4M75G

Crystal structure of lsm1-7 complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
82
Chain Sequence
NLYFQGSMLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNIIDKVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 12
structure length 82
sequence length 98
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75G00
4F7UG 1Y96B 1H641 2FYKA 3EFRA 1WQ7A 4XU2A 3JCMe 4M78F 3JCMh 3JCMg 1LJOA 4F7UA 3JCMV 3GIBA 4QVDA 4Y91A 5GANe 5GAN4 4M7AF 5GANh 5GANg 3JCMf 2DTIA 5GANj 2YHTA 3JCMJ 4M75B 3QO3A 3RKXA 4M77F 4N0AC 4PJOD 3HSBA 5GANf 3JB9D 1LNXA 3JCMd 2DVEA 2YLCA 4F7UE 3L2ZA 2DZCA 4M75G 3L1AA 4C8QB 4M7DB 2DXTA 3HFOA 5GANd 3SWNB 4J5YA 4XTVA 1I81A 1B34A 4JRKA 3RESA 4C92B 3SWNC 4M7DC 2I2LA 5LJ3e 4C92C 4RCBA 4XTXA 5LJ3h 4C8QG 5LJ3g 4M7DG 2DZ9A 3VU3C 3INZA 2ZGWA 3RIRA 5LJ3j 4PJOA 2DTHA 5LJ3f 5GAOl 2FB7A 1WNLA 1D3BA 1M5Q1 4XU0A 4EMKC 5GMKm 4M75D 5LJ3d 3JB9J 4XTYA 4PJOE 5GAMe 3JB9F 4RCCA 1X01A 5GAN8 5GAMh 5GAMg 5GAOm 1HK9A 3M4GA 1Y96A 4JUVA 1JBMA 1WQWA 4M78C 4XTZA 5GAMj 5GAOp 5GAOr 3BY7A 4JRIA 4M7AB 3RUXA 4C8QD 5GAMf 4F7UF 4NL3A 2RD1A 4M7AC 4V2SA 3AHUA 5DY9A 4XU1A 4OP0A 3V7SA 2E64A 2EJ9A 3QHSA 4N0AA 3V7RA 4M77C 4M75A 1N9RA 4M7AG 4XQ3A 5CAIA 5GAMd 2K57A 5LJ5e 2E41A 4J6YA 5LJ5h 4MMKA 3RKYA 5LJ5g 5LJ5j 3V8KA 2DXUA 4C8QA 3FIFA 3FJPA 2EWNA 4XU3A 2JN0A 4C92G 5GMKh 5GMKe 2DEQA 3SWNA 5LJ5f 5GMKj 4C92A 3JCMP 4EMKB 4M75E 4WF2A 4M7DA 1JRIA 3RERA 1YCYA 3BFMA 4HT9A 1HXDA 2VXFA 2EJFA 5GAN3 4PJOF 4MMLA 4HA8A 4EMGA 4X9CA 4C8QE 4M7DE 4M78B 4PNOA 1N9SA 1I5LA 4C92E 2E65A 2Y90A 4XTUA 4A53A 4PJOC 3JCMW 2EJGA 4M7DD 3PGGA 1BIBA 5GAN6 1M8VA 4M78G 3V8LA 4NOYA 5GMKi 4C92D 3FB9A 4M77B 3JCMX 4M78A 5GAOn 1KQ2A 2DTOA 2RB6A 1MGQA 4F7UB 3JB9G 3HFNA 2VXEA 3JCMc 5GAN5 4M7AA 1TH7A 5GAOq 4M77G 3V7CA 4EMHA 5I21A 1BIAA 2QTXA 3QUIA 3JB9I 3BW1A 2EAYA 1I8FA 4M77A 5GAN7 2CGHA 2DJZA 4M78E 4M75F 1U1TA 3SB2A 1I4K1 2E1HA 2RA2A 3EFSA 4M78D 4M7AE 5LJ5d 1WPYA 1KQ1A 4DQ2A 3JCMb 4M75C 3V8JA 1B34B 3BDUA 4M77E 4C8QF 4M7DF 4M7AD 4EMKA 2HNIA 4C92F 2YLBA 4M77D 4PJOB 4X9DA 4QVCA 4C8QC 4JLIA 4HT8A 3JB9H 1D3BB 5GAN2 4PJOG 1U1SA 5GMKl 4J6WA 4A54A 3QSUA 2DKGA 4NL2A 3RKWA 2RM4A 1LOJA 2VC8A 4XTWA 4J6XA 3JCMQ 2E10A
chains in the Genus database with same CATH superfamily
2ZZDA 1GRIA 3GNFB 3LGFA 1SKUB 2DE0X 4N4HA 1QCOA 2ABLA 1Y0MA 3JCMJ 1WJRA 3A8HB 2LCCA 1GCQA 3LW5E 2JZ2A 1QKWA 1TOVA 3AT1B 1TWBA 4C92B 1SEMA 3J80E 1BCOA 3VU3C 2ZGWA 5LJ3f 3PE0A 1M3CA 1K73C 4EMKC 3A1PA 2CH4A 4M75D 1W4SA 3CCVT 3M0SA 5I11A 1OX9A 1PG5B 1M3AA 2P0QA 3AHUA 4YTLA 5D6XA 4XQ3A 2K3BA 5GAMd 4JRQA 5FRMA 1QVFS 1XJWB 2ZCFB 1OI1A 2RI5A 3CC7Q 4JZ4A 4M75E 1VQPT 1YIJQ 3PMIA 3CCQT 1BCMA 1NJIR 4EMGA 3MEWA 3G4ST 2JMAA 1I5LA 3F70A 3DB3A 3HP9A 2RHYA 1WJQA 3JCMX 3R6OA 5KE3A 3OYIA 1M1KC 4LDXA 1FXXA 2O88A 5GAN7 2CGHA 2HMAA 3P8BB 1MV0B 2G6FX 1R0BG 1SRLA 2COWA 4B9XA 5KH6A 2HDAA 2O4XB 1Q7YU 4JDSA 2MAMA 3M57A 2ZPGB 1YJWT 2HL5C 4HCBA 5AT1B 2LJ0A 1OULA 4CC7A 1YJ9A 2PU9B 4ANJA 2NWMA 3JCMh 1VUBA 2QA4A 4JZ3A 4BDZA 4RTXA 5GANh 1WHKA 1JEGA 3BDLA 1NEGA 3CCUT 2YLCA 4F7UE 1YP5A 2J6KA 1UGVA 4F17A 3X24B 2EKHA 2RHUA 1QVPA 3VYGA 4C8QG 4A4EA 3INZA 3CMEA 1X75C 4E6RA 1UJ0A 2XDPA 2EQUA 4IIOA 1ZHIA 3D7SB 5LJ3d 5GAN8 5GAOr 1M90R 1UGSB 5KCHA 1EX4A 2CP3A 1GFCA 1MNEA 3M58A 1K1ZA 1KQSP 4C8QA 1PRLC 4EMKB 2JNGA 3CCSQ 1VQOQ 2PTKA 4RTZA 5GAN3 2QGFB 2VB6A 3EH1A 3NHNA 1BIBA 1BKBA 2RNAA 2QDLA 3FRNA 2ED1A 2HQEA 6AT1B 2RB6A 3JCMc 3CCMT 2PUKB 1Q95G 2RO0A 2DD4A 3HPWA 3OA6A 1TUCA 4E7LA 2RQVA 4PJLA 2V8KA 3QXEB 2QXFA 2ZPIB 4JLGA 4AG2C 2DL4A 1PC0A 1WDXA 4HT8A 1YN8A 1CSKA 1WIEA 4JJDA 1FX7A 4Z8AA 2DO3A 2OTLA 4F7UG 3HTRA 2MOXA 3G6EA 1P92A 4C0DC 1M2VB 2F1LA 1J3TA 1VQ9T 2GNCA 1RAIB 3LLRA 4IUPA 3VS3A 2L8DA 3KUFA 4M7DC 2K2VA 3I9QA 2PUOB 3SDZA 4M7DG 1ZLMA 2BZ8A 2F2VA 1IXDA 1V76A 3NMZC 1GL5A 4JJCA 1I0CA 2E6ZA 3NPFA 3OSVA 1VQ6A 3G71A 3JB9F 4LNPA 5GAOp 1JBMA 1SPKA 2F5KA 4M78C 5L8RE 3OYCA 5CK9A 1QCFA 1YJNT 3MEVA 1OPLA 4B9WA 4OP0A 4OMMA 4RTWA 3HKSA 1K9MC 2L89A 3KFVA 2GTJA 1TUGB 3V8KA 2QEXA 4M7DA 4HVWA 4BE0A 3CC2T 2RHIA 3OSSC 2EQIA 5J39A 4DOWA 1VQ5T 3L2WA 4J9IA 2XI9A 2X4WA 3MHXA 2YT6A 4ORZA 2Y90A 2L0AA 3CBPA 3VJPA 5IXFA 1VQ7A 3FB9A 4M78A 1NYFA 1TXQA 3CMEQ 3EGUA 3GLXA 2NLUA 3OY9A 4M75F 2MF2A 2LP5A 3EGXA 1RAEB 3KBGA 1KIKA 2LTOA 4Z02A 4M77E 2OAUA 2HL3A 2A36A 1RUWA 4X9DA 3VS7A 1ZSZC 1KC8C 3RKWA 1LOJA 4LUEA 1QMCA 2L3PA 4BD3A 2M02A 3OW2A 4D6WA 3PIPA 1LJOA 3M0RA 2OJ2A 1X6BA 4Y91A 5HK0A 3LH0A 1D09B 1T3LA 4PJOD 2WSEE 2GFAA 4HCCA 2C0OA 5FU7C 1TG0A 3RESA 2EFIA 1N8RR 2BE7D 1ABOA 2GQVA 1AEYA 3PVLA 2DL7A 1ZSZA 4PLLA 2XDBA 1Q7YR 1HSQA 3CC4A 2LNVA 4FM4B 4JRPA 4C0DB 3CCRQ 4PJOE 4HCZA 2ROTA 4AMCA 5GAMj 4FYVB 2C06A 2Z0WA 2KVQG 5KYXB 2KEAA 3OS5A 4DBHA 4F7UF 3H9NA 2VUBA 3NTHA 4Y28E 1N9RA 1HYOA 4J9HA 1OU9A 2YSQA 4J6YA 1RI9A 2GTOA 2AHJB 4XU3A 3NFCA 4WF2A 1JRIA 3OYGA 3G6EQ 1HXDA 2F69A 1I5OB 4HA8A 4X9CA 1UGPB 2DRMA 4M78B 1N9SA 4J9CA 2E65A 4KGXB 2WACA 4AFUC 1YHQQ 2J06A 5GAN6 1PHTA 2DD5A 2F2XA 1KQ2A 1YITA 2DK3A 1X27A 4M77G 1ZSGA 1M8MA 1NLPC 4OF1A 3CMAT 1AVZC 3SB2A 1I4K1 4M7AE 2K3XA 2P4TA 3JSCA 1O9SA 1VQ6Q 3JV3A 1QW1A 4AG1C 2LJ3A 1XOVA 2YLBA 1S72Q 2KT1A 3HRUA 4X1VA 3M0TA 1VQMT 2VV5A 1BU1A 1Y96B 1LPLA 2FYKA 1BYMA 3EH2A 2PVOB 3M5AA 1IGUA 4AT1B 2YHTA 1WXUA 4N0AC 1AWWA 2P0KA 1MMDA 4FYWB 2KBTA 1T0HA 1Y71A 4C92C 3VUBA 2LDMA 4A63B 5LJ3j 3TVTA 2LC4A 1WNLA 2R5MA 3CC7A 4ZNXA 1QCNA 5CVIA 1AWXA 1H8KA 3NTKA 2LX9A 2O31A 2FZGB 5GAMe 3QWYA 3OYDA 2KDSA 5FRNA 3BY7A 2KGTA 1ZUYA 2IPOB 1PD0A 4II1A 5FU7B 4JJBA 4N0AA 1PRMC 2EYYA 4MMKA 2FPFA 1W70A 2VGNA 1PD1A 4LN2A 1VQLQ 2X51A 5LJ5f 2XDDA 3MEUA 4C92A 2QQ9A 3UPUA 1AZGB 4ZN3A 2EJFA 2QTVA 3CCJQ 1NG2A 2LQ8A 1EZZB 2KRSA 4J9FA 2A7YA 3THKA 3J81E 1G3WA 1RL2A 2OAWA 4PJJA 2DTOA 2KROA 4ZN1A 4R0KA 5HY6A 1NLOC 4EMHA 2OTJT 1NJIC 2ZPHB 2RI3A 3QDFA 3CC4Q 2D0QB 2COZA 1VQKQ 3U23A 2AK5A 2FG0A 2IVWA 1LVKA 2KXDA 2LNHB 2HKNA 1M1KU 4KH0B 4GLKA 2BUDA 1E6GA 1BBZA 2DNUA 1WHJA 1WFWA 1C0MA 1YIJT 3JCMg 2YXYA 2F5TX 5GANg 4B6MA 2KNBB 2V1RA 4M77F 4BI3A 1PNJA 3JB9D 3L1AA 2DMOA 2DXTA 4WTOB 1BI3A 2KR3A 3JRZA 5LJ3e 2EVRA 1YI2T 5FLXE 5CQYA 1GCPA 2CT4A 4A4KA 1M5Q1 1KD1C 2KK4A 2K3YA 3CCSA 1VQOA 1QVFA 1AD5A 2DIQA 3L2QA 4RCCA 5KYUB 2ECZA 2LT4A 3G4SA 3RUXA 4C8QD 3QZ9B 4FSXA 2JUFA 3P8HA 2DL3A 2LX7A 1IGQA 3QIIA 4E7SA 1VQ8Q 1WHGA 2EKOA 1EFNA 8AT1B 2BIVA 4KUDK 4HT9A 1VA7A 4PJOF 4C8QE 1VQ4T 2R57A 2EPDA 5GJWB 4ESRA 1TH7A 1K9AA 2M1HA 3JB9I 1I8FA 5EC7A 2MWPA 4PL6A 2RA2A 5I22A 3O8VA 3UATA 3VUZA 2XIDA 2KQWA 2DYBA 3BDUA 5CQXA 4EMKA 4ELYC 4X34A 5KE2A 1JO8A 1NZ9A 2R58A 4OMLA 2KRNA 1D3BB 2DXCA 2DVJA 2O9SA 4J6WA 2RJCA 1E7OA 1UGQB 4E47A 4M7AF 4BB7A 4Y92A 2DYIA 2LQKA 4OVAA 2RN8A 3L2ZA 2P4RA 3NGPA 1OX8A 2MWOA 1VIEA 4QT7A 4DBFA 1M2OA 2NUTB 2H3JA 1QVGP 3HRSA 2YUNA 1BI2A 2FHDA 2HAXA 5D7UA 3UF4A 2YUQA 4XTYA 5GAMh 3OYYA 4A4HA 3M55A 4L6V5 2IG0A 2XHCA 1SHFA 1M2VA 3V7RA 2QK0A 1WHMA 4EDUA 2DERA 2EQJA 3M56A 3OYAA 1WA7A 3A8LB 4MZMA 1WXBA 2L2PA 5GMKj 2EQKA 1A0NB 1RLQC 1D0ZA 1N27A 2HZYA 1WHLA 4AFQC 4TVRA 1BI0A 3CCVQ 4M7DE 1PSEA 3EG0A 1K9MU 1Q86C 2JOYA 3OS0A 1Y57A 3OMCA 4IKFA 1SSHA 3UA6A 3ME9A 2EAYA 3TEEA 4M78E 4PFOA 2MYSA 3RBBB 2JVVA 2DM1A 3M54A 2GCXA 4M75C 4LE9A 2RJEA 2CZ6B 3VYHB 3G4SQ 1PKTA 4O5VA 2BTTA 1JU5C 1XNIA 1TUDA 1FMKA 2RQTA 3E2UA 1HD3A 1YJ9T 2D8JA 4XTWA 4DOVA 2GFUA 1H92A 2DLPA 4FL6A 1WQ7A 3UT1A 2QA4T 3GIBA 2K9GA 3CCRA 3A5ZB 1IO6A 1I1JA 3LGLA 5A2QE 2CZ7B 2DVEA 1JB0E 1VIFA 5FW9A 4AFZC 1K8AU 1NE8A 2L3RA 2VASA 5LJ3h 1KG1A 2CREA 2QQAA 4DA4A 4OMPA 5GJVB 2I0NA 1M1KR 4DBRA 2KYMA 4XAXB 5FROA 1WQWA 1N8RC 2C0TA 1PM3A 2EGAA 1NPPA 3CCUQ 2MCNA 1YHQA 3PVQA 3I55A 1UDLA 2HEQA 3EFOA 3QBYA 3QYHB 2FZCB 5GMKe 4JS5A 1OYXA 2VVKA 3RNJA 2DBKA 4CC2A 4QQDA 2XD0A 3OYHA 3VS4A 5J3BA 3FDRA 4Q5WA 2LCSA 1QVGS 2CT3A 5HCKA 2EYWA 3EGDB 4LDVA 2SRCA 3OYEA 5DLOA 2ED0A 1S1NA 4M78G 1S72A 2CZ1B 1UGRB 4JPBW 1Q81C 5KYXA 4OB3B 2SEMA 1KQSA 3V7CA 4IUVA 3QUIA 4QQGA 1LCKA 2DX1A 4E7JA 1TS9A 4GY5A 3JCMb 1B34B 4C8QF 1RLPC 2LJ1A 1OOTA 4M77D 2FO0A 4QVCA 3O5ZA 1M27C 1TU0B 4P5NA 4E7IA 1B07A 3CCMQ 2COYA 2G3RA 1SSFA 4Z88A 2OTLT 4LDWA 1R0CB 1GFDA 2E10A 5A0DA 2JT4A 2A0FB 3G6ET 5IHIA 2DFUA 3UWNA 2DA9A 3CCLA 1D0XA 2MK5A 4PJNA 1I07A 4M75B 4JJNK 3ASKA 1KQSS 2KXCA 3WVDB 1YCSB 1ABQA 2I2LA 3CPFA 2LT1A 3EAEA 2GF7A 3PFSA 4PLIA 2PNIA 1VQLA 4E7ZA 2XG8D 3I5SA 4C0FA 3G71T 3JB9J 1VQNA 4Z89A 5GAOm 1VQ9Q 3M4GA 1Y96A 3CCJA 2W10A 3EFOB 2IIMA 2LCLA 3A8MB 2EJ9A 2AZVA 2QQBA 2AKLA 2QQSA 2QEXT 5LJ5j 4N4GA 3OBYA 3FJPA 2ZPEB 2CZ0B 2HSEB 3EHQA 3I56T 4KH1B 1IB8A 2BZYA 3BFMA 3OYKA 1VYTA 3EG9A 4E7HA 2O9VA 3C12A 1WJSA 4CC3A 1TTHB 2O2OA 4C92E 3DKMA 3I5RA 1VQ7T 2QASA 1VQKA 1YJNQ 3MJXA 3CXCP 1QLYA 2D6FA 1C6VX 1FMWA 1UHFA 4F7UB 3QKJA 2YDLA 4D8KA 3BW1A 4OB2B 4MZPA 3CC2Q 1MMAA 4DBQA 1VQ5Q 2FRYA 4ZTFA 3RMSA 3ZL7C 3V8JA 4M7DF 4M7AD 2QAZA 2M51A 2ZPBB 3TSZA 1M1FA 2H8HA 2E3IA 3ZEHA 4PK4A 1DJ7B 3I55Q 2A3LA 1NJIU 1Y7XA 2DXBA 3ZBDA 2RHZA 3OYFA 3I35A 2DKGA 3QSUA 4WCIA 1W6XA 4QQ6A 3CPWP 1UB4A 2CSIA 4RCBA 2CP2A 4M78F 2V26A 2DBMA 4C5EA 5GAN4 4J9EA 2C0IA 3HSBA 1Q82C 1UE9A 2RI2A 2F2WA 4J7FA 1AZEA 3T9NA 3LX7A 3QZ5B 2XKOC 3MP1A 1YWPA 2MI6A 2CH4W 4J5YA 3SWNB 3QJ6A 5KYYB 1OZ3A 2M0YA 1Y07A 1VQ8A 3H0FA 2A08A 3OYLA 4CI0C 1D1CA 5CKHA 1T0JA 2CP5A 4FW2A 4KUIA 1NYGA 1AOJA 4LUDA 4OGCA 1G3YA 4BE1A 2KSSA 5DY9A 2DRKA 3CEYA 3M0PA 1U8RA 2Y4XA 3SFMA 5CAIA 1RADB 5LJ5e 2XMFA 4PJMA 2XK0A 3CCEA 1JJ2P 3MPUB 2QGGA 1KD1U 3EG9B 1MV3A 4C92G 2FEIA 5GMKh 2DEQA 3E9FA 5HKCA 3TCJA 1X6OA 2M16A 2YRCA 4IUUA 3CCLQ 2VXFA 3VS6A 2M0OA 4J8OA 4RUGA 4OMQA 1K8AR 4FW1A 2RMOA 3CD6T 1YNZA 1IHVA 3VS2A 3EG1A 1OPKA 2JTMA 4HXJA 4PJOC 1KFZA 2ZPFB 2QYZA 1UUEA 1QP3A 3GBQA 5KYUA 1O75A 2W0ZA 4JS4A 1YITT 1MNDA 3HFNA 3MO8A 5GAN5 3VKIA 1N5ZA 4M4ZA 2QTXA 4BI8B 1K73U 1ACMB 1PWTA 2GGRA 4HVUA 2EYZA 3EHRA 1F1BB 1XQHA 1WGSA 1WPYA 1X6GA 2WSFE 1VQNQ 1ZA1B 4BDYA 3FLGA 3Q1JA 1XTDA 4A4GA 5GAN2 4GLMA 1U1SA 3IQLA 2RM4A 4QVZA 3X20B 4E2FB 1H3ZA 2CUBA 4XU2A 1V29B 3CMAQ 4KULA 2YUOA 5CIUA 2PVDB 4FT2A 3JCMf 2DTIA 3QO3A 2KI7A 1R77A 5GANf 2D0NA 4F14A 2JS0A 4ME7A 1JXOA 3MP8A 1EIFA 2JTEA 3VS0A 3GPLA 1WX6A 1NM7A 1VQMQ 3CC7T 1D3BA 4XU0A 2FPDA 5CKEA 4R56A 1Z9QA 3CPWS 5GAMg 1QWEA 2FL7A 3CCVA 4NL3A 1D1AA 2KAFA 5DM7R 2LQNA 1OZ2A 2HD0A 1M4ZA 3L2RA 2E41A 1M3BA 3LYIA 3UDCA 3RKYA 2P0PA 4EIKA 4UC4A 4OB1B 3RDVA 5FWBA 3E19A 2NUTA 1VQPA 3TQ7P 3CCQA 3FJ5A 4PNOA 8ATCB 2K5IA 1ZBJA 4A53A 2JTFA 4NOYA 3M0UA 1UHCA 5I2SA 3GP8A 4OMNA 3QYGB 1WHHA 1KSWA 3PT9A 2P84A 4R55A 1PSFA 1BIAA 3LWHA 4QW2A 1G2BA 1M90C 2GBQA 1U1TA 2HQHA 4N4IA 1M1GA 4IURA 2J05A 5LJ5d 2YUPA 1MHNA 1KQ1A 3MKDA 3VRZA 1JJ2S 2DF6A 3PIOA 1Q86U 5KCOA 4C92F 4PJOB 2L3SA 1SG5A 2L3QA 2CYZB 4A54A 1G8XA 1WI7A 3WXMB 1YJWA 3CCEQ 2X4XA 2OTJQ 4ATOA 3OB9A 1KK7A 1NBEB 2K4YA 4FU6A 4FCYA 3S6WA 2RK1A 4LD6A 3R6NA 2ZAEA 1LNXA 3JCMd 4C5GA 5C0MA 3CCUA 4ZGJB 4ZGEB 5GANd 1D0YA 4JRKA 1WYXA 5LJ3g 4RG8A 2KRMA 4LXCA 1PKSA 5GAOl 2J6OA 3CCST 1VQOT 2HBPA 2QG9B 1TSFA 1GBRA 4MDXA 4OMOA 1HK9A 4FT4A 4XTZA 4M7AB 4F04B 3V7SA 2EIFA 2L5QA 1VOMA 2K57A 2NYSA 5LJ5h 2KT8A 1YI2Q 3CBMA 1ARKA 2PQWA 1IZ6A 3FIFA 3A8GB 2DL8A 4C0GA 4RMOA 1N8RU 4CRIA 3M0QA 1UG1A 2E70A 4BY6B 1Z9ZA 2JMCA 2PZ1A 1W1FA 4HCKA 4M7DD 3L2UA 3S3MA 1UTIA 3PGGA 4DEYA 3V8LA 1RAAB 7AT1B 2LZ6B 1CKAA 4L59A 1X2QA 3JB9G 1W2BP 3PNWC 4PFPA 3CCMA 2RQRA 1D1BA 3VS5A 4VUBA 4M78D 2V1QA 4IIMA 3CBOA 2JJ9A 1VQ4Q 3MCAB 1UEBA 3H0HA 1KD1R 1RAHB 5D6YA 1Q81U 2B8AA 4C8QC 2FZKB 4ZTJA 1ZX6A 3EGDA 4OGEA 1HJDA 3EFRA 2NUPA 3M4YA 5IH2A 3JCMV 3E9GA 5EG2A 3L2VA 1VQPQ 5FU6C 3CCQQ 3L42A 1VQ9A 3N5BB 1K73R 1BI1A 2GQIA 4M75G 1GBQA 4OMFB 4E7KA 1UJYA 1B34A 1I81A 1JXMA 2KYBA 3RIRA 2E5KA 2MMPA 3E1SA 4J9DA 2RH2A 1B3QA 2J7IA 2HSPA 2JXBA 3REBB 3QDRB 4JUVA 1X2KA 2K5FA 2RQUA 4LDYA 4XU1A 1YJNA 2PVGB 1KC8U 4KGZB 4M75A 1YWOA 2JW4A 2XU8A 5M9OA 3CMET 1YJWQ 1QVGA 5CKFA 1K76A 2HKQB 4KRTA 4J7IA 1R8OB 5LL6S 1NPRA 3M9QA 1AWOA 2X9HA 3MEAA 2KE9A 4EPCA 3H0IA 5KYWA 1M9SA 4O6JA 5A0LA 3CC2A 2X35A 2E12A 1VQ5A 3QPHA 3TREA 3META 3QWXX 3WVEB 5HK3A 1KHCA 4XTUA 4F16A 3JCMW 4D8DA 1W2BA 2YRDA 3JAME 3FC3A 1RI0A 2CUDA 1Q7YC 3A98A 3OYJA 5I21A 2V8JA 1MMGA 2D9TA 3OW2P 1KHIA 3HRTA 2EGCA 2K6DA 2XICA 1BK2A 2VGMA 1YBYA 2MPXC 1ZUKA 5C6SA 5GMKl 2NUPB 4HVVA 1OV3A 4KGVB 5I2MA 4F7UA 1SRMA 4BI4A 5L23A 3CCRT 1IREB 3OS1A 1W2BS 1VYUA 2LMJA 4RTVA 3OMGA 1U5SA 2CP0A 2EW3A 3PMTA 3UA7A 5IN1A 2B86A 4J83A 1ZA2B 2DZCA 1QQJA 4C8QB 2ENMA 2DAQA 4LDUA 2J6FA 1H3HA 2A28A 2LQWA 3SWNC 3ER0A 2DZ9A 1YJ9Q 4K11A 1RAFB 2H3EB 1Q86R 4AFSC 4QKUA 5D6WA 5IHNA 3I56A 3GNGA 4NS5A 2QA4Q 3RMQA 1QP2A 1Q82U 4FYYB 5FU6B 2X4JA 5FWCA 2K2MA 1RAGB 3EG3A 1YHQT 3I55T 4RTTA 3G1JA 3MP6A 2E64A 3QHSA 3RR6A 1E6HA 5KYWB 5IT9E 2X3XD 2FRWA 1K4US 2KMTA 1IHWA 3URGA 2O01E 2DXUA 4J9BA 4IUTA 3SWNA 2QI2A 3JCMP 2JM9A 3RERA 1YCYA 2OI3A 1IRXA 1VQ6T 5KYYA 1RABB 4MMLA 2VWFA 2CP6A 1S72T 4XK8E 2D8HA 3PTAA 4FYXB 4C92D 2LVMA 5GAOn 3QJYA 1MGQA 5GAOq 2BZXA 1K8AC 1U3OA 2JM8A 3M53A 3CQTA 2FVUA 1MMNA 2CP7A 3VRYA 1OQKA 5ECAA 3CMAA 2E3HA 3EFSA 3OYMA 2EBPA 4DQ2A 3TU4K 1K0XA 2HNIA 2FPEA 2DJQA 5CR2A 3GF5A 1MUZA 3JB9H 2E6NA 3TSWA 4ZGDB 5IHKA 1VQMA 4PFZA 1FWZA 3VV0A 3CCLT 4CC4B 5AYFA 4QVDA 2DPPB 3DLMA 4FIBA 5GANj 4PKCC 3HL8A 1T3SA 1SF9A 1RACB 3OW2S 4M7DB 3HFOA 3C0CA 2E4HA 1X43A 4ELZC 2VKNA 4XTXA 2RHXA 3OS2A 1VQLT 1K0SA 4FSSA 1WZOA 2V8IA 3S3NA 3P8DA 2OTLQ 5CO7A 4L5GA 4KBMB 1Q81R 1K9MR 4BE2A 4RKUE 1AHJB 1VQNT 2NUZA 3CCJT 1X01A 2X3WD 3CD6A 3OBWA 4JRIA 2RD1A 3J7AF 3S3OA 3OQ5A 2EQMA 2YWWA 3QG1A 4M77C 4C5IA 1G83A 2K5LA 3EGXB 3H41A 2HBWA 1G3TA 4J9GA 2BKDN 9ATCB 5DLQE 3DB4A 1B7TA 3ULRB 3CC4T 2VYTA 4RG2A 3G71Q 1ZUUA 4LD9K 1QKXA 1G3SA 2EGEA 1VQKT 1X69A 2D1XA 2DL5A 2QDYB 1ZQ1A 2EJGA 1M30A 5GMKi 2RQWA 2ESWA 5CCAA 2AZSA 2VXEA 3FEOA 2R5AA 2RJDA 2QEXQ 1BB9A 1JQQA 4M77A 2OTJA 2AIRB 1YFNA 2K79A 1G5VA 3I56Q 1KC8R 3X26B 1FYNA 2CSQA 3C94A 3SD4A 1FMVA 3SEMA 3OYBA 3CXCA 1VQ7Q 1ZSZB 4GBQA 3JCMQ 4PJOG 3VS1A 1VYVA 1OU8A 4NL2A 2VC8A 2YRVA 1M90U 2BE9B 4BUGA 4J6XA 3OYNA 1H641 2HQXA 3JCMe 3A8OB 2EYQA 1YIJA 5GANe 1V1CA 2OX7A 1QVFP 3RKXA 2LRQA 1UECA 2RK2A 4A4FA 1NEBA 1CKBA 2HCKA 3EG2A 3X28B 1PCXA 4XTVA 3CPWA 1OEBA 5A0GA 3X25B 4C0ZA 4HKEA 1VQ8T 4PJOA 2ATCB 1YI2A 1ZBXA 2M9UA 2DIGA 2DTHA 2KY9A 2FB7A 4BACA 5GMKm 1GXIE 3CXCS 2CDTA 3C4SA 3G7ZA 4KT0E 5GAMf 2CKKA 4M7AC 4V2SA 5CKDA 3C95A 3DLLA 4M7AG 2A37A 1WLPB 5IAYA 2AKKA 3CCET 3GOXA 2WSCE 2QQRA 5LJ5g 1AWJA 2MIOA 2EWNA 1U06A 2EYXA 2JN0A 2AT1B 5KYNA 2RPNA 2DILA 4C5HA 3KXTA 4OB0B 3HHTB 4RTYA 5IXBA 3ZFJA 2E5QA 4MDWA 5J26A 4BY6C 2Y4YA 1VQ4A 2ROLA 1M8VA 3H8ZA 4M77B 2DETA 1SHGA 2JS2A 3BE3A 1JJ2A 4M7AA 1Q82R 3H6ZA 1WXTA 4MZTA 3M59A 2DJZA 2RF0A 1GCQC 2E1HA 4RTUA 2DEUA 3LWIA 1UFFA 2X4YA 3NTIA 3CD6Q 1KJWA 4IUQA 1N6AA 2CS7A 3LH5A 3REAB 4JLIA 5CKBA 1YITQ 2K7AA 2RJFA 4DEXA 1QWFA 2O4XA 3SHWA 1AT1B 1C1AA
chains in the Genus database with same CATH topology
1Y96B 2FYKA 2ZZDA 3EFRA 1BYMA 3G6ET 3GNFB 3M4YA 3LGFA 3JCMV 2PVOB 3UWNA 3E9GA 3M5AA 3CCLA 4N4HA 5EG2A 3L2VA 2YHTA 3JCMJ 1WJRA 4M75B 5FU6C 4JJNK 3A8HB 3L42A 3ASKA 2LCCA 4N0AC 3N5BB 1VQ9A 3LW5E 1KQSS 2P0KA 2JZ2A 2D6FA 1BI1A 4M75G 4OMFB 4E7KA 3WVDB 1B34A 1I81A 4C92B 1Y71A 2I2LA 3CPFA 4C92C 3J80E 3VUBA 2LT1A 3EAEA 2LDMA 2GF7A 3PFSA 2ZGWA 2MMPA 4PLIA 3RIRA 3E1SA 3VU3C 5LJ3j 2LC4A 5LJ3f 1VQLA 1WNLA 2RH2A 2R5MA 2XG8D 4EMKC 3CC7A 1K73C 5CVIA 3QDRB 3NTKA 4C0FA 2LX9A 4M75D 3G71T 3JB9J 1W4SA 5GAMe 1VQNA 5GAOm 3CCVT 3M4GA 1Y96A 4JUVA 3OYDA 2KDSA 3CCJA 5FRNA 3BY7A 2K5FA 2LCLA 2P0QA 3AHUA 4LDYA 3A8MB 4II1A 4XU1A 4YTLA 2PVGB 2EJ9A 5FU7B 1YJNA 4N0AA 5D6XA 1KC8U 4M75A 4XQ3A 4JRQA 5GAMd 5FRMA 2QQBA 1QVFS 2XU8A 2QQSA 4MMKA 5M9OA 2QEXT 3CMET 5LJ5j 1QVGA 5CKFA 2VGNA 5LL6S 4J7IA 1R8OB 3OBYA 2ZCFB 1NPRA 3FJPA 3M9QA 2ZPEB 2CZ0B 4N4GA 1OI1A 2RI5A 3MEUA 3MEAA 4EPCA 4C92A 3I56T 2QQ9A 4M75E 3UPUA 1M9SA 4O6JA 4ZN3A 1VQPT 5A0LA 3CC2A 2X35A 3BFMA 3PMIA 3OYKA 4E7HA 2EJFA 3CCQT 2E12A 1VQ5A 3C12A 3QPHA 3TREA 4EMGA 1WJSA 3META 3MEWA 2LQ8A 3WVEB 3G4ST 5HK3A 4C92E 1KHCA 3DKMA 2A7YA 3F70A 3DB3A 4XTUA 3JCMW 1I5LA 1VQ7T 1VQKA 3HP9A 2RHYA 3J81E 1WJQA 1W2BA 3JCMX 3R6OA 5KE3A 1G3WA 1RI0A 1RL2A 3JAME 2DTOA 3OYIA 4ZN1A 3FC3A 4F7UB 1Q7YC 5HY6A 3QKJA 3OYJA 1M1KC 5I21A 4EMHA 2OTJT 1NJIC 4LDXA 5A0DA 3BW1A 1FXXA 2V8JA 4OB2B 5GAN7 2CGHA 3P8BB 4MZPA 2ZPHB 2RI3A 2D9TA 1KHIA 3HRTA 2XICA 2D0QB 4ZTFA 2VGMA 3RMSA 3V8JA 4B9XA 4M7DF 4M7AD 2ZPBB 5KH6A 1M1FA 1YBYA 2IVWA 2O4XB 3ZEHA 1Q7YU 4JDSA 2MAMA 1DJ7B 3M57A 2ZPGB 2A3LA 1M1KU 1NJIU 1Y7XA 5C6SA 2DXBA 3ZBDA 2RHZA 5GMKl 3OYFA 2DKGA 1YJWT 4HCBA 4GLKA 3QSUA 4QQ6A 2BUDA 1UB4A 1YJ9A 2PU9B 4RCBA 5I2MA 1YIJT 4M78F 3JCMh 3JCMg 4F7UA 1VUBA 2F5TX 4BI4A 4C5EA 3CCRT 1IREB 5GAN4 3OS1A 2QA4A 4BDZA 1W2BS 5GANh 5GANg 3OMGA 4M77F 4BI3A 3HSBA 3PMTA 3BDLA 3JB9D 1Q82C 5IN1A 3CCUT 4J83A 2YLCA 4F7UE 2RI2A 2DZCA 4J7FA 3L1AA 3T9NA 3LX7A 4C8QB 2DAQA 2DXTA 3QZ5B 4LDUA 3X24B 2XKOC 3MP1A 2MI6A 4J5YA 1BI3A 3SWNB 2RHUA 3SWNC 3JRZA 5LJ3e 3ER0A 1QVPA 3VYGA 4C8QG 1YI2T 4A4EA 2DZ9A 3QJ6A 3INZA 3CMEA 1OZ3A 1X75C 1Y07A 5FLXE 5CQYA 1VQ8A 3OYLA 4CI0C 4A4KA 1M5Q1 5D6WA 1KD1C 2KK4A 2XDPA 3GNGA 5CKHA 3I56A 2EQUA 4NS5A 2K3YA 1ZHIA 3CCSA 3RMQA 5LJ3d 1VQOA 4KUIA 1QVFA 1QP2A 2DIQA 3L2QA 1Q82U 4RCCA 5GAN8 5FU6B 4OGCA 2LT4A 3G4SA 2X4JA 5GAOr 1UGSB 3RUXA 4C8QD 1G3YA 4BE1A 5KCHA 1YHQT 2KSSA 3QZ9B 3I55T 4FSXA 2JUFA 3P8HA 5DY9A 3MP6A 2E64A 3CEYA 3QHSA 1U8RA 2Y4XA 3SFMA 5CAIA 5IT9E 5LJ5e 3M58A 2XK0A 3CCEA 2KMTA 3QIIA 1KD1U 3URGA 2O01E 2DXUA 4C8QA 4C92G 4IUTA 2EKOA 5GMKh 2DEQA 3SWNA 3E9FA 2QI2A 4EMKB 3JCMP 2JNGA 5HKCA 3TCJA 1X6OA 2BIVA 3RERA 1YCYA 1VQ6T 2M16A 4IUUA 4KUDK 2VXFA 5GAN3 2M0OA 4HT9A 4J8OA 4PJOF 4MMLA 3CD6T 4C8QE 1VQ4T 2JTMA 1S72T 4XK8E 4PJOC 2ZPFB 1BIBA 3PTAA 1QP3A 2R57A 1BKBA 4C92D 2LVMA 3FRNA 5GAOn 1O75A 4JS4A 1YITT 3QJYA 2HQEA 2RB6A 1MGQA 3HFNA 3MO8A 3JCMc 3CCMT 5GAN5 1TH7A 3VKIA 2PUKB 5GAOq 1K8AC 2QTXA 3M53A 2M1HA 2RO0A 3JB9I 2FVUA 4BI8B 1I8FA 1K73U 2DD4A 3HPWA 3OA6A 1XQHA 2MWPA 3CMAA 4E7LA 1WGSA 4PL6A 2V8KA 2RA2A 3EFSA 3O8VA 3QXEB 1WPYA 2WSFE 3VUZA 3OYMA 2XIDA 4DQ2A 4BDYA 2KQWA 3BDUA 5CQXA 3TU4K 2QXFA 4EMKA 2HNIA 2ZPIB 4JLGA 4ELYC 4X34A 5CR2A 3FLGA 5KE2A 3Q1JA 1XTDA 4A4GA 3GF5A 1NZ9A 2R58A 4HT8A 3JB9H 1D3BB 2DXCA 5GAN2 2E6NA 1U1SA 4J6WA 2RJCA 2RM4A 4QVZA 4ZGDB 1FX7A 3X20B 1H3ZA 2DO3A 1UGQB 1VQMA 2OTLA 4F7UG 4XU2A 1V29B 1FWZA 3VV0A 3CCLT 4KULA 5CIUA 2PVDB 5AYFA 4E47A 4QVDA 3G6EA 1P92A 4C0DC 4FT2A 2DPPB 4M7AF 4BB7A 3JCMf 3DLMA 2DTIA 4FIBA 5GANj 1VQ9T 3QO3A 2LQKA 4PKCC 3HL8A 3LLRA 4OVAA 4IUPA 5GANf 4ME7A 2L8DA 3L2ZA 3MP8A 3OW2S 1EIFA 4M7DB 3HFOA 3KUFA 4ELZC 4M7DC 2K2VA 2MWOA 2PUOB 4XTXA 1VIEA 2RHXA 3SDZA 3GPLA 4M7DG 3OS2A 1VQLT 2H3JA 2V8IA 3HRSA 3S3NA 3P8DA 1BI2A 3CC7T 1D3BA 4XU0A 5CO7A 2FHDA 2HAXA 4L5GA 4KBMB 4BE2A 4RKUE 1AHJB 2E6ZA 1VQNT 5CKEA 3OSVA 4XTYA 4R56A 1VQ6A 3CCJT 3G71A 3JB9F 1X01A 3CPWS 5GAMh 5GAMg 2FL7A 5GAOp 1JBMA 2F5KA 4M78C 3OYYA 5L8RE 4A4HA 3CCVA 3M55A 3CD6A 3OYCA 5CK9A 3OBWA 4JRIA 2IG0A 4L6V5 4NL3A 1YJNT 2RD1A 2XHCA 3MEVA 4B9WA 3S3OA 2KAFA 3OQ5A 2EQMA 3J7AF 4OP0A 5DM7R 3V7RA 1OZ2A 3QG1A 4M77C 3HKSA 4EDUA 2HD0A 1K9MC 2L89A 4C5IA 1M4ZA 2K5LA 2E41A 3L2RA 3LYIA 2EQJA 3UDCA 3RKYA 2P0PA 1G3TA 3M56A 3OYAA 3V8KA 4UC4A 2QEXA 2BKDN 4OB1B 4M7DA 4BE0A 3A8LB 4MZMA 5GMKj 5DLQE 3DB4A 3CC2T 2RHIA 3CC4T 2EQKA 3OSSC 5J39A 1VQ5T 4DOWA 2VYTA 4RG2A 3E19A 1VQPA 3L2WA 1N27A 2XI9A 2X4WA 4LD9K 3CCQA 3MHXA 1BI0A 4TVRA 2XDDA 4M7DE 4PNOA 1PSEA 2K5IA 1G3SA 1VQKT 2Y90A 4A53A 2QDYB 1ZQ1A 2EJGA 2JTFA 1K9MU 3CBPA 3VJPA 1VQ7A 4NOYA 5GMKi 1Q86C 3FB9A 5CCAA 4M78A 2JOYA 5I2SA 3GP8A 3OS0A 3OMCA 4IKFA 3QYGB 2VXEA 3PT9A 3ME9A 3FEOA 2R5AA 2RJDA 1PSFA 4R55A 1BIAA 3LWHA 4M77A 2EAYA 3GLXA 2OTJA 2NLUA 4QW2A 3TEEA 1M90C 3OY9A 4M78E 2MF2A 4M75F 1U1TA 1G5VA 2JVVA 3M54A 4N4IA 1M1GA 4IURA 2GCXA 3KBGA 3X26B 5LJ5d 1MHNA 2LTOA 1KQ1A 1JJ2S 4Z02A 4M75C 4M77E 2OAUA 2RJEA 2CZ6B 3VYHB 3PIOA 3C94A 5KCOA 3SD4A 1Q86U 4C92F 4O5VA 4PJOB 3OYBA 4X9DA 3CXCA 1XNIA 4PJOG 1KC8C 2CYZB 4A54A 4NL2A 3RKWA 1LOJA 2VC8A 1YJ9T 2YRVA 3WXMB 1YJWA 4XTWA 2X4XA 4DOVA 4BUGA 2GFUA 1M90U 4BD3A 4J6XA 4FL6A 3OYNA 4ATOA 1H641 2HQXA 3OW2A 1WQ7A 3JCMe 3OB9A 3UT1A 4D6WA 3PIPA 1LJOA 3A8OB 2QA4T 2EYQA 3GIBA 1YIJA 4Y91A 2K4YA 5GANe 5HK0A 3LH0A 3CCRA 3A5ZB 4FU6A 3RKXA 3S6WA 4PJOD 2RK1A 2LRQA 4LD6A 5LJ5f 2WSEE 3LGLA 1LNXA 2CZ7B 2DVEA 2GFAA 1JB0E 2RK2A 4A4FA 4C5GA 5C0MA 3JCMd 3CCUA 4ZGJB 4HCCA 1VIFA 3X28B 4ZGEB 5FU7C 5GANd 3RESA 4XTVA 4JRKA 2EFIA 1K8AU 1NE8A 2L3RA 3CPWA 5LJ3h 5A0GA 5LJ3g 4RG8A 3X25B 4C0ZA 4HKEA 1VQ8T 4PJOA 1KG1A 2GQVA 1YI2A 2QQAA 1ZBXA 2M9UA 4DA4A 2DIGA 2DTHA 2KY9A 2FB7A 5GAOl 4BACA 4PLLA 2XDBA 5GMKm 3CCST 1VQOT 1GXIE 2HBPA 3CXCS 3CC4A 2LNVA 4FM4B 4JRPA 4C0DB 4MDXA 4PJOE 4HCZA 1HK9A 4FT4A 4XAXB 4XTZA 1WQWA 5FROA 5GAMj 1N8RC 3C4SA 2C06A 2KVQG 3OS5A 3G7ZA 4KT0E 4M7AB 5GAMf 4F7UF 1NPPA 2CKKA 4M7AC 4V2SA 2VUBA 3NTHA 5CKDA 3C95A 3DLLA 3V7SA 1YHQA 3I55A 2EIFA 4Y28E 2L5QA 4M7AG 1N9RA 5IAYA 2K57A 3CCET 3GOXA 4J6YA 3QBYA 2WSCE 5LJ5h 2QQRA 5LJ5g 3CBMA 2PQWA 1IZ6A 2AHJB 3QYHB 3FIFA 5GMKe 2EWNA 3NFCA 1OYXA 2JN0A 4XU3A 4JS5A 3A8GB 4WF2A 1JRIA 4QQDA 3OYGA 4C5HA 4C0GA 4RMOA 4OB0B 3OYHA 3KXTA 5J3BA 1N8RU 4CRIA 2XD0A 3FDRA 1HXDA 2F69A 3HHTB 4Q5WA 3ZFJA 2E5QA 4HA8A 4X9CA 2E70A 1UGPB 4M78B 4BY6B 1N9SA 4MDWA 5J26A 1QVGS 4BY6C 2Y4YA 4LDVA 1VQ4A 2E65A 3OYEA 5DLOA 4M7DD 3L2UA 2WACA 3PGGA 3S3MA 1M8VA 5GAN6 3H8ZA 4M78G 2DD5A 3V8LA 1S72A 2CZ1B 4M77B 1UGRB 4L59A 1KQ2A 3JB9G 1Q81C 1YITA 1JJ2A 2DK3A 4M7AA 4OB3B 1KQSA 3PNWC 3H6ZA 4M77G 4IUVA 3V7CA 3CCMA 3QUIA 4QQGA 4OF1A 4MZTA 3M59A 2DJZA 4E7JA 3CMAT 4VUBA 3SB2A 1I4K1 2E1HA 4GY5A 5A2QE 3LWIA 4M7AE 2K3XA 2P4TA 3JSCA 1O9SA 4M78D 3JCMb 3CBOA 1QW1A 1B34B 2X4YA 4C8QF 3NTIA 4IUQA 3MCAB 1UEBA 1N6AA 1XOVA 2YLBA 4M77D 2CS7A 4QVCA 5D6YA 1Q81U 2B8AA 4P5NA 4JLIA 4C8QC 3HRUA 4E7IA 4ZTJA 5CKBA 2RJFA 2O4XA 2G3RA 1SSFA 1VQMT 2OTLT 4LDWA 4OGEA 2VV5A 3JCMQ 2E10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U G;  1Y96 B;  1H64 1;  2FYK A;  3EFR A;  1WQ7 A;  4XU2 A;  3JCM e;  4M78 F;  3JCM h;  3JCM g;  1LJO A;  4F7U A;  3JCM V;  3GIB A;  4QVD A;  4Y91 A;  5GAN e;  5GAN 4;  4M7A F;  5GAN h;  5GAN g;  3JCM f;  2DTI A;  5GAN j;  2YHT A;  3JCM J;  4M75 B;  3QO3 A;  3RKX A;  4M77 F;  4N0A C;  4PJO D;  3HSB A;  5GAN f;  3JB9 D;  1LNX A;  3JCM d;  2DVE A;  2YLC A;  4F7U E;  3L2Z A;  2DZC A;  4M75 G;  3L1A A;  4C8Q B;  4M7D B;  2DXT A;  3HFO A;  5GAN d;  3SWN B;  4J5Y A;  4XTV A;  1I81 A;  1B34 A;  4JRK A;  3RES A;  4C92 B;  3SWN C;  4M7D C;  2I2L A;  5LJ3 e;  4C92 C;  4RCB A;  4XTX A;  5LJ3 h;  4C8Q G;  5LJ3 g;  4M7D G;  2DZ9 A;  3VU3 C;  3INZ A;  2ZGW A;  3RIR A;  5LJ3 j;  4PJO A;  2DTH A;  5LJ3 f;  5GAO l;  2FB7 A;  1WNL A;  1D3B A;  1M5Q 1;  4XU0 A;  4EMK C;  5GMK m;  4M75 D;  5LJ3 d;  3JB9 J;  4XTY A;  4PJO E;  5GAM e;  3JB9 F;  4RCC A;  1X01 A;  5GAN 8;  5GAM h;  5GAM g;  5GAO m;  1HK9 A;  3M4G A;  1Y96 A;  4JUV A;  1JBM A;  1WQW A;  4M78 C;  4XTZ A;  5GAM j;  5GAO p;  5GAO r;  3BY7 A;  4JRI A;  4M7A B;  3RUX A;  4C8Q D;  5GAM f;  4F7U F;  4NL3 A;  2RD1 A;  4M7A C;  4V2S A;  3AHU A;  5DY9 A;  4XU1 A;  4OP0 A;  3V7S A;  2E64 A;  2EJ9 A;  3QHS A;  4N0A A;  3V7R A;  4M77 C;  4M75 A;  1N9R A;  4M7A G;  4XQ3 A;  5CAI A;  5GAM d;  2K57 A;  5LJ5 e;  2E41 A;  4J6Y A;  5LJ5 h;  4MMK A;  3RKY A;  5LJ5 g;  5LJ5 j;  3V8K A;  2DXU A;  4C8Q A;  3FIF A;  3FJP A;  2EWN A;  4XU3 A;  2JN0 A;  4C92 G;  5GMK h;  5GMK e;  2DEQ A;  3SWN A;  5LJ5 f;  5GMK j;  4C92 A;  3JCM P;  4EMK B;  4M75 E;  4WF2 A;  4M7D A;  1JRI A;  3RER A;  1YCY A;  3BFM A;  4HT9 A;  1HXD A;  2VXF A;  2EJF A;  5GAN 3;  4PJO F;  4MML A;  4HA8 A;  4EMG A;  4X9C A;  4C8Q E;  4M7D E;  4M78 B;  4PNO A;  1N9S A;  1I5L A;  4C92 E;  2E65 A;  2Y90 A;  4XTU A;  4A53 A;  4PJO C;  3JCM W;  2EJG A;  4M7D D;  3PGG A;  1BIB A;  5GAN 6;  1M8V A;  4M78 G;  3V8L A;  4NOY A;  5GMK i;  4C92 D;  3FB9 A;  4M77 B;  3JCM X;  4M78 A;  5GAO n;  1KQ2 A;  2DTO A;  2RB6 A;  1MGQ A;  4F7U B;  3JB9 G;  3HFN A;  2VXE A;  3JCM c;  5GAN 5;  4M7A A;  1TH7 A;  5GAO q;  4M77 G;  3V7C A;  4EMH A;  5I21 A;  1BIA A;  2QTX A;  3QUI A;  3JB9 I;  3BW1 A;  2EAY A;  1I8F A;  4M77 A;  5GAN 7;  2CGH A;  2DJZ A;  4M78 E;  4M75 F;  1U1T A;  3SB2 A;  1I4K 1;  2E1H A;  2RA2 A;  3EFS A;  4M78 D;  4M7A E;  5LJ5 d;  1WPY A;  1KQ1 A;  4DQ2 A;  3JCM b;  4M75 C;  3V8J A;  1B34 B;  3BDU A;  4M77 E;  4C8Q F;  4M7D F;  4M7A D;  4EMK A;  2HNI A;  4C92 F;  2YLB A;  4M77 D;  4PJO B;  4X9D A;  4QVC A;  4C8Q C;  4JLI A;  4HT8 A;  3JB9 H;  1D3B B;  5GAN 2;  4PJO G;  1U1S A;  5GMK l;  4J6W A;  4A54 A;  3QSU A;  2DKG A;  4NL2 A;  3RKW A;  2RM4 A;  1LOJ A;  2VC8 A;  4XTW A;  4J6X A;  3JCM Q;  2E10 A; 
#chains in the Genus database with same CATH topology
 2ZZD A;  1GRI A;  3GNF B;  3LGF A;  1SKU B;  2DE0 X;  4N4H A;  1QCO A;  2ABL A;  1Y0M A;  3JCM J;  1WJR A;  3A8H B;  2LCC A;  1GCQ A;  3LW5 E;  2JZ2 A;  1QKW A;  1TOV A;  3AT1 B;  1TWB A;  4C92 B;  1SEM A;  3J80 E;  1BCO A;  3VU3 C;  2ZGW A;  5LJ3 f;  3PE0 A;  1M3C A;  1K73 C;  4EMK C;  3A1P A;  2CH4 A;  4M75 D;  1W4S A;  3CCV T;  3M0S A;  5I11 A;  1OX9 A;  1PG5 B;  1M3A A;  2P0Q A;  3AHU A;  4YTL A;  5D6X A;  4XQ3 A;  2K3B A;  5GAM d;  4JRQ A;  5FRM A;  1QVF S;  1XJW B;  2ZCF B;  1OI1 A;  2RI5 A;  3CC7 Q;  4JZ4 A;  4M75 E;  1VQP T;  1YIJ Q;  3PMI A;  3CCQ T;  1BCM A;  1NJI R;  4EMG A;  3MEW A;  3G4S T;  2JMA A;  1I5L A;  3F70 A;  3DB3 A;  3HP9 A;  2RHY A;  1WJQ A;  3JCM X;  3R6O A;  5KE3 A;  3OYI A;  1M1K C;  4LDX A;  1FXX A;  2O88 A;  5GAN 7;  2CGH A;  2HMA A;  3P8B B;  1MV0 B;  2G6F X;  1R0B G;  1SRL A;  2COW A;  4B9X A;  5KH6 A;  2HDA A;  2O4X B;  1Q7Y U;  4JDS A;  2MAM A;  3M57 A;  2ZPG B;  1YJW T;  2HL5 C;  4HCB A;  5AT1 B;  2LJ0 A;  1OUL A;  4CC7 A;  1YJ9 A;  2PU9 B;  4ANJ A;  2NWM A;  3JCM h;  1VUB A;  2QA4 A;  4JZ3 A;  4BDZ A;  4RTX A;  5GAN h;  1WHK A;  1JEG A;  3BDL A;  1NEG A;  3CCU T;  2YLC A;  4F7U E;  1YP5 A;  2J6K A;  1UGV A;  4F17 A;  3X24 B;  2EKH A;  2RHU A;  1QVP A;  3VYG A;  4C8Q G;  4A4E A;  3INZ A;  3CME A;  1X75 C;  4E6R A;  1UJ0 A;  2XDP A;  2EQU A;  4IIO A;  1ZHI A;  3D7S B;  5LJ3 d;  5GAN 8;  5GAO r;  1M90 R;  1UGS B;  5KCH A;  1EX4 A;  2CP3 A;  1GFC A;  1MNE A;  3M58 A;  1K1Z A;  1KQS P;  4C8Q A;  1PRL C;  4EMK B;  2JNG A;  3CCS Q;  1VQO Q;  2PTK A;  4RTZ A;  5GAN 3;  2QGF B;  2VB6 A;  3EH1 A;  3NHN A;  1BIB A;  1BKB A;  2RNA A;  2QDL A;  3FRN A;  2ED1 A;  2HQE A;  6AT1 B;  2RB6 A;  3JCM c;  3CCM T;  2PUK B;  1Q95 G;  2RO0 A;  2DD4 A;  3HPW A;  3OA6 A;  1TUC A;  4E7L A;  2RQV A;  4PJL A;  2V8K A;  3QXE B;  2QXF A;  2ZPI B;  4JLG A;  4AG2 C;  2DL4 A;  1PC0 A;  1WDX A;  4HT8 A;  1YN8 A;  1CSK A;  1WIE A;  4JJD A;  1FX7 A;  4Z8A A;  2DO3 A;  2OTL A;  4F7U G;  3HTR A;  2MOX A;  3G6E A;  1P92 A;  4C0D C;  1M2V B;  2F1L A;  1J3T A;  1VQ9 T;  2GNC A;  1RAI B;  3LLR A;  4IUP A;  3VS3 A;  2L8D A;  3KUF A;  4M7D C;  2K2V A;  3I9Q A;  2PUO B;  3SDZ A;  4M7D G;  1ZLM A;  2BZ8 A;  2F2V A;  1IXD A;  1V76 A;  3NMZ C;  1GL5 A;  4JJC A;  1I0C A;  2E6Z A;  3NPF A;  3OSV A;  1VQ6 A;  3G71 A;  3JB9 F;  4LNP A;  5GAO p;  1JBM A;  1SPK A;  2F5K A;  4M78 C;  5L8R E;  3OYC A;  5CK9 A;  1QCF A;  1YJN T;  3MEV A;  1OPL A;  4B9W A;  4OP0 A;  4OMM A;  4RTW A;  3HKS A;  1K9M C;  2L89 A;  3KFV A;  2GTJ A;  1TUG B;  3V8K A;  2QEX A;  4M7D A;  4HVW A;  4BE0 A;  3CC2 T;  2RHI A;  3OSS C;  2EQI A;  5J39 A;  4DOW A;  1VQ5 T;  3L2W A;  4J9I A;  2XI9 A;  2X4W A;  3MHX A;  2YT6 A;  4ORZ A;  2Y90 A;  2L0A A;  3CBP A;  3VJP A;  5IXF A;  1VQ7 A;  3FB9 A;  4M78 A;  1NYF A;  1TXQ A;  3CME Q;  3EGU A;  3GLX A;  2NLU A;  3OY9 A;  4M75 F;  2MF2 A;  2LP5 A;  3EGX A;  1RAE B;  3KBG A;  1KIK A;  2LTO A;  4Z02 A;  4M77 E;  2OAU A;  2HL3 A;  2A36 A;  1RUW A;  4X9D A;  3VS7 A;  1ZSZ C;  1KC8 C;  3RKW A;  1LOJ A;  4LUE A;  1QMC A;  2L3P A;  4BD3 A;  2M02 A;  3OW2 A;  4D6W A;  3PIP A;  1LJO A;  3M0R A;  2OJ2 A;  1X6B A;  4Y91 A;  5HK0 A;  3LH0 A;  1D09 B;  1T3L A;  4PJO D;  2WSE E;  2GFA A;  4HCC A;  2C0O A;  5FU7 C;  1TG0 A;  3RES A;  2EFI A;  1N8R R;  2BE7 D;  1ABO A;  2GQV A;  1AEY A;  3PVL A;  2DL7 A;  1ZSZ A;  4PLL A;  2XDB A;  1Q7Y R;  1HSQ A;  3CC4 A;  2LNV A;  4FM4 B;  4JRP A;  4C0D B;  3CCR Q;  4PJO E;  4HCZ A;  2ROT A;  4AMC A;  5GAM j;  4FYV B;  2C06 A;  2Z0W A;  2KVQ G;  5KYX B;  2KEA A;  3OS5 A;  4DBH A;  4F7U F;  3H9N A;  2VUB A;  3NTH A;  4Y28 E;  1N9R A;  1HYO A;  4J9H A;  1OU9 A;  2YSQ A;  4J6Y A;  1RI9 A;  2GTO A;  2AHJ B;  4XU3 A;  3NFC A;  4WF2 A;  1JRI A;  3OYG A;  3G6E Q;  1HXD A;  2F69 A;  1I5O B;  4HA8 A;  4X9C A;  1UGP B;  2DRM A;  4M78 B;  1N9S A;  4J9C A;  2E65 A;  4KGX B;  2WAC A;  4AFU C;  1YHQ Q;  2J06 A;  5GAN 6;  1PHT A;  2DD5 A;  2F2X A;  1KQ2 A;  1YIT A;  2DK3 A;  1X27 A;  4M77 G;  1ZSG A;  1M8M A;  1NLP C;  4OF1 A;  3CMA T;  1AVZ C;  3SB2 A;  1I4K 1;  4M7A E;  2K3X A;  2P4T A;  3JSC A;  1O9S A;  1VQ6 Q;  3JV3 A;  1QW1 A;  4AG1 C;  2LJ3 A;  1XOV A;  2YLB A;  1S72 Q;  2KT1 A;  3HRU A;  4X1V A;  3M0T A;  1VQM T;  2VV5 A;  1BU1 A;  1Y96 B;  1LPL A;  2FYK A;  1BYM A;  3EH2 A;  2PVO B;  3M5A A;  1IGU A;  4AT1 B;  2YHT A;  1WXU A;  4N0A C;  1AWW A;  2P0K A;  1MMD A;  4FYW B;  2KBT A;  1T0H A;  1Y71 A;  4C92 C;  3VUB A;  2LDM A;  4A63 B;  5LJ3 j;  3TVT A;  2LC4 A;  1WNL A;  2R5M A;  3CC7 A;  4ZNX A;  1QCN A;  5CVI A;  1AWX A;  1H8K A;  3NTK A;  2LX9 A;  2O31 A;  2FZG B;  5GAM e;  3QWY A;  3OYD A;  2KDS A;  5FRN A;  3BY7 A;  2KGT A;  1ZUY A;  2IPO B;  1PD0 A;  4II1 A;  5FU7 B;  4JJB A;  4N0A A;  1PRM C;  2EYY A;  4MMK A;  2FPF A;  1W70 A;  2VGN A;  1PD1 A;  4LN2 A;  1VQL Q;  2X51 A;  5LJ5 f;  2XDD A;  3MEU A;  4C92 A;  2QQ9 A;  3UPU A;  1AZG B;  4ZN3 A;  2EJF A;  2QTV A;  3CCJ Q;  1NG2 A;  2LQ8 A;  1EZZ B;  2KRS A;  4J9F A;  2A7Y A;  3THK A;  3J81 E;  1G3W A;  1RL2 A;  2OAW A;  4PJJ A;  2DTO A;  2KRO A;  4ZN1 A;  4R0K A;  5HY6 A;  1NLO C;  4EMH A;  2OTJ T;  1NJI C;  2ZPH B;  2RI3 A;  3QDF A;  3CC4 Q;  2D0Q B;  2COZ A;  1VQK Q;  3U23 A;  2AK5 A;  2FG0 A;  2IVW A;  1LVK A;  2KXD A;  2LNH B;  2HKN A;  1M1K U;  4KH0 B;  4GLK A;  2BUD A;  1E6G A;  1BBZ A;  2DNU A;  1WHJ A;  1WFW A;  1C0M A;  1YIJ T;  3JCM g;  2YXY A;  2F5T X;  5GAN g;  4B6M A;  2KNB B;  2V1R A;  4M77 F;  4BI3 A;  1PNJ A;  3JB9 D;  3L1A A;  2DMO A;  2DXT A;  4WTO B;  1BI3 A;  2KR3 A;  3JRZ A;  5LJ3 e;  2EVR A;  1YI2 T;  5FLX E;  5CQY A;  1GCP A;  2CT4 A;  4A4K A;  1M5Q 1;  1KD1 C;  2KK4 A;  2K3Y A;  3CCS A;  1VQO A;  1QVF A;  1AD5 A;  2DIQ A;  3L2Q A;  4RCC A;  5KYU B;  2ECZ A;  2LT4 A;  3G4S A;  3RUX A;  4C8Q D;  3QZ9 B;  4FSX A;  2JUF A;  3P8H A;  2DL3 A;  2LX7 A;  1IGQ A;  3QII A;  4E7S A;  1VQ8 Q;  1WHG A;  2EKO A;  1EFN A;  8AT1 B;  2BIV A;  4KUD K;  4HT9 A;  1VA7 A;  4PJO F;  4C8Q E;  1VQ4 T;  2R57 A;  2EPD A;  5GJW B;  4ESR A;  1TH7 A;  1K9A A;  2M1H A;  3JB9 I;  1I8F A;  5EC7 A;  2MWP A;  4PL6 A;  2RA2 A;  5I22 A;  3O8V A;  3UAT A;  3VUZ A;  2XID A;  2KQW A;  2DYB A;  3BDU A;  5CQX A;  4EMK A;  4ELY C;  4X34 A;  5KE2 A;  1JO8 A;  1NZ9 A;  2R58 A;  4OML A;  2KRN A;  1D3B B;  2DXC A;  2DVJ A;  2O9S A;  4J6W A;  2RJC A;  1E7O A;  1UGQ B;  4E47 A;  4M7A F;  4BB7 A;  4Y92 A;  2DYI A;  2LQK A;  4OVA A;  2RN8 A;  3L2Z A;  2P4R A;  3NGP A;  1OX8 A;  2MWO A;  1VIE A;  4QT7 A;  4DBF A;  1M2O A;  2NUT B;  2H3J A;  1QVG P;  3HRS A;  2YUN A;  1BI2 A;  2FHD A;  2HAX A;  5D7U A;  3UF4 A;  2YUQ A;  4XTY A;  5GAM h;  3OYY A;  4A4H A;  3M55 A;  4L6V 5;  2IG0 A;  2XHC A;  1SHF A;  1M2V A;  3V7R A;  2QK0 A;  1WHM A;  4EDU A;  2DER A;  2EQJ A;  3M56 A;  3OYA A;  1WA7 A;  3A8L B;  4MZM A;  1WXB A;  2L2P A;  5GMK j;  2EQK A;  1A0N B;  1RLQ C;  1D0Z A;  1N27 A;  2HZY A;  1WHL A;  4AFQ C;  4TVR A;  1BI0 A;  3CCV Q;  4M7D E;  1PSE A;  3EG0 A;  1K9M U;  1Q86 C;  2JOY A;  3OS0 A;  1Y57 A;  3OMC A;  4IKF A;  1SSH A;  3UA6 A;  3ME9 A;  2EAY A;  3TEE A;  4M78 E;  4PFO A;  2MYS A;  3RBB B;  2JVV A;  2DM1 A;  3M54 A;  2GCX A;  4M75 C;  4LE9 A;  2RJE A;  2CZ6 B;  3VYH B;  3G4S Q;  1PKT A;  4O5V A;  2BTT A;  1JU5 C;  1XNI A;  1TUD A;  1FMK A;  2RQT A;  3E2U A;  1HD3 A;  1YJ9 T;  2D8J A;  4XTW A;  4DOV A;  2GFU A;  1H92 A;  2DLP A;  4FL6 A;  1WQ7 A;  3UT1 A;  2QA4 T;  3GIB A;  2K9G A;  3CCR A;  3A5Z B;  1IO6 A;  1I1J A;  3LGL A;  5A2Q E;  2CZ7 B;  2DVE A;  1JB0 E;  1VIF A;  5FW9 A;  4AFZ C;  1K8A U;  1NE8 A;  2L3R A;  2VAS A;  5LJ3 h;  1KG1 A;  2CRE A;  2QQA A;  4DA4 A;  4OMP A;  5GJV B;  2I0N A;  1M1K R;  4DBR A;  2KYM A;  4XAX B;  5FRO A;  1WQW A;  1N8R C;  2C0T A;  1PM3 A;  2EGA A;  1NPP A;  3CCU Q;  2MCN A;  1YHQ A;  3PVQ A;  3I55 A;  1UDL A;  2HEQ A;  3EFO A;  3QBY A;  3QYH B;  2FZC B;  5GMK e;  4JS5 A;  1OYX A;  2VVK A;  3RNJ A;  2DBK A;  4CC2 A;  4QQD A;  2XD0 A;  3OYH A;  3VS4 A;  5J3B A;  3FDR A;  4Q5W A;  2LCS A;  1QVG S;  2CT3 A;  5HCK A;  2EYW A;  3EGD B;  4LDV A;  2SRC A;  3OYE A;  5DLO A;  2ED0 A;  1S1N A;  4M78 G;  1S72 A;  2CZ1 B;  1UGR B;  4JPB W;  1Q81 C;  5KYX A;  4OB3 B;  2SEM A;  1KQS A;  3V7C A;  4IUV A;  3QUI A;  4QQG A;  1LCK A;  2DX1 A;  4E7J A;  1TS9 A;  4GY5 A;  3JCM b;  1B34 B;  4C8Q F;  1RLP C;  2LJ1 A;  1OOT A;  4M77 D;  2FO0 A;  4QVC A;  3O5Z A;  1M27 C;  1TU0 B;  4P5N A;  4E7I A;  1B07 A;  3CCM Q;  2COY A;  2G3R A;  1SSF A;  4Z88 A;  2OTL T;  4LDW A;  1R0C B;  1GFD A;  2E10 A;  5A0D A;  2JT4 A;  2A0F B;  3G6E T;  5IHI A;  2DFU A;  3UWN A;  2DA9 A;  3CCL A;  1D0X A;  2MK5 A;  4PJN A;  1I07 A;  4M75 B;  4JJN K;  3ASK A;  1KQS S;  2KXC A;  3WVD B;  1YCS B;  1ABQ A;  2I2L A;  3CPF A;  2LT1 A;  3EAE A;  2GF7 A;  3PFS A;  4PLI A;  2PNI A;  1VQL A;  4E7Z A;  2XG8 D;  3I5S A;  4C0F A;  3G71 T;  3JB9 J;  1VQN A;  4Z89 A;  5GAO m;  1VQ9 Q;  3M4G A;  1Y96 A;  3CCJ A;  2W10 A;  3EFO B;  2IIM A;  2LCL A;  3A8M B;  2EJ9 A;  2AZV A;  2QQB A;  2AKL A;  2QQS A;  2QEX T;  5LJ5 j;  4N4G A;  3OBY A;  3FJP A;  2ZPE B;  2CZ0 B;  2HSE B;  3EHQ A;  3I56 T;  4KH1 B;  1IB8 A;  2BZY A;  3BFM A;  3OYK A;  1VYT A;  3EG9 A;  4E7H A;  2O9V A;  3C12 A;  1WJS A;  4CC3 A;  1TTH B;  2O2O A;  4C92 E;  3DKM A;  3I5R A;  1VQ7 T;  2QAS A;  1VQK A;  1YJN Q;  3MJX A;  3CXC P;  1QLY A;  2D6F A;  1C6V X;  1FMW A;  1UHF A;  4F7U B;  3QKJ A;  2YDL A;  4D8K A;  3BW1 A;  4OB2 B;  4MZP A;  3CC2 Q;  1MMA A;  4DBQ A;  1VQ5 Q;  2FRY A;  4ZTF A;  3RMS A;  3ZL7 C;  3V8J A;  4M7D F;  4M7A D;  2QAZ A;  2M51 A;  2ZPB B;  3TSZ A;  1M1F A;  2H8H A;  2E3I A;  3ZEH A;  4PK4 A;  1DJ7 B;  3I55 Q;  2A3L A;  1NJI U;  1Y7X A;  2DXB A;  3ZBD A;  2RHZ A;  3OYF A;  3I35 A;  2DKG A;  3QSU A;  4WCI A;  1W6X A;  4QQ6 A;  3CPW P;  1UB4 A;  2CSI A;  4RCB A;  2CP2 A;  4M78 F;  2V26 A;  2DBM A;  4C5E A;  5GAN 4;  4J9E A;  2C0I A;  3HSB A;  1Q82 C;  1UE9 A;  2RI2 A;  2F2W A;  4J7F A;  1AZE A;  3T9N A;  3LX7 A;  3QZ5 B;  2XKO C;  3MP1 A;  1YWP A;  2MI6 A;  2CH4 W;  4J5Y A;  3SWN B;  3QJ6 A;  5KYY B;  1OZ3 A;  2M0Y A;  1Y07 A;  1VQ8 A;  3H0F A;  2A08 A;  3OYL A;  4CI0 C;  1D1C A;  5CKH A;  1T0J A;  2CP5 A;  4FW2 A;  4KUI A;  1NYG A;  1AOJ A;  4LUD A;  4OGC A;  1G3Y A;  4BE1 A;  2KSS A;  5DY9 A;  2DRK A;  3CEY A;  3M0P A;  1U8R A;  2Y4X A;  3SFM A;  5CAI A;  1RAD B;  5LJ5 e;  2XMF A;  4PJM A;  2XK0 A;  3CCE A;  1JJ2 P;  3MPU B;  2QGG A;  1KD1 U;  3EG9 B;  1MV3 A;  4C92 G;  2FEI A;  5GMK h;  2DEQ A;  3E9F A;  5HKC A;  3TCJ A;  1X6O A;  2M16 A;  2YRC A;  4IUU A;  3CCL Q;  2VXF A;  3VS6 A;  2M0O A;  4J8O A;  4RUG A;  4OMQ A;  1K8A R;  4FW1 A;  2RMO A;  3CD6 T;  1YNZ A;  1IHV A;  3VS2 A;  3EG1 A;  1OPK A;  2JTM A;  4HXJ A;  4PJO C;  1KFZ A;  2ZPF B;  2QYZ A;  1UUE A;  1QP3 A;  3GBQ A;  5KYU A;  1O75 A;  2W0Z A;  4JS4 A;  1YIT T;  1MND A;  3HFN A;  3MO8 A;  5GAN 5;  3VKI A;  1N5Z A;  4M4Z A;  2QTX A;  4BI8 B;  1K73 U;  1ACM B;  1PWT A;  2GGR A;  4HVU A;  2EYZ A;  3EHR A;  1F1B B;  1XQH A;  1WGS A;  1WPY A;  1X6G A;  2WSF E;  1VQN Q;  1ZA1 B;  4BDY A;  3FLG A;  3Q1J A;  1XTD A;  4A4G A;  5GAN 2;  4GLM A;  1U1S A;  3IQL A;  2RM4 A;  4QVZ A;  3X20 B;  4E2F B;  1H3Z A;  2CUB A;  4XU2 A;  1V29 B;  3CMA Q;  4KUL A;  2YUO A;  5CIU A;  2PVD B;  4FT2 A;  3JCM f;  2DTI A;  3QO3 A;  2KI7 A;  1R77 A;  5GAN f;  2D0N A;  4F14 A;  2JS0 A;  4ME7 A;  1JXO A;  3MP8 A;  1EIF A;  2JTE A;  3VS0 A;  3GPL A;  1WX6 A;  1NM7 A;  1VQM Q;  3CC7 T;  1D3B A;  4XU0 A;  2FPD A;  5CKE A;  4R56 A;  1Z9Q A;  3CPW S;  5GAM g;  1QWE A;  2FL7 A;  3CCV A;  4NL3 A;  1D1A A;  2KAF A;  5DM7 R;  2LQN A;  1OZ2 A;  2HD0 A;  1M4Z A;  3L2R A;  2E41 A;  1M3B A;  3LYI A;  3UDC A;  3RKY A;  2P0P A;  4EIK A;  4UC4 A;  4OB1 B;  3RDV A;  5FWB A;  3E19 A;  2NUT A;  1VQP A;  3TQ7 P;  3CCQ A;  3FJ5 A;  4PNO A;  8ATC B;  2K5I A;  1ZBJ A;  4A53 A;  2JTF A;  4NOY A;  3M0U A;  1UHC A;  5I2S A;  3GP8 A;  4OMN A;  3QYG B;  1WHH A;  1KSW A;  3PT9 A;  2P84 A;  4R55 A;  1PSF A;  1BIA A;  3LWH A;  4QW2 A;  1G2B A;  1M90 C;  2GBQ A;  1U1T A;  2HQH A;  4N4I A;  1M1G A;  4IUR A;  2J05 A;  5LJ5 d;  2YUP A;  1MHN A;  1KQ1 A;  3MKD A;  3VRZ A;  1JJ2 S;  2DF6 A;  3PIO A;  1Q86 U;  5KCO A;  4C92 F;  4PJO B;  2L3S A;  1SG5 A;  2L3Q A;  2CYZ B;  4A54 A;  1G8X A;  1WI7 A;  3WXM B;  1YJW A;  3CCE Q;  2X4X A;  2OTJ Q;  4ATO A;  3OB9 A;  1KK7 A;  1NBE B;  2K4Y A;  4FU6 A;  4FCY A;  3S6W A;  2RK1 A;  4LD6 A;  3R6N A;  2ZAE A;  1LNX A;  3JCM d;  4C5G A;  5C0M A;  3CCU A;  4ZGJ B;  4ZGE B;  5GAN d;  1D0Y A;  4JRK A;  1WYX A;  5LJ3 g;  4RG8 A;  2KRM A;  4LXC A;  1PKS A;  5GAO l;  2J6O A;  3CCS T;  1VQO T;  2HBP A;  2QG9 B;  1TSF A;  1GBR A;  4MDX A;  4OMO A;  1HK9 A;  4FT4 A;  4XTZ A;  4M7A B;  4F04 B;  3V7S A;  2EIF A;  2L5Q A;  1VOM A;  2K57 A;  2NYS A;  5LJ5 h;  2KT8 A;  1YI2 Q;  3CBM A;  1ARK A;  2PQW A;  1IZ6 A;  3FIF A;  3A8G B;  2DL8 A;  4C0G A;  4RMO A;  1N8R U;  4CRI A;  3M0Q A;  1UG1 A;  2E70 A;  4BY6 B;  1Z9Z A;  2JMC A;  2PZ1 A;  1W1F A;  4HCK A;  4M7D D;  3L2U A;  3S3M A;  1UTI A;  3PGG A;  4DEY A;  3V8L A;  1RAA B;  7AT1 B;  2LZ6 B;  1CKA A;  4L59 A;  1X2Q A;  3JB9 G;  1W2B P;  3PNW C;  4PFP A;  3CCM A;  2RQR A;  1D1B A;  3VS5 A;  4VUB A;  4M78 D;  2V1Q A;  4IIM A;  3CBO A;  2JJ9 A;  1VQ4 Q;  3MCA B;  1UEB A;  3H0H A;  1KD1 R;  1RAH B;  5D6Y A;  1Q81 U;  2B8A A;  4C8Q C;  2FZK B;  4ZTJ A;  1ZX6 A;  3EGD A;  4OGE A;  1HJD A;  3EFR A;  2NUP A;  3M4Y A;  5IH2 A;  3JCM V;  3E9G A;  5EG2 A;  3L2V A;  1VQP Q;  5FU6 C;  3CCQ Q;  3L42 A;  1VQ9 A;  3N5B B;  1K73 R;  1BI1 A;  2GQI A;  4M75 G;  1GBQ A;  4OMF B;  4E7K A;  1UJY A;  1B34 A;  1I81 A;  1JXM A;  2KYB A;  3RIR A;  2E5K A;  2MMP A;  3E1S A;  4J9D A;  2RH2 A;  1B3Q A;  2J7I A;  2HSP A;  2JXB A;  3REB B;  3QDR B;  4JUV A;  1X2K A;  2K5F A;  2RQU A;  4LDY A;  4XU1 A;  1YJN A;  2PVG B;  1KC8 U;  4KGZ B;  4M75 A;  1YWO A;  2JW4 A;  2XU8 A;  5M9O A;  3CME T;  1YJW Q;  1QVG A;  5CKF A;  1K76 A;  2HKQ B;  4KRT A;  4J7I A;  1R8O B;  5LL6 S;  1NPR A;  3M9Q A;  1AWO A;  2X9H A;  3MEA A;  2KE9 A;  4EPC A;  3H0I A;  5KYW A;  1M9S A;  4O6J A;  5A0L A;  3CC2 A;  2X35 A;  2E12 A;  1VQ5 A;  3QPH A;  3TRE A;  3MET A;  3QWX X;  3WVE B;  5HK3 A;  1KHC A;  4XTU A;  4F16 A;  3JCM W;  4D8D A;  1W2B A;  2YRD A;  3JAM E;  3FC3 A;  1RI0 A;  2CUD A;  1Q7Y C;  3A98 A;  3OYJ A;  5I21 A;  2V8J A;  1MMG A;  2D9T A;  3OW2 P;  1KHI A;  3HRT A;  2EGC A;  2K6D A;  2XIC A;  1BK2 A;  2VGM A;  1YBY A;  2MPX C;  1ZUK A;  5C6S A;  5GMK l;  2NUP B;  4HVV A;  1OV3 A;  4KGV B;  5I2M A;  4F7U A;  1SRM A;  4BI4 A;  5L23 A;  3CCR T;  1IRE B;  3OS1 A;  1W2B S;  1VYU A;  2LMJ A;  4RTV A;  3OMG A;  1U5S A;  2CP0 A;  2EW3 A;  3PMT A;  3UA7 A;  5IN1 A;  2B86 A;  4J83 A;  1ZA2 B;  2DZC A;  1QQJ A;  4C8Q B;  2ENM A;  2DAQ A;  4LDU A;  2J6F A;  1H3H A;  2A28 A;  2LQW A;  3SWN C;  3ER0 A;  2DZ9 A;  1YJ9 Q;  4K11 A;  1RAF B;  2H3E B;  1Q86 R;  4AFS C;  4QKU A;  5D6W A;  5IHN A;  3I56 A;  3GNG A;  4NS5 A;  2QA4 Q;  3RMQ A;  1QP2 A;  1Q82 U;  4FYY B;  5FU6 B;  2X4J A;  5FWC A;  2K2M A;  1RAG B;  3EG3 A;  1YHQ T;  3I55 T;  4RTT A;  3G1J A;  3MP6 A;  2E64 A;  3QHS A;  3RR6 A;  1E6H A;  5KYW B;  5IT9 E;  2X3X D;  2FRW A;  1K4U S;  2KMT A;  1IHW A;  3URG A;  2O01 E;  2DXU A;  4J9B A;  4IUT A;  3SWN A;  2QI2 A;  3JCM P;  2JM9 A;  3RER A;  1YCY A;  2OI3 A;  1IRX A;  1VQ6 T;  5KYY A;  1RAB B;  4MML A;  2VWF A;  2CP6 A;  1S72 T;  4XK8 E;  2D8H A;  3PTA A;  4FYX B;  4C92 D;  2LVM A;  5GAO n;  3QJY A;  1MGQ A;  5GAO q;  2BZX A;  1K8A C;  1U3O A;  2JM8 A;  3M53 A;  3CQT A;  2FVU A;  1MMN A;  2CP7 A;  3VRY A;  1OQK A;  5ECA A;  3CMA A;  2E3H A;  3EFS A;  3OYM A;  2EBP A;  4DQ2 A;  3TU4 K;  1K0X A;  2HNI A;  2FPE A;  2DJQ A;  5CR2 A;  3GF5 A;  1MUZ A;  3JB9 H;  2E6N A;  3TSW A;  4ZGD B;  5IHK A;  1VQM A;  4PFZ A;  1FWZ A;  3VV0 A;  3CCL T;  4CC4 B;  5AYF A;  4QVD A;  2DPP B;  3DLM A;  4FIB A;  5GAN j;  4PKC C;  3HL8 A;  1T3S A;  1SF9 A;  1RAC B;  3OW2 S;  4M7D B;  3HFO A;  3C0C A;  2E4H A;  1X43 A;  4ELZ C;  2VKN A;  4XTX A;  2RHX A;  3OS2 A;  1VQL T;  1K0S A;  4FSS A;  1WZO A;  2V8I A;  3S3N A;  3P8D A;  2OTL Q;  5CO7 A;  4L5G A;  4KBM B;  1Q81 R;  1K9M R;  4BE2 A;  4RKU E;  1AHJ B;  1VQN T;  2NUZ A;  3CCJ T;  1X01 A;  2X3W D;  3CD6 A;  3OBW A;  4JRI A;  2RD1 A;  3J7A F;  3S3O A;  3OQ5 A;  2EQM A;  2YWW A;  3QG1 A;  4M77 C;  4C5I A;  1G83 A;  2K5L A;  3EGX B;  3H41 A;  2HBW A;  1G3T A;  4J9G A;  2BKD N;  9ATC B;  5DLQ E;  3DB4 A;  1B7T A;  3ULR B;  3CC4 T;  2VYT A;  4RG2 A;  3G71 Q;  1ZUU A;  4LD9 K;  1QKX A;  1G3S A;  2EGE A;  1VQK T;  1X69 A;  2D1X A;  2DL5 A;  2QDY B;  1ZQ1 A;  2EJG A;  1M30 A;  5GMK i;  2RQW A;  2ESW A;  5CCA A;  2AZS A;  2VXE A;  3FEO A;  2R5A A;  2RJD A;  2QEX Q;  1BB9 A;  1JQQ A;  4M77 A;  2OTJ A;  2AIR B;  1YFN A;  2K79 A;  1G5V A;  3I56 Q;  1KC8 R;  3X26 B;  1FYN A;  2CSQ A;  3C94 A;  3SD4 A;  1FMV A;  3SEM A;  3OYB A;  3CXC A;  1VQ7 Q;  1ZSZ B;  4GBQ A;  3JCM Q;  4PJO G;  3VS1 A;  1VYV A;  1OU8 A;  4NL2 A;  2VC8 A;  2YRV A;  1M90 U;  2BE9 B;  4BUG A;  4J6X A;  3OYN A;  1H64 1;  2HQX A;  3JCM e;  3A8O B;  2EYQ A;  1YIJ A;  5GAN e;  1V1C A;  2OX7 A;  1QVF P;  3RKX A;  2LRQ A;  1UEC A;  2RK2 A;  4A4F A;  1NEB A;  1CKB A;  2HCK A;  3EG2 A;  3X28 B;  1PCX A;  4XTV A;  3CPW A;  1OEB A;  5A0G A;  3X25 B;  4C0Z A;  4HKE A;  1VQ8 T;  4PJO A;  2ATC B;  1YI2 A;  1ZBX A;  2M9U A;  2DIG A;  2DTH A;  2KY9 A;  2FB7 A;  4BAC A;  5GMK m;  1GXI E;  3CXC S;  2CDT A;  3C4S A;  3G7Z A;  4KT0 E;  5GAM f;  2CKK A;  4M7A C;  4V2S A;  5CKD A;  3C95 A;  3DLL A;  4M7A G;  2A37 A;  1WLP B;  5IAY A;  2AKK A;  3CCE T;  3GOX A;  2WSC E;  2QQR A;  5LJ5 g;  1AWJ A;  2MIO A;  2EWN A;  1U06 A;  2EYX A;  2JN0 A;  2AT1 B;  5KYN A;  2RPN A;  2DIL A;  4C5H A;  3KXT A;  4OB0 B;  3HHT B;  4RTY A;  5IXB A;  3ZFJ A;  2E5Q A;  4MDW A;  5J26 A;  4BY6 C;  2Y4Y A;  1VQ4 A;  2ROL A;  1M8V A;  3H8Z A;  4M77 B;  2DET A;  1SHG A;  2JS2 A;  3BE3 A;  1JJ2 A;  4M7A A;  1Q82 R;  3H6Z A;  1WXT A;  4MZT A;  3M59 A;  2DJZ A;  2RF0 A;  1GCQ C;  2E1H A;  4RTU A;  2DEU A;  3LWI A;  1UFF A;  2X4Y A;  3NTI A;  3CD6 Q;  1KJW A;  4IUQ A;  1N6A A;  2CS7 A;  3LH5 A;  3REA B;  4JLI A;  5CKB A;  1YIT Q;  2K7A A;  2RJF A;  4DEX A;  1QWF A;  2O4X A;  3SHW A;  1AT1 B;  1C1A A; 
#chains in the Genus database with same CATH homology
 1Y96 B;  2FYK A;  2ZZD A;  3EFR A;  1BYM A;  3G6E T;  3GNF B;  3M4Y A;  3LGF A;  3JCM V;  2PVO B;  3UWN A;  3E9G A;  3M5A A;  3CCL A;  4N4H A;  5EG2 A;  3L2V A;  2YHT A;  3JCM J;  1WJR A;  4M75 B;  5FU6 C;  4JJN K;  3A8H B;  3L42 A;  3ASK A;  2LCC A;  4N0A C;  3N5B B;  1VQ9 A;  3LW5 E;  1KQS S;  2P0K A;  2JZ2 A;  2D6F A;  1BI1 A;  4M75 G;  4OMF B;  4E7K A;  3WVD B;  1B34 A;  1I81 A;  4C92 B;  1Y71 A;  2I2L A;  3CPF A;  4C92 C;  3J80 E;  3VUB A;  2LT1 A;  3EAE A;  2LDM A;  2GF7 A;  3PFS A;  2ZGW A;  2MMP A;  4PLI A;  3RIR A;  3E1S A;  3VU3 C;  5LJ3 j;  2LC4 A;  5LJ3 f;  1VQL A;  1WNL A;  2RH2 A;  2R5M A;  2XG8 D;  4EMK C;  3CC7 A;  1K73 C;  5CVI A;  3QDR B;  3NTK A;  4C0F A;  2LX9 A;  4M75 D;  3G71 T;  3JB9 J;  1W4S A;  5GAM e;  1VQN A;  5GAO m;  3CCV T;  3M4G A;  1Y96 A;  4JUV A;  3OYD A;  2KDS A;  3CCJ A;  5FRN A;  3BY7 A;  2K5F A;  2LCL A;  2P0Q A;  3AHU A;  4LDY A;  3A8M B;  4II1 A;  4XU1 A;  4YTL A;  2PVG B;  2EJ9 A;  5FU7 B;  1YJN A;  4N0A A;  5D6X A;  1KC8 U;  4M75 A;  4XQ3 A;  4JRQ A;  5GAM d;  5FRM A;  2QQB A;  1QVF S;  2XU8 A;  2QQS A;  4MMK A;  5M9O A;  2QEX T;  3CME T;  5LJ5 j;  1QVG A;  5CKF A;  2VGN A;  5LL6 S;  4J7I A;  1R8O B;  3OBY A;  2ZCF B;  1NPR A;  3FJP A;  3M9Q A;  2ZPE B;  2CZ0 B;  4N4G A;  1OI1 A;  2RI5 A;  3MEU A;  3MEA A;  4EPC A;  4C92 A;  3I56 T;  2QQ9 A;  4M75 E;  3UPU A;  1M9S A;  4O6J A;  4ZN3 A;  1VQP T;  5A0L A;  3CC2 A;  2X35 A;  3BFM A;  3PMI A;  3OYK A;  4E7H A;  2EJF A;  3CCQ T;  2E12 A;  1VQ5 A;  3C12 A;  3QPH A;  3TRE A;  4EMG A;  1WJS A;  3MET A;  3MEW A;  2LQ8 A;  3WVE B;  3G4S T;  5HK3 A;  4C92 E;  1KHC A;  3DKM A;  2A7Y A;  3F70 A;  3DB3 A;  4XTU A;  3JCM W;  1I5L A;  1VQ7 T;  1VQK A;  3HP9 A;  2RHY A;  3J81 E;  1WJQ A;  1W2B A;  3JCM X;  3R6O A;  5KE3 A;  1G3W A;  1RI0 A;  1RL2 A;  3JAM E;  2DTO A;  3OYI A;  4ZN1 A;  3FC3 A;  4F7U B;  1Q7Y C;  5HY6 A;  3QKJ A;  3OYJ A;  1M1K C;  5I21 A;  4EMH A;  2OTJ T;  1NJI C;  4LDX A;  5A0D A;  3BW1 A;  1FXX A;  2V8J A;  4OB2 B;  5GAN 7;  2CGH A;  3P8B B;  4MZP A;  2ZPH B;  2RI3 A;  2D9T A;  1KHI A;  3HRT A;  2XIC A;  2D0Q B;  4ZTF A;  2VGM A;  3RMS A;  3V8J A;  4B9X A;  4M7D F;  4M7A D;  2ZPB B;  5KH6 A;  1M1F A;  1YBY A;  2IVW A;  2O4X B;  3ZEH A;  1Q7Y U;  4JDS A;  2MAM A;  1DJ7 B;  3M57 A;  2ZPG B;  2A3L A;  1M1K U;  1NJI U;  1Y7X A;  5C6S A;  2DXB A;  3ZBD A;  2RHZ A;  5GMK l;  3OYF A;  2DKG A;  1YJW T;  4HCB A;  4GLK A;  3QSU A;  4QQ6 A;  2BUD A;  1UB4 A;  1YJ9 A;  2PU9 B;  4RCB A;  5I2M A;  1YIJ T;  4M78 F;  3JCM h;  3JCM g;  4F7U A;  1VUB A;  2F5T X;  4BI4 A;  4C5E A;  3CCR T;  1IRE B;  5GAN 4;  3OS1 A;  2QA4 A;  4BDZ A;  1W2B S;  5GAN h;  5GAN g;  3OMG A;  4M77 F;  4BI3 A;  3HSB A;  3PMT A;  3BDL A;  3JB9 D;  1Q82 C;  5IN1 A;  3CCU T;  4J83 A;  2YLC A;  4F7U E;  2RI2 A;  2DZC A;  4J7F A;  3L1A A;  3T9N A;  3LX7 A;  4C8Q B;  2DAQ A;  2DXT A;  3QZ5 B;  4LDU A;  3X24 B;  2XKO C;  3MP1 A;  2MI6 A;  4J5Y A;  1BI3 A;  3SWN B;  2RHU A;  3SWN C;  3JRZ A;  5LJ3 e;  3ER0 A;  1QVP A;  3VYG A;  4C8Q G;  1YI2 T;  4A4E A;  2DZ9 A;  3QJ6 A;  3INZ A;  3CME A;  1OZ3 A;  1X75 C;  1Y07 A;  5FLX E;  5CQY A;  1VQ8 A;  3OYL A;  4CI0 C;  4A4K A;  1M5Q 1;  5D6W A;  1KD1 C;  2KK4 A;  2XDP A;  3GNG A;  5CKH A;  3I56 A;  2EQU A;  4NS5 A;  2K3Y A;  1ZHI A;  3CCS A;  3RMQ A;  5LJ3 d;  1VQO A;  4KUI A;  1QVF A;  1QP2 A;  2DIQ A;  3L2Q A;  1Q82 U;  4RCC A;  5GAN 8;  5FU6 B;  4OGC A;  2LT4 A;  3G4S A;  2X4J A;  5GAO r;  1UGS B;  3RUX A;  4C8Q D;  1G3Y A;  4BE1 A;  5KCH A;  1YHQ T;  2KSS A;  3QZ9 B;  3I55 T;  4FSX A;  2JUF A;  3P8H A;  5DY9 A;  3MP6 A;  2E64 A;  3CEY A;  3QHS A;  1U8R A;  2Y4X A;  3SFM A;  5CAI A;  5IT9 E;  5LJ5 e;  3M58 A;  2XK0 A;  3CCE A;  2KMT A;  3QII A;  1KD1 U;  3URG A;  2O01 E;  2DXU A;  4C8Q A;  4C92 G;  4IUT A;  2EKO A;  5GMK h;  2DEQ A;  3SWN A;  3E9F A;  2QI2 A;  4EMK B;  3JCM P;  2JNG A;  5HKC A;  3TCJ A;  1X6O A;  2BIV A;  3RER A;  1YCY A;  1VQ6 T;  2M16 A;  4IUU A;  4KUD K;  2VXF A;  5GAN 3;  2M0O A;  4HT9 A;  4J8O A;  4PJO F;  4MML A;  3CD6 T;  4C8Q E;  1VQ4 T;  2JTM A;  1S72 T;  4XK8 E;  4PJO C;  2ZPF B;  1BIB A;  3PTA A;  1QP3 A;  2R57 A;  1BKB A;  4C92 D;  2LVM A;  3FRN A;  5GAO n;  1O75 A;  4JS4 A;  1YIT T;  3QJY A;  2HQE A;  2RB6 A;  1MGQ A;  3HFN A;  3MO8 A;  3JCM c;  3CCM T;  5GAN 5;  1TH7 A;  3VKI A;  2PUK B;  5GAO q;  1K8A C;  2QTX A;  3M53 A;  2M1H A;  2RO0 A;  3JB9 I;  2FVU A;  4BI8 B;  1I8F A;  1K73 U;  2DD4 A;  3HPW A;  3OA6 A;  1XQH A;  2MWP A;  3CMA A;  4E7L A;  1WGS A;  4PL6 A;  2V8K A;  2RA2 A;  3EFS A;  3O8V A;  3QXE B;  1WPY A;  2WSF E;  3VUZ A;  3OYM A;  2XID A;  4DQ2 A;  4BDY A;  2KQW A;  3BDU A;  5CQX A;  3TU4 K;  2QXF A;  4EMK A;  2HNI A;  2ZPI B;  4JLG A;  4ELY C;  4X34 A;  5CR2 A;  3FLG A;  5KE2 A;  3Q1J A;  1XTD A;  4A4G A;  3GF5 A;  1NZ9 A;  2R58 A;  4HT8 A;  3JB9 H;  1D3B B;  2DXC A;  5GAN 2;  2E6N A;  1U1S A;  4J6W A;  2RJC A;  2RM4 A;  4QVZ A;  4ZGD B;  1FX7 A;  3X20 B;  1H3Z A;  2DO3 A;  1UGQ B;  1VQM A;  2OTL A;  4F7U G;  4XU2 A;  1V29 B;  1FWZ A;  3VV0 A;  3CCL T;  4KUL A;  5CIU A;  2PVD B;  5AYF A;  4E47 A;  4QVD A;  3G6E A;  1P92 A;  4C0D C;  4FT2 A;  2DPP B;  4M7A F;  4BB7 A;  3JCM f;  3DLM A;  2DTI A;  4FIB A;  5GAN j;  1VQ9 T;  3QO3 A;  2LQK A;  4PKC C;  3HL8 A;  3LLR A;  4OVA A;  4IUP A;  5GAN f;  4ME7 A;  2L8D A;  3L2Z A;  3MP8 A;  3OW2 S;  1EIF A;  4M7D B;  3HFO A;  3KUF A;  4ELZ C;  4M7D C;  2K2V A;  2MWO A;  2PUO B;  4XTX A;  1VIE A;  2RHX A;  3SDZ A;  3GPL A;  4M7D G;  3OS2 A;  1VQL T;  2H3J A;  2V8I A;  3HRS A;  3S3N A;  3P8D A;  1BI2 A;  3CC7 T;  1D3B A;  4XU0 A;  5CO7 A;  2FHD A;  2HAX A;  4L5G A;  4KBM B;  4BE2 A;  4RKU E;  1AHJ B;  2E6Z A;  1VQN T;  5CKE A;  3OSV A;  4XTY A;  4R56 A;  1VQ6 A;  3CCJ T;  3G71 A;  3JB9 F;  1X01 A;  3CPW S;  5GAM h;  5GAM g;  2FL7 A;  5GAO p;  1JBM A;  2F5K A;  4M78 C;  3OYY A;  5L8R E;  4A4H A;  3CCV A;  3M55 A;  3CD6 A;  3OYC A;  5CK9 A;  3OBW A;  4JRI A;  2IG0 A;  4L6V 5;  4NL3 A;  1YJN T;  2RD1 A;  2XHC A;  3MEV A;  4B9W A;  3S3O A;  2KAF A;  3OQ5 A;  2EQM A;  3J7A F;  4OP0 A;  5DM7 R;  3V7R A;  1OZ2 A;  3QG1 A;  4M77 C;  3HKS A;  4EDU A;  2HD0 A;  1K9M C;  2L89 A;  4C5I A;  1M4Z A;  2K5L A;  2E41 A;  3L2R A;  3LYI A;  2EQJ A;  3UDC A;  3RKY A;  2P0P A;  1G3T A;  3M56 A;  3OYA A;  3V8K A;  4UC4 A;  2QEX A;  2BKD N;  4OB1 B;  4M7D A;  4BE0 A;  3A8L B;  4MZM A;  5GMK j;  5DLQ E;  3DB4 A;  3CC2 T;  2RHI A;  3CC4 T;  2EQK A;  3OSS C;  5J39 A;  1VQ5 T;  4DOW A;  2VYT A;  4RG2 A;  3E19 A;  1VQP A;  3L2W A;  1N27 A;  2XI9 A;  2X4W A;  4LD9 K;  3CCQ A;  3MHX A;  1BI0 A;  4TVR A;  2XDD A;  4M7D E;  4PNO A;  1PSE A;  2K5I A;  1G3S A;  1VQK T;  2Y90 A;  4A53 A;  2QDY B;  1ZQ1 A;  2EJG A;  2JTF A;  1K9M U;  3CBP A;  3VJP A;  1VQ7 A;  4NOY A;  5GMK i;  1Q86 C;  3FB9 A;  5CCA A;  4M78 A;  2JOY A;  5I2S A;  3GP8 A;  3OS0 A;  3OMC A;  4IKF A;  3QYG B;  2VXE A;  3PT9 A;  3ME9 A;  3FEO A;  2R5A A;  2RJD A;  1PSF A;  4R55 A;  1BIA A;  3LWH A;  4M77 A;  2EAY A;  3GLX A;  2OTJ A;  2NLU A;  4QW2 A;  3TEE A;  1M90 C;  3OY9 A;  4M78 E;  2MF2 A;  4M75 F;  1U1T A;  1G5V A;  2JVV A;  3M54 A;  4N4I A;  1M1G A;  4IUR A;  2GCX A;  3KBG A;  3X26 B;  5LJ5 d;  1MHN A;  2LTO A;  1KQ1 A;  1JJ2 S;  4Z02 A;  4M75 C;  4M77 E;  2OAU A;  2RJE A;  2CZ6 B;  3VYH B;  3PIO A;  3C94 A;  5KCO A;  3SD4 A;  1Q86 U;  4C92 F;  4O5V A;  4PJO B;  3OYB A;  4X9D A;  3CXC A;  1XNI A;  4PJO G;  1KC8 C;  2CYZ B;  4A54 A;  4NL2 A;  3RKW A;  1LOJ A;  2VC8 A;  1YJ9 T;  2YRV A;  3WXM B;  1YJW A;  4XTW A;  2X4X A;  4DOV A;  4BUG A;  2GFU A;  1M90 U;  4BD3 A;  4J6X A;  4FL6 A;  3OYN A;  4ATO A;  1H64 1;  2HQX A;  3OW2 A;  1WQ7 A;  3JCM e;  3OB9 A;  3UT1 A;  4D6W A;  3PIP A;  1LJO A;  3A8O B;  2QA4 T;  2EYQ A;  3GIB A;  1YIJ A;  4Y91 A;  2K4Y A;  5GAN e;  5HK0 A;  3LH0 A;  3CCR A;  3A5Z B;  4FU6 A;  3RKX A;  3S6W A;  4PJO D;  2RK1 A;  2LRQ A;  4LD6 A;  5LJ5 f;  2WSE E;  3LGL A;  1LNX A;  2CZ7 B;  2DVE A;  2GFA A;  1JB0 E;  2RK2 A;  4A4F A;  4C5G A;  5C0M A;  3JCM d;  3CCU A;  4ZGJ B;  4HCC A;  1VIF A;  3X28 B;  4ZGE B;  5FU7 C;  5GAN d;  3RES A;  4XTV A;  4JRK A;  2EFI A;  1K8A U;  1NE8 A;  2L3R A;  3CPW A;  5LJ3 h;  5A0G A;  5LJ3 g;  4RG8 A;  3X25 B;  4C0Z A;  4HKE A;  1VQ8 T;  4PJO A;  1KG1 A;  2GQV A;  1YI2 A;  2QQA A;  1ZBX A;  2M9U A;  4DA4 A;  2DIG A;  2DTH A;  2KY9 A;  2FB7 A;  5GAO l;  4BAC A;  4PLL A;  2XDB A;  5GMK m;  3CCS T;  1VQO T;  1GXI E;  2HBP A;  3CXC S;  3CC4 A;  2LNV A;  4FM4 B;  4JRP A;  4C0D B;  4MDX A;  4PJO E;  4HCZ A;  1HK9 A;  4FT4 A;  4XAX B;  4XTZ A;  1WQW A;  5FRO A;  5GAM j;  1N8R C;  3C4S A;  2C06 A;  2KVQ G;  3OS5 A;  3G7Z A;  4KT0 E;  4M7A B;  5GAM f;  4F7U F;  1NPP A;  2CKK A;  4M7A C;  4V2S A;  2VUB A;  3NTH A;  5CKD A;  3C95 A;  3DLL A;  3V7S A;  1YHQ A;  3I55 A;  2EIF A;  4Y28 E;  2L5Q A;  4M7A G;  1N9R A;  5IAY A;  2K57 A;  3CCE T;  3GOX A;  4J6Y A;  3QBY A;  2WSC E;  5LJ5 h;  2QQR A;  5LJ5 g;  3CBM A;  2PQW A;  1IZ6 A;  2AHJ B;  3QYH B;  3FIF A;  5GMK e;  2EWN A;  3NFC A;  1OYX A;  2JN0 A;  4XU3 A;  4JS5 A;  3A8G B;  4WF2 A;  1JRI A;  4QQD A;  3OYG A;  4C5H A;  4C0G A;  4RMO A;  4OB0 B;  3OYH A;  3KXT A;  5J3B A;  1N8R U;  4CRI A;  2XD0 A;  3FDR A;  1HXD A;  2F69 A;  3HHT B;  4Q5W A;  3ZFJ A;  2E5Q A;  4HA8 A;  4X9C A;  2E70 A;  1UGP B;  4M78 B;  4BY6 B;  1N9S A;  4MDW A;  5J26 A;  1QVG S;  4BY6 C;  2Y4Y A;  4LDV A;  1VQ4 A;  2E65 A;  3OYE A;  5DLO A;  4M7D D;  3L2U A;  2WAC A;  3PGG A;  3S3M A;  1M8V A;  5GAN 6;  3H8Z A;  4M78 G;  2DD5 A;  3V8L A;  1S72 A;  2CZ1 B;  4M77 B;  1UGR B;  4L59 A;  1KQ2 A;  3JB9 G;  1Q81 C;  1YIT A;  1JJ2 A;  2DK3 A;  4M7A A;  4OB3 B;  1KQS A;  3PNW C;  3H6Z A;  4M77 G;  4IUV A;  3V7C A;  3CCM A;  3QUI A;  4QQG A;  4OF1 A;  4MZT A;  3M59 A;  2DJZ A;  4E7J A;  3CMA T;  4VUB A;  3SB2 A;  1I4K 1;  2E1H A;  4GY5 A;  5A2Q E;  3LWI A;  4M7A E;  2K3X A;  2P4T A;  3JSC A;  1O9S A;  4M78 D;  3JCM b;  3CBO A;  1QW1 A;  1B34 B;  2X4Y A;  4C8Q F;  3NTI A;  4IUQ A;  3MCA B;  1UEB A;  1N6A A;  1XOV A;  2YLB A;  4M77 D;  2CS7 A;  4QVC A;  5D6Y A;  1Q81 U;  2B8A A;  4P5N A;  4JLI A;  4C8Q C;  3HRU A;  4E7I A;  4ZTJ A;  5CKB A;  2RJF A;  2O4X A;  2G3R A;  1SSF A;  1VQM T;  2OTL T;  4LDW A;  4OGE A;  2VV5 A;  3JCM Q;  2E10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...