4VUBA

Ccdb, a topoisomerase poison from escherichia coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plasmid
molecule keywords CCDB
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4vubA00
5CQXA 5HK0A 5CKFA 4ELZC 5CKHA 3HPWA 5HK3A 4MZTA 2VUBA 3JRZA 2KMTA 5CCAA 4ELYC 5CKDA 1NE8A 5CK9A 4ME7A 5CKEA 5DLOA 1VUBA 4MDXA 1UB4A 4MZPA 3TCJA 1M1FA 4HKEA 2MF2A 5CO7A 4OF1A 3NFCA 1X75C 3JSCA 5CKBA 3G7ZA 4VUBA 5HKCA 5CR2A 4MZMA 3VUBA 2C06A 5CQYA
chains in the Genus database with same CATH superfamily
3QUIA 1OPLA 2RHYA 1QQJA 1VIEA 2HL3A 2RK1A 3X26B 2QEXA 3KUFA 4RTVA 2LC4A 5CCAA 3OS5A 1PSFA 3THKA 5GMKl 4R0KA 2ZPGB 5GAN7 3TCJA 4ZN3A 1M3CA 3G4SA 2CP0A 1VYTA 1W4SA 3MPUB 1Q95G 1WJQA 2BZYA 1VQNQ 2K2VA 5IXBA 2RNAA 2YRDA 4MDWA 2BE9B 1T0HA 2YXYA 2NUTA 4EMHA 3LX7A 1JU5C 5LJ5d 4JLIA 5LJ3e 4M7DB 2X4WA 8AT1B 3GLXA 5GAOp 3REAB 5IT9E 3D7SB 1YJ9T 1UHCA 2LCCA 1BI1A 3QDFA 2QG9B 3MP6A 1BI2A 4IUQA 2RA2A 3JCMc 1ZBXA 2M51A 4EIKA 3MCAB 4J9FA 2VXEA 1I0CA 1WXUA 3CCJQ 2QXFA 3M57A 1K9MR 1VQ4Q 5GJVB 3A8HB 1B3QA 1Q7YR 3CPWP 2A36A 1HXDA 4ATOA 4HT9A 1WHKA 2E12A 4J9CA 1AVZC 5GAN3 2F69A 4HVVA 3SD4A 4M75C 4KULA 2D6FA 3O5ZA 3X25B 2L89A 4EPCA 3RIRA 3JB9I 3X28B 4AFZC 2HKQB 2DAQA 4F16A 3OYFA 3OW2P 3S6WA 2EVRA 2CP6A 2QTXA 1M27C 2X4JA 4BY6B 4ZNXA 1ZSGA 1UJYA 3BE3A 4QQDA 4PJOC 3CXCP 2P4RA 2JTEA 2K3BA 1OU9A 1P92A 4HA8A 3FJ5A 1LCKA 5GAMj 2DRMA 3CMAQ 1PKSA 1NLPC 2KT8A 3N5BB 2ZPFB 2QA4T 3FJPA 3EG9B 4M78F 2BTTA 1YI2A 3OYEA 2MWPA 1ZA1B 4ZGJB 4KGVB 1QVFS 1D1BA 1NYGA 2OTLA 1M90C 4ANJA 1YJWA 4DBQA 4OMOA 2DXCA 3JSCA 3CD6A 4EMKB 2J05A 1KQSS 2J6OA 1PD1A 2OAWA 1G8XA 4XAXB 1DJ7B 1VQMQ 1X2QA 1NPRA 1NE8A 4N0AA 1UGPB 2E41A 2EQIA 1LOJA 2DIGA 2A08A 2IPOB 1YHQA 1M2OA 1WA7A 2DO3A 3A8GB 4JRQA 3CCVA 4CC7A 4Q5WA 2CS7A 2DL5A 3MKDA 2QGGA 1D1CA 1RAIB 3IQLA 4J8OA 4QQGA 4D6WA 5KYNA 2DIQA 2ESWA 2CKKA 4J83A 4HXJA 4F7UG 3P8DA 4ME7A 2E6ZA 4M75D 2KYMA 2LMJA 1YFNA 1S72T 3LW5E 4UC4A 3C0CA 1M90U 2P0QA 3SWNC 4B9WA 2ZPEB 2O9VA 4C92G 2XU8A 2EBPA 1ZX6A 2HEQA 2EFIA 1VYUA 1KQ2A 2LT1A 3OYHA 2DXBA 1Y07A 2F5KA 2XI9A 4PJOD 3CC7A 1VQOQ 3CEYA 5KYXB 4AG1C 3KXTA 4OMLA 1WJSA 3JB9G 2DL7A 4XK8E 1TG0A 2EJGA 2MF2A 1KD1C 3UF4A 3PT9A 2LX7A 2QK0A 4A54A 3JCMd 1BIAA 4MMKA 1IB8A 1MGQA 3OYYA 2K3YA 4J5YA 3QWXX 2RQVA 2AK5A 1LJOA 3EGDB 1WHGA 2EJ9A 1RLPC 3QG1A 4RCBA 3OYDA 1VQ8Q 1HYOA 5GMKm 1NEGA 2DL4A 5CO7A 2CP3A 4RTYA 2IG0A 3DB3A 3CCST 1FMVA 1OPKA 3AT1B 3I35A 4JUVA 3WVEB 2EGAA 2HKNA 1BIBA 1WJRA 1WQ7A 1WPYA 2M9UA 3QDRB 1BK2A 1SHFA 1PKTA 2OI3A 4AT1B 4M7AE 3GF5A 4R56A 2CP2A 4PFPA 3LGFA 2CZ0B 4CC2A 2FZKB 5IXFA 3M4GA 1YJNQ 1VA7A 3X24B 4RG8A 1M2VB 3M55A 4C92B 3OYMA 4XTUA 1VQ6T 1ZLMA 2RQWA 4ELYC 2JW4A 3HSBA 1WFWA 2JZ2A 4FW1A 1V29B 1U5SA 4A4KA 2KT1A 1M8VA 1UJ0A 4M7AA 4HT8A 2ED0A 1I81A 1N8RC 1VQ9Q 3G4SQ 4RTZA 3RKWA 4XU2A 1M5Q1 3H0FA 1TOVA 1VYVA 5FROA 1H92A 5GMKh 3CQTA 1IXDA 2L3SA 2VUBA 4BB7A 4CI0C 2ZPIB 1R8OB 2JJ9A 2K5IA 1UGSB 1OOTA 4XTWA 2QDYB 3LYIA 1VUBA 4ZGEB 2F2XA 1SHGA 2QQ9A 3NFCA 3I56A 1UG1A 2RI2A 2DEQA 1PD0A 1Q86U 1VQNA 1M90R 1TSFA 2RJFA 4QW2A 5IHIA 4FYWB 1Y7XA 1SSFA 5GAMd 4C5HA 1IHWA 4BI8B 1E7OA 3QZ9B 4CC4B 2JS0A 1I07A 4WTOB 5IHKA 3VYGA 1E6GA 2GQVA 3L1AA 3V8LA 4LD9K 3G71T 1UGQB 2XKOC 2NLUA 2ROLA 2QAZA 4M77E 1QVGA 2ATCB 3BDUA 1NM7A 1G3YA 5CAIA 3OYBA 3RERA 5I22A 1ABQA 1RABB 3EG2A 4C8QG 3HRUA 3CCJA 1AEYA 1VQ4A 2CP5A 1U06A 3MEAA 2M1HA 4OGEA 3QO3A 4M77A 5DY9A 2WSCE 2K2MA 3ZEHA 2DZ9A 2HAXA 3LGLA 2CZ7B 3EFOB 1VQ7T 4OMFB 5GAOr 3RMSA 4Z02A 4FSSA 2MWOA 1ZSZA 4RUGA 2J06A 2LDMA 2L3RA 2B8AA 2COWA 3LH5A 3GPLA 2RHZA 1ZBJA 2OTLQ 1WQWA 3CCMA 5CKBA 5I11A 3CD6Q 1TH7A 1TUDA 3CCEA 1KD1R 1WIEA 2O88A 2XMFA 5GAN8 3RR6A 4ELZC 3LWHA 4XU1A 2HL5C 2E64A 3OYGA 1KC8C 2GTOA 2PVGB 1XTDA 4N4HA 4BE1A 1W2BS 2R58A 1M9SA 1YHQQ 3CCVQ 4QKUA 2ENMA 3V8JA 3LH0A 2E4HA 2P4TA 4BDZA 2O9SA 3OY9A 1Y96A 2QGFB 1OV3A 5GANe 1GBQA 1OZ2A 3UWNA 3CCQQ 4KH0B 3META 3JCMg 5KYUB 2O4XA 2L5QA 5LJ3j 3ME9A 3P8BB 4C8QB 1IO6A 4XTXA 5FW9A 2KSSA 2M02A 2EYZA 4E7ZA 3M0TA 1SSHA 3FRNA 4DQ2A 4OMPA 2A28A 2NUZA 4XU3A 2G3RA 4PL6A 4J7IA 4DBRA 3JCMJ 3E9FA 4N0AC 1VQKA 2V8JA 2CSQA 2VGMA 2IVWA 3JV3A 1QWEA 5LJ5f 4GY5A 3EFRA 2VYTA 2YRCA 1GRIA 3CC7Q 4RTXA 5LJ5h 1LNXA 3EG3A 4TVRA 4A63B 4F17A 4M7DE 4VUBA 5FU7C 3VRYA 4M4ZA 2X35A 4PLIA 1N8RR 2GBQA 2FL7A 1ARKA 5GAOl 4JRIA 4KH1B 2E3HA 3EH2A 2EQJA 2FPFA 3JCMQ 2OTJA 3M0PA 2BZ8A 1MHNA 2B86A 3M56A 3CCUA 2YUOA 5FU6C 5KCHA 2CREA 4DEYA 2ROTA 2D9TA 2QDLA 1QVPA 4KUIA 4E7HA 4M7DA 4D8DA 3VRZA 2KY9A 3PMTA 1ACMB 3CCLQ 1M30A 1VOMA 1Q81C 2HMAA 4M78G 4FCYA 2LJ1A 1UDLA 3NHNA 4IUVA 2KROA 4M75F 5FWBA 2E70A 3CMET 2GCXA 2YWWA 1RI0A 1X27A 3FDRA 1I5LA 1AOJA 1SRMA 1WDXA 2CP7A 1GBRA 1ZUKA 3L2VA 1NLOC 1EZZB 1JRIA 4PJOF 3E1SA 2LNVA 1IGQA 1G2BA 1NG2A 1H3ZA 1UB4A 3SWNB 4MZPA 5GAMg 4GLMA 1VQ5A 6AT1B 2DTHA 1YITQ 3A1PA 1PWTA 3A8MB 2BKDN 4FYXB 1YJNA 3ZL7C 4PKCC 2FPEA 2DK3A 3PMIA 4RMOA 2KRNA 5FWCA 3EG1A 3QHSA 4OMNA 1Q81U 5EC7A 5CK9A 1WI7A 2KNBB 1SF9A 3BY7A 4NS5A 2O31A 2VKNA 4JDSA 4EDUA 4JS4A 2O01E 1B34B 2KEAA 3EG9A 3G6EA 1VQ9A 3OYNA 3I56Q 4MZMA 2CH4W 2V8KA 4Z8AA 1NPPA 5HK0A 1TXQA 2DD4A 5IAYA 5KE3A 2E65A 2RK2A 1VQPT 3PIOA 4M7AC 1UUEA 2HQHA 3MP8A 2MOXA 5C6SA 2MYSA 2J7IA 3C94A 3MEVA 4M78B 2P0KA 2R57A 4F14A 2G6FX 1KC8R 1H641 1PC0A 2DE0X 3I5RA 2CZ6B 1K4US 2DF6A 5A0GA 2X9HA 4CRIA 2WSFE 5CKFA 2VV5A 2V1RA 2AKLA 1RAAB 3RKXA 2XICA 4II1A 4V2SA 2EYQA 2NUPB 2RF0A 3DLLA 1YJ9Q 1KIKA 2HD0A 3L2ZA 1RAHB 4OF1A 2L8DA 2PZ1A 1YN8A 1JJ2P 3JCMf 1R0CB 4XTVA 3F70A 1K8AC 4J9HA 3JCMh 2H3JA 3CC4T 2LP5A 2KQWA 1ZQ1A 2CUBA 2CYZB 4PFZA 4RKUE 4JPBW 2LQNA 5LJ3d 1QP2A 2LQWA 1X75C 3CCMQ 3CC2T 1KHIA 5KYXA 2EIFA 5L23A 5CQYA 2ZAEA 2YLBA 3CCEQ 1WYXA 1PRMC 3CMAT 1K9AA 4E6RA 4FW2A 1RAEB 3BDLA 3EGXB 3HFOA 4HCKA 1I5OB 5GAN6 3PFSA 3VKIA 2RH2A 4PJNA 3KBGA 1PNJA 4M77C 3FB9A 4E7SA 2DA9A 5KYWA 2JOYA 1UGVA 1UE9A 3M59A 3L2WA 3OQ5A 4F7UE 4ZTJA 4M7AD 3OA6A 3A8OB 2XK0A 1OYXA 1ZSZC 1QVFA 2QA4Q 1K8AU 5A0LA 1VQMT 4E7LA 4JZ4A 2F1LA 5GAOm 4E2FB 2M0OA 1KQSA 2NWMA 1Q81R 4C92E 4IURA 5GANg 4OP0A 3PNWC 2NUTB 1NJIC 2QASA 3J80E 4XQ3A 2PNIA 5D7UA 1IGUA 2O2OA 1GXIE 1FWZA 3UT1A 4F7UA 3EG0A 3QXEB 1VQKQ 3CCQA 3M0RA 1X6BA 3WVDB 3M54A 1ZUUA 1M2VA 1HJDA 1XJWB 2XD0A 4C92A 3MO8A 2RHUA 2EGCA 2DZCA 2Y4XA 5J39A 2ED1A 5HKCA 4IUTA 3G1JA 1QCNA 1JXOA 5GAMf 4X9CA 2LJ3A 3QJ6A 4MZTA 1YNZA 2OTJQ 5GAMh 3CPFA 4E47A 2EYYA 1H3HA 1VQOT 3CCUQ 4DBHA 1S72Q 2R5MA 4ZGDB 5M9OA 2RO0A 5CR2A 1NJIU 1VQLT 3CCRT 4ORZA 4M77D 3I55A 5CIUA 4LN2A 1YIJT 3OS2A 2K9GA 2YLCA 2HQEA 1VQ8T 1W6XA 4FYYB 2AZVA 3JCMV 2DXTA 1QP3A 2L0AA 1QW1A 1BCMA 2ZCFB 2JMCA 4J9DA 1OU8A 5AT1B 3E2UA 3EAEA 2CGHA 3CCLA 1WXBA 2KMTA 1AWWA 1N5ZA 3NMZC 1V1CA 3OMCA 1K0SA 2MPXC 4QVZA 1VQ5Q 2MCNA 1KG1A 3DB4A 1KD1U 1C0MA 2LCSA 1G3TA 1MUZA 5GANj 1X6GA 1UECA 3DKMA 2WACA 1R0BG 4FL6A 2DYIA 2QEXT 2DX1A 4AFSC 1K8AR 1D3BB 5GAN2 1D0ZA 4AG2C 4JRKA 3EFOA 5FU7B 3SHWA 4HKEA 3G6EQ 3G4ST 1YITA 5FRNA 3A5ZB 2LNHB 3H6ZA 2BZXA 2VC8A 4OB3B 1CKAA 1C6VX 4O6JA 1VQ6Q 2GFAA 5FU6B 2P84A 3QZ5B 3M0QA 4FT4A 2D1XA 4KT0E 3RNJA 3OS0A 2X4YA 4KBMB 4BY6C 1AZEA 3EGUA 2FZGB 1UHFA 5A2QE 1E6HA 1N9RA 4BI4A 5KE2A 3GNFB 3M0SA 2PVDB 2XG8D 4C8QE 2LJ0A 2LX9A 3HP9A 4BACA 5LJ3g 2YUQA 3QBYA 5D6YA 2X51A 1U1TA 4KRTA 2GNCA 2K4YA 4C0ZA 1EIFA 5EG2A 1LPLA 3VS7A 2E5KA 3HL8A 1UTIA 1ZA2B 3L2RA 2H3EB 5KYUA 2DL8A 4GBQA 4ESRA 3QYGB 1N8RU 3S3NA 5C0MA 3SFMA 4C8QA 3OYIA 4J9IA 2E6NA 1NJIR 1RADB 3FIFA 3I9QA 2EQUA 4N4IA 2VASA 2AKKA 4M75G 2JMAA 2EGEA 1YJ9A 2ZPBB 1K1ZA 2M0YA 2JTFA 3RBBB 3PIPA 2LQ8A 4BD3A 1KQSP 1WNLA 4PJOG 2DETA 5IH2A 1WHMA 1YI2T 1EX4A 5ECAA 5GMKe 3VS2A 4QVDA 1MV3A 4IIMA 2OTLT 1BBZA 1YJWT 2H8HA 1YWPA 2PUKB 3H8ZA 1N9SA 3CD6T 4J6WA 2D0NA 4JRPA 1WHLA 1VQ7Q 1GCQA 3VS1A 2L2PA 3CPWS 1YWOA 2JT4A 2I2LA 4J9BA 1D09B 2DBKA 1JJ2S 3V7RA 2JS2A 3PTAA 2QQBA 2FG0A 3X20B 2MIOA 2MK5A 1YHQT 4JZ3A 2D8HA 2JXBA 2Y4YA 4B6MA 4HCBA 3OYAA 5J26A 1OEBA 3OW2S 3H0HA 1W2BA 5DLQE 2QA4A 3JB9J 2BIVA 2EKHA 3VJPA 3OYCA 3CXCS 4RG2A 1ZHIA 3I5SA 4M75B 3GBQA 2YT6A 3MEWA 4PJMA 1W70A 2JVVA 3QPHA 3JCMP 2AT1B 2ZPHB 2COZA 3T9NA 3FC3A 3MP1A 2CT3A 1C1AA 1IHVA 3HRSA 3H0IA 3CC7T 4PJOB 2LQKA 1I1JA 1KC8U 2JM9A 1I4K1 3PE0A 3UATA 2LCLA 1RL2A 2K57A 1AD5A 5I2SA 2KXCA 4M7AF 4M78E 1QCOA 2IIMA 2K3XA 3FEOA 1B34A 2DILA 1D1AA 2E3IA 5I2MA 1XOVA 3I55Q 4C92C 5GANd 2AZSA 3BFMA 4ZTFA 5DLOA 2EPDA 2L3PA 4JLGA 1K73C 4L5GA 3O8VA 1S72A 1RI9A 3HFNA 1PHTA 4J6XA 3TEEA 2KRSA 2HCKA 1YBYA 1QLYA 2C0IA 1ZSZB 3Q1JA 4GLKA 2F5TX 1PM3A 4M78A 5GAN5 5CKHA 3QJYA 2X4XA 3ULRB 4OB0B 3JB9H 2YDLA 1UEBA 2KYBA 2QQAA 1TTHB 7AT1B 2FPDA 4K11A 2QI2A 2HZYA 1MNEA 2VWFA 1M1KC 2KK4A 2GQIA 5LJ3h 2DTIA 3VUBA 3M53A 2NUPA 4HVUA 1SPKA 3OB9A 3E9GA 1QCFA 1OQKA 4IUPA 4HCCA 2DM1A 3M5AA 4OMQA 2A0FB 2EYWA 1Y96B 1F1BB 4BDYA 2AIRB 4J9GA 4F04B 1Q82C 2CT4A 3ER0A 2FB7A 4E7KA 1O9SA 3NPFA 2CZ1B 2PU9B 3CCSA 2KR3A 5LJ5e 4A4FA 3HTRA 2DJQA 4M77F 3VS6A 3URGA 2GFUA 1MMDA 2HNIA 2RB6A 4OGCA 3M58A 3VUZA 3LWIA 4YTLA 1QVGP 2SEMA 3EGXA 1M1FA 3J7AF 1AWJA 2HSPA 2I0NA 3I56T 1NZ9A 4DEXA 4KUDK 1VQNT 3RDVA 4IKFA 2RJDA 4C92D 1H8KA 2DBMA 1EFNA 1VQ6A 1MNDA 3M4YA 4A4HA 5FLXE 4EMKA 4PK4A 2DL3A 2XDDA 1RUWA 3MEUA 3TQ7P 3JB9D 1NEBA 1Q82U 3R6OA 1JQQA 4D8KA 4A53A 2VVKA 2VXFA 5KCOA 1VQPQ 2PQWA 3HHTB 3SEMA 4LNPA 3TU4K 2RHIA 1OZ3A 3CCJT 5HY6A 2RHXA 3S3MA 1VQ4T 2J6FA 1T0JA 1MMAA 2XDPA 3SDZA 1TWBA 1CSKA 4C5GA 3C4SA 1OULA 2FEIA 1KFZA 2EQKA 3H9NA 3VS4A 2RI5A 2HDAA 5KYYB 2RM4A 4NL2A 3EFSA 1M3BA 1G5VA 2COYA 2RN8A 5KH6A 3G71A 2M16A 2E5QA 4C8QC 2QQRA 1W2BP 2DEUA 1M1GA 3CCMT 4Z89A 4PJJA 1OX9A 1ZUYA 2X3WD 4BI3A 1TUGB 8ATCB 3CCET 4XTZA 5D6XA 4B9XA 3CC4Q 4JJNK 2PVOB 2DNUA 3ZBDA 3HPWA 3JRZA 4X9DA 4JS5A 1FX7A 3NTIA 3QSUA 4NL3A 1X69A 2LRQA 3CC2Q 1GFDA 1Y57A 2HBPA 1AHJB 1N6AA 5GAOn 2EWNA 1K73R 3EGDA 2DYBA 4DOVA 1Z9ZA 2K7AA 1VQ7A 4JJBA 1X01A 3QIIA 4E7JA 4M7DF 1WGSA 1SRLA 1A0NB 3TVTA 1TUCA 3CBPA 2F2WA 3WXMB 4AFUC 1X43A 3M0UA 1GCQC 3U23A 1M1KR 1HK9A 1WXTA 2HSEB 4C0GA 2A37A 1Z9QA 2LZ6B 4Y91A 1HSQA 4BUGA 1BYMA 1VQKT 3L42A 1T3SA 1Y0MA 2C0OA 2KVQG 2Z0WA 3REBB 4LDVA 2YUPA 4HCZA 1JB0E 1X2KA 3JCMe 3UPUA 2VGNA 4FT2A 1JXMA 1D3BA 1T3LA 2GGRA 1Q82R 5CQXA 5GAN4 4HVWA 3V7SA 4C0DC 4NOYA 2OTJT 2K5FA 5D6WA 5IHNA 4C8QD 4RTWA 3VYHB 3CCUT 1AWXA 1B7TA 3INZA 3S3OA 1G3WA 1BU1A 1G3SA 1BKBA 2C0TA 1AZGB 1QKXA 1RACB 2FHDA 5CVIA 3PGGA 1KHCA 2DERA 5LL6S 4Y92A 4OB2B 3E19A 3EHRA 1BCOA 1M4ZA 2EQMA 3QKJA 2W10A 3ASKA 5AYFA 4XTYA 1MMNA 3P8HA 1WZOA 2QQSA 2V26A 2YSQA 2CSIA 5GMKj 4QVCA 1BI3A 1VQLQ 3HKSA 4RTTA 3G7ZA 1LVKA 3PVQA 3NTKA 3OSSC 2DKGA 2RMOA 3CCRQ 3OS1A 2FZCB 3BW1A 2LTOA 2J6KA 5KYWB 4BE2A 3GOXA 1KSWA 1YIJQ 3TREA 2EAYA 4FSXA 2ABLA 2ZZDA 2L3QA 2RJCA 1X6OA 4M7DC 4RTUA 3OMGA 4M78C 4DA4A 1VQ5T 1GL5A 1XQHA 2RQUA 3OYKA 2RQRA 3CCSQ 1YJNT 2DVJA 4DBFA 2PTKA 2P0PA 4JJCA 1YCYA 3CMEA 4F7UB 2FVUA 1D0XA 2JN0A 5LJ5g 1Q86C 1W1FA 2KAFA 3G6ET 1VQ9T 4L6V5 2K6DA 2C06A 5GAMe 1QMCA 3NGPA 2R5AA 2YRVA 1AWOA 4OVAA 2V8IA 4LXCA 2QEXQ 2A3LA 3JCMX 5GJWB 2CUDA 1KK7A 1TS9A 2CDTA 3MJXA 2DXUA 4ZN1A 3L2UA 4JJDA 4FM4B 1R77A 4OMMA 4P5NA 3RESA 2RPNA 3C95A 3V8KA 3VV0A 2JUFA 4AFQC 4M7AG 1CKBA 3RKYA 2RQTA 4M75E 1BB9A 4C5EA 1UFFA 4LDUA 2ECZA 4C5IA 4N4GA 1U8RA 1TU0B 2JNGA 2WSEE 2FYKA 1J3TA 3NTHA 2KDSA 2E10A 3VS0A 4PJLA 3UDCA 2K79A 1SEMA 2XIDA 5J3BA 4PJOE 4LDXA 1U3OA 2PUOB 2KI7A 4EMKC 4M75A 2DJZA 1RAGB 2QYZA 1VQPA 1K76A 4C0FA 1RAFB 5GANf 1QVGS 1FMKA 4M7DD 4F7UF 4M78D 4QQ6A 5GANh 3LLRA 3G71Q 2VB6A 1XNIA 3RMQA 2YHTA 3MHXA 4J6YA 1QVFP 1ABOA 1Y71A 4PJOA 2HQXA 1M3AA 4C92F 1FMWA 1WX6A 2MMPA 4FU6A 4DOWA 4Y28E 1JEGA 3OBWA 4CC3A 1QKWA 2KE9A 4KGZB 4E7IA 4XU0A 2LVMA 1MV0B 2DVEA 3JB9F 3OBYA 2QTVA 4PLLA 2YUNA 1O75A 4PFOA 4X34A 5LJ5j 1B07A 4M7AB 4M77G 3CC4A 2D8JA 2RD1A 3A98A 1NYFA 4L59A 3PVLA 5CKDA 1PSEA 2KXDA 1YI2Q 4LUEA 4MMLA 2SRCA 1IRXA 2JM8A 2X3XD 3JCMW 4MDXA 1YJWQ 2CH4A 1YCSB 2FO0A 3CC2A 3L2QA 3CPWA 5HCKA 4BE0A 2DMOA 3CCVT 3TSWA 3CMAA 2KGTA 2ZGWA 1UGRB 1JJ2A 2GF7A 2LT4A 1OI1A 3CCQT 4IIOA 4QT7A 1AT1B 1FYNA 5L8RE 3C12A 3OW2A 1OX8A 3QYHB 3KFVA 1NBEB 1JBMA 1N27A 1G83A 1KJWA 1YP5A 3OYJA 2HBWA 3VU3C 4RCCA 2RJEA 3SWNA 3CXCA 1K9MC 1K0XA 2BUDA 2MI6A 1VQMA 1Q7YC 3UA6A 2DTOA 3EH1A 2EYXA 2D0QB 3EHQA 4EMGA 2OX7A 3UA7A 1WLPB 4R55A 4LE9A 1JO8A 3GNGA 2DD5A 4Z88A 5DM7R 4WF2A 1GFCA 4J9EA 3ZFJA 5GAOq 1Q86R 1WHHA 5GMKi 1GCPA 4LDWA 2F2VA 3I55T 4M77B 2XDBA 1IZ6A 1S1NA 2EJFA 1RLQC 1IREB 1QWFA 2W0ZA 2JTMA 3H41A 1MMGA 3SB2A 2Y90A 1SKUB 3QWYA 3TSZA 2RI3A 4PNOA 5A0DA 3GP8A 2NYSA 2E1HA 2KRMA 3CBMA 3CCLT 4LUDA 2XHCA 3V7CA 5HK3A 1K9MU 3AHUA 2EW3A 1Q7YU 9ATCB 3GIBA 4OB1B 1VQOA 2EKOA 2OAUA 4WCIA 3VS5A 2OJ2A 4KGXB 5LJ3f 1KQ1A 2DPPB 3DLMA 4FIBA 1VQLA 3VS3A 2AHJB 2V1QA 1U1SA 2GTJA 2FRWA 3CCRA 1D0YA 4M7DG 3OSVA 3CBOA 2KBTA 4C8QF 1I8FA 1YIJA 5CKEA 2DFUA 5FRMA 4IUUA 1VQ8A 3CMEQ 3OYLA 1BI0A 4FYVB 4AMCA 5KYYA 3A8LB 1K73U 3R6NA 1HD3A 4O5VA 1PCXA 2K5LA 1M8MA 1YITT 1VIFA 4J7FA 4LD6A 4LDYA 2O4XB 1PG5B 4C0DB 5I21A 2BE7D 3RUXA 2DRKA 1WHJA 3HRTA 1PRLC 2MAMA 5IN1A 3M9QA 2FRYA 4A4EA 3JAME 3J81E 1SG5A 1FXXA 2DLPA 4X1VA 3JCMb 1V76A 1M1KU 4A4GA 3FLGA 2A7YA
chains in the Genus database with same CATH topology
2VC8A 4C0GA 3QUIA 4BDZA 4OB3B 1Y96A 3OY9A 5GANe 4O6JA 2RHYA 4Y91A 1VIEA 1KC8U 1OZ2A 4BUGA 1BYMA 2RK1A 3X26B 3UWNA 2QEXA 1VQKT 3KUFA 2GFAA 2LC4A 3META 5CCAA 5FU6B 3L42A 1PSFA 3OS5A 3JCMg 5GMKl 3QZ5B 2ZPGB 2O4XA 2KVQG 2L5QA 4FT4A 5GAN7 5LJ3j 4LDVA 3ME9A 3P8BB 4KT0E 3OS0A 4C8QB 2X4YA 4KBMB 4BY6C 4XTXA 3TCJA 4ZN3A 4HCZA 1JB0E 5A2QE 3JCMe 3G4SA 2KSSA 1W4SA 1N9RA 1WJQA 4BI4A 2VGNA 3UPUA 4FT2A 5KE2A 3GNFB 2PVDB 2K2VA 3FRNA 4DQ2A 1D3BA 2XG8D 4C8QE 2LX9A 3HP9A 4XU3A 5CQXA 2G3RA 4PL6A 4J7IA 5LJ3g 4BACA 3QBYA 4MDWA 5D6YA 3JCMJ 3E9FA 1U1TA 4N0AC 5GAN4 1VQKA 2K4YA 2V8JA 2VGMA 2IVWA 3V7SA 4C0ZA 4C0DC 4NOYA 5LJ5f 4GY5A 1EIFA 4EMHA 2OTJT 5EG2A 3LX7A 2K5FA 3EFRA 5D6WA 5LJ5d 2VYTA 4JLIA 5LJ3e 4M7DB 4C8QD 2X4WA 5LJ5h 1LNXA 3VYHB 3HL8A 3CCUT 3INZA 3GLXA 4TVRA 5GAOp 3S3OA 3L2RA 5IT9E 1YJ9T 1G3WA 2LCCA 1BI1A 1BKBA 1G3SA 3MP6A 3QYGB 4VUBA 1BI2A 5FU7C 1N8RU 2FHDA 4IUQA 4M7DE 2RA2A 3S3NA 2X35A 5CVIA 4PLIA 3JCMc 5C0MA 1ZBXA 3PGGA 1KHCA 3SFMA 4C8QA 2FL7A 3OYIA 5LL6S 2E6NA 3MCAB 5GAOl 3FIFA 4JRIA 4OB2B 3E19A 2VXEA 2EQJA 3JCMQ 2OTJA 2EQUA 1M4ZA 4N4IA 2EQMA 3QKJA 1MHNA 3ASKA 2QXFA 3M57A 5AYFA 4M75G 3A8HB 4XTYA 3M56A 3CCUA 3P8HA 5FU6C 2QQSA 1HXDA 1YJ9A 4ATOA 5KCHA 4HT9A 5GMKj 2ZPBB 2E12A 4QVCA 5GAN3 1BI3A 2F69A 2D9TA 3HKSA 1QVPA 3G7ZA 3SD4A 4KUIA 4M75C 4KULA 4E7HA 3NTKA 4M7DA 2D6FA 3OSSC 2DKGA 2KY9A 3PMTA 2JTFA 3X25B 3PIPA 3OS1A 2L89A 3BW1A 2LTOA 2LQ8A 4EPCA 4BD3A 3RIRA 1WNLA 4PJOG 3X28B 3JB9I 2DAQA 3OYFA 4BE2A 1Q81C 4M78G 3GOXA 4IUVA 3S6WA 2QTXA 2X4JA 4BY6B 4M75F 1YI2T 3TREA 2EAYA 4FSXA 2E70A 2ZZDA 3CMET 2GCXA 2RJCA 5GMKe 4QVDA 1X6OA 4M7DC 4QQDA 4PJOC 2OTLT 1RI0A 3OMGA 1YJWT 4M78C 4DA4A 1VQ5T 2PUKB 3H8ZA 1XQHA 3FDRA 1N9SA 3CD6T 1P92A 4J6WA 3OYKA 1I5LA 4HA8A 4JRPA 1YJNT 5GAMj 3L2VA 3N5BB 3CPWS 2ZPFB 2QA4T 3FJPA 1JRIA 2P0PA 4PJOF 4M78F 3E1SA 1YI2A 3OYEA 2I2LA 2LNVA 1YCYA 2MWPA 1JJ2S 4ZGJB 3CMEA 4F7UB 1H3ZA 2FVUA 1UB4A 3SWNB 4MZPA 3V7RA 5GAMg 1QVFS 3PTAA 2QQBA 2OTLA 2JN0A 5LJ5g 1M90C 1YJWA 3X20B 1VQ5A 1YHQT 1Q86C 2DTHA 2KAFA 2DXCA 3JSCA 2Y4YA 3G6ET 1VQ9T 3CD6A 3A8MB 3OYAA 4EMKB 4HCBA 2BKDN 5J26A 4L6V5 1YJNA 2C06A 4PKCC 5GAMe 1KQSS 3OW2S 2DK3A 2R5AA 2YRVA 1W2BA 3PMIA 4OVAA 2V8IA 4XAXB 1DJ7B 5DLQE 4RMOA 2A3LA 3JCMX 2QA4A 3JB9J 1NPRA 1NE8A 3QHSA 2BIVA 1Q81U 5CK9A 4N0AA 2DXUA 4ZN1A 3VJPA 1UGPB 2E41A 3BY7A 4NS5A 3OYCA 3CXCS 1LOJA 3L2UA 2DIGA 4JDSA 4RG2A 1ZHIA 4EDUA 4JS4A 4FM4B 2O01E 1YHQA 4M75B 1B34B 2DO3A 3A8GB 3MEWA 3G6EA 1VQ9A 4P5NA 4JRQA 3RESA 3OYNA 3CCVA 3C95A 3V8KA 3VV0A 2JUFA 4M7AG 4Q5WA 2CS7A 4MZMA 3RKYA 2JVVA 2V8KA 3QPHA 3JCMP 4J8OA 1NPPA 4QQGA 4D6WA 4M75E 2ZPHB 2DD4A 5HK0A 2DIQA 5IAYA 2E65A 5KE3A 3T9NA 2CKKA 4C5EA 3MP1A 2RK2A 4J83A 3FC3A 1VQPT 4LDUA 3PIOA 4M7AC 4F7UG 3P8DA 4ME7A 4C5IA 3HRSA 3MP8A 4N4GA 3CC7T 5C6SA 1U8RA 2LQKA 4PJOB 3C94A 3MEVA 4M78B 2E6ZA 2JNGA 1I4K1 2FYKA 2P0KA 2R57A 2WSEE 4M75D 3NTHA 1S72T 3LW5E 4UC4A 1H641 2LCLA 1RL2A 2KDSA 2E10A 1M90U 2P0QA 3UDCA 2K57A 3SWNC 4B9WA 2ZPEB 2CZ6B 2XIDA 5J3BA 5I2SA 4C92G 4PJOE 2XU8A 4LDXA 4M7AF 4M78E 5A0GA 2PUOB 4CRIA 2K3XA 2WSFE 2EFIA 4M75A 2DJZA 3FEOA 1B34A 5CKFA 4EMKC 2VV5A 1VQPA 1KQ2A 2LT1A 3OYHA 4C0FA 5I2MA 2DXBA 1XOVA 1Y07A 5GANf 3RKXA 2XICA 2F5KA 4II1A 2XI9A 4C92C 5GANd 1QVGS 4M7DD 3BFMA 4PJOD 4F7UF 3CC7A 3CEYA 4ZTFA 4V2SA 5DLOA 4M78D 4QQ6A 2EYQA 5GANh 3KXTA 3LLRA 4JLGA 1K73C 4L5GA 1WJSA 3O8VA 3DLLA 1S72A 3JB9G 1XNIA 4XK8E 2HD0A 3RMQA 3HFNA 2EJGA 2MF2A 3L2ZA 4J6XA 2L8DA 4OF1A 3TEEA 2YHTA 3MHXA 1KD1C 4J6YA 1YBYA 3PT9A 3JCMf 1Y71A 4PJOA 3Q1JA 4GLKA 2HQXA 4A54A 2F5TX 4C92F 3JCMd 4M78A 4FU6A 2MMPA 1BIAA 4XTVA 4DOWA 3F70A 4MMKA 1K8AC 1MGQA 3OYYA 4Y28E 3JCMh 2K3YA 5GAN5 2H3JA 5CKHA 3QJYA 2X4XA 3CC4T 4OB0B 4J5YA 3OBWA 3JB9H 2KQWA 1UEBA 1ZQ1A 2CYZB 1LJOA 2QQAA 2QI2A 2EJ9A 3QG1A 4RCBA 3OYDA 4XU0A 2LVMA 4RKUE 4E7IA 5GMKm 1M1KC 2KK4A 2DVEA 1QP2A 5CO7A 5LJ3d 3JB9F 3OBYA 1X75C 5LJ3h 3CC2T 1KHIA 4PLLA 2DTIA 3VUBA 1O75A 2EIFA 3M53A 2IG0A 3DB3A 5CQYA 2YLBA 3CCST 3CMAT 4X34A 4JUVA 3OB9A 3E9GA 5LJ5j 4M7AB 4M77G 3WVEB 3CC4A 2RD1A 1BIBA 1WJRA 3BDLA 3HFOA 4L59A 1WQ7A 5GAN6 1WPYA 3PFSA 5CKDA 1PSEA 2M9UA 4IUPA 4HCCA 3M5AA 3VKIA 3QDRB 2RH2A 4MMLA 3KBGA 4MDXA 3JCMW 1Y96B 4M7AE 4BDYA 4M77C 3FB9A 3GF5A 4R56A 1Q82C 3CC2A 3L2QA 2JOYA 3ER0A 2FB7A 3LGFA 3CPWA 2CZ0B 4E7KA 1O9SA 4BE0A 3M59A 2CZ1B 3M4GA 3X24B 4RG8A 2PU9B 3L2WA 3CCSA 3CCVT 3CMAA 3OQ5A 4F7UE 2ZGWA 4ZTJA 1UGRB 1JJ2A 4M7AD 5LJ5e 3M55A 3A8OB 2XK0A 4A4FA 3OA6A 1OYXA 1QVFA 4C92B 2GF7A 1K8AU 5A0LA 4M77F 3OYMA 4XTUA 1VQ6T 2LT4A 3URGA 2GFUA 1VQMT 1OI1A 4E7LA 2HNIA 3RERA 4ELYC 2RB6A 3CCQT 3HSBA 5GAOm 4OGCA 2JZ2A 3M58A 5L8RE 1V29B 3C12A 3VUZA 3LWIA 2M0OA 4A4KA 1KQSA 3OW2A 1M8VA 4C92E 4M7AA 3QYHB 4IURA 4YTLA 4HT8A 5GANg 1M1FA 4OP0A 1I81A 1N8RC 3PNWC 1JBMA 1N27A 3RKWA 4XU2A 1NJIC 3J7AF 1M5Q1 3J80E 3I56T 4XQ3A 1NZ9A 3OYJA 4KUDK 1VQNT 3VU3C 5FROA 4RCCA 4IKFA 1FWZA 2RJDA 3UT1A 2RJEA 4C92D 3SWNA 4F7UA 5GMKh 3CXCA 1K9MC 3QXEB 2BUDA 2MI6A 1VQ6A 1VQMA 1Q7YC 3M4YA 2DTOA 2VUBA 4BB7A 4A4HA 4CI0C 5FLXE 3WVDB 2ZPIB 1R8OB 3M54A 3CCQA 2K5IA 4EMKA 2D0QB 1UGSB 4XTWA 2QDYB 3LYIA 1VUBA 4EMGA 4ZGEB 2XD0A 4C92A 2XDDA 3MO8A 2QQ9A 2RHUA 3NFCA 3MEUA 2DZCA 2Y4XA 3I56A 3JB9D 5J39A 1Q82U 4R55A 3R6OA 5HKCA 2RI2A 3GNGA 2DD5A 4IUTA 2DEQA 4WF2A 5DM7R 1Q86U 1VQNA 4A53A 2RJFA 3ZFJA 1GXIE 5GAOq 4QW2A 2VXFA 5GMKi 5KCOA 2PQWA 5GAMf 4X9CA 3QJ6A 4MZTA 1Y7XA 1SSFA 3HHTB 4LDWA 5GAMd 4C5HA 3TU4K 2RHIA 3QZ9B 4BI8B 1OZ3A 4M77B 3CPFA 4E47A 1IZ6A 5GAMh 2EJFA 3I55T 2XDBA 3CCJT 1VQOT 5HY6A 2RHXA 3S3MA 1VQ4T 3VYGA 2GQVA 3L1AA 3V8LA 2XDPA 4LD9K 3G71T 2R5MA 1IREB 1UGQB 2JTMA 2XKOC 3SDZA 3SB2A 2NLUA 4C5GA 3C4SA 4M77E 2EQKA 2Y90A 4ZGDB 5M9OA 1QVGA 2RO0A 5CR2A 1NJIU 5A0DA 2RI3A 4PNOA 1VQLT 3BDUA 3GP8A 2RI5A 1G3YA 5CAIA 3OYBA 2E1HA 3CBMA 3CCLT 3CCRT 2RM4A 2XHCA 4NL2A 3V7CA 5HK3A 1K9MU 3AHUA 3EFSA 1Q7YU 4M77D 4C8QG 3I55A 1G5VA 3GIBA 5CIUA 3HRUA 4OB1B 3CCJA 1VQOA 2EKOA 1VQ4A 2OAUA 1YIJT 5KH6A 3G71A 3OS2A 2YLCA 2M16A 2E5QA 2HQEA 2M1HA 3MEAA 4OGEA 1VQ8T 3JCMV 5LJ3f 2DXTA 1QP3A 4C8QC 2QQRA 1KQ1A 1QW1A 2DPPB 3QO3A 3DLMA 1M1GA 4FIBA 4M77A 3CCMT 2ZCFB 1VQLA 5DY9A 2WSCE 4BI3A 2AHJB 1U1SA 3ZEHA 3CCET 3EAEA 2CGHA 2DZ9A 4XTZA 5D6XA 4B9XA 3CCRA 4JJNK 2PVOB 2HAXA 3LGLA 3CCLA 2CZ7B 4M7DG 3ZBDA 4OMFB 3HPWA 5GAOr 3RMSA 3JRZA 1VQ7T 2KMTA 3OSVA 4Z02A 3CBOA 2MWOA 4X9DA 4C8QF 4JS5A 1FX7A 1I8FA 1YIJA 3NTIA 5CKEA 5FRMA 3QSUA 4IUUA 1VQ8A 2LDMA 2L3RA 4NL3A 2B8AA 3OMCA 3OYLA 3GPLA 1BI0A 2RHZA 3A8LB 4QVZA 2LRQA 1K73U 1WQWA 2HBPA 3CCMA 1AHJB 1KG1A 1N6AA 4O5VA 5CKBA 5GAOn 2EWNA 2K5LA 3DB4A 1YITT 1VIFA 4J7FA 4LD6A 1TH7A 4LDYA 1KD1U 2O4XB 3CCEA 4C0DB 5I21A 1G3TA 4DOVA 3RUXA 5GAN8 5GANj 3DKMA 1VQ7A 2WACA 4ELZC 1X01A 4FL6A 3HRTA 3QIIA 4XU1A 3LWHA 4E7JA 2MAMA 4M7DF 2QEXT 1WGSA 5IN1A 3M9QA 2E64A 4A4EA 3OYGA 3JAME 1KC8C 3J81E 2PVGB 1D3BB 1FXXA 1XTDA 4N4HA 5GAN2 4BE1A 1W2BS 4JRKA 5FU7B 3JCMb 2R58A 1M9SA 3CBPA 4HKEA 3WXMB 1M1KU 3G4ST 4A4GA 1YITA 5FRNA 3A5ZB 3H6ZA 1HK9A 3V8JA 3LH0A 3FLGA 2A7YA 2P4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQX A;  5HK0 A;  5CKF A;  4ELZ C;  5CKH A;  3HPW A;  5HK3 A;  4MZT A;  2VUB A;  3JRZ A;  2KMT A;  5CCA A;  4ELY C;  5CKD A;  1NE8 A;  5CK9 A;  4ME7 A;  5CKE A;  5DLO A;  1VUB A;  4MDX A;  1UB4 A;  4MZP A;  3TCJ A;  1M1F A;  4HKE A;  2MF2 A;  5CO7 A;  4OF1 A;  3NFC A;  1X75 C;  3JSC A;  5CKB A;  3G7Z A;  4VUB A;  5HKC A;  5CR2 A;  4MZM A;  3VUB A;  2C06 A;  5CQY A; 
#chains in the Genus database with same CATH topology
 3QUI A;  1OPL A;  2RHY A;  1QQJ A;  1VIE A;  2HL3 A;  2RK1 A;  3X26 B;  2QEX A;  3KUF A;  4RTV A;  2LC4 A;  5CCA A;  3OS5 A;  1PSF A;  3THK A;  5GMK l;  4R0K A;  2ZPG B;  5GAN 7;  3TCJ A;  4ZN3 A;  1M3C A;  3G4S A;  2CP0 A;  1VYT A;  1W4S A;  3MPU B;  1Q95 G;  1WJQ A;  2BZY A;  1VQN Q;  2K2V A;  5IXB A;  2RNA A;  2YRD A;  4MDW A;  2BE9 B;  1T0H A;  2YXY A;  2NUT A;  4EMH A;  3LX7 A;  1JU5 C;  5LJ5 d;  4JLI A;  5LJ3 e;  4M7D B;  2X4W A;  8AT1 B;  3GLX A;  5GAO p;  3REA B;  5IT9 E;  3D7S B;  1YJ9 T;  1UHC A;  2LCC A;  1BI1 A;  3QDF A;  2QG9 B;  3MP6 A;  1BI2 A;  4IUQ A;  2RA2 A;  3JCM c;  1ZBX A;  2M51 A;  4EIK A;  3MCA B;  4J9F A;  2VXE A;  1I0C A;  1WXU A;  3CCJ Q;  2QXF A;  3M57 A;  1K9M R;  1VQ4 Q;  5GJV B;  3A8H B;  1B3Q A;  1Q7Y R;  3CPW P;  2A36 A;  1HXD A;  4ATO A;  4HT9 A;  1WHK A;  2E12 A;  4J9C A;  1AVZ C;  5GAN 3;  2F69 A;  4HVV A;  3SD4 A;  4M75 C;  4KUL A;  2D6F A;  3O5Z A;  3X25 B;  2L89 A;  4EPC A;  3RIR A;  3JB9 I;  3X28 B;  4AFZ C;  2HKQ B;  2DAQ A;  4F16 A;  3OYF A;  3OW2 P;  3S6W A;  2EVR A;  2CP6 A;  2QTX A;  1M27 C;  2X4J A;  4BY6 B;  4ZNX A;  1ZSG A;  1UJY A;  3BE3 A;  4QQD A;  4PJO C;  3CXC P;  2P4R A;  2JTE A;  2K3B A;  1OU9 A;  1P92 A;  4HA8 A;  3FJ5 A;  1LCK A;  5GAM j;  2DRM A;  3CMA Q;  1PKS A;  1NLP C;  2KT8 A;  3N5B B;  2ZPF B;  2QA4 T;  3FJP A;  3EG9 B;  4M78 F;  2BTT A;  1YI2 A;  3OYE A;  2MWP A;  1ZA1 B;  4ZGJ B;  4KGV B;  1QVF S;  1D1B A;  1NYG A;  2OTL A;  1M90 C;  4ANJ A;  1YJW A;  4DBQ A;  4OMO A;  2DXC A;  3JSC A;  3CD6 A;  4EMK B;  2J05 A;  1KQS S;  2J6O A;  1PD1 A;  2OAW A;  1G8X A;  4XAX B;  1DJ7 B;  1VQM Q;  1X2Q A;  1NPR A;  1NE8 A;  4N0A A;  1UGP B;  2E41 A;  2EQI A;  1LOJ A;  2DIG A;  2A08 A;  2IPO B;  1YHQ A;  1M2O A;  1WA7 A;  2DO3 A;  3A8G B;  4JRQ A;  3CCV A;  4CC7 A;  4Q5W A;  2CS7 A;  2DL5 A;  3MKD A;  2QGG A;  1D1C A;  1RAI B;  3IQL A;  4J8O A;  4QQG A;  4D6W A;  5KYN A;  2DIQ A;  2ESW A;  2CKK A;  4J83 A;  4HXJ A;  4F7U G;  3P8D A;  4ME7 A;  2E6Z A;  4M75 D;  2KYM A;  2LMJ A;  1YFN A;  1S72 T;  3LW5 E;  4UC4 A;  3C0C A;  1M90 U;  2P0Q A;  3SWN C;  4B9W A;  2ZPE B;  2O9V A;  4C92 G;  2XU8 A;  2EBP A;  1ZX6 A;  2HEQ A;  2EFI A;  1VYU A;  1KQ2 A;  2LT1 A;  3OYH A;  2DXB A;  1Y07 A;  2F5K A;  2XI9 A;  4PJO D;  3CC7 A;  1VQO Q;  3CEY A;  5KYX B;  4AG1 C;  3KXT A;  4OML A;  1WJS A;  3JB9 G;  2DL7 A;  4XK8 E;  1TG0 A;  2EJG A;  2MF2 A;  1KD1 C;  3UF4 A;  3PT9 A;  2LX7 A;  2QK0 A;  4A54 A;  3JCM d;  1BIA A;  4MMK A;  1IB8 A;  1MGQ A;  3OYY A;  2K3Y A;  4J5Y A;  3QWX X;  2RQV A;  2AK5 A;  1LJO A;  3EGD B;  1WHG A;  2EJ9 A;  1RLP C;  3QG1 A;  4RCB A;  3OYD A;  1VQ8 Q;  1HYO A;  5GMK m;  1NEG A;  2DL4 A;  5CO7 A;  2CP3 A;  4RTY A;  2IG0 A;  3DB3 A;  3CCS T;  1FMV A;  1OPK A;  3AT1 B;  3I35 A;  4JUV A;  3WVE B;  2EGA A;  2HKN A;  1BIB A;  1WJR A;  1WQ7 A;  1WPY A;  2M9U A;  3QDR B;  1BK2 A;  1SHF A;  1PKT A;  2OI3 A;  4AT1 B;  4M7A E;  3GF5 A;  4R56 A;  2CP2 A;  4PFP A;  3LGF A;  2CZ0 B;  4CC2 A;  2FZK B;  5IXF A;  3M4G A;  1YJN Q;  1VA7 A;  3X24 B;  4RG8 A;  1M2V B;  3M55 A;  4C92 B;  3OYM A;  4XTU A;  1VQ6 T;  1ZLM A;  2RQW A;  4ELY C;  2JW4 A;  3HSB A;  1WFW A;  2JZ2 A;  4FW1 A;  1V29 B;  1U5S A;  4A4K A;  2KT1 A;  1M8V A;  1UJ0 A;  4M7A A;  4HT8 A;  2ED0 A;  1I81 A;  1N8R C;  1VQ9 Q;  3G4S Q;  4RTZ A;  3RKW A;  4XU2 A;  1M5Q 1;  3H0F A;  1TOV A;  1VYV A;  5FRO A;  1H92 A;  5GMK h;  3CQT A;  1IXD A;  2L3S A;  2VUB A;  4BB7 A;  4CI0 C;  2ZPI B;  1R8O B;  2JJ9 A;  2K5I A;  1UGS B;  1OOT A;  4XTW A;  2QDY B;  3LYI A;  1VUB A;  4ZGE B;  2F2X A;  1SHG A;  2QQ9 A;  3NFC A;  3I56 A;  1UG1 A;  2RI2 A;  2DEQ A;  1PD0 A;  1Q86 U;  1VQN A;  1M90 R;  1TSF A;  2RJF A;  4QW2 A;  5IHI A;  4FYW B;  1Y7X A;  1SSF A;  5GAM d;  4C5H A;  1IHW A;  4BI8 B;  1E7O A;  3QZ9 B;  4CC4 B;  2JS0 A;  1I07 A;  4WTO B;  5IHK A;  3VYG A;  1E6G A;  2GQV A;  3L1A A;  3V8L A;  4LD9 K;  3G71 T;  1UGQ B;  2XKO C;  2NLU A;  2ROL A;  2QAZ A;  4M77 E;  1QVG A;  2ATC B;  3BDU A;  1NM7 A;  1G3Y A;  5CAI A;  3OYB A;  3RER A;  5I22 A;  1ABQ A;  1RAB B;  3EG2 A;  4C8Q G;  3HRU A;  3CCJ A;  1AEY A;  1VQ4 A;  2CP5 A;  1U06 A;  3MEA A;  2M1H A;  4OGE A;  3QO3 A;  4M77 A;  5DY9 A;  2WSC E;  2K2M A;  3ZEH A;  2DZ9 A;  2HAX A;  3LGL A;  2CZ7 B;  3EFO B;  1VQ7 T;  4OMF B;  5GAO r;  3RMS A;  4Z02 A;  4FSS A;  2MWO A;  1ZSZ A;  4RUG A;  2J06 A;  2LDM A;  2L3R A;  2B8A A;  2COW A;  3LH5 A;  3GPL A;  2RHZ A;  1ZBJ A;  2OTL Q;  1WQW A;  3CCM A;  5CKB A;  5I11 A;  3CD6 Q;  1TH7 A;  1TUD A;  3CCE A;  1KD1 R;  1WIE A;  2O88 A;  2XMF A;  5GAN 8;  3RR6 A;  4ELZ C;  3LWH A;  4XU1 A;  2HL5 C;  2E64 A;  3OYG A;  1KC8 C;  2GTO A;  2PVG B;  1XTD A;  4N4H A;  4BE1 A;  1W2B S;  2R58 A;  1M9S A;  1YHQ Q;  3CCV Q;  4QKU A;  2ENM A;  3V8J A;  3LH0 A;  2E4H A;  2P4T A;  4BDZ A;  2O9S A;  3OY9 A;  1Y96 A;  2QGF B;  1OV3 A;  5GAN e;  1GBQ A;  1OZ2 A;  3UWN A;  3CCQ Q;  4KH0 B;  3MET A;  3JCM g;  5KYU B;  2O4X A;  2L5Q A;  5LJ3 j;  3ME9 A;  3P8B B;  4C8Q B;  1IO6 A;  4XTX A;  5FW9 A;  2KSS A;  2M02 A;  2EYZ A;  4E7Z A;  3M0T A;  1SSH A;  3FRN A;  4DQ2 A;  4OMP A;  2A28 A;  2NUZ A;  4XU3 A;  2G3R A;  4PL6 A;  4J7I A;  4DBR A;  3JCM J;  3E9F A;  4N0A C;  1VQK A;  2V8J A;  2CSQ A;  2VGM A;  2IVW A;  3JV3 A;  1QWE A;  5LJ5 f;  4GY5 A;  3EFR A;  2VYT A;  2YRC A;  1GRI A;  3CC7 Q;  4RTX A;  5LJ5 h;  1LNX A;  3EG3 A;  4TVR A;  4A63 B;  4F17 A;  4M7D E;  4VUB A;  5FU7 C;  3VRY A;  4M4Z A;  2X35 A;  4PLI A;  1N8R R;  2GBQ A;  2FL7 A;  1ARK A;  5GAO l;  4JRI A;  4KH1 B;  2E3H A;  3EH2 A;  2EQJ A;  2FPF A;  3JCM Q;  2OTJ A;  3M0P A;  2BZ8 A;  1MHN A;  2B86 A;  3M56 A;  3CCU A;  2YUO A;  5FU6 C;  5KCH A;  2CRE A;  4DEY A;  2ROT A;  2D9T A;  2QDL A;  1QVP A;  4KUI A;  4E7H A;  4M7D A;  4D8D A;  3VRZ A;  2KY9 A;  3PMT A;  1ACM B;  3CCL Q;  1M30 A;  1VOM A;  1Q81 C;  2HMA A;  4M78 G;  4FCY A;  2LJ1 A;  1UDL A;  3NHN A;  4IUV A;  2KRO A;  4M75 F;  5FWB A;  2E70 A;  3CME T;  2GCX A;  2YWW A;  1RI0 A;  1X27 A;  3FDR A;  1I5L A;  1AOJ A;  1SRM A;  1WDX A;  2CP7 A;  1GBR A;  1ZUK A;  3L2V A;  1NLO C;  1EZZ B;  1JRI A;  4PJO F;  3E1S A;  2LNV A;  1IGQ A;  1G2B A;  1NG2 A;  1H3Z A;  1UB4 A;  3SWN B;  4MZP A;  5GAM g;  4GLM A;  1VQ5 A;  6AT1 B;  2DTH A;  1YIT Q;  3A1P A;  1PWT A;  3A8M B;  2BKD N;  4FYX B;  1YJN A;  3ZL7 C;  4PKC C;  2FPE A;  2DK3 A;  3PMI A;  4RMO A;  2KRN A;  5FWC A;  3EG1 A;  3QHS A;  4OMN A;  1Q81 U;  5EC7 A;  5CK9 A;  1WI7 A;  2KNB B;  1SF9 A;  3BY7 A;  4NS5 A;  2O31 A;  2VKN A;  4JDS A;  4EDU A;  4JS4 A;  2O01 E;  1B34 B;  2KEA A;  3EG9 A;  3G6E A;  1VQ9 A;  3OYN A;  3I56 Q;  4MZM A;  2CH4 W;  2V8K A;  4Z8A A;  1NPP A;  5HK0 A;  1TXQ A;  2DD4 A;  5IAY A;  5KE3 A;  2E65 A;  2RK2 A;  1VQP T;  3PIO A;  4M7A C;  1UUE A;  2HQH A;  3MP8 A;  2MOX A;  5C6S A;  2MYS A;  2J7I A;  3C94 A;  3MEV A;  4M78 B;  2P0K A;  2R57 A;  4F14 A;  2G6F X;  1KC8 R;  1H64 1;  1PC0 A;  2DE0 X;  3I5R A;  2CZ6 B;  1K4U S;  2DF6 A;  5A0G A;  2X9H A;  4CRI A;  2WSF E;  5CKF A;  2VV5 A;  2V1R A;  2AKL A;  1RAA B;  3RKX A;  2XIC A;  4II1 A;  4V2S A;  2EYQ A;  2NUP B;  2RF0 A;  3DLL A;  1YJ9 Q;  1KIK A;  2HD0 A;  3L2Z A;  1RAH B;  4OF1 A;  2L8D A;  2PZ1 A;  1YN8 A;  1JJ2 P;  3JCM f;  1R0C B;  4XTV A;  3F70 A;  1K8A C;  4J9H A;  3JCM h;  2H3J A;  3CC4 T;  2LP5 A;  2KQW A;  1ZQ1 A;  2CUB A;  2CYZ B;  4PFZ A;  4RKU E;  4JPB W;  2LQN A;  5LJ3 d;  1QP2 A;  2LQW A;  1X75 C;  3CCM Q;  3CC2 T;  1KHI A;  5KYX A;  2EIF A;  5L23 A;  5CQY A;  2ZAE A;  2YLB A;  3CCE Q;  1WYX A;  1PRM C;  3CMA T;  1K9A A;  4E6R A;  4FW2 A;  1RAE B;  3BDL A;  3EGX B;  3HFO A;  4HCK A;  1I5O B;  5GAN 6;  3PFS A;  3VKI A;  2RH2 A;  4PJN A;  3KBG A;  1PNJ A;  4M77 C;  3FB9 A;  4E7S A;  2DA9 A;  5KYW A;  2JOY A;  1UGV A;  1UE9 A;  3M59 A;  3L2W A;  3OQ5 A;  4F7U E;  4ZTJ A;  4M7A D;  3OA6 A;  3A8O B;  2XK0 A;  1OYX A;  1ZSZ C;  1QVF A;  2QA4 Q;  1K8A U;  5A0L A;  1VQM T;  4E7L A;  4JZ4 A;  2F1L A;  5GAO m;  4E2F B;  2M0O A;  1KQS A;  2NWM A;  1Q81 R;  4C92 E;  4IUR A;  5GAN g;  4OP0 A;  3PNW C;  2NUT B;  1NJI C;  2QAS A;  3J80 E;  4XQ3 A;  2PNI A;  5D7U A;  1IGU A;  2O2O A;  1GXI E;  1FWZ A;  3UT1 A;  4F7U A;  3EG0 A;  3QXE B;  1VQK Q;  3CCQ A;  3M0R A;  1X6B A;  3WVD B;  3M54 A;  1ZUU A;  1M2V A;  1HJD A;  1XJW B;  2XD0 A;  4C92 A;  3MO8 A;  2RHU A;  2EGC A;  2DZC A;  2Y4X A;  5J39 A;  2ED1 A;  5HKC A;  4IUT A;  3G1J A;  1QCN A;  1JXO A;  5GAM f;  4X9C A;  2LJ3 A;  3QJ6 A;  4MZT A;  1YNZ A;  2OTJ Q;  5GAM h;  3CPF A;  4E47 A;  2EYY A;  1H3H A;  1VQO T;  3CCU Q;  4DBH A;  1S72 Q;  2R5M A;  4ZGD B;  5M9O A;  2RO0 A;  5CR2 A;  1NJI U;  1VQL T;  3CCR T;  4ORZ A;  4M77 D;  3I55 A;  5CIU A;  4LN2 A;  1YIJ T;  3OS2 A;  2K9G A;  2YLC A;  2HQE A;  1VQ8 T;  1W6X A;  4FYY B;  2AZV A;  3JCM V;  2DXT A;  1QP3 A;  2L0A A;  1QW1 A;  1BCM A;  2ZCF B;  2JMC A;  4J9D A;  1OU8 A;  5AT1 B;  3E2U A;  3EAE A;  2CGH A;  3CCL A;  1WXB A;  2KMT A;  1AWW A;  1N5Z A;  3NMZ C;  1V1C A;  3OMC A;  1K0S A;  2MPX C;  4QVZ A;  1VQ5 Q;  2MCN A;  1KG1 A;  3DB4 A;  1KD1 U;  1C0M A;  2LCS A;  1G3T A;  1MUZ A;  5GAN j;  1X6G A;  1UEC A;  3DKM A;  2WAC A;  1R0B G;  4FL6 A;  2DYI A;  2QEX T;  2DX1 A;  4AFS C;  1K8A R;  1D3B B;  5GAN 2;  1D0Z A;  4AG2 C;  4JRK A;  3EFO A;  5FU7 B;  3SHW A;  4HKE A;  3G6E Q;  3G4S T;  1YIT A;  5FRN A;  3A5Z B;  2LNH B;  3H6Z A;  2BZX A;  2VC8 A;  4OB3 B;  1CKA A;  1C6V X;  4O6J A;  1VQ6 Q;  2GFA A;  5FU6 B;  2P84 A;  3QZ5 B;  3M0Q A;  4FT4 A;  2D1X A;  4KT0 E;  3RNJ A;  3OS0 A;  2X4Y A;  4KBM B;  4BY6 C;  1AZE A;  3EGU A;  2FZG B;  1UHF A;  5A2Q E;  1E6H A;  1N9R A;  4BI4 A;  5KE2 A;  3GNF B;  3M0S A;  2PVD B;  2XG8 D;  4C8Q E;  2LJ0 A;  2LX9 A;  3HP9 A;  4BAC A;  5LJ3 g;  2YUQ A;  3QBY A;  5D6Y A;  2X51 A;  1U1T A;  4KRT A;  2GNC A;  2K4Y A;  4C0Z A;  1EIF A;  5EG2 A;  1LPL A;  3VS7 A;  2E5K A;  3HL8 A;  1UTI A;  1ZA2 B;  3L2R A;  2H3E B;  5KYU A;  2DL8 A;  4GBQ A;  4ESR A;  3QYG B;  1N8R U;  3S3N A;  5C0M A;  3SFM A;  4C8Q A;  3OYI A;  4J9I A;  2E6N A;  1NJI R;  1RAD B;  3FIF A;  3I9Q A;  2EQU A;  4N4I A;  2VAS A;  2AKK A;  4M75 G;  2JMA A;  2EGE A;  1YJ9 A;  2ZPB B;  1K1Z A;  2M0Y A;  2JTF A;  3RBB B;  3PIP A;  2LQ8 A;  4BD3 A;  1KQS P;  1WNL A;  4PJO G;  2DET A;  5IH2 A;  1WHM A;  1YI2 T;  1EX4 A;  5ECA A;  5GMK e;  3VS2 A;  4QVD A;  1MV3 A;  4IIM A;  2OTL T;  1BBZ A;  1YJW T;  2H8H A;  1YWP A;  2PUK B;  3H8Z A;  1N9S A;  3CD6 T;  4J6W A;  2D0N A;  4JRP A;  1WHL A;  1VQ7 Q;  1GCQ A;  3VS1 A;  2L2P A;  3CPW S;  1YWO A;  2JT4 A;  2I2L A;  4J9B A;  1D09 B;  2DBK A;  1JJ2 S;  3V7R A;  2JS2 A;  3PTA A;  2QQB A;  2FG0 A;  3X20 B;  2MIO A;  2MK5 A;  1YHQ T;  4JZ3 A;  2D8H A;  2JXB A;  2Y4Y A;  4B6M A;  4HCB A;  3OYA A;  5J26 A;  1OEB A;  3OW2 S;  3H0H A;  1W2B A;  5DLQ E;  2QA4 A;  3JB9 J;  2BIV A;  2EKH A;  3VJP A;  3OYC A;  3CXC S;  4RG2 A;  1ZHI A;  3I5S A;  4M75 B;  3GBQ A;  2YT6 A;  3MEW A;  4PJM A;  1W70 A;  2JVV A;  3QPH A;  3JCM P;  2AT1 B;  2ZPH B;  2COZ A;  3T9N A;  3FC3 A;  3MP1 A;  2CT3 A;  1C1A A;  1IHV A;  3HRS A;  3H0I A;  3CC7 T;  4PJO B;  2LQK A;  1I1J A;  1KC8 U;  2JM9 A;  1I4K 1;  3PE0 A;  3UAT A;  2LCL A;  1RL2 A;  2K57 A;  1AD5 A;  5I2S A;  2KXC A;  4M7A F;  4M78 E;  1QCO A;  2IIM A;  2K3X A;  3FEO A;  1B34 A;  2DIL A;  1D1A A;  2E3I A;  5I2M A;  1XOV A;  3I55 Q;  4C92 C;  5GAN d;  2AZS A;  3BFM A;  4ZTF A;  5DLO A;  2EPD A;  2L3P A;  4JLG A;  1K73 C;  4L5G A;  3O8V A;  1S72 A;  1RI9 A;  3HFN A;  1PHT A;  4J6X A;  3TEE A;  2KRS A;  2HCK A;  1YBY A;  1QLY A;  2C0I A;  1ZSZ B;  3Q1J A;  4GLK A;  2F5T X;  1PM3 A;  4M78 A;  5GAN 5;  5CKH A;  3QJY A;  2X4X A;  3ULR B;  4OB0 B;  3JB9 H;  2YDL A;  1UEB A;  2KYB A;  2QQA A;  1TTH B;  7AT1 B;  2FPD A;  4K11 A;  2QI2 A;  2HZY A;  1MNE A;  2VWF A;  1M1K C;  2KK4 A;  2GQI A;  5LJ3 h;  2DTI A;  3VUB A;  3M53 A;  2NUP A;  4HVU A;  1SPK A;  3OB9 A;  3E9G A;  1QCF A;  1OQK A;  4IUP A;  4HCC A;  2DM1 A;  3M5A A;  4OMQ A;  2A0F B;  2EYW A;  1Y96 B;  1F1B B;  4BDY A;  2AIR B;  4J9G A;  4F04 B;  1Q82 C;  2CT4 A;  3ER0 A;  2FB7 A;  4E7K A;  1O9S A;  3NPF A;  2CZ1 B;  2PU9 B;  3CCS A;  2KR3 A;  5LJ5 e;  4A4F A;  3HTR A;  2DJQ A;  4M77 F;  3VS6 A;  3URG A;  2GFU A;  1MMD A;  2HNI A;  2RB6 A;  4OGC A;  3M58 A;  3VUZ A;  3LWI A;  4YTL A;  1QVG P;  2SEM A;  3EGX A;  1M1F A;  3J7A F;  1AWJ A;  2HSP A;  2I0N A;  3I56 T;  1NZ9 A;  4DEX A;  4KUD K;  1VQN T;  3RDV A;  4IKF A;  2RJD A;  4C92 D;  1H8K A;  2DBM A;  1EFN A;  1VQ6 A;  1MND A;  3M4Y A;  4A4H A;  5FLX E;  4EMK A;  4PK4 A;  2DL3 A;  2XDD A;  1RUW A;  3MEU A;  3TQ7 P;  3JB9 D;  1NEB A;  1Q82 U;  3R6O A;  1JQQ A;  4D8K A;  4A53 A;  2VVK A;  2VXF A;  5KCO A;  1VQP Q;  2PQW A;  3HHT B;  3SEM A;  4LNP A;  3TU4 K;  2RHI A;  1OZ3 A;  3CCJ T;  5HY6 A;  2RHX A;  3S3M A;  1VQ4 T;  2J6F A;  1T0J A;  1MMA A;  2XDP A;  3SDZ A;  1TWB A;  1CSK A;  4C5G A;  3C4S A;  1OUL A;  2FEI A;  1KFZ A;  2EQK A;  3H9N A;  3VS4 A;  2RI5 A;  2HDA A;  5KYY B;  2RM4 A;  4NL2 A;  3EFS A;  1M3B A;  1G5V A;  2COY A;  2RN8 A;  5KH6 A;  3G71 A;  2M16 A;  2E5Q A;  4C8Q C;  2QQR A;  1W2B P;  2DEU A;  1M1G A;  3CCM T;  4Z89 A;  4PJJ A;  1OX9 A;  1ZUY A;  2X3W D;  4BI3 A;  1TUG B;  8ATC B;  3CCE T;  4XTZ A;  5D6X A;  4B9X A;  3CC4 Q;  4JJN K;  2PVO B;  2DNU A;  3ZBD A;  3HPW A;  3JRZ A;  4X9D A;  4JS5 A;  1FX7 A;  3NTI A;  3QSU A;  4NL3 A;  1X69 A;  2LRQ A;  3CC2 Q;  1GFD A;  1Y57 A;  2HBP A;  1AHJ B;  1N6A A;  5GAO n;  2EWN A;  1K73 R;  3EGD A;  2DYB A;  4DOV A;  1Z9Z A;  2K7A A;  1VQ7 A;  4JJB A;  1X01 A;  3QII A;  4E7J A;  4M7D F;  1WGS A;  1SRL A;  1A0N B;  3TVT A;  1TUC A;  3CBP A;  2F2W A;  3WXM B;  4AFU C;  1X43 A;  3M0U A;  1GCQ C;  3U23 A;  1M1K R;  1HK9 A;  1WXT A;  2HSE B;  4C0G A;  2A37 A;  1Z9Q A;  2LZ6 B;  4Y91 A;  1HSQ A;  4BUG A;  1BYM A;  1VQK T;  3L42 A;  1T3S A;  1Y0M A;  2C0O A;  2KVQ G;  2Z0W A;  3REB B;  4LDV A;  2YUP A;  4HCZ A;  1JB0 E;  1X2K A;  3JCM e;  3UPU A;  2VGN A;  4FT2 A;  1JXM A;  1D3B A;  1T3L A;  2GGR A;  1Q82 R;  5CQX A;  5GAN 4;  4HVW A;  3V7S A;  4C0D C;  4NOY A;  2OTJ T;  2K5F A;  5D6W A;  5IHN A;  4C8Q D;  4RTW A;  3VYH B;  3CCU T;  1AWX A;  1B7T A;  3INZ A;  3S3O A;  1G3W A;  1BU1 A;  1G3S A;  1BKB A;  2C0T A;  1AZG B;  1QKX A;  1RAC B;  2FHD A;  5CVI A;  3PGG A;  1KHC A;  2DER A;  5LL6 S;  4Y92 A;  4OB2 B;  3E19 A;  3EHR A;  1BCO A;  1M4Z A;  2EQM A;  3QKJ A;  2W10 A;  3ASK A;  5AYF A;  4XTY A;  1MMN A;  3P8H A;  1WZO A;  2QQS A;  2V26 A;  2YSQ A;  2CSI A;  5GMK j;  4QVC A;  1BI3 A;  1VQL Q;  3HKS A;  4RTT A;  3G7Z A;  1LVK A;  3PVQ A;  3NTK A;  3OSS C;  2DKG A;  2RMO A;  3CCR Q;  3OS1 A;  2FZC B;  3BW1 A;  2LTO A;  2J6K A;  5KYW B;  4BE2 A;  3GOX A;  1KSW A;  1YIJ Q;  3TRE A;  2EAY A;  4FSX A;  2ABL A;  2ZZD A;  2L3Q A;  2RJC A;  1X6O A;  4M7D C;  4RTU A;  3OMG A;  4M78 C;  4DA4 A;  1VQ5 T;  1GL5 A;  1XQH A;  2RQU A;  3OYK A;  2RQR A;  3CCS Q;  1YJN T;  2DVJ A;  4DBF A;  2PTK A;  2P0P A;  4JJC A;  1YCY A;  3CME A;  4F7U B;  2FVU A;  1D0X A;  2JN0 A;  5LJ5 g;  1Q86 C;  1W1F A;  2KAF A;  3G6E T;  1VQ9 T;  4L6V 5;  2K6D A;  2C06 A;  5GAM e;  1QMC A;  3NGP A;  2R5A A;  2YRV A;  1AWO A;  4OVA A;  2V8I A;  4LXC A;  2QEX Q;  2A3L A;  3JCM X;  5GJW B;  2CUD A;  1KK7 A;  1TS9 A;  2CDT A;  3MJX A;  2DXU A;  4ZN1 A;  3L2U A;  4JJD A;  4FM4 B;  1R77 A;  4OMM A;  4P5N A;  3RES A;  2RPN A;  3C95 A;  3V8K A;  3VV0 A;  2JUF A;  4AFQ C;  4M7A G;  1CKB A;  3RKY A;  2RQT A;  4M75 E;  1BB9 A;  4C5E A;  1UFF A;  4LDU A;  2ECZ A;  4C5I A;  4N4G A;  1U8R A;  1TU0 B;  2JNG A;  2WSE E;  2FYK A;  1J3T A;  3NTH A;  2KDS A;  2E10 A;  3VS0 A;  4PJL A;  3UDC A;  2K79 A;  1SEM A;  2XID A;  5J3B A;  4PJO E;  4LDX A;  1U3O A;  2PUO B;  2KI7 A;  4EMK C;  4M75 A;  2DJZ A;  1RAG B;  2QYZ A;  1VQP A;  1K76 A;  4C0F A;  1RAF B;  5GAN f;  1QVG S;  1FMK A;  4M7D D;  4F7U F;  4M78 D;  4QQ6 A;  5GAN h;  3LLR A;  3G71 Q;  2VB6 A;  1XNI A;  3RMQ A;  2YHT A;  3MHX A;  4J6Y A;  1QVF P;  1ABO A;  1Y71 A;  4PJO A;  2HQX A;  1M3A A;  4C92 F;  1FMW A;  1WX6 A;  2MMP A;  4FU6 A;  4DOW A;  4Y28 E;  1JEG A;  3OBW A;  4CC3 A;  1QKW A;  2KE9 A;  4KGZ B;  4E7I A;  4XU0 A;  2LVM A;  1MV0 B;  2DVE A;  3JB9 F;  3OBY A;  2QTV A;  4PLL A;  2YUN A;  1O75 A;  4PFO A;  4X34 A;  5LJ5 j;  1B07 A;  4M7A B;  4M77 G;  3CC4 A;  2D8J A;  2RD1 A;  3A98 A;  1NYF A;  4L59 A;  3PVL A;  5CKD A;  1PSE A;  2KXD A;  1YI2 Q;  4LUE A;  4MML A;  2SRC A;  1IRX A;  2JM8 A;  2X3X D;  3JCM W;  4MDX A;  1YJW Q;  2CH4 A;  1YCS B;  2FO0 A;  3CC2 A;  3L2Q A;  3CPW A;  5HCK A;  4BE0 A;  2DMO A;  3CCV T;  3TSW A;  3CMA A;  2KGT A;  2ZGW A;  1UGR B;  1JJ2 A;  2GF7 A;  2LT4 A;  1OI1 A;  3CCQ T;  4IIO A;  4QT7 A;  1AT1 B;  1FYN A;  5L8R E;  3C12 A;  3OW2 A;  1OX8 A;  3QYH B;  3KFV A;  1NBE B;  1JBM A;  1N27 A;  1G83 A;  1KJW A;  1YP5 A;  3OYJ A;  2HBW A;  3VU3 C;  4RCC A;  2RJE A;  3SWN A;  3CXC A;  1K9M C;  1K0X A;  2BUD A;  2MI6 A;  1VQM A;  1Q7Y C;  3UA6 A;  2DTO A;  3EH1 A;  2EYX A;  2D0Q B;  3EHQ A;  4EMG A;  2OX7 A;  3UA7 A;  1WLP B;  4R55 A;  4LE9 A;  1JO8 A;  3GNG A;  2DD5 A;  4Z88 A;  5DM7 R;  4WF2 A;  1GFC A;  4J9E A;  3ZFJ A;  5GAO q;  1Q86 R;  1WHH A;  5GMK i;  1GCP A;  4LDW A;  2F2V A;  3I55 T;  4M77 B;  2XDB A;  1IZ6 A;  1S1N A;  2EJF A;  1RLQ C;  1IRE B;  1QWF A;  2W0Z A;  2JTM A;  3H41 A;  1MMG A;  3SB2 A;  2Y90 A;  1SKU B;  3QWY A;  3TSZ A;  2RI3 A;  4PNO A;  5A0D A;  3GP8 A;  2NYS A;  2E1H A;  2KRM A;  3CBM A;  3CCL T;  4LUD A;  2XHC A;  3V7C A;  5HK3 A;  1K9M U;  3AHU A;  2EW3 A;  1Q7Y U;  9ATC B;  3GIB A;  4OB1 B;  1VQO A;  2EKO A;  2OAU A;  4WCI A;  3VS5 A;  2OJ2 A;  4KGX B;  5LJ3 f;  1KQ1 A;  2DPP B;  3DLM A;  4FIB A;  1VQL A;  3VS3 A;  2AHJ B;  2V1Q A;  1U1S A;  2GTJ A;  2FRW A;  3CCR A;  1D0Y A;  4M7D G;  3OSV A;  3CBO A;  2KBT A;  4C8Q F;  1I8F A;  1YIJ A;  5CKE A;  2DFU A;  5FRM A;  4IUU A;  1VQ8 A;  3CME Q;  3OYL A;  1BI0 A;  4FYV B;  4AMC A;  5KYY A;  3A8L B;  1K73 U;  3R6N A;  1HD3 A;  4O5V A;  1PCX A;  2K5L A;  1M8M A;  1YIT T;  1VIF A;  4J7F A;  4LD6 A;  4LDY A;  2O4X B;  1PG5 B;  4C0D B;  5I21 A;  2BE7 D;  3RUX A;  2DRK A;  1WHJ A;  3HRT A;  1PRL C;  2MAM A;  5IN1 A;  3M9Q A;  2FRY A;  4A4E A;  3JAM E;  3J81 E;  1SG5 A;  1FXX A;  2DLP A;  4X1V A;  3JCM b;  1V76 A;  1M1K U;  4A4G A;  3FLG A;  2A7Y A; 
#chains in the Genus database with same CATH homology
 2VC8 A;  4C0G A;  3QUI A;  4BDZ A;  4OB3 B;  1Y96 A;  3OY9 A;  5GAN e;  4O6J A;  2RHY A;  4Y91 A;  1VIE A;  1KC8 U;  1OZ2 A;  4BUG A;  1BYM A;  2RK1 A;  3X26 B;  3UWN A;  2QEX A;  1VQK T;  3KUF A;  2GFA A;  2LC4 A;  3MET A;  5CCA A;  5FU6 B;  3L42 A;  1PSF A;  3OS5 A;  3JCM g;  5GMK l;  3QZ5 B;  2ZPG B;  2O4X A;  2KVQ G;  2L5Q A;  4FT4 A;  5GAN 7;  5LJ3 j;  4LDV A;  3ME9 A;  3P8B B;  4KT0 E;  3OS0 A;  4C8Q B;  2X4Y A;  4KBM B;  4BY6 C;  4XTX A;  3TCJ A;  4ZN3 A;  4HCZ A;  1JB0 E;  5A2Q E;  3JCM e;  3G4S A;  2KSS A;  1W4S A;  1N9R A;  1WJQ A;  4BI4 A;  2VGN A;  3UPU A;  4FT2 A;  5KE2 A;  3GNF B;  2PVD B;  2K2V A;  3FRN A;  4DQ2 A;  1D3B A;  2XG8 D;  4C8Q E;  2LX9 A;  3HP9 A;  4XU3 A;  5CQX A;  2G3R A;  4PL6 A;  4J7I A;  5LJ3 g;  4BAC A;  3QBY A;  4MDW A;  5D6Y A;  3JCM J;  3E9F A;  1U1T A;  4N0A C;  5GAN 4;  1VQK A;  2K4Y A;  2V8J A;  2VGM A;  2IVW A;  3V7S A;  4C0Z A;  4C0D C;  4NOY A;  5LJ5 f;  4GY5 A;  1EIF A;  4EMH A;  2OTJ T;  5EG2 A;  3LX7 A;  2K5F A;  3EFR A;  5D6W A;  5LJ5 d;  2VYT A;  4JLI A;  5LJ3 e;  4M7D B;  4C8Q D;  2X4W A;  5LJ5 h;  1LNX A;  3VYH B;  3HL8 A;  3CCU T;  3INZ A;  3GLX A;  4TVR A;  5GAO p;  3S3O A;  3L2R A;  5IT9 E;  1YJ9 T;  1G3W A;  2LCC A;  1BI1 A;  1BKB A;  1G3S A;  3MP6 A;  3QYG B;  4VUB A;  1BI2 A;  5FU7 C;  1N8R U;  2FHD A;  4IUQ A;  4M7D E;  2RA2 A;  3S3N A;  2X35 A;  5CVI A;  4PLI A;  3JCM c;  5C0M A;  1ZBX A;  3PGG A;  1KHC A;  3SFM A;  4C8Q A;  2FL7 A;  3OYI A;  5LL6 S;  2E6N A;  3MCA B;  5GAO l;  3FIF A;  4JRI A;  4OB2 B;  3E19 A;  2VXE A;  2EQJ A;  3JCM Q;  2OTJ A;  2EQU A;  1M4Z A;  4N4I A;  2EQM A;  3QKJ A;  1MHN A;  3ASK A;  2QXF A;  3M57 A;  5AYF A;  4M75 G;  3A8H B;  4XTY A;  3M56 A;  3CCU A;  3P8H A;  5FU6 C;  2QQS A;  1HXD A;  1YJ9 A;  4ATO A;  5KCH A;  4HT9 A;  5GMK j;  2ZPB B;  2E12 A;  4QVC A;  5GAN 3;  1BI3 A;  2F69 A;  2D9T A;  3HKS A;  1QVP A;  3G7Z A;  3SD4 A;  4KUI A;  4M75 C;  4KUL A;  4E7H A;  3NTK A;  4M7D A;  2D6F A;  3OSS C;  2DKG A;  2KY9 A;  3PMT A;  2JTF A;  3X25 B;  3PIP A;  3OS1 A;  2L89 A;  3BW1 A;  2LTO A;  2LQ8 A;  4EPC A;  4BD3 A;  3RIR A;  1WNL A;  4PJO G;  3X28 B;  3JB9 I;  2DAQ A;  3OYF A;  4BE2 A;  1Q81 C;  4M78 G;  3GOX A;  4IUV A;  3S6W A;  2QTX A;  2X4J A;  4BY6 B;  4M75 F;  1YI2 T;  3TRE A;  2EAY A;  4FSX A;  2E70 A;  2ZZD A;  3CME T;  2GCX A;  2RJC A;  5GMK e;  4QVD A;  1X6O A;  4M7D C;  4QQD A;  4PJO C;  2OTL T;  1RI0 A;  3OMG A;  1YJW T;  4M78 C;  4DA4 A;  1VQ5 T;  2PUK B;  3H8Z A;  1XQH A;  3FDR A;  1N9S A;  3CD6 T;  1P92 A;  4J6W A;  3OYK A;  1I5L A;  4HA8 A;  4JRP A;  1YJN T;  5GAM j;  3L2V A;  3N5B B;  3CPW S;  2ZPF B;  2QA4 T;  3FJP A;  1JRI A;  2P0P A;  4PJO F;  4M78 F;  3E1S A;  1YI2 A;  3OYE A;  2I2L A;  2LNV A;  1YCY A;  2MWP A;  1JJ2 S;  4ZGJ B;  3CME A;  4F7U B;  1H3Z A;  2FVU A;  1UB4 A;  3SWN B;  4MZP A;  3V7R A;  5GAM g;  1QVF S;  3PTA A;  2QQB A;  2OTL A;  2JN0 A;  5LJ5 g;  1M90 C;  1YJW A;  3X20 B;  1VQ5 A;  1YHQ T;  1Q86 C;  2DTH A;  2KAF A;  2DXC A;  3JSC A;  2Y4Y A;  3G6E T;  1VQ9 T;  3CD6 A;  3A8M B;  3OYA A;  4EMK B;  4HCB A;  2BKD N;  5J26 A;  4L6V 5;  1YJN A;  2C06 A;  4PKC C;  5GAM e;  1KQS S;  3OW2 S;  2DK3 A;  2R5A A;  2YRV A;  1W2B A;  3PMI A;  4OVA A;  2V8I A;  4XAX B;  1DJ7 B;  5DLQ E;  4RMO A;  2A3L A;  3JCM X;  2QA4 A;  3JB9 J;  1NPR A;  1NE8 A;  3QHS A;  2BIV A;  1Q81 U;  5CK9 A;  4N0A A;  2DXU A;  4ZN1 A;  3VJP A;  1UGP B;  2E41 A;  3BY7 A;  4NS5 A;  3OYC A;  3CXC S;  1LOJ A;  3L2U A;  2DIG A;  4JDS A;  4RG2 A;  1ZHI A;  4EDU A;  4JS4 A;  4FM4 B;  2O01 E;  1YHQ A;  4M75 B;  1B34 B;  2DO3 A;  3A8G B;  3MEW A;  3G6E A;  1VQ9 A;  4P5N A;  4JRQ A;  3RES A;  3OYN A;  3CCV A;  3C95 A;  3V8K A;  3VV0 A;  2JUF A;  4M7A G;  4Q5W A;  2CS7 A;  4MZM A;  3RKY A;  2JVV A;  2V8K A;  3QPH A;  3JCM P;  4J8O A;  1NPP A;  4QQG A;  4D6W A;  4M75 E;  2ZPH B;  2DD4 A;  5HK0 A;  2DIQ A;  5IAY A;  2E65 A;  5KE3 A;  3T9N A;  2CKK A;  4C5E A;  3MP1 A;  2RK2 A;  4J83 A;  3FC3 A;  1VQP T;  4LDU A;  3PIO A;  4M7A C;  4F7U G;  3P8D A;  4ME7 A;  4C5I A;  3HRS A;  3MP8 A;  4N4G A;  3CC7 T;  5C6S A;  1U8R A;  2LQK A;  4PJO B;  3C94 A;  3MEV A;  4M78 B;  2E6Z A;  2JNG A;  1I4K 1;  2FYK A;  2P0K A;  2R57 A;  2WSE E;  4M75 D;  3NTH A;  1S72 T;  3LW5 E;  4UC4 A;  1H64 1;  2LCL A;  1RL2 A;  2KDS A;  2E10 A;  1M90 U;  2P0Q A;  3UDC A;  2K57 A;  3SWN C;  4B9W A;  2ZPE B;  2CZ6 B;  2XID A;  5J3B A;  5I2S A;  4C92 G;  4PJO E;  2XU8 A;  4LDX A;  4M7A F;  4M78 E;  5A0G A;  2PUO B;  4CRI A;  2K3X A;  2WSF E;  2EFI A;  4M75 A;  2DJZ A;  3FEO A;  1B34 A;  5CKF A;  4EMK C;  2VV5 A;  1VQP A;  1KQ2 A;  2LT1 A;  3OYH A;  4C0F A;  5I2M A;  2DXB A;  1XOV A;  1Y07 A;  5GAN f;  3RKX A;  2XIC A;  2F5K A;  4II1 A;  2XI9 A;  4C92 C;  5GAN d;  1QVG S;  4M7D D;  3BFM A;  4PJO D;  4F7U F;  3CC7 A;  3CEY A;  4ZTF A;  4V2S A;  5DLO A;  4M78 D;  4QQ6 A;  2EYQ A;  5GAN h;  3KXT A;  3LLR A;  4JLG A;  1K73 C;  4L5G A;  1WJS A;  3O8V A;  3DLL A;  1S72 A;  3JB9 G;  1XNI A;  4XK8 E;  2HD0 A;  3RMQ A;  3HFN A;  2EJG A;  2MF2 A;  3L2Z A;  4J6X A;  2L8D A;  4OF1 A;  3TEE A;  2YHT A;  3MHX A;  1KD1 C;  4J6Y A;  1YBY A;  3PT9 A;  3JCM f;  1Y71 A;  4PJO A;  3Q1J A;  4GLK A;  2HQX A;  4A54 A;  2F5T X;  4C92 F;  3JCM d;  4M78 A;  4FU6 A;  2MMP A;  1BIA A;  4XTV A;  4DOW A;  3F70 A;  4MMK A;  1K8A C;  1MGQ A;  3OYY A;  4Y28 E;  3JCM h;  2K3Y A;  5GAN 5;  2H3J A;  5CKH A;  3QJY A;  2X4X A;  3CC4 T;  4OB0 B;  4J5Y A;  3OBW A;  3JB9 H;  2KQW A;  1UEB A;  1ZQ1 A;  2CYZ B;  1LJO A;  2QQA A;  2QI2 A;  2EJ9 A;  3QG1 A;  4RCB A;  3OYD A;  4XU0 A;  2LVM A;  4RKU E;  4E7I A;  5GMK m;  1M1K C;  2KK4 A;  2DVE A;  1QP2 A;  5CO7 A;  5LJ3 d;  3JB9 F;  3OBY A;  1X75 C;  5LJ3 h;  3CC2 T;  1KHI A;  4PLL A;  2DTI A;  3VUB A;  1O75 A;  2EIF A;  3M53 A;  2IG0 A;  3DB3 A;  5CQY A;  2YLB A;  3CCS T;  3CMA T;  4X34 A;  4JUV A;  3OB9 A;  3E9G A;  5LJ5 j;  4M7A B;  4M77 G;  3WVE B;  3CC4 A;  2RD1 A;  1BIB A;  1WJR A;  3BDL A;  3HFO A;  4L59 A;  1WQ7 A;  5GAN 6;  1WPY A;  3PFS A;  5CKD A;  1PSE A;  2M9U A;  4IUP A;  4HCC A;  3M5A A;  3VKI A;  3QDR B;  2RH2 A;  4MML A;  3KBG A;  4MDX A;  3JCM W;  1Y96 B;  4M7A E;  4BDY A;  4M77 C;  3FB9 A;  3GF5 A;  4R56 A;  1Q82 C;  3CC2 A;  3L2Q A;  2JOY A;  3ER0 A;  2FB7 A;  3LGF A;  3CPW A;  2CZ0 B;  4E7K A;  1O9S A;  4BE0 A;  3M59 A;  2CZ1 B;  3M4G A;  3X24 B;  4RG8 A;  2PU9 B;  3L2W A;  3CCS A;  3CCV T;  3CMA A;  3OQ5 A;  4F7U E;  2ZGW A;  4ZTJ A;  1UGR B;  1JJ2 A;  4M7A D;  5LJ5 e;  3M55 A;  3A8O B;  2XK0 A;  4A4F A;  3OA6 A;  1OYX A;  1QVF A;  4C92 B;  2GF7 A;  1K8A U;  5A0L A;  4M77 F;  3OYM A;  4XTU A;  1VQ6 T;  2LT4 A;  3URG A;  2GFU A;  1VQM T;  1OI1 A;  4E7L A;  2HNI A;  3RER A;  4ELY C;  2RB6 A;  3CCQ T;  3HSB A;  5GAO m;  4OGC A;  2JZ2 A;  3M58 A;  5L8R E;  1V29 B;  3C12 A;  3VUZ A;  3LWI A;  2M0O A;  4A4K A;  1KQS A;  3OW2 A;  1M8V A;  4C92 E;  4M7A A;  3QYH B;  4IUR A;  4YTL A;  4HT8 A;  5GAN g;  1M1F A;  4OP0 A;  1I81 A;  1N8R C;  3PNW C;  1JBM A;  1N27 A;  3RKW A;  4XU2 A;  1NJI C;  3J7A F;  1M5Q 1;  3J80 E;  3I56 T;  4XQ3 A;  1NZ9 A;  3OYJ A;  4KUD K;  1VQN T;  3VU3 C;  5FRO A;  4RCC A;  4IKF A;  1FWZ A;  2RJD A;  3UT1 A;  2RJE A;  4C92 D;  3SWN A;  4F7U A;  5GMK h;  3CXC A;  1K9M C;  3QXE B;  2BUD A;  2MI6 A;  1VQ6 A;  1VQM A;  1Q7Y C;  3M4Y A;  2DTO A;  2VUB A;  4BB7 A;  4A4H A;  4CI0 C;  5FLX E;  3WVD B;  2ZPI B;  1R8O B;  3M54 A;  3CCQ A;  2K5I A;  4EMK A;  2D0Q B;  1UGS B;  4XTW A;  2QDY B;  3LYI A;  1VUB A;  4EMG A;  4ZGE B;  2XD0 A;  4C92 A;  2XDD A;  3MO8 A;  2QQ9 A;  2RHU A;  3NFC A;  3MEU A;  2DZC A;  2Y4X A;  3I56 A;  3JB9 D;  5J39 A;  1Q82 U;  4R55 A;  3R6O A;  5HKC A;  2RI2 A;  3GNG A;  2DD5 A;  4IUT A;  2DEQ A;  4WF2 A;  5DM7 R;  1Q86 U;  1VQN A;  4A53 A;  2RJF A;  3ZFJ A;  1GXI E;  5GAO q;  4QW2 A;  2VXF A;  5GMK i;  5KCO A;  2PQW A;  5GAM f;  4X9C A;  3QJ6 A;  4MZT A;  1Y7X A;  1SSF A;  3HHT B;  4LDW A;  5GAM d;  4C5H A;  3TU4 K;  2RHI A;  3QZ9 B;  4BI8 B;  1OZ3 A;  4M77 B;  3CPF A;  4E47 A;  1IZ6 A;  5GAM h;  2EJF A;  3I55 T;  2XDB A;  3CCJ T;  1VQO T;  5HY6 A;  2RHX A;  3S3M A;  1VQ4 T;  3VYG A;  2GQV A;  3L1A A;  3V8L A;  2XDP A;  4LD9 K;  3G71 T;  2R5M A;  1IRE B;  1UGQ B;  2JTM A;  2XKO C;  3SDZ A;  3SB2 A;  2NLU A;  4C5G A;  3C4S A;  4M77 E;  2EQK A;  2Y90 A;  4ZGD B;  5M9O A;  1QVG A;  2RO0 A;  5CR2 A;  1NJI U;  5A0D A;  2RI3 A;  4PNO A;  1VQL T;  3BDU A;  3GP8 A;  2RI5 A;  1G3Y A;  5CAI A;  3OYB A;  2E1H A;  3CBM A;  3CCL T;  3CCR T;  2RM4 A;  2XHC A;  4NL2 A;  3V7C A;  5HK3 A;  1K9M U;  3AHU A;  3EFS A;  1Q7Y U;  4M77 D;  4C8Q G;  3I55 A;  1G5V A;  3GIB A;  5CIU A;  3HRU A;  4OB1 B;  3CCJ A;  1VQO A;  2EKO A;  1VQ4 A;  2OAU A;  1YIJ T;  5KH6 A;  3G71 A;  3OS2 A;  2YLC A;  2M16 A;  2E5Q A;  2HQE A;  2M1H A;  3MEA A;  4OGE A;  1VQ8 T;  3JCM V;  5LJ3 f;  2DXT A;  1QP3 A;  4C8Q C;  2QQR A;  1KQ1 A;  1QW1 A;  2DPP B;  3QO3 A;  3DLM A;  1M1G A;  4FIB A;  4M77 A;  3CCM T;  2ZCF B;  1VQL A;  5DY9 A;  2WSC E;  4BI3 A;  2AHJ B;  1U1S A;  3ZEH A;  3CCE T;  3EAE A;  2CGH A;  2DZ9 A;  4XTZ A;  5D6X A;  4B9X A;  3CCR A;  4JJN K;  2PVO B;  2HAX A;  3LGL A;  3CCL A;  2CZ7 B;  4M7D G;  3ZBD A;  4OMF B;  3HPW A;  5GAO r;  3RMS A;  3JRZ A;  1VQ7 T;  2KMT A;  3OSV A;  4Z02 A;  3CBO A;  2MWO A;  4X9D A;  4C8Q F;  4JS5 A;  1FX7 A;  1I8F A;  1YIJ A;  3NTI A;  5CKE A;  5FRM A;  3QSU A;  4IUU A;  1VQ8 A;  2LDM A;  2L3R A;  4NL3 A;  2B8A A;  3OMC A;  3OYL A;  3GPL A;  1BI0 A;  2RHZ A;  3A8L B;  4QVZ A;  2LRQ A;  1K73 U;  1WQW A;  2HBP A;  3CCM A;  1AHJ B;  1KG1 A;  1N6A A;  4O5V A;  5CKB A;  5GAO n;  2EWN A;  2K5L A;  3DB4 A;  1YIT T;  1VIF A;  4J7F A;  4LD6 A;  1TH7 A;  4LDY A;  1KD1 U;  2O4X B;  3CCE A;  4C0D B;  5I21 A;  1G3T A;  4DOV A;  3RUX A;  5GAN 8;  5GAN j;  3DKM A;  1VQ7 A;  2WAC A;  4ELZ C;  1X01 A;  4FL6 A;  3HRT A;  3QII A;  4XU1 A;  3LWH A;  4E7J A;  2MAM A;  4M7D F;  2QEX T;  1WGS A;  5IN1 A;  3M9Q A;  2E64 A;  4A4E A;  3OYG A;  3JAM E;  1KC8 C;  3J81 E;  2PVG B;  1D3B B;  1FXX A;  1XTD A;  4N4H A;  5GAN 2;  4BE1 A;  1W2B S;  4JRK A;  5FU7 B;  3JCM b;  2R58 A;  1M9S A;  3CBP A;  4HKE A;  3WXM B;  1M1K U;  3G4S T;  4A4G A;  1YIT A;  5FRN A;  3A5Z B;  3H6Z A;  1HK9 A;  3V8J A;  3LH0 A;  3FLG A;  2A7Y A;  2P4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...