1GL5A

Nmr structure of the sh3 domain from the tec protein tyrosine kinase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSEIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNNLDQYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE TEC
publication title The solution structure and intramolecular associations of the Tec kinase SRC homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 11
structure length 67
sequence length 67
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gl5A00
2DL5A 1UE9A 1UECA 2YT6A 2AKKA 2LQWA 2AZVA 3TSZA 1V1CA 2L3PA 3H0FA 5IHNA 2KNBB 1AVZC 1AWOA 2MIOA 4R0KA 2BZXA 1GRIA 4M4ZA 1T0JA 1E6HA 2HEQA 2EKHA 1H8KA 2FPDA 1PRLC 1ZLMA 3EG0A 1X2QA 1PHTA 4LUEA 2J7IA 1QKWA 2LQNA 2D0NA 2L3QA 1B07A 1RLQC 2EYWA 1G83A 2YDLA 2DA9A 1ABQA 2KEAA 1X6GA 2DL3A 2LNHB 1U06A 2LJ1A 1M3CA 2LJ0A 3NMZC 3I5RA 1HSQA 1YWOA 2O31A 3M0TA 2EGCA 4HVUA 3VRYA 3VS2A 1KFZA 2A28A 3VS7A 1M30A 2V1QA 3GBQA 1OPLA 4J9BA 1KSWA 3LH5A 2DBMA 1WI7A 2K2MA 5I22A 2LJ3A 1H3HA 2LX7A 1TG0A 1AOJA 2OJ2A 2KRNA 4OMMA 1WDXA 1WYXA 1GBRA 2RN8A 2LZ6B 1ARKA 2M0YA 2YUPA 2ENMA 4X1VA 1UJYA 2RPNA 2L3SA 2K3BA 3EG3A 5FWBA 3M0QA 4D8KA 2XMFA 1RI9A 1AEYA 2A08A 1FMKA 3R6NA 1VYUA 1JQQA 2O9SA 1VYTA 1ZSGA 2ECZA 2ESWA 3H41A 1YCSB 5IXBA 1RUWA 2KT8A 1TUCA 1PKTA 1SSHA 1T3LA 1X6BA 1B3QA 4F14A 4GLMA 4CC3A 2DRKA 2E5KA 2GBQA 3FJ5A 2CT4A 1K9AA 3CQTA 1MUZA 1BK2A 1SHFA 4J9CA 4CC7A 5IH2A 1W6XA 2HDAA 1RLPC 1A0NB 1MV3A 1QWFA 3H0HA 2DMOA 2KBTA 2P4RA 2FEIA 4J9HA 3THKA 2YUNA 4LNPA 2CH4A 5IHIA 4E6RA 1QKXA 1SHGA 2EQIA 3KFVA 1Z9ZA 1UUEA 1PWTA 1X27A 2VKNA 4F17A 1CSKA 4HVWA 4LE9A 2KR3A 4ORZA 1GFDA 2K6DA 1WA7A 2KRMA 1AWXA 2OAWA 2CSQA 5ECAA 2CREA 2RQVA 2AKLA 1U3OA 4WCIA 2KXDA 2SEMA 1HD3A 1QCFA 1W70A 4HXJA 2ROTA 4Y92A 1M27C 1K4US 4DEXA 3REBB 1JXMA 1ABOA 2KYBA 1NG2A 2RQWA 1ZUYA 1OPKA 1AWJA 3SHWA 1MV0B 1S1NA 3M0PA 4GBQA 2O2OA 3PE0A 1M8MA 2GTJA 2NUZA 2DL8A 4JZ3A 1WXBA 1Y0MA 2IIMA 4D8DA 2V1RA 3EHQA 3PVQA 2B86A 4AFQC 2VVKA 1ZBJA 1NEBA 3ULRB 3NGPA 3VS0A 2ED0A 1JU5C 2YUQA 2DL7A 2DF6A 2K9GA 1VA7A 4KRTA 5FWCA 2AZSA 4RTYA 1GCQA 1G2BA 1AZEA 1WXTA 4JJCA 1BU1A 1AWWA 1VYVA 1Y57A 2GNCA 1QLYA 1ZUUA 2JTEA 2RQRA 1J3TA 3A98A 2RF0A 1GCQC 4J9EA 2HBWA 5IXFA 2FG0A 1SEMA 1N5ZA 1PRMC 3RBBB 3UF4A 1JEGA 2JM8A 2LMJA 3IQLA 4IIMA 2J6OA 4JPBW 3M0SA 3QWXX 2GGRA 5L23A 3VS6A 1WX6A 4RTXA 4FSSA 2RQTA 1PKSA 2PNIA 1M3BA 1GCPA 3U23A 4ZNXA 2QDLA 2BZYA 3VS4A 2MCNA 2G6FX 1UJ0A 3EG1A 2JS0A 2GTOA 4J9GA 1WFWA 2DJQA 4Z88A 3EG2A 3VS3A 2DBKA 2DE0X 4OMNA 5IHKA 2RQUA 1OEBA 2NWMA 4RTUA 2AK5A 3UATA 3I5SA 4AG2C 4HCKA 2DRMA 1NLPC 1I1JA 1TUDA 4HVVA 2D8JA 5I11A 2FRWA 2DNUA 1BB9A 4K11A 3EHRA 2CDTA 2J6FA 2KE9A 1YWPA 2KROA 1HJDA 1K0SA 4J9FA 5GJWB 4OMPA 2X3XD 2C0TA 1M3AA 1UG1A 1WIEA 2JW4A 4J9DA 4AFSC 1U5SA 3I9QA 4EIKA 3EGUA 2FPFA 5HCKA 2DX1A 2C0OA 1GL5A 5GJVB 1YP5A 2EW3A 2DL4A 1QWEA 1WXUA 2EGAA 2EPDA 4OMLA 3RNJA 2CSIA 2DVJA 4ESRA 2EYXA 2JS2A 4DEYA 1BBZA 2O9VA 1CKAA 3I35A 1KIKA 3UA6A 1EFNA 4A63B 2FRYA 2ED1A 1I0CA 2L0AA 2EBPA 1CKBA 2A36A 2CH4W 5EC7A 2K79A 2J05A 1NYFA 2FO0A 2BTTA 1UTIA 2A37A 4F16A 1ZUKA 1WLPB 2JMAA 1UHFA 1KJWA 2BZ8A 3JV3A 2ABLA 3NHNA 3SEMA 4QT7A 4JJDA 2W10A 4CC2A 2H8HA 2O88A 1I07A 2DILA 2CUDA 4RTVA 1X43A 4RTTA 1E6GA 3TVTA 1UGVA 1JO8A 2YSQA 1IO6A 1E7OA 3M0UA 1NLOC 2LCSA 2DM1A 1ZX6A 2L2PA 4AFUC 4LUDA 2JT4A 1Z9QA 1UFFA 1K76A 2KXCA 4Z8AA 3TSWA 4OMOA 3NPFA 2OI3A 2HCKA 2J06A 2KGTA 2X3WD 3ZL7C 2KRSA 2GQIA 2RMOA 1LCKA 1T0HA 2EGEA 1H92A 4OMQA 1OV3A 1AZGB 3M0RA 1PNJA 2KT1A 1YN8A 2DYBA 4AG1C 4RUGA 5FW9A 4RTWA 2EVRA 2EYZA 4IIOA 2W0ZA 4LN2A 4RTZA 3QWYA 1UHCA 1X69A 2PZ1A 4CC4B 2JM9A 3PVLA 2LP5A 1W1FA 3VRZA 1OOTA 2C0IA 2K7AA 3O5ZA 2SRCA 3VS5A 2DLPA 1SRLA 2VWFA 2RNAA 2D8HA 2F2XA 4AFZC 2KYMA 2JMCA 2JXBA 2ROLA 1SRMA 2D1XA 2MOXA 2CUBA 2FPEA 1NEGA 3H0IA 2CT3A 2M51A 2F2WA 2YUOA 2I0NA 1XOVA 2F2VA 1GBQA 2EYYA 1K0XA 1JXOA 3REAB 1X2KA 2HSPA 1FYNA 1UDLA 1YNZA 4JZ4A 1T3SA 3UA7A 1GFCA 3C0CA 2J6KA 3VS1A 1NM7A 4J9IA 2PTKA 4JJBA 1K1ZA 1SPKA 1NYGA 4Z89A 1AD5A
chains in the Genus database with same CATH superfamily
2DL5A 4A54A 3ZFJA 3MHXA 2HAXA 2AZVA 5KYYA 3JCMc 8AT1B 2L3PA 1KHIA 4XU3A 3H0FA 5IHNA 2KNBB 2X4JA 3G1JA 2CS7A 1M2OA 4RKUE 3L2UA 1T0JA 2DO3A 3PIOA 1D0YA 1K9MR 4RCCA 2ZPGB 1R77A 1PRLC 2MWPA 1PC0A 1VQ7Q 3G4SQ 2DKGA 2DTIA 4DBRA 1QKWA 1IXDA 3JCMV 5DY9A 2CP0A 2RK2A 2EYWA 5CR2A 1TXQA 4ZGEB 2KEAA 3V8LA 4M77E 4N0AA 2LNHB 4ELYC 5KYYB 4PLIA 1HSQA 1YWOA 3M0TA 4HVUA 3VS2A 3GBQA 1OPLA 4FL6A 4J9BA 1QVGA 1YJWA 3OQ5A 5I21A 4C92G 5LJ3h 1HXDA 3UPUA 3HP9A 5KCHA 1YJ9Q 2DBMA 1PSEA 5GMKl 1M90C 3X26B 2QA4T 4OMMA 3MEVA 1WDXA 1WYXA 3FEOA 4EMHA 1R0BG 2AT1B 2RN8A 5GAMj 4OMFB 4IUUA 1VQ5Q 1AHJB 1YBYA 2YUPA 4M77D 1YI2Q 2COWA 2XMFA 2XK0A 3UWNA 5HK3A 3A8LB 3INZA 1FMKA 2P4TA 2ESWA 3CCUQ 1VQOT 2EQKA 2GFUA 4C0DB 1H641 4C92C 3OA6A 3QZ9B 2DRKA 1YIJQ 1JBMA 2QQSA 3DKMA 1QVPA 2E5KA 2GBQA 2F5TX 3I56A 1OZ2A 1YITT 1M9SA 2XDDA 3CQTA 1MUZA 1WGSA 2CP7A 2HDAA 1RLPC 4PLLA 4M7AF 3H0HA 3BDLA 1UB4A 3OYJA 2XI9A 3CPFA 4XU1A 5IHIA 4LDVA 4PFZA 3KFVA 4OB2B 1D09B 2VKNA 3CXCS 2QASA 2KR3A 1QCNA 2KRMA 2Y90A 1YHQQ 2R5AA 3FLGA 1QP3A 3I56T 2KXDA 2X4XA 4HXJA 2ROTA 3MP6A 4Y92A 1WQ7A 4DEXA 2K3YA 2DXCA 4QQGA 3MEUA 4N4GA 3HRUA 2DK3A 1MV0B 5DLQE 3G6ET 1M8MA 4QVZA 1WXBA 4DOWA 2X4WA 2AIRB 1NJIU 4J7FA 4OF1A 2IPOB 3O8VA 4AFQC 1ZBJA 2CZ0B 4QVDA 3NGPA 1RAGB 4FCYA 2P0PA 5GAN7 4JJNK 2QQRA 2XG8D 1GCQA 1KHCA 4JJCA 1BU1A 4F7UA 5KYUB 1YJNA 5GAN4 3JCMd 3CD6Q 2E64A 1GCQC 2RHZA 4J9EA 1SEMA 1N5ZA 1KQ1A 1JEGA 2JM8A 1OYXA 2LMJA 4IIMA 1UGSB 2GGRA 5L23A 3VS6A 1PKSA 2V8KA 2PNIA 4F7UB 3U23A 2QDLA 2K3XA 5GAMh 3VS4A 5CKFA 4M78G 2G6FX 4ELZC 2WSFE 3JCMJ 1JRIA 4JDSA 3PIPA 4L6V5 3J80E 3M58A 1MMGA 3OS1A 3JB9H 5GAOq 3JCMP 3CCVA 2VYTA 4C8QD 3MP8A 4AG2C 1I1JA 1TUDA 2NLUA 3I55T 5I2MA 2LC4A 1K9MC 3DB4A 2CDTA 4UC4A 3CCLQ 4A53A 2KROA 3TU4K 2JN0A 2RH2A 1K0SA 5GJWB 4M78C 1M3AA 1UG1A 2VXEA 5GANe 4CI0C 1RABB 1V76A 4XAXB 1U5SA 3I9QA 1OX9A 1KC8C 1G3TA 2FPFA 2ZAEA 5HCKA 2C0OA 1GL5A 2JVVA 3S3NA 2EJFA 4OMLA 2CSIA 2DVJA 4ESRA 3LX7A 5CCAA 3CC7T 1BBZA 2RJCA 1K73U 3CCET 1CKAA 3GF5A 1KIKA 3CCRA 1Y7XA 3CEYA 2DYIA 2ZPEB 3NTKA 4EPCA 4IUVA 2QA4Q 2QYZA 4BI8B 2EBPA 2A36A 4JRPA 1M4ZA 1K73R 5KCOA 5C6SA 1NYFA 4XTYA 1G3YA 2FO0A 3V8KA 2B8AA 2DIGA 1ZUKA 5LJ5g 3JSCA 2GFAA 1VQOQ 2QEXT 3SEMA 1BI2A 3F70A 2E41A 3JB9G 2XIDA 3CC2A 4O5VA 4HKEA 2DETA 1UGQB 2FYKA 3TVTA 3OYLA 1YITQ 2JUFA 3GNGA 1IO6A 4IKFA 2LX9A 1E7OA 1KQSA 3M0UA 2QG9B 1TU0B 1D0XA 3URGA 2KAFA 1ZX6A 5J3BA 4LUDA 3CC4A 1Z9QA 1UFFA 4Z8AA 3OYAA 4OMOA 3AHUA 1W4SA 4A4KA 1KQ2A 3OYKA 2DXBA 4OP0A 2MWOA 2LT1A 2X3WD 3SB2A 1QVFS 4NS5A 2EGEA 2EFIA 4OMQA 3E9FA 3OY9A 1PNJA 2VGNA 1OULA 1YN8A 2F69A 2JNGA 1Y07A 4RUGA 5FU6B 2BE9B 4RTWA 2IVWA 1Q82R 5HK0A 1VQ4A 2EYZA 3OSVA 5D7UA 1VQ6A 1SF9A 4CC4B 2CP5A 2JM9A 2C0IA 2K7AA 1D1AA 2RNAA 2RI2A 3G6EQ 2ROLA 1SRMA 2MOXA 3OYBA 1Q81U 1VQPA 1LJOA 1WJRA 5A0LA 3L2RA 1B34A 1PD1A 3VV0A 1VQKA 1MMNA 4DBFA 2F2VA 1K0XA 1JXOA 5L8RE 9ATCB 5LL6S 2QQAA 2E6NA 5LJ3e 4JZ4A 2M16A 2E65A 2L8DA 1Q81R 4WF2A 3CCMQ 4KULA 3UDCA 1NM7A 3RMQA 5FU7C 3CCQA 2LT4A 4L59A 3GLXA 1EIFA 1FMVA 1NYGA 4M7AA 2ZPBB 4F7UF 1IHVA 4QW2A 4PNOA 4KH1B 4PJOA 4LDXA 4OB0B 2YT6A 2LQWA 3TSZA 4OVAA 1V1CA 5FU7B 1VQKT 1AVZC 2XDBA 3BE3A 2OTJT 3PTAA 1GRIA 1E6HA 3KUFA 2HEQA 5CKBA 2A0FB 2EKHA 1ZQ1A 4FM4B 1ZLMA 1W2BS 4KBMB 3NFCA 4LUEA 2XU8A 2LQNA 3JCMW 2DIQA 1RL2A 2L3QA 1B07A 2YDLA 2DA9A 4PJOB 4EMKC 1U06A 3MJXA 5LJ3j 2LJ0A 2DZ9A 3NMZC 4R55A 2EGCA 3VRYA 3C95A 3I55Q 4X34A 1M30A 2O01E 4C5HA 2E3IA 2Z0WA 1KSWA 3N5BB 4KGXB 1JJ2P 1WI7A 2K2MA 1H3HA 2LCCA 2D9TA 2LX7A 4MZMA 2KRNA 4DOVA 2AHJB 2XKOC 1GBRA 4XTZA 1D1CA 2M0YA 4M77G 3M4YA 2HSEB 3CPWS 2IG0A 4LDYA 5FWBA 3M0QA 1AEYA 3WXMB 4EMGA 3OYGA 2DXUA 1OU9A 3EGXA 5GANf 4FW1A 1VYTA 3CC7Q 1YCSB 3UT1A 3CCEQ 1RUWA 2KT8A 1TUCA 3PFSA 4M7DG 4L5GA 4BDZA 5GAN2 1X6BA 3G71T 2MF2A 2EJGA 2EAYA 2RK1A 2O4XA 4RG2A 4N4HA 4HCZA 3A8OB 2X4YA 3RKWA 3QBYA 4M7AE 2C06A 3OW2P 4XK8E 3SDZA 4FYWB 5A0DA 1SHFA 1JJ2A 5EG2A 4M77C 2DEUA 3EGXB 4ZGJB 3L2WA 2KBTA 2PQWA 2P4RA 4J9HA 1D3BA 3THKA 1VQ9Q 4LNPA 2CH4A 4E6RA 4FU6A 4BACA 4B9XA 1UUEA 3PNWC 4J6YA 5KYXB 2HQHA 2O4XB 2QEXQ 4M7DC 4ME7A 4X9DA 3V7SA 4LE9A 4M75A 3EFOA 2HKNA 2R57A 3C94A 2OAWA 2NUPA 1K9MU 2OTLT 4M7AD 4FT4A 2JZ2A 4ATOA 1VQMT 5ECAA 3MKDA 4HT9A 1IREB 3P8HA 1QCFA 4M7DB 1K4US 4M75C 5GAMe 2KDSA 1ABOA 1NG2A 1AT1B 3JCMg 1D3BB 2CZ7B 3OW2A 2RQWA 4JS4A 1H3ZA 1AWJA 5CO7A 2RJEA 3VUZA 2H3JA 1S1NA 1KC8U 3M0PA 4Y28E 4GBQA 4BUGA 2JTMA 4PFPA 3H9NA 4M75B 3MEWA 2DL8A 3FC3A 4JZ3A 2VC8A 3EFOB 1Q82C 1N27A 2IIMA 2NUPB 2V1RA 4BE1A 4OGCA 1NEBA 2P0KA 2YWWA 3QKJA 4MMLA 3ULRB 2DD5A 2FVUA 2ED0A 1KC8R 1BI3A 2AZSA 4RTYA 2PVGB 1KD1U 1RAIB 2HL5C 1TUGB 1LVKA 1S72A 2A3LA 2RQRA 3A98A 5LJ5j 4J83A 3E2UA 4J8OA 3OYEA 3G7ZA 1O75A 3RBBB 3UF4A 1D0ZA 3IQLA 2J6OA 4WTOB 4E7ZA 4PJMA 1KD1R 2CZ1B 1WX6A 4RTXA 2RQTA 2D6FA 1GCPA 2QQBA 1Q81C 3J7AF 4ZNXA 4C92A 2LQKA 1WJSA 4OB3B 2VB6A 1UJ0A 3EG1A 2QK0A 3M5AA 3EAEA 1YJWT 1WHMA 3MPUB 4Z88A 3EG2A 2MK5A 2DE0X 4C8QG 4PK4A 1OEBA 1VQNQ 4RTUA 2AK5A 3CMAA 4KGZB 3QIIA 3VUBA 5CKDA 4HT8A 4C92B 3LYIA 2QAZA 3S3MA 2D0QB 4K11A 3EHRA 1I81A 2OTJQ 1G8XA 2ZGWA 4P5NA 4PJOF 2F5KA 4B9WA 2C0TA 3RR6A 3NTIA 1U1TA 1WIEA 2JW4A 4J9DA 3A8GB 4EIKA 3A8HB 4J7IA 4C8QC 2DX1A 2R58A 4MMKA 5GAN5 3QJ6A 5AT1B 3RNJA 1WXUA 5IAYA 4JRQA 2EYXA 3S6WA 3I35A 5KYUA 3QSUA 4C8QB 1MNEA 2WACA 2XICA 5HY6A 3EH1A 2BE7D 1Q95G 2ED1A 1KG1A 3EG9B 2EJ9A 2CGHA 4Q5WA 1CKBA 7AT1B 3RMSA 2CH4W 5GAN6 3CMEA 2KK4A 1WLPB 1UHFA 1KJWA 2ATCB 2K5IA 3CCJA 3JV3A 2YHTA 4QT7A 4J6WA 2W10A 3G71Q 2O88A 2FHDA 1I07A 2DILA 2HMAA 2CUDA 3TEEA 1E6GA 1UGVA 2LCSA 3PGGA 5IT9E 5GANd 2L2PA 5LJ5h 5J39A 3X20B 2JT4A 2KXCA 3CXCP 3TSWA 2COZA 2OI3A 2HKQB 5D6YA 4RCBA 2J06A 2KGTA 1WHJA 1YJNT 4BE0A 1VIEA 2GQIA 3X25B 2RMOA 3CCSA 1LCKA 4II1A 4QKUA 1H92A 4CRIA 1OV3A 4M7DF 3M0RA 4A4FA 2G3RA 2KT1A 1X01A 3SWNC 3OYHA 2EVRA 5IN1A 3FIFA 3P8DA 2OTLQ 2E10A 3EH2A 1VQMQ 1M2VA 1VQ8A 5CK9A 1OQKA 2FZCB 4M78A 2FZGB 1X69A 3QPHA 2XDPA 2LP5A 4M75F 1W1FA 3MCAB 4LD9K 1OOTA 3SWNB 3O5ZA 1G3WA 4AFZC 3EGDB 4D6WA 1WHGA 5FLXE 2D1XA 1VQLA 3CBPA 1VUBA 3CXCA 1F1BB 5GAMf 2M51A 1B7TA 5CKHA 3LWHA 1M2VB 2I0NA 1XOVA 3CCVT 5FRNA 8ATCB 4M78B 3REAB 1TS9A 4N4IA 1FYNA 1YNZA 2E70A 3VKIA 1GFCA 4NL2A 4MZPA 4F7UE 2J6KA 4PJLA 2ZPHB 1KQSP 1M1GA 1K1ZA 1UGPB 1SPKA 1KD1C 1PD0A 1AD5A 2MAMA 5I2SA 2VASA 1UE9A 1ZSZA 1Y96A 2AKKA 1Q7YR 2KVQG 4BY6C 4R0KA 2BZXA 4M4ZA 1ZSZC 2FPDA 3EFSA 3KXTA 1X2QA 2LVMA 3CCRT 2DTOA 4E7KA 1YJWQ 4BY6B 2BUDA 3GNFB 4C92F 2DPPB 4QQ6A 1G83A 3A5ZB 3OS2A 1ZSZB 2DL3A 2RJDA 5CQXA 3LGLA 1Y96B 2LJ1A 2YXYA 2HL3A 2HD0A 1M3CA 3I5RA 2O31A 4ZTJA 1JB0E 1SSFA 1KFZA 3R6OA 1VQ7A 2M02A 3G4SA 2LCLA 1Q82U 3LH5A 2CZ6B 3X28B 2DFUA 2PU9B 2OJ2A 3ER0A 3QZ5B 1DJ7B 4BI3A 2VGMA 1ARKA 2ENMA 4NL3A 3CC2T 2K3BA 1Q86R 4C8QF 1YJ9A 1I4K1 4D8KA 3I56Q 5GAOl 3RKYA 1ZSGA 2ECZA 3H41A 5IXBA 4RG8A 1VQ7T 1PKTA 3CC4T 1VQ5A 4F14A 4X9CA 1YI2A 5DM7R 2HQEA 4ZTFA 2RM4A 3CCUA 4C0ZA 2XD0A 2E5QA 3M55A 1A0NB 4XTWA 1QWFA 1YCYA 2DMOA 2Y4YA 1VQ4T 1YIJA 2FEIA 1RAEB 2CYZB 2YUNA 1VQ6T 2WSCE 1QKXA 3TREA 2EQIA 1PWTA 4C0GA 1BCMA 2E12A 2X9HA 5M9OA 1CSKA 3L1AA 4ZN3A 4ORZA 1K8AU 1GFDA 5CAIA 1WA7A 4C5EA 1G3SA 1AWXA 2CSQA 4J6XA 1SKUB 3RDVA 4JLIA 1U3OA 1NBEB 2RHUA 1P92A 3SD4A 1VQPT 1JXMA 5CVIA 1ZUYA 2F1LA 3RUXA 1K8AR 3SHWA 3E9GA 1MHNA 1EX4A 2E6ZA 1YHQA 4BD3A 1YJNQ 2M1HA 1OZ3A 3RESA 4EMKA 1RI0A 1WHLA 4D8DA 3CCQT 2VVKA 2QTXA 2YUQA 2BKDN 3JCMh 4IUQA 2K5LA 2DF6A 2K9GA 1VA7A 3MP1A 4KRTA 1AZEA 1WXTA 2OAUA 2V26A 1YFNA 2P0QA 1AWWA 1WHKA 5GAN8 1VYVA 3LWIA 1Y57A 2GNCA 4MDWA 2JTEA 4EMKB 1U1SA 2GF7A 2HBWA 5IXFA 1QW1A 1C0MA 2WSEE 2L3RA 4M78F 4XTVA 2EWNA 2LRQA 3M0SA 1WHHA 3JAME 4BI4A 3H8ZA 4FSSA 2K57A 3CD6A 3V8JA 1M3BA 3C12A 2HBPA 3CCVQ 1QVGS 1UEBA 4QQDA 5KYNA 3OBYA 2MPXC 2MCNA 5GMKi 2ZCFB 2GTOA 4J9GA 1RAFB 2DJQA 1HYOA 2ZPIB 5GAMd 4R56A 5KYXA 1M8VA 4M77A 3HL8A 3NTHA 2DBKA 1R0CB 5IHKA 2RQUA 2KMTA 2NWMA 1Q7YC 3I5SA 2DRMA 1NLPC 2D8JA 5I11A 4PJOE 1W2BP 3SFMA 2FRWA 4V2SA 2DNUA 2VUBA 4M7DA 1BB9A 3A8MB 4FT2A 3FRNA 2A7YA 2HZYA 2RHIA 4J9FA 5J26A 2X3XD 4XQ3A 1WNLA 4Z02A 2K5FA 3OYYA 3JCMQ 4M77B 4GY5A 1M1KC 3CCRQ 2KI7A 2MI6A 4QVCA 4BDYA 3E1SA 3CCLA 2KY9A 5LJ5e 1OI1A 4DQ2A 3LW5E 4E47A 1YP5A 1XQHA 3MEAA 4J5YA 2ZPFB 2EGAA 4RMOA 3FB9A 4PJOD 4TVRA 4E7IA 5A0GA 3JCMX 1EFNA 4A63B 4PKCC 2YLBA 2FRYA 3JCMb 1ZBXA 3RIRA 3CPWP 1W2BA 1UGRB 1WJQA 1I0CA 2L0AA 1Q86C 4E2FB 5EC7A 2LDMA 5GANg 5GAOm 2HQXA 2J05A 3JB9F 3C4SA 3CC2Q 3CCLT 2BTTA 5GMKe 1UTIA 3T9NA 3OYIA 1IGUA 4F16A 2OX7A 2JMAA 1N8RR 2QA4A 3HRTA 4O6JA 5KYWA 1LOJA 3EFRA 2BZ8A 1I5OB 3J81E 1MMDA 3CC4Q 4JLGA 5D6WA 2LQ8A 1X43A 3A1PA 1TH7A 3BFMA 4JRKA 3CBMA 3QHSA 2VXFA 3OYMA 2EQUA 1XTDA 2M0OA 1VQOA 3CPWA 4AFUC 3L2ZA 1EZZB 1RACB 4N0AC 1GXIE 1K76A 3BW1A 3NPFA 5AYFA 5KYWB 1VQ4Q 4M7DE 1LPLA 2HCKA 3HRSA 5DLOA 1VQ6Q 3QDRB 4DBQA 1YITA 3ZL7C 2COYA 1IHWA 2PVDB 4FYYB 1S72T 2HNIA 3OB9A 4C0DC 5FW9A 3L42A 2CKKA 3MO8A 5GMKj 4M75E 4OB1B 5LJ3f 4IIOA 4LN2A 5GAN3 3QWYA 1VQPQ 1K8AC 1UHCA 4FSXA 3M54A 4KGVB 1VQKQ 3DB3A 4M7DD 1SRLA 2VWFA 1IRXA 1X75C 1IZ6A 3TCJA 4C8QA 1OU8A 1MGQA 1MMAA 2CP6A 2FPEA 1NEGA 3H0IA 2X51A 2CT3A 4A4EA 2F2WA 3EG9A 3FDRA 3OSSC 3CCQQ 3OS5A 2EKOA 4M75D 1GBQA 2EYYA 5A2QE 4DA4A 2EQJA 1M1FA 1BIBA 2JJ9A 4HCCA 3G6EA 3CMAT 3AT1B 3HFNA 4LXCA 3S3OA 4HCBA 2GQVA 3ZEHA 2PTKA 5HKCA 2RO0A 3VYHB 2DXTA 2M9UA 4XTUA 1M5Q1 1QCOA 1UECA 5GAOn 4JRIA 1ZA2B 1C1AA 2H3EB 3CCMA 3HKSA 4VUBA 1AWOA 3X24B 2MIOA 1U8RA 5KE3A 2RHYA 2MYSA 2RD1A 2DEQA 4F7UG 4C92E 1N9RA 1H8KA 3OYDA 4LDWA 3CBOA 3EG0A 2XHCA 1XJWB 4AT1B 1PHTA 4IURA 5LJ3g 1QMCA 2J7IA 2D0NA 1RLQC 1ABQA 1NE8A 1X6GA 3QO3A 1FX7A 1IB8A 2A28A 3VS7A 2V1QA 4NOYA 4M77F 1SG5A 3CMET 3CCMT 1NJIR 3LGFA 1O9SA 2X35A 4C92D 1TSFA 2LJ3A 5I22A 3SWNA 4JS5A 3OYCA 1TG0A 1AOJA 4C5IA 4C8QE 3CCJT 4Y91A 1PM3A 3EGDA 1BKBA 3ASKA 2EYQA 2LZ6B 4C5GA 3I55A 2V8JA 2RHXA 4PL6A 1KQSS 4X1VA 1UJYA 2CP2A 2L3SA 2RPNA 3EG3A 3E19A 4KUDK 4EDUA 1RI9A 3WVEB 5KH6A 2A08A 2QQ9A 3R6NA 1VYUA 1JQQA 2O9SA 1TTHB 2E1HA 3OBWA 5GMKh 1SSHA 3GOXA 1PSFA 1T3LA 4XU0A 1B3QA 2L5QA 3QYHB 3GP8A 5LJ5f 4GLMA 4CC3A 1WQWA 3FJ5A 4KUIA 2CT4A 1K9AA 3CCST 3JCMe 1BI1A 1BK2A 3QUIA 4J9CA 4XU2A 4CC7A 5CKEA 5IH2A 3CC7A 3CCEA 1W6XA 4PJNA 1OX8A 1KK7A 1MV3A 1TOVA 1N8RC 1FMWA 2FL7A 3V7RA 3VYGA 1VQ8T 2QGGA 2RI3A 1SHGA 3V7CA 1N9SA 1Z9ZA 2YRCA 1X27A 1Q7YU 1I8FA 2KSSA 4F17A 1ACMB 1QP2A 4HVWA 3JB9J 1HK9A 2K6DA 2KQWA 3OMCA 4JUVA 4XTXA 3WVDB 2CREA 2RQVA 1VQLT 2AKLA 4WCIA 2SEMA 2VV5A 1HD3A 1W70A 1VQ9A 1M27C 2NYSA 4FYXB 2QEXA 3REBB 2KYBA 1BCOA 1M1KU 5GMKm 1WZOA 3HPWA 1OPKA 1RADB 5D6XA 1V29B 3Q1JA 1IGQA 2O2OA 2JTFA 3PE0A 2GTJA 2NUZA 2RI5A 3BDUA 2FB7A 1Y0MA 1Y71A 2ZZDA 1X6OA 1S72Q 1PG5B 3EHQA 3LLRA 3PVQA 4KT0E 2B86A 5C0MA 4BE2A 1M1KR 3VS0A 1JU5C 3BY7A 2DL7A 3DLLA 3JRZA 5FWCA 4FW2A 1G2BA 1VQ9T 5GANj 4M78E 1Q86U 4IUPA 1QLYA 1ZUUA 5GAMg 1J3TA 4C0FA 4E7JA 2RF0A 2DZCA 4F04B 2FG0A 1C6VX 2P84A 1PRMC 3M59A 4JPBW 5LJ3d 1LNXA 3M9QA 3QWXX 2GCXA 4A4HA 5GAOr 3HTRA 5FU6C 5FRMA 2BZYA 2QTVA 3QXEB 1QQJA 3CMAQ 2JS0A 4M78D 3G4ST 1WFWA 1VIFA 3OMGA 4E7LA 3VS3A 4OMNA 2V8IA 3UATA 3PMTA 4HCKA 2E4HA 2QXFA 4HVVA 2QI2A 1M90U 1NPRA 3TQ7P 3VU3C 1RAHB 2J6FA 3QDFA 2KE9A 1D1BA 1YWPA 2EIFA 4MZTA 1HJDA 1YJ9T 5CQYA 2PUKB 4OGEA 1I5LA 4OMPA 2LTOA 3ZBDA 4ZN1A 5CIUA 4DBHA 1VQNA 4AFSC 3M57A 3DLMA 1M90R 1VQ5T 3EGUA 1FXXA 4M7AG 1JJ2S 3QJYA 2OTJA 1NPPA 1YI2T 5GJVB 2K2VA 2QDYB 4PJOG 2EW3A 2NUTA 2DL4A 1QWEA 2E3HA 2EPDA 4GLKA 1NJIC 1QVFP 2JS2A 4DEYA 2O9VA 3CCUT 2YRVA 3ME9A 4LDUA 3CMEQ 3UA6A 4LD6A 2DTHA 3H6ZA 1YIJT 1RAAB 2PUOB 1B34B 1VQNT 3CCJQ 4HA8A 1WPYA 4AMCA 2K79A 4A4GA 4M7AC 2NUTB 2R5MA 4PFOA 1FWZA 3OS0A 4PJOC 2YLCA 2DAQA 1BIAA 2A37A 3OW2S 2ABLA 3NHNA 2EQMA 4JJDA 4CC2A 4M7AB 2H8HA 3HSBA 3QG1A 1QVFA 3RERA 4RTVA 3OYNA 2LNVA 4RTTA 3HFOA 3JB9D 2QGFB 5GANh 2L89A 2RB6A 1YHQT 2FZKB 1JO8A 2YSQA 5KE2A 3META 3CCSQ 3RKXA 2PVOB 1NLOC 1PCXA 2DM1A 4ZGDB 4KH0B 4B6MA 3G71A 1NZ9A 3P8BB 5GAOp 1N6AA 4FIBA 1VQ8Q 5LJ5d 2RA2A 2BIVA 2Y4XA 3JCMf 2KRSA 1ZHIA 1T0HA 1AZGB 4E7SA 2K4YA 2DYBA 3D7SB 4YTLA 4AG1C 3FJPA 3GIBA 3L2VA 1BI0A 2DD4A 2YRDA 1VQLQ 3PMIA 3GPLA 2W0ZA 4PJJA 4RTZA 2JOYA 1VOMA 2MMPA 2PZ1A 3PVLA 3OYFA 1XNIA 3VRZA 3CD6T 2SRCA 4IUTA 3VS5A 2DLPA 2DVEA 2RJFA 4BB7A 6AT1B 2D8HA 2F2XA 3HHTB 2KYMA 2JMCA 3JB9I 2JXBA 2OTLA 1K73C 1VQMA 5FROA 3KBGA 1TWBA 3VJPA 2CUBA 2DJZA 2YUOA 4M75G 3M56A 4ANJA 3M53A 3M4GA 3L2QA 4E7HA 1ZA1B 3PT9A 3QYGB 1X2KA 2HSPA 2DERA 1UDLA 4FYVB 1MNDA 1T3SA 3UA7A 1G5VA 3C0CA 3VS1A 4MDXA 2I2LA 1R8OB 4J9IA 4JJBA 2CP3A 1BYMA 4Z89A 1N8RU 3LH0A 1QVGP
chains in the Genus database with same CATH topology
2DL5A 1UE9A 1UECA 2YT6A 2AKKA 2LQWA 2AZVA 3TSZA 1V1CA 2L3PA 3H0FA 5IHNA 2KNBB 1AVZC 1AWOA 2MIOA 4R0KA 2BZXA 1GRIA 4M4ZA 1T0JA 1E6HA 2HEQA 2EKHA 1H8KA 2FPDA 1PRLC 1ZLMA 3EG0A 1X2QA 1PHTA 4LUEA 2J7IA 1QKWA 2LQNA 2D0NA 2L3QA 1B07A 1RLQC 2EYWA 1G83A 2YDLA 2DA9A 1ABQA 2KEAA 1X6GA 2DL3A 2LNHB 1U06A 2LJ1A 1M3CA 2LJ0A 3NMZC 3I5RA 1HSQA 1YWOA 2O31A 3M0TA 2EGCA 4HVUA 3VRYA 3VS2A 1KFZA 2A28A 3VS7A 1M30A 2V1QA 3GBQA 1OPLA 4J9BA 1KSWA 3LH5A 2DBMA 1WI7A 2K2MA 5I22A 2LJ3A 1H3HA 2LX7A 1TG0A 1AOJA 2OJ2A 2KRNA 4OMMA 1WDXA 1WYXA 1GBRA 2RN8A 2LZ6B 1ARKA 2M0YA 2YUPA 2ENMA 4X1VA 1UJYA 2RPNA 2L3SA 2K3BA 3EG3A 5FWBA 3M0QA 4D8KA 2XMFA 1RI9A 1AEYA 2A08A 1FMKA 3R6NA 1VYUA 1JQQA 2O9SA 1VYTA 1ZSGA 2ECZA 2ESWA 3H41A 1YCSB 5IXBA 1RUWA 2KT8A 1TUCA 1PKTA 1SSHA 1T3LA 1X6BA 1B3QA 4F14A 4GLMA 4CC3A 2DRKA 2E5KA 2GBQA 3FJ5A 2CT4A 1K9AA 3CQTA 1MUZA 1BK2A 1SHFA 4J9CA 4CC7A 5IH2A 1W6XA 2HDAA 1RLPC 1A0NB 1MV3A 1QWFA 3H0HA 2DMOA 2KBTA 2P4RA 2FEIA 4J9HA 3THKA 2YUNA 4LNPA 2CH4A 5IHIA 4E6RA 1QKXA 1SHGA 2EQIA 3KFVA 1Z9ZA 1UUEA 1PWTA 1X27A 2VKNA 4F17A 1CSKA 4HVWA 4LE9A 2KR3A 4ORZA 1GFDA 2K6DA 1WA7A 2KRMA 1AWXA 2OAWA 2CSQA 5ECAA 2CREA 2RQVA 2AKLA 1U3OA 4WCIA 2KXDA 2SEMA 1HD3A 1QCFA 1W70A 4HXJA 2ROTA 4Y92A 1M27C 1K4US 4DEXA 3REBB 1JXMA 1ABOA 2KYBA 1NG2A 2RQWA 1ZUYA 1OPKA 1AWJA 3SHWA 1MV0B 1S1NA 3M0PA 4GBQA 2O2OA 3PE0A 1M8MA 2GTJA 2NUZA 2DL8A 4JZ3A 1WXBA 1Y0MA 2IIMA 4D8DA 2V1RA 3EHQA 3PVQA 2B86A 4AFQC 2VVKA 1ZBJA 1NEBA 3ULRB 3NGPA 3VS0A 2ED0A 1JU5C 2YUQA 2DL7A 2DF6A 2K9GA 1VA7A 4KRTA 5FWCA 2AZSA 4RTYA 1GCQA 1G2BA 1AZEA 1WXTA 4JJCA 1BU1A 1AWWA 1VYVA 1Y57A 2GNCA 1QLYA 1ZUUA 2JTEA 2RQRA 1J3TA 3A98A 2RF0A 1GCQC 4J9EA 2HBWA 5IXFA 2FG0A 1SEMA 1N5ZA 1PRMC 3RBBB 3UF4A 1JEGA 2JM8A 2LMJA 3IQLA 4IIMA 2J6OA 4JPBW 3M0SA 3QWXX 2GGRA 5L23A 3VS6A 1WX6A 4RTXA 4FSSA 2RQTA 1PKSA 2PNIA 1M3BA 1GCPA 3U23A 4ZNXA 2QDLA 2BZYA 3VS4A 2MCNA 2G6FX 1UJ0A 3EG1A 2JS0A 2GTOA 4J9GA 1WFWA 2DJQA 4Z88A 3EG2A 3VS3A 2DBKA 2DE0X 4OMNA 5IHKA 2RQUA 1OEBA 2NWMA 4RTUA 2AK5A 3UATA 3I5SA 4AG2C 4HCKA 2DRMA 1NLPC 1I1JA 1TUDA 4HVVA 2D8JA 5I11A 2FRWA 2DNUA 1BB9A 4K11A 3EHRA 2CDTA 2J6FA 2KE9A 1YWPA 2KROA 1HJDA 1K0SA 4J9FA 5GJWB 4OMPA 2X3XD 2C0TA 1M3AA 1UG1A 1WIEA 2JW4A 4J9DA 4AFSC 1U5SA 3I9QA 4EIKA 3EGUA 2FPFA 5HCKA 2DX1A 2C0OA 1GL5A 5GJVB 1YP5A 2EW3A 2DL4A 1QWEA 1WXUA 2EGAA 2EPDA 4OMLA 3RNJA 2CSIA 2DVJA 4ESRA 2EYXA 2JS2A 4DEYA 1BBZA 2O9VA 1CKAA 3I35A 1KIKA 3UA6A 1EFNA 4A63B 2FRYA 2ED1A 1I0CA 2L0AA 2EBPA 1CKBA 2A36A 2CH4W 5EC7A 2K79A 2J05A 1NYFA 2FO0A 2BTTA 1UTIA 2A37A 4F16A 1ZUKA 1WLPB 2JMAA 1UHFA 1KJWA 2BZ8A 3JV3A 2ABLA 3NHNA 3SEMA 4QT7A 4JJDA 2W10A 4CC2A 2H8HA 2O88A 1I07A 2DILA 2CUDA 4RTVA 1X43A 4RTTA 1E6GA 3TVTA 1UGVA 1JO8A 2YSQA 1IO6A 1E7OA 3M0UA 1NLOC 2LCSA 2DM1A 1ZX6A 2L2PA 4AFUC 4LUDA 2JT4A 1Z9QA 1UFFA 1K76A 2KXCA 4Z8AA 3TSWA 4OMOA 3NPFA 2OI3A 2HCKA 2J06A 2KGTA 2X3WD 3ZL7C 2KRSA 2GQIA 2RMOA 1LCKA 1T0HA 2EGEA 1H92A 4OMQA 1OV3A 1AZGB 3M0RA 1PNJA 2KT1A 1YN8A 2DYBA 4AG1C 4RUGA 5FW9A 4RTWA 2EVRA 2EYZA 4IIOA 2W0ZA 4LN2A 4RTZA 3QWYA 1UHCA 1X69A 2PZ1A 4CC4B 2JM9A 3PVLA 2LP5A 1W1FA 3VRZA 1OOTA 2C0IA 2K7AA 3O5ZA 2SRCA 3VS5A 2DLPA 1SRLA 2VWFA 2RNAA 2D8HA 2F2XA 4AFZC 2KYMA 2JMCA 2JXBA 2ROLA 1SRMA 2D1XA 2MOXA 2CUBA 2FPEA 1NEGA 3H0IA 2CT3A 2M51A 2F2WA 2YUOA 2I0NA 1XOVA 2F2VA 1GBQA 2EYYA 1K0XA 1JXOA 3REAB 1X2KA 2HSPA 1FYNA 1UDLA 1YNZA 4JZ4A 1T3SA 3UA7A 1GFCA 3C0CA 2J6KA 3VS1A 1NM7A 4J9IA 2PTKA 4JJBA 1K1ZA 1SPKA 1NYGA 4Z89A 1AD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL5 A;  1UE9 A;  1UEC A;  2YT6 A;  2AKK A;  2LQW A;  2AZV A;  3TSZ A;  1V1C A;  2L3P A;  3H0F A;  5IHN A;  2KNB B;  1AVZ C;  1AWO A;  2MIO A;  4R0K A;  2BZX A;  1GRI A;  4M4Z A;  1T0J A;  1E6H A;  2HEQ A;  2EKH A;  1H8K A;  2FPD A;  1PRL C;  1ZLM A;  3EG0 A;  1X2Q A;  1PHT A;  4LUE A;  2J7I A;  1QKW A;  2LQN A;  2D0N A;  2L3Q A;  1B07 A;  1RLQ C;  2EYW A;  1G83 A;  2YDL A;  2DA9 A;  1ABQ A;  2KEA A;  1X6G A;  2DL3 A;  2LNH B;  1U06 A;  2LJ1 A;  1M3C A;  2LJ0 A;  3NMZ C;  3I5R A;  1HSQ A;  1YWO A;  2O31 A;  3M0T A;  2EGC A;  4HVU A;  3VRY A;  3VS2 A;  1KFZ A;  2A28 A;  3VS7 A;  1M30 A;  2V1Q A;  3GBQ A;  1OPL A;  4J9B A;  1KSW A;  3LH5 A;  2DBM A;  1WI7 A;  2K2M A;  5I22 A;  2LJ3 A;  1H3H A;  2LX7 A;  1TG0 A;  1AOJ A;  2OJ2 A;  2KRN A;  4OMM A;  1WDX A;  1WYX A;  1GBR A;  2RN8 A;  2LZ6 B;  1ARK A;  2M0Y A;  2YUP A;  2ENM A;  4X1V A;  1UJY A;  2RPN A;  2L3S A;  2K3B A;  3EG3 A;  5FWB A;  3M0Q A;  4D8K A;  2XMF A;  1RI9 A;  1AEY A;  2A08 A;  1FMK A;  3R6N A;  1VYU A;  1JQQ A;  2O9S A;  1VYT A;  1ZSG A;  2ECZ A;  2ESW A;  3H41 A;  1YCS B;  5IXB A;  1RUW A;  2KT8 A;  1TUC A;  1PKT A;  1SSH A;  1T3L A;  1X6B A;  1B3Q A;  4F14 A;  4GLM A;  4CC3 A;  2DRK A;  2E5K A;  2GBQ A;  3FJ5 A;  2CT4 A;  1K9A A;  3CQT A;  1MUZ A;  1BK2 A;  1SHF A;  4J9C A;  4CC7 A;  5IH2 A;  1W6X A;  2HDA A;  1RLP C;  1A0N B;  1MV3 A;  1QWF A;  3H0H A;  2DMO A;  2KBT A;  2P4R A;  2FEI A;  4J9H A;  3THK A;  2YUN A;  4LNP A;  2CH4 A;  5IHI A;  4E6R A;  1QKX A;  1SHG A;  2EQI A;  3KFV A;  1Z9Z A;  1UUE A;  1PWT A;  1X27 A;  2VKN A;  4F17 A;  1CSK A;  4HVW A;  4LE9 A;  2KR3 A;  4ORZ A;  1GFD A;  2K6D A;  1WA7 A;  2KRM A;  1AWX A;  2OAW A;  2CSQ A;  5ECA A;  2CRE A;  2RQV A;  2AKL A;  1U3O A;  4WCI A;  2KXD A;  2SEM A;  1HD3 A;  1QCF A;  1W70 A;  4HXJ A;  2ROT A;  4Y92 A;  1M27 C;  1K4U S;  4DEX A;  3REB B;  1JXM A;  1ABO A;  2KYB A;  1NG2 A;  2RQW A;  1ZUY A;  1OPK A;  1AWJ A;  3SHW A;  1MV0 B;  1S1N A;  3M0P A;  4GBQ A;  2O2O A;  3PE0 A;  1M8M A;  2GTJ A;  2NUZ A;  2DL8 A;  4JZ3 A;  1WXB A;  1Y0M A;  2IIM A;  4D8D A;  2V1R A;  3EHQ A;  3PVQ A;  2B86 A;  4AFQ C;  2VVK A;  1ZBJ A;  1NEB A;  3ULR B;  3NGP A;  3VS0 A;  2ED0 A;  1JU5 C;  2YUQ A;  2DL7 A;  2DF6 A;  2K9G A;  1VA7 A;  4KRT A;  5FWC A;  2AZS A;  4RTY A;  1GCQ A;  1G2B A;  1AZE A;  1WXT A;  4JJC A;  1BU1 A;  1AWW A;  1VYV A;  1Y57 A;  2GNC A;  1QLY A;  1ZUU A;  2JTE A;  2RQR A;  1J3T A;  3A98 A;  2RF0 A;  1GCQ C;  4J9E A;  2HBW A;  5IXF A;  2FG0 A;  1SEM A;  1N5Z A;  1PRM C;  3RBB B;  3UF4 A;  1JEG A;  2JM8 A;  2LMJ A;  3IQL A;  4IIM A;  2J6O A;  4JPB W;  3M0S A;  3QWX X;  2GGR A;  5L23 A;  3VS6 A;  1WX6 A;  4RTX A;  4FSS A;  2RQT A;  1PKS A;  2PNI A;  1M3B A;  1GCP A;  3U23 A;  4ZNX A;  2QDL A;  2BZY A;  3VS4 A;  2MCN A;  2G6F X;  1UJ0 A;  3EG1 A;  2JS0 A;  2GTO A;  4J9G A;  1WFW A;  2DJQ A;  4Z88 A;  3EG2 A;  3VS3 A;  2DBK A;  2DE0 X;  4OMN A;  5IHK A;  2RQU A;  1OEB A;  2NWM A;  4RTU A;  2AK5 A;  3UAT A;  3I5S A;  4AG2 C;  4HCK A;  2DRM A;  1NLP C;  1I1J A;  1TUD A;  4HVV A;  2D8J A;  5I11 A;  2FRW A;  2DNU A;  1BB9 A;  4K11 A;  3EHR A;  2CDT A;  2J6F A;  2KE9 A;  1YWP A;  2KRO A;  1HJD A;  1K0S A;  4J9F A;  5GJW B;  4OMP A;  2X3X D;  2C0T A;  1M3A A;  1UG1 A;  1WIE A;  2JW4 A;  4J9D A;  4AFS C;  1U5S A;  3I9Q A;  4EIK A;  3EGU A;  2FPF A;  5HCK A;  2DX1 A;  2C0O A;  1GL5 A;  5GJV B;  1YP5 A;  2EW3 A;  2DL4 A;  1QWE A;  1WXU A;  2EGA A;  2EPD A;  4OML A;  3RNJ A;  2CSI A;  2DVJ A;  4ESR A;  2EYX A;  2JS2 A;  4DEY A;  1BBZ A;  2O9V A;  1CKA A;  3I35 A;  1KIK A;  3UA6 A;  1EFN A;  4A63 B;  2FRY A;  2ED1 A;  1I0C A;  2L0A A;  2EBP A;  1CKB A;  2A36 A;  2CH4 W;  5EC7 A;  2K79 A;  2J05 A;  1NYF A;  2FO0 A;  2BTT A;  1UTI A;  2A37 A;  4F16 A;  1ZUK A;  1WLP B;  2JMA A;  1UHF A;  1KJW A;  2BZ8 A;  3JV3 A;  2ABL A;  3NHN A;  3SEM A;  4QT7 A;  4JJD A;  2W10 A;  4CC2 A;  2H8H A;  2O88 A;  1I07 A;  2DIL A;  2CUD A;  4RTV A;  1X43 A;  4RTT A;  1E6G A;  3TVT A;  1UGV A;  1JO8 A;  2YSQ A;  1IO6 A;  1E7O A;  3M0U A;  1NLO C;  2LCS A;  2DM1 A;  1ZX6 A;  2L2P A;  4AFU C;  4LUD A;  2JT4 A;  1Z9Q A;  1UFF A;  1K76 A;  2KXC A;  4Z8A A;  3TSW A;  4OMO A;  3NPF A;  2OI3 A;  2HCK A;  2J06 A;  2KGT A;  2X3W D;  3ZL7 C;  2KRS A;  2GQI A;  2RMO A;  1LCK A;  1T0H A;  2EGE A;  1H92 A;  4OMQ A;  1OV3 A;  1AZG B;  3M0R A;  1PNJ A;  2KT1 A;  1YN8 A;  2DYB A;  4AG1 C;  4RUG A;  5FW9 A;  4RTW A;  2EVR A;  2EYZ A;  4IIO A;  2W0Z A;  4LN2 A;  4RTZ A;  3QWY A;  1UHC A;  1X69 A;  2PZ1 A;  4CC4 B;  2JM9 A;  3PVL A;  2LP5 A;  1W1F A;  3VRZ A;  1OOT A;  2C0I A;  2K7A A;  3O5Z A;  2SRC A;  3VS5 A;  2DLP A;  1SRL A;  2VWF A;  2RNA A;  2D8H A;  2F2X A;  4AFZ C;  2KYM A;  2JMC A;  2JXB A;  2ROL A;  1SRM A;  2D1X A;  2MOX A;  2CUB A;  2FPE A;  1NEG A;  3H0I A;  2CT3 A;  2M51 A;  2F2W A;  2YUO A;  2I0N A;  1XOV A;  2F2V A;  1GBQ A;  2EYY A;  1K0X A;  1JXO A;  3REA B;  1X2K A;  2HSP A;  1FYN A;  1UDL A;  1YNZ A;  4JZ4 A;  1T3S A;  3UA7 A;  1GFC A;  3C0C A;  2J6K A;  3VS1 A;  1NM7 A;  4J9I A;  2PTK A;  4JJB A;  1K1Z A;  1SPK A;  1NYG A;  4Z89 A;  1AD5 A; 
#chains in the Genus database with same CATH topology
 2DL5 A;  4A54 A;  3ZFJ A;  3MHX A;  2HAX A;  2AZV A;  5KYY A;  3JCM c;  8AT1 B;  2L3P A;  1KHI A;  4XU3 A;  3H0F A;  5IHN A;  2KNB B;  2X4J A;  3G1J A;  2CS7 A;  1M2O A;  4RKU E;  3L2U A;  1T0J A;  2DO3 A;  3PIO A;  1D0Y A;  1K9M R;  4RCC A;  2ZPG B;  1R77 A;  1PRL C;  2MWP A;  1PC0 A;  1VQ7 Q;  3G4S Q;  2DKG A;  2DTI A;  4DBR A;  1QKW A;  1IXD A;  3JCM V;  5DY9 A;  2CP0 A;  2RK2 A;  2EYW A;  5CR2 A;  1TXQ A;  4ZGE B;  2KEA A;  3V8L A;  4M77 E;  4N0A A;  2LNH B;  4ELY C;  5KYY B;  4PLI A;  1HSQ A;  1YWO A;  3M0T A;  4HVU A;  3VS2 A;  3GBQ A;  1OPL A;  4FL6 A;  4J9B A;  1QVG A;  1YJW A;  3OQ5 A;  5I21 A;  4C92 G;  5LJ3 h;  1HXD A;  3UPU A;  3HP9 A;  5KCH A;  1YJ9 Q;  2DBM A;  1PSE A;  5GMK l;  1M90 C;  3X26 B;  2QA4 T;  4OMM A;  3MEV A;  1WDX A;  1WYX A;  3FEO A;  4EMH A;  1R0B G;  2AT1 B;  2RN8 A;  5GAM j;  4OMF B;  4IUU A;  1VQ5 Q;  1AHJ B;  1YBY A;  2YUP A;  4M77 D;  1YI2 Q;  2COW A;  2XMF A;  2XK0 A;  3UWN A;  5HK3 A;  3A8L B;  3INZ A;  1FMK A;  2P4T A;  2ESW A;  3CCU Q;  1VQO T;  2EQK A;  2GFU A;  4C0D B;  1H64 1;  4C92 C;  3OA6 A;  3QZ9 B;  2DRK A;  1YIJ Q;  1JBM A;  2QQS A;  3DKM A;  1QVP A;  2E5K A;  2GBQ A;  2F5T X;  3I56 A;  1OZ2 A;  1YIT T;  1M9S A;  2XDD A;  3CQT A;  1MUZ A;  1WGS A;  2CP7 A;  2HDA A;  1RLP C;  4PLL A;  4M7A F;  3H0H A;  3BDL A;  1UB4 A;  3OYJ A;  2XI9 A;  3CPF A;  4XU1 A;  5IHI A;  4LDV A;  4PFZ A;  3KFV A;  4OB2 B;  1D09 B;  2VKN A;  3CXC S;  2QAS A;  2KR3 A;  1QCN A;  2KRM A;  2Y90 A;  1YHQ Q;  2R5A A;  3FLG A;  1QP3 A;  3I56 T;  2KXD A;  2X4X A;  4HXJ A;  2ROT A;  3MP6 A;  4Y92 A;  1WQ7 A;  4DEX A;  2K3Y A;  2DXC A;  4QQG A;  3MEU A;  4N4G A;  3HRU A;  2DK3 A;  1MV0 B;  5DLQ E;  3G6E T;  1M8M A;  4QVZ A;  1WXB A;  4DOW A;  2X4W A;  2AIR B;  1NJI U;  4J7F A;  4OF1 A;  2IPO B;  3O8V A;  4AFQ C;  1ZBJ A;  2CZ0 B;  4QVD A;  3NGP A;  1RAG B;  4FCY A;  2P0P A;  5GAN 7;  4JJN K;  2QQR A;  2XG8 D;  1GCQ A;  1KHC A;  4JJC A;  1BU1 A;  4F7U A;  5KYU B;  1YJN A;  5GAN 4;  3JCM d;  3CD6 Q;  2E64 A;  1GCQ C;  2RHZ A;  4J9E A;  1SEM A;  1N5Z A;  1KQ1 A;  1JEG A;  2JM8 A;  1OYX A;  2LMJ A;  4IIM A;  1UGS B;  2GGR A;  5L23 A;  3VS6 A;  1PKS A;  2V8K A;  2PNI A;  4F7U B;  3U23 A;  2QDL A;  2K3X A;  5GAM h;  3VS4 A;  5CKF A;  4M78 G;  2G6F X;  4ELZ C;  2WSF E;  3JCM J;  1JRI A;  4JDS A;  3PIP A;  4L6V 5;  3J80 E;  3M58 A;  1MMG A;  3OS1 A;  3JB9 H;  5GAO q;  3JCM P;  3CCV A;  2VYT A;  4C8Q D;  3MP8 A;  4AG2 C;  1I1J A;  1TUD A;  2NLU A;  3I55 T;  5I2M A;  2LC4 A;  1K9M C;  3DB4 A;  2CDT A;  4UC4 A;  3CCL Q;  4A53 A;  2KRO A;  3TU4 K;  2JN0 A;  2RH2 A;  1K0S A;  5GJW B;  4M78 C;  1M3A A;  1UG1 A;  2VXE A;  5GAN e;  4CI0 C;  1RAB B;  1V76 A;  4XAX B;  1U5S A;  3I9Q A;  1OX9 A;  1KC8 C;  1G3T A;  2FPF A;  2ZAE A;  5HCK A;  2C0O A;  1GL5 A;  2JVV A;  3S3N A;  2EJF A;  4OML A;  2CSI A;  2DVJ A;  4ESR A;  3LX7 A;  5CCA A;  3CC7 T;  1BBZ A;  2RJC A;  1K73 U;  3CCE T;  1CKA A;  3GF5 A;  1KIK A;  3CCR A;  1Y7X A;  3CEY A;  2DYI A;  2ZPE B;  3NTK A;  4EPC A;  4IUV A;  2QA4 Q;  2QYZ A;  4BI8 B;  2EBP A;  2A36 A;  4JRP A;  1M4Z A;  1K73 R;  5KCO A;  5C6S A;  1NYF A;  4XTY A;  1G3Y A;  2FO0 A;  3V8K A;  2B8A A;  2DIG A;  1ZUK A;  5LJ5 g;  3JSC A;  2GFA A;  1VQO Q;  2QEX T;  3SEM A;  1BI2 A;  3F70 A;  2E41 A;  3JB9 G;  2XID A;  3CC2 A;  4O5V A;  4HKE A;  2DET A;  1UGQ B;  2FYK A;  3TVT A;  3OYL A;  1YIT Q;  2JUF A;  3GNG A;  1IO6 A;  4IKF A;  2LX9 A;  1E7O A;  1KQS A;  3M0U A;  2QG9 B;  1TU0 B;  1D0X A;  3URG A;  2KAF A;  1ZX6 A;  5J3B A;  4LUD A;  3CC4 A;  1Z9Q A;  1UFF A;  4Z8A A;  3OYA A;  4OMO A;  3AHU A;  1W4S A;  4A4K A;  1KQ2 A;  3OYK A;  2DXB A;  4OP0 A;  2MWO A;  2LT1 A;  2X3W D;  3SB2 A;  1QVF S;  4NS5 A;  2EGE A;  2EFI A;  4OMQ A;  3E9F A;  3OY9 A;  1PNJ A;  2VGN A;  1OUL A;  1YN8 A;  2F69 A;  2JNG A;  1Y07 A;  4RUG A;  5FU6 B;  2BE9 B;  4RTW A;  2IVW A;  1Q82 R;  5HK0 A;  1VQ4 A;  2EYZ A;  3OSV A;  5D7U A;  1VQ6 A;  1SF9 A;  4CC4 B;  2CP5 A;  2JM9 A;  2C0I A;  2K7A A;  1D1A A;  2RNA A;  2RI2 A;  3G6E Q;  2ROL A;  1SRM A;  2MOX A;  3OYB A;  1Q81 U;  1VQP A;  1LJO A;  1WJR A;  5A0L A;  3L2R A;  1B34 A;  1PD1 A;  3VV0 A;  1VQK A;  1MMN A;  4DBF A;  2F2V A;  1K0X A;  1JXO A;  5L8R E;  9ATC B;  5LL6 S;  2QQA A;  2E6N A;  5LJ3 e;  4JZ4 A;  2M16 A;  2E65 A;  2L8D A;  1Q81 R;  4WF2 A;  3CCM Q;  4KUL A;  3UDC A;  1NM7 A;  3RMQ A;  5FU7 C;  3CCQ A;  2LT4 A;  4L59 A;  3GLX A;  1EIF A;  1FMV A;  1NYG A;  4M7A A;  2ZPB B;  4F7U F;  1IHV A;  4QW2 A;  4PNO A;  4KH1 B;  4PJO A;  4LDX A;  4OB0 B;  2YT6 A;  2LQW A;  3TSZ A;  4OVA A;  1V1C A;  5FU7 B;  1VQK T;  1AVZ C;  2XDB A;  3BE3 A;  2OTJ T;  3PTA A;  1GRI A;  1E6H A;  3KUF A;  2HEQ A;  5CKB A;  2A0F B;  2EKH A;  1ZQ1 A;  4FM4 B;  1ZLM A;  1W2B S;  4KBM B;  3NFC A;  4LUE A;  2XU8 A;  2LQN A;  3JCM W;  2DIQ A;  1RL2 A;  2L3Q A;  1B07 A;  2YDL A;  2DA9 A;  4PJO B;  4EMK C;  1U06 A;  3MJX A;  5LJ3 j;  2LJ0 A;  2DZ9 A;  3NMZ C;  4R55 A;  2EGC A;  3VRY A;  3C95 A;  3I55 Q;  4X34 A;  1M30 A;  2O01 E;  4C5H A;  2E3I A;  2Z0W A;  1KSW A;  3N5B B;  4KGX B;  1JJ2 P;  1WI7 A;  2K2M A;  1H3H A;  2LCC A;  2D9T A;  2LX7 A;  4MZM A;  2KRN A;  4DOV A;  2AHJ B;  2XKO C;  1GBR A;  4XTZ A;  1D1C A;  2M0Y A;  4M77 G;  3M4Y A;  2HSE B;  3CPW S;  2IG0 A;  4LDY A;  5FWB A;  3M0Q A;  1AEY A;  3WXM B;  4EMG A;  3OYG A;  2DXU A;  1OU9 A;  3EGX A;  5GAN f;  4FW1 A;  1VYT A;  3CC7 Q;  1YCS B;  3UT1 A;  3CCE Q;  1RUW A;  2KT8 A;  1TUC A;  3PFS A;  4M7D G;  4L5G A;  4BDZ A;  5GAN 2;  1X6B A;  3G71 T;  2MF2 A;  2EJG A;  2EAY A;  2RK1 A;  2O4X A;  4RG2 A;  4N4H A;  4HCZ A;  3A8O B;  2X4Y A;  3RKW A;  3QBY A;  4M7A E;  2C06 A;  3OW2 P;  4XK8 E;  3SDZ A;  4FYW B;  5A0D A;  1SHF A;  1JJ2 A;  5EG2 A;  4M77 C;  2DEU A;  3EGX B;  4ZGJ B;  3L2W A;  2KBT A;  2PQW A;  2P4R A;  4J9H A;  1D3B A;  3THK A;  1VQ9 Q;  4LNP A;  2CH4 A;  4E6R A;  4FU6 A;  4BAC A;  4B9X A;  1UUE A;  3PNW C;  4J6Y A;  5KYX B;  2HQH A;  2O4X B;  2QEX Q;  4M7D C;  4ME7 A;  4X9D A;  3V7S A;  4LE9 A;  4M75 A;  3EFO A;  2HKN A;  2R57 A;  3C94 A;  2OAW A;  2NUP A;  1K9M U;  2OTL T;  4M7A D;  4FT4 A;  2JZ2 A;  4ATO A;  1VQM T;  5ECA A;  3MKD A;  4HT9 A;  1IRE B;  3P8H A;  1QCF A;  4M7D B;  1K4U S;  4M75 C;  5GAM e;  2KDS A;  1ABO A;  1NG2 A;  1AT1 B;  3JCM g;  1D3B B;  2CZ7 B;  3OW2 A;  2RQW A;  4JS4 A;  1H3Z A;  1AWJ A;  5CO7 A;  2RJE A;  3VUZ A;  2H3J A;  1S1N A;  1KC8 U;  3M0P A;  4Y28 E;  4GBQ A;  4BUG A;  2JTM A;  4PFP A;  3H9N A;  4M75 B;  3MEW A;  2DL8 A;  3FC3 A;  4JZ3 A;  2VC8 A;  3EFO B;  1Q82 C;  1N27 A;  2IIM A;  2NUP B;  2V1R A;  4BE1 A;  4OGC A;  1NEB A;  2P0K A;  2YWW A;  3QKJ A;  4MML A;  3ULR B;  2DD5 A;  2FVU A;  2ED0 A;  1KC8 R;  1BI3 A;  2AZS A;  4RTY A;  2PVG B;  1KD1 U;  1RAI B;  2HL5 C;  1TUG B;  1LVK A;  1S72 A;  2A3L A;  2RQR A;  3A98 A;  5LJ5 j;  4J83 A;  3E2U A;  4J8O A;  3OYE A;  3G7Z A;  1O75 A;  3RBB B;  3UF4 A;  1D0Z A;  3IQL A;  2J6O A;  4WTO B;  4E7Z A;  4PJM A;  1KD1 R;  2CZ1 B;  1WX6 A;  4RTX A;  2RQT A;  2D6F A;  1GCP A;  2QQB A;  1Q81 C;  3J7A F;  4ZNX A;  4C92 A;  2LQK A;  1WJS A;  4OB3 B;  2VB6 A;  1UJ0 A;  3EG1 A;  2QK0 A;  3M5A A;  3EAE A;  1YJW T;  1WHM A;  3MPU B;  4Z88 A;  3EG2 A;  2MK5 A;  2DE0 X;  4C8Q G;  4PK4 A;  1OEB A;  1VQN Q;  4RTU A;  2AK5 A;  3CMA A;  4KGZ B;  3QII A;  3VUB A;  5CKD A;  4HT8 A;  4C92 B;  3LYI A;  2QAZ A;  3S3M A;  2D0Q B;  4K11 A;  3EHR A;  1I81 A;  2OTJ Q;  1G8X A;  2ZGW A;  4P5N A;  4PJO F;  2F5K A;  4B9W A;  2C0T A;  3RR6 A;  3NTI A;  1U1T A;  1WIE A;  2JW4 A;  4J9D A;  3A8G B;  4EIK A;  3A8H B;  4J7I A;  4C8Q C;  2DX1 A;  2R58 A;  4MMK A;  5GAN 5;  3QJ6 A;  5AT1 B;  3RNJ A;  1WXU A;  5IAY A;  4JRQ A;  2EYX A;  3S6W A;  3I35 A;  5KYU A;  3QSU A;  4C8Q B;  1MNE A;  2WAC A;  2XIC A;  5HY6 A;  3EH1 A;  2BE7 D;  1Q95 G;  2ED1 A;  1KG1 A;  3EG9 B;  2EJ9 A;  2CGH A;  4Q5W A;  1CKB A;  7AT1 B;  3RMS A;  2CH4 W;  5GAN 6;  3CME A;  2KK4 A;  1WLP B;  1UHF A;  1KJW A;  2ATC B;  2K5I A;  3CCJ A;  3JV3 A;  2YHT A;  4QT7 A;  4J6W A;  2W10 A;  3G71 Q;  2O88 A;  2FHD A;  1I07 A;  2DIL A;  2HMA A;  2CUD A;  3TEE A;  1E6G A;  1UGV A;  2LCS A;  3PGG A;  5IT9 E;  5GAN d;  2L2P A;  5LJ5 h;  5J39 A;  3X20 B;  2JT4 A;  2KXC A;  3CXC P;  3TSW A;  2COZ A;  2OI3 A;  2HKQ B;  5D6Y A;  4RCB A;  2J06 A;  2KGT A;  1WHJ A;  1YJN T;  4BE0 A;  1VIE A;  2GQI A;  3X25 B;  2RMO A;  3CCS A;  1LCK A;  4II1 A;  4QKU A;  1H92 A;  4CRI A;  1OV3 A;  4M7D F;  3M0R A;  4A4F A;  2G3R A;  2KT1 A;  1X01 A;  3SWN C;  3OYH A;  2EVR A;  5IN1 A;  3FIF A;  3P8D A;  2OTL Q;  2E10 A;  3EH2 A;  1VQM Q;  1M2V A;  1VQ8 A;  5CK9 A;  1OQK A;  2FZC B;  4M78 A;  2FZG B;  1X69 A;  3QPH A;  2XDP A;  2LP5 A;  4M75 F;  1W1F A;  3MCA B;  4LD9 K;  1OOT A;  3SWN B;  3O5Z A;  1G3W A;  4AFZ C;  3EGD B;  4D6W A;  1WHG A;  5FLX E;  2D1X A;  1VQL A;  3CBP A;  1VUB A;  3CXC A;  1F1B B;  5GAM f;  2M51 A;  1B7T A;  5CKH A;  3LWH A;  1M2V B;  2I0N A;  1XOV A;  3CCV T;  5FRN A;  8ATC B;  4M78 B;  3REA B;  1TS9 A;  4N4I A;  1FYN A;  1YNZ A;  2E70 A;  3VKI A;  1GFC A;  4NL2 A;  4MZP A;  4F7U E;  2J6K A;  4PJL A;  2ZPH B;  1KQS P;  1M1G A;  1K1Z A;  1UGP B;  1SPK A;  1KD1 C;  1PD0 A;  1AD5 A;  2MAM A;  5I2S A;  2VAS A;  1UE9 A;  1ZSZ A;  1Y96 A;  2AKK A;  1Q7Y R;  2KVQ G;  4BY6 C;  4R0K A;  2BZX A;  4M4Z A;  1ZSZ C;  2FPD A;  3EFS A;  3KXT A;  1X2Q A;  2LVM A;  3CCR T;  2DTO A;  4E7K A;  1YJW Q;  4BY6 B;  2BUD A;  3GNF B;  4C92 F;  2DPP B;  4QQ6 A;  1G83 A;  3A5Z B;  3OS2 A;  1ZSZ B;  2DL3 A;  2RJD A;  5CQX A;  3LGL A;  1Y96 B;  2LJ1 A;  2YXY A;  2HL3 A;  2HD0 A;  1M3C A;  3I5R A;  2O31 A;  4ZTJ A;  1JB0 E;  1SSF A;  1KFZ A;  3R6O A;  1VQ7 A;  2M02 A;  3G4S A;  2LCL A;  1Q82 U;  3LH5 A;  2CZ6 B;  3X28 B;  2DFU A;  2PU9 B;  2OJ2 A;  3ER0 A;  3QZ5 B;  1DJ7 B;  4BI3 A;  2VGM A;  1ARK A;  2ENM A;  4NL3 A;  3CC2 T;  2K3B A;  1Q86 R;  4C8Q F;  1YJ9 A;  1I4K 1;  4D8K A;  3I56 Q;  5GAO l;  3RKY A;  1ZSG A;  2ECZ A;  3H41 A;  5IXB A;  4RG8 A;  1VQ7 T;  1PKT A;  3CC4 T;  1VQ5 A;  4F14 A;  4X9C A;  1YI2 A;  5DM7 R;  2HQE A;  4ZTF A;  2RM4 A;  3CCU A;  4C0Z A;  2XD0 A;  2E5Q A;  3M55 A;  1A0N B;  4XTW A;  1QWF A;  1YCY A;  2DMO A;  2Y4Y A;  1VQ4 T;  1YIJ A;  2FEI A;  1RAE B;  2CYZ B;  2YUN A;  1VQ6 T;  2WSC E;  1QKX A;  3TRE A;  2EQI A;  1PWT A;  4C0G A;  1BCM A;  2E12 A;  2X9H A;  5M9O A;  1CSK A;  3L1A A;  4ZN3 A;  4ORZ A;  1K8A U;  1GFD A;  5CAI A;  1WA7 A;  4C5E A;  1G3S A;  1AWX A;  2CSQ A;  4J6X A;  1SKU B;  3RDV A;  4JLI A;  1U3O A;  1NBE B;  2RHU A;  1P92 A;  3SD4 A;  1VQP T;  1JXM A;  5CVI A;  1ZUY A;  2F1L A;  3RUX A;  1K8A R;  3SHW A;  3E9G A;  1MHN A;  1EX4 A;  2E6Z A;  1YHQ A;  4BD3 A;  1YJN Q;  2M1H A;  1OZ3 A;  3RES A;  4EMK A;  1RI0 A;  1WHL A;  4D8D A;  3CCQ T;  2VVK A;  2QTX A;  2YUQ A;  2BKD N;  3JCM h;  4IUQ A;  2K5L A;  2DF6 A;  2K9G A;  1VA7 A;  3MP1 A;  4KRT A;  1AZE A;  1WXT A;  2OAU A;  2V26 A;  1YFN A;  2P0Q A;  1AWW A;  1WHK A;  5GAN 8;  1VYV A;  3LWI A;  1Y57 A;  2GNC A;  4MDW A;  2JTE A;  4EMK B;  1U1S A;  2GF7 A;  2HBW A;  5IXF A;  1QW1 A;  1C0M A;  2WSE E;  2L3R A;  4M78 F;  4XTV A;  2EWN A;  2LRQ A;  3M0S A;  1WHH A;  3JAM E;  4BI4 A;  3H8Z A;  4FSS A;  2K57 A;  3CD6 A;  3V8J A;  1M3B A;  3C12 A;  2HBP A;  3CCV Q;  1QVG S;  1UEB A;  4QQD A;  5KYN A;  3OBY A;  2MPX C;  2MCN A;  5GMK i;  2ZCF B;  2GTO A;  4J9G A;  1RAF B;  2DJQ A;  1HYO A;  2ZPI B;  5GAM d;  4R56 A;  5KYX A;  1M8V A;  4M77 A;  3HL8 A;  3NTH A;  2DBK A;  1R0C B;  5IHK A;  2RQU A;  2KMT A;  2NWM A;  1Q7Y C;  3I5S A;  2DRM A;  1NLP C;  2D8J A;  5I11 A;  4PJO E;  1W2B P;  3SFM A;  2FRW A;  4V2S A;  2DNU A;  2VUB A;  4M7D A;  1BB9 A;  3A8M B;  4FT2 A;  3FRN A;  2A7Y A;  2HZY A;  2RHI A;  4J9F A;  5J26 A;  2X3X D;  4XQ3 A;  1WNL A;  4Z02 A;  2K5F A;  3OYY A;  3JCM Q;  4M77 B;  4GY5 A;  1M1K C;  3CCR Q;  2KI7 A;  2MI6 A;  4QVC A;  4BDY A;  3E1S A;  3CCL A;  2KY9 A;  5LJ5 e;  1OI1 A;  4DQ2 A;  3LW5 E;  4E47 A;  1YP5 A;  1XQH A;  3MEA A;  4J5Y A;  2ZPF B;  2EGA A;  4RMO A;  3FB9 A;  4PJO D;  4TVR A;  4E7I A;  5A0G A;  3JCM X;  1EFN A;  4A63 B;  4PKC C;  2YLB A;  2FRY A;  3JCM b;  1ZBX A;  3RIR A;  3CPW P;  1W2B A;  1UGR B;  1WJQ A;  1I0C A;  2L0A A;  1Q86 C;  4E2F B;  5EC7 A;  2LDM A;  5GAN g;  5GAO m;  2HQX A;  2J05 A;  3JB9 F;  3C4S A;  3CC2 Q;  3CCL T;  2BTT A;  5GMK e;  1UTI A;  3T9N A;  3OYI A;  1IGU A;  4F16 A;  2OX7 A;  2JMA A;  1N8R R;  2QA4 A;  3HRT A;  4O6J A;  5KYW A;  1LOJ A;  3EFR A;  2BZ8 A;  1I5O B;  3J81 E;  1MMD A;  3CC4 Q;  4JLG A;  5D6W A;  2LQ8 A;  1X43 A;  3A1P A;  1TH7 A;  3BFM A;  4JRK A;  3CBM A;  3QHS A;  2VXF A;  3OYM A;  2EQU A;  1XTD A;  2M0O A;  1VQO A;  3CPW A;  4AFU C;  3L2Z A;  1EZZ B;  1RAC B;  4N0A C;  1GXI E;  1K76 A;  3BW1 A;  3NPF A;  5AYF A;  5KYW B;  1VQ4 Q;  4M7D E;  1LPL A;  2HCK A;  3HRS A;  5DLO A;  1VQ6 Q;  3QDR B;  4DBQ A;  1YIT A;  3ZL7 C;  2COY A;  1IHW A;  2PVD B;  4FYY B;  1S72 T;  2HNI A;  3OB9 A;  4C0D C;  5FW9 A;  3L42 A;  2CKK A;  3MO8 A;  5GMK j;  4M75 E;  4OB1 B;  5LJ3 f;  4IIO A;  4LN2 A;  5GAN 3;  3QWY A;  1VQP Q;  1K8A C;  1UHC A;  4FSX A;  3M54 A;  4KGV B;  1VQK Q;  3DB3 A;  4M7D D;  1SRL A;  2VWF A;  1IRX A;  1X75 C;  1IZ6 A;  3TCJ A;  4C8Q A;  1OU8 A;  1MGQ A;  1MMA A;  2CP6 A;  2FPE A;  1NEG A;  3H0I A;  2X51 A;  2CT3 A;  4A4E A;  2F2W A;  3EG9 A;  3FDR A;  3OSS C;  3CCQ Q;  3OS5 A;  2EKO A;  4M75 D;  1GBQ A;  2EYY A;  5A2Q E;  4DA4 A;  2EQJ A;  1M1F A;  1BIB A;  2JJ9 A;  4HCC A;  3G6E A;  3CMA T;  3AT1 B;  3HFN A;  4LXC A;  3S3O A;  4HCB A;  2GQV A;  3ZEH A;  2PTK A;  5HKC A;  2RO0 A;  3VYH B;  2DXT A;  2M9U A;  4XTU A;  1M5Q 1;  1QCO A;  1UEC A;  5GAO n;  4JRI A;  1ZA2 B;  1C1A A;  2H3E B;  3CCM A;  3HKS A;  4VUB A;  1AWO A;  3X24 B;  2MIO A;  1U8R A;  5KE3 A;  2RHY A;  2MYS A;  2RD1 A;  2DEQ A;  4F7U G;  4C92 E;  1N9R A;  1H8K A;  3OYD A;  4LDW A;  3CBO A;  3EG0 A;  2XHC A;  1XJW B;  4AT1 B;  1PHT A;  4IUR A;  5LJ3 g;  1QMC A;  2J7I A;  2D0N A;  1RLQ C;  1ABQ A;  1NE8 A;  1X6G A;  3QO3 A;  1FX7 A;  1IB8 A;  2A28 A;  3VS7 A;  2V1Q A;  4NOY A;  4M77 F;  1SG5 A;  3CME T;  3CCM T;  1NJI R;  3LGF A;  1O9S A;  2X35 A;  4C92 D;  1TSF A;  2LJ3 A;  5I22 A;  3SWN A;  4JS5 A;  3OYC A;  1TG0 A;  1AOJ A;  4C5I A;  4C8Q E;  3CCJ T;  4Y91 A;  1PM3 A;  3EGD A;  1BKB A;  3ASK A;  2EYQ A;  2LZ6 B;  4C5G A;  3I55 A;  2V8J A;  2RHX A;  4PL6 A;  1KQS S;  4X1V A;  1UJY A;  2CP2 A;  2L3S A;  2RPN A;  3EG3 A;  3E19 A;  4KUD K;  4EDU A;  1RI9 A;  3WVE B;  5KH6 A;  2A08 A;  2QQ9 A;  3R6N A;  1VYU A;  1JQQ A;  2O9S A;  1TTH B;  2E1H A;  3OBW A;  5GMK h;  1SSH A;  3GOX A;  1PSF A;  1T3L A;  4XU0 A;  1B3Q A;  2L5Q A;  3QYH B;  3GP8 A;  5LJ5 f;  4GLM A;  4CC3 A;  1WQW A;  3FJ5 A;  4KUI A;  2CT4 A;  1K9A A;  3CCS T;  3JCM e;  1BI1 A;  1BK2 A;  3QUI A;  4J9C A;  4XU2 A;  4CC7 A;  5CKE A;  5IH2 A;  3CC7 A;  3CCE A;  1W6X A;  4PJN A;  1OX8 A;  1KK7 A;  1MV3 A;  1TOV A;  1N8R C;  1FMW A;  2FL7 A;  3V7R A;  3VYG A;  1VQ8 T;  2QGG A;  2RI3 A;  1SHG A;  3V7C A;  1N9S A;  1Z9Z A;  2YRC A;  1X27 A;  1Q7Y U;  1I8F A;  2KSS A;  4F17 A;  1ACM B;  1QP2 A;  4HVW A;  3JB9 J;  1HK9 A;  2K6D A;  2KQW A;  3OMC A;  4JUV A;  4XTX A;  3WVD B;  2CRE A;  2RQV A;  1VQL T;  2AKL A;  4WCI A;  2SEM A;  2VV5 A;  1HD3 A;  1W70 A;  1VQ9 A;  1M27 C;  2NYS A;  4FYX B;  2QEX A;  3REB B;  2KYB A;  1BCO A;  1M1K U;  5GMK m;  1WZO A;  3HPW A;  1OPK A;  1RAD B;  5D6X A;  1V29 B;  3Q1J A;  1IGQ A;  2O2O A;  2JTF A;  3PE0 A;  2GTJ A;  2NUZ A;  2RI5 A;  3BDU A;  2FB7 A;  1Y0M A;  1Y71 A;  2ZZD A;  1X6O A;  1S72 Q;  1PG5 B;  3EHQ A;  3LLR A;  3PVQ A;  4KT0 E;  2B86 A;  5C0M A;  4BE2 A;  1M1K R;  3VS0 A;  1JU5 C;  3BY7 A;  2DL7 A;  3DLL A;  3JRZ A;  5FWC A;  4FW2 A;  1G2B A;  1VQ9 T;  5GAN j;  4M78 E;  1Q86 U;  4IUP A;  1QLY A;  1ZUU A;  5GAM g;  1J3T A;  4C0F A;  4E7J A;  2RF0 A;  2DZC A;  4F04 B;  2FG0 A;  1C6V X;  2P84 A;  1PRM C;  3M59 A;  4JPB W;  5LJ3 d;  1LNX A;  3M9Q A;  3QWX X;  2GCX A;  4A4H A;  5GAO r;  3HTR A;  5FU6 C;  5FRM A;  2BZY A;  2QTV A;  3QXE B;  1QQJ A;  3CMA Q;  2JS0 A;  4M78 D;  3G4S T;  1WFW A;  1VIF A;  3OMG A;  4E7L A;  3VS3 A;  4OMN A;  2V8I A;  3UAT A;  3PMT A;  4HCK A;  2E4H A;  2QXF A;  4HVV A;  2QI2 A;  1M90 U;  1NPR A;  3TQ7 P;  3VU3 C;  1RAH B;  2J6F A;  3QDF A;  2KE9 A;  1D1B A;  1YWP A;  2EIF A;  4MZT A;  1HJD A;  1YJ9 T;  5CQY A;  2PUK B;  4OGE A;  1I5L A;  4OMP A;  2LTO A;  3ZBD A;  4ZN1 A;  5CIU A;  4DBH A;  1VQN A;  4AFS C;  3M57 A;  3DLM A;  1M90 R;  1VQ5 T;  3EGU A;  1FXX A;  4M7A G;  1JJ2 S;  3QJY A;  2OTJ A;  1NPP A;  1YI2 T;  5GJV B;  2K2V A;  2QDY B;  4PJO G;  2EW3 A;  2NUT A;  2DL4 A;  1QWE A;  2E3H A;  2EPD A;  4GLK A;  1NJI C;  1QVF P;  2JS2 A;  4DEY A;  2O9V A;  3CCU T;  2YRV A;  3ME9 A;  4LDU A;  3CME Q;  3UA6 A;  4LD6 A;  2DTH A;  3H6Z A;  1YIJ T;  1RAA B;  2PUO B;  1B34 B;  1VQN T;  3CCJ Q;  4HA8 A;  1WPY A;  4AMC A;  2K79 A;  4A4G A;  4M7A C;  2NUT B;  2R5M A;  4PFO A;  1FWZ A;  3OS0 A;  4PJO C;  2YLC A;  2DAQ A;  1BIA A;  2A37 A;  3OW2 S;  2ABL A;  3NHN A;  2EQM A;  4JJD A;  4CC2 A;  4M7A B;  2H8H A;  3HSB A;  3QG1 A;  1QVF A;  3RER A;  4RTV A;  3OYN A;  2LNV A;  4RTT A;  3HFO A;  3JB9 D;  2QGF B;  5GAN h;  2L89 A;  2RB6 A;  1YHQ T;  2FZK B;  1JO8 A;  2YSQ A;  5KE2 A;  3MET A;  3CCS Q;  3RKX A;  2PVO B;  1NLO C;  1PCX A;  2DM1 A;  4ZGD B;  4KH0 B;  4B6M A;  3G71 A;  1NZ9 A;  3P8B B;  5GAO p;  1N6A A;  4FIB A;  1VQ8 Q;  5LJ5 d;  2RA2 A;  2BIV A;  2Y4X A;  3JCM f;  2KRS A;  1ZHI A;  1T0H A;  1AZG B;  4E7S A;  2K4Y A;  2DYB A;  3D7S B;  4YTL A;  4AG1 C;  3FJP A;  3GIB A;  3L2V A;  1BI0 A;  2DD4 A;  2YRD A;  1VQL Q;  3PMI A;  3GPL A;  2W0Z A;  4PJJ A;  4RTZ A;  2JOY A;  1VOM A;  2MMP A;  2PZ1 A;  3PVL A;  3OYF A;  1XNI A;  3VRZ A;  3CD6 T;  2SRC A;  4IUT A;  3VS5 A;  2DLP A;  2DVE A;  2RJF A;  4BB7 A;  6AT1 B;  2D8H A;  2F2X A;  3HHT B;  2KYM A;  2JMC A;  3JB9 I;  2JXB A;  2OTL A;  1K73 C;  1VQM A;  5FRO A;  3KBG A;  1TWB A;  3VJP A;  2CUB A;  2DJZ A;  2YUO A;  4M75 G;  3M56 A;  4ANJ A;  3M53 A;  3M4G A;  3L2Q A;  4E7H A;  1ZA1 B;  3PT9 A;  3QYG B;  1X2K A;  2HSP A;  2DER A;  1UDL A;  4FYV B;  1MND A;  1T3S A;  3UA7 A;  1G5V A;  3C0C A;  3VS1 A;  4MDX A;  2I2L A;  1R8O B;  4J9I A;  4JJB A;  2CP3 A;  1BYM A;  4Z89 A;  1N8R U;  3LH0 A;  1QVG P; 
#chains in the Genus database with same CATH homology
 2DL5 A;  1UE9 A;  1UEC A;  2YT6 A;  2AKK A;  2LQW A;  2AZV A;  3TSZ A;  1V1C A;  2L3P A;  3H0F A;  5IHN A;  2KNB B;  1AVZ C;  1AWO A;  2MIO A;  4R0K A;  2BZX A;  1GRI A;  4M4Z A;  1T0J A;  1E6H A;  2HEQ A;  2EKH A;  1H8K A;  2FPD A;  1PRL C;  1ZLM A;  3EG0 A;  1X2Q A;  1PHT A;  4LUE A;  2J7I A;  1QKW A;  2LQN A;  2D0N A;  2L3Q A;  1B07 A;  1RLQ C;  2EYW A;  1G83 A;  2YDL A;  2DA9 A;  1ABQ A;  2KEA A;  1X6G A;  2DL3 A;  2LNH B;  1U06 A;  2LJ1 A;  1M3C A;  2LJ0 A;  3NMZ C;  3I5R A;  1HSQ A;  1YWO A;  2O31 A;  3M0T A;  2EGC A;  4HVU A;  3VRY A;  3VS2 A;  1KFZ A;  2A28 A;  3VS7 A;  1M30 A;  2V1Q A;  3GBQ A;  1OPL A;  4J9B A;  1KSW A;  3LH5 A;  2DBM A;  1WI7 A;  2K2M A;  5I22 A;  2LJ3 A;  1H3H A;  2LX7 A;  1TG0 A;  1AOJ A;  2OJ2 A;  2KRN A;  4OMM A;  1WDX A;  1WYX A;  1GBR A;  2RN8 A;  2LZ6 B;  1ARK A;  2M0Y A;  2YUP A;  2ENM A;  4X1V A;  1UJY A;  2RPN A;  2L3S A;  2K3B A;  3EG3 A;  5FWB A;  3M0Q A;  4D8K A;  2XMF A;  1RI9 A;  1AEY A;  2A08 A;  1FMK A;  3R6N A;  1VYU A;  1JQQ A;  2O9S A;  1VYT A;  1ZSG A;  2ECZ A;  2ESW A;  3H41 A;  1YCS B;  5IXB A;  1RUW A;  2KT8 A;  1TUC A;  1PKT A;  1SSH A;  1T3L A;  1X6B A;  1B3Q A;  4F14 A;  4GLM A;  4CC3 A;  2DRK A;  2E5K A;  2GBQ A;  3FJ5 A;  2CT4 A;  1K9A A;  3CQT A;  1MUZ A;  1BK2 A;  1SHF A;  4J9C A;  4CC7 A;  5IH2 A;  1W6X A;  2HDA A;  1RLP C;  1A0N B;  1MV3 A;  1QWF A;  3H0H A;  2DMO A;  2KBT A;  2P4R A;  2FEI A;  4J9H A;  3THK A;  2YUN A;  4LNP A;  2CH4 A;  5IHI A;  4E6R A;  1QKX A;  1SHG A;  2EQI A;  3KFV A;  1Z9Z A;  1UUE A;  1PWT A;  1X27 A;  2VKN A;  4F17 A;  1CSK A;  4HVW A;  4LE9 A;  2KR3 A;  4ORZ A;  1GFD A;  2K6D A;  1WA7 A;  2KRM A;  1AWX A;  2OAW A;  2CSQ A;  5ECA A;  2CRE A;  2RQV A;  2AKL A;  1U3O A;  4WCI A;  2KXD A;  2SEM A;  1HD3 A;  1QCF A;  1W70 A;  4HXJ A;  2ROT A;  4Y92 A;  1M27 C;  1K4U S;  4DEX A;  3REB B;  1JXM A;  1ABO A;  2KYB A;  1NG2 A;  2RQW A;  1ZUY A;  1OPK A;  1AWJ A;  3SHW A;  1MV0 B;  1S1N A;  3M0P A;  4GBQ A;  2O2O A;  3PE0 A;  1M8M A;  2GTJ A;  2NUZ A;  2DL8 A;  4JZ3 A;  1WXB A;  1Y0M A;  2IIM A;  4D8D A;  2V1R A;  3EHQ A;  3PVQ A;  2B86 A;  4AFQ C;  2VVK A;  1ZBJ A;  1NEB A;  3ULR B;  3NGP A;  3VS0 A;  2ED0 A;  1JU5 C;  2YUQ A;  2DL7 A;  2DF6 A;  2K9G A;  1VA7 A;  4KRT A;  5FWC A;  2AZS A;  4RTY A;  1GCQ A;  1G2B A;  1AZE A;  1WXT A;  4JJC A;  1BU1 A;  1AWW A;  1VYV A;  1Y57 A;  2GNC A;  1QLY A;  1ZUU A;  2JTE A;  2RQR A;  1J3T A;  3A98 A;  2RF0 A;  1GCQ C;  4J9E A;  2HBW A;  5IXF A;  2FG0 A;  1SEM A;  1N5Z A;  1PRM C;  3RBB B;  3UF4 A;  1JEG A;  2JM8 A;  2LMJ A;  3IQL A;  4IIM A;  2J6O A;  4JPB W;  3M0S A;  3QWX X;  2GGR A;  5L23 A;  3VS6 A;  1WX6 A;  4RTX A;  4FSS A;  2RQT A;  1PKS A;  2PNI A;  1M3B A;  1GCP A;  3U23 A;  4ZNX A;  2QDL A;  2BZY A;  3VS4 A;  2MCN A;  2G6F X;  1UJ0 A;  3EG1 A;  2JS0 A;  2GTO A;  4J9G A;  1WFW A;  2DJQ A;  4Z88 A;  3EG2 A;  3VS3 A;  2DBK A;  2DE0 X;  4OMN A;  5IHK A;  2RQU A;  1OEB A;  2NWM A;  4RTU A;  2AK5 A;  3UAT A;  3I5S A;  4AG2 C;  4HCK A;  2DRM A;  1NLP C;  1I1J A;  1TUD A;  4HVV A;  2D8J A;  5I11 A;  2FRW A;  2DNU A;  1BB9 A;  4K11 A;  3EHR A;  2CDT A;  2J6F A;  2KE9 A;  1YWP A;  2KRO A;  1HJD A;  1K0S A;  4J9F A;  5GJW B;  4OMP A;  2X3X D;  2C0T A;  1M3A A;  1UG1 A;  1WIE A;  2JW4 A;  4J9D A;  4AFS C;  1U5S A;  3I9Q A;  4EIK A;  3EGU A;  2FPF A;  5HCK A;  2DX1 A;  2C0O A;  1GL5 A;  5GJV B;  1YP5 A;  2EW3 A;  2DL4 A;  1QWE A;  1WXU A;  2EGA A;  2EPD A;  4OML A;  3RNJ A;  2CSI A;  2DVJ A;  4ESR A;  2EYX A;  2JS2 A;  4DEY A;  1BBZ A;  2O9V A;  1CKA A;  3I35 A;  1KIK A;  3UA6 A;  1EFN A;  4A63 B;  2FRY A;  2ED1 A;  1I0C A;  2L0A A;  2EBP A;  1CKB A;  2A36 A;  2CH4 W;  5EC7 A;  2K79 A;  2J05 A;  1NYF A;  2FO0 A;  2BTT A;  1UTI A;  2A37 A;  4F16 A;  1ZUK A;  1WLP B;  2JMA A;  1UHF A;  1KJW A;  2BZ8 A;  3JV3 A;  2ABL A;  3NHN A;  3SEM A;  4QT7 A;  4JJD A;  2W10 A;  4CC2 A;  2H8H A;  2O88 A;  1I07 A;  2DIL A;  2CUD A;  4RTV A;  1X43 A;  4RTT A;  1E6G A;  3TVT A;  1UGV A;  1JO8 A;  2YSQ A;  1IO6 A;  1E7O A;  3M0U A;  1NLO C;  2LCS A;  2DM1 A;  1ZX6 A;  2L2P A;  4AFU C;  4LUD A;  2JT4 A;  1Z9Q A;  1UFF A;  1K76 A;  2KXC A;  4Z8A A;  3TSW A;  4OMO A;  3NPF A;  2OI3 A;  2HCK A;  2J06 A;  2KGT A;  2X3W D;  3ZL7 C;  2KRS A;  2GQI A;  2RMO A;  1LCK A;  1T0H A;  2EGE A;  1H92 A;  4OMQ A;  1OV3 A;  1AZG B;  3M0R A;  1PNJ A;  2KT1 A;  1YN8 A;  2DYB A;  4AG1 C;  4RUG A;  5FW9 A;  4RTW A;  2EVR A;  2EYZ A;  4IIO A;  2W0Z A;  4LN2 A;  4RTZ A;  3QWY A;  1UHC A;  1X69 A;  2PZ1 A;  4CC4 B;  2JM9 A;  3PVL A;  2LP5 A;  1W1F A;  3VRZ A;  1OOT A;  2C0I A;  2K7A A;  3O5Z A;  2SRC A;  3VS5 A;  2DLP A;  1SRL A;  2VWF A;  2RNA A;  2D8H A;  2F2X A;  4AFZ C;  2KYM A;  2JMC A;  2JXB A;  2ROL A;  1SRM A;  2D1X A;  2MOX A;  2CUB A;  2FPE A;  1NEG A;  3H0I A;  2CT3 A;  2M51 A;  2F2W A;  2YUO A;  2I0N A;  1XOV A;  2F2V A;  1GBQ A;  2EYY A;  1K0X A;  1JXO A;  3REA B;  1X2K A;  2HSP A;  1FYN A;  1UDL A;  1YNZ A;  4JZ4 A;  1T3S A;  3UA7 A;  1GFC A;  3C0C A;  2J6K A;  3VS1 A;  1NM7 A;  4J9I A;  2PTK A;  4JJB A;  1K1Z A;  1SPK A;  1NYG A;  4Z89 A;  1AD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...