4VUBA

Ccdb, a topoisomerase poison from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
b'MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCDB
molecule tags Plasmid
source organism Escherichia coli
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4vubA00
4MDXA 3TCJA 3JSCA 5HKCA 4ELZC 5CKBA 5CQYA 1M1FA 2C06A 1X75C 5HK3A 5CKFA 2VUBA 2MF2A 3JRZA 4MZTA 2KMTA 5CKEA 4HKEA 5CCAA 4MZPA 4VUBA 4OF1A 5CR2A 3VUBA 1UB4A 4ME7A 5HK0A 5CKDA 3G7ZA 4ELYC 5CO7A 1NE8A 5CKHA 5DLOA 5CQXA 3NFCA 5CK9A 4MZMA 3HPWA 1VUBA
chains in the Genus database with same CATH superfamily
2L3RA 4AG1C 3P8HA 4OMQA 5HKCA 5GANd 1PCXA 3PGGA 3M54A 2L3SA 4LN2A 2KSSA 3X24B 2D0NA 4X1VA 5GANf 4RTWA 5CR2A 2DD4A 2KRSA 1SHFA 3OYEA 4DBRA 4J9GA 1KJWA 1OOTA 3V7RA 2BZXA 3LWHA 3X28B 5GAMe 1RLPC 2X3WD 2RQVA 1NYGA 1IHVA 4LDVA 4JRKA 3I5SA 3R6NA 3M55A 4HVUA 3OSSC 4Z8AA 4HT8A 2A36A 1D1CA 1QCOA 3PTAA 4MMLA 2V8KA 2GGRA 4IUUA 1BI1A 3OA6A 2HL3A 1G3SA 3J80E 2R57A 2FG0A 4J9DA 1M30A 4ANJA 2QA4A 3V7SA 2KT1A 4R56A 4PL6A 3LH5A 2VB6A 1RI0A 2QQBA 1MGQA 2E3HA 2HSEB 2DERA 1JO8A 1AWWA 1JQQA 3QJYA 4C8QG 5GAMd 3M57A 4MZMA 3UA6A 2OJ2A 2DK3A 5D7UA 2B8AA 1VQ7T 1RI9A 1R8OB 2COWA 2RJCA 2ZAEA 2QAZA 1VQPT 2I0NA 5L8RE 1M90U 1PRMC 1VQLA 1RAEB 2XG8D 3SD4A 4DQ2A 3JCMW 4HXJA 3RMQA 4OF1A 3VKIA 3L2VA 2XD0A 1DJ7B 1UGVA 4F16A 4C92A 1AWOA 2FRWA 2HD0A 1K9MU 1PWTA 3PIOA 1YI2A 1I8FA 2DTHA 3CCJQ 3ER0A 4BUGA 1NYFA 2CH4A 3JSCA 2LX7A 2ROTA 3VYHB 5LJ5f 3GNFB 2DXTA 2VUBA 2E41A 4JPBW 3IQLA 4JLGA 1BBZA 2K6DA 4X9DA 4C8QF 5GAN2 2M0OA 2NUTA 1LJOA 4Y91A 3VRZA 3SB2A 4F17A 4PJOC 1WPYA 1BI0A 2HNIA 1MMDA 4P5NA 4HCBA 1WJQA 2L3PA 2KYMA 3C0CA 4NL2A 4IUQA 5KYXA 1UJYA 4C92B 1SSHA 1YJ9Q 2P4TA 3FDRA 2WSCE 2V8JA 2DVJA 2DIGA 3JCMV 4PJNA 3I56T 1VQ6T 2FO0A 4XTZA 1KD1C 3UWNA 1QVGA 2FEIA 2K7AA 3NPFA 2V8IA 2P0PA 2RI2A 1R0CB 2HQXA 1Y0MA 3OYLA 2DBMA 1W70A 4E7SA 1RACB 1X2KA 2RK1A 2FZCB 2JVVA 2JW4A 4C92G 3M0QA 1Q81C 1OPKA 1YITT 2OI3A 1WA7A 1KG1A 1IREB 2NUPB 4FT2A 4A54A 3L2RA 4BB7A 5D6WA 3E9GA 2LNHB 4BY6C 2X4WA 3JAME 2ECZA 1ABOA 1B07A 1RABB 2ZPEB 1FXXA 4J9FA 1JBMA 1OI1A 4M77B 1VQKQ 1VQ5Q 2K57A 1VQ8T 4F04B 1U1SA 1T3LA 2GFAA 4Y92A 3OB9A 3M0RA 1IGUA 1ZQ1A 4ZGDB 4XTYA 2F2WA 4M77G 5FU6C 1N27A 2R5AA 3QO3A 3OYCA 2JT4A 5CKHA 1Y96B 2QASA 2Y4XA 1WXBA 3M0UA 4O6JA 5IHIA 4RMOA 1YHQT 2RMOA 2PVDB 2RK2A 4E7JA 1T0JA 1X01A 3GNGA 3M0PA 4C5GA 1H8KA 4WTOB 2FVUA 3A1PA 4J7FA 1IRXA 1D0YA 3H41A 4K11A 4RG2A 2XKOC 4M7AF 1VQ7Q 3MPUB 5KYUA 4C5IA 2FZGB 4XU2A 2E4HA 3CBOA 4LDWA 4JS4A 3H0FA 2ZPIB 1JRIA 4OMLA 2ZPFB 2YLCA 1KIKA 3EG9A 2K3BA 4LXCA 2KK4A 2MCNA 3UATA 2X3XD 1T0HA 4M77F 9ATCB 2EGAA 2K2VA 2LDMA 3OYJA 2KRNA 1OQKA 2RI5A 4XTVA 4M77D 2QDLA 3RMSA 1O9SA 4PFPA 1CKBA 3OBWA 2RH2A 2K3XA 3EGUA 1F1BB 2DO3A 3L42A 2AKKA 2ABLA 4J9EA 5FU7B 3FRNA 4M78G 1RL2A 1JXMA 4EIKA 4II1A 2EQMA 2JTEA 4V2SA 2ZCFB 5LJ3f 3G4ST 3G71A 3CCRA 3ZBDA 1SKUB 2E65A 2PQWA 4M7DC 1NLOC 3GOXA 4RUGA 1IGQA 1MHNA 3OS5A 1JJ2A 2LVMA 2K9GA 1AWJA 2M16A 2E3IA 3CCUQ 2LCCA 4XTWA 2ZPBB 2GCXA 2RF0A 3V8KA 1Z9ZA 3C95A 3AT1B 2YRVA 5FRMA 3HFNA 2EFIA 2QG9B 2RHZA 1K9AA 1OX9A 2Y4YA 1K1ZA 3BE3A 1U5SA 3OW2P 3CCSA 2EJGA 4QT7A 5LJ3g 1AZGB 3HL8A 1VQ9A 4RTUA 2F2XA 3EH2A 1Q86R 2YUPA 1GFDA 2YXYA 1FYNA 3CCET 4E7HA 4NL3A 2MYSA 3V8JA 4E6RA 4LD9K 2KNBB 3NTHA 3A5ZB 3MP1A 4ORZA 4J9HA 1XNIA 2EAYA 2JOYA 2EYZA 3CXCS 5GAOr 2A08A 3CCQQ 4L5GA 2MMPA 1BB9A 4OGCA 5HK3A 2CZ0B 2EQJA 2D8JA 4KH0B 3OBYA 2A3LA 4NS5A 3HRSA 4FT4A 3A8LB 5C6SA 1Q7YC 1K8AU 1K8AR 2FL7A 2F2VA 2LC4A 1KD1U 1UTIA 1I5LA 1KFZA 1OX8A 2HCKA 4J6WA 4KGXB 2KDSA 4N4IA 4KBMB 2PZ1A 4QQGA 3CC7T 3OYGA 4LD6A 1SRLA 4J8OA 3CD6Q 3EFOA 2FPEA 4J9IA 3CC4T 1EFNA 1WNLA 4XU3A 1S1NA 3EG0A 2DL8A 2CUBA 2DPPB 4PFZA 3URGA 2X4JA 5GAOn 1Q82U 4N0AA 5ECAA 1G3TA 1E7OA 3GPLA 1KQSA 3VS5A 3VYGA 1M9SA 5GAOq 1OZ2A 4C0ZA 3QG1A 3RERA 1PRLC 5GAN6 1GCQA 2KYBA 1K73R 3BDLA 2YDLA 3FB9A 3PE0A 1G2BA 2DIQA 4HKEA 2K5FA 4FYVB 2KVQG 4Z89A 3NTKA 4JZ3A 1XTDA 3PMIA 2HQEA 4B9XA 2BUDA 5GANh 4LDXA 5CQXA 2EYXA 4DEYA 1Y07A 3QIIA 3HPWA 4N0AC 4BI4A 2YUQA 4MDXA 3UDCA 5GAOm 1M1KU 1M8MA 2DVEA 2DETA 1VQMQ 1Z9QA 4KGVB 4HA8A 2QXFA 3JB9J 5GAMh 2BIVA 2EQUA 2P0KA 3REAB 1M3AA 2DZ9A 3EFSA 2EYQA 5CCAA 5IHNA 2OTLT 3RKWA 2LT1A 4ZN3A 2DF6A 3HTRA 1QVPA 3CCJT 3OS1A 5FRNA 2K4YA 2IG0A 2YT6A 3UT1A 3LH0A 1WZOA 1TUGB 2Y90A 3J81E 3JB9H 2X51A 1GXIE 3NHNA 2YSQA 1AOJA 2EGEA 3QXEB 1GCQC 3TREA 1SRMA 3O8VA 4BD3A 4R55A 3CCUA 1NJIU 2LZ6B 5LJ5e 4EMHA 4MMKA 5IN1A 3SEMA 4L6V5 2H3EB 5GAN3 1FWZA 5DM7R 3BW1A 2E10A 1PHTA 1ZX6A 2IVWA 5GAOp 1M4ZA 1RLQC 2KR3A 2O01E 3E9FA 4OB2B 3EGXB 3JB9D 3MEWA 4JRIA 3UA7A 1WFWA 2ED1A 3OSVA 4QW2A 1QW1A 2MK5A 1MUZA 5D6YA 2QDYB 4PLIA 1FX7A 4XU1A 4DA4A 3DKMA 4GBQA 1YJNT 4GLMA 1FMVA 1UGSB 4C92F 4FU6A 2DRKA 3OQ5A 5A0LA 1M90R 5CAIA 4ZTJA 2VGMA 1FMKA 1FMWA 5GAN7 2J06A 1Q81U 2JM8A 3FLGA 4OMFB 4MZPA 2XDBA 2V1RA 3EHRA 4JLIA 1N8RR 3RDVA 4TVRA 3HP9A 4F7UA 5A0DA 1B7TA 3MEVA 2NUTB 2R5MA 1BIAA 3INZA 2X35A 5LJ3e 2EYWA 3H0IA 3JB9G 4UC4A 1VQNQ 1S72A 2COZA 3PFSA 1PKSA 3HRUA 4MZTA 5IT9E 4ZGJB 3E1SA 1WHJA 3VUBA 2P4RA 5DY9A 1K76A 5I2MA 1QVFP 2LP5A 4DEXA 5IXFA 4D8KA 1W2BA 3M0TA 4CC3A 4BE2A 3HHTB 1OU9A 3E19A 2WSFE 2DM1A 3F70A 2RQUA 3ZEHA 3CMEA 3C12A 1X43A 2J6OA 4PJOG 3BDUA 3CCQA 1M3BA 1B34B 2LQ8A 1UECA 2RJFA 3JV3A 2QA4Q 1G3YA 1Y96A 2DYIA 4FSSA 1WXUA 2CSIA 3EH1A 3RBBB 1KHCA 2KT8A 1TS9A 2BE9B 3CCVA 1Q81R 3T9NA 2OTLQ 3NFCA 3JB9F 4ATOA 1I81A 1GRIA 2COYA 2LMJA 3M53A 5KCOA 1VQ5T 1Q86C 2WACA 5GAN4 4F14A 4QKUA 3QYHB 1H92A 3D7SB 1HYOA 3JCMb 2DXBA 3JCMf 4FYXB 2LRQA 2W10A 4BACA 1YHQA 2DFUA 4PJOF 3EGDB 2EQKA 2O88A 1MV0B 1X75C 1BI2A 4OB1B 2JM9A 2IIMA 3CPWA 1I0CA 2DMOA 1ZA1B 1JEGA 1TUCA 1VQ4T 3CC2T 2MWOA 1OEBA 1YFNA 3MKDA 1HSQA 2QI2A 4PJOA 2ZPHB 1D0XA 5KE2A 1I1JA 1J3TA 2XHCA 3SDZA 3TU4K 3OYNA 4EMKA 1VQOT 2HQHA 3I9QA 4E47A 1R0BG 1HJDA 2NLUA 2DILA 1UGPB 2V1QA 1K0SA 2LCSA 2XMFA 1LVKA 1KK7A 3GIBA 1M2OA 4OMOA 4HCCA 1X6BA 1EZZB 1I5OB 4X34A 4HVWA 4AFSC 2MPXC 4NOYA 2PUKB 5KCHA 2H3JA 2M51A 5IHKA 4M75D 3NMZC 4LDYA 4AT1B 3CCEQ 1QVFS 5FW9A 2RJEA 3CMAA 1M90C 1W4SA 2YRCA 3L2WA 5KYWA 2PTKA 3I55T 4QQ6A 1YWPA 1VQPQ 4FW2A 3VJPA 1SSFA 2OTJT 1UEBA 1YI2Q 1PSEA 4AFQC 2X4XA 1ZBJA 3QKJA 4M78E 2M0YA 3UF4A 2GTOA 2JN0A 2WSEE 3RESA 5GANj 4QVDA 4OVAA 3CC7Q 3OMGA 2MWPA 1VQNA 3S6WA 4E2FB 3SWNB 4KRTA 8AT1B 1Q82R 3EG3A 3MEAA 3HSBA 2KEAA 1AVZC 3OMCA 2KY9A 2KQWA 5HK0A 2FRYA 4QVCA 3CMEQ 4MDWA 5DLOA 1KQSS 2K5IA 1BKBA 1CKAA 1MNEA 2M1HA 4JRPA 2RHUA 3JCMd 1G3WA 2DYBA 1RAAB 2K79A 1TU0B 2L3QA 4OMPA 5FROA 5KYWB 1AZEA 4M78C 3P8BB 3QDFA 4Q5WA 1AWXA 1QCNA 2ATCB 1V29B 2E6ZA 5KYUB 2D6FA 2EW3A 2VWFA 3I35A 1UDLA 2CYZB 4M7DB 1HD3A 3G7ZA 2CP5A 2E5KA 2DL4A 2JMAA 4LDUA 5FLXE 5LJ5d 3OY9A 4C5EA 3KFVA 4D6WA 2O9SA 4XQ3A 3A98A 3H9NA 1VQPA 1D3BA 2RQWA 1VA7A 1PD1A 2NWMA 2LQNA 3LX7A 2ZPGB 3M56A 4B9WA 3KUFA 4J6YA 5FWCA 2PUOB 3FIFA 1N8RC 1UB4A 4A4KA 1KSWA 4PJMA 1PC0A 3MHXA 1Q7YU 1K8AC 4EPCA 4F7UB 5GAMf 1BU1A 4M7AE 4CRIA 2EIFA 2XI9A 1IHWA 2VXFA 4J7IA 4J9CA 2CH4W 2DX1A 4M4ZA 2NYSA 5GANe 4M77E 2IPOB 2GTJA 4IUVA 4M7AC 2HAXA 4M78A 1X27A 4JDSA 4CC4B 2QEXA 1U1TA 1UGRB 1R77A 2JUFA 5J26A 3CQTA 4YTLA 1CSKA 2M9UA 3C94A 3LGLA 1UFFA 2FHDA 1K9MR 2J6FA 4RTZA 5EG2A 4M77C 2DTIA 1ZSZB 1NEGA 3M9QA 1VQ8A 1X69A 3P8DA 2K2MA 1QVGS 3QWXX 4C0GA 5EC7A 2GFUA 4OMMA 5IH2A 1EIFA 1YIJA 2CUDA 2CP0A 3TQ7P 1RAIB 1VQ8Q 5CIUA 2YLBA 1WXTA 1D0ZA 4C0DB 3OYIA 2AZSA 6AT1B 1PNJA 3VS2A 1KC8U 2DEQA 2DXUA 2BZ8A 5GANg 1TOVA 2BZYA 1N9RA 2XICA 2CP2A 5KYNA 5KYYB 2O9VA 3MJXA 2MI6A 3VS3A 4PKCC 2KGTA 5CO7A 1NE8A 1YIJT 4F7UF 1WHGA 3EG9B 1YITQ 1I07A 5AYFA 2AKLA 5GJWB 3VRYA 2C0IA 1ZUKA 2C06A 3ZFJA 2OTJQ 1AEYA 2E12A 4PFOA 2JTFA 4ESRA 2CREA 2D0QB 2XDPA 5CKEA 4E7ZA 3QSUA 2RQRA 4M78B 1D09B 1VQ4A 2NUZA 1YJWQ 1YHQQ 4KH1B 4IKFA 3G6EQ 4J9BA 3L2QA 3EGXA 2XU8A 2CZ7B 1YJ9T 4BDYA 2RI3A 3N5BB 1WIEA 4OGEA 1ZUYA 1M3CA 2BTTA 1Y7XA 2F5KA 1GFCA 4GLKA 3CPWP 3LWIA 1QP3A 4OMNA 4FL6A 3DLLA 2ZGWA 3CCLA 1Y71A 1Q95G 2GBQA 4M77A 3GF5A 4HT9A 2L8DA 4AG2C 3RKYA 1NLPC 2K5LA 3OYHA 2JS0A 1TWBA 3VS0A 4LE9A 1MNDA 3EG1A 4FM4B 2NUPA 3C4SA 2BKDN 3G6ET 1UE9A 2O4XB 1JJ2P 4X9CA 3DB3A 1YJWT 4JRQA 3LLRA 3DB4A 2RQTA 2OX7A 1UJ0A 2SRCA 4IUTA 5C0MA 5LJ5h 2DJQA 1M1KC 3GBQA 1KQ1A 4DOWA 3EFRA 4BI3A 1A0NB 1ZSGA 1QVGP 1OYXA 1RAGB 2ROLA 4FW1A 1VQ5A 2EWNA 1WQ7A 4PNOA 1VQ6Q 3CXCP 2DL3A 1NZ9A 1GBRA 5LJ3h 2QGFB 2AZVA 3QBYA 1N5ZA 2EBPA 1JXOA 1WGSA 3CD6T 2JS2A 1T3SA 3EFOB 2RJDA 1OPLA 3RIRA 5KYXB 1W2BP 2GQIA 2JTMA 4KUIA 2CP3A 1VQ7A 2PVGB 4ZTFA 3QUIA 3JCMJ 1TTHB 1X6GA 1H3ZA 2LQKA 2RA2A 2MF2A 3PNWC 5GMKh 3CCEA 4F7UE 2QEXQ 2OAUA 5CKDA 1MV3A 1VOMA 3TCJA 1YJ9A 3TVTA 1YP5A 1EX4A 3CC4A 2RO0A 4M75G 2EYYA 3G1JA 4PJOB 1TXQA 1VQKA 1VQ9Q 1P92A 3V8LA 1XOVA 1OULA 2Z0WA 3CMAQ 2I2LA 3OYFA 1QKXA 1WJRA 2KXCA 1MMAA 1YNZA 2VASA 1X6OA 1ZSZC 3ASKA 4ZGEB 3VUZA 3CCMQ 3HFOA 1YIJQ 5CQYA 5GMKj 4EMKC 1VQNT 2C0OA 1M5Q1 1KD1R 1VQOA 3CPFA 4DBHA 3KBGA 4XK8E 5KE3A 3G4SA 3G71T 4N4HA 3CCRT 4FCYA 2KI7A 3JCMc 5GMKm 4AMCA 5D6XA 3CCSQ 3MCAB 4PJLA 1K4US 3KXTA 3JCMQ 1M1FA 4IIMA 8ATCB 3OYDA 1RUWA 3R6OA 2D9TA 1VYUA 4BI8B 1IXDA 3M58A 1BCMA 4M75C 3H6ZA 4R0KA 5L23A 1G83A 2YRDA 3OYBA 4CC7A 5GAN5 2RNAA 1U8RA 1K9MC 3VS4A 5HCKA 1SHGA 1PKTA 1NBEB 1M2VB 3CBMA 2DE0X 1K73C 4PJOE 2RPNA 3MP8A 4AFUC 4AFZC 1YJNA 4M75A 2DNUA 4XTXA 1VIEA 3CCST 1KHIA 3QDRB 1AD5A 2JJ9A 1NJIC 1WDXA 4KULA 1M1KR 5KH6A 4M75E 4Y28E 3M59A 1NPPA 3J7AF 1E6GA 3CCMT 4WF2A 3OYAA 5LJ5j 1H641 3WVEB 1YBYA 1YI2T 1B34A 1LOJA 3CMAT 4J83A 1QVFA 1BK2A 4FYWB 2HMAA 3M5AA 1SPKA 1Q7YR 2OTJA 1O75A 5GMKi 1VIFA 2O2OA 1NG2A 2C0TA 3OS0A 2DJZA 1JU5C 2M02A 2A28A 4GY5A 1UHCA 2FZKB 3LW5E 3MO8A 2VGNA 4RTXA 2QK0A 2VXEA 4JJCA 4O5VA 3X25B 5FWBA 3CMET 1AT1B 2GF7A 2DEUA 3SWNC 3S3OA 3VV0A 4JS5A 1VQKT 2L5QA 4BE0A 3MEUA 4VUBA 2KBTA 2QQAA 2ZZDA 5AT1B 1QWEA 2R58A 1RAHB 4HCZA 3VS7A 2DLPA 4J6XA 4A53A 1VQOQ 1KC8C 4KT0E 4M7DG 4XTUA 4M75B 3OW2A 3ME9A 3S3NA 3PVQA 1GCPA 1M2VA 3L1AA 3H8ZA 2EGCA 3E2UA 3PIPA 1C1AA 2RD1A 1U3OA 2HKNA 3SHWA 3CC2A 1M1GA 1TSFA 1VYTA 4A4HA 2LT4A 2CKKA 1TH7A 4IUPA 4DBQA 2XDDA 3LGFA 5I2SA 4CI0C 5I22A 3NGPA 1ZA2B 2RM4A 1WI7A 4JJBA 2YUNA 3M4GA 3S3MA 3CC4Q 2X9HA 4IIOA 2HL5C 4E7KA 3CCMA 1B3QA 5GAOl 2JXBA 4QQDA 5CVIA 2EPDA 5A2QE 3OYMA 4F7UG 3QWYA 1G5VA 1IB8A 3CXCA 2AIRB 1WHKA 2QTVA 2RHXA 1OV3A 1M8VA 2MOXA 1HK9A 2QQRA 2PVOB 4DOVA 3META 5A0GA 1MMGA 3DLMA 1SG5A 4RCCA 3I56A 4JUVA 3Q1JA 2EJ9A 3X26B 1QMCA 2E64A 2CZ6B 2DRMA 2O31A 2RHIA 2G3RA 1D1BA 2K3YA 3THKA 1UHFA 1VQMA 3CC2Q 4M7DA 2VKNA 3JRZA 1V76A 5LJ3j 2QQ9A 1N8RU 2KAFA 1TUDA 1ZUUA 2D8HA 4N4GA 4OB0B 4Z02A 2OTLA 1VQLT 4C92C 4OP0A 2JZ2A 2EVRA 2RHYA 4RKUE 2LJ0A 2YHTA 5HY6A 3CCJA 4FYYB 2MIOA 2X4YA 3OYYA 5GJVB 2L89A 3BY7A 4ZNXA 3JCMP 4LUDA 1ZHIA 4M78D 4M7DF 4C5HA 1QLYA 2CT3A 4PLLA 3CCLT 5I11A 1VQ6A 4C8QA 2JMCA 2L0AA 3U23A 2YUOA 3CBPA 1V1CA 1ABQA 2A37A 4XAXB 3JB9I 1JJ2S 2W0ZA 3RR6A 4LNPA 2LNVA 3QHSA 1RAFB 4M7AB 4EMGA 3RNJA 2GQVA 2QA4T 2J05A 3QYGB 2J7IA 2VYTA 3REBB 5M9OA 4M7AG 3G4SQ 3FJPA 2AT1B 1SEMA 1YJNQ 1BCOA 1LCKA 3I5RA 3CCVQ 2CS7A 4A4EA 2L2PA 3QZ9B 2A0FB 1IZ6A 1PG5B 3AHUA 2A7YA 1S72T 2AK5A 2HEQA 1GBQA 4M7DE 3EHQA 2DXCA 3SWNA 4JJDA 3M4YA 2CDTA 5LJ3d 2KXDA 4C0DC 3CCLQ 5LL6S 4BY6B 3TSWA 2H8HA 3MP6A 1KQ2A 3JCMX 5I21A 2ENMA 5DLQE 2XIDA 1WLPB 5CKFA 2LJ3A 1WJSA 1VYVA 2DZCA 3PVLA 2P0QA 4EMKB 1S72Q 2PU9B 3VU3C 3G6EA 3NTIA 4RTYA 4HCKA 1QKWA 4M7AD 2LJ1A 1E6HA 1PM3A 4RCBA 3CCVT 4OB3B 4KGZB 1ACMB 1VQ9T 5J3BA 4E7IA 2E1HA 4ZN1A 2EKHA 3L2UA 1MMNA 1LPLA 2DBKA 4RTVA 4IURA 3BFMA 5FU7C 3LYIA 4KUDK 3QPHA 4A63B 2AHJB 3CEYA 5GMKl 4M7AA 3EGDA 3EG2A 3V7CA 4EDUA 2QEXT 1VUBA 4RTTA 3FEOA 2BE7D 1G8XA 1NM7A 2CGHA 4XU0A 3OW2S 3SFMA 5KYYA 1VQMT 2F69A 3M0SA 4HVVA 1Q82C 1UGQB 2GNCA 2KE9A 4PJJA 2LCLA 1SF9A 3JCMh 3WVDB 1W1FA 4ME7A 1XQHA 2QQSA 1RADB 2V26A 1H3HA 5FU6B 1U06A 1N9SA 1N6AA 4BDZA 2FPDA 3A8MB 2CP6A 1QCFA 2DA9A 1WHHA 2EJFA 2LQWA 2OAWA 4L59A 1VQLQ 2E70A 2G6FX 3I55Q 4C0FA 3A8OB 1OZ3A 1W6XA 3X20B 3H0HA 1WHMA 4LUEA 7AT1B 5LJ5g 4C8QE 1WQWA 1NEBA 3EAEA 3I56Q 2O4XA 1K0XA 4PJOD 1YN8A 2ED0A 3UPUA 3HRTA 1M27C 2D1XA 1AHJB 3O5ZA 2XK0A 4C8QB 2RN8A 2E6NA 2HZYA 3WXMB 2HSPA 3JCMg 4FSXA 4Z88A 1Q86U 1C0MA 4C8QD 1ZBXA 3FC3A 3VS1A 5J39A 3ULRB 3ZL7C 2CSQA 5GAN8 4WCIA 4ELZC 4QVZA 1JB0E 1Y57A 3CCQT 2DD5A 4JZ4A 1OU8A 1BYMA 3HKSA 2F1LA 3I55A 1QP2A 1ARKA 5GMKe 1PSFA 2CZ1B 1D3BB 1BIBA 1YWOA 1YCSB 2DAQA 4A4FA 2VC8A 3QZ5B 2KROA 2DTOA 3A8HB 2FB7A 4A4GA 2CP7A 4C92E 1VQ4Q 4E7LA 4M78F 4M7DD 2YWWA 1I4K1 1KQSP 2E5QA 4C8QC 1WX6A 4M75F 3RUXA 2SEMA 3CPWS 3OYKA 1YJWA 1K73U 3CC7A 2EQIA 2B86A 3PMTA 1YCYA 2LTOA 4FIBA 4J5YA 3VS6A 1NJIR 1WYXA 2VV5A 1QWFA 1GL5A 2QYZA 1D1AA 2HBWA 3A8GB 3FJ5A 3GLXA 1HXDA 4PK4A 3RKXA 2KMTA 1TG0A 2DL7A 1PD0A 1C6VX 3L2ZA 4C92D 1YITA 4ELYC 2EKOA 4BE1A 3CD6A 3CCUT 1KC8R 2JNGA 1WHLA 2LX9A 1ZSZA 2DKGA 5CKBA 2DL5A 5IXBA 2QGGA 4JJNK 3GP8A 2QTXA 2PNIA 3JCMe 2KRMA 3TSZA 1LNXA 4RG8A 1X2QA 2CT4A 5IAYA 2FYKA 2P84A 5CK9A 2RB6A 2ESWA 4D8DA 4DBFA 1W2BS 3QJ6A 1IO6A 1UUEA 1ZLMA 3OS2A 3PT9A 1UG1A 1BI3A 2FPFA 3G71Q 1XJWB 5GAMj 3CCRQ 4CC2A 3TEEA 2VVKA 4B6MA 2HKQB 2HDAA 1NPRA 2HBPA 1QQJA 5GAMg 2MAMA 2F5TX 2J6KA
chains in the Genus database with same CATH topology
2L3RA 5GAMf 3P8HA 4M7AE 1G3TA 2XDDA 3GPLA 3LGFA 5I2SA 5HKCA 1KQSA 4CRIA 4CI0C 2EIFA 5GANd 2XI9A 3VYGA 1M9SA 3PGGA 5GAOq 1OZ2A 4C0ZA 3QG1A 3M54A 2RM4A 3RERA 5GAN6 3M4GA 2KSSA 2VXFA 4J7IA 3X24B 3S3MA 3BDLA 3FB9A 4HKEA 2DIQA 2K5FA 5GANf 2KVQG 5CR2A 4E7KA 5GANe 2DD4A 4M77E 3NTKA 1XTDA 3CCMA 3PMIA 4IUVA 2HQEA 3OYEA 1K8AC 4M7AC 4B9XA 2HAXA 4M78A 2BUDA 5GANh 5GAOl 4JDSA 4LDXA 5CQXA 4QQDA 5CVIA 1UGRB 1U1TA 1Y07A 3QIIA 2QEXA 3HPWA 2JUFA 4N0AC 3V7RA 4BI4A 4MDXA 3UDCA 5GAOm 3LWHA 1M1KU 3OYMA 3X28B 2DVEA 5J26A 4F7UG 5GAMe 5A2QE 4YTLA 3C94A 2M9UA 1G5VA 3LGLA 2FHDA 4HA8A 4LDVA 3CXCA 5EG2A 2QXFA 4M77C 5GAMh 3JB9J 4JRKA 2DTIA 2BIVA 2EQUA 2P0KA 2RHXA 3M55A 2DZ9A 3EFSA 3M9QA 1M8VA 1HK9A 1VQ8A 3P8DA 2EYQA 5CCAA 2QQRA 1QVGS 3OSSC 2OTLT 2PVOB 4DOVA 3RKWA 3META 4C0GA 5A0GA 4HT8A 2GFUA 2LT1A 3DLMA 4ZN3A 4RCCA 3I56A 4JUVA 1QVPA 1EIFA 3Q1JA 3CCJT 1YIJA 3OS1A 5FRNA 2K4YA 2EJ9A 3PTAA 4MMLA 3X26B 2V8KA 4IUUA 2E64A 1BI1A 2IG0A 3OA6A 2CZ6B 5CIUA 2YLBA 1G3SA 2RHIA 3OYIA 2G3RA 4C0DB 3UT1A 3LH0A 3J80E 2R57A 2K3YA 2Y90A 3J81E 2QA4A 1VQMA 1KC8U 3V7SA 4M7DA 2DEQA 2DXUA 4R56A 3JRZA 5GANg 4PL6A 1N8RU 5LJ3j 2QQ9A 2KAFA 4N4GA 1N9RA 3JB9H 2XICA 1RI0A 2QQBA 4OB0B 1GXIE 4Z02A 1MGQA 2OTLA 1VQLT 4C92C 4OP0A 2JZ2A 2MI6A 2RHYA 3QJYA 4PKCC 4RKUE 2YHTA 3QXEB 5CO7A 1NE8A 5HY6A 4C8QG 5GAMd 3CCJA 4F7UB 1YIJT 2X4YA 3TREA 3M57A 4F7UF 3OYYA 4MZMA 3O8VA 4BD3A 2DK3A 5AYFA 4R55A 3CCUA 2L89A 1NJIU 2B8AA 3BY7A 5LJ5e 1VQ7T 4EMHA 4MMKA 1R8OB 2RJCA 5IN1A 3JCMP 2C06A 3ZFJA 4L6V5 1ZHIA 1VQPT 5GAN3 4M78D 4M7DF 2E12A 4C5HA 1FWZA 5DM7R 2JTFA 5L8RE 1M90U 2D0QB 2XDPA 5CKEA 1VQLA 3BW1A 2XG8D 2E10A 4PLLA 3SD4A 4DQ2A 3JCMW 3RMQA 4OF1A 3CCLT 1VQ6A 3QSUA 2IVWA 4M78B 1M4ZA 3VKIA 4C8QA 5GAOp 3L2VA 1VQ4A 2XD0A 2O01E 3E9FA 1DJ7B 4C92A 4OB2B 4IKFA 3CBPA 3L2QA 3JB9D 2HD0A 3MEWA 1K9MU 3JB9I 4XAXB 3PIOA 1YI2A 1I8FA 4JRIA 1JJ2S 2DTHA 2XU8A 2CZ7B 1YJ9T 3ER0A 4BUGA 4BDYA 2RI3A 3JSCA 2LNVA 3N5BB 3OSVA 3QHSA 4OGEA 4M7AB 3VYHB 4EMGA 5LJ5f 4QW2A 1QW1A 3GNFB 1Y7XA 2DXTA 2F5KA 2QDYB 2VUBA 5D6YA 2E41A 4GLKA 4PLIA 3LWIA 1FX7A 2GQVA 4JLGA 4XU1A 1QP3A 3DKMA 4FL6A 2QA4T 4DA4A 4X9DA 4C8QF 1YJNT 3DLLA 3QYGB 2ZGWA 2VYTA 5M9OA 3CCLA 1Y71A 4M7AG 3FJPA 1UGSB 5GAN2 4C92F 4FU6A 2M0OA 3OQ5A 5A0LA 4M77A 3GF5A 1LJOA 4Y91A 4HT9A 5CAIA 2L8DA 3SB2A 4ZTJA 4PJOC 2VGMA 2CS7A 3RKYA 2K5LA 1WPYA 4A4EA 1BI0A 2HNIA 3QZ9B 4P5NA 3OYHA 4HCBA 1WJQA 5GAN7 4NL2A 4IUQA 1IZ6A 4C92B 3AHUA 1Q81U 4FM4B 2P4TA 2A7YA 3FDRA 3FLGA 3C4SA 1S72T 4OMFB 2WSCE 2BKDN 2V8JA 4MZPA 3G6ET 2XDBA 2DIGA 2O4XB 4M7DE 4X9CA 2DXCA 3SWNA 3JCMV 4JLIA 3DB3A 3M4YA 1YJWT 3I56T 4JRQA 3LLRA 4XTZA 5LJ3d 3DB4A 1VQ6T 1KD1C 4TVRA 4IUTA 1VQKT 3UWNA 5C0MA 1QVGA 4C0DC 5LJ5h 5LL6S 3HP9A 1M1KC 4BY6B 4F7UA 1KQ1A 5A0DA 2V8IA 4DOWA 3MEVA 3MP6A 2R5MA 2P0PA 2RI2A 3EFRA 4BI3A 1BIAA 3JCMX 1KQ2A 1OYXA 5I21A 3INZA 2X35A 1VQ5A 5DLQE 2HQXA 5LJ3e 3OYLA 2XIDA 2EWNA 3JB9G 1WQ7A 4UC4A 4PNOA 2RK1A 5CKFA 1S72A 1NZ9A 1WJSA 2JVVA 5LJ3h 3PFSA 2DZCA 5IT9E 3HRUA 4MZTA 4C92G 2P0QA 4ZGJB 3E1SA 1Q81C 4EMKB 3QBYA 1YITT 2PU9B 3VU3C 3VUBA 3G6EA 3NTIA 1KG1A 1IREB 4FT2A 4A54A 1WGSA 3L2RA 5DY9A 3CD6T 4M7AD 2RJDA 5I2MA 3RIRA 4RCBA 4BB7A 5D6WA 3E9GA 4BY6C 1W2BA 2JTMA 4BE2A 4KUIA 1VQ7A 3CCVT 2PVGB 3HHTB 4OB3B 3E19A 2WSFE 4ZTFA 3QUIA 2X4WA 3F70A 3JAME 3JCMJ 1VQ9T 5J3BA 3ZEHA 3CMEA 2E1HA 4E7IA 2ZPEB 1FXXA 3C12A 1H3ZA 1JBMA 1OI1A 4M77B 4ZN1A 4PJOG 3L2UA 3BDUA 2LQKA 2RA2A 3CCQA 2MF2A 2K57A 1B34B 2LQ8A 3PNWC 1VQ8T 1U1SA 4IURA 5GMKh 2GFAA 2RJFA 3OB9A 3CCEA 1G3YA 1Y96A 3BFMA 1ZQ1A 4F7UE 4ZGDB 4XTYA 5FU7C 3LYIA 4M77G 2OAUA 5FU6C 1N27A 2R5AA 3QO3A 4KUDK 5CKDA 3OYCA 1KHCA 3QPHA 2AHJB 3CCVA 3CEYA 5CKHA 3T9NA 5GMKl 3NFCA 4M7AA 3V7CA 4EDUA 1Y96B 2QEXT 1VUBA 3JB9F 2Y4XA 3FEOA 3TCJA 4ATOA 1YJ9A 2CGHA 4XU0A 4O6JA 4RMOA 3OW2S 1YHQT 1I81A 3CC4A 2PVDB 2RK2A 3M53A 3SFMA 2RO0A 5KCOA 4E7JA 1VQ5T 1VQMT 1Q86C 4M75G 2F69A 2WACA 5GAN4 1X01A 1Q82C 4PJOB 1UGQB 3GNGA 3QYHB 2LCLA 3JCMh 4C5GA 1VQKA 3WVDB 1P92A 2FVUA 4J7FA 4ME7A 3JCMb 1XQHA 2QQSA 3V8LA 1XOVA 2I2LA 4RG2A 2DXBA 2XKOC 3OYFA 3JCMf 4M7AF 5FU6B 1WJRA 2LRQA 1N9SA 4C5IA 1N6AA 4BACA 4BDZA 4XU2A 3A8MB 3CBOA 4LDWA 4JS4A 1YHQA 2ZPIB 1X6OA 1JRIA 3ASKA 4PJOF 2EQKA 3VUZA 4ZGEB 2ZPFB 3HFOA 2YLCA 5CQYA 1X75C 2EJFA 5GMKj 2KK4A 4EMKC 4L59A 1BI2A 4OB1B 1VQNT 2E70A 4M77F 3CPWA 1M5Q1 2K2VA 4C0FA 2LDMA 3OYJA 3A8OB 1OZ3A 1VQ4T 3X20B 1VQOA 2RI5A 2MWOA 3CC2T 3CPFA 4XTVA 4M77D 3RMSA 3KBGA 4XK8E 1O9SA 5LJ5g 2QI2A 5KE3A 4C8QE 1WQWA 3EAEA 3G4SA 2O4XA 4N4HA 3G71T 3CCRT 3OBWA 3JCMc 2RH2A 5GMKm 5D6XA 4PJOD 4PJOA 3MCAB 2K3XA 2ZPHB 2DO3A 3UPUA 3L42A 3HRTA 3KXTA 5KE2A 3JCMQ 1M1FA 1AHJB 2XHCA 3OYDA 3SDZA 2XK0A 5FU7B 3R6OA 2D9TA 4C8QB 3FRNA 3TU4K 4BI8B 3OYNA 4M78G 4EMKA 1VQOT 1RL2A 2E6NA 3M58A 4E47A 4M75C 3H6ZA 3WXMB 3JCMg 2NLUA 1UGPB 4FSXA 4II1A 2EQMA 3OYBA 4V2SA 2ZCFB 5LJ3f 3G4ST 4C8QD 5GAN5 3G71A 3CCRA 1Q86U 1ZBXA 3FC3A 1U8RA 3ZBDA 5J39A 1K9MC 5GAN8 3GIBA 2E65A 2PQWA 4ELZC 4M7DC 3GOXA 4QVZA 1JB0E 1MHNA 3CCQT 4HCCA 2DD5A 3OS5A 4X34A 1JJ2A 2LVMA 1BYMA 3HKSA 3CBMA 4PJOE 3I55A 1QP2A 1K73C 2M16A 4NOYA 5GMKe 3MP8A 1PSFA 2PUKB 5KCHA 2CZ1B 1D3BB 2LCCA 2H3JA 4M75A 1BIBA 4XTWA 4XTXA 1YJNA 1VIEA 4M75D 2ZPBB 3CCST 1KHIA 3QDRB 2GCXA 2DAQA 4A4FA 3V8KA 1NJIC 4LDYA 2VC8A 3C95A 3QZ5B 2DTOA 3A8HB 1QVFS 2YRVA 5FRMA 4KULA 2RJEA 2FB7A 4A4GA 3HFNA 4C92E 3CMAA 4E7LA 1M90C 1W4SA 4M78F 2EFIA 5KH6A 3L2WA 4M7DD 3I55T 1I4K1 4M75E 4QQ6A 2E5QA 4Y28E 3M59A 3VJPA 1SSFA 1NPPA 3J7AF 2OTJT 2RHZA 4C8QC 1UEBA 1PSEA 4M75F 2Y4YA 2X4XA 3QKJA 3RUXA 3CPWS 3CCMT 3OYKA 4WF2A 4M78E 3OYAA 1YJWA 2JN0A 3CC7A 5LJ5j 1H641 3CCSA 1K73U 2EJGA 2WSEE 3WVEB 3RESA 5LJ3g 3PMTA 1YCYA 5GANj 1YBYA 1YI2T 4QVDA 2LTOA 3HL8A 1B34A 1LOJA 1VQ9A 4OVAA 3CMAT 4J83A 4FIBA 1QVFA 3OMGA 4J5YA 2MWPA 2VV5A 1VQNA 3M5AA 2OTJA 3S6WA 3SWNB 1O75A 5GMKi 1VIFA 3A8GB 3GLXA 1HXDA 3CCET 3RKXA 2KMTA 3MEAA 3OS0A 4E7HA 3HSBA 2DJZA 3L2ZA 4NL3A 4C92D 3OMCA 2KY9A 1YITA 3V8JA 2KQWA 5HK0A 4GY5A 4QVCA 4ELYC 2EKOA 4BE1A 3CD6A 4LD9K 3LW5E 3MO8A 4MDWA 2VGNA 2JNGA 3NTHA 5DLOA 3CCUT 1KQSS 3A5ZB 3MP1A 2K5IA 1BKBA 2M1HA 2VXEA 1XNIA 4JRPA 2RHUA 3JCMd 2EAYA 2LX9A 1G3WA 2JOYA 4O5VA 3X25B 3CXCS 5GAOr 2DKGA 3CMET 5CKBA 2GF7A 4L5GA 2MMPA 4OGCA 3SWNC 2CZ0B 5HK3A 5FROA 2EQJA 3VV0A 3S3OA 4M78C 4JJNK 3GP8A 3P8BB 4Q5WA 2QTXA 3OBYA 2A3LA 4JS5A 4NS5A 1V29B 2E6ZA 2L5QA 3A8LB 3HRSA 3MEUA 4FT4A 4VUBA 3JCMe 4BE0A 2D6FA 5C6SA 1Q7YC 1K8AU 2QQAA 1LNXA 2CYZB 2FL7A 2LC4A 2ZZDA 1KD1U 4RG8A 4M7DB 2R58A 1I5LA 4J6WA 3G7ZA 4HCZA 5IAYA 2KDSA 4N4IA 2FYKA 4KBMB 4J6XA 5CK9A 2RB6A 4A53A 4QQGA 3CC7T 3OYGA 4LD6A 1KC8C 4LDUA 5FLXE 5LJ5d 4KT0E 4C5EA 3OY9A 4M7DG 4J8OA 4D6WA 1W2BS 4XQ3A 3QJ6A 1VQPA 4XTUA 1D3BA 4M75B 3CC4T 3ME9A 3OW2A 3OS2A 1WNLA 3PT9A 3S3NA 3LX7A 4XU3A 2ZPGB 3L1AA 1BI3A 3H8ZA 3M56A 3PIPA 4B9WA 3KUFA 2RD1A 4J6YA 2DPPB 5GAMj 2PUOB 3TEEA 3FIFA 1N8RC 3CC2A 1UB4A 4A4KA 1M1GA 1NPRA 3URGA 2X4JA 5GAOn 1Q82U 2HBPA 4N0AA 2LT4A 2MAMA 3MHXA 2CKKA 4A4HA 5GAMg 1TH7A 2F5TX 1Q7YU 4EPCA 4IUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDX A;  3TCJ A;  3JSC A;  5HKC A;  4ELZ C;  5CKB A;  5CQY A;  1M1F A;  2C06 A;  1X75 C;  5HK3 A;  5CKF A;  2VUB A;  2MF2 A;  3JRZ A;  4MZT A;  2KMT A;  5CKE A;  4HKE A;  5CCA A;  4MZP A;  4VUB A;  4OF1 A;  5CR2 A;  3VUB A;  1UB4 A;  4ME7 A;  5HK0 A;  5CKD A;  3G7Z A;  4ELY C;  5CO7 A;  1NE8 A;  5CKH A;  5DLO A;  5CQX A;  3NFC A;  5CK9 A;  4MZM A;  3HPW A;  1VUB A; 
#chains in the Genus database with same CATH topology
 2L3R A;  4AG1 C;  3P8H A;  4OMQ A;  5HKC A;  5GAN d;  1PCX A;  3PGG A;  3M54 A;  2L3S A;  4LN2 A;  2KSS A;  3X24 B;  2D0N A;  4X1V A;  5GAN f;  4RTW A;  5CR2 A;  2DD4 A;  2KRS A;  1SHF A;  3OYE A;  4DBR A;  4J9G A;  1KJW A;  1OOT A;  3V7R A;  2BZX A;  3LWH A;  3X28 B;  5GAM e;  1RLP C;  2X3W D;  2RQV A;  1NYG A;  1IHV A;  4LDV A;  4JRK A;  3I5S A;  3R6N A;  3M55 A;  4HVU A;  3OSS C;  4Z8A A;  4HT8 A;  2A36 A;  1D1C A;  1QCO A;  3PTA A;  4MML A;  2V8K A;  2GGR A;  4IUU A;  1BI1 A;  3OA6 A;  2HL3 A;  1G3S A;  3J80 E;  2R57 A;  2FG0 A;  4J9D A;  1M30 A;  4ANJ A;  2QA4 A;  3V7S A;  2KT1 A;  4R56 A;  4PL6 A;  3LH5 A;  2VB6 A;  1RI0 A;  2QQB A;  1MGQ A;  2E3H A;  2HSE B;  2DER A;  1JO8 A;  1AWW A;  1JQQ A;  3QJY A;  4C8Q G;  5GAM d;  3M57 A;  4MZM A;  3UA6 A;  2OJ2 A;  2DK3 A;  5D7U A;  2B8A A;  1VQ7 T;  1RI9 A;  1R8O B;  2COW A;  2RJC A;  2ZAE A;  2QAZ A;  1VQP T;  2I0N A;  5L8R E;  1M90 U;  1PRM C;  1VQL A;  1RAE B;  2XG8 D;  3SD4 A;  4DQ2 A;  3JCM W;  4HXJ A;  3RMQ A;  4OF1 A;  3VKI A;  3L2V A;  2XD0 A;  1DJ7 B;  1UGV A;  4F16 A;  4C92 A;  1AWO A;  2FRW A;  2HD0 A;  1K9M U;  1PWT A;  3PIO A;  1YI2 A;  1I8F A;  2DTH A;  3CCJ Q;  3ER0 A;  4BUG A;  1NYF A;  2CH4 A;  3JSC A;  2LX7 A;  2ROT A;  3VYH B;  5LJ5 f;  3GNF B;  2DXT A;  2VUB A;  2E41 A;  4JPB W;  3IQL A;  4JLG A;  1BBZ A;  2K6D A;  4X9D A;  4C8Q F;  5GAN 2;  2M0O A;  2NUT A;  1LJO A;  4Y91 A;  3VRZ A;  3SB2 A;  4F17 A;  4PJO C;  1WPY A;  1BI0 A;  2HNI A;  1MMD A;  4P5N A;  4HCB A;  1WJQ A;  2L3P A;  2KYM A;  3C0C A;  4NL2 A;  4IUQ A;  5KYX A;  1UJY A;  4C92 B;  1SSH A;  1YJ9 Q;  2P4T A;  3FDR A;  2WSC E;  2V8J A;  2DVJ A;  2DIG A;  3JCM V;  4PJN A;  3I56 T;  1VQ6 T;  2FO0 A;  4XTZ A;  1KD1 C;  3UWN A;  1QVG A;  2FEI A;  2K7A A;  3NPF A;  2V8I A;  2P0P A;  2RI2 A;  1R0C B;  2HQX A;  1Y0M A;  3OYL A;  2DBM A;  1W70 A;  4E7S A;  1RAC B;  1X2K A;  2RK1 A;  2FZC B;  2JVV A;  2JW4 A;  4C92 G;  3M0Q A;  1Q81 C;  1OPK A;  1YIT T;  2OI3 A;  1WA7 A;  1KG1 A;  1IRE B;  2NUP B;  4FT2 A;  4A54 A;  3L2R A;  4BB7 A;  5D6W A;  3E9G A;  2LNH B;  4BY6 C;  2X4W A;  3JAM E;  2ECZ A;  1ABO A;  1B07 A;  1RAB B;  2ZPE B;  1FXX A;  4J9F A;  1JBM A;  1OI1 A;  4M77 B;  1VQK Q;  1VQ5 Q;  2K57 A;  1VQ8 T;  4F04 B;  1U1S A;  1T3L A;  2GFA A;  4Y92 A;  3OB9 A;  3M0R A;  1IGU A;  1ZQ1 A;  4ZGD B;  4XTY A;  2F2W A;  4M77 G;  5FU6 C;  1N27 A;  2R5A A;  3QO3 A;  3OYC A;  2JT4 A;  5CKH A;  1Y96 B;  2QAS A;  2Y4X A;  1WXB A;  3M0U A;  4O6J A;  5IHI A;  4RMO A;  1YHQ T;  2RMO A;  2PVD B;  2RK2 A;  4E7J A;  1T0J A;  1X01 A;  3GNG A;  3M0P A;  4C5G A;  1H8K A;  4WTO B;  2FVU A;  3A1P A;  4J7F A;  1IRX A;  1D0Y A;  3H41 A;  4K11 A;  4RG2 A;  2XKO C;  4M7A F;  1VQ7 Q;  3MPU B;  5KYU A;  4C5I A;  2FZG B;  4XU2 A;  2E4H A;  3CBO A;  4LDW A;  4JS4 A;  3H0F A;  2ZPI B;  1JRI A;  4OML A;  2ZPF B;  2YLC A;  1KIK A;  3EG9 A;  2K3B A;  4LXC A;  2KK4 A;  2MCN A;  3UAT A;  2X3X D;  1T0H A;  4M77 F;  9ATC B;  2EGA A;  2K2V A;  2LDM A;  3OYJ A;  2KRN A;  1OQK A;  2RI5 A;  4XTV A;  4M77 D;  2QDL A;  3RMS A;  1O9S A;  4PFP A;  1CKB A;  3OBW A;  2RH2 A;  2K3X A;  3EGU A;  1F1B B;  2DO3 A;  3L42 A;  2AKK A;  2ABL A;  4J9E A;  5FU7 B;  3FRN A;  4M78 G;  1RL2 A;  1JXM A;  4EIK A;  4II1 A;  2EQM A;  2JTE A;  4V2S A;  2ZCF B;  5LJ3 f;  3G4S T;  3G71 A;  3CCR A;  3ZBD A;  1SKU B;  2E65 A;  2PQW A;  4M7D C;  1NLO C;  3GOX A;  4RUG A;  1IGQ A;  1MHN A;  3OS5 A;  1JJ2 A;  2LVM A;  2K9G A;  1AWJ A;  2M16 A;  2E3I A;  3CCU Q;  2LCC A;  4XTW A;  2ZPB B;  2GCX A;  2RF0 A;  3V8K A;  1Z9Z A;  3C95 A;  3AT1 B;  2YRV A;  5FRM A;  3HFN A;  2EFI A;  2QG9 B;  2RHZ A;  1K9A A;  1OX9 A;  2Y4Y A;  1K1Z A;  3BE3 A;  1U5S A;  3OW2 P;  3CCS A;  2EJG A;  4QT7 A;  5LJ3 g;  1AZG B;  3HL8 A;  1VQ9 A;  4RTU A;  2F2X A;  3EH2 A;  1Q86 R;  2YUP A;  1GFD A;  2YXY A;  1FYN A;  3CCE T;  4E7H A;  4NL3 A;  2MYS A;  3V8J A;  4E6R A;  4LD9 K;  2KNB B;  3NTH A;  3A5Z B;  3MP1 A;  4ORZ A;  4J9H A;  1XNI A;  2EAY A;  2JOY A;  2EYZ A;  3CXC S;  5GAO r;  2A08 A;  3CCQ Q;  4L5G A;  2MMP A;  1BB9 A;  4OGC A;  5HK3 A;  2CZ0 B;  2EQJ A;  2D8J A;  4KH0 B;  3OBY A;  2A3L A;  4NS5 A;  3HRS A;  4FT4 A;  3A8L B;  5C6S A;  1Q7Y C;  1K8A U;  1K8A R;  2FL7 A;  2F2V A;  2LC4 A;  1KD1 U;  1UTI A;  1I5L A;  1KFZ A;  1OX8 A;  2HCK A;  4J6W A;  4KGX B;  2KDS A;  4N4I A;  4KBM B;  2PZ1 A;  4QQG A;  3CC7 T;  3OYG A;  4LD6 A;  1SRL A;  4J8O A;  3CD6 Q;  3EFO A;  2FPE A;  4J9I A;  3CC4 T;  1EFN A;  1WNL A;  4XU3 A;  1S1N A;  3EG0 A;  2DL8 A;  2CUB A;  2DPP B;  4PFZ A;  3URG A;  2X4J A;  5GAO n;  1Q82 U;  4N0A A;  5ECA A;  1G3T A;  1E7O A;  3GPL A;  1KQS A;  3VS5 A;  3VYG A;  1M9S A;  5GAO q;  1OZ2 A;  4C0Z A;  3QG1 A;  3RER A;  1PRL C;  5GAN 6;  1GCQ A;  2KYB A;  1K73 R;  3BDL A;  2YDL A;  3FB9 A;  3PE0 A;  1G2B A;  2DIQ A;  4HKE A;  2K5F A;  4FYV B;  2KVQ G;  4Z89 A;  3NTK A;  4JZ3 A;  1XTD A;  3PMI A;  2HQE A;  4B9X A;  2BUD A;  5GAN h;  4LDX A;  5CQX A;  2EYX A;  4DEY A;  1Y07 A;  3QII A;  3HPW A;  4N0A C;  4BI4 A;  2YUQ A;  4MDX A;  3UDC A;  5GAO m;  1M1K U;  1M8M A;  2DVE A;  2DET A;  1VQM Q;  1Z9Q A;  4KGV B;  4HA8 A;  2QXF A;  3JB9 J;  5GAM h;  2BIV A;  2EQU A;  2P0K A;  3REA B;  1M3A A;  2DZ9 A;  3EFS A;  2EYQ A;  5CCA A;  5IHN A;  2OTL T;  3RKW A;  2LT1 A;  4ZN3 A;  2DF6 A;  3HTR A;  1QVP A;  3CCJ T;  3OS1 A;  5FRN A;  2K4Y A;  2IG0 A;  2YT6 A;  3UT1 A;  3LH0 A;  1WZO A;  1TUG B;  2Y90 A;  3J81 E;  3JB9 H;  2X51 A;  1GXI E;  3NHN A;  2YSQ A;  1AOJ A;  2EGE A;  3QXE B;  1GCQ C;  3TRE A;  1SRM A;  3O8V A;  4BD3 A;  4R55 A;  3CCU A;  1NJI U;  2LZ6 B;  5LJ5 e;  4EMH A;  4MMK A;  5IN1 A;  3SEM A;  4L6V 5;  2H3E B;  5GAN 3;  1FWZ A;  5DM7 R;  3BW1 A;  2E10 A;  1PHT A;  1ZX6 A;  2IVW A;  5GAO p;  1M4Z A;  1RLQ C;  2KR3 A;  2O01 E;  3E9F A;  4OB2 B;  3EGX B;  3JB9 D;  3MEW A;  4JRI A;  3UA7 A;  1WFW A;  2ED1 A;  3OSV A;  4QW2 A;  1QW1 A;  2MK5 A;  1MUZ A;  5D6Y A;  2QDY B;  4PLI A;  1FX7 A;  4XU1 A;  4DA4 A;  3DKM A;  4GBQ A;  1YJN T;  4GLM A;  1FMV A;  1UGS B;  4C92 F;  4FU6 A;  2DRK A;  3OQ5 A;  5A0L A;  1M90 R;  5CAI A;  4ZTJ A;  2VGM A;  1FMK A;  1FMW A;  5GAN 7;  2J06 A;  1Q81 U;  2JM8 A;  3FLG A;  4OMF B;  4MZP A;  2XDB A;  2V1R A;  3EHR A;  4JLI A;  1N8R R;  3RDV A;  4TVR A;  3HP9 A;  4F7U A;  5A0D A;  1B7T A;  3MEV A;  2NUT B;  2R5M A;  1BIA A;  3INZ A;  2X35 A;  5LJ3 e;  2EYW A;  3H0I A;  3JB9 G;  4UC4 A;  1VQN Q;  1S72 A;  2COZ A;  3PFS A;  1PKS A;  3HRU A;  4MZT A;  5IT9 E;  4ZGJ B;  3E1S A;  1WHJ A;  3VUB A;  2P4R A;  5DY9 A;  1K76 A;  5I2M A;  1QVF P;  2LP5 A;  4DEX A;  5IXF A;  4D8K A;  1W2B A;  3M0T A;  4CC3 A;  4BE2 A;  3HHT B;  1OU9 A;  3E19 A;  2WSF E;  2DM1 A;  3F70 A;  2RQU A;  3ZEH A;  3CME A;  3C12 A;  1X43 A;  2J6O A;  4PJO G;  3BDU A;  3CCQ A;  1M3B A;  1B34 B;  2LQ8 A;  1UEC A;  2RJF A;  3JV3 A;  2QA4 Q;  1G3Y A;  1Y96 A;  2DYI A;  4FSS A;  1WXU A;  2CSI A;  3EH1 A;  3RBB B;  1KHC A;  2KT8 A;  1TS9 A;  2BE9 B;  3CCV A;  1Q81 R;  3T9N A;  2OTL Q;  3NFC A;  3JB9 F;  4ATO A;  1I81 A;  1GRI A;  2COY A;  2LMJ A;  3M53 A;  5KCO A;  1VQ5 T;  1Q86 C;  2WAC A;  5GAN 4;  4F14 A;  4QKU A;  3QYH B;  1H92 A;  3D7S B;  1HYO A;  3JCM b;  2DXB A;  3JCM f;  4FYX B;  2LRQ A;  2W10 A;  4BAC A;  1YHQ A;  2DFU A;  4PJO F;  3EGD B;  2EQK A;  2O88 A;  1MV0 B;  1X75 C;  1BI2 A;  4OB1 B;  2JM9 A;  2IIM A;  3CPW A;  1I0C A;  2DMO A;  1ZA1 B;  1JEG A;  1TUC A;  1VQ4 T;  3CC2 T;  2MWO A;  1OEB A;  1YFN A;  3MKD A;  1HSQ A;  2QI2 A;  4PJO A;  2ZPH B;  1D0X A;  5KE2 A;  1I1J A;  1J3T A;  2XHC A;  3SDZ A;  3TU4 K;  3OYN A;  4EMK A;  1VQO T;  2HQH A;  3I9Q A;  4E47 A;  1R0B G;  1HJD A;  2NLU A;  2DIL A;  1UGP B;  2V1Q A;  1K0S A;  2LCS A;  2XMF A;  1LVK A;  1KK7 A;  3GIB A;  1M2O A;  4OMO A;  4HCC A;  1X6B A;  1EZZ B;  1I5O B;  4X34 A;  4HVW A;  4AFS C;  2MPX C;  4NOY A;  2PUK B;  5KCH A;  2H3J A;  2M51 A;  5IHK A;  4M75 D;  3NMZ C;  4LDY A;  4AT1 B;  3CCE Q;  1QVF S;  5FW9 A;  2RJE A;  3CMA A;  1M90 C;  1W4S A;  2YRC A;  3L2W A;  5KYW A;  2PTK A;  3I55 T;  4QQ6 A;  1YWP A;  1VQP Q;  4FW2 A;  3VJP A;  1SSF A;  2OTJ T;  1UEB A;  1YI2 Q;  1PSE A;  4AFQ C;  2X4X A;  1ZBJ A;  3QKJ A;  4M78 E;  2M0Y A;  3UF4 A;  2GTO A;  2JN0 A;  2WSE E;  3RES A;  5GAN j;  4QVD A;  4OVA A;  3CC7 Q;  3OMG A;  2MWP A;  1VQN A;  3S6W A;  4E2F B;  3SWN B;  4KRT A;  8AT1 B;  1Q82 R;  3EG3 A;  3MEA A;  3HSB A;  2KEA A;  1AVZ C;  3OMC A;  2KY9 A;  2KQW A;  5HK0 A;  2FRY A;  4QVC A;  3CME Q;  4MDW A;  5DLO A;  1KQS S;  2K5I A;  1BKB A;  1CKA A;  1MNE A;  2M1H A;  4JRP A;  2RHU A;  3JCM d;  1G3W A;  2DYB A;  1RAA B;  2K79 A;  1TU0 B;  2L3Q A;  4OMP A;  5FRO A;  5KYW B;  1AZE A;  4M78 C;  3P8B B;  3QDF A;  4Q5W A;  1AWX A;  1QCN A;  2ATC B;  1V29 B;  2E6Z A;  5KYU B;  2D6F A;  2EW3 A;  2VWF A;  3I35 A;  1UDL A;  2CYZ B;  4M7D B;  1HD3 A;  3G7Z A;  2CP5 A;  2E5K A;  2DL4 A;  2JMA A;  4LDU A;  5FLX E;  5LJ5 d;  3OY9 A;  4C5E A;  3KFV A;  4D6W A;  2O9S A;  4XQ3 A;  3A98 A;  3H9N A;  1VQP A;  1D3B A;  2RQW A;  1VA7 A;  1PD1 A;  2NWM A;  2LQN A;  3LX7 A;  2ZPG B;  3M56 A;  4B9W A;  3KUF A;  4J6Y A;  5FWC A;  2PUO B;  3FIF A;  1N8R C;  1UB4 A;  4A4K A;  1KSW A;  4PJM A;  1PC0 A;  3MHX A;  1Q7Y U;  1K8A C;  4EPC A;  4F7U B;  5GAM f;  1BU1 A;  4M7A E;  4CRI A;  2EIF A;  2XI9 A;  1IHW A;  2VXF A;  4J7I A;  4J9C A;  2CH4 W;  2DX1 A;  4M4Z A;  2NYS A;  5GAN e;  4M77 E;  2IPO B;  2GTJ A;  4IUV A;  4M7A C;  2HAX A;  4M78 A;  1X27 A;  4JDS A;  4CC4 B;  2QEX A;  1U1T A;  1UGR B;  1R77 A;  2JUF A;  5J26 A;  3CQT A;  4YTL A;  1CSK A;  2M9U A;  3C94 A;  3LGL A;  1UFF A;  2FHD A;  1K9M R;  2J6F A;  4RTZ A;  5EG2 A;  4M77 C;  2DTI A;  1ZSZ B;  1NEG A;  3M9Q A;  1VQ8 A;  1X69 A;  3P8D A;  2K2M A;  1QVG S;  3QWX X;  4C0G A;  5EC7 A;  2GFU A;  4OMM A;  5IH2 A;  1EIF A;  1YIJ A;  2CUD A;  2CP0 A;  3TQ7 P;  1RAI B;  1VQ8 Q;  5CIU A;  2YLB A;  1WXT A;  1D0Z A;  4C0D B;  3OYI A;  2AZS A;  6AT1 B;  1PNJ A;  3VS2 A;  1KC8 U;  2DEQ A;  2DXU A;  2BZ8 A;  5GAN g;  1TOV A;  2BZY A;  1N9R A;  2XIC A;  2CP2 A;  5KYN A;  5KYY B;  2O9V A;  3MJX A;  2MI6 A;  3VS3 A;  4PKC C;  2KGT A;  5CO7 A;  1NE8 A;  1YIJ T;  4F7U F;  1WHG A;  3EG9 B;  1YIT Q;  1I07 A;  5AYF A;  2AKL A;  5GJW B;  3VRY A;  2C0I A;  1ZUK A;  2C06 A;  3ZFJ A;  2OTJ Q;  1AEY A;  2E12 A;  4PFO A;  2JTF A;  4ESR A;  2CRE A;  2D0Q B;  2XDP A;  5CKE A;  4E7Z A;  3QSU A;  2RQR A;  4M78 B;  1D09 B;  1VQ4 A;  2NUZ A;  1YJW Q;  1YHQ Q;  4KH1 B;  4IKF A;  3G6E Q;  4J9B A;  3L2Q A;  3EGX A;  2XU8 A;  2CZ7 B;  1YJ9 T;  4BDY A;  2RI3 A;  3N5B B;  1WIE A;  4OGE A;  1ZUY A;  1M3C A;  2BTT A;  1Y7X A;  2F5K A;  1GFC A;  4GLK A;  3CPW P;  3LWI A;  1QP3 A;  4OMN A;  4FL6 A;  3DLL A;  2ZGW A;  3CCL A;  1Y71 A;  1Q95 G;  2GBQ A;  4M77 A;  3GF5 A;  4HT9 A;  2L8D A;  4AG2 C;  3RKY A;  1NLP C;  2K5L A;  3OYH A;  2JS0 A;  1TWB A;  3VS0 A;  4LE9 A;  1MND A;  3EG1 A;  4FM4 B;  2NUP A;  3C4S A;  2BKD N;  3G6E T;  1UE9 A;  2O4X B;  1JJ2 P;  4X9C A;  3DB3 A;  1YJW T;  4JRQ A;  3LLR A;  3DB4 A;  2RQT A;  2OX7 A;  1UJ0 A;  2SRC A;  4IUT A;  5C0M A;  5LJ5 h;  2DJQ A;  1M1K C;  3GBQ A;  1KQ1 A;  4DOW A;  3EFR A;  4BI3 A;  1A0N B;  1ZSG A;  1QVG P;  1OYX A;  1RAG B;  2ROL A;  4FW1 A;  1VQ5 A;  2EWN A;  1WQ7 A;  4PNO A;  1VQ6 Q;  3CXC P;  2DL3 A;  1NZ9 A;  1GBR A;  5LJ3 h;  2QGF B;  2AZV A;  3QBY A;  1N5Z A;  2EBP A;  1JXO A;  1WGS A;  3CD6 T;  2JS2 A;  1T3S A;  3EFO B;  2RJD A;  1OPL A;  3RIR A;  5KYX B;  1W2B P;  2GQI A;  2JTM A;  4KUI A;  2CP3 A;  1VQ7 A;  2PVG B;  4ZTF A;  3QUI A;  3JCM J;  1TTH B;  1X6G A;  1H3Z A;  2LQK A;  2RA2 A;  2MF2 A;  3PNW C;  5GMK h;  3CCE A;  4F7U E;  2QEX Q;  2OAU A;  5CKD A;  1MV3 A;  1VOM A;  3TCJ A;  1YJ9 A;  3TVT A;  1YP5 A;  1EX4 A;  3CC4 A;  2RO0 A;  4M75 G;  2EYY A;  3G1J A;  4PJO B;  1TXQ A;  1VQK A;  1VQ9 Q;  1P92 A;  3V8L A;  1XOV A;  1OUL A;  2Z0W A;  3CMA Q;  2I2L A;  3OYF A;  1QKX A;  1WJR A;  2KXC A;  1MMA A;  1YNZ A;  2VAS A;  1X6O A;  1ZSZ C;  3ASK A;  4ZGE B;  3VUZ A;  3CCM Q;  3HFO A;  1YIJ Q;  5CQY A;  5GMK j;  4EMK C;  1VQN T;  2C0O A;  1M5Q 1;  1KD1 R;  1VQO A;  3CPF A;  4DBH A;  3KBG A;  4XK8 E;  5KE3 A;  3G4S A;  3G71 T;  4N4H A;  3CCR T;  4FCY A;  2KI7 A;  3JCM c;  5GMK m;  4AMC A;  5D6X A;  3CCS Q;  3MCA B;  4PJL A;  1K4U S;  3KXT A;  3JCM Q;  1M1F A;  4IIM A;  8ATC B;  3OYD A;  1RUW A;  3R6O A;  2D9T A;  1VYU A;  4BI8 B;  1IXD A;  3M58 A;  1BCM A;  4M75 C;  3H6Z A;  4R0K A;  5L23 A;  1G83 A;  2YRD A;  3OYB A;  4CC7 A;  5GAN 5;  2RNA A;  1U8R A;  1K9M C;  3VS4 A;  5HCK A;  1SHG A;  1PKT A;  1NBE B;  1M2V B;  3CBM A;  2DE0 X;  1K73 C;  4PJO E;  2RPN A;  3MP8 A;  4AFU C;  4AFZ C;  1YJN A;  4M75 A;  2DNU A;  4XTX A;  1VIE A;  3CCS T;  1KHI A;  3QDR B;  1AD5 A;  2JJ9 A;  1NJI C;  1WDX A;  4KUL A;  1M1K R;  5KH6 A;  4M75 E;  4Y28 E;  3M59 A;  1NPP A;  3J7A F;  1E6G A;  3CCM T;  4WF2 A;  3OYA A;  5LJ5 j;  1H64 1;  3WVE B;  1YBY A;  1YI2 T;  1B34 A;  1LOJ A;  3CMA T;  4J83 A;  1QVF A;  1BK2 A;  4FYW B;  2HMA A;  3M5A A;  1SPK A;  1Q7Y R;  2OTJ A;  1O75 A;  5GMK i;  1VIF A;  2O2O A;  1NG2 A;  2C0T A;  3OS0 A;  2DJZ A;  1JU5 C;  2M02 A;  2A28 A;  4GY5 A;  1UHC A;  2FZK B;  3LW5 E;  3MO8 A;  2VGN A;  4RTX A;  2QK0 A;  2VXE A;  4JJC A;  4O5V A;  3X25 B;  5FWB A;  3CME T;  1AT1 B;  2GF7 A;  2DEU A;  3SWN C;  3S3O A;  3VV0 A;  4JS5 A;  1VQK T;  2L5Q A;  4BE0 A;  3MEU A;  4VUB A;  2KBT A;  2QQA A;  2ZZD A;  5AT1 B;  1QWE A;  2R58 A;  1RAH B;  4HCZ A;  3VS7 A;  2DLP A;  4J6X A;  4A53 A;  1VQO Q;  1KC8 C;  4KT0 E;  4M7D G;  4XTU A;  4M75 B;  3OW2 A;  3ME9 A;  3S3N A;  3PVQ A;  1GCP A;  1M2V A;  3L1A A;  3H8Z A;  2EGC A;  3E2U A;  3PIP A;  1C1A A;  2RD1 A;  1U3O A;  2HKN A;  3SHW A;  3CC2 A;  1M1G A;  1TSF A;  1VYT A;  4A4H A;  2LT4 A;  2CKK A;  1TH7 A;  4IUP A;  4DBQ A;  2XDD A;  3LGF A;  5I2S A;  4CI0 C;  5I22 A;  3NGP A;  1ZA2 B;  2RM4 A;  1WI7 A;  4JJB A;  2YUN A;  3M4G A;  3S3M A;  3CC4 Q;  2X9H A;  4IIO A;  2HL5 C;  4E7K A;  3CCM A;  1B3Q A;  5GAO l;  2JXB A;  4QQD A;  5CVI A;  2EPD A;  5A2Q E;  3OYM A;  4F7U G;  3QWY A;  1G5V A;  1IB8 A;  3CXC A;  2AIR B;  1WHK A;  2QTV A;  2RHX A;  1OV3 A;  1M8V A;  2MOX A;  1HK9 A;  2QQR A;  2PVO B;  4DOV A;  3MET A;  5A0G A;  1MMG A;  3DLM A;  1SG5 A;  4RCC A;  3I56 A;  4JUV A;  3Q1J A;  2EJ9 A;  3X26 B;  1QMC A;  2E64 A;  2CZ6 B;  2DRM A;  2O31 A;  2RHI A;  2G3R A;  1D1B A;  2K3Y A;  3THK A;  1UHF A;  1VQM A;  3CC2 Q;  4M7D A;  2VKN A;  3JRZ A;  1V76 A;  5LJ3 j;  2QQ9 A;  1N8R U;  2KAF A;  1TUD A;  1ZUU A;  2D8H A;  4N4G A;  4OB0 B;  4Z02 A;  2OTL A;  1VQL T;  4C92 C;  4OP0 A;  2JZ2 A;  2EVR A;  2RHY A;  4RKU E;  2LJ0 A;  2YHT A;  5HY6 A;  3CCJ A;  4FYY B;  2MIO A;  2X4Y A;  3OYY A;  5GJV B;  2L89 A;  3BY7 A;  4ZNX A;  3JCM P;  4LUD A;  1ZHI A;  4M78 D;  4M7D F;  4C5H A;  1QLY A;  2CT3 A;  4PLL A;  3CCL T;  5I11 A;  1VQ6 A;  4C8Q A;  2JMC A;  2L0A A;  3U23 A;  2YUO A;  3CBP A;  1V1C A;  1ABQ A;  2A37 A;  4XAX B;  3JB9 I;  1JJ2 S;  2W0Z A;  3RR6 A;  4LNP A;  2LNV A;  3QHS A;  1RAF B;  4M7A B;  4EMG A;  3RNJ A;  2GQV A;  2QA4 T;  2J05 A;  3QYG B;  2J7I A;  2VYT A;  3REB B;  5M9O A;  4M7A G;  3G4S Q;  3FJP A;  2AT1 B;  1SEM A;  1YJN Q;  1BCO A;  1LCK A;  3I5R A;  3CCV Q;  2CS7 A;  4A4E A;  2L2P A;  3QZ9 B;  2A0F B;  1IZ6 A;  1PG5 B;  3AHU A;  2A7Y A;  1S72 T;  2AK5 A;  2HEQ A;  1GBQ A;  4M7D E;  3EHQ A;  2DXC A;  3SWN A;  4JJD A;  3M4Y A;  2CDT A;  5LJ3 d;  2KXD A;  4C0D C;  3CCL Q;  5LL6 S;  4BY6 B;  3TSW A;  2H8H A;  3MP6 A;  1KQ2 A;  3JCM X;  5I21 A;  2ENM A;  5DLQ E;  2XID A;  1WLP B;  5CKF A;  2LJ3 A;  1WJS A;  1VYV A;  2DZC A;  3PVL A;  2P0Q A;  4EMK B;  1S72 Q;  2PU9 B;  3VU3 C;  3G6E A;  3NTI A;  4RTY A;  4HCK A;  1QKW A;  4M7A D;  2LJ1 A;  1E6H A;  1PM3 A;  4RCB A;  3CCV T;  4OB3 B;  4KGZ B;  1ACM B;  1VQ9 T;  5J3B A;  4E7I A;  2E1H A;  4ZN1 A;  2EKH A;  3L2U A;  1MMN A;  1LPL A;  2DBK A;  4RTV A;  4IUR A;  3BFM A;  5FU7 C;  3LYI A;  4KUD K;  3QPH A;  4A63 B;  2AHJ B;  3CEY A;  5GMK l;  4M7A A;  3EGD A;  3EG2 A;  3V7C A;  4EDU A;  2QEX T;  1VUB A;  4RTT A;  3FEO A;  2BE7 D;  1G8X A;  1NM7 A;  2CGH A;  4XU0 A;  3OW2 S;  3SFM A;  5KYY A;  1VQM T;  2F69 A;  3M0S A;  4HVV A;  1Q82 C;  1UGQ B;  2GNC A;  2KE9 A;  4PJJ A;  2LCL A;  1SF9 A;  3JCM h;  3WVD B;  1W1F A;  4ME7 A;  1XQH A;  2QQS A;  1RAD B;  2V26 A;  1H3H A;  5FU6 B;  1U06 A;  1N9S A;  1N6A A;  4BDZ A;  2FPD A;  3A8M B;  2CP6 A;  1QCF A;  2DA9 A;  1WHH A;  2EJF A;  2LQW A;  2OAW A;  4L59 A;  1VQL Q;  2E70 A;  2G6F X;  3I55 Q;  4C0F A;  3A8O B;  1OZ3 A;  1W6X A;  3X20 B;  3H0H A;  1WHM A;  4LUE A;  7AT1 B;  5LJ5 g;  4C8Q E;  1WQW A;  1NEB A;  3EAE A;  3I56 Q;  2O4X A;  1K0X A;  4PJO D;  1YN8 A;  2ED0 A;  3UPU A;  3HRT A;  1M27 C;  2D1X A;  1AHJ B;  3O5Z A;  2XK0 A;  4C8Q B;  2RN8 A;  2E6N A;  2HZY A;  3WXM B;  2HSP A;  3JCM g;  4FSX A;  4Z88 A;  1Q86 U;  1C0M A;  4C8Q D;  1ZBX A;  3FC3 A;  3VS1 A;  5J39 A;  3ULR B;  3ZL7 C;  2CSQ A;  5GAN 8;  4WCI A;  4ELZ C;  4QVZ A;  1JB0 E;  1Y57 A;  3CCQ T;  2DD5 A;  4JZ4 A;  1OU8 A;  1BYM A;  3HKS A;  2F1L A;  3I55 A;  1QP2 A;  1ARK A;  5GMK e;  1PSF A;  2CZ1 B;  1D3B B;  1BIB A;  1YWO A;  1YCS B;  2DAQ A;  4A4F A;  2VC8 A;  3QZ5 B;  2KRO A;  2DTO A;  3A8H B;  2FB7 A;  4A4G A;  2CP7 A;  4C92 E;  1VQ4 Q;  4E7L A;  4M78 F;  4M7D D;  2YWW A;  1I4K 1;  1KQS P;  2E5Q A;  4C8Q C;  1WX6 A;  4M75 F;  3RUX A;  2SEM A;  3CPW S;  3OYK A;  1YJW A;  1K73 U;  3CC7 A;  2EQI A;  2B86 A;  3PMT A;  1YCY A;  2LTO A;  4FIB A;  4J5Y A;  3VS6 A;  1NJI R;  1WYX A;  2VV5 A;  1QWF A;  1GL5 A;  2QYZ A;  1D1A A;  2HBW A;  3A8G B;  3FJ5 A;  3GLX A;  1HXD A;  4PK4 A;  3RKX A;  2KMT A;  1TG0 A;  2DL7 A;  1PD0 A;  1C6V X;  3L2Z A;  4C92 D;  1YIT A;  4ELY C;  2EKO A;  4BE1 A;  3CD6 A;  3CCU T;  1KC8 R;  2JNG A;  1WHL A;  2LX9 A;  1ZSZ A;  2DKG A;  5CKB A;  2DL5 A;  5IXB A;  2QGG A;  4JJN K;  3GP8 A;  2QTX A;  2PNI A;  3JCM e;  2KRM A;  3TSZ A;  1LNX A;  4RG8 A;  1X2Q A;  2CT4 A;  5IAY A;  2FYK A;  2P84 A;  5CK9 A;  2RB6 A;  2ESW A;  4D8D A;  4DBF A;  1W2B S;  3QJ6 A;  1IO6 A;  1UUE A;  1ZLM A;  3OS2 A;  3PT9 A;  1UG1 A;  1BI3 A;  2FPF A;  3G71 Q;  1XJW B;  5GAM j;  3CCR Q;  4CC2 A;  3TEE A;  2VVK A;  4B6M A;  2HKQ B;  2HDA A;  1NPR A;  2HBP A;  1QQJ A;  5GAM g;  2MAM A;  2F5T X;  2J6K A; 
#chains in the Genus database with same CATH homology
 2L3R A;  5GAM f;  3P8H A;  4M7A E;  1G3T A;  2XDD A;  3GPL A;  3LGF A;  5I2S A;  5HKC A;  1KQS A;  4CRI A;  4CI0 C;  2EIF A;  5GAN d;  2XI9 A;  3VYG A;  1M9S A;  3PGG A;  5GAO q;  1OZ2 A;  4C0Z A;  3QG1 A;  3M54 A;  2RM4 A;  3RER A;  5GAN 6;  3M4G A;  2KSS A;  2VXF A;  4J7I A;  3X24 B;  3S3M A;  3BDL A;  3FB9 A;  4HKE A;  2DIQ A;  2K5F A;  5GAN f;  2KVQ G;  5CR2 A;  4E7K A;  5GAN e;  2DD4 A;  4M77 E;  3NTK A;  1XTD A;  3CCM A;  3PMI A;  4IUV A;  2HQE A;  3OYE A;  1K8A C;  4M7A C;  4B9X A;  2HAX A;  4M78 A;  2BUD A;  5GAN h;  5GAO l;  4JDS A;  4LDX A;  5CQX A;  4QQD A;  5CVI A;  1UGR B;  1U1T A;  1Y07 A;  3QII A;  2QEX A;  3HPW A;  2JUF A;  4N0A C;  3V7R A;  4BI4 A;  4MDX A;  3UDC A;  5GAO m;  3LWH A;  1M1K U;  3OYM A;  3X28 B;  2DVE A;  5J26 A;  4F7U G;  5GAM e;  5A2Q E;  4YTL A;  3C94 A;  2M9U A;  1G5V A;  3LGL A;  2FHD A;  4HA8 A;  4LDV A;  3CXC A;  5EG2 A;  2QXF A;  4M77 C;  5GAM h;  3JB9 J;  4JRK A;  2DTI A;  2BIV A;  2EQU A;  2P0K A;  2RHX A;  3M55 A;  2DZ9 A;  3EFS A;  3M9Q A;  1M8V A;  1HK9 A;  1VQ8 A;  3P8D A;  2EYQ A;  5CCA A;  2QQR A;  1QVG S;  3OSS C;  2OTL T;  2PVO B;  4DOV A;  3RKW A;  3MET A;  4C0G A;  5A0G A;  4HT8 A;  2GFU A;  2LT1 A;  3DLM A;  4ZN3 A;  4RCC A;  3I56 A;  4JUV A;  1QVP A;  1EIF A;  3Q1J A;  3CCJ T;  1YIJ A;  3OS1 A;  5FRN A;  2K4Y A;  2EJ9 A;  3PTA A;  4MML A;  3X26 B;  2V8K A;  4IUU A;  2E64 A;  1BI1 A;  2IG0 A;  3OA6 A;  2CZ6 B;  5CIU A;  2YLB A;  1G3S A;  2RHI A;  3OYI A;  2G3R A;  4C0D B;  3UT1 A;  3LH0 A;  3J80 E;  2R57 A;  2K3Y A;  2Y90 A;  3J81 E;  2QA4 A;  1VQM A;  1KC8 U;  3V7S A;  4M7D A;  2DEQ A;  2DXU A;  4R56 A;  3JRZ A;  5GAN g;  4PL6 A;  1N8R U;  5LJ3 j;  2QQ9 A;  2KAF A;  4N4G A;  1N9R A;  3JB9 H;  2XIC A;  1RI0 A;  2QQB A;  4OB0 B;  1GXI E;  4Z02 A;  1MGQ A;  2OTL A;  1VQL T;  4C92 C;  4OP0 A;  2JZ2 A;  2MI6 A;  2RHY A;  3QJY A;  4PKC C;  4RKU E;  2YHT A;  3QXE B;  5CO7 A;  1NE8 A;  5HY6 A;  4C8Q G;  5GAM d;  3CCJ A;  4F7U B;  1YIJ T;  2X4Y A;  3TRE A;  3M57 A;  4F7U F;  3OYY A;  4MZM A;  3O8V A;  4BD3 A;  2DK3 A;  5AYF A;  4R55 A;  3CCU A;  2L89 A;  1NJI U;  2B8A A;  3BY7 A;  5LJ5 e;  1VQ7 T;  4EMH A;  4MMK A;  1R8O B;  2RJC A;  5IN1 A;  3JCM P;  2C06 A;  3ZFJ A;  4L6V 5;  1ZHI A;  1VQP T;  5GAN 3;  4M78 D;  4M7D F;  2E12 A;  4C5H A;  1FWZ A;  5DM7 R;  2JTF A;  5L8R E;  1M90 U;  2D0Q B;  2XDP A;  5CKE A;  1VQL A;  3BW1 A;  2XG8 D;  2E10 A;  4PLL A;  3SD4 A;  4DQ2 A;  3JCM W;  3RMQ A;  4OF1 A;  3CCL T;  1VQ6 A;  3QSU A;  2IVW A;  4M78 B;  1M4Z A;  3VKI A;  4C8Q A;  5GAO p;  3L2V A;  1VQ4 A;  2XD0 A;  2O01 E;  3E9F A;  1DJ7 B;  4C92 A;  4OB2 B;  4IKF A;  3CBP A;  3L2Q A;  3JB9 D;  2HD0 A;  3MEW A;  1K9M U;  3JB9 I;  4XAX B;  3PIO A;  1YI2 A;  1I8F A;  4JRI A;  1JJ2 S;  2DTH A;  2XU8 A;  2CZ7 B;  1YJ9 T;  3ER0 A;  4BUG A;  4BDY A;  2RI3 A;  3JSC A;  2LNV A;  3N5B B;  3OSV A;  3QHS A;  4OGE A;  4M7A B;  3VYH B;  4EMG A;  5LJ5 f;  4QW2 A;  1QW1 A;  3GNF B;  1Y7X A;  2DXT A;  2F5K A;  2QDY B;  2VUB A;  5D6Y A;  2E41 A;  4GLK A;  4PLI A;  3LWI A;  1FX7 A;  2GQV A;  4JLG A;  4XU1 A;  1QP3 A;  3DKM A;  4FL6 A;  2QA4 T;  4DA4 A;  4X9D A;  4C8Q F;  1YJN T;  3DLL A;  3QYG B;  2ZGW A;  2VYT A;  5M9O A;  3CCL A;  1Y71 A;  4M7A G;  3FJP A;  1UGS B;  5GAN 2;  4C92 F;  4FU6 A;  2M0O A;  3OQ5 A;  5A0L A;  4M77 A;  3GF5 A;  1LJO A;  4Y91 A;  4HT9 A;  5CAI A;  2L8D A;  3SB2 A;  4ZTJ A;  4PJO C;  2VGM A;  2CS7 A;  3RKY A;  2K5L A;  1WPY A;  4A4E A;  1BI0 A;  2HNI A;  3QZ9 B;  4P5N A;  3OYH A;  4HCB A;  1WJQ A;  5GAN 7;  4NL2 A;  4IUQ A;  1IZ6 A;  4C92 B;  3AHU A;  1Q81 U;  4FM4 B;  2P4T A;  2A7Y A;  3FDR A;  3FLG A;  3C4S A;  1S72 T;  4OMF B;  2WSC E;  2BKD N;  2V8J A;  4MZP A;  3G6E T;  2XDB A;  2DIG A;  2O4X B;  4M7D E;  4X9C A;  2DXC A;  3SWN A;  3JCM V;  4JLI A;  3DB3 A;  3M4Y A;  1YJW T;  3I56 T;  4JRQ A;  3LLR A;  4XTZ A;  5LJ3 d;  3DB4 A;  1VQ6 T;  1KD1 C;  4TVR A;  4IUT A;  1VQK T;  3UWN A;  5C0M A;  1QVG A;  4C0D C;  5LJ5 h;  5LL6 S;  3HP9 A;  1M1K C;  4BY6 B;  4F7U A;  1KQ1 A;  5A0D A;  2V8I A;  4DOW A;  3MEV A;  3MP6 A;  2R5M A;  2P0P A;  2RI2 A;  3EFR A;  4BI3 A;  1BIA A;  3JCM X;  1KQ2 A;  1OYX A;  5I21 A;  3INZ A;  2X35 A;  1VQ5 A;  5DLQ E;  2HQX A;  5LJ3 e;  3OYL A;  2XID A;  2EWN A;  3JB9 G;  1WQ7 A;  4UC4 A;  4PNO A;  2RK1 A;  5CKF A;  1S72 A;  1NZ9 A;  1WJS A;  2JVV A;  5LJ3 h;  3PFS A;  2DZC A;  5IT9 E;  3HRU A;  4MZT A;  4C92 G;  2P0Q A;  4ZGJ B;  3E1S A;  1Q81 C;  4EMK B;  3QBY A;  1YIT T;  2PU9 B;  3VU3 C;  3VUB A;  3G6E A;  3NTI A;  1KG1 A;  1IRE B;  4FT2 A;  4A54 A;  1WGS A;  3L2R A;  5DY9 A;  3CD6 T;  4M7A D;  2RJD A;  5I2M A;  3RIR A;  4RCB A;  4BB7 A;  5D6W A;  3E9G A;  4BY6 C;  1W2B A;  2JTM A;  4BE2 A;  4KUI A;  1VQ7 A;  3CCV T;  2PVG B;  3HHT B;  4OB3 B;  3E19 A;  2WSF E;  4ZTF A;  3QUI A;  2X4W A;  3F70 A;  3JAM E;  3JCM J;  1VQ9 T;  5J3B A;  3ZEH A;  3CME A;  2E1H A;  4E7I A;  2ZPE B;  1FXX A;  3C12 A;  1H3Z A;  1JBM A;  1OI1 A;  4M77 B;  4ZN1 A;  4PJO G;  3L2U A;  3BDU A;  2LQK A;  2RA2 A;  3CCQ A;  2MF2 A;  2K57 A;  1B34 B;  2LQ8 A;  3PNW C;  1VQ8 T;  1U1S A;  4IUR A;  5GMK h;  2GFA A;  2RJF A;  3OB9 A;  3CCE A;  1G3Y A;  1Y96 A;  3BFM A;  1ZQ1 A;  4F7U E;  4ZGD B;  4XTY A;  5FU7 C;  3LYI A;  4M77 G;  2OAU A;  5FU6 C;  1N27 A;  2R5A A;  3QO3 A;  4KUD K;  5CKD A;  3OYC A;  1KHC A;  3QPH A;  2AHJ B;  3CCV A;  3CEY A;  5CKH A;  3T9N A;  5GMK l;  3NFC A;  4M7A A;  3V7C A;  4EDU A;  1Y96 B;  2QEX T;  1VUB A;  3JB9 F;  2Y4X A;  3FEO A;  3TCJ A;  4ATO A;  1YJ9 A;  2CGH A;  4XU0 A;  4O6J A;  4RMO A;  3OW2 S;  1YHQ T;  1I81 A;  3CC4 A;  2PVD B;  2RK2 A;  3M53 A;  3SFM A;  2RO0 A;  5KCO A;  4E7J A;  1VQ5 T;  1VQM T;  1Q86 C;  4M75 G;  2F69 A;  2WAC A;  5GAN 4;  1X01 A;  1Q82 C;  4PJO B;  1UGQ B;  3GNG A;  3QYH B;  2LCL A;  3JCM h;  4C5G A;  1VQK A;  3WVD B;  1P92 A;  2FVU A;  4J7F A;  4ME7 A;  3JCM b;  1XQH A;  2QQS A;  3V8L A;  1XOV A;  2I2L A;  4RG2 A;  2DXB A;  2XKO C;  3OYF A;  3JCM f;  4M7A F;  5FU6 B;  1WJR A;  2LRQ A;  1N9S A;  4C5I A;  1N6A A;  4BAC A;  4BDZ A;  4XU2 A;  3A8M B;  3CBO A;  4LDW A;  4JS4 A;  1YHQ A;  2ZPI B;  1X6O A;  1JRI A;  3ASK A;  4PJO F;  2EQK A;  3VUZ A;  4ZGE B;  2ZPF B;  3HFO A;  2YLC A;  5CQY A;  1X75 C;  2EJF A;  5GMK j;  2KK4 A;  4EMK C;  4L59 A;  1BI2 A;  4OB1 B;  1VQN T;  2E70 A;  4M77 F;  3CPW A;  1M5Q 1;  2K2V A;  4C0F A;  2LDM A;  3OYJ A;  3A8O B;  1OZ3 A;  1VQ4 T;  3X20 B;  1VQO A;  2RI5 A;  2MWO A;  3CC2 T;  3CPF A;  4XTV A;  4M77 D;  3RMS A;  3KBG A;  4XK8 E;  1O9S A;  5LJ5 g;  2QI2 A;  5KE3 A;  4C8Q E;  1WQW A;  3EAE A;  3G4S A;  2O4X A;  4N4H A;  3G71 T;  3CCR T;  3OBW A;  3JCM c;  2RH2 A;  5GMK m;  5D6X A;  4PJO D;  4PJO A;  3MCA B;  2K3X A;  2ZPH B;  2DO3 A;  3UPU A;  3L42 A;  3HRT A;  3KXT A;  5KE2 A;  3JCM Q;  1M1F A;  1AHJ B;  2XHC A;  3OYD A;  3SDZ A;  2XK0 A;  5FU7 B;  3R6O A;  2D9T A;  4C8Q B;  3FRN A;  3TU4 K;  4BI8 B;  3OYN A;  4M78 G;  4EMK A;  1VQO T;  1RL2 A;  2E6N A;  3M58 A;  4E47 A;  4M75 C;  3H6Z A;  3WXM B;  3JCM g;  2NLU A;  1UGP B;  4FSX A;  4II1 A;  2EQM A;  3OYB A;  4V2S A;  2ZCF B;  5LJ3 f;  3G4S T;  4C8Q D;  5GAN 5;  3G71 A;  3CCR A;  1Q86 U;  1ZBX A;  3FC3 A;  1U8R A;  3ZBD A;  5J39 A;  1K9M C;  5GAN 8;  3GIB A;  2E65 A;  2PQW A;  4ELZ C;  4M7D C;  3GOX A;  4QVZ A;  1JB0 E;  1MHN A;  3CCQ T;  4HCC A;  2DD5 A;  3OS5 A;  4X34 A;  1JJ2 A;  2LVM A;  1BYM A;  3HKS A;  3CBM A;  4PJO E;  3I55 A;  1QP2 A;  1K73 C;  2M16 A;  4NOY A;  5GMK e;  3MP8 A;  1PSF A;  2PUK B;  5KCH A;  2CZ1 B;  1D3B B;  2LCC A;  2H3J A;  4M75 A;  1BIB A;  4XTW A;  4XTX A;  1YJN A;  1VIE A;  4M75 D;  2ZPB B;  3CCS T;  1KHI A;  3QDR B;  2GCX A;  2DAQ A;  4A4F A;  3V8K A;  1NJI C;  4LDY A;  2VC8 A;  3C95 A;  3QZ5 B;  2DTO A;  3A8H B;  1QVF S;  2YRV A;  5FRM A;  4KUL A;  2RJE A;  2FB7 A;  4A4G A;  3HFN A;  4C92 E;  3CMA A;  4E7L A;  1M90 C;  1W4S A;  4M78 F;  2EFI A;  5KH6 A;  3L2W A;  4M7D D;  3I55 T;  1I4K 1;  4M75 E;  4QQ6 A;  2E5Q A;  4Y28 E;  3M59 A;  3VJP A;  1SSF A;  1NPP A;  3J7A F;  2OTJ T;  2RHZ A;  4C8Q C;  1UEB A;  1PSE A;  4M75 F;  2Y4Y A;  2X4X A;  3QKJ A;  3RUX A;  3CPW S;  3CCM T;  3OYK A;  4WF2 A;  4M78 E;  3OYA A;  1YJW A;  2JN0 A;  3CC7 A;  5LJ5 j;  1H64 1;  3CCS A;  1K73 U;  2EJG A;  2WSE E;  3WVE B;  3RES A;  5LJ3 g;  3PMT A;  1YCY A;  5GAN j;  1YBY A;  1YI2 T;  4QVD A;  2LTO A;  3HL8 A;  1B34 A;  1LOJ A;  1VQ9 A;  4OVA A;  3CMA T;  4J83 A;  4FIB A;  1QVF A;  3OMG A;  4J5Y A;  2MWP A;  2VV5 A;  1VQN A;  3M5A A;  2OTJ A;  3S6W A;  3SWN B;  1O75 A;  5GMK i;  1VIF A;  3A8G B;  3GLX A;  1HXD A;  3CCE T;  3RKX A;  2KMT A;  3MEA A;  3OS0 A;  4E7H A;  3HSB A;  2DJZ A;  3L2Z A;  4NL3 A;  4C92 D;  3OMC A;  2KY9 A;  1YIT A;  3V8J A;  2KQW A;  5HK0 A;  4GY5 A;  4QVC A;  4ELY C;  2EKO A;  4BE1 A;  3CD6 A;  4LD9 K;  3LW5 E;  3MO8 A;  4MDW A;  2VGN A;  2JNG A;  3NTH A;  5DLO A;  3CCU T;  1KQS S;  3A5Z B;  3MP1 A;  2K5I A;  1BKB A;  2M1H A;  2VXE A;  1XNI A;  4JRP A;  2RHU A;  3JCM d;  2EAY A;  2LX9 A;  1G3W A;  2JOY A;  4O5V A;  3X25 B;  3CXC S;  5GAO r;  2DKG A;  3CME T;  5CKB A;  2GF7 A;  4L5G A;  2MMP A;  4OGC A;  3SWN C;  2CZ0 B;  5HK3 A;  5FRO A;  2EQJ A;  3VV0 A;  3S3O A;  4M78 C;  4JJN K;  3GP8 A;  3P8B B;  4Q5W A;  2QTX A;  3OBY A;  2A3L A;  4JS5 A;  4NS5 A;  1V29 B;  2E6Z A;  2L5Q A;  3A8L B;  3HRS A;  3MEU A;  4FT4 A;  4VUB A;  3JCM e;  4BE0 A;  2D6F A;  5C6S A;  1Q7Y C;  1K8A U;  2QQA A;  1LNX A;  2CYZ B;  2FL7 A;  2LC4 A;  2ZZD A;  1KD1 U;  4RG8 A;  4M7D B;  2R58 A;  1I5L A;  4J6W A;  3G7Z A;  4HCZ A;  5IAY A;  2KDS A;  4N4I A;  2FYK A;  4KBM B;  4J6X A;  5CK9 A;  2RB6 A;  4A53 A;  4QQG A;  3CC7 T;  3OYG A;  4LD6 A;  1KC8 C;  4LDU A;  5FLX E;  5LJ5 d;  4KT0 E;  4C5E A;  3OY9 A;  4M7D G;  4J8O A;  4D6W A;  1W2B S;  4XQ3 A;  3QJ6 A;  1VQP A;  4XTU A;  1D3B A;  4M75 B;  3CC4 T;  3ME9 A;  3OW2 A;  3OS2 A;  1WNL A;  3PT9 A;  3S3N A;  3LX7 A;  4XU3 A;  2ZPG B;  3L1A A;  1BI3 A;  3H8Z A;  3M56 A;  3PIP A;  4B9W A;  3KUF A;  2RD1 A;  4J6Y A;  2DPP B;  5GAM j;  2PUO B;  3TEE A;  3FIF A;  1N8R C;  3CC2 A;  1UB4 A;  4A4K A;  1M1G A;  1NPR A;  3URG A;  2X4J A;  5GAO n;  1Q82 U;  2HBP A;  4N0A A;  2LT4 A;  2MAM A;  3MHX A;  2CKK A;  4A4H A;  5GAM g;  1TH7 A;  2F5T X;  1Q7Y U;  4EPC A;  4IUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...