4VUBA

Ccdb, a topoisomerase poison from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCDB
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Plasmid
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4vubA00
3TCJA 3VUBA 2KMTA 3NFCA 5DLOA 4MZTA 4MDXA 5HKCA 5CK9A 5HK3A 5CKEA 4VUBA 1X75C 4HKEA 5CKBA 4ELZC 2MF2A 5CKFA 4MZPA 4ELYC 5CQXA 1VUBA 5CKHA 4OF1A 3G7ZA 2VUBA 4MZMA 5CCAA 3JRZA 1UB4A 5HK0A 4ME7A 1M1FA 5CO7A 5CKDA 5CR2A 1NE8A 3JSCA 5CQYA 2C06A 3HPWA
chains in the Genus database with same CATH superfamily
3HP9A 3TEEA 4DOWA 1PM3A 2ROLA 3VV0A 2DETA 2BZXA 2XD0A 3SWNB 3L2QA 4C0FA 5GANf 1Q82R 1G83A 1I07A 2FG0A 1YITQ 3VS1A 3QSUA 2JOYA 1Q82U 4HA8A 2EBPA 2EGEA 1WPYA 1YHQT 5GJVB 1GBRA 1VQPA 1PC0A 3G6EQ 1NEGA 5LJ5e 2KY9A 4MZTA 1C1AA 4ZTJA 1VQ6A 4J6WA 1VQMQ 2PVOB 2VASA 2EJFA 4ZGEB 1WHJA 2DXUA 2EKHA 5CCAA 1V29B 1UB4A 2FL7A 2YLCA 4N4GA 4ME7A 4KGVB 1V76A 1WXBA 4AMCA 3MHXA 2KI7A 1WNLA 1QCOA 2D0NA 5LJ3h 3NTIA 1OEBA 1YIJT 1B07A 1Q81R 5FU6C 4QT7A 2JT4A 1I0CA 2DF6A 1IB8A 3H9NA 1Q81U 1OZ3A 3JV3A 2W10A 1T3SA 4ZNXA 3I55T 3RIRA 1D1AA 3OMCA 1PSEA 2QASA 4PJLA 2CP3A 2FVUA 4PFZA 3EH2A 1T3LA 2HL3A 1KQ1A 2AHJB 1TWBA 4OB1B 3PFSA 4BY6B 4XTYA 4JZ3A 1UECA 2AZSA 2J6KA 2G3RA 3ULRB 2MF2A 1YNZA 2BZ8A 3OY9A 2CZ7B 3G71Q 2F2XA 1NG2A 2RK1A 4M7AA 3QZ5B 3A5ZB 3LX7A 3E9FA 5LJ5f 3FC3A 1OU9A 1Y07A 4LUEA 1OX8A 2R58A 2ZPBB 3U23A 1I4K1 1AEYA 4C92A 3CMAQ 3NPFA 3I56A 4X1VA 3CC2Q 1FMWA 2MWOA 2FZKB 2E10A 3I9QA 3J80E 1M8MA 1VQOQ 1N8RC 2E6NA 3HL8A 2DD4A 5GAN6 1JU5C 2H8HA 2DL5A 2E70A 2CZ0B 2DL8A 3MJXA 3O5ZA 2RHYA 3SFMA 1UJYA 2DX1A 2OTLQ 1S72A 3EGDB 1BB9A 5GAOr 3J81E 2BUDA 4DEYA 3OA6A 4A53A 2DYBA 2DTIA 1QWFA 1UDLA 1AZGB 4M7AD 3WVDB 2IVWA 3M0TA 2RJCA 2W0ZA 1Y96B 1UE9A 2CZ6B 2JM8A 4HT8A 2M16A 4M77B 2FZCB 1M30A 4WCIA 1WHLA 4RCCA 3PVQA 1YHQQ 2C0OA 2XDDA 1YJNT 3UF4A 4C92D 1YI2A 2DM1A 2F1LA 2RJEA 2KAFA 4ELYC 1SF9A 1WJQA 5CIUA 4EPCA 2LT4A 1UUEA 3AT1B 3VS3A 5KE3A 2DXCA 4F16A 2DVJA 1WJSA 2RB6A 4J9BA 2DXTA 3A8HB 4WF2A 5HKCA 3CD6A 2RQWA 3L2UA 2FYKA 1JXMA 1YIJQ 1GBQA 4C8QC 2YRDA 5A0GA 3HFNA 2DEQA 3RMQA 3I55Q 4Y28E 1G3SA 2OTJA 1ZA1B 1JEGA 4RTWA 3R6OA 3JCMX 3RNJA 4FYVB 4A4GA 2PNIA 4HCKA 2QQBA 5LJ5j 2X9HA 2JMAA 4JLGA 3RKWA 4DA4A 2DD5A 2I2LA 2LCSA 3JCMW 2X4YA 1Q95G 2JTMA 9ATCB 2EJ9A 1RAEB 1WIEA 4M78B 2KBTA 1U1TA 3DLLA 1E6GA 3I5SA 5GMKh 5AYFA 4RUGA 1MNDA 5FRMA 2A7YA 1Y71A 2KROA 3QIIA 2OI3A 2RK2A 4A63B 1KD1R 4VUBA 2QA4A 4J9IA 2GTJA 3V7RA 1KD1U 3G4SA 2HSEB 1N9RA 2QXFA 3QDFA 4D8DA 1U1SA 1VQ4T 2JJ9A 5IHNA 1WHHA 2D1XA 4CC7A 1YJWA 2LZ6B 1CKBA 1KK7A 1SHGA 1K76A 2J05A 4XAXB 3CC7A 3VRZA 3CCLT 3H0HA 2FB7A 2K5IA 4J9CA 4LDXA 4HCZA 2BE9B 1RL2A 4JUVA 1BU1A 1VOMA 3LLRA 3JCMh 1WZOA 1RLPC 5KCHA 3JRZA 1FMVA 1VQNT 4HVUA 5FRNA 1FXXA 3NMZC 1NLOC 2BKDN 4NS5A 5J26A 2KRMA 4JDSA 2ZPFB 2CP2A 3OW2P 3E19A 1VQLA 3BDLA 2KDSA 4N4HA 4JRIA 1JB0E 1WA7A 2RA2A 1NPRA 2NLUA 4CI0C 2HMAA 4FM4B 5IAYA 2CP0A 2QDYB 1YJNQ 4DBRA 1D09B 3VYGA 4FYXB 1M1KR 1VQ5A 3CC4A 5GAOl 4EDUA 1D3BA 1KJWA 2RQVA 3JCMc 1FYNA 2LQ8A 5L23A 3M0RA 2O4XA 2EPDA 2CT4A 1RAGB 2VWFA 2FHDA 1M1GA 4ELZC 2VV5A 4E7LA 1VQ9T 2C0IA 5GAOp 4OMNA 5ECAA 3CBOA 4Z89A 4A54A 2RI2A 1BI1A 1VQKA 2CKKA 3MEAA 3QPHA 5GANg 4E7JA 2ZPGB 2YUNA 3OYMA 3P8DA 3QJ6A 3CCMA 2SEMA 1ZUKA 4DQ2A 1WHMA 5CQXA 5GAOn 4M75F 1WX6A 1PD0A 1LVKA 1XQHA 3RR6A 2ED0A 3S3NA 1JRIA 4C0DB 2LC4A 2PUOB 4K11A 3M56A 5HY6A 1K9AA 3R6NA 5GAN2 4L59A 4ZGDB 4AG1C 1KC8C 1D0XA 4BI3A 2YHTA 2D9TA 3A8GB 1C6VX 4ESRA 3EG3A 2DYIA 3REBB 2Y4YA 4RG2A 3ME9A 1WXTA 1D0YA 4IKFA 1D0ZA 2V8KA 2XI9A 1PD1A 1NYFA 2M0YA 1VQ4Q 3JB9H 2GQIA 2OAUA 2RMOA 1AHJB 1GFCA 5GAMh 5LJ3e 4M7AF 3M4GA 4Z88A 1X6BA 2YT6A 4GLMA 1K8AC 3CCLQ 4J9EA 3HRTA 1PKSA 1VQ8A 2LX7A 1BBZA 4D8KA 3GF5A 3MEVA 1PHTA 1VQNQ 1M9SA 2GFAA 2E1HA 4N0AC 2CP7A 1AWJA 2FO0A 4C8QD 3H8ZA 2QEXA 4J7FA 1MV3A 4M75C 1T0JA 2MI6A 1PKTA 2GCXA 4J6XA 2KE9A 3RDVA 2BIVA 5I22A 1BK2A 1IRXA 1M90R 2ZCFB 1C0MA 1TTHB 2PTKA 2CYZB 1M90U 2AZVA 4OMOA 2LMJA 4B9WA 2XIDA 2JXBA 3CQTA 3IQLA 1R8OB 3JCMd 3ZL7C 1TS9A 1DJ7B 2PUKB 2SRCA 2BZYA 2XK0A 3BDUA 1O75A 4PFOA 1VQ9Q 3EH1A 3G6EA 1BKBA 2FRWA 1LOJA 2JN0A 3EG1A 1BCOA 3ZEHA 1WQ7A 3P8HA 2ZPEB 2B86A 4XU1A 2E41A 1CSKA 3M55A 2L8DA 3MPUB 2V1QA 4QQDA 2KXDA 4M75G 3M0PA 5FROA 4PK4A 2PVGB 3OYYA 3QJYA 4L5GA 1IREB 4C5IA 5A0LA 2M9UA 4LDYA 2HKQB 3FDRA 4EMKB 4AT1B 1E7OA 3BFMA 2A0FB 3MEWA 1ZBXA 4RCBA 2EYXA 3JCMJ 2K5LA 1JJ2S 2OJ2A 3AHUA 4C0ZA 1AZEA 3SB2A 4JS5A 2RM4A 2KYMA 1Y0MA 1OPLA 4KGZB 1HXDA 3OSSC 1W1FA 3EFOA 1JQQA 2J6OA 1QLYA 3CXCS 3HPWA 1NEBA 4Y92A 1RLQC 5FU6B 4F7UF 3S3OA 1WFWA 1Q86R 1ZLMA 3JAME 3M53A 3G71A 2YXYA 4JJNK 1OULA 2KT1A 1Q86U 2NUTA 2QGFB 3BY7A 2XKOC 2EQKA 2VYTA 5I11A 1RAHB 3TREA 5I21A 1YN8A 2JUFA 2P4TA 2YSQA 2P4RA 3CMAA 1YWOA 3LWIA 3CC2A 2EQIA 2RPNA 3FIFA 4RG8A 1NJIC 4JRPA 1QP2A 4ATOA 1VQOA 2NWMA 2M1HA 3J7AF 3HRSA 3JB9F 2D8JA 4LXCA 2M0OA 3VUZA 4E7ZA 2OTLA 1YCSB 3CCJA 5GAMd 1ZQ1A 2FZGB 2VXFA 3VUBA 5GMKe 3MEUA 5GJWB 3M9QA 4JRQA 2DJQA 3L2WA 4J6YA 1LNXA 2DL3A 4YTLA 4DOVA 1ZUUA 4N0AA 1K9MR 3UDCA 1ABQA 1IGUA 2JW4A 1WDXA 2L2PA 3EHQA 2PZ1A 2YLBA 3PVLA 3CCRT 1YHQA 1K9MU 5EG2A 2VVKA 4M75A 2M02A 5A0DA 2E12A 4M7DD 3A8LB 5IT9E 1D3BB 5C6SA 2DMOA 2X3WD 5D7UA 1IZ6A 1H641 2ATCB 4JPBW 3I35A 1SHFA 3REAB 1SRMA 3JCMe 3A8OB 4ORZA 2K3XA 3PE0A 1SSHA 3HRUA 1ZUYA 1YIJA 1OYXA 2DK3A 5LL6S 4KULA 1KQ2A 2EFIA 5CAIA 4LUDA 1GRIA 1R0BG 5GMKl 2KXCA 2DZ9A 3S6WA 3X28B 1F1BB 1PWTA 5KYXB 3JCMP 3ER0A 2GF7A 1M3BA 2QTXA 2YUPA 1R0CB 4B6MA 1Y57A 4F7UG 4M75D 2IG0A 3I56T 3EG9A 2X35A 4RTTA 3SWNC 3ASKA 5CKBA 2XDBA 2JZ2A 3HKSA 2EAYA 2A28A 3OYLA 1H8KA 2QQSA 4HT9A 5FWCA 3TU4K 4C8QF 3QBYA 2VB6A 1U5SA 2EYWA 3QDRB 4E47A 2EVRA 5GANj 4PJOF 4C0GA 1Q7YC 1S72T 2HDAA 2K3BA 2CZ1B 1JJ2A 2X4WA 5EC7A 4F14A 2OX7A 3VU3C 4R0KA 3JCMf 2O9SA 4MZMA 2EGAA 1K73C 3JB9G 5IN1A 1G3TA 1UGQB 3CXCA 4FSSA 4IIOA 1MGQA 4RTYA 4E7HA 3NFCA 4WTOB 3P8BB 1QCNA 3OYDA 4M7AE 1KQSS 4HCCA 2V1RA 3QG1A 4KT0E 2AKKA 3RBBB 1MV0B 1RI0A 4OF1A 3H41A 3VYHB 4FW2A 2DKGA 2L5QA 2CREA 3M0UA 4C92E 3OYFA 1WQWA 1X01A 2GGRA 1AT1B 3CCVA 2C06A 1UTIA 3GBQA 4CRIA 2DVEA 2BTTA 2HD0A 3CD6T 1ZA2B 2RHIA 5GAN5 2LQNA 1Z9QA 2L89A 3CCRQ 3Q1JA 3M4YA 2KYBA 1M2VA 1BI0A 2MPXC 5GAMe 1M1KC 2D6FA 2NUZA 1SSFA 2AKLA 3E2UA 2E5QA 3VS6A 2WACA 2OTJT 4PNOA 3WXMB 4MMKA 2CS7A 4XTWA 1ZSZC 4PJOC 4NL3A 4MDXA 2LP5A 2LVMA 1R77A 5FLXE 3MKDA 3M5AA 2KRNA 3L2ZA 3M58A 1TXQA 6AT1B 4J9FA 5IHKA 2EKOA 4F7UA 1IXDA 1UHCA 1AWXA 1ZHIA 1FWZA 1M3CA 5LJ3d 3TSZA 2COWA 4BE1A 2NYSA 2DRKA 1M2OA 1RACB 3LW5E 4BDYA 4B9XA 3X24B 3G4ST 4KH1B 1QQJA 1SEMA 2ROTA 5LJ3g 3PT9A 4CC2A 1SG5A 2XICA 3I56Q 3CCET 4C8QG 2F2VA 1ACMB 4Q5WA 1WHKA 3JB9I 1YJWT 3OS0A 5I2SA 1XJWB 5GAN7 5LJ5h 4IUUA 4M77C 4PJOG 3OS2A 2F5TX 2R5MA 2KMTA 5GAMf 2X4XA 3CCSA 5DLOA 4X34A 3EFOB 4Y91A 1YJ9T 3OB9A 1S72Q 3A8MB 2V8IA 3TQ7P 3FLGA 3S3MA 3UT1A 4OP0A 1VQ4A 2VC8A 2NUTB 3MO8A 2DBMA 4O5VA 2J7IA 1MHNA 2O2OA 4FYYB 2L0AA 2JM9A 3SWNA 2DPPB 5KH6A 5M9OA 3OYGA 4JLIA 5HK3A 1JXOA 4F7UE 3M57A 4HKEA 1AD5A 2IIMA 1ZX6A 3V8KA 4M7DF 1VQ5T 1T0HA 3CC4T 1UJ0A 3F70A 4IURA 1B7TA 1KG1A 1V1CA 4QW2A 1VQNA 2FPEA 3JSCA 1CKAA 1AWWA 3QO3A 2DNUA 4XTUA 2RHUA 3QYGB 3LGFA 1KSWA 4LDWA 3CD6Q 1U3OA 3CCUT 1W4SA 4FCYA 4FIBA 3JB9D 2COZA 2X4JA 4OMFB 5GAN8 4C5HA 1MMDA 8AT1B 3CCQT 3CBPA 2K2VA 2HL5C 3FJ5A 3GIBA 2XDPA 2EJGA 5DY9A 3DKMA 1YCYA 1YP5A 1QKXA 2YRCA 2OTJQ 4C5GA 2F2WA 1KQSA 3HSBA 2JVVA 3INZA 2KRSA 2DBKA 2E4HA 4KRTA 2L3SA 2PU9B 4OMMA 4M75B 2V26A 1VQ9A 2DTHA 3OYBA 1G3WA 2RQTA 3RESA 5D6WA 1UEBA 2QDLA 2ZGWA 3DB3A 3V7SA 1VQ7A 2K6DA 3TCJA 3OSVA 2EYYA 3SD4A 5FU7B 4BDZA 5CK9A 4C8QA 2MOXA 2O31A 5FW9A 4E2FB 4M7DC 1QWEA 2VKNA 4PJOA 1ZSZA 3G4SQ 3HTRA 5DM7R 2LQKA 3JCMQ 1X6OA 2E64A 4FYWB 3CCEQ 3HHTB 2PQWA 3OYJA 1YJWQ 4KUDK 7AT1B 1QVGS 2CH4W 2ESWA 2JNGA 4M7AB 2CP6A 2L3PA 2AIRB 1OQKA 1VQ8T 1HD3A 1YJ9Q 3EG0A 1U8RA 2Z0WA 3EG9B 3CMEA 4C92B 3DLMA 4BUGA 5CR2A 1W2BS 2F69A 4F04B 2CH4A 5KE2A 3H6ZA 5J39A 4LD9K 1WLPB 4GY5A 2KGTA 3T9NA 1I8FA 2FRYA 4M7DG 2RD1A 4MDWA 4PJOD 5HK0A 3C12A 4QQ6A 4C8QE 4GLKA 4MMLA 4RKUE 2J6FA 1VQ5Q 2O01E 3FEOA 2M51A 3CC4Q 4LDVA 2ZZDA 2XMFA 1P92A 2QGGA 1Q82C 2CDTA 4II1A 1QKWA 1QVFS 2VGNA 2Y90A 2FEIA 1YITA 1B3QA 1VIEA 2P0KA 4OVAA 1KHCA 3OYKA 1OV3A 3LGLA 4J83A 3M54A 4L6V5 2YUQA 3CCUQ 4C0DC 1N6AA 2I0NA 4EMGA 5C0MA 1BYMA 1N27A 5LJ3f 3JCMg 1UGSB 1UGVA 3NTKA 3CCQQ 3X20B 2CSQA 1MNEA 1VQMA 4OGEA 3FRNA 3FB9A 2HZYA 1W6XA 5CKHA 2MAMA 4M77D 1VYTA 4RTUA 1M2VB 2KVQG 1TOVA 3LH5A 1Q81C 2K57A 2ECZA 1OOTA 3UATA 2PVDB 2XU8A 1X2QA 2DE0X 2L3RA 4PKCC 3RERA 4J9GA 2QYZA 4CC3A 3EGXA 4E7IA 1UHFA 4BB7A 3SHWA 3VRYA 2LJ0A 1FMKA 2HCKA 4AFQC 4ZN3A 1N5ZA 2F5KA 1RUWA 3C0CA 1KC8R 1W70A 5I2MA 1MMAA 2DIGA 2EYQA 2DIQA 3MP6A 1AWOA 2QQRA 1U06A 4KUIA 1ZSGA 1KC8U 2DERA 3ZFJA 2HNIA 3I5RA 1MMGA 1WXUA 4F7UB 2JTEA 3OYAA 2RN8A 1O9SA 4TVRA 1JJ2P 1JBMA 4QVZA 1E6HA 2CSIA 2R5AA 2X51A 1OZ2A 1K8AR 1VQ8Q 4ZTFA 3QHSA 1WI7A 3RKYA 1RAFB 1K8AU 3CXCP 3V8JA 5CVIA 4M7DA 1WJRA 5KYUA 3RKXA 4FSXA 1EX4A 1MUZA 4NOYA 2RQUA 4M78D 1X2KA 2QG9B 4J9HA 5KYNA 4BE0A 2JTFA 2LT1A 2JS2A 2WSEE 1WHGA 2WSCE 2GQVA 1XTDA 3G1JA 1VQPT 3CCJT 1G3YA 4OMQA 3VJPA 1QVGA 3PNWC 4HCBA 1VQ6T 4O6JA 4AG2C 1H3ZA 5LJ3j 5CKFA 1UFFA 2B8AA 1H92A 2GFUA 2DL7A 3X26B 4RTXA 4LNPA 5GAMg 1KHIA 5DLQE 4EMKC 5FWBA 5CKDA 2XG8D 2LQWA 1W2BA 3KXTA 2QQ9A 5KYYA 5A2QE 3VS2A 2DRMA 1TH7A 5GAN4 2YUOA 2KEAA 1HSQA 2IPOB 2LNHB 2O4XB 1VYVA 4M7DE 3G7ZA 1D1BA 4QVDA 3GNFB 4JZ4A 2X3XD 1S1NA 3CCRA 1K0XA 1QVFA 3CPFA 1HK9A 3M0SA 3EFRA 3PMTA 1RAIB 2HBPA 4HVVA 3I55A 1GL5A 4ANJA 1QMCA 5L8RE 3LWHA 3QWYA 2RJFA 3OYEA 4A4EA 2HAXA 2HKNA 1X75C 1UG1A 3CPWA 3SEMA 1FX7A 4LD6A 3H0IA 4M75E 3M59A 4C8QB 1JO8A 2LCLA 2RI3A 2VXEA 5KCOA 5GAOm 1KD1C 3OS1A 3E1SA 1ZSZB 4IUQA 4PJOB 5IXBA 1EFNA 1VIFA 3L2RA 2CUBA 2ZPIB 4FT2A 2YDLA 2LTOA 1I5OB 2RHXA 4P5NA 5J3BA 2E65A 3MCAB 1X6GA 4KGXB 2E3IA 1OU8A 2LX9A 2OAWA 1NJIR 2J06A 4RTZA 2ED1A 2K9GA 3C4SA 1NJIU 3EFSA 1VQPQ 3M0QA 3CCJQ 1YI2T 2DZCA 2CGHA 4DBFA 1Z9ZA 5GANh 1VQ6Q 4F17A 2KQWA 3BE3A 1XNIA 2DL4A 5GAOq 3CCVT 8ATCB 2LJ1A 4X9DA 1K0SA 2P84A 4OB2B 4M77F 4BY6C 4IUPA 2HBWA 1BCMA 1X43A 4J7IA 1G2BA 3JCMV 2AK5A 4DBHA 1M4ZA 2A37A 1SKUB 4BD3A 1KQSP 1M27C 2R57A 5D6XA 1YJNA 3X25B 2V8JA 2Y4XA 3L42A 4FW1A 3NTHA 3BW1A 2LDMA 3D7SB 4J5YA 2K3YA 2CUDA 1PSFA 2A08A 4M4ZA 3OYHA 1NLPC 4FU6A 2VGMA 3N5BB 1B34A 4EMKA 4LE9A 5GMKj 1PCXA 2E3HA 1TUGB 2NUPA 1OPKA 2DILA 3VS5A 3C95A 3OMGA 1H3HA 5CO7A 3UA6A 1IHWA 2MMPA 4PJNA 3OQ5A 2DEUA 1GCQC 2HQHA 2GNCA 5KYWA 1I1JA 4PJJA 2QA4T 3QYHB 2RO0A 4FT4A 3NHNA 5AT1B 3UPUA 2O9VA 4QQGA 3QKJA 2YRVA 3EGXB 2RQRA 3RUXA 2P0QA 1ABOA 2LNVA 1I81A 2DAQA 2MYSA 4M78F 2WSFE 1KIKA 3CCST 1UGPB 2CT3A 3CC7T 4BI4A 4IUVA 2JMCA 1N8RR 1EZZB 1X69A 1Q7YR 3PTAA 2CP5A 1QVPA 3QUIA 1N8RU 1SRLA 4UC4A 1QP3A 1Q7YU 3KUFA 3CCEA 2MK5A 3PIPA 2K79A 3OW2S 1VQLT 1K73R 1NZ9A 4DEXA 4EIKA 4OMPA 1Y7XA 4A4KA 2K2MA 1AOJA 1X27A 1G5VA 1K73U 3CCLA 4V2SA 1YJ9A 3ZBDA 4JJCA 4RTVA 1M3AA 1BI3A 3FJPA 2H3EB 4M7DB 1HJDA 3GPLA 2EQUA 1VYUA 1YI2Q 5KYUB 4JS4A 1XOVA 4LDUA 1A0NB 4M77G 3UA7A 1TU0B 2XHCA 3CCVQ 4E7KA 3GNGA 2QAZA 1YWPA 2DXBA 1SPKA 3EHRA 1M90C 2RJDA 1VQKT 1NM7A 2EGCA 2EIFA 4AFUC 2A3LA 4A4FA 4ZN1A 3EG2A 4M78C 4NL2A 3OYNA 1M1KU 2QK0A 4JRKA 3WVEB 4XQ3A 3MP8A 1NYGA 4XU3A 3CCMT 4PL6A 2O88A 2RI5A 2DTOA 5GANd 5KYYB 1I5LA 2LJ3A 3CCUA 3QZ9B 3HFOA 2A36A 4Z02A 1NBEB 2DA9A 2FPDA 2KK4A 4D6WA 1VQ7T 4R56A 1TUDA 4QVCA 3CCQA 2RNAA 2EW3A 3GOXA 1LJOA 4IUTA 1BI2A 2LCCA 2KR3A 5KYXA 4IIMA 4HVWA 2DFUA 2MCNA 1IHVA 3URGA 2G6FX 4MZPA 1K1ZA 2HQXA 2QA4Q 5GAMj 2VUBA 1D1CA 1VA7A 2EYZA 3L1AA 4M78G 1PRMC 2L3QA 1RADB 2GBQA 1NPPA 3SDZA 1EIFA 1N9SA 3GLXA 3V7CA 2HSPA 2E5KA 4XTVA 3VKIA 5GMKi 3TSWA 3A98A 1GXIE 3CBMA 1GFDA 5CKEA 2KNBB 3CCSQ 3CC7Q 2K7AA 1BIAA 1PRLC 3CMET 1GCQA 3CEYA 4E6RA 1ZBJA 4PLLA 1M8VA 4C5EA 3NGPA 1IGQA 2DJZA 3EGDA 2COYA 4XK8E 1Q86C 2RHZA 1RI9A 3OYIA 4BE2A 2H3JA 3EGUA 2ZPHB 4CC4B 2YWWA 2QEXT 4EMHA 1QVGP 1YBYA 4PJMA 1G8XA 4Z8AA 2FPFA 1LCKA 1VQLQ 1Y96A 4GBQA 2C0TA 2LRQA 4ZGJB 4M77A 4DBQA 4C92F 5D6YA 1GCPA 5LJ5d 3META 3H0FA 2RH2A 1W2BP 3O8VA 1TG0A 4QKUA 4PJOE 2D8HA 4A4HA 1YITT 4JJDA 3OBYA 2D0QB 5LJ5g 2DO3A 2EQJA 5GMKm 1VUBA 1K4US 1RAAB 3EAEA 4N4IA 5IH2A 3G6ET 2HQEA 4BACA 4XTZA 3PIOA 1ARKA 1VQKQ 1PG5B 3OW2A 1VQMT 3VS0A 1MMNA 5FU7C 4KBMB 1LPLA 3PMIA 3OBWA 1QVFP 4X9CA 4JJBA 3CCMQ 1K9MC 3VS4A 1TSFA 3CPWS 2BE7D 1J3TA 5HCKA 2AT1B 4AFZC 1M1FA 5IXFA 1IO6A 2ZAEA 3LH0A 3UWNA 2MIOA 1PNJA 2QTVA 4M77E 3KFVA 1VQ7Q 3RMSA 4M7AC 5IHIA 2ABLA 2MWPA 2E6ZA 1TUCA 4OB0B 3VS7A 4M78A 2HEQA 4OB3B 4J8OA 2QQAA 3OS5A 3E9GA 1KFZA 3CPWP 1QCFA 3A1PA 1UGRB 5GANe 1B34B 3QXEB 4PFPA 1QW1A 4C92C 1NE8A 3LYIA 2NUPB 3L2VA 4KH0B 3TVTA 2K5FA 2QI2A 1BIBA 2RF0A 4PLIA 3JB9J 3PGGA 3G71T 4RMOA 2K4YA 4J9DA 3GP8A 3V8LA 5KYWB 2JS0A 4FL6A 1OI1A 5GAN3 4LN2A 3MP1A 4R55A 4E7SA 2ENMA 1RABB 3CMEQ 5CQYA 1YFNA 2KT8A 4XU2A 1M5Q1 3DB4A 4OMLA 3KBGA 3CMAT 4M7AG 3C94A 1AVZC 3CC2T 4OGCA 1HYOA 2EQMA 1OX9A 3OYCA 2QEXQ 4XTXA 1VQOT 1WGSA 4HXJA 1WYXA 2KSSA 4C92G 3QWXX 3JCMb 2GTOA 2P0PA 2DLPA 2EWNA 3THKA 4XU0A 2OTLT 4M78E 4BI8B 4AFSC
chains in the Genus database with same CATH topology
3HP9A 3OYGA 4JLIA 3TEEA 4DOWA 3C4SA 1NJIU 1M9SA 2GFAA 2E1HA 4N0AC 3EFSA 3VV0A 5HK3A 4C8QD 4F7UE 1YI2T 3H8ZA 2DZCA 3M57A 2QEXA 4HKEA 2CGHA 2XD0A 3SWNB 3L2QA 4C0FA 4J7FA 5GANf 5GANh 4M75C 3V8KA 4M7DF 3QSUA 2KQWA 2JOYA 1VQ5T 1XNIA 2MI6A 3CC4T 1Q82U 3F70A 4IURA 2GCXA 4HA8A 5GAOq 1KG1A 4J6XA 3CCVT 4QW2A 1WPYA 2BIVA 1YHQT 1VQNA 3JSCA 4X9DA 2ZCFB 1VQPA 4OB2B 4M77F 4BY6C 4IUPA 3QO3A 2CYZB 5LJ5e 4J7IA 1M90U 2KY9A 4MZTA 4B9WA 4XTUA 2XIDA 3JCMV 2RHUA 1M4ZA 3QYGB 4ZTJA 1VQ6A 3LGFA 4J6WA 4BD3A 2PVOB 4LDWA 3CCUT 1W4SA 1R8OB 2R57A 3JCMd 4FIBA 5D6XA 3JB9D 3X25B 1DJ7B 1YJNA 2EJFA 2PUKB 2V8JA 4ZGEB 2X4JA 2Y4XA 2DXUA 2XK0A 3BDUA 4OMFB 1O75A 5GAN8 5CCAA 1V29B 1UB4A 2FL7A 2YLCA 3L42A 4N4GA 4ME7A 4C5HA 3MHXA 3NTHA 3CCQT 3CBPA 3BW1A 3G6EA 1WNLA 2K2VA 1BKBA 1LOJA 2LDMA 2XDPA 3GIBA 5LJ3h 2JN0A 3NTIA 4J5YA 3ZEHA 2EJGA 1WQ7A 3P8HA 5DY9A 1YIJT 2K3YA 3DKMA 2ZPEB 1PSFA 1YCYA 4XU1A 2E41A 3OYHA 5FU6C 3M55A 4C5GA 1KQSA 2L8DA 4FU6A 2VGMA 3HSBA 2JVVA 3N5BB 1OZ3A 1B34A 3INZA 1Q81U 4EMKA 4QQDA 5GMKj 5FROA 4M75G 2PU9B 3I55T 2PVGB 4M75B 3RIRA 1VQ9A 3C95A 3OMCA 3OMGA 3OYYA 2DTHA 3QJYA 1PSEA 1IREB 4L5GA 3OYBA 1G3WA 4C5IA 5A0LA 2M9UA 4LDYA 3RESA 2FVUA 5CO7A 5D6WA 3FDRA 1KQ1A 1UEBA 2MMPA 2ZGWA 3DB3A 4EMKB 3BFMA 2AHJB 3V7SA 3OQ5A 4OB1B 1VQ7A 3PFSA 4BY6B 3TCJA 3MEWA 1ZBXA 4XTYA 3OSVA 4RCBA 3SD4A 5FU7B 4BDZA 2QA4T 5CK9A 3JCMJ 4C8QA 2K5LA 1JJ2S 3QYHB 3AHUA 2RO0A 4FT4A 2G3RA 2MF2A 4C0ZA 3SB2A 4JS5A 3OY9A 3UPUA 2CZ7B 4QQGA 2RM4A 4M7DC 3QKJA 2YRVA 4PJOA 5DM7R 2LQKA 3JCMQ 1HXDA 3RUXA 2RK1A 4M7AA 1X6OA 2E64A 2P0QA 2LNVA 3OSSC 3QZ5B 1I81A 3A5ZB 2DAQA 3LX7A 3E9FA 4M78F 2WSFE 5LJ5f 3FC3A 1Y07A 3HHTB 3CXCS 3CCST 1UGPB 3HPWA 3CC7T 2PQWA 3OYJA 4KUDK 2R58A 4BI4A 1QVGS 2ZPBB 4IUVA 2JNGA 5FU6B 4M7AB 4F7UF 3S3OA 1I4K1 3JAME 3M53A 4C92A 3G71A 4JJNK 3I56A 1Q86U 3PTAA 1VQ8T 1QVPA 3QUIA 3BY7A 1N8RU 2MWOA 4UC4A 2XKOC 2E10A 1U8RA 2EQKA 1QP3A 3J80E 1Q7YU 2VYTA 3CMEA 3KUFA 3TREA 3CCEA 5I21A 4C92B 3DLMA 4BUGA 5CR2A 1W2BS 1N8RC 3PIPA 2E6NA 2F69A 3HL8A 2DD4A 5KE2A 2JUFA 2P4TA 5GAN6 3OW2S 1NZ9A 2E70A 1VQLT 2CZ0B 3CMAA 2RHYA 3H6ZA 1Y7XA 4A4KA 3SFMA 5J39A 1S72A 3LWIA 4LD9K 3CC2A 1G5VA 1K73U 4GY5A 5GAOr 3FIFA 1YJ9A 3CCLA 3ZBDA 4V2SA 3T9NA 1I8FA 3J81E 2BUDA 1BI3A 4M7DG 4RG8A 3OA6A 3FJPA 4M7DB 1NJIC 4A53A 2EQUA 3GPLA 4JRPA 2RD1A 4MDWA 1QP2A 4JS4A 4ATOA 4PJOD 2DTIA 3C12A 5HK0A 1VQOA 4QQ6A 4C8QE 1XOVA 4GLKA 2M1HA 4MMLA 4LDUA 3WVDB 2IVWA 4M7AD 3J7AF 3HRSA 3JB9F 4RKUE 2RJCA 1Y96B 2CZ6B 4M77G 2O01E 2M0OA 3FEOA 4HT8A 2M16A 4M77B 3VUZA 4LDVA 2OTLA 2XHCA 2ZZDA 3CCJA 5GAMd 1ZQ1A 2VXFA 1P92A 3VUBA 1Q82C 4II1A 4RCCA 5GMKe 4E7KA 1QVFS 2VGNA 2Y90A 3MEUA 4M7DD 3GNGA 2XDDA 3M9QA 1YJNT 1YITA 4C92D 4JRQA 1YI2A 2RJEA 2KAFA 1VIEA 4ELYC 2P0KA 2DXBA 3L2WA 4J6YA 1LNXA 4OVAA 4YTLA 1WJQA 5CIUA 2RJDA 4DOVA 1KHCA 4EPCA 3OYKA 1M90C 1VQKT 3LGLA 4J83A 3M54A 4L6V5 4N0AA 2EIFA 2A3LA 4A4FA 4ZN1A 4C0DC 2LT4A 1N6AA 4M78C 4NL2A 3UDCA 3OYNA 5KE3A 4EMGA 2DXCA 3CCRT 2YLBA 1M1KU 5C0MA 1BYMA 4JRKA 1N27A 5LJ3f 1YHQA 3JCMg 3WVEB 1K9MU 5EG2A 4XQ3A 1UGSB 3MP8A 3NTKA 4M75A 5A0DA 2E12A 3X20B 1WJSA 2RB6A 4XU3A 3CCMT 3A8LB 5IT9E 2DXTA 3A8HB 4WF2A 5HKCA 4OGEA 1VQMA 4PL6A 1D3BB 3CD6A 5C6SA 3L2UA 2RI5A 3FRNA 2FYKA 2DTOA 3FB9A 5GANd 1IZ6A 1H641 1I5LA 5CKHA 2MAMA 3CCUA 4M77D 4C8QC 3QZ9B 3HFOA 4Z02A 2KVQG 5A0GA 3JCMe 3HFNA 1Q81C 2KK4A 4D6WA 2DEQA 3A8OB 4R56A 1VQ7T 3RMQA 2K57A 4QVCA 2K3XA 4Y28E 3CCQA 1G3SA 3GOXA 2OTJA 2PVDB 1LJOA 2XU8A 3HRUA 4IUTA 1BI2A 4PKCC 2L3RA 2LCCA 3R6OA 3JCMX 1YIJA 3RERA 1OYXA 2DK3A 4A4GA 4E7IA 5LL6S 2QQBA 4KULA 3URGA 4BB7A 4JLGA 5LJ5j 2EFIA 3RKWA 1KQ2A 5CAIA 4MZPA 2HQXA 4DA4A 4ZN3A 5GMKl 2DD5A 2I2LA 3JCMW 2DZ9A 5GAMj 2F5KA 3S6WA 2VUBA 2X4YA 3X28B 2JTMA 3JCMP 3ER0A 2EJ9A 3L1AA 5I2MA 2DIGA 2EYQA 2GF7A 2QTXA 4M78G 2DIQA 3MP6A 4M78B 1U1TA 3DLLA 2QQRA 5GMKh 5AYFA 4KUIA 1KC8U 1NPPA 3SDZA 1EIFA 1N9SA 3GLXA 3ZFJA 5FRMA 3V7CA 2HNIA 2A7YA 1Y71A 3QIIA 4F7UG 4M75D 4XTVA 3VKIA 2RK2A 2IG0A 4F7UB 5GMKi 3OYAA 1GXIE 3CBMA 3I56T 5CKEA 4VUBA 2QA4A 2X35A 1O9SA 4TVRA 3SWNC 3ASKA 5CKBA 2XDBA 1BIAA 2JZ2A 3HKSA 2EAYA 3V7RA 1JBMA 3OYLA 4QVZA 3G4SA 1KD1U 3CMET 1N9RA 2QQSA 2QXFA 4HT9A 3TU4K 3CEYA 1U1SA 2R5AA 1VQ4T 4PLLA 4C8QF 3QBYA 1M8VA 4C5EA 1OZ2A 3QDRB 2DJZA 4ZTFA 4E47A 1YJWA 1Q86C 3QHSA 4XK8E 5GANj 2RHZA 3RKYA 3OYIA 4BE2A 4PJOF 2H3JA 4C0GA 1K8AU 4XAXB 1Q7YC 2ZPHB 1S72T 3CC7A 3V8JA 5CVIA 4M7DA 3CCLT 2QEXT 1WJRA 4EMHA 2FB7A 1YBYA 2CZ1B 2K5IA 3RKXA 1JJ2A 4FSXA 4LDXA 2X4WA 4HCZA 1RL2A 4JUVA 3VU3C 4NOYA 3LLRA 4M78D 4BE0A 1Y96A 3JCMh 3JCMf 2JTFA 2LT1A 2LRQA 2WSEE 4M77A 4ZGJB 5KCHA 4MZMA 3JRZA 2WSCE 4C92F 1K73C 1VQNT 5D6YA 2GQVA 5IN1A 3JB9G 1XTDA 1G3TA 5FRNA 5LJ5d 1VQPT 3CCJT 1FXXA 1UGQB 3CXCA 3META 2BKDN 4NS5A 1G3YA 2RH2A 3VJPA 5J26A 1QVGA 3O8VA 1MGQA 4JDSA 2ZPFB 3NFCA 4E7HA 4PJOE 3E19A 4A4HA 3PNWC 1VQLA 3BDLA 3P8BB 1YITT 4O6JA 3OYDA 4HCBA 1VQ6T 4M7AE 1KQSS 4HCCA 2KDSA 3OBYA 2D0QB 1H3ZA 3QG1A 4KT0E 5LJ5g 2DO3A 4N4HA 4JRIA 5CKFA 2B8AA 2EQJA 5LJ3j 1JB0E 5GMKm 2GFUA 1VUBA 2RA2A 3X26B 1NPRA 2NLUA 4CI0C 1RI0A 4OF1A 3VYHB 4FM4B 5IAYA 3EAEA 5GAMg 4N4IA 2QDYB 3G6ET 1KHIA 2HQEA 5DLQE 4BACA 2DKGA 3VYGA 4EMKC 4XTZA 5CKDA 2L5QA 2XG8D 1VQ5A 3CC4A 5GAOl 4EDUA 1D3BA 4C92E 3OYFA 1W2BA 1WQWA 1X01A 3PIOA 3CCVA 2C06A 3KXTA 4CRIA 2DVEA 3JCMc 2QQ9A 3OW2A 2HD0A 2LQ8A 1VQMT 3CD6T 2O4XA 5FU7C 5A2QE 2RHIA 5GAN5 4KBMB 3PMIA 2L89A 3OBWA 3Q1JA 3M4YA 1TH7A 1BI0A 5GAMe 2FHDA 1M1GA 1M1KC 4X9CA 4ELZC 5GAN4 2D6FA 2VV5A 4E7LA 1VQ9T 1K9MC 5GAOp 2O4XB 3CPWS 3CBOA 1SSFA 4M7DE 3G7ZA 4A54A 2RI2A 1BI1A 2E5QA 4QVDA 1M1FA 5M9OA 1VQKA 2WACA 2CKKA 3LH0A 2OTJT 4PNOA 3UWNA 3MEAA 3WXMB 3GNFB 3QPHA 5GANg 4E7JA 4MMKA 2CS7A 4XTWA 2ZPGB 3CCRA 4PJOC 3OYMA 4M77E 4NL3A 1QVFA 4M7AC 3RMSA 3P8DA 3QJ6A 2LVMA 3CPFA 4MDXA 1HK9A 3CCMA 2MWPA 2E6ZA 4OB0B 5FLXE 3M5AA 4DQ2A 3EFRA 5CQXA 4M78A 3PMTA 5GAOn 4OB3B 4M75F 2HBPA 3L2ZA 2QQAA 4J8OA 3OS5A 3E9GA 3M58A 1UGRB 3I55A 5GANe 1B34B 3QXEB 4C92C 1QW1A 1XQHA 2EKOA 1NE8A 3LYIA 4F7UA 3S3NA 1JRIA 5L8RE 4C0DB 3LWHA 3L2VA 1ZHIA 1FWZA 2LC4A 5LJ3d 4BE1A 2PUOB 3M56A 2RJFA 5HY6A 2K5FA 2QI2A 5GAN2 4L59A 3LW5E 1BIBA 3OYEA 4PLIA 4A4EA 3PGGA 4ZGDB 3G71T 3JB9J 4BDYA 2HAXA 4B9XA 3X24B 3G4ST 1X75C 4RMOA 1KC8C 4BI3A 2YHTA 2K4YA 2D9TA 5LJ3g 3CPWA 3PT9A 3A8GB 4PJOB 1FX7A 3GP8A 3V8LA 2XICA 4LD6A 3CCET 4C8QG 4FL6A 4M75E 3M59A 1OI1A 4Q5WA 2Y4YA 4RG2A 3ME9A 4C8QB 5GAN3 3JB9I 2LCLA 1YJWT 3MP1A 2RI3A 2VXEA 5KCOA 5I2SA 5GAOm 4R55A 3OS0A 4IKFA 5GAN7 5LJ5h 2V8KA 2XI9A 4IUUA 5CQYA 1KD1C 4M77C 3OS1A 4XU2A 4PJOG 1M5Q1 3OS2A 2F5TX 3E1SA 2R5MA 3DB4A 3KBGA 2OAUA 4IUQA 3CMAT 3JB9H 3C94A 1AHJB 4M7AG 2KMTA 5GAMf 2X4XA 5LJ3e 5GAMh 3CCSA 5DLOA 3CC2T 4M7AF 4OGCA 4X34A 4Y91A 3M4GA 1YJ9T 1VIFA 3L2RA 3OB9A 2ZPIB 2EQMA 4FT2A 3A8MB 2V8IA 1K8AC 3OYCA 2LTOA 4XTXA 1VQOT 1WGSA 2RHXA 3HRTA 3FLGA 2KSSA 4P5NA 1VQ8A 4C92G 3S3MA 3UT1A 5J3BA 2E65A 4OP0A 3JCMb 1VQ4A 3MCAB 2P0PA 2VC8A 2EWNA 2LX9A 3MO8A 4O5VA 1MHNA 3GF5A 2OTLT 4XU0A 3MEVA 4M78E 5KH6A 3SWNA 2DPPB 4BI8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCJ A;  3VUB A;  2KMT A;  3NFC A;  5DLO A;  4MZT A;  4MDX A;  5HKC A;  5CK9 A;  5HK3 A;  5CKE A;  4VUB A;  1X75 C;  4HKE A;  5CKB A;  4ELZ C;  2MF2 A;  5CKF A;  4MZP A;  4ELY C;  5CQX A;  1VUB A;  5CKH A;  4OF1 A;  3G7Z A;  2VUB A;  4MZM A;  5CCA A;  3JRZ A;  1UB4 A;  5HK0 A;  4ME7 A;  1M1F A;  5CO7 A;  5CKD A;  5CR2 A;  1NE8 A;  3JSC A;  5CQY A;  2C06 A;  3HPW A; 
#chains in the Genus database with same CATH topology
 3HP9 A;  3TEE A;  4DOW A;  1PM3 A;  2ROL A;  3VV0 A;  2DET A;  2BZX A;  2XD0 A;  3SWN B;  3L2Q A;  4C0F A;  5GAN f;  1Q82 R;  1G83 A;  1I07 A;  2FG0 A;  1YIT Q;  3VS1 A;  3QSU A;  2JOY A;  1Q82 U;  4HA8 A;  2EBP A;  2EGE A;  1WPY A;  1YHQ T;  5GJV B;  1GBR A;  1VQP A;  1PC0 A;  3G6E Q;  1NEG A;  5LJ5 e;  2KY9 A;  4MZT A;  1C1A A;  4ZTJ A;  1VQ6 A;  4J6W A;  1VQM Q;  2PVO B;  2VAS A;  2EJF A;  4ZGE B;  1WHJ A;  2DXU A;  2EKH A;  5CCA A;  1V29 B;  1UB4 A;  2FL7 A;  2YLC A;  4N4G A;  4ME7 A;  4KGV B;  1V76 A;  1WXB A;  4AMC A;  3MHX A;  2KI7 A;  1WNL A;  1QCO A;  2D0N A;  5LJ3 h;  3NTI A;  1OEB A;  1YIJ T;  1B07 A;  1Q81 R;  5FU6 C;  4QT7 A;  2JT4 A;  1I0C A;  2DF6 A;  1IB8 A;  3H9N A;  1Q81 U;  1OZ3 A;  3JV3 A;  2W10 A;  1T3S A;  4ZNX A;  3I55 T;  3RIR A;  1D1A A;  3OMC A;  1PSE A;  2QAS A;  4PJL A;  2CP3 A;  2FVU A;  4PFZ A;  3EH2 A;  1T3L A;  2HL3 A;  1KQ1 A;  2AHJ B;  1TWB A;  4OB1 B;  3PFS A;  4BY6 B;  4XTY A;  4JZ3 A;  1UEC A;  2AZS A;  2J6K A;  2G3R A;  3ULR B;  2MF2 A;  1YNZ A;  2BZ8 A;  3OY9 A;  2CZ7 B;  3G71 Q;  2F2X A;  1NG2 A;  2RK1 A;  4M7A A;  3QZ5 B;  3A5Z B;  3LX7 A;  3E9F A;  5LJ5 f;  3FC3 A;  1OU9 A;  1Y07 A;  4LUE A;  1OX8 A;  2R58 A;  2ZPB B;  3U23 A;  1I4K 1;  1AEY A;  4C92 A;  3CMA Q;  3NPF A;  3I56 A;  4X1V A;  3CC2 Q;  1FMW A;  2MWO A;  2FZK B;  2E10 A;  3I9Q A;  3J80 E;  1M8M A;  1VQO Q;  1N8R C;  2E6N A;  3HL8 A;  2DD4 A;  5GAN 6;  1JU5 C;  2H8H A;  2DL5 A;  2E70 A;  2CZ0 B;  2DL8 A;  3MJX A;  3O5Z A;  2RHY A;  3SFM A;  1UJY A;  2DX1 A;  2OTL Q;  1S72 A;  3EGD B;  1BB9 A;  5GAO r;  3J81 E;  2BUD A;  4DEY A;  3OA6 A;  4A53 A;  2DYB A;  2DTI A;  1QWF A;  1UDL A;  1AZG B;  4M7A D;  3WVD B;  2IVW A;  3M0T A;  2RJC A;  2W0Z A;  1Y96 B;  1UE9 A;  2CZ6 B;  2JM8 A;  4HT8 A;  2M16 A;  4M77 B;  2FZC B;  1M30 A;  4WCI A;  1WHL A;  4RCC A;  3PVQ A;  1YHQ Q;  2C0O A;  2XDD A;  1YJN T;  3UF4 A;  4C92 D;  1YI2 A;  2DM1 A;  2F1L A;  2RJE A;  2KAF A;  4ELY C;  1SF9 A;  1WJQ A;  5CIU A;  4EPC A;  2LT4 A;  1UUE A;  3AT1 B;  3VS3 A;  5KE3 A;  2DXC A;  4F16 A;  2DVJ A;  1WJS A;  2RB6 A;  4J9B A;  2DXT A;  3A8H B;  4WF2 A;  5HKC A;  3CD6 A;  2RQW A;  3L2U A;  2FYK A;  1JXM A;  1YIJ Q;  1GBQ A;  4C8Q C;  2YRD A;  5A0G A;  3HFN A;  2DEQ A;  3RMQ A;  3I55 Q;  4Y28 E;  1G3S A;  2OTJ A;  1ZA1 B;  1JEG A;  4RTW A;  3R6O A;  3JCM X;  3RNJ A;  4FYV B;  4A4G A;  2PNI A;  4HCK A;  2QQB A;  5LJ5 j;  2X9H A;  2JMA A;  4JLG A;  3RKW A;  4DA4 A;  2DD5 A;  2I2L A;  2LCS A;  3JCM W;  2X4Y A;  1Q95 G;  2JTM A;  9ATC B;  2EJ9 A;  1RAE B;  1WIE A;  4M78 B;  2KBT A;  1U1T A;  3DLL A;  1E6G A;  3I5S A;  5GMK h;  5AYF A;  4RUG A;  1MND A;  5FRM A;  2A7Y A;  1Y71 A;  2KRO A;  3QII A;  2OI3 A;  2RK2 A;  4A63 B;  1KD1 R;  4VUB A;  2QA4 A;  4J9I A;  2GTJ A;  3V7R A;  1KD1 U;  3G4S A;  2HSE B;  1N9R A;  2QXF A;  3QDF A;  4D8D A;  1U1S A;  1VQ4 T;  2JJ9 A;  5IHN A;  1WHH A;  2D1X A;  4CC7 A;  1YJW A;  2LZ6 B;  1CKB A;  1KK7 A;  1SHG A;  1K76 A;  2J05 A;  4XAX B;  3CC7 A;  3VRZ A;  3CCL T;  3H0H A;  2FB7 A;  2K5I A;  4J9C A;  4LDX A;  4HCZ A;  2BE9 B;  1RL2 A;  4JUV A;  1BU1 A;  1VOM A;  3LLR A;  3JCM h;  1WZO A;  1RLP C;  5KCH A;  3JRZ A;  1FMV A;  1VQN T;  4HVU A;  5FRN A;  1FXX A;  3NMZ C;  1NLO C;  2BKD N;  4NS5 A;  5J26 A;  2KRM A;  4JDS A;  2ZPF B;  2CP2 A;  3OW2 P;  3E19 A;  1VQL A;  3BDL A;  2KDS A;  4N4H A;  4JRI A;  1JB0 E;  1WA7 A;  2RA2 A;  1NPR A;  2NLU A;  4CI0 C;  2HMA A;  4FM4 B;  5IAY A;  2CP0 A;  2QDY B;  1YJN Q;  4DBR A;  1D09 B;  3VYG A;  4FYX B;  1M1K R;  1VQ5 A;  3CC4 A;  5GAO l;  4EDU A;  1D3B A;  1KJW A;  2RQV A;  3JCM c;  1FYN A;  2LQ8 A;  5L23 A;  3M0R A;  2O4X A;  2EPD A;  2CT4 A;  1RAG B;  2VWF A;  2FHD A;  1M1G A;  4ELZ C;  2VV5 A;  4E7L A;  1VQ9 T;  2C0I A;  5GAO p;  4OMN A;  5ECA A;  3CBO A;  4Z89 A;  4A54 A;  2RI2 A;  1BI1 A;  1VQK A;  2CKK A;  3MEA A;  3QPH A;  5GAN g;  4E7J A;  2ZPG B;  2YUN A;  3OYM A;  3P8D A;  3QJ6 A;  3CCM A;  2SEM A;  1ZUK A;  4DQ2 A;  1WHM A;  5CQX A;  5GAO n;  4M75 F;  1WX6 A;  1PD0 A;  1LVK A;  1XQH A;  3RR6 A;  2ED0 A;  3S3N A;  1JRI A;  4C0D B;  2LC4 A;  2PUO B;  4K11 A;  3M56 A;  5HY6 A;  1K9A A;  3R6N A;  5GAN 2;  4L59 A;  4ZGD B;  4AG1 C;  1KC8 C;  1D0X A;  4BI3 A;  2YHT A;  2D9T A;  3A8G B;  1C6V X;  4ESR A;  3EG3 A;  2DYI A;  3REB B;  2Y4Y A;  4RG2 A;  3ME9 A;  1WXT A;  1D0Y A;  4IKF A;  1D0Z A;  2V8K A;  2XI9 A;  1PD1 A;  1NYF A;  2M0Y A;  1VQ4 Q;  3JB9 H;  2GQI A;  2OAU A;  2RMO A;  1AHJ B;  1GFC A;  5GAM h;  5LJ3 e;  4M7A F;  3M4G A;  4Z88 A;  1X6B A;  2YT6 A;  4GLM A;  1K8A C;  3CCL Q;  4J9E A;  3HRT A;  1PKS A;  1VQ8 A;  2LX7 A;  1BBZ A;  4D8K A;  3GF5 A;  3MEV A;  1PHT A;  1VQN Q;  1M9S A;  2GFA A;  2E1H A;  4N0A C;  2CP7 A;  1AWJ A;  2FO0 A;  4C8Q D;  3H8Z A;  2QEX A;  4J7F A;  1MV3 A;  4M75 C;  1T0J A;  2MI6 A;  1PKT A;  2GCX A;  4J6X A;  2KE9 A;  3RDV A;  2BIV A;  5I22 A;  1BK2 A;  1IRX A;  1M90 R;  2ZCF B;  1C0M A;  1TTH B;  2PTK A;  2CYZ B;  1M90 U;  2AZV A;  4OMO A;  2LMJ A;  4B9W A;  2XID A;  2JXB A;  3CQT A;  3IQL A;  1R8O B;  3JCM d;  3ZL7 C;  1TS9 A;  1DJ7 B;  2PUK B;  2SRC A;  2BZY A;  2XK0 A;  3BDU A;  1O75 A;  4PFO A;  1VQ9 Q;  3EH1 A;  3G6E A;  1BKB A;  2FRW A;  1LOJ A;  2JN0 A;  3EG1 A;  1BCO A;  3ZEH A;  1WQ7 A;  3P8H A;  2ZPE B;  2B86 A;  4XU1 A;  2E41 A;  1CSK A;  3M55 A;  2L8D A;  3MPU B;  2V1Q A;  4QQD A;  2KXD A;  4M75 G;  3M0P A;  5FRO A;  4PK4 A;  2PVG B;  3OYY A;  3QJY A;  4L5G A;  1IRE B;  4C5I A;  5A0L A;  2M9U A;  4LDY A;  2HKQ B;  3FDR A;  4EMK B;  4AT1 B;  1E7O A;  3BFM A;  2A0F B;  3MEW A;  1ZBX A;  4RCB A;  2EYX A;  3JCM J;  2K5L A;  1JJ2 S;  2OJ2 A;  3AHU A;  4C0Z A;  1AZE A;  3SB2 A;  4JS5 A;  2RM4 A;  2KYM A;  1Y0M A;  1OPL A;  4KGZ B;  1HXD A;  3OSS C;  1W1F A;  3EFO A;  1JQQ A;  2J6O A;  1QLY A;  3CXC S;  3HPW A;  1NEB A;  4Y92 A;  1RLQ C;  5FU6 B;  4F7U F;  3S3O A;  1WFW A;  1Q86 R;  1ZLM A;  3JAM E;  3M53 A;  3G71 A;  2YXY A;  4JJN K;  1OUL A;  2KT1 A;  1Q86 U;  2NUT A;  2QGF B;  3BY7 A;  2XKO C;  2EQK A;  2VYT A;  5I11 A;  1RAH B;  3TRE A;  5I21 A;  1YN8 A;  2JUF A;  2P4T A;  2YSQ A;  2P4R A;  3CMA A;  1YWO A;  3LWI A;  3CC2 A;  2EQI A;  2RPN A;  3FIF A;  4RG8 A;  1NJI C;  4JRP A;  1QP2 A;  4ATO A;  1VQO A;  2NWM A;  2M1H A;  3J7A F;  3HRS A;  3JB9 F;  2D8J A;  4LXC A;  2M0O A;  3VUZ A;  4E7Z A;  2OTL A;  1YCS B;  3CCJ A;  5GAM d;  1ZQ1 A;  2FZG B;  2VXF A;  3VUB A;  5GMK e;  3MEU A;  5GJW B;  3M9Q A;  4JRQ A;  2DJQ A;  3L2W A;  4J6Y A;  1LNX A;  2DL3 A;  4YTL A;  4DOV A;  1ZUU A;  4N0A A;  1K9M R;  3UDC A;  1ABQ A;  1IGU A;  2JW4 A;  1WDX A;  2L2P A;  3EHQ A;  2PZ1 A;  2YLB A;  3PVL A;  3CCR T;  1YHQ A;  1K9M U;  5EG2 A;  2VVK A;  4M75 A;  2M02 A;  5A0D A;  2E12 A;  4M7D D;  3A8L B;  5IT9 E;  1D3B B;  5C6S A;  2DMO A;  2X3W D;  5D7U A;  1IZ6 A;  1H64 1;  2ATC B;  4JPB W;  3I35 A;  1SHF A;  3REA B;  1SRM A;  3JCM e;  3A8O B;  4ORZ A;  2K3X A;  3PE0 A;  1SSH A;  3HRU A;  1ZUY A;  1YIJ A;  1OYX A;  2DK3 A;  5LL6 S;  4KUL A;  1KQ2 A;  2EFI A;  5CAI A;  4LUD A;  1GRI A;  1R0B G;  5GMK l;  2KXC A;  2DZ9 A;  3S6W A;  3X28 B;  1F1B B;  1PWT A;  5KYX B;  3JCM P;  3ER0 A;  2GF7 A;  1M3B A;  2QTX A;  2YUP A;  1R0C B;  4B6M A;  1Y57 A;  4F7U G;  4M75 D;  2IG0 A;  3I56 T;  3EG9 A;  2X35 A;  4RTT A;  3SWN C;  3ASK A;  5CKB A;  2XDB A;  2JZ2 A;  3HKS A;  2EAY A;  2A28 A;  3OYL A;  1H8K A;  2QQS A;  4HT9 A;  5FWC A;  3TU4 K;  4C8Q F;  3QBY A;  2VB6 A;  1U5S A;  2EYW A;  3QDR B;  4E47 A;  2EVR A;  5GAN j;  4PJO F;  4C0G A;  1Q7Y C;  1S72 T;  2HDA A;  2K3B A;  2CZ1 B;  1JJ2 A;  2X4W A;  5EC7 A;  4F14 A;  2OX7 A;  3VU3 C;  4R0K A;  3JCM f;  2O9S A;  4MZM A;  2EGA A;  1K73 C;  3JB9 G;  5IN1 A;  1G3T A;  1UGQ B;  3CXC A;  4FSS A;  4IIO A;  1MGQ A;  4RTY A;  4E7H A;  3NFC A;  4WTO B;  3P8B B;  1QCN A;  3OYD A;  4M7A E;  1KQS S;  4HCC A;  2V1R A;  3QG1 A;  4KT0 E;  2AKK A;  3RBB B;  1MV0 B;  1RI0 A;  4OF1 A;  3H41 A;  3VYH B;  4FW2 A;  2DKG A;  2L5Q A;  2CRE A;  3M0U A;  4C92 E;  3OYF A;  1WQW A;  1X01 A;  2GGR A;  1AT1 B;  3CCV A;  2C06 A;  1UTI A;  3GBQ A;  4CRI A;  2DVE A;  2BTT A;  2HD0 A;  3CD6 T;  1ZA2 B;  2RHI A;  5GAN 5;  2LQN A;  1Z9Q A;  2L89 A;  3CCR Q;  3Q1J A;  3M4Y A;  2KYB A;  1M2V A;  1BI0 A;  2MPX C;  5GAM e;  1M1K C;  2D6F A;  2NUZ A;  1SSF A;  2AKL A;  3E2U A;  2E5Q A;  3VS6 A;  2WAC A;  2OTJ T;  4PNO A;  3WXM B;  4MMK A;  2CS7 A;  4XTW A;  1ZSZ C;  4PJO C;  4NL3 A;  4MDX A;  2LP5 A;  2LVM A;  1R77 A;  5FLX E;  3MKD A;  3M5A A;  2KRN A;  3L2Z A;  3M58 A;  1TXQ A;  6AT1 B;  4J9F A;  5IHK A;  2EKO A;  4F7U A;  1IXD A;  1UHC A;  1AWX A;  1ZHI A;  1FWZ A;  1M3C A;  5LJ3 d;  3TSZ A;  2COW A;  4BE1 A;  2NYS A;  2DRK A;  1M2O A;  1RAC B;  3LW5 E;  4BDY A;  4B9X A;  3X24 B;  3G4S T;  4KH1 B;  1QQJ A;  1SEM A;  2ROT A;  5LJ3 g;  3PT9 A;  4CC2 A;  1SG5 A;  2XIC A;  3I56 Q;  3CCE T;  4C8Q G;  2F2V A;  1ACM B;  4Q5W A;  1WHK A;  3JB9 I;  1YJW T;  3OS0 A;  5I2S A;  1XJW B;  5GAN 7;  5LJ5 h;  4IUU A;  4M77 C;  4PJO G;  3OS2 A;  2F5T X;  2R5M A;  2KMT A;  5GAM f;  2X4X A;  3CCS A;  5DLO A;  4X34 A;  3EFO B;  4Y91 A;  1YJ9 T;  3OB9 A;  1S72 Q;  3A8M B;  2V8I A;  3TQ7 P;  3FLG A;  3S3M A;  3UT1 A;  4OP0 A;  1VQ4 A;  2VC8 A;  2NUT B;  3MO8 A;  2DBM A;  4O5V A;  2J7I A;  1MHN A;  2O2O A;  4FYY B;  2L0A A;  2JM9 A;  3SWN A;  2DPP B;  5KH6 A;  5M9O A;  3OYG A;  4JLI A;  5HK3 A;  1JXO A;  4F7U E;  3M57 A;  4HKE A;  1AD5 A;  2IIM A;  1ZX6 A;  3V8K A;  4M7D F;  1VQ5 T;  1T0H A;  3CC4 T;  1UJ0 A;  3F70 A;  4IUR A;  1B7T A;  1KG1 A;  1V1C A;  4QW2 A;  1VQN A;  2FPE A;  3JSC A;  1CKA A;  1AWW A;  3QO3 A;  2DNU A;  4XTU A;  2RHU A;  3QYG B;  3LGF A;  1KSW A;  4LDW A;  3CD6 Q;  1U3O A;  3CCU T;  1W4S A;  4FCY A;  4FIB A;  3JB9 D;  2COZ A;  2X4J A;  4OMF B;  5GAN 8;  4C5H A;  1MMD A;  8AT1 B;  3CCQ T;  3CBP A;  2K2V A;  2HL5 C;  3FJ5 A;  3GIB A;  2XDP A;  2EJG A;  5DY9 A;  3DKM A;  1YCY A;  1YP5 A;  1QKX A;  2YRC A;  2OTJ Q;  4C5G A;  2F2W A;  1KQS A;  3HSB A;  2JVV A;  3INZ A;  2KRS A;  2DBK A;  2E4H A;  4KRT A;  2L3S A;  2PU9 B;  4OMM A;  4M75 B;  2V26 A;  1VQ9 A;  2DTH A;  3OYB A;  1G3W A;  2RQT A;  3RES A;  5D6W A;  1UEB A;  2QDL A;  2ZGW A;  3DB3 A;  3V7S A;  1VQ7 A;  2K6D A;  3TCJ A;  3OSV A;  2EYY A;  3SD4 A;  5FU7 B;  4BDZ A;  5CK9 A;  4C8Q A;  2MOX A;  2O31 A;  5FW9 A;  4E2F B;  4M7D C;  1QWE A;  2VKN A;  4PJO A;  1ZSZ A;  3G4S Q;  3HTR A;  5DM7 R;  2LQK A;  3JCM Q;  1X6O A;  2E64 A;  4FYW B;  3CCE Q;  3HHT B;  2PQW A;  3OYJ A;  1YJW Q;  4KUD K;  7AT1 B;  1QVG S;  2CH4 W;  2ESW A;  2JNG A;  4M7A B;  2CP6 A;  2L3P A;  2AIR B;  1OQK A;  1VQ8 T;  1HD3 A;  1YJ9 Q;  3EG0 A;  1U8R A;  2Z0W A;  3EG9 B;  3CME A;  4C92 B;  3DLM A;  4BUG A;  5CR2 A;  1W2B S;  2F69 A;  4F04 B;  2CH4 A;  5KE2 A;  3H6Z A;  5J39 A;  4LD9 K;  1WLP B;  4GY5 A;  2KGT A;  3T9N A;  1I8F A;  2FRY A;  4M7D G;  2RD1 A;  4MDW A;  4PJO D;  5HK0 A;  3C12 A;  4QQ6 A;  4C8Q E;  4GLK A;  4MML A;  4RKU E;  2J6F A;  1VQ5 Q;  2O01 E;  3FEO A;  2M51 A;  3CC4 Q;  4LDV A;  2ZZD A;  2XMF A;  1P92 A;  2QGG A;  1Q82 C;  2CDT A;  4II1 A;  1QKW A;  1QVF S;  2VGN A;  2Y90 A;  2FEI A;  1YIT A;  1B3Q A;  1VIE A;  2P0K A;  4OVA A;  1KHC A;  3OYK A;  1OV3 A;  3LGL A;  4J83 A;  3M54 A;  4L6V 5;  2YUQ A;  3CCU Q;  4C0D C;  1N6A A;  2I0N A;  4EMG A;  5C0M A;  1BYM A;  1N27 A;  5LJ3 f;  3JCM g;  1UGS B;  1UGV A;  3NTK A;  3CCQ Q;  3X20 B;  2CSQ A;  1MNE A;  1VQM A;  4OGE A;  3FRN A;  3FB9 A;  2HZY A;  1W6X A;  5CKH A;  2MAM A;  4M77 D;  1VYT A;  4RTU A;  1M2V B;  2KVQ G;  1TOV A;  3LH5 A;  1Q81 C;  2K57 A;  2ECZ A;  1OOT A;  3UAT A;  2PVD B;  2XU8 A;  1X2Q A;  2DE0 X;  2L3R A;  4PKC C;  3RER A;  4J9G A;  2QYZ A;  4CC3 A;  3EGX A;  4E7I A;  1UHF A;  4BB7 A;  3SHW A;  3VRY A;  2LJ0 A;  1FMK A;  2HCK A;  4AFQ C;  4ZN3 A;  1N5Z A;  2F5K A;  1RUW A;  3C0C A;  1KC8 R;  1W70 A;  5I2M A;  1MMA A;  2DIG A;  2EYQ A;  2DIQ A;  3MP6 A;  1AWO A;  2QQR A;  1U06 A;  4KUI A;  1ZSG A;  1KC8 U;  2DER A;  3ZFJ A;  2HNI A;  3I5R A;  1MMG A;  1WXU A;  4F7U B;  2JTE A;  3OYA A;  2RN8 A;  1O9S A;  4TVR A;  1JJ2 P;  1JBM A;  4QVZ A;  1E6H A;  2CSI A;  2R5A A;  2X51 A;  1OZ2 A;  1K8A R;  1VQ8 Q;  4ZTF A;  3QHS A;  1WI7 A;  3RKY A;  1RAF B;  1K8A U;  3CXC P;  3V8J A;  5CVI A;  4M7D A;  1WJR A;  5KYU A;  3RKX A;  4FSX A;  1EX4 A;  1MUZ A;  4NOY A;  2RQU A;  4M78 D;  1X2K A;  2QG9 B;  4J9H A;  5KYN A;  4BE0 A;  2JTF A;  2LT1 A;  2JS2 A;  2WSE E;  1WHG A;  2WSC E;  2GQV A;  1XTD A;  3G1J A;  1VQP T;  3CCJ T;  1G3Y A;  4OMQ A;  3VJP A;  1QVG A;  3PNW C;  4HCB A;  1VQ6 T;  4O6J A;  4AG2 C;  1H3Z A;  5LJ3 j;  5CKF A;  1UFF A;  2B8A A;  1H92 A;  2GFU A;  2DL7 A;  3X26 B;  4RTX A;  4LNP A;  5GAM g;  1KHI A;  5DLQ E;  4EMK C;  5FWB A;  5CKD A;  2XG8 D;  2LQW A;  1W2B A;  3KXT A;  2QQ9 A;  5KYY A;  5A2Q E;  3VS2 A;  2DRM A;  1TH7 A;  5GAN 4;  2YUO A;  2KEA A;  1HSQ A;  2IPO B;  2LNH B;  2O4X B;  1VYV A;  4M7D E;  3G7Z A;  1D1B A;  4QVD A;  3GNF B;  4JZ4 A;  2X3X D;  1S1N A;  3CCR A;  1K0X A;  1QVF A;  3CPF A;  1HK9 A;  3M0S A;  3EFR A;  3PMT A;  1RAI B;  2HBP A;  4HVV A;  3I55 A;  1GL5 A;  4ANJ A;  1QMC A;  5L8R E;  3LWH A;  3QWY A;  2RJF A;  3OYE A;  4A4E A;  2HAX A;  2HKN A;  1X75 C;  1UG1 A;  3CPW A;  3SEM A;  1FX7 A;  4LD6 A;  3H0I A;  4M75 E;  3M59 A;  4C8Q B;  1JO8 A;  2LCL A;  2RI3 A;  2VXE A;  5KCO A;  5GAO m;  1KD1 C;  3OS1 A;  3E1S A;  1ZSZ B;  4IUQ A;  4PJO B;  5IXB A;  1EFN A;  1VIF A;  3L2R A;  2CUB A;  2ZPI B;  4FT2 A;  2YDL A;  2LTO A;  1I5O B;  2RHX A;  4P5N A;  5J3B A;  2E65 A;  3MCA B;  1X6G A;  4KGX B;  2E3I A;  1OU8 A;  2LX9 A;  2OAW A;  1NJI R;  2J06 A;  4RTZ A;  2ED1 A;  2K9G A;  3C4S A;  1NJI U;  3EFS A;  1VQP Q;  3M0Q A;  3CCJ Q;  1YI2 T;  2DZC A;  2CGH A;  4DBF A;  1Z9Z A;  5GAN h;  1VQ6 Q;  4F17 A;  2KQW A;  3BE3 A;  1XNI A;  2DL4 A;  5GAO q;  3CCV T;  8ATC B;  2LJ1 A;  4X9D A;  1K0S A;  2P84 A;  4OB2 B;  4M77 F;  4BY6 C;  4IUP A;  2HBW A;  1BCM A;  1X43 A;  4J7I A;  1G2B A;  3JCM V;  2AK5 A;  4DBH A;  1M4Z A;  2A37 A;  1SKU B;  4BD3 A;  1KQS P;  1M27 C;  2R57 A;  5D6X A;  1YJN A;  3X25 B;  2V8J A;  2Y4X A;  3L42 A;  4FW1 A;  3NTH A;  3BW1 A;  2LDM A;  3D7S B;  4J5Y A;  2K3Y A;  2CUD A;  1PSF A;  2A08 A;  4M4Z A;  3OYH A;  1NLP C;  4FU6 A;  2VGM A;  3N5B B;  1B34 A;  4EMK A;  4LE9 A;  5GMK j;  1PCX A;  2E3H A;  1TUG B;  2NUP A;  1OPK A;  2DIL A;  3VS5 A;  3C95 A;  3OMG A;  1H3H A;  5CO7 A;  3UA6 A;  1IHW A;  2MMP A;  4PJN A;  3OQ5 A;  2DEU A;  1GCQ C;  2HQH A;  2GNC A;  5KYW A;  1I1J A;  4PJJ A;  2QA4 T;  3QYH B;  2RO0 A;  4FT4 A;  3NHN A;  5AT1 B;  3UPU A;  2O9V A;  4QQG A;  3QKJ A;  2YRV A;  3EGX B;  2RQR A;  3RUX A;  2P0Q A;  1ABO A;  2LNV A;  1I81 A;  2DAQ A;  2MYS A;  4M78 F;  2WSF E;  1KIK A;  3CCS T;  1UGP B;  2CT3 A;  3CC7 T;  4BI4 A;  4IUV A;  2JMC A;  1N8R R;  1EZZ B;  1X69 A;  1Q7Y R;  3PTA A;  2CP5 A;  1QVP A;  3QUI A;  1N8R U;  1SRL A;  4UC4 A;  1QP3 A;  1Q7Y U;  3KUF A;  3CCE A;  2MK5 A;  3PIP A;  2K79 A;  3OW2 S;  1VQL T;  1K73 R;  1NZ9 A;  4DEX A;  4EIK A;  4OMP A;  1Y7X A;  4A4K A;  2K2M A;  1AOJ A;  1X27 A;  1G5V A;  1K73 U;  3CCL A;  4V2S A;  1YJ9 A;  3ZBD A;  4JJC A;  4RTV A;  1M3A A;  1BI3 A;  3FJP A;  2H3E B;  4M7D B;  1HJD A;  3GPL A;  2EQU A;  1VYU A;  1YI2 Q;  5KYU B;  4JS4 A;  1XOV A;  4LDU A;  1A0N B;  4M77 G;  3UA7 A;  1TU0 B;  2XHC A;  3CCV Q;  4E7K A;  3GNG A;  2QAZ A;  1YWP A;  2DXB A;  1SPK A;  3EHR A;  1M90 C;  2RJD A;  1VQK T;  1NM7 A;  2EGC A;  2EIF A;  4AFU C;  2A3L A;  4A4F A;  4ZN1 A;  3EG2 A;  4M78 C;  4NL2 A;  3OYN A;  1M1K U;  2QK0 A;  4JRK A;  3WVE B;  4XQ3 A;  3MP8 A;  1NYG A;  4XU3 A;  3CCM T;  4PL6 A;  2O88 A;  2RI5 A;  2DTO A;  5GAN d;  5KYY B;  1I5L A;  2LJ3 A;  3CCU A;  3QZ9 B;  3HFO A;  2A36 A;  4Z02 A;  1NBE B;  2DA9 A;  2FPD A;  2KK4 A;  4D6W A;  1VQ7 T;  4R56 A;  1TUD A;  4QVC A;  3CCQ A;  2RNA A;  2EW3 A;  3GOX A;  1LJO A;  4IUT A;  1BI2 A;  2LCC A;  2KR3 A;  5KYX A;  4IIM A;  4HVW A;  2DFU A;  2MCN A;  1IHV A;  3URG A;  2G6F X;  4MZP A;  1K1Z A;  2HQX A;  2QA4 Q;  5GAM j;  2VUB A;  1D1C A;  1VA7 A;  2EYZ A;  3L1A A;  4M78 G;  1PRM C;  2L3Q A;  1RAD B;  2GBQ A;  1NPP A;  3SDZ A;  1EIF A;  1N9S A;  3GLX A;  3V7C A;  2HSP A;  2E5K A;  4XTV A;  3VKI A;  5GMK i;  3TSW A;  3A98 A;  1GXI E;  3CBM A;  1GFD A;  5CKE A;  2KNB B;  3CCS Q;  3CC7 Q;  2K7A A;  1BIA A;  1PRL C;  3CME T;  1GCQ A;  3CEY A;  4E6R A;  1ZBJ A;  4PLL A;  1M8V A;  4C5E A;  3NGP A;  1IGQ A;  2DJZ A;  3EGD A;  2COY A;  4XK8 E;  1Q86 C;  2RHZ A;  1RI9 A;  3OYI A;  4BE2 A;  2H3J A;  3EGU A;  2ZPH B;  4CC4 B;  2YWW A;  2QEX T;  4EMH A;  1QVG P;  1YBY A;  4PJM A;  1G8X A;  4Z8A A;  2FPF A;  1LCK A;  1VQL Q;  1Y96 A;  4GBQ A;  2C0T A;  2LRQ A;  4ZGJ B;  4M77 A;  4DBQ A;  4C92 F;  5D6Y A;  1GCP A;  5LJ5 d;  3MET A;  3H0F A;  2RH2 A;  1W2B P;  3O8V A;  1TG0 A;  4QKU A;  4PJO E;  2D8H A;  4A4H A;  1YIT T;  4JJD A;  3OBY A;  2D0Q B;  5LJ5 g;  2DO3 A;  2EQJ A;  5GMK m;  1VUB A;  1K4U S;  1RAA B;  3EAE A;  4N4I A;  5IH2 A;  3G6E T;  2HQE A;  4BAC A;  4XTZ A;  3PIO A;  1ARK A;  1VQK Q;  1PG5 B;  3OW2 A;  1VQM T;  3VS0 A;  1MMN A;  5FU7 C;  4KBM B;  1LPL A;  3PMI A;  3OBW A;  1QVF P;  4X9C A;  4JJB A;  3CCM Q;  1K9M C;  3VS4 A;  1TSF A;  3CPW S;  2BE7 D;  1J3T A;  5HCK A;  2AT1 B;  4AFZ C;  1M1F A;  5IXF A;  1IO6 A;  2ZAE A;  3LH0 A;  3UWN A;  2MIO A;  1PNJ A;  2QTV A;  4M77 E;  3KFV A;  1VQ7 Q;  3RMS A;  4M7A C;  5IHI A;  2ABL A;  2MWP A;  2E6Z A;  1TUC A;  4OB0 B;  3VS7 A;  4M78 A;  2HEQ A;  4OB3 B;  4J8O A;  2QQA A;  3OS5 A;  3E9G A;  1KFZ A;  3CPW P;  1QCF A;  3A1P A;  1UGR B;  5GAN e;  1B34 B;  3QXE B;  4PFP A;  1QW1 A;  4C92 C;  1NE8 A;  3LYI A;  2NUP B;  3L2V A;  4KH0 B;  3TVT A;  2K5F A;  2QI2 A;  1BIB A;  2RF0 A;  4PLI A;  3JB9 J;  3PGG A;  3G71 T;  4RMO A;  2K4Y A;  4J9D A;  3GP8 A;  3V8L A;  5KYW B;  2JS0 A;  4FL6 A;  1OI1 A;  5GAN 3;  4LN2 A;  3MP1 A;  4R55 A;  4E7S A;  2ENM A;  1RAB B;  3CME Q;  5CQY A;  1YFN A;  2KT8 A;  4XU2 A;  1M5Q 1;  3DB4 A;  4OML A;  3KBG A;  3CMA T;  4M7A G;  3C94 A;  1AVZ C;  3CC2 T;  4OGC A;  1HYO A;  2EQM A;  1OX9 A;  3OYC A;  2QEX Q;  4XTX A;  1VQO T;  1WGS A;  4HXJ A;  1WYX A;  2KSS A;  4C92 G;  3QWX X;  3JCM b;  2GTO A;  2P0P A;  2DLP A;  2EWN A;  3THK A;  4XU0 A;  2OTL T;  4M78 E;  4BI8 B;  4AFS C; 
#chains in the Genus database with same CATH homology
 3HP9 A;  3OYG A;  4JLI A;  3TEE A;  4DOW A;  3C4S A;  1NJI U;  1M9S A;  2GFA A;  2E1H A;  4N0A C;  3EFS A;  3VV0 A;  5HK3 A;  4C8Q D;  4F7U E;  1YI2 T;  3H8Z A;  2DZC A;  3M57 A;  2QEX A;  4HKE A;  2CGH A;  2XD0 A;  3SWN B;  3L2Q A;  4C0F A;  4J7F A;  5GAN f;  5GAN h;  4M75 C;  3V8K A;  4M7D F;  3QSU A;  2KQW A;  2JOY A;  1VQ5 T;  1XNI A;  2MI6 A;  3CC4 T;  1Q82 U;  3F70 A;  4IUR A;  2GCX A;  4HA8 A;  5GAO q;  1KG1 A;  4J6X A;  3CCV T;  4QW2 A;  1WPY A;  2BIV A;  1YHQ T;  1VQN A;  3JSC A;  4X9D A;  2ZCF B;  1VQP A;  4OB2 B;  4M77 F;  4BY6 C;  4IUP A;  3QO3 A;  2CYZ B;  5LJ5 e;  4J7I A;  1M90 U;  2KY9 A;  4MZT A;  4B9W A;  4XTU A;  2XID A;  3JCM V;  2RHU A;  1M4Z A;  3QYG B;  4ZTJ A;  1VQ6 A;  3LGF A;  4J6W A;  4BD3 A;  2PVO B;  4LDW A;  3CCU T;  1W4S A;  1R8O B;  2R57 A;  3JCM d;  4FIB A;  5D6X A;  3JB9 D;  3X25 B;  1DJ7 B;  1YJN A;  2EJF A;  2PUK B;  2V8J A;  4ZGE B;  2X4J A;  2Y4X A;  2DXU A;  2XK0 A;  3BDU A;  4OMF B;  1O75 A;  5GAN 8;  5CCA A;  1V29 B;  1UB4 A;  2FL7 A;  2YLC A;  3L42 A;  4N4G A;  4ME7 A;  4C5H A;  3MHX A;  3NTH A;  3CCQ T;  3CBP A;  3BW1 A;  3G6E A;  1WNL A;  2K2V A;  1BKB A;  1LOJ A;  2LDM A;  2XDP A;  3GIB A;  5LJ3 h;  2JN0 A;  3NTI A;  4J5Y A;  3ZEH A;  2EJG A;  1WQ7 A;  3P8H A;  5DY9 A;  1YIJ T;  2K3Y A;  3DKM A;  2ZPE B;  1PSF A;  1YCY A;  4XU1 A;  2E41 A;  3OYH A;  5FU6 C;  3M55 A;  4C5G A;  1KQS A;  2L8D A;  4FU6 A;  2VGM A;  3HSB A;  2JVV A;  3N5B B;  1OZ3 A;  1B34 A;  3INZ A;  1Q81 U;  4EMK A;  4QQD A;  5GMK j;  5FRO A;  4M75 G;  2PU9 B;  3I55 T;  2PVG B;  4M75 B;  3RIR A;  1VQ9 A;  3C95 A;  3OMC A;  3OMG A;  3OYY A;  2DTH A;  3QJY A;  1PSE A;  1IRE B;  4L5G A;  3OYB A;  1G3W A;  4C5I A;  5A0L A;  2M9U A;  4LDY A;  3RES A;  2FVU A;  5CO7 A;  5D6W A;  3FDR A;  1KQ1 A;  1UEB A;  2MMP A;  2ZGW A;  3DB3 A;  4EMK B;  3BFM A;  2AHJ B;  3V7S A;  3OQ5 A;  4OB1 B;  1VQ7 A;  3PFS A;  4BY6 B;  3TCJ A;  3MEW A;  1ZBX A;  4XTY A;  3OSV A;  4RCB A;  3SD4 A;  5FU7 B;  4BDZ A;  2QA4 T;  5CK9 A;  3JCM J;  4C8Q A;  2K5L A;  1JJ2 S;  3QYH B;  3AHU A;  2RO0 A;  4FT4 A;  2G3R A;  2MF2 A;  4C0Z A;  3SB2 A;  4JS5 A;  3OY9 A;  3UPU A;  2CZ7 B;  4QQG A;  2RM4 A;  4M7D C;  3QKJ A;  2YRV A;  4PJO A;  5DM7 R;  2LQK A;  3JCM Q;  1HXD A;  3RUX A;  2RK1 A;  4M7A A;  1X6O A;  2E64 A;  2P0Q A;  2LNV A;  3OSS C;  3QZ5 B;  1I81 A;  3A5Z B;  2DAQ A;  3LX7 A;  3E9F A;  4M78 F;  2WSF E;  5LJ5 f;  3FC3 A;  1Y07 A;  3HHT B;  3CXC S;  3CCS T;  1UGP B;  3HPW A;  3CC7 T;  2PQW A;  3OYJ A;  4KUD K;  2R58 A;  4BI4 A;  1QVG S;  2ZPB B;  4IUV A;  2JNG A;  5FU6 B;  4M7A B;  4F7U F;  3S3O A;  1I4K 1;  3JAM E;  3M53 A;  4C92 A;  3G71 A;  4JJN K;  3I56 A;  1Q86 U;  3PTA A;  1VQ8 T;  1QVP A;  3QUI A;  3BY7 A;  1N8R U;  2MWO A;  4UC4 A;  2XKO C;  2E10 A;  1U8R A;  2EQK A;  1QP3 A;  3J80 E;  1Q7Y U;  2VYT A;  3CME A;  3KUF A;  3TRE A;  3CCE A;  5I21 A;  4C92 B;  3DLM A;  4BUG A;  5CR2 A;  1W2B S;  1N8R C;  3PIP A;  2E6N A;  2F69 A;  3HL8 A;  2DD4 A;  5KE2 A;  2JUF A;  2P4T A;  5GAN 6;  3OW2 S;  1NZ9 A;  2E70 A;  1VQL T;  2CZ0 B;  3CMA A;  2RHY A;  3H6Z A;  1Y7X A;  4A4K A;  3SFM A;  5J39 A;  1S72 A;  3LWI A;  4LD9 K;  3CC2 A;  1G5V A;  1K73 U;  4GY5 A;  5GAO r;  3FIF A;  1YJ9 A;  3CCL A;  3ZBD A;  4V2S A;  3T9N A;  1I8F A;  3J81 E;  2BUD A;  1BI3 A;  4M7D G;  4RG8 A;  3OA6 A;  3FJP A;  4M7D B;  1NJI C;  4A53 A;  2EQU A;  3GPL A;  4JRP A;  2RD1 A;  4MDW A;  1QP2 A;  4JS4 A;  4ATO A;  4PJO D;  2DTI A;  3C12 A;  5HK0 A;  1VQO A;  4QQ6 A;  4C8Q E;  1XOV A;  4GLK A;  2M1H A;  4MML A;  4LDU A;  3WVD B;  2IVW A;  4M7A D;  3J7A F;  3HRS A;  3JB9 F;  4RKU E;  2RJC A;  1Y96 B;  2CZ6 B;  4M77 G;  2O01 E;  2M0O A;  3FEO A;  4HT8 A;  2M16 A;  4M77 B;  3VUZ A;  4LDV A;  2OTL A;  2XHC A;  2ZZD A;  3CCJ A;  5GAM d;  1ZQ1 A;  2VXF A;  1P92 A;  3VUB A;  1Q82 C;  4II1 A;  4RCC A;  5GMK e;  4E7K A;  1QVF S;  2VGN A;  2Y90 A;  3MEU A;  4M7D D;  3GNG A;  2XDD A;  3M9Q A;  1YJN T;  1YIT A;  4C92 D;  4JRQ A;  1YI2 A;  2RJE A;  2KAF A;  1VIE A;  4ELY C;  2P0K A;  2DXB A;  3L2W A;  4J6Y A;  1LNX A;  4OVA A;  4YTL A;  1WJQ A;  5CIU A;  2RJD A;  4DOV A;  1KHC A;  4EPC A;  3OYK A;  1M90 C;  1VQK T;  3LGL A;  4J83 A;  3M54 A;  4L6V 5;  4N0A A;  2EIF A;  2A3L A;  4A4F A;  4ZN1 A;  4C0D C;  2LT4 A;  1N6A A;  4M78 C;  4NL2 A;  3UDC A;  3OYN A;  5KE3 A;  4EMG A;  2DXC A;  3CCR T;  2YLB A;  1M1K U;  5C0M A;  1BYM A;  4JRK A;  1N27 A;  5LJ3 f;  1YHQ A;  3JCM g;  3WVE B;  1K9M U;  5EG2 A;  4XQ3 A;  1UGS B;  3MP8 A;  3NTK A;  4M75 A;  5A0D A;  2E12 A;  3X20 B;  1WJS A;  2RB6 A;  4XU3 A;  3CCM T;  3A8L B;  5IT9 E;  2DXT A;  3A8H B;  4WF2 A;  5HKC A;  4OGE A;  1VQM A;  4PL6 A;  1D3B B;  3CD6 A;  5C6S A;  3L2U A;  2RI5 A;  3FRN A;  2FYK A;  2DTO A;  3FB9 A;  5GAN d;  1IZ6 A;  1H64 1;  1I5L A;  5CKH A;  2MAM A;  3CCU A;  4M77 D;  4C8Q C;  3QZ9 B;  3HFO A;  4Z02 A;  2KVQ G;  5A0G A;  3JCM e;  3HFN A;  1Q81 C;  2KK4 A;  4D6W A;  2DEQ A;  3A8O B;  4R56 A;  1VQ7 T;  3RMQ A;  2K57 A;  4QVC A;  2K3X A;  4Y28 E;  3CCQ A;  1G3S A;  3GOX A;  2OTJ A;  2PVD B;  1LJO A;  2XU8 A;  3HRU A;  4IUT A;  1BI2 A;  4PKC C;  2L3R A;  2LCC A;  3R6O A;  3JCM X;  1YIJ A;  3RER A;  1OYX A;  2DK3 A;  4A4G A;  4E7I A;  5LL6 S;  2QQB A;  4KUL A;  3URG A;  4BB7 A;  4JLG A;  5LJ5 j;  2EFI A;  3RKW A;  1KQ2 A;  5CAI A;  4MZP A;  2HQX A;  4DA4 A;  4ZN3 A;  5GMK l;  2DD5 A;  2I2L A;  3JCM W;  2DZ9 A;  5GAM j;  2F5K A;  3S6W A;  2VUB A;  2X4Y A;  3X28 B;  2JTM A;  3JCM P;  3ER0 A;  2EJ9 A;  3L1A A;  5I2M A;  2DIG A;  2EYQ A;  2GF7 A;  2QTX A;  4M78 G;  2DIQ A;  3MP6 A;  4M78 B;  1U1T A;  3DLL A;  2QQR A;  5GMK h;  5AYF A;  4KUI A;  1KC8 U;  1NPP A;  3SDZ A;  1EIF A;  1N9S A;  3GLX A;  3ZFJ A;  5FRM A;  3V7C A;  2HNI A;  2A7Y A;  1Y71 A;  3QII A;  4F7U G;  4M75 D;  4XTV A;  3VKI A;  2RK2 A;  2IG0 A;  4F7U B;  5GMK i;  3OYA A;  1GXI E;  3CBM A;  3I56 T;  5CKE A;  4VUB A;  2QA4 A;  2X35 A;  1O9S A;  4TVR A;  3SWN C;  3ASK A;  5CKB A;  2XDB A;  1BIA A;  2JZ2 A;  3HKS A;  2EAY A;  3V7R A;  1JBM A;  3OYL A;  4QVZ A;  3G4S A;  1KD1 U;  3CME T;  1N9R A;  2QQS A;  2QXF A;  4HT9 A;  3TU4 K;  3CEY A;  1U1S A;  2R5A A;  1VQ4 T;  4PLL A;  4C8Q F;  3QBY A;  1M8V A;  4C5E A;  1OZ2 A;  3QDR B;  2DJZ A;  4ZTF A;  4E47 A;  1YJW A;  1Q86 C;  3QHS A;  4XK8 E;  5GAN j;  2RHZ A;  3RKY A;  3OYI A;  4BE2 A;  4PJO F;  2H3J A;  4C0G A;  1K8A U;  4XAX B;  1Q7Y C;  2ZPH B;  1S72 T;  3CC7 A;  3V8J A;  5CVI A;  4M7D A;  3CCL T;  2QEX T;  1WJR A;  4EMH A;  2FB7 A;  1YBY A;  2CZ1 B;  2K5I A;  3RKX A;  1JJ2 A;  4FSX A;  4LDX A;  2X4W A;  4HCZ A;  1RL2 A;  4JUV A;  3VU3 C;  4NOY A;  3LLR A;  4M78 D;  4BE0 A;  1Y96 A;  3JCM h;  3JCM f;  2JTF A;  2LT1 A;  2LRQ A;  2WSE E;  4M77 A;  4ZGJ B;  5KCH A;  4MZM A;  3JRZ A;  2WSC E;  4C92 F;  1K73 C;  1VQN T;  5D6Y A;  2GQV A;  5IN1 A;  3JB9 G;  1XTD A;  1G3T A;  5FRN A;  5LJ5 d;  1VQP T;  3CCJ T;  1FXX A;  1UGQ B;  3CXC A;  3MET A;  2BKD N;  4NS5 A;  1G3Y A;  2RH2 A;  3VJP A;  5J26 A;  1QVG A;  3O8V A;  1MGQ A;  4JDS A;  2ZPF B;  3NFC A;  4E7H A;  4PJO E;  3E19 A;  4A4H A;  3PNW C;  1VQL A;  3BDL A;  3P8B B;  1YIT T;  4O6J A;  3OYD A;  4HCB A;  1VQ6 T;  4M7A E;  1KQS S;  4HCC A;  2KDS A;  3OBY A;  2D0Q B;  1H3Z A;  3QG1 A;  4KT0 E;  5LJ5 g;  2DO3 A;  4N4H A;  4JRI A;  5CKF A;  2B8A A;  2EQJ A;  5LJ3 j;  1JB0 E;  5GMK m;  2GFU A;  1VUB A;  2RA2 A;  3X26 B;  1NPR A;  2NLU A;  4CI0 C;  1RI0 A;  4OF1 A;  3VYH B;  4FM4 B;  5IAY A;  3EAE A;  5GAM g;  4N4I A;  2QDY B;  3G6E T;  1KHI A;  2HQE A;  5DLQ E;  4BAC A;  2DKG A;  3VYG A;  4EMK C;  4XTZ A;  5CKD A;  2L5Q A;  2XG8 D;  1VQ5 A;  3CC4 A;  5GAO l;  4EDU A;  1D3B A;  4C92 E;  3OYF A;  1W2B A;  1WQW A;  1X01 A;  3PIO A;  3CCV A;  2C06 A;  3KXT A;  4CRI A;  2DVE A;  3JCM c;  2QQ9 A;  3OW2 A;  2HD0 A;  2LQ8 A;  1VQM T;  3CD6 T;  2O4X A;  5FU7 C;  5A2Q E;  2RHI A;  5GAN 5;  4KBM B;  3PMI A;  2L89 A;  3OBW A;  3Q1J A;  3M4Y A;  1TH7 A;  1BI0 A;  5GAM e;  2FHD A;  1M1G A;  1M1K C;  4X9C A;  4ELZ C;  5GAN 4;  2D6F A;  2VV5 A;  4E7L A;  1VQ9 T;  1K9M C;  5GAO p;  2O4X B;  3CPW S;  3CBO A;  1SSF A;  4M7D E;  3G7Z A;  4A54 A;  2RI2 A;  1BI1 A;  2E5Q A;  4QVD A;  1M1F A;  5M9O A;  1VQK A;  2WAC A;  2CKK A;  3LH0 A;  2OTJ T;  4PNO A;  3UWN A;  3MEA A;  3WXM B;  3GNF B;  3QPH A;  5GAN g;  4E7J A;  4MMK A;  2CS7 A;  4XTW A;  2ZPG B;  3CCR A;  4PJO C;  3OYM A;  4M77 E;  4NL3 A;  1QVF A;  4M7A C;  3RMS A;  3P8D A;  3QJ6 A;  2LVM A;  3CPF A;  4MDX A;  1HK9 A;  3CCM A;  2MWP A;  2E6Z A;  4OB0 B;  5FLX E;  3M5A A;  4DQ2 A;  3EFR A;  5CQX A;  4M78 A;  3PMT A;  5GAO n;  4OB3 B;  4M75 F;  2HBP A;  3L2Z A;  2QQA A;  4J8O A;  3OS5 A;  3E9G A;  3M58 A;  1UGR B;  3I55 A;  5GAN e;  1B34 B;  3QXE B;  4C92 C;  1QW1 A;  1XQH A;  2EKO A;  1NE8 A;  3LYI A;  4F7U A;  3S3N A;  1JRI A;  5L8R E;  4C0D B;  3LWH A;  3L2V A;  1ZHI A;  1FWZ A;  2LC4 A;  5LJ3 d;  4BE1 A;  2PUO B;  3M56 A;  2RJF A;  5HY6 A;  2K5F A;  2QI2 A;  5GAN 2;  4L59 A;  3LW5 E;  1BIB A;  3OYE A;  4PLI A;  4A4E A;  3PGG A;  4ZGD B;  3G71 T;  3JB9 J;  4BDY A;  2HAX A;  4B9X A;  3X24 B;  3G4S T;  1X75 C;  4RMO A;  1KC8 C;  4BI3 A;  2YHT A;  2K4Y A;  2D9T A;  5LJ3 g;  3CPW A;  3PT9 A;  3A8G B;  4PJO B;  1FX7 A;  3GP8 A;  3V8L A;  2XIC A;  4LD6 A;  3CCE T;  4C8Q G;  4FL6 A;  4M75 E;  3M59 A;  1OI1 A;  4Q5W A;  2Y4Y A;  4RG2 A;  3ME9 A;  4C8Q B;  5GAN 3;  3JB9 I;  2LCL A;  1YJW T;  3MP1 A;  2RI3 A;  2VXE A;  5KCO A;  5I2S A;  5GAO m;  4R55 A;  3OS0 A;  4IKF A;  5GAN 7;  5LJ5 h;  2V8K A;  2XI9 A;  4IUU A;  5CQY A;  1KD1 C;  4M77 C;  3OS1 A;  4XU2 A;  4PJO G;  1M5Q 1;  3OS2 A;  2F5T X;  3E1S A;  2R5M A;  3DB4 A;  3KBG A;  2OAU A;  4IUQ A;  3CMA T;  3JB9 H;  3C94 A;  1AHJ B;  4M7A G;  2KMT A;  5GAM f;  2X4X A;  5LJ3 e;  5GAM h;  3CCS A;  5DLO A;  3CC2 T;  4M7A F;  4OGC A;  4X34 A;  4Y91 A;  3M4G A;  1YJ9 T;  1VIF A;  3L2R A;  3OB9 A;  2ZPI B;  2EQM A;  4FT2 A;  3A8M B;  2V8I A;  1K8A C;  3OYC A;  2LTO A;  4XTX A;  1VQO T;  1WGS A;  2RHX A;  3HRT A;  3FLG A;  2KSS A;  4P5N A;  1VQ8 A;  4C92 G;  3S3M A;  3UT1 A;  5J3B A;  2E65 A;  4OP0 A;  3JCM b;  1VQ4 A;  3MCA B;  2P0P A;  2VC8 A;  2EWN A;  2LX9 A;  3MO8 A;  4O5V A;  1MHN A;  3GF5 A;  2OTL T;  4XU0 A;  3MEV A;  4M78 E;  5KH6 A;  3SWN A;  2DPP B;  4BI8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...