1GL5A

Nmr structure of the sh3 domain from the tec protein tyrosine kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNNLDQYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE TEC
publication title The solution structure and intramolecular associations of the Tec kinase SRC homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gl5A00
2RQVA 4RTXA 2P4RA 2KYBA 3KFVA 2K3BA 1GBQA 1PRLC 1PRMC 2DMOA 2LMJA 3NPFA 3SHWA 3H0FA 2V1QA 5I22A 1PHTA 1VA7A 2GQIA 3LH5A 1MV3A 3TSWA 1M3AA 4Z89A 2LJ0A 4RTTA 4OMPA 4AFSC 2XMFA 2ENMA 3VS5A 2YUPA 1UECA 4ORZA 1M8MA 2A28A 1KJWA 1WXBA 1PKSA 1AOJA 1N5ZA 4J9BA 1E6GA 3VS3A 1GCPA 3VS1A 2LZ6B 2KRMA 1T3LA 1UUEA 1YWPA 4OMLA 2ROLA 2FRWA 3EG3A 1AWWA 2LP5A 1Y0MA 1FYNA 3UATA 1X27A 2FPFA 1X2KA 2SRCA 2GTOA 4JJBA 2AKLA 4DEYA 1MV0B 4AFZC 1ARKA 3CQTA 2O31A 3TVTA 3NMZC 2L3QA 4HVVA 3VRZA 2OAWA 2LX7A 4HXJA 2RF0A 3VS7A 1H92A 2G6FX 1AZGB 3R6NA 1M3BA 2DE0X 1NEGA 2GGRA 3EHRA 3M0TA 2V1RA 1RLQC 2M0YA 1RUWA 1WXUA 5IHKA 3VS2A 1KIKA 2FO0A 1UJ0A 2EYWA 2KXDA 2K6DA 2EVRA 1NYGA 3REBB 2DM1A 4OMQA 1OOTA 4EIKA 2C0OA 2AK5A 2JMAA 2BZXA 4J9EA 3U23A 4CC2A 2A08A 2DILA 2DYBA 2EW3A 2L3PA 1K4US 2DBKA 2BTTA 1PNJA 4X1VA 1UE9A 1AVZC 1V1CA 1AEYA 2KNBB 1W6XA 1FMKA 2OJ2A 1BB9A 2IIMA 2AZVA 2FG0A 4E6RA 4J9IA 2BZ8A 2ESWA 2FRYA 1U5SA 2HEQA 1WFWA 3H0HA 4CC7A 3PE0A 3M0RA 1EFNA 1PWTA 1HJDA 2HDAA 1WYXA 2JS2A 2DL5A 2K79A 1I1JA 3M0PA 5ECAA 1A0NB 2GBQA 1H3HA 1GCQC 1K76A 2DJQA 1K9AA 1ZLMA 2DVJA 1AWXA 2JXBA 1JQQA 2ED1A 1GFDA 2QDLA 1UHCA 4RTYA 4RTVA 4OMNA 3I5RA 1E7OA 4JJDA 4F16A 1WI7A 3M0UA 4RTWA 2J6OA 3UA7A 2O88A 5HCKA 1UFFA 3RBBB 1I07A 2K2MA 2D0NA 1MUZA 1YP5A 5IHNA 2FPEA 4RTUA 1TUCA 2X3XD 2FEIA 2JT4A 4Z8AA 2PZ1A 3H0IA 2D1XA 4JPBW 1GFCA 3REAB 3EG2A 2AZSA 2CSQA 2X3WD 1KSWA 1AZEA 1GRIA 3M0QA 3UA6A 4OMOA 2YT6A 1X6BA 4HCKA 4DEXA 4AFUC 3FJ5A 2O2OA 1M27C 2ED0A 2EKHA 4F17A 2DBMA 2AKKA 3NGPA 2W10A 4J9CA 4M4ZA 3EG1A 1UTIA 1GCQA 1ZUUA 4R0KA 2JTEA 1QWEA 1OPKA 3ULRB 2LQNA 2EGCA 1X43A 1ZX6A 1X2QA 4LNPA 1JO8A 1WIEA 2RNAA 2RMOA 2FPDA 2KRNA 2KE9A 5FWBA 2RQRA 3C0CA 2L0AA 1OPLA 2JM8A 1SRMA 2C0IA 2MIOA 1U3OA 2HSPA 1U06A 2YUOA 2BZYA 2O9VA 1Z9ZA 2EGAA 5I11A 2EYXA 1H8KA 2KGTA 2W0ZA 5L23A 5GJVB 3EG0A 2EPDA 4HVWA 1I0CA 1M30A 2MCNA 1K0XA 4AFQC 2L2PA 1NLPC 4JZ4A 1WLPB 3SEMA 2CSIA 1PKTA 1K1ZA 2H8HA 3NHNA 4ZNXA 4J9FA 2A36A 1NLOC 4LE9A 1LCKA 2CH4A 3M0SA 2HBWA 2O9SA 1JEGA 2J6FA 1CKAA 2KT8A 2LCSA 2PNIA 1WDXA 3EHQA 1GBRA 2DNUA 2A37A 1X69A 5EC7A 1NG2A 1WX6A 4LUEA 1IO6A 1QLYA 2D8JA 1RI9A 1UDLA 1T0JA 4CC3A 2CH4W 2LQWA 2PTKA 2NWMA 1QCFA 1Y57A 1J3TA 2I0NA 4JZ3A 2GTJA 1YCSB 2JS0A 1QKXA 1GL5A 2VKNA 2YUQA 2NUZA 2ROTA 4CC4B 3IQLA 1T0HA 1YWOA 1SHFA 1BBZA 2J05A 4K11A 1SHGA 1UG1A 2JM9A 1XOVA 2D8HA 4RUGA 2DRMA 2M51A 2KXCA 2LNHB 1JU5C 1SRLA 1X6GA 2KYMA 2ECZA 2RN8A 1G83A 4A63B 3PVLA 2DRKA 2K9GA 1SSHA 1ZBJA 2CT3A 4F14A 2J06A 2RQWA 2LJ3A 1G2BA 2DL3A 1HSQA 4HVUA 2KROA 2GNCA 3VRYA 4JJCA 2CDTA 2DL4A 2RQTA 1T3SA 1W1FA 4LUDA 5IXBA 2KBTA 2YUNA 2DX1A 1AWOA 1M3CA 2HCKA 2JMCA 1JXOA 3O5ZA 3ZL7C 1OV3A 1B3QA 1BK2A 5IXFA 5GJWB 4OMMA 3QWYA 2MOXA 2CUBA 3I9QA 1VYTA 1YN8A 2CUDA 2F2VA 3I35A 1AWJA 2VVKA 2DLPA 2F2WA 1ABQA 2DL7A 4QT7A 4RTZA 5FWCA 2YDLA 3PVQA 4GLMA 2KR3A 3I5SA 2OI3A 2EQIA 4D8KA 2RPNA 2ABLA 3JV3A 3QWXX 1NEBA 1E6HA 1WA7A 5IHIA 1NM7A 1S1NA 1TUDA 1Z9QA 1QWFA 4D8DA 4IIOA 3EGUA 2CT4A 2B86A 3GBQA 4Y92A 3THKA 1CKBA 1QKWA 2C0TA 1W70A 1JXMA 1KFZA 1YNZA 1ZSGA 5FW9A 1UHFA 1HD3A 2J7IA 2L3SA 1VYUA 1NYFA 3VS6A 2JW4A 3VS0A 1ABOA 4J9GA 2F2XA 3H41A 4KRTA 3A98A 4J9HA 4Z88A 2DF6A 2CREA 2EGEA 2SEMA 1CSKA 5IH2A 4J9DA 3RNJA 2RQUA 2KRSA 4AG2C 1SEMA 3VS4A 3TSZA 4WCIA 2YSQA 4LN2A 1K0SA 2EYZA 4ESRA 1ZUYA 1AD5A 2EYYA 1B07A 1UGVA 1TG0A 3UF4A 2E5KA 2LJ1A 4FSSA 2EBPA 2DL8A 2J6KA 2K7AA 1BU1A 1ZUKA 4GBQA 4AG1C 1WXTA 1OEBA 1UJYA 2VWFA 2KEAA 4IIMA 1SPKA 1RLPC 2KT1A 1VYVA 2DA9A
chains in the Genus database with same CATH superfamily
2P4RA 3KFVA 4KH1B 3GNFB 1IRXA 3OYAA 5IT9E 3NPFA 5GAN6 1YITQ 3FB9A 4HKEA 2RHIA 5HY6A 1G8XA 1D0YA 2HD0A 1WNLA 1RAAB 1MV3A 2EJFA 3CCMQ 3NTKA 4RTTA 1OX8A 4C92G 2L3RA 4OMPA 3CCST 2DXTA 3S3MA 2XMFA 1RI0A 2DXCA 4FW2A 1UECA 3OYKA 3CBPA 3TQ7P 4F7UB 4ORZA 1VQ8A 3SWNC 3PMTA 1PKSA 1JJ2A 1K73U 1E6GA 4XU3A 2LZ6B 1YWPA 4EMKA 3EG3A 3MJXA 5GANf 1FYNA 2VUBA 1BKBA 2QK0A 1VQ6Q 4XTZA 1NPPA 2FPFA 4GY5A 4DA4A 2NUTB 2KSSA 2E4HA 5FU6C 3FIFA 1VQOA 1D1BA 3NMZC 5CIUA 2ZGWA 3VRZA 2DTIA 1QVFS 5CKEA 3QUIA 4E7IA 3VS7A 1H92A 1NEGA 2IG0A 3EHRA 4PFPA 2M0YA 1YJNA 1WXUA 3VS2A 1UGSB 3CCUQ 2FO0A 1UJ0A 4LD9K 2P0KA 2KXDA 2WSFE 1NYGA 3REBB 2MWPA 2C0OA 2AK5A 1WQ7A 2JMAA 3M55A 2OTJQ 2MK5A 4N4GA 4TVRA 2EW3A 2L3PA 1MHNA 5GAN8 1MMAA 2DBKA 5AT1B 5KYWA 2YRVA 1PNJA 4X1VA 3JCMb 2ZPBB 1YIJT 1LPLA 2CP7A 1FMKA 3OQ5A 4M78G 3GIBA 1N9SA 5C6SA 4QKUA 3PMIA 5KYXA 4M77E 2K5LA 1IGUA 2K4YA 1PD1A 2FG0A 5AYFA 5I2MA 4C0ZA 2ESWA 1YI2T 4DBFA 1ZHIA 1YHQA 1HJDA 2E64A 1XNIA 2K2VA 2DL5A 2DKGA 3M0PA 4PJOB 5L8RE 3GF5A 5J26A 2JXBA 2X4YA 3G6EQ 1JQQA 1IB8A 1GFDA 1M5Q1 1UHCA 2QDLA 3UWNA 1LVKA 3I56A 3I55Q 4PLLA 2C06A 1VQ4A 3GP8A 4OMNA 4QQGA 4HT9A 1C1AA 1HK9A 1WI7A 2X4JA 1UFFA 1I07A 1Y96A 1RABB 2K2MA 4FYXB 3VU3C 5IHNA 2FPEA 1MMDA 3EH1A 3TCJA 5GANj 2GFAA 1M90C 3VUZA 1MNDA 2CSQA 2X3WD 3CC7A 4JRQA 3M0QA 3UA6A 1WHGA 3QHSA 3V8LA 3OY9A 1X6BA 3X25B 3OYNA 1ZBXA 4KUDK 2EKHA 1RAGB 2AKKA 3EG1A 3A8HB 1GCQA 1ZUUA 2P0QA 4MZMA 5A0GA 4HCBA 1ZX6A 3CC4T 3OYHA 2JTFA 5M9OA 2CP5A 4J5YA 4FW1A 3CXCP 1LJOA 4C92F 3CXCA 2CGHA 2CZ0B 2CZ6B 3OW2P 4X9DA 2YUOA 2BZYA 2E65A 3OW2A 1Q86C 1OU8A 2A0FB 1YJ9Q 1M2VB 3SB2A 2EQJA 2EPDA 4JRKA 3EGDB 3MHXA 4E7ZA 4M7AA 4AFQC 2L89A 2COZA 1WLPB 5GAMh 3QIIA 1PKTA 3VYGA 2PVGB 4A4GA 3ZBDA 3VYHB 1YFNA 1EX4A 1NLOC 2RI3A 4LE9A 1M2OA 2PUKB 5A2QE 5KH6A 2QA4A 1VQKA 4N4HA 1S72T 2EWNA 1CKAA 4ZTFA 2KT8A 4BACA 3T9NA 2PNIA 3CC2A 4IKFA 2A37A 1O75A 4BE1A 4Z02A 2AT1B 2HAXA 1T0JA 3MEUA 4VUBA 5GANe 3F70A 3SWNB 3BY7A 3L2QA 2ZPGB 5IAYA 1PSEA 4QVZA 1D3BB 2JS0A 1QKXA 1VQ8Q 4MZTA 1GL5A 4M7DG 4CC4B 2XDDA 5J3BA 1R8OB 4M78F 1SHFA 2K5FA 2J05A 4K11A 1XOVA 2D8HA 2FZGB 1IZ6A 1IHVA 5CQYA 3M4GA 2M16A 3UT1A 3CBOA 2RN8A 5GAOp 3CCRT 4C5EA 3CCLT 3JCMd 1VQOQ 3PVLA 2DRKA 2K9GA 4ZGDB 2QXFA 2DXBA 3FEOA 3H9NA 4F14A 4E7SA 4A4FA 2CZ7B 2DL3A 5KE2A 4M77B 2DL4A 1T3SA 1W1FA 5IXBA 2EJGA 1G3SA 1M90U 1YJNQ 1JXOA 5GAOl 2EIFA 2E10A 5IXFA 3VKIA 5CCAA 2XIDA 3QWYA 1WQWA 3LW5E 4L59A 2E70A 3I9QA 1VQ7A 1YN8A 2GQVA 3HKSA 3LH0A 1K8AU 1AWJA 2BIVA 4M7AE 1KQSS 1M90R 3EFOA 1N8RU 1ABQA 2YHTA 5GANg 4NL3A 4C92D 1TTHB 4XU2A 3QYGB 3CD6A 1QW1A 2YDLA 5FROA 2KR3A 2MI6A 2EQIA 4D8KA 1Q86U 2E1HA 3QWXX 1E6HA 1WA7A 2E12A 1QWFA 1TH7A 2P0PA 3G7ZA 2CP2A 1UGPB 4NL2A 1KD1C 1WJSA 5GMKm 3I56Q 1G3TA 1VQ4Q 1KFZA 1YNZA 2LRQA 4Y28E 1UGQB 4ZGJB 5FW9A 1NYFA 1HXDA 5FU7C 3OS2A 2L5QA 2JUFA 4R55A 1SKUB 4UC4A 4J9HA 4LXCA 2E6NA 3HRUA 4Z88A 1QP2A 3HL8A 3CC7Q 2CREA 1CSKA 5IH2A 4BE0A 3A8OB 1VQ5A 3OB9A 3LWHA 3R6OA 2A3LA 4WCIA 2YSQA 4F7UE 1K0SA 3LGFA 5GAOq 1G5VA 1N6AA 1YITT 3LWIA 3RUXA 5KYXB 4DBRA 2EBPA 4EPCA 2DL8A 3OYDA 3CCMT 2R5AA 3OYEA 3HFOA 3CPWS 2J6KA 4NOYA 4M78D 3QDFA 5CKHA 3I35A 2KT1A 2DA9A 1VQLA 2RQVA 2LT1A 1VIEA 1QCOA 2VV5A 2E41A 1Q81R 1W4SA 3L2WA 1GBQA 4RMOA 1DJ7B 1PRMC 2BKDN 2DMOA 2LMJA 4AMCA 1V76A 3SHWA 4C8QC 4M7DF 2CP6A 3A8LB 3H0FA 3QO3A 1VA7A 2HL5C 1VQ6T 3CCQA 2KVQG 1M4ZA 3FDRA 5A0DA 1Y96B 2ATCB 1QVFP 4AFSC 4J7IA 1QVFA 3E9FA 4C8QG 3J81E 2KI7A 1AOJA 1NJIU 2FZKB 1GCPA 2QA4Q 3O8VA 1VQKQ 5HK0A 3ASKA 2KRMA 1UUEA 4OMLA 4M75G 1M1GA 1Y0MA 2JNGA 2HBPA 3UATA 4QVCA 4N4IA 3CC2Q 3CCUT 1X2KA 2GTOA 2B8AA 4AFZC 4C92A 3FC3A 1WGSA 2OTJT 3GNGA 1RAIB 2R5MA 2FHDA 5LJ3e 3OBWA 2OAWA 2CZ1B 4BUGA 4PJOE 2VC8A 2DVEA 4HXJA 2DIGA 2RF0A 1M1FA 2BE9B 3LX7A 2DE0X 3S3NA 1UGRB 1KQ1A 3HFNA 2KDSA 1X75C 2EVRA 2ZPHB 4YTLA 3QKJA 4B9XA 3SWNA 1W2BS 3TU4K 4L5GA 1KD1U 3ZFJA 4CC2A 3QG1A 2A08A 1KHIA 3CCJA 2KNBB 1W6XA 3G6ET 3UPUA 2HKQB 1QMCA 4XTVA 3I55T 1BB9A 1OU9A 2AZVA 1V29B 4IURA 3CCVA 5LJ5d 3OYFA 3M5AA 4JDSA 1KD1R 3QPHA 1U1TA 2YRDA 1U5SA 2K5IA 2HEQA 4FM4B 2VGNA 4CC7A 3PIPA 1QVGS 1I8FA 2HMAA 2VYTA 3S3OA 3RERA 3RMSA 1I1JA 5ECAA 3A8MB 3S6WA 1VQ7Q 5CO7A 2FZCB 2DVJA 2EFIA 4M78A 4ZN3A 5FRMA 4PK4A 4C92C 3DLMA 3GPLA 4RTVA 3A8GB 2V8KA 2LNVA 3I5RA 3EAEA 4RTWA 1WHKA 3DKMA 2O88A 5HCKA 5GAN3 5LJ3g 3FJPA 1MUZA 2E3HA 1JB0E 1TOVA 2FEIA 2OTLA 2JT4A 4M7DD 4Z8AA 4PJJA 3H0IA 3M4YA 2D1XA 3M56A 3REAB 3EG2A 1KSWA 1GRIA 5LJ5e 1JJ2P 4HCKA 2XDBA 3VUBA 1M27C 1YJ9T 3NGPA 3EFRA 5FU7B 4M4ZA 4XAXB 1VIFA 4OGEA 3E9GA 2E5QA 2M9UA 4B9WA 1OPKA 3ULRB 2QQ9A 1M1KR 3EGXA 2RI5A 3LGLA 2RMOA 1ZA2B 3C0CA 2MIOA 2HSPA 1U06A 1VQ5Q 1Z9ZA 1HYOA 4C8QF 2R58A 5KE3A 3JB9D 4KGVB 3EFOB 3MO8A 4LD6A 5GJVB 4M75F 1Q7YR 1I0CA 4M78C 2DEQA 3PIOA 3SEMA 3JB9H 2CSIA 4XTUA 3KXTA 2H8HA 2YXYA 1BI1A 5IN1A 4J9FA 2X35A 1LCKA 2CH4A 4OB3B 1VQLQ 4ZGEB 1VQ8T 1JEGA 3L2ZA 2LDMA 3TREA 1UEBA 3HHTB 3G71A 1GBRA 2DNUA 2QASA 2QQRA 1WX6A 3CCQQ 3J7AF 4X34A 3OYYA 3PT9A 4WTOB 5LJ5g 5GAOn 4ZTJA 2RK1A 4CC3A 2LQWA 2PTKA 2XI9A 1VQOT 1J3TA 3HP9A 4JZ3A 5CK9A 2GTJA 1WHLA 4QQ6A 1YCSB 3MKDA 4XK8E 3DLLA 2KQWA 1Q95G 1I5LA 4LDXA 2GCXA 1YJNT 1BBZA 1SHGA 5KYYA 4O6JA 1PM3A 2KMTA 2M51A 2DFUA 2DJZA 3JCMV 4DQ2A 4KH0B 2ECZA 4BE2A 2ZPFB 1G83A 1YJWA 3QSUA 1VQ9A 4BY6C 1KQSP 3PGGA 4KGXB 1SSHA 1KQSA 2JJ9A 2FB7A 4M7DA 2J06A 2RQWA 4E2FB 2LJ3A 3AHUA 4JJNK 3OS5A 2QYZA 1VQPA 4HVUA 3VJPA 2GNCA 3VRYA 3V7RA 2RQTA 4KGZB 4HCCA 2YUNA 1PCXA 2DX1A 2PU9B 3HRTA 3LLRA 4A4KA 1TUGB 1QQJA 3JCMh 3ZL7C 4J6WA 1OV3A 4RG2A 2WSCE 2RH2A 1R0BG 4R56A 8AT1B 1YCYA 2JVVA 2MOXA 3JCMP 2VVKA 4HA8A 3CCJQ 5GANd 5GAMf 1WZOA 1VQ4T 2DL7A 2MYSA 3CCVQ 4QT7A 3CCEA 5D6WA 3PNWC 5DM7R 4EMHA 3PVQA 1XTDA 2R57A 2QTVA 1QP3A 3A1PA 2OI3A 4C8QD 2QDYB 2RPNA 2CS7A 3JV3A 4RCCA 1XQHA 4C92B 2MWOA 4M75D 3WXMB 3CBMA 5J39A 4IIOA 5CKFA 3CC7T 2D6FA 1OQKA 2CT4A 4HCZA 3V8KA 3GBQA 2PVOB 1CKBA 4OB1B 2DD5A 1TSFA 2C0TA 1W70A 1JXMA 4B6MA 1IHWA 1Y71A 4FT2A 1HD3A 3CPWP 4M7DC 2X9HA 3CPWA 3VS0A 3E2UA 1ABOA 3H8ZA 2K57A 1RAFB 3QJ6A 2OTLQ 4XTWA 3A98A 4OVAA 2HQEA 4A4EA 2V8JA 1M9SA 3H6ZA 3DB4A 2DF6A 2EGEA 2SEMA 1Q81C 3G4SA 2PQWA 1M8VA 2Z0WA 4ESRA 4A4HA 3JCMJ 1AD5A 2EYYA 1B07A 1UGVA 1TG0A 5FU6B 1NBEB 3UF4A 1Y07A 3G1JA 2RA2A 4KUIA 2CYZB 3V7SA 2K7AA 1BU1A 1ZUKA 1OEBA 2VWFA 3LYIA 4IIMA 1RLPC 2OX7A 3TSWA 4QQDA 1VYVA 4ATOA 2NYSA 2DXUA 4E7HA 2QA4T 1VQKT 4M78B 3RKYA 2V1QA 2EQKA 1VOMA 3CC2T 2HL3A 5GAMj 3X26B 2DAQA 3QYHB 2H3JA 1M3AA 5KYUA 4IUTA 4XU1A 3C4SA 3JB9G 1WHHA 3PTAA 4FL6A 2Y4XA 5EG2A 3EH2A 3JSCA 1M8MA 1KJWA 1WXBA 1ZQ1A 1N5ZA 4J9BA 3VS3A 2M1HA 1FMVA 1T3LA 2RI2A 2FRWA 3BDUA 5CAIA 4J6XA 3G71Q 3MPUB 2YLBA 2EQUA 2QQBA 3WVEB 2QAZA 2AKLA 4DEYA 2F1LA 4C5GA 1YHQQ 2O31A 2LCCA 4C8QA 3TVTA 3X24B 2DIQA 4HVVA 3NTIA 5KYNA 2LX7A 1X6OA 4C5HA 2M02A 3EGXB 4M75A 1K9MR 2G6FX 1AZGB 2YRCA 3R6NA 2GGRA 3M0TA 2V1RA 2P84A 4LDWA 1KIKA 1UB4A 5C0MA 2K6DA 2MPXC 4BY6B 3QZ9B 1OOTA 4EIKA 3L2RA 1QCNA 1G3YA 1PG5B 4JLIA 3RDVA 4FYYB 3U23A 4PKCC 1YJWQ 1VQ9Q 1Y7XA 4DBHA 2BTTA 1VQ7T 5GMKh 1AVZC 4LDYA 2HKNA 2A7YA 2KY9A 2XKOC 3CMAA 1VQPQ 2OJ2A 1RAHB 2VXEA 4FU6A 1VQMA 2QQAA 2BZ8A 2FRYA 3L2VA 3H0HA 2X51A 5GAMe 2QGFB 1Q81U 3URGA 3CPFA 3MEVA 3BE3A 6AT1B 3QDRB 5GMKl 1A0NB 2GBQA 4F7UG 1BYMA 1K76A 3EG9B 2DJQA 1P92A 2FVUA 3JCMQ 2ZAEA 2DERA 2DZ9A 3RR6A 2XHCA 4F16A 1OULA 3RKXA 3META 3M0UA 5LJ3d 3UA7A 3CCEQ 3RBBB 1AHJB 4D6WA 3TEEA 1YP5A 5CKBA 4M75C 1TUCA 3NTHA 5KYYB 1M1KC 4ELZC 4GLKA 3RESA 3OYLA 1AZEA 3INZA 4E47A 1WPYA 3CMEA 4RKUE 2RJDA 2O4XB 2ZPIB 4DEXA 1VQ5T 1U1SA 3DB3A 2RK2A 4M7DB 2O2OA 2JOYA 1Q7YC 1IGQA 1IREB 3OBYA 4R0KA 2MMPA 5GAN4 1NPRA 1QWEA 5GMKj 2EGCA 2D9TA 1X2QA 2Y4YA 4LNPA 2LC4A 1WIEA 2F5TX 3P8BB 2FPDA 2KRNA 4II1A 3JB9F 1EIFA 2QEXA 1OPLA 2JM8A 2L0AA 1SRMA 1U3OA 5GAMg 3G4SQ 3QZ5B 1RADB 2BE7D 4PJLA 2CP0A 2CP3A 2G3RA 5I11A 5GAN7 1H8KA 5L23A 4HVWA 4XTXA 2GFUA 4BD3A 2NLUA 1TS9A 2MCNA 3J80E 3CCQT 2L2PA 1NLPC 2MAMA 4JZ4A 4PFOA 2P4TA 3E1SA 4PJOG 1K1ZA 3M9QA 4M7AF 4EMGA 3WVDB 1VQNA 4MDWA 2QI2A 4ANJA 5D6XA 3M0SA 4O5VA 2HBWA 4HT8A 2O9SA 2J6FA 3CEYA 2LCSA 1WDXA 1QVPA 2F69A 2XU8A 4MMKA 4DOWA 3PFSA 4IUPA 5EC7A 2JTMA 3FRNA 4OGCA 1RI9A 2RO0A 1UDLA 2CH4W 3CCSA 2VB6A 1ZA1B 2I0NA 3C12A 5LL6S 4PFZA 1WJRA 9ATCB 2RD1A 2VKNA 2ROTA 4OF1A 3IQLA 1T0HA 1YWOA 1OZ3A 2K3XA 5GAOr 3D7SB 2KXCA 2LNHB 1I4K1 1X6GA 2KYMA 3OYJA 4KT0E 1GXIE 3CD6Q 3GOXA 1BCOA 2DZCA 3X28B 4C0FA 4A63B 4LDVA 4ELYC 5I2SA 1ZBJA 4FSXA 4CI0C 4F7UF 2DTOA 4C92E 2KROA 3CCJT 2EYQA 2CDTA 1M1KU 4LUDA 4FT4A 2KBTA 2DPPB 1AWOA 1M3CA 4FYWB 2JMCA 1N9RA 2JZ2A 3CCVT 3L42A 2MF2A 1FMWA 3SFMA 4JRPA 2E6ZA 1D1AA 1B3QA 1BK2A 4FIBA 1C6VX 2DTHA 4P5NA 4E7KA 1Q7YU 3C94A 4BB7A 5KYUB 2CUDA 1BI0A 1B34B 1YIJA 2XD0A 1PSFA 4DBQA 4IUVA 4OB2B 3MP1A 4PNOA 3CMAQ 4OB0B 4OP0A 2KAFA 1YI2A 1VQMQ 2X4XA 4GLMA 2YLCA 4N0AA 1NE8A 3BDLA 1K73R 4ME7A 3JCMW 4OMFB 2OTLT 5GANh 5IHIA 1NM7A 1Z9QA 4MMLA 4C8QB 1QKWA 4M7AD 1B7TA 4M77C 4M75B 3RKWA 1RAEB 2L3SA 4M78E 4F04B 2RHZA 3OYIA 1O9SA 4JLGA 3OYCA 2DD4A 2F2XA 3EG9A 5GAN5 1KQ2A 1KK7A 4PJOF 1U8RA 3RNJA 4M77G 2RQUA 2WSEE 3CMEQ 4AG2C 3QJYA 1G3WA 2RJFA 4LN2A 3OS1A 4BI3A 3MP8A 1TWBA 3HRSA 1VUBA 3M59A 1H641 2YWWA 1ZSZA 2LJ1A 4X9CA 2ZPEB 1SG5A 3ER0A 3CC4A 4EMKC 2EQMA 2IPOB 2RB6A 1OYXA 4GBQA 1UJYA 2KEAA 2K3YA 3JCMf 2O4XA 4RTXA 2QEXQ 2KYBA 5KCHA 3EFSA 4JUVA 4V2SA 1OI1A 2K3BA 4N0AC 4BDZA 1PRLC 1TXQA 5I22A 5GAN2 3G71T 1PHTA 2GQIA 3LH5A 3VV0A 1NZ9A 4C0DC 5CR2A 4Z89A 2LJ0A 1YHQT 4ZN1A 1N27A 2GF7A 4Y91A 2ENMA 3VS5A 1VQNQ 2YUPA 2LT4A 4PL6A 2RHUA 1K9MC 2A28A 1JRIA 1S72A 3JRZA 2H3EB 2HNIA 3VS1A 1K8AC 1AWWA 2ROLA 4PLIA 5DLOA 2LP5A 3I56T 5D7UA 4WF2A 1X27A 2SRCA 4JJBA 3QBYA 1N8RC 1MV0B 3BW1A 1ARKA 3CQTA 4E7JA 4BI8B 5HKCA 3JB9I 3CCSQ 4AT1B 1YJWT 1VQ9T 2NUPA 2L3QA 1C0MA 1X01A 4BDYA 2V26A 1ZSZC 2COWA 2XG8D 3L1AA 3MCAB 4BI4A 1VQPT 1M3BA 3OA6A 1JJ2S 3M53A 1RLQC 2M0OA 2WACA 1RUWA 2EAYA 5IHKA 3OS0A 2EYWA 2V8IA 2QTXA 3HTRA 2HQHA 2DM1A 4OMQA 3CCRA 2X4WA 3CCLA 4J9EA 2BZXA 3KUFA 2DILA 2DYBA 2DEUA 2LTOA 4IUQA 2DO3A 1K4US 2JN0A 2QGGA 1I5OB 1UE9A 1V1CA 1AEYA 4Q5WA 4DOVA 3OMCA 1BIBA 1WHJA 3OMGA 1SF9A 2IIMA 4PJOD 4FYVB 4E6RA 5KCOA 2LX9A 4J9IA 4M7DE 3CCET 1WFWA 2DK3A 3PE0A 3M0RA 1EFNA 1PWTA 1IXDA 2HDAA 2LQKA 1WYXA 2JS2A 4J83A 4A53A 2K79A 1YBYA 5GAOm 1GCQC 1H3HA 3JB9J 4CRIA 1K9AA 1ZLMA 1YIJQ 1AWXA 1R0CB 1JBMA 3M57A 4LDUA 2ED1A 3OSSC 3P8HA 4RTYA 4M77F 1E7OA 4JJDA 4JRIA 2J6OA 1Q82C 3OYBA 1YI2Q 2RM4A 5LJ3f 2D0NA 1PC0A 4A54A 1TU0B 4RTUA 5D6YA 1AT1B 2X3XD 4F7UA 2PZ1A 1B34A 4JPBW 1GFCA 2AZSA 3QXEB 4M7AC 1RACB 3M54A 4OMOA 1WJQA 2YT6A 5CVIA 5LJ3h 2LQ8A 2FYKA 3G4ST 4AFUC 3FJ5A 2E3IA 3M58A 2QQSA 1BI3A 2ED0A 2NUTA 4F17A 2DBMA 2W10A 4J9CA 1UTIA 1NJIC 4XTYA 1XJWB 1W2BP 1K9MU 2JTEA 1W2BA 1LOJA 2I2LA 2LQNA 2RJEA 1X43A 4E7LA 8ATCB 4M7AG 2EJ9A 1JO8A 2RNAA 2FL7A 1MMGA 2D0QB 2KE9A 5GAMd 3OYMA 5FWBA 2RQRA 2C0IA 1BCMA 2O9VA 3N5BB 2EGAA 1MNEA 1YITA 2EYXA 2RHXA 2EKOA 3P8DA 2KGTA 2W0ZA 3JCMe 2OAUA 3V8JA 4EMKB 3EG0A 2LCLA 1QVGP 1D09B 1H3ZA 1M30A 1K8AR 3CCMA 1QVGA 1OX9A 1K0XA 5I21A 3RMQA 1KC8C 3CC4Q 4J8OA 4J6YA 2AIRB 3NHNA 4ZNXA 2XK0A 1N8RR 2A36A 3C95A 4C5IA 3ZEHA 1D0XA 1WHMA 4RG8A 3CXCS 2RHYA 3HSBA 3MEAA 5FLXE 7AT1B 3EHQA 3OW2S 1Q86R 3UDCA 1VQ6A 2DETA 1X69A 4C0DB 1NG2A 3AT1B 2L8DA 4LUEA 4IUUA 1IO6A 1QLYA 2QG9B 2D8JA 1R77A 1EZZB 5LJ5f 4PJOA 3CD6T 2VXFA 3L2UA 1RL2A 5LJ3j 2NWMA 1QCFA 1Y57A 3NFCA 2XICA 4JS4A 3V7CA 2HZYA 3RIRA 5KYWB 1KHCA 1S72Q 2YUQA 2NUZA 5LJ5h 1LNXA 4NS5A 1I81A 3CCUA 1UG1A 2JM9A 4RUGA 2DRMA 1JU5C 1SRLA 3SD4A 4MZPA 4M77D 2OTJA 1ZSZB 4FCYA 3HPWA 3JCMg 1Q82U 2CT3A 4KBMB 4RCBA 1G2BA 4XQ3A 3X20B 1HSQA 2O01E 3FLGA 2CKKA 4JJCA 2F5KA 3CMAT 5CQXA 3SDZA 1MGQA 4C8QE 2HCKA 2XDPA 5GMKi 1FXXA 5DY9A 1VQMT 2LVMA 3O5ZA 4PJMA 1FWZA 1K73C 4M75E 1Q82R 1ACMB 4PJNA 3OSVA 3CCRQ 3MEWA 3CCLQ 5GJWB 4OMMA 5A0LA 2Y90A 1FX7A 3ME9A 2CUBA 2ZZDA 1VYTA 2F2VA 3OYGA 3G6EA 3JCMc 4PJOC 1M2VA 4QVDA 2DLPA 2F2WA 3I55A 3GLXA 1VQLT 3KBGA 3EGDA 1SSFA 2KK4A 5FRNA 2AHJB 3BFMA 2DYIA 4RTZA 5FWCA 3I5SA 2HQXA 1NJIR 2ABLA 1NEBA 1F1BB 2COYA 4XU0A 4C0GA 5LJ5j 1S1NA 1TUDA 2PVDB 4D8DA 3EGUA 2B86A 4Y92A 3CMET 3Q1JA 2BUDA 1PD0A 2NUPB 3THKA 1KC8U 2RJCA 1ZSGA 1UHFA 2J7IA 1VYUA 1D1CA 3VS6A 2VASA 1MMNA 2JW4A 1D3BA 3JCMX 4M7AB 4J9GA 3H41A 4KRTA 1BIAA 1KC8R 4KULA 1OZ2A 3A5ZB 4J9DA 2VGMA 3JAME 2QEXT 3E19A 2KRSA 1SEMA 1D0ZA 3VS4A 3TSZA 2EYZA 1YJ9A 1KG1A 1ZUYA 4L6V5 2PUOB 5DLQE 5CKDA 4JS5A 2E5KA 5HK3A 4FSSA 3MP6A 2IVWA 4QW2A 1BI2A 4J7FA 1WXTA 4AG1C 4EDUA 2HSEB 2ZCFB 5GMKe 4MDXA 4M77A 1VQNT 1SPKA
chains in the Genus database with same CATH topology
2RQVA 4RTXA 2P4RA 2KYBA 3KFVA 2K3BA 1GBQA 1PRLC 1PRMC 2DMOA 2LMJA 3NPFA 3SHWA 3H0FA 2V1QA 5I22A 1PHTA 1VA7A 2GQIA 3LH5A 1MV3A 3TSWA 1M3AA 4Z89A 2LJ0A 4RTTA 4OMPA 4AFSC 2XMFA 2ENMA 3VS5A 2YUPA 1UECA 4ORZA 1M8MA 2A28A 1KJWA 1WXBA 1PKSA 1AOJA 1N5ZA 4J9BA 1E6GA 3VS3A 1GCPA 3VS1A 2LZ6B 2KRMA 1T3LA 1UUEA 1YWPA 4OMLA 2ROLA 2FRWA 3EG3A 1AWWA 2LP5A 1Y0MA 1FYNA 3UATA 1X27A 2FPFA 1X2KA 2SRCA 2GTOA 4JJBA 2AKLA 4DEYA 1MV0B 4AFZC 1ARKA 3CQTA 2O31A 3TVTA 3NMZC 2L3QA 4HVVA 3VRZA 2OAWA 2LX7A 4HXJA 2RF0A 3VS7A 1H92A 2G6FX 1AZGB 3R6NA 1M3BA 2DE0X 1NEGA 2GGRA 3EHRA 3M0TA 2V1RA 1RLQC 2M0YA 1RUWA 1WXUA 5IHKA 3VS2A 1KIKA 2FO0A 1UJ0A 2EYWA 2KXDA 2K6DA 2EVRA 1NYGA 3REBB 2DM1A 4OMQA 1OOTA 4EIKA 2C0OA 2AK5A 2JMAA 2BZXA 4J9EA 3U23A 4CC2A 2A08A 2DILA 2DYBA 2EW3A 2L3PA 1K4US 2DBKA 2BTTA 1PNJA 4X1VA 1UE9A 1AVZC 1V1CA 1AEYA 2KNBB 1W6XA 1FMKA 2OJ2A 1BB9A 2IIMA 2AZVA 2FG0A 4E6RA 4J9IA 2BZ8A 2ESWA 2FRYA 1U5SA 2HEQA 1WFWA 3H0HA 4CC7A 3PE0A 3M0RA 1EFNA 1PWTA 1HJDA 2HDAA 1WYXA 2JS2A 2DL5A 2K79A 1I1JA 3M0PA 5ECAA 1A0NB 2GBQA 1H3HA 1GCQC 1K76A 2DJQA 1K9AA 1ZLMA 2DVJA 1AWXA 2JXBA 1JQQA 2ED1A 1GFDA 2QDLA 1UHCA 4RTYA 4RTVA 4OMNA 3I5RA 1E7OA 4JJDA 4F16A 1WI7A 3M0UA 4RTWA 2J6OA 3UA7A 2O88A 5HCKA 1UFFA 3RBBB 1I07A 2K2MA 2D0NA 1MUZA 1YP5A 5IHNA 2FPEA 4RTUA 1TUCA 2X3XD 2FEIA 2JT4A 4Z8AA 2PZ1A 3H0IA 2D1XA 4JPBW 1GFCA 3REAB 3EG2A 2AZSA 2CSQA 2X3WD 1KSWA 1AZEA 1GRIA 3M0QA 3UA6A 4OMOA 2YT6A 1X6BA 4HCKA 4DEXA 4AFUC 3FJ5A 2O2OA 1M27C 2ED0A 2EKHA 4F17A 2DBMA 2AKKA 3NGPA 2W10A 4J9CA 4M4ZA 3EG1A 1UTIA 1GCQA 1ZUUA 4R0KA 2JTEA 1QWEA 1OPKA 3ULRB 2LQNA 2EGCA 1X43A 1ZX6A 1X2QA 4LNPA 1JO8A 1WIEA 2RNAA 2RMOA 2FPDA 2KRNA 2KE9A 5FWBA 2RQRA 3C0CA 2L0AA 1OPLA 2JM8A 1SRMA 2C0IA 2MIOA 1U3OA 2HSPA 1U06A 2YUOA 2BZYA 2O9VA 1Z9ZA 2EGAA 5I11A 2EYXA 1H8KA 2KGTA 2W0ZA 5L23A 5GJVB 3EG0A 2EPDA 4HVWA 1I0CA 1M30A 2MCNA 1K0XA 4AFQC 2L2PA 1NLPC 4JZ4A 1WLPB 3SEMA 2CSIA 1PKTA 1K1ZA 2H8HA 3NHNA 4ZNXA 4J9FA 2A36A 1NLOC 4LE9A 1LCKA 2CH4A 3M0SA 2HBWA 2O9SA 1JEGA 2J6FA 1CKAA 2KT8A 2LCSA 2PNIA 1WDXA 3EHQA 1GBRA 2DNUA 2A37A 1X69A 5EC7A 1NG2A 1WX6A 4LUEA 1IO6A 1QLYA 2D8JA 1RI9A 1UDLA 1T0JA 4CC3A 2CH4W 2LQWA 2PTKA 2NWMA 1QCFA 1Y57A 1J3TA 2I0NA 4JZ3A 2GTJA 1YCSB 2JS0A 1QKXA 1GL5A 2VKNA 2YUQA 2NUZA 2ROTA 4CC4B 3IQLA 1T0HA 1YWOA 1SHFA 1BBZA 2J05A 4K11A 1SHGA 1UG1A 2JM9A 1XOVA 2D8HA 4RUGA 2DRMA 2M51A 2KXCA 2LNHB 1JU5C 1SRLA 1X6GA 2KYMA 2ECZA 2RN8A 1G83A 4A63B 3PVLA 2DRKA 2K9GA 1SSHA 1ZBJA 2CT3A 4F14A 2J06A 2RQWA 2LJ3A 1G2BA 2DL3A 1HSQA 4HVUA 2KROA 2GNCA 3VRYA 4JJCA 2CDTA 2DL4A 2RQTA 1T3SA 1W1FA 4LUDA 5IXBA 2KBTA 2YUNA 2DX1A 1AWOA 1M3CA 2HCKA 2JMCA 1JXOA 3O5ZA 3ZL7C 1OV3A 1B3QA 1BK2A 5IXFA 5GJWB 4OMMA 3QWYA 2MOXA 2CUBA 3I9QA 1VYTA 1YN8A 2CUDA 2F2VA 3I35A 1AWJA 2VVKA 2DLPA 2F2WA 1ABQA 2DL7A 4QT7A 4RTZA 5FWCA 2YDLA 3PVQA 4GLMA 2KR3A 3I5SA 2OI3A 2EQIA 4D8KA 2RPNA 2ABLA 3JV3A 3QWXX 1NEBA 1E6HA 1WA7A 5IHIA 1NM7A 1S1NA 1TUDA 1Z9QA 1QWFA 4D8DA 4IIOA 3EGUA 2CT4A 2B86A 3GBQA 4Y92A 3THKA 1CKBA 1QKWA 2C0TA 1W70A 1JXMA 1KFZA 1YNZA 1ZSGA 5FW9A 1UHFA 1HD3A 2J7IA 2L3SA 1VYUA 1NYFA 3VS6A 2JW4A 3VS0A 1ABOA 4J9GA 2F2XA 3H41A 4KRTA 3A98A 4J9HA 4Z88A 2DF6A 2CREA 2EGEA 2SEMA 1CSKA 5IH2A 4J9DA 3RNJA 2RQUA 2KRSA 4AG2C 1SEMA 3VS4A 3TSZA 4WCIA 2YSQA 4LN2A 1K0SA 2EYZA 4ESRA 1ZUYA 1AD5A 2EYYA 1B07A 1UGVA 1TG0A 3UF4A 2E5KA 2LJ1A 4FSSA 2EBPA 2DL8A 2J6KA 2K7AA 1BU1A 1ZUKA 4GBQA 4AG1C 1WXTA 1OEBA 1UJYA 2VWFA 2KEAA 4IIMA 1SPKA 1RLPC 2KT1A 1VYVA 2DA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQV A;  4RTX A;  2P4R A;  2KYB A;  3KFV A;  2K3B A;  1GBQ A;  1PRL C;  1PRM C;  2DMO A;  2LMJ A;  3NPF A;  3SHW A;  3H0F A;  2V1Q A;  5I22 A;  1PHT A;  1VA7 A;  2GQI A;  3LH5 A;  1MV3 A;  3TSW A;  1M3A A;  4Z89 A;  2LJ0 A;  4RTT A;  4OMP A;  4AFS C;  2XMF A;  2ENM A;  3VS5 A;  2YUP A;  1UEC A;  4ORZ A;  1M8M A;  2A28 A;  1KJW A;  1WXB A;  1PKS A;  1AOJ A;  1N5Z A;  4J9B A;  1E6G A;  3VS3 A;  1GCP A;  3VS1 A;  2LZ6 B;  2KRM A;  1T3L A;  1UUE A;  1YWP A;  4OML A;  2ROL A;  2FRW A;  3EG3 A;  1AWW A;  2LP5 A;  1Y0M A;  1FYN A;  3UAT A;  1X27 A;  2FPF A;  1X2K A;  2SRC A;  2GTO A;  4JJB A;  2AKL A;  4DEY A;  1MV0 B;  4AFZ C;  1ARK A;  3CQT A;  2O31 A;  3TVT A;  3NMZ C;  2L3Q A;  4HVV A;  3VRZ A;  2OAW A;  2LX7 A;  4HXJ A;  2RF0 A;  3VS7 A;  1H92 A;  2G6F X;  1AZG B;  3R6N A;  1M3B A;  2DE0 X;  1NEG A;  2GGR A;  3EHR A;  3M0T A;  2V1R A;  1RLQ C;  2M0Y A;  1RUW A;  1WXU A;  5IHK A;  3VS2 A;  1KIK A;  2FO0 A;  1UJ0 A;  2EYW A;  2KXD A;  2K6D A;  2EVR A;  1NYG A;  3REB B;  2DM1 A;  4OMQ A;  1OOT A;  4EIK A;  2C0O A;  2AK5 A;  2JMA A;  2BZX A;  4J9E A;  3U23 A;  4CC2 A;  2A08 A;  2DIL A;  2DYB A;  2EW3 A;  2L3P A;  1K4U S;  2DBK A;  2BTT A;  1PNJ A;  4X1V A;  1UE9 A;  1AVZ C;  1V1C A;  1AEY A;  2KNB B;  1W6X A;  1FMK A;  2OJ2 A;  1BB9 A;  2IIM A;  2AZV A;  2FG0 A;  4E6R A;  4J9I A;  2BZ8 A;  2ESW A;  2FRY A;  1U5S A;  2HEQ A;  1WFW A;  3H0H A;  4CC7 A;  3PE0 A;  3M0R A;  1EFN A;  1PWT A;  1HJD A;  2HDA A;  1WYX A;  2JS2 A;  2DL5 A;  2K79 A;  1I1J A;  3M0P A;  5ECA A;  1A0N B;  2GBQ A;  1H3H A;  1GCQ C;  1K76 A;  2DJQ A;  1K9A A;  1ZLM A;  2DVJ A;  1AWX A;  2JXB A;  1JQQ A;  2ED1 A;  1GFD A;  2QDL A;  1UHC A;  4RTY A;  4RTV A;  4OMN A;  3I5R A;  1E7O A;  4JJD A;  4F16 A;  1WI7 A;  3M0U A;  4RTW A;  2J6O A;  3UA7 A;  2O88 A;  5HCK A;  1UFF A;  3RBB B;  1I07 A;  2K2M A;  2D0N A;  1MUZ A;  1YP5 A;  5IHN A;  2FPE A;  4RTU A;  1TUC A;  2X3X D;  2FEI A;  2JT4 A;  4Z8A A;  2PZ1 A;  3H0I A;  2D1X A;  4JPB W;  1GFC A;  3REA B;  3EG2 A;  2AZS A;  2CSQ A;  2X3W D;  1KSW A;  1AZE A;  1GRI A;  3M0Q A;  3UA6 A;  4OMO A;  2YT6 A;  1X6B A;  4HCK A;  4DEX A;  4AFU C;  3FJ5 A;  2O2O A;  1M27 C;  2ED0 A;  2EKH A;  4F17 A;  2DBM A;  2AKK A;  3NGP A;  2W10 A;  4J9C A;  4M4Z A;  3EG1 A;  1UTI A;  1GCQ A;  1ZUU A;  4R0K A;  2JTE A;  1QWE A;  1OPK A;  3ULR B;  2LQN A;  2EGC A;  1X43 A;  1ZX6 A;  1X2Q A;  4LNP A;  1JO8 A;  1WIE A;  2RNA A;  2RMO A;  2FPD A;  2KRN A;  2KE9 A;  5FWB A;  2RQR A;  3C0C A;  2L0A A;  1OPL A;  2JM8 A;  1SRM A;  2C0I A;  2MIO A;  1U3O A;  2HSP A;  1U06 A;  2YUO A;  2BZY A;  2O9V A;  1Z9Z A;  2EGA A;  5I11 A;  2EYX A;  1H8K A;  2KGT A;  2W0Z A;  5L23 A;  5GJV B;  3EG0 A;  2EPD A;  4HVW A;  1I0C A;  1M30 A;  2MCN A;  1K0X A;  4AFQ C;  2L2P A;  1NLP C;  4JZ4 A;  1WLP B;  3SEM A;  2CSI A;  1PKT A;  1K1Z A;  2H8H A;  3NHN A;  4ZNX A;  4J9F A;  2A36 A;  1NLO C;  4LE9 A;  1LCK A;  2CH4 A;  3M0S A;  2HBW A;  2O9S A;  1JEG A;  2J6F A;  1CKA A;  2KT8 A;  2LCS A;  2PNI A;  1WDX A;  3EHQ A;  1GBR A;  2DNU A;  2A37 A;  1X69 A;  5EC7 A;  1NG2 A;  1WX6 A;  4LUE A;  1IO6 A;  1QLY A;  2D8J A;  1RI9 A;  1UDL A;  1T0J A;  4CC3 A;  2CH4 W;  2LQW A;  2PTK A;  2NWM A;  1QCF A;  1Y57 A;  1J3T A;  2I0N A;  4JZ3 A;  2GTJ A;  1YCS B;  2JS0 A;  1QKX A;  1GL5 A;  2VKN A;  2YUQ A;  2NUZ A;  2ROT A;  4CC4 B;  3IQL A;  1T0H A;  1YWO A;  1SHF A;  1BBZ A;  2J05 A;  4K11 A;  1SHG A;  1UG1 A;  2JM9 A;  1XOV A;  2D8H A;  4RUG A;  2DRM A;  2M51 A;  2KXC A;  2LNH B;  1JU5 C;  1SRL A;  1X6G A;  2KYM A;  2ECZ A;  2RN8 A;  1G83 A;  4A63 B;  3PVL A;  2DRK A;  2K9G A;  1SSH A;  1ZBJ A;  2CT3 A;  4F14 A;  2J06 A;  2RQW A;  2LJ3 A;  1G2B A;  2DL3 A;  1HSQ A;  4HVU A;  2KRO A;  2GNC A;  3VRY A;  4JJC A;  2CDT A;  2DL4 A;  2RQT A;  1T3S A;  1W1F A;  4LUD A;  5IXB A;  2KBT A;  2YUN A;  2DX1 A;  1AWO A;  1M3C A;  2HCK A;  2JMC A;  1JXO A;  3O5Z A;  3ZL7 C;  1OV3 A;  1B3Q A;  1BK2 A;  5IXF A;  5GJW B;  4OMM A;  3QWY A;  2MOX A;  2CUB A;  3I9Q A;  1VYT A;  1YN8 A;  2CUD A;  2F2V A;  3I35 A;  1AWJ A;  2VVK A;  2DLP A;  2F2W A;  1ABQ A;  2DL7 A;  4QT7 A;  4RTZ A;  5FWC A;  2YDL A;  3PVQ A;  4GLM A;  2KR3 A;  3I5S A;  2OI3 A;  2EQI A;  4D8K A;  2RPN A;  2ABL A;  3JV3 A;  3QWX X;  1NEB A;  1E6H A;  1WA7 A;  5IHI A;  1NM7 A;  1S1N A;  1TUD A;  1Z9Q A;  1QWF A;  4D8D A;  4IIO A;  3EGU A;  2CT4 A;  2B86 A;  3GBQ A;  4Y92 A;  3THK A;  1CKB A;  1QKW A;  2C0T A;  1W70 A;  1JXM A;  1KFZ A;  1YNZ A;  1ZSG A;  5FW9 A;  1UHF A;  1HD3 A;  2J7I A;  2L3S A;  1VYU A;  1NYF A;  3VS6 A;  2JW4 A;  3VS0 A;  1ABO A;  4J9G A;  2F2X A;  3H41 A;  4KRT A;  3A98 A;  4J9H A;  4Z88 A;  2DF6 A;  2CRE A;  2EGE A;  2SEM A;  1CSK A;  5IH2 A;  4J9D A;  3RNJ A;  2RQU A;  2KRS A;  4AG2 C;  1SEM A;  3VS4 A;  3TSZ A;  4WCI A;  2YSQ A;  4LN2 A;  1K0S A;  2EYZ A;  4ESR A;  1ZUY A;  1AD5 A;  2EYY A;  1B07 A;  1UGV A;  1TG0 A;  3UF4 A;  2E5K A;  2LJ1 A;  4FSS A;  2EBP A;  2DL8 A;  2J6K A;  2K7A A;  1BU1 A;  1ZUK A;  4GBQ A;  4AG1 C;  1WXT A;  1OEB A;  1UJY A;  2VWF A;  2KEA A;  4IIM A;  1SPK A;  1RLP C;  2KT1 A;  1VYV A;  2DA9 A; 
#chains in the Genus database with same CATH topology
 2P4R A;  3KFV A;  4KH1 B;  3GNF B;  1IRX A;  3OYA A;  5IT9 E;  3NPF A;  5GAN 6;  1YIT Q;  3FB9 A;  4HKE A;  2RHI A;  5HY6 A;  1G8X A;  1D0Y A;  2HD0 A;  1WNL A;  1RAA B;  1MV3 A;  2EJF A;  3CCM Q;  3NTK A;  4RTT A;  1OX8 A;  4C92 G;  2L3R A;  4OMP A;  3CCS T;  2DXT A;  3S3M A;  2XMF A;  1RI0 A;  2DXC A;  4FW2 A;  1UEC A;  3OYK A;  3CBP A;  3TQ7 P;  4F7U B;  4ORZ A;  1VQ8 A;  3SWN C;  3PMT A;  1PKS A;  1JJ2 A;  1K73 U;  1E6G A;  4XU3 A;  2LZ6 B;  1YWP A;  4EMK A;  3EG3 A;  3MJX A;  5GAN f;  1FYN A;  2VUB A;  1BKB A;  2QK0 A;  1VQ6 Q;  4XTZ A;  1NPP A;  2FPF A;  4GY5 A;  4DA4 A;  2NUT B;  2KSS A;  2E4H A;  5FU6 C;  3FIF A;  1VQO A;  1D1B A;  3NMZ C;  5CIU A;  2ZGW A;  3VRZ A;  2DTI A;  1QVF S;  5CKE A;  3QUI A;  4E7I A;  3VS7 A;  1H92 A;  1NEG A;  2IG0 A;  3EHR A;  4PFP A;  2M0Y A;  1YJN A;  1WXU A;  3VS2 A;  1UGS B;  3CCU Q;  2FO0 A;  1UJ0 A;  4LD9 K;  2P0K A;  2KXD A;  2WSF E;  1NYG A;  3REB B;  2MWP A;  2C0O A;  2AK5 A;  1WQ7 A;  2JMA A;  3M55 A;  2OTJ Q;  2MK5 A;  4N4G A;  4TVR A;  2EW3 A;  2L3P A;  1MHN A;  5GAN 8;  1MMA A;  2DBK A;  5AT1 B;  5KYW A;  2YRV A;  1PNJ A;  4X1V A;  3JCM b;  2ZPB B;  1YIJ T;  1LPL A;  2CP7 A;  1FMK A;  3OQ5 A;  4M78 G;  3GIB A;  1N9S A;  5C6S A;  4QKU A;  3PMI A;  5KYX A;  4M77 E;  2K5L A;  1IGU A;  2K4Y A;  1PD1 A;  2FG0 A;  5AYF A;  5I2M A;  4C0Z A;  2ESW A;  1YI2 T;  4DBF A;  1ZHI A;  1YHQ A;  1HJD A;  2E64 A;  1XNI A;  2K2V A;  2DL5 A;  2DKG A;  3M0P A;  4PJO B;  5L8R E;  3GF5 A;  5J26 A;  2JXB A;  2X4Y A;  3G6E Q;  1JQQ A;  1IB8 A;  1GFD A;  1M5Q 1;  1UHC A;  2QDL A;  3UWN A;  1LVK A;  3I56 A;  3I55 Q;  4PLL A;  2C06 A;  1VQ4 A;  3GP8 A;  4OMN A;  4QQG A;  4HT9 A;  1C1A A;  1HK9 A;  1WI7 A;  2X4J A;  1UFF A;  1I07 A;  1Y96 A;  1RAB B;  2K2M A;  4FYX B;  3VU3 C;  5IHN A;  2FPE A;  1MMD A;  3EH1 A;  3TCJ A;  5GAN j;  2GFA A;  1M90 C;  3VUZ A;  1MND A;  2CSQ A;  2X3W D;  3CC7 A;  4JRQ A;  3M0Q A;  3UA6 A;  1WHG A;  3QHS A;  3V8L A;  3OY9 A;  1X6B A;  3X25 B;  3OYN A;  1ZBX A;  4KUD K;  2EKH A;  1RAG B;  2AKK A;  3EG1 A;  3A8H B;  1GCQ A;  1ZUU A;  2P0Q A;  4MZM A;  5A0G A;  4HCB A;  1ZX6 A;  3CC4 T;  3OYH A;  2JTF A;  5M9O A;  2CP5 A;  4J5Y A;  4FW1 A;  3CXC P;  1LJO A;  4C92 F;  3CXC A;  2CGH A;  2CZ0 B;  2CZ6 B;  3OW2 P;  4X9D A;  2YUO A;  2BZY A;  2E65 A;  3OW2 A;  1Q86 C;  1OU8 A;  2A0F B;  1YJ9 Q;  1M2V B;  3SB2 A;  2EQJ A;  2EPD A;  4JRK A;  3EGD B;  3MHX A;  4E7Z A;  4M7A A;  4AFQ C;  2L89 A;  2COZ A;  1WLP B;  5GAM h;  3QII A;  1PKT A;  3VYG A;  2PVG B;  4A4G A;  3ZBD A;  3VYH B;  1YFN A;  1EX4 A;  1NLO C;  2RI3 A;  4LE9 A;  1M2O A;  2PUK B;  5A2Q E;  5KH6 A;  2QA4 A;  1VQK A;  4N4H A;  1S72 T;  2EWN A;  1CKA A;  4ZTF A;  2KT8 A;  4BAC A;  3T9N A;  2PNI A;  3CC2 A;  4IKF A;  2A37 A;  1O75 A;  4BE1 A;  4Z02 A;  2AT1 B;  2HAX A;  1T0J A;  3MEU A;  4VUB A;  5GAN e;  3F70 A;  3SWN B;  3BY7 A;  3L2Q A;  2ZPG B;  5IAY A;  1PSE A;  4QVZ A;  1D3B B;  2JS0 A;  1QKX A;  1VQ8 Q;  4MZT A;  1GL5 A;  4M7D G;  4CC4 B;  2XDD A;  5J3B A;  1R8O B;  4M78 F;  1SHF A;  2K5F A;  2J05 A;  4K11 A;  1XOV A;  2D8H A;  2FZG B;  1IZ6 A;  1IHV A;  5CQY A;  3M4G A;  2M16 A;  3UT1 A;  3CBO A;  2RN8 A;  5GAO p;  3CCR T;  4C5E A;  3CCL T;  3JCM d;  1VQO Q;  3PVL A;  2DRK A;  2K9G A;  4ZGD B;  2QXF A;  2DXB A;  3FEO A;  3H9N A;  4F14 A;  4E7S A;  4A4F A;  2CZ7 B;  2DL3 A;  5KE2 A;  4M77 B;  2DL4 A;  1T3S A;  1W1F A;  5IXB A;  2EJG A;  1G3S A;  1M90 U;  1YJN Q;  1JXO A;  5GAO l;  2EIF A;  2E10 A;  5IXF A;  3VKI A;  5CCA A;  2XID A;  3QWY A;  1WQW A;  3LW5 E;  4L59 A;  2E70 A;  3I9Q A;  1VQ7 A;  1YN8 A;  2GQV A;  3HKS A;  3LH0 A;  1K8A U;  1AWJ A;  2BIV A;  4M7A E;  1KQS S;  1M90 R;  3EFO A;  1N8R U;  1ABQ A;  2YHT A;  5GAN g;  4NL3 A;  4C92 D;  1TTH B;  4XU2 A;  3QYG B;  3CD6 A;  1QW1 A;  2YDL A;  5FRO A;  2KR3 A;  2MI6 A;  2EQI A;  4D8K A;  1Q86 U;  2E1H A;  3QWX X;  1E6H A;  1WA7 A;  2E12 A;  1QWF A;  1TH7 A;  2P0P A;  3G7Z A;  2CP2 A;  1UGP B;  4NL2 A;  1KD1 C;  1WJS A;  5GMK m;  3I56 Q;  1G3T A;  1VQ4 Q;  1KFZ A;  1YNZ A;  2LRQ A;  4Y28 E;  1UGQ B;  4ZGJ B;  5FW9 A;  1NYF A;  1HXD A;  5FU7 C;  3OS2 A;  2L5Q A;  2JUF A;  4R55 A;  1SKU B;  4UC4 A;  4J9H A;  4LXC A;  2E6N A;  3HRU A;  4Z88 A;  1QP2 A;  3HL8 A;  3CC7 Q;  2CRE A;  1CSK A;  5IH2 A;  4BE0 A;  3A8O B;  1VQ5 A;  3OB9 A;  3LWH A;  3R6O A;  2A3L A;  4WCI A;  2YSQ A;  4F7U E;  1K0S A;  3LGF A;  5GAO q;  1G5V A;  1N6A A;  1YIT T;  3LWI A;  3RUX A;  5KYX B;  4DBR A;  2EBP A;  4EPC A;  2DL8 A;  3OYD A;  3CCM T;  2R5A A;  3OYE A;  3HFO A;  3CPW S;  2J6K A;  4NOY A;  4M78 D;  3QDF A;  5CKH A;  3I35 A;  2KT1 A;  2DA9 A;  1VQL A;  2RQV A;  2LT1 A;  1VIE A;  1QCO A;  2VV5 A;  2E41 A;  1Q81 R;  1W4S A;  3L2W A;  1GBQ A;  4RMO A;  1DJ7 B;  1PRM C;  2BKD N;  2DMO A;  2LMJ A;  4AMC A;  1V76 A;  3SHW A;  4C8Q C;  4M7D F;  2CP6 A;  3A8L B;  3H0F A;  3QO3 A;  1VA7 A;  2HL5 C;  1VQ6 T;  3CCQ A;  2KVQ G;  1M4Z A;  3FDR A;  5A0D A;  1Y96 B;  2ATC B;  1QVF P;  4AFS C;  4J7I A;  1QVF A;  3E9F A;  4C8Q G;  3J81 E;  2KI7 A;  1AOJ A;  1NJI U;  2FZK B;  1GCP A;  2QA4 Q;  3O8V A;  1VQK Q;  5HK0 A;  3ASK A;  2KRM A;  1UUE A;  4OML A;  4M75 G;  1M1G A;  1Y0M A;  2JNG A;  2HBP A;  3UAT A;  4QVC A;  4N4I A;  3CC2 Q;  3CCU T;  1X2K A;  2GTO A;  2B8A A;  4AFZ C;  4C92 A;  3FC3 A;  1WGS A;  2OTJ T;  3GNG A;  1RAI B;  2R5M A;  2FHD A;  5LJ3 e;  3OBW A;  2OAW A;  2CZ1 B;  4BUG A;  4PJO E;  2VC8 A;  2DVE A;  4HXJ A;  2DIG A;  2RF0 A;  1M1F A;  2BE9 B;  3LX7 A;  2DE0 X;  3S3N A;  1UGR B;  1KQ1 A;  3HFN A;  2KDS A;  1X75 C;  2EVR A;  2ZPH B;  4YTL A;  3QKJ A;  4B9X A;  3SWN A;  1W2B S;  3TU4 K;  4L5G A;  1KD1 U;  3ZFJ A;  4CC2 A;  3QG1 A;  2A08 A;  1KHI A;  3CCJ A;  2KNB B;  1W6X A;  3G6E T;  3UPU A;  2HKQ B;  1QMC A;  4XTV A;  3I55 T;  1BB9 A;  1OU9 A;  2AZV A;  1V29 B;  4IUR A;  3CCV A;  5LJ5 d;  3OYF A;  3M5A A;  4JDS A;  1KD1 R;  3QPH A;  1U1T A;  2YRD A;  1U5S A;  2K5I A;  2HEQ A;  4FM4 B;  2VGN A;  4CC7 A;  3PIP A;  1QVG S;  1I8F A;  2HMA A;  2VYT A;  3S3O A;  3RER A;  3RMS A;  1I1J A;  5ECA A;  3A8M B;  3S6W A;  1VQ7 Q;  5CO7 A;  2FZC B;  2DVJ A;  2EFI A;  4M78 A;  4ZN3 A;  5FRM A;  4PK4 A;  4C92 C;  3DLM A;  3GPL A;  4RTV A;  3A8G B;  2V8K A;  2LNV A;  3I5R A;  3EAE A;  4RTW A;  1WHK A;  3DKM A;  2O88 A;  5HCK A;  5GAN 3;  5LJ3 g;  3FJP A;  1MUZ A;  2E3H A;  1JB0 E;  1TOV A;  2FEI A;  2OTL A;  2JT4 A;  4M7D D;  4Z8A A;  4PJJ A;  3H0I A;  3M4Y A;  2D1X A;  3M56 A;  3REA B;  3EG2 A;  1KSW A;  1GRI A;  5LJ5 e;  1JJ2 P;  4HCK A;  2XDB A;  3VUB A;  1M27 C;  1YJ9 T;  3NGP A;  3EFR A;  5FU7 B;  4M4Z A;  4XAX B;  1VIF A;  4OGE A;  3E9G A;  2E5Q A;  2M9U A;  4B9W A;  1OPK A;  3ULR B;  2QQ9 A;  1M1K R;  3EGX A;  2RI5 A;  3LGL A;  2RMO A;  1ZA2 B;  3C0C A;  2MIO A;  2HSP A;  1U06 A;  1VQ5 Q;  1Z9Z A;  1HYO A;  4C8Q F;  2R58 A;  5KE3 A;  3JB9 D;  4KGV B;  3EFO B;  3MO8 A;  4LD6 A;  5GJV B;  4M75 F;  1Q7Y R;  1I0C A;  4M78 C;  2DEQ A;  3PIO A;  3SEM A;  3JB9 H;  2CSI A;  4XTU A;  3KXT A;  2H8H A;  2YXY A;  1BI1 A;  5IN1 A;  4J9F A;  2X35 A;  1LCK A;  2CH4 A;  4OB3 B;  1VQL Q;  4ZGE B;  1VQ8 T;  1JEG A;  3L2Z A;  2LDM A;  3TRE A;  1UEB A;  3HHT B;  3G71 A;  1GBR A;  2DNU A;  2QAS A;  2QQR A;  1WX6 A;  3CCQ Q;  3J7A F;  4X34 A;  3OYY A;  3PT9 A;  4WTO B;  5LJ5 g;  5GAO n;  4ZTJ A;  2RK1 A;  4CC3 A;  2LQW A;  2PTK A;  2XI9 A;  1VQO T;  1J3T A;  3HP9 A;  4JZ3 A;  5CK9 A;  2GTJ A;  1WHL A;  4QQ6 A;  1YCS B;  3MKD A;  4XK8 E;  3DLL A;  2KQW A;  1Q95 G;  1I5L A;  4LDX A;  2GCX A;  1YJN T;  1BBZ A;  1SHG A;  5KYY A;  4O6J A;  1PM3 A;  2KMT A;  2M51 A;  2DFU A;  2DJZ A;  3JCM V;  4DQ2 A;  4KH0 B;  2ECZ A;  4BE2 A;  2ZPF B;  1G83 A;  1YJW A;  3QSU A;  1VQ9 A;  4BY6 C;  1KQS P;  3PGG A;  4KGX B;  1SSH A;  1KQS A;  2JJ9 A;  2FB7 A;  4M7D A;  2J06 A;  2RQW A;  4E2F B;  2LJ3 A;  3AHU A;  4JJN K;  3OS5 A;  2QYZ A;  1VQP A;  4HVU A;  3VJP A;  2GNC A;  3VRY A;  3V7R A;  2RQT A;  4KGZ B;  4HCC A;  2YUN A;  1PCX A;  2DX1 A;  2PU9 B;  3HRT A;  3LLR A;  4A4K A;  1TUG B;  1QQJ A;  3JCM h;  3ZL7 C;  4J6W A;  1OV3 A;  4RG2 A;  2WSC E;  2RH2 A;  1R0B G;  4R56 A;  8AT1 B;  1YCY A;  2JVV A;  2MOX A;  3JCM P;  2VVK A;  4HA8 A;  3CCJ Q;  5GAN d;  5GAM f;  1WZO A;  1VQ4 T;  2DL7 A;  2MYS A;  3CCV Q;  4QT7 A;  3CCE A;  5D6W A;  3PNW C;  5DM7 R;  4EMH A;  3PVQ A;  1XTD A;  2R57 A;  2QTV A;  1QP3 A;  3A1P A;  2OI3 A;  4C8Q D;  2QDY B;  2RPN A;  2CS7 A;  3JV3 A;  4RCC A;  1XQH A;  4C92 B;  2MWO A;  4M75 D;  3WXM B;  3CBM A;  5J39 A;  4IIO A;  5CKF A;  3CC7 T;  2D6F A;  1OQK A;  2CT4 A;  4HCZ A;  3V8K A;  3GBQ A;  2PVO B;  1CKB A;  4OB1 B;  2DD5 A;  1TSF A;  2C0T A;  1W70 A;  1JXM A;  4B6M A;  1IHW A;  1Y71 A;  4FT2 A;  1HD3 A;  3CPW P;  4M7D C;  2X9H A;  3CPW A;  3VS0 A;  3E2U A;  1ABO A;  3H8Z A;  2K57 A;  1RAF B;  3QJ6 A;  2OTL Q;  4XTW A;  3A98 A;  4OVA A;  2HQE A;  4A4E A;  2V8J A;  1M9S A;  3H6Z A;  3DB4 A;  2DF6 A;  2EGE A;  2SEM A;  1Q81 C;  3G4S A;  2PQW A;  1M8V A;  2Z0W A;  4ESR A;  4A4H A;  3JCM J;  1AD5 A;  2EYY A;  1B07 A;  1UGV A;  1TG0 A;  5FU6 B;  1NBE B;  3UF4 A;  1Y07 A;  3G1J A;  2RA2 A;  4KUI A;  2CYZ B;  3V7S A;  2K7A A;  1BU1 A;  1ZUK A;  1OEB A;  2VWF A;  3LYI A;  4IIM A;  1RLP C;  2OX7 A;  3TSW A;  4QQD A;  1VYV A;  4ATO A;  2NYS A;  2DXU A;  4E7H A;  2QA4 T;  1VQK T;  4M78 B;  3RKY A;  2V1Q A;  2EQK A;  1VOM A;  3CC2 T;  2HL3 A;  5GAM j;  3X26 B;  2DAQ A;  3QYH B;  2H3J A;  1M3A A;  5KYU A;  4IUT A;  4XU1 A;  3C4S A;  3JB9 G;  1WHH A;  3PTA A;  4FL6 A;  2Y4X A;  5EG2 A;  3EH2 A;  3JSC A;  1M8M A;  1KJW A;  1WXB A;  1ZQ1 A;  1N5Z A;  4J9B A;  3VS3 A;  2M1H A;  1FMV A;  1T3L A;  2RI2 A;  2FRW A;  3BDU A;  5CAI A;  4J6X A;  3G71 Q;  3MPU B;  2YLB A;  2EQU A;  2QQB A;  3WVE B;  2QAZ A;  2AKL A;  4DEY A;  2F1L A;  4C5G A;  1YHQ Q;  2O31 A;  2LCC A;  4C8Q A;  3TVT A;  3X24 B;  2DIQ A;  4HVV A;  3NTI A;  5KYN A;  2LX7 A;  1X6O A;  4C5H A;  2M02 A;  3EGX B;  4M75 A;  1K9M R;  2G6F X;  1AZG B;  2YRC A;  3R6N A;  2GGR A;  3M0T A;  2V1R A;  2P84 A;  4LDW A;  1KIK A;  1UB4 A;  5C0M A;  2K6D A;  2MPX C;  4BY6 B;  3QZ9 B;  1OOT A;  4EIK A;  3L2R A;  1QCN A;  1G3Y A;  1PG5 B;  4JLI A;  3RDV A;  4FYY B;  3U23 A;  4PKC C;  1YJW Q;  1VQ9 Q;  1Y7X A;  4DBH A;  2BTT A;  1VQ7 T;  5GMK h;  1AVZ C;  4LDY A;  2HKN A;  2A7Y A;  2KY9 A;  2XKO C;  3CMA A;  1VQP Q;  2OJ2 A;  1RAH B;  2VXE A;  4FU6 A;  1VQM A;  2QQA A;  2BZ8 A;  2FRY A;  3L2V A;  3H0H A;  2X51 A;  5GAM e;  2QGF B;  1Q81 U;  3URG A;  3CPF A;  3MEV A;  3BE3 A;  6AT1 B;  3QDR B;  5GMK l;  1A0N B;  2GBQ A;  4F7U G;  1BYM A;  1K76 A;  3EG9 B;  2DJQ A;  1P92 A;  2FVU A;  3JCM Q;  2ZAE A;  2DER A;  2DZ9 A;  3RR6 A;  2XHC A;  4F16 A;  1OUL A;  3RKX A;  3MET A;  3M0U A;  5LJ3 d;  3UA7 A;  3CCE Q;  3RBB B;  1AHJ B;  4D6W A;  3TEE A;  1YP5 A;  5CKB A;  4M75 C;  1TUC A;  3NTH A;  5KYY B;  1M1K C;  4ELZ C;  4GLK A;  3RES A;  3OYL A;  1AZE A;  3INZ A;  4E47 A;  1WPY A;  3CME A;  4RKU E;  2RJD A;  2O4X B;  2ZPI B;  4DEX A;  1VQ5 T;  1U1S A;  3DB3 A;  2RK2 A;  4M7D B;  2O2O A;  2JOY A;  1Q7Y C;  1IGQ A;  1IRE B;  3OBY A;  4R0K A;  2MMP A;  5GAN 4;  1NPR A;  1QWE A;  5GMK j;  2EGC A;  2D9T A;  1X2Q A;  2Y4Y A;  4LNP A;  2LC4 A;  1WIE A;  2F5T X;  3P8B B;  2FPD A;  2KRN A;  4II1 A;  3JB9 F;  1EIF A;  2QEX A;  1OPL A;  2JM8 A;  2L0A A;  1SRM A;  1U3O A;  5GAM g;  3G4S Q;  3QZ5 B;  1RAD B;  2BE7 D;  4PJL A;  2CP0 A;  2CP3 A;  2G3R A;  5I11 A;  5GAN 7;  1H8K A;  5L23 A;  4HVW A;  4XTX A;  2GFU A;  4BD3 A;  2NLU A;  1TS9 A;  2MCN A;  3J80 E;  3CCQ T;  2L2P A;  1NLP C;  2MAM A;  4JZ4 A;  4PFO A;  2P4T A;  3E1S A;  4PJO G;  1K1Z A;  3M9Q A;  4M7A F;  4EMG A;  3WVD B;  1VQN A;  4MDW A;  2QI2 A;  4ANJ A;  5D6X A;  3M0S A;  4O5V A;  2HBW A;  4HT8 A;  2O9S A;  2J6F A;  3CEY A;  2LCS A;  1WDX A;  1QVP A;  2F69 A;  2XU8 A;  4MMK A;  4DOW A;  3PFS A;  4IUP A;  5EC7 A;  2JTM A;  3FRN A;  4OGC A;  1RI9 A;  2RO0 A;  1UDL A;  2CH4 W;  3CCS A;  2VB6 A;  1ZA1 B;  2I0N A;  3C12 A;  5LL6 S;  4PFZ A;  1WJR A;  9ATC B;  2RD1 A;  2VKN A;  2ROT A;  4OF1 A;  3IQL A;  1T0H A;  1YWO A;  1OZ3 A;  2K3X A;  5GAO r;  3D7S B;  2KXC A;  2LNH B;  1I4K 1;  1X6G A;  2KYM A;  3OYJ A;  4KT0 E;  1GXI E;  3CD6 Q;  3GOX A;  1BCO A;  2DZC A;  3X28 B;  4C0F A;  4A63 B;  4LDV A;  4ELY C;  5I2S A;  1ZBJ A;  4FSX A;  4CI0 C;  4F7U F;  2DTO A;  4C92 E;  2KRO A;  3CCJ T;  2EYQ A;  2CDT A;  1M1K U;  4LUD A;  4FT4 A;  2KBT A;  2DPP B;  1AWO A;  1M3C A;  4FYW B;  2JMC A;  1N9R A;  2JZ2 A;  3CCV T;  3L42 A;  2MF2 A;  1FMW A;  3SFM A;  4JRP A;  2E6Z A;  1D1A A;  1B3Q A;  1BK2 A;  4FIB A;  1C6V X;  2DTH A;  4P5N A;  4E7K A;  1Q7Y U;  3C94 A;  4BB7 A;  5KYU B;  2CUD A;  1BI0 A;  1B34 B;  1YIJ A;  2XD0 A;  1PSF A;  4DBQ A;  4IUV A;  4OB2 B;  3MP1 A;  4PNO A;  3CMA Q;  4OB0 B;  4OP0 A;  2KAF A;  1YI2 A;  1VQM Q;  2X4X A;  4GLM A;  2YLC A;  4N0A A;  1NE8 A;  3BDL A;  1K73 R;  4ME7 A;  3JCM W;  4OMF B;  2OTL T;  5GAN h;  5IHI A;  1NM7 A;  1Z9Q A;  4MML A;  4C8Q B;  1QKW A;  4M7A D;  1B7T A;  4M77 C;  4M75 B;  3RKW A;  1RAE B;  2L3S A;  4M78 E;  4F04 B;  2RHZ A;  3OYI A;  1O9S A;  4JLG A;  3OYC A;  2DD4 A;  2F2X A;  3EG9 A;  5GAN 5;  1KQ2 A;  1KK7 A;  4PJO F;  1U8R A;  3RNJ A;  4M77 G;  2RQU A;  2WSE E;  3CME Q;  4AG2 C;  3QJY A;  1G3W A;  2RJF A;  4LN2 A;  3OS1 A;  4BI3 A;  3MP8 A;  1TWB A;  3HRS A;  1VUB A;  3M59 A;  1H64 1;  2YWW A;  1ZSZ A;  2LJ1 A;  4X9C A;  2ZPE B;  1SG5 A;  3ER0 A;  3CC4 A;  4EMK C;  2EQM A;  2IPO B;  2RB6 A;  1OYX A;  4GBQ A;  1UJY A;  2KEA A;  2K3Y A;  3JCM f;  2O4X A;  4RTX A;  2QEX Q;  2KYB A;  5KCH A;  3EFS A;  4JUV A;  4V2S A;  1OI1 A;  2K3B A;  4N0A C;  4BDZ A;  1PRL C;  1TXQ A;  5I22 A;  5GAN 2;  3G71 T;  1PHT A;  2GQI A;  3LH5 A;  3VV0 A;  1NZ9 A;  4C0D C;  5CR2 A;  4Z89 A;  2LJ0 A;  1YHQ T;  4ZN1 A;  1N27 A;  2GF7 A;  4Y91 A;  2ENM A;  3VS5 A;  1VQN Q;  2YUP A;  2LT4 A;  4PL6 A;  2RHU A;  1K9M C;  2A28 A;  1JRI A;  1S72 A;  3JRZ A;  2H3E B;  2HNI A;  3VS1 A;  1K8A C;  1AWW A;  2ROL A;  4PLI A;  5DLO A;  2LP5 A;  3I56 T;  5D7U A;  4WF2 A;  1X27 A;  2SRC A;  4JJB A;  3QBY A;  1N8R C;  1MV0 B;  3BW1 A;  1ARK A;  3CQT A;  4E7J A;  4BI8 B;  5HKC A;  3JB9 I;  3CCS Q;  4AT1 B;  1YJW T;  1VQ9 T;  2NUP A;  2L3Q A;  1C0M A;  1X01 A;  4BDY A;  2V26 A;  1ZSZ C;  2COW A;  2XG8 D;  3L1A A;  3MCA B;  4BI4 A;  1VQP T;  1M3B A;  3OA6 A;  1JJ2 S;  3M53 A;  1RLQ C;  2M0O A;  2WAC A;  1RUW A;  2EAY A;  5IHK A;  3OS0 A;  2EYW A;  2V8I A;  2QTX A;  3HTR A;  2HQH A;  2DM1 A;  4OMQ A;  3CCR A;  2X4W A;  3CCL A;  4J9E A;  2BZX A;  3KUF A;  2DIL A;  2DYB A;  2DEU A;  2LTO A;  4IUQ A;  2DO3 A;  1K4U S;  2JN0 A;  2QGG A;  1I5O B;  1UE9 A;  1V1C A;  1AEY A;  4Q5W A;  4DOV A;  3OMC A;  1BIB A;  1WHJ A;  3OMG A;  1SF9 A;  2IIM A;  4PJO D;  4FYV B;  4E6R A;  5KCO A;  2LX9 A;  4J9I A;  4M7D E;  3CCE T;  1WFW A;  2DK3 A;  3PE0 A;  3M0R A;  1EFN A;  1PWT A;  1IXD A;  2HDA A;  2LQK A;  1WYX A;  2JS2 A;  4J83 A;  4A53 A;  2K79 A;  1YBY A;  5GAO m;  1GCQ C;  1H3H A;  3JB9 J;  4CRI A;  1K9A A;  1ZLM A;  1YIJ Q;  1AWX A;  1R0C B;  1JBM A;  3M57 A;  4LDU A;  2ED1 A;  3OSS C;  3P8H A;  4RTY A;  4M77 F;  1E7O A;  4JJD A;  4JRI A;  2J6O A;  1Q82 C;  3OYB A;  1YI2 Q;  2RM4 A;  5LJ3 f;  2D0N A;  1PC0 A;  4A54 A;  1TU0 B;  4RTU A;  5D6Y A;  1AT1 B;  2X3X D;  4F7U A;  2PZ1 A;  1B34 A;  4JPB W;  1GFC A;  2AZS A;  3QXE B;  4M7A C;  1RAC B;  3M54 A;  4OMO A;  1WJQ A;  2YT6 A;  5CVI A;  5LJ3 h;  2LQ8 A;  2FYK A;  3G4S T;  4AFU C;  3FJ5 A;  2E3I A;  3M58 A;  2QQS A;  1BI3 A;  2ED0 A;  2NUT A;  4F17 A;  2DBM A;  2W10 A;  4J9C A;  1UTI A;  1NJI C;  4XTY A;  1XJW B;  1W2B P;  1K9M U;  2JTE A;  1W2B A;  1LOJ A;  2I2L A;  2LQN A;  2RJE A;  1X43 A;  4E7L A;  8ATC B;  4M7A G;  2EJ9 A;  1JO8 A;  2RNA A;  2FL7 A;  1MMG A;  2D0Q B;  2KE9 A;  5GAM d;  3OYM A;  5FWB A;  2RQR A;  2C0I A;  1BCM A;  2O9V A;  3N5B B;  2EGA A;  1MNE A;  1YIT A;  2EYX A;  2RHX A;  2EKO A;  3P8D A;  2KGT A;  2W0Z A;  3JCM e;  2OAU A;  3V8J A;  4EMK B;  3EG0 A;  2LCL A;  1QVG P;  1D09 B;  1H3Z A;  1M30 A;  1K8A R;  3CCM A;  1QVG A;  1OX9 A;  1K0X A;  5I21 A;  3RMQ A;  1KC8 C;  3CC4 Q;  4J8O A;  4J6Y A;  2AIR B;  3NHN A;  4ZNX A;  2XK0 A;  1N8R R;  2A36 A;  3C95 A;  4C5I A;  3ZEH A;  1D0X A;  1WHM A;  4RG8 A;  3CXC S;  2RHY A;  3HSB A;  3MEA A;  5FLX E;  7AT1 B;  3EHQ A;  3OW2 S;  1Q86 R;  3UDC A;  1VQ6 A;  2DET A;  1X69 A;  4C0D B;  1NG2 A;  3AT1 B;  2L8D A;  4LUE A;  4IUU A;  1IO6 A;  1QLY A;  2QG9 B;  2D8J A;  1R77 A;  1EZZ B;  5LJ5 f;  4PJO A;  3CD6 T;  2VXF A;  3L2U A;  1RL2 A;  5LJ3 j;  2NWM A;  1QCF A;  1Y57 A;  3NFC A;  2XIC A;  4JS4 A;  3V7C A;  2HZY A;  3RIR A;  5KYW B;  1KHC A;  1S72 Q;  2YUQ A;  2NUZ A;  5LJ5 h;  1LNX A;  4NS5 A;  1I81 A;  3CCU A;  1UG1 A;  2JM9 A;  4RUG A;  2DRM A;  1JU5 C;  1SRL A;  3SD4 A;  4MZP A;  4M77 D;  2OTJ A;  1ZSZ B;  4FCY A;  3HPW A;  3JCM g;  1Q82 U;  2CT3 A;  4KBM B;  4RCB A;  1G2B A;  4XQ3 A;  3X20 B;  1HSQ A;  2O01 E;  3FLG A;  2CKK A;  4JJC A;  2F5K A;  3CMA T;  5CQX A;  3SDZ A;  1MGQ A;  4C8Q E;  2HCK A;  2XDP A;  5GMK i;  1FXX A;  5DY9 A;  1VQM T;  2LVM A;  3O5Z A;  4PJM A;  1FWZ A;  1K73 C;  4M75 E;  1Q82 R;  1ACM B;  4PJN A;  3OSV A;  3CCR Q;  3MEW A;  3CCL Q;  5GJW B;  4OMM A;  5A0L A;  2Y90 A;  1FX7 A;  3ME9 A;  2CUB A;  2ZZD A;  1VYT A;  2F2V A;  3OYG A;  3G6E A;  3JCM c;  4PJO C;  1M2V A;  4QVD A;  2DLP A;  2F2W A;  3I55 A;  3GLX A;  1VQL T;  3KBG A;  3EGD A;  1SSF A;  2KK4 A;  5FRN A;  2AHJ B;  3BFM A;  2DYI A;  4RTZ A;  5FWC A;  3I5S A;  2HQX A;  1NJI R;  2ABL A;  1NEB A;  1F1B B;  2COY A;  4XU0 A;  4C0G A;  5LJ5 j;  1S1N A;  1TUD A;  2PVD B;  4D8D A;  3EGU A;  2B86 A;  4Y92 A;  3CME T;  3Q1J A;  2BUD A;  1PD0 A;  2NUP B;  3THK A;  1KC8 U;  2RJC A;  1ZSG A;  1UHF A;  2J7I A;  1VYU A;  1D1C A;  3VS6 A;  2VAS A;  1MMN A;  2JW4 A;  1D3B A;  3JCM X;  4M7A B;  4J9G A;  3H41 A;  4KRT A;  1BIA A;  1KC8 R;  4KUL A;  1OZ2 A;  3A5Z B;  4J9D A;  2VGM A;  3JAM E;  2QEX T;  3E19 A;  2KRS A;  1SEM A;  1D0Z A;  3VS4 A;  3TSZ A;  2EYZ A;  1YJ9 A;  1KG1 A;  1ZUY A;  4L6V 5;  2PUO B;  5DLQ E;  5CKD A;  4JS5 A;  2E5K A;  5HK3 A;  4FSS A;  3MP6 A;  2IVW A;  4QW2 A;  1BI2 A;  4J7F A;  1WXT A;  4AG1 C;  4EDU A;  2HSE B;  2ZCF B;  5GMK e;  4MDX A;  4M77 A;  1VQN T;  1SPK A; 
#chains in the Genus database with same CATH homology
 2RQV A;  4RTX A;  2P4R A;  2KYB A;  3KFV A;  2K3B A;  1GBQ A;  1PRL C;  1PRM C;  2DMO A;  2LMJ A;  3NPF A;  3SHW A;  3H0F A;  2V1Q A;  5I22 A;  1PHT A;  1VA7 A;  2GQI A;  3LH5 A;  1MV3 A;  3TSW A;  1M3A A;  4Z89 A;  2LJ0 A;  4RTT A;  4OMP A;  4AFS C;  2XMF A;  2ENM A;  3VS5 A;  2YUP A;  1UEC A;  4ORZ A;  1M8M A;  2A28 A;  1KJW A;  1WXB A;  1PKS A;  1AOJ A;  1N5Z A;  4J9B A;  1E6G A;  3VS3 A;  1GCP A;  3VS1 A;  2LZ6 B;  2KRM A;  1T3L A;  1UUE A;  1YWP A;  4OML A;  2ROL A;  2FRW A;  3EG3 A;  1AWW A;  2LP5 A;  1Y0M A;  1FYN A;  3UAT A;  1X27 A;  2FPF A;  1X2K A;  2SRC A;  2GTO A;  4JJB A;  2AKL A;  4DEY A;  1MV0 B;  4AFZ C;  1ARK A;  3CQT A;  2O31 A;  3TVT A;  3NMZ C;  2L3Q A;  4HVV A;  3VRZ A;  2OAW A;  2LX7 A;  4HXJ A;  2RF0 A;  3VS7 A;  1H92 A;  2G6F X;  1AZG B;  3R6N A;  1M3B A;  2DE0 X;  1NEG A;  2GGR A;  3EHR A;  3M0T A;  2V1R A;  1RLQ C;  2M0Y A;  1RUW A;  1WXU A;  5IHK A;  3VS2 A;  1KIK A;  2FO0 A;  1UJ0 A;  2EYW A;  2KXD A;  2K6D A;  2EVR A;  1NYG A;  3REB B;  2DM1 A;  4OMQ A;  1OOT A;  4EIK A;  2C0O A;  2AK5 A;  2JMA A;  2BZX A;  4J9E A;  3U23 A;  4CC2 A;  2A08 A;  2DIL A;  2DYB A;  2EW3 A;  2L3P A;  1K4U S;  2DBK A;  2BTT A;  1PNJ A;  4X1V A;  1UE9 A;  1AVZ C;  1V1C A;  1AEY A;  2KNB B;  1W6X A;  1FMK A;  2OJ2 A;  1BB9 A;  2IIM A;  2AZV A;  2FG0 A;  4E6R A;  4J9I A;  2BZ8 A;  2ESW A;  2FRY A;  1U5S A;  2HEQ A;  1WFW A;  3H0H A;  4CC7 A;  3PE0 A;  3M0R A;  1EFN A;  1PWT A;  1HJD A;  2HDA A;  1WYX A;  2JS2 A;  2DL5 A;  2K79 A;  1I1J A;  3M0P A;  5ECA A;  1A0N B;  2GBQ A;  1H3H A;  1GCQ C;  1K76 A;  2DJQ A;  1K9A A;  1ZLM A;  2DVJ A;  1AWX A;  2JXB A;  1JQQ A;  2ED1 A;  1GFD A;  2QDL A;  1UHC A;  4RTY A;  4RTV A;  4OMN A;  3I5R A;  1E7O A;  4JJD A;  4F16 A;  1WI7 A;  3M0U A;  4RTW A;  2J6O A;  3UA7 A;  2O88 A;  5HCK A;  1UFF A;  3RBB B;  1I07 A;  2K2M A;  2D0N A;  1MUZ A;  1YP5 A;  5IHN A;  2FPE A;  4RTU A;  1TUC A;  2X3X D;  2FEI A;  2JT4 A;  4Z8A A;  2PZ1 A;  3H0I A;  2D1X A;  4JPB W;  1GFC A;  3REA B;  3EG2 A;  2AZS A;  2CSQ A;  2X3W D;  1KSW A;  1AZE A;  1GRI A;  3M0Q A;  3UA6 A;  4OMO A;  2YT6 A;  1X6B A;  4HCK A;  4DEX A;  4AFU C;  3FJ5 A;  2O2O A;  1M27 C;  2ED0 A;  2EKH A;  4F17 A;  2DBM A;  2AKK A;  3NGP A;  2W10 A;  4J9C A;  4M4Z A;  3EG1 A;  1UTI A;  1GCQ A;  1ZUU A;  4R0K A;  2JTE A;  1QWE A;  1OPK A;  3ULR B;  2LQN A;  2EGC A;  1X43 A;  1ZX6 A;  1X2Q A;  4LNP A;  1JO8 A;  1WIE A;  2RNA A;  2RMO A;  2FPD A;  2KRN A;  2KE9 A;  5FWB A;  2RQR A;  3C0C A;  2L0A A;  1OPL A;  2JM8 A;  1SRM A;  2C0I A;  2MIO A;  1U3O A;  2HSP A;  1U06 A;  2YUO A;  2BZY A;  2O9V A;  1Z9Z A;  2EGA A;  5I11 A;  2EYX A;  1H8K A;  2KGT A;  2W0Z A;  5L23 A;  5GJV B;  3EG0 A;  2EPD A;  4HVW A;  1I0C A;  1M30 A;  2MCN A;  1K0X A;  4AFQ C;  2L2P A;  1NLP C;  4JZ4 A;  1WLP B;  3SEM A;  2CSI A;  1PKT A;  1K1Z A;  2H8H A;  3NHN A;  4ZNX A;  4J9F A;  2A36 A;  1NLO C;  4LE9 A;  1LCK A;  2CH4 A;  3M0S A;  2HBW A;  2O9S A;  1JEG A;  2J6F A;  1CKA A;  2KT8 A;  2LCS A;  2PNI A;  1WDX A;  3EHQ A;  1GBR A;  2DNU A;  2A37 A;  1X69 A;  5EC7 A;  1NG2 A;  1WX6 A;  4LUE A;  1IO6 A;  1QLY A;  2D8J A;  1RI9 A;  1UDL A;  1T0J A;  4CC3 A;  2CH4 W;  2LQW A;  2PTK A;  2NWM A;  1QCF A;  1Y57 A;  1J3T A;  2I0N A;  4JZ3 A;  2GTJ A;  1YCS B;  2JS0 A;  1QKX A;  1GL5 A;  2VKN A;  2YUQ A;  2NUZ A;  2ROT A;  4CC4 B;  3IQL A;  1T0H A;  1YWO A;  1SHF A;  1BBZ A;  2J05 A;  4K11 A;  1SHG A;  1UG1 A;  2JM9 A;  1XOV A;  2D8H A;  4RUG A;  2DRM A;  2M51 A;  2KXC A;  2LNH B;  1JU5 C;  1SRL A;  1X6G A;  2KYM A;  2ECZ A;  2RN8 A;  1G83 A;  4A63 B;  3PVL A;  2DRK A;  2K9G A;  1SSH A;  1ZBJ A;  2CT3 A;  4F14 A;  2J06 A;  2RQW A;  2LJ3 A;  1G2B A;  2DL3 A;  1HSQ A;  4HVU A;  2KRO A;  2GNC A;  3VRY A;  4JJC A;  2CDT A;  2DL4 A;  2RQT A;  1T3S A;  1W1F A;  4LUD A;  5IXB A;  2KBT A;  2YUN A;  2DX1 A;  1AWO A;  1M3C A;  2HCK A;  2JMC A;  1JXO A;  3O5Z A;  3ZL7 C;  1OV3 A;  1B3Q A;  1BK2 A;  5IXF A;  5GJW B;  4OMM A;  3QWY A;  2MOX A;  2CUB A;  3I9Q A;  1VYT A;  1YN8 A;  2CUD A;  2F2V A;  3I35 A;  1AWJ A;  2VVK A;  2DLP A;  2F2W A;  1ABQ A;  2DL7 A;  4QT7 A;  4RTZ A;  5FWC A;  2YDL A;  3PVQ A;  4GLM A;  2KR3 A;  3I5S A;  2OI3 A;  2EQI A;  4D8K A;  2RPN A;  2ABL A;  3JV3 A;  3QWX X;  1NEB A;  1E6H A;  1WA7 A;  5IHI A;  1NM7 A;  1S1N A;  1TUD A;  1Z9Q A;  1QWF A;  4D8D A;  4IIO A;  3EGU A;  2CT4 A;  2B86 A;  3GBQ A;  4Y92 A;  3THK A;  1CKB A;  1QKW A;  2C0T A;  1W70 A;  1JXM A;  1KFZ A;  1YNZ A;  1ZSG A;  5FW9 A;  1UHF A;  1HD3 A;  2J7I A;  2L3S A;  1VYU A;  1NYF A;  3VS6 A;  2JW4 A;  3VS0 A;  1ABO A;  4J9G A;  2F2X A;  3H41 A;  4KRT A;  3A98 A;  4J9H A;  4Z88 A;  2DF6 A;  2CRE A;  2EGE A;  2SEM A;  1CSK A;  5IH2 A;  4J9D A;  3RNJ A;  2RQU A;  2KRS A;  4AG2 C;  1SEM A;  3VS4 A;  3TSZ A;  4WCI A;  2YSQ A;  4LN2 A;  1K0S A;  2EYZ A;  4ESR A;  1ZUY A;  1AD5 A;  2EYY A;  1B07 A;  1UGV A;  1TG0 A;  3UF4 A;  2E5K A;  2LJ1 A;  4FSS A;  2EBP A;  2DL8 A;  2J6K A;  2K7A A;  1BU1 A;  1ZUK A;  4GBQ A;  4AG1 C;  1WXT A;  1OEB A;  1UJY A;  2VWF A;  2KEA A;  4IIM A;  1SPK A;  1RLP C;  2KT1 A;  1VYV A;  2DA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...