4M75G

Crystal structure of lsm1-7 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
82
Chain Sequence
NLYFQGSMLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
total genus 12
structure length 82
sequence length 98
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75G00
1BIAA 3V8LA 4M75A 5LJ3f 4EMGA 5GAOl 2ZGWA 2FYKA 4M78A 4C92D 3JCMW 5LJ5h 3JCMJ 4M78F 2CGHA 4NOYA 3JB9D 4M7AA 2DVEA 4XQ3A 4XU0A 2EJFA 4M75F 4C8QB 4EMKB 5LJ5d 2K57A 5GANh 2RD1A 5GAOm 3RERA 4N0AC 3V8JA 1BIBA 4XTXA 4F7UB 5LJ5e 4XU1A 5GAN8 2RM4A 1Y96B 4RCCA 5GAN2 1HXDA 4M75C 4J6YA 2E65A 2FB7A 3JCMd 5LJ5j 3JCMe 2I2LA 5GMKi 2EWNA 2EAYA 3EFSA 1WQ7A 5GANj 2RB6A 1WQWA 2DZ9A 4NL3A 4N0AA 1B34A 3QUIA 4M77A 3JCMb 4F7UG 5GAMf 5GMKh 4C8QA 4XTZA 3M4GA 3JCMc 2YHTA 4M78C 3RKWA 5LJ3h 5GAMd 2DTIA 4C92G 3JB9G 4X9DA 3BDUA 4M7DF 5LJ5f 3SWNC 1HK9A 4QVDA 3FIFA 3JCMg 3QO3A 4M78B 4C92E 5GANf 2DJZA 1U1SA 4Y91A 5DY9A 3GIBA 5GMKj 1M5Q1 4F7UA 4M75E 3RESA 1B34B 4M77B 4EMKC 4PJOB 3AHUA 4M77F 4C92B 1I81A 4XU2A 2E41A 2DEQA 4J6XA 3HSBA 4J5YA 4XTUA 2VXEA 3JB9H 4M77E 3V7SA 5GAOr 4C8QC 3JCMV 1JBMA 4C8QG 3JB9J 1H641 5LJ3g 5GAMj 5GAOn 2JN0A 4JUVA 3JCMf 4RCBA 4M7AG 2VXFA 3FB9A 5CAIA 5GANg 4JRKA 5GMKm 4EMHA 4HT8A 4PJOA 4X9CA 2YLBA 1I8FA 4C92A 4M7DE 2VC8A 4HA8A 4J6WA 1M8VA 4F7UE 4MMLA 5LJ3e 3QSUA 4M75D 3RIRA 4M77C 3L1AA 4XU3A 4PJOD 4M7AD 4C92F 4DQ2A 2EJ9A 3JB9F 4M7AC 4C8QE 5LJ3d 5GAMh 3VU3C 2E64A 1D3BA 2DZCA 5GANe 5GAMg 5GANd 5GAN5 1JRIA 1YCYA 4C92C 4M77D 4PJOC 4C8QF 1MGQA 3JB9I 4HT9A 3RKYA 1KQ1A 3JCMh 5GAN3 3HFOA 2Y90A 3HFNA 3BW1A 3V7RA 4A53A 1I5LA 2DTHA 4JRIA 2RA2A 3JCMQ 1KQ2A 3SWNB 1U1TA 3L2ZA 4C8QD 2E1HA 4M7DD 4OP0A 2DKGA 2DTOA 1D3BB 1I4K1 4MMKA 3RUXA 3JCMX 5GMKe 4PJOG 2E10A 5GAOq 4M75B 1WNLA 3FJPA 3SB2A 1LNXA 1WPYA 3INZA 5GAN7 1N9RA 2DXUA 4M78E 1TH7A 4QVCA 5GMKl 5GAOp 4M7AF 4PJOE 4PJOF 4M7AE 4XTYA 4XTWA 4JLIA 4A54A 4M7DA 4M78G 3BFMA 3PGGA 5GAN4 4V2SA 4M75G 1LJOA 2HNIA 4WF2A 4M7DG 1Y96A 3SWNA 3V7CA 4PNOA 5LJ3j 5GAN6 3QHSA 4M7AB 5I21A 4EMKA 1N9SA 5GAMe 4M7DC 4NL2A 3RKXA 3JCMP 4M77G 1LOJA 2YLCA 4M78D 4XTVA 5LJ5g 3V8KA 3BY7A 4M7DB 2EJGA 2QTXA 3EFRA 4F7UF 2DXTA 1X01A
chains in the Genus database with same CATH superfamily
1XJWB 1YJ9Q 5CKFA 2DVEA 1VQPQ 3F70A 2L0AA 2DILA 2V8JA 4J9HA 3HL8A 4LDVA 1V1CA 2EIFA 4LUDA 3EG9A 1RL2A 3X26B 1BK2A 4XTZA 4DBHA 3S3MA 2K5LA 1G5VA 1G3SA 2KDSA 1ZSGA 5IHNA 4F14A 2DL3A 1ABOA 4BDYA 2DYIA 1OZ3A 1I0CA 4HVWA 3CC7T 2VWFA 2GCXA 2J6OA 2DEUA 2OJ2A 4JRQA 1NYGA 2KBTA 3HSBA 1OOTA 4KGZB 2QXFA 4KGVB 2SRCA 2GTOA 2VV5A 4XAXB 5GMKm 3I5SA 3VJPA 3OS5A 4LD9K 2VC8A 3HRTA 3OW2S 2EBPA 4F17A 1WHKA 1ZA1B 2KRNA 1VQMQ 2V8IA 2O2OA 1YBYA 3G6EA 2HQEA 2WACA 4C5GA 4Y28E 4N4GA 2LTOA 1OX9A 2PTKA 4LE9A 1KQSA 1WJQA 5HCKA 4F16A 1Q7YC 3EAEA 4M78G 1Y7XA 4C0DB 5IH2A 4RUGA 3CCRA 4M75G 5CKEA 4FU6A 1S72Q 1M1KR 1YI2T 1Q82U 2RQRA 1D0YA 1BKBA 1T3SA 3CCJQ 4CC7A 1VQ9A 2AKKA 3OYYA 1JXOA 3LX7A 2COZA 1BIAA 2HQHA 1AD5A 2RK1A 1YHQA 1U8RA 1B7TA 1ZLMA 2I0NA 2YUNA 3G7ZA 2QK0A 4OF1A 3SHWA 1QWFA 5CKBA 4LN2A 1Q86R 2NWMA 3M55A 3CC2A 1WQ7A 2DD5A 1OULA 2XHCA 1G3WA 2OAWA 4ZTFA 1G3YA 2PVDB 4M78C 5IT9E 4IIMA 4BI3A 1VOMA 2DNUA 5LJ5f 2EYWA 3DLMA 4BDZA 4E7ZA 1M1KU 4LDXA 3GIBA 1M2VA 1B34B 5KYWA 2L3QA 3KUFA 3LGFA 2KROA 4BY6B 3E9FA 1EX4A 2YUOA 1J3TA 2OTJT 2EQJA 2QASA 5A0DA 2XKOC 3S6WA 2KY9A 4HCZA 4X9CA 1YWOA 2DAQA 1WZOA 3UDCA 3CC2Q 4KH1B 1M2VB 2A7YA 3P8DA 1K8AU 4M7AD 1M4ZA 4O5VA 3GP8A 5LJ3d 2RO0A 3DLLA 1NEGA 2JUFA 1X43A 1QP3A 3OS2A 3KXTA 2DXBA 4QKUA 3RKYA 4J9BA 2ROLA 2FZGB 2K9GA 5CR2A 5DLQE 2OTLT 1ZSZC 1KC8U 3L2ZA 2YT6A 2P84A 2HAXA 4M78E 4ATOA 1WX6A 1NLPC 3PGGA 2RNAA 4JDSA 2X4YA 4PNOA 3CQTA 2L5QA 3SDZA 1E6HA 3MEAA 4IUPA 2CREA 1R8OB 1IGQA 4ORZA 1Q81U 2EJGA 4A4EA 1JJ2P 4KBMB 2DYBA 4C5IA 4D8DA 1RACB 1Q82R 4F7UB 2LVMA 1MMGA 2RM4A 4GY5A 4J6YA 3MPUB 2GF7A 2JMCA 5CIUA 3O8VA 1OYXA 1K4US 2DVJA 3C95A 2F5TX 3NGPA 5CKHA 3MKDA 3FIFA 1GL5A 3QO3A 3M0TA 2ZPGB 1K8AC 5CVIA 5A0GA 4JPBW 4F7UA 2RQUA 2CZ0B 1WJSA 3CCQT 2VXEA 1YCSB 3DKMA 3NFCA 3M58A 4DA4A 4C8QG 2JTFA 4LDWA 3J7AF 1YIJT 3GNGA 1TOVA 1VQ6T 1RABB 4LDUA 2RHIA 2FRWA 2YXYA 4M77C 1NEBA 1TUCA 2JXBA 4E7KA 2A28A 2G3RA 3LGLA 1H8KA 2HDAA 3VU3C 1VQPA 2A0FB 1YHQT 3EH1A 5GANd 4QQDA 1WHHA 4CI0C 5GAN3 3HFOA 1FMWA 3PNWC 2X4XA 1KFZA 1K73R 2JMAA 4C8QD 5HK3A 1TXQA 3JV3A 2E10A 1AVZC 1AEYA 3WVEB 5CKDA 3H41A 5GAN7 1TH7A 3HP9A 2E12A 1E7OA 1G83A 1LJOA 2XDPA 4WF2A 2ROTA 1WA7A 2FZKB 5FU6C 4D8KA 2DXTA 4OMPA 4HCBA 2FHDA 3SD4A 2DJQA 1PWTA 4PK4A 5LJ5d 1AZGB 2M02A 3HPWA 4XTXA 3QKJA 3R6OA 4M75C 1Q81R 2IPOB 5LJ5j 1SPKA 3I55Q 2HL5C 1SHGA 2EAYA 2RB6A 2RF0A 2LT1A 1QVGA 4QW2A 2FL7A 3PMIA 2IIMA 3TQ7P 1BU1A 1RI0A 3D7SB 3CD6T 1U06A 3OYAA 2EKHA 3CXCA 4J83A 1YJNQ 3RBBB 4RTUA 2D0QB 3DB3A 3EG3A 4DBFA 3RESA 4OMFB 3CBOA 1XNIA 2E41A 3AT1B 2V8KA 4J6XA 4XTUA 1ZUUA 1IZ6A 3P8HA 1JB0E 5I2SA 3A8LB 4OB2B 4JRKA 4R55A 2YRVA 2FPEA 1VUBA 4EMHA 3RDVA 1MMAA 1R0BG 1M3AA 4MMLA 2KT8A 3L42A 3UT1A 4C5EA 3CCQQ 1GFCA 3WXMB 2K7AA 1KIKA 4C92C 1SG5A 5KYXA 4M77D 2BZXA 2RH2A 3OYEA 2LRQA 3NTIA 1AZEA 2KXCA 2Y90A 4A53A 3V7RA 4PLIA 4RTXA 1T0JA 2E1HA 1VA7A 2DKGA 3X20B 2NUPA 1NPPA 1QKWA 4MZMA 4ZNXA 2XD0A 1M1GA 5GAOq 2EYYA 4J9EA 2G6FX 3PVQA 1N27A 1QVPA 2DMOA 4AFUC 3UA7A 2OTJA 4M7AB 4GLMA 1W2BP 1PCXA 4M77G 4PJNA 5FW9A 2YLCA 3HTRA 3OYLA 3I9QA 2WSFE 4KUIA 4M7DB 5IAYA 2HD0A 2L3SA 2QTXA 4BE2A 3R6NA 3E19A 4M75A 2KSSA 2EVRA 3A8OB 4M75F 3A98A 4N0AC 3UA6A 2L3RA 1RADB 4PFZA 2YWWA 2E6ZA 2FZCB 1KSWA 2I2LA 1T3LA 1PD1A 4HVUA 2EQUA 4GBQA 2IG0A 4E7LA 4B9XA 2EPDA 3RKWA 1XQHA 2FPFA 1UGPB 3CCMT 3CMAT 1ARKA 2KI7A 2KGTA 4ZN1A 1N6AA 1QKXA 2DL7A 6AT1B 4M78B 3VS2A 3OYIA 1M5Q1 1ACMB 3PE0A 2BUDA 2D8JA 2J06A 4AFSC 1KD1C 2EQIA 3TCJA 4OB3B 1SKUB 1VQNQ 4M77E 4RTVA 1ABQA 1YFNA 1ZX6A 1W2BS 2L3PA 2JN0A 2RQWA 3EG1A 1N8RC 3FB9A 1MV3A 3M54A 2PVOB 4IUQA 2YLBA 2ABLA 2QA4Q 2OX7A 3KFVA 3OYBA 2JM8A 1WFWA 4C92F 2RHYA 3SEMA 3NMZC 1UGVA 4HVVA 2CP7A 3OYJA 1MV0B 4XK8E 1AWJA 4ZGDB 3QIIA 3UF4A 4JJNK 1TTHB 2K5FA 2PVGB 5CQYA 1BI2A 1VQ5T 1WNLA 3OYFA 3CD6A 4PJOE 2C0IA 2HQXA 2VKNA 4J7IA 5GAN4 2CKKA 2O31A 2HNIA 3MEVA 2CZ6B 3QPHA 5A0LA 4OGEA 3QHSA 5FLXE 1Y71A 3CC4T 2V1RA 5J39A 4DOVA 2M51A 1X01A 2K5IA 3QZ5B 2LP5A 2FYKA 4M78A 4C92D 2FPDA 2CH4W 4IUVA 5GANh 1S72T 5IN1A 4LUEA 2NUZA 3CEYA 5GAN8 3CCEA 3LW5E 4IIOA 1FX7A 3ZFJA 2LCLA 2K3XA 5GANj 1VQ7T 1X2QA 1C6VX 2JOYA 3HRSA 3FDRA 4N0AA 5J26A 4ELZC 2QQRA 3QUIA 3CD6Q 1X6OA 3M4GA 4FSSA 4ZN3A 2CP6A 4N4IA 1SRLA 1KJWA 1HK9A 3VV0A 3OYMA 3CPWP 1HYOA 3I55T 3Q1JA 3EG9B 4M77F 1AWOA 2MF2A 5KE3A 4RG8A 2DEQA 2PUKB 2QGGA 4LD6A 1M90C 1M30A 3EG0A 1OPLA 3QG1A 5D6YA 1Y0MA 1PKTA 2X4WA 3CCEQ 3M9QA 1ZBXA 2GQVA 2B86A 1AOJA 1K9MU 4M7AC 1YN8A 1QVFS 2LJ3A 2E64A 5DM7R 2QQBA 2MWOA 1BBZA 4C8QF 4A4HA 2RHXA 3ULRB 1UGRB 5GJVB 1Z9QA 4J8OA 2DTHA 3CCMQ 4ESRA 4A4KA 2RN8A 4E7SA 1ZUKA 4PJOG 3FJPA 4C5HA 2AHJB 2AK5A 3CCUA 2DM1A 2LMJA 1JJ2A 2LC4A 2W10A 3MHXA 3CMEQ 2EGEA 3M0SA 3V7CA 2X51A 4K11A 2JNGA 1KQSS 4E2FB 1ZA2B 2AZSA 5FWBA 4CC3A 3FC3A 2VGNA 3V8KA 4ZGJB 1K9MR 5KE2A 2XK0A 2HCKA 3A5ZB 4M7DG 1X27A 3V8JA 4QQ6A 1D1AA 2F2VA 3JCMd 1B3QA 1RAFB 4C0DC 4AT1B 1IRXA 5EC7A 3GPLA 1S1NA 2PZ1A 3X24B 1MUZA 2ZPHB 5KCHA 1YJNA 3JB9G 4JJBA 2MIOA 2X3XD 1UGQB 1JU5C 1DJ7B 2K79A 5IXBA 4M75E 3L2UA 4JS5A 2MWPA 2JJ9A 2RJEA 2CS7A 2XICA 4FYXB 3A8GB 3UWNA 5GANg 4PJOA 4ZGEB 3ZEHA 3CC4Q 2QDLA 2O4XB 1BI3A 1VIFA 2W0ZA 3MJXA 1ZBJA 2CP3A 4C8QE 1D3BA 2ZPFB 3VS4A 4RG2A 1YJNT 3C12A 2DIQA 4HXJA 2LQNA 5FRNA 1YWPA 1VQ5A 2EKOA 5GMKe 3O5ZA 1TSFA 3NPFA 4PJOF 4XTYA 4M7DA 2MPXC 2CDTA 1VQ8A 3SWNA 4FM4B 2F5KA 4EMKA 1Z9ZA 1H3HA 5GAMe 1NJIR 1VYTA 3M56A 3VKIA 2CP5A 2E4HA 4MZPA 4BB7A 1RLPC 1GCPA 2DZ9A 1M2OA 2OAUA 2EGAA 3QDRB 2P0QA 5LJ3f 4EMGA 4FT4A 4M78F 3NTKA 1ZHIA 3OS0A 3CMET 2O9SA 1X6GA 4BI4A 1YNZA 3TREA 4BACA 2COYA 1K73U 4RTYA 1WYXA 4NL3A 3ZBDA 1UG1A 3THKA 3PIPA 4E47A 3EHRA 2RJDA 4PJLA 3QBYA 1D0XA 5KYNA 1YI2A 2CH4A 3M59A 1VQ7Q 3PT9A 1IO6A 1OPKA 1JEGA 3REAB 1KK7A 4OB1B 4C92B 1YHQQ 2R58A 5KYYA 1K73C 2YSQA 3E1SA 1ZQ1A 1WXTA 1RI9A 4PLLA 5CK9A 3CCET 1OU8A 3EGDB 2XDBA 4M7AG 4FYVB 1KD1U 2OTJQ 1LVKA 3MEUA 2AKLA 4II1A 4ME7A 1YJ9A 2CUBA 1UE9A 2BE9B 2DK3A 2DXCA 2RK2A 3I55A 1IXDA 5KYUB 1V76A 1M90U 3J81E 1X6BA 1Q7YR 2GFUA 1B07A 1Y57A 1VYVA 5I11A 3OYDA 5KCOA 4FT2A 2L89A 1W2BA 2Y4YA 4RMOA 2LQWA 3VS7A 3RKXA 3OYCA 3JCMP 4R56A 1LCKA 2EFIA 1Q86U 2E5QA 2PU9B 2Z0WA 3OBWA 5IHIA 5FU6B 3JB9D 3EGXA 4M7AA 3TSZA 2LNHB 4XU1A 4MDWA 3CC7Q 1HXDA 2HEQA 5KYYB 5GMKi 1VQOA 2CSQA 3G4SA 2CP0A 2R5AA 3EGXB 3RNJA 3CMAQ 4O6JA 3JCMc 3CCLA 1W6XA 2DTIA 3CXCS 4X9DA 4JLGA 4Z89A 3SWNC 4JJDA 1U1SA 1OV3A 1FXXA 1EIFA 4QQGA 2LNVA 2DF6A 4OMOA 3TU4K 4KULA 2GNCA 3M0UA 1C1AA 1QWEA 4OMMA 1R0CB 2A3LA 2CT4A 5CO7A 4JZ3A 3VS1A 1K8AR 3JCMV 1GCQA 1H641 3EG2A 5ECAA 2E5KA 4JUVA 4RCBA 3VS0A 2QA4T 2P0KA 1C0MA 1EFNA 1WHGA 2JTMA 2QQSA 3JRZA 3I35A 4PJMA 3OBYA 2HMAA 3L2WA 3CCJA 1SF9A 4F7UE 1NBEB 2RPNA 4XU3A 2EJ9A 3L2QA 3EFOA 5J3BA 5GAMh 1RAAB 4Z02A 1YCYA 3HHTB 4PJOC 1OEBA 3ZL7C 4OGCA 3CCMA 3BW1A 2RA2A 2ENMA 3MCAB 3JCMQ 1G2BA 3M57A 2GBQA 2FG0A 5IHKA 3INZA 1N9RA 1M27C 3QYGB 5CQXA 4M7AE 2GGRA 4A54A 4JS4A 1U3OA 2KE9A 3QWYA 3DB4A 1K9AA 2C06A 5KH6A 1M8MA 4RKUE 1G3TA 1N8RR 4J9FA 3CCJT 2JZ2A 3NTHA 2F2XA 2HKQB 2ZGWA 1WXUA 3M53A 2CGHA 2XDDA 1NM7A 3FRNA 4XU0A 1VQKQ 1AT1B 1PM3A 2CT3A 2WSEE 1IHWA 3SFMA 2YRCA 1I1JA 5LJ5e 1Y96B 2CUDA 5FWCA 1D09B 1Q81C 3MEWA 4BUGA 3QXEB 3C0CA 1B34A 1G8XA 4PFPA 5KYWB 1SHFA 5GMKh 4C8QA 3OYNA 3A8HB 2DBMA 1K0XA 4M7DF 2QA4A 1KQSP 2DLPA 3LH0A 1P92A 1VQLA 1BI1A 3MP8A 2YUQA 1K76A 4X34A 2O01E 2RJFA 1KG1A 1I81A 1JJ2S 1MMDA 2LX9A 4BE1A 1VIEA 4FW2A 3KBGA 1HSQA 5GAOn 3OS1A 3GNFB 2ECZA 3P8BB 5CAIA 4HT8A 2B8AA 2KRMA 4HA8A 3CC7A 3OB9A 1LPLA 2JVVA 4N4HA 2LDMA 5CCAA 3H6ZA 2BIVA 3FLGA 2D1XA 5L23A 3CBMA 3H0HA 2LCCA 2JTEA 1FMVA 2E3IA 1U5SA 4P5NA 2EGCA 1TUDA 2X9HA 2XG8D 3RUXA 4MMKA 1RAIB 2FEIA 2AIRB 2VGMA 4FYWB 3LWIA 1OU9A 1CKAA 4JLIA 1PSEA 1PD0A 1VQ6Q 1V29B 3CC2T 3CCRQ 3G71T 3CPWS 5C0MA 3WVDB 1YJ9T 2H3EB 3RMQA 2MYSA 2MI6A 3OMGA 1ZUYA 3M5AA 1UTIA 1JXMA 1UUEA 3JCMW 2YRDA 3X28B 2QDYB 2C0OA 4NOYA 1PNJA 4BD3A 1YIJA 4JJCA 4RCCA 1QCNA 1QW1A 1Y07A 4FW1A 3RMSA 1GBRA 2JT4A 3H0FA 5GAMf 3PFSA 3BDUA 4AFZC 4QVDA 2RQVA 1IGUA 2KK4A 4FSXA 2O9VA 4OMQA 1JQQA 1HD3A 3I56Q 3HKSA 1KD1R 1GFDA 1M9SA 3PTAA 4FL6A 5I22A 3CCSA 5GAOr 1AHJB 1JBMA 3CCVA 4RTWA 2RMOA 3CCVT 3CPFA 1MNEA 1WGSA 2ED0A 2VYTA 2D9TA 1SRMA 4MDXA 2P0PA 3META 3L1AA 4A63B 3M4YA 4Z88A 1UHCA 1H3ZA 1VQ5Q 4OMLA 2RHUA 3QJ6A 1WHLA 4B6MA 1VQLQ 2AT1B 4JRIA 4PFOA 4J9GA 3CCST 3CCUT 4PJJA 1X75C 2O4XA 3CXCP 5GJWB 2BZ8A 1NJIC 4XTWA 3VS3A 2RI2A 2HZYA 1D0ZA 4AG1C 1HJDA 5KYUA 2HL3A 2C0TA 2J05A 4Z8AA 3OA6A 4UC4A 3QDFA 2A37A 3MO8A 2KNBB 2J6KA 2NLUA 1PC0A 4E7IA 4F7UF 3G71A 4TVRA 1VQNT 3L2VA 5LJ5h 3GLXA 3LLRA 3T9NA 4XQ3A 1RAGB 3QJYA 4R0KA 1BIBA 3CBPA 2R57A 3JCMe 2EQKA 2LQ8A 3U23A 2BZYA 2RI5A 5DLOA 1VQ8T 1VQ4A 1K0SA 3G6EQ 3VRZA 3CCSQ 2M1HA 1WLPB 1NPRA 5GANf 2DD4A 3G1JA 2DERA 2RJCA 4B9WA 3L2RA 2DRMA 4E6RA 1VQNA 2X35A 1UDLA 3G4SQ 1KC8C 4FCYA 4FIBA 3I5RA 4EPCA 1BYMA 1XOVA 3URGA 1KHCA 4JRPA 2ESWA 3V7SA 2QGFB 3JB9J 2EYQA 1MNDA 2DBKA 1K9MC 4L5GA 2D8HA 4C92A 2YDLA 1VQ9Q 2X3WD 1BCMA 3MP6A 2CP2A 3C94A 1AWXA 2BTTA 3QYHB 1WHJA 1IREB 4ELYC 4KT0E 1UB4A 2KYBA 4HT9A 1KQ1A 3PVLA 2QI2A 1KHIA 2DL8A 3HFNA 4C0GA 4LDYA 1U1TA 3LWHA 2M0OA 3GBQA 4MZTA 3M0RA 1LNXA 3CMAA 2LQKA 2X4JA 1PHTA 2E3HA 4DBRA 1WHMA 2LJ1A 1VQMA 3FEOA 4L6V5 2H3JA 1N9SA 4M7DC 2K3YA 4Y92A 2DFUA 5A2QE 3VYGA 2K2MA 1MHNA 5GAOl 2EYXA 2ZAEA 3OSVA 3CCRT 3UPUA 4M4ZA 1NJIU 1QVFA 1Q7YU 1GXIE 2HBPA 2DE0X 4OMNA 1UGSB 4HCKA 1RUWA 2F69A 2MCNA 1UJ0A 2CYZB 4C92E 4HCCA 2NYSA 2PQWA 2RI3A 4Y91A 3TEEA 2J7IA 2D6FA 3BE3A 3OW2A 2D0NA 1I07A 3H9NA 3OYHA 1VQMT 2L8DA 1YITA 1IB8A 4XU2A 2P4TA 4J5YA 1WDXA 2DO3A 7AT1B 4C8QC 4C0FA 4KRTA 4OB0B 4EIKA 8AT1B 2RHZA 1I8FA 1RAHB 1N5ZA 2FVUA 3J80E 2JS0A 5LJ3e 4DBQA 4AFQC 3VUZA 4DQ2A 1KC8R 5HY6A 1N8RU 3GOXA 1WXBA 5GANe 2DZCA 2A36A 3JSCA 2AZVA 4D6WA 3JB9I 1YJWQ 1NZ9A 1T0HA 1QMCA 1VQ7A 1OZ2A 2J6FA 4DEYA 4RTTA 4M7DD 1GBQA 2NUTB 2DTOA 3E9GA 3JCMX 4FYYB 3CMEA 2CZ7B 4AG2C 3CPWA 4M75B 2VUBA 1QP2A 3H8ZA 4GLKA 2DXUA 5GAOp 1PSFA 4KH0B 4ZTJA 3EFOB 9ATCB 1X69A 2K3BA 2QTVA 4V2SA 2DRKA 1Y96A 2E6NA 1PRLC 1NLOC 8ATCB 5GAN6 2A08A 1WJRA 1BCOA 1YIJQ 4XTVA 2QEXQ 2KYMA 1O75A 4IUUA 4WTOB 1UHFA 3V8LA 4IURA 2BE7D 4C8QB 3VS6A 5GAOm 3G4ST 1UJYA 2OI3A 4A4FA 5GAN2 1FWZA 5LL6S 2EWNA 4IKFA 3CCLT 3EFSA 2BKDN 1WQWA 2RQTA 2PNIA 1PKSA 2V1QA 4M77A 3OY9A 1QCFA 4Q5WA 2GTJA 4QVZA 1Q82C 2YHTA 5GAMd 5FU7C 1CSKA 3VYHB 4C92G 2CSIA 3BDLA 1M1FA 3I56A 1YJWT 2FO0A 2ED1A 3S3NA 2KAFA 1R77A 4M77B 4J9IA 3X25B 1GRIA 5EG2A 2DX1A 2HBWA 1WIEA 3JB9H 2VB6A 3C4SA 1W1FA 1QQJA 1BB9A 5FRMA 2JS2A 1VQ9T 1M3BA 3JCMf 5D7UA 3VS5A 1QCOA 3REBB 4M7DE 2V26A 1VQOQ 2MK5A 4J6WA 2QAZA 3QWXX 1E6GA 4M75D 1FMKA 2QYZA 3NHNA 4PJOD 3JB9F 1NYFA 1X2KA 3N5BB 4J9CA 2QG9B 3TSWA 2KQWA 3TVTA 5GAN5 1VQ4T 1QVGP 2O88A 1MGQA 2HKNA 3CCUQ 2KEAA 2OTLQ 3EHQA 1TWBA 3PMTA 1KQ2A 2R5MA 2KVQG 3G6ET 2LX7A 1VQ8Q 2XI9A 4J7FA 5AYFA 1Q95G 3M0QA 4RTZA 1MMNA 3BFMA 4CRIA 4DEXA 5C6SA 2CZ1B 2EW3A 2P4RA 5I21A 1TG0A 2LZ6B 4NL2A 1QVGS 2JM9A 2ZZDA 1LOJA 4M78D 5LJ5g 2MAMA 3CCVQ 1PRMC 1O9SA 2LT4A 2M16A 3EFRA 3OQ5A 3VUBA 1H92A 3UATA 1ZSZA 3OW2P 3JCMJ 4L59A 2EJFA 3I56T 1OX8A 2EQMA 2K4YA 1YJWA 3RERA 4CC2A 2GQIA 2E65A 2DPPB 2FB7A 3CC4A 1FYNA 1ZSZB 3JCMb 2OTLA 4F7UG 1SSHA 3GF5A 4X1VA 5LJ3h 2DIGA 4LNPA 3JCMg 3CCLQ 3PIOA 2DJZA 5HK0A 1YITQ 1RLQC 2HSEB 3H0IA 2FRYA 2QQAA 1W4SA 4NS5A 4PJOB 1OI1A 3AHUA 5I2MA 3OMCA 4YTLA 1WI7A 3IQLA 4WCIA 2M0YA 4BE0A 2XMFA 5M9OA 2MOXA 2K6DA 2QEXA 5HKCA 4QT7A 2SEMA 3LYIA 3ER0A 4J9DA 1TS9A 5L8RE 2DETA 1YP5A 2YUPA 2Y4XA 1K1ZA 5KYXB 1YI2Q 1TUGB 3G71Q 1EZZB 2F2WA 3E2UA 1M90R 4BY6C 1M8VA 3QSUA 1W70A 2WSCE 1RAEB 2ATCB 2NUPB 3A8MB 5GAMg 1JRIA 5FROA 4JZ4A 1UECA 5IXFA 5FU7B 1YITT 4PKCC 1XTDA 3SWNB 4E7HA 4OP0A 1I4K1 2ZPIB 1VQ4Q 1D1CA 5GMKl 4QVCA 4M7AF 3HRUA 2L2PA 3OSSC 5LJ3j 2K2VA 1VQOT 2GFAA 2M9UA 2E70A 4A4GA 4E7JA 1TU0B 2F1LA 3A1PA 4PL6A 3BY7A 1VYUA 1VQ6A 1M1KC 2XU8A 1D1BA 4EDUA 3RR6A 4EMKB 2MMPA 3ASKA 2K57A 1F1BB 2RD1A 2ZCFB 2DL4A 1NE8A 1PG5B 4ANJA 2KT1A 3S3OA 3CCQA 5D6WA 3EH2A 1SEMA 2H8HA 2VASA 4C0ZA 4AMCA 3MP1A 1UEBA 4IUTA 1CKBA 1VQLT 1UFFA 5DY9A 2XIDA 5GMKj 2LJ0A 2EYZA 1GCQC 4EMKC 4LXCA 1VQKA 1VQPT 1VQKT 3EGUA 2VVKA 3M0PA 4CC4B 1JO8A 4KUDK 5LJ3g 5GAMj 3FJ5A 4DOWA 2VXFA 2JW4A 2COWA 1QLYA 1M3CA 4HKEA 3RIRA 1NG2A 2DA9A 3ME9A 5AT1B 4KGXB 4BI8B 3JCMh 3EGDA 1I5LA 2KR3A 2HSPA 2KRSA 4OVAA 3VRYA 1Q86C 1D3BB 1AWWA 1A0NB 1QVFP 3OYKA 2QQ9A 4F04B 1BI0A 1IHVA 2IVWA 3SB2A 5D6XA 1WPYA 1OQKA 2ZPEB 3OYGA 2KXDA 1S72A 3LH5A 3JAME 2KMTA 2PUOB 2ZPBB 1I5OB 2DL5A 3QZ9B 4VUBA 2NUTA 2LCSA 2QEXT 1SSFA
chains in the Genus database with same CATH topology
1MHNA 3E19A 4M75A 5FU6B 5GAOl 3JB9D 4M7AA 2KSSA 5CKFA 3A8OB 2DVEA 3OSVA 4M75F 3F70A 3CCRT 3UPUA 1NJIU 4N0AC 1QVFA 2L3RA 1Q7YU 4XU1A 2V8JA 4MDWA 1GXIE 1HXDA 3HL8A 2E6ZA 4LDVA 2I2LA 5GMKi 2HBPA 1VQOA 2EQUA 2EIFA 3G4SA 1UGSB 2R5AA 1RL2A 4O6JA 3X26B 2IG0A 4XTZA 4E7LA 3JCMc 4B9XA 3S3MA 2K5LA 3CCLA 3RKWA 1G5VA 1XQHA 1G3SA 1UGPB 2DTIA 3CXCS 3CCMT 2KDSA 4X9DA 3CMAT 4JLGA 4ZN1A 1N6AA 3SWNC 2F69A 4M78B 2CYZB 4C92E 3OYIA 4HCCA 4BDYA 1OZ3A 2PQWA 1U1SA 2RI3A 4Y91A 3TEEA 1FXXA 1M5Q1 3CC7T 2D6FA 1EIFA 3OW2A 4QQGA 2LNVA 3OYHA 2BUDA 4KULA 2L8DA 3TU4K 2GCXA 1VQMT 1YITA 1KD1C 4XU2A 3TCJA 2P4TA 4OB3B 4JRQA 2A3LA 3HSBA 4J5YA 4M77E 2QXFA 2DO3A 5CO7A 4C8QC 3JCMV 1W2BS 1H641 2VV5A 4C0FA 2JN0A 4JUVA 1N8RC 4RCBA 4XAXB 4OB0B 3FB9A 2QA4T 2P0KA 5GMKm 3M54A 2RHZA 2PVOB 4IUQA 1I8FA 2QQSA 2JTMA 2YLBA 3JRZA 3OS5A 3VJPA 4LD9K 2VC8A 3OBYA 3L2WA 2FVUA 3CCJA 3J80E 4F7UE 5LJ3e 3CCLT 3HRTA 3OYBA 3OW2S 3VUZA 4XU3A 4C92F 4DQ2A 2EJ9A 5HY6A 3L2QA 1N8RU 3CD6A 3GOXA 5J3BA 5GAMh 4Z02A 2RHYA 2DZCA 5GANe 1YCYA 3HHTB 4PJOC 2V8IA 3JSCA 3OYJA 4D6WA 1YBYA 3JB9I 3G6EA 3CC2A 4OGCA 4XK8E 3CCMA 1NZ9A 4ZGDB 2HQEA 2WACA 3QIIA 4C5GA 1VQ7A 3BW1A 4JJNK 1OZ2A 4N4GA 2K5FA 2RA2A 3MCAB 2LTOA 2PVGB 4Y28E 3JCMQ 4M7DD 3M57A 2DTOA 3E9GA 5CQYA 3JCMX 3CMEA 2CZ7B 1BI2A 3CPWA 1KQSA 1VQ5T 4M75B 1WJQA 1WNLA 1QP2A 2VUBA 3H8ZA 4GLKA 3INZA 3OYFA 1N9RA 2DXUA 3VYGA 3QYGB 5GAOp 1PSFA 4PJOE 5CQXA 4ZTJA 4M7AE 1Q7YC 4A54A 3EAEA 4M78G 1Y7XA 2HQXA 4J7IA 4C0DB 5GAN4 2CKKA 4M75G 3CCRA 4JS4A 2HNIA 3MEVA 4V2SA 1Y96A 2CZ6B 3QPHA 2E6NA 5A0LA 5CKEA 4OGEA 4FU6A 3QHSA 5GAN6 5FLXE 1Y71A 3DB4A 3CC4T 1YI2T 1Q82U 1WJRA 5J39A 4DOVA 2C06A 4XTVA 5KH6A 1BKBA 4RKUE 1VQ9A 1G3TA 3OYYA 1O75A 3CCJT 4IUUA 2JZ2A 2K5IA 1X01A 3LX7A 3NTHA 3QZ5B 1BIAA 3V8LA 4IURA 2ZGWA 2FYKA 4M78A 2RK1A 3M53A 4C92D 2CGHA 2XDDA 3FRNA 1YHQA 4XU0A 4IUVA 1U8RA 2WSEE 4C8QB 5GANh 1S72T 5IN1A 5GAOm 3SFMA 3G7ZA 3G4ST 4OF1A 3CEYA 5CKBA 5LJ5e 5GAN8 3CCEA 1Y96B 4A4FA 5GAN2 1FWZA 5LL6S 3LW5E 3M55A 2EWNA 1Q81C 3MEWA 3EFSA 1FX7A 1WQ7A 2LCLA 2K3XA 3ZFJA 2BKDN 1WQWA 4BUGA 5GANj 1VQ7T 2DD5A 2XHCA 1G3WA 2JOYA 3HRSA 3FDRA 3QXEB 4N0AA 5J26A 4ELZC 1B34A 2QQRA 3QUIA 1X6OA 4M77A 3OY9A 4ZTFA 1G3YA 5GMKh 4C8QA 4Q5WA 3M4GA 2PVDB 4QVZA 4ZN3A 2YHTA 3A8HB 4M78C 5GAMd 4BI3A 5FU7C 3OYNA 5IT9E 3VYHB 4C92G 4N4IA 4M7DF 5LJ5f 3VV0A 1HK9A 3OYMA 3LH0A 1P92A 3BDLA 3DLMA 2QA4A 1VQLA 1M1FA 3I56A 1BI1A 3MP8A 4BDZA 1YJWT 3S3NA 3I55T 1M1KU 4LDXA 3Q1JA 2KAFA 3GIBA 4X34A 1B34B 4M77B 3KUFA 3LGFA 3X25B 4M77F 2O01E 2RJFA 1KG1A 1I81A 5EG2A 2MF2A 5KE3A 4BY6B 1JJ2S 4RG8A 3E9FA 2DEQA 2PUKB 3JB9H 4LD6A 3C4SA 1M90C 2LX9A 4BE1A 1VIEA 5FRMA 3KBGA 1VQ9T 5GAOn 2OTJT 3OS1A 2EQJA 3GNFB 3JCMf 5A0DA 2XKOC 3P8BB 5CAIA 3S6WA 4HT8A 2KY9A 4HCZA 4X9CA 3QG1A 2DAQA 4M7DE 2B8AA 5D6YA 3UDCA 2X4WA 4HA8A 4J6WA 3CC7A 3OB9A 3M9QA 1ZBXA 2A7YA 3P8DA 2GQVA 4M75D 2JVVA 1K8AU 4PJOD 4N4HA 2LDMA 3JB9F 1K9MU 4M7AD 1M4ZA 4O5VA 3GP8A 4M7AC 5LJ3d 5CCAA 1QVFS 2RO0A 3DLLA 3H6ZA 2E64A 2BIVA 2QQBA 3FLGA 3N5BB 5DM7R 2KQWA 2JUFA 5GAN5 1QP3A 2MWOA 3CBMA 3OS2A 2LCCA 4A4HA 4C8QF 2RHXA 3KXTA 1UGRB 1MGQA 2DXBA 1VQ4T 3RKYA 5CR2A 4J8OA 5DLQE 3PMTA 2DTHA 4P5NA 2OTLT 1KQ2A 1KC8U 2R5MA 2KVQG 3L2ZA 4A4KA 3G6ET 2XG8D 3RUXA 4MMKA 4PJOG 2XI9A 4J7FA 3FJPA 4C5HA 2AHJB 2VGMA 5AYFA 2HAXA 4M78E 3LWIA 3CCUA 4ATOA 4JLIA 3BFMA 3PGGA 1JJ2A 1PSEA 4CRIA 2LC4A 3MHXA 5C6SA 4JDSA 2X4YA 3V7CA 4PNOA 1V29B 2CZ1B 3CC2T 2L5QA 3SDZA 2JNGA 5I21A 3G71T 3MEAA 3CPWS 1KQSS 5C0MA 3WVDB 4NL2A 4IUPA 1YJ9T 1R8OB 1QVGS 2ZZDA 1LOJA 4M78D 5LJ5g 2MAMA 2VGNA 3V8KA 3FC3A 3RMQA 4ZGJB 1Q81U 2EJGA 1O9SA 2LT4A 2M16A 3EFRA 2MI6A 3OQ5A 4KBMB 3OMGA 3VUBA 4A4EA 2XK0A 5KE2A 4C5IA 3M5AA 3JCMJ 3A5ZB 3JCMW 4L59A 3X28B 2QDYB 4NOYA 4BD3A 1YIJA 4M7DG 2EJFA 3I56T 2EQMA 2K4YA 1YJWA 3RERA 4F7UB 3V8JA 2LVMA 4QQ6A 2RM4A 4GY5A 4RCCA 4J6YA 1QW1A 2DPPB 2E65A 2FB7A 1Y07A 3JCMd 3CC4A 2GF7A 5CIUA 3O8VA 4C0DC 3RMSA 1OYXA 3JCMb 3GPLA 2OTLA 4F7UG 5GAMf 3GF5A 3X24B 5KCHA 2ZPHB 5LJ3h 3C95A 2F5TX 2DIGA 5CKHA 1YJNA 3JB9G 3PFSA 3BDUA 4QVDA 3FIFA 3JCMg 3QO3A 2ZPGB 1K8AC 3PIOA 2DJZA 1UGQB 5HK0A 5CVIA 1DJ7B 5A0GA 2KK4A 4FSXA 4M75E 4F7UA 3L2UA 2QQAA 4JS5A 1W4SA 4NS5A 2CZ0B 4PJOB 1OI1A 3AHUA 3HKSA 1WJSA 5I2MA 3OMCA 2MWPA 4YTLA 2RJEA 3CCQT 1M9SA 3PTAA 2VXEA 4BE0A 4FL6A 5M9OA 3NFCA 3DKMA 3M58A 3CCSA 5GAOr 2CS7A 2XICA 1AHJB 2QEXA 5HKCA 4DA4A 1JBMA 4C8QG 2JTFA 4LDWA 3CCVA 3A8GB 3LYIA 3ER0A 3UWNA 3CCVT 3CPFA 3J7AF 5GANg 5L8RE 1WGSA 4ZGEB 1YIJT 4PJOA 2Y4XA 2VYTA 3GNGA 3ZEHA 2D9TA 2O4XB 1BI3A 4BY6C 1VQ6T 1M8VA 1VIFA 4LDUA 2RHIA 3QSUA 4MDXA 2P0PA 3META 3L1AA 4M77C 4E7KA 2G3RA 2WSCE 3LGLA 4C8QE 3M4YA 3VU3C 1VQPA 1YHQT 1D3BA 3A8MB 5GAMg 2ZPFB 5GANd 4QQDA 1JRIA 1H3ZA 5FROA 4CI0C 2RHUA 5FU7B 5GAN3 3QJ6A 1YITT 4RG2A 3HFOA 4PKCC 1YJNT 3PNWC 3C12A 2X4XA 1XTDA 4JRIA 2DIQA 3CCUT 3SWNB 3CCST 4E7HA 1VQKA 4C8QD 5HK3A 4OP0A 1X75C 1I4K1 2O4XA 5FRNA 1VQ5A 2EKOA 2ZPIB 5GMKe 2E10A 3WVEB 5CKDA 5GAN7 5GMKl 1TH7A 4QVCA 3HP9A 4M7AF 1NJIC 3HRUA 4PJOF 4XTYA 4XTWA 4M7DA 2E12A 2XDPA 1LJOA 2RI2A 1VQ8A 4WF2A 3SWNA 3OSSC 4FM4B 5LJ3j 2K2VA 2F5KA 1VQOT 2GFAA 2M9UA 3OA6A 4EMKA 2E70A 4A4GA 5GAMe 4E7JA 4UC4A 3M56A 3VKIA 4MZPA 4PL6A 4BB7A 3BY7A 3MO8A 5FU6C 2NLUA 4E7IA 4F7UF 2DZ9A 2DXTA 2OAUA 3G71A 2FHDA 4HCBA 3SD4A 1M1KC 1VQ6A 4TVRA 3QDRB 1VQNT 2XU8A 2P0QA 5LJ3f 4EMGA 3L2VA 4EDUA 5LJ5h 4FT4A 4M78F 3GLXA 3LLRA 3T9NA 4EMKB 3NTKA 3QJYA 4XQ3A 1ZHIA 2MMPA 3ASKA 5LJ5d 2K57A 2ZCFB 2RD1A 3HPWA 3OS0A 3CMET 1BIBA 4XTXA 3QKJA 4BI4A 1NE8A 3CBPA 3R6OA 3TREA 4BACA 4M75C 2R57A 5LJ5j 3JCMe 3S3OA 1K73U 2EAYA 2EQKA 2LQ8A 3CCQA 2RB6A 4NL3A 2LT1A 3ZBDA 5D6WA 3PIPA 2RI5A 4E47A 5DLOA 1VQ8T 2RJDA 1QVGA 3QBYA 2FL7A 4QW2A 3PMIA 1VQ4A 4C0ZA 1RI0A 1YI2A 3CD6T 3MP1A 3OYAA 2M1HA 3CXCA 1UEBA 4IUTA 1VQLT 3M59A 4J83A 1NPRA 5GANf 2DD4A 2D0QB 2RJCA 3PT9A 2XIDA 5DY9A 4B9WA 5GMKj 3L2RA 3DB3A 3RESA 1VQNA 2X35A 4EMKC 1KC8C 4FIBA 4OB1B 4OMFB 4C92B 3CBOA 2R58A 1VQPT 1K73C 4EPCA 1XNIA 2E41A 1VQKT 1XOVA 2V8KA 1BYMA 4J6XA 3URGA 1KHCA 4XTUA 3E1SA 4JRPA 1IZ6A 1ZQ1A 3V7SA 4PLLA 3P8HA 1JB0E 5CK9A 5I2SA 3CCET 4KUDK 3JB9J 5LJ3g 2EYQA 5GAMj 2XDBA 4DOWA 3A8LB 1K9MC 4M7AG 2VXFA 4OB2B 4JRKA 4L5GA 2YRVA 4EMHA 1VUBA 4R55A 4C92A 1KD1U 3MEUA 3MP6A 4IKFA 4MMLA 3C94A 4HKEA 3RIRA 3L42A 4II1A 3UT1A 3QYHB 4C5EA 3ME9A 4ME7A 1IREB 1YJ9A 3WXMB 4ELYC 2DK3A 2DXCA 2RK2A 3I55A 4C92C 4KT0E 4M77D 1UB4A 4BI8B 1M90U 2RH2A 1KQ1A 3JCMh 3J81E 3OYEA 4HT9A 2LRQA 2QI2A 3NTIA 1KHIA 2Y90A 3HFNA 4A53A 3V7RA 2GFUA 1I5LA 4PLIA 4LDYA 4OVAA 1U1TA 4C0GA 3LWHA 2E1HA 2M0OA 2DKGA 1D3BB 3X20B 1Q86C 3OYDA 1NPPA 4MZMA 5KCOA 3OYKA 2XD0A 2QQ9A 1M1GA 4FT2A 1BI0A 2L89A 4MZTA 5GAOq 2IVWA 3SB2A 5D6XA 1LNXA 1WPYA 2LQKA 3CMAA 1W2BA 2X4JA 2ZPEB 3OYGA 2Y4YA 1N27A 1QVPA 1S72A 4RMOA 3JAME 2KMTA 1VQMA 2PUOB 2OTJA 4M7AB 3FEOA 4L6V5 2H3JA 2ZPBB 1N9SA 3QZ9B 4M7DC 2K3YA 4VUBA 3RKXA 3OYCA 3JCMP 4M77G 4R56A 2YLCA 5A2QE 3OYLA 2EFIA 1Q82C 2WSFE 1Q86U 4KUIA 4M7DB 5IAYA 2HD0A 2E5QA 2QTXA 2QEXT 2PU9B 1SSFA 4BE2A 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  3V8L A;  4M75 A;  5LJ3 f;  4EMG A;  5GAO l;  2ZGW A;  2FYK A;  4M78 A;  4C92 D;  3JCM W;  5LJ5 h;  3JCM J;  4M78 F;  2CGH A;  4NOY A;  3JB9 D;  4M7A A;  2DVE A;  4XQ3 A;  4XU0 A;  2EJF A;  4M75 F;  4C8Q B;  4EMK B;  5LJ5 d;  2K57 A;  5GAN h;  2RD1 A;  5GAO m;  3RER A;  4N0A C;  3V8J A;  1BIB A;  4XTX A;  4F7U B;  5LJ5 e;  4XU1 A;  5GAN 8;  2RM4 A;  1Y96 B;  4RCC A;  5GAN 2;  1HXD A;  4M75 C;  4J6Y A;  2E65 A;  2FB7 A;  3JCM d;  5LJ5 j;  3JCM e;  2I2L A;  5GMK i;  2EWN A;  2EAY A;  3EFS A;  1WQ7 A;  5GAN j;  2RB6 A;  1WQW A;  2DZ9 A;  4NL3 A;  4N0A A;  1B34 A;  3QUI A;  4M77 A;  3JCM b;  4F7U G;  5GAM f;  5GMK h;  4C8Q A;  4XTZ A;  3M4G A;  3JCM c;  2YHT A;  4M78 C;  3RKW A;  5LJ3 h;  5GAM d;  2DTI A;  4C92 G;  3JB9 G;  4X9D A;  3BDU A;  4M7D F;  5LJ5 f;  3SWN C;  1HK9 A;  4QVD A;  3FIF A;  3JCM g;  3QO3 A;  4M78 B;  4C92 E;  5GAN f;  2DJZ A;  1U1S A;  4Y91 A;  5DY9 A;  3GIB A;  5GMK j;  1M5Q 1;  4F7U A;  4M75 E;  3RES A;  1B34 B;  4M77 B;  4EMK C;  4PJO B;  3AHU A;  4M77 F;  4C92 B;  1I81 A;  4XU2 A;  2E41 A;  2DEQ A;  4J6X A;  3HSB A;  4J5Y A;  4XTU A;  2VXE A;  3JB9 H;  4M77 E;  3V7S A;  5GAO r;  4C8Q C;  3JCM V;  1JBM A;  4C8Q G;  3JB9 J;  1H64 1;  5LJ3 g;  5GAM j;  5GAO n;  2JN0 A;  4JUV A;  3JCM f;  4RCB A;  4M7A G;  2VXF A;  3FB9 A;  5CAI A;  5GAN g;  4JRK A;  5GMK m;  4EMH A;  4HT8 A;  4PJO A;  4X9C A;  2YLB A;  1I8F A;  4C92 A;  4M7D E;  2VC8 A;  4HA8 A;  4J6W A;  1M8V A;  4F7U E;  4MML A;  5LJ3 e;  3QSU A;  4M75 D;  3RIR A;  4M77 C;  3L1A A;  4XU3 A;  4PJO D;  4M7A D;  4C92 F;  4DQ2 A;  2EJ9 A;  3JB9 F;  4M7A C;  4C8Q E;  5LJ3 d;  5GAM h;  3VU3 C;  2E64 A;  1D3B A;  2DZC A;  5GAN e;  5GAM g;  5GAN d;  5GAN 5;  1JRI A;  1YCY A;  4C92 C;  4M77 D;  4PJO C;  4C8Q F;  1MGQ A;  3JB9 I;  4HT9 A;  3RKY A;  1KQ1 A;  3JCM h;  5GAN 3;  3HFO A;  2Y90 A;  3HFN A;  3BW1 A;  3V7R A;  4A53 A;  1I5L A;  2DTH A;  4JRI A;  2RA2 A;  3JCM Q;  1KQ2 A;  3SWN B;  1U1T A;  3L2Z A;  4C8Q D;  2E1H A;  4M7D D;  4OP0 A;  2DKG A;  2DTO A;  1D3B B;  1I4K 1;  4MMK A;  3RUX A;  3JCM X;  5GMK e;  4PJO G;  2E10 A;  5GAO q;  4M75 B;  1WNL A;  3FJP A;  3SB2 A;  1LNX A;  1WPY A;  3INZ A;  5GAN 7;  1N9R A;  2DXU A;  4M78 E;  1TH7 A;  4QVC A;  5GMK l;  5GAO p;  4M7A F;  4PJO E;  4PJO F;  4M7A E;  4XTY A;  4XTW A;  4JLI A;  4A54 A;  4M7D A;  4M78 G;  3BFM A;  3PGG A;  5GAN 4;  4V2S A;  4M75 G;  1LJO A;  2HNI A;  4WF2 A;  4M7D G;  1Y96 A;  3SWN A;  3V7C A;  4PNO A;  5LJ3 j;  5GAN 6;  3QHS A;  4M7A B;  5I21 A;  4EMK A;  1N9S A;  5GAM e;  4M7D C;  4NL2 A;  3RKX A;  3JCM P;  4M77 G;  1LOJ A;  2YLC A;  4M78 D;  4XTV A;  5LJ5 g;  3V8K A;  3BY7 A;  4M7D B;  2EJG A;  2QTX A;  3EFR A;  4F7U F;  2DXT A;  1X01 A; 
#chains in the Genus database with same CATH topology
 1XJW B;  1YJ9 Q;  5CKF A;  2DVE A;  1VQP Q;  3F70 A;  2L0A A;  2DIL A;  2V8J A;  4J9H A;  3HL8 A;  4LDV A;  1V1C A;  2EIF A;  4LUD A;  3EG9 A;  1RL2 A;  3X26 B;  1BK2 A;  4XTZ A;  4DBH A;  3S3M A;  2K5L A;  1G5V A;  1G3S A;  2KDS A;  1ZSG A;  5IHN A;  4F14 A;  2DL3 A;  1ABO A;  4BDY A;  2DYI A;  1OZ3 A;  1I0C A;  4HVW A;  3CC7 T;  2VWF A;  2GCX A;  2J6O A;  2DEU A;  2OJ2 A;  4JRQ A;  1NYG A;  2KBT A;  3HSB A;  1OOT A;  4KGZ B;  2QXF A;  4KGV B;  2SRC A;  2GTO A;  2VV5 A;  4XAX B;  5GMK m;  3I5S A;  3VJP A;  3OS5 A;  4LD9 K;  2VC8 A;  3HRT A;  3OW2 S;  2EBP A;  4F17 A;  1WHK A;  1ZA1 B;  2KRN A;  1VQM Q;  2V8I A;  2O2O A;  1YBY A;  3G6E A;  2HQE A;  2WAC A;  4C5G A;  4Y28 E;  4N4G A;  2LTO A;  1OX9 A;  2PTK A;  4LE9 A;  1KQS A;  1WJQ A;  5HCK A;  4F16 A;  1Q7Y C;  3EAE A;  4M78 G;  1Y7X A;  4C0D B;  5IH2 A;  4RUG A;  3CCR A;  4M75 G;  5CKE A;  4FU6 A;  1S72 Q;  1M1K R;  1YI2 T;  1Q82 U;  2RQR A;  1D0Y A;  1BKB A;  1T3S A;  3CCJ Q;  4CC7 A;  1VQ9 A;  2AKK A;  3OYY A;  1JXO A;  3LX7 A;  2COZ A;  1BIA A;  2HQH A;  1AD5 A;  2RK1 A;  1YHQ A;  1U8R A;  1B7T A;  1ZLM A;  2I0N A;  2YUN A;  3G7Z A;  2QK0 A;  4OF1 A;  3SHW A;  1QWF A;  5CKB A;  4LN2 A;  1Q86 R;  2NWM A;  3M55 A;  3CC2 A;  1WQ7 A;  2DD5 A;  1OUL A;  2XHC A;  1G3W A;  2OAW A;  4ZTF A;  1G3Y A;  2PVD B;  4M78 C;  5IT9 E;  4IIM A;  4BI3 A;  1VOM A;  2DNU A;  5LJ5 f;  2EYW A;  3DLM A;  4BDZ A;  4E7Z A;  1M1K U;  4LDX A;  3GIB A;  1M2V A;  1B34 B;  5KYW A;  2L3Q A;  3KUF A;  3LGF A;  2KRO A;  4BY6 B;  3E9F A;  1EX4 A;  2YUO A;  1J3T A;  2OTJ T;  2EQJ A;  2QAS A;  5A0D A;  2XKO C;  3S6W A;  2KY9 A;  4HCZ A;  4X9C A;  1YWO A;  2DAQ A;  1WZO A;  3UDC A;  3CC2 Q;  4KH1 B;  1M2V B;  2A7Y A;  3P8D A;  1K8A U;  4M7A D;  1M4Z A;  4O5V A;  3GP8 A;  5LJ3 d;  2RO0 A;  3DLL A;  1NEG A;  2JUF A;  1X43 A;  1QP3 A;  3OS2 A;  3KXT A;  2DXB A;  4QKU A;  3RKY A;  4J9B A;  2ROL A;  2FZG B;  2K9G A;  5CR2 A;  5DLQ E;  2OTL T;  1ZSZ C;  1KC8 U;  3L2Z A;  2YT6 A;  2P84 A;  2HAX A;  4M78 E;  4ATO A;  1WX6 A;  1NLP C;  3PGG A;  2RNA A;  4JDS A;  2X4Y A;  4PNO A;  3CQT A;  2L5Q A;  3SDZ A;  1E6H A;  3MEA A;  4IUP A;  2CRE A;  1R8O B;  1IGQ A;  4ORZ A;  1Q81 U;  2EJG A;  4A4E A;  1JJ2 P;  4KBM B;  2DYB A;  4C5I A;  4D8D A;  1RAC B;  1Q82 R;  4F7U B;  2LVM A;  1MMG A;  2RM4 A;  4GY5 A;  4J6Y A;  3MPU B;  2GF7 A;  2JMC A;  5CIU A;  3O8V A;  1OYX A;  1K4U S;  2DVJ A;  3C95 A;  2F5T X;  3NGP A;  5CKH A;  3MKD A;  3FIF A;  1GL5 A;  3QO3 A;  3M0T A;  2ZPG B;  1K8A C;  5CVI A;  5A0G A;  4JPB W;  4F7U A;  2RQU A;  2CZ0 B;  1WJS A;  3CCQ T;  2VXE A;  1YCS B;  3DKM A;  3NFC A;  3M58 A;  4DA4 A;  4C8Q G;  2JTF A;  4LDW A;  3J7A F;  1YIJ T;  3GNG A;  1TOV A;  1VQ6 T;  1RAB B;  4LDU A;  2RHI A;  2FRW A;  2YXY A;  4M77 C;  1NEB A;  1TUC A;  2JXB A;  4E7K A;  2A28 A;  2G3R A;  3LGL A;  1H8K A;  2HDA A;  3VU3 C;  1VQP A;  2A0F B;  1YHQ T;  3EH1 A;  5GAN d;  4QQD A;  1WHH A;  4CI0 C;  5GAN 3;  3HFO A;  1FMW A;  3PNW C;  2X4X A;  1KFZ A;  1K73 R;  2JMA A;  4C8Q D;  5HK3 A;  1TXQ A;  3JV3 A;  2E10 A;  1AVZ C;  1AEY A;  3WVE B;  5CKD A;  3H41 A;  5GAN 7;  1TH7 A;  3HP9 A;  2E12 A;  1E7O A;  1G83 A;  1LJO A;  2XDP A;  4WF2 A;  2ROT A;  1WA7 A;  2FZK B;  5FU6 C;  4D8K A;  2DXT A;  4OMP A;  4HCB A;  2FHD A;  3SD4 A;  2DJQ A;  1PWT A;  4PK4 A;  5LJ5 d;  1AZG B;  2M02 A;  3HPW A;  4XTX A;  3QKJ A;  3R6O A;  4M75 C;  1Q81 R;  2IPO B;  5LJ5 j;  1SPK A;  3I55 Q;  2HL5 C;  1SHG A;  2EAY A;  2RB6 A;  2RF0 A;  2LT1 A;  1QVG A;  4QW2 A;  2FL7 A;  3PMI A;  2IIM A;  3TQ7 P;  1BU1 A;  1RI0 A;  3D7S B;  3CD6 T;  1U06 A;  3OYA A;  2EKH A;  3CXC A;  4J83 A;  1YJN Q;  3RBB B;  4RTU A;  2D0Q B;  3DB3 A;  3EG3 A;  4DBF A;  3RES A;  4OMF B;  3CBO A;  1XNI A;  2E41 A;  3AT1 B;  2V8K A;  4J6X A;  4XTU A;  1ZUU A;  1IZ6 A;  3P8H A;  1JB0 E;  5I2S A;  3A8L B;  4OB2 B;  4JRK A;  4R55 A;  2YRV A;  2FPE A;  1VUB A;  4EMH A;  3RDV A;  1MMA A;  1R0B G;  1M3A A;  4MML A;  2KT8 A;  3L42 A;  3UT1 A;  4C5E A;  3CCQ Q;  1GFC A;  3WXM B;  2K7A A;  1KIK A;  4C92 C;  1SG5 A;  5KYX A;  4M77 D;  2BZX A;  2RH2 A;  3OYE A;  2LRQ A;  3NTI A;  1AZE A;  2KXC A;  2Y90 A;  4A53 A;  3V7R A;  4PLI A;  4RTX A;  1T0J A;  2E1H A;  1VA7 A;  2DKG A;  3X20 B;  2NUP A;  1NPP A;  1QKW A;  4MZM A;  4ZNX A;  2XD0 A;  1M1G A;  5GAO q;  2EYY A;  4J9E A;  2G6F X;  3PVQ A;  1N27 A;  1QVP A;  2DMO A;  4AFU C;  3UA7 A;  2OTJ A;  4M7A B;  4GLM A;  1W2B P;  1PCX A;  4M77 G;  4PJN A;  5FW9 A;  2YLC A;  3HTR A;  3OYL A;  3I9Q A;  2WSF E;  4KUI A;  4M7D B;  5IAY A;  2HD0 A;  2L3S A;  2QTX A;  4BE2 A;  3R6N A;  3E19 A;  4M75 A;  2KSS A;  2EVR A;  3A8O B;  4M75 F;  3A98 A;  4N0A C;  3UA6 A;  2L3R A;  1RAD B;  4PFZ A;  2YWW A;  2E6Z A;  2FZC B;  1KSW A;  2I2L A;  1T3L A;  1PD1 A;  4HVU A;  2EQU A;  4GBQ A;  2IG0 A;  4E7L A;  4B9X A;  2EPD A;  3RKW A;  1XQH A;  2FPF A;  1UGP B;  3CCM T;  3CMA T;  1ARK A;  2KI7 A;  2KGT A;  4ZN1 A;  1N6A A;  1QKX A;  2DL7 A;  6AT1 B;  4M78 B;  3VS2 A;  3OYI A;  1M5Q 1;  1ACM B;  3PE0 A;  2BUD A;  2D8J A;  2J06 A;  4AFS C;  1KD1 C;  2EQI A;  3TCJ A;  4OB3 B;  1SKU B;  1VQN Q;  4M77 E;  4RTV A;  1ABQ A;  1YFN A;  1ZX6 A;  1W2B S;  2L3P A;  2JN0 A;  2RQW A;  3EG1 A;  1N8R C;  3FB9 A;  1MV3 A;  3M54 A;  2PVO B;  4IUQ A;  2YLB A;  2ABL A;  2QA4 Q;  2OX7 A;  3KFV A;  3OYB A;  2JM8 A;  1WFW A;  4C92 F;  2RHY A;  3SEM A;  3NMZ C;  1UGV A;  4HVV A;  2CP7 A;  3OYJ A;  1MV0 B;  4XK8 E;  1AWJ A;  4ZGD B;  3QII A;  3UF4 A;  4JJN K;  1TTH B;  2K5F A;  2PVG B;  5CQY A;  1BI2 A;  1VQ5 T;  1WNL A;  3OYF A;  3CD6 A;  4PJO E;  2C0I A;  2HQX A;  2VKN A;  4J7I A;  5GAN 4;  2CKK A;  2O31 A;  2HNI A;  3MEV A;  2CZ6 B;  3QPH A;  5A0L A;  4OGE A;  3QHS A;  5FLX E;  1Y71 A;  3CC4 T;  2V1R A;  5J39 A;  4DOV A;  2M51 A;  1X01 A;  2K5I A;  3QZ5 B;  2LP5 A;  2FYK A;  4M78 A;  4C92 D;  2FPD A;  2CH4 W;  4IUV A;  5GAN h;  1S72 T;  5IN1 A;  4LUE A;  2NUZ A;  3CEY A;  5GAN 8;  3CCE A;  3LW5 E;  4IIO A;  1FX7 A;  3ZFJ A;  2LCL A;  2K3X A;  5GAN j;  1VQ7 T;  1X2Q A;  1C6V X;  2JOY A;  3HRS A;  3FDR A;  4N0A A;  5J26 A;  4ELZ C;  2QQR A;  3QUI A;  3CD6 Q;  1X6O A;  3M4G A;  4FSS A;  4ZN3 A;  2CP6 A;  4N4I A;  1SRL A;  1KJW A;  1HK9 A;  3VV0 A;  3OYM A;  3CPW P;  1HYO A;  3I55 T;  3Q1J A;  3EG9 B;  4M77 F;  1AWO A;  2MF2 A;  5KE3 A;  4RG8 A;  2DEQ A;  2PUK B;  2QGG A;  4LD6 A;  1M90 C;  1M30 A;  3EG0 A;  1OPL A;  3QG1 A;  5D6Y A;  1Y0M A;  1PKT A;  2X4W A;  3CCE Q;  3M9Q A;  1ZBX A;  2GQV A;  2B86 A;  1AOJ A;  1K9M U;  4M7A C;  1YN8 A;  1QVF S;  2LJ3 A;  2E64 A;  5DM7 R;  2QQB A;  2MWO A;  1BBZ A;  4C8Q F;  4A4H A;  2RHX A;  3ULR B;  1UGR B;  5GJV B;  1Z9Q A;  4J8O A;  2DTH A;  3CCM Q;  4ESR A;  4A4K A;  2RN8 A;  4E7S A;  1ZUK A;  4PJO G;  3FJP A;  4C5H A;  2AHJ B;  2AK5 A;  3CCU A;  2DM1 A;  2LMJ A;  1JJ2 A;  2LC4 A;  2W10 A;  3MHX A;  3CME Q;  2EGE A;  3M0S A;  3V7C A;  2X51 A;  4K11 A;  2JNG A;  1KQS S;  4E2F B;  1ZA2 B;  2AZS A;  5FWB A;  4CC3 A;  3FC3 A;  2VGN A;  3V8K A;  4ZGJ B;  1K9M R;  5KE2 A;  2XK0 A;  2HCK A;  3A5Z B;  4M7D G;  1X27 A;  3V8J A;  4QQ6 A;  1D1A A;  2F2V A;  3JCM d;  1B3Q A;  1RAF B;  4C0D C;  4AT1 B;  1IRX A;  5EC7 A;  3GPL A;  1S1N A;  2PZ1 A;  3X24 B;  1MUZ A;  2ZPH B;  5KCH A;  1YJN A;  3JB9 G;  4JJB A;  2MIO A;  2X3X D;  1UGQ B;  1JU5 C;  1DJ7 B;  2K79 A;  5IXB A;  4M75 E;  3L2U A;  4JS5 A;  2MWP A;  2JJ9 A;  2RJE A;  2CS7 A;  2XIC A;  4FYX B;  3A8G B;  3UWN A;  5GAN g;  4PJO A;  4ZGE B;  3ZEH A;  3CC4 Q;  2QDL A;  2O4X B;  1BI3 A;  1VIF A;  2W0Z A;  3MJX A;  1ZBJ A;  2CP3 A;  4C8Q E;  1D3B A;  2ZPF B;  3VS4 A;  4RG2 A;  1YJN T;  3C12 A;  2DIQ A;  4HXJ A;  2LQN A;  5FRN A;  1YWP A;  1VQ5 A;  2EKO A;  5GMK e;  3O5Z A;  1TSF A;  3NPF A;  4PJO F;  4XTY A;  4M7D A;  2MPX C;  2CDT A;  1VQ8 A;  3SWN A;  4FM4 B;  2F5K A;  4EMK A;  1Z9Z A;  1H3H A;  5GAM e;  1NJI R;  1VYT A;  3M56 A;  3VKI A;  2CP5 A;  2E4H A;  4MZP A;  4BB7 A;  1RLP C;  1GCP A;  2DZ9 A;  1M2O A;  2OAU A;  2EGA A;  3QDR B;  2P0Q A;  5LJ3 f;  4EMG A;  4FT4 A;  4M78 F;  3NTK A;  1ZHI A;  3OS0 A;  3CME T;  2O9S A;  1X6G A;  4BI4 A;  1YNZ A;  3TRE A;  4BAC A;  2COY A;  1K73 U;  4RTY A;  1WYX A;  4NL3 A;  3ZBD A;  1UG1 A;  3THK A;  3PIP A;  4E47 A;  3EHR A;  2RJD A;  4PJL A;  3QBY A;  1D0X A;  5KYN A;  1YI2 A;  2CH4 A;  3M59 A;  1VQ7 Q;  3PT9 A;  1IO6 A;  1OPK A;  1JEG A;  3REA B;  1KK7 A;  4OB1 B;  4C92 B;  1YHQ Q;  2R58 A;  5KYY A;  1K73 C;  2YSQ A;  3E1S A;  1ZQ1 A;  1WXT A;  1RI9 A;  4PLL A;  5CK9 A;  3CCE T;  1OU8 A;  3EGD B;  2XDB A;  4M7A G;  4FYV B;  1KD1 U;  2OTJ Q;  1LVK A;  3MEU A;  2AKL A;  4II1 A;  4ME7 A;  1YJ9 A;  2CUB A;  1UE9 A;  2BE9 B;  2DK3 A;  2DXC A;  2RK2 A;  3I55 A;  1IXD A;  5KYU B;  1V76 A;  1M90 U;  3J81 E;  1X6B A;  1Q7Y R;  2GFU A;  1B07 A;  1Y57 A;  1VYV A;  5I11 A;  3OYD A;  5KCO A;  4FT2 A;  2L89 A;  1W2B A;  2Y4Y A;  4RMO A;  2LQW A;  3VS7 A;  3RKX A;  3OYC A;  3JCM P;  4R56 A;  1LCK A;  2EFI A;  1Q86 U;  2E5Q A;  2PU9 B;  2Z0W A;  3OBW A;  5IHI A;  5FU6 B;  3JB9 D;  3EGX A;  4M7A A;  3TSZ A;  2LNH B;  4XU1 A;  4MDW A;  3CC7 Q;  1HXD A;  2HEQ A;  5KYY B;  5GMK i;  1VQO A;  2CSQ A;  3G4S A;  2CP0 A;  2R5A A;  3EGX B;  3RNJ A;  3CMA Q;  4O6J A;  3JCM c;  3CCL A;  1W6X A;  2DTI A;  3CXC S;  4X9D A;  4JLG A;  4Z89 A;  3SWN C;  4JJD A;  1U1S A;  1OV3 A;  1FXX A;  1EIF A;  4QQG A;  2LNV A;  2DF6 A;  4OMO A;  3TU4 K;  4KUL A;  2GNC A;  3M0U A;  1C1A A;  1QWE A;  4OMM A;  1R0C B;  2A3L A;  2CT4 A;  5CO7 A;  4JZ3 A;  3VS1 A;  1K8A R;  3JCM V;  1GCQ A;  1H64 1;  3EG2 A;  5ECA A;  2E5K A;  4JUV A;  4RCB A;  3VS0 A;  2QA4 T;  2P0K A;  1C0M A;  1EFN A;  1WHG A;  2JTM A;  2QQS A;  3JRZ A;  3I35 A;  4PJM A;  3OBY A;  2HMA A;  3L2W A;  3CCJ A;  1SF9 A;  4F7U E;  1NBE B;  2RPN A;  4XU3 A;  2EJ9 A;  3L2Q A;  3EFO A;  5J3B A;  5GAM h;  1RAA B;  4Z02 A;  1YCY A;  3HHT B;  4PJO C;  1OEB A;  3ZL7 C;  4OGC A;  3CCM A;  3BW1 A;  2RA2 A;  2ENM A;  3MCA B;  3JCM Q;  1G2B A;  3M57 A;  2GBQ A;  2FG0 A;  5IHK A;  3INZ A;  1N9R A;  1M27 C;  3QYG B;  5CQX A;  4M7A E;  2GGR A;  4A54 A;  4JS4 A;  1U3O A;  2KE9 A;  3QWY A;  3DB4 A;  1K9A A;  2C06 A;  5KH6 A;  1M8M A;  4RKU E;  1G3T A;  1N8R R;  4J9F A;  3CCJ T;  2JZ2 A;  3NTH A;  2F2X A;  2HKQ B;  2ZGW A;  1WXU A;  3M53 A;  2CGH A;  2XDD A;  1NM7 A;  3FRN A;  4XU0 A;  1VQK Q;  1AT1 B;  1PM3 A;  2CT3 A;  2WSE E;  1IHW A;  3SFM A;  2YRC A;  1I1J A;  5LJ5 e;  1Y96 B;  2CUD A;  5FWC A;  1D09 B;  1Q81 C;  3MEW A;  4BUG A;  3QXE B;  3C0C A;  1B34 A;  1G8X A;  4PFP A;  5KYW B;  1SHF A;  5GMK h;  4C8Q A;  3OYN A;  3A8H B;  2DBM A;  1K0X A;  4M7D F;  2QA4 A;  1KQS P;  2DLP A;  3LH0 A;  1P92 A;  1VQL A;  1BI1 A;  3MP8 A;  2YUQ A;  1K76 A;  4X34 A;  2O01 E;  2RJF A;  1KG1 A;  1I81 A;  1JJ2 S;  1MMD A;  2LX9 A;  4BE1 A;  1VIE A;  4FW2 A;  3KBG A;  1HSQ A;  5GAO n;  3OS1 A;  3GNF B;  2ECZ A;  3P8B B;  5CAI A;  4HT8 A;  2B8A A;  2KRM A;  4HA8 A;  3CC7 A;  3OB9 A;  1LPL A;  2JVV A;  4N4H A;  2LDM A;  5CCA A;  3H6Z A;  2BIV A;  3FLG A;  2D1X A;  5L23 A;  3CBM A;  3H0H A;  2LCC A;  2JTE A;  1FMV A;  2E3I A;  1U5S A;  4P5N A;  2EGC A;  1TUD A;  2X9H A;  2XG8 D;  3RUX A;  4MMK A;  1RAI B;  2FEI A;  2AIR B;  2VGM A;  4FYW B;  3LWI A;  1OU9 A;  1CKA A;  4JLI A;  1PSE A;  1PD0 A;  1VQ6 Q;  1V29 B;  3CC2 T;  3CCR Q;  3G71 T;  3CPW S;  5C0M A;  3WVD B;  1YJ9 T;  2H3E B;  3RMQ A;  2MYS A;  2MI6 A;  3OMG A;  1ZUY A;  3M5A A;  1UTI A;  1JXM A;  1UUE A;  3JCM W;  2YRD A;  3X28 B;  2QDY B;  2C0O A;  4NOY A;  1PNJ A;  4BD3 A;  1YIJ A;  4JJC A;  4RCC A;  1QCN A;  1QW1 A;  1Y07 A;  4FW1 A;  3RMS A;  1GBR A;  2JT4 A;  3H0F A;  5GAM f;  3PFS A;  3BDU A;  4AFZ C;  4QVD A;  2RQV A;  1IGU A;  2KK4 A;  4FSX A;  2O9V A;  4OMQ A;  1JQQ A;  1HD3 A;  3I56 Q;  3HKS A;  1KD1 R;  1GFD A;  1M9S A;  3PTA A;  4FL6 A;  5I22 A;  3CCS A;  5GAO r;  1AHJ B;  1JBM A;  3CCV A;  4RTW A;  2RMO A;  3CCV T;  3CPF A;  1MNE A;  1WGS A;  2ED0 A;  2VYT A;  2D9T A;  1SRM A;  4MDX A;  2P0P A;  3MET A;  3L1A A;  4A63 B;  3M4Y A;  4Z88 A;  1UHC A;  1H3Z A;  1VQ5 Q;  4OML A;  2RHU A;  3QJ6 A;  1WHL A;  4B6M A;  1VQL Q;  2AT1 B;  4JRI A;  4PFO A;  4J9G A;  3CCS T;  3CCU T;  4PJJ A;  1X75 C;  2O4X A;  3CXC P;  5GJW B;  2BZ8 A;  1NJI C;  4XTW A;  3VS3 A;  2RI2 A;  2HZY A;  1D0Z A;  4AG1 C;  1HJD A;  5KYU A;  2HL3 A;  2C0T A;  2J05 A;  4Z8A A;  3OA6 A;  4UC4 A;  3QDF A;  2A37 A;  3MO8 A;  2KNB B;  2J6K A;  2NLU A;  1PC0 A;  4E7I A;  4F7U F;  3G71 A;  4TVR A;  1VQN T;  3L2V A;  5LJ5 h;  3GLX A;  3LLR A;  3T9N A;  4XQ3 A;  1RAG B;  3QJY A;  4R0K A;  1BIB A;  3CBP A;  2R57 A;  3JCM e;  2EQK A;  2LQ8 A;  3U23 A;  2BZY A;  2RI5 A;  5DLO A;  1VQ8 T;  1VQ4 A;  1K0S A;  3G6E Q;  3VRZ A;  3CCS Q;  2M1H A;  1WLP B;  1NPR A;  5GAN f;  2DD4 A;  3G1J A;  2DER A;  2RJC A;  4B9W A;  3L2R A;  2DRM A;  4E6R A;  1VQN A;  2X35 A;  1UDL A;  3G4S Q;  1KC8 C;  4FCY A;  4FIB A;  3I5R A;  4EPC A;  1BYM A;  1XOV A;  3URG A;  1KHC A;  4JRP A;  2ESW A;  3V7S A;  2QGF B;  3JB9 J;  2EYQ A;  1MND A;  2DBK A;  1K9M C;  4L5G A;  2D8H A;  4C92 A;  2YDL A;  1VQ9 Q;  2X3W D;  1BCM A;  3MP6 A;  2CP2 A;  3C94 A;  1AWX A;  2BTT A;  3QYH B;  1WHJ A;  1IRE B;  4ELY C;  4KT0 E;  1UB4 A;  2KYB A;  4HT9 A;  1KQ1 A;  3PVL A;  2QI2 A;  1KHI A;  2DL8 A;  3HFN A;  4C0G A;  4LDY A;  1U1T A;  3LWH A;  2M0O A;  3GBQ A;  4MZT A;  3M0R A;  1LNX A;  3CMA A;  2LQK A;  2X4J A;  1PHT A;  2E3H A;  4DBR A;  1WHM A;  2LJ1 A;  1VQM A;  3FEO A;  4L6V 5;  2H3J A;  1N9S A;  4M7D C;  2K3Y A;  4Y92 A;  2DFU A;  5A2Q E;  3VYG A;  2K2M A;  1MHN A;  5GAO l;  2EYX A;  2ZAE A;  3OSV A;  3CCR T;  3UPU A;  4M4Z A;  1NJI U;  1QVF A;  1Q7Y U;  1GXI E;  2HBP A;  2DE0 X;  4OMN A;  1UGS B;  4HCK A;  1RUW A;  2F69 A;  2MCN A;  1UJ0 A;  2CYZ B;  4C92 E;  4HCC A;  2NYS A;  2PQW A;  2RI3 A;  4Y91 A;  3TEE A;  2J7I A;  2D6F A;  3BE3 A;  3OW2 A;  2D0N A;  1I07 A;  3H9N A;  3OYH A;  1VQM T;  2L8D A;  1YIT A;  1IB8 A;  4XU2 A;  2P4T A;  4J5Y A;  1WDX A;  2DO3 A;  7AT1 B;  4C8Q C;  4C0F A;  4KRT A;  4OB0 B;  4EIK A;  8AT1 B;  2RHZ A;  1I8F A;  1RAH B;  1N5Z A;  2FVU A;  3J80 E;  2JS0 A;  5LJ3 e;  4DBQ A;  4AFQ C;  3VUZ A;  4DQ2 A;  1KC8 R;  5HY6 A;  1N8R U;  3GOX A;  1WXB A;  5GAN e;  2DZC A;  2A36 A;  3JSC A;  2AZV A;  4D6W A;  3JB9 I;  1YJW Q;  1NZ9 A;  1T0H A;  1QMC A;  1VQ7 A;  1OZ2 A;  2J6F A;  4DEY A;  4RTT A;  4M7D D;  1GBQ A;  2NUT B;  2DTO A;  3E9G A;  3JCM X;  4FYY B;  3CME A;  2CZ7 B;  4AG2 C;  3CPW A;  4M75 B;  2VUB A;  1QP2 A;  3H8Z A;  4GLK A;  2DXU A;  5GAO p;  1PSF A;  4KH0 B;  4ZTJ A;  3EFO B;  9ATC B;  1X69 A;  2K3B A;  2QTV A;  4V2S A;  2DRK A;  1Y96 A;  2E6N A;  1PRL C;  1NLO C;  8ATC B;  5GAN 6;  2A08 A;  1WJR A;  1BCO A;  1YIJ Q;  4XTV A;  2QEX Q;  2KYM A;  1O75 A;  4IUU A;  4WTO B;  1UHF A;  3V8L A;  4IUR A;  2BE7 D;  4C8Q B;  3VS6 A;  5GAO m;  3G4S T;  1UJY A;  2OI3 A;  4A4F A;  5GAN 2;  1FWZ A;  5LL6 S;  2EWN A;  4IKF A;  3CCL T;  3EFS A;  2BKD N;  1WQW A;  2RQT A;  2PNI A;  1PKS A;  2V1Q A;  4M77 A;  3OY9 A;  1QCF A;  4Q5W A;  2GTJ A;  4QVZ A;  1Q82 C;  2YHT A;  5GAM d;  5FU7 C;  1CSK A;  3VYH B;  4C92 G;  2CSI A;  3BDL A;  1M1F A;  3I56 A;  1YJW T;  2FO0 A;  2ED1 A;  3S3N A;  2KAF A;  1R77 A;  4M77 B;  4J9I A;  3X25 B;  1GRI A;  5EG2 A;  2DX1 A;  2HBW A;  1WIE A;  3JB9 H;  2VB6 A;  3C4S A;  1W1F A;  1QQJ A;  1BB9 A;  5FRM A;  2JS2 A;  1VQ9 T;  1M3B A;  3JCM f;  5D7U A;  3VS5 A;  1QCO A;  3REB B;  4M7D E;  2V26 A;  1VQO Q;  2MK5 A;  4J6W A;  2QAZ A;  3QWX X;  1E6G A;  4M75 D;  1FMK A;  2QYZ A;  3NHN A;  4PJO D;  3JB9 F;  1NYF A;  1X2K A;  3N5B B;  4J9C A;  2QG9 B;  3TSW A;  2KQW A;  3TVT A;  5GAN 5;  1VQ4 T;  1QVG P;  2O88 A;  1MGQ A;  2HKN A;  3CCU Q;  2KEA A;  2OTL Q;  3EHQ A;  1TWB A;  3PMT A;  1KQ2 A;  2R5M A;  2KVQ G;  3G6E T;  2LX7 A;  1VQ8 Q;  2XI9 A;  4J7F A;  5AYF A;  1Q95 G;  3M0Q A;  4RTZ A;  1MMN A;  3BFM A;  4CRI A;  4DEX A;  5C6S A;  2CZ1 B;  2EW3 A;  2P4R A;  5I21 A;  1TG0 A;  2LZ6 B;  4NL2 A;  1QVG S;  2JM9 A;  2ZZD A;  1LOJ A;  4M78 D;  5LJ5 g;  2MAM A;  3CCV Q;  1PRM C;  1O9S A;  2LT4 A;  2M16 A;  3EFR A;  3OQ5 A;  3VUB A;  1H92 A;  3UAT A;  1ZSZ A;  3OW2 P;  3JCM J;  4L59 A;  2EJF A;  3I56 T;  1OX8 A;  2EQM A;  2K4Y A;  1YJW A;  3RER A;  4CC2 A;  2GQI A;  2E65 A;  2DPP B;  2FB7 A;  3CC4 A;  1FYN A;  1ZSZ B;  3JCM b;  2OTL A;  4F7U G;  1SSH A;  3GF5 A;  4X1V A;  5LJ3 h;  2DIG A;  4LNP A;  3JCM g;  3CCL Q;  3PIO A;  2DJZ A;  5HK0 A;  1YIT Q;  1RLQ C;  2HSE B;  3H0I A;  2FRY A;  2QQA A;  1W4S A;  4NS5 A;  4PJO B;  1OI1 A;  3AHU A;  5I2M A;  3OMC A;  4YTL A;  1WI7 A;  3IQL A;  4WCI A;  2M0Y A;  4BE0 A;  2XMF A;  5M9O A;  2MOX A;  2K6D A;  2QEX A;  5HKC A;  4QT7 A;  2SEM A;  3LYI A;  3ER0 A;  4J9D A;  1TS9 A;  5L8R E;  2DET A;  1YP5 A;  2YUP A;  2Y4X A;  1K1Z A;  5KYX B;  1YI2 Q;  1TUG B;  3G71 Q;  1EZZ B;  2F2W A;  3E2U A;  1M90 R;  4BY6 C;  1M8V A;  3QSU A;  1W70 A;  2WSC E;  1RAE B;  2ATC B;  2NUP B;  3A8M B;  5GAM g;  1JRI A;  5FRO A;  4JZ4 A;  1UEC A;  5IXF A;  5FU7 B;  1YIT T;  4PKC C;  1XTD A;  3SWN B;  4E7H A;  4OP0 A;  1I4K 1;  2ZPI B;  1VQ4 Q;  1D1C A;  5GMK l;  4QVC A;  4M7A F;  3HRU A;  2L2P A;  3OSS C;  5LJ3 j;  2K2V A;  1VQO T;  2GFA A;  2M9U A;  2E70 A;  4A4G A;  4E7J A;  1TU0 B;  2F1L A;  3A1P A;  4PL6 A;  3BY7 A;  1VYU A;  1VQ6 A;  1M1K C;  2XU8 A;  1D1B A;  4EDU A;  3RR6 A;  4EMK B;  2MMP A;  3ASK A;  2K57 A;  1F1B B;  2RD1 A;  2ZCF B;  2DL4 A;  1NE8 A;  1PG5 B;  4ANJ A;  2KT1 A;  3S3O A;  3CCQ A;  5D6W A;  3EH2 A;  1SEM A;  2H8H A;  2VAS A;  4C0Z A;  4AMC A;  3MP1 A;  1UEB A;  4IUT A;  1CKB A;  1VQL T;  1UFF A;  5DY9 A;  2XID A;  5GMK j;  2LJ0 A;  2EYZ A;  1GCQ C;  4EMK C;  4LXC A;  1VQK A;  1VQP T;  1VQK T;  3EGU A;  2VVK A;  3M0P A;  4CC4 B;  1JO8 A;  4KUD K;  5LJ3 g;  5GAM j;  3FJ5 A;  4DOW A;  2VXF A;  2JW4 A;  2COW A;  1QLY A;  1M3C A;  4HKE A;  3RIR A;  1NG2 A;  2DA9 A;  3ME9 A;  5AT1 B;  4KGX B;  4BI8 B;  3JCM h;  3EGD A;  1I5L A;  2KR3 A;  2HSP A;  2KRS A;  4OVA A;  3VRY A;  1Q86 C;  1D3B B;  1AWW A;  1A0N B;  1QVF P;  3OYK A;  2QQ9 A;  4F04 B;  1BI0 A;  1IHV A;  2IVW A;  3SB2 A;  5D6X A;  1WPY A;  1OQK A;  2ZPE B;  3OYG A;  2KXD A;  1S72 A;  3LH5 A;  3JAM E;  2KMT A;  2PUO B;  2ZPB B;  1I5O B;  2DL5 A;  3QZ9 B;  4VUB A;  2NUT A;  2LCS A;  2QEX T;  1SSF A; 
#chains in the Genus database with same CATH homology
 1MHN A;  3E19 A;  4M75 A;  5FU6 B;  5GAO l;  3JB9 D;  4M7A A;  2KSS A;  5CKF A;  3A8O B;  2DVE A;  3OSV A;  4M75 F;  3F70 A;  3CCR T;  3UPU A;  1NJI U;  4N0A C;  1QVF A;  2L3R A;  1Q7Y U;  4XU1 A;  2V8J A;  4MDW A;  1GXI E;  1HXD A;  3HL8 A;  2E6Z A;  4LDV A;  2I2L A;  5GMK i;  2HBP A;  1VQO A;  2EQU A;  2EIF A;  3G4S A;  1UGS B;  2R5A A;  1RL2 A;  4O6J A;  3X26 B;  2IG0 A;  4XTZ A;  4E7L A;  3JCM c;  4B9X A;  3S3M A;  2K5L A;  3CCL A;  3RKW A;  1G5V A;  1XQH A;  1G3S A;  1UGP B;  2DTI A;  3CXC S;  3CCM T;  2KDS A;  4X9D A;  3CMA T;  4JLG A;  4ZN1 A;  1N6A A;  3SWN C;  2F69 A;  4M78 B;  2CYZ B;  4C92 E;  3OYI A;  4HCC A;  4BDY A;  1OZ3 A;  2PQW A;  1U1S A;  2RI3 A;  4Y91 A;  3TEE A;  1FXX A;  1M5Q 1;  3CC7 T;  2D6F A;  1EIF A;  3OW2 A;  4QQG A;  2LNV A;  3OYH A;  2BUD A;  4KUL A;  2L8D A;  3TU4 K;  2GCX A;  1VQM T;  1YIT A;  1KD1 C;  4XU2 A;  3TCJ A;  2P4T A;  4OB3 B;  4JRQ A;  2A3L A;  3HSB A;  4J5Y A;  4M77 E;  2QXF A;  2DO3 A;  5CO7 A;  4C8Q C;  3JCM V;  1W2B S;  1H64 1;  2VV5 A;  4C0F A;  2JN0 A;  4JUV A;  1N8R C;  4RCB A;  4XAX B;  4OB0 B;  3FB9 A;  2QA4 T;  2P0K A;  5GMK m;  3M54 A;  2RHZ A;  2PVO B;  4IUQ A;  1I8F A;  2QQS A;  2JTM A;  2YLB A;  3JRZ A;  3OS5 A;  3VJP A;  4LD9 K;  2VC8 A;  3OBY A;  3L2W A;  2FVU A;  3CCJ A;  3J80 E;  4F7U E;  5LJ3 e;  3CCL T;  3HRT A;  3OYB A;  3OW2 S;  3VUZ A;  4XU3 A;  4C92 F;  4DQ2 A;  2EJ9 A;  5HY6 A;  3L2Q A;  1N8R U;  3CD6 A;  3GOX A;  5J3B A;  5GAM h;  4Z02 A;  2RHY A;  2DZC A;  5GAN e;  1YCY A;  3HHT B;  4PJO C;  2V8I A;  3JSC A;  3OYJ A;  4D6W A;  1YBY A;  3JB9 I;  3G6E A;  3CC2 A;  4OGC A;  4XK8 E;  3CCM A;  1NZ9 A;  4ZGD B;  2HQE A;  2WAC A;  3QII A;  4C5G A;  1VQ7 A;  3BW1 A;  4JJN K;  1OZ2 A;  4N4G A;  2K5F A;  2RA2 A;  3MCA B;  2LTO A;  2PVG B;  4Y28 E;  3JCM Q;  4M7D D;  3M57 A;  2DTO A;  3E9G A;  5CQY A;  3JCM X;  3CME A;  2CZ7 B;  1BI2 A;  3CPW A;  1KQS A;  1VQ5 T;  4M75 B;  1WJQ A;  1WNL A;  1QP2 A;  2VUB A;  3H8Z A;  4GLK A;  3INZ A;  3OYF A;  1N9R A;  2DXU A;  3VYG A;  3QYG B;  5GAO p;  1PSF A;  4PJO E;  5CQX A;  4ZTJ A;  4M7A E;  1Q7Y C;  4A54 A;  3EAE A;  4M78 G;  1Y7X A;  2HQX A;  4J7I A;  4C0D B;  5GAN 4;  2CKK A;  4M75 G;  3CCR A;  4JS4 A;  2HNI A;  3MEV A;  4V2S A;  1Y96 A;  2CZ6 B;  3QPH A;  2E6N A;  5A0L A;  5CKE A;  4OGE A;  4FU6 A;  3QHS A;  5GAN 6;  5FLX E;  1Y71 A;  3DB4 A;  3CC4 T;  1YI2 T;  1Q82 U;  1WJR A;  5J39 A;  4DOV A;  2C06 A;  4XTV A;  5KH6 A;  1BKB A;  4RKU E;  1VQ9 A;  1G3T A;  3OYY A;  1O75 A;  3CCJ T;  4IUU A;  2JZ2 A;  2K5I A;  1X01 A;  3LX7 A;  3NTH A;  3QZ5 B;  1BIA A;  3V8L A;  4IUR A;  2ZGW A;  2FYK A;  4M78 A;  2RK1 A;  3M53 A;  4C92 D;  2CGH A;  2XDD A;  3FRN A;  1YHQ A;  4XU0 A;  4IUV A;  1U8R A;  2WSE E;  4C8Q B;  5GAN h;  1S72 T;  5IN1 A;  5GAO m;  3SFM A;  3G7Z A;  3G4S T;  4OF1 A;  3CEY A;  5CKB A;  5LJ5 e;  5GAN 8;  3CCE A;  1Y96 B;  4A4F A;  5GAN 2;  1FWZ A;  5LL6 S;  3LW5 E;  3M55 A;  2EWN A;  1Q81 C;  3MEW A;  3EFS A;  1FX7 A;  1WQ7 A;  2LCL A;  2K3X A;  3ZFJ A;  2BKD N;  1WQW A;  4BUG A;  5GAN j;  1VQ7 T;  2DD5 A;  2XHC A;  1G3W A;  2JOY A;  3HRS A;  3FDR A;  3QXE B;  4N0A A;  5J26 A;  4ELZ C;  1B34 A;  2QQR A;  3QUI A;  1X6O A;  4M77 A;  3OY9 A;  4ZTF A;  1G3Y A;  5GMK h;  4C8Q A;  4Q5W A;  3M4G A;  2PVD B;  4QVZ A;  4ZN3 A;  2YHT A;  3A8H B;  4M78 C;  5GAM d;  4BI3 A;  5FU7 C;  3OYN A;  5IT9 E;  3VYH B;  4C92 G;  4N4I A;  4M7D F;  5LJ5 f;  3VV0 A;  1HK9 A;  3OYM A;  3LH0 A;  1P92 A;  3BDL A;  3DLM A;  2QA4 A;  1VQL A;  1M1F A;  3I56 A;  1BI1 A;  3MP8 A;  4BDZ A;  1YJW T;  3S3N A;  3I55 T;  1M1K U;  4LDX A;  3Q1J A;  2KAF A;  3GIB A;  4X34 A;  1B34 B;  4M77 B;  3KUF A;  3LGF A;  3X25 B;  4M77 F;  2O01 E;  2RJF A;  1KG1 A;  1I81 A;  5EG2 A;  2MF2 A;  5KE3 A;  4BY6 B;  1JJ2 S;  4RG8 A;  3E9F A;  2DEQ A;  2PUK B;  3JB9 H;  4LD6 A;  3C4S A;  1M90 C;  2LX9 A;  4BE1 A;  1VIE A;  5FRM A;  3KBG A;  1VQ9 T;  5GAO n;  2OTJ T;  3OS1 A;  2EQJ A;  3GNF B;  3JCM f;  5A0D A;  2XKO C;  3P8B B;  5CAI A;  3S6W A;  4HT8 A;  2KY9 A;  4HCZ A;  4X9C A;  3QG1 A;  2DAQ A;  4M7D E;  2B8A A;  5D6Y A;  3UDC A;  2X4W A;  4HA8 A;  4J6W A;  3CC7 A;  3OB9 A;  3M9Q A;  1ZBX A;  2A7Y A;  3P8D A;  2GQV A;  4M75 D;  2JVV A;  1K8A U;  4PJO D;  4N4H A;  2LDM A;  3JB9 F;  1K9M U;  4M7A D;  1M4Z A;  4O5V A;  3GP8 A;  4M7A C;  5LJ3 d;  5CCA A;  1QVF S;  2RO0 A;  3DLL A;  3H6Z A;  2E64 A;  2BIV A;  2QQB A;  3FLG A;  3N5B B;  5DM7 R;  2KQW A;  2JUF A;  5GAN 5;  1QP3 A;  2MWO A;  3CBM A;  3OS2 A;  2LCC A;  4A4H A;  4C8Q F;  2RHX A;  3KXT A;  1UGR B;  1MGQ A;  2DXB A;  1VQ4 T;  3RKY A;  5CR2 A;  4J8O A;  5DLQ E;  3PMT A;  2DTH A;  4P5N A;  2OTL T;  1KQ2 A;  1KC8 U;  2R5M A;  2KVQ G;  3L2Z A;  4A4K A;  3G6E T;  2XG8 D;  3RUX A;  4MMK A;  4PJO G;  2XI9 A;  4J7F A;  3FJP A;  4C5H A;  2AHJ B;  2VGM A;  5AYF A;  2HAX A;  4M78 E;  3LWI A;  3CCU A;  4ATO A;  4JLI A;  3BFM A;  3PGG A;  1JJ2 A;  1PSE A;  4CRI A;  2LC4 A;  3MHX A;  5C6S A;  4JDS A;  2X4Y A;  3V7C A;  4PNO A;  1V29 B;  2CZ1 B;  3CC2 T;  2L5Q A;  3SDZ A;  2JNG A;  5I21 A;  3G71 T;  3MEA A;  3CPW S;  1KQS S;  5C0M A;  3WVD B;  4NL2 A;  4IUP A;  1YJ9 T;  1R8O B;  1QVG S;  2ZZD A;  1LOJ A;  4M78 D;  5LJ5 g;  2MAM A;  2VGN A;  3V8K A;  3FC3 A;  3RMQ A;  4ZGJ B;  1Q81 U;  2EJG A;  1O9S A;  2LT4 A;  2M16 A;  3EFR A;  2MI6 A;  3OQ5 A;  4KBM B;  3OMG A;  3VUB A;  4A4E A;  2XK0 A;  5KE2 A;  4C5I A;  3M5A A;  3JCM J;  3A5Z B;  3JCM W;  4L59 A;  3X28 B;  2QDY B;  4NOY A;  4BD3 A;  1YIJ A;  4M7D G;  2EJF A;  3I56 T;  2EQM A;  2K4Y A;  1YJW A;  3RER A;  4F7U B;  3V8J A;  2LVM A;  4QQ6 A;  2RM4 A;  4GY5 A;  4RCC A;  4J6Y A;  1QW1 A;  2DPP B;  2E65 A;  2FB7 A;  1Y07 A;  3JCM d;  3CC4 A;  2GF7 A;  5CIU A;  3O8V A;  4C0D C;  3RMS A;  1OYX A;  3JCM b;  3GPL A;  2OTL A;  4F7U G;  5GAM f;  3GF5 A;  3X24 B;  5KCH A;  2ZPH B;  5LJ3 h;  3C95 A;  2F5T X;  2DIG A;  5CKH A;  1YJN A;  3JB9 G;  3PFS A;  3BDU A;  4QVD A;  3FIF A;  3JCM g;  3QO3 A;  2ZPG B;  1K8A C;  3PIO A;  2DJZ A;  1UGQ B;  5HK0 A;  5CVI A;  1DJ7 B;  5A0G A;  2KK4 A;  4FSX A;  4M75 E;  4F7U A;  3L2U A;  2QQA A;  4JS5 A;  1W4S A;  4NS5 A;  2CZ0 B;  4PJO B;  1OI1 A;  3AHU A;  3HKS A;  1WJS A;  5I2M A;  3OMC A;  2MWP A;  4YTL A;  2RJE A;  3CCQ T;  1M9S A;  3PTA A;  2VXE A;  4BE0 A;  4FL6 A;  5M9O A;  3NFC A;  3DKM A;  3M58 A;  3CCS A;  5GAO r;  2CS7 A;  2XIC A;  1AHJ B;  2QEX A;  5HKC A;  4DA4 A;  1JBM A;  4C8Q G;  2JTF A;  4LDW A;  3CCV A;  3A8G B;  3LYI A;  3ER0 A;  3UWN A;  3CCV T;  3CPF A;  3J7A F;  5GAN g;  5L8R E;  1WGS A;  4ZGE B;  1YIJ T;  4PJO A;  2Y4X A;  2VYT A;  3GNG A;  3ZEH A;  2D9T A;  2O4X B;  1BI3 A;  4BY6 C;  1VQ6 T;  1M8V A;  1VIF A;  4LDU A;  2RHI A;  3QSU A;  4MDX A;  2P0P A;  3MET A;  3L1A A;  4M77 C;  4E7K A;  2G3R A;  2WSC E;  3LGL A;  4C8Q E;  3M4Y A;  3VU3 C;  1VQP A;  1YHQ T;  1D3B A;  3A8M B;  5GAM g;  2ZPF B;  5GAN d;  4QQD A;  1JRI A;  1H3Z A;  5FRO A;  4CI0 C;  2RHU A;  5FU7 B;  5GAN 3;  3QJ6 A;  1YIT T;  4RG2 A;  3HFO A;  4PKC C;  1YJN T;  3PNW C;  3C12 A;  2X4X A;  1XTD A;  4JRI A;  2DIQ A;  3CCU T;  3SWN B;  3CCS T;  4E7H A;  1VQK A;  4C8Q D;  5HK3 A;  4OP0 A;  1X75 C;  1I4K 1;  2O4X A;  5FRN A;  1VQ5 A;  2EKO A;  2ZPI B;  5GMK e;  2E10 A;  3WVE B;  5CKD A;  5GAN 7;  5GMK l;  1TH7 A;  4QVC A;  3HP9 A;  4M7A F;  1NJI C;  3HRU A;  4PJO F;  4XTY A;  4XTW A;  4M7D A;  2E12 A;  2XDP A;  1LJO A;  2RI2 A;  1VQ8 A;  4WF2 A;  3SWN A;  3OSS C;  4FM4 B;  5LJ3 j;  2K2V A;  2F5K A;  1VQO T;  2GFA A;  2M9U A;  3OA6 A;  4EMK A;  2E70 A;  4A4G A;  5GAM e;  4E7J A;  4UC4 A;  3M56 A;  3VKI A;  4MZP A;  4PL6 A;  4BB7 A;  3BY7 A;  3MO8 A;  5FU6 C;  2NLU A;  4E7I A;  4F7U F;  2DZ9 A;  2DXT A;  2OAU A;  3G71 A;  2FHD A;  4HCB A;  3SD4 A;  1M1K C;  1VQ6 A;  4TVR A;  3QDR B;  1VQN T;  2XU8 A;  2P0Q A;  5LJ3 f;  4EMG A;  3L2V A;  4EDU A;  5LJ5 h;  4FT4 A;  4M78 F;  3GLX A;  3LLR A;  3T9N A;  4EMK B;  3NTK A;  3QJY A;  4XQ3 A;  1ZHI A;  2MMP A;  3ASK A;  5LJ5 d;  2K57 A;  2ZCF B;  2RD1 A;  3HPW A;  3OS0 A;  3CME T;  1BIB A;  4XTX A;  3QKJ A;  4BI4 A;  1NE8 A;  3CBP A;  3R6O A;  3TRE A;  4BAC A;  4M75 C;  2R57 A;  5LJ5 j;  3JCM e;  3S3O A;  1K73 U;  2EAY A;  2EQK A;  2LQ8 A;  3CCQ A;  2RB6 A;  4NL3 A;  2LT1 A;  3ZBD A;  5D6W A;  3PIP A;  2RI5 A;  4E47 A;  5DLO A;  1VQ8 T;  2RJD A;  1QVG A;  3QBY A;  2FL7 A;  4QW2 A;  3PMI A;  1VQ4 A;  4C0Z A;  1RI0 A;  1YI2 A;  3CD6 T;  3MP1 A;  3OYA A;  2M1H A;  3CXC A;  1UEB A;  4IUT A;  1VQL T;  3M59 A;  4J83 A;  1NPR A;  5GAN f;  2DD4 A;  2D0Q B;  2RJC A;  3PT9 A;  2XID A;  5DY9 A;  4B9W A;  5GMK j;  3L2R A;  3DB3 A;  3RES A;  1VQN A;  2X35 A;  4EMK C;  1KC8 C;  4FIB A;  4OB1 B;  4OMF B;  4C92 B;  3CBO A;  2R58 A;  1VQP T;  1K73 C;  4EPC A;  1XNI A;  2E41 A;  1VQK T;  1XOV A;  2V8K A;  1BYM A;  4J6X A;  3URG A;  1KHC A;  4XTU A;  3E1S A;  4JRP A;  1IZ6 A;  1ZQ1 A;  3V7S A;  4PLL A;  3P8H A;  1JB0 E;  5CK9 A;  5I2S A;  3CCE T;  4KUD K;  3JB9 J;  5LJ3 g;  2EYQ A;  5GAM j;  2XDB A;  4DOW A;  3A8L B;  1K9M C;  4M7A G;  2VXF A;  4OB2 B;  4JRK A;  4L5G A;  2YRV A;  4EMH A;  1VUB A;  4R55 A;  4C92 A;  1KD1 U;  3MEU A;  3MP6 A;  4IKF A;  4MML A;  3C94 A;  4HKE A;  3RIR A;  3L42 A;  4II1 A;  3UT1 A;  3QYH B;  4C5E A;  3ME9 A;  4ME7 A;  1IRE B;  1YJ9 A;  3WXM B;  4ELY C;  2DK3 A;  2DXC A;  2RK2 A;  3I55 A;  4C92 C;  4KT0 E;  4M77 D;  1UB4 A;  4BI8 B;  1M90 U;  2RH2 A;  1KQ1 A;  3JCM h;  3J81 E;  3OYE A;  4HT9 A;  2LRQ A;  2QI2 A;  3NTI A;  1KHI A;  2Y90 A;  3HFN A;  4A53 A;  3V7R A;  2GFU A;  1I5L A;  4PLI A;  4LDY A;  4OVA A;  1U1T A;  4C0G A;  3LWH A;  2E1H A;  2M0O A;  2DKG A;  1D3B B;  3X20 B;  1Q86 C;  3OYD A;  1NPP A;  4MZM A;  5KCO A;  3OYK A;  2XD0 A;  2QQ9 A;  1M1G A;  4FT2 A;  1BI0 A;  2L89 A;  4MZT A;  5GAO q;  2IVW A;  3SB2 A;  5D6X A;  1LNX A;  1WPY A;  2LQK A;  3CMA A;  1W2B A;  2X4J A;  2ZPE B;  3OYG A;  2Y4Y A;  1N27 A;  1QVP A;  1S72 A;  4RMO A;  3JAM E;  2KMT A;  1VQM A;  2PUO B;  2OTJ A;  4M7A B;  3FEO A;  4L6V 5;  2H3J A;  2ZPB B;  1N9S A;  3QZ9 B;  4M7D C;  2K3Y A;  4VUB A;  3RKX A;  3OYC A;  3JCM P;  4M77 G;  4R56 A;  2YLC A;  5A2Q E;  3OYL A;  2EFI A;  1Q82 C;  2WSF E;  1Q86 U;  4KUI A;  4M7D B;  5IAY A;  2HD0 A;  2E5Q A;  2QTX A;  2QEX T;  2PU9 B;  1SSF A;  4BE2 A;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...