2COYA

Solution structure of the cap-gly domain in human dynactin 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
b'GSSGSSGMAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
molecule tags Protein binding
source organism Homo sapiens
publication title Solution structure of the CAP-Gly domain in human Dynactin 1
rcsb
total genus 8
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2coyA01
1WHGA 1WHLA 2M02A 3E2UA 1WHKA 2MPXC 1WHHA 2COZA 1TXQA 2COYA 2CP5A 2HKNA 2E3HA 2CP2A 2HL3A 2HKQB 2CP0A 2HL5C 4B6MA 1LPLA 2HQHA 2QK0A 3RDVA 2Z0WA 2E4HA 2E3IA 2COWA 3TQ7P 1TOVA 1WHMA 2CP7A 2CP6A 1IXDA 1WHJA 2CP3A
chains in the Genus database with same CATH superfamily
3CCUA 1KHIA 3HHTB 4L6V5 2RQRA 4E7ZA 1M90C 4PJOB 2JW4A 2MCNA 4PFPA 2LJ0A 3EH2A 1BU1A 2PVOB 3R6NA 2DXUA 1GRIA 2RQWA 4JJCA 4DA4A 1C6VX 4LNPA 2EWNA 1M1KC 2VXFA 5LJ3h 1VQ5Q 2ENMA 4PFOA 1QVFP 2E3HA 3E19A 1SKUB 1OV3A 2FRYA 1YIJA 3DB4A 2AKKA 2ROLA 1G3SA 2O88A 3CXCS 1OU9A 3PVQA 2EAYA 1J3TA 4DBHA 2EVRA 2K5IA 1G2BA 2LT1A 1ABOA 2DXBA 2LNHB 2EYQA 1GCPA 4GBQA 2JUFA 2DTHA 2HKQB 3VS2A 1JQQA 2RHZA 1TTHB 4DOVA 1YJ9Q 4HCBA 4ELZC 3TSWA 1VQOT 2JS0A 2L3PA 1ACMB 4PJOE 4A4FA 1N8RU 4JRQA 3M0PA 1RACB 1M3CA 1QVPA 5GANh 2XU8A 4OB0B 4AMCA 2QGFB 3VJPA 3UATA 1ABQA 2HL3A 2VYTA 5HY6A 4PJOC 4KRTA 1F1BB 2RA2A 2QK0A 3JCMd 1M8VA 4M7DD 4N0AC 5GANg 3NHNA 1I4K1 1K9MU 2BZXA 3RESA 3HKSA 1MUZA 4J83A 4FW1A 2LZ6B 3MP8A 3CCRQ 2VGMA 1RAIB 5LJ3j 4ZN1A 5CKBA 2CP2A 2D9TA 5FU7B 3PVLA 3REAB 1K4US 1T0HA 1P92A 1NEGA 4J6XA 1V76A 1M1KR 2DE0X 1N27A 2L0AA 2X51A 4OB1B 5KCHA 3MEAA 4KH1B 2RO0A 4LXCA 3L2VA 3ER0A 5HCKA 3VS3A 4V2SA 3VS5A 2RI5A 5KE3A 2RHXA 1GFDA 1VIEA 3GBQA 1KQSS 4PJOG 4Z88A 5FU6B 4M7AF 4FCYA 2COWA 2ZCFB 3CD6Q 1SG5A 4ATOA 1RL2A 3A8GB 3I56T 2DO3A 3M0SA 3CCJT 1BCOA 2LX7A 1BIBA 2RHYA 1YI2A 4FYWB 3C4SA 3A5ZB 2W0ZA 5GANj 3CCEA 3N5BB 5CKDA 4XU3A 4RKUE 5LJ3d 1Q7YC 3M53A 2JMCA 3RMQA 3JCMh 3X25B 2OTLA 2YWWA 2HNIA 1YN8A 5DLQE 2DILA 2BIVA 2DJQA 3J81E 1RABB 2KYMA 4IURA 2ATCB 1K8AC 4M78D 4E47A 3JRZA 3ZEHA 1PKTA 2J6FA 4A4HA 1BI2A 1VQPA 2OX7A 5A0GA 5IXBA 2KDSA 3RKYA 1OX8A 4PFZA 1AEYA 2H3JA 5GAMf 2JZ2A 1K9MC 4LD6A 2LT4A 2AHJB 1AZGB 1YCYA 2RJEA 3QG1A 3VUBA 5GMKm 4GY5A 4PL6A 2DMOA 3C12A 3QYHB 1VQ7Q 2YRCA 3P8BB 4J9IA 4WCIA 3FLGA 1LCKA 4ESRA 3CC7A 4B9WA 4PJOD 1S72A 3H0FA 2DL7A 4M77G 4C0GA 3ASKA 1M9SA 1FWZA 2HMAA 5GAOn 1BI1A 5LJ3f 1KQ1A 3CC4A 4C0ZA 5CK9A 3JCMb 1KFZA 1NEBA 4PJOF 5CKHA 2V1RA 4JJDA 2CP7A 2DRMA 1LNXA 2J6OA 5GMKl 2EFIA 4E7KA 2VVKA 2RMOA 1WHKA 2YT6A 4A63B 1IREB 4OMFB 3CCLA 3O5ZA 3RERA 3GPLA 3LGFA 3ZFJA 3QPHA 1R8OB 4M7DE 1Q95G 3SWNB 1G5VA 2EW3A 5GMKi 4F16A 4ZTFA 3M0RA 3OYYA 3QBYA 3MKDA 1ZSZB 3JCMg 2Y4YA 2K6DA 3CC7Q 2XICA 2DTIA 3MEWA 1YWPA 2MMPA 2GF7A 2FPEA 3VS4A 5J39A 2OTJA 2FEIA 3OS0A 5GAOp 4F7UA 2OTLT 4BDYA 3MEVA 1PRMC 4KGXB 2EPDA 3CQTA 2BZYA 1HYOA 4RMOA 4CRIA 2LJ3A 1RADB 3I9QA 2RI2A 3C0CA 1X2QA 1UB4A 4LDXA 1VQ4T 1Q82R 1UHCA 2LTOA 2F2VA 3I56A 3QZ9B 2LDMA 2P0QA 4OMLA 1ZUUA 5AT1B 5D6WA 3CCJQ 4ZTJA 3LH5A 3H9NA 4XTWA 2VC8A 1WHMA 3CC2A 2FYKA 3CPFA 3UA6A 2DD5A 1NPPA 1IHWA 1OOTA 2EGEA 2DNUA 2A0FB 1X27A 5KCOA 3VV0A 2SEMA 3CCSA 1M1KU 4M77B 5ECAA 5GAN6 5I11A 2EQKA 4IUPA 1RAHB 2QDLA 2X9HA 2G6FX 1Q7YU 1K73U 3NTKA 4A4KA 1WGSA 4BY6C 1MV0B 4BUGA 1ZSGA 3FRNA 3JCMf 2CZ1B 3OW2A 4E7HA 4NOYA 2KI7A 2CH4W 2JMAA 1LJOA 1T0JA 1C0MA 1TU0B 2OI3A 2DIQA 2ESWA 1JXMA 1ZSZA 2CT4A 1O75A 4QVZA 5FWCA 2EGAA 4M77C 1WYXA 3TVTA 2QEXQ 2QGGA 3VS0A 2V1QA 9ATCB 2MF2A 5CO7A 1UE9A 4N4HA 1G3WA 4HVUA 2COYA 4KT0E 4EMKC 2X4XA 2E5KA 1QLYA 2EYYA 4M77A 3GP8A 3MP1A 5LJ3g 1AD5A 1FYNA 2QA4Q 3SD4A 3PT9A 1UTIA 1ZUKA 4XTYA 1K73C 2GFAA 3G6EA 4BI3A 1RLPC 3UT1A 2PVDB 4RTTA 3G6ET 3CC4Q 1WHHA 4M78B 2EQJA 2PZ1A 1ZHIA 1OYXA 3OYGA 3G71Q 2M16A 3A1PA 4DEXA 3HFOA 4HKEA 5GAOl 3EG1A 2NYSA 4MDXA 2JN0A 2I2LA 2L5QA 4FU6A 4C5IA 3FC3A 4BE0A 2CP6A 1FX7A 2DFUA 3VYGA 2D0QB 1QKWA 2OAUA 5C0MA 2MPXC 4Q5WA 4JUVA 2ABLA 2ZPFB 3LGLA 1VYTA 2HKNA 4C0DB 4C92D 3CMAA 1D3BA 3EGDB 1ZX6A 2L89A 4JZ4A 1QWFA 1M90U 4ORZA 1IHVA 4E7JA 1UFFA 1GXIE 4QT7A 2ZZDA 2DZ9A 2P84A 2C0TA 1B3QA 2FB7A 2G3RA 2F2XA 1RLQC 1IGUA 1M2VA 1HD3A 2E64A 3REBB 1UUEA 4RG8A 4C0DC 1RAFB 2A3LA 2V8IA 5LJ5g 1PG5B 3JCMc 3EG9A 3NTHA 4RG2A 3VS7A 1PSFA 1K1ZA 2ROTA 3EG3A 4XU0A 2DVJA 3CEYA 2GCXA 1PM3A 3S3OA 2CSIA 4PNOA 3S3MA 1WXUA 2GGRA 5GJVB 1MV3A 3FIFA 4MZPA 3CCST 4JPBW 4Y91A 5FLXE 2KE9A 3JCMe 3OB9A 1VQMA 1QVGP 1LVKA 2O4XB 2R57A 4UC4A 1WQ7A 2MI6A 2BUDA 3OYBA 1VQKT 2FZCB 2P0PA 2AZSA 5FU6C 2M0YA 2Y4XA 2DRKA 4N4GA 1UGSB 4NL3A 3LYIA 1B34B 2F2WA 1X69A 1WI7A 1M1FA 3EAEA 3SEMA 3CCVQ 4PJLA 1Q86C 2ZAEA 2DTOA 5HK0A 4LUDA 2NUTA 1RAGB 1XTDA 3H6ZA 4FT2A 2RJCA 3V7SA 1UGVA 1NJIC 1I5OB 2H8HA 3I55Q 4NL2A 1M3BA 4M7AC 3G71T 2HSEB 2PQWA 4O5VA 1VQKQ 1VQ9T 3G6EQ 3MPUB 3CXCP 2JOYA 4M77F 4LDYA 1MMGA 4OGEA 1U8RA 4OMOA 3META 1GBRA 2KMTA 1W2BS 3SHWA 2E5QA 3OYIA 2DBMA 2BE7D 1VQMQ 2BZ8A 1H3ZA 1K8AU 2AKLA 2DZCA 4M78A 2B8AA 1VQOQ 2QEXA 3OS1A 1MHNA 2AZVA 1BI0A 3BDLA 1MNEA 1NLPC 3OBYA 4P5NA 2QEXT 2D0NA 5L23A 1AWWA 2FO0A 3HP9A 1Y57A 2OTJQ 2CUBA 2EJ9A 2RK1A 2V26A 1D0YA 1Y07A 1S72Q 4XK8E 4HCZA 2COZA 4OMMA 1KC8C 1PRLC 3CPWS 1JJ2S 3C95A 1QCFA 2LMJA 2RH2A 3MO8A 3L1AA 2R58A 2IVWA 3JCMQ 3M4GA 4C92C 4BY6B 2EQMA 4E7SA 1YJWT 4KUDK 3LX7A 1BKBA 4QQ6A 3AHUA 1B07A 1I5LA 1W6XA 4C5HA 1M30A 1H92A 4JLGA 2CKKA 1G3TA 2LQKA 1M2VB 2K4YA 2QYZA 2VV5A 4DBRA 4GLKA 3PIOA 1JJ2A 4KULA 2JTMA 2JNGA 1SRMA 2M51A 4ZN3A 4M7AG 2L8DA 1VQ8T 4QKUA 1K8AR 3CC2Q 5FWBA 2QXFA 2JM9A 2DXCA 1WJSA 2LNVA 5GAOq 2YDLA 4LUEA 1YHQA 5KYWA 3U23A 3JB9J 3E1SA 1X43A 2CP0A 4D6WA 3NPFA 4IIMA 4XTXA 3OMCA 3CCQQ 4J5YA 4F7UE 3TQ7P 1TOVA 5A0LA 1YJ9T 1WJQA 2RJFA 3JCMX 3CBPA 2XDDA 4JJNK 1YIJQ 1JBMA 2BTTA 4LDWA 1X75C 3CC2T 1IB8A 3OS2A 1W2BP 1XQHA 3OW2P 2YUPA 1GBQA 2V8KA 3FJPA 2QASA 1WIEA 3EG0A 1UDLA 4FM4B 1YCSB 4RCCA 1W2BA 3GF5A 2QTVA 3INZA 1VQPQ 5M9OA 1Q86R 3EFOA 2K3YA 2VKNA 5IHNA 3ULRB 3PE0A 2XKOC 3I5SA 1FXXA 1WQWA 1K0XA 1D0XA 3VRZA 5D7UA 2L3QA 3HRTA 2CT3A 3LH0A 3M54A 3QYGB 1WNLA 5LJ5d 2HQHA 2NUPA 2E65A 1YIJT 2DF6A 1VQOA 1VOMA 1PNJA 1CSKA 2QA4A 4QVCA 5GAN3 3QO3A 2CP3A 5HK3A 1Y7XA 5KYXB 3M0TA 1QVFS 1NZ9A 1BK2A 2MOXA 2D8HA 4PLLA 3I35A 2L2PA 4JS5A 1YP5A 4J7IA 1JJ2P 4DBFA 1YWOA 4BI4A 2GFUA 3TEEA 2QQBA 1TUGB 3A8MB 3CCMT 4A54A 3CCMA 1KC8R 2CZ7B 2ECZA 2CSQA 2NWMA 2QQAA 4OP0A 2RNAA 3JB9H 1H8KA 1VA7A 2J6KA 2LVMA 4J8OA 2NUPB 5GAMh 3FDRA 3MP6A 2VB6A 3WVDB 5CAIA 1LPLA 2QQSA 4FYYB 2E1HA 1UECA 1TS9A 1VQLT 1CKAA 3OSSC 1NJIU 4J9CA 5GMKe 1YJWA 2CS7A 5GAOm 3EFOB 1ZBXA 5GANd 1W70A 4C5EA 1U06A 2CDTA 5IN1A 1EZZB 4FT4A 3SFMA 2VUBA 5KYNA 2DL3A 4JS4A 2QDYB 4RTWA 1JXOA 2DL8A 5A2QE 2XG8D 4KGZB 2OTJT 3EH1A 3CPWA 2K7AA 3OYNA 1JRIA 3KUFA 4OB3B 4BACA 3L2ZA 2MWOA 3L2WA 3WVEB 3CMAT 5I2MA 2GNCA 1FMWA 3E2UA 3QSUA 4CC7A 3PTAA 2X3XD 3SB2A 1HJDA 2JT4A 1G3YA 8AT1B 2GTJA 1SSHA 5CKFA 4M7DF 1H641 4M75E 2LCCA 1D09B 1GFCA 4ME7A 2KXDA 1YNZA 2X4JA 3TU4K 3EGXA 1V1CA 4M75G 3MJXA 1AZEA 2ZGWA 3BW1A 1UJ0A 3NTIA 1SSFA 5HKCA 1JO8A 1SRLA 4C8QG 4C8QB 3QJ6A 1VQ4A 3QXEB 3HSBA 3MCAB 3V8JA 3CCUT 1Q81C 3Q1JA 4HCCA 5D6YA 3L42A 4HT9A 3JAME 3RIRA 1S1NA 2DLPA 3CMAQ 1VQ4Q 1HSQA 3V8KA 1OPKA 2IG0A 1AWJA 2LC4A 3H41A 3QIIA 5CIUA 2JVVA 2BE9B 3IQLA 4FSXA 2X4WA 3BDUA 4ZGEB 4Z8AA 3A98A 5C6SA 3ZBDA 4Y28E 3DLMA 1PD1A 3JB9G 1N8RR 4MZMA 1VQ5T 4QW2A 4QQDA 1Q81R 1X01A 4ANJA 3JCMJ 5KE2A 3NMZC 3S6WA 4HVWA 4B9XA 4TVRA 1IZ6A 2D1XA 3P8HA 4IUUA 2I0NA 1MNDA 1V29B 1RI0A 5GAN2 5CR2A 4J6WA 1MMDA 2EIFA 1YITA 2KBTA 3MHXA 3VS6A 1Y71A 4C92G 5GAN5 5KYUB 2KVQG 2ED0A 2C0OA 1A0NB 1X6GA 1TG0A 1PD0A 2A37A 3OYLA 8ATCB 1B7TA 3VU3C 5CKEA 1ARKA 4M7DA 1KJWA 2FPDA 4HVVA 2DK3A 4M7DB 1O9SA 3DB3A 2H3EB 2RF0A 4RTVA 3RKWA 2HL5C 3X20B 3CD6T 4KH0B 3UF4A 1QVFA 2IIMA 2A08A 2R5AA 2DYBA 2ED1A 3OYAA 3PFSA 3M57A 4L5GA 3PGGA 2VASA 1K9MR 2RD1A 3I55A 4F7UB 1WHGA 4RTXA 5J26A 4XAXB 1TXQA 3PMIA 2KXCA 3E9FA 2EBPA 3D7SB 1N6AA 2M0OA 2HBPA 4JDSA 1B34A 1BI3A 1YJWQ 3VKIA 1TUCA 3VS1A 2XIDA 3O8VA 2K3BA 1WXBA 2DL5A 4F04B 4BE1A 2LRQA 4PJNA 2HD0A 2QQRA 1UGQB 4D8KA 4EIKA 1KQSA 4A53A 3EHRA 4WTOB 1VQLQ 3CCUQ 1LOJA 1YHQT 3CCJA 2VWFA 1YI2T 4AG2C 5GAN7 3FEOA 3CMEQ 5I21A 1VQ8A 4BDZA 3QKJA 4M75B 5IHIA 1Y0MA 4JLIA 3JCMW 1XNIA 2W10A 1WA7A 1AVZC 1NM7A 2P4RA 3PMTA 5GAMe 5GAMj 1D3BB 3EGDA 1YJNT 4M78E 1GL5A 3OYMA 1OQKA 4M75D 1VQ8Q 2YHTA 2FVUA 2PNIA 3OYDA 2SRCA 1FMKA 4K11A 3LWHA 3TSZA 2AK5A 2DXTA 5FW9A 4LE9A 4XQ3A 1QVGS 3H8ZA 2HEQA 1E6GA 1QW1A 2WACA 4C5GA 3UA7A 2ZPIB 2CYZB 2QG9B 4E7IA 1OEBA 2HSPA 2YRDA 2X35A 1SF9A 3RDVA 1OULA 4BE2A 4M77E 3BE3A 4Z02A 1BYMA 1VQ9A 3EFSA 3S3NA 4RTYA 1ZSZC 3RBBB 1UHFA 3V7CA 4ZGDB 1X6BA 1GCQA 3QDFA 1S72T 4CI0C 1KIKA 2CZ6B 1HK9A 3RKXA 4A4EA 1VQ7A 2CREA 2K5LA 5L8RE 1M5Q1 2EKOA 4B6MA 2HDAA 1M1GA 4ZGJB 1OZ3A 1VQ5A 4EMKA 5KYUA 3F70A 4GLMA 3H0HA 1U3OA 2F5KA 5FRMA 2RN8A 3OW2S 4C92E 4FL6A 1NPRA 1WX6A 3FJ5A 2M02A 3X24B 3OYFA 3OYKA 4DQ2A 2O01E 3HL8A 1OZ2A 4M7AA 2O4XA 2QI2A 2XD0A 4MMLA 4J9GA 3J7AF 2RQUA 4C92A 1RI9A 1R77A 4IUTA 3PNWC 4MZTA 4AFSC 2DETA 1W4SA 1WXTA 2DERA 3RR6A 3L2UA 4M7AD 5GAN8 3EGUA 2QAZA 2E6ZA 4AFUC 1JEGA 3KBGA 2GTOA 1QWEA 2KRMA 1SHFA 3JCMP 1KG1A 1M3AA 2KQWA 1JU5C 4AT1B 1N9SA 2OJ2A 4J9FA 1XJWB 1I0CA 2HCKA 3KXTA 4FYVB 4X9DA 3BFMA 4HA8A 3CD6A 3QHSA 3GNGA 2DBKA 2O9SA 3EG2A 1WPYA 2YSQA 4OVAA 3L2RA 3LLRA 1QCNA 2MAMA 4YTLA 2E3IA 3J80E 2E12A 1Z9QA 1E6HA 3GOXA 2PVGB 4VUBA 3V7RA 1HXDA 1UGRB 3G7ZA 2LX9A 2ZPGB 1ZLMA 1QQJA 3M0UA 2X3WD 5LJ5e 1M27C 5GANe 2DEUA 2EKHA 5IAYA 4M78F 3UPUA 3HPWA 1PWTA 1AWOA 1MMNA 2DX1A 2XDBA 2GQVA 4XU2A 3I56Q 2RK2A 3CCSQ 2PUOB 2FPFA 1KD1C 3CMEA 4R55A 4IUQA 1VQMT 2LQ8A 3OYHA 1VQNA 1Q86U 1VQ9Q 1M2OA 2RHIA 5GANf 3BY7A 3QJYA 2YUQA 4OF1A 2LP5A 4PK4A 1I07A 3GLXA 1K0SA 2JJ9A 2JTFA 4CC4B 4ELYC 1BIAA 4FSSA 3JV3A 1OU8A 3CBOA 2A7YA 2FL7A 1VQKA 4XTVA 4X1VA 5KYYB 5GJWB 2KT1A 2YXYA 3M9QA 2HQEA 1ZA2B 4OMQA 4O6JA 2K2MA 1Q82U 3SWNA 5KYXA 5GMKh 2LJ1A 2C0IA 4XU1A 4OMPA 3NFCA 6AT1B 1AT1B 1VQ7T 4DOWA 4M78C 3PIPA 3CC7T 1KSWA 2F5TX 4DEYA 1KQ2A 3FB9A 1NG2A 3QWXX 2O9VA 3G4SQ 1Z9ZA 1EFNA 2FG0A 1RAAB 2DYIA 2KROA 3KFVA 2PUKB 5KYYA 4N4IA 4Y92A 2XI9A 2HAXA 3V8LA 1VQ6Q 3QDRB 4KUIA 1IRXA 4C8QA 2CUDA 4CC2A 2CH4A 2BKDN 4QVDA 3H0IA 2MYSA 3G1JA 2WSFE 1DJ7B 4C92F 2M1HA 4J6YA 5LJ5j 1JB0E 2LCSA 4M7AE 2VGNA 4C8QC 3CC4T 4LDVA 1AWXA 2MIOA 1TH7A 3QWYA 4RCBA 2ZPBB 1VQ6T 3A8HB 2EQUA 4LDUA 2VXEA 1KC8U 1KD1R 4QQGA 4FYXB 4N0AA 4JRKA 2KSSA 1FMVA 3JB9I 1OI1A 5KH6A 1OX9A 1VYVA 5DY9A 4BI8B 3OQ5A 3I55T 5LJ5f 1TSFA 4M75C 4EMHA 4BD3A 4AFQC 2K79A 5EC7A 2WSEE 1RUWA 1QCOA 4M75A 4J7FA 2KYBA 4F7UG 4WF2A 1U5SA 2L3RA 2JM8A 1Q82C 3M0QA 3DKMA 5J3BA 3X26B 1K9AA 4E6RA 4XTZA 5CQYA 1ZUYA 3TCJA 2HQXA 3RUXA 1NYFA 1VQNQ 3JB9D 1OPLA 5FU7C 4M7DG 3HFNA 1WDXA 2KRNA 1WJRA 1M4ZA 2AT1B 2EQIA 1CKBA 2B86A 4HCKA 1K76A 3OY9A 4LN2A 2DKGA 4PJMA 2P0KA 3OYCA 5IXFA 4C8QF 4M77D 1WHLA 5I2SA 1VQNT 2FZGB 5IH2A 1BB9A 2P4TA 4JRIA 3T9NA 2V8JA 3UDCA 1YFNA 4C92B 5GAMd 4MDWA 3CMET 3LWIA 1EIFA 2RM4A 2KEAA 1WZOA 2M9UA 2R5MA 3M56A 1YJ9A 2HBWA 3G4ST 5DLOA 4IIOA 1EX4A 2RQTA 2L3SA 4Z89A 4EMKB 3EG9B 1AOJA 3CCQA 2D6FA 4FW2A 4AFZC 1Y96A 2YUOA 3OYJA 1SHGA 2F1LA 3OA6A 2PU9B 2F69A 3QZ5B 2QQ9A 3SDZA 4J9DA 4F17A 3E9GA 3WXMB 3CCVT 3CCVA 2IPOB 2RHUA 3MEUA 2DVEA 4RUGA 2JS2A 4F7UF 4AG1C 3NGPA 2YLBA 3OBWA 1XOVA 5I22A 5EG2A 1QP2A 2NUTB 2KNBB 1KHCA 1SPKA 4M78G 2OAWA 1N9RA 2KK4A 2X4YA 3CCLT 5LJ3e 5A0DA 2GQIA 3X28B 2QA4T 1K73R 4KGVB 4PJJA 5FROA 5GAMg 4OGCA 1YITT 1N5ZA 1Y96B 3ME9A 1W1FA 2K57A 1I81A 3VRYA 1PSEA 4E2FB 2KRSA 2FZKB 2LCLA 1NBEB 1NJIR 1VQ6A 3VUZA 3OYEA 5CVIA 3URGA 3RMSA 5GAOr 1VYUA 1D1CA 4X9CA 1U1TA 5IT9E 2A28A 1QP3A 1KD1U 5GMKj 4R0KA 1QMCA 4KBMB 2XHCA 3RNJA 2Z0WA 3EHQA 4HXJA 4R56A 4J9BA 2DJZA 1WHJA 2HZYA 1UEBA 2FRWA 4E7LA 3JSCA 1KQSP 1X2KA 2CGHA 2MK5A 3I5RA 3CCRT 4ZNXA 1G8XA 2CP5A 4JRPA 3OS5A 2E10A 4A4GA 3CCET 5LJ5h 4J9HA 1G83A 1WLPB 1N8RC 2A36A 3ZL7C 4II1A 1ZQ1A 4OMNA 4LD9K 1NYGA 3CCQT 2DEQA 2WSCE 2XDPA 3GIBA 4EDUA 2KAFA 2ZPEB 3M59A 4CC3A 2C06A 3EFRA 2LQNA 3P8DA 3DLLA 1TWBA 1PHTA 3JCMV 2GBQA 1U1SA 1D0ZA 3HRSA 1H3HA 2Y90A 1YJNQ 4C8QE 1R0CB 3M58A 1M90R 3QUIA 3SWNC 1UG1A 1YHQQ 4JZ3A 1IXDA 2EYXA 2DD4A 1NLOC 1YJNA 2RJDA 5AYFA 1M8MA 4IKFA 1YI2Q 1D1BA 2DM1A 2OTLQ 3CCEQ 1C1AA 2RQVA 4RTZA 2DPPB 1UGPB 3TREA 2E41A 1VQPT 4J9EA 2O2OA 2ZPHB 4DBQA 3THKA 3OSVA 3G4SA 4BB7A 3AT1B 4D8DA 1VUBA 1T3SA 2LQWA 2KR3A 1X6OA 2KGTA 2YUNA 2O31A 2KT8A 4M7DC 2E70A 1IGQA 4MMKA 4FIBA 1QKXA 1R0BG 4HT8A 4NS5A 2EYWA 2E4HA 1ZBJA 3M55A 1BCMA 2DAQA 1AHJB 2DL4A 1PC0A 2XMFA 1RAEB 2K3XA 2XK0A 3GNFB 3M5AA 4M4ZA 4XTUA 2K9GA 3HRUA 2PTKA 2DA9A 1NE8A 1GCQC 3VYHB 1BBZA 3CCMQ 3G71A 2E6NA 3CPWP 2CZ0B 1Q81U 4PJOA 1I1JA 2J7IA 4X34A 4OB2B 1UJYA 3JB9F 1YITQ 2DIGA 4M7AB 4IUVA 4PLIA 2QTXA 3EGXB 5IHKA 2KY9A 3A8OB 4RTUA 3M4YA 2K2VA 5FRNA 5CCAA 3CCLQ 4L59A 5GAN4 1Q7YR 2MWPA 1ZA1B 4F14A 3L2QA 2NUZA 1T3LA 5CQXA 5D6XA 1YBYA 2AIRB 1VQLA 5DM7R 2NLUA 2RB6A 3CXCA 4M75F 4EPCA 1PKSA 1I8FA 1MMAA 2D8JA 2JXBA 1SEMA 1VIFA 1IO6A 4EMGA 1TUDA 1QVGA 4C0FA 2J06A 2K5FA 4PKCC 2JTEA 3CCRA 2EYZA 7AT1B 1E7OA 3LW5E 2YRVA 3A8LB 2EGCA 3CBMA 1MGQA 2J05A 2RI3A 3HTRA 1WFWA 1D1AA 3C94A 4C8QD 5KYWB 1KK7A 2YLCA 2EJGA 1PCXA 3OMGA 2FHDA 3R6OA 4JJBA 2EJFA 5LL6S 2RPNA 3UWNA
chains in the Genus database with same CATH topology
1WHGA 1WHLA 2M02A 3E2UA 1WHKA 2MPXC 1WHHA 2COZA 1TXQA 2COYA 2CP5A 2HKNA 2E3HA 2CP2A 2HL3A 2HKQB 2CP0A 2HL5C 4B6MA 1LPLA 2HQHA 2QK0A 3RDVA 2Z0WA 2E4HA 2E3IA 2COWA 3TQ7P 1TOVA 1WHMA 2CP7A 2CP6A 1IXDA 1WHJA 2CP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHG A;  1WHL A;  2M02 A;  3E2U A;  1WHK A;  2MPX C;  1WHH A;  2COZ A;  1TXQ A;  2COY A;  2CP5 A;  2HKN A;  2E3H A;  2CP2 A;  2HL3 A;  2HKQ B;  2CP0 A;  2HL5 C;  4B6M A;  1LPL A;  2HQH A;  2QK0 A;  3RDV A;  2Z0W A;  2E4H A;  2E3I A;  2COW A;  3TQ7 P;  1TOV A;  1WHM A;  2CP7 A;  2CP6 A;  1IXD A;  1WHJ A;  2CP3 A; 
#chains in the Genus database with same CATH topology
 3CCU A;  1KHI A;  3HHT B;  4L6V 5;  2RQR A;  4E7Z A;  1M90 C;  4PJO B;  2JW4 A;  2MCN A;  4PFP A;  2LJ0 A;  3EH2 A;  1BU1 A;  2PVO B;  3R6N A;  2DXU A;  1GRI A;  2RQW A;  4JJC A;  4DA4 A;  1C6V X;  4LNP A;  2EWN A;  1M1K C;  2VXF A;  5LJ3 h;  1VQ5 Q;  2ENM A;  4PFO A;  1QVF P;  2E3H A;  3E19 A;  1SKU B;  1OV3 A;  2FRY A;  1YIJ A;  3DB4 A;  2AKK A;  2ROL A;  1G3S A;  2O88 A;  3CXC S;  1OU9 A;  3PVQ A;  2EAY A;  1J3T A;  4DBH A;  2EVR A;  2K5I A;  1G2B A;  2LT1 A;  1ABO A;  2DXB A;  2LNH B;  2EYQ A;  1GCP A;  4GBQ A;  2JUF A;  2DTH A;  2HKQ B;  3VS2 A;  1JQQ A;  2RHZ A;  1TTH B;  4DOV A;  1YJ9 Q;  4HCB A;  4ELZ C;  3TSW A;  1VQO T;  2JS0 A;  2L3P A;  1ACM B;  4PJO E;  4A4F A;  1N8R U;  4JRQ A;  3M0P A;  1RAC B;  1M3C A;  1QVP A;  5GAN h;  2XU8 A;  4OB0 B;  4AMC A;  2QGF B;  3VJP A;  3UAT A;  1ABQ A;  2HL3 A;  2VYT A;  5HY6 A;  4PJO C;  4KRT A;  1F1B B;  2RA2 A;  2QK0 A;  3JCM d;  1M8V A;  4M7D D;  4N0A C;  5GAN g;  3NHN A;  1I4K 1;  1K9M U;  2BZX A;  3RES A;  3HKS A;  1MUZ A;  4J83 A;  4FW1 A;  2LZ6 B;  3MP8 A;  3CCR Q;  2VGM A;  1RAI B;  5LJ3 j;  4ZN1 A;  5CKB A;  2CP2 A;  2D9T A;  5FU7 B;  3PVL A;  3REA B;  1K4U S;  1T0H A;  1P92 A;  1NEG A;  4J6X A;  1V76 A;  1M1K R;  2DE0 X;  1N27 A;  2L0A A;  2X51 A;  4OB1 B;  5KCH A;  3MEA A;  4KH1 B;  2RO0 A;  4LXC A;  3L2V A;  3ER0 A;  5HCK A;  3VS3 A;  4V2S A;  3VS5 A;  2RI5 A;  5KE3 A;  2RHX A;  1GFD A;  1VIE A;  3GBQ A;  1KQS S;  4PJO G;  4Z88 A;  5FU6 B;  4M7A F;  4FCY A;  2COW A;  2ZCF B;  3CD6 Q;  1SG5 A;  4ATO A;  1RL2 A;  3A8G B;  3I56 T;  2DO3 A;  3M0S A;  3CCJ T;  1BCO A;  2LX7 A;  1BIB A;  2RHY A;  1YI2 A;  4FYW B;  3C4S A;  3A5Z B;  2W0Z A;  5GAN j;  3CCE A;  3N5B B;  5CKD A;  4XU3 A;  4RKU E;  5LJ3 d;  1Q7Y C;  3M53 A;  2JMC A;  3RMQ A;  3JCM h;  3X25 B;  2OTL A;  2YWW A;  2HNI A;  1YN8 A;  5DLQ E;  2DIL A;  2BIV A;  2DJQ A;  3J81 E;  1RAB B;  2KYM A;  4IUR A;  2ATC B;  1K8A C;  4M78 D;  4E47 A;  3JRZ A;  3ZEH A;  1PKT A;  2J6F A;  4A4H A;  1BI2 A;  1VQP A;  2OX7 A;  5A0G A;  5IXB A;  2KDS A;  3RKY A;  1OX8 A;  4PFZ A;  1AEY A;  2H3J A;  5GAM f;  2JZ2 A;  1K9M C;  4LD6 A;  2LT4 A;  2AHJ B;  1AZG B;  1YCY A;  2RJE A;  3QG1 A;  3VUB A;  5GMK m;  4GY5 A;  4PL6 A;  2DMO A;  3C12 A;  3QYH B;  1VQ7 Q;  2YRC A;  3P8B B;  4J9I A;  4WCI A;  3FLG A;  1LCK A;  4ESR A;  3CC7 A;  4B9W A;  4PJO D;  1S72 A;  3H0F A;  2DL7 A;  4M77 G;  4C0G A;  3ASK A;  1M9S A;  1FWZ A;  2HMA A;  5GAO n;  1BI1 A;  5LJ3 f;  1KQ1 A;  3CC4 A;  4C0Z A;  5CK9 A;  3JCM b;  1KFZ A;  1NEB A;  4PJO F;  5CKH A;  2V1R A;  4JJD A;  2CP7 A;  2DRM A;  1LNX A;  2J6O A;  5GMK l;  2EFI A;  4E7K A;  2VVK A;  2RMO A;  1WHK A;  2YT6 A;  4A63 B;  1IRE B;  4OMF B;  3CCL A;  3O5Z A;  3RER A;  3GPL A;  3LGF A;  3ZFJ A;  3QPH A;  1R8O B;  4M7D E;  1Q95 G;  3SWN B;  1G5V A;  2EW3 A;  5GMK i;  4F16 A;  4ZTF A;  3M0R A;  3OYY A;  3QBY A;  3MKD A;  1ZSZ B;  3JCM g;  2Y4Y A;  2K6D A;  3CC7 Q;  2XIC A;  2DTI A;  3MEW A;  1YWP A;  2MMP A;  2GF7 A;  2FPE A;  3VS4 A;  5J39 A;  2OTJ A;  2FEI A;  3OS0 A;  5GAO p;  4F7U A;  2OTL T;  4BDY A;  3MEV A;  1PRM C;  4KGX B;  2EPD A;  3CQT A;  2BZY A;  1HYO A;  4RMO A;  4CRI A;  2LJ3 A;  1RAD B;  3I9Q A;  2RI2 A;  3C0C A;  1X2Q A;  1UB4 A;  4LDX A;  1VQ4 T;  1Q82 R;  1UHC A;  2LTO A;  2F2V A;  3I56 A;  3QZ9 B;  2LDM A;  2P0Q A;  4OML A;  1ZUU A;  5AT1 B;  5D6W A;  3CCJ Q;  4ZTJ A;  3LH5 A;  3H9N A;  4XTW A;  2VC8 A;  1WHM A;  3CC2 A;  2FYK A;  3CPF A;  3UA6 A;  2DD5 A;  1NPP A;  1IHW A;  1OOT A;  2EGE A;  2DNU A;  2A0F B;  1X27 A;  5KCO A;  3VV0 A;  2SEM A;  3CCS A;  1M1K U;  4M77 B;  5ECA A;  5GAN 6;  5I11 A;  2EQK A;  4IUP A;  1RAH B;  2QDL A;  2X9H A;  2G6F X;  1Q7Y U;  1K73 U;  3NTK A;  4A4K A;  1WGS A;  4BY6 C;  1MV0 B;  4BUG A;  1ZSG A;  3FRN A;  3JCM f;  2CZ1 B;  3OW2 A;  4E7H A;  4NOY A;  2KI7 A;  2CH4 W;  2JMA A;  1LJO A;  1T0J A;  1C0M A;  1TU0 B;  2OI3 A;  2DIQ A;  2ESW A;  1JXM A;  1ZSZ A;  2CT4 A;  1O75 A;  4QVZ A;  5FWC A;  2EGA A;  4M77 C;  1WYX A;  3TVT A;  2QEX Q;  2QGG A;  3VS0 A;  2V1Q A;  9ATC B;  2MF2 A;  5CO7 A;  1UE9 A;  4N4H A;  1G3W A;  4HVU A;  2COY A;  4KT0 E;  4EMK C;  2X4X A;  2E5K A;  1QLY A;  2EYY A;  4M77 A;  3GP8 A;  3MP1 A;  5LJ3 g;  1AD5 A;  1FYN A;  2QA4 Q;  3SD4 A;  3PT9 A;  1UTI A;  1ZUK A;  4XTY A;  1K73 C;  2GFA A;  3G6E A;  4BI3 A;  1RLP C;  3UT1 A;  2PVD B;  4RTT A;  3G6E T;  3CC4 Q;  1WHH A;  4M78 B;  2EQJ A;  2PZ1 A;  1ZHI A;  1OYX A;  3OYG A;  3G71 Q;  2M16 A;  3A1P A;  4DEX A;  3HFO A;  4HKE A;  5GAO l;  3EG1 A;  2NYS A;  4MDX A;  2JN0 A;  2I2L A;  2L5Q A;  4FU6 A;  4C5I A;  3FC3 A;  4BE0 A;  2CP6 A;  1FX7 A;  2DFU A;  3VYG A;  2D0Q B;  1QKW A;  2OAU A;  5C0M A;  2MPX C;  4Q5W A;  4JUV A;  2ABL A;  2ZPF B;  3LGL A;  1VYT A;  2HKN A;  4C0D B;  4C92 D;  3CMA A;  1D3B A;  3EGD B;  1ZX6 A;  2L89 A;  4JZ4 A;  1QWF A;  1M90 U;  4ORZ A;  1IHV A;  4E7J A;  1UFF A;  1GXI E;  4QT7 A;  2ZZD A;  2DZ9 A;  2P84 A;  2C0T A;  1B3Q A;  2FB7 A;  2G3R A;  2F2X A;  1RLQ C;  1IGU A;  1M2V A;  1HD3 A;  2E64 A;  3REB B;  1UUE A;  4RG8 A;  4C0D C;  1RAF B;  2A3L A;  2V8I A;  5LJ5 g;  1PG5 B;  3JCM c;  3EG9 A;  3NTH A;  4RG2 A;  3VS7 A;  1PSF A;  1K1Z A;  2ROT A;  3EG3 A;  4XU0 A;  2DVJ A;  3CEY A;  2GCX A;  1PM3 A;  3S3O A;  2CSI A;  4PNO A;  3S3M A;  1WXU A;  2GGR A;  5GJV B;  1MV3 A;  3FIF A;  4MZP A;  3CCS T;  4JPB W;  4Y91 A;  5FLX E;  2KE9 A;  3JCM e;  3OB9 A;  1VQM A;  1QVG P;  1LVK A;  2O4X B;  2R57 A;  4UC4 A;  1WQ7 A;  2MI6 A;  2BUD A;  3OYB A;  1VQK T;  2FZC B;  2P0P A;  2AZS A;  5FU6 C;  2M0Y A;  2Y4X A;  2DRK A;  4N4G A;  1UGS B;  4NL3 A;  3LYI A;  1B34 B;  2F2W A;  1X69 A;  1WI7 A;  1M1F A;  3EAE A;  3SEM A;  3CCV Q;  4PJL A;  1Q86 C;  2ZAE A;  2DTO A;  5HK0 A;  4LUD A;  2NUT A;  1RAG B;  1XTD A;  3H6Z A;  4FT2 A;  2RJC A;  3V7S A;  1UGV A;  1NJI C;  1I5O B;  2H8H A;  3I55 Q;  4NL2 A;  1M3B A;  4M7A C;  3G71 T;  2HSE B;  2PQW A;  4O5V A;  1VQK Q;  1VQ9 T;  3G6E Q;  3MPU B;  3CXC P;  2JOY A;  4M77 F;  4LDY A;  1MMG A;  4OGE A;  1U8R A;  4OMO A;  3MET A;  1GBR A;  2KMT A;  1W2B S;  3SHW A;  2E5Q A;  3OYI A;  2DBM A;  2BE7 D;  1VQM Q;  2BZ8 A;  1H3Z A;  1K8A U;  2AKL A;  2DZC A;  4M78 A;  2B8A A;  1VQO Q;  2QEX A;  3OS1 A;  1MHN A;  2AZV A;  1BI0 A;  3BDL A;  1MNE A;  1NLP C;  3OBY A;  4P5N A;  2QEX T;  2D0N A;  5L23 A;  1AWW A;  2FO0 A;  3HP9 A;  1Y57 A;  2OTJ Q;  2CUB A;  2EJ9 A;  2RK1 A;  2V26 A;  1D0Y A;  1Y07 A;  1S72 Q;  4XK8 E;  4HCZ A;  2COZ A;  4OMM A;  1KC8 C;  1PRL C;  3CPW S;  1JJ2 S;  3C95 A;  1QCF A;  2LMJ A;  2RH2 A;  3MO8 A;  3L1A A;  2R58 A;  2IVW A;  3JCM Q;  3M4G A;  4C92 C;  4BY6 B;  2EQM A;  4E7S A;  1YJW T;  4KUD K;  3LX7 A;  1BKB A;  4QQ6 A;  3AHU A;  1B07 A;  1I5L A;  1W6X A;  4C5H A;  1M30 A;  1H92 A;  4JLG A;  2CKK A;  1G3T A;  2LQK A;  1M2V B;  2K4Y A;  2QYZ A;  2VV5 A;  4DBR A;  4GLK A;  3PIO A;  1JJ2 A;  4KUL A;  2JTM A;  2JNG A;  1SRM A;  2M51 A;  4ZN3 A;  4M7A G;  2L8D A;  1VQ8 T;  4QKU A;  1K8A R;  3CC2 Q;  5FWB A;  2QXF A;  2JM9 A;  2DXC A;  1WJS A;  2LNV A;  5GAO q;  2YDL A;  4LUE A;  1YHQ A;  5KYW A;  3U23 A;  3JB9 J;  3E1S A;  1X43 A;  2CP0 A;  4D6W A;  3NPF A;  4IIM A;  4XTX A;  3OMC A;  3CCQ Q;  4J5Y A;  4F7U E;  3TQ7 P;  1TOV A;  5A0L A;  1YJ9 T;  1WJQ A;  2RJF A;  3JCM X;  3CBP A;  2XDD A;  4JJN K;  1YIJ Q;  1JBM A;  2BTT A;  4LDW A;  1X75 C;  3CC2 T;  1IB8 A;  3OS2 A;  1W2B P;  1XQH A;  3OW2 P;  2YUP A;  1GBQ A;  2V8K A;  3FJP A;  2QAS A;  1WIE A;  3EG0 A;  1UDL A;  4FM4 B;  1YCS B;  4RCC A;  1W2B A;  3GF5 A;  2QTV A;  3INZ A;  1VQP Q;  5M9O A;  1Q86 R;  3EFO A;  2K3Y A;  2VKN A;  5IHN A;  3ULR B;  3PE0 A;  2XKO C;  3I5S A;  1FXX A;  1WQW A;  1K0X A;  1D0X A;  3VRZ A;  5D7U A;  2L3Q A;  3HRT A;  2CT3 A;  3LH0 A;  3M54 A;  3QYG B;  1WNL A;  5LJ5 d;  2HQH A;  2NUP A;  2E65 A;  1YIJ T;  2DF6 A;  1VQO A;  1VOM A;  1PNJ A;  1CSK A;  2QA4 A;  4QVC A;  5GAN 3;  3QO3 A;  2CP3 A;  5HK3 A;  1Y7X A;  5KYX B;  3M0T A;  1QVF S;  1NZ9 A;  1BK2 A;  2MOX A;  2D8H A;  4PLL A;  3I35 A;  2L2P A;  4JS5 A;  1YP5 A;  4J7I A;  1JJ2 P;  4DBF A;  1YWO A;  4BI4 A;  2GFU A;  3TEE A;  2QQB A;  1TUG B;  3A8M B;  3CCM T;  4A54 A;  3CCM A;  1KC8 R;  2CZ7 B;  2ECZ A;  2CSQ A;  2NWM A;  2QQA A;  4OP0 A;  2RNA A;  3JB9 H;  1H8K A;  1VA7 A;  2J6K A;  2LVM A;  4J8O A;  2NUP B;  5GAM h;  3FDR A;  3MP6 A;  2VB6 A;  3WVD B;  5CAI A;  1LPL A;  2QQS A;  4FYY B;  2E1H A;  1UEC A;  1TS9 A;  1VQL T;  1CKA A;  3OSS C;  1NJI U;  4J9C A;  5GMK e;  1YJW A;  2CS7 A;  5GAO m;  3EFO B;  1ZBX A;  5GAN d;  1W70 A;  4C5E A;  1U06 A;  2CDT A;  5IN1 A;  1EZZ B;  4FT4 A;  3SFM A;  2VUB A;  5KYN A;  2DL3 A;  4JS4 A;  2QDY B;  4RTW A;  1JXO A;  2DL8 A;  5A2Q E;  2XG8 D;  4KGZ B;  2OTJ T;  3EH1 A;  3CPW A;  2K7A A;  3OYN A;  1JRI A;  3KUF A;  4OB3 B;  4BAC A;  3L2Z A;  2MWO A;  3L2W A;  3WVE B;  3CMA T;  5I2M A;  2GNC A;  1FMW A;  3E2U A;  3QSU A;  4CC7 A;  3PTA A;  2X3X D;  3SB2 A;  1HJD A;  2JT4 A;  1G3Y A;  8AT1 B;  2GTJ A;  1SSH A;  5CKF A;  4M7D F;  1H64 1;  4M75 E;  2LCC A;  1D09 B;  1GFC A;  4ME7 A;  2KXD A;  1YNZ A;  2X4J A;  3TU4 K;  3EGX A;  1V1C A;  4M75 G;  3MJX A;  1AZE A;  2ZGW A;  3BW1 A;  1UJ0 A;  3NTI A;  1SSF A;  5HKC A;  1JO8 A;  1SRL A;  4C8Q G;  4C8Q B;  3QJ6 A;  1VQ4 A;  3QXE B;  3HSB A;  3MCA B;  3V8J A;  3CCU T;  1Q81 C;  3Q1J A;  4HCC A;  5D6Y A;  3L42 A;  4HT9 A;  3JAM E;  3RIR A;  1S1N A;  2DLP A;  3CMA Q;  1VQ4 Q;  1HSQ A;  3V8K A;  1OPK A;  2IG0 A;  1AWJ A;  2LC4 A;  3H41 A;  3QII A;  5CIU A;  2JVV A;  2BE9 B;  3IQL A;  4FSX A;  2X4W A;  3BDU A;  4ZGE B;  4Z8A A;  3A98 A;  5C6S A;  3ZBD A;  4Y28 E;  3DLM A;  1PD1 A;  3JB9 G;  1N8R R;  4MZM A;  1VQ5 T;  4QW2 A;  4QQD A;  1Q81 R;  1X01 A;  4ANJ A;  3JCM J;  5KE2 A;  3NMZ C;  3S6W A;  4HVW A;  4B9X A;  4TVR A;  1IZ6 A;  2D1X A;  3P8H A;  4IUU A;  2I0N A;  1MND A;  1V29 B;  1RI0 A;  5GAN 2;  5CR2 A;  4J6W A;  1MMD A;  2EIF A;  1YIT A;  2KBT A;  3MHX A;  3VS6 A;  1Y71 A;  4C92 G;  5GAN 5;  5KYU B;  2KVQ G;  2ED0 A;  2C0O A;  1A0N B;  1X6G A;  1TG0 A;  1PD0 A;  2A37 A;  3OYL A;  8ATC B;  1B7T A;  3VU3 C;  5CKE A;  1ARK A;  4M7D A;  1KJW A;  2FPD A;  4HVV A;  2DK3 A;  4M7D B;  1O9S A;  3DB3 A;  2H3E B;  2RF0 A;  4RTV A;  3RKW A;  2HL5 C;  3X20 B;  3CD6 T;  4KH0 B;  3UF4 A;  1QVF A;  2IIM A;  2A08 A;  2R5A A;  2DYB A;  2ED1 A;  3OYA A;  3PFS A;  3M57 A;  4L5G A;  3PGG A;  2VAS A;  1K9M R;  2RD1 A;  3I55 A;  4F7U B;  1WHG A;  4RTX A;  5J26 A;  4XAX B;  1TXQ A;  3PMI A;  2KXC A;  3E9F A;  2EBP A;  3D7S B;  1N6A A;  2M0O A;  2HBP A;  4JDS A;  1B34 A;  1BI3 A;  1YJW Q;  3VKI A;  1TUC A;  3VS1 A;  2XID A;  3O8V A;  2K3B A;  1WXB A;  2DL5 A;  4F04 B;  4BE1 A;  2LRQ A;  4PJN A;  2HD0 A;  2QQR A;  1UGQ B;  4D8K A;  4EIK A;  1KQS A;  4A53 A;  3EHR A;  4WTO B;  1VQL Q;  3CCU Q;  1LOJ A;  1YHQ T;  3CCJ A;  2VWF A;  1YI2 T;  4AG2 C;  5GAN 7;  3FEO A;  3CME Q;  5I21 A;  1VQ8 A;  4BDZ A;  3QKJ A;  4M75 B;  5IHI A;  1Y0M A;  4JLI A;  3JCM W;  1XNI A;  2W10 A;  1WA7 A;  1AVZ C;  1NM7 A;  2P4R A;  3PMT A;  5GAM e;  5GAM j;  1D3B B;  3EGD A;  1YJN T;  4M78 E;  1GL5 A;  3OYM A;  1OQK A;  4M75 D;  1VQ8 Q;  2YHT A;  2FVU A;  2PNI A;  3OYD A;  2SRC A;  1FMK A;  4K11 A;  3LWH A;  3TSZ A;  2AK5 A;  2DXT A;  5FW9 A;  4LE9 A;  4XQ3 A;  1QVG S;  3H8Z A;  2HEQ A;  1E6G A;  1QW1 A;  2WAC A;  4C5G A;  3UA7 A;  2ZPI B;  2CYZ B;  2QG9 B;  4E7I A;  1OEB A;  2HSP A;  2YRD A;  2X35 A;  1SF9 A;  3RDV A;  1OUL A;  4BE2 A;  4M77 E;  3BE3 A;  4Z02 A;  1BYM A;  1VQ9 A;  3EFS A;  3S3N A;  4RTY A;  1ZSZ C;  3RBB B;  1UHF A;  3V7C A;  4ZGD B;  1X6B A;  1GCQ A;  3QDF A;  1S72 T;  4CI0 C;  1KIK A;  2CZ6 B;  1HK9 A;  3RKX A;  4A4E A;  1VQ7 A;  2CRE A;  2K5L A;  5L8R E;  1M5Q 1;  2EKO A;  4B6M A;  2HDA A;  1M1G A;  4ZGJ B;  1OZ3 A;  1VQ5 A;  4EMK A;  5KYU A;  3F70 A;  4GLM A;  3H0H A;  1U3O A;  2F5K A;  5FRM A;  2RN8 A;  3OW2 S;  4C92 E;  4FL6 A;  1NPR A;  1WX6 A;  3FJ5 A;  2M02 A;  3X24 B;  3OYF A;  3OYK A;  4DQ2 A;  2O01 E;  3HL8 A;  1OZ2 A;  4M7A A;  2O4X A;  2QI2 A;  2XD0 A;  4MML A;  4J9G A;  3J7A F;  2RQU A;  4C92 A;  1RI9 A;  1R77 A;  4IUT A;  3PNW C;  4MZT A;  4AFS C;  2DET A;  1W4S A;  1WXT A;  2DER A;  3RR6 A;  3L2U A;  4M7A D;  5GAN 8;  3EGU A;  2QAZ A;  2E6Z A;  4AFU C;  1JEG A;  3KBG A;  2GTO A;  1QWE A;  2KRM A;  1SHF A;  3JCM P;  1KG1 A;  1M3A A;  2KQW A;  1JU5 C;  4AT1 B;  1N9S A;  2OJ2 A;  4J9F A;  1XJW B;  1I0C A;  2HCK A;  3KXT A;  4FYV B;  4X9D A;  3BFM A;  4HA8 A;  3CD6 A;  3QHS A;  3GNG A;  2DBK A;  2O9S A;  3EG2 A;  1WPY A;  2YSQ A;  4OVA A;  3L2R A;  3LLR A;  1QCN A;  2MAM A;  4YTL A;  2E3I A;  3J80 E;  2E12 A;  1Z9Q A;  1E6H A;  3GOX A;  2PVG B;  4VUB A;  3V7R A;  1HXD A;  1UGR B;  3G7Z A;  2LX9 A;  2ZPG B;  1ZLM A;  1QQJ A;  3M0U A;  2X3W D;  5LJ5 e;  1M27 C;  5GAN e;  2DEU A;  2EKH A;  5IAY A;  4M78 F;  3UPU A;  3HPW A;  1PWT A;  1AWO A;  1MMN A;  2DX1 A;  2XDB A;  2GQV A;  4XU2 A;  3I56 Q;  2RK2 A;  3CCS Q;  2PUO B;  2FPF A;  1KD1 C;  3CME A;  4R55 A;  4IUQ A;  1VQM T;  2LQ8 A;  3OYH A;  1VQN A;  1Q86 U;  1VQ9 Q;  1M2O A;  2RHI A;  5GAN f;  3BY7 A;  3QJY A;  2YUQ A;  4OF1 A;  2LP5 A;  4PK4 A;  1I07 A;  3GLX A;  1K0S A;  2JJ9 A;  2JTF A;  4CC4 B;  4ELY C;  1BIA A;  4FSS A;  3JV3 A;  1OU8 A;  3CBO A;  2A7Y A;  2FL7 A;  1VQK A;  4XTV A;  4X1V A;  5KYY B;  5GJW B;  2KT1 A;  2YXY A;  3M9Q A;  2HQE A;  1ZA2 B;  4OMQ A;  4O6J A;  2K2M A;  1Q82 U;  3SWN A;  5KYX A;  5GMK h;  2LJ1 A;  2C0I A;  4XU1 A;  4OMP A;  3NFC A;  6AT1 B;  1AT1 B;  1VQ7 T;  4DOW A;  4M78 C;  3PIP A;  3CC7 T;  1KSW A;  2F5T X;  4DEY A;  1KQ2 A;  3FB9 A;  1NG2 A;  3QWX X;  2O9V A;  3G4S Q;  1Z9Z A;  1EFN A;  2FG0 A;  1RAA B;  2DYI A;  2KRO A;  3KFV A;  2PUK B;  5KYY A;  4N4I A;  4Y92 A;  2XI9 A;  2HAX A;  3V8L A;  1VQ6 Q;  3QDR B;  4KUI A;  1IRX A;  4C8Q A;  2CUD A;  4CC2 A;  2CH4 A;  2BKD N;  4QVD A;  3H0I A;  2MYS A;  3G1J A;  2WSF E;  1DJ7 B;  4C92 F;  2M1H A;  4J6Y A;  5LJ5 j;  1JB0 E;  2LCS A;  4M7A E;  2VGN A;  4C8Q C;  3CC4 T;  4LDV A;  1AWX A;  2MIO A;  1TH7 A;  3QWY A;  4RCB A;  2ZPB B;  1VQ6 T;  3A8H B;  2EQU A;  4LDU A;  2VXE A;  1KC8 U;  1KD1 R;  4QQG A;  4FYX B;  4N0A A;  4JRK A;  2KSS A;  1FMV A;  3JB9 I;  1OI1 A;  5KH6 A;  1OX9 A;  1VYV A;  5DY9 A;  4BI8 B;  3OQ5 A;  3I55 T;  5LJ5 f;  1TSF A;  4M75 C;  4EMH A;  4BD3 A;  4AFQ C;  2K79 A;  5EC7 A;  2WSE E;  1RUW A;  1QCO A;  4M75 A;  4J7F A;  2KYB A;  4F7U G;  4WF2 A;  1U5S A;  2L3R A;  2JM8 A;  1Q82 C;  3M0Q A;  3DKM A;  5J3B A;  3X26 B;  1K9A A;  4E6R A;  4XTZ A;  5CQY A;  1ZUY A;  3TCJ A;  2HQX A;  3RUX A;  1NYF A;  1VQN Q;  3JB9 D;  1OPL A;  5FU7 C;  4M7D G;  3HFN A;  1WDX A;  2KRN A;  1WJR A;  1M4Z A;  2AT1 B;  2EQI A;  1CKB A;  2B86 A;  4HCK A;  1K76 A;  3OY9 A;  4LN2 A;  2DKG A;  4PJM A;  2P0K A;  3OYC A;  5IXF A;  4C8Q F;  4M77 D;  1WHL A;  5I2S A;  1VQN T;  2FZG B;  5IH2 A;  1BB9 A;  2P4T A;  4JRI A;  3T9N A;  2V8J A;  3UDC A;  1YFN A;  4C92 B;  5GAM d;  4MDW A;  3CME T;  3LWI A;  1EIF A;  2RM4 A;  2KEA A;  1WZO A;  2M9U A;  2R5M A;  3M56 A;  1YJ9 A;  2HBW A;  3G4S T;  5DLO A;  4IIO A;  1EX4 A;  2RQT A;  2L3S A;  4Z89 A;  4EMK B;  3EG9 B;  1AOJ A;  3CCQ A;  2D6F A;  4FW2 A;  4AFZ C;  1Y96 A;  2YUO A;  3OYJ A;  1SHG A;  2F1L A;  3OA6 A;  2PU9 B;  2F69 A;  3QZ5 B;  2QQ9 A;  3SDZ A;  4J9D A;  4F17 A;  3E9G A;  3WXM B;  3CCV T;  3CCV A;  2IPO B;  2RHU A;  3MEU A;  2DVE A;  4RUG A;  2JS2 A;  4F7U F;  4AG1 C;  3NGP A;  2YLB A;  3OBW A;  1XOV A;  5I22 A;  5EG2 A;  1QP2 A;  2NUT B;  2KNB B;  1KHC A;  1SPK A;  4M78 G;  2OAW A;  1N9R A;  2KK4 A;  2X4Y A;  3CCL T;  5LJ3 e;  5A0D A;  2GQI A;  3X28 B;  2QA4 T;  1K73 R;  4KGV B;  4PJJ A;  5FRO A;  5GAM g;  4OGC A;  1YIT T;  1N5Z A;  1Y96 B;  3ME9 A;  1W1F A;  2K57 A;  1I81 A;  3VRY A;  1PSE A;  4E2F B;  2KRS A;  2FZK B;  2LCL A;  1NBE B;  1NJI R;  1VQ6 A;  3VUZ A;  3OYE A;  5CVI A;  3URG A;  3RMS A;  5GAO r;  1VYU A;  1D1C A;  4X9C A;  1U1T A;  5IT9 E;  2A28 A;  1QP3 A;  1KD1 U;  5GMK j;  4R0K A;  1QMC A;  4KBM B;  2XHC A;  3RNJ A;  2Z0W A;  3EHQ A;  4HXJ A;  4R56 A;  4J9B A;  2DJZ A;  1WHJ A;  2HZY A;  1UEB A;  2FRW A;  4E7L A;  3JSC A;  1KQS P;  1X2K A;  2CGH A;  2MK5 A;  3I5R A;  3CCR T;  4ZNX A;  1G8X A;  2CP5 A;  4JRP A;  3OS5 A;  2E10 A;  4A4G A;  3CCE T;  5LJ5 h;  4J9H A;  1G83 A;  1WLP B;  1N8R C;  2A36 A;  3ZL7 C;  4II1 A;  1ZQ1 A;  4OMN A;  4LD9 K;  1NYG A;  3CCQ T;  2DEQ A;  2WSC E;  2XDP A;  3GIB A;  4EDU A;  2KAF A;  2ZPE B;  3M59 A;  4CC3 A;  2C06 A;  3EFR A;  2LQN A;  3P8D A;  3DLL A;  1TWB A;  1PHT A;  3JCM V;  2GBQ A;  1U1S A;  1D0Z A;  3HRS A;  1H3H A;  2Y90 A;  1YJN Q;  4C8Q E;  1R0C B;  3M58 A;  1M90 R;  3QUI A;  3SWN C;  1UG1 A;  1YHQ Q;  4JZ3 A;  1IXD A;  2EYX A;  2DD4 A;  1NLO C;  1YJN A;  2RJD A;  5AYF A;  1M8M A;  4IKF A;  1YI2 Q;  1D1B A;  2DM1 A;  2OTL Q;  3CCE Q;  1C1A A;  2RQV A;  4RTZ A;  2DPP B;  1UGP B;  3TRE A;  2E41 A;  1VQP T;  4J9E A;  2O2O A;  2ZPH B;  4DBQ A;  3THK A;  3OSV A;  3G4S A;  4BB7 A;  3AT1 B;  4D8D A;  1VUB A;  1T3S A;  2LQW A;  2KR3 A;  1X6O A;  2KGT A;  2YUN A;  2O31 A;  2KT8 A;  4M7D C;  2E70 A;  1IGQ A;  4MMK A;  4FIB A;  1QKX A;  1R0B G;  4HT8 A;  4NS5 A;  2EYW A;  2E4H A;  1ZBJ A;  3M55 A;  1BCM A;  2DAQ A;  1AHJ B;  2DL4 A;  1PC0 A;  2XMF A;  1RAE B;  2K3X A;  2XK0 A;  3GNF B;  3M5A A;  4M4Z A;  4XTU A;  2K9G A;  3HRU A;  2PTK A;  2DA9 A;  1NE8 A;  1GCQ C;  3VYH B;  1BBZ A;  3CCM Q;  3G71 A;  2E6N A;  3CPW P;  2CZ0 B;  1Q81 U;  4PJO A;  1I1J A;  2J7I A;  4X34 A;  4OB2 B;  1UJY A;  3JB9 F;  1YIT Q;  2DIG A;  4M7A B;  4IUV A;  4PLI A;  2QTX A;  3EGX B;  5IHK A;  2KY9 A;  3A8O B;  4RTU A;  3M4Y A;  2K2V A;  5FRN A;  5CCA A;  3CCL Q;  4L59 A;  5GAN 4;  1Q7Y R;  2MWP A;  1ZA1 B;  4F14 A;  3L2Q A;  2NUZ A;  1T3L A;  5CQX A;  5D6X A;  1YBY A;  2AIR B;  1VQL A;  5DM7 R;  2NLU A;  2RB6 A;  3CXC A;  4M75 F;  4EPC A;  1PKS A;  1I8F A;  1MMA A;  2D8J A;  2JXB A;  1SEM A;  1VIF A;  1IO6 A;  4EMG A;  1TUD A;  1QVG A;  4C0F A;  2J06 A;  2K5F A;  4PKC C;  2JTE A;  3CCR A;  2EYZ A;  7AT1 B;  1E7O A;  3LW5 E;  2YRV A;  3A8L B;  2EGC A;  3CBM A;  1MGQ A;  2J05 A;  2RI3 A;  3HTR A;  1WFW A;  1D1A A;  3C94 A;  4C8Q D;  5KYW B;  1KK7 A;  2YLC A;  2EJG A;  1PCX A;  3OMG A;  2FHD A;  3R6O A;  4JJB A;  2EJF A;  5LL6 S;  2RPN A;  3UWN A; 
#chains in the Genus database with same CATH homology
 1WHG A;  1WHL A;  2M02 A;  3E2U A;  1WHK A;  2MPX C;  1WHH A;  2COZ A;  1TXQ A;  2COY A;  2CP5 A;  2HKN A;  2E3H A;  2CP2 A;  2HL3 A;  2HKQ B;  2CP0 A;  2HL5 C;  4B6M A;  1LPL A;  2HQH A;  2QK0 A;  3RDV A;  2Z0W A;  2E4H A;  2E3I A;  2COW A;  3TQ7 P;  1TOV A;  1WHM A;  2CP7 A;  2CP6 A;  1IXD A;  1WHJ A;  2CP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...