1GL5A

Nmr structure of the sh3 domain from the tec protein tyrosine kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNNLDQYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure and intramolecular associations of the Tec kinase SRC homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE TEC
total genus 11
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gl5A00
4HVVA 1VYUA 3TSZA 2D1XA 4F17A 5IXBA 2LMJA 4IIOA 2EBPA 3I35A 2E5KA 3PVLA 1W70A 2L2PA 2CH4W 3PVQA 1HSQA 2YUOA 4RTWA 4DEYA 1AVZC 1BB9A 5IHNA 1UHCA 2JM8A 1M3BA 5FWBA 2O88A 1UE9A 1K9AA 1UG1A 3I5SA 1T3LA 1YN8A 2J6OA 2LNHB 4AFZC 2JW4A 1X6GA 2CREA 1UGVA 4X1VA 1QWFA 2CUBA 2DL3A 4RTYA 1QLYA 2AZVA 5GJVB 2AKLA 3O5ZA 2DL8A 2HDAA 2O2OA 2OI3A 2A37A 2NUZA 1PHTA 2YT6A 2A28A 2K6DA 4AG2C 1KFZA 4HVUA 1KSWA 1AZEA 4RUGA 4CC4B 1CKBA 1X2KA 2DE0X 1UJ0A 3UA6A 4D8DA 3VS3A 1AZGB 2BZXA 2JM9A 2L3PA 3H0IA 4M4ZA 2CT4A 4J9FA 3VS6A 2RF0A 2J6FA 4J9IA 2ECZA 1BBZA 4J9CA 1GL5A 1H8KA 2FRWA 2FRYA 4GLMA 1OPKA 2PNIA 1JU5C 3VS4A 4KRTA 2KR3A 2YUPA 3U23A 5HCKA 2EYYA 1BK2A 2KXDA 3A98A 1X43A 2JS2A 2KRNA 1TUDA 1AWXA 3VS1A 3QWYA 2ED0A 1WA7A 4LNPA 3NPFA 2GBQA 1AWWA 2IIMA 1T0HA 2EKHA 2VKNA 3KFVA 1M30A 4JZ4A 1OPLA 1U06A 2EYWA 1WLPB 2RNAA 2A08A 2X3WD 1CKAA 1AOJA 2DNUA 2KE9A 2F2XA 2K3BA 3M0QA 2OJ2A 2PTKA 3NMZC 2LQNA 3EG1A 1TG0A 5L23A 2J06A 1W6XA 2ED1A 4Z89A 2KBTA 1PKTA 2FEIA 2L3QA 1FMKA 2O31A 1UUEA 4JJBA 4LN2A 2DM1A 2GQIA 2KROA 4JJDA 4OMQA 2CSIA 2W10A 2K9GA 5IXFA 2ENMA 2KRSA 5GJWB 1M3AA 1JO8A 1H3HA 1QCFA 4Y92A 1GBQA 1MV0B 2GTOA 3H0HA 1UFFA 2KXCA 2MOXA 4AFUC 1T0JA 2M51A 4OMPA 2YUQA 5EC7A 2RQVA 1NYGA 1ZUUA 2KYBA 2DRKA 1YNZA 2RQRA 4F16A 4J9HA 4IIMA 3RBBB 4JZ3A 2EGEA 2YSQA 4LUEA 2LZ6B 1AEYA 3NHNA 1Z9ZA 1Y57A 1ZBJA 2GTJA 3EHQA 1ABQA 1YWPA 3I9QA 1ARKA 1OV3A 1G2BA 2KRMA 2X3XD 2CDTA 2DL4A 3JV3A 1GCPA 2DJQA 2K7AA 1NG2A 3M0PA 2LJ3A 1GBRA 1SHGA 1WDXA 1KIKA 2RN8A 1Y0MA 2DL5A 3VS7A 1W1FA 2EW3A 1QKWA 5I22A 2SRCA 2JT4A 1JEGA 1I07A 1X6BA 3THKA 2RQTA 1G83A 4WCIA 4HXJA 1M27C 1S1NA 3VRZA 1MUZA 1YWOA 1B07A 1QKXA 2LQWA 2BZ8A 3RNJA 2JMCA 1K4US 4HCKA 2K79A 3QWXX 4GBQA 3ZL7C 2CSQA 1U3OA 4J9DA 2VWFA 2YUNA 3TSWA 1GRIA 1SRLA 2HSPA 1AWJA 2DA9A 3VS2A 1I1JA 1ZUYA 1BU1A 4LUDA 4ESRA 1RI9A 3H0FA 3M0TA 2F2WA 3H41A 5FW9A 1FYNA 4RTTA 2RQWA 1PWTA 1AWOA 1K0XA 2I0NA 2LP5A 2BTTA 1ZLMA 1M3CA 3FJ5A 1M8MA 1PNJA 1Z9QA 2VVKA 2HCKA 4J9EA 2C0OA 3C0CA 2EYZA 2NWMA 1X2QA 1OEBA 2DYBA 2D8JA 5IH2A 1WI7A 1WX6A 2KT8A 1NLOC 4AG1C 1CSKA 1SRMA 4AFQC 3EG0A 1PRMC 1VYVA 5IHKA 4DEXA 1UTIA 1ABOA 2RPNA 4OMLA 2CH4A 3SEMA 2AZSA 2CUDA 2RQUA 2DMOA 1PKSA 1UDLA 2OAWA 1WIEA 2DBMA 2V1QA 3TVTA 2CT3A 2EQIA 3EG3A 2MCNA 2EYXA 4J9BA 3EHRA 2FPEA 1K1ZA 3IQLA 1E6GA 1E6HA 2BZYA 2F2VA 5ECAA 4ZNXA 1X27A 2LJ1A 4K11A 2SEMA 3M0RA 2V1RA 1TUCA 2P4RA 1VYTA 2J7IA 4Z88A 1H92A 1GFCA 2AK5A 4RTXA 3UF4A 2C0IA 2MIOA 3EGUA 1EFNA 2C0TA 3SHWA 5IHIA 5FWCA 1WFWA 4R0KA 2EGCA 4OMMA 2J05A 1J3TA 1PRLC 2LCSA 2JXBA 4A63B 2ROLA 4D8KA 1MV3A 2XMFA 1XOVA 1NM7A 2JMAA 3I5RA 4CC2A 1NLPC 1T3SA 2GNCA 2KNBB 5I11A 1HD3A 4CC3A 4LE9A 1WYXA 2JS0A 2LJ0A 2HEQA 1ZUKA 3CQTA 4JPBW 2DX1A 2L3SA 3M0SA 1YP5A 2LX7A 3ULRB 2AKKA 1WXUA 3M0UA 1E7OA 1GCQA 4RTUA 2DILA 1X69A 1JXOA 1ZX6A 3LH5A 4AFSC 1YCSB 3UA7A 2KGTA 1K76A 4EIKA 1U5SA 3VS0A 4HVWA 1WXTA 1K0SA 1ZSGA 4RTVA 3GBQA 1NEBA 2H8HA 1OOTA 1N5ZA 2G6FX 1SHFA 2DBKA 2HBWA 2KT1A 2O9SA 2RMOA 1QWEA 2FPDA 3UATA 4E6RA 1AD5A 3PE0A 3VRYA 1B3QA 2K2MA 4FSSA 2DL7A 1V1CA 2DF6A 2PZ1A 2FPFA 1RLQC 1GCQC 2B86A 2EPDA 1NYFA 2ESWA 2J6KA 2D0NA 2FO0A 2ROTA 2DRMA 1I0CA 2M0YA 4JJCA 1GFDA 2QDLA 2W0ZA 2DLPA 1SSHA 1JQQA 1VA7A 2YDLA 2EVRA 1SEMA 4Z8AA 3VS5A 2D8HA 2EGAA 2GGRA 1NEGA 1UJYA 1UECA 2FG0A 1SPKA 2O9VA 4J9GA 1RUWA 1WXBA 1RLPC 1KJWA 2DVJA 4CC7A 2L0AA 4OMNA 4RTZA 2ABLA 3R6NA 1HJDA 1LCKA 4ORZA 3REAB 1IO6A 4F14A 2JTEA 3EG2A 1UHFA 3NGPA 4OMOA 1JXMA 3REBB 2A36A 2KEAA 2KYMA 1A0NB 4QT7A
chains in the Genus database with same CATH superfamily
4MZTA 1Q7YC 4HVVA 1I5LA 3FB9A 3CC4T 1N27A 3OS0A 2ATCB 1QVGP 4F17A 2X4YA 2F5KA 2K3XA 3HRTA 2QQSA 1W2BP 1YJWA 1B34B 4N4IA 2E5KA 1W70A 3FJPA 1K9MC 1RAEB 1BKBA 1Y71A 2L2PA 3CCVA 1KG1A 1WHJA 1BB9A 1UHCA 1Q86R 3X20B 3JCMJ 5GAOq 1T3LA 2LNHB 2JW4A 4ELZC 3LGLA 4BDZA 1YJWT 2E6ZA 1QVGA 2CREA 5KE2A 2ZPHB 4E2FB 1QWFA 2CUBA 3LX7A 4XTYA 5HKCA 3DB3A 1MMNA 2O2OA 2YT6A 2A28A 4HCZA 4AG2C 1YJ9T 4M7DE 1CKBA 3PTAA 3UT1A 4EMGA 2V8IA 3VKIA 1YJ9Q 1AZGB 2JM9A 2L3PA 4M4ZA 1AT1B 2HNIA 2ECZA 2HAXA 3SWNC 4WTOB 5KYNA 1YHQQ 2FRYA 4A54A 4EMKC 2PNIA 1JU5C 3EGDA 5GAMj 4KRTA 3QYHB 2VXFA 2EYYA 3A1PA 4FYVB 4IURA 1BIAA 2DFUA 5CCAA 2XI9A 5HK0A 2IIMA 3MP1A 1WHMA 2E65A 1U06A 4F7UB 3M53A 1UEBA 2QEXA 3CC2T 4IUVA 5GMKh 2RJDA 1CKAA 2DNUA 2F2XA 2X51A 2FYKA 5C6SA 5GAOl 3L2RA 3EG1A 1BI3A 1Q86U 4JDSA 2EFIA 5L23A 2J06A 3OS2A 3MEWA 4LXCA 3CBMA 4LD9K 1M1FA 4OGCA 2L3QA 4DBRA 1VQMT 5DM7R 4LN2A 3CC4A 3RMSA 4C92A 4OMQA 3PT9A 1K73U 4QVZA 3OYMA 5IXFA 2ENMA 1JO8A 4FYXB 3QUIA 4M77G 3PFSA 3H0HA 3I55Q 1UFFA 3CMAA 2MK5A 4XU1A 1X01A 4C5HA 1OQKA 1DJ7B 3S3OA 4C0GA 4ZGDB 3OB9A 3CD6A 1S72Q 3JB9F 2EGEA 2YSQA 5HK3A 2GF7A 3NHNA 4IUPA 5GAMd 4M75B 1YWPA 4A4GA 3RESA 2DTOA 2F1LA 2F5TX 3JV3A 4KULA 3CMAQ 1GCPA 1NG2A 4C8QC 4LD6A 3H6ZA 3BE3A 1GBRA 1SHGA 1Y0MA 1BIBA 3VS7A 1VQPT 1U1SA 1FX7A 5CQXA 2BKDN 1YJ9A 5I22A 4RMOA 2O4XA 1X6BA 4EMKB 3HHTB 4WCIA 1YWOA 2CGHA 1IHWA 2E3IA 4PJNA 1QKXA 2LQWA 2JMCA 2E5QA 2K79A 3QWXX 1M1KR 5KYUB 4FSXA 5CKBA 2LQ8A 1SRLA 1MMDA 3M58A 1N9SA 3JCMc 1ZUYA 4LUDA 2EQKA 3H0FA 5GANj 2F2WA 4KGXB 3FLGA 4C8QG 2XU8A 3FC3A 3MO8A 1GXIE 2RQWA 1OULA 5GAN6 3C95A 2E3HA 3EGDB 2KVQG 1ZLMA 1M3CA 2NUPB 2ZGWA 1VQ5T 2DO3A 4JS5A 3CMEA 1Y07A 1Z9QA 2HCKA 2C0OA 2X9HA 2XG8D 4DBQA 4KH1B 3OYLA 3S3MA 1MHNA 2X35A 3V8JA 6AT1B 2XDBA 4BI4A 4FL6A 1N6AA 1SRMA 4AFQC 3GLXA 1IGQA 5IHKA 1KD1R 3FRNA 1ABOA 2LNVA 2RPNA 2Y4YA 2AZSA 5CQYA 2RQUA 2YLBA 3H9NA 1VQ6Q 1X75C 3EH1A 2OAWA 4BY6B 1M1GA 1MNDA 3RUXA 1JJ2A 2VYTA 2DZ9A 3TVTA 2EYXA 4J9BA 1VQOA 2FPEA 2D9TA 3CMAT 3SD4A 4B9XA 1VQ9T 5KYYB 2Y4XA 2SEMA 1M2VA 1WQ7A 4C92F 5GAOr 1M1KU 2JOYA 4O6JA 1VIEA 4VUBA 1K8AC 1NPRA 4Y91A 5CR2A 2C0TA 3AT1B 4A4FA 5IHIA 1TWBA 3E19A 4Q5WA 2JXBA 1M1KC 2GCXA 4HKEA 1I8FA 1JBMA 4C8QA 4C8QB 1PM3A 3C4SA 3G6EA 2XMFA 1BI2A 2E4HA 1XOVA 1WJQA 2JMAA 3MP8A 3M5AA 1MGQA 4QQGA 3GOXA 3CCQT 1HD3A 1WYXA 2LJ0A 5CKHA 3CQTA 4PFPA 4PJOB 3QZ5B 1YP5A 2LX7A 3G6ET 2XDPA 2A7YA 2LT4A 1D0YA 2RH2A 1C1AA 1GCQA 3HRSA 5LJ5d 2RJFA 2WSEE 4IUQA 2RI3A 5GANf 3JCMf 1K76A 4EIKA 5GMKm 2LDMA 4RTVA 1NEBA 2H3JA 3G71Q 1OOTA 1VQLT 1WHKA 2G6FX 2DBKA 2KT1A 2D0QB 1P92A 2O9SA 1VQ4T 2CZ0B 3UATA 2QGFB 1VQKA 2MF2A 4JJNK 3VRYA 4M7DF 4C8QE 2K2MA 3SDZA 3LW5E 1QVFS 2DF6A 2R5MA 4PJLA 3BFMA 2EIFA 1YFNA 4XTVA 1QVGS 2RHYA 2QYZA 1GCQC 2EPDA 1VQNQ 1ZSZC 1VQOQ 2MWPA 1I4K1 4M7DC 2ROTA 5KYUA 4FIBA 2LQKA 1GFDA 4XTXA 2QDLA 1SKUB 3J81E 2DLPA 2ZPIB 1JQQA 3VJPA 1VA7A 2YDLA 5GMKi 2D8HA 1Q81U 1XJWB 3CXCP 2DKGA 3QHSA 2FG0A 4J9GA 4J6YA 2JTFA 3OBYA 1VQPQ 4E47A 3I56A 3CCUT 2LRQA 1YI2Q 3C94A 4EDUA 1NE8A 4RTZA 5C0MA 1IO6A 3EG2A 1BI0A 1JXMA 4MDWA 1YITT 4KT0E 1XNIA 4IKFA 2EWNA 3EFRA 1V29B 4HT9A 1FXXA 4IIOA 2PU9B 1NPPA 2RK1A 2CH4W 1HSQA 5KYYA 4MMKA 5GAN3 4M78D 4JLIA 2JM8A 1M3BA 2BE7D 3ZFJA 2O88A 1K9AA 3I5SA 1QW1A 2HBPA 4RKUE 4AFZC 1BYMA 1M5Q1 1PCXA 2QGGA 4XU3A 2E12A 1Q82C 1KQ2A 3L2UA 1WHHA 2DL8A 2HDAA 3CCLQ 2A37A 4JLGA 1YJNA 1IHVA 2RO0A 1AZEA 4RUGA 3E2UA 3OYJA 2DE0X 1QQJA 4D8DA 2HSEB 2H3EB 3JCMX 1YBYA 2CT4A 3CCJA 3E1SA 5KYXB 2J6FA 5GAMh 1BI1A 1I5OB 3ER0A 1VQ7A 2FRWA 1OPKA 2YUPA 2NUPA 3QWYA 4M77A 1NZ9A 2PVOB 4PJOD 1EIFA 3NPFA 4ME7A 2O4XB 4BDYA 2E10A 3OYCA 2EQMA 5J3BA 4M7DB 1M30A 2OTJQ 3JB9J 3HFNA 5FU6B 3JCMh 1QVFP 3CMET 3ME9A 2Z0WA 2A08A 3T9NA 1M9SA 1AOJA 4ZN3A 3G4SQ 2K3BA 4JRIA 5GMKj 2YWWA 2PTKA 3NMZC 4LDVA 3TQ7P 2LQNA 3JB9H 4A4HA 3L2QA 4M7DA 8ATCB 2KMTA 5KYWB 3RDVA 1K8AU 3CCRQ 1W6XA 1W4SA 1VQ9Q 2QG9B 2G3RA 2FL7A 1FMKA 1S72A 1R0BG 1UUEA 1YI2T 2QDYB 3CCUQ 1NBEB 3URGA 4MZMA 3L2ZA 1M3AA 1YITQ 1K73R 2KK4A 4PJOC 3JCMg 3V7SA 1T0JA 2M51A 4OMPA 2YUQA 3PMIA 4M7AE 4L59A 1TS9A 1TOVA 1ZUUA 3BW1A 1TTHB 4N0AA 2DRKA 4ZN1A 5I2SA 1YNZA 3ASKA 4AT1B 3CCMA 4IIMA 1LOJA 2KI7A 4B6MA 1Z9ZA 1Y57A 2OTLA 1ZBJA 2GTJA 2ZPFB 3OW2P 1ABQA 3OYBA 2DD5A 4R56A 3A8LB 4N4HA 2KRMA 4FW1A 2X3XD 2DL4A 3CBOA 1WGSA 4L6V5 2LJ3A 4M77E 1YIJA 1VQNT 4O5VA 1O9SA 1WDXA 1KIKA 2DL5A 1ZBXA 4M78G 1W1FA 1EZZB 1F1BB 2VGNA 3PMTA 1Y7XA 4M77B 4XQ3A 1OU8A 4C92E 4A53A 1UGQB 1HXDA 2FZCB 4FYYB 2CZ6B 1WJSA 3RIRA 4X9DA 2RQTA 1G83A 3RKYA 2RHUA 3G71A 2HD0A 2CP7A 8AT1B 3EAEA 3JCMP 1M27C 3BDLA 3VRZA 1VQLQ 1TU0B 1K4US 1VQ7T 2CSQA 4J9DA 1Y96B 1GRIA 1AWJA 2DA9A 4M7AF 2GFUA 5I2MA 3H8ZA 3PIOA 2GQVA 3EGXB 2RM4A 5FW9A 4PJOE 3CCLT 3AHUA 2DK3A 3QXEB 1KC8U 3CBPA 1AWOA 4M78C 2I0NA 3P8DA 1VQKQ 1K0XA 2LP5A 4OVAA 4C0DC 2RJEA 1VQKT 3FJ5A 4J6XA 3WVEB 1G3WA 2K5FA 3LLRA 1M8MA 1PNJA 4M77F 3MEVA 2EYZA 5DLOA 1X2QA 5GANg 1OEBA 3KBGA 5CAIA 2KT8A 1QVPA 2JZ2A 1NLOC 4EPCA 5I21A 1KC8R 3EG0A 2DETA 3ZBDA 4XTZA 2HL3A 1YI2A 2XD0A 2E41A 1VQ6T 1UDLA 2V1QA 2CT3A 1ZQ1A 2F69A 2CP3A 5A0LA 5CK9A 1K1ZA 1E6HA 2MAMA 3F70A 4PJOF 5ECAA 2QEXT 4ZNXA 2LJ1A 4K11A 1TUCA 3M54A 1VYTA 2XK0A 1UGRB 2C06A 5HY6A 2VC8A 1H92A 2C0IA 3EGUA 1YIJT 2DXTA 2XICA 1QVFA 2KY9A 5KCHA 2PQWA 3D7SB 1SSFA 2J05A 3SB2A 1PRLC 2M02A 2ROLA 4PLIA 1VOMA 4ANJA 3I5RA 4CC2A 1T3SA 2GNCA 2KNBB 1KD1C 4PLLA 3G71T 1KK7A 2HEQA 4DOVA 4J7FA 3EFOA 2L3SA 3V8LA 2AKKA 1ZSZB 5GANe 2DILA 4AFSC 4C0DB 3QDFA 4M78B 3JCMe 3CC7Q 5CKFA 4BE0A 3VS0A 4HVWA 5IAYA 2CKKA 1ZSGA 3GBQA 2H8HA 3CMEQ 2Y90A 1N5ZA 2HBWA 2HZYA 5A2QE 1QWEA 2FPDA 1XTDA 4F04B 2YRVA 3VUBA 1VQPA 4KBMB 1B3QA 1V1CA 5GAN5 2PZ1A 3A8OB 2FPFA 4YTLA 2QA4A 2P0KA 2J6KA 3E9FA 2DD4A 2FO0A 2DRMA 5KH6A 1I0CA 4JJCA 3A8HB 1TUGB 4QVDA 3E9GA 1SEMA 1TH7A 4OB2B 4Z8AA 2EGAA 1K9MR 1UJYA 1RUWA 1G3YA 3NTHA 5FRNA 2K57A 2VGMA 2QA4T 2QK0A 1S72T 3LGFA 5KYWA 1U1TA 1R0CB 5GANh 1FMVA 3M9QA 2L0AA 4OMNA 4M77C 2R57A 5FROA 1PD1A 2QTVA 3CCJT 3CCJQ 1RAHB 4NS5A 2KDSA 1WQWA 2JTEA 1UHFA 2JVVA 3NGPA 4OMOA 3REBB 3OYIA 3GP8A 3M4GA 3G1JA 1PD0A 4N4GA 1YJNQ 3LWHA 4BI8B 4EMKA 4X9CA 2LMJA 1QP2A 2EBPA 2HKQB 4BB7A 3I35A 2DPPB 2K3YA 3HRUA 3QO3A 3JCMV 1KD1U 2X4WA 2LX9A 4RTWA 3CCEA 2OTLT 3VU3C 2FHDA 1LVKA 1RADB 4DA4A 5FWBA 3CPWA 3KUFA 2HKNA 1IZ6A 2K4YA 1YN8A 3OYKA 2OAUA 2YRDA 3X25B 1X6GA 4BY6C 2X4JA 3CEYA 1UGVA 4M77D 3L42A 2VB6A 2AZVA 1AHJB 2D6FA 1VQOT 2DZCA 1Q7YU 4M7AA 2K5LA 4QQDA 2NUZA 3CC7T 2LTOA 3JCMb 2RHIA 1BCOA 1Q81C 1KFZA 1VQMA 1X2KA 2R5AA 2ZPGB 4JS4A 2BZXA 2V26A 3VS6A 3OYNA 1KC8C 2RF0A 2E64A 4J9CA 4E7SA 4PKCC 1H8KA 4M7AD 3X26B 1OX8A 2KR3A 3U23A 4C0ZA 1BK2A 2KXDA 1X43A 2JS2A 2P4TA 3G4SA 2ED0A 1WA7A 4LNPA 1K9MU 2GBQA 2EKHA 2VKNA 3KFVA 2M16A 3HKSA 3CPFA 1PSFA 1OPLA 3CCQA 1G5VA 3TCJA 2EYWA 3TU4K 1WLPB 4XU2A 3JCMW 4UC4A 1Q81R 2IVWA 3A5ZB 1QCOA 2JNGA 4BUGA 2WACA 3M0QA 4PJMA 2OJ2A 1OZ3A 5LJ3g 4FT2A 3SWNB 2CP2A 4M78A 2OTLQ 3BDUA 3G6EQ 2ED1A 2QEXQ 1WZOA 3LWIA 4PJOA 3CPWS 4LDXA 1IXDA 1NJIR 1RL2A 3FDRA 3OQ5A 1UB4A 2GQIA 1VQLA 2KROA 3L2VA 4JJDA 4XK8E 2CSIA 2W10A 4D6WA 2K9GA 3RKXA 2K2VA 5EG2A 5GJWB 1QCNA 1H3HA 4M75A 4Y92A 1YJNT 1EX4A 1GBQA 1MV0B 3DKMA 2O01E 2GTOA 1XQHA 2MOXA 4AFUC 2RQVA 1NYGA 5LL6S 3X28B 4WF2A 5GAOp 3CCLA 4HT8A 2RQRA 1C6VX 2COYA 3RBBB 3CXCA 4N0AC 4JZ3A 1OZ2A 3GIBA 4A4KA 1AEYA 4RG2A 5GAMg 3EHQA 3P8BB 1N8RU 4GLKA 3I9QA 1ARKA 4QKUA 2DIGA 1SG5A 4M7AG 1G2BA 1VQMQ 3CC2Q 4OMFB 2WSFE 2FVUA 4PFZA 4Z02A 3QPHA 4DOWA 2QQ9A 2K5IA 2SRCA 1ZSZA 2JT4A 2L89A 1I07A 3VV0A 2OTJA 1LNXA 2JJ9A 3HPWA 2RK2A 1S1NA 2CS7A 3QIIA 4PK4A 2RJCA 2BZ8A 4NL2A 4HCKA 1D1AA 1RI0A 1M2VB 5CVIA 4C8QD 3VS2A 3RKWA 4HCBA 2AIRB 1BU1A 1RAAB 4A4EA 1RI9A 3R6OA 3H41A 4OB0B 5GAN7 2V8KA 1W2BS 4RTTA 4E7LA 5GMKl 1PWTA 4RCCA 2PUKB 2BTTA 2DEQA 1YHQT 2EJGA 2DERA 1WJRA 1PSEA 2CYZB 5GMKe 1YJWQ 2RI5A 4M7DG 3Q1JA 3C0CA 3OS1A 3M56A 4QW2A 1NJIC 5FRMA 5D6WA 5CO7A 2DYBA 2D8JA 2ZPBB 1WI7A 3LYIA 4AG1C 1KQ1A 1LJOA 4KUIA 1YHQA 5GAN8 3N5BB 4BI3A 5KCOA 2IPOB 5LJ3d 1R8OB 3GNFB 3CCQQ 4OMLA 3V8KA 1KHCA 1ZHIA 3ZEHA 4MZPA 2DMOA 5GAMe 2HQHA 3QKJA 1WIEA 1Q82U 3UPUA 4BACA 1D09B 3QBYA 5FU6C 3EG3A 4LDUA 2EKOA 2HMAA 5FU7B 7AT1B 3KXTA 2GFAA 2M0OA 4MDXA 2XIDA 3CCEQ 3S3NA 2L8DA 2V1RA 2DXBA 2P4RA 2LCLA 2J7IA 1D3BA 3OS5A 1QP3A 2AK5A 5KYXA 4RTXA 5LJ3j 2MIOA 3CCET 3VUZA 5FWCA 2EGCA 4LDYA 4IUUA 1J3TA 4C5IA 4J8OA 3I55T 4B9WA 3QYGB 1MV3A 2KSSA 4NL3A 5AYFA 1WPYA 4E7HA 1NLPC 1K8AR 2LC4A 1OX9A 4J83A 1B7TA 3FIFA 4JRKA 5I11A 1HYOA 4CC3A 2LCCA 2VASA 4LE9A 5DY9A 3CC7A 3L1AA 3M4YA 3MCAB 5D6YA 4JPBW 3CD6Q 3M0SA 2NUTA 3QJ6A 1D0ZA 4AMCA 2I2LA 2EQUA 2CZ1B 3M0UA 1E7OA 4RTUA 3EGXA 2M9UA 1X69A 1JXOA 1ZX6A 1YCSB 3UA7A 1VQ5Q 2KGTA 3M59A 1KHIA 1VQ6A 1VQ8T 4XAXB 1B34A 1U5SA 2HL5C 4DQ2A 1WXTA 1K0SA 4FW2A 4RCBA 4X34A 3JB9D 2PUOB 4J6WA 3OA6A 4ZTFA 1SHFA 4F7UF 2RMOA 1LPLA 5GAMf 5D6XA 4FSSA 4XU0A 2DL7A 3META 1SF9A 2QQAA 3OYAA 4FM4B 1Q82R 2YRCA 3CCRA 1RLQC 2E70A 2RA2A 2EAYA 1NYFA 2ESWA 2MYSA 2D0NA 2M0YA 2NUTB 4HCCA 1WHGA 2COWA 3A8GB 2W0ZA 3EFSA 3JCMd 4HA8A 2EVRA 1NEGA 1UECA 2QTXA 1SPKA 5FU7C 2VXEA 1Q95G 1RLPC 1KJWA 1I81A 2DVJA 4PJOG 1UGPB 3R6NA 1HJDA 2QQRA 4NOYA 4ORZA 2DIQA 3REAB 1YIJQ 1RABB 2A36A 2KEAA 1VYUA 3WXMB 1OU9A 3QSUA 3TSZA 1O75A 2D1XA 3G4ST 4FU6A 4C92D 2EJFA 5IXBA 2NYSA 2DJZA 3UWNA 3PVLA 3I55A 2FB7A 1FMWA 4XTWA 4LDWA 3CCSQ 3PVQA 2YUOA 1WNLA 3TEEA 2DAQA 1VQ4A 2P0QA 4DEYA 4M7AC 1AVZC 4L5GA 5IHNA 4JUVA 1UE9A 1UG1A 3OYGA 2J6OA 3GF5A 4X1VA 3JB9I 2DL3A 4RTYA 1QLYA 2JN0A 3MHXA 5GJVB 2AKLA 3BY7A 3O5ZA 2JTMA 3GNGA 2OI3A 4OGEA 3MPUB 4M75D 1VQ8Q 1RAFB 2K6DA 2VUBA 4HVUA 3JSCA 2OTJT 1KSWA 3EG9A 3I56Q 4Y28E 1QMCA 2CP6A 3RERA 4CC4B 1D0XA 2BUDA 2NLUA 1UJ0A 3UA6A 2RHXA 1JJ2P 4ZGJB 3VS3A 5LJ5e 3HTRA 3H0IA 4J9FA 5LJ5h 1M8VA 4J9IA 1BBZA 4V2SA 1GL5A 3CCMQ 5LJ3f 4GLMA 3VS4A 2L5QA 5HCKA 3A98A 1ZA2B 2KRNA 1TUDA 2XHCA 4OP0A 1IGUA 1AWXA 3VS1A 3PNWC 4C5GA 3X24B 4PJJA 5IT9E 2DEUA 1WHLA 1AWWA 3HP9A 1T0HA 1N9RA 3OSSC 4M7DD 1W2BA 4E7KA 4JZ4A 2VV5A 1TSFA 2RNAA 1VQ9A 4JRPA 2X3WD 2QASA 1H641 3OMCA 1M2OA 2CZ7B 2BIVA 3VYHB 2KE9A 3RR6A 2WSCE 1R77A 4E7ZA 2RD1A 3QG1A 1G8XA 3LH0A 1TG0A 3QJYA 3PGGA 4R55A 2PVDB 4Z89A 1N8RC 3TREA 2KBTA 4KH0B 3EH2A 1PKTA 3V7RA 2FEIA 2RHZA 1D1CA 2O31A 4JJBA 2DM1A 3DLMA 1VIFA 1VUBA 2FZGB 2KRSA 4M75F 1QCFA 4GY5A 3CCVQ 4F7UE 4J7IA 3OYDA 2KXCA 3OW2S 5EC7A 1VQ5A 3J80E 2KYBA 4F7UG 2DTHA 1Y96A 5L8RE 1IB8A 4F16A 4J9HA 1YCYA 3HFOA 4ATOA 1FWZA 4LUEA 2LZ6B 3CCVT 3CC4Q 2YLCA 4M75G 2COZA 3M55A 4E7JA 3SWNA 5D7UA 3OW2A 3C12A 4C92G 1TXQA 1HK9A 1OV3A 5CKDA 4II1A 1H3ZA 4M78E 1Q86C 4QVCA 2PVGB 2CDTA 3JCMQ 2JUFA 2DJQA 2K7AA 3M0PA 1C0MA 1M90U 2XKOC 2DTIA 2V8JA 2QA4Q 2RN8A 2AHJB 2CP0A 3HSBA 2EW3A 4PNOA 1QKWA 2DVEA 5GAOm 1JEGA 2P0PA 4CI0C 4E7IA 5J26A 3THKA 1G3SA 4HXJA 5DLQE 4M75E 1U8RA 1MUZA 1JB0E 1B07A 3JRZA 4F7UA 1MMGA 3RNJA 4M75C 4C5EA 2E1HA 4GBQA 3ZL7C 1U3OA 3MEUA 2VWFA 2YUNA 3TSWA 3P8HA 1UGSB 2HSPA 4DBHA 1I1JA 4C92C 3EG9B 4ESRA 4PL6A 5GANd 4FYWB 4ZGEB 3OSVA 3G7ZA 1VQ8A 3JAME 4C8QF 3M0TA 3I56T 3CCUA 4FCYA 3NTKA 2MPXC 5LJ3e 5LJ5f 3QDRB 4P5NA 1FYNA 5AT1B 2HQXA 3OBWA 3CD6T 3MP6A 5LJ3h 4BE2A 3HL8A 3OYYA 3CCMT 2QXFA 3SFMA 2VVKA 3CPWP 2YXYA 3CC2A 3NTIA 4J9EA 1MMAA 2NWMA 4OF1A 1ACMB 5IH2A 1WX6A 5CKEA 1BCMA 9ATCB 2DXUA 1CSKA 3QZ9B 1VQ7Q 1PRMC 1D1BA 2RB6A 1VYVA 1OI1A 1VQNA 4DEXA 4OB3B 2RI2A 1UTIA 3SEMA 2CH4A 1PG5B 2X4XA 4KGVB 2CUDA 4KUDK 1PKSA 4OB1B 1IRXA 2MI6A 3OYFA 3M57A 5LJ5g 2DBMA 3OMGA 2MCNA 2EQIA 2R58A 2A3LA 3EHRA 5IN1A 3V7CA 5GAN2 3CCST 3IQLA 1E6GA 2BZYA 1K73C 4M7AB 2F2VA 1X27A 2ZCFB 3NFCA 3M0RA 1M90R 2ZZDA 4TVRA 1N8RR 3JB9G 1M90C 4Z88A 1JRIA 1GFCA 1D3BB 3J7AF 2MMPA 4J5YA 2IG0A 2B8AA 1IREB 5FLXE 3WVDB 3UF4A 2DXCA 1EFNA 3SHWA 1WFWA 4R0KA 3S6WA 4C0FA 5J39A 4OMMA 3RMQA 1KQSA 3CCRT 3GPLA 2LCSA 2ZAEA 4A63B 4D8KA 2A0FB 4QQ6A 2EJ9A 1RAIB 2EQJA 2HQEA 1NM7A 4BE1A 3O8VA 1VQ4Q 5A0GA 4RG8A 1NJIU 1G3TA 2OX7A 2JS0A 5KE3A 4KGZB 1ZUKA 2LT1A 2QQBA 2BE9B 1X6OA 2DX1A 1YITA 3OYHA 3ULRB 2M1HA 2MWOA 1WXUA 3MEAA 5A0DA 2LVMA 1OYXA 2AT1B 3PIPA 2ZPEB 3LH5A 2DYIA 1RACB 2QI2A 4BD3A 3DLLA 3DB4A 3INZA 4XTUA 5GAN4 2EYQA 3L2WA 1Q7YR 3MJXA 4C92B 4DBFA 4ELYC 4E6RA 1AD5A 1PC0A 1V76A 4M78F 1KQSS 3PE0A 1M4ZA 2KAFA 2QAZA 3MKDA 3UDCA 4EMHA 2B86A 2YHTA 1MNEA 4JRQA 2KQWA 4CRIA 5M9OA 1KQSP 2CP5A 3FEOA 4MMLA 1SSHA 3VYGA 3VS5A 2P84A 2XDDA 4ZTJA 2GGRA 2FZKB 3A8MB 2O9VA 5LJ5j 1RAGB 4FT4A 4IUTA 1WXBA 1JJ2S 4CC7A 5CIUA 1ZA1B 2ABLA 3OY9A 4PFOA 1LCKA 2E6NA 3CCSA 5GAOn 3EFOB 4F14A 3CXCS 2L3RA 3OYEA 1PHTA 2KYMA 1A0NB 4QT7A
chains in the Genus database with same CATH topology
4HVVA 1VYUA 3TSZA 2D1XA 4F17A 5IXBA 2LMJA 4IIOA 2EBPA 3I35A 2E5KA 3PVLA 1W70A 2L2PA 2CH4W 3PVQA 1HSQA 2YUOA 4RTWA 4DEYA 1AVZC 1BB9A 5IHNA 1UHCA 2JM8A 1M3BA 5FWBA 2O88A 1UE9A 1K9AA 1UG1A 3I5SA 1T3LA 1YN8A 2J6OA 2LNHB 4AFZC 2JW4A 1X6GA 2CREA 1UGVA 4X1VA 1QWFA 2CUBA 2DL3A 4RTYA 1QLYA 2AZVA 5GJVB 2AKLA 3O5ZA 2DL8A 2HDAA 2O2OA 2OI3A 2A37A 2NUZA 1PHTA 2YT6A 2A28A 2K6DA 4AG2C 1KFZA 4HVUA 1KSWA 1AZEA 4RUGA 4CC4B 1CKBA 1X2KA 2DE0X 1UJ0A 3UA6A 4D8DA 3VS3A 1AZGB 2BZXA 2JM9A 2L3PA 3H0IA 4M4ZA 2CT4A 4J9FA 3VS6A 2RF0A 2J6FA 4J9IA 2ECZA 1BBZA 4J9CA 1GL5A 1H8KA 2FRWA 2FRYA 4GLMA 1OPKA 2PNIA 1JU5C 3VS4A 4KRTA 2KR3A 2YUPA 3U23A 5HCKA 2EYYA 1BK2A 2KXDA 3A98A 1X43A 2JS2A 2KRNA 1TUDA 1AWXA 3VS1A 3QWYA 2ED0A 1WA7A 4LNPA 3NPFA 2GBQA 1AWWA 2IIMA 1T0HA 2EKHA 2VKNA 3KFVA 1M30A 4JZ4A 1OPLA 1U06A 2EYWA 1WLPB 2RNAA 2A08A 2X3WD 1CKAA 1AOJA 2DNUA 2KE9A 2F2XA 2K3BA 3M0QA 2OJ2A 2PTKA 3NMZC 2LQNA 3EG1A 1TG0A 5L23A 2J06A 1W6XA 2ED1A 4Z89A 2KBTA 1PKTA 2FEIA 2L3QA 1FMKA 2O31A 1UUEA 4JJBA 4LN2A 2DM1A 2GQIA 2KROA 4JJDA 4OMQA 2CSIA 2W10A 2K9GA 5IXFA 2ENMA 2KRSA 5GJWB 1M3AA 1JO8A 1H3HA 1QCFA 4Y92A 1GBQA 1MV0B 2GTOA 3H0HA 1UFFA 2KXCA 2MOXA 4AFUC 1T0JA 2M51A 4OMPA 2YUQA 5EC7A 2RQVA 1NYGA 1ZUUA 2KYBA 2DRKA 1YNZA 2RQRA 4F16A 4J9HA 4IIMA 3RBBB 4JZ3A 2EGEA 2YSQA 4LUEA 2LZ6B 1AEYA 3NHNA 1Z9ZA 1Y57A 1ZBJA 2GTJA 3EHQA 1ABQA 1YWPA 3I9QA 1ARKA 1OV3A 1G2BA 2KRMA 2X3XD 2CDTA 2DL4A 3JV3A 1GCPA 2DJQA 2K7AA 1NG2A 3M0PA 2LJ3A 1GBRA 1SHGA 1WDXA 1KIKA 2RN8A 1Y0MA 2DL5A 3VS7A 1W1FA 2EW3A 1QKWA 5I22A 2SRCA 2JT4A 1JEGA 1I07A 1X6BA 3THKA 2RQTA 1G83A 4WCIA 4HXJA 1M27C 1S1NA 3VRZA 1MUZA 1YWOA 1B07A 1QKXA 2LQWA 2BZ8A 3RNJA 2JMCA 1K4US 4HCKA 2K79A 3QWXX 4GBQA 3ZL7C 2CSQA 1U3OA 4J9DA 2VWFA 2YUNA 3TSWA 1GRIA 1SRLA 2HSPA 1AWJA 2DA9A 3VS2A 1I1JA 1ZUYA 1BU1A 4LUDA 4ESRA 1RI9A 3H0FA 3M0TA 2F2WA 3H41A 5FW9A 1FYNA 4RTTA 2RQWA 1PWTA 1AWOA 1K0XA 2I0NA 2LP5A 2BTTA 1ZLMA 1M3CA 3FJ5A 1M8MA 1PNJA 1Z9QA 2VVKA 2HCKA 4J9EA 2C0OA 3C0CA 2EYZA 2NWMA 1X2QA 1OEBA 2DYBA 2D8JA 5IH2A 1WI7A 1WX6A 2KT8A 1NLOC 4AG1C 1CSKA 1SRMA 4AFQC 3EG0A 1PRMC 1VYVA 5IHKA 4DEXA 1UTIA 1ABOA 2RPNA 4OMLA 2CH4A 3SEMA 2AZSA 2CUDA 2RQUA 2DMOA 1PKSA 1UDLA 2OAWA 1WIEA 2DBMA 2V1QA 3TVTA 2CT3A 2EQIA 3EG3A 2MCNA 2EYXA 4J9BA 3EHRA 2FPEA 1K1ZA 3IQLA 1E6GA 1E6HA 2BZYA 2F2VA 5ECAA 4ZNXA 1X27A 2LJ1A 4K11A 2SEMA 3M0RA 2V1RA 1TUCA 2P4RA 1VYTA 2J7IA 4Z88A 1H92A 1GFCA 2AK5A 4RTXA 3UF4A 2C0IA 2MIOA 3EGUA 1EFNA 2C0TA 3SHWA 5IHIA 5FWCA 1WFWA 4R0KA 2EGCA 4OMMA 2J05A 1J3TA 1PRLC 2LCSA 2JXBA 4A63B 2ROLA 4D8KA 1MV3A 2XMFA 1XOVA 1NM7A 2JMAA 3I5RA 4CC2A 1NLPC 1T3SA 2GNCA 2KNBB 5I11A 1HD3A 4CC3A 4LE9A 1WYXA 2JS0A 2LJ0A 2HEQA 1ZUKA 3CQTA 4JPBW 2DX1A 2L3SA 3M0SA 1YP5A 2LX7A 3ULRB 2AKKA 1WXUA 3M0UA 1E7OA 1GCQA 4RTUA 2DILA 1X69A 1JXOA 1ZX6A 3LH5A 4AFSC 1YCSB 3UA7A 2KGTA 1K76A 4EIKA 1U5SA 3VS0A 4HVWA 1WXTA 1K0SA 1ZSGA 4RTVA 3GBQA 1NEBA 2H8HA 1OOTA 1N5ZA 2G6FX 1SHFA 2DBKA 2HBWA 2KT1A 2O9SA 2RMOA 1QWEA 2FPDA 3UATA 4E6RA 1AD5A 3PE0A 3VRYA 1B3QA 2K2MA 4FSSA 2DL7A 1V1CA 2DF6A 2PZ1A 2FPFA 1RLQC 1GCQC 2B86A 2EPDA 1NYFA 2ESWA 2J6KA 2D0NA 2FO0A 2ROTA 2DRMA 1I0CA 2M0YA 4JJCA 1GFDA 2QDLA 2W0ZA 2DLPA 1SSHA 1JQQA 1VA7A 2YDLA 2EVRA 1SEMA 4Z8AA 3VS5A 2D8HA 2EGAA 2GGRA 1NEGA 1UJYA 1UECA 2FG0A 1SPKA 2O9VA 4J9GA 1RUWA 1WXBA 1RLPC 1KJWA 2DVJA 4CC7A 2L0AA 4OMNA 4RTZA 2ABLA 3R6NA 1HJDA 1LCKA 4ORZA 3REAB 1IO6A 4F14A 2JTEA 3EG2A 1UHFA 3NGPA 4OMOA 1JXMA 3REBB 2A36A 2KEAA 2KYMA 1A0NB 4QT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVV A;  1VYU A;  3TSZ A;  2D1X A;  4F17 A;  5IXB A;  2LMJ A;  4IIO A;  2EBP A;  3I35 A;  2E5K A;  3PVL A;  1W70 A;  2L2P A;  2CH4 W;  3PVQ A;  1HSQ A;  2YUO A;  4RTW A;  4DEY A;  1AVZ C;  1BB9 A;  5IHN A;  1UHC A;  2JM8 A;  1M3B A;  5FWB A;  2O88 A;  1UE9 A;  1K9A A;  1UG1 A;  3I5S A;  1T3L A;  1YN8 A;  2J6O A;  2LNH B;  4AFZ C;  2JW4 A;  1X6G A;  2CRE A;  1UGV A;  4X1V A;  1QWF A;  2CUB A;  2DL3 A;  4RTY A;  1QLY A;  2AZV A;  5GJV B;  2AKL A;  3O5Z A;  2DL8 A;  2HDA A;  2O2O A;  2OI3 A;  2A37 A;  2NUZ A;  1PHT A;  2YT6 A;  2A28 A;  2K6D A;  4AG2 C;  1KFZ A;  4HVU A;  1KSW A;  1AZE A;  4RUG A;  4CC4 B;  1CKB A;  1X2K A;  2DE0 X;  1UJ0 A;  3UA6 A;  4D8D A;  3VS3 A;  1AZG B;  2BZX A;  2JM9 A;  2L3P A;  3H0I A;  4M4Z A;  2CT4 A;  4J9F A;  3VS6 A;  2RF0 A;  2J6F A;  4J9I A;  2ECZ A;  1BBZ A;  4J9C A;  1GL5 A;  1H8K A;  2FRW A;  2FRY A;  4GLM A;  1OPK A;  2PNI A;  1JU5 C;  3VS4 A;  4KRT A;  2KR3 A;  2YUP A;  3U23 A;  5HCK A;  2EYY A;  1BK2 A;  2KXD A;  3A98 A;  1X43 A;  2JS2 A;  2KRN A;  1TUD A;  1AWX A;  3VS1 A;  3QWY A;  2ED0 A;  1WA7 A;  4LNP A;  3NPF A;  2GBQ A;  1AWW A;  2IIM A;  1T0H A;  2EKH A;  2VKN A;  3KFV A;  1M30 A;  4JZ4 A;  1OPL A;  1U06 A;  2EYW A;  1WLP B;  2RNA A;  2A08 A;  2X3W D;  1CKA A;  1AOJ A;  2DNU A;  2KE9 A;  2F2X A;  2K3B A;  3M0Q A;  2OJ2 A;  2PTK A;  3NMZ C;  2LQN A;  3EG1 A;  1TG0 A;  5L23 A;  2J06 A;  1W6X A;  2ED1 A;  4Z89 A;  2KBT A;  1PKT A;  2FEI A;  2L3Q A;  1FMK A;  2O31 A;  1UUE A;  4JJB A;  4LN2 A;  2DM1 A;  2GQI A;  2KRO A;  4JJD A;  4OMQ A;  2CSI A;  2W10 A;  2K9G A;  5IXF A;  2ENM A;  2KRS A;  5GJW B;  1M3A A;  1JO8 A;  1H3H A;  1QCF A;  4Y92 A;  1GBQ A;  1MV0 B;  2GTO A;  3H0H A;  1UFF A;  2KXC A;  2MOX A;  4AFU C;  1T0J A;  2M51 A;  4OMP A;  2YUQ A;  5EC7 A;  2RQV A;  1NYG A;  1ZUU A;  2KYB A;  2DRK A;  1YNZ A;  2RQR A;  4F16 A;  4J9H A;  4IIM A;  3RBB B;  4JZ3 A;  2EGE A;  2YSQ A;  4LUE A;  2LZ6 B;  1AEY A;  3NHN A;  1Z9Z A;  1Y57 A;  1ZBJ A;  2GTJ A;  3EHQ A;  1ABQ A;  1YWP A;  3I9Q A;  1ARK A;  1OV3 A;  1G2B A;  2KRM A;  2X3X D;  2CDT A;  2DL4 A;  3JV3 A;  1GCP A;  2DJQ A;  2K7A A;  1NG2 A;  3M0P A;  2LJ3 A;  1GBR A;  1SHG A;  1WDX A;  1KIK A;  2RN8 A;  1Y0M A;  2DL5 A;  3VS7 A;  1W1F A;  2EW3 A;  1QKW A;  5I22 A;  2SRC A;  2JT4 A;  1JEG A;  1I07 A;  1X6B A;  3THK A;  2RQT A;  1G83 A;  4WCI A;  4HXJ A;  1M27 C;  1S1N A;  3VRZ A;  1MUZ A;  1YWO A;  1B07 A;  1QKX A;  2LQW A;  2BZ8 A;  3RNJ A;  2JMC A;  1K4U S;  4HCK A;  2K79 A;  3QWX X;  4GBQ A;  3ZL7 C;  2CSQ A;  1U3O A;  4J9D A;  2VWF A;  2YUN A;  3TSW A;  1GRI A;  1SRL A;  2HSP A;  1AWJ A;  2DA9 A;  3VS2 A;  1I1J A;  1ZUY A;  1BU1 A;  4LUD A;  4ESR A;  1RI9 A;  3H0F A;  3M0T A;  2F2W A;  3H41 A;  5FW9 A;  1FYN A;  4RTT A;  2RQW A;  1PWT A;  1AWO A;  1K0X A;  2I0N A;  2LP5 A;  2BTT A;  1ZLM A;  1M3C A;  3FJ5 A;  1M8M A;  1PNJ A;  1Z9Q A;  2VVK A;  2HCK A;  4J9E A;  2C0O A;  3C0C A;  2EYZ A;  2NWM A;  1X2Q A;  1OEB A;  2DYB A;  2D8J A;  5IH2 A;  1WI7 A;  1WX6 A;  2KT8 A;  1NLO C;  4AG1 C;  1CSK A;  1SRM A;  4AFQ C;  3EG0 A;  1PRM C;  1VYV A;  5IHK A;  4DEX A;  1UTI A;  1ABO A;  2RPN A;  4OML A;  2CH4 A;  3SEM A;  2AZS A;  2CUD A;  2RQU A;  2DMO A;  1PKS A;  1UDL A;  2OAW A;  1WIE A;  2DBM A;  2V1Q A;  3TVT A;  2CT3 A;  2EQI A;  3EG3 A;  2MCN A;  2EYX A;  4J9B A;  3EHR A;  2FPE A;  1K1Z A;  3IQL A;  1E6G A;  1E6H A;  2BZY A;  2F2V A;  5ECA A;  4ZNX A;  1X27 A;  2LJ1 A;  4K11 A;  2SEM A;  3M0R A;  2V1R A;  1TUC A;  2P4R A;  1VYT A;  2J7I A;  4Z88 A;  1H92 A;  1GFC A;  2AK5 A;  4RTX A;  3UF4 A;  2C0I A;  2MIO A;  3EGU A;  1EFN A;  2C0T A;  3SHW A;  5IHI A;  5FWC A;  1WFW A;  4R0K A;  2EGC A;  4OMM A;  2J05 A;  1J3T A;  1PRL C;  2LCS A;  2JXB A;  4A63 B;  2ROL A;  4D8K A;  1MV3 A;  2XMF A;  1XOV A;  1NM7 A;  2JMA A;  3I5R A;  4CC2 A;  1NLP C;  1T3S A;  2GNC A;  2KNB B;  5I11 A;  1HD3 A;  4CC3 A;  4LE9 A;  1WYX A;  2JS0 A;  2LJ0 A;  2HEQ A;  1ZUK A;  3CQT A;  4JPB W;  2DX1 A;  2L3S A;  3M0S A;  1YP5 A;  2LX7 A;  3ULR B;  2AKK A;  1WXU A;  3M0U A;  1E7O A;  1GCQ A;  4RTU A;  2DIL A;  1X69 A;  1JXO A;  1ZX6 A;  3LH5 A;  4AFS C;  1YCS B;  3UA7 A;  2KGT A;  1K76 A;  4EIK A;  1U5S A;  3VS0 A;  4HVW A;  1WXT A;  1K0S A;  1ZSG A;  4RTV A;  3GBQ A;  1NEB A;  2H8H A;  1OOT A;  1N5Z A;  2G6F X;  1SHF A;  2DBK A;  2HBW A;  2KT1 A;  2O9S A;  2RMO A;  1QWE A;  2FPD A;  3UAT A;  4E6R A;  1AD5 A;  3PE0 A;  3VRY A;  1B3Q A;  2K2M A;  4FSS A;  2DL7 A;  1V1C A;  2DF6 A;  2PZ1 A;  2FPF A;  1RLQ C;  1GCQ C;  2B86 A;  2EPD A;  1NYF A;  2ESW A;  2J6K A;  2D0N A;  2FO0 A;  2ROT A;  2DRM A;  1I0C A;  2M0Y A;  4JJC A;  1GFD A;  2QDL A;  2W0Z A;  2DLP A;  1SSH A;  1JQQ A;  1VA7 A;  2YDL A;  2EVR A;  1SEM A;  4Z8A A;  3VS5 A;  2D8H A;  2EGA A;  2GGR A;  1NEG A;  1UJY A;  1UEC A;  2FG0 A;  1SPK A;  2O9V A;  4J9G A;  1RUW A;  1WXB A;  1RLP C;  1KJW A;  2DVJ A;  4CC7 A;  2L0A A;  4OMN A;  4RTZ A;  2ABL A;  3R6N A;  1HJD A;  1LCK A;  4ORZ A;  3REA B;  1IO6 A;  4F14 A;  2JTE A;  3EG2 A;  1UHF A;  3NGP A;  4OMO A;  1JXM A;  3REB B;  2A36 A;  2KEA A;  2KYM A;  1A0N B;  4QT7 A; 
#chains in the Genus database with same CATH topology
 4MZT A;  1Q7Y C;  4HVV A;  1I5L A;  3FB9 A;  3CC4 T;  1N27 A;  3OS0 A;  2ATC B;  1QVG P;  4F17 A;  2X4Y A;  2F5K A;  2K3X A;  3HRT A;  2QQS A;  1W2B P;  1YJW A;  1B34 B;  4N4I A;  2E5K A;  1W70 A;  3FJP A;  1K9M C;  1RAE B;  1BKB A;  1Y71 A;  2L2P A;  3CCV A;  1KG1 A;  1WHJ A;  1BB9 A;  1UHC A;  1Q86 R;  3X20 B;  3JCM J;  5GAO q;  1T3L A;  2LNH B;  2JW4 A;  4ELZ C;  3LGL A;  4BDZ A;  1YJW T;  2E6Z A;  1QVG A;  2CRE A;  5KE2 A;  2ZPH B;  4E2F B;  1QWF A;  2CUB A;  3LX7 A;  4XTY A;  5HKC A;  3DB3 A;  1MMN A;  2O2O A;  2YT6 A;  2A28 A;  4HCZ A;  4AG2 C;  1YJ9 T;  4M7D E;  1CKB A;  3PTA A;  3UT1 A;  4EMG A;  2V8I A;  3VKI A;  1YJ9 Q;  1AZG B;  2JM9 A;  2L3P A;  4M4Z A;  1AT1 B;  2HNI A;  2ECZ A;  2HAX A;  3SWN C;  4WTO B;  5KYN A;  1YHQ Q;  2FRY A;  4A54 A;  4EMK C;  2PNI A;  1JU5 C;  3EGD A;  5GAM j;  4KRT A;  3QYH B;  2VXF A;  2EYY A;  3A1P A;  4FYV B;  4IUR A;  1BIA A;  2DFU A;  5CCA A;  2XI9 A;  5HK0 A;  2IIM A;  3MP1 A;  1WHM A;  2E65 A;  1U06 A;  4F7U B;  3M53 A;  1UEB A;  2QEX A;  3CC2 T;  4IUV A;  5GMK h;  2RJD A;  1CKA A;  2DNU A;  2F2X A;  2X51 A;  2FYK A;  5C6S A;  5GAO l;  3L2R A;  3EG1 A;  1BI3 A;  1Q86 U;  4JDS A;  2EFI A;  5L23 A;  2J06 A;  3OS2 A;  3MEW A;  4LXC A;  3CBM A;  4LD9 K;  1M1F A;  4OGC A;  2L3Q A;  4DBR A;  1VQM T;  5DM7 R;  4LN2 A;  3CC4 A;  3RMS A;  4C92 A;  4OMQ A;  3PT9 A;  1K73 U;  4QVZ A;  3OYM A;  5IXF A;  2ENM A;  1JO8 A;  4FYX B;  3QUI A;  4M77 G;  3PFS A;  3H0H A;  3I55 Q;  1UFF A;  3CMA A;  2MK5 A;  4XU1 A;  1X01 A;  4C5H A;  1OQK A;  1DJ7 B;  3S3O A;  4C0G A;  4ZGD B;  3OB9 A;  3CD6 A;  1S72 Q;  3JB9 F;  2EGE A;  2YSQ A;  5HK3 A;  2GF7 A;  3NHN A;  4IUP A;  5GAM d;  4M75 B;  1YWP A;  4A4G A;  3RES A;  2DTO A;  2F1L A;  2F5T X;  3JV3 A;  4KUL A;  3CMA Q;  1GCP A;  1NG2 A;  4C8Q C;  4LD6 A;  3H6Z A;  3BE3 A;  1GBR A;  1SHG A;  1Y0M A;  1BIB A;  3VS7 A;  1VQP T;  1U1S A;  1FX7 A;  5CQX A;  2BKD N;  1YJ9 A;  5I22 A;  4RMO A;  2O4X A;  1X6B A;  4EMK B;  3HHT B;  4WCI A;  1YWO A;  2CGH A;  1IHW A;  2E3I A;  4PJN A;  1QKX A;  2LQW A;  2JMC A;  2E5Q A;  2K79 A;  3QWX X;  1M1K R;  5KYU B;  4FSX A;  5CKB A;  2LQ8 A;  1SRL A;  1MMD A;  3M58 A;  1N9S A;  3JCM c;  1ZUY A;  4LUD A;  2EQK A;  3H0F A;  5GAN j;  2F2W A;  4KGX B;  3FLG A;  4C8Q G;  2XU8 A;  3FC3 A;  3MO8 A;  1GXI E;  2RQW A;  1OUL A;  5GAN 6;  3C95 A;  2E3H A;  3EGD B;  2KVQ G;  1ZLM A;  1M3C A;  2NUP B;  2ZGW A;  1VQ5 T;  2DO3 A;  4JS5 A;  3CME A;  1Y07 A;  1Z9Q A;  2HCK A;  2C0O A;  2X9H A;  2XG8 D;  4DBQ A;  4KH1 B;  3OYL A;  3S3M A;  1MHN A;  2X35 A;  3V8J A;  6AT1 B;  2XDB A;  4BI4 A;  4FL6 A;  1N6A A;  1SRM A;  4AFQ C;  3GLX A;  1IGQ A;  5IHK A;  1KD1 R;  3FRN A;  1ABO A;  2LNV A;  2RPN A;  2Y4Y A;  2AZS A;  5CQY A;  2RQU A;  2YLB A;  3H9N A;  1VQ6 Q;  1X75 C;  3EH1 A;  2OAW A;  4BY6 B;  1M1G A;  1MND A;  3RUX A;  1JJ2 A;  2VYT A;  2DZ9 A;  3TVT A;  2EYX A;  4J9B A;  1VQO A;  2FPE A;  2D9T A;  3CMA T;  3SD4 A;  4B9X A;  1VQ9 T;  5KYY B;  2Y4X A;  2SEM A;  1M2V A;  1WQ7 A;  4C92 F;  5GAO r;  1M1K U;  2JOY A;  4O6J A;  1VIE A;  4VUB A;  1K8A C;  1NPR A;  4Y91 A;  5CR2 A;  2C0T A;  3AT1 B;  4A4F A;  5IHI A;  1TWB A;  3E19 A;  4Q5W A;  2JXB A;  1M1K C;  2GCX A;  4HKE A;  1I8F A;  1JBM A;  4C8Q A;  4C8Q B;  1PM3 A;  3C4S A;  3G6E A;  2XMF A;  1BI2 A;  2E4H A;  1XOV A;  1WJQ A;  2JMA A;  3MP8 A;  3M5A A;  1MGQ A;  4QQG A;  3GOX A;  3CCQ T;  1HD3 A;  1WYX A;  2LJ0 A;  5CKH A;  3CQT A;  4PFP A;  4PJO B;  3QZ5 B;  1YP5 A;  2LX7 A;  3G6E T;  2XDP A;  2A7Y A;  2LT4 A;  1D0Y A;  2RH2 A;  1C1A A;  1GCQ A;  3HRS A;  5LJ5 d;  2RJF A;  2WSE E;  4IUQ A;  2RI3 A;  5GAN f;  3JCM f;  1K76 A;  4EIK A;  5GMK m;  2LDM A;  4RTV A;  1NEB A;  2H3J A;  3G71 Q;  1OOT A;  1VQL T;  1WHK A;  2G6F X;  2DBK A;  2KT1 A;  2D0Q B;  1P92 A;  2O9S A;  1VQ4 T;  2CZ0 B;  3UAT A;  2QGF B;  1VQK A;  2MF2 A;  4JJN K;  3VRY A;  4M7D F;  4C8Q E;  2K2M A;  3SDZ A;  3LW5 E;  1QVF S;  2DF6 A;  2R5M A;  4PJL A;  3BFM A;  2EIF A;  1YFN A;  4XTV A;  1QVG S;  2RHY A;  2QYZ A;  1GCQ C;  2EPD A;  1VQN Q;  1ZSZ C;  1VQO Q;  2MWP A;  1I4K 1;  4M7D C;  2ROT A;  5KYU A;  4FIB A;  2LQK A;  1GFD A;  4XTX A;  2QDL A;  1SKU B;  3J81 E;  2DLP A;  2ZPI B;  1JQQ A;  3VJP A;  1VA7 A;  2YDL A;  5GMK i;  2D8H A;  1Q81 U;  1XJW B;  3CXC P;  2DKG A;  3QHS A;  2FG0 A;  4J9G A;  4J6Y A;  2JTF A;  3OBY A;  1VQP Q;  4E47 A;  3I56 A;  3CCU T;  2LRQ A;  1YI2 Q;  3C94 A;  4EDU A;  1NE8 A;  4RTZ A;  5C0M A;  1IO6 A;  3EG2 A;  1BI0 A;  1JXM A;  4MDW A;  1YIT T;  4KT0 E;  1XNI A;  4IKF A;  2EWN A;  3EFR A;  1V29 B;  4HT9 A;  1FXX A;  4IIO A;  2PU9 B;  1NPP A;  2RK1 A;  2CH4 W;  1HSQ A;  5KYY A;  4MMK A;  5GAN 3;  4M78 D;  4JLI A;  2JM8 A;  1M3B A;  2BE7 D;  3ZFJ A;  2O88 A;  1K9A A;  3I5S A;  1QW1 A;  2HBP A;  4RKU E;  4AFZ C;  1BYM A;  1M5Q 1;  1PCX A;  2QGG A;  4XU3 A;  2E12 A;  1Q82 C;  1KQ2 A;  3L2U A;  1WHH A;  2DL8 A;  2HDA A;  3CCL Q;  2A37 A;  4JLG A;  1YJN A;  1IHV A;  2RO0 A;  1AZE A;  4RUG A;  3E2U A;  3OYJ A;  2DE0 X;  1QQJ A;  4D8D A;  2HSE B;  2H3E B;  3JCM X;  1YBY A;  2CT4 A;  3CCJ A;  3E1S A;  5KYX B;  2J6F A;  5GAM h;  1BI1 A;  1I5O B;  3ER0 A;  1VQ7 A;  2FRW A;  1OPK A;  2YUP A;  2NUP A;  3QWY A;  4M77 A;  1NZ9 A;  2PVO B;  4PJO D;  1EIF A;  3NPF A;  4ME7 A;  2O4X B;  4BDY A;  2E10 A;  3OYC A;  2EQM A;  5J3B A;  4M7D B;  1M30 A;  2OTJ Q;  3JB9 J;  3HFN A;  5FU6 B;  3JCM h;  1QVF P;  3CME T;  3ME9 A;  2Z0W A;  2A08 A;  3T9N A;  1M9S A;  1AOJ A;  4ZN3 A;  3G4S Q;  2K3B A;  4JRI A;  5GMK j;  2YWW A;  2PTK A;  3NMZ C;  4LDV A;  3TQ7 P;  2LQN A;  3JB9 H;  4A4H A;  3L2Q A;  4M7D A;  8ATC B;  2KMT A;  5KYW B;  3RDV A;  1K8A U;  3CCR Q;  1W6X A;  1W4S A;  1VQ9 Q;  2QG9 B;  2G3R A;  2FL7 A;  1FMK A;  1S72 A;  1R0B G;  1UUE A;  1YI2 T;  2QDY B;  3CCU Q;  1NBE B;  3URG A;  4MZM A;  3L2Z A;  1M3A A;  1YIT Q;  1K73 R;  2KK4 A;  4PJO C;  3JCM g;  3V7S A;  1T0J A;  2M51 A;  4OMP A;  2YUQ A;  3PMI A;  4M7A E;  4L59 A;  1TS9 A;  1TOV A;  1ZUU A;  3BW1 A;  1TTH B;  4N0A A;  2DRK A;  4ZN1 A;  5I2S A;  1YNZ A;  3ASK A;  4AT1 B;  3CCM A;  4IIM A;  1LOJ A;  2KI7 A;  4B6M A;  1Z9Z A;  1Y57 A;  2OTL A;  1ZBJ A;  2GTJ A;  2ZPF B;  3OW2 P;  1ABQ A;  3OYB A;  2DD5 A;  4R56 A;  3A8L B;  4N4H A;  2KRM A;  4FW1 A;  2X3X D;  2DL4 A;  3CBO A;  1WGS A;  4L6V 5;  2LJ3 A;  4M77 E;  1YIJ A;  1VQN T;  4O5V A;  1O9S A;  1WDX A;  1KIK A;  2DL5 A;  1ZBX A;  4M78 G;  1W1F A;  1EZZ B;  1F1B B;  2VGN A;  3PMT A;  1Y7X A;  4M77 B;  4XQ3 A;  1OU8 A;  4C92 E;  4A53 A;  1UGQ B;  1HXD A;  2FZC B;  4FYY B;  2CZ6 B;  1WJS A;  3RIR A;  4X9D A;  2RQT A;  1G83 A;  3RKY A;  2RHU A;  3G71 A;  2HD0 A;  2CP7 A;  8AT1 B;  3EAE A;  3JCM P;  1M27 C;  3BDL A;  3VRZ A;  1VQL Q;  1TU0 B;  1K4U S;  1VQ7 T;  2CSQ A;  4J9D A;  1Y96 B;  1GRI A;  1AWJ A;  2DA9 A;  4M7A F;  2GFU A;  5I2M A;  3H8Z A;  3PIO A;  2GQV A;  3EGX B;  2RM4 A;  5FW9 A;  4PJO E;  3CCL T;  3AHU A;  2DK3 A;  3QXE B;  1KC8 U;  3CBP A;  1AWO A;  4M78 C;  2I0N A;  3P8D A;  1VQK Q;  1K0X A;  2LP5 A;  4OVA A;  4C0D C;  2RJE A;  1VQK T;  3FJ5 A;  4J6X A;  3WVE B;  1G3W A;  2K5F A;  3LLR A;  1M8M A;  1PNJ A;  4M77 F;  3MEV A;  2EYZ A;  5DLO A;  1X2Q A;  5GAN g;  1OEB A;  3KBG A;  5CAI A;  2KT8 A;  1QVP A;  2JZ2 A;  1NLO C;  4EPC A;  5I21 A;  1KC8 R;  3EG0 A;  2DET A;  3ZBD A;  4XTZ A;  2HL3 A;  1YI2 A;  2XD0 A;  2E41 A;  1VQ6 T;  1UDL A;  2V1Q A;  2CT3 A;  1ZQ1 A;  2F69 A;  2CP3 A;  5A0L A;  5CK9 A;  1K1Z A;  1E6H A;  2MAM A;  3F70 A;  4PJO F;  5ECA A;  2QEX T;  4ZNX A;  2LJ1 A;  4K11 A;  1TUC A;  3M54 A;  1VYT A;  2XK0 A;  1UGR B;  2C06 A;  5HY6 A;  2VC8 A;  1H92 A;  2C0I A;  3EGU A;  1YIJ T;  2DXT A;  2XIC A;  1QVF A;  2KY9 A;  5KCH A;  2PQW A;  3D7S B;  1SSF A;  2J05 A;  3SB2 A;  1PRL C;  2M02 A;  2ROL A;  4PLI A;  1VOM A;  4ANJ A;  3I5R A;  4CC2 A;  1T3S A;  2GNC A;  2KNB B;  1KD1 C;  4PLL A;  3G71 T;  1KK7 A;  2HEQ A;  4DOV A;  4J7F A;  3EFO A;  2L3S A;  3V8L A;  2AKK A;  1ZSZ B;  5GAN e;  2DIL A;  4AFS C;  4C0D B;  3QDF A;  4M78 B;  3JCM e;  3CC7 Q;  5CKF A;  4BE0 A;  3VS0 A;  4HVW A;  5IAY A;  2CKK A;  1ZSG A;  3GBQ A;  2H8H A;  3CME Q;  2Y90 A;  1N5Z A;  2HBW A;  2HZY A;  5A2Q E;  1QWE A;  2FPD A;  1XTD A;  4F04 B;  2YRV A;  3VUB A;  1VQP A;  4KBM B;  1B3Q A;  1V1C A;  5GAN 5;  2PZ1 A;  3A8O B;  2FPF A;  4YTL A;  2QA4 A;  2P0K A;  2J6K A;  3E9F A;  2DD4 A;  2FO0 A;  2DRM A;  5KH6 A;  1I0C A;  4JJC A;  3A8H B;  1TUG B;  4QVD A;  3E9G A;  1SEM A;  1TH7 A;  4OB2 B;  4Z8A A;  2EGA A;  1K9M R;  1UJY A;  1RUW A;  1G3Y A;  3NTH A;  5FRN A;  2K57 A;  2VGM A;  2QA4 T;  2QK0 A;  1S72 T;  3LGF A;  5KYW A;  1U1T A;  1R0C B;  5GAN h;  1FMV A;  3M9Q A;  2L0A A;  4OMN A;  4M77 C;  2R57 A;  5FRO A;  1PD1 A;  2QTV A;  3CCJ T;  3CCJ Q;  1RAH B;  4NS5 A;  2KDS A;  1WQW A;  2JTE A;  1UHF A;  2JVV A;  3NGP A;  4OMO A;  3REB B;  3OYI A;  3GP8 A;  3M4G A;  3G1J A;  1PD0 A;  4N4G A;  1YJN Q;  3LWH A;  4BI8 B;  4EMK A;  4X9C A;  2LMJ A;  1QP2 A;  2EBP A;  2HKQ B;  4BB7 A;  3I35 A;  2DPP B;  2K3Y A;  3HRU A;  3QO3 A;  3JCM V;  1KD1 U;  2X4W A;  2LX9 A;  4RTW A;  3CCE A;  2OTL T;  3VU3 C;  2FHD A;  1LVK A;  1RAD B;  4DA4 A;  5FWB A;  3CPW A;  3KUF A;  2HKN A;  1IZ6 A;  2K4Y A;  1YN8 A;  3OYK A;  2OAU A;  2YRD A;  3X25 B;  1X6G A;  4BY6 C;  2X4J A;  3CEY A;  1UGV A;  4M77 D;  3L42 A;  2VB6 A;  2AZV A;  1AHJ B;  2D6F A;  1VQO T;  2DZC A;  1Q7Y U;  4M7A A;  2K5L A;  4QQD A;  2NUZ A;  3CC7 T;  2LTO A;  3JCM b;  2RHI A;  1BCO A;  1Q81 C;  1KFZ A;  1VQM A;  1X2K A;  2R5A A;  2ZPG B;  4JS4 A;  2BZX A;  2V26 A;  3VS6 A;  3OYN A;  1KC8 C;  2RF0 A;  2E64 A;  4J9C A;  4E7S A;  4PKC C;  1H8K A;  4M7A D;  3X26 B;  1OX8 A;  2KR3 A;  3U23 A;  4C0Z A;  1BK2 A;  2KXD A;  1X43 A;  2JS2 A;  2P4T A;  3G4S A;  2ED0 A;  1WA7 A;  4LNP A;  1K9M U;  2GBQ A;  2EKH A;  2VKN A;  3KFV A;  2M16 A;  3HKS A;  3CPF A;  1PSF A;  1OPL A;  3CCQ A;  1G5V A;  3TCJ A;  2EYW A;  3TU4 K;  1WLP B;  4XU2 A;  3JCM W;  4UC4 A;  1Q81 R;  2IVW A;  3A5Z B;  1QCO A;  2JNG A;  4BUG A;  2WAC A;  3M0Q A;  4PJM A;  2OJ2 A;  1OZ3 A;  5LJ3 g;  4FT2 A;  3SWN B;  2CP2 A;  4M78 A;  2OTL Q;  3BDU A;  3G6E Q;  2ED1 A;  2QEX Q;  1WZO A;  3LWI A;  4PJO A;  3CPW S;  4LDX A;  1IXD A;  1NJI R;  1RL2 A;  3FDR A;  3OQ5 A;  1UB4 A;  2GQI A;  1VQL A;  2KRO A;  3L2V A;  4JJD A;  4XK8 E;  2CSI A;  2W10 A;  4D6W A;  2K9G A;  3RKX A;  2K2V A;  5EG2 A;  5GJW B;  1QCN A;  1H3H A;  4M75 A;  4Y92 A;  1YJN T;  1EX4 A;  1GBQ A;  1MV0 B;  3DKM A;  2O01 E;  2GTO A;  1XQH A;  2MOX A;  4AFU C;  2RQV A;  1NYG A;  5LL6 S;  3X28 B;  4WF2 A;  5GAO p;  3CCL A;  4HT8 A;  2RQR A;  1C6V X;  2COY A;  3RBB B;  3CXC A;  4N0A C;  4JZ3 A;  1OZ2 A;  3GIB A;  4A4K A;  1AEY A;  4RG2 A;  5GAM g;  3EHQ A;  3P8B B;  1N8R U;  4GLK A;  3I9Q A;  1ARK A;  4QKU A;  2DIG A;  1SG5 A;  4M7A G;  1G2B A;  1VQM Q;  3CC2 Q;  4OMF B;  2WSF E;  2FVU A;  4PFZ A;  4Z02 A;  3QPH A;  4DOW A;  2QQ9 A;  2K5I A;  2SRC A;  1ZSZ A;  2JT4 A;  2L89 A;  1I07 A;  3VV0 A;  2OTJ A;  1LNX A;  2JJ9 A;  3HPW A;  2RK2 A;  1S1N A;  2CS7 A;  3QII A;  4PK4 A;  2RJC A;  2BZ8 A;  4NL2 A;  4HCK A;  1D1A A;  1RI0 A;  1M2V B;  5CVI A;  4C8Q D;  3VS2 A;  3RKW A;  4HCB A;  2AIR B;  1BU1 A;  1RAA B;  4A4E A;  1RI9 A;  3R6O A;  3H41 A;  4OB0 B;  5GAN 7;  2V8K A;  1W2B S;  4RTT A;  4E7L A;  5GMK l;  1PWT A;  4RCC A;  2PUK B;  2BTT A;  2DEQ A;  1YHQ T;  2EJG A;  2DER A;  1WJR A;  1PSE A;  2CYZ B;  5GMK e;  1YJW Q;  2RI5 A;  4M7D G;  3Q1J A;  3C0C A;  3OS1 A;  3M56 A;  4QW2 A;  1NJI C;  5FRM A;  5D6W A;  5CO7 A;  2DYB A;  2D8J A;  2ZPB B;  1WI7 A;  3LYI A;  4AG1 C;  1KQ1 A;  1LJO A;  4KUI A;  1YHQ A;  5GAN 8;  3N5B B;  4BI3 A;  5KCO A;  2IPO B;  5LJ3 d;  1R8O B;  3GNF B;  3CCQ Q;  4OML A;  3V8K A;  1KHC A;  1ZHI A;  3ZEH A;  4MZP A;  2DMO A;  5GAM e;  2HQH A;  3QKJ A;  1WIE A;  1Q82 U;  3UPU A;  4BAC A;  1D09 B;  3QBY A;  5FU6 C;  3EG3 A;  4LDU A;  2EKO A;  2HMA A;  5FU7 B;  7AT1 B;  3KXT A;  2GFA A;  2M0O A;  4MDX A;  2XID A;  3CCE Q;  3S3N A;  2L8D A;  2V1R A;  2DXB A;  2P4R A;  2LCL A;  2J7I A;  1D3B A;  3OS5 A;  1QP3 A;  2AK5 A;  5KYX A;  4RTX A;  5LJ3 j;  2MIO A;  3CCE T;  3VUZ A;  5FWC A;  2EGC A;  4LDY A;  4IUU A;  1J3T A;  4C5I A;  4J8O A;  3I55 T;  4B9W A;  3QYG B;  1MV3 A;  2KSS A;  4NL3 A;  5AYF A;  1WPY A;  4E7H A;  1NLP C;  1K8A R;  2LC4 A;  1OX9 A;  4J83 A;  1B7T A;  3FIF A;  4JRK A;  5I11 A;  1HYO A;  4CC3 A;  2LCC A;  2VAS A;  4LE9 A;  5DY9 A;  3CC7 A;  3L1A A;  3M4Y A;  3MCA B;  5D6Y A;  4JPB W;  3CD6 Q;  3M0S A;  2NUT A;  3QJ6 A;  1D0Z A;  4AMC A;  2I2L A;  2EQU A;  2CZ1 B;  3M0U A;  1E7O A;  4RTU A;  3EGX A;  2M9U A;  1X69 A;  1JXO A;  1ZX6 A;  1YCS B;  3UA7 A;  1VQ5 Q;  2KGT A;  3M59 A;  1KHI A;  1VQ6 A;  1VQ8 T;  4XAX B;  1B34 A;  1U5S A;  2HL5 C;  4DQ2 A;  1WXT A;  1K0S A;  4FW2 A;  4RCB A;  4X34 A;  3JB9 D;  2PUO B;  4J6W A;  3OA6 A;  4ZTF A;  1SHF A;  4F7U F;  2RMO A;  1LPL A;  5GAM f;  5D6X A;  4FSS A;  4XU0 A;  2DL7 A;  3MET A;  1SF9 A;  2QQA A;  3OYA A;  4FM4 B;  1Q82 R;  2YRC A;  3CCR A;  1RLQ C;  2E70 A;  2RA2 A;  2EAY A;  1NYF A;  2ESW A;  2MYS A;  2D0N A;  2M0Y A;  2NUT B;  4HCC A;  1WHG A;  2COW A;  3A8G B;  2W0Z A;  3EFS A;  3JCM d;  4HA8 A;  2EVR A;  1NEG A;  1UEC A;  2QTX A;  1SPK A;  5FU7 C;  2VXE A;  1Q95 G;  1RLP C;  1KJW A;  1I81 A;  2DVJ A;  4PJO G;  1UGP B;  3R6N A;  1HJD A;  2QQR A;  4NOY A;  4ORZ A;  2DIQ A;  3REA B;  1YIJ Q;  1RAB B;  2A36 A;  2KEA A;  1VYU A;  3WXM B;  1OU9 A;  3QSU A;  3TSZ A;  1O75 A;  2D1X A;  3G4S T;  4FU6 A;  4C92 D;  2EJF A;  5IXB A;  2NYS A;  2DJZ A;  3UWN A;  3PVL A;  3I55 A;  2FB7 A;  1FMW A;  4XTW A;  4LDW A;  3CCS Q;  3PVQ A;  2YUO A;  1WNL A;  3TEE A;  2DAQ A;  1VQ4 A;  2P0Q A;  4DEY A;  4M7A C;  1AVZ C;  4L5G A;  5IHN A;  4JUV A;  1UE9 A;  1UG1 A;  3OYG A;  2J6O A;  3GF5 A;  4X1V A;  3JB9 I;  2DL3 A;  4RTY A;  1QLY A;  2JN0 A;  3MHX A;  5GJV B;  2AKL A;  3BY7 A;  3O5Z A;  2JTM A;  3GNG A;  2OI3 A;  4OGE A;  3MPU B;  4M75 D;  1VQ8 Q;  1RAF B;  2K6D A;  2VUB A;  4HVU A;  3JSC A;  2OTJ T;  1KSW A;  3EG9 A;  3I56 Q;  4Y28 E;  1QMC A;  2CP6 A;  3RER A;  4CC4 B;  1D0X A;  2BUD A;  2NLU A;  1UJ0 A;  3UA6 A;  2RHX A;  1JJ2 P;  4ZGJ B;  3VS3 A;  5LJ5 e;  3HTR A;  3H0I A;  4J9F A;  5LJ5 h;  1M8V A;  4J9I A;  1BBZ A;  4V2S A;  1GL5 A;  3CCM Q;  5LJ3 f;  4GLM A;  3VS4 A;  2L5Q A;  5HCK A;  3A98 A;  1ZA2 B;  2KRN A;  1TUD A;  2XHC A;  4OP0 A;  1IGU A;  1AWX A;  3VS1 A;  3PNW C;  4C5G A;  3X24 B;  4PJJ A;  5IT9 E;  2DEU A;  1WHL A;  1AWW A;  3HP9 A;  1T0H A;  1N9R A;  3OSS C;  4M7D D;  1W2B A;  4E7K A;  4JZ4 A;  2VV5 A;  1TSF A;  2RNA A;  1VQ9 A;  4JRP A;  2X3W D;  2QAS A;  1H64 1;  3OMC A;  1M2O A;  2CZ7 B;  2BIV A;  3VYH B;  2KE9 A;  3RR6 A;  2WSC E;  1R77 A;  4E7Z A;  2RD1 A;  3QG1 A;  1G8X A;  3LH0 A;  1TG0 A;  3QJY A;  3PGG A;  4R55 A;  2PVD B;  4Z89 A;  1N8R C;  3TRE A;  2KBT A;  4KH0 B;  3EH2 A;  1PKT A;  3V7R A;  2FEI A;  2RHZ A;  1D1C A;  2O31 A;  4JJB A;  2DM1 A;  3DLM A;  1VIF A;  1VUB A;  2FZG B;  2KRS A;  4M75 F;  1QCF A;  4GY5 A;  3CCV Q;  4F7U E;  4J7I A;  3OYD A;  2KXC A;  3OW2 S;  5EC7 A;  1VQ5 A;  3J80 E;  2KYB A;  4F7U G;  2DTH A;  1Y96 A;  5L8R E;  1IB8 A;  4F16 A;  4J9H A;  1YCY A;  3HFO A;  4ATO A;  1FWZ A;  4LUE A;  2LZ6 B;  3CCV T;  3CC4 Q;  2YLC A;  4M75 G;  2COZ A;  3M55 A;  4E7J A;  3SWN A;  5D7U A;  3OW2 A;  3C12 A;  4C92 G;  1TXQ A;  1HK9 A;  1OV3 A;  5CKD A;  4II1 A;  1H3Z A;  4M78 E;  1Q86 C;  4QVC A;  2PVG B;  2CDT A;  3JCM Q;  2JUF A;  2DJQ A;  2K7A A;  3M0P A;  1C0M A;  1M90 U;  2XKO C;  2DTI A;  2V8J A;  2QA4 Q;  2RN8 A;  2AHJ B;  2CP0 A;  3HSB A;  2EW3 A;  4PNO A;  1QKW A;  2DVE A;  5GAO m;  1JEG A;  2P0P A;  4CI0 C;  4E7I A;  5J26 A;  3THK A;  1G3S A;  4HXJ A;  5DLQ E;  4M75 E;  1U8R A;  1MUZ A;  1JB0 E;  1B07 A;  3JRZ A;  4F7U A;  1MMG A;  3RNJ A;  4M75 C;  4C5E A;  2E1H A;  4GBQ A;  3ZL7 C;  1U3O A;  3MEU A;  2VWF A;  2YUN A;  3TSW A;  3P8H A;  1UGS B;  2HSP A;  4DBH A;  1I1J A;  4C92 C;  3EG9 B;  4ESR A;  4PL6 A;  5GAN d;  4FYW B;  4ZGE B;  3OSV A;  3G7Z A;  1VQ8 A;  3JAM E;  4C8Q F;  3M0T A;  3I56 T;  3CCU A;  4FCY A;  3NTK A;  2MPX C;  5LJ3 e;  5LJ5 f;  3QDR B;  4P5N A;  1FYN A;  5AT1 B;  2HQX A;  3OBW A;  3CD6 T;  3MP6 A;  5LJ3 h;  4BE2 A;  3HL8 A;  3OYY A;  3CCM T;  2QXF A;  3SFM A;  2VVK A;  3CPW P;  2YXY A;  3CC2 A;  3NTI A;  4J9E A;  1MMA A;  2NWM A;  4OF1 A;  1ACM B;  5IH2 A;  1WX6 A;  5CKE A;  1BCM A;  9ATC B;  2DXU A;  1CSK A;  3QZ9 B;  1VQ7 Q;  1PRM C;  1D1B A;  2RB6 A;  1VYV A;  1OI1 A;  1VQN A;  4DEX A;  4OB3 B;  2RI2 A;  1UTI A;  3SEM A;  2CH4 A;  1PG5 B;  2X4X A;  4KGV B;  2CUD A;  4KUD K;  1PKS A;  4OB1 B;  1IRX A;  2MI6 A;  3OYF A;  3M57 A;  5LJ5 g;  2DBM A;  3OMG A;  2MCN A;  2EQI A;  2R58 A;  2A3L A;  3EHR A;  5IN1 A;  3V7C A;  5GAN 2;  3CCS T;  3IQL A;  1E6G A;  2BZY A;  1K73 C;  4M7A B;  2F2V A;  1X27 A;  2ZCF B;  3NFC A;  3M0R A;  1M90 R;  2ZZD A;  4TVR A;  1N8R R;  3JB9 G;  1M90 C;  4Z88 A;  1JRI A;  1GFC A;  1D3B B;  3J7A F;  2MMP A;  4J5Y A;  2IG0 A;  2B8A A;  1IRE B;  5FLX E;  3WVD B;  3UF4 A;  2DXC A;  1EFN A;  3SHW A;  1WFW A;  4R0K A;  3S6W A;  4C0F A;  5J39 A;  4OMM A;  3RMQ A;  1KQS A;  3CCR T;  3GPL A;  2LCS A;  2ZAE A;  4A63 B;  4D8K A;  2A0F B;  4QQ6 A;  2EJ9 A;  1RAI B;  2EQJ A;  2HQE A;  1NM7 A;  4BE1 A;  3O8V A;  1VQ4 Q;  5A0G A;  4RG8 A;  1NJI U;  1G3T A;  2OX7 A;  2JS0 A;  5KE3 A;  4KGZ B;  1ZUK A;  2LT1 A;  2QQB A;  2BE9 B;  1X6O A;  2DX1 A;  1YIT A;  3OYH A;  3ULR B;  2M1H A;  2MWO A;  1WXU A;  3MEA A;  5A0D A;  2LVM A;  1OYX A;  2AT1 B;  3PIP A;  2ZPE B;  3LH5 A;  2DYI A;  1RAC B;  2QI2 A;  4BD3 A;  3DLL A;  3DB4 A;  3INZ A;  4XTU A;  5GAN 4;  2EYQ A;  3L2W A;  1Q7Y R;  3MJX A;  4C92 B;  4DBF A;  4ELY C;  4E6R A;  1AD5 A;  1PC0 A;  1V76 A;  4M78 F;  1KQS S;  3PE0 A;  1M4Z A;  2KAF A;  2QAZ A;  3MKD A;  3UDC A;  4EMH A;  2B86 A;  2YHT A;  1MNE A;  4JRQ A;  2KQW A;  4CRI A;  5M9O A;  1KQS P;  2CP5 A;  3FEO A;  4MML A;  1SSH A;  3VYG A;  3VS5 A;  2P84 A;  2XDD A;  4ZTJ A;  2GGR A;  2FZK B;  3A8M B;  2O9V A;  5LJ5 j;  1RAG B;  4FT4 A;  4IUT A;  1WXB A;  1JJ2 S;  4CC7 A;  5CIU A;  1ZA1 B;  2ABL A;  3OY9 A;  4PFO A;  1LCK A;  2E6N A;  3CCS A;  5GAO n;  3EFO B;  4F14 A;  3CXC S;  2L3R A;  3OYE A;  1PHT A;  2KYM A;  1A0N B;  4QT7 A; 
#chains in the Genus database with same CATH homology
 4HVV A;  1VYU A;  3TSZ A;  2D1X A;  4F17 A;  5IXB A;  2LMJ A;  4IIO A;  2EBP A;  3I35 A;  2E5K A;  3PVL A;  1W70 A;  2L2P A;  2CH4 W;  3PVQ A;  1HSQ A;  2YUO A;  4RTW A;  4DEY A;  1AVZ C;  1BB9 A;  5IHN A;  1UHC A;  2JM8 A;  1M3B A;  5FWB A;  2O88 A;  1UE9 A;  1K9A A;  1UG1 A;  3I5S A;  1T3L A;  1YN8 A;  2J6O A;  2LNH B;  4AFZ C;  2JW4 A;  1X6G A;  2CRE A;  1UGV A;  4X1V A;  1QWF A;  2CUB A;  2DL3 A;  4RTY A;  1QLY A;  2AZV A;  5GJV B;  2AKL A;  3O5Z A;  2DL8 A;  2HDA A;  2O2O A;  2OI3 A;  2A37 A;  2NUZ A;  1PHT A;  2YT6 A;  2A28 A;  2K6D A;  4AG2 C;  1KFZ A;  4HVU A;  1KSW A;  1AZE A;  4RUG A;  4CC4 B;  1CKB A;  1X2K A;  2DE0 X;  1UJ0 A;  3UA6 A;  4D8D A;  3VS3 A;  1AZG B;  2BZX A;  2JM9 A;  2L3P A;  3H0I A;  4M4Z A;  2CT4 A;  4J9F A;  3VS6 A;  2RF0 A;  2J6F A;  4J9I A;  2ECZ A;  1BBZ A;  4J9C A;  1GL5 A;  1H8K A;  2FRW A;  2FRY A;  4GLM A;  1OPK A;  2PNI A;  1JU5 C;  3VS4 A;  4KRT A;  2KR3 A;  2YUP A;  3U23 A;  5HCK A;  2EYY A;  1BK2 A;  2KXD A;  3A98 A;  1X43 A;  2JS2 A;  2KRN A;  1TUD A;  1AWX A;  3VS1 A;  3QWY A;  2ED0 A;  1WA7 A;  4LNP A;  3NPF A;  2GBQ A;  1AWW A;  2IIM A;  1T0H A;  2EKH A;  2VKN A;  3KFV A;  1M30 A;  4JZ4 A;  1OPL A;  1U06 A;  2EYW A;  1WLP B;  2RNA A;  2A08 A;  2X3W D;  1CKA A;  1AOJ A;  2DNU A;  2KE9 A;  2F2X A;  2K3B A;  3M0Q A;  2OJ2 A;  2PTK A;  3NMZ C;  2LQN A;  3EG1 A;  1TG0 A;  5L23 A;  2J06 A;  1W6X A;  2ED1 A;  4Z89 A;  2KBT A;  1PKT A;  2FEI A;  2L3Q A;  1FMK A;  2O31 A;  1UUE A;  4JJB A;  4LN2 A;  2DM1 A;  2GQI A;  2KRO A;  4JJD A;  4OMQ A;  2CSI A;  2W10 A;  2K9G A;  5IXF A;  2ENM A;  2KRS A;  5GJW B;  1M3A A;  1JO8 A;  1H3H A;  1QCF A;  4Y92 A;  1GBQ A;  1MV0 B;  2GTO A;  3H0H A;  1UFF A;  2KXC A;  2MOX A;  4AFU C;  1T0J A;  2M51 A;  4OMP A;  2YUQ A;  5EC7 A;  2RQV A;  1NYG A;  1ZUU A;  2KYB A;  2DRK A;  1YNZ A;  2RQR A;  4F16 A;  4J9H A;  4IIM A;  3RBB B;  4JZ3 A;  2EGE A;  2YSQ A;  4LUE A;  2LZ6 B;  1AEY A;  3NHN A;  1Z9Z A;  1Y57 A;  1ZBJ A;  2GTJ A;  3EHQ A;  1ABQ A;  1YWP A;  3I9Q A;  1ARK A;  1OV3 A;  1G2B A;  2KRM A;  2X3X D;  2CDT A;  2DL4 A;  3JV3 A;  1GCP A;  2DJQ A;  2K7A A;  1NG2 A;  3M0P A;  2LJ3 A;  1GBR A;  1SHG A;  1WDX A;  1KIK A;  2RN8 A;  1Y0M A;  2DL5 A;  3VS7 A;  1W1F A;  2EW3 A;  1QKW A;  5I22 A;  2SRC A;  2JT4 A;  1JEG A;  1I07 A;  1X6B A;  3THK A;  2RQT A;  1G83 A;  4WCI A;  4HXJ A;  1M27 C;  1S1N A;  3VRZ A;  1MUZ A;  1YWO A;  1B07 A;  1QKX A;  2LQW A;  2BZ8 A;  3RNJ A;  2JMC A;  1K4U S;  4HCK A;  2K79 A;  3QWX X;  4GBQ A;  3ZL7 C;  2CSQ A;  1U3O A;  4J9D A;  2VWF A;  2YUN A;  3TSW A;  1GRI A;  1SRL A;  2HSP A;  1AWJ A;  2DA9 A;  3VS2 A;  1I1J A;  1ZUY A;  1BU1 A;  4LUD A;  4ESR A;  1RI9 A;  3H0F A;  3M0T A;  2F2W A;  3H41 A;  5FW9 A;  1FYN A;  4RTT A;  2RQW A;  1PWT A;  1AWO A;  1K0X A;  2I0N A;  2LP5 A;  2BTT A;  1ZLM A;  1M3C A;  3FJ5 A;  1M8M A;  1PNJ A;  1Z9Q A;  2VVK A;  2HCK A;  4J9E A;  2C0O A;  3C0C A;  2EYZ A;  2NWM A;  1X2Q A;  1OEB A;  2DYB A;  2D8J A;  5IH2 A;  1WI7 A;  1WX6 A;  2KT8 A;  1NLO C;  4AG1 C;  1CSK A;  1SRM A;  4AFQ C;  3EG0 A;  1PRM C;  1VYV A;  5IHK A;  4DEX A;  1UTI A;  1ABO A;  2RPN A;  4OML A;  2CH4 A;  3SEM A;  2AZS A;  2CUD A;  2RQU A;  2DMO A;  1PKS A;  1UDL A;  2OAW A;  1WIE A;  2DBM A;  2V1Q A;  3TVT A;  2CT3 A;  2EQI A;  3EG3 A;  2MCN A;  2EYX A;  4J9B A;  3EHR A;  2FPE A;  1K1Z A;  3IQL A;  1E6G A;  1E6H A;  2BZY A;  2F2V A;  5ECA A;  4ZNX A;  1X27 A;  2LJ1 A;  4K11 A;  2SEM A;  3M0R A;  2V1R A;  1TUC A;  2P4R A;  1VYT A;  2J7I A;  4Z88 A;  1H92 A;  1GFC A;  2AK5 A;  4RTX A;  3UF4 A;  2C0I A;  2MIO A;  3EGU A;  1EFN A;  2C0T A;  3SHW A;  5IHI A;  5FWC A;  1WFW A;  4R0K A;  2EGC A;  4OMM A;  2J05 A;  1J3T A;  1PRL C;  2LCS A;  2JXB A;  4A63 B;  2ROL A;  4D8K A;  1MV3 A;  2XMF A;  1XOV A;  1NM7 A;  2JMA A;  3I5R A;  4CC2 A;  1NLP C;  1T3S A;  2GNC A;  2KNB B;  5I11 A;  1HD3 A;  4CC3 A;  4LE9 A;  1WYX A;  2JS0 A;  2LJ0 A;  2HEQ A;  1ZUK A;  3CQT A;  4JPB W;  2DX1 A;  2L3S A;  3M0S A;  1YP5 A;  2LX7 A;  3ULR B;  2AKK A;  1WXU A;  3M0U A;  1E7O A;  1GCQ A;  4RTU A;  2DIL A;  1X69 A;  1JXO A;  1ZX6 A;  3LH5 A;  4AFS C;  1YCS B;  3UA7 A;  2KGT A;  1K76 A;  4EIK A;  1U5S A;  3VS0 A;  4HVW A;  1WXT A;  1K0S A;  1ZSG A;  4RTV A;  3GBQ A;  1NEB A;  2H8H A;  1OOT A;  1N5Z A;  2G6F X;  1SHF A;  2DBK A;  2HBW A;  2KT1 A;  2O9S A;  2RMO A;  1QWE A;  2FPD A;  3UAT A;  4E6R A;  1AD5 A;  3PE0 A;  3VRY A;  1B3Q A;  2K2M A;  4FSS A;  2DL7 A;  1V1C A;  2DF6 A;  2PZ1 A;  2FPF A;  1RLQ C;  1GCQ C;  2B86 A;  2EPD A;  1NYF A;  2ESW A;  2J6K A;  2D0N A;  2FO0 A;  2ROT A;  2DRM A;  1I0C A;  2M0Y A;  4JJC A;  1GFD A;  2QDL A;  2W0Z A;  2DLP A;  1SSH A;  1JQQ A;  1VA7 A;  2YDL A;  2EVR A;  1SEM A;  4Z8A A;  3VS5 A;  2D8H A;  2EGA A;  2GGR A;  1NEG A;  1UJY A;  1UEC A;  2FG0 A;  1SPK A;  2O9V A;  4J9G A;  1RUW A;  1WXB A;  1RLP C;  1KJW A;  2DVJ A;  4CC7 A;  2L0A A;  4OMN A;  4RTZ A;  2ABL A;  3R6N A;  1HJD A;  1LCK A;  4ORZ A;  3REA B;  1IO6 A;  4F14 A;  2JTE A;  3EG2 A;  1UHF A;  3NGP A;  4OMO A;  1JXM A;  3REB B;  2A36 A;  2KEA A;  2KYM A;  1A0N B;  4QT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...