4M75G

Crystal structure of lsm1-7 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
82
Chain Sequence
NLYFQGSMLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 82
sequence length 98
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75G00
4QVCA 5GANf 1BIBA 5GMKh 4PJOE 3BY7A 2CGHA 1KQ2A 4PJOC 4M77D 3RKYA 3FJPA 4N0AA 2DZCA 4XQ3A 4M7AA 1Y96A 2JN0A 3QO3A 4C92B 5LJ3h 3V8LA 4XTWA 5GAOq 1KQ1A 3RUXA 4J6XA 5GAN7 4JUVA 1I8FA 2E41A 3VU3C 2EJFA 3FIFA 3RKWA 2I2LA 3FB9A 2DKGA 3M4GA 5GAOl 2E10A 4QVDA 4M7AF 4NL3A 2EJ9A 5GMKl 2FYKA 4M75A 4F7UB 5GANe 2E1HA 4M77B 4NOYA 5I21A 4M7AD 4M75E 3BDUA 4PNOA 4JLIA 3JCMh 4EMKA 1TH7A 4OP0A 3JCMQ 3HSBA 2DVEA 5GMKi 3INZA 1U1TA 3QUIA 4EMGA 2DXUA 4JRKA 3JB9F 5GMKm 4M7DC 4PJOA 4C8QC 4M75F 1D3BB 4M78D 1M5Q1 5GMKj 2VXEA 5GANd 3JB9D 3SWNC 5GAMh 4C8QG 2YLBA 3JCMc 4M7DG 3JCMb 3JCMX 1I5LA 5GAOm 3QHSA 2DXTA 4M7AB 1Y96B 1JRIA 2DTIA 1JBMA 2E65A 2RD1A 4J5YA 3RKXA 1BIAA 4C92C 5LJ3j 4X9CA 4PJOF 2DZ9A 2YLCA 4C92G 2Y90A 4XTUA 3V8JA 5LJ3d 2QTXA 5LJ3g 4PJOD 5LJ3f 3HFOA 5DY9A 4M78B 3GIBA 5GAN3 3JCMW 3JCMJ 4DQ2A 1LNXA 3BFMA 4XU1A 2DJZA 4M77C 3EFSA 4XTVA 4EMKB 4F7UG 4M77G 4M7DA 1WQ7A 2DEQA 2DTHA 4C8QA 5GAN8 1M8VA 5GAMe 5GMKe 1WQWA 4XU0A 4M7DE 3SWNA 4C8QE 3V7SA 3JCMg 3JB9I 3JCMf 4PJOB 3JB9J 5GAMj 4XU2A 3V7RA 5LJ3e 4C92A 4M75D 3RESA 4JRIA 4M7DF 2DTOA 4C8QF 1LJOA 4C92E 5GAMd 4XTZA 4A53A 5GAMg 4HA8A 4RCBA 4C8QD 5GAMf 1X01A 5GAN4 4MMLA 4M7AG 1H641 4EMHA 3RIRA 4NL2A 4C92F 2EJGA 1B34A 4M77A 3JCMP 4M78C 2EWNA 3JCMe 4F7UE 2RA2A 5LJ5h 4M77E 4A54A 1N9SA 1WPYA 3PGGA 4M75B 4M78G 3RERA 1U1SA 5GANh 3JB9G 1LOJA 4WF2A 2YHTA 2E64A 4MMKA 4C8QB 1D3BA 4M77F 2K57A 4XU3A 3SWNB 2EAYA 5GAN2 5GAOn 3EFRA 3JCMd 3V8KA 1MGQA 1HXDA 3JB9H 1I4K1 4Y91A 4V2SA 5CAIA 4PJOG 3QSUA 3HFNA 4X9DA 2VC8A 4M7AE 5GAOp 4N0AC 3AHUA 4M7AC 2VXFA 2RB6A 4M7DD 3V7CA 4M78A 3BW1A 5LJ5e 5GAOr 4HT8A 4HT9A 5GAN6 5GAN5 1N9RA 4M78E 4RCCA 4F7UA 1B34B 4J6WA 5LJ5j 4XTXA 1YCYA 2RM4A 4XTYA 4C92D 3SB2A 1WNLA 4M75C 5GANj 2FB7A 3JCMV 4M78F 3L1AA 4M75G 5LJ5g 4EMKC 4J6YA 1I81A 5LJ5f 5LJ5d 4M7DB 2HNIA 4F7UF 1HK9A 3L2ZA 2ZGWA 5GANg
chains in the Genus database with same CATH superfamily
1WHKA 4BE0A 3I56T 3FJPA 4E2FB 1Y96A 3H0IA 4B9WA 4LUDA 1KQSS 2R5AA 4BD3A 1VA7A 3REBB 1KC8R 3URGA 3JSCA 1YWPA 1GBRA 4FYYB 2E1HA 2LRQA 5C6SA 2QTVA 2EYZA 1ACMB 2J06A 3HSBA 1VYVA 4K11A 5IXFA 3CCMT 3JB9F 4J9CA 1BCOA 1Y7XA 4FT4A 1Q7YC 2M51A 4O6JA 1SKUB 3IQLA 3L2WA 1QLYA 1PD0A 1ZUUA 1OULA 4AFQC 2CUDA 1TUDA 1IREB 2KQWA 2RHYA 3C94A 3JCMW 3BFMA 2DJZA 1MMDA 1GCQA 2CKKA 1M2VB 3EFSA 4XTVA 4M77G 2FZKB 2DD4A 3HPWA 2VGMA 2GTOA 2HD0A 1KJWA 2ECZA 3FRNA 1UGSB 4M7DF 3EG0A 4A53A 3HKSA 2XD0A 4RUGA 2KSSA 3JCMP 3CPWA 4J9BA 2RJCA 3CQTA 5KYXB 4M75B 2LJ0A 1M3CA 3VS7A 1LOJA 2D8JA 4FYWB 1KFZA 1AVZC 1X2KA 2K57A 5GAN2 1RAAB 2HSPA 4PLLA 3VYHB 4V2SA 2FRWA 2KMTA 1D0XA 3QDRB 2K2MA 4QVZA 4PL6A 2D9TA 2HBPA 2LX7A 4FT2A 5D6YA 2MI6A 1B34B 2RO0A 4PFZA 2AZVA 1OU8A 2PZ1A 2PUKB 2X4JA 4IUUA 3CCJQ 4M78F 5LJ5d 3G4SQ 1BB9A 4P5NA 3G71Q 2D0NA 3CCJA 1C0MA 5J26A 3DB3A 2JN0A 2BKDN 1ZA1B 3G4SA 2EJFA 4WTOB 3L42A 3G71A 1VQ9A 2KRMA 2KAFA 3CCRQ 4M7AF 5GANe 4JJDA 2DMOA 4EMKA 1WJSA 3KUFA 2VASA 1X27A 2LQNA 4OMFB 2F2XA 5CKEA 5IHIA 4NS5A 1M5Q1 4M7DG 4OB3B 1I5LA 3LWIA 2RNAA 2E70A 2GF7A 2M16A 3QHSA 4OB0B 3UWNA 1K4US 5IN1A 3OS1A 3RMQA 2GQIA 2MYSA 4L5GA 2CP3A 1AT1B 2YT6A 2L3QA 5LJ3d 4B9XA 1LNXA 1C1AA 2FPFA 4A4EA 2EGCA 4JJCA 4PJMA 4C8QA 5CQXA 1WA7A 2CH4W 1PM3A 1VQPQ 1QVGA 4C8QE 3CMET 2L8DA 1CKBA 4KH0B 5KYYA 4XU2A 1Q82C 2QEXQ 4A63B 8AT1B 3FC3A 1VQPA 1VQ7Q 4MMLA 1H641 3PE0A 3M0SA 1D1AA 2P4RA 2QEXA 1JEGA 4BI3A 1VQ8A 4FSXA 2DX1A 3MPUB 2PQWA 3ZFJA 4M78G 1VQ7A 1VQ5A 4IUQA 4FYXB 3C0CA 2JS0A 2OAUA 3LH5A 1G2BA 4A4HA 5ECAA 1NZ9A 2QGGA 3QXEB 1WHLA 3FJ5A 2X35A 4J6WA 1VQNQ 2DYIA 3JV3A 1Q81R 1ZX6A 3CCQA 4M75C 2LNHB 1NYGA 1YITQ 1TTHB 4J6YA 4VUBA 1HK9A 3HRUA 5GANf 1HJDA 1EIFA 4N0AA 2PVDB 4C92B 2NUZA 4OMQA 3BE3A 1TSFA 1RI9A 1OV3A 4HCKA 2LTOA 4DOWA 2GCXA 1K73R 2RQWA 1MHNA 1Q95G 4BE1A 3A8GB 4OMLA 1RAFB 2QYZA 4E47A 2Y4YA 2DIQA 3SD4A 4QW2A 5GMKi 4PJOA 3OYDA 2X51A 3OYIA 1WHMA 2OI3A 4PJJA 1JBMA 4BI4A 3MJXA 4KBMB 1VIEA 1OU9A 2LC4A 1JB0E 1N6AA 4AFUC 1M1KU 4PFOA 3FEOA 4PJLA 3PFSA 2XDBA 2JTMA 4FYVB 1Q7YR 1WQ7A 1M8VA 2DILA 2MF2A 1JO8A 4Z88A 3UF4A 1W6XA 3TU4K 3QPHA 3H0FA 3VS2A 2CSQA 4HA8A 4Y92A 1N8RU 5KCOA 2AIRB 2K79A 2JTFA 1AWJA 4JPBW 1N5ZA 3FDRA 3VS4A 3QWYA 2I0NA 3CCUQ 2G3RA 4C0ZA 3TVTA 4PJNA 1AZEA 2P4TA 3JCMd 2QA4T 5IH2A 3NHNA 4PJOG 3QSUA 3EHRA 1PKTA 3CCEQ 3G71T 2RQUA 3CXCA 1YNZA 1VQ9T 4HKEA 4YTLA 1KD1R 1OX9A 1YCYA 3A8HB 3CCEA 3JCMV 2HQEA 1WJRA 1I81A 3L2ZA 2OTLT 3OYBA 1EX4A 2MMPA 4Y28E 1UEBA 5D6XA 3VUZA 2FEIA 5KE3A 2A08A 1WFWA 1M2VA 3KBGA 1RABB 1WGSA 2F69A 2FZGB 1QVFP 2XK0A 1PCXA 4M75F 1YCSB 2MWPA 2PVGB 2E3IA 4Z02A 2EVRA 4C92C 1Q86C 3MEVA 5A0DA 2DA9A 2J6FA 2QEXT 2JXBA 1VQ8T 3WXMB 3KFVA 3HFOA 3H41A 3RNJA 4X1VA 1VQ4Q 2DJQA 1PG5B 1VQ5T 1ARKA 4RG8A 2MCNA 2COZA 2Z0WA 3I56Q 1NJIC 1OPLA 1QKXA 1YWOA 2Y4XA 3JB9J 4AMCA 2H8HA 2HSEB 1P92A 2ZPEB 4N4HA 2NUTB 1EFNA 1J3TA 3I56A 1O9SA 2V8IA 2H3JA 3QZ9B 2QQBA 4F14A 2RK1A 1B34A 3THKA 2EYYA 2RPNA 2VUBA 4F7UE 3CCQT 2YRCA 3CCMQ 1D09B 2D0QB 5J3BA 2BUDA 3EFRA 3CCMA 1MGQA 2ED1A 2LT4A 1U06A 1U3OA 2VC8A 9ATCB 3G6ET 3AHUA 4E7JA 5EC7A 4J7FA 4LDWA 1UB4A 3BW1A 4HT9A 4F04B 3D7SB 2RM4A 2NYSA 2BZYA 1GRIA 2DL7A 4M75G 1SHFA 2FVUA 2ZGWA 3TREA 2D8HA 1GL5A 3BY7A 2HAXA 2B8AA 5KYYB 4LDUA 3QO3A 5CKHA 1D0ZA 2CH4A 4L59A 4RTTA 3QBYA 1K9MU 4NOYA 3M55A 3JCMh 3CC2T 1NM7A 3ZBDA 1GCQC 1U1TA 1WHHA 5AYFA 2G6FX 1WHGA 4J9HA 4E7ZA 2K5FA 4J83A 2DXTA 2RD1A 2O9VA 3OS2A 3HP9A 4OGCA 4D6WA 5CKBA 1C6VX 3GIBA 3UT1A 4DQ2A 3JRZA 4EPCA 1UE9A 2AZSA 5GJVB 1WQWA 2CP2A 5FU6B 3JCMg 2CS7A 3X25B 3QDFA 3OS0A 1K9MR 3I9QA 4XK8E 3LH0A 1MMGA 5GAMd 2DFUA 2IPOB 1RLQC 1IO6A 2V1RA 4C92F 5CK9A 1YHQA 2DNUA 3PIPA 3QYHB 4OF1A 3EFOB 3TEEA 4N4GA 3R6OA 4WCIA 1OI1A 2KE9A 2FRYA 4FW1A 3MCAB 1AWOA 2VB6A 3LGLA 1X6OA 4Y91A 4D8KA 5FLXE 4DBHA 2L3PA 2EQMA 5FRMA 5CO7A 2DXCA 2KI7A 5LJ5e 3VS0A 4XTYA 3CMEQ 2QQ9A 3AT1B 1X6BA 4EMKC 1IHVA 1KC8U 1BIBA 4MZTA 2MPXC 4C0DC 5A0LA 1SRLA 3CMEA 2X3WD 2DZCA 2HCKA 1PKSA 2YUNA 3X26B 1G3SA 3J7AF 1E6GA 4QKUA 4X34A 4C5GA 3OYHA 2I2LA 4BY6B 1UHCA 4IUVA 3NMZC 1YJWT 1U5SA 3BDUA 1SF9A 4J9GA 4AFSC 2YRVA 3OW2A 2RQRA 4C8QC 4QQDA 1QMCA 4BDZA 2VXEA 2DLPA 3JCMb 1QW1A 3A1PA 1UG1A 1E7OA 3SHWA 4C92G 3M0UA 2QQAA 2FPEA 4R0KA 4ATOA 3H0HA 2ABLA 3PMTA 3CPWS 4E7LA 3DB4A 2OJ2A 2P0KA 1IZ6A 1K8AR 1HSQA 2KRNA 3A5ZB 2PUOB 2IIMA 1TOVA 3P8BB 3TSWA 2NLUA 4RTWA 4PKCC 2W0ZA 4BUGA 3CBMA 2YXYA 2LNVA 5J39A 2OTJT 2ED0A 4DA4A 6AT1B 3PNWC 3RERA 1SPKA 4IKFA 1IXDA 1RADB 2W10A 5FU6C 1W2BS 4OVAA 1YFNA 1D0YA 4N0AC 5L8RE 1ZLMA 2VWFA 1H3HA 4OB1B 2C06A 1VQMT 1YBYA 2EQIA 3EG9B 1W1FA 4ELZC 3LW5E 1AEYA 4QVCA 2CSIA 3M0PA 4PJOC 1K0SA 3L2UA 1JJ2P 3NTIA 4XQ3A 3ME9A 3VKIA 2HEQA 1KQSA 1K0XA 2VV5A 1V1CA 4LDYA 5KYNA 1OEBA 5KYWB 2KY9A 4F7UB 1R77A 2R58A 1UGPB 2QA4Q 3INZA 3QUIA 1MV3A 3J81E 1QVGS 2DAQA 4ME7A 1BCMA 2FG0A 2ZPFB 2DD5A 3JB9D 2XHCA 3JCMX 1VQ9Q 1M2OA 2FZCB 2NUTA 2QA4A 1YP5A 5GMKm 4JJBA 2E5QA 4ORZA 1YHQT 3OMGA 4Z8AA 1PRLC 3M58A 5CIUA 1V29B 2V26A 1KHIA 4KRTA 3C4SA 3EAEA 3M4YA 1AWWA 3PVLA 1FWZA 2OTLQ 1M90R 2DPPB 3HRSA 2X3XD 2YUQA 4ZGDB 1RLPC 1ZSZA 1X6GA 2OTLA 2DTOA 4C8QF 1LJOA 4JZ3A 2K9GA 4RTZA 4ZGJB 1UUEA 2EKHA 1BBZA 3M54A 2DRMA 3VUBA 3JCMe 4WF2A 2JMAA 3CD6Q 1D3BA 3SWNB 2E4HA 1NPRA 4E6RA 3L2RA 2XICA 5CAIA 1PNJA 4FCYA 3CD6A 1VQ8Q 4BACA 4RG2A 1Q81U 3OYCA 4M7AE 3M53A 3WVEB 1JQQA 1VQ5Q 2RI3A 4Z89A 5GAN6 3H9NA 3LX7A 1TUCA 1M8MA 5EG2A 1IGUA 3SB2A 1D1BA 1BKBA 2QK0A 1AWXA 3OYNA 3X28B 1M30A 2EYXA 1KQ2A 1K73U 4IIOA 2M0OA 1K1ZA 4ESRA 1YJ9T 3EGDA 1M27C 2DO3A 4JRQA 2CP5A 3CCQQ 2AK5A 1UFFA 2DKGA 4QVDA 4GLKA 2XDPA 1EZZB 1XTDA 3KXTA 4M7AD 1D1CA 3QJ6A 2QDYB 4AT1B 1GCPA 1Y0MA 3GLXA 3QZ5B 4RTVA 3G6EQ 2M0YA 4C8QG 3JCMc 1QQJA 3RBBB 3OYLA 1WXBA 1SSHA 1YIJT 1JRIA 1U8RA 3OYEA 4PJOF 3TSZA 1Q7YU 3G6EA 2JZ2A 2K3BA 3EFOA 1FXXA 2COWA 1M4ZA 3A8OB 4DOVA 1FX7A 3HL8A 1NLPC 2CREA 2KT8A 1Z9ZA 1R8OB 1W70A 3JCMf 1IHWA 2LJ3A 1ABQA 4FL6A 1X01A 3CXCS 3I55T 3CC2Q 2DETA 5LJ5h 3GP8A 8ATCB 1VUBA 3X24B 2ROTA 1JJ2S 3OMCA 3CC2A 2P0PA 2O4XB 2ZAEA 1KD1U 2K3YA 4X9DA 2V1QA 4BDYA 4JZ4A 1N9RA 1I07A 3HHTB 2DRKA 2DL5A 5LJ5j 1TUGB 4XTXA 2WSFE 1A0NB 2KGTA 4CI0C 4PFPA 1SHGA 1JXMA 2HL3A 3QKJA 2WSCE 5LJ5g 2GBQA 4CC4B 2CGHA 3J80E 2OAWA 1XQHA 2LX9A 2RQVA 2DL8A 5LJ3h 7AT1B 2JW4A 5GAOq 1KIKA 1OZ2A 2CZ0B 4Q5WA 3PIOA 5CKDA 4C5IA 5CCAA 1Y71A 3FB9A 1RI0A 1XOVA 2FYKA 4PK4A 4ANJA 1TWBA 3NPFA 2CP0A 3JCMQ 4C0FA 2BZ8A 4EMGA 1AZGB 3VS1A 4KUDK 1H92A 1RL2A 1YN8A 5KYUB 2JM9A 3CCVT 2HL5C 5GAOm 4C5EA 3RKXA 3OBWA 5LJ3j 5D7UA 2DZ9A 4RTXA 2WACA 1SRMA 2ZZDA 2E5KA 2QG9B 5LJ3g 4UC4A 5IHKA 4XU1A 1FMKA 2ZPGB 3L2QA 2RK2A 3T9NA 2DTHA 2OX7A 5GAMe 2DIGA 1VQLT 1M1GA 3EH2A 3CD6T 5L23A 4JRIA 2LDMA 1ZHIA 1YJWQ 1OPKA 3I5RA 2CZ7B 3HTRA 2CT4A 1QKWA 4OMPA 5I11A 2EBPA 1PWTA 1U1SA 4MZPA 2YHTA 3EG9A 1YJWA 3A8MB 2LP5A 2RN8A 1S72A 4KT0E 1LCKA 3ER0A 2X4WA 2CYZB 1PRMC 3A98A 1GBQA 1VQKT 1R0CB 5DLQE 3V7CA 3QIIA 3P8HA 1QP2A 1WDXA 2DE0X 5KYWA 3CC4A 2P84A 1G3TA 4F7UA 3I5SA 4LDXA 3C95A 4R55A 2ZPIB 2DF6A 3UPUA 2EYWA 2FPDA 2K5IA 1Q82R 2KBTA 2VVKA 4KH1B 3CPWP 1WXUA 1ZQ1A 2SRCA 4LN2A 3NFCA 3RKYA 1PHTA 2KDSA 1YJNA 1ZSZB 3EGUA 3RUXA 2OTJQ 2JOYA 4F17A 2JM8A 2RI5A 1ZSGA 4NL3A 2C0TA 4ZNXA 2EIFA 5I21A 2JNGA 2OTJA 1QWEA 4D8DA 4HVWA 2F1LA 4LE9A 1D3BB 3EG2A 1VQOA 2ZCFB 2DBKA 2SEMA 3DKMA 1B3QA 4GY5A 4M7AB 1WI7A 4QQ6A 4A4FA 3M56A 4JRPA 1R0BG 1VQMQ 1N27A 1W2BP 1AOJA 2KEAA 1KHCA 2YUOA 1NPPA 4F7UG 3OYYA 2PNIA 2KYBA 5GAN8 1VQMA 3SWNA 3V7SA 1WIEA 1QWFA 4HVUA 1M3AA 2E12A 1M3BA 2RHUA 4IIMA 2CP6A 3NTKA 4RCBA 3EGDB 5GAN4 1IGQA 5FWBA 2E3HA 1BU1A 1FYNA 2RA2A 4IURA 4ZN3A 3MP8A 2MOXA 2O9SA 2RHXA 2A0FB 2HBWA 1YHQQ 1MV0B 1WXTA 1I1JA 2JMCA 1QVGP 2KXDA 2RB6A 3OYGA 1G3YA 4LXCA 1W4SA 4KUIA 2A36A 1WZOA 1OYXA 2YWWA 2V8KA 4RTUA 4HCCA 4LNPA 3ASKA 2ZPHB 2QASA 3G7ZA 2JJ9A 4IUPA 2A7YA 2EQJA 3JB9H 3OSSC 1G3WA 5IHNA 2YRDA 2LMJA 2EW3A 5IAYA 1GFCA 1Y07A 2L2PA 4E7SA 4JUVA 1I8FA 2RJEA 3RKWA 2K7AA 1SG5A 1TU0B 1B7TA 5CR2A 2J6OA 5HK0A 1T3SA 2HQHA 3RDVA 4KGVB 3ZL7C 4JRKA 4KGXB 3CEYA 2BE9B 4CC3A 3N5BB 1PD1A 2GTJA 1ZBXA 2DK3A 4HCBA 4J5YA 1ZSZC 2ESWA 3PTAA 2CZ6B 1PSEA 2JTEA 1K8AU 1UDLA 3L2VA 5LL6S 1H8KA 3PMIA 4MDXA 1CKAA 1NLOC 4ZGEB 2AHJB 3M59A 2DL4A 1BI3A 3CMAT 2HMAA 1S72T 1CSKA 5C0MA 2L0AA 5A0GA 1Q81C 1YJ9Q 2O4XA 3V7RA 4R56A 2A28A 5LJ3e 2O31A 2QAZA 1NJIU 2LZ6B 4QT7A 4DEYA 1VYUA 3S3OA 1IRXA 1KG1A 1YJ9A 3CC4T 3CBOA 5FROA 4M77A 2WSEE 1X2QA 4M77E 1WPYA 3OB9A 4L6V5 2XU8A 2DEUA 5AT1B 1QCNA 1YIJQ 4FW2A 1YJNT 3FLGA 1Q86R 3OQ5A 3OA6A 4LUEA 2J6KA 5GAOp 2LVMA 3QG1A 2A3LA 1YIJA 3LGFA 1QVFA 4RCCA 1TXQA 1K9AA 4DBFA 2D1XA 1NJIR 2LQWA 2F5TX 4J9EA 5LJ5f 1VQOT 1HXDA 1OX8A 2K2VA 2DL3A 2KT1A 5KYUA 5GMKh 3PT9A 2C0OA 2L3SA 4M77D 3DLLA 3UDCA 2VGNA 2CP7A 3I55Q 2EKOA 2LCLA 1MMAA 3REAB 3M4GA 2E10A 2LT1A 2RQTA 3I55A 1VQ6T 1VIFA 1M1FA 3CXCP 5FRNA 2DVEA 1B07A 1BK2A 1V76A 2DXUA 3META 2RI2A 5GMKj 2EGEA 2K4YA 2M9UA 1BI2A 5GAMh 2YLBA 2X4XA 2PU9B 4FU6A 2EFIA 2JVVA 4AG1C 1OZ3A 2E65A 3MHXA 1GFDA 1M1KC 1M90U 1TG0A 1NE8A 3UA6A 1BI0A 1K76A 4PLIA 5LJ3f 3JCMJ 1ZUKA 1T0HA 2EPDA 1LVKA 1KD1C 2RJFA 3LLRA 4M7DA 2DEQA 3VV0A 4M7DE 2YUPA 3JB9I 3GBQA 1N8RC 4EIKA 3OYJA 4MDWA 2KNBB 5GAMj 1WX6A 1GXIE 2RJDA 1T3LA 2BIVA 5GAMg 2ATCB 2JS2A 3EGXB 2JUFA 4NL2A 2O88A 1SSFA 4BY6C 2EQUA 2QQSA 3S3MA 3JB9G 1HD3A 1ZBJA 3CCVQ 3GOXA 1NEBA 4C5HA 3EG3A 1W2BA 3TQ7P 1I4K1 1UTIA 4CC2A 3HFNA 2E6NA 2XI9A 3CCVA 2X9HA 2DERA 3S6WA 4M7DD 4M78A 2KROA 1G83A 4HT8A 4M78E 2FO0A 2MWOA 1UGVA 3MP6A 2J7IA 1MNEA 2DM1A 1VQLQ 3CCRA 2HNIA 4RTYA 1M9SA 3CCST 2K5LA 3MEUA 4M7AA 1VQLA 2LQKA 4AG2C 1KQ1A 1WLPB 2PTKA 2D6FA 4J6XA 3GNGA 2DBMA 3FIFA 2RHZA 4OMNA 2LCCA 2QGFB 1UGQB 5HKCA 3WVDB 3EH1A 3MEWA 2MIOA 1F1BB 2DVJA 3OYKA 4M78D 4A4GA 1YI2Q 4HXJA 1AD5A 1PSFA 1VQKQ 3EHQA 3MEAA 3GF5A 1S1NA 4EDUA 1YI2A 4XTUA 4DBRA 1RAGB 2XG8D 3VS6A 5GAN3 1VQKA 4KULA 3M5AA 5IT9E 2KVQG 5HK3A 1QVPA 2QI2A 3OY9A 4LDVA 3O8VA 2JT4A 2FL7A 3LYIA 4C8QD 4M7AG 2EJGA 2COYA 4C0GA 1RACB 1RAIB 2AKLA 3RR6A 2KRSA 1BYMA 1KK7A 3OSVA 5KE2A 1I5OB 3E9FA 2VKNA 3OYFA 2EAYA 1VQNA 2R57A 3LWHA 3H6ZA 3CC7Q 1YITA 2YSQA 4FIBA 2VXFA 3VS3A 4O5VA 1QCOA 1SEMA 1KSWA 5GAN5 3CC7A 3SEMA 1HYOA 4B6MA 3VYGA 3QWXX 1DJ7B 5DM7R 4F16A 2KR3A 3MO8A 4PJOE 4HCZA 4BB7A 4E7HA 2F2WA 4KGZB 3QYGB 5FWCA 1K9MC 5A2QE 3SDZA 4CRIA 2EJ9A 1MNDA 5GMKl 2CZ1B 4M77B 4PNOA 5M9OA 4FSSA 4OP0A 2GFUA 4OGEA 1PC0A 2ROLA 4MZMA 2XIDA 1MUZA 4RMOA 2C0IA 5GANd 4J9DA 3SWNC 2GFAA 1Y96B 2DTIA 3RMSA 3I35A 3PVQA 1BIAA 1AHJB 4X9CA 1T0JA 1TS9A 2B86A 3DLMA 2A37A 2NUPA 3V8JA 4ZTFA 4PJOD 3E1SA 2RHIA 1BI1A 3M0QA 2K3XA 1Z9QA 1UGRB 5GMKe 2F2VA 2HDAA 2KYMA 3CCJT 4JS5A 1M1KR 1OOTA 5FU7B 2EGAA 2H3EB 3G4ST 3CCUA 2QDLA 1UECA 2K6DA 4XTZA 3OW2P 4OMOA 2NWMA 2HKNA 3OBYA 2X4YA 2EWNA 4J7IA 5HCKA 1N9SA 1JJ2A 1N8RR 3CPFA 4II1A 3CCRT 1WYXA 2HZYA 5GAOn 3CCLQ 3CBPA 1RAHB 3M0RA 5FW9A 3TCJA 1I0CA 2FHDA 2IVWA 3O5ZA 3GNFB 3CCLA 4RKUE 5CVIA 1Q82U 1X69A 1WJQA 2P0QA 3CMAQ 1S72Q 1G8XA 1X43A 1UJ0A 4JJNK 1KC8C 1WNLA 2EYQA 2E6ZA 2RMOA 4M7DB 5KCHA 3SFMA 4CC7A 4F7UF 2J05A 2LJ1A 3CMAA 1K8AC 4BE2A 3MKDA 1VQPT 3CC4Q 2O01E 1YI2T 2HKQB 4M4ZA 2QXFA 2E41A 3UA7A 5I22A 4N4IA 3E2UA 4AFZC 2AT1B 5KYXA 1VQ7T 4M75A 3NGPA 5HY6A 5IXBA 4M75E 2CT3A 4JLIA 3VRYA 1TH7A 1YJNQ 1RAEB 5I2MA 1UJYA 4DEXA 1VQ4A 2RF0A 2CDTA 2BTTA 4OMMA 2DXBA 3EGXA 2YLCA 4TVRA 2F5KA 5DY9A 4M78B 5GJWB 3A8LB 3OYMA 1VQOQ 4M77C 1KQSP 3EG1A 5CQYA 3U23A 4EMKB 1NBEB 1VQNT 3OYAA 2EQKA 4J8OA 4C0DB 3F70A 2L5QA 1YITT 3VRZA 4M75D 3RESA 2DYBA 3QJYA 4A4KA 2CUBA 1NG2A 5GAMf 3UATA 3R6NA 3MP1A 3CC7T 1VQ6Q 2YDLA 4ZTJA 2QQRA 1QCFA 2M02A 3GPLA 2LCSA 4A54A 3PGGA 2L3RA 5GANh 1VQ6A 4C8QB 3Q1JA 4JDSA 3P8DA 1VYTA 3S3NA 3JAME 5FU7C 1QP3A 2R5MA 4JS4A 2MK5A 4J9IA 2VYTA 1FMVA 1ABOA 1NYFA 5GANj 1ZA2B 3L1AA 1XJWB 5D6WA 1M90C 5GANg 5KH6A 2M1HA 4BI8B 4E7KA 2ENMA 4JLGA 1JXOA 1O75A 4XTWA 3V8LA 2LQ8A 1X75C 5GAN7 1OQKA 3HRTA 3VU3C 2KK4A 2BE7D 1G5VA 2KXCA 2PVOB 2BZXA 1WHJA 5GAOl 2GQVA 1RUWA 1IB8A 2XMFA 4M7DC 3OW2S 4FM4B 3BDLA 3CCUT 1MMNA 3H8ZA 3E9GA 3OS5A 1Y57A 4LD6A 4QQGA 2ZPBB 3G1JA 4LD9K 1VOMA 3X20B 2Y90A 3VJPA 2QTXA 1LPLA 3CCET 3NTHA 4GLMA 3CCSQ 3M9QA 4XU0A 2IG0A 1NEGA 4PJOB 3ZEHA 2GNCA 3VS5A 4C92A 4C92E 2XDDA 5I2SA 3CCLT 5DLOA 3CCSA 4XAXB 3M57A 4EMHA 1QVFS 3RIRA 4ZN1A 4M78C 4ELYC 1Q86U 2V8JA 2HQXA 1XNIA 2E64A 4MMKA 4M77F 4DBQA 1E6HA 4XU3A 4HVVA 4E7IA 3V8KA 4J9FA 3M0TA 4M7AC 3E19A 2GGRA 4GBQA 5GAOr 1FMWA 1H3ZA 2NUPB 4IUTA 2AKKA 4C92D 4OB2B 1ZUYA 2FB7A 5CKFA 2MAMA 3C12A 1K73C 3ULRB 2O2OA 1VQ4T 1UHFA 2L89A 1JU5C 2RH2A 2XKOC
chains in the Genus database with same CATH topology
1M9SA 3BY7A 2CGHA 3CCST 4BE0A 2HAXA 2K5LA 3MEUA 3I56T 3J80E 3FJPA 2B8AA 1XQHA 2LX9A 4LDUA 1Y96A 3QO3A 5CKHA 1VQLA 4M7AA 2LQKA 5LJ3h 5GAOq 4B9WA 1KQ1A 1OZ2A 2CZ0B 2D6FA 4J6XA 4Q5WA 2R5AA 4BD3A 3PIOA 5CKDA 1KQSS 3GNGA 3URGA 4C5IA 4L59A 5CCAA 1Y71A 3FIFA 3FB9A 2RHZA 3JSCA 2LCCA 1RI0A 1XOVA 2FYKA 2E1HA 3QBYA 1UGQB 2LRQA 5C6SA 4NOYA 5HKCA 1K9MU 3M55A 3JCMh 3JCMQ 3CC2T 3WVDB 3HSBA 3ZBDA 1U1TA 3MEWA 5AYFA 4C0FA 3CCMT 4EMGA 3JB9F 4KUDK 3OYKA 1Y7XA 4M78D 4A4GA 1RL2A 4FT4A 1PSFA 3CCVT 1Q7YC 4O6JA 2K5FA 5GAOm 3L2WA 4J83A 2DXTA 3RKXA 2RD1A 3MEAA 3OBWA 4C5EA 5LJ3j 3OS2A 3HP9A 4OGCA 3GF5A 2DZ9A 2WACA 4D6WA 4EDUA 1YI2A 2ZZDA 4XTUA 5CKBA 5LJ3g 4UC4A 3GIBA 2XG8D 3UT1A 1IREB 2KQWA 2RHYA 3C94A 5GAN3 4DQ2A 3JCMW 3BFMA 4XU1A 3JRZA 2DJZA 2ZPGB 2CKKA 4KULA 3M5AA 3EFSA 4XTVA 5IT9E 2KVQG 3L2QA 2RK2A 4M77G 3T9NA 2DTHA 5HK3A 2DD4A 3HPWA 1WQWA 5GAMe 5FU6B 3JCMg 2CS7A 2DIGA 1VQLT 1M1GA 1QVPA 2VGMA 3X25B 3CD6T 3OS0A 2QI2A 3OY9A 4LDVA 3O8VA 2HD0A 3FRNA 4JRIA 1UGSB 4M7DF 2FL7A 4XK8E 3LH0A 3LYIA 4A53A 5GAMd 2LDMA 3HKSA 4C8QD 1ZHIA 4M7AG 3TREA 2XD0A 2KSSA 4C92F 5CK9A 1YHQA 2EJGA 2CZ7B 3PIPA 3QYHB 3CPWA 3JCMP 4OF1A 3TEEA 2RJCA 4N4GA 4C0GA 4M75B 1BYMA 3R6OA 1U1SA 3OSVA 5KE2A 4MZPA 1OI1A 1LOJA 2YHTA 3E9FA 1YJWA 3A8MB 2K57A 3OYFA 2EAYA 5GAN2 1S72A 4KT0E 1VQNA 2R57A 3MCAB 4PLLA 3VYHB 3LWHA 3LGLA 4V2SA 1X6OA 4Y91A 3H6ZA 2KMTA 3QDRB 5FLXE 1YITA 4FIBA 3ER0A 4QVZA 4PL6A 2X4WA 2CYZB 2EQMA 2D9TA 2VXFA 5CO7A 5FRMA 1VQKT 2DXCA 2HBPA 4O5VA 4FT2A 5DLQE 3V7CA 3QIIA 3P8HA 1QP2A 2MI6A 5D6YA 5LJ5e 5GAN5 3CC7A 3CC4A 4F7UA 1G3TA 1B34B 2RO0A 4LDXA 4XTYA 3C95A 4R55A 2ZPIB 3VYGA 2PUKB 2QQ9A 3UPUA 2X4JA 4IUUA 2K5IA 4M78F 1DJ7B 5LJ5d 4EMKC 5DM7R 1KC8U 3MO8A 4PJOE 1BIBA 4HCZA 1ZQ1A 4P5NA 4MZTA 4BB7A 3NFCA 4C0DC 5A0LA 3RKYA 2KDSA 3CMEA 2DZCA 1YJNA 3CCJA 5J26A 3DB3A 2JN0A 3X26B 4E7HA 1G3SA 3J7AF 2BKDN 3RUXA 2JOYA 3QYGB 3G4SA 1K9MC 4X34A 4C5GA 2RI5A 2EJFA 3L42A 3OYHA 2I2LA 5A2QE 3G71A 4BY6B 1VQ9A 3SDZA 2KAFA 4CRIA 2EJ9A 5GMKl 4IUVA 2CZ1B 4NL3A 5GANe 4M7AF 4M77B 1YJWT 2EIFA 5I21A 2JNGA 3BDUA 4PNOA 4EMKA 5M9OA 2OTJA 4OP0A 2GFUA 1WJSA 3KUFA 4OGEA 4MZMA 2YRVA 2XIDA 4OMFB 5CKEA 4RMOA 3OW2A 4NS5A 4C8QC 1D3BB 4QQDA 1M5Q1 5GANd 2VXEA 2ZCFB 4BDZA 1VQOA 3SWNC 4M7DG 3DKMA 4OB3B 3JCMb 1QW1A 1I5LA 2GFAA 3LWIA 4GY5A 2E70A 2M16A 2GF7A 3QHSA 1Y96B 2DTIA 4OB0B 5IN1A 4M7AB 3RMSA 4QQ6A 3UWNA 1BIAA 1AHJB 4A4FA 4X9CA 3RMQA 3OS1A 4L5GA 3M56A 3DLMA 4JRPA 4C92G 4ZTFA 3V8JA 2QQAA 5LJ3d 4PJOD 3E1SA 4ATOA 1N27A 3PMTA 4B9XA 1LNXA 1BI1A 2RHIA 3CPWS 4E7LA 3DB4A 1KHCA 1NPPA 2P0KA 4A4EA 4F7UG 2K3XA 3OYYA 1UGRB 4C8QA 1IZ6A 5GAN8 5CQXA 5GMKe 1VQMA 1QVGA 3SWNA 4C8QE 3CMET 3V7SA 2L8DA 3CCJT 4JS5A 3A5ZB 2PUOB 2E12A 4XU2A 1Q82C 3P8BB 5FU7B 2NLUA 3G4ST 3CCUA 4PKCC 2RHUA 3FC3A 3NTKA 1VQPA 4XTZA 4RCBA 4BUGA 5GAN4 4MMLA 3CBMA 1H641 2LNVA 3OBYA 5J39A 2QEXA 4BI3A 1VQ8A 2X4YA 4FSXA 2EWNA 4DA4A 2OTJT 2RA2A 2PQWA 4J7IA 3ZFJA 1N9SA 4M78G 3PNWC 3RERA 1JJ2A 3CPFA 4II1A 4IURA 3CCRT 1VQ7A 4ZN3A 1VQ5A 4IKFA 4IUQA 3MP8A 5GAOn 3CBPA 5FU6C 2RHXA 3TCJA 1W2BS 2FHDA 2OAUA 4OVAA 2IVWA 3GNFB 4N0AC 5L8RE 4A4HA 1NZ9A 2RB6A 3OYGA 3CCLA 1G3YA 4RKUE 5CVIA 1Q82U 3QXEB 1W4SA 1WJQA 2X35A 2P0QA 4KUIA 4J6WA 4OB1B 1OYXA 2V8KA 4JJNK 1WNLA 1VQMT 3ASKA 2ZPHB 2EYQA 4M75C 3CCQA 1KC8C 2C06A 1YBYA 3G7ZA 4J6YA 4ELZC 2E6ZA 4VUBA 4M7DB 5KCHA 3SFMA 4F7UF 1HK9A 3LW5E 2A7YA 2EQJA 4IUPA 3HRUA 3JB9H 4QVCA 5GANf 3CMAA 1K8AC 4BE2A 4PJOC 3OSSC 1VQPT 1EIFA 1G3WA 4N0AA 3L2UA 3NTIA 4XQ3A 2PVDB 4C92B 3ME9A 3VKIA 5IAYA 2O01E 1YI2T 1Y07A 1KQSA 2VV5A 2QXFA 1I8FA 2E41A 4JUVA 2RJEA 4LDYA 4N4IA 3RKWA 2LTOA 4DOWA 2GCXA 2KY9A 1MHNA 4M75A 2R58A 4F7UB 4BE1A 1UGPB 5HY6A 1VQ7T 3A8GB 5CR2A 4M75E 4JLIA 5HK0A 1TH7A 2Y4YA 2DIQA 4E47A 3SD4A 4QW2A 5GMKi 3INZA 3QUIA 4JRKA 3J81E 3CEYA 2DAQA 4ME7A 5I2MA 1QVGS 3OYDA 1VQ4A 4PJOA 2ZPFB 2DD5A 3JB9D 3OYIA 2XHCA 3N5BB 3JCMX 1ZBXA 2DK3A 4HCBA 2QA4A 5GMKm 4J5YA 1JBMA 4BI4A 2E5QA 2DXBA 3PTAA 2CZ6B 4KBMB 1VIEA 1PSEA 2YLCA 4TVRA 1YHQT 1K8AU 3OMGA 2F5KA 3L2VA 5LL6S 3PMIA 4MDXA 3M58A 2LC4A 4M78B 5DY9A 1JB0E 1N6AA 1V29B 5CIUA 1M1KU 3A8LB 1KHIA 3FEOA 3C4SA 3EAEA 3M4YA 4M77C 4ZGEB 3OYMA 1FWZA 2AHJB 3M59A 3PFSA 5CQYA 2XDBA 2JTMA 4EMKB 2DPPB 3HRSA 1BI3A 3CMAT 1WQ7A 1S72T 1VQNT 5C0MA 1M8VA 5A0GA 1Q81C 3OYAA 2EQKA 4J8OA 2MF2A 4C0DB 2O4XA 3F70A 2L5QA 4ZGDB 1YITT 3V7RA 4R56A 5LJ3e 3TU4K 2OTLA 4M75D 3RESA 2DTOA 4C8QF 1LJOA 1NJIU 3QPHA 3QJYA 4A4KA 1N8RU 4HA8A 5GAMf 3S3OA 1KG1A 3MP1A 1YJ9A 5KCOA 3CC7T 3CC4T 3CBOA 4ZGJB 5FROA 4ZTJA 2QQRA 4M77A 3M54A 3VUBA 3JCMe 2WSEE 3GPLA 2JTFA 4M77E 4A54A 1WPYA 3PGGA 2L3RA 3OB9A 3FDRA 5GANh 4L6V5 2XU8A 4WF2A 2G3RA 1VQ6A 3OW2S 4C0ZA 4C8QB 3Q1JA 1D3BA 3SWNB 1NPRA 2P4TA 3JCMd 2QA4T 3L2RA 2XICA 3FLGA 4JDSA 1YJNT 3OQ5A 3P8DA 5CAIA 4PJOG 3OA6A 3JAME 5FU7C 1QP3A 2R5MA 4JS4A 3S3NA 3CD6A 3QSUA 4BACA 4RG2A 1Q81U 3OYCA 5GAOp 4M7AE 2LVMA 3QG1A 2A3LA 3G71T 3CXCA 1VQ9T 1YIJA 2VYTA 3LGFA 3M53A 4HKEA 1QVFA 3WVEB 4YTLA 2RI3A 5GAN6 4RCCA 3LX7A 1YCYA 5EG2A 3SB2A 3A8HB 3CCEA 5GANj 3JCMV 1BKBA 2HQEA 2F5TX 3L1AA 1WJRA 1I81A 5LJ5f 3OYNA 1VQOT 1HXDA 5D6WA 3L2ZA 3X28B 1M90C 5GANg 2OTLT 3OYBA 2K2VA 5GMKh 3PT9A 5KH6A 1KQ2A 2M1HA 4M77D 3DLLA 3UDCA 2M0OA 1K73U 4BI8B 4E7KA 2VGNA 2MMPA 4Y28E 1YJ9T 4JLGA 1O75A 3V8LA 4XTWA 1UEBA 5D6XA 2DO3A 2EKOA 2LQ8A 3VUZA 4JRQA 2LCLA 1X75C 5GAN7 5KE3A 3HRTA 3VU3C 2KK4A 1G5VA 2PVOB 3M4GA 2DKGA 5GAOl 2E10A 2LT1A 4QVDA 4GLKA 2GQVA 2XDPA 3I55A 1XTDA 3KBGA 3KXTA 1VQ6T 4M7AD 1WGSA 1VIFA 1M1FA 2F69A 5FRNA 2DVEA 3QJ6A 2XK0A 2QDYB 2DXUA 3META 4M7DC 2RI2A 4FM4B 2MWPA 3BDLA 4M75F 3GLXA 3QZ5B 2PVGB 5GMKj 2K4YA 3CCUT 2M9UA 1BI2A 5GAMh 3H8ZA 2YLBA 3E9GA 2X4XA 2PU9B 4FU6A 4Z02A 3JCMc 4C8QG 2EFIA 3OYLA 2JVVA 3CCRA 1YIJT 1JRIA 1OZ3A 2E65A 3OS5A 3MHXA 4C92C 4LD6A 3OYEA 1U8RA 1Q86C 3MEVA 4PJOF 5A0DA 1M1KC 1NE8A 4QQGA 2ZPBB 4LD9K 1Q7YU 1BI0A 2QEXT 3X20B 2Y90A 1VQ8T 4PLIA 3VJPA 3WXMB 2QTXA 3G6EA 5LJ3f 3HFOA 3CCET 2JZ2A 3JCMJ 3NTHA 1FXXA 1M4ZA 1VQ5T 4RG8A 3A8OB 1KD1C 2RJFA 4HCCA 3LLRA 4DOVA 4M7DA 1FX7A 3HL8A 2DEQA 3M9QA 3VV0A 4XU0A 1R8OB 4M7DE 1NJIC 2IG0A 1M90U 2Y4XA 3JCMf 3JB9I 3JB9J 4PJOB 1N8RC 3ZEHA 3OYJA 4MDWA 5GAMj 4C92A 1GXIE 1P92A 2RJDA 2ZPEB 4N4HA 4C92E 2XDDA 2BIVA 5I2SA 5DLOA 3CCLT 3CCSA 3I56A 1O9SA 5GAMg 4XAXB 2V8IA 4FL6A 3M57A 1X01A 2H3JA 4EMHA 3CXCS 3QZ9B 3RIRA 3I55T 2JUFA 2QQBA 4NL2A 4ZN1A 1QVFS 2RK1A 1B34A 4M78C 1SSFA 4ELYC 2VUBA 4F7UE 4BY6C 5LJ5h 3GP8A 3CCQT 1Q86U 2V8JA 2HQXA 2EQUA 2QQSA 3S3MA 1VUBA 3JB9G 3X24B 2D0QB 1JJ2S 3OMCA 1XNIA 2E64A 4MMKA 5J3BA 3GOXA 4M77F 4XU3A 4C5HA 3CC2A 2BUDA 2P0PA 3EFRA 4E7IA 1W2BA 2O4XB 3V8KA 1MGQA 3CCMA 1I4K1 1KD1U 2LT4A 2K3YA 3HFNA 2E6NA 4X9DA 2VC8A 2XI9A 3CCVA 3G6ET 3AHUA 4E7JA 3S6WA 3E19A 4M7AC 4J7FA 4LDWA 1UB4A 4M7DD 1VQKA 4M78A 3BW1A 5GAOr 4HT8A 4HT9A 1H3ZA 4BDYA 1N9RA 4M78E 3HHTB 3MP6A 2MWOA 4IUTA 5LJ5j 4XTXA 2RM4A 2WSFE 4CI0C 4C92D 3QKJA 2FB7A 4OB2B 2WSCE 5CKFA 2MAMA 3C12A 1K73C 1VQ4T 4M75G 5LJ5g 2L89A 4EPCA 2HNIA 2RH2A 2FVUA 2XKOC 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QVC A;  5GAN f;  1BIB A;  5GMK h;  4PJO E;  3BY7 A;  2CGH A;  1KQ2 A;  4PJO C;  4M77 D;  3RKY A;  3FJP A;  4N0A A;  2DZC A;  4XQ3 A;  4M7A A;  1Y96 A;  2JN0 A;  3QO3 A;  4C92 B;  5LJ3 h;  3V8L A;  4XTW A;  5GAO q;  1KQ1 A;  3RUX A;  4J6X A;  5GAN 7;  4JUV A;  1I8F A;  2E41 A;  3VU3 C;  2EJF A;  3FIF A;  3RKW A;  2I2L A;  3FB9 A;  2DKG A;  3M4G A;  5GAO l;  2E10 A;  4QVD A;  4M7A F;  4NL3 A;  2EJ9 A;  5GMK l;  2FYK A;  4M75 A;  4F7U B;  5GAN e;  2E1H A;  4M77 B;  4NOY A;  5I21 A;  4M7A D;  4M75 E;  3BDU A;  4PNO A;  4JLI A;  3JCM h;  4EMK A;  1TH7 A;  4OP0 A;  3JCM Q;  3HSB A;  2DVE A;  5GMK i;  3INZ A;  1U1T A;  3QUI A;  4EMG A;  2DXU A;  4JRK A;  3JB9 F;  5GMK m;  4M7D C;  4PJO A;  4C8Q C;  4M75 F;  1D3B B;  4M78 D;  1M5Q 1;  5GMK j;  2VXE A;  5GAN d;  3JB9 D;  3SWN C;  5GAM h;  4C8Q G;  2YLB A;  3JCM c;  4M7D G;  3JCM b;  3JCM X;  1I5L A;  5GAO m;  3QHS A;  2DXT A;  4M7A B;  1Y96 B;  1JRI A;  2DTI A;  1JBM A;  2E65 A;  2RD1 A;  4J5Y A;  3RKX A;  1BIA A;  4C92 C;  5LJ3 j;  4X9C A;  4PJO F;  2DZ9 A;  2YLC A;  4C92 G;  2Y90 A;  4XTU A;  3V8J A;  5LJ3 d;  2QTX A;  5LJ3 g;  4PJO D;  5LJ3 f;  3HFO A;  5DY9 A;  4M78 B;  3GIB A;  5GAN 3;  3JCM W;  3JCM J;  4DQ2 A;  1LNX A;  3BFM A;  4XU1 A;  2DJZ A;  4M77 C;  3EFS A;  4XTV A;  4EMK B;  4F7U G;  4M77 G;  4M7D A;  1WQ7 A;  2DEQ A;  2DTH A;  4C8Q A;  5GAN 8;  1M8V A;  5GAM e;  5GMK e;  1WQW A;  4XU0 A;  4M7D E;  3SWN A;  4C8Q E;  3V7S A;  3JCM g;  3JB9 I;  3JCM f;  4PJO B;  3JB9 J;  5GAM j;  4XU2 A;  3V7R A;  5LJ3 e;  4C92 A;  4M75 D;  3RES A;  4JRI A;  4M7D F;  2DTO A;  4C8Q F;  1LJO A;  4C92 E;  5GAM d;  4XTZ A;  4A53 A;  5GAM g;  4HA8 A;  4RCB A;  4C8Q D;  5GAM f;  1X01 A;  5GAN 4;  4MML A;  4M7A G;  1H64 1;  4EMH A;  3RIR A;  4NL2 A;  4C92 F;  2EJG A;  1B34 A;  4M77 A;  3JCM P;  4M78 C;  2EWN A;  3JCM e;  4F7U E;  2RA2 A;  5LJ5 h;  4M77 E;  4A54 A;  1N9S A;  1WPY A;  3PGG A;  4M75 B;  4M78 G;  3RER A;  1U1S A;  5GAN h;  3JB9 G;  1LOJ A;  4WF2 A;  2YHT A;  2E64 A;  4MMK A;  4C8Q B;  1D3B A;  4M77 F;  2K57 A;  4XU3 A;  3SWN B;  2EAY A;  5GAN 2;  5GAO n;  3EFR A;  3JCM d;  3V8K A;  1MGQ A;  1HXD A;  3JB9 H;  1I4K 1;  4Y91 A;  4V2S A;  5CAI A;  4PJO G;  3QSU A;  3HFN A;  4X9D A;  2VC8 A;  4M7A E;  5GAO p;  4N0A C;  3AHU A;  4M7A C;  2VXF A;  2RB6 A;  4M7D D;  3V7C A;  4M78 A;  3BW1 A;  5LJ5 e;  5GAO r;  4HT8 A;  4HT9 A;  5GAN 6;  5GAN 5;  1N9R A;  4M78 E;  4RCC A;  4F7U A;  1B34 B;  4J6W A;  5LJ5 j;  4XTX A;  1YCY A;  2RM4 A;  4XTY A;  4C92 D;  3SB2 A;  1WNL A;  4M75 C;  5GAN j;  2FB7 A;  3JCM V;  4M78 F;  3L1A A;  4M75 G;  5LJ5 g;  4EMK C;  4J6Y A;  1I81 A;  5LJ5 f;  5LJ5 d;  4M7D B;  2HNI A;  4F7U F;  1HK9 A;  3L2Z A;  2ZGW A;  5GAN g; 
#chains in the Genus database with same CATH topology
 1WHK A;  4BE0 A;  3I56 T;  3FJP A;  4E2F B;  1Y96 A;  3H0I A;  4B9W A;  4LUD A;  1KQS S;  2R5A A;  4BD3 A;  1VA7 A;  3REB B;  1KC8 R;  3URG A;  3JSC A;  1YWP A;  1GBR A;  4FYY B;  2E1H A;  2LRQ A;  5C6S A;  2QTV A;  2EYZ A;  1ACM B;  2J06 A;  3HSB A;  1VYV A;  4K11 A;  5IXF A;  3CCM T;  3JB9 F;  4J9C A;  1BCO A;  1Y7X A;  4FT4 A;  1Q7Y C;  2M51 A;  4O6J A;  1SKU B;  3IQL A;  3L2W A;  1QLY A;  1PD0 A;  1ZUU A;  1OUL A;  4AFQ C;  2CUD A;  1TUD A;  1IRE B;  2KQW A;  2RHY A;  3C94 A;  3JCM W;  3BFM A;  2DJZ A;  1MMD A;  1GCQ A;  2CKK A;  1M2V B;  3EFS A;  4XTV A;  4M77 G;  2FZK B;  2DD4 A;  3HPW A;  2VGM A;  2GTO A;  2HD0 A;  1KJW A;  2ECZ A;  3FRN A;  1UGS B;  4M7D F;  3EG0 A;  4A53 A;  3HKS A;  2XD0 A;  4RUG A;  2KSS A;  3JCM P;  3CPW A;  4J9B A;  2RJC A;  3CQT A;  5KYX B;  4M75 B;  2LJ0 A;  1M3C A;  3VS7 A;  1LOJ A;  2D8J A;  4FYW B;  1KFZ A;  1AVZ C;  1X2K A;  2K57 A;  5GAN 2;  1RAA B;  2HSP A;  4PLL A;  3VYH B;  4V2S A;  2FRW A;  2KMT A;  1D0X A;  3QDR B;  2K2M A;  4QVZ A;  4PL6 A;  2D9T A;  2HBP A;  2LX7 A;  4FT2 A;  5D6Y A;  2MI6 A;  1B34 B;  2RO0 A;  4PFZ A;  2AZV A;  1OU8 A;  2PZ1 A;  2PUK B;  2X4J A;  4IUU A;  3CCJ Q;  4M78 F;  5LJ5 d;  3G4S Q;  1BB9 A;  4P5N A;  3G71 Q;  2D0N A;  3CCJ A;  1C0M A;  5J26 A;  3DB3 A;  2JN0 A;  2BKD N;  1ZA1 B;  3G4S A;  2EJF A;  4WTO B;  3L42 A;  3G71 A;  1VQ9 A;  2KRM A;  2KAF A;  3CCR Q;  4M7A F;  5GAN e;  4JJD A;  2DMO A;  4EMK A;  1WJS A;  3KUF A;  2VAS A;  1X27 A;  2LQN A;  4OMF B;  2F2X A;  5CKE A;  5IHI A;  4NS5 A;  1M5Q 1;  4M7D G;  4OB3 B;  1I5L A;  3LWI A;  2RNA A;  2E70 A;  2GF7 A;  2M16 A;  3QHS A;  4OB0 B;  3UWN A;  1K4U S;  5IN1 A;  3OS1 A;  3RMQ A;  2GQI A;  2MYS A;  4L5G A;  2CP3 A;  1AT1 B;  2YT6 A;  2L3Q A;  5LJ3 d;  4B9X A;  1LNX A;  1C1A A;  2FPF A;  4A4E A;  2EGC A;  4JJC A;  4PJM A;  4C8Q A;  5CQX A;  1WA7 A;  2CH4 W;  1PM3 A;  1VQP Q;  1QVG A;  4C8Q E;  3CME T;  2L8D A;  1CKB A;  4KH0 B;  5KYY A;  4XU2 A;  1Q82 C;  2QEX Q;  4A63 B;  8AT1 B;  3FC3 A;  1VQP A;  1VQ7 Q;  4MML A;  1H64 1;  3PE0 A;  3M0S A;  1D1A A;  2P4R A;  2QEX A;  1JEG A;  4BI3 A;  1VQ8 A;  4FSX A;  2DX1 A;  3MPU B;  2PQW A;  3ZFJ A;  4M78 G;  1VQ7 A;  1VQ5 A;  4IUQ A;  4FYX B;  3C0C A;  2JS0 A;  2OAU A;  3LH5 A;  1G2B A;  4A4H A;  5ECA A;  1NZ9 A;  2QGG A;  3QXE B;  1WHL A;  3FJ5 A;  2X35 A;  4J6W A;  1VQN Q;  2DYI A;  3JV3 A;  1Q81 R;  1ZX6 A;  3CCQ A;  4M75 C;  2LNH B;  1NYG A;  1YIT Q;  1TTH B;  4J6Y A;  4VUB A;  1HK9 A;  3HRU A;  5GAN f;  1HJD A;  1EIF A;  4N0A A;  2PVD B;  4C92 B;  2NUZ A;  4OMQ A;  3BE3 A;  1TSF A;  1RI9 A;  1OV3 A;  4HCK A;  2LTO A;  4DOW A;  2GCX A;  1K73 R;  2RQW A;  1MHN A;  1Q95 G;  4BE1 A;  3A8G B;  4OML A;  1RAF B;  2QYZ A;  4E47 A;  2Y4Y A;  2DIQ A;  3SD4 A;  4QW2 A;  5GMK i;  4PJO A;  3OYD A;  2X51 A;  3OYI A;  1WHM A;  2OI3 A;  4PJJ A;  1JBM A;  4BI4 A;  3MJX A;  4KBM B;  1VIE A;  1OU9 A;  2LC4 A;  1JB0 E;  1N6A A;  4AFU C;  1M1K U;  4PFO A;  3FEO A;  4PJL A;  3PFS A;  2XDB A;  2JTM A;  4FYV B;  1Q7Y R;  1WQ7 A;  1M8V A;  2DIL A;  2MF2 A;  1JO8 A;  4Z88 A;  3UF4 A;  1W6X A;  3TU4 K;  3QPH A;  3H0F A;  3VS2 A;  2CSQ A;  4HA8 A;  4Y92 A;  1N8R U;  5KCO A;  2AIR B;  2K79 A;  2JTF A;  1AWJ A;  4JPB W;  1N5Z A;  3FDR A;  3VS4 A;  3QWY A;  2I0N A;  3CCU Q;  2G3R A;  4C0Z A;  3TVT A;  4PJN A;  1AZE A;  2P4T A;  3JCM d;  2QA4 T;  5IH2 A;  3NHN A;  4PJO G;  3QSU A;  3EHR A;  1PKT A;  3CCE Q;  3G71 T;  2RQU A;  3CXC A;  1YNZ A;  1VQ9 T;  4HKE A;  4YTL A;  1KD1 R;  1OX9 A;  1YCY A;  3A8H B;  3CCE A;  3JCM V;  2HQE A;  1WJR A;  1I81 A;  3L2Z A;  2OTL T;  3OYB A;  1EX4 A;  2MMP A;  4Y28 E;  1UEB A;  5D6X A;  3VUZ A;  2FEI A;  5KE3 A;  2A08 A;  1WFW A;  1M2V A;  3KBG A;  1RAB B;  1WGS A;  2F69 A;  2FZG B;  1QVF P;  2XK0 A;  1PCX A;  4M75 F;  1YCS B;  2MWP A;  2PVG B;  2E3I A;  4Z02 A;  2EVR A;  4C92 C;  1Q86 C;  3MEV A;  5A0D A;  2DA9 A;  2J6F A;  2QEX T;  2JXB A;  1VQ8 T;  3WXM B;  3KFV A;  3HFO A;  3H41 A;  3RNJ A;  4X1V A;  1VQ4 Q;  2DJQ A;  1PG5 B;  1VQ5 T;  1ARK A;  4RG8 A;  2MCN A;  2COZ A;  2Z0W A;  3I56 Q;  1NJI C;  1OPL A;  1QKX A;  1YWO A;  2Y4X A;  3JB9 J;  4AMC A;  2H8H A;  2HSE B;  1P92 A;  2ZPE B;  4N4H A;  2NUT B;  1EFN A;  1J3T A;  3I56 A;  1O9S A;  2V8I A;  2H3J A;  3QZ9 B;  2QQB A;  4F14 A;  2RK1 A;  1B34 A;  3THK A;  2EYY A;  2RPN A;  2VUB A;  4F7U E;  3CCQ T;  2YRC A;  3CCM Q;  1D09 B;  2D0Q B;  5J3B A;  2BUD A;  3EFR A;  3CCM A;  1MGQ A;  2ED1 A;  2LT4 A;  1U06 A;  1U3O A;  2VC8 A;  9ATC B;  3G6E T;  3AHU A;  4E7J A;  5EC7 A;  4J7F A;  4LDW A;  1UB4 A;  3BW1 A;  4HT9 A;  4F04 B;  3D7S B;  2RM4 A;  2NYS A;  2BZY A;  1GRI A;  2DL7 A;  4M75 G;  1SHF A;  2FVU A;  2ZGW A;  3TRE A;  2D8H A;  1GL5 A;  3BY7 A;  2HAX A;  2B8A A;  5KYY B;  4LDU A;  3QO3 A;  5CKH A;  1D0Z A;  2CH4 A;  4L59 A;  4RTT A;  3QBY A;  1K9M U;  4NOY A;  3M55 A;  3JCM h;  3CC2 T;  1NM7 A;  3ZBD A;  1GCQ C;  1U1T A;  1WHH A;  5AYF A;  2G6F X;  1WHG A;  4J9H A;  4E7Z A;  2K5F A;  4J83 A;  2DXT A;  2RD1 A;  2O9V A;  3OS2 A;  3HP9 A;  4OGC A;  4D6W A;  5CKB A;  1C6V X;  3GIB A;  3UT1 A;  4DQ2 A;  3JRZ A;  4EPC A;  1UE9 A;  2AZS A;  5GJV B;  1WQW A;  2CP2 A;  5FU6 B;  3JCM g;  2CS7 A;  3X25 B;  3QDF A;  3OS0 A;  1K9M R;  3I9Q A;  4XK8 E;  3LH0 A;  1MMG A;  5GAM d;  2DFU A;  2IPO B;  1RLQ C;  1IO6 A;  2V1R A;  4C92 F;  5CK9 A;  1YHQ A;  2DNU A;  3PIP A;  3QYH B;  4OF1 A;  3EFO B;  3TEE A;  4N4G A;  3R6O A;  4WCI A;  1OI1 A;  2KE9 A;  2FRY A;  4FW1 A;  3MCA B;  1AWO A;  2VB6 A;  3LGL A;  1X6O A;  4Y91 A;  4D8K A;  5FLX E;  4DBH A;  2L3P A;  2EQM A;  5FRM A;  5CO7 A;  2DXC A;  2KI7 A;  5LJ5 e;  3VS0 A;  4XTY A;  3CME Q;  2QQ9 A;  3AT1 B;  1X6B A;  4EMK C;  1IHV A;  1KC8 U;  1BIB A;  4MZT A;  2MPX C;  4C0D C;  5A0L A;  1SRL A;  3CME A;  2X3W D;  2DZC A;  2HCK A;  1PKS A;  2YUN A;  3X26 B;  1G3S A;  3J7A F;  1E6G A;  4QKU A;  4X34 A;  4C5G A;  3OYH A;  2I2L A;  4BY6 B;  1UHC A;  4IUV A;  3NMZ C;  1YJW T;  1U5S A;  3BDU A;  1SF9 A;  4J9G A;  4AFS C;  2YRV A;  3OW2 A;  2RQR A;  4C8Q C;  4QQD A;  1QMC A;  4BDZ A;  2VXE A;  2DLP A;  3JCM b;  1QW1 A;  3A1P A;  1UG1 A;  1E7O A;  3SHW A;  4C92 G;  3M0U A;  2QQA A;  2FPE A;  4R0K A;  4ATO A;  3H0H A;  2ABL A;  3PMT A;  3CPW S;  4E7L A;  3DB4 A;  2OJ2 A;  2P0K A;  1IZ6 A;  1K8A R;  1HSQ A;  2KRN A;  3A5Z B;  2PUO B;  2IIM A;  1TOV A;  3P8B B;  3TSW A;  2NLU A;  4RTW A;  4PKC C;  2W0Z A;  4BUG A;  3CBM A;  2YXY A;  2LNV A;  5J39 A;  2OTJ T;  2ED0 A;  4DA4 A;  6AT1 B;  3PNW C;  3RER A;  1SPK A;  4IKF A;  1IXD A;  1RAD B;  2W10 A;  5FU6 C;  1W2B S;  4OVA A;  1YFN A;  1D0Y A;  4N0A C;  5L8R E;  1ZLM A;  2VWF A;  1H3H A;  4OB1 B;  2C06 A;  1VQM T;  1YBY A;  2EQI A;  3EG9 B;  1W1F A;  4ELZ C;  3LW5 E;  1AEY A;  4QVC A;  2CSI A;  3M0P A;  4PJO C;  1K0S A;  3L2U A;  1JJ2 P;  3NTI A;  4XQ3 A;  3ME9 A;  3VKI A;  2HEQ A;  1KQS A;  1K0X A;  2VV5 A;  1V1C A;  4LDY A;  5KYN A;  1OEB A;  5KYW B;  2KY9 A;  4F7U B;  1R77 A;  2R58 A;  1UGP B;  2QA4 Q;  3INZ A;  3QUI A;  1MV3 A;  3J81 E;  1QVG S;  2DAQ A;  4ME7 A;  1BCM A;  2FG0 A;  2ZPF B;  2DD5 A;  3JB9 D;  2XHC A;  3JCM X;  1VQ9 Q;  1M2O A;  2FZC B;  2NUT A;  2QA4 A;  1YP5 A;  5GMK m;  4JJB A;  2E5Q A;  4ORZ A;  1YHQ T;  3OMG A;  4Z8A A;  1PRL C;  3M58 A;  5CIU A;  1V29 B;  2V26 A;  1KHI A;  4KRT A;  3C4S A;  3EAE A;  3M4Y A;  1AWW A;  3PVL A;  1FWZ A;  2OTL Q;  1M90 R;  2DPP B;  3HRS A;  2X3X D;  2YUQ A;  4ZGD B;  1RLP C;  1ZSZ A;  1X6G A;  2OTL A;  2DTO A;  4C8Q F;  1LJO A;  4JZ3 A;  2K9G A;  4RTZ A;  4ZGJ B;  1UUE A;  2EKH A;  1BBZ A;  3M54 A;  2DRM A;  3VUB A;  3JCM e;  4WF2 A;  2JMA A;  3CD6 Q;  1D3B A;  3SWN B;  2E4H A;  1NPR A;  4E6R A;  3L2R A;  2XIC A;  5CAI A;  1PNJ A;  4FCY A;  3CD6 A;  1VQ8 Q;  4BAC A;  4RG2 A;  1Q81 U;  3OYC A;  4M7A E;  3M53 A;  3WVE B;  1JQQ A;  1VQ5 Q;  2RI3 A;  4Z89 A;  5GAN 6;  3H9N A;  3LX7 A;  1TUC A;  1M8M A;  5EG2 A;  1IGU A;  3SB2 A;  1D1B A;  1BKB A;  2QK0 A;  1AWX A;  3OYN A;  3X28 B;  1M30 A;  2EYX A;  1KQ2 A;  1K73 U;  4IIO A;  2M0O A;  1K1Z A;  4ESR A;  1YJ9 T;  3EGD A;  1M27 C;  2DO3 A;  4JRQ A;  2CP5 A;  3CCQ Q;  2AK5 A;  1UFF A;  2DKG A;  4QVD A;  4GLK A;  2XDP A;  1EZZ B;  1XTD A;  3KXT A;  4M7A D;  1D1C A;  3QJ6 A;  2QDY B;  4AT1 B;  1GCP A;  1Y0M A;  3GLX A;  3QZ5 B;  4RTV A;  3G6E Q;  2M0Y A;  4C8Q G;  3JCM c;  1QQJ A;  3RBB B;  3OYL A;  1WXB A;  1SSH A;  1YIJ T;  1JRI A;  1U8R A;  3OYE A;  4PJO F;  3TSZ A;  1Q7Y U;  3G6E A;  2JZ2 A;  2K3B A;  3EFO A;  1FXX A;  2COW A;  1M4Z A;  3A8O B;  4DOV A;  1FX7 A;  3HL8 A;  1NLP C;  2CRE A;  2KT8 A;  1Z9Z A;  1R8O B;  1W70 A;  3JCM f;  1IHW A;  2LJ3 A;  1ABQ A;  4FL6 A;  1X01 A;  3CXC S;  3I55 T;  3CC2 Q;  2DET A;  5LJ5 h;  3GP8 A;  8ATC B;  1VUB A;  3X24 B;  2ROT A;  1JJ2 S;  3OMC A;  3CC2 A;  2P0P A;  2O4X B;  2ZAE A;  1KD1 U;  2K3Y A;  4X9D A;  2V1Q A;  4BDY A;  4JZ4 A;  1N9R A;  1I07 A;  3HHT B;  2DRK A;  2DL5 A;  5LJ5 j;  1TUG B;  4XTX A;  2WSF E;  1A0N B;  2KGT A;  4CI0 C;  4PFP A;  1SHG A;  1JXM A;  2HL3 A;  3QKJ A;  2WSC E;  5LJ5 g;  2GBQ A;  4CC4 B;  2CGH A;  3J80 E;  2OAW A;  1XQH A;  2LX9 A;  2RQV A;  2DL8 A;  5LJ3 h;  7AT1 B;  2JW4 A;  5GAO q;  1KIK A;  1OZ2 A;  2CZ0 B;  4Q5W A;  3PIO A;  5CKD A;  4C5I A;  5CCA A;  1Y71 A;  3FB9 A;  1RI0 A;  1XOV A;  2FYK A;  4PK4 A;  4ANJ A;  1TWB A;  3NPF A;  2CP0 A;  3JCM Q;  4C0F A;  2BZ8 A;  4EMG A;  1AZG B;  3VS1 A;  4KUD K;  1H92 A;  1RL2 A;  1YN8 A;  5KYU B;  2JM9 A;  3CCV T;  2HL5 C;  5GAO m;  4C5E A;  3RKX A;  3OBW A;  5LJ3 j;  5D7U A;  2DZ9 A;  4RTX A;  2WAC A;  1SRM A;  2ZZD A;  2E5K A;  2QG9 B;  5LJ3 g;  4UC4 A;  5IHK A;  4XU1 A;  1FMK A;  2ZPG B;  3L2Q A;  2RK2 A;  3T9N A;  2DTH A;  2OX7 A;  5GAM e;  2DIG A;  1VQL T;  1M1G A;  3EH2 A;  3CD6 T;  5L23 A;  4JRI A;  2LDM A;  1ZHI A;  1YJW Q;  1OPK A;  3I5R A;  2CZ7 B;  3HTR A;  2CT4 A;  1QKW A;  4OMP A;  5I11 A;  2EBP A;  1PWT A;  1U1S A;  4MZP A;  2YHT A;  3EG9 A;  1YJW A;  3A8M B;  2LP5 A;  2RN8 A;  1S72 A;  4KT0 E;  1LCK A;  3ER0 A;  2X4W A;  2CYZ B;  1PRM C;  3A98 A;  1GBQ A;  1VQK T;  1R0C B;  5DLQ E;  3V7C A;  3QII A;  3P8H A;  1QP2 A;  1WDX A;  2DE0 X;  5KYW A;  3CC4 A;  2P84 A;  1G3T A;  4F7U A;  3I5S A;  4LDX A;  3C95 A;  4R55 A;  2ZPI B;  2DF6 A;  3UPU A;  2EYW A;  2FPD A;  2K5I A;  1Q82 R;  2KBT A;  2VVK A;  4KH1 B;  3CPW P;  1WXU A;  1ZQ1 A;  2SRC A;  4LN2 A;  3NFC A;  3RKY A;  1PHT A;  2KDS A;  1YJN A;  1ZSZ B;  3EGU A;  3RUX A;  2OTJ Q;  2JOY A;  4F17 A;  2JM8 A;  2RI5 A;  1ZSG A;  4NL3 A;  2C0T A;  4ZNX A;  2EIF A;  5I21 A;  2JNG A;  2OTJ A;  1QWE A;  4D8D A;  4HVW A;  2F1L A;  4LE9 A;  1D3B B;  3EG2 A;  1VQO A;  2ZCF B;  2DBK A;  2SEM A;  3DKM A;  1B3Q A;  4GY5 A;  4M7A B;  1WI7 A;  4QQ6 A;  4A4F A;  3M56 A;  4JRP A;  1R0B G;  1VQM Q;  1N27 A;  1W2B P;  1AOJ A;  2KEA A;  1KHC A;  2YUO A;  1NPP A;  4F7U G;  3OYY A;  2PNI A;  2KYB A;  5GAN 8;  1VQM A;  3SWN A;  3V7S A;  1WIE A;  1QWF A;  4HVU A;  1M3A A;  2E12 A;  1M3B A;  2RHU A;  4IIM A;  2CP6 A;  3NTK A;  4RCB A;  3EGD B;  5GAN 4;  1IGQ A;  5FWB A;  2E3H A;  1BU1 A;  1FYN A;  2RA2 A;  4IUR A;  4ZN3 A;  3MP8 A;  2MOX A;  2O9S A;  2RHX A;  2A0F B;  2HBW A;  1YHQ Q;  1MV0 B;  1WXT A;  1I1J A;  2JMC A;  1QVG P;  2KXD A;  2RB6 A;  3OYG A;  1G3Y A;  4LXC A;  1W4S A;  4KUI A;  2A36 A;  1WZO A;  1OYX A;  2YWW A;  2V8K A;  4RTU A;  4HCC A;  4LNP A;  3ASK A;  2ZPH B;  2QAS A;  3G7Z A;  2JJ9 A;  4IUP A;  2A7Y A;  2EQJ A;  3JB9 H;  3OSS C;  1G3W A;  5IHN A;  2YRD A;  2LMJ A;  2EW3 A;  5IAY A;  1GFC A;  1Y07 A;  2L2P A;  4E7S A;  4JUV A;  1I8F A;  2RJE A;  3RKW A;  2K7A A;  1SG5 A;  1TU0 B;  1B7T A;  5CR2 A;  2J6O A;  5HK0 A;  1T3S A;  2HQH A;  3RDV A;  4KGV B;  3ZL7 C;  4JRK A;  4KGX B;  3CEY A;  2BE9 B;  4CC3 A;  3N5B B;  1PD1 A;  2GTJ A;  1ZBX A;  2DK3 A;  4HCB A;  4J5Y A;  1ZSZ C;  2ESW A;  3PTA A;  2CZ6 B;  1PSE A;  2JTE A;  1K8A U;  1UDL A;  3L2V A;  5LL6 S;  1H8K A;  3PMI A;  4MDX A;  1CKA A;  1NLO C;  4ZGE B;  2AHJ B;  3M59 A;  2DL4 A;  1BI3 A;  3CMA T;  2HMA A;  1S72 T;  1CSK A;  5C0M A;  2L0A A;  5A0G A;  1Q81 C;  1YJ9 Q;  2O4X A;  3V7R A;  4R56 A;  2A28 A;  5LJ3 e;  2O31 A;  2QAZ A;  1NJI U;  2LZ6 B;  4QT7 A;  4DEY A;  1VYU A;  3S3O A;  1IRX A;  1KG1 A;  1YJ9 A;  3CC4 T;  3CBO A;  5FRO A;  4M77 A;  2WSE E;  1X2Q A;  4M77 E;  1WPY A;  3OB9 A;  4L6V 5;  2XU8 A;  2DEU A;  5AT1 B;  1QCN A;  1YIJ Q;  4FW2 A;  1YJN T;  3FLG A;  1Q86 R;  3OQ5 A;  3OA6 A;  4LUE A;  2J6K A;  5GAO p;  2LVM A;  3QG1 A;  2A3L A;  1YIJ A;  3LGF A;  1QVF A;  4RCC A;  1TXQ A;  1K9A A;  4DBF A;  2D1X A;  1NJI R;  2LQW A;  2F5T X;  4J9E A;  5LJ5 f;  1VQO T;  1HXD A;  1OX8 A;  2K2V A;  2DL3 A;  2KT1 A;  5KYU A;  5GMK h;  3PT9 A;  2C0O A;  2L3S A;  4M77 D;  3DLL A;  3UDC A;  2VGN A;  2CP7 A;  3I55 Q;  2EKO A;  2LCL A;  1MMA A;  3REA B;  3M4G A;  2E10 A;  2LT1 A;  2RQT A;  3I55 A;  1VQ6 T;  1VIF A;  1M1F A;  3CXC P;  5FRN A;  2DVE A;  1B07 A;  1BK2 A;  1V76 A;  2DXU A;  3MET A;  2RI2 A;  5GMK j;  2EGE A;  2K4Y A;  2M9U A;  1BI2 A;  5GAM h;  2YLB A;  2X4X A;  2PU9 B;  4FU6 A;  2EFI A;  2JVV A;  4AG1 C;  1OZ3 A;  2E65 A;  3MHX A;  1GFD A;  1M1K C;  1M90 U;  1TG0 A;  1NE8 A;  3UA6 A;  1BI0 A;  1K76 A;  4PLI A;  5LJ3 f;  3JCM J;  1ZUK A;  1T0H A;  2EPD A;  1LVK A;  1KD1 C;  2RJF A;  3LLR A;  4M7D A;  2DEQ A;  3VV0 A;  4M7D E;  2YUP A;  3JB9 I;  3GBQ A;  1N8R C;  4EIK A;  3OYJ A;  4MDW A;  2KNB B;  5GAM j;  1WX6 A;  1GXI E;  2RJD A;  1T3L A;  2BIV A;  5GAM g;  2ATC B;  2JS2 A;  3EGX B;  2JUF A;  4NL2 A;  2O88 A;  1SSF A;  4BY6 C;  2EQU A;  2QQS A;  3S3M A;  3JB9 G;  1HD3 A;  1ZBJ A;  3CCV Q;  3GOX A;  1NEB A;  4C5H A;  3EG3 A;  1W2B A;  3TQ7 P;  1I4K 1;  1UTI A;  4CC2 A;  3HFN A;  2E6N A;  2XI9 A;  3CCV A;  2X9H A;  2DER A;  3S6W A;  4M7D D;  4M78 A;  2KRO A;  1G83 A;  4HT8 A;  4M78 E;  2FO0 A;  2MWO A;  1UGV A;  3MP6 A;  2J7I A;  1MNE A;  2DM1 A;  1VQL Q;  3CCR A;  2HNI A;  4RTY A;  1M9S A;  3CCS T;  2K5L A;  3MEU A;  4M7A A;  1VQL A;  2LQK A;  4AG2 C;  1KQ1 A;  1WLP B;  2PTK A;  2D6F A;  4J6X A;  3GNG A;  2DBM A;  3FIF A;  2RHZ A;  4OMN A;  2LCC A;  2QGF B;  1UGQ B;  5HKC A;  3WVD B;  3EH1 A;  3MEW A;  2MIO A;  1F1B B;  2DVJ A;  3OYK A;  4M78 D;  4A4G A;  1YI2 Q;  4HXJ A;  1AD5 A;  1PSF A;  1VQK Q;  3EHQ A;  3MEA A;  3GF5 A;  1S1N A;  4EDU A;  1YI2 A;  4XTU A;  4DBR A;  1RAG B;  2XG8 D;  3VS6 A;  5GAN 3;  1VQK A;  4KUL A;  3M5A A;  5IT9 E;  2KVQ G;  5HK3 A;  1QVP A;  2QI2 A;  3OY9 A;  4LDV A;  3O8V A;  2JT4 A;  2FL7 A;  3LYI A;  4C8Q D;  4M7A G;  2EJG A;  2COY A;  4C0G A;  1RAC B;  1RAI B;  2AKL A;  3RR6 A;  2KRS A;  1BYM A;  1KK7 A;  3OSV A;  5KE2 A;  1I5O B;  3E9F A;  2VKN A;  3OYF A;  2EAY A;  1VQN A;  2R57 A;  3LWH A;  3H6Z A;  3CC7 Q;  1YIT A;  2YSQ A;  4FIB A;  2VXF A;  3VS3 A;  4O5V A;  1QCO A;  1SEM A;  1KSW A;  5GAN 5;  3CC7 A;  3SEM A;  1HYO A;  4B6M A;  3VYG A;  3QWX X;  1DJ7 B;  5DM7 R;  4F16 A;  2KR3 A;  3MO8 A;  4PJO E;  4HCZ A;  4BB7 A;  4E7H A;  2F2W A;  4KGZ B;  3QYG B;  5FWC A;  1K9M C;  5A2Q E;  3SDZ A;  4CRI A;  2EJ9 A;  1MND A;  5GMK l;  2CZ1 B;  4M77 B;  4PNO A;  5M9O A;  4FSS A;  4OP0 A;  2GFU A;  4OGE A;  1PC0 A;  2ROL A;  4MZM A;  2XID A;  1MUZ A;  4RMO A;  2C0I A;  5GAN d;  4J9D A;  3SWN C;  2GFA A;  1Y96 B;  2DTI A;  3RMS A;  3I35 A;  3PVQ A;  1BIA A;  1AHJ B;  4X9C A;  1T0J A;  1TS9 A;  2B86 A;  3DLM A;  2A37 A;  2NUP A;  3V8J A;  4ZTF A;  4PJO D;  3E1S A;  2RHI A;  1BI1 A;  3M0Q A;  2K3X A;  1Z9Q A;  1UGR B;  5GMK e;  2F2V A;  2HDA A;  2KYM A;  3CCJ T;  4JS5 A;  1M1K R;  1OOT A;  5FU7 B;  2EGA A;  2H3E B;  3G4S T;  3CCU A;  2QDL A;  1UEC A;  2K6D A;  4XTZ A;  3OW2 P;  4OMO A;  2NWM A;  2HKN A;  3OBY A;  2X4Y A;  2EWN A;  4J7I A;  5HCK A;  1N9S A;  1JJ2 A;  1N8R R;  3CPF A;  4II1 A;  3CCR T;  1WYX A;  2HZY A;  5GAO n;  3CCL Q;  3CBP A;  1RAH B;  3M0R A;  5FW9 A;  3TCJ A;  1I0C A;  2FHD A;  2IVW A;  3O5Z A;  3GNF B;  3CCL A;  4RKU E;  5CVI A;  1Q82 U;  1X69 A;  1WJQ A;  2P0Q A;  3CMA Q;  1S72 Q;  1G8X A;  1X43 A;  1UJ0 A;  4JJN K;  1KC8 C;  1WNL A;  2EYQ A;  2E6Z A;  2RMO A;  4M7D B;  5KCH A;  3SFM A;  4CC7 A;  4F7U F;  2J05 A;  2LJ1 A;  3CMA A;  1K8A C;  4BE2 A;  3MKD A;  1VQP T;  3CC4 Q;  2O01 E;  1YI2 T;  2HKQ B;  4M4Z A;  2QXF A;  2E41 A;  3UA7 A;  5I22 A;  4N4I A;  3E2U A;  4AFZ C;  2AT1 B;  5KYX A;  1VQ7 T;  4M75 A;  3NGP A;  5HY6 A;  5IXB A;  4M75 E;  2CT3 A;  4JLI A;  3VRY A;  1TH7 A;  1YJN Q;  1RAE B;  5I2M A;  1UJY A;  4DEX A;  1VQ4 A;  2RF0 A;  2CDT A;  2BTT A;  4OMM A;  2DXB A;  3EGX A;  2YLC A;  4TVR A;  2F5K A;  5DY9 A;  4M78 B;  5GJW B;  3A8L B;  3OYM A;  1VQO Q;  4M77 C;  1KQS P;  3EG1 A;  5CQY A;  3U23 A;  4EMK B;  1NBE B;  1VQN T;  3OYA A;  2EQK A;  4J8O A;  4C0D B;  3F70 A;  2L5Q A;  1YIT T;  3VRZ A;  4M75 D;  3RES A;  2DYB A;  3QJY A;  4A4K A;  2CUB A;  1NG2 A;  5GAM f;  3UAT A;  3R6N A;  3MP1 A;  3CC7 T;  1VQ6 Q;  2YDL A;  4ZTJ A;  2QQR A;  1QCF A;  2M02 A;  3GPL A;  2LCS A;  4A54 A;  3PGG A;  2L3R A;  5GAN h;  1VQ6 A;  4C8Q B;  3Q1J A;  4JDS A;  3P8D A;  1VYT A;  3S3N A;  3JAM E;  5FU7 C;  1QP3 A;  2R5M A;  4JS4 A;  2MK5 A;  4J9I A;  2VYT A;  1FMV A;  1ABO A;  1NYF A;  5GAN j;  1ZA2 B;  3L1A A;  1XJW B;  5D6W A;  1M90 C;  5GAN g;  5KH6 A;  2M1H A;  4BI8 B;  4E7K A;  2ENM A;  4JLG A;  1JXO A;  1O75 A;  4XTW A;  3V8L A;  2LQ8 A;  1X75 C;  5GAN 7;  1OQK A;  3HRT A;  3VU3 C;  2KK4 A;  2BE7 D;  1G5V A;  2KXC A;  2PVO B;  2BZX A;  1WHJ A;  5GAO l;  2GQV A;  1RUW A;  1IB8 A;  2XMF A;  4M7D C;  3OW2 S;  4FM4 B;  3BDL A;  3CCU T;  1MMN A;  3H8Z A;  3E9G A;  3OS5 A;  1Y57 A;  4LD6 A;  4QQG A;  2ZPB B;  3G1J A;  4LD9 K;  1VOM A;  3X20 B;  2Y90 A;  3VJP A;  2QTX A;  1LPL A;  3CCE T;  3NTH A;  4GLM A;  3CCS Q;  3M9Q A;  4XU0 A;  2IG0 A;  1NEG A;  4PJO B;  3ZEH A;  2GNC A;  3VS5 A;  4C92 A;  4C92 E;  2XDD A;  5I2S A;  3CCL T;  5DLO A;  3CCS A;  4XAX B;  3M57 A;  4EMH A;  1QVF S;  3RIR A;  4ZN1 A;  4M78 C;  4ELY C;  1Q86 U;  2V8J A;  2HQX A;  1XNI A;  2E64 A;  4MMK A;  4M77 F;  4DBQ A;  1E6H A;  4XU3 A;  4HVV A;  4E7I A;  3V8K A;  4J9F A;  3M0T A;  4M7A C;  3E19 A;  2GGR A;  4GBQ A;  5GAO r;  1FMW A;  1H3Z A;  2NUP B;  4IUT A;  2AKK A;  4C92 D;  4OB2 B;  1ZUY A;  2FB7 A;  5CKF A;  2MAM A;  3C12 A;  1K73 C;  3ULR B;  2O2O A;  1VQ4 T;  1UHF A;  2L89 A;  1JU5 C;  2RH2 A;  2XKO C; 
#chains in the Genus database with same CATH homology
 1M9S A;  3BY7 A;  2CGH A;  3CCS T;  4BE0 A;  2HAX A;  2K5L A;  3MEU A;  3I56 T;  3J80 E;  3FJP A;  2B8A A;  1XQH A;  2LX9 A;  4LDU A;  1Y96 A;  3QO3 A;  5CKH A;  1VQL A;  4M7A A;  2LQK A;  5LJ3 h;  5GAO q;  4B9W A;  1KQ1 A;  1OZ2 A;  2CZ0 B;  2D6F A;  4J6X A;  4Q5W A;  2R5A A;  4BD3 A;  3PIO A;  5CKD A;  1KQS S;  3GNG A;  3URG A;  4C5I A;  4L59 A;  5CCA A;  1Y71 A;  3FIF A;  3FB9 A;  2RHZ A;  3JSC A;  2LCC A;  1RI0 A;  1XOV A;  2FYK A;  2E1H A;  3QBY A;  1UGQ B;  2LRQ A;  5C6S A;  4NOY A;  5HKC A;  1K9M U;  3M55 A;  3JCM h;  3JCM Q;  3CC2 T;  3WVD B;  3HSB A;  3ZBD A;  1U1T A;  3MEW A;  5AYF A;  4C0F A;  3CCM T;  4EMG A;  3JB9 F;  4KUD K;  3OYK A;  1Y7X A;  4M78 D;  4A4G A;  1RL2 A;  4FT4 A;  1PSF A;  3CCV T;  1Q7Y C;  4O6J A;  2K5F A;  5GAO m;  3L2W A;  4J83 A;  2DXT A;  3RKX A;  2RD1 A;  3MEA A;  3OBW A;  4C5E A;  5LJ3 j;  3OS2 A;  3HP9 A;  4OGC A;  3GF5 A;  2DZ9 A;  2WAC A;  4D6W A;  4EDU A;  1YI2 A;  2ZZD A;  4XTU A;  5CKB A;  5LJ3 g;  4UC4 A;  3GIB A;  2XG8 D;  3UT1 A;  1IRE B;  2KQW A;  2RHY A;  3C94 A;  5GAN 3;  4DQ2 A;  3JCM W;  3BFM A;  4XU1 A;  3JRZ A;  2DJZ A;  2ZPG B;  2CKK A;  4KUL A;  3M5A A;  3EFS A;  4XTV A;  5IT9 E;  2KVQ G;  3L2Q A;  2RK2 A;  4M77 G;  3T9N A;  2DTH A;  5HK3 A;  2DD4 A;  3HPW A;  1WQW A;  5GAM e;  5FU6 B;  3JCM g;  2CS7 A;  2DIG A;  1VQL T;  1M1G A;  1QVP A;  2VGM A;  3X25 B;  3CD6 T;  3OS0 A;  2QI2 A;  3OY9 A;  4LDV A;  3O8V A;  2HD0 A;  3FRN A;  4JRI A;  1UGS B;  4M7D F;  2FL7 A;  4XK8 E;  3LH0 A;  3LYI A;  4A53 A;  5GAM d;  2LDM A;  3HKS A;  4C8Q D;  1ZHI A;  4M7A G;  3TRE A;  2XD0 A;  2KSS A;  4C92 F;  5CK9 A;  1YHQ A;  2EJG A;  2CZ7 B;  3PIP A;  3QYH B;  3CPW A;  3JCM P;  4OF1 A;  3TEE A;  2RJC A;  4N4G A;  4C0G A;  4M75 B;  1BYM A;  3R6O A;  1U1S A;  3OSV A;  5KE2 A;  4MZP A;  1OI1 A;  1LOJ A;  2YHT A;  3E9F A;  1YJW A;  3A8M B;  2K57 A;  3OYF A;  2EAY A;  5GAN 2;  1S72 A;  4KT0 E;  1VQN A;  2R57 A;  3MCA B;  4PLL A;  3VYH B;  3LWH A;  3LGL A;  4V2S A;  1X6O A;  4Y91 A;  3H6Z A;  2KMT A;  3QDR B;  5FLX E;  1YIT A;  4FIB A;  3ER0 A;  4QVZ A;  4PL6 A;  2X4W A;  2CYZ B;  2EQM A;  2D9T A;  2VXF A;  5CO7 A;  5FRM A;  1VQK T;  2DXC A;  2HBP A;  4O5V A;  4FT2 A;  5DLQ E;  3V7C A;  3QII A;  3P8H A;  1QP2 A;  2MI6 A;  5D6Y A;  5LJ5 e;  5GAN 5;  3CC7 A;  3CC4 A;  4F7U A;  1G3T A;  1B34 B;  2RO0 A;  4LDX A;  4XTY A;  3C95 A;  4R55 A;  2ZPI B;  3VYG A;  2PUK B;  2QQ9 A;  3UPU A;  2X4J A;  4IUU A;  2K5I A;  4M78 F;  1DJ7 B;  5LJ5 d;  4EMK C;  5DM7 R;  1KC8 U;  3MO8 A;  4PJO E;  1BIB A;  4HCZ A;  1ZQ1 A;  4P5N A;  4MZT A;  4BB7 A;  3NFC A;  4C0D C;  5A0L A;  3RKY A;  2KDS A;  3CME A;  2DZC A;  1YJN A;  3CCJ A;  5J26 A;  3DB3 A;  2JN0 A;  3X26 B;  4E7H A;  1G3S A;  3J7A F;  2BKD N;  3RUX A;  2JOY A;  3QYG B;  3G4S A;  1K9M C;  4X34 A;  4C5G A;  2RI5 A;  2EJF A;  3L42 A;  3OYH A;  2I2L A;  5A2Q E;  3G71 A;  4BY6 B;  1VQ9 A;  3SDZ A;  2KAF A;  4CRI A;  2EJ9 A;  5GMK l;  4IUV A;  2CZ1 B;  4NL3 A;  5GAN e;  4M7A F;  4M77 B;  1YJW T;  2EIF A;  5I21 A;  2JNG A;  3BDU A;  4PNO A;  4EMK A;  5M9O A;  2OTJ A;  4OP0 A;  2GFU A;  1WJS A;  3KUF A;  4OGE A;  4MZM A;  2YRV A;  2XID A;  4OMF B;  5CKE A;  4RMO A;  3OW2 A;  4NS5 A;  4C8Q C;  1D3B B;  4QQD A;  1M5Q 1;  5GAN d;  2VXE A;  2ZCF B;  4BDZ A;  1VQO A;  3SWN C;  4M7D G;  3DKM A;  4OB3 B;  3JCM b;  1QW1 A;  1I5L A;  2GFA A;  3LWI A;  4GY5 A;  2E70 A;  2M16 A;  2GF7 A;  3QHS A;  1Y96 B;  2DTI A;  4OB0 B;  5IN1 A;  4M7A B;  3RMS A;  4QQ6 A;  3UWN A;  1BIA A;  1AHJ B;  4A4F A;  4X9C A;  3RMQ A;  3OS1 A;  4L5G A;  3M56 A;  3DLM A;  4JRP A;  4C92 G;  4ZTF A;  3V8J A;  2QQA A;  5LJ3 d;  4PJO D;  3E1S A;  4ATO A;  1N27 A;  3PMT A;  4B9X A;  1LNX A;  1BI1 A;  2RHI A;  3CPW S;  4E7L A;  3DB4 A;  1KHC A;  1NPP A;  2P0K A;  4A4E A;  4F7U G;  2K3X A;  3OYY A;  1UGR B;  4C8Q A;  1IZ6 A;  5GAN 8;  5CQX A;  5GMK e;  1VQM A;  1QVG A;  3SWN A;  4C8Q E;  3CME T;  3V7S A;  2L8D A;  3CCJ T;  4JS5 A;  3A5Z B;  2PUO B;  2E12 A;  4XU2 A;  1Q82 C;  3P8B B;  5FU7 B;  2NLU A;  3G4S T;  3CCU A;  4PKC C;  2RHU A;  3FC3 A;  3NTK A;  1VQP A;  4XTZ A;  4RCB A;  4BUG A;  5GAN 4;  4MML A;  3CBM A;  1H64 1;  2LNV A;  3OBY A;  5J39 A;  2QEX A;  4BI3 A;  1VQ8 A;  2X4Y A;  4FSX A;  2EWN A;  4DA4 A;  2OTJ T;  2RA2 A;  2PQW A;  4J7I A;  3ZFJ A;  1N9S A;  4M78 G;  3PNW C;  3RER A;  1JJ2 A;  3CPF A;  4II1 A;  4IUR A;  3CCR T;  1VQ7 A;  4ZN3 A;  1VQ5 A;  4IKF A;  4IUQ A;  3MP8 A;  5GAO n;  3CBP A;  5FU6 C;  2RHX A;  3TCJ A;  1W2B S;  2FHD A;  2OAU A;  4OVA A;  2IVW A;  3GNF B;  4N0A C;  5L8R E;  4A4H A;  1NZ9 A;  2RB6 A;  3OYG A;  3CCL A;  1G3Y A;  4RKU E;  5CVI A;  1Q82 U;  3QXE B;  1W4S A;  1WJQ A;  2X35 A;  2P0Q A;  4KUI A;  4J6W A;  4OB1 B;  1OYX A;  2V8K A;  4JJN K;  1WNL A;  1VQM T;  3ASK A;  2ZPH B;  2EYQ A;  4M75 C;  3CCQ A;  1KC8 C;  2C06 A;  1YBY A;  3G7Z A;  4J6Y A;  4ELZ C;  2E6Z A;  4VUB A;  4M7D B;  5KCH A;  3SFM A;  4F7U F;  1HK9 A;  3LW5 E;  2A7Y A;  2EQJ A;  4IUP A;  3HRU A;  3JB9 H;  4QVC A;  5GAN f;  3CMA A;  1K8A C;  4BE2 A;  4PJO C;  3OSS C;  1VQP T;  1EIF A;  1G3W A;  4N0A A;  3L2U A;  3NTI A;  4XQ3 A;  2PVD B;  4C92 B;  3ME9 A;  3VKI A;  5IAY A;  2O01 E;  1YI2 T;  1Y07 A;  1KQS A;  2VV5 A;  2QXF A;  1I8F A;  2E41 A;  4JUV A;  2RJE A;  4LDY A;  4N4I A;  3RKW A;  2LTO A;  4DOW A;  2GCX A;  2KY9 A;  1MHN A;  4M75 A;  2R58 A;  4F7U B;  4BE1 A;  1UGP B;  5HY6 A;  1VQ7 T;  3A8G B;  5CR2 A;  4M75 E;  4JLI A;  5HK0 A;  1TH7 A;  2Y4Y A;  2DIQ A;  4E47 A;  3SD4 A;  4QW2 A;  5GMK i;  3INZ A;  3QUI A;  4JRK A;  3J81 E;  3CEY A;  2DAQ A;  4ME7 A;  5I2M A;  1QVG S;  3OYD A;  1VQ4 A;  4PJO A;  2ZPF B;  2DD5 A;  3JB9 D;  3OYI A;  2XHC A;  3N5B B;  3JCM X;  1ZBX A;  2DK3 A;  4HCB A;  2QA4 A;  5GMK m;  4J5Y A;  1JBM A;  4BI4 A;  2E5Q A;  2DXB A;  3PTA A;  2CZ6 B;  4KBM B;  1VIE A;  1PSE A;  2YLC A;  4TVR A;  1YHQ T;  1K8A U;  3OMG A;  2F5K A;  3L2V A;  5LL6 S;  3PMI A;  4MDX A;  3M58 A;  2LC4 A;  4M78 B;  5DY9 A;  1JB0 E;  1N6A A;  1V29 B;  5CIU A;  1M1K U;  3A8L B;  1KHI A;  3FEO A;  3C4S A;  3EAE A;  3M4Y A;  4M77 C;  4ZGE B;  3OYM A;  1FWZ A;  2AHJ B;  3M59 A;  3PFS A;  5CQY A;  2XDB A;  2JTM A;  4EMK B;  2DPP B;  3HRS A;  1BI3 A;  3CMA T;  1WQ7 A;  1S72 T;  1VQN T;  5C0M A;  1M8V A;  5A0G A;  1Q81 C;  3OYA A;  2EQK A;  4J8O A;  2MF2 A;  4C0D B;  2O4X A;  3F70 A;  2L5Q A;  4ZGD B;  1YIT T;  3V7R A;  4R56 A;  5LJ3 e;  3TU4 K;  2OTL A;  4M75 D;  3RES A;  2DTO A;  4C8Q F;  1LJO A;  1NJI U;  3QPH A;  3QJY A;  4A4K A;  1N8R U;  4HA8 A;  5GAM f;  3S3O A;  1KG1 A;  3MP1 A;  1YJ9 A;  5KCO A;  3CC7 T;  3CC4 T;  3CBO A;  4ZGJ B;  5FRO A;  4ZTJ A;  2QQR A;  4M77 A;  3M54 A;  3VUB A;  3JCM e;  2WSE E;  3GPL A;  2JTF A;  4M77 E;  4A54 A;  1WPY A;  3PGG A;  2L3R A;  3OB9 A;  3FDR A;  5GAN h;  4L6V 5;  2XU8 A;  4WF2 A;  2G3R A;  1VQ6 A;  3OW2 S;  4C0Z A;  4C8Q B;  3Q1J A;  1D3B A;  3SWN B;  1NPR A;  2P4T A;  3JCM d;  2QA4 T;  3L2R A;  2XIC A;  3FLG A;  4JDS A;  1YJN T;  3OQ5 A;  3P8D A;  5CAI A;  4PJO G;  3OA6 A;  3JAM E;  5FU7 C;  1QP3 A;  2R5M A;  4JS4 A;  3S3N A;  3CD6 A;  3QSU A;  4BAC A;  4RG2 A;  1Q81 U;  3OYC A;  5GAO p;  4M7A E;  2LVM A;  3QG1 A;  2A3L A;  3G71 T;  3CXC A;  1VQ9 T;  1YIJ A;  2VYT A;  3LGF A;  3M53 A;  4HKE A;  1QVF A;  3WVE B;  4YTL A;  2RI3 A;  5GAN 6;  4RCC A;  3LX7 A;  1YCY A;  5EG2 A;  3SB2 A;  3A8H B;  3CCE A;  5GAN j;  3JCM V;  1BKB A;  2HQE A;  2F5T X;  3L1A A;  1WJR A;  1I81 A;  5LJ5 f;  3OYN A;  1VQO T;  1HXD A;  5D6W A;  3L2Z A;  3X28 B;  1M90 C;  5GAN g;  2OTL T;  3OYB A;  2K2V A;  5GMK h;  3PT9 A;  5KH6 A;  1KQ2 A;  2M1H A;  4M77 D;  3DLL A;  3UDC A;  2M0O A;  1K73 U;  4BI8 B;  4E7K A;  2VGN A;  2MMP A;  4Y28 E;  1YJ9 T;  4JLG A;  1O75 A;  3V8L A;  4XTW A;  1UEB A;  5D6X A;  2DO3 A;  2EKO A;  2LQ8 A;  3VUZ A;  4JRQ A;  2LCL A;  1X75 C;  5GAN 7;  5KE3 A;  3HRT A;  3VU3 C;  2KK4 A;  1G5V A;  2PVO B;  3M4G A;  2DKG A;  5GAO l;  2E10 A;  2LT1 A;  4QVD A;  4GLK A;  2GQV A;  2XDP A;  3I55 A;  1XTD A;  3KBG A;  3KXT A;  1VQ6 T;  4M7A D;  1WGS A;  1VIF A;  1M1F A;  2F69 A;  5FRN A;  2DVE A;  3QJ6 A;  2XK0 A;  2QDY B;  2DXU A;  3MET A;  4M7D C;  2RI2 A;  4FM4 B;  2MWP A;  3BDL A;  4M75 F;  3GLX A;  3QZ5 B;  2PVG B;  5GMK j;  2K4Y A;  3CCU T;  2M9U A;  1BI2 A;  5GAM h;  3H8Z A;  2YLB A;  3E9G A;  2X4X A;  2PU9 B;  4FU6 A;  4Z02 A;  3JCM c;  4C8Q G;  2EFI A;  3OYL A;  2JVV A;  3CCR A;  1YIJ T;  1JRI A;  1OZ3 A;  2E65 A;  3OS5 A;  3MHX A;  4C92 C;  4LD6 A;  3OYE A;  1U8R A;  1Q86 C;  3MEV A;  4PJO F;  5A0D A;  1M1K C;  1NE8 A;  4QQG A;  2ZPB B;  4LD9 K;  1Q7Y U;  1BI0 A;  2QEX T;  3X20 B;  2Y90 A;  1VQ8 T;  4PLI A;  3VJP A;  3WXM B;  2QTX A;  3G6E A;  5LJ3 f;  3HFO A;  3CCE T;  2JZ2 A;  3JCM J;  3NTH A;  1FXX A;  1M4Z A;  1VQ5 T;  4RG8 A;  3A8O B;  1KD1 C;  2RJF A;  4HCC A;  3LLR A;  4DOV A;  4M7D A;  1FX7 A;  3HL8 A;  2DEQ A;  3M9Q A;  3VV0 A;  4XU0 A;  1R8O B;  4M7D E;  1NJI C;  2IG0 A;  1M90 U;  2Y4X A;  3JCM f;  3JB9 I;  3JB9 J;  4PJO B;  1N8R C;  3ZEH A;  3OYJ A;  4MDW A;  5GAM j;  4C92 A;  1GXI E;  1P92 A;  2RJD A;  2ZPE B;  4N4H A;  4C92 E;  2XDD A;  2BIV A;  5I2S A;  5DLO A;  3CCL T;  3CCS A;  3I56 A;  1O9S A;  5GAM g;  4XAX B;  2V8I A;  4FL6 A;  3M57 A;  1X01 A;  2H3J A;  4EMH A;  3CXC S;  3QZ9 B;  3RIR A;  3I55 T;  2JUF A;  2QQB A;  4NL2 A;  4ZN1 A;  1QVF S;  2RK1 A;  1B34 A;  4M78 C;  1SSF A;  4ELY C;  2VUB A;  4F7U E;  4BY6 C;  5LJ5 h;  3GP8 A;  3CCQ T;  1Q86 U;  2V8J A;  2HQX A;  2EQU A;  2QQS A;  3S3M A;  1VUB A;  3JB9 G;  3X24 B;  2D0Q B;  1JJ2 S;  3OMC A;  1XNI A;  2E64 A;  4MMK A;  5J3B A;  3GOX A;  4M77 F;  4XU3 A;  4C5H A;  3CC2 A;  2BUD A;  2P0P A;  3EFR A;  4E7I A;  1W2B A;  2O4X B;  3V8K A;  1MGQ A;  3CCM A;  1I4K 1;  1KD1 U;  2LT4 A;  2K3Y A;  3HFN A;  2E6N A;  4X9D A;  2VC8 A;  2XI9 A;  3CCV A;  3G6E T;  3AHU A;  4E7J A;  3S6W A;  3E19 A;  4M7A C;  4J7F A;  4LDW A;  1UB4 A;  4M7D D;  1VQK A;  4M78 A;  3BW1 A;  5GAO r;  4HT8 A;  4HT9 A;  1H3Z A;  4BDY A;  1N9R A;  4M78 E;  3HHT B;  3MP6 A;  2MWO A;  4IUT A;  5LJ5 j;  4XTX A;  2RM4 A;  2WSF E;  4CI0 C;  4C92 D;  3QKJ A;  2FB7 A;  4OB2 B;  2WSC E;  5CKF A;  2MAM A;  3C12 A;  1K73 C;  1VQ4 T;  4M75 G;  5LJ5 g;  2L89 A;  4EPC A;  2HNI A;  2RH2 A;  2FVU A;  2XKO C;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...