2COYA

Solution structure of the cap-gly domain in human dynactin 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
GSSGSSGMAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title Solution structure of the CAP-Gly domain in human Dynactin 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2coyA01
1TXQA 1WHKA 2CP0A 3RDVA 2HKQB 2E3HA 1WHMA 2E3IA 1WHGA 2COYA 2CP7A 2E4HA 2M02A 2COWA 2Z0WA 1LPLA 1TOVA 2HKNA 1WHHA 4B6MA 2CP6A 2CP2A 2QK0A 2CP5A 1WHLA 2COZA 3TQ7P 2CP3A 2HL3A 3E2UA 2MPXC 2HL5C 1IXDA 1WHJA 2HQHA
chains in the Genus database with same CATH superfamily
3E9FA 4A63B 3CCVT 1WXUA 2LNVA 4BDZA 1WQWA 2ZAEA 5FLXE 4LE9A 3J80E 1NPPA 4CC2A 1VQ7T 4FSXA 3CCEA 4A4HA 5DY9A 5IAYA 3OS0A 2CUBA 1YITA 2ESWA 2VKNA 3TSZA 4M7DB 1VQLA 1K1ZA 2DM1A 3P8BB 3MJXA 3OB9A 1BCMA 1SSHA 2GFUA 3A8OB 4Z02A 3EG3A 2KT1A 1NEBA 1KQ1A 4N4GA 4BI3A 1EX4A 1FYNA 4FYVB 3JCMf 3HHTB 2MWOA 2XG8D 2COZA 4M77G 3CC7A 2XDBA 2EGCA 4DBFA 1N9SA 1V29B 1AT1B 3X28B 2F2VA 2K3XA 3A8LB 1LVKA 2EW3A 4A4KA 1TUDA 4OMQA 2KSSA 4ZGDB 1VQ8A 2DBMA 3H9NA 4X34A 5GMKj 2FRYA 1OX8A 1VQNQ 2EPDA 2J6KA 3MO8A 3V8KA 4JJBA 1UJ0A 4PJOF 3A8MB 2EYZA 2F5KA 1R77A 2OTJA 3HFNA 4RTXA 3QSUA 2XI9A 5CAIA 4FYWB 3ULRB 1K8AC 3OYMA 3RMSA 3CC2A 5IHNA 1M1KU 2H8HA 5GAMe 3L2QA 2DXUA 3NGPA 5KYWB 1WHMA 2NUPB 1LNXA 1R0BG 1HXDA 2MMPA 3HFOA 2KGTA 2QQSA 2E65A 2YRVA 3OBYA 3GIBA 1IGUA 2M51A 2SEMA 3C95A 3GBQA 4N0AC 3OW2P 1PD0A 3OYCA 2KXDA 2P0KA 1EZZB 1XQHA 1M8VA 2JOYA 3UA6A 2D0QB 1I81A 1M30A 1D3BA 2X51A 3JB9F 4GLKA 1AVZC 3CCJT 2VYTA 2RM4A 5FROA 3CCLQ 3G71T 2HD0A 4JPBW 2X3XD 1ABQA 1AWJA 2DERA 2RI2A 1R0CB 3CD6T 3FLGA 3MPUB 4ZTJA 2NYSA 3HRUA 3PTAA 2J7IA 1B7TA 3CCRQ 4J5YA 4OP0A 3M0QA 1YCSB 1S72Q 1UB4A 3GOXA 4XU3A 4IUPA 5GJWB 3VU3C 4MDWA 2CUDA 2V1QA 3N5BB 1O75A 2GFAA 5KCHA 2WSFE 3LYIA 2RQUA 1QP2A 2V8IA 3OSSC 4P5NA 2RA2A 2O4XA 3JCMJ 2DL3A 4M77F 1Z9QA 3C12A 3CMAA 3CC4A 1MMAA 2D1XA 2BIVA 2XMFA 1BIBA 1UFFA 1ZA1B 4D8DA 1YJNQ 1PWTA 2RHYA 2FEIA 5D6WA 2L3SA 2DYIA 1X01A 3JSCA 5KYUA 4KT0E 3LWHA 4RG2A 3VRZA 1D3BB 2DBKA 4C92C 4Z88A 1VQLT 2V26A 2ZPGB 4FM4B 2DTOA 1GCQA 1TUCA 2J06A 4C0GA 2E5KA 4EIKA 3VYHB 4PJOC 1D1BA 2GGRA 4RTYA 2E41A 3A98A 3CCQA 1QWFA 1WXBA 3CCMQ 5A2QE 1ZLMA 1RI9A 2FRWA 2HSEB 1OYXA 3MEWA 1YJ9A 1OULA 1X75C 2LJ0A 1BYMA 2ZPHB 2OTJT 4C0ZA 1SKUB 2XK0A 2ZZDA 1VQ6Q 2FL7A 2VXFA 3KXTA 3M54A 1VQOQ 3EH1A 2O4XB 2F69A 2ZPBB 2L0AA 3F70A 1WLPB 1Q7YU 1K9MC 2KRNA 1G3WA 4LDYA 3PMTA 4XTXA 2EWNA 4DOVA 2K5IA 1YWOA 4HCZA 2YSQA 2OTLA 3RR6A 1KQSP 4JZ4A 2RNAA 1B07A 5KYXA 2OAWA 1OU9A 4AFZC 3J7AF 4M78F 1WJSA 1HJDA 1VQPQ 1T0JA 3HKSA 5KYUB 3VRYA 3O8VA 1QVGA 2Y4YA 4QVDA 1RL2A 4HCCA 2QDYB 2PUKB 2DFUA 3OYNA 1K9MR 2PVDB 2QTXA 5HCKA 5CKDA 4J6WA 1M1KC 2F2WA 4J9HA 2D8HA 1MNEA 2IIMA 2RHXA 2CH4W 3C94A 1ABOA 2SRCA 8ATCB 2YWWA 5CCAA 4D6WA 2EQKA 3EFSA 2XKOC 2DRMA 3EGXA 4M7AD 2KQWA 2HEQA 1UG1A 3FEOA 3L2VA 1TG0A 2KEAA 2DETA 1QVPA 2RHZA 3JCMc 5EG2A 4C8QC 5GAOr 1XTDA 3I56A 2BZYA 3H8ZA 5GMKh 5GAN5 3PE0A 1FWZA 5J26A 4BI4A 4M7AE 2CS7A 3PGGA 4M7DF 1HK9A 2JS2A 1ZSZC 3LGLA 2GQIA 1Q81R 3V7CA 2OX7A 4N4HA 1YWPA 3R6NA 3H0FA 2DJQA 1OU8A 4RTWA 3NFCA 4CC4B 1ZQ1A 3E1SA 3AT1B 4OGEA 3FC3A 2LQ8A 2KROA 3ZEHA 4J83A 2DD5A 3CXCP 3QG1A 2CREA 5M9OA 3P8DA 1H641 2CH4A 5I21A 3X24B 4ME7A 2NUZA 2E64A 2EJGA 2XDPA 2JJ9A 1U8RA 1UUEA 2ZGWA 5FU6B 2A0FB 1QCFA 1YIJQ 2JUFA 1N5ZA 3EG0A 1H8KA 1NEGA 2F5TX 3LH0A 3I55A 2EQUA 1G2BA 2M0YA 3M53A 4JJNK 1XOVA 3CXCA 1OZ3A 2YUNA 4CC7A 3SDZA 2DILA 4KH1B 2L3QA 2LMJA 2EVRA 2KMTA 3EG9A 4KULA 3VV0A 1V76A 3EFOA 2NWMA 4IIMA 2K5LA 4F7UE 2YUQA 1W2BA 1VQ4Q 2E12A 2PQWA 4PK4A 4LN2A 5GAOn 4F16A 4M7AA 1YP5A 4E7IA 1Z9ZA 5IT9E 2LNHB 1E7OA 1VQMQ 4ZNXA 3J81E 2RO0A 2FVUA 4FIBA 2YUOA 3DLMA 1Y96A 4LDUA 3LH5A 4JRKA 3CCSQ 4M78C 3HRTA 1VQ5A 5C6SA 3M58A 2RMOA 1IRXA 5CR2A 2YLBA 5GMKm 4XTZA 4C0FA 3SWNA 3SHWA 1JB0E 2M0OA 4C0DC 4ORZA 4BACA 1TXQA 4AMCA 2DVEA 1M2OA 3CCVQ 3UF4A 1E6HA 1I1JA 3NPFA 4M75D 2GQVA 4OB3B 4GBQA 3R6OA 3JCMX 1AZGB 3NMZC 3PVQA 4Z8AA 5FWBA 2D0NA 4BY6C 5FWCA 4XU1A 3G4SA 1VQ7Q 3DB3A 4PFOA 4DEXA 1OPKA 1PKSA 1JRIA 3JCMP 4FT2A 1YI2T 5I2SA 3OYYA 1QVFA 1KK7A 1Q82R 5J3BA 3UT1A 2XD0A 2VUBA 4RCBA 3CBMA 2EYYA 3EFOB 2E6ZA 2RHIA 2LQWA 3EHRA 1KC8R 1K9AA 2MPXC 1QKXA 2EBPA 4M7DC 1YJWT 2QA4A 5J39A 4LUEA 4M7AB 2IVWA 1DJ7B 4KBMB 3CBPA 1PHTA 4AG2C 1QVGS 2BUDA 3OYLA 4JRQA 1GFDA 2P0PA 1M90R 4MZPA 2DL5A 3M0SA 1YCYA 4CI0C 5IH2A 2C0IA 1BB9A 1MGQA 2JZ2A 4LDWA 1D1CA 2EJ9A 1WNLA 1T3LA 2CZ1B 2CT3A 2K2MA 2RQTA 4ZN3A 3SWNB 1UTIA 1JBMA 2FPEA 5IXBA 4ZN1A 1GRIA 4R0KA 3OYDA 3PVLA 2CSIA 4EMKA 5IXFA 1VIFA 2PNIA 1PSFA 2C0TA 2K4YA 1BIAA 1BI1A 2BE9B 2JXBA 1G83A 1AWXA 1JO8A 1M8MA 2R58A 3M9QA 4B9XA 3CMET 1VYVA 2A36A 3JCMQ 5DLOA 1UE9A 1R8OB 1WXTA 1ZA2B 2RJEA 4M75A 3KFVA 2G3RA 4IKFA 1RADB 2KNBB 4AFUC 4J6XA 3VUBA 5GAN7 5KYNA 1ZUKA 2CP7A 2RI5A 4OMMA 2X4JA 1MV3A 3VS3A 5GAOl 3JRZA 4HT8A 1VQNA 4E6RA 1VQ9Q 2CGHA 3ZBDA 3OYJA 3CCJQ 3PMIA 3L42A 1WHLA 2K3YA 2KBTA 3G71Q 4F7UB 1YBYA 1RAIB 2NUTB 5L8RE 2QXFA 4C5IA 3CD6Q 2V1RA 1X6GA 1AD5A 1YHQT 2DTIA 4A54A 1QKWA 3CEYA 3OSVA 1LCKA 2EKHA 2M02A 5GAN6 2DXBA 2JVVA 4RTVA 3OS5A 1K9MU 5FRMA 5LJ3j 2JMAA 2HAXA 2HL3A 3FB9A 7AT1B 4JJCA 1WDXA 3QUIA 5FU7B 1OZ2A 5GAN3 3M55A 5LJ5g 1WHKA 4XTUA 4D8KA 4ZGEB 3OMCA 3RKYA 1I0CA 3M0UA 1BU1A 3VS1A 2G6FX 5LJ5j 5KE2A 4EMKB 2HDAA 2DEQA 4II1A 2BE7D 3OYGA 2DAQA 3IQLA 3G6ET 1W2BS 1C6VX 5A0DA 3I9QA 3G1JA 3OBWA 2HZYA 4ELZC 1NLPC 1I8FA 2YLCA 1W4SA 3CCRA 2L3RA 2A08A 1ZX6A 2OJ2A 2QEXA 4PJLA 1S72A 5GANj 2KE9A 1VQKT 3ZFJA 1RACB 2X3WD 3HSBA 1KD1R 1VQLQ 2P0QA 4XU0A 3VS2A 3RUXA 3REBB 3H0IA 3FJ5A 4WF2A 3BFMA 3CCUA 5KE3A 5L23A 1WHHA 1VQ9T 3LGFA 2J6FA 1U3OA 3QJ6A 2YT6A 4C92D 4JZ3A 2QGFB 1X43A 2QAZA 1NE8A 4PLIA 3QDRB 4KGXB 1YJNA 3OW2A 2DZ9A 5LJ3d 3V8JA 4M7AG 2QQRA 1Y07A 2E4HA 5KYYA 1KJWA 3VUZA 2OTJQ 1TUGB 1M3BA 4B6MA 2BTTA 2OI3A 2KYMA 3T9NA 1UGSB 2DEUA 1QVFS 4E7HA 1Q86C 4C92E 2K3BA 2RF0A 1K0SA 1WQ7A 1AEYA 2JN0A 2DNUA 1KQ2A 4PLLA 1QWEA 2LZ6B 3NTHA 2XICA 2DX1A 1PD1A 2HKQB 1EFNA 2CZ0B 5LJ5d 3EH2A 1RAHB 5I11A 4PJNA 1GL5A 3OYIA 2QI2A 1NPRA 2Y90A 2OAUA 4FCYA 3OQ5A 4MZMA 3UPUA 1EIFA 1SG5A 2QDLA 3LW5E 1VYUA 4C5EA 1Q86R 4BDYA 3CCMA 1X6BA 4KH0B 2DD4A 4LD6A 4AT1B 1N27A 1WFWA 4X9CA 4MZTA 5IN1A 5GANd 1HSQA 2X35A 3JB9D 1BI3A 4F14A 2FYKA 3CCET 2YRDA 1JXOA 2DO3A 4ESRA 3TQ7P 2CP3A 4EMGA 1YITT 4F7UG 1VQ6A 1SPKA 4QW2A 1VQOA 2KRSA 2ROTA 1NYFA 2RD1A 3CPWP 3QYGB 3GNGA 5A0GA 4V2SA 4FYYB 2MYSA 1WX6A 4J9CA 3UDCA 2KDSA 2L8DA 2WSEE 1JJ2P 1K76A 1G3SA 1WI7A 3CC7T 4RTZA 2HQEA 4XTYA 5EC7A 4WCIA 3QZ5B 4C92A 2YXYA 1ZSGA 3SFMA 3TU4K 1VQ8T 1VQPA 1OEBA 2JT4A 1MHNA 3EHQA 5D7UA 3GPLA 1QP3A 2MAMA 3GF5A 2FZGB 1KC8U 4PJOA 1AWOA 2PVOB 2H3EB 1J3TA 1PNJA 3HTRA 5FW9A 2FG0A 3JCMd 2JTMA 3H41A 1Y0MA 4C8QD 4DQ2A 3P8HA 5CQYA 1U5SA 3TVTA 3WVEB 3CC2T 4HA8A 2EKOA 2K2VA 3EAEA 3M56A 2R5MA 4OMPA 4M7AF 1M90U 1N8RR 3S3NA 2QG9B 4LDVA 1UGVA 2CZ7B 3X25B 1HD3A 4C8QE 3QKJA 4M75G 3JB9I 2GCXA 4QVCA 2CP6A 1Q95G 1MMGA 2DK3A 2H3JA 3A8HB 4LDXA 5GAMj 3WVDB 3HPWA 1KSWA 2RH2A 1UEBA 1JQQA 3CCUT 1KFZA 1TSFA 1JEGA 2KVQG 5FU6C 3HP9A 1LPLA 2QYZA 2QQAA 4FYXB 2WACA 4QT7A 3Q1JA 1KQSA 2F1LA 3OY9A 3VYGA 4E7SA 3M4YA 4C92B 4F17A 2O2OA 1D0YA 4ZTFA 1Q81C 3HRSA 4DOWA 2RB6A 2RJFA 5GMKi 2ECZA 3RESA 2DRKA 3UWNA 1AHJB 3OS1A 2KXCA 4M77C 3EFRA 4F7UF 2RI3A 2XDDA 4YTLA 1K73C 4RTTA 4IUVA 3PT9A 5CQXA 4CRIA 1WHJA 4OVAA 3GNFB 5LJ5h 3SB2A 4HKEA 4Q5WA 3CMAT 4C8QA 3CC4T 2R5AA 1QLYA 1H3HA 3MEAA 4XTWA 1S1NA 4M78D 5KH6A 2B8AA 2DXCA 3QWYA 1VQ4A 4LNPA 1ZSZA 3VS6A 5DLQE 5KYXB 2YDLA 2JMCA 1K73R 1ZBXA 4L6V5 1YI2Q 4BE2A 1ZUUA 3UA7A 1NBEB 1LOJA 2RQWA 1N9RA 3SEMA 2AKLA 5GAMd 1MMDA 2VXEA 1TOVA 2DF6A 1OPLA 4PJJA 2VV5A 1CSKA 4BUGA 1OV3A 4OB0B 1RI0A 2DKGA 3CCSA 1PCXA 4E47A 3M5AA 4MMLA 1U06A 4JRPA 1LJOA 3I5SA 1YJWQ 4C5HA 3BW1A 3FJPA 4J8OA 2PZ1A 3QIIA 1KD1U 4J9EA 2QQ9A 2AIRB 4XK8E 2ATCB 3EGXB 1VUBA 3CCVA 3CCQT 4PL6A 1G3YA 1XJWB 3BE3A 2GTJA 1VQ7A 2E1HA 3FIFA 4M7AC 2HBWA 3JAME 1YJ9T 4M7DD 3VS7A 3TEEA 2I2LA 1D1AA 4GY5A 5HK3A 5GMKe 1BKBA 3RKWA 4C5GA 1BI0A 3MEVA 1PKTA 2A3LA 1H92A 2A7YA 2LJ1A 4C8QB 1RAAB 3M0RA 3JCMW 1D09B 1Q82C 3CMEQ 2LT4A 1JXMA 3SWNC 2OTLT 1XNIA 4FT4A 2K5FA 4M78A 3GLXA 2LC4A 2M16A 3D7SB 5AT1B 5KCOA 2VVKA 1SF9A 4HT9A 1KC8C 4BE1A 3ME9A 2MIOA 1RAGB 2DL7A 1RUWA 3LX7A 2RPNA 3LWIA 3QXEB 1T3SA 2DL4A 1NYGA 2J6OA 3S3OA 6AT1B 3EGDA 1YHQQ 3RDVA 4EMHA 4XTVA 4HCKA 3RERA 4JLIA 4M75E 3OYEA 2EYQA 1Q86U 1X27A 1GCPA 1M90C 1FX7A 1NG2A 1G3TA 4XU2A 1M27C 3EG9B 3E19A 4E7LA 3LLRA 3BDUA 4QQ6A 2ABLA 2HL5C 4NOYA 1PRMC 4BE0A 3TCJA 4C92G 1I4K1 2EQMA 2L89A 2P4RA 3QHSA 1F1BB 2AT1B 5LJ3f 2P84A 3EG1A 2W0ZA 2KI7A 1M3AA 3I56T 2VGNA 2E10A 1VYTA 2CP2A 1Y96B 2CDTA 3I35A 3OYAA 5FU7C 3CCJA 4M7DA 4MDXA 3E2UA 3JCMb 4LXCA 2PUOB 5CO7A 1C1AA 4HCBA 4DBRA 3G6EQ 2ENMA 5CKBA 2DZCA 4JLGA 3CD6A 4M4ZA 1KQSS 2BKDN 5DM7R 5LJ5f 3G4SQ 1GBRA 2O9VA 2LRQA 2EIFA 4EMKC 2DVJA 1W1FA 2ZPEB 2VGMA 2X4YA 3ER0A 4KUIA 1VQKQ 2E5QA 5GMKl 2AK5A 4O5VA 1IHVA 4MMKA 2YHTA 4OF1A 2QGGA 5AYFA 1QCOA 2E3IA 3A8GB 4GLMA 3TREA 2K7AA 3I55T 3JB9G 1N8RU 4IIOA 2JM8A 3M0TA 1X6OA 5LJ3g 3OYFA 5CVIA 2HQHA 4PJMA 2K79A 2RQRA 4J9FA 2GF7A 2KAFA 4CC3A 1K4US 1QQJA 4KGZB 2LCSA 2XHCA 1JU5C 2X4XA 3UATA 1D0XA 2O9SA 2EJFA 4Y28E 3KUFA 4J9BA 4X1VA 3VJPA 3I5RA 1PG5B 5LL6S 4A4GA 1VQ5T 4FW1A 2M9UA 1UECA 4E7KA 2EGEA 2A37A 1TTHB 3MKDA 1VIEA 3CXCS 1KD1C 4C92F 4C8QG 1D0ZA 3VKIA 3CCLA 1GBQA 4XQ3A 2LJ3A 4OMFB 5GANg 1ZUYA 3NTKA 1AWWA 2CT4A 4E2FB 2VB6A 4HXJA 1B34A 4E7JA 3S6WA 3G4ST 4OMNA 2COWA 2KR3A 3CCEQ 4M75B 4OMOA 3REAB 2O01E 2D8JA 2CP5A 2CKKA 1X2QA 1Q81U 1WYXA 1OX9A 3L2ZA 1OQKA 1YITQ 3OMGA 1K0XA 4QQDA 4VUBA 1PM3A 1E6GA 1M1GA 2FZKB 5C0MA 3L2UA 3PIPA 2LTOA 1X69A 3MP6A 1K73U 3MP8A 3CC7Q 4RMOA 4ELYC 1PSEA 4N0AA 4UC4A 3CBOA 3PIOA 2QA4T 2LQNA 2CSQA 1NLOC 1QCNA 3ASKA 5GAOp 2VWFA 1VQ8Q 2DXTA 1TS9A 1K8AR 3ZL7C 3V8LA 3JCMg 4J9IA 4ZGJB 3JV3A 3QZ9B 3OYBA 2COYA 5CKFA 2KK4A 1M1FA 4FU6A 3MHXA 4R56A 4PJOD 3URGA 2ZPIB 4OB2B 2DTHA 2MI6A 2DPPB 1PRLC 5GAN4 3CC2Q 2HNIA 3S3MA 5GJVB 2GTOA 1O9SA 1A0NB 2O31A 4PJOE 3QO3A 2QEXQ 1NJIC 4KGVB 2L3PA 4A4FA 1UJYA 2LX9A 1B34B 3THKA 1UGQB 4M78G 2D6FA 1KHCA 2LDMA 2MCNA 2JS0A 1QW1A 4DBHA 3DKMA 1BI2A 2CZ6B 1H3ZA 4PNOA 1M9SA 3CCUQ 4DA4A 1VQNT 2PVGB 3V7SA 1WJRA 3WXMB 2VASA 1KHIA 1SHGA 5GAMf 3CQTA 2XU8A 4C8QF 4JS5A 2QK0A 2FPDA 3QYHB 1NJIR 1I07A 2LP5A 1ARKA 1M3CA 4DEYA 1VA7A 4RUGA 1NM7A 8AT1B 3BDLA 3A5ZB 2JNGA 2ED0A 2RJDA 5I22A 1SHFA 3RNJA 2DL8A 2E3HA 1Y57A 4BB7A 1WJQA 2LQKA 5GAOq 1GCQC 3RIRA 4KRTA 1Q82U 2EFIA 3VS4A 3QPHA 2MF2A 3OA6A 5KYYB 3PFSA 2DJZA 1UHCA 1N8RC 2JTEA 4E7ZA 4J9DA 4J7FA 4M7DG 3MCAB 4QVZA 2RQVA 3M59A 5A0LA 3CPWA 3CMAQ 4JRIA 4O6JA 3CC4Q 2MWPA 4M77D 1M4ZA 1MMNA 4HVVA 2KT8A 2HKNA 3CCLT 4RG8A 4L5GA 1JJ2A 2BZXA 2LCCA 3X26B 4X9DA 1UHFA 1RAEB 1X2KA 2X9HA 5GAMg 1CKBA 3INZA 3M4GA 2Y4XA 3CCRT 1V1CA 2XIDA 4M77E 4L59A 4IUQA 1U1TA 2L5QA 2QEXT 1S72T 2ED1A 2HSPA 4NL2A 4OMLA 2YUPA 1QVGP 1UGPB 4IUTA 3QBYA 2YRCA 1N6AA 1CKAA 5GAN8 2FB7A 1MUZA 4IUUA 4EDUA 3RBBB 2ZCFB 2K6DA 1FMVA 2LVMA 3CCQQ 3A1PA 2BZ8A 3MP1A 4J6YA 5HY6A 2DE0X 4LUDA 4A53A 5FRNA 1YJNT 3G7ZA 3PNWC 4JDSA 4NL3A 1RABB 1YJ9Q 3C4SA 5HKCA 5IHIA 3X20B 2ROLA 2LX7A 5LJ3h 1YI2A 3C0CA 3M0PA 3M57A 3L2RA 4LD9K 1Y7XA 4K11A 3L2WA 2P4TA 2Z0WA 4J9GA 1P92A 4PJOB 4JJDA 4QKUA 4ATOA 2GBQA 3H6ZA 1YIJA 4DBQA 4A4EA 2RHUA 1M5Q1 4Y91A 2PU9B 2OTLQ 2IG0A 1YJWA 2C0OA 5I2MA 4M77A 2DA9A 1NZ9A 3QWXX 5CIUA 1U1SA 1M1KR 4RKUE 2KY9A 2MK5A 2E6NA 2FHDA 2J05A 3OW2S 1WIEA 3CCMT 3QJYA 3MEUA 2WSCE 1UDLA 2HQXA 1IXDA 3O5ZA 5D6XA 1AOJA 1FMWA 4RCCA 3DLLA 5HK0A 1VQMA 2QTVA 5GANh 4OB1B 1TWBA 5D6YA 2FO0A 5IHKA 1YNZA 4M78E 1VQ6T 1ACMB 3JCMV 4IURA 1VQOT 1Y71A 4AG1C 4JUVA 4AFQC 5CK9A 2O88A 2K9GA 2KRMA 1SRLA 4R55A 1C0MA 1M2VA 4PKCC 1G5VA 3AHUA 1SSFA 1MV0B 3VS5A 3NTIA 3OS2A 2NLUA 3CMEA 4FL6A 2DIGA 4HVWA 1W2BP 4M75F 4PFZA 3I56Q 3META 1G8XA 2AZSA 2D9TA 1VQPT 2EYWA 5LJ3e 2FZCB 3RMQA 1BK2A 2LCLA 3EG2A 4F04B 2V8JA 4N4IA 2HMAA 1WPYA 2B86A 1TU0B 2HBPA 2RK1A 2A28A 3SD4A 3QDFA 3RKXA 1YHQA 1T0HA 1HYOA 2K57A 3JCMh 1K8AU 2I0NA 4AFSC 5ECAA 1IHWA 1VOMA 4M77B 2AKKA 2X4WA 4KUDK 2RN8A 1YFNA 2M1HA 1IGQA 4RTUA 4M7DE 1WZOA 1RLPC 5LJ5e 4FW2A 2RJCA 5CKEA 4Y92A 2EGAA 2W10A 4PFPA 3FDRA 1W70A 1ZSZB 4QQGA 4ANJA 4JS4A 3BY7A 4BD3A 2MOXA 1WA7A 4J7IA 3I55Q 2C06A 4XAXB 3GP8A 2AZVA 2RK2A 1QVFP 1SRMA 1I5LA 2DYBA 3CPWS 1TH7A 5GANe 3CPFA 2GNCA 2CP0A 1BCOA 3OYHA 1JJ2S 1IREB 3H0HA 5GAN2 3G6EA 1M2VB 5GAOm 2LT1A 3U23A 2EAYA 4HVUA 4NS5A 2CYZB 2EYXA 1I5OB 1QMCA 1UGRB 2DIQA 1VQKA 1GFCA 4B9WA 1GXIE 3E9GA 1NJIU 1BBZA 3HL8A 3NHNA 1Q7YC 1WHGA 4F7UA 2R57A 1VQ5Q 3OYKA 4EPCA 1WGSA 2NUTA 1YIJT 4TVRA 3VS0A 2AHJB 2EQIA 4PJOG 4Z89A 3KBGA 3EGUA 1VQ9A 4FSSA 2QQBA 3L1AA 9ATCB 1RLQC 4BI8B 3G71A 1OOTA 3JCMe 2DLPA 2JTFA 1YN8A 2V8KA 1OI1A 3TSWA 2VC8A 3JB9J 1KG1A 2JW4A 1Q7YR 2ZPFB 1VQ4T 1IB8A 1PC0A 1FXXA 2FPFA 4M78B 1IZ6A 2DMOA 1AZEA 3DB4A 2EQJA 2KYBA 1VQMT 1ZHIA 2PTKA 4WTOB 1SEMA 2E70A 3JB9H 1FMKA 4C0DB 1KIKA 2IPOB 4M75C 5GANf 5GAMh 1W6XA 1ZBJA 3EGDB 5CKHA 2F2XA 3CCST 3FRNA 1IO6A 4OGCA 1B3QA 2L2PA 4BY6B 2QA4Q 5KYWA 1MNDA 2QASA 1RAFB 2NUPA 3V7RA 2JM9A 2HCKA
chains in the Genus database with same CATH topology
1TXQA 1WHKA 2CP0A 3RDVA 2HKQB 2E3HA 1WHMA 2E3IA 1WHGA 2COYA 2CP7A 2E4HA 2M02A 2COWA 2Z0WA 1LPLA 1TOVA 2HKNA 1WHHA 4B6MA 2CP6A 2CP2A 2QK0A 2CP5A 1WHLA 2COZA 3TQ7P 2CP3A 2HL3A 3E2UA 2MPXC 2HL5C 1IXDA 1WHJA 2HQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXQ A;  1WHK A;  2CP0 A;  3RDV A;  2HKQ B;  2E3H A;  1WHM A;  2E3I A;  1WHG A;  2COY A;  2CP7 A;  2E4H A;  2M02 A;  2COW A;  2Z0W A;  1LPL A;  1TOV A;  2HKN A;  1WHH A;  4B6M A;  2CP6 A;  2CP2 A;  2QK0 A;  2CP5 A;  1WHL A;  2COZ A;  3TQ7 P;  2CP3 A;  2HL3 A;  3E2U A;  2MPX C;  2HL5 C;  1IXD A;  1WHJ A;  2HQH A; 
#chains in the Genus database with same CATH topology
 3E9F A;  4A63 B;  3CCV T;  1WXU A;  2LNV A;  4BDZ A;  1WQW A;  2ZAE A;  5FLX E;  4LE9 A;  3J80 E;  1NPP A;  4CC2 A;  1VQ7 T;  4FSX A;  3CCE A;  4A4H A;  5DY9 A;  5IAY A;  3OS0 A;  2CUB A;  1YIT A;  2ESW A;  2VKN A;  3TSZ A;  4M7D B;  1VQL A;  1K1Z A;  2DM1 A;  3P8B B;  3MJX A;  3OB9 A;  1BCM A;  1SSH A;  2GFU A;  3A8O B;  4Z02 A;  3EG3 A;  2KT1 A;  1NEB A;  1KQ1 A;  4N4G A;  4BI3 A;  1EX4 A;  1FYN A;  4FYV B;  3JCM f;  3HHT B;  2MWO A;  2XG8 D;  2COZ A;  4M77 G;  3CC7 A;  2XDB A;  2EGC A;  4DBF A;  1N9S A;  1V29 B;  1AT1 B;  3X28 B;  2F2V A;  2K3X A;  3A8L B;  1LVK A;  2EW3 A;  4A4K A;  1TUD A;  4OMQ A;  2KSS A;  4ZGD B;  1VQ8 A;  2DBM A;  3H9N A;  4X34 A;  5GMK j;  2FRY A;  1OX8 A;  1VQN Q;  2EPD A;  2J6K A;  3MO8 A;  3V8K A;  4JJB A;  1UJ0 A;  4PJO F;  3A8M B;  2EYZ A;  2F5K A;  1R77 A;  2OTJ A;  3HFN A;  4RTX A;  3QSU A;  2XI9 A;  5CAI A;  4FYW B;  3ULR B;  1K8A C;  3OYM A;  3RMS A;  3CC2 A;  5IHN A;  1M1K U;  2H8H A;  5GAM e;  3L2Q A;  2DXU A;  3NGP A;  5KYW B;  1WHM A;  2NUP B;  1LNX A;  1R0B G;  1HXD A;  2MMP A;  3HFO A;  2KGT A;  2QQS A;  2E65 A;  2YRV A;  3OBY A;  3GIB A;  1IGU A;  2M51 A;  2SEM A;  3C95 A;  3GBQ A;  4N0A C;  3OW2 P;  1PD0 A;  3OYC A;  2KXD A;  2P0K A;  1EZZ B;  1XQH A;  1M8V A;  2JOY A;  3UA6 A;  2D0Q B;  1I81 A;  1M30 A;  1D3B A;  2X51 A;  3JB9 F;  4GLK A;  1AVZ C;  3CCJ T;  2VYT A;  2RM4 A;  5FRO A;  3CCL Q;  3G71 T;  2HD0 A;  4JPB W;  2X3X D;  1ABQ A;  1AWJ A;  2DER A;  2RI2 A;  1R0C B;  3CD6 T;  3FLG A;  3MPU B;  4ZTJ A;  2NYS A;  3HRU A;  3PTA A;  2J7I A;  1B7T A;  3CCR Q;  4J5Y A;  4OP0 A;  3M0Q A;  1YCS B;  1S72 Q;  1UB4 A;  3GOX A;  4XU3 A;  4IUP A;  5GJW B;  3VU3 C;  4MDW A;  2CUD A;  2V1Q A;  3N5B B;  1O75 A;  2GFA A;  5KCH A;  2WSF E;  3LYI A;  2RQU A;  1QP2 A;  2V8I A;  3OSS C;  4P5N A;  2RA2 A;  2O4X A;  3JCM J;  2DL3 A;  4M77 F;  1Z9Q A;  3C12 A;  3CMA A;  3CC4 A;  1MMA A;  2D1X A;  2BIV A;  2XMF A;  1BIB A;  1UFF A;  1ZA1 B;  4D8D A;  1YJN Q;  1PWT A;  2RHY A;  2FEI A;  5D6W A;  2L3S A;  2DYI A;  1X01 A;  3JSC A;  5KYU A;  4KT0 E;  3LWH A;  4RG2 A;  3VRZ A;  1D3B B;  2DBK A;  4C92 C;  4Z88 A;  1VQL T;  2V26 A;  2ZPG B;  4FM4 B;  2DTO A;  1GCQ A;  1TUC A;  2J06 A;  4C0G A;  2E5K A;  4EIK A;  3VYH B;  4PJO C;  1D1B A;  2GGR A;  4RTY A;  2E41 A;  3A98 A;  3CCQ A;  1QWF A;  1WXB A;  3CCM Q;  5A2Q E;  1ZLM A;  1RI9 A;  2FRW A;  2HSE B;  1OYX A;  3MEW A;  1YJ9 A;  1OUL A;  1X75 C;  2LJ0 A;  1BYM A;  2ZPH B;  2OTJ T;  4C0Z A;  1SKU B;  2XK0 A;  2ZZD A;  1VQ6 Q;  2FL7 A;  2VXF A;  3KXT A;  3M54 A;  1VQO Q;  3EH1 A;  2O4X B;  2F69 A;  2ZPB B;  2L0A A;  3F70 A;  1WLP B;  1Q7Y U;  1K9M C;  2KRN A;  1G3W A;  4LDY A;  3PMT A;  4XTX A;  2EWN A;  4DOV A;  2K5I A;  1YWO A;  4HCZ A;  2YSQ A;  2OTL A;  3RR6 A;  1KQS P;  4JZ4 A;  2RNA A;  1B07 A;  5KYX A;  2OAW A;  1OU9 A;  4AFZ C;  3J7A F;  4M78 F;  1WJS A;  1HJD A;  1VQP Q;  1T0J A;  3HKS A;  5KYU B;  3VRY A;  3O8V A;  1QVG A;  2Y4Y A;  4QVD A;  1RL2 A;  4HCC A;  2QDY B;  2PUK B;  2DFU A;  3OYN A;  1K9M R;  2PVD B;  2QTX A;  5HCK A;  5CKD A;  4J6W A;  1M1K C;  2F2W A;  4J9H A;  2D8H A;  1MNE A;  2IIM A;  2RHX A;  2CH4 W;  3C94 A;  1ABO A;  2SRC A;  8ATC B;  2YWW A;  5CCA A;  4D6W A;  2EQK A;  3EFS A;  2XKO C;  2DRM A;  3EGX A;  4M7A D;  2KQW A;  2HEQ A;  1UG1 A;  3FEO A;  3L2V A;  1TG0 A;  2KEA A;  2DET A;  1QVP A;  2RHZ A;  3JCM c;  5EG2 A;  4C8Q C;  5GAO r;  1XTD A;  3I56 A;  2BZY A;  3H8Z A;  5GMK h;  5GAN 5;  3PE0 A;  1FWZ A;  5J26 A;  4BI4 A;  4M7A E;  2CS7 A;  3PGG A;  4M7D F;  1HK9 A;  2JS2 A;  1ZSZ C;  3LGL A;  2GQI A;  1Q81 R;  3V7C A;  2OX7 A;  4N4H A;  1YWP A;  3R6N A;  3H0F A;  2DJQ A;  1OU8 A;  4RTW A;  3NFC A;  4CC4 B;  1ZQ1 A;  3E1S A;  3AT1 B;  4OGE A;  3FC3 A;  2LQ8 A;  2KRO A;  3ZEH A;  4J83 A;  2DD5 A;  3CXC P;  3QG1 A;  2CRE A;  5M9O A;  3P8D A;  1H64 1;  2CH4 A;  5I21 A;  3X24 B;  4ME7 A;  2NUZ A;  2E64 A;  2EJG A;  2XDP A;  2JJ9 A;  1U8R A;  1UUE A;  2ZGW A;  5FU6 B;  2A0F B;  1QCF A;  1YIJ Q;  2JUF A;  1N5Z A;  3EG0 A;  1H8K A;  1NEG A;  2F5T X;  3LH0 A;  3I55 A;  2EQU A;  1G2B A;  2M0Y A;  3M53 A;  4JJN K;  1XOV A;  3CXC A;  1OZ3 A;  2YUN A;  4CC7 A;  3SDZ A;  2DIL A;  4KH1 B;  2L3Q A;  2LMJ A;  2EVR A;  2KMT A;  3EG9 A;  4KUL A;  3VV0 A;  1V76 A;  3EFO A;  2NWM A;  4IIM A;  2K5L A;  4F7U E;  2YUQ A;  1W2B A;  1VQ4 Q;  2E12 A;  2PQW A;  4PK4 A;  4LN2 A;  5GAO n;  4F16 A;  4M7A A;  1YP5 A;  4E7I A;  1Z9Z A;  5IT9 E;  2LNH B;  1E7O A;  1VQM Q;  4ZNX A;  3J81 E;  2RO0 A;  2FVU A;  4FIB A;  2YUO A;  3DLM A;  1Y96 A;  4LDU A;  3LH5 A;  4JRK A;  3CCS Q;  4M78 C;  3HRT A;  1VQ5 A;  5C6S A;  3M58 A;  2RMO A;  1IRX A;  5CR2 A;  2YLB A;  5GMK m;  4XTZ A;  4C0F A;  3SWN A;  3SHW A;  1JB0 E;  2M0O A;  4C0D C;  4ORZ A;  4BAC A;  1TXQ A;  4AMC A;  2DVE A;  1M2O A;  3CCV Q;  3UF4 A;  1E6H A;  1I1J A;  3NPF A;  4M75 D;  2GQV A;  4OB3 B;  4GBQ A;  3R6O A;  3JCM X;  1AZG B;  3NMZ C;  3PVQ A;  4Z8A A;  5FWB A;  2D0N A;  4BY6 C;  5FWC A;  4XU1 A;  3G4S A;  1VQ7 Q;  3DB3 A;  4PFO A;  4DEX A;  1OPK A;  1PKS A;  1JRI A;  3JCM P;  4FT2 A;  1YI2 T;  5I2S A;  3OYY A;  1QVF A;  1KK7 A;  1Q82 R;  5J3B A;  3UT1 A;  2XD0 A;  2VUB A;  4RCB A;  3CBM A;  2EYY A;  3EFO B;  2E6Z A;  2RHI A;  2LQW A;  3EHR A;  1KC8 R;  1K9A A;  2MPX C;  1QKX A;  2EBP A;  4M7D C;  1YJW T;  2QA4 A;  5J39 A;  4LUE A;  4M7A B;  2IVW A;  1DJ7 B;  4KBM B;  3CBP A;  1PHT A;  4AG2 C;  1QVG S;  2BUD A;  3OYL A;  4JRQ A;  1GFD A;  2P0P A;  1M90 R;  4MZP A;  2DL5 A;  3M0S A;  1YCY A;  4CI0 C;  5IH2 A;  2C0I A;  1BB9 A;  1MGQ A;  2JZ2 A;  4LDW A;  1D1C A;  2EJ9 A;  1WNL A;  1T3L A;  2CZ1 B;  2CT3 A;  2K2M A;  2RQT A;  4ZN3 A;  3SWN B;  1UTI A;  1JBM A;  2FPE A;  5IXB A;  4ZN1 A;  1GRI A;  4R0K A;  3OYD A;  3PVL A;  2CSI A;  4EMK A;  5IXF A;  1VIF A;  2PNI A;  1PSF A;  2C0T A;  2K4Y A;  1BIA A;  1BI1 A;  2BE9 B;  2JXB A;  1G83 A;  1AWX A;  1JO8 A;  1M8M A;  2R58 A;  3M9Q A;  4B9X A;  3CME T;  1VYV A;  2A36 A;  3JCM Q;  5DLO A;  1UE9 A;  1R8O B;  1WXT A;  1ZA2 B;  2RJE A;  4M75 A;  3KFV A;  2G3R A;  4IKF A;  1RAD B;  2KNB B;  4AFU C;  4J6X A;  3VUB A;  5GAN 7;  5KYN A;  1ZUK A;  2CP7 A;  2RI5 A;  4OMM A;  2X4J A;  1MV3 A;  3VS3 A;  5GAO l;  3JRZ A;  4HT8 A;  1VQN A;  4E6R A;  1VQ9 Q;  2CGH A;  3ZBD A;  3OYJ A;  3CCJ Q;  3PMI A;  3L42 A;  1WHL A;  2K3Y A;  2KBT A;  3G71 Q;  4F7U B;  1YBY A;  1RAI B;  2NUT B;  5L8R E;  2QXF A;  4C5I A;  3CD6 Q;  2V1R A;  1X6G A;  1AD5 A;  1YHQ T;  2DTI A;  4A54 A;  1QKW A;  3CEY A;  3OSV A;  1LCK A;  2EKH A;  2M02 A;  5GAN 6;  2DXB A;  2JVV A;  4RTV A;  3OS5 A;  1K9M U;  5FRM A;  5LJ3 j;  2JMA A;  2HAX A;  2HL3 A;  3FB9 A;  7AT1 B;  4JJC A;  1WDX A;  3QUI A;  5FU7 B;  1OZ2 A;  5GAN 3;  3M55 A;  5LJ5 g;  1WHK A;  4XTU A;  4D8K A;  4ZGE B;  3OMC A;  3RKY A;  1I0C A;  3M0U A;  1BU1 A;  3VS1 A;  2G6F X;  5LJ5 j;  5KE2 A;  4EMK B;  2HDA A;  2DEQ A;  4II1 A;  2BE7 D;  3OYG A;  2DAQ A;  3IQL A;  3G6E T;  1W2B S;  1C6V X;  5A0D A;  3I9Q A;  3G1J A;  3OBW A;  2HZY A;  4ELZ C;  1NLP C;  1I8F A;  2YLC A;  1W4S A;  3CCR A;  2L3R A;  2A08 A;  1ZX6 A;  2OJ2 A;  2QEX A;  4PJL A;  1S72 A;  5GAN j;  2KE9 A;  1VQK T;  3ZFJ A;  1RAC B;  2X3W D;  3HSB A;  1KD1 R;  1VQL Q;  2P0Q A;  4XU0 A;  3VS2 A;  3RUX A;  3REB B;  3H0I A;  3FJ5 A;  4WF2 A;  3BFM A;  3CCU A;  5KE3 A;  5L23 A;  1WHH A;  1VQ9 T;  3LGF A;  2J6F A;  1U3O A;  3QJ6 A;  2YT6 A;  4C92 D;  4JZ3 A;  2QGF B;  1X43 A;  2QAZ A;  1NE8 A;  4PLI A;  3QDR B;  4KGX B;  1YJN A;  3OW2 A;  2DZ9 A;  5LJ3 d;  3V8J A;  4M7A G;  2QQR A;  1Y07 A;  2E4H A;  5KYY A;  1KJW A;  3VUZ A;  2OTJ Q;  1TUG B;  1M3B A;  4B6M A;  2BTT A;  2OI3 A;  2KYM A;  3T9N A;  1UGS B;  2DEU A;  1QVF S;  4E7H A;  1Q86 C;  4C92 E;  2K3B A;  2RF0 A;  1K0S A;  1WQ7 A;  1AEY A;  2JN0 A;  2DNU A;  1KQ2 A;  4PLL A;  1QWE A;  2LZ6 B;  3NTH A;  2XIC A;  2DX1 A;  1PD1 A;  2HKQ B;  1EFN A;  2CZ0 B;  5LJ5 d;  3EH2 A;  1RAH B;  5I11 A;  4PJN A;  1GL5 A;  3OYI A;  2QI2 A;  1NPR A;  2Y90 A;  2OAU A;  4FCY A;  3OQ5 A;  4MZM A;  3UPU A;  1EIF A;  1SG5 A;  2QDL A;  3LW5 E;  1VYU A;  4C5E A;  1Q86 R;  4BDY A;  3CCM A;  1X6B A;  4KH0 B;  2DD4 A;  4LD6 A;  4AT1 B;  1N27 A;  1WFW A;  4X9C A;  4MZT A;  5IN1 A;  5GAN d;  1HSQ A;  2X35 A;  3JB9 D;  1BI3 A;  4F14 A;  2FYK A;  3CCE T;  2YRD A;  1JXO A;  2DO3 A;  4ESR A;  3TQ7 P;  2CP3 A;  4EMG A;  1YIT T;  4F7U G;  1VQ6 A;  1SPK A;  4QW2 A;  1VQO A;  2KRS A;  2ROT A;  1NYF A;  2RD1 A;  3CPW P;  3QYG B;  3GNG A;  5A0G A;  4V2S A;  4FYY B;  2MYS A;  1WX6 A;  4J9C A;  3UDC A;  2KDS A;  2L8D A;  2WSE E;  1JJ2 P;  1K76 A;  1G3S A;  1WI7 A;  3CC7 T;  4RTZ A;  2HQE A;  4XTY A;  5EC7 A;  4WCI A;  3QZ5 B;  4C92 A;  2YXY A;  1ZSG A;  3SFM A;  3TU4 K;  1VQ8 T;  1VQP A;  1OEB A;  2JT4 A;  1MHN A;  3EHQ A;  5D7U A;  3GPL A;  1QP3 A;  2MAM A;  3GF5 A;  2FZG B;  1KC8 U;  4PJO A;  1AWO A;  2PVO B;  2H3E B;  1J3T A;  1PNJ A;  3HTR A;  5FW9 A;  2FG0 A;  3JCM d;  2JTM A;  3H41 A;  1Y0M A;  4C8Q D;  4DQ2 A;  3P8H A;  5CQY A;  1U5S A;  3TVT A;  3WVE B;  3CC2 T;  4HA8 A;  2EKO A;  2K2V A;  3EAE A;  3M56 A;  2R5M A;  4OMP A;  4M7A F;  1M90 U;  1N8R R;  3S3N A;  2QG9 B;  4LDV A;  1UGV A;  2CZ7 B;  3X25 B;  1HD3 A;  4C8Q E;  3QKJ A;  4M75 G;  3JB9 I;  2GCX A;  4QVC A;  2CP6 A;  1Q95 G;  1MMG A;  2DK3 A;  2H3J A;  3A8H B;  4LDX A;  5GAM j;  3WVD B;  3HPW A;  1KSW A;  2RH2 A;  1UEB A;  1JQQ A;  3CCU T;  1KFZ A;  1TSF A;  1JEG A;  2KVQ G;  5FU6 C;  3HP9 A;  1LPL A;  2QYZ A;  2QQA A;  4FYX B;  2WAC A;  4QT7 A;  3Q1J A;  1KQS A;  2F1L A;  3OY9 A;  3VYG A;  4E7S A;  3M4Y A;  4C92 B;  4F17 A;  2O2O A;  1D0Y A;  4ZTF A;  1Q81 C;  3HRS A;  4DOW A;  2RB6 A;  2RJF A;  5GMK i;  2ECZ A;  3RES A;  2DRK A;  3UWN A;  1AHJ B;  3OS1 A;  2KXC A;  4M77 C;  3EFR A;  4F7U F;  2RI3 A;  2XDD A;  4YTL A;  1K73 C;  4RTT A;  4IUV A;  3PT9 A;  5CQX A;  4CRI A;  1WHJ A;  4OVA A;  3GNF B;  5LJ5 h;  3SB2 A;  4HKE A;  4Q5W A;  3CMA T;  4C8Q A;  3CC4 T;  2R5A A;  1QLY A;  1H3H A;  3MEA A;  4XTW A;  1S1N A;  4M78 D;  5KH6 A;  2B8A A;  2DXC A;  3QWY A;  1VQ4 A;  4LNP A;  1ZSZ A;  3VS6 A;  5DLQ E;  5KYX B;  2YDL A;  2JMC A;  1K73 R;  1ZBX A;  4L6V 5;  1YI2 Q;  4BE2 A;  1ZUU A;  3UA7 A;  1NBE B;  1LOJ A;  2RQW A;  1N9R A;  3SEM A;  2AKL A;  5GAM d;  1MMD A;  2VXE A;  1TOV A;  2DF6 A;  1OPL A;  4PJJ A;  2VV5 A;  1CSK A;  4BUG A;  1OV3 A;  4OB0 B;  1RI0 A;  2DKG A;  3CCS A;  1PCX A;  4E47 A;  3M5A A;  4MML A;  1U06 A;  4JRP A;  1LJO A;  3I5S A;  1YJW Q;  4C5H A;  3BW1 A;  3FJP A;  4J8O A;  2PZ1 A;  3QII A;  1KD1 U;  4J9E A;  2QQ9 A;  2AIR B;  4XK8 E;  2ATC B;  3EGX B;  1VUB A;  3CCV A;  3CCQ T;  4PL6 A;  1G3Y A;  1XJW B;  3BE3 A;  2GTJ A;  1VQ7 A;  2E1H A;  3FIF A;  4M7A C;  2HBW A;  3JAM E;  1YJ9 T;  4M7D D;  3VS7 A;  3TEE A;  2I2L A;  1D1A A;  4GY5 A;  5HK3 A;  5GMK e;  1BKB A;  3RKW A;  4C5G A;  1BI0 A;  3MEV A;  1PKT A;  2A3L A;  1H92 A;  2A7Y A;  2LJ1 A;  4C8Q B;  1RAA B;  3M0R A;  3JCM W;  1D09 B;  1Q82 C;  3CME Q;  2LT4 A;  1JXM A;  3SWN C;  2OTL T;  1XNI A;  4FT4 A;  2K5F A;  4M78 A;  3GLX A;  2LC4 A;  2M16 A;  3D7S B;  5AT1 B;  5KCO A;  2VVK A;  1SF9 A;  4HT9 A;  1KC8 C;  4BE1 A;  3ME9 A;  2MIO A;  1RAG B;  2DL7 A;  1RUW A;  3LX7 A;  2RPN A;  3LWI A;  3QXE B;  1T3S A;  2DL4 A;  1NYG A;  2J6O A;  3S3O A;  6AT1 B;  3EGD A;  1YHQ Q;  3RDV A;  4EMH A;  4XTV A;  4HCK A;  3RER A;  4JLI A;  4M75 E;  3OYE A;  2EYQ A;  1Q86 U;  1X27 A;  1GCP A;  1M90 C;  1FX7 A;  1NG2 A;  1G3T A;  4XU2 A;  1M27 C;  3EG9 B;  3E19 A;  4E7L A;  3LLR A;  3BDU A;  4QQ6 A;  2ABL A;  2HL5 C;  4NOY A;  1PRM C;  4BE0 A;  3TCJ A;  4C92 G;  1I4K 1;  2EQM A;  2L89 A;  2P4R A;  3QHS A;  1F1B B;  2AT1 B;  5LJ3 f;  2P84 A;  3EG1 A;  2W0Z A;  2KI7 A;  1M3A A;  3I56 T;  2VGN A;  2E10 A;  1VYT A;  2CP2 A;  1Y96 B;  2CDT A;  3I35 A;  3OYA A;  5FU7 C;  3CCJ A;  4M7D A;  4MDX A;  3E2U A;  3JCM b;  4LXC A;  2PUO B;  5CO7 A;  1C1A A;  4HCB A;  4DBR A;  3G6E Q;  2ENM A;  5CKB A;  2DZC A;  4JLG A;  3CD6 A;  4M4Z A;  1KQS S;  2BKD N;  5DM7 R;  5LJ5 f;  3G4S Q;  1GBR A;  2O9V A;  2LRQ A;  2EIF A;  4EMK C;  2DVJ A;  1W1F A;  2ZPE B;  2VGM A;  2X4Y A;  3ER0 A;  4KUI A;  1VQK Q;  2E5Q A;  5GMK l;  2AK5 A;  4O5V A;  1IHV A;  4MMK A;  2YHT A;  4OF1 A;  2QGG A;  5AYF A;  1QCO A;  2E3I A;  3A8G B;  4GLM A;  3TRE A;  2K7A A;  3I55 T;  3JB9 G;  1N8R U;  4IIO A;  2JM8 A;  3M0T A;  1X6O A;  5LJ3 g;  3OYF A;  5CVI A;  2HQH A;  4PJM A;  2K79 A;  2RQR A;  4J9F A;  2GF7 A;  2KAF A;  4CC3 A;  1K4U S;  1QQJ A;  4KGZ B;  2LCS A;  2XHC A;  1JU5 C;  2X4X A;  3UAT A;  1D0X A;  2O9S A;  2EJF A;  4Y28 E;  3KUF A;  4J9B A;  4X1V A;  3VJP A;  3I5R A;  1PG5 B;  5LL6 S;  4A4G A;  1VQ5 T;  4FW1 A;  2M9U A;  1UEC A;  4E7K A;  2EGE A;  2A37 A;  1TTH B;  3MKD A;  1VIE A;  3CXC S;  1KD1 C;  4C92 F;  4C8Q G;  1D0Z A;  3VKI A;  3CCL A;  1GBQ A;  4XQ3 A;  2LJ3 A;  4OMF B;  5GAN g;  1ZUY A;  3NTK A;  1AWW A;  2CT4 A;  4E2F B;  2VB6 A;  4HXJ A;  1B34 A;  4E7J A;  3S6W A;  3G4S T;  4OMN A;  2COW A;  2KR3 A;  3CCE Q;  4M75 B;  4OMO A;  3REA B;  2O01 E;  2D8J A;  2CP5 A;  2CKK A;  1X2Q A;  1Q81 U;  1WYX A;  1OX9 A;  3L2Z A;  1OQK A;  1YIT Q;  3OMG A;  1K0X A;  4QQD A;  4VUB A;  1PM3 A;  1E6G A;  1M1G A;  2FZK B;  5C0M A;  3L2U A;  3PIP A;  2LTO A;  1X69 A;  3MP6 A;  1K73 U;  3MP8 A;  3CC7 Q;  4RMO A;  4ELY C;  1PSE A;  4N0A A;  4UC4 A;  3CBO A;  3PIO A;  2QA4 T;  2LQN A;  2CSQ A;  1NLO C;  1QCN A;  3ASK A;  5GAO p;  2VWF A;  1VQ8 Q;  2DXT A;  1TS9 A;  1K8A R;  3ZL7 C;  3V8L A;  3JCM g;  4J9I A;  4ZGJ B;  3JV3 A;  3QZ9 B;  3OYB A;  2COY A;  5CKF A;  2KK4 A;  1M1F A;  4FU6 A;  3MHX A;  4R56 A;  4PJO D;  3URG A;  2ZPI B;  4OB2 B;  2DTH A;  2MI6 A;  2DPP B;  1PRL C;  5GAN 4;  3CC2 Q;  2HNI A;  3S3M A;  5GJV B;  2GTO A;  1O9S A;  1A0N B;  2O31 A;  4PJO E;  3QO3 A;  2QEX Q;  1NJI C;  4KGV B;  2L3P A;  4A4F A;  1UJY A;  2LX9 A;  1B34 B;  3THK A;  1UGQ B;  4M78 G;  2D6F A;  1KHC A;  2LDM A;  2MCN A;  2JS0 A;  1QW1 A;  4DBH A;  3DKM A;  1BI2 A;  2CZ6 B;  1H3Z A;  4PNO A;  1M9S A;  3CCU Q;  4DA4 A;  1VQN T;  2PVG B;  3V7S A;  1WJR A;  3WXM B;  2VAS A;  1KHI A;  1SHG A;  5GAM f;  3CQT A;  2XU8 A;  4C8Q F;  4JS5 A;  2QK0 A;  2FPD A;  3QYH B;  1NJI R;  1I07 A;  2LP5 A;  1ARK A;  1M3C A;  4DEY A;  1VA7 A;  4RUG A;  1NM7 A;  8AT1 B;  3BDL A;  3A5Z B;  2JNG A;  2ED0 A;  2RJD A;  5I22 A;  1SHF A;  3RNJ A;  2DL8 A;  2E3H A;  1Y57 A;  4BB7 A;  1WJQ A;  2LQK A;  5GAO q;  1GCQ C;  3RIR A;  4KRT A;  1Q82 U;  2EFI A;  3VS4 A;  3QPH A;  2MF2 A;  3OA6 A;  5KYY B;  3PFS A;  2DJZ A;  1UHC A;  1N8R C;  2JTE A;  4E7Z A;  4J9D A;  4J7F A;  4M7D G;  3MCA B;  4QVZ A;  2RQV A;  3M59 A;  5A0L A;  3CPW A;  3CMA Q;  4JRI A;  4O6J A;  3CC4 Q;  2MWP A;  4M77 D;  1M4Z A;  1MMN A;  4HVV A;  2KT8 A;  2HKN A;  3CCL T;  4RG8 A;  4L5G A;  1JJ2 A;  2BZX A;  2LCC A;  3X26 B;  4X9D A;  1UHF A;  1RAE B;  1X2K A;  2X9H A;  5GAM g;  1CKB A;  3INZ A;  3M4G A;  2Y4X A;  3CCR T;  1V1C A;  2XID A;  4M77 E;  4L59 A;  4IUQ A;  1U1T A;  2L5Q A;  2QEX T;  1S72 T;  2ED1 A;  2HSP A;  4NL2 A;  4OML A;  2YUP A;  1QVG P;  1UGP B;  4IUT A;  3QBY A;  2YRC A;  1N6A A;  1CKA A;  5GAN 8;  2FB7 A;  1MUZ A;  4IUU A;  4EDU A;  3RBB B;  2ZCF B;  2K6D A;  1FMV A;  2LVM A;  3CCQ Q;  3A1P A;  2BZ8 A;  3MP1 A;  4J6Y A;  5HY6 A;  2DE0 X;  4LUD A;  4A53 A;  5FRN A;  1YJN T;  3G7Z A;  3PNW C;  4JDS A;  4NL3 A;  1RAB B;  1YJ9 Q;  3C4S A;  5HKC A;  5IHI A;  3X20 B;  2ROL A;  2LX7 A;  5LJ3 h;  1YI2 A;  3C0C A;  3M0P A;  3M57 A;  3L2R A;  4LD9 K;  1Y7X A;  4K11 A;  3L2W A;  2P4T A;  2Z0W A;  4J9G A;  1P92 A;  4PJO B;  4JJD A;  4QKU A;  4ATO A;  2GBQ A;  3H6Z A;  1YIJ A;  4DBQ A;  4A4E A;  2RHU A;  1M5Q 1;  4Y91 A;  2PU9 B;  2OTL Q;  2IG0 A;  1YJW A;  2C0O A;  5I2M A;  4M77 A;  2DA9 A;  1NZ9 A;  3QWX X;  5CIU A;  1U1S A;  1M1K R;  4RKU E;  2KY9 A;  2MK5 A;  2E6N A;  2FHD A;  2J05 A;  3OW2 S;  1WIE A;  3CCM T;  3QJY A;  3MEU A;  2WSC E;  1UDL A;  2HQX A;  1IXD A;  3O5Z A;  5D6X A;  1AOJ A;  1FMW A;  4RCC A;  3DLL A;  5HK0 A;  1VQM A;  2QTV A;  5GAN h;  4OB1 B;  1TWB A;  5D6Y A;  2FO0 A;  5IHK A;  1YNZ A;  4M78 E;  1VQ6 T;  1ACM B;  3JCM V;  4IUR A;  1VQO T;  1Y71 A;  4AG1 C;  4JUV A;  4AFQ C;  5CK9 A;  2O88 A;  2K9G A;  2KRM A;  1SRL A;  4R55 A;  1C0M A;  1M2V A;  4PKC C;  1G5V A;  3AHU A;  1SSF A;  1MV0 B;  3VS5 A;  3NTI A;  3OS2 A;  2NLU A;  3CME A;  4FL6 A;  2DIG A;  4HVW A;  1W2B P;  4M75 F;  4PFZ A;  3I56 Q;  3MET A;  1G8X A;  2AZS A;  2D9T A;  1VQP T;  2EYW A;  5LJ3 e;  2FZC B;  3RMQ A;  1BK2 A;  2LCL A;  3EG2 A;  4F04 B;  2V8J A;  4N4I A;  2HMA A;  1WPY A;  2B86 A;  1TU0 B;  2HBP A;  2RK1 A;  2A28 A;  3SD4 A;  3QDF A;  3RKX A;  1YHQ A;  1T0H A;  1HYO A;  2K57 A;  3JCM h;  1K8A U;  2I0N A;  4AFS C;  5ECA A;  1IHW A;  1VOM A;  4M77 B;  2AKK A;  2X4W A;  4KUD K;  2RN8 A;  1YFN A;  2M1H A;  1IGQ A;  4RTU A;  4M7D E;  1WZO A;  1RLP C;  5LJ5 e;  4FW2 A;  2RJC A;  5CKE A;  4Y92 A;  2EGA A;  2W10 A;  4PFP A;  3FDR A;  1W70 A;  1ZSZ B;  4QQG A;  4ANJ A;  4JS4 A;  3BY7 A;  4BD3 A;  2MOX A;  1WA7 A;  4J7I A;  3I55 Q;  2C06 A;  4XAX B;  3GP8 A;  2AZV A;  2RK2 A;  1QVF P;  1SRM A;  1I5L A;  2DYB A;  3CPW S;  1TH7 A;  5GAN e;  3CPF A;  2GNC A;  2CP0 A;  1BCO A;  3OYH A;  1JJ2 S;  1IRE B;  3H0H A;  5GAN 2;  3G6E A;  1M2V B;  5GAO m;  2LT1 A;  3U23 A;  2EAY A;  4HVU A;  4NS5 A;  2CYZ B;  2EYX A;  1I5O B;  1QMC A;  1UGR B;  2DIQ A;  1VQK A;  1GFC A;  4B9W A;  1GXI E;  3E9G A;  1NJI U;  1BBZ A;  3HL8 A;  3NHN A;  1Q7Y C;  1WHG A;  4F7U A;  2R57 A;  1VQ5 Q;  3OYK A;  4EPC A;  1WGS A;  2NUT A;  1YIJ T;  4TVR A;  3VS0 A;  2AHJ B;  2EQI A;  4PJO G;  4Z89 A;  3KBG A;  3EGU A;  1VQ9 A;  4FSS A;  2QQB A;  3L1A A;  9ATC B;  1RLQ C;  4BI8 B;  3G71 A;  1OOT A;  3JCM e;  2DLP A;  2JTF A;  1YN8 A;  2V8K A;  1OI1 A;  3TSW A;  2VC8 A;  3JB9 J;  1KG1 A;  2JW4 A;  1Q7Y R;  2ZPF B;  1VQ4 T;  1IB8 A;  1PC0 A;  1FXX A;  2FPF A;  4M78 B;  1IZ6 A;  2DMO A;  1AZE A;  3DB4 A;  2EQJ A;  2KYB A;  1VQM T;  1ZHI A;  2PTK A;  4WTO B;  1SEM A;  2E70 A;  3JB9 H;  1FMK A;  4C0D B;  1KIK A;  2IPO B;  4M75 C;  5GAN f;  5GAM h;  1W6X A;  1ZBJ A;  3EGD B;  5CKH A;  2F2X A;  3CCS T;  3FRN A;  1IO6 A;  4OGC A;  1B3Q A;  2L2P A;  4BY6 B;  2QA4 Q;  5KYW A;  1MND A;  2QAS A;  1RAF B;  2NUP A;  3V7R A;  2JM9 A;  2HCK A; 
#chains in the Genus database with same CATH homology
 1TXQ A;  1WHK A;  2CP0 A;  3RDV A;  2HKQ B;  2E3H A;  1WHM A;  2E3I A;  1WHG A;  2COY A;  2CP7 A;  2E4H A;  2M02 A;  2COW A;  2Z0W A;  1LPL A;  1TOV A;  2HKN A;  1WHH A;  4B6M A;  2CP6 A;  2CP2 A;  2QK0 A;  2CP5 A;  1WHL A;  2COZ A;  3TQ7 P;  2CP3 A;  2HL3 A;  3E2U A;  2MPX C;  2HL5 C;  1IXD A;  1WHJ A;  2HQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...