HVVA 4AFUC 1ZBJA 4X1VA 5I22A 2EYWA 1AOJA 3EHRA 2J6OA 2DL3A 1M3AA 3SEMA 4K11A 2K2MA 3RBBB 1V1CA 2EKHA 2KT8A 2EGAA 4J9CA 2XMFA 4ORZA 2C0TA 2GTJA 2L3PA 1ZX6A 2DRMA 3H41A 3THKA 1S1NA 2J6KA 4Z89A 4F16A 2RN8A 2KXCA 1YCSB 3UA7A 1RLQC 2KEAA 5EC7A 1FYNA 1WXTA 1QKXA 2DA9A 1WIEA 3IQLA 2EGCA 4OMNA 1CSKA 1AZEA 1QCFA 2D8JA 5L23A 3I35A 3QWXX 2I0NA 2CDTA 3EHQA 1OPLA 1AWJA 1H8KA 2CT4A 2DL8A 3PE0A 3VS6A 1E7OA 1RLPC 2CREA 2FPFA 2F2WA 1UFFA 1VYVA 4IIOA 3U23A 1PKTA 2YSQA 1LCKA 3M0TA 3EG2A 1GBQA 2K7AA 2YUNA 2FPEA 3I5RA 2JS2A 4RTZA 1BBZA 1WFWA 1YNZA 1M3CA 1PRLC 1ABQA 2H8HA 2KRMA 4GBQA 4RTTA 4OMMA 1JU5C 3VRYA 1K1ZA 1BU1A 2DX1A 4J9GA 2FRWA 4LN2A 4D8DA 4J9HA 1T0HA 4GLMA 1W1FA 4RTXA 3M0PA 2DBKA 3I9QA 2DYBA 2A37A 4OMOA 4RTVA 3H0HA 1QWFA 4KRTA 3JV3A 2X3XD 5ECAA 3TSZA 2AZVA 1E6HA 4CC7A 1K0XA 1AD5A 3REBB 4EIKA 5IH2A 5IXBA 1SRMA 2DILA 4JJDA 1XOVA 2RQTA 1UHFA 1W70A 1Y0MA 2FPDA 1QWEA 2KR3A
chains in the Genus database with same CATH superfamily
2L8DA 4EMKA 2EYXA 4QT7A 3A8HB 1TXQA 4XTZA 3CMAA 5CKFA 2EQIA 2LCLA 1PKSA 3H0FA 3CC7Q 3VS0A 4E7KA 1ZSZB 4KUIA 4BY6B 1M27C 4FCYA 2BTTA 2M02A 3QYHB 3PMIA 4FW2A 1M1GA 3G6EQ 5GAMd 4R55A 3QKJA 1Q86U 3KUFA 2VXFA 1AT1B 1AWOA 2KRNA 2ESWA 1XNIA 4XAXB 3PGGA 4F7UF 2DL5A 1NJIC 1UDLA 3Q1JA 2NUTA 3CPWA 2VWFA 3M4YA 5D6XA 3CMAQ 1WLPB 2XU8A 2JM9A 2JM8A 4P5NA 1SG5A 2VYTA 2F5TX 2DF6A 1IRXA 1Q7YR 4LDUA 1QP2A 2YLBA 2KK4A 2O01E 2YRCA 1LJOA 3CC2T 2QI2A 3MEVA 1G5VA 2RNAA 2WSCE 3A8MB 4XTVA 3OYLA 1X2QA 5AYFA 1WHJA 1PSEA 4X9CA 4D8KA 1N5ZA 2NUZA 4JJNK 1I07A 1NEBA 1KC8R 3S3MA 2O31A 1RADB 1ZQ1A 2A36A 4E6RA 4ELYC 5GAN2 5I21A 1BI3A 1KFZA 2SEMA 3OS5A 3OYFA 2CUDA 2E5QA 4Y92A 3UA6A 3LH5A 3V7CA 3SWNA 2YRVA 4A4EA 4DBQA 3OS2A 1NLOC 2ZPIB 1HYOA 4OMPA 1XQHA 3L2ZA 4DOWA 1QW1A 5LJ5f 2KBTA 2OI3A 1UGSB 1SHGA 2EVRA 2AKKA 2Y4XA 2ED0A 3SB2A 1F1BB 5LJ5h 4AFSC 1T3LA 2RJEA 3HFOA 3ZL7C 1I8FA 2CGHA 5I2MA 1VQMT 1B7TA 4XTUA 2L0AA 4F17A 1BYMA 1HSQA 4J9FA 5HY6A 4DEYA 1VQ9A 1ZA2B 3MP8A 1WGSA 3VYGA 1Q86R 2Y4YA 4LE9A 4XTXA 2JN0A 3JAME 2BZXA 5LL6S 3M57A 2VGNA 4GY5A 4PJLA 4N0AA 3CPWP 2DXBA 2V1RA 1X27A 2CZ1B 2O2OA 2OAWA 4IUUA 1NPRA 5DY9A 4MZPA 5A0LA 4M7AA 5KE2A 1UTIA 2LJ3A 3JCMe 1B34B 2DXCA 1JJ2A 3NPFA 3G4ST 1ZLMA 1QVFS 3M53A 2WSFE 1V29B 4JS5A 1KQ2A 4M78F 4A4GA 2GF7A 3VKIA 1VQMA 4ME7A 4C92C 1VQ9Q 3EFOB 1KD1U 2RK1A 1AEYA 1GCQA 2A08A 4RG2A 2MK5A 2M9UA 1N8RU 1QLYA 4BE1A 5KYNA 3RKYA 1OQKA 4C8QE 2QGGA 3UDCA 1X6GA 3CCVA 1TUCA 2GGRA 4M75B 1IXDA 1G3TA 3G4SA 2MWPA 4M7AG 2M51A 1U3OA 4EDUA 5GJVB 1VQMQ 1IHWA 4CRIA 1ZSZA 2MIOA 2E6NA 3VUBA 3OYAA 3SDZA 3REAB 4L6V5 1VQNA 1YJ9T 2YHTA 2X51A 1U1SA 2EKOA 3OBWA 3PVQA 4A4FA 4E2FB 3VS5A 3WVEB 3JCMg 1JXMA 2RHIA 3QJ6A 3CCVQ 2XDDA 5CO7A 4JZ4A 2V8JA 4C0DC 2K4YA 5CQYA 2LC4A 3G4SQ 1IREB 5A0DA 1U06A 2YRDA 3A8GB 3QUIA 2BIVA 1KC8C 1M3BA 4ESRA 3VS4A 2XK0A 4AFZC 2XD0A 2RA2A 2W0ZA 1SEMA 1VQNQ 3QZ9B 1YJ9A 1RUWA 1JBMA 2LNHB 2GFUA 4F7UB 1M8MA 2HMAA 2DM1A 2JTMA 3I55A 2DERA 5LJ3f 2V26A 1KD1R 1H3HA 2CZ7B 3C0CA 3O5ZA 1M1KC 2QDLA 5LJ3h 2L3RA 1R77A 2LJ0A 2LX7A 3JB9H 2O4XB 2CSQA 2QQAA 4M7DC 1RI9A 4EMHA 1I4K1 1KQSS 1WA7A 3QWYA 1XTDA 5CCAA 4FSSA 2Z0WA 3X28B 4NL2A 1PD0A 2GCXA 2DXTA 1YJ9Q 3FC3A 4LD6A 2JW4A 2RHYA 2DLPA 5KE3A 4ZTFA 4DBRA 1RL2A 1QVPA 1TS9A 4BE0A 3I55Q 4X1VA 5I22A 2R5MA 2J6OA 2HL5C 2DL3A 1M3AA 3G71T 1U1TA 1S72T 3J81E 3RBBB 2DEQA 4J8OA 3OYMA 2E6ZA 2XMFA 2RHXA 2Y90A 2C0TA 3OYYA 3CCST 4FU6A 2H3EB 5GAOr 5GMKe 4EPCA 4C0ZA 2J6KA 2NUPB 3BY7A 4Z89A 2VUBA 4XU3A 2RN8A 3OYGA 3F70A 1RLQC 2KEAA 2KAFA 5EC7A 3ZBDA 5DLQE 1WXTA 2R58A 2IG0A 2EQUA 5LJ5d 1PCXA 1PC0A 1Y71A 4YTLA 3JCMb 3MEAA 1IGUA 5FRNA 4C92D 5KH6A 2DYIA 3I35A 3QZ5B 3JCMP 5J3BA 4JRQA 4L59A 4C8QA 2EQJA 3ER0A 3OB9A 2CT4A 3BDUA 4J5YA 2CYZB 1UFFA 1W2BA 4BD3A 4M75A 4QVDA 2CP2A 3EH1A 4M78B 2DK3A 3OYEA 4N4IA 3EG2A 1QVGS 2KMTA 4RTZA 1YNZA 1EX4A 3CEYA 2CZ6B 1OX8A 2DETA 2QG9B 2P0KA 3FJPA 4EMKB 3CBOA 2CP6A 1BU1A 1PD1A 2FRWA 2XDBA 4GLMA 3M0PA 2PVDB 2D9TA 2A37A 5D6WA 1PG5B 4RTVA 4C8QG 1K73U 3H0HA 2QYZA 4OB0B 4OVAA 4FT2A 1E6HA 2KVQG 4OP0A 3RMQA 3CCMT 4BUGA 3REBB 2RHZA 3JCMf 1K9MU 1QQJA 1VOMA 2KI7A 4N4HA 2LX9A 3EGXB 4E7LA 1BI0A 1Y0MA 3JCMh 3S6WA 4Q5WA 3OMGA 4PJOC 2KR3A 3EGUA 4B9WA 2HQHA 4F7UA 2DNUA 3OYIA 4M77C 1VQ7A 1GBRA 2V8KA 4M7AC 3JCMc 3OYNA 3LW5E 1N6AA 2D1XA 2K3XA 3CCJA 2EW3A 2LNVA 4C5HA 1W6XA 1NYGA 4BB7A 2ROTA 2PUKB 1NM7A 2V1QA 5IN1A 1WHMA 3DB3A 1ZUKA 1GCQC 1VQPT 3MJXA 4E7JA 4J6XA 2OAUA 3G1JA 4FYWB 5IHNA 3RUXA 3V7SA 1U8RA 3GIBA 4M7DD 5KYXA 2ABLA 3TCJA 1B07A 2EIFA 2HQEA 1YHQA 1OV3A 2K2VA 1UGVA 2YUPA 1VQ7Q 4F7UG 1MNEA 2KYMA 1UE9A 3EG0A 1TOVA 5KYWA 1HXDA 3CCJQ 2CZ0B 2K3BA 2DKGA 2HDAA 4BE2A 4J7FA 3OW2A 3L2WA 1KK7A 2FEIA 1ZSZC 3CC4A 1NE8A 3CC7T 5LJ3d 1K73R 5DLOA 1WYXA 2HL3A 2F5KA 1VQPA 1W4SA 3QYGB 2CSIA 2QK0A 3EG3A 2KSSA 3EGDB 2NUPA 4C0GA 1SSHA 5GANe 2MF2A 4ATOA 2EQMA 5FW9A 4KGVB 1YHQQ 1K9MR 2KQWA 1KJWA 2A7YA 2M0YA 2JNGA 1BB9A 2EJ9A 1WHLA 5CKBA 1OU8A 1RAIB 4A53A 2C06A 1D3BB 1O75A 1Z9QA 3PTAA 3HTRA 1I5OB 3CC4Q 4DBFA 1H92A 1M2VA 1NYFA 4FM4B 5CKHA 3M55A 4HVUA 3JCMJ 3CPWS 1VQPQ 1YWOA 2LRQA 2AZSA 5J26A 2B86A 4M78A 5KYUB 5KCOA 1IHVA 3HRSA 1QP3A 1YN8A 5I11A 2J06A 3WVDB 1JEGA 3QSUA 1PHTA 1Y96B 2LZ6B 4II1A 2K57A 3L2QA 1K0SA 2OTLA 3M0RA 1X43A 2O88A 3FEOA 4DQ2A 1AWWA 2DEUA 3GNFB 4LXCA 2X4WA 2DTHA 1X69A 3NFCA 2LMJA 5GANg 4XK8E 5C6SA 1BKBA 1YP5A 2J7IA 3OW2P 1NLPC 1KHCA 2ATCB 1KSWA 2RPNA 2PNIA 2KT1A 2P84A 3MP1A 3QG1A 5HCKA 3MHXA 4M78G 1ABOA 2ENMA 1EZZB 1NEGA 3EGXA 2K79A 5GMKh 2OTLQ 3AHUA 4M4ZA 2G6FX 3VS2A 3HRTA 3ASKA 4FL6A 2RF0A 2F69A 3X20B 4PJOD 3RR6A 1WZOA 1SPKA 1FMWA 1A0NB 3VS3A 4M77D 4GLKA 3CPFA 2KNBB 4BI3A 4XU0A 4M7AD 3RDVA 3GBQA 4OB2B 4QQDA 3VJPA 1M30A 3LH0A 4E7SA 3M0QA 4Z8AA 1MMGA 2KROA 1RAAB 3HFNA 1VQ9T 2LCSA 1M5Q1 2CP3A 5GAN5 2HZYA 1LPLA 3BFMA 2ROLA 3JCMd 1RAGB 1K73C 1YITT 4M75C 1IB8A 4HCZA 3QBYA 4PFZA 2ZPFB 4CC2A 4KULA 4C5EA 2VGMA 1K9MC 2A28A 1G3WA 1UB4A 4J9IA 1FMKA 1KIKA 5GAMe 4J9DA 5GMKl 2ECZA 3JCMX 2J6FA 1D0XA 2OX7A 3EGDA 3OQ5A 5CAIA 3L2RA 3LGLA 1DJ7B 4OMFB 2DL4A 3TVTA 2DTIA 4IIMA 4JJCA 2CT3A 2DD5A 1YITA 1KHIA 2PQWA 1VQ5T 3DLMA 3NGPA 3CCVT 1VQ6A 3QO3A 4LNPA 1WQWA 1D3BA 2FVUA 1BK2A 2ZAEA 4ZN3A 4OGEA 4WCIA 3RESA 2DRKA 5IT9E 1FXXA 2ED1A 2EBPA 2P4RA 1PWTA 1LOJA 1VQLA 2EYQA 2LQKA 4J6YA 4AFUC 4XU2A 5KYUA 1ZBJA 4LDVA 1BIBA 1VQNT 1Y96A 3SEMA 3CXCA 4K11A 2K2MA 4MZTA 1YITQ 3OYCA 4C8QB 1M4ZA 3DB4A 4C5GA 5GAMg 1VQ5A 1VQ6Q 2EGAA 1OU9A 2HBPA 4KGZB 4J9CA 4M7DF 4BACA 5GAN3 1M2OA 1Q81U 2GTJA 1VIFA 5M9OA 1KQ1A 2RHUA 3AT1B 3H41A 1VQLQ 4FYXB 3KBGA 2KXCA 3UA7A 3A8LB 1QMCA 4IUPA 1QCNA 4Y28E 3OA6A 2DA9A 3R6OA 3JB9F 3EAEA 1Q7YC 5L23A 3FLGA 3I55T 2XIDA 1VQ5Q 1AWJA 1WJRA 2QA4A 3OYBA 3QXEB 3CCRT 4IIOA 3PIOA 3U23A 8ATCB 1BI1A 2YSQA 9ATCB 2MYSA 3JRZA 2GQVA 5KCHA 4MMKA 2JS2A 2RK2A 2QTXA 4FIBA 1YIJT 1WFWA 1QVFA 1M3CA 1PRLC 4ZGDB 2H8HA 4BDYA 1JJ2P 2KRMA 3MKDA 1YJWT 4VUBA 4OMMA 2G3RA 3L2UA 3H8ZA 5D7UA 3UPUA 1JU5C 3VRYA 3VU3C 1K1ZA 4J9GA 4O5VA 1W1FA 2QA4Q 4RTXA 1M90U 3CXCP 2X35A 3I9QA 1N8RR 3V7RA 1FX7A 4KRTA 3JV3A 3CCRA 2X3XD 4IUQA 3A5ZB 1K0XA 1AD5A 4C92E 4M78C 4PFPA 1YIJA 4M75D 4QVZA 4EIKA 5IH2A 3PNWC 1SRMA 2DILA 1UHFA 1YJWA 4IKFA 1W70A 1Q86C 5KYXB 3OYDA 4C0FA 5GAOn 3FJ5A 4AG2C 4EMKC 4AG1C 1W2BS 5GMKj 3PIPA 5CIUA 1TTHB 1PRMC 2XICA 1YFNA 4RTYA 3WXMB 2ZPBB 1TUGB 4X9DA 2HD0A 5KYWB 3QJYA 2LDMA 1T3SA 1H641 3CCRQ 2JXBA 2P0PA 5GMKm 1IO6A 1IGQA 1GFDA 2VB6A 2PTKA 1MHNA 3CQTA 3CMEA 1YIJQ 2DD4A 1C0MA 4PJOF 1YJWQ 2KGTA 2QQBA 1M8VA 3OY9A 5GAN4 4HCBA 1BIAA 5GAN8 3CBMA 2L3QA 3OMCA 4M77F 3MCAB 4C0DB 4A63B 2YWWA 1UJ0A 2D6FA 2DIGA 1RAFB 1TSFA 2O9SA 4F14A 5CK9A 7AT1B 2FO0A 2L2PA 5IHKA 2IPOB 5GJWB 3VYHB 3CMEQ 1M2VB 3QDFA 1M90R 1VA7A 1BCOA 4RCBA 4RTWA 3OBYA 2CP7A 4ANJA 2GBQA 1ZSGA 1UGQB 4E7HA 4RMOA 1I0CA 2JUFA 3CCLT 1KQSA 1LNXA 1SRLA 2EFIA 8AT1B 2COWA 2YDLA 2DIQA 3L1AA 1WJSA 4OB3B 5GAOp 3CCQT 1Y7XA 2EYZA 3SWNC 1NPPA 1WI7A 4M7DB 4M7DE 4NOYA 2EWNA 1MMAA 1VQ7T 4QW2A 1VQKA 3CCJT 2DAQA 2EGEA 3HKSA 3URGA 3JB9I 1TH7A 3BE3A 3ZEHA 3CCLA 2JOYA 2QASA 2EYYA 1AWXA 1XJWB 2YXYA 4OMLA 2XHCA 4MZMA 1KD1C 4QKUA 3EG9B 5LJ5e 1N8RC 3OW2S 4KH0B 4PFOA 2BZ8A 1WDXA 2COZA 3CCQA 2BZYA 4N0AC 1YHQT 1UGPB 4Y91A 3NMZC 5HKCA 2F1LA 1WJQA 2CUBA 3M0SA 1G2BA 1WX6A 1VQKQ 4RCCA 2PVOB 2FB7A 2X3WD 5GAOl 2HSPA 4J83A 2D0QB 3CCLQ 3G7ZA 4DEXA 4MDWA 3RERA 3MEWA 3CC4T 2K5LA 3V8KA 1YWPA 1W2BP 2LP5A 3P8BB 1QCOA 2DPPB 1QVGA 4UC4A 4M78D 2OJ2A 4HVWA 2RD1A 3D7SB 1CKBA 3KFVA 2WSEE 4KT0E 3CCQQ 4Z02A 2D0NA 2NYSA 2X4YA 1OZ2A 2DJQA 1K9AA 2KXDA 5GANj 2LT4A 4ZTJA 2JTEA 2KY9A 2C0OA 2D8HA 4ZGJB 2DXUA 3V8LA 2K9GA 1D1CA 3X25B 3GOXA 5LJ5g 2R5AA 3RKWA 3EFRA 4QVCA 5IHIA 4F04B 4BY6C 2KE9A 1Q82U 2GNCA 1U5SA 2E1HA 3EG1A 3GF5A 1R0CB 2L5QA 2OTJT 2PU9B 2VKNA 5CR2A 4XQ3A 3VUZA 2JMCA 1NZ9A 5IAYA 4CI0C 1H3ZA 2JVVA 2FYKA 1D1BA 3VS7A 1M90C 4CC3A 2P0QA 2JT4A 2LTOA 1ACMB 3CCUT 2DL7A 1QKWA 2E4HA 5FU7B 2BKDN 4E7ZA 2OTLT 2MOXA 3E9FA 1UG1A 2E41A 2HAXA 2JJ9A 2QXFA 3M56A 2L3SA 4WTOB 2RI3A 1AZGB 4PJOB 2CKKA 1OYXA 3TEEA 4B6MA 4PJOE 2V8IA 2YT6A 4PJMA 1MNDA 2M16A 3V8JA 2WACA 4Z88A 2K3YA 2OTJA 3PFSA 5C0MA 2IIMA 3M4GA 1AVZC 4M77E 2ZPHB 5A0GA 1G8XA 2KYBA 2QQ9A 4M7AE 4A54A 3N5BB 4JRIA 5CKDA 1YCYA 3C12A 3JSCA 4M75F 4AFQC 3CCUA 1NG2A 1R8OB 1SHFA 1BCMA 4A4HA 2DVEA 5FU6B 2JMAA 2VC8A 2FRYA 3INZA 2COYA 1SSFA 4E47A 4M7DA 1HJDA 2CH4W 4HA8A 3TSWA 4RG8A 2PUOB 4JLGA 5D6YA 3J80E 4RUGA 2RB6A 1UHCA 5I2SA 1ZUUA 2OTJQ 2E65A 4HVVA 2FZGB 5L8RE 5FROA 1Q95G 4NS5A 2EYWA 3FRNA 2CP5A 3EHRA 1I81A 1Q82R 2A0FB 5J39A 4JUVA 1M1KU 3CCUQ 3EG9A 3GP8A 4DBHA 3SFMA 3LX7A 1M9SA 2DO3A 4KH1B 1V1CA 2EKHA 2M1HA 2RI2A 4ORZA 1ZX6A 2LCCA 1ZHIA 2QAZA 4AMCA 3OSSC 1S1NA 2I2LA 2MMPA 4M7DG 1YJNT 5KYYA 1YCSB 3P8HA 4C92F 3C4SA 3PMTA 3JCMW 2DJZA 4XU1A 3LWHA 1QKXA 1OX9A 1WIEA 1C6VX 3IQLA 1O9SA 2EGCA 4OMNA 2HKNA 2E64A 3L42A 2VASA 1QCFA 1JB0E 2JTFA 3EFSA 3QWXX 2I0NA 5GAMj 2CDTA 5GAOm 1PSFA 5LJ3g 1JJ2S 3CCET 3J7AF 1OPLA 3M54A 3JB9G 4OGCA 4C8QC 1OZ3A 4PNOA 3PE0A 2FL7A 2RJDA 2FPFA 1VYVA 1OI1A 4N4GA 1G3YA 2FZCB 3BDLA 1PKTA 1LCKA 1VQ6T 2EJGA 1YJNA 1GBQA 2K7AA 3CXCS 2FPEA 1BBZA 2ZPGB 3GNGA 3ZFJA 1EIFA 2HNIA 4GBQA 1VQLT 2ZZDA 5FRMA 4MDXA 2DX1A 3CC2A 3CCEA 1HK9A 1X75C 2EQKA 1M1KR 3CBPA 2QQSA 2AZVA 2HQXA 2QTVA 1YJNQ 2L89A 1UEBA 4JJDA 1XOVA 2MAMA 4X34A 4PJOA 1N9RA 1IZ6A 2VXEA 2FG0A 5GAN7 3OSVA 2E5KA 5FWBA 3CC2Q 3A8OB 4RKUE 3CCEQ 2E3HA 1GL5A 4M77A 2VVKA 3LYIA 1HD3A 4QQ6A 2DFUA 3TQ7P 4HXJA 1C1AA 4PKCC 3S3NA 5CVIA 2DMOA 4IURA 3FDRA 1MMDA 2HEQA 4IUTA 1X6BA 1UECA 1OPKA 2FZKB 2QA4T 2CP0A 1Q82C 1CKAA 4PLIA 2RQVA 4AT1B 2EPDA 4NL3A 2RQWA 4PJJA 1SF9A 1K8AU 2RI5A 2GTOA 2YLCA 4PJOG 3HPWA 1WPYA 4R0KA 4FT4A 1SKUB 2X4XA 4C5IA 1VQOT 4M75E 1K4US 4M77G 5GANf 4FYVB 1JQQA 3DKMA 2ZCFB 5GANh 2RQRA 1TWBA 4KUDK 2R57A 4HKEA 2CH4A 3UWNA 2B8AA 2E3IA 3PT9A 2RMOA 3TU4K 2XKOC 5GAOq 2LQNA 4E7IA 4HCKA 4J7IA 4PJNA 2C0IA 4HT9A 1Z9ZA 3TREA 3A1PA 2RQUA 3GPLA 3I5SA 1RABB 4JLIA 4R56A 3E19A 1T0JA 3OS0A 3S3OA 1M1FA 4IUVA 1VQOA 3M0UA 4QQGA 2LQ8A 1X2KA 2PZ1A 2YUQA 1UJYA 1OULA 3NTHA 3LWIA 1EFNA 3HSBA 1PM3A 1VQ4T 2NLUA 3PVLA 1MV0B 2AT1B 3FB9A 4OMQA 2W10A 2QQRA 4C8QD 3RNJA 4FYYB 1K76A 2X9HA 4PL6A 2RJFA 4C92B 2YUOA 4FW1A 3UATA 4F7UE 4ZN1A 1VYTA 3CMET 3E1SA 3H6ZA 4JRKA 1Q81R 1P92A 3E2UA 3CD6T 1RAEB 2MCNA 1VQOQ 1GXIE 2MPXC 2H3JA 3ULRB 4BDZA 2XDPA 1K8AR 1WHHA 2LVMA 1G83A 3M58A 3LGFA 1YBYA 3ME9A 2DZCA 3JCMV 2EJFA 3C94A 5GMKi 1VQ4A 2GQIA 4JJBA 2ZPEB 4J9BA 1WNLA 4JZ3A 3NTIA 4KGXB 3OYHA 4JRPA 1X01A 2AIRB 4JPBW 3JCMQ 1B3QA 3RKXA 3JB9J 4A4KA 3X26B 2LJ1A 4ZNXA 2RM4A 1NBEB 1VYUA 3CD6A 1VIEA 3M59A 3RIRA 1VQ8T 3M5AA 4J9EA 4LDXA 3HHTB 2DTOA 3BW1A 3VS1A 2QEXT 1E6GA 2J05A 2AKLA 3MP6A 3X24B 4D6WA 1OEBA 1QVFP 3I56T 1MV3A 1MUZA 4M7AF 4J6WA 3L2VA 2DE0X 5HK3A 1KG1A 1VQ4Q 2BE7D 3NTKA 1YI2T 1B34A 4DA4A 5FWCA 4O6JA 1WXBA 2CS7A 2JS0A 5IXFA 1J3TA 4FSXA 4RTUA 1N27A 2NWMA 4BI8B 1VQKT 2P4TA 3EFOA 3EH2A 3NHNA 4JDSA 3CD6Q 2F2VA 4LUEA 2HSEB 4PK4A 1VQ8A 2KDSA 3MO8A 3G71A 2AK5A 2HKQB 1ZA1B 2HBWA 4ZGEB 2MI6A 1ZUYA 2QEXA 1S72A 1NJIU 2K6DA 2AHJB 4ELZC 4OB1B 1RI0A 4HCCA 5EG2A 5GAMf 3I56A 3MEUA 1UUEA 3SHWA 1PNJA 1TUDA 3CCSA 3UF4A 1G3SA 2HCKA 1GRIA 2ZGWA 5GAMh 2SRCA 1ARKA 1YI2A 4M78E 5LJ5j 3QHSA 3QPHA 4CC4B 3KXTA 2K5IA 4XTYA 1D1AA 3LLRA 4V2SA 1MMNA 2A3LA 1VQ8Q 1OOTA 3G71Q 1TG0A 2BUDA 2QEXQ 1S72Q 4L5GA 1GFCA 2O9VA 1I1JA 3RMSA 3M9QA 3OS1A 3I56Q 2DVJA 4BI4A 1JXOA 1FMVA 2LT1A 3C95A 4JS4A 1N9SA 4EMGA 3CCSQ 2F2XA 2LQWA 3T9NA 2K5FA 4LUDA 1YI2Q 3HRUA 5FU7C 1JO8A 2KRSA 2IVWA 1Y57A 3META 4M75G 2RJCA 1WXUA 3A98A 1Q81C 2QDYB 2MWOA 1X6OA 3H0IA 3R6NA 5KYYB 1GCPA 3OYJA 3DLLA 2DBMA 1AHJB 2NUTB 3VRZA 5GANd 1K8AC 4XTWA 4C92A 5FLXE 1AOJA 4B9XA 2BE9B 3MPUB 3QIIA 3UT1A 1KQSP 1NJIR 3H9NA 2KT8A 3HL8A 3CCMA 2FHDA 5FU6C 2JZ2A 3SD4A 2L3PA 2O4XA 4LDWA 4OF1A 2DRMA 3THKA 2DZ9A 5AT1B 4HT8A 4F16A 4WF2A 2RO0A 4LD9K 1R0BG 1VUBA 1FYNA 1RAHB 5DM7R 2E70A 5A2QE 1RACB 3OYKA 4C92G 3P8DA 1UGRB 3SWNB 1CSKA 1AZEA 1V76A 2X4JA 2D8JA 1WHGA 5CQXA 1FWZA 3EHQA 3CCMQ 3O8VA 3HP9A 3E9GA 2RH2A 1H8KA 2DL8A 3JB9D 3VS6A 1E7OA 1RLPC 3QDRB 2CREA 2F2WA 3FIFA 5CKEA 1D0YA 3M0TA 2XI9A 4PLLA 2YUNA 3I5RA 1I5LA 2EAYA 1WHKA 1MGQA 5HK0A 3G6ET 1ABQA 2VV5A 1TU0B 4RTTA 1LVKA 1Q7YU 6AT1B 4DOVA 1D09B 2XG8D 2E12A 1JRIA 1ZBXA 2GFAA 5LJ3j 4M77B 4C8QF 3CMAT 4LN2A 4D8DA 4J9HA 1T0HA 4MMLA 3VV0A 4M7AB 1QVGP 2DBKA 1WQ7A 2DYBA 4OMOA 1QWFA 3CC7A 5ECAA 3TSZA 4LDYA 3GLXA 2PVGB 4CC7A 4TVRA 1BI2A 1KC8U 4KBMB 2M0OA 1Y07A 2QGFB 5GAN6 1D0ZA 5IXBA 3G6EA 5LJ3e 2RQTA 2E10A 2FPDA 1QWEA
chains in the Genus database with same CATH topology
3FJ5A 3EGUA 2EYXA 2FG0A 4AG2C 4QT7A 4AG1C 2DNUA 2E5KA 5FWBA 1GL5A 2VVKA 1HD3A 1PRMC 2EQIA 4RTYA 1PKSA 4HXJA 1GBRA 3H0FA 1T3SA 2DMOA 2JXBA 2D1XA 1IO6A 2EW3A 2HEQA 3VS0A 1X6BA 1UECA 1OPKA 1GFDA 1M27C 1W6XA 2PTKA 1NYGA 3CQTA 2ROTA 2BTTA 1NM7A 2V1QA 1ZUKA 1CKAA 1GCQC 2RQVA 2KGTA 2EPDA 2RQWA 1AWOA 2KRNA 5IHNA 2ESWA 2ABLA 2DL5A 1B07A 1UDLA 2GTOA 2L3QA 2VWFA 4R0KA 1WLPB 2JM9A 4A63B 1OV3A 1UGVA 2YUPA 2JM8A 1UJ0A 2DF6A 2KYMA 1K4US 1UE9A 3EG0A 2K3BA 1JQQA 2HDAA 2O9SA 4F14A 2FO0A 2RQRA 2L2PA 5IHKA 5GJWB 2RNAA 2CH4A 2FEIA 1VA7A 4RTWA 2RMOA 2GBQA 1X2QA 1ZSGA 2LQNA 1WYXA 4HCKA 4D8KA 1N5ZA 2CSIA 2NUZA 2C0IA 3EG3A 1I0CA 1Z9ZA 2RQUA 3I5SA 1SSHA 1I07A 1NEBA 1SRLA 2O31A 2A36A 5FW9A 4E6RA 1T0JA 2YDLA 1KJWA 2M0YA 1KFZA 1BB9A 2SEMA 2CUDA 4Y92A 3UA6A 3LH5A 3M0UA 1NLOC 2EYZA 4OMPA 1X2KA 2PZ1A 1WI7A 2YUQA 1UJYA 1Z9QA 1EFNA 2KBTA 2OI3A 1SHGA 3PVLA 1MV0B 2EVRA 1H92A 2AKKA 4OMQA 1NYFA 2W10A 2ED0A 4HVUA 4AFSC 1T3LA 1YWOA 2EGEA 3RNJA 3ZL7C 2AZSA 1K76A 2B86A 2YUOA 3UATA 1VYTA 2L0AA 1YN8A 5I11A 4F17A 2J06A 1JEGA 1HSQA 2EYYA 4J9FA 4DEYA 1AWXA 1PHTA 4OMLA 2LZ6B 2MCNA 4LE9A 2BZ8A 1K0SA 2BZXA 1WDXA 3M0RA 3ULRB 1X43A 2BZYA 2V1RA 2O88A 1G83A 1X27A 2O2OA 3NMZC 2OAWA 1AWWA 2CUBA 1X69A 2LMJA 1G2BA 3M0SA 1UTIA 2LJ3A 2GQIA 1WX6A 4JJBA 3NPFA 4J9BA 4JZ3A 1ZLMA 1YP5A 2X3WD 2J7IA 2HSPA 1NLPC 4DEXA 4JPBW 1B3QA 1KSWA 2RPNA 1YWPA 2PNIA 2KT1A 2LP5A 2LJ1A 4ZNXA 5HCKA 1AEYA 1GCQA 2A08A 1ABOA 1QLYA 2ENMA 1VYUA 1NEGA 2OJ2A 4HVWA 4J9EA 1CKBA 3VS1A 2K79A 3KFVA 1E6GA 4M4ZA 2G6FX 2AKLA 2J05A 3VS2A 1OEBA 2D0NA 2RF0A 2DJQA 1MV3A 1X6GA 1MUZA 1K9AA 1TUCA 2GGRA 2KXDA 2DE0X 2JTEA 2C0OA 2D8HA 1SPKA 1A0NB 2K9GA 3VS3A 5FWCA 1WXBA 2M51A 1U3OA 5GJVB 2KNBB 2JS0A 5IXFA 3GBQA 5IHIA 1J3TA 2MIOA 2KE9A 4RTUA 1M30A 2NWMA 2GNCA 1U5SA 3EG1A 3REAB 3NHNA 2F2VA 4LUEA 2VKNA 3PVQA 3M0QA 4Z8AA 2JMCA 2AK5A 2HBWA 3VS5A 1ZUYA 2KROA 2K6DA 1JXMA 2LCSA 3VS7A 1UUEA 4CC3A 2ROLA 3SHWA 2JT4A 4JZ4A 1PNJA 1TUDA 2DL7A 1QKWA 3UF4A 2HCKA 1GRIA 2MOXA 1UG1A 2SRCA 1ARKA 1U06A 1M3BA 4CC4B 2L3SA 4ESRA 4CC2A 1AZGB 3VS4A 2A28A 4AFZC 4J9IA 1FMKA 2W0ZA 1SEMA 1KIKA 2YT6A 4J9DA 1RUWA 1OOTA 4Z88A 2ECZA 2LNHB 1TG0A 2J6FA 2IIMA 1M8MA 1GFCA 2DM1A 1AVZC 2O9VA 1I1JA 2KYBA 2DVJA 1JXOA 1H3HA 2DL4A 3TVTA 3C0CA 3O5ZA 4IIMA 4AFQC 2F2XA 2LQWA 4JJCA 2QDLA 1NG2A 2CT3A 4LUDA 2LJ0A 1SHFA 2LX7A 1JO8A 2KRSA 2JMAA 1Y57A 3NGPA 2FRYA 4LNPA 2CSQA 1HJDA 2CH4W 1WXUA 3A98A 1BK2A 3TSWA 1RI9A 3H0IA 1WA7A 4WCIA 3QWYA 3R6NA 2DRKA 4FSSA 4RUGA 2ED1A 2EBPA 1GCPA 2P4RA 1UHCA 1ZUUA 2DBMA 1PWTA 2JW4A 2DLPA 3VRZA 4HVVA 4AFUC 1ZBJA 4X1VA 5I22A 2EYWA 1AOJA 3EHRA 2J6OA 2DL3A 1M3AA 3SEMA 4K11A 2K2MA 3RBBB 1V1CA 2EKHA 2KT8A 2EGAA 4J9CA 2XMFA 4ORZA 2C0TA 2GTJA 2L3PA 1ZX6A 2DRMA 3H41A 3THKA 1S1NA 2J6KA 4Z89A 4F16A 2RN8A 2KXCA 1YCSB 3UA7A 1RLQC 2KEAA 5EC7A 1FYNA 1WXTA 1QKXA 2DA9A 1WIEA 3IQLA 2EGCA 4OMNA 1CSKA 1AZEA 1QCFA 2D8JA 5L23A 3I35A 3QWXX 2I0NA 2CDTA 3EHQA 1OPLA 1AWJA 1H8KA 2CT4A 2DL8A 3PE0A 3VS6A 1E7OA 1RLPC 2CREA 2FPFA 2F2WA 1UFFA 1VYVA 4IIOA 3U23A 1PKTA 2YSQA 1LCKA 3M0TA 3EG2A 1GBQA 2K7AA 2YUNA 2FPEA 3I5RA 2JS2A 4RTZA 1BBZA 1WFWA 1YNZA 1M3CA 1PRLC 1ABQA 2H8HA 2KRMA 4GBQA 4RTTA 4OMMA 1JU5C 3VRYA 1K1ZA 1BU1A 2DX1A 4J9GA 2FRWA 4LN2A 4D8DA 4J9HA 1T0HA 4GLMA 1W1FA 4RTXA 3M0PA 2DBKA 3I9QA 2DYBA 2A37A 4OMOA 4RTVA 3H0HA 1QWFA 4KRTA 3JV3A 2X3XD 5ECAA 3TSZA 2AZVA 1E6HA 4CC7A 1K0XA 1AD5A 3REBB 4EIKA 5IH2A 5IXBA 1SRMA 2DILA 4JJDA 1XOVA 2RQTA 1UHFA 1W70A 1Y0MA 2FPDA 1QWEA 2KR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJ5 A;  3EGU A;  2EYX A;  2FG0 A;  4AG2 C;  4QT7 A;  4AG1 C;  2DNU A;  2E5K A;  5FWB A;  1GL5 A;  2VVK A;  1HD3 A;  1PRM C;  2EQI A;  4RTY A;  1PKS A;  4HXJ A;  1GBR A;  3H0F A;  1T3S A;  2DMO A;  2JXB A;  2D1X A;  1IO6 A;  2EW3 A;  2HEQ A;  3VS0 A;  1X6B A;  1UEC A;  1OPK A;  1GFD A;  1M27 C;  1W6X A;  2PTK A;  1NYG A;  3CQT A;  2ROT A;  2BTT A;  1NM7 A;  2V1Q A;  1ZUK A;  1CKA A;  1GCQ C;  2RQV A;  2KGT A;  2EPD A;  2RQW A;  1AWO A;  2KRN A;  5IHN A;  2ESW A;  2ABL A;  2DL5 A;  1B07 A;  1UDL A;  2GTO A;  2L3Q A;  2VWF A;  4R0K A;  1WLP B;  2JM9 A;  4A63 B;  1OV3 A;  1UGV A;  2YUP A;  2JM8 A;  1UJ0 A;  2DF6 A;  2KYM A;  1K4U S;  1UE9 A;  3EG0 A;  2K3B A;  1JQQ A;  2HDA A;  2O9S A;  4F14 A;  2FO0 A;  2RQR A;  2L2P A;  5IHK A;  5GJW B;  2RNA A;  2CH4 A;  2FEI A;  1VA7 A;  4RTW A;  2RMO A;  2GBQ A;  1X2Q A;  1ZSG A;  2LQN A;  1WYX A;  4HCK A;  4D8K A;  1N5Z A;  2CSI A;  2NUZ A;  2C0I A;  3EG3 A;  1I0C A;  1Z9Z A;  2RQU A;  3I5S A;  1SSH A;  1I07 A;  1NEB A;  1SRL A;  2O31 A;  2A36 A;  5FW9 A;  4E6R A;  1T0J A;  2YDL A;  1KJW A;  2M0Y A;  1KFZ A;  1BB9 A;  2SEM A;  2CUD A;  4Y92 A;  3UA6 A;  3LH5 A;  3M0U A;  1NLO C;  2EYZ A;  4OMP A;  1X2K A;  2PZ1 A;  1WI7 A;  2YUQ A;  1UJY A;  1Z9Q A;  1EFN A;  2KBT A;  2OI3 A;  1SHG A;  3PVL A;  1MV0 B;  2EVR A;  1H92 A;  2AKK A;  4OMQ A;  1NYF A;  2W10 A;  2ED0 A;  4HVU A;  4AFS C;  1T3L A;  1YWO A;  2EGE A;  3RNJ A;  3ZL7 C;  2AZS A;  1K76 A;  2B86 A;  2YUO A;  3UAT A;  1VYT A;  2L0A A;  1YN8 A;  5I11 A;  4F17 A;  2J06 A;  1JEG A;  1HSQ A;  2EYY A;  4J9F A;  4DEY A;  1AWX A;  1PHT A;  4OML A;  2LZ6 B;  2MCN A;  4LE9 A;  2BZ8 A;  1K0S A;  2BZX A;  1WDX A;  3M0R A;  3ULR B;  1X43 A;  2BZY A;  2V1R A;  2O88 A;  1G83 A;  1X27 A;  2O2O A;  3NMZ C;  2OAW A;  1AWW A;  2CUB A;  1X69 A;  2LMJ A;  1G2B A;  3M0S A;  1UTI A;  2LJ3 A;  2GQI A;  1WX6 A;  4JJB A;  3NPF A;  4J9B A;  4JZ3 A;  1ZLM A;  1YP5 A;  2X3W D;  2J7I A;  2HSP A;  1NLP C;  4DEX A;  4JPB W;  1B3Q A;  1KSW A;  2RPN A;  1YWP A;  2PNI A;  2KT1 A;  2LP5 A;  2LJ1 A;  4ZNX A;  5HCK A;  1AEY A;  1GCQ A;  2A08 A;  1ABO A;  1QLY A;  2ENM A;  1VYU A;  1NEG A;  2OJ2 A;  4HVW A;  4J9E A;  1CKB A;  3VS1 A;  2K79 A;  3KFV A;  1E6G A;  4M4Z A;  2G6F X;  2AKL A;  2J05 A;  3VS2 A;  1OEB A;  2D0N A;  2RF0 A;  2DJQ A;  1MV3 A;  1X6G A;  1MUZ A;  1K9A A;  1TUC A;  2GGR A;  2KXD A;  2DE0 X;  2JTE A;  2C0O A;  2D8H A;  1SPK A;  1A0N B;  2K9G A;  3VS3 A;  5FWC A;  1WXB A;  2M51 A;  1U3O A;  5GJV B;  2KNB B;  2JS0 A;  5IXF A;  3GBQ A;  5IHI A;  1J3T A;  2MIO A;  2KE9 A;  4RTU A;  1M30 A;  2NWM A;  2GNC A;  1U5S A;  3EG1 A;  3REA B;  3NHN A;  2F2V A;  4LUE A;  2VKN A;  3PVQ A;  3M0Q A;  4Z8A A;  2JMC A;  2AK5 A;  2HBW A;  3VS5 A;  1ZUY A;  2KRO A;  2K6D A;  1JXM A;  2LCS A;  3VS7 A;  1UUE A;  4CC3 A;  2ROL A;  3SHW A;  2JT4 A;  4JZ4 A;  1PNJ A;  1TUD A;  2DL7 A;  1QKW A;  3UF4 A;  2HCK A;  1GRI A;  2MOX A;  1UG1 A;  2SRC A;  1ARK A;  1U06 A;  1M3B A;  4CC4 B;  2L3S A;  4ESR A;  4CC2 A;  1AZG B;  3VS4 A;  2A28 A;  4AFZ C;  4J9I A;  1FMK A;  2W0Z A;  1SEM A;  1KIK A;  2YT6 A;  4J9D A;  1RUW A;  1OOT A;  4Z88 A;  2ECZ A;  2LNH B;  1TG0 A;  2J6F A;  2IIM A;  1M8M A;  1GFC A;  2DM1 A;  1AVZ C;  2O9V A;  1I1J A;  2KYB A;  2DVJ A;  1JXO A;  1H3H A;  2DL4 A;  3TVT A;  3C0C A;  3O5Z A;  4IIM A;  4AFQ C;  2F2X A;  2LQW A;  4JJC A;  2QDL A;  1NG2 A;  2CT3 A;  4LUD A;  2LJ0 A;  1SHF A;  2LX7 A;  1JO8 A;  2KRS A;  2JMA A;  1Y57 A;  3NGP A;  2FRY A;  4LNP A;  2CSQ A;  1HJD A;  2CH4 W;  1WXU A;  3A98 A;  1BK2 A;  3TSW A;  1RI9 A;  3H0I A;  1WA7 A;  4WCI A;  3QWY A;  3R6N A;  2DRK A;  4FSS A;  4RUG A;  2ED1 A;  2EBP A;  1GCP A;  2P4R A;  1UHC A;  1ZUU A;  2DBM A;  1PWT A;  2JW4 A;  2DLP A;  3VRZ A;  4HVV A;  4AFU C;  1ZBJ A;  4X1V A;  5I22 A;  2EYW A;  1AOJ A;  3EHR A;  2J6O A;  2DL3 A;  1M3A A;  3SEM A;  4K11 A;  2K2M A;  3RBB B;  1V1C A;  2EKH A;  2KT8 A;  2EGA A;  4J9C A;  2XMF A;  4ORZ A;  2C0T A;  2GTJ A;  2L3P A;  1ZX6 A;  2DRM A;  3H41 A;  3THK A;  1S1N A;  2J6K A;  4Z89 A;  4F16 A;  2RN8 A;  2KXC A;  1YCS B;  3UA7 A;  1RLQ C;  2KEA A;  5EC7 A;  1FYN A;  1WXT A;  1QKX A;  2DA9 A;  1WIE A;  3IQL A;  2EGC A;  4OMN A;  1CSK A;  1AZE A;  1QCF A;  2D8J A;  5L23 A;  3I35 A;  3QWX X;  2I0N A;  2CDT A;  3EHQ A;  1OPL A;  1AWJ A;  1H8K A;  2CT4 A;  2DL8 A;  3PE0 A;  3VS6 A;  1E7O A;  1RLP C;  2CRE A;  2FPF A;  2F2W A;  1UFF A;  1VYV A;  4IIO A;  3U23 A;  1PKT A;  2YSQ A;  1LCK A;  3M0T A;  3EG2 A;  1GBQ A;  2K7A A;  2YUN A;  2FPE A;  3I5R A;  2JS2 A;  4RTZ A;  1BBZ A;  1WFW A;  1YNZ A;  1M3C A;  1PRL C;  1ABQ A;  2H8H A;  2KRM A;  4GBQ A;  4RTT A;  4OMM A;  1JU5 C;  3VRY A;  1K1Z A;  1BU1 A;  2DX1 A;  4J9G A;  2FRW A;  4LN2 A;  4D8D A;  4J9H A;  1T0H A;  4GLM A;  1W1F A;  4RTX A;  3M0P A;  2DBK A;  3I9Q A;  2DYB A;  2A37 A;  4OMO A;  4RTV A;  3H0H A;  1QWF A;  4KRT A;  3JV3 A;  2X3X D;  5ECA A;  3TSZ A;  2AZV A;  1E6H A;  4CC7 A;  1K0X A;  1AD5 A;  3REB B;  4EIK A;  5IH2 A;  5IXB A;  1SRM A;  2DIL A;  4JJD A;  1XOV A;  2RQT A;  1UHF A;  1W70 A;  1Y0M A;  2FPD A;  1QWE A;  2KR3 A; 
#chains in the Genus database with same CATH topology
 2L8D A;  4EMK A;  2EYX A;  4QT7 A;  3A8H B;  1TXQ A;  4XTZ A;  3CMA A;  5CKF A;  2EQI A;  2LCL A;  1PKS A;  3H0F A;  3CC7 Q;  3VS0 A;  4E7K A;  1ZSZ B;  4KUI A;  4BY6 B;  1M27 C;  4FCY A;  2BTT A;  2M02 A;  3QYH B;  3PMI A;  4FW2 A;  1M1G A;  3G6E Q;  5GAM d;  4R55 A;  3QKJ A;  1Q86 U;  3KUF A;  2VXF A;  1AT1 B;  1AWO A;  2KRN A;  2ESW A;  1XNI A;  4XAX B;  3PGG A;  4F7U F;  2DL5 A;  1NJI C;  1UDL A;  3Q1J A;  2NUT A;  3CPW A;  2VWF A;  3M4Y A;  5D6X A;  3CMA Q;  1WLP B;  2XU8 A;  2JM9 A;  2JM8 A;  4P5N A;  1SG5 A;  2VYT A;  2F5T X;  2DF6 A;  1IRX A;  1Q7Y R;  4LDU A;  1QP2 A;  2YLB A;  2KK4 A;  2O01 E;  2YRC A;  1LJO A;  3CC2 T;  2QI2 A;  3MEV A;  1G5V A;  2RNA A;  2WSC E;  3A8M B;  4XTV A;  3OYL A;  1X2Q A;  5AYF A;  1WHJ A;  1PSE A;  4X9C A;  4D8K A;  1N5Z A;  2NUZ A;  4JJN K;  1I07 A;  1NEB A;  1KC8 R;  3S3M A;  2O31 A;  1RAD B;  1ZQ1 A;  2A36 A;  4E6R A;  4ELY C;  5GAN 2;  5I21 A;  1BI3 A;  1KFZ A;  2SEM A;  3OS5 A;  3OYF A;  2CUD A;  2E5Q A;  4Y92 A;  3UA6 A;  3LH5 A;  3V7C A;  3SWN A;  2YRV A;  4A4E A;  4DBQ A;  3OS2 A;  1NLO C;  2ZPI B;  1HYO A;  4OMP A;  1XQH A;  3L2Z A;  4DOW A;  1QW1 A;  5LJ5 f;  2KBT A;  2OI3 A;  1UGS B;  1SHG A;  2EVR A;  2AKK A;  2Y4X A;  2ED0 A;  3SB2 A;  1F1B B;  5LJ5 h;  4AFS C;  1T3L A;  2RJE A;  3HFO A;  3ZL7 C;  1I8F A;  2CGH A;  5I2M A;  1VQM T;  1B7T A;  4XTU A;  2L0A A;  4F17 A;  1BYM A;  1HSQ A;  4J9F A;  5HY6 A;  4DEY A;  1VQ9 A;  1ZA2 B;  3MP8 A;  1WGS A;  3VYG A;  1Q86 R;  2Y4Y A;  4LE9 A;  4XTX A;  2JN0 A;  3JAM E;  2BZX A;  5LL6 S;  3M57 A;  2VGN A;  4GY5 A;  4PJL A;  4N0A A;  3CPW P;  2DXB A;  2V1R A;  1X27 A;  2CZ1 B;  2O2O A;  2OAW A;  4IUU A;  1NPR A;  5DY9 A;  4MZP A;  5A0L A;  4M7A A;  5KE2 A;  1UTI A;  2LJ3 A;  3JCM e;  1B34 B;  2DXC A;  1JJ2 A;  3NPF A;  3G4S T;  1ZLM A;  1QVF S;  3M53 A;  2WSF E;  1V29 B;  4JS5 A;  1KQ2 A;  4M78 F;  4A4G A;  2GF7 A;  3VKI A;  1VQM A;  4ME7 A;  4C92 C;  1VQ9 Q;  3EFO B;  1KD1 U;  2RK1 A;  1AEY A;  1GCQ A;  2A08 A;  4RG2 A;  2MK5 A;  2M9U A;  1N8R U;  1QLY A;  4BE1 A;  5KYN A;  3RKY A;  1OQK A;  4C8Q E;  2QGG A;  3UDC A;  1X6G A;  3CCV A;  1TUC A;  2GGR A;  4M75 B;  1IXD A;  1G3T A;  3G4S A;  2MWP A;  4M7A G;  2M51 A;  1U3O A;  4EDU A;  5GJV B;  1VQM Q;  1IHW A;  4CRI A;  1ZSZ A;  2MIO A;  2E6N A;  3VUB A;  3OYA A;  3SDZ A;  3REA B;  4L6V 5;  1VQN A;  1YJ9 T;  2YHT A;  2X51 A;  1U1S A;  2EKO A;  3OBW A;  3PVQ A;  4A4F A;  4E2F B;  3VS5 A;  3WVE B;  3JCM g;  1JXM A;  2RHI A;  3QJ6 A;  3CCV Q;  2XDD A;  5CO7 A;  4JZ4 A;  2V8J A;  4C0D C;  2K4Y A;  5CQY A;  2LC4 A;  3G4S Q;  1IRE B;  5A0D A;  1U06 A;  2YRD A;  3A8G B;  3QUI A;  2BIV A;  1KC8 C;  1M3B A;  4ESR A;  3VS4 A;  2XK0 A;  4AFZ C;  2XD0 A;  2RA2 A;  2W0Z A;  1SEM A;  1VQN Q;  3QZ9 B;  1YJ9 A;  1RUW A;  1JBM A;  2LNH B;  2GFU A;  4F7U B;  1M8M A;  2HMA A;  2DM1 A;  2JTM A;  3I55 A;  2DER A;  5LJ3 f;  2V26 A;  1KD1 R;  1H3H A;  2CZ7 B;  3C0C A;  3O5Z A;  1M1K C;  2QDL A;  5LJ3 h;  2L3R A;  1R77 A;  2LJ0 A;  2LX7 A;  3JB9 H;  2O4X B;  2CSQ A;  2QQA A;  4M7D C;  1RI9 A;  4EMH A;  1I4K 1;  1KQS S;  1WA7 A;  3QWY A;  1XTD A;  5CCA A;  4FSS A;  2Z0W A;  3X28 B;  4NL2 A;  1PD0 A;  2GCX A;  2DXT A;  1YJ9 Q;  3FC3 A;  4LD6 A;  2JW4 A;  2RHY A;  2DLP A;  5KE3 A;  4ZTF A;  4DBR A;  1RL2 A;  1QVP A;  1TS9 A;  4BE0 A;  3I55 Q;  4X1V A;  5I22 A;  2R5M A;  2J6O A;  2HL5 C;  2DL3 A;  1M3A A;  3G71 T;  1U1T A;  1S72 T;  3J81 E;  3RBB B;  2DEQ A;  4J8O A;  3OYM A;  2E6Z A;  2XMF A;  2RHX A;  2Y90 A;  2C0T A;  3OYY A;  3CCS T;  4FU6 A;  2H3E B;  5GAO r;  5GMK e;  4EPC A;  4C0Z A;  2J6K A;  2NUP B;  3BY7 A;  4Z89 A;  2VUB A;  4XU3 A;  2RN8 A;  3OYG A;  3F70 A;  1RLQ C;  2KEA A;  2KAF A;  5EC7 A;  3ZBD A;  5DLQ E;  1WXT A;  2R58 A;  2IG0 A;  2EQU A;  5LJ5 d;  1PCX A;  1PC0 A;  1Y71 A;  4YTL A;  3JCM b;  3MEA A;  1IGU A;  5FRN A;  4C92 D;  5KH6 A;  2DYI A;  3I35 A;  3QZ5 B;  3JCM P;  5J3B A;  4JRQ A;  4L59 A;  4C8Q A;  2EQJ A;  3ER0 A;  3OB9 A;  2CT4 A;  3BDU A;  4J5Y A;  2CYZ B;  1UFF A;  1W2B A;  4BD3 A;  4M75 A;  4QVD A;  2CP2 A;  3EH1 A;  4M78 B;  2DK3 A;  3OYE A;  4N4I A;  3EG2 A;  1QVG S;  2KMT A;  4RTZ A;  1YNZ A;  1EX4 A;  3CEY A;  2CZ6 B;  1OX8 A;  2DET A;  2QG9 B;  2P0K A;  3FJP A;  4EMK B;  3CBO A;  2CP6 A;  1BU1 A;  1PD1 A;  2FRW A;  2XDB A;  4GLM A;  3M0P A;  2PVD B;  2D9T A;  2A37 A;  5D6W A;  1PG5 B;  4RTV A;  4C8Q G;  1K73 U;  3H0H A;  2QYZ A;  4OB0 B;  4OVA A;  4FT2 A;  1E6H A;  2KVQ G;  4OP0 A;  3RMQ A;  3CCM T;  4BUG A;  3REB B;  2RHZ A;  3JCM f;  1K9M U;  1QQJ A;  1VOM A;  2KI7 A;  4N4H A;  2LX9 A;  3EGX B;  4E7L A;  1BI0 A;  1Y0M A;  3JCM h;  3S6W A;  4Q5W A;  3OMG A;  4PJO C;  2KR3 A;  3EGU A;  4B9W A;  2HQH A;  4F7U A;  2DNU A;  3OYI A;  4M77 C;  1VQ7 A;  1GBR A;  2V8K A;  4M7A C;  3JCM c;  3OYN A;  3LW5 E;  1N6A A;  2D1X A;  2K3X A;  3CCJ A;  2EW3 A;  2LNV A;  4C5H A;  1W6X A;  1NYG A;  4BB7 A;  2ROT A;  2PUK B;  1NM7 A;  2V1Q A;  5IN1 A;  1WHM A;  3DB3 A;  1ZUK A;  1GCQ C;  1VQP T;  3MJX A;  4E7J A;  4J6X A;  2OAU A;  3G1J A;  4FYW B;  5IHN A;  3RUX A;  3V7S A;  1U8R A;  3GIB A;  4M7D D;  5KYX A;  2ABL A;  3TCJ A;  1B07 A;  2EIF A;  2HQE A;  1YHQ A;  1OV3 A;  2K2V A;  1UGV A;  2YUP A;  1VQ7 Q;  4F7U G;  1MNE A;  2KYM A;  1UE9 A;  3EG0 A;  1TOV A;  5KYW A;  1HXD A;  3CCJ Q;  2CZ0 B;  2K3B A;  2DKG A;  2HDA A;  4BE2 A;  4J7F A;  3OW2 A;  3L2W A;  1KK7 A;  2FEI A;  1ZSZ C;  3CC4 A;  1NE8 A;  3CC7 T;  5LJ3 d;  1K73 R;  5DLO A;  1WYX A;  2HL3 A;  2F5K A;  1VQP A;  1W4S A;  3QYG B;  2CSI A;  2QK0 A;  3EG3 A;  2KSS A;  3EGD B;  2NUP A;  4C0G A;  1SSH A;  5GAN e;  2MF2 A;  4ATO A;  2EQM A;  5FW9 A;  4KGV B;  1YHQ Q;  1K9M R;  2KQW A;  1KJW A;  2A7Y A;  2M0Y A;  2JNG A;  1BB9 A;  2EJ9 A;  1WHL A;  5CKB A;  1OU8 A;  1RAI B;  4A53 A;  2C06 A;  1D3B B;  1O75 A;  1Z9Q A;  3PTA A;  3HTR A;  1I5O B;  3CC4 Q;  4DBF A;  1H92 A;  1M2V A;  1NYF A;  4FM4 B;  5CKH A;  3M55 A;  4HVU A;  3JCM J;  3CPW S;  1VQP Q;  1YWO A;  2LRQ A;  2AZS A;  5J26 A;  2B86 A;  4M78 A;  5KYU B;  5KCO A;  1IHV A;  3HRS A;  1QP3 A;  1YN8 A;  5I11 A;  2J06 A;  3WVD B;  1JEG A;  3QSU A;  1PHT A;  1Y96 B;  2LZ6 B;  4II1 A;  2K57 A;  3L2Q A;  1K0S A;  2OTL A;  3M0R A;  1X43 A;  2O88 A;  3FEO A;  4DQ2 A;  1AWW A;  2DEU A;  3GNF B;  4LXC A;  2X4W A;  2DTH A;  1X69 A;  3NFC A;  2LMJ A;  5GAN g;  4XK8 E;  5C6S A;  1BKB A;  1YP5 A;  2J7I A;  3OW2 P;  1NLP C;  1KHC A;  2ATC B;  1KSW A;  2RPN A;  2PNI A;  2KT1 A;  2P84 A;  3MP1 A;  3QG1 A;  5HCK A;  3MHX A;  4M78 G;  1ABO A;  2ENM A;  1EZZ B;  1NEG A;  3EGX A;  2K79 A;  5GMK h;  2OTL Q;  3AHU A;  4M4Z A;  2G6F X;  3VS2 A;  3HRT A;  3ASK A;  4FL6 A;  2RF0 A;  2F69 A;  3X20 B;  4PJO D;  3RR6 A;  1WZO A;  1SPK A;  1FMW A;  1A0N B;  3VS3 A;  4M77 D;  4GLK A;  3CPF A;  2KNB B;  4BI3 A;  4XU0 A;  4M7A D;  3RDV A;  3GBQ A;  4OB2 B;  4QQD A;  3VJP A;  1M30 A;  3LH0 A;  4E7S A;  3M0Q A;  4Z8A A;  1MMG A;  2KRO A;  1RAA B;  3HFN A;  1VQ9 T;  2LCS A;  1M5Q 1;  2CP3 A;  5GAN 5;  2HZY A;  1LPL A;  3BFM A;  2ROL A;  3JCM d;  1RAG B;  1K73 C;  1YIT T;  4M75 C;  1IB8 A;  4HCZ A;  3QBY A;  4PFZ A;  2ZPF B;  4CC2 A;  4KUL A;  4C5E A;  2VGM A;  1K9M C;  2A28 A;  1G3W A;  1UB4 A;  4J9I A;  1FMK A;  1KIK A;  5GAM e;  4J9D A;  5GMK l;  2ECZ A;  3JCM X;  2J6F A;  1D0X A;  2OX7 A;  3EGD A;  3OQ5 A;  5CAI A;  3L2R A;  3LGL A;  1DJ7 B;  4OMF B;  2DL4 A;  3TVT A;  2DTI A;  4IIM A;  4JJC A;  2CT3 A;  2DD5 A;  1YIT A;  1KHI A;  2PQW A;  1VQ5 T;  3DLM A;  3NGP A;  3CCV T;  1VQ6 A;  3QO3 A;  4LNP A;  1WQW A;  1D3B A;  2FVU A;  1BK2 A;  2ZAE A;  4ZN3 A;  4OGE A;  4WCI A;  3RES A;  2DRK A;  5IT9 E;  1FXX A;  2ED1 A;  2EBP A;  2P4R A;  1PWT A;  1LOJ A;  1VQL A;  2EYQ A;  2LQK A;  4J6Y A;  4AFU C;  4XU2 A;  5KYU A;  1ZBJ A;  4LDV A;  1BIB A;  1VQN T;  1Y96 A;  3SEM A;  3CXC A;  4K11 A;  2K2M A;  4MZT A;  1YIT Q;  3OYC A;  4C8Q B;  1M4Z A;  3DB4 A;  4C5G A;  5GAM g;  1VQ5 A;  1VQ6 Q;  2EGA A;  1OU9 A;  2HBP A;  4KGZ B;  4J9C A;  4M7D F;  4BAC A;  5GAN 3;  1M2O A;  1Q81 U;  2GTJ A;  1VIF A;  5M9O A;  1KQ1 A;  2RHU A;  3AT1 B;  3H41 A;  1VQL Q;  4FYX B;  3KBG A;  2KXC A;  3UA7 A;  3A8L B;  1QMC A;  4IUP A;  1QCN A;  4Y28 E;  3OA6 A;  2DA9 A;  3R6O A;  3JB9 F;  3EAE A;  1Q7Y C;  5L23 A;  3FLG A;  3I55 T;  2XID A;  1VQ5 Q;  1AWJ A;  1WJR A;  2QA4 A;  3OYB A;  3QXE B;  3CCR T;  4IIO A;  3PIO A;  3U23 A;  8ATC B;  1BI1 A;  2YSQ A;  9ATC B;  2MYS A;  3JRZ A;  2GQV A;  5KCH A;  4MMK A;  2JS2 A;  2RK2 A;  2QTX A;  4FIB A;  1YIJ T;  1WFW A;  1QVF A;  1M3C A;  1PRL C;  4ZGD B;  2H8H A;  4BDY A;  1JJ2 P;  2KRM A;  3MKD A;  1YJW T;  4VUB A;  4OMM A;  2G3R A;  3L2U A;  3H8Z A;  5D7U A;  3UPU A;  1JU5 C;  3VRY A;  3VU3 C;  1K1Z A;  4J9G A;  4O5V A;  1W1F A;  2QA4 Q;  4RTX A;  1M90 U;  3CXC P;  2X35 A;  3I9Q A;  1N8R R;  3V7R A;  1FX7 A;  4KRT A;  3JV3 A;  3CCR A;  2X3X D;  4IUQ A;  3A5Z B;  1K0X A;  1AD5 A;  4C92 E;  4M78 C;  4PFP A;  1YIJ A;  4M75 D;  4QVZ A;  4EIK A;  5IH2 A;  3PNW C;  1SRM A;  2DIL A;  1UHF A;  1YJW A;  4IKF A;  1W70 A;  1Q86 C;  5KYX B;  3OYD A;  4C0F A;  5GAO n;  3FJ5 A;  4AG2 C;  4EMK C;  4AG1 C;  1W2B S;  5GMK j;  3PIP A;  5CIU A;  1TTH B;  1PRM C;  2XIC A;  1YFN A;  4RTY A;  3WXM B;  2ZPB B;  1TUG B;  4X9D A;  2HD0 A;  5KYW B;  3QJY A;  2LDM A;  1T3S A;  1H64 1;  3CCR Q;  2JXB A;  2P0P A;  5GMK m;  1IO6 A;  1IGQ A;  1GFD A;  2VB6 A;  2PTK A;  1MHN A;  3CQT A;  3CME A;  1YIJ Q;  2DD4 A;  1C0M A;  4PJO F;  1YJW Q;  2KGT A;  2QQB A;  1M8V A;  3OY9 A;  5GAN 4;  4HCB A;  1BIA A;  5GAN 8;  3CBM A;  2L3Q A;  3OMC A;  4M77 F;  3MCA B;  4C0D B;  4A63 B;  2YWW A;  1UJ0 A;  2D6F A;  2DIG A;  1RAF B;  1TSF A;  2O9S A;  4F14 A;  5CK9 A;  7AT1 B;  2FO0 A;  2L2P A;  5IHK A;  2IPO B;  5GJW B;  3VYH B;  3CME Q;  1M2V B;  3QDF A;  1M90 R;  1VA7 A;  1BCO A;  4RCB A;  4RTW A;  3OBY A;  2CP7 A;  4ANJ A;  2GBQ A;  1ZSG A;  1UGQ B;  4E7H A;  4RMO A;  1I0C A;  2JUF A;  3CCL T;  1KQS A;  1LNX A;  1SRL A;  2EFI A;  8AT1 B;  2COW A;  2YDL A;  2DIQ A;  3L1A A;  1WJS A;  4OB3 B;  5GAO p;  3CCQ T;  1Y7X A;  2EYZ A;  3SWN C;  1NPP A;  1WI7 A;  4M7D B;  4M7D E;  4NOY A;  2EWN A;  1MMA A;  1VQ7 T;  4QW2 A;  1VQK A;  3CCJ T;  2DAQ A;  2EGE A;  3HKS A;  3URG A;  3JB9 I;  1TH7 A;  3BE3 A;  3ZEH A;  3CCL A;  2JOY A;  2QAS A;  2EYY A;  1AWX A;  1XJW B;  2YXY A;  4OML A;  2XHC A;  4MZM A;  1KD1 C;  4QKU A;  3EG9 B;  5LJ5 e;  1N8R C;  3OW2 S;  4KH0 B;  4PFO A;  2BZ8 A;  1WDX A;  2COZ A;  3CCQ A;  2BZY A;  4N0A C;  1YHQ T;  1UGP B;  4Y91 A;  3NMZ C;  5HKC A;  2F1L A;  1WJQ A;  2CUB A;  3M0S A;  1G2B A;  1WX6 A;  1VQK Q;  4RCC A;  2PVO B;  2FB7 A;  2X3W D;  5GAO l;  2HSP A;  4J83 A;  2D0Q B;  3CCL Q;  3G7Z A;  4DEX A;  4MDW A;  3RER A;  3MEW A;  3CC4 T;  2K5L A;  3V8K A;  1YWP A;  1W2B P;  2LP5 A;  3P8B B;  1QCO A;  2DPP B;  1QVG A;  4UC4 A;  4M78 D;  2OJ2 A;  4HVW A;  2RD1 A;  3D7S B;  1CKB A;  3KFV A;  2WSE E;  4KT0 E;  3CCQ Q;  4Z02 A;  2D0N A;  2NYS A;  2X4Y A;  1OZ2 A;  2DJQ A;  1K9A A;  2KXD A;  5GAN j;  2LT4 A;  4ZTJ A;  2JTE A;  2KY9 A;  2C0O A;  2D8H A;  4ZGJ B;  2DXU A;  3V8L A;  2K9G A;  1D1C A;  3X25 B;  3GOX A;  5LJ5 g;  2R5A A;  3RKW A;  3EFR A;  4QVC A;  5IHI A;  4F04 B;  4BY6 C;  2KE9 A;  1Q82 U;  2GNC A;  1U5S A;  2E1H A;  3EG1 A;  3GF5 A;  1R0C B;  2L5Q A;  2OTJ T;  2PU9 B;  2VKN A;  5CR2 A;  4XQ3 A;  3VUZ A;  2JMC A;  1NZ9 A;  5IAY A;  4CI0 C;  1H3Z A;  2JVV A;  2FYK A;  1D1B A;  3VS7 A;  1M90 C;  4CC3 A;  2P0Q A;  2JT4 A;  2LTO A;  1ACM B;  3CCU T;  2DL7 A;  1QKW A;  2E4H A;  5FU7 B;  2BKD N;  4E7Z A;  2OTL T;  2MOX A;  3E9F A;  1UG1 A;  2E41 A;  2HAX A;  2JJ9 A;  2QXF A;  3M56 A;  2L3S A;  4WTO B;  2RI3 A;  1AZG B;  4PJO B;  2CKK A;  1OYX A;  3TEE A;  4B6M A;  4PJO E;  2V8I A;  2YT6 A;  4PJM A;  1MND A;  2M16 A;  3V8J A;  2WAC A;  4Z88 A;  2K3Y A;  2OTJ A;  3PFS A;  5C0M A;  2IIM A;  3M4G A;  1AVZ C;  4M77 E;  2ZPH B;  5A0G A;  1G8X A;  2KYB A;  2QQ9 A;  4M7A E;  4A54 A;  3N5B B;  4JRI A;  5CKD A;  1YCY A;  3C12 A;  3JSC A;  4M75 F;  4AFQ C;  3CCU A;  1NG2 A;  1R8O B;  1SHF A;  1BCM A;  4A4H A;  2DVE A;  5FU6 B;  2JMA A;  2VC8 A;  2FRY A;  3INZ A;  2COY A;  1SSF A;  4E47 A;  4M7D A;  1HJD A;  2CH4 W;  4HA8 A;  3TSW A;  4RG8 A;  2PUO B;  4JLG A;  5D6Y A;  3J80 E;  4RUG A;  2RB6 A;  1UHC A;  5I2S A;  1ZUU A;  2OTJ Q;  2E65 A;  4HVV A;  2FZG B;  5L8R E;  5FRO A;  1Q95 G;  4NS5 A;  2EYW A;  3FRN A;  2CP5 A;  3EHR A;  1I81 A;  1Q82 R;  2A0F B;  5J39 A;  4JUV A;  1M1K U;  3CCU Q;  3EG9 A;  3GP8 A;  4DBH A;  3SFM A;  3LX7 A;  1M9S A;  2DO3 A;  4KH1 B;  1V1C A;  2EKH A;  2M1H A;  2RI2 A;  4ORZ A;  1ZX6 A;  2LCC A;  1ZHI A;  2QAZ A;  4AMC A;  3OSS C;  1S1N A;  2I2L A;  2MMP A;  4M7D G;  1YJN T;  5KYY A;  1YCS B;  3P8H A;  4C92 F;  3C4S A;  3PMT A;  3JCM W;  2DJZ A;  4XU1 A;  3LWH A;  1QKX A;  1OX9 A;  1WIE A;  1C6V X;  3IQL A;  1O9S A;  2EGC A;  4OMN A;  2HKN A;  2E64 A;  3L42 A;  2VAS A;  1QCF A;  1JB0 E;  2JTF A;  3EFS A;  3QWX X;  2I0N A;  5GAM j;  2CDT A;  5GAO m;  1PSF A;  5LJ3 g;  1JJ2 S;  3CCE T;  3J7A F;  1OPL A;  3M54 A;  3JB9 G;  4OGC A;  4C8Q C;  1OZ3 A;  4PNO A;  3PE0 A;  2FL7 A;  2RJD A;  2FPF A;  1VYV A;  1OI1 A;  4N4G A;  1G3Y A;  2FZC B;  3BDL A;  1PKT A;  1LCK A;  1VQ6 T;  2EJG A;  1YJN A;  1GBQ A;  2K7A A;  3CXC S;  2FPE A;  1BBZ A;  2ZPG B;  3GNG A;  3ZFJ A;  1EIF A;  2HNI A;  4GBQ A;  1VQL T;  2ZZD A;  5FRM A;  4MDX A;  2DX1 A;  3CC2 A;  3CCE A;  1HK9 A;  1X75 C;  2EQK A;  1M1K R;  3CBP A;  2QQS A;  2AZV A;  2HQX A;  2QTV A;  1YJN Q;  2L89 A;  1UEB A;  4JJD A;  1XOV A;  2MAM A;  4X34 A;  4PJO A;  1N9R A;  1IZ6 A;  2VXE A;  2FG0 A;  5GAN 7;  3OSV A;  2E5K A;  5FWB A;  3CC2 Q;  3A8O B;  4RKU E;  3CCE Q;  2E3H A;  1GL5 A;  4M77 A;  2VVK A;  3LYI A;  1HD3 A;  4QQ6 A;  2DFU A;  3TQ7 P;  4HXJ A;  1C1A A;  4PKC C;  3S3N A;  5CVI A;  2DMO A;  4IUR A;  3FDR A;  1MMD A;  2HEQ A;  4IUT A;  1X6B A;  1UEC A;  1OPK A;  2FZK B;  2QA4 T;  2CP0 A;  1Q82 C;  1CKA A;  4PLI A;  2RQV A;  4AT1 B;  2EPD A;  4NL3 A;  2RQW A;  4PJJ A;  1SF9 A;  1K8A U;  2RI5 A;  2GTO A;  2YLC A;  4PJO G;  3HPW A;  1WPY A;  4R0K A;  4FT4 A;  1SKU B;  2X4X A;  4C5I A;  1VQO T;  4M75 E;  1K4U S;  4M77 G;  5GAN f;  4FYV B;  1JQQ A;  3DKM A;  2ZCF B;  5GAN h;  2RQR A;  1TWB A;  4KUD K;  2R57 A;  4HKE A;  2CH4 A;  3UWN A;  2B8A A;  2E3I A;  3PT9 A;  2RMO A;  3TU4 K;  2XKO C;  5GAO q;  2LQN A;  4E7I A;  4HCK A;  4J7I A;  4PJN A;  2C0I A;  4HT9 A;  1Z9Z A;  3TRE A;  3A1P A;  2RQU A;  3GPL A;  3I5S A;  1RAB B;  4JLI A;  4R56 A;  3E19 A;  1T0J A;  3OS0 A;  3S3O A;  1M1F A;  4IUV A;  1VQO A;  3M0U A;  4QQG A;  2LQ8 A;  1X2K A;  2PZ1 A;  2YUQ A;  1UJY A;  1OUL A;  3NTH A;  3LWI A;  1EFN A;  3HSB A;  1PM3 A;  1VQ4 T;  2NLU A;  3PVL A;  1MV0 B;  2AT1 B;  3FB9 A;  4OMQ A;  2W10 A;  2QQR A;  4C8Q D;  3RNJ A;  4FYY B;  1K76 A;  2X9H A;  4PL6 A;  2RJF A;  4C92 B;  2YUO A;  4FW1 A;  3UAT A;  4F7U E;  4ZN1 A;  1VYT A;  3CME T;  3E1S A;  3H6Z A;  4JRK A;  1Q81 R;  1P92 A;  3E2U A;  3CD6 T;  1RAE B;  2MCN A;  1VQO Q;  1GXI E;  2MPX C;  2H3J A;  3ULR B;  4BDZ A;  2XDP A;  1K8A R;  1WHH A;  2LVM A;  1G83 A;  3M58 A;  3LGF A;  1YBY A;  3ME9 A;  2DZC A;  3JCM V;  2EJF A;  3C94 A;  5GMK i;  1VQ4 A;  2GQI A;  4JJB A;  2ZPE B;  4J9B A;  1WNL A;  4JZ3 A;  3NTI A;  4KGX B;  3OYH A;  4JRP A;  1X01 A;  2AIR B;  4JPB W;  3JCM Q;  1B3Q A;  3RKX A;  3JB9 J;  4A4K A;  3X26 B;  2LJ1 A;  4ZNX A;  2RM4 A;  1NBE B;  1VYU A;  3CD6 A;  1VIE A;  3M59 A;  3RIR A;  1VQ8 T;  3M5A A;  4J9E A;  4LDX A;  3HHT B;  2DTO A;  3BW1 A;  3VS1 A;  2QEX T;  1E6G A;  2J05 A;  2AKL A;  3MP6 A;  3X24 B;  4D6W A;  1OEB A;  1QVF P;  3I56 T;  1MV3 A;  1MUZ A;  4M7A F;  4J6W A;  3L2V A;  2DE0 X;  5HK3 A;  1KG1 A;  1VQ4 Q;  2BE7 D;  3NTK A;  1YI2 T;  1B34 A;  4DA4 A;  5FWC A;  4O6J A;  1WXB A;  2CS7 A;  2JS0 A;  5IXF A;  1J3T A;  4FSX A;  4RTU A;  1N27 A;  2NWM A;  4BI8 B;  1VQK T;  2P4T A;  3EFO A;  3EH2 A;  3NHN A;  4JDS A;  3CD6 Q;  2F2V A;  4LUE A;  2HSE B;  4PK4 A;  1VQ8 A;  2KDS A;  3MO8 A;  3G71 A;  2AK5 A;  2HKQ B;  1ZA1 B;  2HBW A;  4ZGE B;  2MI6 A;  1ZUY A;  2QEX A;  1S72 A;  1NJI U;  2K6D A;  2AHJ B;  4ELZ C;  4OB1 B;  1RI0 A;  4HCC A;  5EG2 A;  5GAM f;  3I56 A;  3MEU A;  1UUE A;  3SHW A;  1PNJ A;  1TUD A;  3CCS A;  3UF4 A;  1G3S A;  2HCK A;  1GRI A;  2ZGW A;  5GAM h;  2SRC A;  1ARK A;  1YI2 A;  4M78 E;  5LJ5 j;  3QHS A;  3QPH A;  4CC4 B;  3KXT A;  2K5I A;  4XTY A;  1D1A A;  3LLR A;  4V2S A;  1MMN A;  2A3L A;  1VQ8 Q;  1OOT A;  3G71 Q;  1TG0 A;  2BUD A;  2QEX Q;  1S72 Q;  4L5G A;  1GFC A;  2O9V A;  1I1J A;  3RMS A;  3M9Q A;  3OS1 A;  3I56 Q;  2DVJ A;  4BI4 A;  1JXO A;  1FMV A;  2LT1 A;  3C95 A;  4JS4 A;  1N9S A;  4EMG A;  3CCS Q;  2F2X A;  2LQW A;  3T9N A;  2K5F A;  4LUD A;  1YI2 Q;  3HRU A;  5FU7 C;  1JO8 A;  2KRS A;  2IVW A;  1Y57 A;  3MET A;  4M75 G;  2RJC A;  1WXU A;  3A98 A;  1Q81 C;  2QDY B;  2MWO A;  1X6O A;  3H0I A;  3R6N A;  5KYY B;  1GCP A;  3OYJ A;  3DLL A;  2DBM A;  1AHJ B;  2NUT B;  3VRZ A;  5GAN d;  1K8A C;  4XTW A;  4C92 A;  5FLX E;  1AOJ A;  4B9X A;  2BE9 B;  3MPU B;  3QII A;  3UT1 A;  1KQS P;  1NJI R;  3H9N A;  2KT8 A;  3HL8 A;  3CCM A;  2FHD A;  5FU6 C;  2JZ2 A;  3SD4 A;  2L3P A;  2O4X A;  4LDW A;  4OF1 A;  2DRM A;  3THK A;  2DZ9 A;  5AT1 B;  4HT8 A;  4F16 A;  4WF2 A;  2RO0 A;  4LD9 K;  1R0B G;  1VUB A;  1FYN A;  1RAH B;  5DM7 R;  2E70 A;  5A2Q E;  1RAC B;  3OYK A;  4C92 G;  3P8D A;  1UGR B;  3SWN B;  1CSK A;  1AZE A;  1V76 A;  2X4J A;  2D8J A;  1WHG A;  5CQX A;  1FWZ A;  3EHQ A;  3CCM Q;  3O8V A;  3HP9 A;  3E9G A;  2RH2 A;  1H8K A;  2DL8 A;  3JB9 D;  3VS6 A;  1E7O A;  1RLP C;  3QDR B;  2CRE A;  2F2W A;  3FIF A;  5CKE A;  1D0Y A;  3M0T A;  2XI9 A;  4PLL A;  2YUN A;  3I5R A;  1I5L A;  2EAY A;  1WHK A;  1MGQ A;  5HK0 A;  3G6E T;  1ABQ A;  2VV5 A;  1TU0 B;  4RTT A;  1LVK A;  1Q7Y U;  6AT1 B;  4DOV A;  1D09 B;  2XG8 D;  2E12 A;  1JRI A;  1ZBX A;  2GFA A;  5LJ3 j;  4M77 B;  4C8Q F;  3CMA T;  4LN2 A;  4D8D A;  4J9H A;  1T0H A;  4MML A;  3VV0 A;  4M7A B;  1QVG P;  2DBK A;  1WQ7 A;  2DYB A;  4OMO A;  1QWF A;  3CC7 A;  5ECA A;  3TSZ A;  4LDY A;  3GLX A;  2PVG B;  4CC7 A;  4TVR A;  1BI2 A;  1KC8 U;  4KBM B;  2M0O A;  1Y07 A;  2QGF B;  5GAN 6;  1D0Z A;  5IXB A;  3G6E A;  5LJ3 e;  2RQT A;  2E10 A;  2FPD A;  1QWE A; 
#chains in the Genus database with same CATH homology
 3FJ5 A;  3EGU A;  2EYX A;  2FG0 A;  4AG2 C;  4QT7 A;  4AG1 C;  2DNU A;  2E5K A;  5FWB A;  1GL5 A;  2VVK A;  1HD3 A;  1PRM C;  2EQI A;  4RTY A;  1PKS A;  4HXJ A;  1GBR A;  3H0F A;  1T3S A;  2DMO A;  2JXB A;  2D1X A;  1IO6 A;  2EW3 A;  2HEQ A;  3VS0 A;  1X6B A;  1UEC A;  1OPK A;  1GFD A;  1M27 C;  1W6X A;  2PTK A;  1NYG A;  3CQT A;  2ROT A;  2BTT A;  1NM7 A;  2V1Q A;  1ZUK A;  1CKA A;  1GCQ C;  2RQV A;  2KGT A;  2EPD A;  2RQW A;  1AWO A;  2KRN A;  5IHN A;  2ESW A;  2ABL A;  2DL5 A;  1B07 A;  1UDL A;  2GTO A;  2L3Q A;  2VWF A;  4R0K A;  1WLP B;  2JM9 A;  4A63 B;  1OV3 A;  1UGV A;  2YUP A;  2JM8 A;  1UJ0 A;  2DF6 A;  2KYM A;  1K4U S;  1UE9 A;  3EG0 A;  2K3B A;  1JQQ A;  2HDA A;  2O9S A;  4F14 A;  2FO0 A;  2RQR A;  2L2P A;  5IHK A;  5GJW B;  2RNA A;  2CH4 A;  2FEI A;  1VA7 A;  4RTW A;  2RMO A;  2GBQ A;  1X2Q A;  1ZSG A;  2LQN A;  1WYX A;  4HCK A;  4D8K A;  1N5Z A;  2CSI A;  2NUZ A;  2C0I A;  3EG3 A;  1I0C A;  1Z9Z A;  2RQU A;  3I5S A;  1SSH A;  1I07 A;  1NEB A;  1SRL A;  2O31 A;  2A36 A;  5FW9 A;  4E6R A;  1T0J A;  2YDL A;  1KJW A;  2M0Y A;  1KFZ A;  1BB9 A;  2SEM A;  2CUD A;  4Y92 A;  3UA6 A;  3LH5 A;  3M0U A;  1NLO C;  2EYZ A;  4OMP A;  1X2K A;  2PZ1 A;  1WI7 A;  2YUQ A;  1UJY A;  1Z9Q A;  1EFN A;  2KBT A;  2OI3 A;  1SHG A;  3PVL A;  1MV0 B;  2EVR A;  1H92 A;  2AKK A;  4OMQ A;  1NYF A;  2W10 A;  2ED0 A;  4HVU A;  4AFS C;  1T3L A;  1YWO A;  2EGE A;  3RNJ A;  3ZL7 C;  2AZS A;  1K76 A;  2B86 A;  2YUO A;  3UAT A;  1VYT A;  2L0A A;  1YN8 A;  5I11 A;  4F17 A;  2J06 A;  1JEG A;  1HSQ A;  2EYY A;  4J9F A;  4DEY A;  1AWX A;  1PHT A;  4OML A;  2LZ6 B;  2MCN A;  4LE9 A;  2BZ8 A;  1K0S A;  2BZX A;  1WDX A;  3M0R A;  3ULR B;  1X43 A;  2BZY A;  2V1R A;  2O88 A;  1G83 A;  1X27 A;  2O2O A;  3NMZ C;  2OAW A;  1AWW A;  2CUB A;  1X69 A;  2LMJ A;  1G2B A;  3M0S A;  1UTI A;  2LJ3 A;  2GQI A;  1WX6 A;  4JJB A;  3NPF A;  4J9B A;  4JZ3 A;  1ZLM A;  1YP5 A;  2X3W D;  2J7I A;  2HSP A;  1NLP C;  4DEX A;  4JPB W;  1B3Q A;  1KSW A;  2RPN A;  1YWP A;  2PNI A;  2KT1 A;  2LP5 A;  2LJ1 A;  4ZNX A;  5HCK A;  1AEY A;  1GCQ A;  2A08 A;  1ABO A;  1QLY A;  2ENM A;  1VYU A;  1NEG A;  2OJ2 A;  4HVW A;  4J9E A;  1CKB A;  3VS1 A;  2K79 A;  3KFV A;  1E6G A;  4M4Z A;  2G6F X;  2AKL A;  2J05 A;  3VS2 A;  1OEB A;  2D0N A;  2RF0 A;  2DJQ A;  1MV3 A;  1X6G A;  1MUZ A;  1K9A A;  1TUC A;  2GGR A;  2KXD A;  2DE0 X;  2JTE A;  2C0O A;  2D8H A;  1SPK A;  1A0N B;  2K9G A;  3VS3 A;  5FWC A;  1WXB A;  2M51 A;  1U3O A;  5GJV B;  2KNB B;  2JS0 A;  5IXF A;  3GBQ A;  5IHI A;  1J3T A;  2MIO A;  2KE9 A;  4RTU A;  1M30 A;  2NWM A;  2GNC A;  1U5S A;  3EG1 A;  3REA B;  3NHN A;  2F2V A;  4LUE A;  2VKN A;  3PVQ A;  3M0Q A;  4Z8A A;  2JMC A;  2AK5 A;  2HBW A;  3VS5 A;  1ZUY A;  2KRO A;  2K6D A;  1JXM A;  2LCS A;  3VS7 A;  1UUE A;  4CC3 A;  2ROL A;  3SHW A;  2JT4 A;  4JZ4 A;  1PNJ A;  1TUD A;  2DL7 A;  1QKW A;  3UF4 A;  2HCK A;  1GRI A;  2MOX A;  1UG1 A;  2SRC A;  1ARK A;  1U06 A;  1M3B A;  4CC4 B;  2L3S A;  4ESR A;  4CC2 A;  1AZG B;  3VS4 A;  2A28 A;  4AFZ C;  4J9I A;  1FMK A;  2W0Z A;  1SEM A;  1KIK A;  2YT6 A;  4J9D A;  1RUW A;  1OOT A;  4Z88 A;  2ECZ A;  2LNH B;  1TG0 A;  2J6F A;  2IIM A;  1M8M A;  1GFC A;  2DM1 A;  1AVZ C;  2O9V A;  1I1J A;  2KYB A;  2DVJ A;  1JXO A;  1H3H A;  2DL4 A;  3TVT A;  3C0C A;  3O5Z A;  4IIM A;  4AFQ C;  2F2X A;  2LQW A;  4JJC A;  2QDL A;  1NG2 A;  2CT3 A;  4LUD A;  2LJ0 A;  1SHF A;  2LX7 A;  1JO8 A;  2KRS A;  2JMA A;  1Y57 A;  3NGP A;  2FRY A;  4LNP A;  2CSQ A;  1HJD A;  2CH4 W;  1WXU A;  3A98 A;  1BK2 A;  3TSW A;  1RI9 A;  3H0I A;  1WA7 A;  4WCI A;  3QWY A;  3R6N A;  2DRK A;  4FSS A;  4RUG A;  2ED1 A;  2EBP A;  1GCP A;  2P4R A;  1UHC A;  1ZUU A;  2DBM A;  1PWT A;  2JW4 A;  2DLP A;  3VRZ A;  4HVV A;  4AFU C;  1ZBJ A;  4X1V A;  5I22 A;  2EYW A;  1AOJ A;  3EHR A;  2J6O A;  2DL3 A;  1M3A A;  3SEM A;  4K11 A;  2K2M A;  3RBB B;  1V1C A;  2EKH A;  2KT8 A;  2EGA A;  4J9C A;  2XMF A;  4ORZ A;  2C0T A;  2GTJ A;  2L3P A;  1ZX6 A;  2DRM A;  3H41 A;  3THK A;  1S1N A;  2J6K A;  4Z89 A;  4F16 A;  2RN8 A;  2KXC A;  1YCS B;  3UA7 A;  1RLQ C;  2KEA A;  5EC7 A;  1FYN A;  1WXT A;  1QKX A;  2DA9 A;  1WIE A;  3IQL A;  2EGC A;  4OMN A;  1CSK A;  1AZE A;  1QCF A;  2D8J A;  5L23 A;  3I35 A;  3QWX X;  2I0N A;  2CDT A;  3EHQ A;  1OPL A;  1AWJ A;  1H8K A;  2CT4 A;  2DL8 A;  3PE0 A;  3VS6 A;  1E7O A;  1RLP C;  2CRE A;  2FPF A;  2F2W A;  1UFF A;  1VYV A;  4IIO A;  3U23 A;  1PKT A;  2YSQ A;  1LCK A;  3M0T A;  3EG2 A;  1GBQ A;  2K7A A;  2YUN A;  2FPE A;  3I5R A;  2JS2 A;  4RTZ A;  1BBZ A;  1WFW A;  1YNZ A;  1M3C A;  1PRL C;  1ABQ A;  2H8H A;  2KRM A;  4GBQ A;  4RTT A;  4OMM A;  1JU5 C;  3VRY A;  1K1Z A;  1BU1 A;  2DX1 A;  4J9G A;  2FRW A;  4LN2 A;  4D8D A;  4J9H A;  1T0H A;  4GLM A;  1W1F A;  4RTX A;  3M0P A;  2DBK A;  3I9Q A;  2DYB A;  2A37 A;  4OMO A;  4RTV A;  3H0H A;  1QWF A;  4KRT A;  3JV3 A;  2X3X D;  5ECA A;  3TSZ A;  2AZV A;  1E6H A;  4CC7 A;  1K0X A;  1AD5 A;  3REB B;  4EIK A;  5IH2 A;  5IXB A;  1SRM A;  2DIL A;  4JJD A;  1XOV A;  2RQT A;  1UHF A;  1W70 A;  1Y0M A;  2FPD A;  1QWE A;  2KR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...