4M75G

Crystal structure of lsm1-7 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
82
Chain Sequence
b'NLYFQGSMLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 82
sequence length 98
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75G00
3SWNA 4M77D 4C8QC 5GAN5 3FIFA 4M78D 5GANd 1LJOA 1LNXA 2VC8A 2DTHA 4JUVA 4A53A 1BIBA 1JBMA 4C8QA 3JB9D 5GAN8 4C92D 4X9CA 2YHTA 2E10A 2DXUA 5GMKj 1HXDA 4OP0A 4PJOF 3JCMc 5LJ5g 5LJ3g 1I8FA 5GANe 5CAIA 5GAOp 5I21A 3JB9J 2DJZA 4M77E 5GAN3 4J5YA 4M78E 5GANf 1N9SA 5LJ3h 4M7DG 2EJFA 1I5LA 4C92E 4M75F 5GMKm 2DXTA 3GIBA 1H641 5GAOm 2RA2A 1LOJA 1BIAA 1D3BA 4M7AD 4M7DC 1U1SA 1D3BB 2JN0A 4M77C 4MMKA 1YCYA 3RKXA 4M78C 3V8JA 4C8QG 5GMKh 5GAN4 1KQ2A 3BFMA 1TH7A 4M78A 4NOYA 3JCMb 2QTXA 5LJ5j 4NL3A 4M78B 2ZGWA 4Y91A 4WF2A 3RUXA 3HFNA 4C92A 3JB9I 1WQWA 4RCBA 2EWNA 4C92B 4F7UF 5GAMh 3L1AA 4M7AE 4M7DF 1I81A 1Y96A 3JCMJ 5GAMd 3JCMW 1Y96B 2DEQA 2E1HA 4EMKA 5GMKl 2HNIA 3VU3C 5GAOl 4EMKB 4C8QF 5GAMe 5GAN2 5LJ5h 4XTWA 4F7UG 2RM4A 4M77G 4M7AA 1HK9A 5GAMf 5LJ3d 3FB9A 4M78G 4M7AB 5LJ5d 5GAOn 2RB6A 4QVDA 3JCMV 4XTVA 3JB9G 1B34B 3INZA 2EJGA 2FYKA 3EFSA 4EMGA 1M5Q1 4XTZA 2DZ9A 1WNLA 2VXEA 2VXFA 3JCMX 3RIRA 2YLCA 5LJ5e 5LJ3e 5GAOq 3HSBA 4C92C 1WQ7A 4JRIA 5LJ3f 2YLBA 5LJ5f 4V2SA 4PJOD 3RKYA 1MGQA 1WPYA 4RCCA 4DQ2A 4M75B 1KQ1A 4J6YA 4M77F 4HA8A 3QHSA 4M78F 5GMKe 4J6WA 4HT8A 3M4GA 3BW1A 1U1TA 4M75D 4EMKC 3JB9H 3QSUA 4M7AG 3JCMg 3JB9F 2E64A 4C92F 2DTOA 3HFOA 4PJOE 4XTXA 4M7AC 4XTYA 3JCMh 4N0AA 2DKGA 4XTUA 5GANg 5GAN7 4PNOA 3BY7A 3JCMd 1N9RA 5GAOr 4M75E 4A54A 1B34A 2E65A 4PJOC 3RESA 4C92G 3PGGA 1M8VA 4X9DA 4HT9A 4M7DD 4XU2A 1I4K1 4PJOA 3AHUA 4J6XA 3SWNB 3JCMe 4XU3A 2K57A 4M7AF 3V8LA 3V7CA 4PJOB 5DY9A 3V7RA 2CGHA 4C8QB 1X01A 4M75C 3RKWA 3JCMf 5GMKi 3RERA 4XU0A 2E41A 4M75A 4C8QD 2I2LA 3BDUA 4MMLA 4XQ3A 4F7UE 4M7DE 3L2ZA 5GANj 4JRKA 5GANh 3V8KA 3QUIA 4NL2A 5GAMj 2RD1A 2EJ9A 4XU1A 4N0AC 4C8QE 2DVEA 3JCMQ 4PJOG 2Y90A 2FB7A 5GAN6 4F7UA 3JCMP 1JRIA 4M7DA 2DZCA 4EMHA 4M77A 3EFRA 3QO3A 3SB2A 4F7UB 4M7DB 4QVCA 4M77B 5GAMg 3SWNC 2DTIA 3V7SA 2EAYA 5LJ3j 4JLIA 3FJPA 4M75G
chains in the Genus database with same CATH superfamily
2VGMA 4FT2A 2AIRB 2K6DA 3N5BB 1UGVA 2QDLA 3CCRT 2DAQA 4E7KA 4QKUA 2ATCB 3UA6A 1MV0B 4HKEA 3CCJT 3JAME 5IHIA 3NTKA 4KRTA 2PNIA 2CH4A 4M7AD 1C0MA 2ED0A 2LQ8A 3V8JA 5CQXA 1JJ2A 1M9SA 2IPOB 3QWYA 4X34A 1OQKA 2MWOA 4FYXB 3OY9A 4C0FA 2EYQA 3U23A 1Y96B 1EZZB 2OI3A 2LTOA 2QQRA 4JDSA 1VQNA 1JO8A 1N5ZA 1SRMA 3VUBA 3G6ET 4J9DA 3BE3A 3LW5E 2JTMA 3EFSA 4KH1B 3RIRA 1CSKA 3LLRA 4GLKA 4BI4A 2QEXA 2DRKA 2E4HA 1WA7A 4M77F 1VQLT 4BACA 3CQTA 2AKLA 2QASA 3M4GA 3JB9F 4BDYA 4MDWA 2FZGB 3C0CA 4OMPA 1GBQA 2C0OA 5KYNA 1FX7A 4N0AA 4XTUA 5GANg 2E5QA 3VS6A 3ZBDA 1Q82R 4Z02A 4JS5A 4PJOC 1RLQC 4JJDA 1D1AA 2BZXA 3EH2A 2K5IA 3L42A 3QWXX 2IIMA 1OOTA 3V8KA 1YHQT 3MEUA 1D0ZA 3J7AF 2G3RA 3GNFB 1PKTA 5HY6A 2M9UA 2CZ7B 2ZPIB 5EG2A 1H92A 1WFWA 2CKKA 1K8AC 4FYYB 5KYUB 4C8QC 2CH4W 1Q81R 2WACA 4FL6A 2RI2A 4OMNA 4KH0B 3TEEA 1RADB 1M3CA 4C92D 5LJ5g 4OP0A 1BCMA 2CS7A 1PD0A 2QA4T 1X6GA 3M0SA 4HVVA 1KQSA 2OAUA 4L5GA 1H641 1ZA1B 3PIOA 1BIAA 4O6JA 4FSSA 3OYNA 2FZCB 1DJ7B 3CMAA 3CD6T 1NG2A 1OX9A 3OYMA 3ME9A 4WF2A 3URGA 2PUKB 2F5KA 3L2VA 4F7UF 5CO7A 2CZ0B 4BE2A 3PVLA 3JCMW 1RAHB 3CCLT 1XTDA 1M90C 1SPKA 5FU6B 1O75A 3INZA 4R0KA 2FYKA 4IURA 3FDRA 3GNGA 4V2SA 2YWWA 2DILA 2YUQA 1GFDA 4RCCA 2YRDA 2J06A 1TUCA 1SHGA 2GBQA 2RI3A 3AT1B 2O2OA 4M75D 2GTJA 1YJNQ 4M7AG 1YNZA 1YJ9Q 2Y4XA 5FLXE 1NJIC 1AWXA 1BBZA 2HAXA 3QPHA 3I56A 5C0MA 1RI0A 4HT9A 1VQOT 3JCMe 4J83A 1WHJA 5DY9A 3HHTB 4C0DB 3D7SB 4XU0A 3VS0A 2K7AA 1BI3A 2JS0A 1BK2A 1VQ4Q 1VQ6T 3I5SA 1UJYA 2EKHA 1PKSA 4DBRA 3QO3A 2HSPA 1BB9A 2DMOA 2NUPA 2CT4A 3MEAA 3OYFA 1UE9A 1TUGB 2CYZB 4OF1A 3S6WA 3ZL7C 1WZOA 1M1GA 4M78E 2MCNA 2OTLT 4C0ZA 3EGXA 2GQIA 1KIKA 1NLPC 2PZ1A 5GAOm 1NPRA 2DJQA 1ZSZB 2E3IA 3EAEA 2CP0A 1BU1A 5IH2A 1TH7A 1QVFP 2VB6A 1ABOA 1Q7YR 3LWIA 4OMLA 4GBQA 4M7DF 3TSZA 4E7IA 1MNEA 4BY6B 3LGLA 5GJVB 3RBBB 3EGUA 1K73R 2ZCFB 2NWMA 1ZBXA 5DM7R 2KMTA 3OSSC 2RNAA 4N4IA 2A0FB 4Z88A 2HQEA 3LX7A 2DO3A 2L3QA 4QW2A 4DOWA 4J6YA 6AT1B 2DD4A 2ENMA 2DTOA 2FPDA 3F70A 2XKOC 1BYMA 1EFNA 4LN2A 3NHNA 4J9EA 4AFSC 1XNIA 1YP5A 2KK4A 1N27A 3HL8A 2LCLA 2DERA 3V7CA 4ESRA 1V76A 3MP8A 2PQWA 2HQHA 1RL2A 2EYXA 4BE1A 2EQMA 2V8IA 5AYFA 1VQ9T 2RJCA 2F1LA 2C0IA 3CC7T 2X9HA 2DVEA 2CP7A 3HPWA 3OS5A 4P5NA 4PKCC 4F7UA 1QKWA 4N4GA 1AOJA 3SWNC 3V7SA 1IREB 3FJPA 4M75G 1OX8A 1OI1A 2PUOB 3M57A 3H9NA 2KT1A 2C06A 4LUEA 5FW9A 1YJWQ 2QAZA 5I21A 2NUZA 2ZPFB 3VS5A 3FC3A 1VQMT 4BE0A 5FRNA 3CCQQ 2M02A 3GIBA 1YJNA 1QVGA 1YJ9A 3G4SA 4M7DC 4B9XA 3MHXA 1KHCA 2COWA 1K1ZA 4DBFA 4M78C 1EX4A 1RABB 3L2UA 1AT1B 1RI9A 1ZA2B 4IUTA 1MV3A 1HD3A 1NYFA 1PG5B 1JXOA 2A7YA 2LNVA 4DA4A 1HK9A 2M0OA 2ZPEB 1VQ4A 1WNLA 1QVFS 1YIJA 1Q86U 4ELZC 4HCBA 3MO8A 1R8OB 1M3BA 1TWBA 2BIVA 1K8AR 4HT8A 3QSUA 2ABLA 1YI2T 2MYSA 3RMQA 4QQ6A 4MDXA 1H8KA 5CKHA 2E3HA 3VS3A 1JB0E 5FROA 2KRMA 1ARKA 3AHUA 1Y71A 1M1FA 1OULA 2DETA 4C8QB 5CVIA 3NGPA 3LH5A 1YITQ 2KRNA 5J26A 5GANj 4C5HA 3FEOA 3Q1JA 4LDVA 3CCSQ 2LJ3A 1G3WA 3E9FA 2RD1A 3CPWP 2F2XA 3CXCA 1G3SA 2FB7A 4M7DA 1U06A 1ZUUA 1MMNA 2EAYA 2NUPB 1M90R 1ZHIA 1UHFA 1OEBA 1M8MA 4JUVA 1QCOA 2DTHA 1VYVA 3G6EA 4X1VA 4ELYC 3H0HA 5A0GA 4C0GA 1JU5C 4PLLA 2K2VA 5CKBA 4J9BA 2DXTA 3CMET 1VQ7T 1D3BA 1VQ5Q 4LUDA 1NJIR 2DM1A 5KCHA 4NL3A 1G3YA 5LJ5j 5KYUA 2KGTA 3FJ5A 1WQWA 4WCIA 1N6AA 5GMKl 1VQKQ 3NFCA 5CKFA 4AFQC 2GCXA 2YUNA 2RM4A 5GAMf 5GAOn 3MKDA 3FB9A 1XQHA 4RG2A 5I2MA 3OW2P 3S3OA 1X75C 4JRIA 1TS9A 1MGQA 2MMPA 1ZBJA 2O31A 4AFUC 1M2VA 3CCVT 1CKBA 4MZMA 1SG5A 1KJWA 5D7UA 1TXQA 4XTYA 1H3HA 9ATCB 1AZGB 2DKGA 3X28B 4QVZA 1ZX6A 2X3WD 2ZPGB 4XU2A 2DPPB 1UDLA 1RLPC 1WXUA 2HSEB 3JRZA 3TCJA 4BI3A 1B07A 4ATOA 3LGFA 2E70A 1VQ9Q 2HMAA 4RMOA 4ZGJB 2GGRA 1KK7A 2YUOA 3CBPA 4A4EA 2QG9B 2W0ZA 4RTWA 4E7ZA 1JRIA 4IIMA 4BI8B 4F7UB 1MMAA 1FXXA 2RI5A 4JZ4A 2MI6A 2FO0A 2CUBA 2E10A 5GMKj 1BKBA 1NZ9A 4PJOF 3JCMc 4PJJA 5CAIA 2F2VA 2X4WA 4Y28E 2XDDA 2L2PA 3CPWS 4LD9K 4CI0C 1FMKA 2CP2A 2CSIA 2FL7A 2DL5A 3E19A 3I9QA 2FPFA 1MUZA 3OS2A 4C5EA 1FMVA 1U1SA 2JN0A 2LC4A 3EFOB 1PHTA 3VS4A 1JQQA 4OB2B 1QW1A 3CCUT 2DIQA 1MNDA 4RG8A 4M7AE 4JRQA 2DXCA 4VUBA 3PE0A 1IZ6A 1LVKA 3CCET 3VS2A 1PD1A 2BE9B 3I56Q 4C8QF 3VYHB 2P0QA 3I35A 5KYWA 1YITA 1G8XA 4QQDA 2ZPBB 3CCSA 1ZSZA 4J9FA 3HRSA 4PFOA 4CC4B 1W2BA 5LJ3f 2AHJB 1Q86C 4DQ2A 1VQ8T 2K3BA 5GMKe 2DL8A 4WTOB 1VA7A 3TQ7P 1QKXA 1K9AA 1WDXA 2P4RA 5I11A 2KAFA 2DYBA 1JJ2P 2FHDA 2DD5A 2EYZA 2PU9B 3PGGA 1IHWA 2F69A 4FCYA 3SWNB 1VQ5A 2BUDA 3PTAA 4JZ3A 3M58A 4DBHA 2CGHA 1B7TA 2FG0A 2JW4A 5A0DA 5FWBA 4KUIA 1KC8R 3UPUA 1GCPA 4CC7A 4RTYA 5IAYA 2RJFA 1VQKA 1GFCA 3JCMP 3EFRA 4M7DB 2DTIA 2XHCA 2PVOB 1YCSB 2E5KA 4M77D 2LP5A 1LJOA 3OS1A 2VC8A 2JS2A 3JB9D 2M0YA 2K3XA 2OTJT 2JM9A 4J9HA 5I22A 2QGGA 5LJ3h 1NLOC 5A2QE 4E7LA 1N8RU 4ZNXA 3IQLA 4C92E 4LDUA 1I5LA 2P4TA 1BI0A 2VWFA 1D3BB 1UGSB 3A1PA 2I0NA 3ER0A 3BFMA 4ZGEB 4IUVA 2LCCA 2F2WA 3CCMQ 2X35A 1FMWA 3OMGA 5HKCA 1SKUB 1CKAA 2QTVA 4F04B 3MEVA 2HNIA 5CR2A 1Y7XA 4XTWA 1W4SA 3OYAA 3VRZA 2JTEA 3M55A 2LQNA 4XTVA 1VQ9A 2O9SA 4EMGA 1PSEA 2VXEA 2YLCA 5EC7A 3M0QA 2EQKA 3HSBA 3CC7A 5KYXB 4E7HA 2O9VA 1S72T 3META 1UEBA 1I1JA 1M2VB 3VS1A 2ECZA 3JB9H 5KYYA 1YWPA 1PM3A 2EGAA 3CCVQ 3CBMA 2KYBA 4AG1C 1SHFA 1LPLA 2FPEA 4M75E 2IG0A 1K9MC 2RQUA 1KD1C 2DEUA 3GPLA 2EQJA 4PJOA 1I4K1 3QYGB 3BDLA 2NYSA 8AT1B 1X2KA 3V7RA 3E1SA 3RERA 4OGEA 5GMKi 3M0UA 2MAMA 3KFVA 4XQ3A 4E2FB 1Q82U 3GOXA 3M0RA 2QQSA 5CQYA 3EH1A 5D6WA 3G4SQ 5LL6S 3DKMA 4EPCA 1JJ2S 2QQ9A 3UF4A 1W1FA 1NBEB 3VV0A 3FIFA 2DL3A 1LNXA 4ORZA 4C8QA 2YXYA 4OMOA 4D8KA 1NYGA 4J5YA 5GANf 3CEYA 4GY5A 1Q81U 1IGUA 2EGEA 2BTTA 1NEGA 1YIJQ 2YRVA 1VOMA 1IXDA 1TOVA 1HSQA 1XJWB 5GAN4 1I0CA 1ZSGA 2EBPA 2DA9A 1YBYA 2KI7A 1U8RA 3JCMJ 1Q95G 2KSSA 2OAWA 3CCRQ 2LJ1A 4FYWB 1M2OA 2KQWA 3I55T 4JJCA 3ZEHA 1ZUYA 4M77G 5KYWB 2DK3A 2MOXA 1M3AA 3CCJQ 2DX1A 3TVTA 3JB9G 1B34B 2F5TX 4FT4A 2RHXA 1OU9A 2DFUA 1VQNT 4RTVA 4PK4A 2XG8D 3QKJA 5LJ5f 3H6ZA 5GJWB 1LCKA 4M78F 1VUBA 1C6VX 2DE0X 5IXFA 1M1KR 3X26B 4E6RA 3M56A 3TU4K 2QEXT 2MF2A 3DLMA 3GLXA 1VYUA 1C1AA 1MMGA 1N9RA 2CP6A 1BCOA 1E6GA 4C92G 3L2RA 1WX6A 3G6EQ 1B3QA 2QQBA 4M7DD 1P92A 2EGCA 1WHGA 3CBOA 3G7ZA 4A4FA 2B86A 2K2MA 4M75C 3RKWA 1V1CA 3CMEA 1TSFA 2RHZA 3REAB 3CCMA 4JRKA 2HCKA 1WXTA 1VQLQ 1PCXA 1VYTA 2COZA 4RTZA 3SD4A 2RHIA 2YSQA 2K79A 2K4YA 4A54A 2D1XA 3ZFJA 1OZ2A 4Y92A 2YHTA 3THKA 3KXTA 4PFPA 3DB4A 4UC4A 1YFNA 2OTJQ 2JXBA 1N8RC 3EHRA 1YHQQ 3CCVA 1WHMA 2L8DA 3G1JA 1KQ2A 2CT3A 1UHCA 2CSQA 1QP3A 1X2QA 3EG0A 3PNWC 1PNJA 1PRMC 3CMAT 1M30A 4IUUA 2FEIA 2A37A 1MHNA 2O88A 2PVDB 5DLQE 4AMCA 2HKQB 1Q7YU 2V8JA 4B6MA 5CIUA 2ZPHB 2QA4Q 2CZ6B 3JCMV 2YRCA 2VVKA 2EFIA 3EFOA 3JCMX 4XTZA 2DZ9A 3X25B 1MMDA 1K73U 3OYKA 1WQ7A 3CD6Q 1FYNA 4HA8A 3QHSA 4J6WA 3JCMg 5KYYB 1E6HA 1G83A 2X4YA 3P8BB 2DRMA 3M0TA 5HK0A 1TTHB 2PTKA 2COYA 3CCLQ 4X9DA 4OGCA 4LNPA 4B9WA 1PC0A 4PJOB 1M27C 2RQVA 1RUWA 2RF0A 4HXJA 5DLOA 3RMSA 2CP5A 2EYWA 4ZGDB 2ZAEA 5FU7C 4ZN3A 4JRPA 1KSWA 4J7FA 3QYHB 1X6OA 2DL4A 3M0PA 5KE2A 3CCRA 3WXMB 5KCOA 5GAN6 1U5SA 3SWNA 3CCJA 5CKEA 4KUDK 3CC2T 2X4JA 1VQOQ 3JB9J 3PT9A 4HVUA 2FRWA 4DEYA 1KFZA 4QT7A 3R6OA 4M7DG 3CPWA 5HK3A 4DOVA 5L23A 1LOJA 4OMMA 3X24B 2V1QA 1VQ6Q 3MP6A 3EG9B 4OVAA 4Q5WA 4M78A 3JCMb 2HBWA 4Y91A 1K9MR 2KROA 3C12A 5J3BA 1KD1R 2NLUA 1T3LA 3G71T 1WHHA 2DEQA 2KE9A 3UDCA 4M4ZA 2P0PA 3JSCA 3MP1A 5GAN2 1H3ZA 3VS7A 1W6XA 2HL5C 3GBQA 3I55Q 2OTLQ 1RAFB 2EJGA 1VQLA 3EGDA 3OYIA 2SRCA 2LNHB 3UA7A 4LE9A 1D1CA 2AT1B 2BE7D 3BW1A 3EG1A 1UG1A 2EVRA 5IT9E 2GQVA 4GLMA 4IKFA 3QIIA 1WI7A 4PNOA 4LDXA 1FWZA 3J80E 2L0AA 2J05A 2E65A 2OTJA 4C0DC 1R77A 1QVPA 3M53A 1T3SA 2AKKA 1YHQA 5KYXA 1Z9ZA 2LT4A 3JCMf 1K76A 3P8DA 4K11A 4PFZA 2AZSA 3HRUA 3E2UA 1AHJB 2KXDA 3I5RA 1WJRA 3EG2A 4IUQA 3PIPA 2QA4A 2RMOA 3JV3A 2P0KA 4PJLA 2JUFA 1KHIA 1BIBA 5A0LA 2R5AA 1I8FA 5GAOp 1RAEB 3CD6A 2A28A 3TREA 4BD3A 2YDLA 1AZEA 4A63B 5GMKm 2DIGA 2RA2A 1QLYA 3RR6A 3CC7Q 5FRMA 1ZQ1A 3KBGA 1ZUKA 4IIOA 1A0NB 2XICA 2EQUA 1YJNT 5GAMh 3CCLA 4F14A 5GAMd 3OYGA 1NJIU 2D8JA 1QWFA 2QQAA 3LH0A 2XU8A 2K5LA 3MCAB 2LMJA 2H3EB 3A8HB 2R58A 1D1BA 1VQMQ 4JJBA 4MZPA 3OYLA 3MEWA 2QDYB 2HL3A 4FYVB 4PJOD 2M51A 4FW1A 5IXBA 3QZ5B 1VQ4T 1U3OA 1D0XA 1KQ1A 4M75B 3HP9A 1VQOA 2OJ2A 1IHVA 2JMCA 3O5ZA 4JJNK 5GAN7 2LCSA 1B34A 3T9NA 2HD0A 1N8RR 4M7AF 1D0YA 3V8LA 5IN1A 3S3MA 1VQ6A 2KRSA 3M4YA 4C8QD 2I2LA 2BZ8A 4PJMA 1VQPT 3REBB 4LDWA 2L3SA 3OA6A 1K0SA 3ASKA 3S3NA 4A4GA 4ZTJA 2RO0A 1YI2Q 3OW2S 3X20B 1PSFA 1W2BP 1WHLA 1XOVA 2XK0A 3HTRA 3I55A 2OTLA 1KG1A 2LQWA 4PJNA 1QCFA 2DXUA 2PVGB 4E7SA 2DL7A 2QYZA 4QQGA 4M77E 3CC2Q 1N9SA 2JJ9A 2J6FA 2R57A 3P8HA 4HCCA 4BB7A 2HBPA 3A5ZB 4N4HA 1WYXA 4OMFB 2XD0A 2DYIA 3L2QA 1X43A 2YUPA 4M78B 1S1NA 3NTIA 2WSFE 3HFNA 3JB9I 2GF7A 4RCBA 3L1AA 5I2SA 1NE8A 3OBWA 1YN8A 2MPXC 1WHKA 4OB0B 1WIEA 3DB3A 2BZYA 3G71Q 4ZN1A 5LJ3d 2J7IA 4YTLA 2CDTA 1WGSA 3EGDB 2X51A 1UECA 3CMEQ 1VQ7Q 4A4HA 4C5IA 2HKNA 4PL6A 1T0HA 1NM7A 1V29B 2RHYA 2HEQA 4NS5A 4C92F 4J9GA 1OPLA 5FU7B 2K5FA 2L89A 2X3XD 4M7AC 1D09B 1SSHA 2R5MA 4R56A 2LRQA 1AWJA 2VGNA 1WJSA 3OYCA 1O9SA 2FRYA 4J6XA 2K57A 1YJWT 2ZZDA 5IHNA 2JM8A 4MMLA 3CCQT 2JZ2A 4F7UE 8ATCB 4AT1B 2LJ0A 1KQSP 3QUIA 4NL2A 5GAMj 2WSCE 2QXFA 4XU1A 5L8RE 3QJ6A 4PJOG 3NMZC 2DZCA 3SB2A 1KC8U 1X69A 1VQMA 4A53A 1JBMA 5GAN8 2H3JA 1BI2A 1QMCA 2ED1A 4M75F 2RQRA 5AT1B 4M77C 3RKXA 1W2BS 4C8QG 1RACB 2KVQG 1JEGA 2QTXA 2L5QA 4A4KA 1UUEA 2EWNA 3H41A 3CC4T 1OPKA 1X6BA 4EIKA 1T0JA 3OBYA 1IRXA 5GAOl 2NUTA 1NPPA 5GAMe 3OYYA 4M7AA 2IVWA 2Y4YA 1Y07A 3EG9A 5HCKA 3M59A 2RPNA 4C92C 1YITT 4J9CA 1YI2A 2GFUA 4KGVB 3CCST 5C6SA 1OYXA 2HZYA 3QDRB 1I5OB 1OU8A 1BI1A 5IHKA 2EYYA 3L2WA 1U1TA 4EMKC 2A08A 2D0NA 3CCUQ 2V8KA 2KY9A 3CCEQ 3CC2A 2W10A 2E12A 2DBKA 3QBYA 2GTOA 4O5VA 3EG3A 2XDPA 3QG1A 2O4XA 2RN8A 5CK9A 1Y0MA 3SDZA 2P84A 4HVWA 2XIDA 3OSVA 1QVFA 3H8ZA 3GF5A 2DLPA 1G3TA 2AK5A 1IO6A 4M7DE 4TVRA 1VQ5T 1VQ8Q 2KDSA 2EJ9A 3WVDB 1VQPQ 3J81E 2GNCA 4RTTA 3VYGA 4RKUE 4M77A 3G71A 4CRIA 1Y57A 1TUDA 4QVCA 4D8DA 2MWPA 2CUDA 4F16A 5LJ3j 4JLIA 5GANh 4M78D 5GANd 1VQKT 1JXMA 1VQ7A 5ECAA 3OYHA 5D6XA 1KQSS 2RK1A 2X4XA 3LYIA 2QI2A 2LQKA 2RK2A 1ABQA 1OZ3A 2E6NA 3MPUB 1Z9QA 2JTFA 3PVQA 1RAIB 1QWEA 2SEMA 1YCYA 1R0BG 2VV5A 3ULRB 4FIBA 2MK5A 4MZTA 2Z0WA 2RJDA 3QJYA 4C92A 3EHQA 3MJXA 4DEXA 1I81A 2EQIA 2EIFA 4RUGA 2CREA 4EMKA 4OMQA 5M9OA 4XK8E 1R0CB 1Q86R 2CP3A 2HQXA 5LJ5h 4F7UG 5LJ5d 2JNGA 4RTUA 2JT4A 2DF6A 3M9QA 2VXFA 2DNUA 3UWNA 1OV3A 5LJ3e 1K4US 1GCQC 2BKDN 2YLBA 4RTXA 4BDZA 3OYJA 1QP2A 3SEMA 4C5GA 1TG0A 2L3PA 2E64A 1QQJA 3HFOA 4HCKA 2C0TA 2G6FX 1WJQA 4XTXA 2JOYA 3A8MB 3PMIA 5GAOr 3BY7A 2MIOA 3A8LB 2RH2A 7AT1B 2VUBA 2LT1A 1M1KU 2DBMA 1G2BA 1UJ0A 4XU3A 2GFAA 3C94A 2DXBA 4II1A 2K9GA 4M75A 2LX9A 3PMTA 4J8OA 4F17A 2M1HA 4J9IA 5CCAA 5FWCA 2AZVA 4HCZA 1S72Q 4J7IA 1QVGP 1UFFA 3GP8A 1AWOA 2OX7A 2Y90A 1HJDA 3WVEB 1ZLMA 2WSEE 5GAMg 1KC8C 2LVMA 1WLPB 2DVJA 3QDFA 3I56T 4X9CA 3A8GB 3OQ5A 4E7JA 2JVVA 5GAN3 3VUZA 3VRYA 2RQTA 1Q82C 3C4SA 3FRNA 1SRLA 1UB4A 3CCUA 3E9GA 3TSWA 2A3LA 4BUGA 5GMKh 3CCEA 4LD6A 1VIFA 4NOYA 2XDBA 2ZGWA 2EPDA 1EIFA 1GCQA 2KYMA 1PRLC 4AFZC 1PWTA 1IGQA 1Y96A 2J6KA 4PLIA 2E1HA 5D6YA 1UGPB 3VU3C 1QCNA 3CC4Q 2NUTB 2XMFA 2D8HA 2KR3A 4M78G 4M7AB 2RB6A 4ANJA 2KEAA 1Q81C 1VQ8A 2B8AA 2CZ1B 1TU0B 1VQPA 2M16A 2VASA 3RKYA 1WPYA 1IB8A 1NEBA 2D0QB 2LX7A 3CXCP 2KNBB 4D6WA 1X27A 3CPFA 3RNJA 2V1RA 5FU6C 4E47A 4KULA 2D9TA 2ROLA 2J6OA 3C95A 1HYOA 1M8VA 4JS4A 3DLLA 2O4XB 1VIEA 3FLGA 3H0IA 1M4ZA 3KUFA 4KGXB 2V26A 3QZ9B 3PFSA 1UGRB 1VQNQ 3BDUA 1AD5A 4LXCA 4FSXA 2E6ZA 3EGXB 3RDVA 3A98A 3OB9A 3JCMQ 1GL5A 1YWOA 1AWWA 3NPFA 3CCMT 1K8AU 2KXCA 1SEMA 4CC3A 2QEXQ 4M77B 2K3YA 3OW2A 4FW2A 5GAN5 3UATA 4EDUA 1AEYA 1GRIA 4CC2A 2A36A 1J3TA 2H8HA 4L6V5 1HXDA 5LJ3g 5GANe 1RAAB 2DJZA 5J39A 3VJPA 1QVGS 1F1BB 4DBQA 1AVZC 4KT0E 2EJFA 2QK0A 4Z8AA 3UT1A 2YT6A 3M54A 3NTHA 2VYTA 2O01E 2KBTA 4MMKA 2L3RA 2RHUA 4LDYA 3RUXA 2RQWA 1SF9A 4C92B 3HKSA 2D6FA 4JLGA 2KT8A 1ACMB 2ROTA 2LDMA 4EMKB 1W70A 2FZKB 3SHWA 1M90U 1K9MU 1YJWA 4FU6A 1ZSZC 4ME7A 4Z89A 1KD1U 3VKIA 1S72A 4QVDA 3CCQA 3QXEB 1M5Q1 4AG2C 5KE3A 5LJ5e 5GAOq 1WXBA 2XI9A 1GBRA 1RAGB 2VKNA 4KBMB 1YJ9T 1E7OA 2QGFB 3G4ST 3O8VA 4BY6C 5CKDA 3OYBA 2HDAA 4JPBW 3LWHA 3A8OB 4PJOE 2LZ6B 4OB1B 4ZTFA 3CMAQ 3JCMh 2JMAA 3JCMd 2RJEA 4IUPA 4OB3B 1Q7YC 1I07A 3RESA 1K0XA 3SFMA 4XAXB 1M1KC 4KGZB 4FM4B 1X01A 4L59A 1K73C 2E41A 2FVUA 2ESWA 3OYDA 2EKOA 3L2ZA 1SSFA 3CXCS 3OS0A 1YIJT 2EW3A 1UTIA 5KH6A 3OMCA 4N0AC 1G5VA 4C8QE 3R6NA 3HRTA 1UGQB 3CC4A 4R55A 4EMHA 3M5AA 1GXIE 3H0FA 3OYEA
chains in the Genus database with same CATH topology
3ZFJA 2VGMA 1OZ2A 1ZHIA 4FT2A 1VQMA 4JUVA 2DTHA 4A53A 3N5BB 3G6EA 1JBMA 3CCRT 4ELYC 2DAQA 5GAN8 4E7KA 2H3JA 2YHTA 1BI2A 3KXTA 5A0GA 4C0GA 4HKEA 3CCJT 3DB4A 3JAME 4PLLA 2K2VA 4UC4A 5CKBA 3NTKA 4M75F 2DXTA 3CMET 1N8RC 1VQ7T 1D3BA 4M7AD 4M77C 3CCVA 3RKXA 1W2BS 2L8DA 2LQ8A 3V8JA 4C8QG 5CQXA 1KQ2A 1JJ2A 1M9SA 2KVQG 5KCHA 4NL3A 1QP3A 1G3YA 2QTXA 5LJ5j 2L5QA 1WQWA 3PNWC 4X34A 4A4KA 2EWNA 2MWOA 3OY9A 4C0FA 2EYQA 3CC4T 1N6AA 1Y96B 2LTOA 3CMAT 4IUUA 2QQRA 3OBYA 5GMKl 1MHNA 2PVDB 5GAOl 4JDSA 5DLQE 3NFCA 1NPPA 1VQNA 5GAMe 5CKFA 1Q7YU 2GCXA 2V8JA 2RM4A 3OYYA 3VUBA 3G6ET 5CIUA 5GAMf 5GAOn 3FB9A 4M7AA 2IVWA 2ZPHB 1XQHA 2CZ6B 4RG2A 5I2MA 3JCMV 3LW5E 2Y4YA 1Y07A 2EFIA 2JTMA 3EFSA 1VQ5A 3JCMX 4XTZA 2DZ9A 3X25B 3S3OA 3RIRA 1K73U 3M59A 3OYKA 1X75C 4C92C 1YITT 1WQ7A 1YI2A 3LLRA 4GLKA 4JRIA 2GFUA 4BI4A 3CCST 2QEXA 1MGQA 5C6SA 1OYXA 2MMPA 3QDRB 1BI1A 4M77F 1VQLT 4HA8A 3QHSA 4BACA 3L2WA 3CCVT 4J6WA 3M4GA 1U1TA 4MZMA 4EMKC 3JCMg 3JB9F 2V8KA 2KY9A 4BDYA 4MDWA 4XTYA 2X4YA 1FX7A 3P8BB 4N0AA 2DKGA 4XTUA 3X28B 5GANg 4QVZA 3CC2A 2E12A 5HK0A 3QBYA 2E5QA 4O5VA 3ZBDA 4Z02A 4JS5A 2XDPA 2ZPGB 3QG1A 4PJOC 2O4XA 5CK9A 4X9DA 4OGCA 4XU2A 4B9WA 2DPPB 4PJOB 2K5IA 3SDZA 3L42A 2XIDA 3OSVA 1QVFA 3H8ZA 5DLOA 3GF5A 3JRZA 1G3TA 3RMSA 3TCJA 4BI3A 4M7DE 4ATOA 4ZGDB 3LGFA 4TVRA 5FU7C 3V8KA 4ZN3A 2E70A 1VQ5T 1YHQT 3MEUA 4JRPA 2KDSA 4J7FA 3J7AF 2EJ9A 4RMOA 3QYHB 4ZGJB 2G3RA 3WVDB 1X6OA 3GNFB 5HY6A 3CBPA 4A4EA 5KE2A 3J81E 3CCRA 3WXMB 5KCOA 5GAN6 2M9UA 3VYGA 4RKUE 1JRIA 2CZ7B 4BI8B 4M77A 4F7UB 4CRIA 3G71A 1FXXA 2ZPIB 5EG2A 4QVCA 2MWPA 5LJ3j 4JLIA 2RI5A 5GANh 1K8AC 2CKKA 3SWNA 3CCJA 4C8QC 5CKEA 2WACA 4FL6A 2RI2A 4M78D 5GANd 4KUDK 3TEEA 1VQKT 4C92D 2MI6A 3CC2T 2X4JA 2E10A 5GMKj 1VQ7A 5LJ5g 1BKBA 1NZ9A 4OP0A 4PJOF 3JCMc 3PT9A 5D6XA 5CAIA 3OYHA 3JB9J 2X4WA 4Y28E 2RK1A 2X4XA 2XDDA 1KQSS 3CPWS 4LD9K 2CS7A 2QA4T 4M7AE 4CI0C 3R6OA 3LYIA 2QI2A 2LQKA 2FL7A 2RK2A 1KQSA 1OZ3A 4M7DG 2E6NA 2OAUA 3E19A 5HK3A 4DOVA 3CPWA 4L5GA 1H641 3PIOA 1LOJA 1BIAA 2JTFA 4C5EA 3OS2A 3X24B 1U1SA 2JN0A 2LC4A 3MP6A 1YCYA 2VV5A 4O6JA 4OVAA 3OYNA 1DJ7B 3CMAA 3CD6T 4Q5WA 4M78A 3JCMb 4FIBA 3OYMA 3ME9A 4Y91A 4MZTA 4WF2A 3QJYA 2RJDA 4C92A 4OB2B 3URGA 2PUKB 1QW1A 2F5KA 2DIQA 4RG8A 4F7UF 3C12A 5J3BA 5CO7A 3L2VA 2DXCA 3CCUT 4JRQA 2CZ0B 4VUBA 1IZ6A 1I81A 4BE2A 2NLUA 3JCMW 2EIFA 3G71T 3CCET 2DEQA 3UDCA 4EMKA 2P0PA 4C8QF 3VYHB 3JSCA 4XK8E 3MP1A 5M9OA 5GAN2 2HQXA 2P0QA 5LJ5h 4F7UG 3CCLT 1YITA 1H3ZA 4QQDA 1XTDA 2JNGA 2ZPBB 5LJ5d 3CCSA 1M90C 5FU6B 3HRSA 1O75A 3INZA 2EJGA 2FYKA 1VQLA 3M9QA 2VXFA 3OYIA 3UWNA 5LJ3e 4IURA 3FDRA 1W2BA 2BKDN 3GNGA 5LJ3f 2YLBA 4V2SA 4BDZA 2AHJB 1Q86C 3OYJA 4RCCA 4DQ2A 1VQ8T 1QP2A 2RI3A 4C5GA 5GMKe 3BW1A 4M75D 4M7AG 5IT9E 2E64A 3HFOA 2GQVA 4IKFA 1YHQA 2Y4XA 5FLXE 1WJQA 4XTXA 3QIIA 1NJIC 2JOYA 2HAXA 3QPHA 3A8MB 3PMIA 3I56A 2KAFA 4PNOA 3BY7A 3A8LB 5GAOr 4LDXA 1FWZA 2RH2A 3J80E 2VUBA 2LT1A 2E65A 2DD5A 2FHDA 2PU9B 5C0MA 3PGGA 1RI0A 1M1KU 4HT9A 2OTJA 2F69A 1VQOT 4C0DC 3SWNB 3JCMe 1QVPA 2GFAA 3C94A 3M53A 2BUDA 4J83A 2DXBA 4XU3A 4II1A 5DY9A 3M58A 3PTAA 2CGHA 2LT4A 3HHTB 3JCMf 4C0DB 4XU0A 3P8DA 4M75A 2LX9A 3PMTA 4J8OA 2M1HA 5CCAA 4HCZA 5A0DA 1BI3A 4KUIA 3UPUA 1VQ6T 4J7IA 3HRUA 1AHJB 3GP8A 5IAYA 2RJFA 2Y90A 1VQKA 3JCMP 3WVEB 3EFRA 3QO3A 4M7DB 2WSEE 1WJRA 5GAMg 2DTIA 2XHCA 2PVOB 3MEAA 4IUQA 3PIPA 3OYFA 4M77D 2QA4A 1KC8C 2LVMA 1LJOA 2P0KA 3OS1A 2CYZB 2VC8A 2JUFA 1KHIA 1BIBA 4OF1A 5A0LA 3I56T 3JB9D 4X9CA 3S6WA 3A8GB 1M1GA 2R5AA 3OQ5A 1I8FA 2K3XA 5GAOp 4E7JA 2OTJT 2JVVA 5GAN3 3CD6A 3VUZA 4M78E 3TREA 4BD3A 5LJ3h 4C0ZA 3C4SA 3FRNA 5A2QE 4E7LA 1Q82C 1N8RU 2OTLT 1I5LA 4C92E 4LDUA 1UB4A 2P4TA 5GMKm 2DIGA 5GAOm 2RA2A 3CCUA 1BI0A 1NPRA 3E9GA 1D3BB 2A3LA 1UGSB 3EAEA 4BUGA 5FRMA 5GMKh 1ZQ1A 3ER0A 3KBGA 3BFMA 4ZGEB 4LD6A 1TH7A 3CCEA 1VIFA 4NOYA 2XDBA 4IUVA 2ZGWA 2XICA 2EQUA 2LCCA 1YJNT 1EIFA 3LWIA 2X35A 5GAMh 3CCLA 4M7DF 3OMGA 5HKCA 1Y96A 4E7IA 5GAMd 3OYGA 1NJIU 4PLIA 4BY6B 3LGLA 2E1HA 3MEVA 5D6YA 1UGPB 2HNIA 3VU3C 5CR2A 2QQAA 2ZCFB 3LH0A 2XU8A 2K5LA 1Y7XA 4XTWA 1W4SA 3MCAB 1ZBXA 5DM7R 3A8HB 4M78G 2R58A 4M7AB 3OYAA 2KMTA 2RB6A 1Q81C 3M55A 4XTVA 1VQ8A 1VQ9A 3OSSC 4EMGA 2B8AA 2CZ1B 1PSEA 2VXEA 4N4IA 4MZPA 2YLCA 2HQEA 3OYLA 1VQPA 3LX7A 2M16A 2QDYB 2EQKA 3MEWA 3HSBA 3CC7A 4E7HA 4PJOD 2DO3A 3RKYA 1S72T 1WPYA 3QZ5B 4QW2A 1VQ4T 4M75B 1KQ1A 4J6YA 4DOWA 2D0QB 3META 1UEBA 2DD4A 3JB9H 3HP9A 2DTOA 1VQOA 3F70A 2XKOC 4D6WA 1BYMA 3CBMA 3CPFA 5FU6C 4E47A 5GAN7 4JJNK 4KULA 4M75E 2IG0A 1K9MC 1XNIA 1B34A 2D9TA 3C95A 2KK4A 1N27A 1KD1C 1M8VA 3HL8A 3GPLA 2EQJA 4JS4A 3DLLA 2O4XB 2LCLA 1I4K1 1VIEA 3FLGA 3BDLA 3QYGB 2HD0A 3T9NA 4M7AF 4PJOA 1M4ZA 3KUFA 3V7CA 5IN1A 3V8LA 3S3MA 1VQ6A 3MP8A 3V7RA 3M4YA 3E1SA 2PQWA 3RERA 3QZ9B 4OGEA 5GMKi 1RL2A 3PFSA 1UGRB 4BE1A 2MAMA 2EQMA 2V8IA 4C8QD 2I2LA 3BDUA 4XQ3A 5AYFA 1VQ9T 1Q82U 3GOXA 2RJCA 4FSXA 2QQSA 5CQYA 1VQPT 2E6ZA 5D6WA 4LDWA 3CC7T 3OA6A 5LL6S 3DKMA 3ASKA 3OB9A 2DVEA 3JCMQ 3S3NA 3HPWA 4EPCA 1JJ2S 4A4GA 4ZTJA 2RO0A 3OS5A 4P5NA 4PKCC 4F7UA 3X20B 3CCMT 2QQ9A 3OW2S 1K8AU 1PSFA 4M77B 4N4GA 2K3YA 3SWNC 3V7SA 1IREB 3OW2A 1XOVA 3FJPA 4M75G 3VV0A 5GAN5 3FIFA 2XK0A 4EDUA 3I55A 2OTLA 1LNXA 1OI1A 4C8QA 1KG1A 2PUOB 3M57A 2C06A 2DXUA 4L6V5 1HXDA 5LJ3g 2PVGB 5GANe 4QQGA 5I21A 2DJZA 2ZPFB 5J39A 4M77E 4J5YA 3FC3A 5GANf 1N9SA 3VJPA 1QVGS 1VQMT 3CEYA 4GY5A 2R57A 3P8HA 4KT0E 4BE0A 1Q81U 2EJFA 4HCCA 5FRNA 3UT1A 4BB7A 1YJNA 3GIBA 1QVGA 2HBPA 1YJ9A 3A5ZB 3M54A 3NTHA 3G4SA 4M7DC 2YRVA 4B9XA 1KHCA 2O01E 2VYTA 3MHXA 4MMKA 4N4HA 4M78C 4OMFB 2XD0A 5GAN4 2L3RA 2RHUA 3L2UA 3L2QA 4M78B 4LDYA 1YBYA 3NTIA 3RUXA 2WSFE 3HFNA 3JB9I 2GF7A 1U8RA 4RCBA 4C92B 4IUTA 3L1AA 5I2SA 1NE8A 3HKSA 3JCMJ 3OBWA 4JLGA 2D6FA 4OB0B 2LDMA 2KSSA 4EMKB 3DB3A 1M90U 2A7YA 2KQWA 3I55T 2LNVA 1YJWA 1K9MU 3ZEHA 4ZN1A 4M77G 4FU6A 4ME7A 1HK9A 4DA4A 5LJ3d 1KD1U 2DK3A 3VKIA 1S72A 4QVDA 2M0OA 2ZPEB 1VQ4A 3JB9G 4YTLA 3CCQA 1B34B 2F5TX 3QXEB 4FT4A 1M5Q1 1WGSA 2RHXA 1WNLA 1QVFS 5KE3A 5LJ5e 1YIJA 1VQNT 5GAOq 1Q86U 4A4HA 2XG8D 4C5IA 4ELZC 3QKJA 4HCBA 4PL6A 5LJ5f 3H6ZA 2XI9A 4KBMB 3MO8A 1YJ9T 1R8OB 3G4ST 3O8VA 4BY6C 1V29B 2BIVA 5CKDA 4M78F 3OYBA 4HT8A 2RHYA 3QSUA 1VUBA 3LWHA 3A8OB 4NS5A 3X26B 4C92F 4PJOE 1YI2T 3M56A 3TU4K 5FU7B 4OB1B 4ZTFA 2K5FA 2L89A 2QEXT 4M7AC 2MF2A 3DLMA 4QQ6A 3RMQA 3JCMh 4MDXA 3GLXA 5CKHA 2R5MA 3JCMd 1N9RA 2RJEA 4IUPA 4OB3B 4R56A 1JB0E 1Q7YC 2LRQA 3RESA 4C92G 5FROA 3L2RA 3SFMA 4M7DD 2VGNA 1WJSA 2QQBA 4XAXB 1O9SA 1P92A 4J6XA 1Y71A 3OYCA 3AHUA 2K57A 3CBOA 3G7ZA 4A4FA 1M1KC 1YJWT 1M1FA 2ZZDA 4FM4B 1X01A 4M75C 4L59A 5CVIA 3RKWA 4C8QB 1K73C 2E41A 2FVUA 3CMEA 4MMLA 3CCQT 2JZ2A 2RHZA 4F7UE 3OYDA 2EKOA 5J26A 3L2ZA 1SSFA 3CCMA 4C5HA 4JRKA 3FEOA 3Q1JA 4LDVA 3OS0A 3CXCS 5GANj 1YIJT 3QUIA 4NL2A 1G3WA 3E9FA 2RD1A 5GAMj 5KH6A 2WSCE 3CXCA 3OMCA 2QXFA 3SD4A 4XU1A 4N0AC 5L8RE 3QJ6A 2RHIA 4C8QE 1G3SA 1G5VA 4PJOG 3HRTA 1UGQB 2FB7A 3CC4A 4M7DA 4R55A 2DZCA 3M5AA 4EMHA 3SB2A 1GXIE 1KC8U 2K4YA 2EAYA 4A54A 3OYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWN A;  4M77 D;  4C8Q C;  5GAN 5;  3FIF A;  4M78 D;  5GAN d;  1LJO A;  1LNX A;  2VC8 A;  2DTH A;  4JUV A;  4A53 A;  1BIB A;  1JBM A;  4C8Q A;  3JB9 D;  5GAN 8;  4C92 D;  4X9C A;  2YHT A;  2E10 A;  2DXU A;  5GMK j;  1HXD A;  4OP0 A;  4PJO F;  3JCM c;  5LJ5 g;  5LJ3 g;  1I8F A;  5GAN e;  5CAI A;  5GAO p;  5I21 A;  3JB9 J;  2DJZ A;  4M77 E;  5GAN 3;  4J5Y A;  4M78 E;  5GAN f;  1N9S A;  5LJ3 h;  4M7D G;  2EJF A;  1I5L A;  4C92 E;  4M75 F;  5GMK m;  2DXT A;  3GIB A;  1H64 1;  5GAO m;  2RA2 A;  1LOJ A;  1BIA A;  1D3B A;  4M7A D;  4M7D C;  1U1S A;  1D3B B;  2JN0 A;  4M77 C;  4MMK A;  1YCY A;  3RKX A;  4M78 C;  3V8J A;  4C8Q G;  5GMK h;  5GAN 4;  1KQ2 A;  3BFM A;  1TH7 A;  4M78 A;  4NOY A;  3JCM b;  2QTX A;  5LJ5 j;  4NL3 A;  4M78 B;  2ZGW A;  4Y91 A;  4WF2 A;  3RUX A;  3HFN A;  4C92 A;  3JB9 I;  1WQW A;  4RCB A;  2EWN A;  4C92 B;  4F7U F;  5GAM h;  3L1A A;  4M7A E;  4M7D F;  1I81 A;  1Y96 A;  3JCM J;  5GAM d;  3JCM W;  1Y96 B;  2DEQ A;  2E1H A;  4EMK A;  5GMK l;  2HNI A;  3VU3 C;  5GAO l;  4EMK B;  4C8Q F;  5GAM e;  5GAN 2;  5LJ5 h;  4XTW A;  4F7U G;  2RM4 A;  4M77 G;  4M7A A;  1HK9 A;  5GAM f;  5LJ3 d;  3FB9 A;  4M78 G;  4M7A B;  5LJ5 d;  5GAO n;  2RB6 A;  4QVD A;  3JCM V;  4XTV A;  3JB9 G;  1B34 B;  3INZ A;  2EJG A;  2FYK A;  3EFS A;  4EMG A;  1M5Q 1;  4XTZ A;  2DZ9 A;  1WNL A;  2VXE A;  2VXF A;  3JCM X;  3RIR A;  2YLC A;  5LJ5 e;  5LJ3 e;  5GAO q;  3HSB A;  4C92 C;  1WQ7 A;  4JRI A;  5LJ3 f;  2YLB A;  5LJ5 f;  4V2S A;  4PJO D;  3RKY A;  1MGQ A;  1WPY A;  4RCC A;  4DQ2 A;  4M75 B;  1KQ1 A;  4J6Y A;  4M77 F;  4HA8 A;  3QHS A;  4M78 F;  5GMK e;  4J6W A;  4HT8 A;  3M4G A;  3BW1 A;  1U1T A;  4M75 D;  4EMK C;  3JB9 H;  3QSU A;  4M7A G;  3JCM g;  3JB9 F;  2E64 A;  4C92 F;  2DTO A;  3HFO A;  4PJO E;  4XTX A;  4M7A C;  4XTY A;  3JCM h;  4N0A A;  2DKG A;  4XTU A;  5GAN g;  5GAN 7;  4PNO A;  3BY7 A;  3JCM d;  1N9R A;  5GAO r;  4M75 E;  4A54 A;  1B34 A;  2E65 A;  4PJO C;  3RES A;  4C92 G;  3PGG A;  1M8V A;  4X9D A;  4HT9 A;  4M7D D;  4XU2 A;  1I4K 1;  4PJO A;  3AHU A;  4J6X A;  3SWN B;  3JCM e;  4XU3 A;  2K57 A;  4M7A F;  3V8L A;  3V7C A;  4PJO B;  5DY9 A;  3V7R A;  2CGH A;  4C8Q B;  1X01 A;  4M75 C;  3RKW A;  3JCM f;  5GMK i;  3RER A;  4XU0 A;  2E41 A;  4M75 A;  4C8Q D;  2I2L A;  3BDU A;  4MML A;  4XQ3 A;  4F7U E;  4M7D E;  3L2Z A;  5GAN j;  4JRK A;  5GAN h;  3V8K A;  3QUI A;  4NL2 A;  5GAM j;  2RD1 A;  2EJ9 A;  4XU1 A;  4N0A C;  4C8Q E;  2DVE A;  3JCM Q;  4PJO G;  2Y90 A;  2FB7 A;  5GAN 6;  4F7U A;  3JCM P;  1JRI A;  4M7D A;  2DZC A;  4EMH A;  4M77 A;  3EFR A;  3QO3 A;  3SB2 A;  4F7U B;  4M7D B;  4QVC A;  4M77 B;  5GAM g;  3SWN C;  2DTI A;  3V7S A;  2EAY A;  5LJ3 j;  4JLI A;  3FJP A;  4M75 G; 
#chains in the Genus database with same CATH topology
 2VGM A;  4FT2 A;  2AIR B;  2K6D A;  3N5B B;  1UGV A;  2QDL A;  3CCR T;  2DAQ A;  4E7K A;  4QKU A;  2ATC B;  3UA6 A;  1MV0 B;  4HKE A;  3CCJ T;  3JAM E;  5IHI A;  3NTK A;  4KRT A;  2PNI A;  2CH4 A;  4M7A D;  1C0M A;  2ED0 A;  2LQ8 A;  3V8J A;  5CQX A;  1JJ2 A;  1M9S A;  2IPO B;  3QWY A;  4X34 A;  1OQK A;  2MWO A;  4FYX B;  3OY9 A;  4C0F A;  2EYQ A;  3U23 A;  1Y96 B;  1EZZ B;  2OI3 A;  2LTO A;  2QQR A;  4JDS A;  1VQN A;  1JO8 A;  1N5Z A;  1SRM A;  3VUB A;  3G6E T;  4J9D A;  3BE3 A;  3LW5 E;  2JTM A;  3EFS A;  4KH1 B;  3RIR A;  1CSK A;  3LLR A;  4GLK A;  4BI4 A;  2QEX A;  2DRK A;  2E4H A;  1WA7 A;  4M77 F;  1VQL T;  4BAC A;  3CQT A;  2AKL A;  2QAS A;  3M4G A;  3JB9 F;  4BDY A;  4MDW A;  2FZG B;  3C0C A;  4OMP A;  1GBQ A;  2C0O A;  5KYN A;  1FX7 A;  4N0A A;  4XTU A;  5GAN g;  2E5Q A;  3VS6 A;  3ZBD A;  1Q82 R;  4Z02 A;  4JS5 A;  4PJO C;  1RLQ C;  4JJD A;  1D1A A;  2BZX A;  3EH2 A;  2K5I A;  3L42 A;  3QWX X;  2IIM A;  1OOT A;  3V8K A;  1YHQ T;  3MEU A;  1D0Z A;  3J7A F;  2G3R A;  3GNF B;  1PKT A;  5HY6 A;  2M9U A;  2CZ7 B;  2ZPI B;  5EG2 A;  1H92 A;  1WFW A;  2CKK A;  1K8A C;  4FYY B;  5KYU B;  4C8Q C;  2CH4 W;  1Q81 R;  2WAC A;  4FL6 A;  2RI2 A;  4OMN A;  4KH0 B;  3TEE A;  1RAD B;  1M3C A;  4C92 D;  5LJ5 g;  4OP0 A;  1BCM A;  2CS7 A;  1PD0 A;  2QA4 T;  1X6G A;  3M0S A;  4HVV A;  1KQS A;  2OAU A;  4L5G A;  1H64 1;  1ZA1 B;  3PIO A;  1BIA A;  4O6J A;  4FSS A;  3OYN A;  2FZC B;  1DJ7 B;  3CMA A;  3CD6 T;  1NG2 A;  1OX9 A;  3OYM A;  3ME9 A;  4WF2 A;  3URG A;  2PUK B;  2F5K A;  3L2V A;  4F7U F;  5CO7 A;  2CZ0 B;  4BE2 A;  3PVL A;  3JCM W;  1RAH B;  3CCL T;  1XTD A;  1M90 C;  1SPK A;  5FU6 B;  1O75 A;  3INZ A;  4R0K A;  2FYK A;  4IUR A;  3FDR A;  3GNG A;  4V2S A;  2YWW A;  2DIL A;  2YUQ A;  1GFD A;  4RCC A;  2YRD A;  2J06 A;  1TUC A;  1SHG A;  2GBQ A;  2RI3 A;  3AT1 B;  2O2O A;  4M75 D;  2GTJ A;  1YJN Q;  4M7A G;  1YNZ A;  1YJ9 Q;  2Y4X A;  5FLX E;  1NJI C;  1AWX A;  1BBZ A;  2HAX A;  3QPH A;  3I56 A;  5C0M A;  1RI0 A;  4HT9 A;  1VQO T;  3JCM e;  4J83 A;  1WHJ A;  5DY9 A;  3HHT B;  4C0D B;  3D7S B;  4XU0 A;  3VS0 A;  2K7A A;  1BI3 A;  2JS0 A;  1BK2 A;  1VQ4 Q;  1VQ6 T;  3I5S A;  1UJY A;  2EKH A;  1PKS A;  4DBR A;  3QO3 A;  2HSP A;  1BB9 A;  2DMO A;  2NUP A;  2CT4 A;  3MEA A;  3OYF A;  1UE9 A;  1TUG B;  2CYZ B;  4OF1 A;  3S6W A;  3ZL7 C;  1WZO A;  1M1G A;  4M78 E;  2MCN A;  2OTL T;  4C0Z A;  3EGX A;  2GQI A;  1KIK A;  1NLP C;  2PZ1 A;  5GAO m;  1NPR A;  2DJQ A;  1ZSZ B;  2E3I A;  3EAE A;  2CP0 A;  1BU1 A;  5IH2 A;  1TH7 A;  1QVF P;  2VB6 A;  1ABO A;  1Q7Y R;  3LWI A;  4OML A;  4GBQ A;  4M7D F;  3TSZ A;  4E7I A;  1MNE A;  4BY6 B;  3LGL A;  5GJV B;  3RBB B;  3EGU A;  1K73 R;  2ZCF B;  2NWM A;  1ZBX A;  5DM7 R;  2KMT A;  3OSS C;  2RNA A;  4N4I A;  2A0F B;  4Z88 A;  2HQE A;  3LX7 A;  2DO3 A;  2L3Q A;  4QW2 A;  4DOW A;  4J6Y A;  6AT1 B;  2DD4 A;  2ENM A;  2DTO A;  2FPD A;  3F70 A;  2XKO C;  1BYM A;  1EFN A;  4LN2 A;  3NHN A;  4J9E A;  4AFS C;  1XNI A;  1YP5 A;  2KK4 A;  1N27 A;  3HL8 A;  2LCL A;  2DER A;  3V7C A;  4ESR A;  1V76 A;  3MP8 A;  2PQW A;  2HQH A;  1RL2 A;  2EYX A;  4BE1 A;  2EQM A;  2V8I A;  5AYF A;  1VQ9 T;  2RJC A;  2F1L A;  2C0I A;  3CC7 T;  2X9H A;  2DVE A;  2CP7 A;  3HPW A;  3OS5 A;  4P5N A;  4PKC C;  4F7U A;  1QKW A;  4N4G A;  1AOJ A;  3SWN C;  3V7S A;  1IRE B;  3FJP A;  4M75 G;  1OX8 A;  1OI1 A;  2PUO B;  3M57 A;  3H9N A;  2KT1 A;  2C06 A;  4LUE A;  5FW9 A;  1YJW Q;  2QAZ A;  5I21 A;  2NUZ A;  2ZPF B;  3VS5 A;  3FC3 A;  1VQM T;  4BE0 A;  5FRN A;  3CCQ Q;  2M02 A;  3GIB A;  1YJN A;  1QVG A;  1YJ9 A;  3G4S A;  4M7D C;  4B9X A;  3MHX A;  1KHC A;  2COW A;  1K1Z A;  4DBF A;  4M78 C;  1EX4 A;  1RAB B;  3L2U A;  1AT1 B;  1RI9 A;  1ZA2 B;  4IUT A;  1MV3 A;  1HD3 A;  1NYF A;  1PG5 B;  1JXO A;  2A7Y A;  2LNV A;  4DA4 A;  1HK9 A;  2M0O A;  2ZPE B;  1VQ4 A;  1WNL A;  1QVF S;  1YIJ A;  1Q86 U;  4ELZ C;  4HCB A;  3MO8 A;  1R8O B;  1M3B A;  1TWB A;  2BIV A;  1K8A R;  4HT8 A;  3QSU A;  2ABL A;  1YI2 T;  2MYS A;  3RMQ A;  4QQ6 A;  4MDX A;  1H8K A;  5CKH A;  2E3H A;  3VS3 A;  1JB0 E;  5FRO A;  2KRM A;  1ARK A;  3AHU A;  1Y71 A;  1M1F A;  1OUL A;  2DET A;  4C8Q B;  5CVI A;  3NGP A;  3LH5 A;  1YIT Q;  2KRN A;  5J26 A;  5GAN j;  4C5H A;  3FEO A;  3Q1J A;  4LDV A;  3CCS Q;  2LJ3 A;  1G3W A;  3E9F A;  2RD1 A;  3CPW P;  2F2X A;  3CXC A;  1G3S A;  2FB7 A;  4M7D A;  1U06 A;  1ZUU A;  1MMN A;  2EAY A;  2NUP B;  1M90 R;  1ZHI A;  1UHF A;  1OEB A;  1M8M A;  4JUV A;  1QCO A;  2DTH A;  1VYV A;  3G6E A;  4X1V A;  4ELY C;  3H0H A;  5A0G A;  4C0G A;  1JU5 C;  4PLL A;  2K2V A;  5CKB A;  4J9B A;  2DXT A;  3CME T;  1VQ7 T;  1D3B A;  1VQ5 Q;  4LUD A;  1NJI R;  2DM1 A;  5KCH A;  4NL3 A;  1G3Y A;  5LJ5 j;  5KYU A;  2KGT A;  3FJ5 A;  1WQW A;  4WCI A;  1N6A A;  5GMK l;  1VQK Q;  3NFC A;  5CKF A;  4AFQ C;  2GCX A;  2YUN A;  2RM4 A;  5GAM f;  5GAO n;  3MKD A;  3FB9 A;  1XQH A;  4RG2 A;  5I2M A;  3OW2 P;  3S3O A;  1X75 C;  4JRI A;  1TS9 A;  1MGQ A;  2MMP A;  1ZBJ A;  2O31 A;  4AFU C;  1M2V A;  3CCV T;  1CKB A;  4MZM A;  1SG5 A;  1KJW A;  5D7U A;  1TXQ A;  4XTY A;  1H3H A;  9ATC B;  1AZG B;  2DKG A;  3X28 B;  4QVZ A;  1ZX6 A;  2X3W D;  2ZPG B;  4XU2 A;  2DPP B;  1UDL A;  1RLP C;  1WXU A;  2HSE B;  3JRZ A;  3TCJ A;  4BI3 A;  1B07 A;  4ATO A;  3LGF A;  2E70 A;  1VQ9 Q;  2HMA A;  4RMO A;  4ZGJ B;  2GGR A;  1KK7 A;  2YUO A;  3CBP A;  4A4E A;  2QG9 B;  2W0Z A;  4RTW A;  4E7Z A;  1JRI A;  4IIM A;  4BI8 B;  4F7U B;  1MMA A;  1FXX A;  2RI5 A;  4JZ4 A;  2MI6 A;  2FO0 A;  2CUB A;  2E10 A;  5GMK j;  1BKB A;  1NZ9 A;  4PJO F;  3JCM c;  4PJJ A;  5CAI A;  2F2V A;  2X4W A;  4Y28 E;  2XDD A;  2L2P A;  3CPW S;  4LD9 K;  4CI0 C;  1FMK A;  2CP2 A;  2CSI A;  2FL7 A;  2DL5 A;  3E19 A;  3I9Q A;  2FPF A;  1MUZ A;  3OS2 A;  4C5E A;  1FMV A;  1U1S A;  2JN0 A;  2LC4 A;  3EFO B;  1PHT A;  3VS4 A;  1JQQ A;  4OB2 B;  1QW1 A;  3CCU T;  2DIQ A;  1MND A;  4RG8 A;  4M7A E;  4JRQ A;  2DXC A;  4VUB A;  3PE0 A;  1IZ6 A;  1LVK A;  3CCE T;  3VS2 A;  1PD1 A;  2BE9 B;  3I56 Q;  4C8Q F;  3VYH B;  2P0Q A;  3I35 A;  5KYW A;  1YIT A;  1G8X A;  4QQD A;  2ZPB B;  3CCS A;  1ZSZ A;  4J9F A;  3HRS A;  4PFO A;  4CC4 B;  1W2B A;  5LJ3 f;  2AHJ B;  1Q86 C;  4DQ2 A;  1VQ8 T;  2K3B A;  5GMK e;  2DL8 A;  4WTO B;  1VA7 A;  3TQ7 P;  1QKX A;  1K9A A;  1WDX A;  2P4R A;  5I11 A;  2KAF A;  2DYB A;  1JJ2 P;  2FHD A;  2DD5 A;  2EYZ A;  2PU9 B;  3PGG A;  1IHW A;  2F69 A;  4FCY A;  3SWN B;  1VQ5 A;  2BUD A;  3PTA A;  4JZ3 A;  3M58 A;  4DBH A;  2CGH A;  1B7T A;  2FG0 A;  2JW4 A;  5A0D A;  5FWB A;  4KUI A;  1KC8 R;  3UPU A;  1GCP A;  4CC7 A;  4RTY A;  5IAY A;  2RJF A;  1VQK A;  1GFC A;  3JCM P;  3EFR A;  4M7D B;  2DTI A;  2XHC A;  2PVO B;  1YCS B;  2E5K A;  4M77 D;  2LP5 A;  1LJO A;  3OS1 A;  2VC8 A;  2JS2 A;  3JB9 D;  2M0Y A;  2K3X A;  2OTJ T;  2JM9 A;  4J9H A;  5I22 A;  2QGG A;  5LJ3 h;  1NLO C;  5A2Q E;  4E7L A;  1N8R U;  4ZNX A;  3IQL A;  4C92 E;  4LDU A;  1I5L A;  2P4T A;  1BI0 A;  2VWF A;  1D3B B;  1UGS B;  3A1P A;  2I0N A;  3ER0 A;  3BFM A;  4ZGE B;  4IUV A;  2LCC A;  2F2W A;  3CCM Q;  2X35 A;  1FMW A;  3OMG A;  5HKC A;  1SKU B;  1CKA A;  2QTV A;  4F04 B;  3MEV A;  2HNI A;  5CR2 A;  1Y7X A;  4XTW A;  1W4S A;  3OYA A;  3VRZ A;  2JTE A;  3M55 A;  2LQN A;  4XTV A;  1VQ9 A;  2O9S A;  4EMG A;  1PSE A;  2VXE A;  2YLC A;  5EC7 A;  3M0Q A;  2EQK A;  3HSB A;  3CC7 A;  5KYX B;  4E7H A;  2O9V A;  1S72 T;  3MET A;  1UEB A;  1I1J A;  1M2V B;  3VS1 A;  2ECZ A;  3JB9 H;  5KYY A;  1YWP A;  1PM3 A;  2EGA A;  3CCV Q;  3CBM A;  2KYB A;  4AG1 C;  1SHF A;  1LPL A;  2FPE A;  4M75 E;  2IG0 A;  1K9M C;  2RQU A;  1KD1 C;  2DEU A;  3GPL A;  2EQJ A;  4PJO A;  1I4K 1;  3QYG B;  3BDL A;  2NYS A;  8AT1 B;  1X2K A;  3V7R A;  3E1S A;  3RER A;  4OGE A;  5GMK i;  3M0U A;  2MAM A;  3KFV A;  4XQ3 A;  4E2F B;  1Q82 U;  3GOX A;  3M0R A;  2QQS A;  5CQY A;  3EH1 A;  5D6W A;  3G4S Q;  5LL6 S;  3DKM A;  4EPC A;  1JJ2 S;  2QQ9 A;  3UF4 A;  1W1F A;  1NBE B;  3VV0 A;  3FIF A;  2DL3 A;  1LNX A;  4ORZ A;  4C8Q A;  2YXY A;  4OMO A;  4D8K A;  1NYG A;  4J5Y A;  5GAN f;  3CEY A;  4GY5 A;  1Q81 U;  1IGU A;  2EGE A;  2BTT A;  1NEG A;  1YIJ Q;  2YRV A;  1VOM A;  1IXD A;  1TOV A;  1HSQ A;  1XJW B;  5GAN 4;  1I0C A;  1ZSG A;  2EBP A;  2DA9 A;  1YBY A;  2KI7 A;  1U8R A;  3JCM J;  1Q95 G;  2KSS A;  2OAW A;  3CCR Q;  2LJ1 A;  4FYW B;  1M2O A;  2KQW A;  3I55 T;  4JJC A;  3ZEH A;  1ZUY A;  4M77 G;  5KYW B;  2DK3 A;  2MOX A;  1M3A A;  3CCJ Q;  2DX1 A;  3TVT A;  3JB9 G;  1B34 B;  2F5T X;  4FT4 A;  2RHX A;  1OU9 A;  2DFU A;  1VQN T;  4RTV A;  4PK4 A;  2XG8 D;  3QKJ A;  5LJ5 f;  3H6Z A;  5GJW B;  1LCK A;  4M78 F;  1VUB A;  1C6V X;  2DE0 X;  5IXF A;  1M1K R;  3X26 B;  4E6R A;  3M56 A;  3TU4 K;  2QEX T;  2MF2 A;  3DLM A;  3GLX A;  1VYU A;  1C1A A;  1MMG A;  1N9R A;  2CP6 A;  1BCO A;  1E6G A;  4C92 G;  3L2R A;  1WX6 A;  3G6E Q;  1B3Q A;  2QQB A;  4M7D D;  1P92 A;  2EGC A;  1WHG A;  3CBO A;  3G7Z A;  4A4F A;  2B86 A;  2K2M A;  4M75 C;  3RKW A;  1V1C A;  3CME A;  1TSF A;  2RHZ A;  3REA B;  3CCM A;  4JRK A;  2HCK A;  1WXT A;  1VQL Q;  1PCX A;  1VYT A;  2COZ A;  4RTZ A;  3SD4 A;  2RHI A;  2YSQ A;  2K79 A;  2K4Y A;  4A54 A;  2D1X A;  3ZFJ A;  1OZ2 A;  4Y92 A;  2YHT A;  3THK A;  3KXT A;  4PFP A;  3DB4 A;  4UC4 A;  1YFN A;  2OTJ Q;  2JXB A;  1N8R C;  3EHR A;  1YHQ Q;  3CCV A;  1WHM A;  2L8D A;  3G1J A;  1KQ2 A;  2CT3 A;  1UHC A;  2CSQ A;  1QP3 A;  1X2Q A;  3EG0 A;  3PNW C;  1PNJ A;  1PRM C;  3CMA T;  1M30 A;  4IUU A;  2FEI A;  2A37 A;  1MHN A;  2O88 A;  2PVD B;  5DLQ E;  4AMC A;  2HKQ B;  1Q7Y U;  2V8J A;  4B6M A;  5CIU A;  2ZPH B;  2QA4 Q;  2CZ6 B;  3JCM V;  2YRC A;  2VVK A;  2EFI A;  3EFO A;  3JCM X;  4XTZ A;  2DZ9 A;  3X25 B;  1MMD A;  1K73 U;  3OYK A;  1WQ7 A;  3CD6 Q;  1FYN A;  4HA8 A;  3QHS A;  4J6W A;  3JCM g;  5KYY B;  1E6H A;  1G83 A;  2X4Y A;  3P8B B;  2DRM A;  3M0T A;  5HK0 A;  1TTH B;  2PTK A;  2COY A;  3CCL Q;  4X9D A;  4OGC A;  4LNP A;  4B9W A;  1PC0 A;  4PJO B;  1M27 C;  2RQV A;  1RUW A;  2RF0 A;  4HXJ A;  5DLO A;  3RMS A;  2CP5 A;  2EYW A;  4ZGD B;  2ZAE A;  5FU7 C;  4ZN3 A;  4JRP A;  1KSW A;  4J7F A;  3QYH B;  1X6O A;  2DL4 A;  3M0P A;  5KE2 A;  3CCR A;  3WXM B;  5KCO A;  5GAN 6;  1U5S A;  3SWN A;  3CCJ A;  5CKE A;  4KUD K;  3CC2 T;  2X4J A;  1VQO Q;  3JB9 J;  3PT9 A;  4HVU A;  2FRW A;  4DEY A;  1KFZ A;  4QT7 A;  3R6O A;  4M7D G;  3CPW A;  5HK3 A;  4DOV A;  5L23 A;  1LOJ A;  4OMM A;  3X24 B;  2V1Q A;  1VQ6 Q;  3MP6 A;  3EG9 B;  4OVA A;  4Q5W A;  4M78 A;  3JCM b;  2HBW A;  4Y91 A;  1K9M R;  2KRO A;  3C12 A;  5J3B A;  1KD1 R;  2NLU A;  1T3L A;  3G71 T;  1WHH A;  2DEQ A;  2KE9 A;  3UDC A;  4M4Z A;  2P0P A;  3JSC A;  3MP1 A;  5GAN 2;  1H3Z A;  3VS7 A;  1W6X A;  2HL5 C;  3GBQ A;  3I55 Q;  2OTL Q;  1RAF B;  2EJG A;  1VQL A;  3EGD A;  3OYI A;  2SRC A;  2LNH B;  3UA7 A;  4LE9 A;  1D1C A;  2AT1 B;  2BE7 D;  3BW1 A;  3EG1 A;  1UG1 A;  2EVR A;  5IT9 E;  2GQV A;  4GLM A;  4IKF A;  3QII A;  1WI7 A;  4PNO A;  4LDX A;  1FWZ A;  3J80 E;  2L0A A;  2J05 A;  2E65 A;  2OTJ A;  4C0D C;  1R77 A;  1QVP A;  3M53 A;  1T3S A;  2AKK A;  1YHQ A;  5KYX A;  1Z9Z A;  2LT4 A;  3JCM f;  1K76 A;  3P8D A;  4K11 A;  4PFZ A;  2AZS A;  3HRU A;  3E2U A;  1AHJ B;  2KXD A;  3I5R A;  1WJR A;  3EG2 A;  4IUQ A;  3PIP A;  2QA4 A;  2RMO A;  3JV3 A;  2P0K A;  4PJL A;  2JUF A;  1KHI A;  1BIB A;  5A0L A;  2R5A A;  1I8F A;  5GAO p;  1RAE B;  3CD6 A;  2A28 A;  3TRE A;  4BD3 A;  2YDL A;  1AZE A;  4A63 B;  5GMK m;  2DIG A;  2RA2 A;  1QLY A;  3RR6 A;  3CC7 Q;  5FRM A;  1ZQ1 A;  3KBG A;  1ZUK A;  4IIO A;  1A0N B;  2XIC A;  2EQU A;  1YJN T;  5GAM h;  3CCL A;  4F14 A;  5GAM d;  3OYG A;  1NJI U;  2D8J A;  1QWF A;  2QQA A;  3LH0 A;  2XU8 A;  2K5L A;  3MCA B;  2LMJ A;  2H3E B;  3A8H B;  2R58 A;  1D1B A;  1VQM Q;  4JJB A;  4MZP A;  3OYL A;  3MEW A;  2QDY B;  2HL3 A;  4FYV B;  4PJO D;  2M51 A;  4FW1 A;  5IXB A;  3QZ5 B;  1VQ4 T;  1U3O A;  1D0X A;  1KQ1 A;  4M75 B;  3HP9 A;  1VQO A;  2OJ2 A;  1IHV A;  2JMC A;  3O5Z A;  4JJN K;  5GAN 7;  2LCS A;  1B34 A;  3T9N A;  2HD0 A;  1N8R R;  4M7A F;  1D0Y A;  3V8L A;  5IN1 A;  3S3M A;  1VQ6 A;  2KRS A;  3M4Y A;  4C8Q D;  2I2L A;  2BZ8 A;  4PJM A;  1VQP T;  3REB B;  4LDW A;  2L3S A;  3OA6 A;  1K0S A;  3ASK A;  3S3N A;  4A4G A;  4ZTJ A;  2RO0 A;  1YI2 Q;  3OW2 S;  3X20 B;  1PSF A;  1W2B P;  1WHL A;  1XOV A;  2XK0 A;  3HTR A;  3I55 A;  2OTL A;  1KG1 A;  2LQW A;  4PJN A;  1QCF A;  2DXU A;  2PVG B;  4E7S A;  2DL7 A;  2QYZ A;  4QQG A;  4M77 E;  3CC2 Q;  1N9S A;  2JJ9 A;  2J6F A;  2R57 A;  3P8H A;  4HCC A;  4BB7 A;  2HBP A;  3A5Z B;  4N4H A;  1WYX A;  4OMF B;  2XD0 A;  2DYI A;  3L2Q A;  1X43 A;  2YUP A;  4M78 B;  1S1N A;  3NTI A;  2WSF E;  3HFN A;  3JB9 I;  2GF7 A;  4RCB A;  3L1A A;  5I2S A;  1NE8 A;  3OBW A;  1YN8 A;  2MPX C;  1WHK A;  4OB0 B;  1WIE A;  3DB3 A;  2BZY A;  3G71 Q;  4ZN1 A;  5LJ3 d;  2J7I A;  4YTL A;  2CDT A;  1WGS A;  3EGD B;  2X51 A;  1UEC A;  3CME Q;  1VQ7 Q;  4A4H A;  4C5I A;  2HKN A;  4PL6 A;  1T0H A;  1NM7 A;  1V29 B;  2RHY A;  2HEQ A;  4NS5 A;  4C92 F;  4J9G A;  1OPL A;  5FU7 B;  2K5F A;  2L89 A;  2X3X D;  4M7A C;  1D09 B;  1SSH A;  2R5M A;  4R56 A;  2LRQ A;  1AWJ A;  2VGN A;  1WJS A;  3OYC A;  1O9S A;  2FRY A;  4J6X A;  2K57 A;  1YJW T;  2ZZD A;  5IHN A;  2JM8 A;  4MML A;  3CCQ T;  2JZ2 A;  4F7U E;  8ATC B;  4AT1 B;  2LJ0 A;  1KQS P;  3QUI A;  4NL2 A;  5GAM j;  2WSC E;  2QXF A;  4XU1 A;  5L8R E;  3QJ6 A;  4PJO G;  3NMZ C;  2DZC A;  3SB2 A;  1KC8 U;  1X69 A;  1VQM A;  4A53 A;  1JBM A;  5GAN 8;  2H3J A;  1BI2 A;  1QMC A;  2ED1 A;  4M75 F;  2RQR A;  5AT1 B;  4M77 C;  3RKX A;  1W2B S;  4C8Q G;  1RAC B;  2KVQ G;  1JEG A;  2QTX A;  2L5Q A;  4A4K A;  1UUE A;  2EWN A;  3H41 A;  3CC4 T;  1OPK A;  1X6B A;  4EIK A;  1T0J A;  3OBY A;  1IRX A;  5GAO l;  2NUT A;  1NPP A;  5GAM e;  3OYY A;  4M7A A;  2IVW A;  2Y4Y A;  1Y07 A;  3EG9 A;  5HCK A;  3M59 A;  2RPN A;  4C92 C;  1YIT T;  4J9C A;  1YI2 A;  2GFU A;  4KGV B;  3CCS T;  5C6S A;  1OYX A;  2HZY A;  3QDR B;  1I5O B;  1OU8 A;  1BI1 A;  5IHK A;  2EYY A;  3L2W A;  1U1T A;  4EMK C;  2A08 A;  2D0N A;  3CCU Q;  2V8K A;  2KY9 A;  3CCE Q;  3CC2 A;  2W10 A;  2E12 A;  2DBK A;  3QBY A;  2GTO A;  4O5V A;  3EG3 A;  2XDP A;  3QG1 A;  2O4X A;  2RN8 A;  5CK9 A;  1Y0M A;  3SDZ A;  2P84 A;  4HVW A;  2XID A;  3OSV A;  1QVF A;  3H8Z A;  3GF5 A;  2DLP A;  1G3T A;  2AK5 A;  1IO6 A;  4M7D E;  4TVR A;  1VQ5 T;  1VQ8 Q;  2KDS A;  2EJ9 A;  3WVD B;  1VQP Q;  3J81 E;  2GNC A;  4RTT A;  3VYG A;  4RKU E;  4M77 A;  3G71 A;  4CRI A;  1Y57 A;  1TUD A;  4QVC A;  4D8D A;  2MWP A;  2CUD A;  4F16 A;  5LJ3 j;  4JLI A;  5GAN h;  4M78 D;  5GAN d;  1VQK T;  1JXM A;  1VQ7 A;  5ECA A;  3OYH A;  5D6X A;  1KQS S;  2RK1 A;  2X4X A;  3LYI A;  2QI2 A;  2LQK A;  2RK2 A;  1ABQ A;  1OZ3 A;  2E6N A;  3MPU B;  1Z9Q A;  2JTF A;  3PVQ A;  1RAI B;  1QWE A;  2SEM A;  1YCY A;  1R0B G;  2VV5 A;  3ULR B;  4FIB A;  2MK5 A;  4MZT A;  2Z0W A;  2RJD A;  3QJY A;  4C92 A;  3EHQ A;  3MJX A;  4DEX A;  1I81 A;  2EQI A;  2EIF A;  4RUG A;  2CRE A;  4EMK A;  4OMQ A;  5M9O A;  4XK8 E;  1R0C B;  1Q86 R;  2CP3 A;  2HQX A;  5LJ5 h;  4F7U G;  5LJ5 d;  2JNG A;  4RTU A;  2JT4 A;  2DF6 A;  3M9Q A;  2VXF A;  2DNU A;  3UWN A;  1OV3 A;  5LJ3 e;  1K4U S;  1GCQ C;  2BKD N;  2YLB A;  4RTX A;  4BDZ A;  3OYJ A;  1QP2 A;  3SEM A;  4C5G A;  1TG0 A;  2L3P A;  2E64 A;  1QQJ A;  3HFO A;  4HCK A;  2C0T A;  2G6F X;  1WJQ A;  4XTX A;  2JOY A;  3A8M B;  3PMI A;  5GAO r;  3BY7 A;  2MIO A;  3A8L B;  2RH2 A;  7AT1 B;  2VUB A;  2LT1 A;  1M1K U;  2DBM A;  1G2B A;  1UJ0 A;  4XU3 A;  2GFA A;  3C94 A;  2DXB A;  4II1 A;  2K9G A;  4M75 A;  2LX9 A;  3PMT A;  4J8O A;  4F17 A;  2M1H A;  4J9I A;  5CCA A;  5FWC A;  2AZV A;  4HCZ A;  1S72 Q;  4J7I A;  1QVG P;  1UFF A;  3GP8 A;  1AWO A;  2OX7 A;  2Y90 A;  1HJD A;  3WVE B;  1ZLM A;  2WSE E;  5GAM g;  1KC8 C;  2LVM A;  1WLP B;  2DVJ A;  3QDF A;  3I56 T;  4X9C A;  3A8G B;  3OQ5 A;  4E7J A;  2JVV A;  5GAN 3;  3VUZ A;  3VRY A;  2RQT A;  1Q82 C;  3C4S A;  3FRN A;  1SRL A;  1UB4 A;  3CCU A;  3E9G A;  3TSW A;  2A3L A;  4BUG A;  5GMK h;  3CCE A;  4LD6 A;  1VIF A;  4NOY A;  2XDB A;  2ZGW A;  2EPD A;  1EIF A;  1GCQ A;  2KYM A;  1PRL C;  4AFZ C;  1PWT A;  1IGQ A;  1Y96 A;  2J6K A;  4PLI A;  2E1H A;  5D6Y A;  1UGP B;  3VU3 C;  1QCN A;  3CC4 Q;  2NUT B;  2XMF A;  2D8H A;  2KR3 A;  4M78 G;  4M7A B;  2RB6 A;  4ANJ A;  2KEA A;  1Q81 C;  1VQ8 A;  2B8A A;  2CZ1 B;  1TU0 B;  1VQP A;  2M16 A;  2VAS A;  3RKY A;  1WPY A;  1IB8 A;  1NEB A;  2D0Q B;  2LX7 A;  3CXC P;  2KNB B;  4D6W A;  1X27 A;  3CPF A;  3RNJ A;  2V1R A;  5FU6 C;  4E47 A;  4KUL A;  2D9T A;  2ROL A;  2J6O A;  3C95 A;  1HYO A;  1M8V A;  4JS4 A;  3DLL A;  2O4X B;  1VIE A;  3FLG A;  3H0I A;  1M4Z A;  3KUF A;  4KGX B;  2V26 A;  3QZ9 B;  3PFS A;  1UGR B;  1VQN Q;  3BDU A;  1AD5 A;  4LXC A;  4FSX A;  2E6Z A;  3EGX B;  3RDV A;  3A98 A;  3OB9 A;  3JCM Q;  1GL5 A;  1YWO A;  1AWW A;  3NPF A;  3CCM T;  1K8A U;  2KXC A;  1SEM A;  4CC3 A;  2QEX Q;  4M77 B;  2K3Y A;  3OW2 A;  4FW2 A;  5GAN 5;  3UAT A;  4EDU A;  1AEY A;  1GRI A;  4CC2 A;  2A36 A;  1J3T A;  2H8H A;  4L6V 5;  1HXD A;  5LJ3 g;  5GAN e;  1RAA B;  2DJZ A;  5J39 A;  3VJP A;  1QVG S;  1F1B B;  4DBQ A;  1AVZ C;  4KT0 E;  2EJF A;  2QK0 A;  4Z8A A;  3UT1 A;  2YT6 A;  3M54 A;  3NTH A;  2VYT A;  2O01 E;  2KBT A;  4MMK A;  2L3R A;  2RHU A;  4LDY A;  3RUX A;  2RQW A;  1SF9 A;  4C92 B;  3HKS A;  2D6F A;  4JLG A;  2KT8 A;  1ACM B;  2ROT A;  2LDM A;  4EMK B;  1W70 A;  2FZK B;  3SHW A;  1M90 U;  1K9M U;  1YJW A;  4FU6 A;  1ZSZ C;  4ME7 A;  4Z89 A;  1KD1 U;  3VKI A;  1S72 A;  4QVD A;  3CCQ A;  3QXE B;  1M5Q 1;  4AG2 C;  5KE3 A;  5LJ5 e;  5GAO q;  1WXB A;  2XI9 A;  1GBR A;  1RAG B;  2VKN A;  4KBM B;  1YJ9 T;  1E7O A;  2QGF B;  3G4S T;  3O8V A;  4BY6 C;  5CKD A;  3OYB A;  2HDA A;  4JPB W;  3LWH A;  3A8O B;  4PJO E;  2LZ6 B;  4OB1 B;  4ZTF A;  3CMA Q;  3JCM h;  2JMA A;  3JCM d;  2RJE A;  4IUP A;  4OB3 B;  1Q7Y C;  1I07 A;  3RES A;  1K0X A;  3SFM A;  4XAX B;  1M1K C;  4KGZ B;  4FM4 B;  1X01 A;  4L59 A;  1K73 C;  2E41 A;  2FVU A;  2ESW A;  3OYD A;  2EKO A;  3L2Z A;  1SSF A;  3CXC S;  3OS0 A;  1YIJ T;  2EW3 A;  1UTI A;  5KH6 A;  3OMC A;  4N0A C;  1G5V A;  4C8Q E;  3R6N A;  3HRT A;  1UGQ B;  3CC4 A;  4R55 A;  4EMH A;  3M5A A;  1GXI E;  3H0F A;  3OYE A; 
#chains in the Genus database with same CATH homology
 3ZFJ A;  2VGM A;  1OZ2 A;  1ZHI A;  4FT2 A;  1VQM A;  4JUV A;  2DTH A;  4A53 A;  3N5B B;  3G6E A;  1JBM A;  3CCR T;  4ELY C;  2DAQ A;  5GAN 8;  4E7K A;  2H3J A;  2YHT A;  1BI2 A;  3KXT A;  5A0G A;  4C0G A;  4HKE A;  3CCJ T;  3DB4 A;  3JAM E;  4PLL A;  2K2V A;  4UC4 A;  5CKB A;  3NTK A;  4M75 F;  2DXT A;  3CME T;  1N8R C;  1VQ7 T;  1D3B A;  4M7A D;  4M77 C;  3CCV A;  3RKX A;  1W2B S;  2L8D A;  2LQ8 A;  3V8J A;  4C8Q G;  5CQX A;  1KQ2 A;  1JJ2 A;  1M9S A;  2KVQ G;  5KCH A;  4NL3 A;  1QP3 A;  1G3Y A;  2QTX A;  5LJ5 j;  2L5Q A;  1WQW A;  3PNW C;  4X34 A;  4A4K A;  2EWN A;  2MWO A;  3OY9 A;  4C0F A;  2EYQ A;  3CC4 T;  1N6A A;  1Y96 B;  2LTO A;  3CMA T;  4IUU A;  2QQR A;  3OBY A;  5GMK l;  1MHN A;  2PVD B;  5GAO l;  4JDS A;  5DLQ E;  3NFC A;  1NPP A;  1VQN A;  5GAM e;  5CKF A;  1Q7Y U;  2GCX A;  2V8J A;  2RM4 A;  3OYY A;  3VUB A;  3G6E T;  5CIU A;  5GAM f;  5GAO n;  3FB9 A;  4M7A A;  2IVW A;  2ZPH B;  1XQH A;  2CZ6 B;  4RG2 A;  5I2M A;  3JCM V;  3LW5 E;  2Y4Y A;  1Y07 A;  2EFI A;  2JTM A;  3EFS A;  1VQ5 A;  3JCM X;  4XTZ A;  2DZ9 A;  3X25 B;  3S3O A;  3RIR A;  1K73 U;  3M59 A;  3OYK A;  1X75 C;  4C92 C;  1YIT T;  1WQ7 A;  1YI2 A;  3LLR A;  4GLK A;  4JRI A;  2GFU A;  4BI4 A;  3CCS T;  2QEX A;  1MGQ A;  5C6S A;  1OYX A;  2MMP A;  3QDR B;  1BI1 A;  4M77 F;  1VQL T;  4HA8 A;  3QHS A;  4BAC A;  3L2W A;  3CCV T;  4J6W A;  3M4G A;  1U1T A;  4MZM A;  4EMK C;  3JCM g;  3JB9 F;  2V8K A;  2KY9 A;  4BDY A;  4MDW A;  4XTY A;  2X4Y A;  1FX7 A;  3P8B B;  4N0A A;  2DKG A;  4XTU A;  3X28 B;  5GAN g;  4QVZ A;  3CC2 A;  2E12 A;  5HK0 A;  3QBY A;  2E5Q A;  4O5V A;  3ZBD A;  4Z02 A;  4JS5 A;  2XDP A;  2ZPG B;  3QG1 A;  4PJO C;  2O4X A;  5CK9 A;  4X9D A;  4OGC A;  4XU2 A;  4B9W A;  2DPP B;  4PJO B;  2K5I A;  3SDZ A;  3L42 A;  2XID A;  3OSV A;  1QVF A;  3H8Z A;  5DLO A;  3GF5 A;  3JRZ A;  1G3T A;  3RMS A;  3TCJ A;  4BI3 A;  4M7D E;  4ATO A;  4ZGD B;  3LGF A;  4TVR A;  5FU7 C;  3V8K A;  4ZN3 A;  2E70 A;  1VQ5 T;  1YHQ T;  3MEU A;  4JRP A;  2KDS A;  4J7F A;  3J7A F;  2EJ9 A;  4RMO A;  3QYH B;  4ZGJ B;  2G3R A;  3WVD B;  1X6O A;  3GNF B;  5HY6 A;  3CBP A;  4A4E A;  5KE2 A;  3J81 E;  3CCR A;  3WXM B;  5KCO A;  5GAN 6;  2M9U A;  3VYG A;  4RKU E;  1JRI A;  2CZ7 B;  4BI8 B;  4M77 A;  4F7U B;  4CRI A;  3G71 A;  1FXX A;  2ZPI B;  5EG2 A;  4QVC A;  2MWP A;  5LJ3 j;  4JLI A;  2RI5 A;  5GAN h;  1K8A C;  2CKK A;  3SWN A;  3CCJ A;  4C8Q C;  5CKE A;  2WAC A;  4FL6 A;  2RI2 A;  4M78 D;  5GAN d;  4KUD K;  3TEE A;  1VQK T;  4C92 D;  2MI6 A;  3CC2 T;  2X4J A;  2E10 A;  5GMK j;  1VQ7 A;  5LJ5 g;  1BKB A;  1NZ9 A;  4OP0 A;  4PJO F;  3JCM c;  3PT9 A;  5D6X A;  5CAI A;  3OYH A;  3JB9 J;  2X4W A;  4Y28 E;  2RK1 A;  2X4X A;  2XDD A;  1KQS S;  3CPW S;  4LD9 K;  2CS7 A;  2QA4 T;  4M7A E;  4CI0 C;  3R6O A;  3LYI A;  2QI2 A;  2LQK A;  2FL7 A;  2RK2 A;  1KQS A;  1OZ3 A;  4M7D G;  2E6N A;  2OAU A;  3E19 A;  5HK3 A;  4DOV A;  3CPW A;  4L5G A;  1H64 1;  3PIO A;  1LOJ A;  1BIA A;  2JTF A;  4C5E A;  3OS2 A;  3X24 B;  1U1S A;  2JN0 A;  2LC4 A;  3MP6 A;  1YCY A;  2VV5 A;  4O6J A;  4OVA A;  3OYN A;  1DJ7 B;  3CMA A;  3CD6 T;  4Q5W A;  4M78 A;  3JCM b;  4FIB A;  3OYM A;  3ME9 A;  4Y91 A;  4MZT A;  4WF2 A;  3QJY A;  2RJD A;  4C92 A;  4OB2 B;  3URG A;  2PUK B;  1QW1 A;  2F5K A;  2DIQ A;  4RG8 A;  4F7U F;  3C12 A;  5J3B A;  5CO7 A;  3L2V A;  2DXC A;  3CCU T;  4JRQ A;  2CZ0 B;  4VUB A;  1IZ6 A;  1I81 A;  4BE2 A;  2NLU A;  3JCM W;  2EIF A;  3G71 T;  3CCE T;  2DEQ A;  3UDC A;  4EMK A;  2P0P A;  4C8Q F;  3VYH B;  3JSC A;  4XK8 E;  3MP1 A;  5M9O A;  5GAN 2;  2HQX A;  2P0Q A;  5LJ5 h;  4F7U G;  3CCL T;  1YIT A;  1H3Z A;  4QQD A;  1XTD A;  2JNG A;  2ZPB B;  5LJ5 d;  3CCS A;  1M90 C;  5FU6 B;  3HRS A;  1O75 A;  3INZ A;  2EJG A;  2FYK A;  1VQL A;  3M9Q A;  2VXF A;  3OYI A;  3UWN A;  5LJ3 e;  4IUR A;  3FDR A;  1W2B A;  2BKD N;  3GNG A;  5LJ3 f;  2YLB A;  4V2S A;  4BDZ A;  2AHJ B;  1Q86 C;  3OYJ A;  4RCC A;  4DQ2 A;  1VQ8 T;  1QP2 A;  2RI3 A;  4C5G A;  5GMK e;  3BW1 A;  4M75 D;  4M7A G;  5IT9 E;  2E64 A;  3HFO A;  2GQV A;  4IKF A;  1YHQ A;  2Y4X A;  5FLX E;  1WJQ A;  4XTX A;  3QII A;  1NJI C;  2JOY A;  2HAX A;  3QPH A;  3A8M B;  3PMI A;  3I56 A;  2KAF A;  4PNO A;  3BY7 A;  3A8L B;  5GAO r;  4LDX A;  1FWZ A;  2RH2 A;  3J80 E;  2VUB A;  2LT1 A;  2E65 A;  2DD5 A;  2FHD A;  2PU9 B;  5C0M A;  3PGG A;  1RI0 A;  1M1K U;  4HT9 A;  2OTJ A;  2F69 A;  1VQO T;  4C0D C;  3SWN B;  3JCM e;  1QVP A;  2GFA A;  3C94 A;  3M53 A;  2BUD A;  4J83 A;  2DXB A;  4XU3 A;  4II1 A;  5DY9 A;  3M58 A;  3PTA A;  2CGH A;  2LT4 A;  3HHT B;  3JCM f;  4C0D B;  4XU0 A;  3P8D A;  4M75 A;  2LX9 A;  3PMT A;  4J8O A;  2M1H A;  5CCA A;  4HCZ A;  5A0D A;  1BI3 A;  4KUI A;  3UPU A;  1VQ6 T;  4J7I A;  3HRU A;  1AHJ B;  3GP8 A;  5IAY A;  2RJF A;  2Y90 A;  1VQK A;  3JCM P;  3WVE B;  3EFR A;  3QO3 A;  4M7D B;  2WSE E;  1WJR A;  5GAM g;  2DTI A;  2XHC A;  2PVO B;  3MEA A;  4IUQ A;  3PIP A;  3OYF A;  4M77 D;  2QA4 A;  1KC8 C;  2LVM A;  1LJO A;  2P0K A;  3OS1 A;  2CYZ B;  2VC8 A;  2JUF A;  1KHI A;  1BIB A;  4OF1 A;  5A0L A;  3I56 T;  3JB9 D;  4X9C A;  3S6W A;  3A8G B;  1M1G A;  2R5A A;  3OQ5 A;  1I8F A;  2K3X A;  5GAO p;  4E7J A;  2OTJ T;  2JVV A;  5GAN 3;  3CD6 A;  3VUZ A;  4M78 E;  3TRE A;  4BD3 A;  5LJ3 h;  4C0Z A;  3C4S A;  3FRN A;  5A2Q E;  4E7L A;  1Q82 C;  1N8R U;  2OTL T;  1I5L A;  4C92 E;  4LDU A;  1UB4 A;  2P4T A;  5GMK m;  2DIG A;  5GAO m;  2RA2 A;  3CCU A;  1BI0 A;  1NPR A;  3E9G A;  1D3B B;  2A3L A;  1UGS B;  3EAE A;  4BUG A;  5FRM A;  5GMK h;  1ZQ1 A;  3ER0 A;  3KBG A;  3BFM A;  4ZGE B;  4LD6 A;  1TH7 A;  3CCE A;  1VIF A;  4NOY A;  2XDB A;  4IUV A;  2ZGW A;  2XIC A;  2EQU A;  2LCC A;  1YJN T;  1EIF A;  3LWI A;  2X35 A;  5GAM h;  3CCL A;  4M7D F;  3OMG A;  5HKC A;  1Y96 A;  4E7I A;  5GAM d;  3OYG A;  1NJI U;  4PLI A;  4BY6 B;  3LGL A;  2E1H A;  3MEV A;  5D6Y A;  1UGP B;  2HNI A;  3VU3 C;  5CR2 A;  2QQA A;  2ZCF B;  3LH0 A;  2XU8 A;  2K5L A;  1Y7X A;  4XTW A;  1W4S A;  3MCA B;  1ZBX A;  5DM7 R;  3A8H B;  4M78 G;  2R58 A;  4M7A B;  3OYA A;  2KMT A;  2RB6 A;  1Q81 C;  3M55 A;  4XTV A;  1VQ8 A;  1VQ9 A;  3OSS C;  4EMG A;  2B8A A;  2CZ1 B;  1PSE A;  2VXE A;  4N4I A;  4MZP A;  2YLC A;  2HQE A;  3OYL A;  1VQP A;  3LX7 A;  2M16 A;  2QDY B;  2EQK A;  3MEW A;  3HSB A;  3CC7 A;  4E7H A;  4PJO D;  2DO3 A;  3RKY A;  1S72 T;  1WPY A;  3QZ5 B;  4QW2 A;  1VQ4 T;  4M75 B;  1KQ1 A;  4J6Y A;  4DOW A;  2D0Q B;  3MET A;  1UEB A;  2DD4 A;  3JB9 H;  3HP9 A;  2DTO A;  1VQO A;  3F70 A;  2XKO C;  4D6W A;  1BYM A;  3CBM A;  3CPF A;  5FU6 C;  4E47 A;  5GAN 7;  4JJN K;  4KUL A;  4M75 E;  2IG0 A;  1K9M C;  1XNI A;  1B34 A;  2D9T A;  3C95 A;  2KK4 A;  1N27 A;  1KD1 C;  1M8V A;  3HL8 A;  3GPL A;  2EQJ A;  4JS4 A;  3DLL A;  2O4X B;  2LCL A;  1I4K 1;  1VIE A;  3FLG A;  3BDL A;  3QYG B;  2HD0 A;  3T9N A;  4M7A F;  4PJO A;  1M4Z A;  3KUF A;  3V7C A;  5IN1 A;  3V8L A;  3S3M A;  1VQ6 A;  3MP8 A;  3V7R A;  3M4Y A;  3E1S A;  2PQW A;  3RER A;  3QZ9 B;  4OGE A;  5GMK i;  1RL2 A;  3PFS A;  1UGR B;  4BE1 A;  2MAM A;  2EQM A;  2V8I A;  4C8Q D;  2I2L A;  3BDU A;  4XQ3 A;  5AYF A;  1VQ9 T;  1Q82 U;  3GOX A;  2RJC A;  4FSX A;  2QQS A;  5CQY A;  1VQP T;  2E6Z A;  5D6W A;  4LDW A;  3CC7 T;  3OA6 A;  5LL6 S;  3DKM A;  3ASK A;  3OB9 A;  2DVE A;  3JCM Q;  3S3N A;  3HPW A;  4EPC A;  1JJ2 S;  4A4G A;  4ZTJ A;  2RO0 A;  3OS5 A;  4P5N A;  4PKC C;  4F7U A;  3X20 B;  3CCM T;  2QQ9 A;  3OW2 S;  1K8A U;  1PSF A;  4M77 B;  4N4G A;  2K3Y A;  3SWN C;  3V7S A;  1IRE B;  3OW2 A;  1XOV A;  3FJP A;  4M75 G;  3VV0 A;  5GAN 5;  3FIF A;  2XK0 A;  4EDU A;  3I55 A;  2OTL A;  1LNX A;  1OI1 A;  4C8Q A;  1KG1 A;  2PUO B;  3M57 A;  2C06 A;  2DXU A;  4L6V 5;  1HXD A;  5LJ3 g;  2PVG B;  5GAN e;  4QQG A;  5I21 A;  2DJZ A;  2ZPF B;  5J39 A;  4M77 E;  4J5Y A;  3FC3 A;  5GAN f;  1N9S A;  3VJP A;  1QVG S;  1VQM T;  3CEY A;  4GY5 A;  2R57 A;  3P8H A;  4KT0 E;  4BE0 A;  1Q81 U;  2EJF A;  4HCC A;  5FRN A;  3UT1 A;  4BB7 A;  1YJN A;  3GIB A;  1QVG A;  2HBP A;  1YJ9 A;  3A5Z B;  3M54 A;  3NTH A;  3G4S A;  4M7D C;  2YRV A;  4B9X A;  1KHC A;  2O01 E;  2VYT A;  3MHX A;  4MMK A;  4N4H A;  4M78 C;  4OMF B;  2XD0 A;  5GAN 4;  2L3R A;  2RHU A;  3L2U A;  3L2Q A;  4M78 B;  4LDY A;  1YBY A;  3NTI A;  3RUX A;  2WSF E;  3HFN A;  3JB9 I;  2GF7 A;  1U8R A;  4RCB A;  4C92 B;  4IUT A;  3L1A A;  5I2S A;  1NE8 A;  3HKS A;  3JCM J;  3OBW A;  4JLG A;  2D6F A;  4OB0 B;  2LDM A;  2KSS A;  4EMK B;  3DB3 A;  1M90 U;  2A7Y A;  2KQW A;  3I55 T;  2LNV A;  1YJW A;  1K9M U;  3ZEH A;  4ZN1 A;  4M77 G;  4FU6 A;  4ME7 A;  1HK9 A;  4DA4 A;  5LJ3 d;  1KD1 U;  2DK3 A;  3VKI A;  1S72 A;  4QVD A;  2M0O A;  2ZPE B;  1VQ4 A;  3JB9 G;  4YTL A;  3CCQ A;  1B34 B;  2F5T X;  3QXE B;  4FT4 A;  1M5Q 1;  1WGS A;  2RHX A;  1WNL A;  1QVF S;  5KE3 A;  5LJ5 e;  1YIJ A;  1VQN T;  5GAO q;  1Q86 U;  4A4H A;  2XG8 D;  4C5I A;  4ELZ C;  3QKJ A;  4HCB A;  4PL6 A;  5LJ5 f;  3H6Z A;  2XI9 A;  4KBM B;  3MO8 A;  1YJ9 T;  1R8O B;  3G4S T;  3O8V A;  4BY6 C;  1V29 B;  2BIV A;  5CKD A;  4M78 F;  3OYB A;  4HT8 A;  2RHY A;  3QSU A;  1VUB A;  3LWH A;  3A8O B;  4NS5 A;  3X26 B;  4C92 F;  4PJO E;  1YI2 T;  3M56 A;  3TU4 K;  5FU7 B;  4OB1 B;  4ZTF A;  2K5F A;  2L89 A;  2QEX T;  4M7A C;  2MF2 A;  3DLM A;  4QQ6 A;  3RMQ A;  3JCM h;  4MDX A;  3GLX A;  5CKH A;  2R5M A;  3JCM d;  1N9R A;  2RJE A;  4IUP A;  4OB3 B;  4R56 A;  1JB0 E;  1Q7Y C;  2LRQ A;  3RES A;  4C92 G;  5FRO A;  3L2R A;  3SFM A;  4M7D D;  2VGN A;  1WJS A;  2QQB A;  4XAX B;  1O9S A;  1P92 A;  4J6X A;  1Y71 A;  3OYC A;  3AHU A;  2K57 A;  3CBO A;  3G7Z A;  4A4F A;  1M1K C;  1YJW T;  1M1F A;  2ZZD A;  4FM4 B;  1X01 A;  4M75 C;  4L59 A;  5CVI A;  3RKW A;  4C8Q B;  1K73 C;  2E41 A;  2FVU A;  3CME A;  4MML A;  3CCQ T;  2JZ2 A;  2RHZ A;  4F7U E;  3OYD A;  2EKO A;  5J26 A;  3L2Z A;  1SSF A;  3CCM A;  4C5H A;  4JRK A;  3FEO A;  3Q1J A;  4LDV A;  3OS0 A;  3CXC S;  5GAN j;  1YIJ T;  3QUI A;  4NL2 A;  1G3W A;  3E9F A;  2RD1 A;  5GAM j;  5KH6 A;  2WSC E;  3CXC A;  3OMC A;  2QXF A;  3SD4 A;  4XU1 A;  4N0A C;  5L8R E;  3QJ6 A;  2RHI A;  4C8Q E;  1G3S A;  1G5V A;  4PJO G;  3HRT A;  1UGQ B;  2FB7 A;  3CC4 A;  4M7D A;  4R55 A;  2DZC A;  3M5A A;  4EMH A;  3SB2 A;  1GXI E;  1KC8 U;  2K4Y A;  2EAY A;  4A54 A;  3OYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...