4M75G

Crystal structure of lsm1-7 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
82
Chain Sequence
b'NLYFQGSMLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 12
structure length 82
sequence length 98
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75G00
5I21A 4F7UE 4NOYA 1HK9A 5LJ3g 2DTHA 2FYKA 4J6WA 4M75B 4M78B 3JCMb 3JB9J 4PJOF 5GANh 2DZCA 4M7AA 5LJ5d 4NL3A 1KQ2A 4PNOA 4PJOG 2RD1A 3RESA 5GANj 5GAMe 1I4K1 3RERA 4HT9A 4M75G 4M78G 4M77C 1YCYA 4M7AB 3M4GA 3FJPA 3VU3C 5LJ3f 3JB9G 3V7SA 1U1TA 3BY7A 3JCMP 4XTVA 4JRIA 4C92A 1BIBA 3BDUA 4EMHA 4F7UB 5GMKe 5DY9A 3RKYA 1X01A 2EJ9A 3SWNC 5GMKl 4C92G 5LJ3j 3JCMJ 5GAOm 4C92C 2DVEA 1BIAA 4RCBA 4M78E 4M75E 4XTWA 3RUXA 4J6YA 2VXEA 3JCMh 5LJ5h 1LOJA 3INZA 2JN0A 3RKWA 4HT8A 1I5LA 2YHTA 4NL2A 2Y90A 3EFRA 4M77G 4XU2A 4M7DF 2DTIA 4Y91A 4XQ3A 4C8QG 4M7DD 3V8JA 4X9DA 4M77A 4C8QF 4EMKB 4XTZA 4MMKA 3AHUA 3L2ZA 4F7UA 4XTUA 4M7AD 1N9RA 2HNIA 4N0AA 2DKGA 2E64A 3JCMg 4C8QB 4QVCA 5LJ5f 5GAMj 3HFOA 3JCMc 1WNLA 2E1HA 4J6XA 3V7RA 1M8VA 3FB9A 2FB7A 3JCMV 5GAOn 4PJOE 4V2SA 4M7DB 1LJOA 1WPYA 2I2LA 1JRIA 2VXFA 1MGQA 5GAOr 3JB9D 1N9SA 4M7DA 3SWNB 3BFMA 4JUVA 3V8LA 2DJZA 4A53A 4A54A 3JCMf 5LJ3e 4X9CA 5LJ5j 2EJGA 4XU3A 2E41A 3EFSA 3JB9F 4PJOC 2ZGWA 1JBMA 4M7DG 4M7DC 2DZ9A 3L1AA 4M77E 3GIBA 3QUIA 4F7UF 2EJFA 5GMKi 1D3BA 4C8QE 5GAN6 5GANe 4XTYA 4M7AG 4DQ2A 4HA8A 5GAN7 4M7AC 4PJOB 4OP0A 4PJOA 4M7AF 5GAN2 2VC8A 3FIFA 5GAN8 5GMKm 1Y96B 5GAMh 4F7UG 5GMKh 5GANd 4C8QD 3JCMQ 4M7DE 4XU1A 3JCMd 2QTXA 5LJ3d 1WQWA 3PGGA 5GANg 1I81A 5GMKj 2DXUA 4M75F 4M78F 4JRKA 4PJOD 2E65A 3JCMX 3JCMe 5GAOp 4XU0A 4C92B 1HXDA 1U1SA 3QSUA 3HFNA 5GAMg 3HSBA 3QO3A 4C8QA 4N0AC 4WF2A 5LJ5e 5GAN3 5GANf 5GAOl 4QVDA 1TH7A 1Y96A 2RM4A 3QHSA 4M77B 3V7CA 3JB9I 4M7AE 5GAN4 4JLIA 2K57A 2RA2A 5GAMd 3BW1A 4M77D 2DEQA 4EMKC 4XTXA 3JB9H 4MMLA 2DXTA 4C8QC 5LJ3h 5GAMf 2YLBA 4M75A 4M78A 2DTOA 5LJ5g 4M77F 4RCCA 2E10A 2YLCA 1I8FA 4M75D 4M78D 3SB2A 2CGHA 5GAN5 4J5YA 1KQ1A 4M78C 4M75C 2RB6A 1B34B 3V8KA 1B34A 4EMGA 1M5Q1 2EAYA 4C92E 4EMKA 5GAOq 1WQ7A 3RIRA 3RKXA 3SWNA 1H641 1D3BB 1LNXA 4C92F 5CAIA 3JCMW 2EWNA 4C92D
chains in the Genus database with same CATH superfamily
1BI3A 2KT1A 2IIMA 2KGTA 1TXQA 2VUBA 1AVZC 2LCSA 3MEUA 3WVEB 3EG9A 2EQIA 3M0RA 1C0MA 1M1GA 3M4GA 2C06A 3VU3C 2NUZA 2K3BA 4L5GA 4C0ZA 2D8JA 4JJCA 4EMHA 2K5LA 2X4WA 1Y07A 3RMQA 2H8HA 2KY9A 2YHTA 2KSSA 2GGRA 3N5BB 2M0YA 2KROA 1GCQA 4OMQA 4XTZA 1NYGA 4HVUA 2BE7D 2L89A 4QVCA 3KXTA 1MUZA 1WNLA 4BE0A 3CEYA 2JUFA 2I2LA 1JJ2S 2FEIA 2ECZA 2O4XA 2FPDA 1WJSA 5CKBA 2RMOA 1M2VA 3HRUA 1FXXA 4DOWA 2HQXA 3G71T 4DQ2A 2LJ0A 1Y96B 4WCIA 2KNBB 2E5QA 1PD1A 1KHIA 4FSXA 1OZ3A 4J9BA 1K73U 3ULRB 1YJWA 4ZGJB 2DM1A 4AMCA 1VQ4A 1Y71A 5GANf 2BTTA 2KMTA 3H8ZA 1QQJA 4LE9A 3CCSA 4RTZA 5LJ3h 9ATCB 5GAMf 2CSQA 3P8HA 2J06A 1WDXA 3QDFA 2DRMA 3SB2A 1WJRA 3OY9A 3CCVQ 1AWXA 1YFNA 5C6SA 3JSCA 3G4SA 5KE2A 3MP8A 2OTJT 4HVVA 4M75B 4PJOF 4NL3A 4LDUA 1WHJA 2KDSA 5FU6B 2JS2A 3V7SA 1G3YA 4R55A 2X4YA 1VQKA 1MNEA 3EH2A 2MWOA 3M5AA 5IN1A 2NUPB 1HSQA 4QQ6A 5GAOm 1H3ZA 3JCMh 4OB1B 4DBFA 4C5GA 3LH5A 5LJ5h 5A0LA 1WYXA 4OGCA 2OTLQ 4C8QG 3KBGA 4ORZA 1NYFA 1TOVA 2HKNA 1G3TA 4FW1A 1NEBA 4M7AD 2QEXA 1M8VA 5KYYA 2QDLA 1LJOA 2RI5A 5GJVB 1VA7A 6AT1B 4J9CA 2DJZA 2HAXA 3JAME 3CCEA 1KC8R 1WLPB 2P0PA 1J3TA 3CC7T 2GF7A 4PLLA 2CYZB 1ZSGA 2FRYA 5IXFA 2P0QA 4HCCA 5D6YA 1PKTA 2QTXA 3DB4A 4MZMA 1VQ8Q 2FG0A 2DXUA 1OU8A 1W70A 2YT6A 1MV0B 2HMAA 1M1FA 2PQWA 1RUWA 1WXUA 2DL7A 3QO3A 1ACMB 2MF2A 2NUTA 1PNJA 2EPDA 3I56Q 2K57A 2V8JA 3J7AF 1YJ9Q 1SHGA 3GLXA 2DE0X 4M78A 3DLLA 5KYXA 1VQMA 3CD6Q 2OI3A 2X51A 3EHRA 4M75C 2LC4A 4Q5WA 2DK3A 3NTKA 3V8KA 4C5IA 4GBQA 5HK0A 2QASA 5LJ3g 3H0IA 4M7AA 4FYXB 2QEXQ 1QP3A 4JRQA 2RD1A 3ZFJA 4FSSA 2L3PA 2LQ8A 2P0KA 1YJNA 2V1RA 5IHNA 5GJWB 4CC3A 3EG2A 3G7ZA 2A37A 2XK0A 2KYBA 3BY7A 4XTVA 1ARKA 1WJQA 2DIQA 2EGEA 3CBPA 1E6GA 5HK3A 5GMKl 4OMPA 4LD9K 3H0FA 4J6YA 4J9HA 1K8AR 2H3JA 3CCUT 1Z9QA 3ZEHA 2YDLA 5HY6A 2XICA 2F2XA 3AHUA 2C0TA 2E4HA 1NG2A 3CD6A 1N9RA 2BZ8A 2HNIA 1JU5C 3I5SA 3PMTA 3JCMg 2E6NA 4RTWA 3JCMc 2E1HA 4J6XA 2EYYA 1S72Q 2QQSA 3NTHA 5GAOn 1QVFA 1OEBA 3LX7A 1M1KC 4OMNA 3V8LA 1Q7YC 1QCFA 1VYUA 3OB9A 1YIJT 1SRLA 1K73C 4D8DA 1D3BA 5DLOA 4BE1A 4PJOB 4ZGDB 3FIFA 2HZYA 2JW4A 2AK5A 3SEMA 3C95A 1ABOA 3NHNA 1VQPA 2YRVA 5J3BA 3L2RA 3CCST 2YUNA 4BDYA 2FRWA 4JRKA 4JJNK 3CBMA 3LGFA 1R77A 1XNIA 1U1SA 1HJDA 2AHJB 2ED0A 3SFMA 5GAN3 1O75A 1BCMA 3OYDA 1ZBXA 4JLIA 2DYBA 1YJ9T 4FW2A 4EMKC 1ZLMA 1HYOA 1OI1A 4M75A 3C94A 2MK5A 3M4YA 4PJJA 5GAN5 2NWMA 3ER0A 3KFVA 1U8RA 2A7YA 5L8RE 1PWTA 2E5KA 1RABB 5D7UA 2K79A 3JB9J 1YI2A 4C0DB 2K2MA 2DMOA 1M3CA 5IAYA 3G71Q 1WGSA 4ZN1A 1H8KA 4LDWA 2V1QA 1PKSA 1VQ5T 1I4K1 2QK0A 2QA4Q 2C0IA 1M27C 3I35A 1M4ZA 2KAFA 3REBB 2RHXA 3PVLA 5DY9A 3RKYA 1K73R 1IB8A 3GBQA 4C92C 4QVZA 1H92A 2HEQA 3RUXA 2DA9A 1VQ6A 1GFDA 1GCPA 2LQKA 4C8QF 2P4TA 3EFOB 4F7UA 2O31A 5LJ5f 1B07A 4ATOA 1K0SA 2NLUA 5AYFA 1EZZB 2FB7A 2PU9B 2QQAA 1N9SA 3OYEA 3BDLA 3JCMf 4BD3A 2M51A 1M90C 2XHCA 4XAXB 2D8HA 4CC7A 3TU4K 3CCJA 2X4JA 2V26A 4A4GA 2VC8A 4R56A 1UB4A 3OYBA 3EGXB 4XU1A 4HCZA 4QT7A 3T9NA 5IH2A 2GCXA 2ZPHB 1NJIU 1X2KA 1VQMT 1K9MR 4XU0A 3O5ZA 1K4US 1AWWA 4QVDA 1TUCA 4HCKA 1QVGP 4PLIA 3CCLA 1ZHIA 2LNVA 4FYVB 1NBEB 2JMAA 3JV3A 1VIFA 2DRKA 1YWOA 1QVFP 4MDWA 3CPWA 2DO3A 4RTTA 2RB6A 1W6XA 1QVPA 1KC8U 1IGQA 1MNDA 1AWOA 3WXMB 1FMVA 1RAAB 4B6MA 5FRNA 4C0GA 3L42A 4FIBA 4MZTA 3ZL7C 1KQ2A 3C4SA 1MV3A 4UC4A 1KQSS 3QYGB 3X25B 1RAFB 3QXEB 2MIOA 3OMGA 1UGRB 1QLYA 2LQNA 2XIDA 2FO0A 1UE9A 5DLQE 4C92A 1KD1U 4KUDK 5CIUA 2KXDA 3NTIA 1WIEA 4Y28E 2ROTA 2ZAEA 2LVMA 4PK4A 2DTIA 5CVIA 4ELZC 4M77A 3QWYA 2XKOC 1OQKA 3MHXA 1OV3A 3E9GA 4KT0E 4BI4A 5I2MA 3V7RA 4J9DA 3VYGA 3TVTA 2ZPGB 1GBRA 3S3OA 5LJ5j 1WXTA 3CCLQ 1VQPT 4PJOC 1K8AU 1KG1A 2DZ9A 2LRQA 5GMKi 3LWIA 2VVKA 3M56A 1UTIA 2HD0A 3OYKA 1M30A 1Q7YR 2OTLA 3CCEQ 3PGGA 4KRTA 3OQ5A 1VYVA 3P8BB 3FDRA 2E65A 4XK8E 1M3AA 3HFNA 2DXBA 4HCBA 2XI9A 2J6OA 4WF2A 2RO0A 4Y92A 2DL3A 2RQWA 1BI0A 1YITA 3M0QA 2E10A 4J5YA 2OJ2A 2O88A 1KD1R 4IKFA 4EMGA 4KH0B 1M5Q1 5GAOq 2A08A 3O8VA 3UDCA 2XDPA 4J6WA 1JJ2A 2KRNA 1M90R 2BIVA 4KGXB 4C5EA 3FEOA 4N4IA 1ZSZB 1UGPB 2HBPA 4B9XA 4M78G 2DIGA 3CCJQ 5KYYB 1VQ6T 1VIEA 4AFSC 1LPLA 3E9FA 3X20B 2A36A 3LWHA 1G5VA 3RR6A 2ED1A 1D09B 2DFUA 3CPWS 1KK7A 3GNGA 3LLRA 3PIPA 1K0XA 1QKXA 2NYSA 1K76A 3PE0A 2D1XA 5A2QE 1VQKT 4JS4A 4RG2A 2R57A 3GNFB 2RQVA 4C8QB 5GAMj 1OPKA 3HFOA 4F17A 4BACA 1VQNQ 4V2SA 4PJOE 2VXFA 3I5RA 3OW2P 3NFCA 1HD3A 2J6KA 1WZOA 2ATCB 2ZGWA 1XOVA 5FWBA 1X2QA 4ANJA 2ZPIB 2L2PA 4M7AG 1Q95G 2QA4A 1KD1C 1RAGB 2RK2A 4X34A 4E7JA 1NEGA 3SD4A 1GRIA 3A98A 4J9EA 1N8RR 2GFAA 3TREA 2ABLA 1VQ4Q 1CKAA 4BI3A 4C8QA 4N0AC 2ZPFB 2QDYB 2V8KA 4M77D 3JB9H 1VQOT 1V1CA 2Y4XA 2JT4A 1Q86R 4KGZB 2ZCFB 1B34B 4EMKA 3M0PA 5M9OA 4KBMB 4KH1B 1E6HA 3JRZA 5KYUB 4KGVB 4MDXA 2GQVA 5CKFA 2DZCA 4L6V5 3ASKA 2KYMA 2F5TX 2K5IA 1YI2T 4MZPA 4BI8B 5GANj 2HSPA 1EIFA 4ZN3A 4PJMA 3JB9G 1U3OA 2G6FX 4JPBW 1IRXA 2P84A 2ZPBB 3LH0A 2VYTA 5KE3A 2GBQA 1P92A 4PL6A 1JB0E 5I11A 1UJYA 4PKCC 2LCCA 2EGCA 1YJNT 1Q82U 1SSHA 2O2OA 3QZ5B 2QQRA 4M7DD 2DJQA 2K3XA 3RNJA 1NPRA 2MCNA 3QZ9B 3CC2Q 2EKHA 4LUDA 4D6WA 2XG8D 1VQOQ 2QGGA 3QYHB 3OYFA 5C0MA 3VV0A 4X9CA 1G2BA 2MOXA 5KCOA 2QYZA 2CP5A 2YSQA 2CP2A 3VUBA 3A8HB 3FJ5A 5GAN6 2DBMA 4C5HA 2EIFA 4JDSA 3LYIA 1X75C 2COWA 4FU6A 2XMFA 3M59A 3CC2T 4M78F 4PJOD 3OYYA 1HXDA 1KHCA 5CR2A 1FMKA 2HKQB 3ZBDA 2KRMA 1U5SA 2XU8A 1JXOA 1QMCA 5GAOl 1V76A 1BI1A 1IHWA 2OX7A 4M77B 3QJ6A 2M16A 1AHJB 1D0YA 3QDRB 2CREA 4J7IA 2W10A 2CUBA 5LJ5g 3HHTB 2KRSA 2R5MA 2RHUA 2K4YA 2JTFA 4PFOA 1VQ7T 3FLGA 3EH1A 3E2UA 4OMFB 3HPWA 2O9SA 2JJ9A 5I21A 4F7UE 2X3WD 2CT4A 2FYKA 2VGMA 1YJ9A 2LQWA 2AKLA 4LDVA 2VB6A 3RMSA 1GCQC 1MMDA 1SRMA 1M9SA 2W0ZA 2J7IA 3VS1A 3CMAQ 1MMAA 1U1TA 3JCMP 3CC4Q 4JRIA 4RUGA 3M0TA 5GMKe 5KH6A 3EGDA 2QXFA 1A0NB 3CMEQ 1BBZA 3GOXA 2VXEA 2M0OA 3RKWA 1M3BA 4M77G 4M7DF 4J9IA 1B3QA 4BY6B 1S1NA 2LX9A 4IURA 4ESRA 1V29B 1BCOA 5FRMA 2J6FA 3L2UA 1RACB 4XTUA 2E64A 3CCMQ 1PRLC 3VS4A 1BKBA 3FB9A 5CKHA 1RL2A 2GQIA 1D0XA 5CCAA 4IIMA 4FCYA 1NJIR 1OX9A 2X35A 1LCKA 2CT3A 2BUDA 3MP6A 4IUQA 1GL5A 4PJOA 1YBYA 3R6NA 3TQ7P 3QJYA 1AD5A 4Z88A 2F2WA 1WQWA 3OYMA 4M75F 2D0NA 3JCMX 2OTLT 2HDAA 1RAHB 3H0HA 3EG0A 4J7FA 3CCRQ 2KBTA 3CCJT 1VQ6Q 3MKDA 1TH7A 3UF4A 3V7CA 2RM4A 3M57A 1VQPQ 5D6WA 2DNUA 1XJWB 4C0FA 4PJLA 4LUEA 4MMLA 1PSEA 2DXTA 4FL6A 1X6OA 2LP5A 2HCKA 4M4ZA 3G4ST 2HQEA 4OF1A 4E2FB 3WVDB 3GPLA 1WHMA 1NM7A 3RKXA 5FU7B 3G1JA 4C92D 5CK9A 5KYXB 4FT2A 2RJEA 4IUVA 4M78B 4FYWB 5LJ5d 1Q82C 3RESA 2PUKB 1M90U 1BI2A 2J05A 3OSSC 1UFFA 2RJDA 1MMNA 4OB2B 1Q81U 2DX1A 2E6ZA 4CC4B 1TUGB 3SWNC 1WHKA 3CCRA 1VQNT 3INZA 4RKUE 1UJ0A 1UEBA 3NGPA 2RQUA 4RTVA 1VQ7Q 2DEUA 1ABQA 2AIRB 2DVJA 5CQXA 3L2ZA 3CCQA 2EGAA 2FVUA 1PHTA 5D6XA 5A0DA 3PNWC 3SHWA 1OU9A 2CKKA 4E7SA 3CCET 1YWPA 3AT1B 3JCMe 3VS3A 1JJ2P 2DL8A 3CC4A 2O9VA 1K1ZA 4AG2C 4M7DC 3QUIA 2F2VA 5GANe 4XTYA 1T3SA 2EVRA 2FZKB 4OP0A 5GAMh 3G6EA 1RADB 5GANg 5I22A 5KCHA 2DPPB 4FM4B 2YUQA 3KUFA 2DAQA 2RHZA 1VQ7A 5LJ5e 2KE9A 2CUDA 2MAMA 4F14A 3FRNA 2HBWA 3JB9I 3X24B 1VQ9Q 1I5OB 2MYSA 4C8QC 3OW2S 4C0DC 2PVGB 1X69A 2CGHA 1VQOA 4M78C 1OOTA 1ZUKA 4ZTFA 2GFUA 2M1HA 4C92F 1FMWA 1LNXA 2L3QA 3M58A 5GAMg 1KSWA 2DLPA 5GANh 4EPCA 1YJNQ 2M9UA 4GLMA 2BKDN 3CC7Q 1QWFA 2MWPA 5GAMe 2L3RA 4M7AB 2CZ0B 1I1JA 2B8AA 1IXDA 3A8LB 3EFOA 4F7UB 1W2BP 1VQ8A 2R58A 4C92G 1BIAA 4RCBA 4HXJA 4J8OA 1NZ9A 3F70A 3OS5A 3EAEA 1UG1A 4EMKB 3CCSQ 3HP9A 1VYTA 3MP1A 4OMMA 5HCKA 2DKGA 2BE9B 3PFSA 1PC0A 3UA6A 3H41A 4HVWA 1YJWQ 4ELYC 5ECAA 2HL3A 4E7LA 2MI6A 2K6DA 4M7DA 1AEYA 2IPOB 4ZTJA 4A54A 4JRPA 1YHQQ 3DLMA 2EJGA 3S3MA 4JZ4A 1AZEA 3QG1A 2QQ9A 1YP5A 4M77E 3GIBA 2YRDA 2EJFA 4BE2A 4DBHA 2COYA 2QQBA 4HA8A 5HKCA 2B86A 2OTJQ 4F7UG 2X3XD 1UHCA 1SSFA 3TEEA 3OBYA 2O4XB 3OYNA 4DBRA 4JJBA 1IO6A 2HL5C 4CRIA 1D1CA 1N8RC 2RF0A 2QA4T 1S72A 1W2BS 1K9MU 2FPFA 3UT1A 4E47A 4OMLA 3VRYA 5FWCA 2RHIA 3QHSA 4AFQC 5GAN4 2MPXC 1M1KU 1BK2A 2QTVA 3GF5A 2CZ7B 2YLCA 3CCVA 5IT9E 3RIRA 4A4EA 5CAIA 2IG0A 1D3BB 2DBKA 2FZGB 2K2VA 3NPFA 1VQKQ 2A3LA 4NOYA 4AT1B 1QW1A 2RJCA 5CO7A 2LMJA 2QGFB 1IHVA 5DM7R 3OYHA 1AT1B 1SPKA 2DXCA 2OTJA 4LXCA 2RPNA 2AKKA 3FJPA 1RLQC 5LJ3f 2DL4A 2VASA 5KYWA 2HSEB 4JLGA 2DERA 5J26A 1FX7A 1WX6A 2V8IA 4VUBA 2JTEA 4B9WA 1QVGS 5IXBA 1O9SA 4HT8A 1I5LA 3EFRA 4DOVA 1KFZA 3CC4T 3EHQA 1VOMA 2KVQG 4MMKA 3G4SQ 1ZUUA 1QP2A 2VWFA 5L23A 4N0AA 4WTOB 3VUZA 2VKNA 2PNIA 4M7DB 3CQTA 4EDUA 2JNGA 3G6ET 3GP8A 4IIOA 1UGSB 3CMAA 4A53A 2P4RA 4XU3A 4DBQA 3UPUA 1CSKA 2DD5A 2ENMA 1YIJQ 2O01E 1WA7A 1WHLA 1FYNA 1T0HA 1ZBJA 1UGQB 2AZSA 4GLKA 1UECA 1TS9A 2RNAA 3CC7A 3JCMQ 3M55A 2DYIA 1XTDA 1Q7YU 1N5ZA 4E6RA 2D0QB 2JOYA 3Q1JA 2NUTB 3CCLT 1TTHB 3THKA 3FC3A 3OS1A 1Y96A 1X6GA 4AFUC 2EQMA 3SDZA 4XTXA 3CC2A 4CC2A 2LTOA 1NLPC 2DTOA 4M77F 1OYXA 1KQ1A 2JM8A 4FYYB 2CP0A 2EW3A 3MJXA 2ZZDA 4PJNA 2EWNA 4Z02A 3VS2A 2JZ2A 1TG0A 1NE8A 4E7KA 1B7TA 1ZA2B 2RN8A 1SF9A 1UUEA 4JJDA 3RERA 1RLPC 4M77C 4Z89A 3QPHA 1C1AA 1TSFA 1N8RU 3VJPA 4J9GA 1BIBA 1R0CB 2CP6A 2YWWA 2L8DA 2LDMA 4XTWA 1BB9A 2VV5A 2H3EB 4AG1C 2E3IA 8AT1B 2E12A 4RTUA 5EC7A 3OYGA 3UWNA 2RHYA 2LT1A 3CCUA 2NUPA 1PSFA 2QAZA 1VQ5Q 1TWBA 2AT1B 1K9AA 5AT1B 3MO8A 1IREB 2D9TA 3TSZA 3CCQT 2KT8A 2E70A 3QKJA 3J81E 3BE3A 5LJ3e 3P8DA 1NJIC 2WSFE 3PT9A 1X43A 3PMIA 3E1SA 3M54A 4OB3B 3CBOA 3UATA 2YXYA 4IUTA 4RTYA 1E7OA 3MEVA 4M7DE 3EGUA 5LJ3d 2I0NA 1VQLA 1JEGA 5IHIA 1D1BA 3VRZA 2X9HA 4IUPA 4L59A 2QG9B 3C0CA 4OMOA 1SG5A 1U06A 2ROLA 2C0OA 1OULA 4M7AE 2RA2A 3BW1A 3CCMA 1VQ9T 2KK4A 2DD4A 1T3LA 3A8OB 3U23A 3RDVA 2CH4A 1I8FA 3QWXX 2GTJA 1Q81R 1WFWA 1OX8A 4YTLA 1Q81C 3MPUB 4TVRA 2CH4W 1G8XA 1WHGA 1I0CA 1H3HA 1KJWA 2BZYA 2JTMA 4PFZA 4QQGA 4PJOG 5J39A 1YN8A 4RTXA 1WI7A 1SKUB 1R0BG 4HT9A 1M2OA 4FT4A 2LJ3A 2CDTA 1W1FA 2GTOA 4QKUA 3BDUA 3M0UA 1D0ZA 1R8OB 3CMEA 2FHDA 5IHKA 2EQKA 4II1A 2R5AA 5FLXE 1LOJA 2JMCA 2L5QA 1I07A 4BB7A 5FU7C 2Y90A 2WSCE 4OVAA 4XQ3A 2EKOA 4X9DA 3C12A 1AZGB 3PIOA 2KXCA 2HQHA 1ZSZA 5KYWB 1VQNA 3DB3A 1Y0MA 3G71A 3HTRA 2K3YA 3EG9B 3REAB 2OAUA 3SWNB 3BFMA 2EFIA 1QVFS 3EFSA 3L2QA 2Z0WA 4ZGEB 2F1LA 4Z8AA 1RAEB 3VS5A 2AZVA 1N27A 2JXBA 2X4XA 1YJWT 4M7AF 5GAN2 1Y57A 2IVWA 3MCAB 3VYHB 3VKIA 3JCMd 3CXCA 3CPWP 1BYMA 1G3WA 3LW5E 4N4GA 5GMKj 1RAIB 1K8AC 3M9QA 3RBBB 3HSBA 1JXMA 4DEXA 4X1VA 2EQJA 2QI2A 2COZA 4ZNXA 3I56A 1ZX6A 4KULA 2K7AA 3NMZC 2L0AA 1YHQT 4IUUA 1S72T 1EFNA 1UHFA 2RI2A 1Q86U 1NLOC 4RCCA 1NPPA 4M75D 3I55Q 1VQMQ 3OMCA 2JS0A 1WQ7A 5A0GA 2LCLA 2DTHA 7AT1B 2F5KA 2A0FB 1PRMC 1M8MA 2DF6A 3OS2A 2RI3A 1WXBA 2PVOB 3OYAA 2K5FA 1KIKA 1TU0B 2K9GA 1GXIE 1VQLQ 3JCMJ 1AOJA 4LDXA 2QEXT 1Q82R 2DVEA 2CS7A 2GNCA 4DEYA 1FWZA 3A5ZB 4NL2A 2RH2A 4XU2A 1ZQ1A 2RQTA 3V8JA 1XQHA 1QKWA 1KQSA 2RQRA 3H6ZA 1VQ8T 3A1PA 1D1AA 4J9FA 3MEWA 4EIKA 3PTAA 2KQWA 4RMOA 1WPYA 1JRIA 2LX7A 2PZ1A 1GBQA 4RG8A 3EGXA 1VQLT 2KEAA 1QWEA 2YUPA 3META 4N4HA 3TCJA 3A8MB 1K9MC 3CMAT 3I55A 5CKDA 2EYXA 1X27A 1ZSZC 3OA6A 2CSIA 4A4HA 4K11A 5GANd 2FZCB 4C8QD 2PUOB 2FPEA 2JVVA 1VQ9A 3CXCS 3M53A 1OPLA 5CQYA 3OYLA 4JZ3A 2CZ1B 4A4KA 3G6EQ 1LVKA 3CCUQ 1G83A 1F1BB 5GAMd 4A63B 2DILA 4PFPA 4M78D 3VS7A 1UDLA 1YITT 1RI0A 3M0SA 1B34A 4C92E 1VUBA 3OSVA 4O6JA 3JCMW 4LD6A 2XDBA 1WHHA 3OYCA 1HK9A 3CMET 2EYQA 2LT4A 4PNOA 3OBWA 4ME7A 3IQLA 3OS0A 5I2SA 3EGDB 3CCVT 3S3NA 2YUOA 1SEMA 4M75G 1YCYA 4F04B 1PD0A 1AWJA 3MEAA 2SRCA 4E7IA 2RK1A 2F69A 2EJ9A 3CD6T 2XD0A 2DETA 2M02A 4AFZC 3UA7A 3OYJA 4DA4A 4M78E 4A4FA 4HKEA 3R6OA 3CXCP 4Y91A 1IZ6A 2EYWA 3CPFA 4E7HA 4OGEA 2PVDB 1YITQ 3HRSA 4JS5A 3JCMV 3LGLA 1T0JA 4BUGA 2LZ6B 2LJ1A 5FW9A 5GAOr 3JB9D 4NS5A 3QIIA 4JUVA 1QCNA 3TSWA 3JB9F 3VS0A 4M7DG 1TUDA 3L1AA 4F7UF 1JO8A 1KC8C 5KYNA 5GAN7 2WACA 5CKEA 3X28B 2CZ6B 1YHQA 3HRTA 4GY5A 1BU1A 3H9NA 2EYZA 4QQDA 2D6FA 5GAOp 3QSUA 3I9QA 2RJFA 1G3SA 1MMGA 2KR3A 1YCSB 1OZ2A 1SHFA 4BDZA 1MHNA 2DEQA 2DL5A 4P5NA 2A28A 1VQ5A 1GFCA 3A8GB 3CCMT 1VQ4T 3X26B 1CKBA 1ZUYA 3SWNA 1H641 2L3SA 3QBYA 2PTKA 2VGNA 4J83A 3JCMb 1W4SA 1Q86C 3E19A 2BZXA 2KI7A 3DKMA 3VS6A 1KQSP 2MMPA 1EX4A 8ATCB 3CCRT 2FL7A 2LNHB 1DJ7B 1X01A 3PVQA 3CCQQ 5LJ3j 3S6WA 3HKSA 5FU6C 1PG5B 4M75E 2JN0A 1ZA1B 1X6BA 2EBPA 5KYUA 1Z9ZA 3URGA 4LDYA 3OW2A 1PM3A 4D8KA 4OB0B 2EQUA 2CP7A 4BY6C 3I55T 2OAWA 1YIJA 4R0KA 3ME9A 1MGQA 4CI0C 3EG3A 5LL6S 1JQQA 2E41A 1JBMA 1M2VB 1YNZA 3OYIA 2Y4YA 3J80E 4C8QE 1RI9A 2JM9A 4M7AC 5GAN8 5GMKm 2XDDA 5GMKh 2YRCA 5FROA 4KUIA 1QCOA 1I81A 2SEMA 1W2BA 1C6VX 2E3HA 4C92B 3EG1A 1PCXA 5EG2A 2WSEE 4F16A 4E7ZA 1N6AA 3HL8A 4O5VA 1UGVA 4LNPA 1Y7XA 1IGUA 2YLBA 3I56T 3L2VA 1QVGA 2ZPEB 1M1KR 3L2WA 2G3RA 4QW2A 2CP3A 3D7SB 2EAYA 1YI2Q 2ESWA 4LN2A
chains in the Genus database with same CATH topology
5FRNA 4C0GA 1BI3A 3L42A 2RJEA 4FIBA 4FT2A 4IUVA 4M78B 4MZTA 5LJ5d 1KQ2A 2JTMA 3C4SA 4UC4A 4PJOG 4QQGA 1Q82C 5J39A 1KQSS 3QYGB 3RESA 2PUKB 2VUBA 1M90U 3X25B 1BI2A 3QXEB 4HT9A 3MEUA 3OSSC 3WVEB 1M1GA 2RJDA 1UGRB 3M4GA 3OMGA 4FT4A 3VU3C 2C06A 2XIDA 4L5GA 4C0ZA 4OB2B 4C92A 5DLQE 1Q81U 3BDUA 4EMHA 1KD1U 2E6ZA 4KUDK 3SWNC 1R8OB 5CIUA 3CMEA 3CCRA 2FHDA 3NTIA 1VQNT 2EQKA 2K5LA 1Y07A 2X4WA 4Y28E 4II1A 2LVMA 2R5AA 5FLXE 3RMQA 1LOJA 3INZA 4RKUE 2L5QA 4BB7A 5FU7C 2KY9A 2YHTA 2KSSA 2Y90A 3N5BB 1UEBA 2DTIA 5CVIA 4ELZC 2WSCE 4OVAA 4XQ3A 2EKOA 4X9DA 4M77A 4XTZA 3C12A 5CQXA 3L2ZA 3PIOA 3CCQA 2XKOC 3MHXA 2L89A 2FVUA 3E9GA 4KT0E 5D6XA 4BI4A 5A0DA 4QVCA 5I2MA 3DB3A 1WNLA 3PNWC 3KXTA 3V7RA 3G71A 4BE0A 2CKKA 3CEYA 2K3YA 3CCET 3VYGA 2JUFA 2I2LA 2OAUA 2ZPGB 1JJ2S 3SWNB 3BFMA 2EFIA 3S3OA 1QVFS 3JCMe 5LJ5j 1VQPT 3CC4A 4PJOC 2O4XA 3EFSA 3L2QA 1WJSA 1K8AU 5CKBA 4ZGEB 1KG1A 4M7DC 2DZ9A 3QUIA 3HRUA 2LRQA 1FXXA 4DOWA 5GMKi 2HQXA 5GANe 4XTYA 3LWIA 4DQ2A 3G71T 1N27A 2X4XA 3M56A 4OP0A 1YJWT 4M7AF 5GAN2 2IVWA 3MCAB 1Y96B 2HD0A 3VYHB 5GAMh 3G6EA 3OYKA 2OTLA 3VKIA 3JCMd 3CXCA 3PGGA 5GANg 2E5QA 1G3WA 3LW5E 3OQ5A 1BYMA 4N4GA 3P8BB 5KCHA 5GMKj 2DPPB 4FM4B 1KHIA 3FDRA 1K8AC 2E65A 4FSXA 3M9QA 4XK8E 1OZ3A 1K73U 3KUFA 2DAQA 3HFNA 2DXBA 2RHZA 3HSBA 4HCBA 2XI9A 1YJWA 4ZGJB 2EQJA 2QI2A 4WF2A 1VQ4A 2RO0A 5LJ5e 2MAMA 1Y71A 5GANf 3I56A 4KULA 3FRNA 1YHQT 1BI0A 4IUUA 3JB9I 2KMTA 3X24B 1S72T 3H8ZA 1YITA 2RI2A 1Q86U 4C8QC 3CCSA 5LJ3h 5GAMf 3OW2S 3P8HA 4RCCA 1NPPA 2E10A 4M75D 4C0DC 3SB2A 2PVGB 2CGHA 1WJRA 4J5YA 1VQOA 4M78C 3OY9A 3OMCA 4IKFA 4EMGA 4ZTFA 1M5Q1 5GAOq 1WQ7A 2GFUA 2M1HA 5A0GA 5C6SA 3O8VA 1LNXA 3M58A 4C92F 3JSCA 3UDCA 5GAMg 3G4SA 2LCLA 2DTHA 2XDPA 3MP8A 4J6WA 5KE2A 1JJ2A 4M75B 2OTJT 4PJOF 5GANh 2BIVA 4NL3A 4LDUA 4C5EA 4EPCA 2F5KA 2M9UA 3FEOA 4N4IA 2BKDN 1UGPB 2MWPA 2HBPA 2KDSA 2L3RA 4B9XA 5GAMe 4M78G 2DIGA 3OS2A 2RI3A 4M7AB 2CZ0B 5FU6B 1VQ6T 1VIEA 1G3YA 2B8AA 2PVOB 3A8LB 2X4YA 3V7SA 4R55A 3OYAA 1VQKA 2K5FA 3E9FA 2MWOA 3M5AA 3X20B 5IN1A 4F7UB 3LWHA 1G5VA 1GXIE 1VQ8A 2R58A 4C92G 4QQ6A 3JCMJ 4LDXA 2QEXT 5GAOm 1H3ZA 2DVEA 1BIAA 2CS7A 4RCBA 4J8OA 3CPWS 3JCMh 4OB1B 5LJ5h 4C5GA 1FWZA 1NZ9A 3A5ZB 3F70A 3GNGA 3LLRA 4OGCA 5A0LA 4NL2A 3PIPA 2RH2A 4XU2A 1ZQ1A 3OS5A 3JCMW 4C8QG 3KBGA 3V8JA 3EAEA 5A2QE 1VQKT 4EMKB 1XQHA 4RG2A 1G3TA 2R57A 3HP9A 4JS4A 1KQSA 3MP1A 3H6ZA 1VQ8T 4M7AD 3GNFB 3MEWA 2DKGA 3PFSA 2QEXA 4C8QB 5GAMj 3HFOA 3PTAA 2KQWA 4BACA 1M8VA 3CD6T 4V2SA 4PJOE 1LJOA 2RI5A 4ELYC 4E7LA 4RMOA 1WPYA 1JRIA 2VXFA 2MI6A 3NFCA 4M7DA 4ZTJA 2DJZA 2HAXA 4A54A 3JAME 4JRPA 3DLMA 2EJGA 4RG8A 3CCEA 3S3MA 1VQLT 2ZGWA 2P0PA 1XOVA 3QG1A 2QQ9A 4M77E 3META 3GIBA 4N4HA 3CC7T 2GF7A 2EJFA 4PLLA 2CYZB 4BE2A 3TCJA 3A8MB 2ZPIB 1K9MC 3CMAT 3I55A 4M7AG 2QA4A 4HA8A 2QQBA 5CKDA 2P0QA 4HCCA 1KD1C 5HKCA 2RK2A 4X34A 3OA6A 4E7JA 5D6YA 4A4HA 4F7UG 5GANd 4C8QD 3SD4A 2QTXA 3DB4A 2PUOB 4MZMA 1SSFA 3TEEA 2JVVA 3OBYA 2O4XB 3OYNA 1VQ9A 2DXUA 3CXCS 2GFAA 3M53A 1M1FA 5CQYA 4CRIA 3OYLA 2PQWA 1N8RC 3TREA 2QA4T 3QO3A 4BI3A 4C8QA 1S72A 1W2BS 1K9MU 2MF2A 4N0AC 2CZ1B 2ZPFB 3UT1A 4E47A 4A4KA 2RHIA 2QDYB 3QHSA 2V8KA 5GAN4 2K57A 5GAMd 2V8JA 4M77D 1VQOT 3JB9H 3J7AF 1M1KU 3GLXA 4M78A 3DLLA 2Y4XA 1VQMA 3GF5A 2CZ7B 4M78D 2YLCA 3CCVA 5IT9E 2ZCFB 1YITT 4M75C 2LC4A 1RI0A 1B34B 2DK3A 1B34A 3NTKA 4Q5WA 3V8KA 1VUBA 3OSVA 4O6JA 4C92E 3RIRA 4EMKA 4A4EA 4LD6A 2IG0A 1D3BB 4C5IA 5CAIA 5M9OA 5HK0A 2K2VA 4KBMB 2XDBA 3OYCA 2A3LA 4NOYA 1HK9A 1QW1A 3JRZA 5LJ3g 2RJCA 5CO7A 3CMET 4MDXA 2GQVA 5CKFA 4M7AA 2DZCA 2EYQA 2LT4A 3ASKA 1QP3A 4L6V5 5DM7R 3OYHA 4JRQA 4PNOA 3OBWA 2F5TX 2RD1A 4ME7A 2K5IA 3ZFJA 1YI2T 3OS0A 5I2SA 4MZPA 4BI8B 3CCVT 2LQ8A 2DXCA 2P0KA 1EIFA 4ZN3A 3S3NA 5GANj 1YJNA 2OTJA 4M75G 1YCYA 3G7ZA 3FJPA 3JB9G 5LJ3f 2XK0A 3BY7A 1VQ7A 4XTVA 3MEAA 1WJQA 4JLGA 4E7IA 2DIQA 2RK1A 2F69A 3CBPA 2EJ9A 1FX7A 2ZPBB 3LH0A 5J26A 5HK3A 2VYTA 5KE3A 2V8IA 5GMKl 4VUBA 2XD0A 1P92A 4PL6A 4B9WA 4LD9K 1QVGS 3OYJA 4DA4A 4M78E 1JB0E 4A4FA 4HKEA 4J6YA 4PKCC 1O9SA 2LCCA 3R6OA 2H3JA 1YJNT 1Q82U 4HT8A 1I5LA 3CCUT 3EFRA 4DOVA 4Y91A 3QZ5B 2QQRA 3ZEHA 4M7DD 1IZ6A 5HY6A 2XICA 3CC4T 2K3XA 2KVQG 3CPFA 4MMKA 3AHUA 1QP2A 3CD6A 1NPRA 4E7HA 1N9RA 2HNIA 4N0AA 2PVDB 3QZ9B 3PMTA 3HRSA 4OGEA 3JCMg 4JS5A 2E6NA 3JCMc 2E1HA 4J6XA 3VUZA 2QQSA 3NTHA 3LGLA 3JCMV 5GAOn 4M7DB 1QVFA 4D6WA 4BUGA 3LX7A 2XG8D 2JNGA 4EDUA 1M1KC 5GAOr 3G6ET 3JB9D 4NS5A 3QIIA 3GP8A 1UGSB 4JUVA 3QYHB 3V8LA 4A53A 3OYFA 3CMAA 5C0MA 3VV0A 4X9CA 1Q7YC 4XU3A 3OB9A 1YIJT 3JB9F 5KCOA 3UPUA 4M7DG 3VUBA 3L1AA 1K73C 4F7UF 1KC8C 3A8HB 1D3BA 5GAN6 5DLOA 4BE1A 2DD5A 2O01E 5GAN7 4C5HA 2WACA 4PJOB 1UGQB 2EIFA 5CKEA 4GLKA 4JDSA 3FIFA 4ZGDB 3X28B 3LYIA 3CC7A 1X75C 3JCMQ 2CZ6B 3C95A 3HRTA 4FU6A 4GY5A 1YHQA 3M55A 1VQPA 2YRVA 3M59A 1XTDA 1Q7YU 5J3BA 3L2RA 3CCST 3CC2T 4M78F 4BDYA 4JRKA 2D0QB 4QQDA 2JOYA 4JJNK 2D6FA 5GAOp 4PJOD 3CBMA 3LGFA 3OYYA 1KHCA 1HXDA 1U1SA 1XNIA 3Q1JA 5CR2A 3ZBDA 3QSUA 3CCLT 2AHJB 3SFMA 2XU8A 3FC3A 5GAN3 5GAOl 2RJFA 1G3SA 1O75A 1BI1A 3OS1A 1Y96A 3OYDA 4M77B 1ZBXA 2EQMA 3QJ6A 2M16A 4JLIA 1OZ2A 1YJ9T 4BDZA 1AHJB 3SDZA 1MHNA 2DEQA 3QDRB 4XTXA 4EMKC 3CC2A 2LTOA 1OI1A 4J7IA 4P5NA 4M75A 2DTOA 3C94A 3HHTB 4M77F 5LJ5g 3M4YA 5GAN5 3ER0A 1OYXA 2R5MA 2RHUA 1VQ5A 1KQ1A 3A8GB 1U8RA 2K4YA 2JTFA 3CCMT 2A7YA 5L8RE 1VQ7T 3FLGA 1VQ4T 3X26B 4OMFB 3SWNA 1H641 2ZZDA 3HPWA 3JB9J 1YI2A 2EWNA 5I21A 3QBYA 4C0DB 4F7UE 2FYKA 2VGMA 4Z02A 2VGNA 4J83A 3JCMb 1YJ9A 2JZ2A 1W4SA 4LDVA 5IAYA 1NE8A 4E7KA 1Q86C 3E19A 1WGSA 4ZN1A 3RMSA 3DKMA 4LDWA 1VQ5T 1M9SA 1I4K1 3RERA 4M77C 2MMPA 3CCRT 3QPHA 1U1TA 1M4ZA 3JCMP 3VJPA 2FL7A 1N8RU 4JRIA 2KAFA 1BIBA 1DJ7B 2RHXA 5GMKe 5KH6A 5DY9A 3RKYA 1X01A 5LJ3j 3S6WA 2QXFA 2L8DA 4C92C 3HKSA 4QVZA 5FU6C 4M75E 2LDMA 3GOXA 4XTWA 3RUXA 2VXEA 2VV5A 2JN0A 2M0OA 3RKWA 4M77G 3URGA 1VQ6A 4M7DF 4LDYA 2E12A 3OYGA 3OW2A 4BY6B 2LX9A 4IURA 2LQKA 3UWNA 2P4TA 4OB0B 1V29B 2RHYA 4C8QF 1VQNA 2LT1A 5FRMA 3CCUA 3L2UA 4F7UA 2EQUA 1PSFA 4XTUA 5LJ5f 2E64A 4ATOA 4BY6C 3I55T 2NLUA 5AYFA 1BKBA 2FB7A 3FB9A 5CKHA 1RL2A 1IREB 2D9TA 3MO8A 1YIJA 3CCQT 2PU9B 2QQAA 3ME9A 1MGQA 4CI0C 1N9SA 5CCAA 2E70A 3OYEA 3QKJA 3J81E 5LL6S 3BDLA 3JCMf 4BD3A 5LJ3e 1M90C 2E41A 3P8DA 2XHCA 1NJIC 2X35A 1JBMA 4XAXB 2WSFE 3PT9A 2BUDA 3OYIA 2Y4YA 3J80E 4C8QE 3TU4K 3MP6A 3CCJA 2X4JA 4IUQA 4M7AC 4PJOA 3PMIA 3E1SA 3M54A 1YBYA 4A4GA 2VC8A 4OB3B 4R56A 1UB4A 3CBOA 5GMKm 5GAN8 2XDDA 3QJYA 4IUTA 5GMKh 3OYBA 3MEVA 4M7DE 5FROA 4KUIA 4XU1A 5LJ3d 4HCZA 1WQWA 3T9NA 1VQLA 1I81A 3OYMA 2GCXA 2ZPHB 4M75F 1NJIU 1W2BA 1VQMT 3JCMX 2OTLT 4XU0A 4J7FA 4IUPA 4C92B 3CCJT 4L59A 5EG2A 4QVDA 2WSEE 1TH7A 1N6AA 2RM4A 3HL8A 3M57A 4PLIA 3V7CA 5D6WA 4M7AE 3CCLA 1ZHIA 2RA2A 4O5VA 3BW1A 4C0FA 3CCMA 1Y7XA 1PSEA 2DXTA 2LNVA 2KK4A 4FL6A 1X6OA 4MMLA 1VQ9T 2YLBA 3I56T 2DD4A 3L2VA 1QVGA 3A8OB 1VIFA 2ZPEB 1I8FA 4MDWA 3G4ST 3CPWA 3L2WA 2G3RA 2HQEA 4OF1A 2DO3A 4QW2A 3WVDB 3GPLA 2RB6A 4YTLA 1QVPA 2EAYA 1Q81C 3RKXA 1KC8U 4TVRA 5FU7B 3WXMB 4C92D 5CK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I21 A;  4F7U E;  4NOY A;  1HK9 A;  5LJ3 g;  2DTH A;  2FYK A;  4J6W A;  4M75 B;  4M78 B;  3JCM b;  3JB9 J;  4PJO F;  5GAN h;  2DZC A;  4M7A A;  5LJ5 d;  4NL3 A;  1KQ2 A;  4PNO A;  4PJO G;  2RD1 A;  3RES A;  5GAN j;  5GAM e;  1I4K 1;  3RER A;  4HT9 A;  4M75 G;  4M78 G;  4M77 C;  1YCY A;  4M7A B;  3M4G A;  3FJP A;  3VU3 C;  5LJ3 f;  3JB9 G;  3V7S A;  1U1T A;  3BY7 A;  3JCM P;  4XTV A;  4JRI A;  4C92 A;  1BIB A;  3BDU A;  4EMH A;  4F7U B;  5GMK e;  5DY9 A;  3RKY A;  1X01 A;  2EJ9 A;  3SWN C;  5GMK l;  4C92 G;  5LJ3 j;  3JCM J;  5GAO m;  4C92 C;  2DVE A;  1BIA A;  4RCB A;  4M78 E;  4M75 E;  4XTW A;  3RUX A;  4J6Y A;  2VXE A;  3JCM h;  5LJ5 h;  1LOJ A;  3INZ A;  2JN0 A;  3RKW A;  4HT8 A;  1I5L A;  2YHT A;  4NL2 A;  2Y90 A;  3EFR A;  4M77 G;  4XU2 A;  4M7D F;  2DTI A;  4Y91 A;  4XQ3 A;  4C8Q G;  4M7D D;  3V8J A;  4X9D A;  4M77 A;  4C8Q F;  4EMK B;  4XTZ A;  4MMK A;  3AHU A;  3L2Z A;  4F7U A;  4XTU A;  4M7A D;  1N9R A;  2HNI A;  4N0A A;  2DKG A;  2E64 A;  3JCM g;  4C8Q B;  4QVC A;  5LJ5 f;  5GAM j;  3HFO A;  3JCM c;  1WNL A;  2E1H A;  4J6X A;  3V7R A;  1M8V A;  3FB9 A;  2FB7 A;  3JCM V;  5GAO n;  4PJO E;  4V2S A;  4M7D B;  1LJO A;  1WPY A;  2I2L A;  1JRI A;  2VXF A;  1MGQ A;  5GAO r;  3JB9 D;  1N9S A;  4M7D A;  3SWN B;  3BFM A;  4JUV A;  3V8L A;  2DJZ A;  4A53 A;  4A54 A;  3JCM f;  5LJ3 e;  4X9C A;  5LJ5 j;  2EJG A;  4XU3 A;  2E41 A;  3EFS A;  3JB9 F;  4PJO C;  2ZGW A;  1JBM A;  4M7D G;  4M7D C;  2DZ9 A;  3L1A A;  4M77 E;  3GIB A;  3QUI A;  4F7U F;  2EJF A;  5GMK i;  1D3B A;  4C8Q E;  5GAN 6;  5GAN e;  4XTY A;  4M7A G;  4DQ2 A;  4HA8 A;  5GAN 7;  4M7A C;  4PJO B;  4OP0 A;  4PJO A;  4M7A F;  5GAN 2;  2VC8 A;  3FIF A;  5GAN 8;  5GMK m;  1Y96 B;  5GAM h;  4F7U G;  5GMK h;  5GAN d;  4C8Q D;  3JCM Q;  4M7D E;  4XU1 A;  3JCM d;  2QTX A;  5LJ3 d;  1WQW A;  3PGG A;  5GAN g;  1I81 A;  5GMK j;  2DXU A;  4M75 F;  4M78 F;  4JRK A;  4PJO D;  2E65 A;  3JCM X;  3JCM e;  5GAO p;  4XU0 A;  4C92 B;  1HXD A;  1U1S A;  3QSU A;  3HFN A;  5GAM g;  3HSB A;  3QO3 A;  4C8Q A;  4N0A C;  4WF2 A;  5LJ5 e;  5GAN 3;  5GAN f;  5GAO l;  4QVD A;  1TH7 A;  1Y96 A;  2RM4 A;  3QHS A;  4M77 B;  3V7C A;  3JB9 I;  4M7A E;  5GAN 4;  4JLI A;  2K57 A;  2RA2 A;  5GAM d;  3BW1 A;  4M77 D;  2DEQ A;  4EMK C;  4XTX A;  3JB9 H;  4MML A;  2DXT A;  4C8Q C;  5LJ3 h;  5GAM f;  2YLB A;  4M75 A;  4M78 A;  2DTO A;  5LJ5 g;  4M77 F;  4RCC A;  2E10 A;  2YLC A;  1I8F A;  4M75 D;  4M78 D;  3SB2 A;  2CGH A;  5GAN 5;  4J5Y A;  1KQ1 A;  4M78 C;  4M75 C;  2RB6 A;  1B34 B;  3V8K A;  1B34 A;  4EMG A;  1M5Q 1;  2EAY A;  4C92 E;  4EMK A;  5GAO q;  1WQ7 A;  3RIR A;  3RKX A;  3SWN A;  1H64 1;  1D3B B;  1LNX A;  4C92 F;  5CAI A;  3JCM W;  2EWN A;  4C92 D; 
#chains in the Genus database with same CATH topology
 1BI3 A;  2KT1 A;  2IIM A;  2KGT A;  1TXQ A;  2VUB A;  1AVZ C;  2LCS A;  3MEU A;  3WVE B;  3EG9 A;  2EQI A;  3M0R A;  1C0M A;  1M1G A;  3M4G A;  2C06 A;  3VU3 C;  2NUZ A;  2K3B A;  4L5G A;  4C0Z A;  2D8J A;  4JJC A;  4EMH A;  2K5L A;  2X4W A;  1Y07 A;  3RMQ A;  2H8H A;  2KY9 A;  2YHT A;  2KSS A;  2GGR A;  3N5B B;  2M0Y A;  2KRO A;  1GCQ A;  4OMQ A;  4XTZ A;  1NYG A;  4HVU A;  2BE7 D;  2L89 A;  4QVC A;  3KXT A;  1MUZ A;  1WNL A;  4BE0 A;  3CEY A;  2JUF A;  2I2L A;  1JJ2 S;  2FEI A;  2ECZ A;  2O4X A;  2FPD A;  1WJS A;  5CKB A;  2RMO A;  1M2V A;  3HRU A;  1FXX A;  4DOW A;  2HQX A;  3G71 T;  4DQ2 A;  2LJ0 A;  1Y96 B;  4WCI A;  2KNB B;  2E5Q A;  1PD1 A;  1KHI A;  4FSX A;  1OZ3 A;  4J9B A;  1K73 U;  3ULR B;  1YJW A;  4ZGJ B;  2DM1 A;  4AMC A;  1VQ4 A;  1Y71 A;  5GAN f;  2BTT A;  2KMT A;  3H8Z A;  1QQJ A;  4LE9 A;  3CCS A;  4RTZ A;  5LJ3 h;  9ATC B;  5GAM f;  2CSQ A;  3P8H A;  2J06 A;  1WDX A;  3QDF A;  2DRM A;  3SB2 A;  1WJR A;  3OY9 A;  3CCV Q;  1AWX A;  1YFN A;  5C6S A;  3JSC A;  3G4S A;  5KE2 A;  3MP8 A;  2OTJ T;  4HVV A;  4M75 B;  4PJO F;  4NL3 A;  4LDU A;  1WHJ A;  2KDS A;  5FU6 B;  2JS2 A;  3V7S A;  1G3Y A;  4R55 A;  2X4Y A;  1VQK A;  1MNE A;  3EH2 A;  2MWO A;  3M5A A;  5IN1 A;  2NUP B;  1HSQ A;  4QQ6 A;  5GAO m;  1H3Z A;  3JCM h;  4OB1 B;  4DBF A;  4C5G A;  3LH5 A;  5LJ5 h;  5A0L A;  1WYX A;  4OGC A;  2OTL Q;  4C8Q G;  3KBG A;  4ORZ A;  1NYF A;  1TOV A;  2HKN A;  1G3T A;  4FW1 A;  1NEB A;  4M7A D;  2QEX A;  1M8V A;  5KYY A;  2QDL A;  1LJO A;  2RI5 A;  5GJV B;  1VA7 A;  6AT1 B;  4J9C A;  2DJZ A;  2HAX A;  3JAM E;  3CCE A;  1KC8 R;  1WLP B;  2P0P A;  1J3T A;  3CC7 T;  2GF7 A;  4PLL A;  2CYZ B;  1ZSG A;  2FRY A;  5IXF A;  2P0Q A;  4HCC A;  5D6Y A;  1PKT A;  2QTX A;  3DB4 A;  4MZM A;  1VQ8 Q;  2FG0 A;  2DXU A;  1OU8 A;  1W70 A;  2YT6 A;  1MV0 B;  2HMA A;  1M1F A;  2PQW A;  1RUW A;  1WXU A;  2DL7 A;  3QO3 A;  1ACM B;  2MF2 A;  2NUT A;  1PNJ A;  2EPD A;  3I56 Q;  2K57 A;  2V8J A;  3J7A F;  1YJ9 Q;  1SHG A;  3GLX A;  2DE0 X;  4M78 A;  3DLL A;  5KYX A;  1VQM A;  3CD6 Q;  2OI3 A;  2X51 A;  3EHR A;  4M75 C;  2LC4 A;  4Q5W A;  2DK3 A;  3NTK A;  3V8K A;  4C5I A;  4GBQ A;  5HK0 A;  2QAS A;  5LJ3 g;  3H0I A;  4M7A A;  4FYX B;  2QEX Q;  1QP3 A;  4JRQ A;  2RD1 A;  3ZFJ A;  4FSS A;  2L3P A;  2LQ8 A;  2P0K A;  1YJN A;  2V1R A;  5IHN A;  5GJW B;  4CC3 A;  3EG2 A;  3G7Z A;  2A37 A;  2XK0 A;  2KYB A;  3BY7 A;  4XTV A;  1ARK A;  1WJQ A;  2DIQ A;  2EGE A;  3CBP A;  1E6G A;  5HK3 A;  5GMK l;  4OMP A;  4LD9 K;  3H0F A;  4J6Y A;  4J9H A;  1K8A R;  2H3J A;  3CCU T;  1Z9Q A;  3ZEH A;  2YDL A;  5HY6 A;  2XIC A;  2F2X A;  3AHU A;  2C0T A;  2E4H A;  1NG2 A;  3CD6 A;  1N9R A;  2BZ8 A;  2HNI A;  1JU5 C;  3I5S A;  3PMT A;  3JCM g;  2E6N A;  4RTW A;  3JCM c;  2E1H A;  4J6X A;  2EYY A;  1S72 Q;  2QQS A;  3NTH A;  5GAO n;  1QVF A;  1OEB A;  3LX7 A;  1M1K C;  4OMN A;  3V8L A;  1Q7Y C;  1QCF A;  1VYU A;  3OB9 A;  1YIJ T;  1SRL A;  1K73 C;  4D8D A;  1D3B A;  5DLO A;  4BE1 A;  4PJO B;  4ZGD B;  3FIF A;  2HZY A;  2JW4 A;  2AK5 A;  3SEM A;  3C95 A;  1ABO A;  3NHN A;  1VQP A;  2YRV A;  5J3B A;  3L2R A;  3CCS T;  2YUN A;  4BDY A;  2FRW A;  4JRK A;  4JJN K;  3CBM A;  3LGF A;  1R77 A;  1XNI A;  1U1S A;  1HJD A;  2AHJ B;  2ED0 A;  3SFM A;  5GAN 3;  1O75 A;  1BCM A;  3OYD A;  1ZBX A;  4JLI A;  2DYB A;  1YJ9 T;  4FW2 A;  4EMK C;  1ZLM A;  1HYO A;  1OI1 A;  4M75 A;  3C94 A;  2MK5 A;  3M4Y A;  4PJJ A;  5GAN 5;  2NWM A;  3ER0 A;  3KFV A;  1U8R A;  2A7Y A;  5L8R E;  1PWT A;  2E5K A;  1RAB B;  5D7U A;  2K79 A;  3JB9 J;  1YI2 A;  4C0D B;  2K2M A;  2DMO A;  1M3C A;  5IAY A;  3G71 Q;  1WGS A;  4ZN1 A;  1H8K A;  4LDW A;  2V1Q A;  1PKS A;  1VQ5 T;  1I4K 1;  2QK0 A;  2QA4 Q;  2C0I A;  1M27 C;  3I35 A;  1M4Z A;  2KAF A;  3REB B;  2RHX A;  3PVL A;  5DY9 A;  3RKY A;  1K73 R;  1IB8 A;  3GBQ A;  4C92 C;  4QVZ A;  1H92 A;  2HEQ A;  3RUX A;  2DA9 A;  1VQ6 A;  1GFD A;  1GCP A;  2LQK A;  4C8Q F;  2P4T A;  3EFO B;  4F7U A;  2O31 A;  5LJ5 f;  1B07 A;  4ATO A;  1K0S A;  2NLU A;  5AYF A;  1EZZ B;  2FB7 A;  2PU9 B;  2QQA A;  1N9S A;  3OYE A;  3BDL A;  3JCM f;  4BD3 A;  2M51 A;  1M90 C;  2XHC A;  4XAX B;  2D8H A;  4CC7 A;  3TU4 K;  3CCJ A;  2X4J A;  2V26 A;  4A4G A;  2VC8 A;  4R56 A;  1UB4 A;  3OYB A;  3EGX B;  4XU1 A;  4HCZ A;  4QT7 A;  3T9N A;  5IH2 A;  2GCX A;  2ZPH B;  1NJI U;  1X2K A;  1VQM T;  1K9M R;  4XU0 A;  3O5Z A;  1K4U S;  1AWW A;  4QVD A;  1TUC A;  4HCK A;  1QVG P;  4PLI A;  3CCL A;  1ZHI A;  2LNV A;  4FYV B;  1NBE B;  2JMA A;  3JV3 A;  1VIF A;  2DRK A;  1YWO A;  1QVF P;  4MDW A;  3CPW A;  2DO3 A;  4RTT A;  2RB6 A;  1W6X A;  1QVP A;  1KC8 U;  1IGQ A;  1MND A;  1AWO A;  3WXM B;  1FMV A;  1RAA B;  4B6M A;  5FRN A;  4C0G A;  3L42 A;  4FIB A;  4MZT A;  3ZL7 C;  1KQ2 A;  3C4S A;  1MV3 A;  4UC4 A;  1KQS S;  3QYG B;  3X25 B;  1RAF B;  3QXE B;  2MIO A;  3OMG A;  1UGR B;  1QLY A;  2LQN A;  2XID A;  2FO0 A;  1UE9 A;  5DLQ E;  4C92 A;  1KD1 U;  4KUD K;  5CIU A;  2KXD A;  3NTI A;  1WIE A;  4Y28 E;  2ROT A;  2ZAE A;  2LVM A;  4PK4 A;  2DTI A;  5CVI A;  4ELZ C;  4M77 A;  3QWY A;  2XKO C;  1OQK A;  3MHX A;  1OV3 A;  3E9G A;  4KT0 E;  4BI4 A;  5I2M A;  3V7R A;  4J9D A;  3VYG A;  3TVT A;  2ZPG B;  1GBR A;  3S3O A;  5LJ5 j;  1WXT A;  3CCL Q;  1VQP T;  4PJO C;  1K8A U;  1KG1 A;  2DZ9 A;  2LRQ A;  5GMK i;  3LWI A;  2VVK A;  3M56 A;  1UTI A;  2HD0 A;  3OYK A;  1M30 A;  1Q7Y R;  2OTL A;  3CCE Q;  3PGG A;  4KRT A;  3OQ5 A;  1VYV A;  3P8B B;  3FDR A;  2E65 A;  4XK8 E;  1M3A A;  3HFN A;  2DXB A;  4HCB A;  2XI9 A;  2J6O A;  4WF2 A;  2RO0 A;  4Y92 A;  2DL3 A;  2RQW A;  1BI0 A;  1YIT A;  3M0Q A;  2E10 A;  4J5Y A;  2OJ2 A;  2O88 A;  1KD1 R;  4IKF A;  4EMG A;  4KH0 B;  1M5Q 1;  5GAO q;  2A08 A;  3O8V A;  3UDC A;  2XDP A;  4J6W A;  1JJ2 A;  2KRN A;  1M90 R;  2BIV A;  4KGX B;  4C5E A;  3FEO A;  4N4I A;  1ZSZ B;  1UGP B;  2HBP A;  4B9X A;  4M78 G;  2DIG A;  3CCJ Q;  5KYY B;  1VQ6 T;  1VIE A;  4AFS C;  1LPL A;  3E9F A;  3X20 B;  2A36 A;  3LWH A;  1G5V A;  3RR6 A;  2ED1 A;  1D09 B;  2DFU A;  3CPW S;  1KK7 A;  3GNG A;  3LLR A;  3PIP A;  1K0X A;  1QKX A;  2NYS A;  1K76 A;  3PE0 A;  2D1X A;  5A2Q E;  1VQK T;  4JS4 A;  4RG2 A;  2R57 A;  3GNF B;  2RQV A;  4C8Q B;  5GAM j;  1OPK A;  3HFO A;  4F17 A;  4BAC A;  1VQN Q;  4V2S A;  4PJO E;  2VXF A;  3I5R A;  3OW2 P;  3NFC A;  1HD3 A;  2J6K A;  1WZO A;  2ATC B;  2ZGW A;  1XOV A;  5FWB A;  1X2Q A;  4ANJ A;  2ZPI B;  2L2P A;  4M7A G;  1Q95 G;  2QA4 A;  1KD1 C;  1RAG B;  2RK2 A;  4X34 A;  4E7J A;  1NEG A;  3SD4 A;  1GRI A;  3A98 A;  4J9E A;  1N8R R;  2GFA A;  3TRE A;  2ABL A;  1VQ4 Q;  1CKA A;  4BI3 A;  4C8Q A;  4N0A C;  2ZPF B;  2QDY B;  2V8K A;  4M77 D;  3JB9 H;  1VQO T;  1V1C A;  2Y4X A;  2JT4 A;  1Q86 R;  4KGZ B;  2ZCF B;  1B34 B;  4EMK A;  3M0P A;  5M9O A;  4KBM B;  4KH1 B;  1E6H A;  3JRZ A;  5KYU B;  4KGV B;  4MDX A;  2GQV A;  5CKF A;  2DZC A;  4L6V 5;  3ASK A;  2KYM A;  2F5T X;  2K5I A;  1YI2 T;  4MZP A;  4BI8 B;  5GAN j;  2HSP A;  1EIF A;  4ZN3 A;  4PJM A;  3JB9 G;  1U3O A;  2G6F X;  4JPB W;  1IRX A;  2P84 A;  2ZPB B;  3LH0 A;  2VYT A;  5KE3 A;  2GBQ A;  1P92 A;  4PL6 A;  1JB0 E;  5I11 A;  1UJY A;  4PKC C;  2LCC A;  2EGC A;  1YJN T;  1Q82 U;  1SSH A;  2O2O A;  3QZ5 B;  2QQR A;  4M7D D;  2DJQ A;  2K3X A;  3RNJ A;  1NPR A;  2MCN A;  3QZ9 B;  3CC2 Q;  2EKH A;  4LUD A;  4D6W A;  2XG8 D;  1VQO Q;  2QGG A;  3QYH B;  3OYF A;  5C0M A;  3VV0 A;  4X9C A;  1G2B A;  2MOX A;  5KCO A;  2QYZ A;  2CP5 A;  2YSQ A;  2CP2 A;  3VUB A;  3A8H B;  3FJ5 A;  5GAN 6;  2DBM A;  4C5H A;  2EIF A;  4JDS A;  3LYI A;  1X75 C;  2COW A;  4FU6 A;  2XMF A;  3M59 A;  3CC2 T;  4M78 F;  4PJO D;  3OYY A;  1HXD A;  1KHC A;  5CR2 A;  1FMK A;  2HKQ B;  3ZBD A;  2KRM A;  1U5S A;  2XU8 A;  1JXO A;  1QMC A;  5GAO l;  1V76 A;  1BI1 A;  1IHW A;  2OX7 A;  4M77 B;  3QJ6 A;  2M16 A;  1AHJ B;  1D0Y A;  3QDR B;  2CRE A;  4J7I A;  2W10 A;  2CUB A;  5LJ5 g;  3HHT B;  2KRS A;  2R5M A;  2RHU A;  2K4Y A;  2JTF A;  4PFO A;  1VQ7 T;  3FLG A;  3EH1 A;  3E2U A;  4OMF B;  3HPW A;  2O9S A;  2JJ9 A;  5I21 A;  4F7U E;  2X3W D;  2CT4 A;  2FYK A;  2VGM A;  1YJ9 A;  2LQW A;  2AKL A;  4LDV A;  2VB6 A;  3RMS A;  1GCQ C;  1MMD A;  1SRM A;  1M9S A;  2W0Z A;  2J7I A;  3VS1 A;  3CMA Q;  1MMA A;  1U1T A;  3JCM P;  3CC4 Q;  4JRI A;  4RUG A;  3M0T A;  5GMK e;  5KH6 A;  3EGD A;  2QXF A;  1A0N B;  3CME Q;  1BBZ A;  3GOX A;  2VXE A;  2M0O A;  3RKW A;  1M3B A;  4M77 G;  4M7D F;  4J9I A;  1B3Q A;  4BY6 B;  1S1N A;  2LX9 A;  4IUR A;  4ESR A;  1V29 B;  1BCO A;  5FRM A;  2J6F A;  3L2U A;  1RAC B;  4XTU A;  2E64 A;  3CCM Q;  1PRL C;  3VS4 A;  1BKB A;  3FB9 A;  5CKH A;  1RL2 A;  2GQI A;  1D0X A;  5CCA A;  4IIM A;  4FCY A;  1NJI R;  1OX9 A;  2X35 A;  1LCK A;  2CT3 A;  2BUD A;  3MP6 A;  4IUQ A;  1GL5 A;  4PJO A;  1YBY A;  3R6N A;  3TQ7 P;  3QJY A;  1AD5 A;  4Z88 A;  2F2W A;  1WQW A;  3OYM A;  4M75 F;  2D0N A;  3JCM X;  2OTL T;  2HDA A;  1RAH B;  3H0H A;  3EG0 A;  4J7F A;  3CCR Q;  2KBT A;  3CCJ T;  1VQ6 Q;  3MKD A;  1TH7 A;  3UF4 A;  3V7C A;  2RM4 A;  3M57 A;  1VQP Q;  5D6W A;  2DNU A;  1XJW B;  4C0F A;  4PJL A;  4LUE A;  4MML A;  1PSE A;  2DXT A;  4FL6 A;  1X6O A;  2LP5 A;  2HCK A;  4M4Z A;  3G4S T;  2HQE A;  4OF1 A;  4E2F B;  3WVD B;  3GPL A;  1WHM A;  1NM7 A;  3RKX A;  5FU7 B;  3G1J A;  4C92 D;  5CK9 A;  5KYX B;  4FT2 A;  2RJE A;  4IUV A;  4M78 B;  4FYW B;  5LJ5 d;  1Q82 C;  3RES A;  2PUK B;  1M90 U;  1BI2 A;  2J05 A;  3OSS C;  1UFF A;  2RJD A;  1MMN A;  4OB2 B;  1Q81 U;  2DX1 A;  2E6Z A;  4CC4 B;  1TUG B;  3SWN C;  1WHK A;  3CCR A;  1VQN T;  3INZ A;  4RKU E;  1UJ0 A;  1UEB A;  3NGP A;  2RQU A;  4RTV A;  1VQ7 Q;  2DEU A;  1ABQ A;  2AIR B;  2DVJ A;  5CQX A;  3L2Z A;  3CCQ A;  2EGA A;  2FVU A;  1PHT A;  5D6X A;  5A0D A;  3PNW C;  3SHW A;  1OU9 A;  2CKK A;  4E7S A;  3CCE T;  1YWP A;  3AT1 B;  3JCM e;  3VS3 A;  1JJ2 P;  2DL8 A;  3CC4 A;  2O9V A;  1K1Z A;  4AG2 C;  4M7D C;  3QUI A;  2F2V A;  5GAN e;  4XTY A;  1T3S A;  2EVR A;  2FZK B;  4OP0 A;  5GAM h;  3G6E A;  1RAD B;  5GAN g;  5I22 A;  5KCH A;  2DPP B;  4FM4 B;  2YUQ A;  3KUF A;  2DAQ A;  2RHZ A;  1VQ7 A;  5LJ5 e;  2KE9 A;  2CUD A;  2MAM A;  4F14 A;  3FRN A;  2HBW A;  3JB9 I;  3X24 B;  1VQ9 Q;  1I5O B;  2MYS A;  4C8Q C;  3OW2 S;  4C0D C;  2PVG B;  1X69 A;  2CGH A;  1VQO A;  4M78 C;  1OOT A;  1ZUK A;  4ZTF A;  2GFU A;  2M1H A;  4C92 F;  1FMW A;  1LNX A;  2L3Q A;  3M58 A;  5GAM g;  1KSW A;  2DLP A;  5GAN h;  4EPC A;  1YJN Q;  2M9U A;  4GLM A;  2BKD N;  3CC7 Q;  1QWF A;  2MWP A;  5GAM e;  2L3R A;  4M7A B;  2CZ0 B;  1I1J A;  2B8A A;  1IXD A;  3A8L B;  3EFO A;  4F7U B;  1W2B P;  1VQ8 A;  2R58 A;  4C92 G;  1BIA A;  4RCB A;  4HXJ A;  4J8O A;  1NZ9 A;  3F70 A;  3OS5 A;  3EAE A;  1UG1 A;  4EMK B;  3CCS Q;  3HP9 A;  1VYT A;  3MP1 A;  4OMM A;  5HCK A;  2DKG A;  2BE9 B;  3PFS A;  1PC0 A;  3UA6 A;  3H41 A;  4HVW A;  1YJW Q;  4ELY C;  5ECA A;  2HL3 A;  4E7L A;  2MI6 A;  2K6D A;  4M7D A;  1AEY A;  2IPO B;  4ZTJ A;  4A54 A;  4JRP A;  1YHQ Q;  3DLM A;  2EJG A;  3S3M A;  4JZ4 A;  1AZE A;  3QG1 A;  2QQ9 A;  1YP5 A;  4M77 E;  3GIB A;  2YRD A;  2EJF A;  4BE2 A;  4DBH A;  2COY A;  2QQB A;  4HA8 A;  5HKC A;  2B86 A;  2OTJ Q;  4F7U G;  2X3X D;  1UHC A;  1SSF A;  3TEE A;  3OBY A;  2O4X B;  3OYN A;  4DBR A;  4JJB A;  1IO6 A;  2HL5 C;  4CRI A;  1D1C A;  1N8R C;  2RF0 A;  2QA4 T;  1S72 A;  1W2B S;  1K9M U;  2FPF A;  3UT1 A;  4E47 A;  4OML A;  3VRY A;  5FWC A;  2RHI A;  3QHS A;  4AFQ C;  5GAN 4;  2MPX C;  1M1K U;  1BK2 A;  2QTV A;  3GF5 A;  2CZ7 B;  2YLC A;  3CCV A;  5IT9 E;  3RIR A;  4A4E A;  5CAI A;  2IG0 A;  1D3B B;  2DBK A;  2FZG B;  2K2V A;  3NPF A;  1VQK Q;  2A3L A;  4NOY A;  4AT1 B;  1QW1 A;  2RJC A;  5CO7 A;  2LMJ A;  2QGF B;  1IHV A;  5DM7 R;  3OYH A;  1AT1 B;  1SPK A;  2DXC A;  2OTJ A;  4LXC A;  2RPN A;  2AKK A;  3FJP A;  1RLQ C;  5LJ3 f;  2DL4 A;  2VAS A;  5KYW A;  2HSE B;  4JLG A;  2DER A;  5J26 A;  1FX7 A;  1WX6 A;  2V8I A;  4VUB A;  2JTE A;  4B9W A;  1QVG S;  5IXB A;  1O9S A;  4HT8 A;  1I5L A;  3EFR A;  4DOV A;  1KFZ A;  3CC4 T;  3EHQ A;  1VOM A;  2KVQ G;  4MMK A;  3G4S Q;  1ZUU A;  1QP2 A;  2VWF A;  5L23 A;  4N0A A;  4WTO B;  3VUZ A;  2VKN A;  2PNI A;  4M7D B;  3CQT A;  4EDU A;  2JNG A;  3G6E T;  3GP8 A;  4IIO A;  1UGS B;  3CMA A;  4A53 A;  2P4R A;  4XU3 A;  4DBQ A;  3UPU A;  1CSK A;  2DD5 A;  2ENM A;  1YIJ Q;  2O01 E;  1WA7 A;  1WHL A;  1FYN A;  1T0H A;  1ZBJ A;  1UGQ B;  2AZS A;  4GLK A;  1UEC A;  1TS9 A;  2RNA A;  3CC7 A;  3JCM Q;  3M55 A;  2DYI A;  1XTD A;  1Q7Y U;  1N5Z A;  4E6R A;  2D0Q B;  2JOY A;  3Q1J A;  2NUT B;  3CCL T;  1TTH B;  3THK A;  3FC3 A;  3OS1 A;  1Y96 A;  1X6G A;  4AFU C;  2EQM A;  3SDZ A;  4XTX A;  3CC2 A;  4CC2 A;  2LTO A;  1NLP C;  2DTO A;  4M77 F;  1OYX A;  1KQ1 A;  2JM8 A;  4FYY B;  2CP0 A;  2EW3 A;  3MJX A;  2ZZD A;  4PJN A;  2EWN A;  4Z02 A;  3VS2 A;  2JZ2 A;  1TG0 A;  1NE8 A;  4E7K A;  1B7T A;  1ZA2 B;  2RN8 A;  1SF9 A;  1UUE A;  4JJD A;  3RER A;  1RLP C;  4M77 C;  4Z89 A;  3QPH A;  1C1A A;  1TSF A;  1N8R U;  3VJP A;  4J9G A;  1BIB A;  1R0C B;  2CP6 A;  2YWW A;  2L8D A;  2LDM A;  4XTW A;  1BB9 A;  2VV5 A;  2H3E B;  4AG1 C;  2E3I A;  8AT1 B;  2E12 A;  4RTU A;  5EC7 A;  3OYG A;  3UWN A;  2RHY A;  2LT1 A;  3CCU A;  2NUP A;  1PSF A;  2QAZ A;  1VQ5 Q;  1TWB A;  2AT1 B;  1K9A A;  5AT1 B;  3MO8 A;  1IRE B;  2D9T A;  3TSZ A;  3CCQ T;  2KT8 A;  2E70 A;  3QKJ A;  3J81 E;  3BE3 A;  5LJ3 e;  3P8D A;  1NJI C;  2WSF E;  3PT9 A;  1X43 A;  3PMI A;  3E1S A;  3M54 A;  4OB3 B;  3CBO A;  3UAT A;  2YXY A;  4IUT A;  4RTY A;  1E7O A;  3MEV A;  4M7D E;  3EGU A;  5LJ3 d;  2I0N A;  1VQL A;  1JEG A;  5IHI A;  1D1B A;  3VRZ A;  2X9H A;  4IUP A;  4L59 A;  2QG9 B;  3C0C A;  4OMO A;  1SG5 A;  1U06 A;  2ROL A;  2C0O A;  1OUL A;  4M7A E;  2RA2 A;  3BW1 A;  3CCM A;  1VQ9 T;  2KK4 A;  2DD4 A;  1T3L A;  3A8O B;  3U23 A;  3RDV A;  2CH4 A;  1I8F A;  3QWX X;  2GTJ A;  1Q81 R;  1WFW A;  1OX8 A;  4YTL A;  1Q81 C;  3MPU B;  4TVR A;  2CH4 W;  1G8X A;  1WHG A;  1I0C A;  1H3H A;  1KJW A;  2BZY A;  2JTM A;  4PFZ A;  4QQG A;  4PJO G;  5J39 A;  1YN8 A;  4RTX A;  1WI7 A;  1SKU B;  1R0B G;  4HT9 A;  1M2O A;  4FT4 A;  2LJ3 A;  2CDT A;  1W1F A;  2GTO A;  4QKU A;  3BDU A;  3M0U A;  1D0Z A;  1R8O B;  3CME A;  2FHD A;  5IHK A;  2EQK A;  4II1 A;  2R5A A;  5FLX E;  1LOJ A;  2JMC A;  2L5Q A;  1I07 A;  4BB7 A;  5FU7 C;  2Y90 A;  2WSC E;  4OVA A;  4XQ3 A;  2EKO A;  4X9D A;  3C12 A;  1AZG B;  3PIO A;  2KXC A;  2HQH A;  1ZSZ A;  5KYW B;  1VQN A;  3DB3 A;  1Y0M A;  3G71 A;  3HTR A;  2K3Y A;  3EG9 B;  3REA B;  2OAU A;  3SWN B;  3BFM A;  2EFI A;  1QVF S;  3EFS A;  3L2Q A;  2Z0W A;  4ZGE B;  2F1L A;  4Z8A A;  1RAE B;  3VS5 A;  2AZV A;  1N27 A;  2JXB A;  2X4X A;  1YJW T;  4M7A F;  5GAN 2;  1Y57 A;  2IVW A;  3MCA B;  3VYH B;  3VKI A;  3JCM d;  3CXC A;  3CPW P;  1BYM A;  1G3W A;  3LW5 E;  4N4G A;  5GMK j;  1RAI B;  1K8A C;  3M9Q A;  3RBB B;  3HSB A;  1JXM A;  4DEX A;  4X1V A;  2EQJ A;  2QI2 A;  2COZ A;  4ZNX A;  3I56 A;  1ZX6 A;  4KUL A;  2K7A A;  3NMZ C;  2L0A A;  1YHQ T;  4IUU A;  1S72 T;  1EFN A;  1UHF A;  2RI2 A;  1Q86 U;  1NLO C;  4RCC A;  1NPP A;  4M75 D;  3I55 Q;  1VQM Q;  3OMC A;  2JS0 A;  1WQ7 A;  5A0G A;  2LCL A;  2DTH A;  7AT1 B;  2F5K A;  2A0F B;  1PRM C;  1M8M A;  2DF6 A;  3OS2 A;  2RI3 A;  1WXB A;  2PVO B;  3OYA A;  2K5F A;  1KIK A;  1TU0 B;  2K9G A;  1GXI E;  1VQL Q;  3JCM J;  1AOJ A;  4LDX A;  2QEX T;  1Q82 R;  2DVE A;  2CS7 A;  2GNC A;  4DEY A;  1FWZ A;  3A5Z B;  4NL2 A;  2RH2 A;  4XU2 A;  1ZQ1 A;  2RQT A;  3V8J A;  1XQH A;  1QKW A;  1KQS A;  2RQR A;  3H6Z A;  1VQ8 T;  3A1P A;  1D1A A;  4J9F A;  3MEW A;  4EIK A;  3PTA A;  2KQW A;  4RMO A;  1WPY A;  1JRI A;  2LX7 A;  2PZ1 A;  1GBQ A;  4RG8 A;  3EGX A;  1VQL T;  2KEA A;  1QWE A;  2YUP A;  3MET A;  4N4H A;  3TCJ A;  3A8M B;  1K9M C;  3CMA T;  3I55 A;  5CKD A;  2EYX A;  1X27 A;  1ZSZ C;  3OA6 A;  2CSI A;  4A4H A;  4K11 A;  5GAN d;  2FZC B;  4C8Q D;  2PUO B;  2FPE A;  2JVV A;  1VQ9 A;  3CXC S;  3M53 A;  1OPL A;  5CQY A;  3OYL A;  4JZ3 A;  2CZ1 B;  4A4K A;  3G6E Q;  1LVK A;  3CCU Q;  1G83 A;  1F1B B;  5GAM d;  4A63 B;  2DIL A;  4PFP A;  4M78 D;  3VS7 A;  1UDL A;  1YIT T;  1RI0 A;  3M0S A;  1B34 A;  4C92 E;  1VUB A;  3OSV A;  4O6J A;  3JCM W;  4LD6 A;  2XDB A;  1WHH A;  3OYC A;  1HK9 A;  3CME T;  2EYQ A;  2LT4 A;  4PNO A;  3OBW A;  4ME7 A;  3IQL A;  3OS0 A;  5I2S A;  3EGD B;  3CCV T;  3S3N A;  2YUO A;  1SEM A;  4M75 G;  1YCY A;  4F04 B;  1PD0 A;  1AWJ A;  3MEA A;  2SRC A;  4E7I A;  2RK1 A;  2F69 A;  2EJ9 A;  3CD6 T;  2XD0 A;  2DET A;  2M02 A;  4AFZ C;  3UA7 A;  3OYJ A;  4DA4 A;  4M78 E;  4A4F A;  4HKE A;  3R6O A;  3CXC P;  4Y91 A;  1IZ6 A;  2EYW A;  3CPF A;  4E7H A;  4OGE A;  2PVD B;  1YIT Q;  3HRS A;  4JS5 A;  3JCM V;  3LGL A;  1T0J A;  4BUG A;  2LZ6 B;  2LJ1 A;  5FW9 A;  5GAO r;  3JB9 D;  4NS5 A;  3QII A;  4JUV A;  1QCN A;  3TSW A;  3JB9 F;  3VS0 A;  4M7D G;  1TUD A;  3L1A A;  4F7U F;  1JO8 A;  1KC8 C;  5KYN A;  5GAN 7;  2WAC A;  5CKE A;  3X28 B;  2CZ6 B;  1YHQ A;  3HRT A;  4GY5 A;  1BU1 A;  3H9N A;  2EYZ A;  4QQD A;  2D6F A;  5GAO p;  3QSU A;  3I9Q A;  2RJF A;  1G3S A;  1MMG A;  2KR3 A;  1YCS B;  1OZ2 A;  1SHF A;  4BDZ A;  1MHN A;  2DEQ A;  2DL5 A;  4P5N A;  2A28 A;  1VQ5 A;  1GFC A;  3A8G B;  3CCM T;  1VQ4 T;  3X26 B;  1CKB A;  1ZUY A;  3SWN A;  1H64 1;  2L3S A;  3QBY A;  2PTK A;  2VGN A;  4J83 A;  3JCM b;  1W4S A;  1Q86 C;  3E19 A;  2BZX A;  2KI7 A;  3DKM A;  3VS6 A;  1KQS P;  2MMP A;  1EX4 A;  8ATC B;  3CCR T;  2FL7 A;  2LNH B;  1DJ7 B;  1X01 A;  3PVQ A;  3CCQ Q;  5LJ3 j;  3S6W A;  3HKS A;  5FU6 C;  1PG5 B;  4M75 E;  2JN0 A;  1ZA1 B;  1X6B A;  2EBP A;  5KYU A;  1Z9Z A;  3URG A;  4LDY A;  3OW2 A;  1PM3 A;  4D8K A;  4OB0 B;  2EQU A;  2CP7 A;  4BY6 C;  3I55 T;  2OAW A;  1YIJ A;  4R0K A;  3ME9 A;  1MGQ A;  4CI0 C;  3EG3 A;  5LL6 S;  1JQQ A;  2E41 A;  1JBM A;  1M2V B;  1YNZ A;  3OYI A;  2Y4Y A;  3J80 E;  4C8Q E;  1RI9 A;  2JM9 A;  4M7A C;  5GAN 8;  5GMK m;  2XDD A;  5GMK h;  2YRC A;  5FRO A;  4KUI A;  1QCO A;  1I81 A;  2SEM A;  1W2B A;  1C6V X;  2E3H A;  4C92 B;  3EG1 A;  1PCX A;  5EG2 A;  2WSE E;  4F16 A;  4E7Z A;  1N6A A;  3HL8 A;  4O5V A;  1UGV A;  4LNP A;  1Y7X A;  1IGU A;  2YLB A;  3I56 T;  3L2V A;  1QVG A;  2ZPE B;  1M1K R;  3L2W A;  2G3R A;  4QW2 A;  2CP3 A;  3D7S B;  2EAY A;  1YI2 Q;  2ESW A;  4LN2 A; 
#chains in the Genus database with same CATH homology
 5FRN A;  4C0G A;  1BI3 A;  3L42 A;  2RJE A;  4FIB A;  4FT2 A;  4IUV A;  4M78 B;  4MZT A;  5LJ5 d;  1KQ2 A;  2JTM A;  3C4S A;  4UC4 A;  4PJO G;  4QQG A;  1Q82 C;  5J39 A;  1KQS S;  3QYG B;  3RES A;  2PUK B;  2VUB A;  1M90 U;  3X25 B;  1BI2 A;  3QXE B;  4HT9 A;  3MEU A;  3OSS C;  3WVE B;  1M1G A;  2RJD A;  1UGR B;  3M4G A;  3OMG A;  4FT4 A;  3VU3 C;  2C06 A;  2XID A;  4L5G A;  4C0Z A;  4OB2 B;  4C92 A;  5DLQ E;  1Q81 U;  3BDU A;  4EMH A;  1KD1 U;  2E6Z A;  4KUD K;  3SWN C;  1R8O B;  5CIU A;  3CME A;  3CCR A;  2FHD A;  3NTI A;  1VQN T;  2EQK A;  2K5L A;  1Y07 A;  2X4W A;  4Y28 E;  4II1 A;  2LVM A;  2R5A A;  5FLX E;  3RMQ A;  1LOJ A;  3INZ A;  4RKU E;  2L5Q A;  4BB7 A;  5FU7 C;  2KY9 A;  2YHT A;  2KSS A;  2Y90 A;  3N5B B;  1UEB A;  2DTI A;  5CVI A;  4ELZ C;  2WSC E;  4OVA A;  4XQ3 A;  2EKO A;  4X9D A;  4M77 A;  4XTZ A;  3C12 A;  5CQX A;  3L2Z A;  3PIO A;  3CCQ A;  2XKO C;  3MHX A;  2L89 A;  2FVU A;  3E9G A;  4KT0 E;  5D6X A;  4BI4 A;  5A0D A;  4QVC A;  5I2M A;  3DB3 A;  1WNL A;  3PNW C;  3KXT A;  3V7R A;  3G71 A;  4BE0 A;  2CKK A;  3CEY A;  2K3Y A;  3CCE T;  3VYG A;  2JUF A;  2I2L A;  2OAU A;  2ZPG B;  1JJ2 S;  3SWN B;  3BFM A;  2EFI A;  3S3O A;  1QVF S;  3JCM e;  5LJ5 j;  1VQP T;  3CC4 A;  4PJO C;  2O4X A;  3EFS A;  3L2Q A;  1WJS A;  1K8A U;  5CKB A;  4ZGE B;  1KG1 A;  4M7D C;  2DZ9 A;  3QUI A;  3HRU A;  2LRQ A;  1FXX A;  4DOW A;  5GMK i;  2HQX A;  5GAN e;  4XTY A;  3LWI A;  4DQ2 A;  3G71 T;  1N27 A;  2X4X A;  3M56 A;  4OP0 A;  1YJW T;  4M7A F;  5GAN 2;  2IVW A;  3MCA B;  1Y96 B;  2HD0 A;  3VYH B;  5GAM h;  3G6E A;  3OYK A;  2OTL A;  3VKI A;  3JCM d;  3CXC A;  3PGG A;  5GAN g;  2E5Q A;  1G3W A;  3LW5 E;  3OQ5 A;  1BYM A;  4N4G A;  3P8B B;  5KCH A;  5GMK j;  2DPP B;  4FM4 B;  1KHI A;  3FDR A;  1K8A C;  2E65 A;  4FSX A;  3M9Q A;  4XK8 E;  1OZ3 A;  1K73 U;  3KUF A;  2DAQ A;  3HFN A;  2DXB A;  2RHZ A;  3HSB A;  4HCB A;  2XI9 A;  1YJW A;  4ZGJ B;  2EQJ A;  2QI2 A;  4WF2 A;  1VQ4 A;  2RO0 A;  5LJ5 e;  2MAM A;  1Y71 A;  5GAN f;  3I56 A;  4KUL A;  3FRN A;  1YHQ T;  1BI0 A;  4IUU A;  3JB9 I;  2KMT A;  3X24 B;  1S72 T;  3H8Z A;  1YIT A;  2RI2 A;  1Q86 U;  4C8Q C;  3CCS A;  5LJ3 h;  5GAM f;  3OW2 S;  3P8H A;  4RCC A;  1NPP A;  2E10 A;  4M75 D;  4C0D C;  3SB2 A;  2PVG B;  2CGH A;  1WJR A;  4J5Y A;  1VQO A;  4M78 C;  3OY9 A;  3OMC A;  4IKF A;  4EMG A;  4ZTF A;  1M5Q 1;  5GAO q;  1WQ7 A;  2GFU A;  2M1H A;  5A0G A;  5C6S A;  3O8V A;  1LNX A;  3M58 A;  4C92 F;  3JSC A;  3UDC A;  5GAM g;  3G4S A;  2LCL A;  2DTH A;  2XDP A;  3MP8 A;  4J6W A;  5KE2 A;  1JJ2 A;  4M75 B;  2OTJ T;  4PJO F;  5GAN h;  2BIV A;  4NL3 A;  4LDU A;  4C5E A;  4EPC A;  2F5K A;  2M9U A;  3FEO A;  4N4I A;  2BKD N;  1UGP B;  2MWP A;  2HBP A;  2KDS A;  2L3R A;  4B9X A;  5GAM e;  4M78 G;  2DIG A;  3OS2 A;  2RI3 A;  4M7A B;  2CZ0 B;  5FU6 B;  1VQ6 T;  1VIE A;  1G3Y A;  2B8A A;  2PVO B;  3A8L B;  2X4Y A;  3V7S A;  4R55 A;  3OYA A;  1VQK A;  2K5F A;  3E9F A;  2MWO A;  3M5A A;  3X20 B;  5IN1 A;  4F7U B;  3LWH A;  1G5V A;  1GXI E;  1VQ8 A;  2R58 A;  4C92 G;  4QQ6 A;  3JCM J;  4LDX A;  2QEX T;  5GAO m;  1H3Z A;  2DVE A;  1BIA A;  2CS7 A;  4RCB A;  4J8O A;  3CPW S;  3JCM h;  4OB1 B;  5LJ5 h;  4C5G A;  1FWZ A;  1NZ9 A;  3A5Z B;  3F70 A;  3GNG A;  3LLR A;  4OGC A;  5A0L A;  4NL2 A;  3PIP A;  2RH2 A;  4XU2 A;  1ZQ1 A;  3OS5 A;  3JCM W;  4C8Q G;  3KBG A;  3V8J A;  3EAE A;  5A2Q E;  1VQK T;  4EMK B;  1XQH A;  4RG2 A;  1G3T A;  2R57 A;  3HP9 A;  4JS4 A;  1KQS A;  3MP1 A;  3H6Z A;  1VQ8 T;  4M7A D;  3GNF B;  3MEW A;  2DKG A;  3PFS A;  2QEX A;  4C8Q B;  5GAM j;  3HFO A;  3PTA A;  2KQW A;  4BAC A;  1M8V A;  3CD6 T;  4V2S A;  4PJO E;  1LJO A;  2RI5 A;  4ELY C;  4E7L A;  4RMO A;  1WPY A;  1JRI A;  2VXF A;  2MI6 A;  3NFC A;  4M7D A;  4ZTJ A;  2DJZ A;  2HAX A;  4A54 A;  3JAM E;  4JRP A;  3DLM A;  2EJG A;  4RG8 A;  3CCE A;  3S3M A;  1VQL T;  2ZGW A;  2P0P A;  1XOV A;  3QG1 A;  2QQ9 A;  4M77 E;  3MET A;  3GIB A;  4N4H A;  3CC7 T;  2GF7 A;  2EJF A;  4PLL A;  2CYZ B;  4BE2 A;  3TCJ A;  3A8M B;  2ZPI B;  1K9M C;  3CMA T;  3I55 A;  4M7A G;  2QA4 A;  4HA8 A;  2QQB A;  5CKD A;  2P0Q A;  4HCC A;  1KD1 C;  5HKC A;  2RK2 A;  4X34 A;  3OA6 A;  4E7J A;  5D6Y A;  4A4H A;  4F7U G;  5GAN d;  4C8Q D;  3SD4 A;  2QTX A;  3DB4 A;  2PUO B;  4MZM A;  1SSF A;  3TEE A;  2JVV A;  3OBY A;  2O4X B;  3OYN A;  1VQ9 A;  2DXU A;  3CXC S;  2GFA A;  3M53 A;  1M1F A;  5CQY A;  4CRI A;  3OYL A;  2PQW A;  1N8R C;  3TRE A;  2QA4 T;  3QO3 A;  4BI3 A;  4C8Q A;  1S72 A;  1W2B S;  1K9M U;  2MF2 A;  4N0A C;  2CZ1 B;  2ZPF B;  3UT1 A;  4E47 A;  4A4K A;  2RHI A;  2QDY B;  3QHS A;  2V8K A;  5GAN 4;  2K57 A;  5GAM d;  2V8J A;  4M77 D;  1VQO T;  3JB9 H;  3J7A F;  1M1K U;  3GLX A;  4M78 A;  3DLL A;  2Y4X A;  1VQM A;  3GF5 A;  2CZ7 B;  4M78 D;  2YLC A;  3CCV A;  5IT9 E;  2ZCF B;  1YIT T;  4M75 C;  2LC4 A;  1RI0 A;  1B34 B;  2DK3 A;  1B34 A;  3NTK A;  4Q5W A;  3V8K A;  1VUB A;  3OSV A;  4O6J A;  4C92 E;  3RIR A;  4EMK A;  4A4E A;  4LD6 A;  2IG0 A;  1D3B B;  4C5I A;  5CAI A;  5M9O A;  5HK0 A;  2K2V A;  4KBM B;  2XDB A;  3OYC A;  2A3L A;  4NOY A;  1HK9 A;  1QW1 A;  3JRZ A;  5LJ3 g;  2RJC A;  5CO7 A;  3CME T;  4MDX A;  2GQV A;  5CKF A;  4M7A A;  2DZC A;  2EYQ A;  2LT4 A;  3ASK A;  1QP3 A;  4L6V 5;  5DM7 R;  3OYH A;  4JRQ A;  4PNO A;  3OBW A;  2F5T X;  2RD1 A;  4ME7 A;  2K5I A;  3ZFJ A;  1YI2 T;  3OS0 A;  5I2S A;  4MZP A;  4BI8 B;  3CCV T;  2LQ8 A;  2DXC A;  2P0K A;  1EIF A;  4ZN3 A;  3S3N A;  5GAN j;  1YJN A;  2OTJ A;  4M75 G;  1YCY A;  3G7Z A;  3FJP A;  3JB9 G;  5LJ3 f;  2XK0 A;  3BY7 A;  1VQ7 A;  4XTV A;  3MEA A;  1WJQ A;  4JLG A;  4E7I A;  2DIQ A;  2RK1 A;  2F69 A;  3CBP A;  2EJ9 A;  1FX7 A;  2ZPB B;  3LH0 A;  5J26 A;  5HK3 A;  2VYT A;  5KE3 A;  2V8I A;  5GMK l;  4VUB A;  2XD0 A;  1P92 A;  4PL6 A;  4B9W A;  4LD9 K;  1QVG S;  3OYJ A;  4DA4 A;  4M78 E;  1JB0 E;  4A4F A;  4HKE A;  4J6Y A;  4PKC C;  1O9S A;  2LCC A;  3R6O A;  2H3J A;  1YJN T;  1Q82 U;  4HT8 A;  1I5L A;  3CCU T;  3EFR A;  4DOV A;  4Y91 A;  3QZ5 B;  2QQR A;  3ZEH A;  4M7D D;  1IZ6 A;  5HY6 A;  2XIC A;  3CC4 T;  2K3X A;  2KVQ G;  3CPF A;  4MMK A;  3AHU A;  1QP2 A;  3CD6 A;  1NPR A;  4E7H A;  1N9R A;  2HNI A;  4N0A A;  2PVD B;  3QZ9 B;  3PMT A;  3HRS A;  4OGE A;  3JCM g;  4JS5 A;  2E6N A;  3JCM c;  2E1H A;  4J6X A;  3VUZ A;  2QQS A;  3NTH A;  3LGL A;  3JCM V;  5GAO n;  4M7D B;  1QVF A;  4D6W A;  4BUG A;  3LX7 A;  2XG8 D;  2JNG A;  4EDU A;  1M1K C;  5GAO r;  3G6E T;  3JB9 D;  4NS5 A;  3QII A;  3GP8 A;  1UGS B;  4JUV A;  3QYH B;  3V8L A;  4A53 A;  3OYF A;  3CMA A;  5C0M A;  3VV0 A;  4X9C A;  1Q7Y C;  4XU3 A;  3OB9 A;  1YIJ T;  3JB9 F;  5KCO A;  3UPU A;  4M7D G;  3VUB A;  3L1A A;  1K73 C;  4F7U F;  1KC8 C;  3A8H B;  1D3B A;  5GAN 6;  5DLO A;  4BE1 A;  2DD5 A;  2O01 E;  5GAN 7;  4C5H A;  2WAC A;  4PJO B;  1UGQ B;  2EIF A;  5CKE A;  4GLK A;  4JDS A;  3FIF A;  4ZGD B;  3X28 B;  3LYI A;  3CC7 A;  1X75 C;  3JCM Q;  2CZ6 B;  3C95 A;  3HRT A;  4FU6 A;  4GY5 A;  1YHQ A;  3M55 A;  1VQP A;  2YRV A;  3M59 A;  1XTD A;  1Q7Y U;  5J3B A;  3L2R A;  3CCS T;  3CC2 T;  4M78 F;  4BDY A;  4JRK A;  2D0Q B;  4QQD A;  2JOY A;  4JJN K;  2D6F A;  5GAO p;  4PJO D;  3CBM A;  3LGF A;  3OYY A;  1KHC A;  1HXD A;  1U1S A;  1XNI A;  3Q1J A;  5CR2 A;  3ZBD A;  3QSU A;  3CCL T;  2AHJ B;  3SFM A;  2XU8 A;  3FC3 A;  5GAN 3;  5GAO l;  2RJF A;  1G3S A;  1O75 A;  1BI1 A;  3OS1 A;  1Y96 A;  3OYD A;  4M77 B;  1ZBX A;  2EQM A;  3QJ6 A;  2M16 A;  4JLI A;  1OZ2 A;  1YJ9 T;  4BDZ A;  1AHJ B;  3SDZ A;  1MHN A;  2DEQ A;  3QDR B;  4XTX A;  4EMK C;  3CC2 A;  2LTO A;  1OI1 A;  4J7I A;  4P5N A;  4M75 A;  2DTO A;  3C94 A;  3HHT B;  4M77 F;  5LJ5 g;  3M4Y A;  5GAN 5;  3ER0 A;  1OYX A;  2R5M A;  2RHU A;  1VQ5 A;  1KQ1 A;  3A8G B;  1U8R A;  2K4Y A;  2JTF A;  3CCM T;  2A7Y A;  5L8R E;  1VQ7 T;  3FLG A;  1VQ4 T;  3X26 B;  4OMF B;  3SWN A;  1H64 1;  2ZZD A;  3HPW A;  3JB9 J;  1YI2 A;  2EWN A;  5I21 A;  3QBY A;  4C0D B;  4F7U E;  2FYK A;  2VGM A;  4Z02 A;  2VGN A;  4J83 A;  3JCM b;  1YJ9 A;  2JZ2 A;  1W4S A;  4LDV A;  5IAY A;  1NE8 A;  4E7K A;  1Q86 C;  3E19 A;  1WGS A;  4ZN1 A;  3RMS A;  3DKM A;  4LDW A;  1VQ5 T;  1M9S A;  1I4K 1;  3RER A;  4M77 C;  2MMP A;  3CCR T;  3QPH A;  1U1T A;  1M4Z A;  3JCM P;  3VJP A;  2FL7 A;  1N8R U;  4JRI A;  2KAF A;  1BIB A;  1DJ7 B;  2RHX A;  5GMK e;  5KH6 A;  5DY9 A;  3RKY A;  1X01 A;  5LJ3 j;  3S6W A;  2QXF A;  2L8D A;  4C92 C;  3HKS A;  4QVZ A;  5FU6 C;  4M75 E;  2LDM A;  3GOX A;  4XTW A;  3RUX A;  2VXE A;  2VV5 A;  2JN0 A;  2M0O A;  3RKW A;  4M77 G;  3URG A;  1VQ6 A;  4M7D F;  4LDY A;  2E12 A;  3OYG A;  3OW2 A;  4BY6 B;  2LX9 A;  4IUR A;  2LQK A;  3UWN A;  2P4T A;  4OB0 B;  1V29 B;  2RHY A;  4C8Q F;  1VQN A;  2LT1 A;  5FRM A;  3CCU A;  3L2U A;  4F7U A;  2EQU A;  1PSF A;  4XTU A;  5LJ5 f;  2E64 A;  4ATO A;  4BY6 C;  3I55 T;  2NLU A;  5AYF A;  1BKB A;  2FB7 A;  3FB9 A;  5CKH A;  1RL2 A;  1IRE B;  2D9T A;  3MO8 A;  1YIJ A;  3CCQ T;  2PU9 B;  2QQA A;  3ME9 A;  1MGQ A;  4CI0 C;  1N9S A;  5CCA A;  2E70 A;  3OYE A;  3QKJ A;  3J81 E;  5LL6 S;  3BDL A;  3JCM f;  4BD3 A;  5LJ3 e;  1M90 C;  2E41 A;  3P8D A;  2XHC A;  1NJI C;  2X35 A;  1JBM A;  4XAX B;  2WSF E;  3PT9 A;  2BUD A;  3OYI A;  2Y4Y A;  3J80 E;  4C8Q E;  3TU4 K;  3MP6 A;  3CCJ A;  2X4J A;  4IUQ A;  4M7A C;  4PJO A;  3PMI A;  3E1S A;  3M54 A;  1YBY A;  4A4G A;  2VC8 A;  4OB3 B;  4R56 A;  1UB4 A;  3CBO A;  5GMK m;  5GAN 8;  2XDD A;  3QJY A;  4IUT A;  5GMK h;  3OYB A;  3MEV A;  4M7D E;  5FRO A;  4KUI A;  4XU1 A;  5LJ3 d;  4HCZ A;  1WQW A;  3T9N A;  1VQL A;  1I81 A;  3OYM A;  2GCX A;  2ZPH B;  4M75 F;  1NJI U;  1W2B A;  1VQM T;  3JCM X;  2OTL T;  4XU0 A;  4J7F A;  4IUP A;  4C92 B;  3CCJ T;  4L59 A;  5EG2 A;  4QVD A;  2WSE E;  1TH7 A;  1N6A A;  2RM4 A;  3HL8 A;  3M57 A;  4PLI A;  3V7C A;  5D6W A;  4M7A E;  3CCL A;  1ZHI A;  2RA2 A;  4O5V A;  3BW1 A;  4C0F A;  3CCM A;  1Y7X A;  1PSE A;  2DXT A;  2LNV A;  2KK4 A;  4FL6 A;  1X6O A;  4MML A;  1VQ9 T;  2YLB A;  3I56 T;  2DD4 A;  3L2V A;  1QVG A;  3A8O B;  1VIF A;  2ZPE B;  1I8F A;  4MDW A;  3G4S T;  3CPW A;  3L2W A;  2G3R A;  2HQE A;  4OF1 A;  2DO3 A;  4QW2 A;  3WVD B;  3GPL A;  2RB6 A;  4YTL A;  1QVP A;  2EAY A;  1Q81 C;  3RKX A;  1KC8 U;  4TVR A;  5FU7 B;  3WXM B;  4C92 D;  5CK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...