1GL5A

Nmr structure of the sh3 domain from the tec protein tyrosine kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'GSEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNNLDQYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE TEC
publication title The solution structure and intramolecular associations of the Tec kinase SRC homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gl5A00
2HEQA 2L3QA 1GBQA 4HVUA 1X27A 1U06A 1OPKA 1YCSB 2EW3A 4JJDA 1WXUA 1AWWA 2LZ6B 2DRKA 1OPLA 3UATA 2KBTA 1T0HA 2DL7A 2AK5A 3NHNA 1A0NB 1UUEA 2J6OA 2JT4A 2RQRA 2RQWA 3VS4A 2CT3A 2K6DA 1W6XA 2GGRA 2X3WD 1GFCA 1M30A 1YWOA 2K9GA 2GTJA 1X6GA 2X3XD 4HCKA 1CSKA 2J7IA 1X43A 2FG0A 1UFFA 2RPNA 1NG2A 4JZ4A 2K79A 3U23A 4WCIA 2KRSA 1ZLMA 4Z88A 1H3HA 3SEMA 4J9FA 1B07A 1B3QA 2D0NA 2F2WA 4AG1C 1UJ0A 4AFQC 1TUCA 1MUZA 4F16A 2DJQA 2OI3A 2LP5A 2BTTA 3H0FA 2D8HA 2OJ2A 3CQTA 4JJCA 1FMKA 4EIKA 1ZSGA 2BZXA 2VKNA 1YP5A 3I9QA 1NEGA 2VWFA 1K4US 3NGPA 1VA7A 2ESWA 2AKLA 1YN8A 4AFUC 1VYUA 2EGEA 2KXCA 3PE0A 2LCSA 4HXJA 1E6GA 2DYBA 2RF0A 5L23A 3I5RA 2LX7A 2C0OA 2GNCA 1TUDA 2BZYA 1ARKA 3EG1A 4IIOA 4LE9A 3M0QA 3KFVA 1PRMC 3M0PA 2XMFA 2J05A 4LUDA 1ZUYA 2JXBA 2CREA 2LMJA 1TG0A 1HD3A 1UGVA 2D1XA 4CC2A 1K76A 2V1RA 1BU1A 2PZ1A 2EYWA 2M0YA 4D8DA 3UA7A 1H8KA 3RBBB 2L3SA 2DF6A 3SHWA 2BZ8A 1UJYA 3VS7A 2F2XA 4ZNXA 3VRZA 1AZEA 2EYZA 4FSSA 3ULRB 3O5ZA 3THKA 2DILA 1BBZA 2KT1A 3LH5A 2SEMA 3VS3A 2O9SA 3VS5A 2RQVA 4F14A 1H92A 2NWMA 2PNIA 1VYVA 1I0CA 1RLPC 2CH4W 3QWXX 1RUWA 3VS6A 2E5KA 1XOVA 1JXMA 1Z9QA 2YUQA 2DL8A 4DEXA 1FYNA 2HCKA 1AEYA 2GBQA 2LNHB 2KROA 2DX1A 1VYTA 1M3AA 1N5ZA 4GBQA 2EYXA 1UE9A 1S1NA 5FWBA 4AFZC 3VS0A 4CC4B 1UECA 4J9DA 4IIMA 2J6KA 2FPFA 5GJWB 1JEGA 2LJ0A 1W70A 2DM1A 2CUBA 4RTZA 2IIMA 2GQIA 1QLYA 1WYXA 2YUNA 2KXDA 4KRTA 2AKKA 1SRLA 2DBMA 2RQUA 1J3TA 2YT6A 1AZGB 3UA6A 4F17A 2JMCA 5ECAA 1QWFA 1MV0B 1G2BA 1PRLC 1SEMA 2CUDA 2D8JA 2CT4A 4QT7A 2P4RA 2PTKA 1UHFA 4LUEA 2KYBA 5IXBA 4GLMA 3M0RA 1GFDA 2K3BA 1SSHA 3A98A 1ZUUA 1GCQC 1PNJA 2DE0X 3REAB 4CC7A 1M3CA 3EHRA 4J9GA 4RTWA 1NYGA 2F2VA 2MOXA 5FWCA 3M0TA 1UG1A 1KFZA 2LQNA 4HVVA 2FPEA 2KRMA 4J9EA 4CC3A 4LN2A 4OMNA 3I35A 1NLPC 5FW9A 1PWTA 2DRMA 1KIKA 4M4ZA 1X69A 5IHKA 2G6FX 2GTOA 4LNPA 1IO6A 2DBKA 2A37A 2H8HA 2KR3A 2O2OA 2ABLA 1Y0MA 2MIOA 2M51A 1PKTA 2DL3A 3M0UA 4OMPA 2FPDA 2NUZA 3NMZC 1HSQA 4J9IA 2FEIA 1G83A 1E6HA 1GCQA 3JV3A 4HVWA 1QWEA 3EHQA 4OMMA 2C0TA 2O9VA 3H0IA 2KNBB 1KSWA 2ECZA 2YUOA 1AWJA 2CH4A 2L3PA 2EPDA 1V1CA 1M3BA 4OMLA 5IHIA 1SHFA 2JM9A 2OAWA 2DL5A 2LQWA 1BK2A 2CSQA 4JPBW 1E7OA 1GBRA 2ROLA 1PHTA 1NLOC 1OOTA 3EGUA 2K2MA 2RN8A 1JO8A 2YDLA 2CSIA 5I11A 1U3OA 4DEYA 4JZ3A 1JXOA 4ORZA 1X2KA 1GL5A 1JU5C 2W10A 2J06A 1MV3A 1ABOA 4RTXA 4Z89A 1WLPB 3RNJA 2JS2A 1WX6A 2V1QA 3EG0A 4J9HA 2ROTA 1K9AA 1SHGA 3M0SA 1UTIA 1AVZC 1SPKA 1GCPA 4R0KA 1YNZA 5GJVB 5EC7A 2KEAA 4A63B 2EVRA 4E6RA 1T3LA 3EG2A 1Z9ZA 2MCNA 2KYMA 1PKSA 3UF4A 1X2QA 1SRMA 2ED1A 2JW4A 5I22A 2KT8A 2JS0A 3NPFA 2W0ZA 2LJ3A 3TSWA 1RLQC 1CKBA 4OMOA 2KE9A 1HJDA 3EG3A 4X1VA 2A36A 1RI9A 4J9BA 2DVJA 1EFNA 2A08A 2DL4A 2EYYA 2JMAA 1I1JA 1M8MA 3PVQA 3R6NA 3GBQA 2HDAA 2EGCA 1WDXA 3H0HA 4OMQA 3VS1A 1K0XA 2HSPA 3REBB 1T3SA 1NYFA 1W1FA 1ABQA 1M27C 1UHCA 1BB9A 4AG2C 2L0AA 2O88A 1QKWA 2L2PA 2A28A 2YSQA 2EQIA 2I0NA 3TSZA 2DA9A 2EBPA 3ZL7C 4RTUA 1X6BA 1JQQA 2C0IA 1U5SA 1QKXA 2KGTA 1WA7A 4K11A 2RMOA 1CKAA 4RUGA 4RTTA 1T0JA 2FRWA 2JTEA 1AOJA 4JJBA 1Y57A 1LCKA 4Y92A 3H41A 4J9CA 2HBWA 2FO0A 3C0CA 3VRYA 2EKHA 2O31A 3VS2A 2DNUA 4RTYA 1OV3A 2ED0A 3I5SA 1WXTA 1QCFA 3QWYA 2DMOA 2LJ1A 2AZVA 1I07A 2AZSA 5IXFA 1NEBA 1ZX6A 1KJWA 3IQLA 1ZUKA 3TVTA 3FJ5A 1UDLA 5HCKA 2YUPA 2J6FA 2FRYA 1OEBA 2DLPA 2EGAA 2SRCA 4AFSC 2RQTA 4ESRA 1ZBJA 4RTVA 4D8KA 2QDLA 1K0SA 2K7AA 2KRNA 2CDTA 1WXBA 1AWOA 1AD5A 3PVLA 1AWXA 1GRIA 2B86A 2RNAA 2ENMA 2JM8A 1YWPA 1WIEA 4Z8AA 5IHNA 5IH2A 1NM7A 1WFWA 1K1ZA 2VVKA 1WI7A
chains in the Genus database with same CATH superfamily
3EGDB 1Q86U 1U06A 2LTOA 1OPKA 3UDCA 1VQ4A 1OPLA 1FX7A 2EQMA 2KBTA 1M9SA 2FB7A 3OYLA 1A0NB 4KGVB 1NZ9A 1ACMB 2QQ9A 2CT3A 4KT0E 2VV5A 2JJ9A 1QQJA 1KQSA 4XTVA 1GFCA 1M30A 2K9GA 4PJMA 4OB1B 2YHTA 3MP1A 1W2BS 1CSKA 1UFFA 2RPNA 1OX8A 3AHUA 3PIOA 3VV0A 1Q82U 4Z88A 1H3HA 2QG9B 3CCMA 3VKIA 1D0XA 2LQKA 1VQ6A 3CEYA 1B3QA 2XHCA 3MEVA 1UJ0A 2HQEA 3JAME 2IPOB 2BTTA 5KH6A 3H0FA 2D8HA 4BE1A 1FMKA 1WZOA 4J7FA 2ZPFB 2ZZDA 2RHUA 5A0LA 1VQLA 1WGSA 3M55A 2E41A 2PVOB 2EIFA 3M54A 1G5VA 4C0DC 1TTHB 4C92E 3TU4K 1VA7A 2EWNA 4PJLA 4NL2A 4C5EA 1QVGA 3PE0A 2EGEA 4KUIA 4HXJA 2RF0A 5LJ5f 4O5VA 1BCOA 5GANh 2BZYA 4X9DA 3KBGA 4IIOA 4N4HA 3SDZA 1OU8A 4FU6A 3LWHA 2HD0A 4DA4A 5GAMh 2HQHA 3CD6A 1I5OB 2KI7A 3MPUB 3V8JA 1VQ7T 3DB3A 4C0GA 1UGVA 1XTDA 2E65A 5GMKh 1K76A 2CZ0B 3FC3A 3MKDA 2PZ1A 2M0YA 2EJ9A 4B9XA 3QBYA 2ZGWA 2L3SA 1YITT 1VQPT 4QQ6A 1UJYA 2X4YA 4EMHA 2DD5A 2M16A 1BIAA 2O9SA 4C8QE 1KC8R 1VQ5A 4ME7A 5GAN5 5GAN4 1VQKQ 1I0CA 3ER0A 2E6ZA 3FEOA 4F7UB 1MGQA 1V76A 1XOVA 1M2OA 4C0ZA 1VQ9A 3RMQA 1Z9QA 2YUQA 1YJWT 4M75A 4II1A 5CKHA 4BE0A 4DEXA 1YI2Q 1FYNA 5KYWA 3OSSC 1AEYA 4IUPA 2GBQA 4E7SA 2KROA 1M90R 3CBPA 1IGQA 1ZSZC 1M3AA 2O01E 1N5ZA 2OTJQ 3SWNB 4ATOA 5LL6S 4AFZC 4FT4A 5GAN3 2QA4A 2J6KA 5I2SA 3F70A 2QDYB 1D1BA 2RK1A 2CUBA 4J7IA 1B34A 2GQIA 1QLYA 3OYBA 2YUNA 1SRLA 2RQUA 3WVEB 1AZGB 2JMCA 5ECAA 4M7DA 1SEMA 3CCQA 4ZGEB 2P4RA 2PTKA 1O9SA 1M1FA 4R55A 2FYKA 2KY9A 5IXBA 3M0RA 3P8HA 1GFDA 1YIJT 2COZA 3WVDB 2BE9B 2XU8A 3CBMA 5GAMe 2NUPB 1M3CA 3PFSA 4PLLA 2F2VA 1B7TA 2O4XB 3I56T 3WXMB 1I81A 5GMKe 3CMEA 4J9EA 4PJNA 4M7DF 4OMNA 3CBOA 4M77E 5IHKA 2QI2A 2MK5A 4L59A 4LNPA 3HRTA 1WHHA 2H8HA 1VQ4T 4B6MA 3OYEA 3NMZC 4D6WA 1HSQA 4C92B 4KBMB 1GCQA 3VJPA 1Q86R 3CCSA 4OMMA 3H0IA 3FLGA 2KNBB 1R77A 2E64A 1WHGA 4ZN1A 2CP5A 2ECZA 3NTHA 1Y96A 2YUOA 2L3PA 1VQ7Q 2QQBA 1SHFA 3INZA 4M7DB 2DL5A 4OB0B 1HXDA 5DM7R 2BUDA 4C5HA 4M7AC 3EG9B 5DLQE 1PHTA 4JDSA 2CP2A 2Y4XA 2K2MA 2RN8A 2K3YA 1Q82R 2ZAEA 1S72A 1YITQ 2DTIA 3SFMA 4XU2A 5D6WA 3I55T 4JRIA 1JU5C 2W10A 1MV3A 3MP6A 5KYUB 1FMVA 3A8MB 2A0FB 1SSFA 1C6VX 1SHGA 2E70A 3BW1A 3M0SA 1AVZC 1SPKA 3MEUA 2DIGA 3OBYA 4M75G 3RKWA 4AMCA 4JS4A 4KUDK 1PKSA 3V7RA 2VGMA 1ZA2B 5I22A 5LJ5j 1WQWA 2W0ZA 3TSWA 2X4JA 3LGLA 5GAN7 4RKUE 3EG3A 1QP2A 3CD6T 2HSEB 1RI9A 4J9BA 2DVJA 2A08A 2DL4A 4DBRA 1KD1C 2JMAA 3PVQA 4JRQA 2EGCA 4PLIA 3GF5A 2RJCA 3OW2A 5CIUA 4E7LA 5D7UA 1NJIC 3JCMV 3SWNC 2RA2A 4LDWA 4M7DG 2EQKA 4RCCA 2EQIA 1D1CA 3TSZA 4BI4A 1C1AA 3TREA 1WA7A 1TXQA 5CO7A 1VQ5T 5HK0A 4E7HA 4KGXB 2RM4A 2VXFA 1HYOA 4RUGA 5IT9E 4ZGJB 4EMKB 1IREB 4HCBA 4A4EA 4HCCA 5FU7B 1KD1U 4A4GA 3PT9A 1AOJA 3I56Q 3UPUA 1W2BA 1JBMA 3C0CA 2NUTA 3GP8A 2EKHA 2O31A 3VS2A 1VQ9T 2ZPEB 2DZ9A 4N4IA 1K9MC 2C06A 4JRPA 2P0KA 3URGA 1NJIU 3QG1A 3QSUA 3EH1A 4RG2A 4M77B 1ZX6A 3IQLA 1VQ4Q 2D9TA 3TVTA 2QA4T 1YHQT 3OYJA 4DBFA 3JB9I 2HZYA 1OEBA 5CAIA 3JCMh 4AFSC 4BI3A 2QDLA 2K7AA 2KRNA 3QIIA 1FWZA 5J39A 1AWXA 4XTYA 3CCQT 2DIQA 3ZBDA 4C92C 3QDFA 3CCMQ 4XTUA 4M7DD 2DEUA 1WI7A 2L3QA 3OS0A 3E9GA 1N27A 1YCSB 3JCMP 4JJDA 1AWWA 2RI2A 1BI1A 1IHWA 1KK7A 1QW1A 3SD4A 5LJ5d 2EQJA 2RHYA 2XKOC 1IGUA 2DL7A 2AK5A 3T9NA 2YWWA 1UUEA 1K73U 3JCMX 2J6OA 2JT4A 3JCMQ 2RQRA 3I55Q 2NUTB 3QO3A 3N5BB 2WACA 4N0AA 3MP8A 2R5AA 2GTJA 1VQLQ 3CCEA 1QVGP 2J7IA 1X43A 4C5GA 3G6EA 2ZPHB 3QPHA 1YJ9A 2K79A 3U23A 4BY6B 2AIRB 2KRSA 2LDMA 3CCST 4J9FA 3M4GA 4AFQC 2MAMA 3OYFA 2VB6A 4FCYA 3S3OA 2LP5A 3O8VA 4JS5A 3CD6Q 2LT1A 2P0PA 2LC4A 1TSFA 2OJ2A 3M9QA 2VYTA 1UGPB 2VWFA 1JJ2A 1K4US 3UWNA 2ESWA 4CRIA 1YN8A 1S72T 4MZTA 4IUTA 4AFUC 3BE3A 2LCSA 1E6GA 5CK9A 2RI5A 3A1PA 3A8OB 2LX7A 2XK0A 1DJ7B 2C0OA 2M02A 2GNCA 4MZPA 5CR2A 3JCMe 4ELZC 2QK0A 4FW1A 4LE9A 4F04B 1VQ5Q 1PRMC 1Q81C 2XMFA 2J05A 3JSCA 5GANg 3M58A 5CVIA 3X24B 1VQ9Q 1QCOA 5GAMg 3LWIA 3UA7A 1VQKT 3RBBB 3SHWA 2JTMA 1SKUB 2BZ8A 2FVUA 3VS7A 2F2XA 2KSSA 4EMKC 2FHDA 5FU7C 4ZNXA 3VRZA 1MMGA 2L89A 2P4TA 1WPYA 2EYZA 4PL6A 2QA4Q 4FSSA 3ULRB 2DILA 2KT1A 2Y4YA 3M56A 1NPRA 2SEMA 3V8LA 2RQVA 4F14A 2FL7A 2QASA 2OTJT 1Q81U 2PVGB 3E1SA 2K3XA 1LPLA 4J6XA 1RLPC 3CC4A 4EMGA 2RJDA 1BKBA 1TUGB 2X9HA 3QWXX 1RUWA 3X28B 1D0YA 4M77C 1Q7YU 3R6OA 1GXIE 1WJSA 3CCQQ 1LJOA 1RADB 4IKFA 1LNXA 1VQMA 2DL8A 2HCKA 4NS5A 4PJOA 1BI3A 3CPWS 4HT8A 4GBQA 4Y91A 3CCUA 2WSCE 4CC4B 4KH0B 1UECA 2M9UA 2ZPGB 1JEGA 2FPFA 1IXDA 2Y90A 3OYAA 5KCHA 1KQ1A 3CMEQ 3PTAA 1WNLA 3DLLA 1AT1B 3MJXA 4RTZA 2CZ7B 1KD1R 1WYXA 1TS9A 4KRTA 5GMKl 4TVRA 2L5QA 2YT6A 4PNOA 2EJFA 3EGXA 3ASKA 2E3IA 4L6V5 2QEXA 3OS5A 4LUEA 1NJIR 2KYBA 3CCSQ 2XDDA 5IN1A 1U1TA 2K3BA 2CKKA 1PNJA 1EX4A 3EHRA 4LXCA 4QVDA 4RTWA 5FWCA 2DXTA 1UEBA 8ATCB 2DTHA 1KFZA 2QXFA 2QYZA 4HVVA 3GLXA 4LN2A 2DPPB 1BI2A 1PWTA 2DRMA 2A3LA 4M4ZA 2G6FX 1N9SA 3H6ZA 2A37A 3CXCS 1Y0MA 2MIOA 2M51A 2DL3A 1D1AA 4M7DE 2FPDA 1S72Q 2XD0A 2FEIA 5CKFA 3A5ZB 3JV3A 1QWEA 2A7YA 3EHQA 2X51A 3G4SA 3CCET 3RKXA 4KGZB 1K73R 3G6ET 2CH4A 1N6AA 3S6WA 1YJ9T 1M3BA 2E4HA 5HY6A 3EGXB 2CS7A 5IHIA 2OAWA 1BK2A 3EAEA 4JPBW 1RI0A 1K8AC 2LQ8A 4M78A 3MEAA 5CQYA 4E7JA 1RAIB 2CP7A 2F69A 2CSIA 1KQ2A 3E19A 1U3OA 3M5AA 4DEYA 1NBEB 4JZ3A 3OW2P 1G3WA 4ORZA 1X6OA 4PFPA 1R0CB 3QZ9B 2CP3A 3QUIA 1X75C 1BI0A 3L2ZA 4PJJA 4RTXA 3NFCA 4B9WA 4A4HA 2JS2A 4FM4B 3L1AA 2RJEA 5KYYA 3LW5E 3E2UA 4M78F 1YNZA 3S3NA 1AHJB 5EC7A 2KEAA 4A63B 4E6RA 3EG2A 1K8AU 3BY7A 2MCNA 2KYMA 1SRMA 2ED1A 4PJOG 2KT8A 5J26A 3CCRA 2DD4A 4M75F 3META 1W2BP 2KE9A 1HJDA 2DAQA 3CCVA 4M7AG 2Z0WA 4XTXA 3R6NA 3GBQA 1WDXA 2RHXA 3JCMJ 5GANf 4UC4A 1KG1A 2COYA 2CP6A 2RHIA 5CKBA 1NYFA 1ABQA 1UHCA 3CCLA 2CP0A 4M78B 3A8GB 4AG2C 3HRSA 2L0AA 5GAMf 5GMKi 1QKWA 4HA8A 3L2RA 2YSQA 4LDYA 2EBPA 3OY9A 1N8RC 2IVWA 1LOJA 3QHSA 4M75B 4K11A 1D3BA 1CKAA 1ZHIA 5KYWB 4JJNK 2VVKA 3RR6A 4KULA 1T0JA 2FRWA 3CC4T 4JJBA 1Y57A 1LCKA 2V26A 3EH2A 1M4ZA 1WHKA 1Q81R 2OTLA 2ED0A 2GFAA 4PK4A 2R57A 1ZQ1A 3QWYA 5LJ3g 4FYVB 2LJ1A 4C8QA 4A4FA 1I07A 1B34B 1Q7YR 1NEBA 3CCUT 3RUXA 1KJWA 2K5FA 3FJ5A 4YTLA 4E7IA 2X35A 3JB9G 1N8RU 3CCMT 5EG2A 1RACB 1VQ6T 2DLPA 5GAN2 2RQTA 1M1KC 2DZCA 2JNGA 2CDTA 5LJ3d 1AWOA 3CCEQ 2HAXA 3S3MA 4OF1A 4Y28E 1RAGB 3G6EQ 1YWPA 2PUOB 1WIEA 4Z8AA 1YJ9Q 3PMTA 4DBQA 2QEXT 5IH2A 2MF2A 4JLGA 2HEQA 4HVUA 1X27A 2HBPA 1VQLT 4M78G 2KK4A 1WXUA 3MCAB 1UB4A 3LGFA 1WHLA 1VOMA 3CCJA 3QYGB 3NHNA 3KXTA 1PC0A 2OX7A 4QQDA 2K6DA 2QGFB 1JJ2P 5I2MA 1W6XA 1R0BG 2GGRA 2X3WD 1YWOA 2K2VA 3OS1A 4DBHA 2NYSA 2X3XD 3HSBA 4IUQA 5KE2A 4LD6A 4JZ4A 1Y96B 1ZLMA 1VQNA 2L8DA 3SEMA 1B07A 2H3EB 2HL5C 3FB9A 3G4ST 2F2WA 1PD1A 4A4KA 5GMKm 1TUCA 1QMCA 4OB3B 2RI3A 2DJQA 2VC8A 1NE8A 3OYIA 4OB2B 2F5KA 4EIKA 3OA6A 2RHZA 2CGHA 1YP5A 2CZ1B 3I9QA 2GCXA 4QQGA 2QQSA 3NGPA 1OX9A 4J6YA 3JRZA 2AKLA 4M78D 3CPWA 1Y7XA 3JCMW 5L23A 3I5RA 3CC7A 1IB8A 1FXXA 1ARKA 4JRKA 4E47A 4NOYA 3KFVA 4M75D 2HKNA 1EIFA 2HNIA 1QVPA 4XU1A 2PU9B 1ZUYA 3CC4Q 2CREA 2LMJA 4QW2A 4EDUA 1KQSP 5FROA 1HD3A 3JB9H 1F1BB 4PFZA 3OYYA 1IHVA 5C6SA 2DJZA 3GPLA 4BACA 1QVFS 1JB0E 3CCRT 3BDUA 1VQMQ 4L5GA 5FLXE 4BB7A 4C8QG 4M75C 1H8KA 1O75A 2DF6A 2KVQG 4QVZA 1G3YA 1K8AR 3CCVT 4OGEA 3VYHB 3CCUQ 1JRIA 3EFRA 2RH2A 1AZEA 1R8OB 1TWBA 5KYXA 1K9MU 1BBZA 2K5IA 3LH5A 1U1SA 2XG8D 3PIPA 2QGGA 1VQ6Q 3VS5A 2RO0A 1H92A 1MMAA 2LRQA 2PNIA 4OP0A 1G3SA 3CCLT 5GANj 1WQ7A 3H9NA 2CH4W 2YXYA 4XQ3A 1KC8C 1PSFA 3CXCA 5GAMj 3CMET 2QEXQ 4J83A 3DB4A 4M7DC 2LNHB 2DX1A 1UE9A 1I5LA 1S1NA 4JLIA 3L2UA 3OBWA 3VS0A 4IIMA 4FSXA 2LT4A 2DXUA 3C12A 3MEWA 5GJWB 2LJ0A 2NLUA 2LVMA 2DM1A 2VASA 4C0DB 1PD0A 3OMCA 4AT1B 4EPCA 2OTLT 5KYNA 3HFNA 3G1JA 1VQPA 3VUZA 2MPXC 2ATCB 4F17A 3V7SA 5LJ3f 1QWFA 1MV0B 3BDLA 4QT7A 1X01A 1UHFA 2DK3A 1ZSZA 2XIDA 4Q5WA 1SSHA 2DFUA 1ZUUA 3M53A 3G4SQ 1GCQC 3REAB 4CC7A 1WHMA 4LD9K 3M0TA 1N8RR 1UG1A 4MZMA 2LQNA 4MMKA 4LDUA 2KRMA 1YJWA 2YRDA 3EGDA 3MO8A 4CC3A 1KIKA 1YCYA 4ANJA 1IO6A 4O6JA 3CC2A 1RL2A 3CCJT 3M0UA 2ZCFB 4OMPA 2NUZA 2F5TX 2K57A 2YLCA 1OU9A 1G83A 4HVWA 2FZKB 4RCBA 2VXEA 2O9VA 3ME9A 3H8ZA 1W4SA 3PGGA 1KSWA 1UGSB 4HT9A 4R56A 4BD3A 1VQ8A 5KE3A 2XDPA 3OYCA 1YI2T 1P92A 5LJ5h 4KH1B 5GANd 4OMLA 4GY5A 4FL6A 1VQNT 2LQWA 1PCXA 2EFIA 1YIJA 3L2WA 2ROLA 3A8HB 5GAMd 1NLOC 3CCRQ 5FRNA 1OOTA 3RDVA 3VUBA 2DERA 1JO8A 2YDLA 2BKDN 2V8JA 4E7ZA 3OB9A 4E7KA 3J7AF 2QAZA 3CCVQ 1X2KA 3TEEA 2J06A 4C5IA 4Z89A 5AYFA 3RNJA 1ZA1B 2V1QA 2ROTA 2YRCA 1K9AA 4OGCA 3CCLQ 4R0KA 2E5QA 3V7CA 5GJVB 4M7AA 2QQRA 2EVRA 5CKEA 3CC7T 3OS2A 1T3LA 1D0ZA 5A0GA 2HQXA 4X9CA 3UF4A 4M78E 2JS0A 3NPFA 1WJRA 4J5YA 3OYMA 5I21A 1RLQC 1CKBA 3LLRA 4PJOF 3V8KA 5GAOp 3X20B 1TH7A 9ATCB 1I1JA 3RMSA 2HDAA 4M75E 4DOVA 3H0HA 4OMQA 3VS1A 4M7AF 2HSPA 2DETA 4A54A 3L2VA 2OTLQ 1W1FA 1T3SA 3OMGA 1BB9A 2K4YA 2O88A 4QVCA 3RKYA 2HMAA 2A28A 2HL3A 2RD1A 2I0NA 3I55A 2LCLA 3OYNA 4BY6C 3OYKA 1X6BA 2C0IA 3FRNA 1QKXA 2KGTA 2M0OA 2XDBA 4PJOB 4F7UA 4LDXA 2LCCA 5LJ5e 2JTEA 3LYIA 3HL8A 2RJFA 4Y92A 1K9MR 3H41A 4PFOA 2EKOA 3VRYA 2KDSA 1KHCA 4M7AB 2DNUA 1OYXA 1M2VA 1OV3A 2KAFA 3I5SA 1WXTA 5DLOA 3SWNA 1QCFA 3FDRA 2JOYA 2XICA 2HKQB 2AZSA 3CCJQ 2EYQA 1H3ZA 1ZUKA 1UDLA 4F7UF 2VGNA 2EJGA 5HCKA 3OQ5A 1YFNA 2FRYA 2QTVA 5CCAA 3JB9F 2RB6A 1ZBJA 4RTVA 3C95A 4BDYA 1K0SA 1NPPA 1WXBA 4N0AC 2KQWA 1AD5A 1I8FA 3PVLA 2RNAA 2ENMA 3FJPA 1LVKA 2BIVA 2P84A 2FZCB 4OMFB 1WFWA 1K1ZA 5LJ3j 1VQNQ 3Q1JA 2NUPA 3NTIA 1GBQA 2O4XA 4WF2A 1U8RA 1OZ2A 2EW3A 1XJWB 2GQVA 3HKSA 2LZ6B 4XK8E 2DRKA 3UATA 3HHTB 1T0HA 4GLKA 3UT1A 3G71A 5M9OA 2RQWA 3VS4A 3CMAA 1G8XA 1JJ2S 4FIBA 3G7ZA 2IG0A 2JVVA 3CPWP 1M2VB 1X6GA 2JTFA 4HCKA 1QVFA 1RABB 4C92A 3CC2T 2FG0A 1NG2A 1YJNA 1I4K1 3PMIA 4WCIA 1YHQA 2PUKB 5A2QE 4E2FB 3JCMb 1VQOA 3CC7Q 2D0NA 1RAAB 2DKGA 1XQHA 4AG1C 1MUZA 1VIFA 4F16A 3A8LB 4P5NA 2OI3A 3DLMA 1VQ8T 3X26B 3CQTA 2L3RA 2XI9A 3KUFA 2MWOA 3LH0A 4JJCA 4C92F 5GANe 2DYIA 3J80E 3EG9A 3GIBA 1ZSGA 2BZXA 1C0MA 2VKNA 5FU6B 1NEGA 4X34A 1ZBXA 4DQ2A 4VUBA 1YBYA 5KYYB 2I2LA 1VYUA 2KXCA 2DYBA 2DTOA 4IUUA 4HKEA 5KYUA 3HPWA 1TUDA 3EG1A 3JB9J 1VQMT 4RG8A 2E10A 3M0QA 3CXCP 3QDRB 3GNFB 1MMDA 4F7UG 3M0PA 4PJOD 4LUDA 3OYGA 2JXBA 3TCJA 4V2SA 3JCMc 1TG0A 3HFOA 2E1HA 1KQSS 2D1XA 2E3HA 5J3BA 3DKMA 4CC2A 4M7AD 1PG5B 2DEQA 1BU1A 2V1RA 2EYWA 2MYSA 4D8DA 2WSEE 1MNEA 1IZ6A 4PJOC 4C8QF 1OI1A 5GAOl 3JCMg 2CZ6B 4BDZA 3O5ZA 2H3JA 3THKA 4Z02A 1SF9A 2AT1B 3D7SB 2MI6A 3VS3A 2NWMA 1M1GA 3EFSA 1VYVA 4FYYB 2LNVA 1D3BB 2JUFA 1VQPQ 3VS6A 3C4SA 1OZ3A 3VU3C 2E5KA 1D09B 1JXMA 3JCMd 5FRMA 1M1KU 4ELYC 5GAOq 3ZFJA 1RAHB 4EMKA 1VYTA 2EAYA 4J6WA 3QXEB 4BE2A 1QVGS 2EQUA 2EYXA 4XAXB 5FWBA 1H641 4C8QB 3OYDA 4J9DA 3RIRA 4ZN3A 3QJ6A 1YJWQ 1W70A 2OAUA 3AT1B 2DVEA 1MMNA 1M5Q1 3JB9D 2VUBA 2IIMA 3P8DA 4LDVA 5GAN8 2KXDA 4M77A 1VQKA 1J3TA 2AKKA 2DBMA 5GAOn 4C92G 3GNGA 3UA6A 3CC2Q 2COWA 1G2BA 1PRLC 2CUDA 2DXBA 2D8JA 2CT4A 2V8IA 1TU0B 5KCOA 4FW2A 4BUGA 1YI2A 1WHJA 4GLMA 3L2QA 3A98A 4ZGDB 4IUVA 2DE0X 2OTJA 4MMLA 1VIEA 5HKCA 4J9GA 1NYGA 3X25B 2KMTA 2MOXA 5AT1B 2QTXA 3NTKA 3J81E 2QQAA 4M77F 1VQ8Q 2FPEA 1UGRB 2YLBA 3I35A 1NLPC 5FW9A 5C0MA 1YIJQ 1X69A 4XTZA 2GTOA 3EFOA 3VYGA 2DBKA 2R5MA 2KR3A 2O2OA 2ABLA 1KHIA 1PKTA 5LJ3h 5GAN6 1HK9A 4M78C 4J9IA 2YRVA 3G71T 4JUVA 1E6HA 2C0TA 3CMAT 1MHNA 4XTWA 5D6XA 4WTOB 4NL3A 5FU6C 4MDXA 1N9RA 1XNIA 1AWJA 5HK3A 5L8RE 2EPDA 1V1CA 1YJNT 1UGQB 4C92D 2JM9A 5GAOr 1RAFB 1EZZB 1VQOT 1K73C 2CSQA 2MMPA 1E7OA 3LX7A 2E6NA 1GBRA 4XU3A 2PVDB 3M57A 3OYHA 3L42A 2CYZB 5DY9A 3EGUA 5CKDA 4CI0C 5LJ5g 4ZTFA 5I11A 1Y07A 1TOVA 1JXOA 2AHJB 1GL5A 2E12A 4DOWA 1BCMA 2GF7A 3TQ7P 1ABOA 3SB2A 1WLPB 1OQKA 4BI8B 5IAYA 4PKCC 4HCZA 1WX6A 3EG0A 4J9HA 3HTRA 5GMKj 1UTIA 1GCPA 3EFOB 2DXCA 3ZEHA 1Y71A 1VQ7A 1QCNA 1M90C 3HRUA 1Z9ZA 1QP3A 2FZGB 1X2QA 2JW4A 2LJ3A 3M4YA 1V29B 4OMOA 2M1HA 2B8AA 4MDWA 1YITA 4X1VA 1KC8U 2A36A 4IURA 4C8QD 3QYHB 1EFNA 2R58A 3HP9A 2EYYA 1M8MA 1K0XA 4PJOE 2ZPBB 2GFUA 5D6YA 5KYXB 4RMOA 4ZTJA 1FMWA 3REBB 2D6FA 2DO3A 4M77G 2RK2A 4OVAA 1M27C 3PNWC 5LJ3e 2BE7D 1RAEB 4FYXB 3QJYA 1M90U 3MHXA 2L2PA 4M7AE 1PSEA 1Q95G 3M59A 3GOXA 2K5LA 2F1LA 4C8QC 3P8BB 1IRXA 2DA9A 8AT1B 3ZL7C 4RTUA 1JQQA 2G3RA 1M8VA 1U5SA 1WJQA 2LX9A 2RMOA 3JCMf 5CQXA 3BFMA 4RTTA 2D0QB 2P0QA 5A0DA 4J9CA 1SG5A 2HBWA 2FO0A 3QZ5B 2X4WA 3RESA 4RTYA 1MNDA 3CPFA 3FIFA 2DMOA 1Q86C 2AZVA 1BYMA 4A53A 7AT1B 3RERA 5IXFA 2ZPIB 4XU0A 1OULA 2X4XA 1M1KR 4FT2A 2YUPA 1G3TA 3G71Q 3OSVA 1Q7YC 4QKUA 2J6FA 2JZ2A 1QVFP 3E9FA 1ZSZB 2EGAA 3CMAQ 2SRCA 1VUBA 2WSFE 4ESRA 2JN0A 4D8KA 4F7UE 4C0FA 6AT1B 3I56A 3C94A 1GRIA 2B86A 4J8OA 2JM8A 3QKJA 4M77D 5GAOm 4N4GA 3OW2S 2MWPA 2V8KA 1YJNQ 2PQWA 5IHNA 1PM3A 1YHQQ 1NM7A 1Q82C 4FYWB 1BIBA 1VQOQ
chains in the Genus database with same CATH topology
2HEQA 2L3QA 1GBQA 4HVUA 1X27A 1U06A 1OPKA 1YCSB 2EW3A 4JJDA 1WXUA 1AWWA 2LZ6B 2DRKA 1OPLA 3UATA 2KBTA 1T0HA 2DL7A 2AK5A 3NHNA 1A0NB 1UUEA 2J6OA 2JT4A 2RQRA 2RQWA 3VS4A 2CT3A 2K6DA 1W6XA 2GGRA 2X3WD 1GFCA 1M30A 1YWOA 2K9GA 2GTJA 1X6GA 2X3XD 4HCKA 1CSKA 2J7IA 1X43A 2FG0A 1UFFA 2RPNA 1NG2A 4JZ4A 2K79A 3U23A 4WCIA 2KRSA 1ZLMA 4Z88A 1H3HA 3SEMA 4J9FA 1B07A 1B3QA 2D0NA 2F2WA 4AG1C 1UJ0A 4AFQC 1TUCA 1MUZA 4F16A 2DJQA 2OI3A 2LP5A 2BTTA 3H0FA 2D8HA 2OJ2A 3CQTA 4JJCA 1FMKA 4EIKA 1ZSGA 2BZXA 2VKNA 1YP5A 3I9QA 1NEGA 2VWFA 1K4US 3NGPA 1VA7A 2ESWA 2AKLA 1YN8A 4AFUC 1VYUA 2EGEA 2KXCA 3PE0A 2LCSA 4HXJA 1E6GA 2DYBA 2RF0A 5L23A 3I5RA 2LX7A 2C0OA 2GNCA 1TUDA 2BZYA 1ARKA 3EG1A 4IIOA 4LE9A 3M0QA 3KFVA 1PRMC 3M0PA 2XMFA 2J05A 4LUDA 1ZUYA 2JXBA 2CREA 2LMJA 1TG0A 1HD3A 1UGVA 2D1XA 4CC2A 1K76A 2V1RA 1BU1A 2PZ1A 2EYWA 2M0YA 4D8DA 3UA7A 1H8KA 3RBBB 2L3SA 2DF6A 3SHWA 2BZ8A 1UJYA 3VS7A 2F2XA 4ZNXA 3VRZA 1AZEA 2EYZA 4FSSA 3ULRB 3O5ZA 3THKA 2DILA 1BBZA 2KT1A 3LH5A 2SEMA 3VS3A 2O9SA 3VS5A 2RQVA 4F14A 1H92A 2NWMA 2PNIA 1VYVA 1I0CA 1RLPC 2CH4W 3QWXX 1RUWA 3VS6A 2E5KA 1XOVA 1JXMA 1Z9QA 2YUQA 2DL8A 4DEXA 1FYNA 2HCKA 1AEYA 2GBQA 2LNHB 2KROA 2DX1A 1VYTA 1M3AA 1N5ZA 4GBQA 2EYXA 1UE9A 1S1NA 5FWBA 4AFZC 3VS0A 4CC4B 1UECA 4J9DA 4IIMA 2J6KA 2FPFA 5GJWB 1JEGA 2LJ0A 1W70A 2DM1A 2CUBA 4RTZA 2IIMA 2GQIA 1QLYA 1WYXA 2YUNA 2KXDA 4KRTA 2AKKA 1SRLA 2DBMA 2RQUA 1J3TA 2YT6A 1AZGB 3UA6A 4F17A 2JMCA 5ECAA 1QWFA 1MV0B 1G2BA 1PRLC 1SEMA 2CUDA 2D8JA 2CT4A 4QT7A 2P4RA 2PTKA 1UHFA 4LUEA 2KYBA 5IXBA 4GLMA 3M0RA 1GFDA 2K3BA 1SSHA 3A98A 1ZUUA 1GCQC 1PNJA 2DE0X 3REAB 4CC7A 1M3CA 3EHRA 4J9GA 4RTWA 1NYGA 2F2VA 2MOXA 5FWCA 3M0TA 1UG1A 1KFZA 2LQNA 4HVVA 2FPEA 2KRMA 4J9EA 4CC3A 4LN2A 4OMNA 3I35A 1NLPC 5FW9A 1PWTA 2DRMA 1KIKA 4M4ZA 1X69A 5IHKA 2G6FX 2GTOA 4LNPA 1IO6A 2DBKA 2A37A 2H8HA 2KR3A 2O2OA 2ABLA 1Y0MA 2MIOA 2M51A 1PKTA 2DL3A 3M0UA 4OMPA 2FPDA 2NUZA 3NMZC 1HSQA 4J9IA 2FEIA 1G83A 1E6HA 1GCQA 3JV3A 4HVWA 1QWEA 3EHQA 4OMMA 2C0TA 2O9VA 3H0IA 2KNBB 1KSWA 2ECZA 2YUOA 1AWJA 2CH4A 2L3PA 2EPDA 1V1CA 1M3BA 4OMLA 5IHIA 1SHFA 2JM9A 2OAWA 2DL5A 2LQWA 1BK2A 2CSQA 4JPBW 1E7OA 1GBRA 2ROLA 1PHTA 1NLOC 1OOTA 3EGUA 2K2MA 2RN8A 1JO8A 2YDLA 2CSIA 5I11A 1U3OA 4DEYA 4JZ3A 1JXOA 4ORZA 1X2KA 1GL5A 1JU5C 2W10A 2J06A 1MV3A 1ABOA 4RTXA 4Z89A 1WLPB 3RNJA 2JS2A 1WX6A 2V1QA 3EG0A 4J9HA 2ROTA 1K9AA 1SHGA 3M0SA 1UTIA 1AVZC 1SPKA 1GCPA 4R0KA 1YNZA 5GJVB 5EC7A 2KEAA 4A63B 2EVRA 4E6RA 1T3LA 3EG2A 1Z9ZA 2MCNA 2KYMA 1PKSA 3UF4A 1X2QA 1SRMA 2ED1A 2JW4A 5I22A 2KT8A 2JS0A 3NPFA 2W0ZA 2LJ3A 3TSWA 1RLQC 1CKBA 4OMOA 2KE9A 1HJDA 3EG3A 4X1VA 2A36A 1RI9A 4J9BA 2DVJA 1EFNA 2A08A 2DL4A 2EYYA 2JMAA 1I1JA 1M8MA 3PVQA 3R6NA 3GBQA 2HDAA 2EGCA 1WDXA 3H0HA 4OMQA 3VS1A 1K0XA 2HSPA 3REBB 1T3SA 1NYFA 1W1FA 1ABQA 1M27C 1UHCA 1BB9A 4AG2C 2L0AA 2O88A 1QKWA 2L2PA 2A28A 2YSQA 2EQIA 2I0NA 3TSZA 2DA9A 2EBPA 3ZL7C 4RTUA 1X6BA 1JQQA 2C0IA 1U5SA 1QKXA 2KGTA 1WA7A 4K11A 2RMOA 1CKAA 4RUGA 4RTTA 1T0JA 2FRWA 2JTEA 1AOJA 4JJBA 1Y57A 1LCKA 4Y92A 3H41A 4J9CA 2HBWA 2FO0A 3C0CA 3VRYA 2EKHA 2O31A 3VS2A 2DNUA 4RTYA 1OV3A 2ED0A 3I5SA 1WXTA 1QCFA 3QWYA 2DMOA 2LJ1A 2AZVA 1I07A 2AZSA 5IXFA 1NEBA 1ZX6A 1KJWA 3IQLA 1ZUKA 3TVTA 3FJ5A 1UDLA 5HCKA 2YUPA 2J6FA 2FRYA 1OEBA 2DLPA 2EGAA 2SRCA 4AFSC 2RQTA 4ESRA 1ZBJA 4RTVA 4D8KA 2QDLA 1K0SA 2K7AA 2KRNA 2CDTA 1WXBA 1AWOA 1AD5A 3PVLA 1AWXA 1GRIA 2B86A 2RNAA 2ENMA 2JM8A 1YWPA 1WIEA 4Z8AA 5IHNA 5IH2A 1NM7A 1WFWA 1K1ZA 2VVKA 1WI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEQ A;  2L3Q A;  1GBQ A;  4HVU A;  1X27 A;  1U06 A;  1OPK A;  1YCS B;  2EW3 A;  4JJD A;  1WXU A;  1AWW A;  2LZ6 B;  2DRK A;  1OPL A;  3UAT A;  2KBT A;  1T0H A;  2DL7 A;  2AK5 A;  3NHN A;  1A0N B;  1UUE A;  2J6O A;  2JT4 A;  2RQR A;  2RQW A;  3VS4 A;  2CT3 A;  2K6D A;  1W6X A;  2GGR A;  2X3W D;  1GFC A;  1M30 A;  1YWO A;  2K9G A;  2GTJ A;  1X6G A;  2X3X D;  4HCK A;  1CSK A;  2J7I A;  1X43 A;  2FG0 A;  1UFF A;  2RPN A;  1NG2 A;  4JZ4 A;  2K79 A;  3U23 A;  4WCI A;  2KRS A;  1ZLM A;  4Z88 A;  1H3H A;  3SEM A;  4J9F A;  1B07 A;  1B3Q A;  2D0N A;  2F2W A;  4AG1 C;  1UJ0 A;  4AFQ C;  1TUC A;  1MUZ A;  4F16 A;  2DJQ A;  2OI3 A;  2LP5 A;  2BTT A;  3H0F A;  2D8H A;  2OJ2 A;  3CQT A;  4JJC A;  1FMK A;  4EIK A;  1ZSG A;  2BZX A;  2VKN A;  1YP5 A;  3I9Q A;  1NEG A;  2VWF A;  1K4U S;  3NGP A;  1VA7 A;  2ESW A;  2AKL A;  1YN8 A;  4AFU C;  1VYU A;  2EGE A;  2KXC A;  3PE0 A;  2LCS A;  4HXJ A;  1E6G A;  2DYB A;  2RF0 A;  5L23 A;  3I5R A;  2LX7 A;  2C0O A;  2GNC A;  1TUD A;  2BZY A;  1ARK A;  3EG1 A;  4IIO A;  4LE9 A;  3M0Q A;  3KFV A;  1PRM C;  3M0P A;  2XMF A;  2J05 A;  4LUD A;  1ZUY A;  2JXB A;  2CRE A;  2LMJ A;  1TG0 A;  1HD3 A;  1UGV A;  2D1X A;  4CC2 A;  1K76 A;  2V1R A;  1BU1 A;  2PZ1 A;  2EYW A;  2M0Y A;  4D8D A;  3UA7 A;  1H8K A;  3RBB B;  2L3S A;  2DF6 A;  3SHW A;  2BZ8 A;  1UJY A;  3VS7 A;  2F2X A;  4ZNX A;  3VRZ A;  1AZE A;  2EYZ A;  4FSS A;  3ULR B;  3O5Z A;  3THK A;  2DIL A;  1BBZ A;  2KT1 A;  3LH5 A;  2SEM A;  3VS3 A;  2O9S A;  3VS5 A;  2RQV A;  4F14 A;  1H92 A;  2NWM A;  2PNI A;  1VYV A;  1I0C A;  1RLP C;  2CH4 W;  3QWX X;  1RUW A;  3VS6 A;  2E5K A;  1XOV A;  1JXM A;  1Z9Q A;  2YUQ A;  2DL8 A;  4DEX A;  1FYN A;  2HCK A;  1AEY A;  2GBQ A;  2LNH B;  2KRO A;  2DX1 A;  1VYT A;  1M3A A;  1N5Z A;  4GBQ A;  2EYX A;  1UE9 A;  1S1N A;  5FWB A;  4AFZ C;  3VS0 A;  4CC4 B;  1UEC A;  4J9D A;  4IIM A;  2J6K A;  2FPF A;  5GJW B;  1JEG A;  2LJ0 A;  1W70 A;  2DM1 A;  2CUB A;  4RTZ A;  2IIM A;  2GQI A;  1QLY A;  1WYX A;  2YUN A;  2KXD A;  4KRT A;  2AKK A;  1SRL A;  2DBM A;  2RQU A;  1J3T A;  2YT6 A;  1AZG B;  3UA6 A;  4F17 A;  2JMC A;  5ECA A;  1QWF A;  1MV0 B;  1G2B A;  1PRL C;  1SEM A;  2CUD A;  2D8J A;  2CT4 A;  4QT7 A;  2P4R A;  2PTK A;  1UHF A;  4LUE A;  2KYB A;  5IXB A;  4GLM A;  3M0R A;  1GFD A;  2K3B A;  1SSH A;  3A98 A;  1ZUU A;  1GCQ C;  1PNJ A;  2DE0 X;  3REA B;  4CC7 A;  1M3C A;  3EHR A;  4J9G A;  4RTW A;  1NYG A;  2F2V A;  2MOX A;  5FWC A;  3M0T A;  1UG1 A;  1KFZ A;  2LQN A;  4HVV A;  2FPE A;  2KRM A;  4J9E A;  4CC3 A;  4LN2 A;  4OMN A;  3I35 A;  1NLP C;  5FW9 A;  1PWT A;  2DRM A;  1KIK A;  4M4Z A;  1X69 A;  5IHK A;  2G6F X;  2GTO A;  4LNP A;  1IO6 A;  2DBK A;  2A37 A;  2H8H A;  2KR3 A;  2O2O A;  2ABL A;  1Y0M A;  2MIO A;  2M51 A;  1PKT A;  2DL3 A;  3M0U A;  4OMP A;  2FPD A;  2NUZ A;  3NMZ C;  1HSQ A;  4J9I A;  2FEI A;  1G83 A;  1E6H A;  1GCQ A;  3JV3 A;  4HVW A;  1QWE A;  3EHQ A;  4OMM A;  2C0T A;  2O9V A;  3H0I A;  2KNB B;  1KSW A;  2ECZ A;  2YUO A;  1AWJ A;  2CH4 A;  2L3P A;  2EPD A;  1V1C A;  1M3B A;  4OML A;  5IHI A;  1SHF A;  2JM9 A;  2OAW A;  2DL5 A;  2LQW A;  1BK2 A;  2CSQ A;  4JPB W;  1E7O A;  1GBR A;  2ROL A;  1PHT A;  1NLO C;  1OOT A;  3EGU A;  2K2M A;  2RN8 A;  1JO8 A;  2YDL A;  2CSI A;  5I11 A;  1U3O A;  4DEY A;  4JZ3 A;  1JXO A;  4ORZ A;  1X2K A;  1GL5 A;  1JU5 C;  2W10 A;  2J06 A;  1MV3 A;  1ABO A;  4RTX A;  4Z89 A;  1WLP B;  3RNJ A;  2JS2 A;  1WX6 A;  2V1Q A;  3EG0 A;  4J9H A;  2ROT A;  1K9A A;  1SHG A;  3M0S A;  1UTI A;  1AVZ C;  1SPK A;  1GCP A;  4R0K A;  1YNZ A;  5GJV B;  5EC7 A;  2KEA A;  4A63 B;  2EVR A;  4E6R A;  1T3L A;  3EG2 A;  1Z9Z A;  2MCN A;  2KYM A;  1PKS A;  3UF4 A;  1X2Q A;  1SRM A;  2ED1 A;  2JW4 A;  5I22 A;  2KT8 A;  2JS0 A;  3NPF A;  2W0Z A;  2LJ3 A;  3TSW A;  1RLQ C;  1CKB A;  4OMO A;  2KE9 A;  1HJD A;  3EG3 A;  4X1V A;  2A36 A;  1RI9 A;  4J9B A;  2DVJ A;  1EFN A;  2A08 A;  2DL4 A;  2EYY A;  2JMA A;  1I1J A;  1M8M A;  3PVQ A;  3R6N A;  3GBQ A;  2HDA A;  2EGC A;  1WDX A;  3H0H A;  4OMQ A;  3VS1 A;  1K0X A;  2HSP A;  3REB B;  1T3S A;  1NYF A;  1W1F A;  1ABQ A;  1M27 C;  1UHC A;  1BB9 A;  4AG2 C;  2L0A A;  2O88 A;  1QKW A;  2L2P A;  2A28 A;  2YSQ A;  2EQI A;  2I0N A;  3TSZ A;  2DA9 A;  2EBP A;  3ZL7 C;  4RTU A;  1X6B A;  1JQQ A;  2C0I A;  1U5S A;  1QKX A;  2KGT A;  1WA7 A;  4K11 A;  2RMO A;  1CKA A;  4RUG A;  4RTT A;  1T0J A;  2FRW A;  2JTE A;  1AOJ A;  4JJB A;  1Y57 A;  1LCK A;  4Y92 A;  3H41 A;  4J9C A;  2HBW A;  2FO0 A;  3C0C A;  3VRY A;  2EKH A;  2O31 A;  3VS2 A;  2DNU A;  4RTY A;  1OV3 A;  2ED0 A;  3I5S A;  1WXT A;  1QCF A;  3QWY A;  2DMO A;  2LJ1 A;  2AZV A;  1I07 A;  2AZS A;  5IXF A;  1NEB A;  1ZX6 A;  1KJW A;  3IQL A;  1ZUK A;  3TVT A;  3FJ5 A;  1UDL A;  5HCK A;  2YUP A;  2J6F A;  2FRY A;  1OEB A;  2DLP A;  2EGA A;  2SRC A;  4AFS C;  2RQT A;  4ESR A;  1ZBJ A;  4RTV A;  4D8K A;  2QDL A;  1K0S A;  2K7A A;  2KRN A;  2CDT A;  1WXB A;  1AWO A;  1AD5 A;  3PVL A;  1AWX A;  1GRI A;  2B86 A;  2RNA A;  2ENM A;  2JM8 A;  1YWP A;  1WIE A;  4Z8A A;  5IHN A;  5IH2 A;  1NM7 A;  1WFW A;  1K1Z A;  2VVK A;  1WI7 A; 
#chains in the Genus database with same CATH topology
 3EGD B;  1Q86 U;  1U06 A;  2LTO A;  1OPK A;  3UDC A;  1VQ4 A;  1OPL A;  1FX7 A;  2EQM A;  2KBT A;  1M9S A;  2FB7 A;  3OYL A;  1A0N B;  4KGV B;  1NZ9 A;  1ACM B;  2QQ9 A;  2CT3 A;  4KT0 E;  2VV5 A;  2JJ9 A;  1QQJ A;  1KQS A;  4XTV A;  1GFC A;  1M30 A;  2K9G A;  4PJM A;  4OB1 B;  2YHT A;  3MP1 A;  1W2B S;  1CSK A;  1UFF A;  2RPN A;  1OX8 A;  3AHU A;  3PIO A;  3VV0 A;  1Q82 U;  4Z88 A;  1H3H A;  2QG9 B;  3CCM A;  3VKI A;  1D0X A;  2LQK A;  1VQ6 A;  3CEY A;  1B3Q A;  2XHC A;  3MEV A;  1UJ0 A;  2HQE A;  3JAM E;  2IPO B;  2BTT A;  5KH6 A;  3H0F A;  2D8H A;  4BE1 A;  1FMK A;  1WZO A;  4J7F A;  2ZPF B;  2ZZD A;  2RHU A;  5A0L A;  1VQL A;  1WGS A;  3M55 A;  2E41 A;  2PVO B;  2EIF A;  3M54 A;  1G5V A;  4C0D C;  1TTH B;  4C92 E;  3TU4 K;  1VA7 A;  2EWN A;  4PJL A;  4NL2 A;  4C5E A;  1QVG A;  3PE0 A;  2EGE A;  4KUI A;  4HXJ A;  2RF0 A;  5LJ5 f;  4O5V A;  1BCO A;  5GAN h;  2BZY A;  4X9D A;  3KBG A;  4IIO A;  4N4H A;  3SDZ A;  1OU8 A;  4FU6 A;  3LWH A;  2HD0 A;  4DA4 A;  5GAM h;  2HQH A;  3CD6 A;  1I5O B;  2KI7 A;  3MPU B;  3V8J A;  1VQ7 T;  3DB3 A;  4C0G A;  1UGV A;  1XTD A;  2E65 A;  5GMK h;  1K76 A;  2CZ0 B;  3FC3 A;  3MKD A;  2PZ1 A;  2M0Y A;  2EJ9 A;  4B9X A;  3QBY A;  2ZGW A;  2L3S A;  1YIT T;  1VQP T;  4QQ6 A;  1UJY A;  2X4Y A;  4EMH A;  2DD5 A;  2M16 A;  1BIA A;  2O9S A;  4C8Q E;  1KC8 R;  1VQ5 A;  4ME7 A;  5GAN 5;  5GAN 4;  1VQK Q;  1I0C A;  3ER0 A;  2E6Z A;  3FEO A;  4F7U B;  1MGQ A;  1V76 A;  1XOV A;  1M2O A;  4C0Z A;  1VQ9 A;  3RMQ A;  1Z9Q A;  2YUQ A;  1YJW T;  4M75 A;  4II1 A;  5CKH A;  4BE0 A;  4DEX A;  1YI2 Q;  1FYN A;  5KYW A;  3OSS C;  1AEY A;  4IUP A;  2GBQ A;  4E7S A;  2KRO A;  1M90 R;  3CBP A;  1IGQ A;  1ZSZ C;  1M3A A;  2O01 E;  1N5Z A;  2OTJ Q;  3SWN B;  4ATO A;  5LL6 S;  4AFZ C;  4FT4 A;  5GAN 3;  2QA4 A;  2J6K A;  5I2S A;  3F70 A;  2QDY B;  1D1B A;  2RK1 A;  2CUB A;  4J7I A;  1B34 A;  2GQI A;  1QLY A;  3OYB A;  2YUN A;  1SRL A;  2RQU A;  3WVE B;  1AZG B;  2JMC A;  5ECA A;  4M7D A;  1SEM A;  3CCQ A;  4ZGE B;  2P4R A;  2PTK A;  1O9S A;  1M1F A;  4R55 A;  2FYK A;  2KY9 A;  5IXB A;  3M0R A;  3P8H A;  1GFD A;  1YIJ T;  2COZ A;  3WVD B;  2BE9 B;  2XU8 A;  3CBM A;  5GAM e;  2NUP B;  1M3C A;  3PFS A;  4PLL A;  2F2V A;  1B7T A;  2O4X B;  3I56 T;  3WXM B;  1I81 A;  5GMK e;  3CME A;  4J9E A;  4PJN A;  4M7D F;  4OMN A;  3CBO A;  4M77 E;  5IHK A;  2QI2 A;  2MK5 A;  4L59 A;  4LNP A;  3HRT A;  1WHH A;  2H8H A;  1VQ4 T;  4B6M A;  3OYE A;  3NMZ C;  4D6W A;  1HSQ A;  4C92 B;  4KBM B;  1GCQ A;  3VJP A;  1Q86 R;  3CCS A;  4OMM A;  3H0I A;  3FLG A;  2KNB B;  1R77 A;  2E64 A;  1WHG A;  4ZN1 A;  2CP5 A;  2ECZ A;  3NTH A;  1Y96 A;  2YUO A;  2L3P A;  1VQ7 Q;  2QQB A;  1SHF A;  3INZ A;  4M7D B;  2DL5 A;  4OB0 B;  1HXD A;  5DM7 R;  2BUD A;  4C5H A;  4M7A C;  3EG9 B;  5DLQ E;  1PHT A;  4JDS A;  2CP2 A;  2Y4X A;  2K2M A;  2RN8 A;  2K3Y A;  1Q82 R;  2ZAE A;  1S72 A;  1YIT Q;  2DTI A;  3SFM A;  4XU2 A;  5D6W A;  3I55 T;  4JRI A;  1JU5 C;  2W10 A;  1MV3 A;  3MP6 A;  5KYU B;  1FMV A;  3A8M B;  2A0F B;  1SSF A;  1C6V X;  1SHG A;  2E70 A;  3BW1 A;  3M0S A;  1AVZ C;  1SPK A;  3MEU A;  2DIG A;  3OBY A;  4M75 G;  3RKW A;  4AMC A;  4JS4 A;  4KUD K;  1PKS A;  3V7R A;  2VGM A;  1ZA2 B;  5I22 A;  5LJ5 j;  1WQW A;  2W0Z A;  3TSW A;  2X4J A;  3LGL A;  5GAN 7;  4RKU E;  3EG3 A;  1QP2 A;  3CD6 T;  2HSE B;  1RI9 A;  4J9B A;  2DVJ A;  2A08 A;  2DL4 A;  4DBR A;  1KD1 C;  2JMA A;  3PVQ A;  4JRQ A;  2EGC A;  4PLI A;  3GF5 A;  2RJC A;  3OW2 A;  5CIU A;  4E7L A;  5D7U A;  1NJI C;  3JCM V;  3SWN C;  2RA2 A;  4LDW A;  4M7D G;  2EQK A;  4RCC A;  2EQI A;  1D1C A;  3TSZ A;  4BI4 A;  1C1A A;  3TRE A;  1WA7 A;  1TXQ A;  5CO7 A;  1VQ5 T;  5HK0 A;  4E7H A;  4KGX B;  2RM4 A;  2VXF A;  1HYO A;  4RUG A;  5IT9 E;  4ZGJ B;  4EMK B;  1IRE B;  4HCB A;  4A4E A;  4HCC A;  5FU7 B;  1KD1 U;  4A4G A;  3PT9 A;  1AOJ A;  3I56 Q;  3UPU A;  1W2B A;  1JBM A;  3C0C A;  2NUT A;  3GP8 A;  2EKH A;  2O31 A;  3VS2 A;  1VQ9 T;  2ZPE B;  2DZ9 A;  4N4I A;  1K9M C;  2C06 A;  4JRP A;  2P0K A;  3URG A;  1NJI U;  3QG1 A;  3QSU A;  3EH1 A;  4RG2 A;  4M77 B;  1ZX6 A;  3IQL A;  1VQ4 Q;  2D9T A;  3TVT A;  2QA4 T;  1YHQ T;  3OYJ A;  4DBF A;  3JB9 I;  2HZY A;  1OEB A;  5CAI A;  3JCM h;  4AFS C;  4BI3 A;  2QDL A;  2K7A A;  2KRN A;  3QII A;  1FWZ A;  5J39 A;  1AWX A;  4XTY A;  3CCQ T;  2DIQ A;  3ZBD A;  4C92 C;  3QDF A;  3CCM Q;  4XTU A;  4M7D D;  2DEU A;  1WI7 A;  2L3Q A;  3OS0 A;  3E9G A;  1N27 A;  1YCS B;  3JCM P;  4JJD A;  1AWW A;  2RI2 A;  1BI1 A;  1IHW A;  1KK7 A;  1QW1 A;  3SD4 A;  5LJ5 d;  2EQJ A;  2RHY A;  2XKO C;  1IGU A;  2DL7 A;  2AK5 A;  3T9N A;  2YWW A;  1UUE A;  1K73 U;  3JCM X;  2J6O A;  2JT4 A;  3JCM Q;  2RQR A;  3I55 Q;  2NUT B;  3QO3 A;  3N5B B;  2WAC A;  4N0A A;  3MP8 A;  2R5A A;  2GTJ A;  1VQL Q;  3CCE A;  1QVG P;  2J7I A;  1X43 A;  4C5G A;  3G6E A;  2ZPH B;  3QPH A;  1YJ9 A;  2K79 A;  3U23 A;  4BY6 B;  2AIR B;  2KRS A;  2LDM A;  3CCS T;  4J9F A;  3M4G A;  4AFQ C;  2MAM A;  3OYF A;  2VB6 A;  4FCY A;  3S3O A;  2LP5 A;  3O8V A;  4JS5 A;  3CD6 Q;  2LT1 A;  2P0P A;  2LC4 A;  1TSF A;  2OJ2 A;  3M9Q A;  2VYT A;  1UGP B;  2VWF A;  1JJ2 A;  1K4U S;  3UWN A;  2ESW A;  4CRI A;  1YN8 A;  1S72 T;  4MZT A;  4IUT A;  4AFU C;  3BE3 A;  2LCS A;  1E6G A;  5CK9 A;  2RI5 A;  3A1P A;  3A8O B;  2LX7 A;  2XK0 A;  1DJ7 B;  2C0O A;  2M02 A;  2GNC A;  4MZP A;  5CR2 A;  3JCM e;  4ELZ C;  2QK0 A;  4FW1 A;  4LE9 A;  4F04 B;  1VQ5 Q;  1PRM C;  1Q81 C;  2XMF A;  2J05 A;  3JSC A;  5GAN g;  3M58 A;  5CVI A;  3X24 B;  1VQ9 Q;  1QCO A;  5GAM g;  3LWI A;  3UA7 A;  1VQK T;  3RBB B;  3SHW A;  2JTM A;  1SKU B;  2BZ8 A;  2FVU A;  3VS7 A;  2F2X A;  2KSS A;  4EMK C;  2FHD A;  5FU7 C;  4ZNX A;  3VRZ A;  1MMG A;  2L89 A;  2P4T A;  1WPY A;  2EYZ A;  4PL6 A;  2QA4 Q;  4FSS A;  3ULR B;  2DIL A;  2KT1 A;  2Y4Y A;  3M56 A;  1NPR A;  2SEM A;  3V8L A;  2RQV A;  4F14 A;  2FL7 A;  2QAS A;  2OTJ T;  1Q81 U;  2PVG B;  3E1S A;  2K3X A;  1LPL A;  4J6X A;  1RLP C;  3CC4 A;  4EMG A;  2RJD A;  1BKB A;  1TUG B;  2X9H A;  3QWX X;  1RUW A;  3X28 B;  1D0Y A;  4M77 C;  1Q7Y U;  3R6O A;  1GXI E;  1WJS A;  3CCQ Q;  1LJO A;  1RAD B;  4IKF A;  1LNX A;  1VQM A;  2DL8 A;  2HCK A;  4NS5 A;  4PJO A;  1BI3 A;  3CPW S;  4HT8 A;  4GBQ A;  4Y91 A;  3CCU A;  2WSC E;  4CC4 B;  4KH0 B;  1UEC A;  2M9U A;  2ZPG B;  1JEG A;  2FPF A;  1IXD A;  2Y90 A;  3OYA A;  5KCH A;  1KQ1 A;  3CME Q;  3PTA A;  1WNL A;  3DLL A;  1AT1 B;  3MJX A;  4RTZ A;  2CZ7 B;  1KD1 R;  1WYX A;  1TS9 A;  4KRT A;  5GMK l;  4TVR A;  2L5Q A;  2YT6 A;  4PNO A;  2EJF A;  3EGX A;  3ASK A;  2E3I A;  4L6V 5;  2QEX A;  3OS5 A;  4LUE A;  1NJI R;  2KYB A;  3CCS Q;  2XDD A;  5IN1 A;  1U1T A;  2K3B A;  2CKK A;  1PNJ A;  1EX4 A;  3EHR A;  4LXC A;  4QVD A;  4RTW A;  5FWC A;  2DXT A;  1UEB A;  8ATC B;  2DTH A;  1KFZ A;  2QXF A;  2QYZ A;  4HVV A;  3GLX A;  4LN2 A;  2DPP B;  1BI2 A;  1PWT A;  2DRM A;  2A3L A;  4M4Z A;  2G6F X;  1N9S A;  3H6Z A;  2A37 A;  3CXC S;  1Y0M A;  2MIO A;  2M51 A;  2DL3 A;  1D1A A;  4M7D E;  2FPD A;  1S72 Q;  2XD0 A;  2FEI A;  5CKF A;  3A5Z B;  3JV3 A;  1QWE A;  2A7Y A;  3EHQ A;  2X51 A;  3G4S A;  3CCE T;  3RKX A;  4KGZ B;  1K73 R;  3G6E T;  2CH4 A;  1N6A A;  3S6W A;  1YJ9 T;  1M3B A;  2E4H A;  5HY6 A;  3EGX B;  2CS7 A;  5IHI A;  2OAW A;  1BK2 A;  3EAE A;  4JPB W;  1RI0 A;  1K8A C;  2LQ8 A;  4M78 A;  3MEA A;  5CQY A;  4E7J A;  1RAI B;  2CP7 A;  2F69 A;  2CSI A;  1KQ2 A;  3E19 A;  1U3O A;  3M5A A;  4DEY A;  1NBE B;  4JZ3 A;  3OW2 P;  1G3W A;  4ORZ A;  1X6O A;  4PFP A;  1R0C B;  3QZ9 B;  2CP3 A;  3QUI A;  1X75 C;  1BI0 A;  3L2Z A;  4PJJ A;  4RTX A;  3NFC A;  4B9W A;  4A4H A;  2JS2 A;  4FM4 B;  3L1A A;  2RJE A;  5KYY A;  3LW5 E;  3E2U A;  4M78 F;  1YNZ A;  3S3N A;  1AHJ B;  5EC7 A;  2KEA A;  4A63 B;  4E6R A;  3EG2 A;  1K8A U;  3BY7 A;  2MCN A;  2KYM A;  1SRM A;  2ED1 A;  4PJO G;  2KT8 A;  5J26 A;  3CCR A;  2DD4 A;  4M75 F;  3MET A;  1W2B P;  2KE9 A;  1HJD A;  2DAQ A;  3CCV A;  4M7A G;  2Z0W A;  4XTX A;  3R6N A;  3GBQ A;  1WDX A;  2RHX A;  3JCM J;  5GAN f;  4UC4 A;  1KG1 A;  2COY A;  2CP6 A;  2RHI A;  5CKB A;  1NYF A;  1ABQ A;  1UHC A;  3CCL A;  2CP0 A;  4M78 B;  3A8G B;  4AG2 C;  3HRS A;  2L0A A;  5GAM f;  5GMK i;  1QKW A;  4HA8 A;  3L2R A;  2YSQ A;  4LDY A;  2EBP A;  3OY9 A;  1N8R C;  2IVW A;  1LOJ A;  3QHS A;  4M75 B;  4K11 A;  1D3B A;  1CKA A;  1ZHI A;  5KYW B;  4JJN K;  2VVK A;  3RR6 A;  4KUL A;  1T0J A;  2FRW A;  3CC4 T;  4JJB A;  1Y57 A;  1LCK A;  2V26 A;  3EH2 A;  1M4Z A;  1WHK A;  1Q81 R;  2OTL A;  2ED0 A;  2GFA A;  4PK4 A;  2R57 A;  1ZQ1 A;  3QWY A;  5LJ3 g;  4FYV B;  2LJ1 A;  4C8Q A;  4A4F A;  1I07 A;  1B34 B;  1Q7Y R;  1NEB A;  3CCU T;  3RUX A;  1KJW A;  2K5F A;  3FJ5 A;  4YTL A;  4E7I A;  2X35 A;  3JB9 G;  1N8R U;  3CCM T;  5EG2 A;  1RAC B;  1VQ6 T;  2DLP A;  5GAN 2;  2RQT A;  1M1K C;  2DZC A;  2JNG A;  2CDT A;  5LJ3 d;  1AWO A;  3CCE Q;  2HAX A;  3S3M A;  4OF1 A;  4Y28 E;  1RAG B;  3G6E Q;  1YWP A;  2PUO B;  1WIE A;  4Z8A A;  1YJ9 Q;  3PMT A;  4DBQ A;  2QEX T;  5IH2 A;  2MF2 A;  4JLG A;  2HEQ A;  4HVU A;  1X27 A;  2HBP A;  1VQL T;  4M78 G;  2KK4 A;  1WXU A;  3MCA B;  1UB4 A;  3LGF A;  1WHL A;  1VOM A;  3CCJ A;  3QYG B;  3NHN A;  3KXT A;  1PC0 A;  2OX7 A;  4QQD A;  2K6D A;  2QGF B;  1JJ2 P;  5I2M A;  1W6X A;  1R0B G;  2GGR A;  2X3W D;  1YWO A;  2K2V A;  3OS1 A;  4DBH A;  2NYS A;  2X3X D;  3HSB A;  4IUQ A;  5KE2 A;  4LD6 A;  4JZ4 A;  1Y96 B;  1ZLM A;  1VQN A;  2L8D A;  3SEM A;  1B07 A;  2H3E B;  2HL5 C;  3FB9 A;  3G4S T;  2F2W A;  1PD1 A;  4A4K A;  5GMK m;  1TUC A;  1QMC A;  4OB3 B;  2RI3 A;  2DJQ A;  2VC8 A;  1NE8 A;  3OYI A;  4OB2 B;  2F5K A;  4EIK A;  3OA6 A;  2RHZ A;  2CGH A;  1YP5 A;  2CZ1 B;  3I9Q A;  2GCX A;  4QQG A;  2QQS A;  3NGP A;  1OX9 A;  4J6Y A;  3JRZ A;  2AKL A;  4M78 D;  3CPW A;  1Y7X A;  3JCM W;  5L23 A;  3I5R A;  3CC7 A;  1IB8 A;  1FXX A;  1ARK A;  4JRK A;  4E47 A;  4NOY A;  3KFV A;  4M75 D;  2HKN A;  1EIF A;  2HNI A;  1QVP A;  4XU1 A;  2PU9 B;  1ZUY A;  3CC4 Q;  2CRE A;  2LMJ A;  4QW2 A;  4EDU A;  1KQS P;  5FRO A;  1HD3 A;  3JB9 H;  1F1B B;  4PFZ A;  3OYY A;  1IHV A;  5C6S A;  2DJZ A;  3GPL A;  4BAC A;  1QVF S;  1JB0 E;  3CCR T;  3BDU A;  1VQM Q;  4L5G A;  5FLX E;  4BB7 A;  4C8Q G;  4M75 C;  1H8K A;  1O75 A;  2DF6 A;  2KVQ G;  4QVZ A;  1G3Y A;  1K8A R;  3CCV T;  4OGE A;  3VYH B;  3CCU Q;  1JRI A;  3EFR A;  2RH2 A;  1AZE A;  1R8O B;  1TWB A;  5KYX A;  1K9M U;  1BBZ A;  2K5I A;  3LH5 A;  1U1S A;  2XG8 D;  3PIP A;  2QGG A;  1VQ6 Q;  3VS5 A;  2RO0 A;  1H92 A;  1MMA A;  2LRQ A;  2PNI A;  4OP0 A;  1G3S A;  3CCL T;  5GAN j;  1WQ7 A;  3H9N A;  2CH4 W;  2YXY A;  4XQ3 A;  1KC8 C;  1PSF A;  3CXC A;  5GAM j;  3CME T;  2QEX Q;  4J83 A;  3DB4 A;  4M7D C;  2LNH B;  2DX1 A;  1UE9 A;  1I5L A;  1S1N A;  4JLI A;  3L2U A;  3OBW A;  3VS0 A;  4IIM A;  4FSX A;  2LT4 A;  2DXU A;  3C12 A;  3MEW A;  5GJW B;  2LJ0 A;  2NLU A;  2LVM A;  2DM1 A;  2VAS A;  4C0D B;  1PD0 A;  3OMC A;  4AT1 B;  4EPC A;  2OTL T;  5KYN A;  3HFN A;  3G1J A;  1VQP A;  3VUZ A;  2MPX C;  2ATC B;  4F17 A;  3V7S A;  5LJ3 f;  1QWF A;  1MV0 B;  3BDL A;  4QT7 A;  1X01 A;  1UHF A;  2DK3 A;  1ZSZ A;  2XID A;  4Q5W A;  1SSH A;  2DFU A;  1ZUU A;  3M53 A;  3G4S Q;  1GCQ C;  3REA B;  4CC7 A;  1WHM A;  4LD9 K;  3M0T A;  1N8R R;  1UG1 A;  4MZM A;  2LQN A;  4MMK A;  4LDU A;  2KRM A;  1YJW A;  2YRD A;  3EGD A;  3MO8 A;  4CC3 A;  1KIK A;  1YCY A;  4ANJ A;  1IO6 A;  4O6J A;  3CC2 A;  1RL2 A;  3CCJ T;  3M0U A;  2ZCF B;  4OMP A;  2NUZ A;  2F5T X;  2K57 A;  2YLC A;  1OU9 A;  1G83 A;  4HVW A;  2FZK B;  4RCB A;  2VXE A;  2O9V A;  3ME9 A;  3H8Z A;  1W4S A;  3PGG A;  1KSW A;  1UGS B;  4HT9 A;  4R56 A;  4BD3 A;  1VQ8 A;  5KE3 A;  2XDP A;  3OYC A;  1YI2 T;  1P92 A;  5LJ5 h;  4KH1 B;  5GAN d;  4OML A;  4GY5 A;  4FL6 A;  1VQN T;  2LQW A;  1PCX A;  2EFI A;  1YIJ A;  3L2W A;  2ROL A;  3A8H B;  5GAM d;  1NLO C;  3CCR Q;  5FRN A;  1OOT A;  3RDV A;  3VUB A;  2DER A;  1JO8 A;  2YDL A;  2BKD N;  2V8J A;  4E7Z A;  3OB9 A;  4E7K A;  3J7A F;  2QAZ A;  3CCV Q;  1X2K A;  3TEE A;  2J06 A;  4C5I A;  4Z89 A;  5AYF A;  3RNJ A;  1ZA1 B;  2V1Q A;  2ROT A;  2YRC A;  1K9A A;  4OGC A;  3CCL Q;  4R0K A;  2E5Q A;  3V7C A;  5GJV B;  4M7A A;  2QQR A;  2EVR A;  5CKE A;  3CC7 T;  3OS2 A;  1T3L A;  1D0Z A;  5A0G A;  2HQX A;  4X9C A;  3UF4 A;  4M78 E;  2JS0 A;  3NPF A;  1WJR A;  4J5Y A;  3OYM A;  5I21 A;  1RLQ C;  1CKB A;  3LLR A;  4PJO F;  3V8K A;  5GAO p;  3X20 B;  1TH7 A;  9ATC B;  1I1J A;  3RMS A;  2HDA A;  4M75 E;  4DOV A;  3H0H A;  4OMQ A;  3VS1 A;  4M7A F;  2HSP A;  2DET A;  4A54 A;  3L2V A;  2OTL Q;  1W1F A;  1T3S A;  3OMG A;  1BB9 A;  2K4Y A;  2O88 A;  4QVC A;  3RKY A;  2HMA A;  2A28 A;  2HL3 A;  2RD1 A;  2I0N A;  3I55 A;  2LCL A;  3OYN A;  4BY6 C;  3OYK A;  1X6B A;  2C0I A;  3FRN A;  1QKX A;  2KGT A;  2M0O A;  2XDB A;  4PJO B;  4F7U A;  4LDX A;  2LCC A;  5LJ5 e;  2JTE A;  3LYI A;  3HL8 A;  2RJF A;  4Y92 A;  1K9M R;  3H41 A;  4PFO A;  2EKO A;  3VRY A;  2KDS A;  1KHC A;  4M7A B;  2DNU A;  1OYX A;  1M2V A;  1OV3 A;  2KAF A;  3I5S A;  1WXT A;  5DLO A;  3SWN A;  1QCF A;  3FDR A;  2JOY A;  2XIC A;  2HKQ B;  2AZS A;  3CCJ Q;  2EYQ A;  1H3Z A;  1ZUK A;  1UDL A;  4F7U F;  2VGN A;  2EJG A;  5HCK A;  3OQ5 A;  1YFN A;  2FRY A;  2QTV A;  5CCA A;  3JB9 F;  2RB6 A;  1ZBJ A;  4RTV A;  3C95 A;  4BDY A;  1K0S A;  1NPP A;  1WXB A;  4N0A C;  2KQW A;  1AD5 A;  1I8F A;  3PVL A;  2RNA A;  2ENM A;  3FJP A;  1LVK A;  2BIV A;  2P84 A;  2FZC B;  4OMF B;  1WFW A;  1K1Z A;  5LJ3 j;  1VQN Q;  3Q1J A;  2NUP A;  3NTI A;  1GBQ A;  2O4X A;  4WF2 A;  1U8R A;  1OZ2 A;  2EW3 A;  1XJW B;  2GQV A;  3HKS A;  2LZ6 B;  4XK8 E;  2DRK A;  3UAT A;  3HHT B;  1T0H A;  4GLK A;  3UT1 A;  3G71 A;  5M9O A;  2RQW A;  3VS4 A;  3CMA A;  1G8X A;  1JJ2 S;  4FIB A;  3G7Z A;  2IG0 A;  2JVV A;  3CPW P;  1M2V B;  1X6G A;  2JTF A;  4HCK A;  1QVF A;  1RAB B;  4C92 A;  3CC2 T;  2FG0 A;  1NG2 A;  1YJN A;  1I4K 1;  3PMI A;  4WCI A;  1YHQ A;  2PUK B;  5A2Q E;  4E2F B;  3JCM b;  1VQO A;  3CC7 Q;  2D0N A;  1RAA B;  2DKG A;  1XQH A;  4AG1 C;  1MUZ A;  1VIF A;  4F16 A;  3A8L B;  4P5N A;  2OI3 A;  3DLM A;  1VQ8 T;  3X26 B;  3CQT A;  2L3R A;  2XI9 A;  3KUF A;  2MWO A;  3LH0 A;  4JJC A;  4C92 F;  5GAN e;  2DYI A;  3J80 E;  3EG9 A;  3GIB A;  1ZSG A;  2BZX A;  1C0M A;  2VKN A;  5FU6 B;  1NEG A;  4X34 A;  1ZBX A;  4DQ2 A;  4VUB A;  1YBY A;  5KYY B;  2I2L A;  1VYU A;  2KXC A;  2DYB A;  2DTO A;  4IUU A;  4HKE A;  5KYU A;  3HPW A;  1TUD A;  3EG1 A;  3JB9 J;  1VQM T;  4RG8 A;  2E10 A;  3M0Q A;  3CXC P;  3QDR B;  3GNF B;  1MMD A;  4F7U G;  3M0P A;  4PJO D;  4LUD A;  3OYG A;  2JXB A;  3TCJ A;  4V2S A;  3JCM c;  1TG0 A;  3HFO A;  2E1H A;  1KQS S;  2D1X A;  2E3H A;  5J3B A;  3DKM A;  4CC2 A;  4M7A D;  1PG5 B;  2DEQ A;  1BU1 A;  2V1R A;  2EYW A;  2MYS A;  4D8D A;  2WSE E;  1MNE A;  1IZ6 A;  4PJO C;  4C8Q F;  1OI1 A;  5GAO l;  3JCM g;  2CZ6 B;  4BDZ A;  3O5Z A;  2H3J A;  3THK A;  4Z02 A;  1SF9 A;  2AT1 B;  3D7S B;  2MI6 A;  3VS3 A;  2NWM A;  1M1G A;  3EFS A;  1VYV A;  4FYY B;  2LNV A;  1D3B B;  2JUF A;  1VQP Q;  3VS6 A;  3C4S A;  1OZ3 A;  3VU3 C;  2E5K A;  1D09 B;  1JXM A;  3JCM d;  5FRM A;  1M1K U;  4ELY C;  5GAO q;  3ZFJ A;  1RAH B;  4EMK A;  1VYT A;  2EAY A;  4J6W A;  3QXE B;  4BE2 A;  1QVG S;  2EQU A;  2EYX A;  4XAX B;  5FWB A;  1H64 1;  4C8Q B;  3OYD A;  4J9D A;  3RIR A;  4ZN3 A;  3QJ6 A;  1YJW Q;  1W70 A;  2OAU A;  3AT1 B;  2DVE A;  1MMN A;  1M5Q 1;  3JB9 D;  2VUB A;  2IIM A;  3P8D A;  4LDV A;  5GAN 8;  2KXD A;  4M77 A;  1VQK A;  1J3T A;  2AKK A;  2DBM A;  5GAO n;  4C92 G;  3GNG A;  3UA6 A;  3CC2 Q;  2COW A;  1G2B A;  1PRL C;  2CUD A;  2DXB A;  2D8J A;  2CT4 A;  2V8I A;  1TU0 B;  5KCO A;  4FW2 A;  4BUG A;  1YI2 A;  1WHJ A;  4GLM A;  3L2Q A;  3A98 A;  4ZGD B;  4IUV A;  2DE0 X;  2OTJ A;  4MML A;  1VIE A;  5HKC A;  4J9G A;  1NYG A;  3X25 B;  2KMT A;  2MOX A;  5AT1 B;  2QTX A;  3NTK A;  3J81 E;  2QQA A;  4M77 F;  1VQ8 Q;  2FPE A;  1UGR B;  2YLB A;  3I35 A;  1NLP C;  5FW9 A;  5C0M A;  1YIJ Q;  1X69 A;  4XTZ A;  2GTO A;  3EFO A;  3VYG A;  2DBK A;  2R5M A;  2KR3 A;  2O2O A;  2ABL A;  1KHI A;  1PKT A;  5LJ3 h;  5GAN 6;  1HK9 A;  4M78 C;  4J9I A;  2YRV A;  3G71 T;  4JUV A;  1E6H A;  2C0T A;  3CMA T;  1MHN A;  4XTW A;  5D6X A;  4WTO B;  4NL3 A;  5FU6 C;  4MDX A;  1N9R A;  1XNI A;  1AWJ A;  5HK3 A;  5L8R E;  2EPD A;  1V1C A;  1YJN T;  1UGQ B;  4C92 D;  2JM9 A;  5GAO r;  1RAF B;  1EZZ B;  1VQO T;  1K73 C;  2CSQ A;  2MMP A;  1E7O A;  3LX7 A;  2E6N A;  1GBR A;  4XU3 A;  2PVD B;  3M57 A;  3OYH A;  3L42 A;  2CYZ B;  5DY9 A;  3EGU A;  5CKD A;  4CI0 C;  5LJ5 g;  4ZTF A;  5I11 A;  1Y07 A;  1TOV A;  1JXO A;  2AHJ B;  1GL5 A;  2E12 A;  4DOW A;  1BCM A;  2GF7 A;  3TQ7 P;  1ABO A;  3SB2 A;  1WLP B;  1OQK A;  4BI8 B;  5IAY A;  4PKC C;  4HCZ A;  1WX6 A;  3EG0 A;  4J9H A;  3HTR A;  5GMK j;  1UTI A;  1GCP A;  3EFO B;  2DXC A;  3ZEH A;  1Y71 A;  1VQ7 A;  1QCN A;  1M90 C;  3HRU A;  1Z9Z A;  1QP3 A;  2FZG B;  1X2Q A;  2JW4 A;  2LJ3 A;  3M4Y A;  1V29 B;  4OMO A;  2M1H A;  2B8A A;  4MDW A;  1YIT A;  4X1V A;  1KC8 U;  2A36 A;  4IUR A;  4C8Q D;  3QYH B;  1EFN A;  2R58 A;  3HP9 A;  2EYY A;  1M8M A;  1K0X A;  4PJO E;  2ZPB B;  2GFU A;  5D6Y A;  5KYX B;  4RMO A;  4ZTJ A;  1FMW A;  3REB B;  2D6F A;  2DO3 A;  4M77 G;  2RK2 A;  4OVA A;  1M27 C;  3PNW C;  5LJ3 e;  2BE7 D;  1RAE B;  4FYX B;  3QJY A;  1M90 U;  3MHX A;  2L2P A;  4M7A E;  1PSE A;  1Q95 G;  3M59 A;  3GOX A;  2K5L A;  2F1L A;  4C8Q C;  3P8B B;  1IRX A;  2DA9 A;  8AT1 B;  3ZL7 C;  4RTU A;  1JQQ A;  2G3R A;  1M8V A;  1U5S A;  1WJQ A;  2LX9 A;  2RMO A;  3JCM f;  5CQX A;  3BFM A;  4RTT A;  2D0Q B;  2P0Q A;  5A0D A;  4J9C A;  1SG5 A;  2HBW A;  2FO0 A;  3QZ5 B;  2X4W A;  3RES A;  4RTY A;  1MND A;  3CPF A;  3FIF A;  2DMO A;  1Q86 C;  2AZV A;  1BYM A;  4A53 A;  7AT1 B;  3RER A;  5IXF A;  2ZPI B;  4XU0 A;  1OUL A;  2X4X A;  1M1K R;  4FT2 A;  2YUP A;  1G3T A;  3G71 Q;  3OSV A;  1Q7Y C;  4QKU A;  2J6F A;  2JZ2 A;  1QVF P;  3E9F A;  1ZSZ B;  2EGA A;  3CMA Q;  2SRC A;  1VUB A;  2WSF E;  4ESR A;  2JN0 A;  4D8K A;  4F7U E;  4C0F A;  6AT1 B;  3I56 A;  3C94 A;  1GRI A;  2B86 A;  4J8O A;  2JM8 A;  3QKJ A;  4M77 D;  5GAO m;  4N4G A;  3OW2 S;  2MWP A;  2V8K A;  1YJN Q;  2PQW A;  5IHN A;  1PM3 A;  1YHQ Q;  1NM7 A;  1Q82 C;  4FYW B;  1BIB A;  1VQO Q; 
#chains in the Genus database with same CATH homology
 2HEQ A;  2L3Q A;  1GBQ A;  4HVU A;  1X27 A;  1U06 A;  1OPK A;  1YCS B;  2EW3 A;  4JJD A;  1WXU A;  1AWW A;  2LZ6 B;  2DRK A;  1OPL A;  3UAT A;  2KBT A;  1T0H A;  2DL7 A;  2AK5 A;  3NHN A;  1A0N B;  1UUE A;  2J6O A;  2JT4 A;  2RQR A;  2RQW A;  3VS4 A;  2CT3 A;  2K6D A;  1W6X A;  2GGR A;  2X3W D;  1GFC A;  1M30 A;  1YWO A;  2K9G A;  2GTJ A;  1X6G A;  2X3X D;  4HCK A;  1CSK A;  2J7I A;  1X43 A;  2FG0 A;  1UFF A;  2RPN A;  1NG2 A;  4JZ4 A;  2K79 A;  3U23 A;  4WCI A;  2KRS A;  1ZLM A;  4Z88 A;  1H3H A;  3SEM A;  4J9F A;  1B07 A;  1B3Q A;  2D0N A;  2F2W A;  4AG1 C;  1UJ0 A;  4AFQ C;  1TUC A;  1MUZ A;  4F16 A;  2DJQ A;  2OI3 A;  2LP5 A;  2BTT A;  3H0F A;  2D8H A;  2OJ2 A;  3CQT A;  4JJC A;  1FMK A;  4EIK A;  1ZSG A;  2BZX A;  2VKN A;  1YP5 A;  3I9Q A;  1NEG A;  2VWF A;  1K4U S;  3NGP A;  1VA7 A;  2ESW A;  2AKL A;  1YN8 A;  4AFU C;  1VYU A;  2EGE A;  2KXC A;  3PE0 A;  2LCS A;  4HXJ A;  1E6G A;  2DYB A;  2RF0 A;  5L23 A;  3I5R A;  2LX7 A;  2C0O A;  2GNC A;  1TUD A;  2BZY A;  1ARK A;  3EG1 A;  4IIO A;  4LE9 A;  3M0Q A;  3KFV A;  1PRM C;  3M0P A;  2XMF A;  2J05 A;  4LUD A;  1ZUY A;  2JXB A;  2CRE A;  2LMJ A;  1TG0 A;  1HD3 A;  1UGV A;  2D1X A;  4CC2 A;  1K76 A;  2V1R A;  1BU1 A;  2PZ1 A;  2EYW A;  2M0Y A;  4D8D A;  3UA7 A;  1H8K A;  3RBB B;  2L3S A;  2DF6 A;  3SHW A;  2BZ8 A;  1UJY A;  3VS7 A;  2F2X A;  4ZNX A;  3VRZ A;  1AZE A;  2EYZ A;  4FSS A;  3ULR B;  3O5Z A;  3THK A;  2DIL A;  1BBZ A;  2KT1 A;  3LH5 A;  2SEM A;  3VS3 A;  2O9S A;  3VS5 A;  2RQV A;  4F14 A;  1H92 A;  2NWM A;  2PNI A;  1VYV A;  1I0C A;  1RLP C;  2CH4 W;  3QWX X;  1RUW A;  3VS6 A;  2E5K A;  1XOV A;  1JXM A;  1Z9Q A;  2YUQ A;  2DL8 A;  4DEX A;  1FYN A;  2HCK A;  1AEY A;  2GBQ A;  2LNH B;  2KRO A;  2DX1 A;  1VYT A;  1M3A A;  1N5Z A;  4GBQ A;  2EYX A;  1UE9 A;  1S1N A;  5FWB A;  4AFZ C;  3VS0 A;  4CC4 B;  1UEC A;  4J9D A;  4IIM A;  2J6K A;  2FPF A;  5GJW B;  1JEG A;  2LJ0 A;  1W70 A;  2DM1 A;  2CUB A;  4RTZ A;  2IIM A;  2GQI A;  1QLY A;  1WYX A;  2YUN A;  2KXD A;  4KRT A;  2AKK A;  1SRL A;  2DBM A;  2RQU A;  1J3T A;  2YT6 A;  1AZG B;  3UA6 A;  4F17 A;  2JMC A;  5ECA A;  1QWF A;  1MV0 B;  1G2B A;  1PRL C;  1SEM A;  2CUD A;  2D8J A;  2CT4 A;  4QT7 A;  2P4R A;  2PTK A;  1UHF A;  4LUE A;  2KYB A;  5IXB A;  4GLM A;  3M0R A;  1GFD A;  2K3B A;  1SSH A;  3A98 A;  1ZUU A;  1GCQ C;  1PNJ A;  2DE0 X;  3REA B;  4CC7 A;  1M3C A;  3EHR A;  4J9G A;  4RTW A;  1NYG A;  2F2V A;  2MOX A;  5FWC A;  3M0T A;  1UG1 A;  1KFZ A;  2LQN A;  4HVV A;  2FPE A;  2KRM A;  4J9E A;  4CC3 A;  4LN2 A;  4OMN A;  3I35 A;  1NLP C;  5FW9 A;  1PWT A;  2DRM A;  1KIK A;  4M4Z A;  1X69 A;  5IHK A;  2G6F X;  2GTO A;  4LNP A;  1IO6 A;  2DBK A;  2A37 A;  2H8H A;  2KR3 A;  2O2O A;  2ABL A;  1Y0M A;  2MIO A;  2M51 A;  1PKT A;  2DL3 A;  3M0U A;  4OMP A;  2FPD A;  2NUZ A;  3NMZ C;  1HSQ A;  4J9I A;  2FEI A;  1G83 A;  1E6H A;  1GCQ A;  3JV3 A;  4HVW A;  1QWE A;  3EHQ A;  4OMM A;  2C0T A;  2O9V A;  3H0I A;  2KNB B;  1KSW A;  2ECZ A;  2YUO A;  1AWJ A;  2CH4 A;  2L3P A;  2EPD A;  1V1C A;  1M3B A;  4OML A;  5IHI A;  1SHF A;  2JM9 A;  2OAW A;  2DL5 A;  2LQW A;  1BK2 A;  2CSQ A;  4JPB W;  1E7O A;  1GBR A;  2ROL A;  1PHT A;  1NLO C;  1OOT A;  3EGU A;  2K2M A;  2RN8 A;  1JO8 A;  2YDL A;  2CSI A;  5I11 A;  1U3O A;  4DEY A;  4JZ3 A;  1JXO A;  4ORZ A;  1X2K A;  1GL5 A;  1JU5 C;  2W10 A;  2J06 A;  1MV3 A;  1ABO A;  4RTX A;  4Z89 A;  1WLP B;  3RNJ A;  2JS2 A;  1WX6 A;  2V1Q A;  3EG0 A;  4J9H A;  2ROT A;  1K9A A;  1SHG A;  3M0S A;  1UTI A;  1AVZ C;  1SPK A;  1GCP A;  4R0K A;  1YNZ A;  5GJV B;  5EC7 A;  2KEA A;  4A63 B;  2EVR A;  4E6R A;  1T3L A;  3EG2 A;  1Z9Z A;  2MCN A;  2KYM A;  1PKS A;  3UF4 A;  1X2Q A;  1SRM A;  2ED1 A;  2JW4 A;  5I22 A;  2KT8 A;  2JS0 A;  3NPF A;  2W0Z A;  2LJ3 A;  3TSW A;  1RLQ C;  1CKB A;  4OMO A;  2KE9 A;  1HJD A;  3EG3 A;  4X1V A;  2A36 A;  1RI9 A;  4J9B A;  2DVJ A;  1EFN A;  2A08 A;  2DL4 A;  2EYY A;  2JMA A;  1I1J A;  1M8M A;  3PVQ A;  3R6N A;  3GBQ A;  2HDA A;  2EGC A;  1WDX A;  3H0H A;  4OMQ A;  3VS1 A;  1K0X A;  2HSP A;  3REB B;  1T3S A;  1NYF A;  1W1F A;  1ABQ A;  1M27 C;  1UHC A;  1BB9 A;  4AG2 C;  2L0A A;  2O88 A;  1QKW A;  2L2P A;  2A28 A;  2YSQ A;  2EQI A;  2I0N A;  3TSZ A;  2DA9 A;  2EBP A;  3ZL7 C;  4RTU A;  1X6B A;  1JQQ A;  2C0I A;  1U5S A;  1QKX A;  2KGT A;  1WA7 A;  4K11 A;  2RMO A;  1CKA A;  4RUG A;  4RTT A;  1T0J A;  2FRW A;  2JTE A;  1AOJ A;  4JJB A;  1Y57 A;  1LCK A;  4Y92 A;  3H41 A;  4J9C A;  2HBW A;  2FO0 A;  3C0C A;  3VRY A;  2EKH A;  2O31 A;  3VS2 A;  2DNU A;  4RTY A;  1OV3 A;  2ED0 A;  3I5S A;  1WXT A;  1QCF A;  3QWY A;  2DMO A;  2LJ1 A;  2AZV A;  1I07 A;  2AZS A;  5IXF A;  1NEB A;  1ZX6 A;  1KJW A;  3IQL A;  1ZUK A;  3TVT A;  3FJ5 A;  1UDL A;  5HCK A;  2YUP A;  2J6F A;  2FRY A;  1OEB A;  2DLP A;  2EGA A;  2SRC A;  4AFS C;  2RQT A;  4ESR A;  1ZBJ A;  4RTV A;  4D8K A;  2QDL A;  1K0S A;  2K7A A;  2KRN A;  2CDT A;  1WXB A;  1AWO A;  1AD5 A;  3PVL A;  1AWX A;  1GRI A;  2B86 A;  2RNA A;  2ENM A;  2JM8 A;  1YWP A;  1WIE A;  4Z8A A;  5IHN A;  5IH2 A;  1NM7 A;  1WFW A;  1K1Z A;  2VVK A;  1WI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...