2COYA

Solution structure of the cap-gly domain in human dynactin 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
GSSGSSGMAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Dynactin-1
publication title Solution structure of the CAP-Gly domain in human Dynactin 1
rcsb
source organism Homo sapiens
total genus 8
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2coyA01
2HL5C 2CP5A 1WHJA 2COWA 2HKQB 2M02A 1IXDA 1WHKA 2E4HA 2E3IA 2HL3A 4B6MA 2COZA 1WHMA 3E2UA 2MPXC 3RDVA 1WHLA 1LPLA 2QK0A 1TXQA 2HQHA 2CP2A 1WHHA 2HKNA 2CP7A 1WHGA 1TOVA 2E3HA 2Z0WA 2COYA 2CP6A 2CP0A 3TQ7P 2CP3A
chains in the Genus database with same CATH superfamily
1VIEA 3G1JA 1N6AA 3QO3A 6AT1B 3A1PA 5M9OA 1WX6A 3BE3A 3L2VA 1K4US 2QTVA 2RQVA 1X2KA 1K9MU 2MCNA 2JM9A 1QQJA 1YI2A 3I55Q 1RUWA 2MI6A 2WSCE 1Y96A 1VQMT 3CBOA 2DYBA 2V8JA 4XTYA 1I81A 4II1A 3FRNA 4FSSA 3S3MA 4Z02A 3JCMb 1K9MR 3EG0A 2PUKB 1RACB 3C95A 3VS6A 3CC2T 2XU8A 4OGEA 2LNHB 5KYUB 4KULA 3PMIA 4N4HA 5I11A 1WFWA 1PD0A 2L0AA 3QDRB 3L2QA 2O9VA 3UF4A 1TH7A 3CD6Q 2RM4A 1FMWA 3ASKA 4XU3A 3LX7A 4Y91A 1Q95G 2ZZDA 4JJCA 2KGTA 1QVFS 3A8LB 2E41A 2LNVA 5GANd 2HEQA 3HL8A 1OOTA 1Q81U 2K5FA 2CT4A 2YT6A 4OMMA 2LCSA 1D0YA 2FL7A 1Q82C 2HBPA 2DZCA 2EGCA 2B8AA 3HTRA 2XKOC 2DYIA 2A36A 1X27A 4LDUA 5GJWB 2RQTA 3CCRA 3RKWA 4JRPA 3CD6A 2ZPGB 1Q81R 2LQ8A 1GBQA 3UATA 2HSEB 3VUZA 1G3SA 2QDYB 4RTVA 2FZKB 2HMAA 4FU6A 2RJFA 1MNDA 3NHNA 1VQKQ 3QIIA 1V1CA 2QA4T 2EVRA 3PFSA 5LJ3g 2JJ9A 2P0PA 2E3HA 3CXCS 3PE0A 2V8IA 2F1LA 1NJIU 1ZA1B 2BE7D 1M1KU 1VQ4Q 1R8OB 4F16A 1Q81C 1AOJA 5KYWA 3MEUA 4HVVA 3CCVT 4IUVA 4CRIA 1I1JA 3EG2A 3LGLA 3KXTA 4M75E 1D1AA 1M2VB 4F04B 3CXCP 3WVEB 4AT1B 1W2BS 1IHWA 3I9QA 5GAN8 5IHNA 1M27C 4C0DB 5I2MA 4MDXA 1Y7XA 3QBYA 3QZ9B 3JB9J 1NJIR 1G3WA 1FMKA 5I2SA 3L2WA 1M1KR 3NFCA 5GAOm 2JMCA 2COWA 3RKYA 4M77F 4AFZC 1N27A 2V26A 3QZ5B 2WSFE 4M75D 3VJPA 1X01A 5I21A 3O5ZA 1BI0A 1N8RU 2DLPA 1W2BP 4AG2C 1VQ4A 3OYDA 1E6GA 1OYXA 4EPCA 1FMVA 2L2PA 1R0CB 1WPYA 1T3SA 3CCST 1T3LA 3EFOB 2KVQG 1NJIC 1OZ2A 4M78F 1AD5A 3OSVA 1HD3A 1S1NA 5FU7C 4RTXA 1AEYA 2XDBA 1AWWA 3CC4A 3EFRA 1ARKA 1VQ8A 2K5LA 1N8RR 2CYZB 3ULRB 1NYGA 1QKXA 4ZNXA 2EYXA 1JJ2P 1WXBA 2L5QA 3I5RA 3V8KA 2K7AA 3OYIA 3G6ET 3CCJQ 2MIOA 5CO7A 5HY6A 1KG1A 2RK1A 1WDXA 3TREA 3QDFA 3CBPA 1SHFA 3G4SQ 2O31A 4HCKA 3R6NA 4Y92A 2K2VA 1YJNA 3KUFA 1Q7YU 4DEYA 2A0FB 3JAME 1QVGS 1Q86U 5LL6S 3JCMf 1ZHIA 3JB9G 2CKKA 4RCBA 4ME7A 1OI1A 2OTLQ 1X6GA 4OGCA 2DXUA 2HKQB 2PUOB 4KBMB 4XTWA 1M3BA 2A3LA 2KXCA 1H92A 4M77A 2DO3A 2OAWA 1AZGB 1RAFB 2EJGA 1Q7YR 1K0XA 4A4FA 1QVGP 4E2FB 1Q86R 4XTZA 2OI3A 1QVFA 2QQ9A 4EMHA 3DKMA 2J06A 4KH0B 3P8HA 4C0GA 1CKBA 2FPFA 2E6ZA 1VQ7A 4M78A 1YIJQ 4HVWA 5LJ5f 2E10A 4M77C 2DL7A 4J9HA 3MCAB 4DBRA 2OTLA 2I0NA 2KRSA 1UHCA 1Q7YC 1VIFA 2KY9A 2QGFB 4NOYA 1Q86C 4PJJA 1KHCA 3VS1A 3TQ7P 1ZSZA 4BI8B 1Z9QA 4HCCA 3RKXA 1UG1A 2VYTA 3RIRA 1RI9A 2EGEA 4BD3A 4M78C 3C12A 3OYGA 2X4XA 4ANJA 4KUIA 4XAXB 1NPRA 1PRMC 2A7YA 2NWMA 3CXCA 2KR3A 1VQ9A 3EFSA 1WGSA 2JM8A 1YIJA 4IIMA 3A8OB 5D6XA 1ZSZC 2EQKA 4L6V5 3BFMA 2GNCA 5CR2A 1VQMQ 3BDUA 4OMNA 5FWBA 2EFIA 1W1FA 2GF7A 2QEXT 3OYBA 3OMGA 2IPOB 3ZEHA 1KQSS 1W2BA 3JCMd 2DL4A 5IT9E 2DFUA 3SDZA 1IGQA 4M7AB 2G6FX 4ZN3A 1VQPA 3ER0A 1YWOA 5CCAA 3FIFA 3FEOA 2DM1A 1HJDA 1AZEA 5GANe 2PVGB 3LW5E 3CC7T 4A54A 2LX9A 4YTLA 4JRQA 5KYYA 2E65A 2HZYA 3A8HB 1CSKA 3QPHA 3H9NA 2JS0A 2CZ0B 4GLMA 2M51A 4E7KA 2JTEA 1M4ZA 1OU8A 3M0QA 4M7DB 1VQKT 1KFZA 3GF5A 2FG0A 1VQNT 5LJ5d 4QVDA 2DK3A 4BB7A 4QT7A 2YXYA 3PTAA 1TXQA 1QKWA 1RLPC 1K8AU 1JRIA 3C94A 2RK2A 2RH2A 2ZGWA 5GAN6 1RAIB 3CC2A 4OB1B 1GCQA 2DL3A 2QAZA 1AVZC 1R77A 5CKFA 2O4XB 4ATOA 3TU4K 4IURA 4ORZA 1K8AR 3CCQT 1YBYA 4JJDA 4XU1A 4HCBA 2EGAA 4E7IA 2FEIA 2HDAA 1QVGA 1VQOT 2F5TX 2IIMA 4ZGEB 4C8QB 1UTIA 3FLGA 1S72A 3HRUA 3QYHB 4XTUA 2ED0A 2QA4Q 4ZTJA 2BZYA 1GCQC 1KHIA 3JRZA 1KQ2A 2OJ2A 3QXEB 2CP5A 4B6MA 4BY6C 1BK2A 1U8RA 3CCLT 3SWNB 3JB9H 4C8QA 1K8AC 3CCUT 1GCPA 4C92F 3CCVQ 3M54A 2MWOA 3G71Q 5DLQE 2WSEE 1VQ5A 1WA7A 3OYLA 1ACMB 1MGQA 3UWNA 3REBB 1NEBA 1YJ9T 2CSQA 2R58A 4RUGA 2HL3A 4NL3A 4J9BA 4PJOB 2GTJA 2AKLA 1OU9A 4HCZA 3PIPA 4R0KA 4CC7A 1UEBA 2EYZA 2R5MA 1OEBA 2EW3A 3V8LA 2M9UA 4M77G 1QCOA 2VV5A 1RABB 3REAB 2EJ9A 3CMAT 1WQ7A 2D9TA 2A28A 2RMOA 3NTKA 5GANj 2BUDA 2DNUA 2NUTB 5HK3A 1JBMA 2KDSA 1EIFA 3DLMA 5FRNA 3CCSQ 1NG2A 4IUPA 2KBTA 5C0MA 4M78G 3P8BB 3VS7A 1MMGA 2OTJT 4J9IA 4ZGJB 1UECA 4KGZB 2Z0WA 2DEUA 4LUDA 2X35A 5GAMd 4BE0A 4A4GA 3H0FA 3OYHA 5I22A 4OF1A 2QGGA 3OYEA 1D1BA 1VQ6A 3OS5A 2F5KA 2P4RA 3G6EQ 1QMCA 3X25B 4LD6A 2J6OA 1NLOC 1KQSA 2EPDA 1M8VA 3PMTA 3L2ZA 3MEWA 1YP5A 4C92A 1KK7A 4MZTA 1BCMA 5GANf 1WHJA 2DIGA 4J6XA 1D0XA 1N9SA 8AT1B 2HD0A 1VQLT 1BU1A 1WHLA 2YSQA 4JDSA 2E1HA 1IB8A 3EGXA 4BE1A 4A4HA 1MNEA 2YUPA 5FU6B 1X6OA 5GMKe 2EYWA 2DD4A 5LJ5g 1ZBXA 2CH4W 2LZ6B 3MHXA 2D0NA 1TUCA 3HRTA 2EJFA 3G6EA 3CEYA 1XQHA 3MJXA 3MO8A 2D6FA 4C92C 3EG9B 2D8HA 4PJNA 5A0GA 2YWWA 2YUQA 3E2UA 4J8OA 2QQBA 1IRXA 1KD1U 4FW2A 3MKDA 2NUPB 1OPLA 2VKNA 2V8KA 3ME9A 4M7DE 4XTXA 2QQSA 3CMEA 4RTYA 2DETA 5A0LA 1QLYA 5GMKl 4CI0C 2FYKA 3RUXA 2KYBA 2G3RA 2RB6A 1U1SA 2K2MA 1KD1R 2FHDA 3NTHA 4CC2A 1GRIA 1H3ZA 2JN0A 5CKDA 4M7DD 1R0BG 4J5YA 5HK0A 1UFFA 2P0QA 3L42A 3OYFA 1K73U 2JW4A 5KH6A 5KYXB 1SHGA 3I56T 3EGDB 2K9GA 2HNIA 3JCMe 2MK5A 3ZL7C 1OQKA 4LNPA 3I35A 4C8QE 3I55A 3VUBA 1YN8A 4OVAA 1UUEA 1K73R 1TU0B 3EGDA 2C0TA 2LP5A 3NMZC 1K9MC 4ESRA 1GFDA 2RHYA 5KYUA 2PVDB 2COYA 2QEXQ 3MP8A 1BIBA 4JLGA 4BUGA 3EG1A 2ROTA 2VXFA 3BDLA 2DRKA 1WHKA 4C8QD 3H6ZA 2ECZA 2FRWA 2IG0A 1GFCA 1MMAA 4X9CA 4HVUA 2KRNA 4DBQA 5LJ5e 4A4EA 2MYSA 4C0FA 1QVFP 2HQXA 2X3WD 4JZ3A 3A98A 4VUBA 3S6WA 3CC7Q 1B07A 1V29B 2F2XA 2DILA 4Z88A 1B3QA 5L8RE 1XOVA 1LJOA 5GMKj 4MZPA 1ZX6A 5GAOn 2QEXA 5CIUA 1BIAA 5IH2A 2RJCA 3E1SA 1VQNQ 3O8VA 3RERA 3CBMA 3M5AA 2YLBA 4PFPA 3OSSC 1UE9A 5IHIA 4RTTA 1RAGB 2J6FA 3V8JA 2WACA 3SHWA 2ABLA 1WHMA 2BZ8A 3HRSA 1X69A 5KCOA 3QKJA 1OZ3A 1LPLA 4FT4A 3G71T 1YCSB 1QCFA 2ZPHB 4C92E 4KT0E 1UDLA 2J6KA 3CCQQ 7AT1B 2AIRB 1E7OA 4XQ3A 5C6SA 1VQOQ 2P0KA 1VQKA 3E9FA 4GBQA 2YRVA 1SPKA 3GNFB 2NUZA 2RHUA 1M2VA 2BIVA 4QQDA 2XK0A 2CUDA 2XG8D 1OX8A 3GBQA 4C92D 2DAQA 3CCET 2DVJA 1YITQ 2AK5A 2OAUA 3CCLQ 1M90U 2RQRA 2H8HA 5IN1A 2O01E 3DB4A 4B9WA 1OX9A 3OYAA 3CCUQ 4M75G 3GP8A 1X75C 4R55A 4BI4A 4AFUC 4C92G 1IZ6A 3SFMA 1M1KC 3LWIA 2MPXC 2BKDN 3OMCA 1NPPA 1YJ9Q 1N5ZA 2ZPEB 1BB9A 2H3JA 2ZPFB 3MEVA 4C0DC 1M90R 2DMOA 1YJWT 3EFOA 3M0UA 1Y07A 4V2SA 1UHFA 4GY5A 3CMAQ 4E7JA 5GAMe 2QYZA 3H41A 1QWEA 2ROLA 3CCLA 5LJ5j 1X2QA 2DF6A 4D8KA 4HKEA 5KCHA 2XDDA 3JCMQ 1XTDA 2DBMA 4ELYC 1N8RC 2C0IA 3M56A 4OMLA 1K1ZA 1OV3A 2P84A 3V7CA 4J9EA 5IAYA 2RQUA 2OTJQ 1UB4A 5GMKh 3NPFA 2DTOA 2YHTA 3GIBA 1AWXA 2RD1A 3OYKA 2HBWA 5GANg 3I5SA 3CCJA 2CDTA 3EHRA 2V1RA 1TG0A 1UGPB 3G4SA 1ZQ1A 3CCMQ 1KJWA 4BE2A 3PT9A 2LT1A 1VYVA 4J7IA 3RBBB 3RDVA 1N9RA 2XIDA 3C4SA 1C0MA 3QG1A 4FIBA 3VKIA 2E5QA 4M7AF 2GTOA 1VQLQ 1M5Q1 2L3RA 1RLQC 5CKEA 4IIOA 2LQKA 2CP6A 2LVMA 1KC8U 4JLIA 2RQWA 4EMKB 2CZ6B 2ZAEA 3A8MB 4OMPA 2VVKA 2K79A 4FYWB 4KGVB 4RG2A 5CQXA 4OB2B 4F7UB 1JU5C 3JCMV 3MP6A 1LOJA 2EQUA 3EHQA 1PKSA 1JXOA 3JCMh 4OB0B 2EQJA 2RJEA 1MHNA 4M7DF 2GQIA 4O5VA 4LDVA 2ZCFB 1QCNA 3CQTA 1AWJA 1QVPA 4F7UA 2FZCB 3QWXX 3M9QA 2LQWA 2DJZA 1I4K1 2VC8A 2DXBA 3SB2A 4GLKA 1NE8A 2P4TA 4N0AA 3WXMB 1LCKA 1WNLA 3CCRT 4OMQA 5GAMj 3NGPA 2X4WA 1BBZA 1M3CA 5LJ5h 1WI7A 4PL6A 2E3IA 2LT4A 2E70A 3VS4A 3GLXA 2GGRA 2RN8A 3I56Q 1ABOA 1K0SA 4C8QF 1U3OA 5IXFA 1KQSP 1G3TA 5HCKA 4CC4B 5GAOr 2DE0X 4MMLA 3TVTA 4AFQC 2ZPIB 4N0AC 4M7AA 3E9GA 1VQMA 3JB9I 1H3HA 4F17A 2EQIA 4PK4A 3T9NA 3HP9A 2LJ1A 2E4HA 5DY9A 2KQWA 3OYJA 3OQ5A 3NTIA 2QK0A 1AWOA 2QASA 5D7UA 3VRZA 4C5GA 1WQWA 4KRTA 3H0HA 3L1AA 1Z9ZA 4MZMA 4PJOF 4M7DA 4M7AC 5GAMf 2KE9A 2KT1A 1W4SA 1XJWB 3CPWS 4WCIA 1SSFA 3JCMJ 3M0RA 1NM7A 4RTZA 4E47A 1AHJB 1F1BB 4MMKA 4BI3A 1YWPA 3A8GB 2XICA 1WJQA 2O4XA 2A08A 4M7DC 2KXDA 1IO6A 5GJVB 5LJ3f 3CPWP 4JUVA 3HPWA 1YITT 3OS1A 4ZTFA 3ZBDA 2CP2A 1VQ8T 1TSFA 5AT1B 2DTHA 5GAN5 1VYTA 3WVDB 1O75A 3SD4A 4A63B 2DTIA 1ZUYA 4Z8AA 3HSBA 1KIKA 1MMDA 3SWNA 4RTUA 5CKBA 1G8XA 4QKUA 1YJNT 2QA4A 4ZGDB 1LNXA 5GMKm 1FWZA 4C8QC 2LC4A 2FPDA 4J9FA 2X4JA 5CVIA 3J81E 2AZVA 4C5HA 3CCEQ 1B34B 2O9SA 1M1FA 4PJOA 2M1HA 3HFOA 1T0HA 5FWCA 4OMOA 2CREA 3SWNC 3CCVA 2FPEA 2QQRA 3G71A 2LRQA 2R57A 3S3NA 3LGFA 2GCXA 3BW1A 3UT1A 1SKUB 4FYYB 1B34A 2J7IA 4JS4A 4KUDK 4F7UE 3QJ6A 2NUTA 1D3BB 2RA2A 3H0IA 3HHTB 2Y4YA 2O88A 1YJWQ 1PRLC 4PJOC 1JO8A 3JCMg 1CKAA 1D0ZA 1WJRA 1NLPC 1VOMA 3HKSA 4JJNK 2GFUA 4DBHA 4JS5A 4QVCA 2DRMA 1BCOA 3CCMT 2RI3A 1JQQA 1NYFA 3OW2S 4M75B 3CCSA 2W10A 2CT3A 3HFNA 1SG5A 1UJ0A 2JTMA 2DXTA 5LJ3d 1GBRA 3AT1B 3VS2A 2HQEA 2COZA 1PWTA 4N4IA 1G83A 3KFVA 2L3SA 2KT8A 4M7AE 1YJWA 3GNGA 8ATCB 1VQ9T 2EYQA 3UA6A 2LQNA 3OBYA 1J3TA 2FB7A 4C0ZA 2NYSA 3OYYA 4FW1A 3OY9A 1YI2Q 1QP3A 2EKHA 4LE9A 5A2QE 3X26B 2JVVA 1I5OB 4PJMA 1TTHB 4M7AD 2HKNA 2EWNA 3M0SA 2O2OA 2D8JA 1WJSA 3EG9A 2KRMA 5J3BA 2CZ1B 3M53A 1Y96B 2FVUA 2MMPA 4M7AG 1VQPT 1X6BA 1GXIE 2NUPA 4J9GA 4DQ2A 2RHIA 3JV3A 3CPWA 4FCYA 3ZFJA 1I5LA 1W70A 5FU6C 1BKBA 4XU0A 4ELZC 1PSFA 1E6HA 3QHSA 3LH5A 4XTVA 4QQ6A 5GANh 1D09B 1QP2A 5IXBA 3PVLA 2PTKA 3META 1JXMA 1M9SA 4J9CA 2RNAA 4M7DG 1EZZB 1Q82U 5HKCA 2HQHA 2X51A 4BACA 1YHQT 3EGUA 1KD1C 1U06A 5KYXA 2RI5A 2MOXA 4QVZA 1WHGA 1BYMA 4J6YA 1BI1A 5IHKA 2QI2A 1HK9A 5AYFA 2MWPA 4FT2A 3AHUA 3N5BB 2EKOA 1IGUA 2EAYA 2K6DA 2LJ0A 5CQYA 4LXCA 3CCRQ 1Q82R 4J83A 4N4GA 1QW1A 1UJYA 4QQGA 4D8DA 4JZ4A 3OA6A 1RAAB 2GFAA 4RG8A 1M2OA 4IUQA 2CP7A 3M0TA 2LMJA 3X20B 4FL6A 1JB0E 3RMSA 4C8QG 1EX4A 2JNGA 1S72T 1K73C 1YCYA 4PJOE 3QJYA 5KE2A 4E7LA 3R6OA 3GPLA 2D0QB 1G5VA 3JCMP 3M4YA 1ZLMA 3JCMc 3TSWA 3A5ZB 3VS3A 5GAMg 2K3YA 2L3QA 3M4GA 1EFNA 2J05A 4PJOD 2F2VA 2ENMA 2DVEA 1VQ5T 3J7AF 1I07A 2B86A 2JOYA 4RCCA 2JMAA 3RESA 1Y57A 1HSQA 1SRLA 4J6WA 2JUFA 4RKUE 4X34A 5KYNA 1H8KA 1KSWA 2R5AA 2KROA 4PJOG 5KYWB 4F14A 3E19A 2CGHA 2K5IA 2C06A 3CC7A 3FJPA 1G2BA 1PSEA 2XMFA 5L23A 3M57A 3OW2A 4J9DA 1YNZA 1PCXA 3BY7A 2C0OA 1IXDA 5KE3A 2L89A 1ZUKA 5GAOp 1W6XA 2VGNA 4PLIA 1VQNA 5FU7B 2FRYA 1B7TA 2EIFA 1WZOA 1Y0MA 1D1CA 3KBGA 1RAHB 4PLLA 2E12A 3LLRA 3CC4Q 1VQ8Q 2QDLA 2KK4A 3VS5A 4BDZA 2CS7A 1QWFA 2X9HA 3FJ5A 3VYHB 1P92A 4JRKA 3OYCA 2RHXA 3URGA 2JZ2A 1VQ6T 4D6WA 5A0DA 1GL5A 4LUEA 1HXDA 2DZ9A 3CCQA 4QW2A 1VQOA 1VYUA 1JJ2S 2VASA 1YJNQ 2DJQA 1RL2A 5CKHA 2OX7A 4E7SA 2CUBA 4LDWA 3S3OA 1ZA2B 2GQVA 2RPNA 2VB6A 4RTWA 2M0OA 3V7SA 2ESWA 4HXJA 1YITA 1NBEB 2X3XD 2MF2A 3CPFA 3CCUA 5ECAA 2ED1A 2K57A 1ZBJA 2BTTA 1M90C 2NLUA 4F7UF 1PHTA 1MV3A 1YJ9A 2VUBA 3JB9D 1OULA 3EH1A 2BZXA 2VXEA 4HT8A 4XK8E 3MPUB 4OB3B 5LJ3e 2DX1A 4A53A 4M77B 2XI9A 1WHHA 4ZN1A 1VQ7Q 3TSZA 1TOVA 3CMAA 3P8DA 4DBFA 4WTOB 3RR6A 1WXTA 1YI2T 1V76A 9ATCB 3PGGA 3CMET 3DLLA 4TVRA 2PQWA 5GAN2 4E7HA 2LCLA 2DA9A 2ZPBB 1FXXA 1WIEA 3DB3A 4X1VA 5GAN3 4M78B 2VWFA 3FDRA 1C1AA 2QG9B 1DJ7B 1K9AA 2OTJA 2A37A 2IVWA 1FX7A 3G7ZA 4Q5WA 3OB9A 2DL5A 2VGMA 1UGQB 3VU3C 3EAEA 1OPKA 1PNJA 3D7SB 1VQ9Q 2X4YA 4C5IA 2KAFA 1MUZA 1ZSZB 4DOVA 2ATCB 3X28B 2JT4A 5GAOl 2L8DA 3I55T 2EQMA 2XHCA 5DM7R 3CCMA 3UPUA 3OYMA 4PNOA 4IKFA 4EMKA 4NL2A 1UGRB 4DEXA 1KC8R 1U5SA 1SSHA 3RNJA 1UGVA 4MDWA 3VS0A 5D6YA 2E6NA 2YRDA 1VQLA 2AZSA 4X9DA 1VQPQ 2RI2A 1PKTA 4L59A 5GAN7 2KSSA 2LJ3A 1SF9A 3UA7A 2M0YA 4R56A 4JRIA 4EMKC 2XDPA 1ABQA 3H8ZA 3M58A 4P5NA 4FSXA 5CAIA 1RADB 3CD6T 2L3PA 4PKCC 4J7FA 1KC8C 2LDMA 4M4ZA 2DL8A 3EH2A 3EG3A 2KI7A 3VV0A 2Y4XA 2F69A 3LH0A 2PVOB 1G3YA 2AT1B 2CH4A 3F70A 2DIQA 4JPBW 5KYYB 2LX7A 1YHQQ 2CP3A 3OS2A 1Y71A 4AMCA 2HL5C 3M59A 4LD9K 5FW9A 2F2WA 3CC2Q 2SEMA 1LVKA 2QXFA 5LJ3j 4EIKA 5FRMA 2QTXA 3TEEA 3THKA 4KGXB 4HA8A 2D1XA 2PZ1A 2DERA 1NEGA 5DLOA 1X43A 2H3EB 1JJ2A 1I8FA 4DA4A 3FB9A 1KQ1A 1VUBA 3I56A 1K76A 4Z89A 1TUGB 3UDCA 1S72Q 1IREB 3PIOA 2JS2A 1M1GA 1PD1A 1PM3A 3JSCA 2M16A 3OYNA 4BY6B 1YHQA 2YUNA 4NS5A 5GAN4 2EBPA 2E5KA 4UC4A 1VQ4T 3M55A 4L5GA 5GAOq 4PFOA 4B9XA 1IHVA 2EYYA 1ZUUA 3U23A 3M0PA 3LWHA 4BDYA 2M02A 4EDUA 4FM4B 1VQ5Q 1M8MA 2I2LA 2HCKA 3PVQA 3X24B 2SRCA 4DOWA 2QQAA 3Q1JA 2YUOA 3CC4T 3QWYA 1SEMA 3SEMA 2DXCA 4IUUA 3V7RA 4AG1C 1MMNA 3OS0A 4M77E 4LN2A 3C0CA 2JXBA 2LCCA 3MP1A 3OBWA 1XNIA 4E6RA 3J80E 3L2UA 2DEQA 2RHZA 5EC7A 4M75F 4O6JA 1O9SA 2K3BA 2DPPB 2JTFA 1PC0A 3PNWC 1I0CA 3FC3A 5GAMh 2RO0A 3LYIA 4M77D 3JCMX 2DD5A 4M78E 2GBQA 1TWBA 5GMKi 3JCMW 4OP0A 4C5EA 2PU9B 5FLXE 2MAMA 4EMGA 2DKGA 2KEAA 4Y28E 4FYXB 2K3XA 1VQ6Q 2E64A 3CCJT 2RJDA 3INZA 2LTOA 4LDXA 3RMQA 4PJLA 2KYMA 3TCJA 2PNIA 1H641 5J39A 3G4ST 2YDLA 4M78D 5D6WA 1U1TA 5LJ3h 2HSPA 5CK9A 4RMOA 2DBKA 1VA7A 2BE9B 4E7ZA 1AT1B 1VQ7T 1HYOA 2AHJB 4IUTA 4K11A 4FYVB 3JB9F 1BI3A 5FROA 2OTLT 2FO0A 3CCEA 1NZ9A 1MV0B 2Y90A 5EG2A 5J26A 1D3BA 2YLCA 4AFSC 1UGSB 1M3AA 4CC3A 4C92B 2W0ZA 4KH1B 3QUIA 4WF2A 1ZSGA 2KNBB 3IQLA 4F7UG 3L2RA 3GOXA 4HT9A 3MEAA 4LDYA 3QSUA 3EGXB 4M75A 1BI2A 4A4KA 3OW2P 2YRCA 1M30A 1T0JA 1YFNA 2FZGB 1YIJT 1WLPB 2HAXA 1SRMA 3VYGA 2K4YA 1WXUA 4OMFB 1TS9A 4JJBA 2KMTA 3CMEQ 3VRYA 1RI0A 2CZ7B 1FYNA 1C6VX 1WYXA 2AKKA 2CSIA 2XD0A 1TUDA 2V1QA 4XU2A 1PG5B 4M75C 2RF0A 1RAEB 3QYGB 4PFZA 1JEGA 2CP0A 1A0NB
chains in the Genus database with same CATH topology
2HL5C 2CP5A 1WHJA 2COWA 2HKQB 2M02A 1IXDA 1WHKA 2E4HA 2E3IA 2HL3A 4B6MA 2COZA 1WHMA 3E2UA 2MPXC 3RDVA 1WHLA 1LPLA 2QK0A 1TXQA 2HQHA 2CP2A 1WHHA 2HKNA 2CP7A 1WHGA 1TOVA 2E3HA 2Z0WA 2COYA 2CP6A 2CP0A 3TQ7P 2CP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL5 C;  2CP5 A;  1WHJ A;  2COW A;  2HKQ B;  2M02 A;  1IXD A;  1WHK A;  2E4H A;  2E3I A;  2HL3 A;  4B6M A;  2COZ A;  1WHM A;  3E2U A;  2MPX C;  3RDV A;  1WHL A;  1LPL A;  2QK0 A;  1TXQ A;  2HQH A;  2CP2 A;  1WHH A;  2HKN A;  2CP7 A;  1WHG A;  1TOV A;  2E3H A;  2Z0W A;  2COY A;  2CP6 A;  2CP0 A;  3TQ7 P;  2CP3 A; 
#chains in the Genus database with same CATH topology
 1VIE A;  3G1J A;  1N6A A;  3QO3 A;  6AT1 B;  3A1P A;  5M9O A;  1WX6 A;  3BE3 A;  3L2V A;  1K4U S;  2QTV A;  2RQV A;  1X2K A;  1K9M U;  2MCN A;  2JM9 A;  1QQJ A;  1YI2 A;  3I55 Q;  1RUW A;  2MI6 A;  2WSC E;  1Y96 A;  1VQM T;  3CBO A;  2DYB A;  2V8J A;  4XTY A;  1I81 A;  4II1 A;  3FRN A;  4FSS A;  3S3M A;  4Z02 A;  3JCM b;  1K9M R;  3EG0 A;  2PUK B;  1RAC B;  3C95 A;  3VS6 A;  3CC2 T;  2XU8 A;  4OGE A;  2LNH B;  5KYU B;  4KUL A;  3PMI A;  4N4H A;  5I11 A;  1WFW A;  1PD0 A;  2L0A A;  3QDR B;  3L2Q A;  2O9V A;  3UF4 A;  1TH7 A;  3CD6 Q;  2RM4 A;  1FMW A;  3ASK A;  4XU3 A;  3LX7 A;  4Y91 A;  1Q95 G;  2ZZD A;  4JJC A;  2KGT A;  1QVF S;  3A8L B;  2E41 A;  2LNV A;  5GAN d;  2HEQ A;  3HL8 A;  1OOT A;  1Q81 U;  2K5F A;  2CT4 A;  2YT6 A;  4OMM A;  2LCS A;  1D0Y A;  2FL7 A;  1Q82 C;  2HBP A;  2DZC A;  2EGC A;  2B8A A;  3HTR A;  2XKO C;  2DYI A;  2A36 A;  1X27 A;  4LDU A;  5GJW B;  2RQT A;  3CCR A;  3RKW A;  4JRP A;  3CD6 A;  2ZPG B;  1Q81 R;  2LQ8 A;  1GBQ A;  3UAT A;  2HSE B;  3VUZ A;  1G3S A;  2QDY B;  4RTV A;  2FZK B;  2HMA A;  4FU6 A;  2RJF A;  1MND A;  3NHN A;  1VQK Q;  3QII A;  1V1C A;  2QA4 T;  2EVR A;  3PFS A;  5LJ3 g;  2JJ9 A;  2P0P A;  2E3H A;  3CXC S;  3PE0 A;  2V8I A;  2F1L A;  1NJI U;  1ZA1 B;  2BE7 D;  1M1K U;  1VQ4 Q;  1R8O B;  4F16 A;  1Q81 C;  1AOJ A;  5KYW A;  3MEU A;  4HVV A;  3CCV T;  4IUV A;  4CRI A;  1I1J A;  3EG2 A;  3LGL A;  3KXT A;  4M75 E;  1D1A A;  1M2V B;  4F04 B;  3CXC P;  3WVE B;  4AT1 B;  1W2B S;  1IHW A;  3I9Q A;  5GAN 8;  5IHN A;  1M27 C;  4C0D B;  5I2M A;  4MDX A;  1Y7X A;  3QBY A;  3QZ9 B;  3JB9 J;  1NJI R;  1G3W A;  1FMK A;  5I2S A;  3L2W A;  1M1K R;  3NFC A;  5GAO m;  2JMC A;  2COW A;  3RKY A;  4M77 F;  4AFZ C;  1N27 A;  2V26 A;  3QZ5 B;  2WSF E;  4M75 D;  3VJP A;  1X01 A;  5I21 A;  3O5Z A;  1BI0 A;  1N8R U;  2DLP A;  1W2B P;  4AG2 C;  1VQ4 A;  3OYD A;  1E6G A;  1OYX A;  4EPC A;  1FMV A;  2L2P A;  1R0C B;  1WPY A;  1T3S A;  3CCS T;  1T3L A;  3EFO B;  2KVQ G;  1NJI C;  1OZ2 A;  4M78 F;  1AD5 A;  3OSV A;  1HD3 A;  1S1N A;  5FU7 C;  4RTX A;  1AEY A;  2XDB A;  1AWW A;  3CC4 A;  3EFR A;  1ARK A;  1VQ8 A;  2K5L A;  1N8R R;  2CYZ B;  3ULR B;  1NYG A;  1QKX A;  4ZNX A;  2EYX A;  1JJ2 P;  1WXB A;  2L5Q A;  3I5R A;  3V8K A;  2K7A A;  3OYI A;  3G6E T;  3CCJ Q;  2MIO A;  5CO7 A;  5HY6 A;  1KG1 A;  2RK1 A;  1WDX A;  3TRE A;  3QDF A;  3CBP A;  1SHF A;  3G4S Q;  2O31 A;  4HCK A;  3R6N A;  4Y92 A;  2K2V A;  1YJN A;  3KUF A;  1Q7Y U;  4DEY A;  2A0F B;  3JAM E;  1QVG S;  1Q86 U;  5LL6 S;  3JCM f;  1ZHI A;  3JB9 G;  2CKK A;  4RCB A;  4ME7 A;  1OI1 A;  2OTL Q;  1X6G A;  4OGC A;  2DXU A;  2HKQ B;  2PUO B;  4KBM B;  4XTW A;  1M3B A;  2A3L A;  2KXC A;  1H92 A;  4M77 A;  2DO3 A;  2OAW A;  1AZG B;  1RAF B;  2EJG A;  1Q7Y R;  1K0X A;  4A4F A;  1QVG P;  4E2F B;  1Q86 R;  4XTZ A;  2OI3 A;  1QVF A;  2QQ9 A;  4EMH A;  3DKM A;  2J06 A;  4KH0 B;  3P8H A;  4C0G A;  1CKB A;  2FPF A;  2E6Z A;  1VQ7 A;  4M78 A;  1YIJ Q;  4HVW A;  5LJ5 f;  2E10 A;  4M77 C;  2DL7 A;  4J9H A;  3MCA B;  4DBR A;  2OTL A;  2I0N A;  2KRS A;  1UHC A;  1Q7Y C;  1VIF A;  2KY9 A;  2QGF B;  4NOY A;  1Q86 C;  4PJJ A;  1KHC A;  3VS1 A;  3TQ7 P;  1ZSZ A;  4BI8 B;  1Z9Q A;  4HCC A;  3RKX A;  1UG1 A;  2VYT A;  3RIR A;  1RI9 A;  2EGE A;  4BD3 A;  4M78 C;  3C12 A;  3OYG A;  2X4X A;  4ANJ A;  4KUI A;  4XAX B;  1NPR A;  1PRM C;  2A7Y A;  2NWM A;  3CXC A;  2KR3 A;  1VQ9 A;  3EFS A;  1WGS A;  2JM8 A;  1YIJ A;  4IIM A;  3A8O B;  5D6X A;  1ZSZ C;  2EQK A;  4L6V 5;  3BFM A;  2GNC A;  5CR2 A;  1VQM Q;  3BDU A;  4OMN A;  5FWB A;  2EFI A;  1W1F A;  2GF7 A;  2QEX T;  3OYB A;  3OMG A;  2IPO B;  3ZEH A;  1KQS S;  1W2B A;  3JCM d;  2DL4 A;  5IT9 E;  2DFU A;  3SDZ A;  1IGQ A;  4M7A B;  2G6F X;  4ZN3 A;  1VQP A;  3ER0 A;  1YWO A;  5CCA A;  3FIF A;  3FEO A;  2DM1 A;  1HJD A;  1AZE A;  5GAN e;  2PVG B;  3LW5 E;  3CC7 T;  4A54 A;  2LX9 A;  4YTL A;  4JRQ A;  5KYY A;  2E65 A;  2HZY A;  3A8H B;  1CSK A;  3QPH A;  3H9N A;  2JS0 A;  2CZ0 B;  4GLM A;  2M51 A;  4E7K A;  2JTE A;  1M4Z A;  1OU8 A;  3M0Q A;  4M7D B;  1VQK T;  1KFZ A;  3GF5 A;  2FG0 A;  1VQN T;  5LJ5 d;  4QVD A;  2DK3 A;  4BB7 A;  4QT7 A;  2YXY A;  3PTA A;  1TXQ A;  1QKW A;  1RLP C;  1K8A U;  1JRI A;  3C94 A;  2RK2 A;  2RH2 A;  2ZGW A;  5GAN 6;  1RAI B;  3CC2 A;  4OB1 B;  1GCQ A;  2DL3 A;  2QAZ A;  1AVZ C;  1R77 A;  5CKF A;  2O4X B;  4ATO A;  3TU4 K;  4IUR A;  4ORZ A;  1K8A R;  3CCQ T;  1YBY A;  4JJD A;  4XU1 A;  4HCB A;  2EGA A;  4E7I A;  2FEI A;  2HDA A;  1QVG A;  1VQO T;  2F5T X;  2IIM A;  4ZGE B;  4C8Q B;  1UTI A;  3FLG A;  1S72 A;  3HRU A;  3QYH B;  4XTU A;  2ED0 A;  2QA4 Q;  4ZTJ A;  2BZY A;  1GCQ C;  1KHI A;  3JRZ A;  1KQ2 A;  2OJ2 A;  3QXE B;  2CP5 A;  4B6M A;  4BY6 C;  1BK2 A;  1U8R A;  3CCL T;  3SWN B;  3JB9 H;  4C8Q A;  1K8A C;  3CCU T;  1GCP A;  4C92 F;  3CCV Q;  3M54 A;  2MWO A;  3G71 Q;  5DLQ E;  2WSE E;  1VQ5 A;  1WA7 A;  3OYL A;  1ACM B;  1MGQ A;  3UWN A;  3REB B;  1NEB A;  1YJ9 T;  2CSQ A;  2R58 A;  4RUG A;  2HL3 A;  4NL3 A;  4J9B A;  4PJO B;  2GTJ A;  2AKL A;  1OU9 A;  4HCZ A;  3PIP A;  4R0K A;  4CC7 A;  1UEB A;  2EYZ A;  2R5M A;  1OEB A;  2EW3 A;  3V8L A;  2M9U A;  4M77 G;  1QCO A;  2VV5 A;  1RAB B;  3REA B;  2EJ9 A;  3CMA T;  1WQ7 A;  2D9T A;  2A28 A;  2RMO A;  3NTK A;  5GAN j;  2BUD A;  2DNU A;  2NUT B;  5HK3 A;  1JBM A;  2KDS A;  1EIF A;  3DLM A;  5FRN A;  3CCS Q;  1NG2 A;  4IUP A;  2KBT A;  5C0M A;  4M78 G;  3P8B B;  3VS7 A;  1MMG A;  2OTJ T;  4J9I A;  4ZGJ B;  1UEC A;  4KGZ B;  2Z0W A;  2DEU A;  4LUD A;  2X35 A;  5GAM d;  4BE0 A;  4A4G A;  3H0F A;  3OYH A;  5I22 A;  4OF1 A;  2QGG A;  3OYE A;  1D1B A;  1VQ6 A;  3OS5 A;  2F5K A;  2P4R A;  3G6E Q;  1QMC A;  3X25 B;  4LD6 A;  2J6O A;  1NLO C;  1KQS A;  2EPD A;  1M8V A;  3PMT A;  3L2Z A;  3MEW A;  1YP5 A;  4C92 A;  1KK7 A;  4MZT A;  1BCM A;  5GAN f;  1WHJ A;  2DIG A;  4J6X A;  1D0X A;  1N9S A;  8AT1 B;  2HD0 A;  1VQL T;  1BU1 A;  1WHL A;  2YSQ A;  4JDS A;  2E1H A;  1IB8 A;  3EGX A;  4BE1 A;  4A4H A;  1MNE A;  2YUP A;  5FU6 B;  1X6O A;  5GMK e;  2EYW A;  2DD4 A;  5LJ5 g;  1ZBX A;  2CH4 W;  2LZ6 B;  3MHX A;  2D0N A;  1TUC A;  3HRT A;  2EJF A;  3G6E A;  3CEY A;  1XQH A;  3MJX A;  3MO8 A;  2D6F A;  4C92 C;  3EG9 B;  2D8H A;  4PJN A;  5A0G A;  2YWW A;  2YUQ A;  3E2U A;  4J8O A;  2QQB A;  1IRX A;  1KD1 U;  4FW2 A;  3MKD A;  2NUP B;  1OPL A;  2VKN A;  2V8K A;  3ME9 A;  4M7D E;  4XTX A;  2QQS A;  3CME A;  4RTY A;  2DET A;  5A0L A;  1QLY A;  5GMK l;  4CI0 C;  2FYK A;  3RUX A;  2KYB A;  2G3R A;  2RB6 A;  1U1S A;  2K2M A;  1KD1 R;  2FHD A;  3NTH A;  4CC2 A;  1GRI A;  1H3Z A;  2JN0 A;  5CKD A;  4M7D D;  1R0B G;  4J5Y A;  5HK0 A;  1UFF A;  2P0Q A;  3L42 A;  3OYF A;  1K73 U;  2JW4 A;  5KH6 A;  5KYX B;  1SHG A;  3I56 T;  3EGD B;  2K9G A;  2HNI A;  3JCM e;  2MK5 A;  3ZL7 C;  1OQK A;  4LNP A;  3I35 A;  4C8Q E;  3I55 A;  3VUB A;  1YN8 A;  4OVA A;  1UUE A;  1K73 R;  1TU0 B;  3EGD A;  2C0T A;  2LP5 A;  3NMZ C;  1K9M C;  4ESR A;  1GFD A;  2RHY A;  5KYU A;  2PVD B;  2COY A;  2QEX Q;  3MP8 A;  1BIB A;  4JLG A;  4BUG A;  3EG1 A;  2ROT A;  2VXF A;  3BDL A;  2DRK A;  1WHK A;  4C8Q D;  3H6Z A;  2ECZ A;  2FRW A;  2IG0 A;  1GFC A;  1MMA A;  4X9C A;  4HVU A;  2KRN A;  4DBQ A;  5LJ5 e;  4A4E A;  2MYS A;  4C0F A;  1QVF P;  2HQX A;  2X3W D;  4JZ3 A;  3A98 A;  4VUB A;  3S6W A;  3CC7 Q;  1B07 A;  1V29 B;  2F2X A;  2DIL A;  4Z88 A;  1B3Q A;  5L8R E;  1XOV A;  1LJO A;  5GMK j;  4MZP A;  1ZX6 A;  5GAO n;  2QEX A;  5CIU A;  1BIA A;  5IH2 A;  2RJC A;  3E1S A;  1VQN Q;  3O8V A;  3RER A;  3CBM A;  3M5A A;  2YLB A;  4PFP A;  3OSS C;  1UE9 A;  5IHI A;  4RTT A;  1RAG B;  2J6F A;  3V8J A;  2WAC A;  3SHW A;  2ABL A;  1WHM A;  2BZ8 A;  3HRS A;  1X69 A;  5KCO A;  3QKJ A;  1OZ3 A;  1LPL A;  4FT4 A;  3G71 T;  1YCS B;  1QCF A;  2ZPH B;  4C92 E;  4KT0 E;  1UDL A;  2J6K A;  3CCQ Q;  7AT1 B;  2AIR B;  1E7O A;  4XQ3 A;  5C6S A;  1VQO Q;  2P0K A;  1VQK A;  3E9F A;  4GBQ A;  2YRV A;  1SPK A;  3GNF B;  2NUZ A;  2RHU A;  1M2V A;  2BIV A;  4QQD A;  2XK0 A;  2CUD A;  2XG8 D;  1OX8 A;  3GBQ A;  4C92 D;  2DAQ A;  3CCE T;  2DVJ A;  1YIT Q;  2AK5 A;  2OAU A;  3CCL Q;  1M90 U;  2RQR A;  2H8H A;  5IN1 A;  2O01 E;  3DB4 A;  4B9W A;  1OX9 A;  3OYA A;  3CCU Q;  4M75 G;  3GP8 A;  1X75 C;  4R55 A;  4BI4 A;  4AFU C;  4C92 G;  1IZ6 A;  3SFM A;  1M1K C;  3LWI A;  2MPX C;  2BKD N;  3OMC A;  1NPP A;  1YJ9 Q;  1N5Z A;  2ZPE B;  1BB9 A;  2H3J A;  2ZPF B;  3MEV A;  4C0D C;  1M90 R;  2DMO A;  1YJW T;  3EFO A;  3M0U A;  1Y07 A;  4V2S A;  1UHF A;  4GY5 A;  3CMA Q;  4E7J A;  5GAM e;  2QYZ A;  3H41 A;  1QWE A;  2ROL A;  3CCL A;  5LJ5 j;  1X2Q A;  2DF6 A;  4D8K A;  4HKE A;  5KCH A;  2XDD A;  3JCM Q;  1XTD A;  2DBM A;  4ELY C;  1N8R C;  2C0I A;  3M56 A;  4OML A;  1K1Z A;  1OV3 A;  2P84 A;  3V7C A;  4J9E A;  5IAY A;  2RQU A;  2OTJ Q;  1UB4 A;  5GMK h;  3NPF A;  2DTO A;  2YHT A;  3GIB A;  1AWX A;  2RD1 A;  3OYK A;  2HBW A;  5GAN g;  3I5S A;  3CCJ A;  2CDT A;  3EHR A;  2V1R A;  1TG0 A;  1UGP B;  3G4S A;  1ZQ1 A;  3CCM Q;  1KJW A;  4BE2 A;  3PT9 A;  2LT1 A;  1VYV A;  4J7I A;  3RBB B;  3RDV A;  1N9R A;  2XID A;  3C4S A;  1C0M A;  3QG1 A;  4FIB A;  3VKI A;  2E5Q A;  4M7A F;  2GTO A;  1VQL Q;  1M5Q 1;  2L3R A;  1RLQ C;  5CKE A;  4IIO A;  2LQK A;  2CP6 A;  2LVM A;  1KC8 U;  4JLI A;  2RQW A;  4EMK B;  2CZ6 B;  2ZAE A;  3A8M B;  4OMP A;  2VVK A;  2K79 A;  4FYW B;  4KGV B;  4RG2 A;  5CQX A;  4OB2 B;  4F7U B;  1JU5 C;  3JCM V;  3MP6 A;  1LOJ A;  2EQU A;  3EHQ A;  1PKS A;  1JXO A;  3JCM h;  4OB0 B;  2EQJ A;  2RJE A;  1MHN A;  4M7D F;  2GQI A;  4O5V A;  4LDV A;  2ZCF B;  1QCN A;  3CQT A;  1AWJ A;  1QVP A;  4F7U A;  2FZC B;  3QWX X;  3M9Q A;  2LQW A;  2DJZ A;  1I4K 1;  2VC8 A;  2DXB A;  3SB2 A;  4GLK A;  1NE8 A;  2P4T A;  4N0A A;  3WXM B;  1LCK A;  1WNL A;  3CCR T;  4OMQ A;  5GAM j;  3NGP A;  2X4W A;  1BBZ A;  1M3C A;  5LJ5 h;  1WI7 A;  4PL6 A;  2E3I A;  2LT4 A;  2E70 A;  3VS4 A;  3GLX A;  2GGR A;  2RN8 A;  3I56 Q;  1ABO A;  1K0S A;  4C8Q F;  1U3O A;  5IXF A;  1KQS P;  1G3T A;  5HCK A;  4CC4 B;  5GAO r;  2DE0 X;  4MML A;  3TVT A;  4AFQ C;  2ZPI B;  4N0A C;  4M7A A;  3E9G A;  1VQM A;  3JB9 I;  1H3H A;  4F17 A;  2EQI A;  4PK4 A;  3T9N A;  3HP9 A;  2LJ1 A;  2E4H A;  5DY9 A;  2KQW A;  3OYJ A;  3OQ5 A;  3NTI A;  2QK0 A;  1AWO A;  2QAS A;  5D7U A;  3VRZ A;  4C5G A;  1WQW A;  4KRT A;  3H0H A;  3L1A A;  1Z9Z A;  4MZM A;  4PJO F;  4M7D A;  4M7A C;  5GAM f;  2KE9 A;  2KT1 A;  1W4S A;  1XJW B;  3CPW S;  4WCI A;  1SSF A;  3JCM J;  3M0R A;  1NM7 A;  4RTZ A;  4E47 A;  1AHJ B;  1F1B B;  4MMK A;  4BI3 A;  1YWP A;  3A8G B;  2XIC A;  1WJQ A;  2O4X A;  2A08 A;  4M7D C;  2KXD A;  1IO6 A;  5GJV B;  5LJ3 f;  3CPW P;  4JUV A;  3HPW A;  1YIT T;  3OS1 A;  4ZTF A;  3ZBD A;  2CP2 A;  1VQ8 T;  1TSF A;  5AT1 B;  2DTH A;  5GAN 5;  1VYT A;  3WVD B;  1O75 A;  3SD4 A;  4A63 B;  2DTI A;  1ZUY A;  4Z8A A;  3HSB A;  1KIK A;  1MMD A;  3SWN A;  4RTU A;  5CKB A;  1G8X A;  4QKU A;  1YJN T;  2QA4 A;  4ZGD B;  1LNX A;  5GMK m;  1FWZ A;  4C8Q C;  2LC4 A;  2FPD A;  4J9F A;  2X4J A;  5CVI A;  3J81 E;  2AZV A;  4C5H A;  3CCE Q;  1B34 B;  2O9S A;  1M1F A;  4PJO A;  2M1H A;  3HFO A;  1T0H A;  5FWC A;  4OMO A;  2CRE A;  3SWN C;  3CCV A;  2FPE A;  2QQR A;  3G71 A;  2LRQ A;  2R57 A;  3S3N A;  3LGF A;  2GCX A;  3BW1 A;  3UT1 A;  1SKU B;  4FYY B;  1B34 A;  2J7I A;  4JS4 A;  4KUD K;  4F7U E;  3QJ6 A;  2NUT A;  1D3B B;  2RA2 A;  3H0I A;  3HHT B;  2Y4Y A;  2O88 A;  1YJW Q;  1PRL C;  4PJO C;  1JO8 A;  3JCM g;  1CKA A;  1D0Z A;  1WJR A;  1NLP C;  1VOM A;  3HKS A;  4JJN K;  2GFU A;  4DBH A;  4JS5 A;  4QVC A;  2DRM A;  1BCO A;  3CCM T;  2RI3 A;  1JQQ A;  1NYF A;  3OW2 S;  4M75 B;  3CCS A;  2W10 A;  2CT3 A;  3HFN A;  1SG5 A;  1UJ0 A;  2JTM A;  2DXT A;  5LJ3 d;  1GBR A;  3AT1 B;  3VS2 A;  2HQE A;  2COZ A;  1PWT A;  4N4I A;  1G83 A;  3KFV A;  2L3S A;  2KT8 A;  4M7A E;  1YJW A;  3GNG A;  8ATC B;  1VQ9 T;  2EYQ A;  3UA6 A;  2LQN A;  3OBY A;  1J3T A;  2FB7 A;  4C0Z A;  2NYS A;  3OYY A;  4FW1 A;  3OY9 A;  1YI2 Q;  1QP3 A;  2EKH A;  4LE9 A;  5A2Q E;  3X26 B;  2JVV A;  1I5O B;  4PJM A;  1TTH B;  4M7A D;  2HKN A;  2EWN A;  3M0S A;  2O2O A;  2D8J A;  1WJS A;  3EG9 A;  2KRM A;  5J3B A;  2CZ1 B;  3M53 A;  1Y96 B;  2FVU A;  2MMP A;  4M7A G;  1VQP T;  1X6B A;  1GXI E;  2NUP A;  4J9G A;  4DQ2 A;  2RHI A;  3JV3 A;  3CPW A;  4FCY A;  3ZFJ A;  1I5L A;  1W70 A;  5FU6 C;  1BKB A;  4XU0 A;  4ELZ C;  1PSF A;  1E6H A;  3QHS A;  3LH5 A;  4XTV A;  4QQ6 A;  5GAN h;  1D09 B;  1QP2 A;  5IXB A;  3PVL A;  2PTK A;  3MET A;  1JXM A;  1M9S A;  4J9C A;  2RNA A;  4M7D G;  1EZZ B;  1Q82 U;  5HKC A;  2HQH A;  2X51 A;  4BAC A;  1YHQ T;  3EGU A;  1KD1 C;  1U06 A;  5KYX A;  2RI5 A;  2MOX A;  4QVZ A;  1WHG A;  1BYM A;  4J6Y A;  1BI1 A;  5IHK A;  2QI2 A;  1HK9 A;  5AYF A;  2MWP A;  4FT2 A;  3AHU A;  3N5B B;  2EKO A;  1IGU A;  2EAY A;  2K6D A;  2LJ0 A;  5CQY A;  4LXC A;  3CCR Q;  1Q82 R;  4J83 A;  4N4G A;  1QW1 A;  1UJY A;  4QQG A;  4D8D A;  4JZ4 A;  3OA6 A;  1RAA B;  2GFA A;  4RG8 A;  1M2O A;  4IUQ A;  2CP7 A;  3M0T A;  2LMJ A;  3X20 B;  4FL6 A;  1JB0 E;  3RMS A;  4C8Q G;  1EX4 A;  2JNG A;  1S72 T;  1K73 C;  1YCY A;  4PJO E;  3QJY A;  5KE2 A;  4E7L A;  3R6O A;  3GPL A;  2D0Q B;  1G5V A;  3JCM P;  3M4Y A;  1ZLM A;  3JCM c;  3TSW A;  3A5Z B;  3VS3 A;  5GAM g;  2K3Y A;  2L3Q A;  3M4G A;  1EFN A;  2J05 A;  4PJO D;  2F2V A;  2ENM A;  2DVE A;  1VQ5 T;  3J7A F;  1I07 A;  2B86 A;  2JOY A;  4RCC A;  2JMA A;  3RES A;  1Y57 A;  1HSQ A;  1SRL A;  4J6W A;  2JUF A;  4RKU E;  4X34 A;  5KYN A;  1H8K A;  1KSW A;  2R5A A;  2KRO A;  4PJO G;  5KYW B;  4F14 A;  3E19 A;  2CGH A;  2K5I A;  2C06 A;  3CC7 A;  3FJP A;  1G2B A;  1PSE A;  2XMF A;  5L23 A;  3M57 A;  3OW2 A;  4J9D A;  1YNZ A;  1PCX A;  3BY7 A;  2C0O A;  1IXD A;  5KE3 A;  2L89 A;  1ZUK A;  5GAO p;  1W6X A;  2VGN A;  4PLI A;  1VQN A;  5FU7 B;  2FRY A;  1B7T A;  2EIF A;  1WZO A;  1Y0M A;  1D1C A;  3KBG A;  1RAH B;  4PLL A;  2E12 A;  3LLR A;  3CC4 Q;  1VQ8 Q;  2QDL A;  2KK4 A;  3VS5 A;  4BDZ A;  2CS7 A;  1QWF A;  2X9H A;  3FJ5 A;  3VYH B;  1P92 A;  4JRK A;  3OYC A;  2RHX A;  3URG A;  2JZ2 A;  1VQ6 T;  4D6W A;  5A0D A;  1GL5 A;  4LUE A;  1HXD A;  2DZ9 A;  3CCQ A;  4QW2 A;  1VQO A;  1VYU A;  1JJ2 S;  2VAS A;  1YJN Q;  2DJQ A;  1RL2 A;  5CKH A;  2OX7 A;  4E7S A;  2CUB A;  4LDW A;  3S3O A;  1ZA2 B;  2GQV A;  2RPN A;  2VB6 A;  4RTW A;  2M0O A;  3V7S A;  2ESW A;  4HXJ A;  1YIT A;  1NBE B;  2X3X D;  2MF2 A;  3CPF A;  3CCU A;  5ECA A;  2ED1 A;  2K57 A;  1ZBJ A;  2BTT A;  1M90 C;  2NLU A;  4F7U F;  1PHT A;  1MV3 A;  1YJ9 A;  2VUB A;  3JB9 D;  1OUL A;  3EH1 A;  2BZX A;  2VXE A;  4HT8 A;  4XK8 E;  3MPU B;  4OB3 B;  5LJ3 e;  2DX1 A;  4A53 A;  4M77 B;  2XI9 A;  1WHH A;  4ZN1 A;  1VQ7 Q;  3TSZ A;  1TOV A;  3CMA A;  3P8D A;  4DBF A;  4WTO B;  3RR6 A;  1WXT A;  1YI2 T;  1V76 A;  9ATC B;  3PGG A;  3CME T;  3DLL A;  4TVR A;  2PQW A;  5GAN 2;  4E7H A;  2LCL A;  2DA9 A;  2ZPB B;  1FXX A;  1WIE A;  3DB3 A;  4X1V A;  5GAN 3;  4M78 B;  2VWF A;  3FDR A;  1C1A A;  2QG9 B;  1DJ7 B;  1K9A A;  2OTJ A;  2A37 A;  2IVW A;  1FX7 A;  3G7Z A;  4Q5W A;  3OB9 A;  2DL5 A;  2VGM A;  1UGQ B;  3VU3 C;  3EAE A;  1OPK A;  1PNJ A;  3D7S B;  1VQ9 Q;  2X4Y A;  4C5I A;  2KAF A;  1MUZ A;  1ZSZ B;  4DOV A;  2ATC B;  3X28 B;  2JT4 A;  5GAO l;  2L8D A;  3I55 T;  2EQM A;  2XHC A;  5DM7 R;  3CCM A;  3UPU A;  3OYM A;  4PNO A;  4IKF A;  4EMK A;  4NL2 A;  1UGR B;  4DEX A;  1KC8 R;  1U5S A;  1SSH A;  3RNJ A;  1UGV A;  4MDW A;  3VS0 A;  5D6Y A;  2E6N A;  2YRD A;  1VQL A;  2AZS A;  4X9D A;  1VQP Q;  2RI2 A;  1PKT A;  4L59 A;  5GAN 7;  2KSS A;  2LJ3 A;  1SF9 A;  3UA7 A;  2M0Y A;  4R56 A;  4JRI A;  4EMK C;  2XDP A;  1ABQ A;  3H8Z A;  3M58 A;  4P5N A;  4FSX A;  5CAI A;  1RAD B;  3CD6 T;  2L3P A;  4PKC C;  4J7F A;  1KC8 C;  2LDM A;  4M4Z A;  2DL8 A;  3EH2 A;  3EG3 A;  2KI7 A;  3VV0 A;  2Y4X A;  2F69 A;  3LH0 A;  2PVO B;  1G3Y A;  2AT1 B;  2CH4 A;  3F70 A;  2DIQ A;  4JPB W;  5KYY B;  2LX7 A;  1YHQ Q;  2CP3 A;  3OS2 A;  1Y71 A;  4AMC A;  2HL5 C;  3M59 A;  4LD9 K;  5FW9 A;  2F2W A;  3CC2 Q;  2SEM A;  1LVK A;  2QXF A;  5LJ3 j;  4EIK A;  5FRM A;  2QTX A;  3TEE A;  3THK A;  4KGX B;  4HA8 A;  2D1X A;  2PZ1 A;  2DER A;  1NEG A;  5DLO A;  1X43 A;  2H3E B;  1JJ2 A;  1I8F A;  4DA4 A;  3FB9 A;  1KQ1 A;  1VUB A;  3I56 A;  1K76 A;  4Z89 A;  1TUG B;  3UDC A;  1S72 Q;  1IRE B;  3PIO A;  2JS2 A;  1M1G A;  1PD1 A;  1PM3 A;  3JSC A;  2M16 A;  3OYN A;  4BY6 B;  1YHQ A;  2YUN A;  4NS5 A;  5GAN 4;  2EBP A;  2E5K A;  4UC4 A;  1VQ4 T;  3M55 A;  4L5G A;  5GAO q;  4PFO A;  4B9X A;  1IHV A;  2EYY A;  1ZUU A;  3U23 A;  3M0P A;  3LWH A;  4BDY A;  2M02 A;  4EDU A;  4FM4 B;  1VQ5 Q;  1M8M A;  2I2L A;  2HCK A;  3PVQ A;  3X24 B;  2SRC A;  4DOW A;  2QQA A;  3Q1J A;  2YUO A;  3CC4 T;  3QWY A;  1SEM A;  3SEM A;  2DXC A;  4IUU A;  3V7R A;  4AG1 C;  1MMN A;  3OS0 A;  4M77 E;  4LN2 A;  3C0C A;  2JXB A;  2LCC A;  3MP1 A;  3OBW A;  1XNI A;  4E6R A;  3J80 E;  3L2U A;  2DEQ A;  2RHZ A;  5EC7 A;  4M75 F;  4O6J A;  1O9S A;  2K3B A;  2DPP B;  2JTF A;  1PC0 A;  3PNW C;  1I0C A;  3FC3 A;  5GAM h;  2RO0 A;  3LYI A;  4M77 D;  3JCM X;  2DD5 A;  4M78 E;  2GBQ A;  1TWB A;  5GMK i;  3JCM W;  4OP0 A;  4C5E A;  2PU9 B;  5FLX E;  2MAM A;  4EMG A;  2DKG A;  2KEA A;  4Y28 E;  4FYX B;  2K3X A;  1VQ6 Q;  2E64 A;  3CCJ T;  2RJD A;  3INZ A;  2LTO A;  4LDX A;  3RMQ A;  4PJL A;  2KYM A;  3TCJ A;  2PNI A;  1H64 1;  5J39 A;  3G4S T;  2YDL A;  4M78 D;  5D6W A;  1U1T A;  5LJ3 h;  2HSP A;  5CK9 A;  4RMO A;  2DBK A;  1VA7 A;  2BE9 B;  4E7Z A;  1AT1 B;  1VQ7 T;  1HYO A;  2AHJ B;  4IUT A;  4K11 A;  4FYV B;  3JB9 F;  1BI3 A;  5FRO A;  2OTL T;  2FO0 A;  3CCE A;  1NZ9 A;  1MV0 B;  2Y90 A;  5EG2 A;  5J26 A;  1D3B A;  2YLC A;  4AFS C;  1UGS B;  1M3A A;  4CC3 A;  4C92 B;  2W0Z A;  4KH1 B;  3QUI A;  4WF2 A;  1ZSG A;  2KNB B;  3IQL A;  4F7U G;  3L2R A;  3GOX A;  4HT9 A;  3MEA A;  4LDY A;  3QSU A;  3EGX B;  4M75 A;  1BI2 A;  4A4K A;  3OW2 P;  2YRC A;  1M30 A;  1T0J A;  1YFN A;  2FZG B;  1YIJ T;  1WLP B;  2HAX A;  1SRM A;  3VYG A;  2K4Y A;  1WXU A;  4OMF B;  1TS9 A;  4JJB A;  2KMT A;  3CME Q;  3VRY A;  1RI0 A;  2CZ7 B;  1FYN A;  1C6V X;  1WYX A;  2AKK A;  2CSI A;  2XD0 A;  1TUD A;  2V1Q A;  4XU2 A;  1PG5 B;  4M75 C;  2RF0 A;  1RAE B;  3QYG B;  4PFZ A;  1JEG A;  2CP0 A;  1A0N B; 
#chains in the Genus database with same CATH homology
 2HL5 C;  2CP5 A;  1WHJ A;  2COW A;  2HKQ B;  2M02 A;  1IXD A;  1WHK A;  2E4H A;  2E3I A;  2HL3 A;  4B6M A;  2COZ A;  1WHM A;  3E2U A;  2MPX C;  3RDV A;  1WHL A;  1LPL A;  2QK0 A;  1TXQ A;  2HQH A;  2CP2 A;  1WHH A;  2HKN A;  2CP7 A;  1WHG A;  1TOV A;  2E3H A;  2Z0W A;  2COY A;  2CP6 A;  2CP0 A;  3TQ7 P;  2CP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...