2COYA

Solution structure of the cap-gly domain in human dynactin 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
b'GSSGSSGMAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title Solution structure of the CAP-Gly domain in human Dynactin 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2coyA01
2COYA 2E4HA 2QK0A 3TQ7P 2M02A 1WHGA 2CP3A 2E3IA 2CP6A 2CP2A 1WHMA 3RDVA 2CP5A 2COZA 2COWA 3E2UA 1WHHA 1WHKA 1TOVA 1WHLA 2E3HA 2HKNA 4B6MA 1WHJA 2Z0WA 2MPXC 1TXQA 2HL3A 1IXDA 2CP0A 1LPLA 2CP7A 2HQHA 2HKQB 2HL5C
chains in the Genus database with same CATH superfamily
2X3WD 2DM1A 3H41A 4F17A 1VYVA 1FMKA 2DMOA 1K1ZA 1N27A 3UA7A 3I55T 4XQ3A 1JRIA 3PNWC 5GAN4 2LQWA 3PE0A 3FEOA 4CC4B 4DOWA 1PC0A 1XOVA 3QYHB 5FRMA 3BDLA 5GAN8 3QO3A 2DXUA 4C5GA 2VGNA 4CI0C 1VQ8T 5GMKi 1GXIE 1RACB 1AWJA 1UHFA 2AIRB 4M7AE 1FXXA 1G5VA 1YI2A 1AEYA 2RK1A 4RTZA 2DO3A 4B6MA 2MWPA 1X75C 1YJWQ 3M59A 5DLQE 2FG0A 2O2OA 4OB3B 1ZA1B 2E6ZA 1UGQB 2EVRA 3VKIA 4MZMA 3CCVT 2PVOB 3I9QA 1UJYA 5GAMj 1SRMA 1BIAA 1QW1A 1KHIA 5FWBA 3H8ZA 2VWFA 5IT9E 1JJ2P 2CH4A 3EH1A 2DEQA 4JRKA 5I2SA 3PMTA 5KE3A 1M1GA 4ZN3A 3LX7A 1T3SA 3OB9A 4F7UA 3RMQA 3OYMA 2MMPA 2XK0A 4PJOG 2DVEA 3QHSA 1W2BA 2HMAA 2HKQB 2LCSA 3MEAA 4E7KA 5IHKA 2ROTA 3NTHA 2M02A 2ENMA 2OTJQ 1X43A 2C0OA 4BDZA 4PJOB 3CCMT 2D8HA 2DFUA 4KBMB 5LJ5e 3ZL7C 2QDYB 3OMCA 2RM4A 3OYDA 1Q82C 2RJEA 4CC2A 2PZ1A 1YBYA 2OAUA 5FRNA 2KGTA 4M77B 2DETA 2CP0A 4AT1B 1HJDA 3OYGA 4GLMA 1KFZA 1SF9A 4C92F 2YT6A 4M75C 3TREA 1WYXA 4J6XA 3VS7A 3THKA 4ZGDB 2EBPA 4PJOF 2RF0A 3JB9H 2NYSA 3H0HA 2KRMA 1VQ7Q 2GFUA 1N5ZA 1Q86C 6AT1B 3AT1B 4C8QA 4C8QD 2RJFA 1VQLA 3CD6Q 1BBZA 3G71A 4RKUE 1FMWA 2HL3A 1NPRA 1N8RR 1I81A 1X2QA 5KH6A 1M9SA 5GAOp 2COYA 1QCFA 2QGGA 2O9SA 2RQUA 1X6BA 1AHJB 4M7AB 4DBHA 3UWNA 1CSKA 1GBQA 5GAMg 2PVGB 2EQKA 3BW1A 2E64A 2BKDN 1WA7A 2DERA 4E7HA 2K2VA 2L89A 1K9MR 5GAOr 3S3NA 2EAYA 1AZGB 1SEMA 3CC7A 2HSPA 3VU3C 4BUGA 3QWXX 4ZNXA 2ZPIB 2VASA 2M16A 1YNZA 4DA4A 3MP1A 4FW2A 3V8LA 1YI2T 1OZ2A 1WJRA 5CKEA 2EQJA 4PJLA 5CO7A 2J6OA 5AT1B 1YJNA 2KE9A 3A98A 4MDXA 3GIBA 2RQVA 1JJ2A 1K4US 2P4RA 3URGA 4ZTFA 1D3BA 4M78A 2RJCA 4M78D 5LJ3f 2LT1A 2ZPBB 1H3ZA 1JU5C 2DVJA 2QEXQ 1QVGA 5LJ5h 4LDXA 2Z0WA 3VS4A 3EAEA 2EIFA 2K3YA 2KNBB 1PD1A 3O5ZA 1UGSB 1VIFA 1B07A 3LH5A 2QK0A 4J9DA 3TQ7P 1Y71A 2A7YA 4X9CA 5DY9A 4M7DC 2RHYA 2VKNA 2NUPA 1NPPA 4KULA 1UGRB 2Y4YA 2EYXA 1MV0B 2JUFA 4QQDA 4RTWA 3HTRA 3DLMA 1M27C 2MWOA 1GBRA 2KYMA 1I1JA 4XTWA 2F5KA 1U1TA 1PKTA 4J7IA 2LDMA 2LJ3A 2P0PA 2LC4A 1O9SA 3EFSA 1N9SA 2YRDA 3RUXA 3A8OB 3LGFA 1KQ1A 5KYXA 4PNOA 4JRPA 1UEBA 1VA7A 1VQLT 4ELYC 3G71T 3X26B 2ZGWA 4KGVB 2BIVA 3FRNA 2E3IA 2FB7A 3GPLA 3WXMB 1JBMA 1LJOA 3L1AA 3OS0A 1ACMB 2FRYA 1UECA 4A4HA 2EW3A 3OYLA 3VV0A 3BY7A 3I56Q 4RUGA 1I5OB 3EGDB 5EC7A 3KUFA 2HD0A 1ZLMA 2EYWA 2OX7A 3F70A 3CCJQ 1OULA 2K5FA 1YIJQ 4EMKC 3RR6A 1K73U 4ESRA 3GBQA 1Q86U 3U23A 2DYIA 3CC7T 3RKYA 1U5SA 3WVDB 4E7SA 2K79A 2DJQA 2XICA 1RAHB 2CDTA 2P4TA 5KE2A 5KYUB 1QVFS 1VQOA 2YRVA 3RIRA 1F1BB 2PVDB 4FM4B 4J9IA 3QPHA 2OJ2A 4JLIA 3OYFA 5CKDA 4CC3A 5GANe 2DD4A 2IPOB 2QXFA 1RI0A 2QQSA 1Y07A 3JCMe 4J8OA 3I55Q 3OW2S 1LCKA 4OB1B 2H3JA 4JDSA 2EGCA 4PJOC 2B86A 3JB9D 4F7UE 1W1FA 5D6YA 2ROLA 2YUPA 2JNGA 2CT3A 1PKSA 4M77C 4FSSA 1TSFA 1VQ8Q 3JB9I 2RH2A 4J9CA 3MP8A 5GAMe 1XQHA 2AHJB 3CPWA 2M1HA 2HKNA 4LD9K 2DXTA 1EIFA 1BIBA 2K2MA 2C0TA 3EFOB 1KHCA 4N4IA 2K7AA 1FWZA 3GOXA 1Y57A 1GCQC 4KUDK 2L3RA 3QJ6A 3CCVQ 1QVFP 2E65A 2MF2A 3QUIA 2HSEB 5LJ3j 4AG2C 2A28A 4M7AC 4RCBA 4C8QE 2JM8A 2JTMA 2DEUA 4KGZB 3M0PA 3PIPA 4Z8AA 3DB4A 2YWWA 2FZCB 1SRLA 2NUTA 1I5LA 3KFVA 2DXCA 4J6YA 3X24B 4LDYA 4M75G 4C0FA 3A8LB 3HHTB 4L5GA 2L0AA 1CKAA 3V7SA 2RO0A 1G3WA 3JCMV 4C0DB 4DEXA 4RG2A 2J05A 3S3MA 2M0OA 5KYNA 4PJNA 4OF1A 1HYOA 2E41A 3SWNB 2EJGA 2AKLA 1WJSA 1BK2A 3H0FA 2EGEA 4IUTA 5GANh 3EHRA 1C0MA 1KQ2A 3JCMh 2DL7A 2WSCE 1W2BS 1RI9A 1SSFA 1IREB 2RPNA 1C6VX 4M75F 2EWNA 4BI4A 1V76A 1VQOT 3SD4A 3FDRA 1OEBA 3X20B 1RAIB 3SHWA 4WF2A 3L2RA 2PTKA 3CMEA 2DPPB 2CP5A 1QCOA 1B34A 2SEMA 1Q7YR 4M78E 2RI2A 3QBYA 5GAMh 3CCUA 2JN0A 4X34A 1R77A 4DBQA 3LH0A 4Y91A 1BU1A 2KI7A 2E10A 4JRIA 3META 1KK7A 2QASA 4HT9A 1K9MC 2K5IA 5CKFA 3V8KA 2RI3A 2MK5A 4FW1A 3M0RA 1U1SA 1BI1A 2QA4A 2NUZA 3NMZC 4EMHA 4AG1C 1YI2Q 5HKCA 2XU8A 1NJIR 5KCHA 1WGSA 3JCMJ 3RESA 1H3HA 2M9UA 5A0GA 1FYNA 3LWIA 4PJJA 1H8KA 1NEGA 2JT4A 1W2BP 2Y90A 4E7JA 5KYYA 4FIBA 1GFDA 2QAZA 3CBMA 5GAN3 3KBGA 3CCEA 3DB3A 5A0DA 3OYCA 2BZXA 1LPLA 1AWWA 4HVWA 4RTVA 1KJWA 4FYXB 2CZ7B 3MHXA 1VIEA 2HBWA 4LXCA 2VUBA 5GAN6 2QQ9A 4KH1B 1WIEA 2X4YA 1MNDA 2GNCA 4BI3A 3JCMW 5FU6B 4C0GA 2LRQA 2D0NA 2HEQA 5LL6S 3VJPA 3NPFA 3M53A 1SG5A 2JVVA 3LWHA 1JJ2S 4PL6A 4C92E 2V8IA 1YFNA 5HCKA 2DD5A 2BE7D 1I0CA 2LNVA 2H3EB 3OS1A 2D6FA 2L8DA 1T0HA 1D3BB 2FO0A 4VUBA 2XMFA 2DKGA 1QVGS 1M90C 1ZSZB 1M2VA 4XTUA 2RQWA 2EQIA 1QKXA 4Q5WA 1JEGA 3TCJA 4J9GA 3CCLA 2XIDA 4RTYA 2BUDA 1O75A 4JRQA 4EMGA 3EGXB 4N0AC 4XU2A 3T9NA 1VQLQ 3G71Q 1X69A 3SEMA 4LE9A 4FYYB 5GANj 1RLPC 2QQBA 2LX9A 3EG9A 2DXBA 3HRUA 2DNUA 3CXCA 1XTDA 2FPDA 1HXDA 2DF6A 1S1NA 1M3AA 2RMOA 1AWOA 4QVCA 3Q1JA 3FIFA 4ELZC 3CCUT 2MI6A 1GL5A 1VQ4A 1C1AA 2EYYA 2PUOB 5KYWB 2W0ZA 2QTVA 1XJWB 4GLKA 1KC8R 2LJ1A 1HD3A 1M5Q1 3CC7Q 4NOYA 5KYXB 4QW2A 3CBOA 1ABOA 1N8RU 2QA4T 3FLGA 1QVGP 4NL3A 1NEBA 5HY6A 2YLBA 2QG9B 4MZPA 3M0SA 2EQUA 2HCKA 2BZYA 2IG0A 3INZA 2EKHA 3NTKA 2RJDA 1YJNQ 3VRZA 4M77G 5GAOl 1M8MA 1WHHA 1TUCA 4OMNA 4AFZC 4B9WA 5ECAA 4II1A 2XD0A 4D6WA 1AVZC 3CMAA 4GY5A 2CUBA 3ASKA 4IUVA 3CCET 1G2BA 2HL5C 3CQTA 1SPKA 3JCMc 3HL8A 3UATA 3IQLA 1K9MU 3OBYA 5IH2A 4C0DC 2CP2A 3V7CA 2DL8A 5IHNA 5GANg 1K73C 1MNEA 1WDXA 3I5SA 3JCMg 2LQNA 2BTTA 2LMJA 3VS2A 3SWNC 3S6WA 1U06A 5LJ3e 2F1LA 2EJFA 4M7AG 4M77F 2KRNA 2MAMA 3TEEA 2V1RA 2JJ9A 1UFFA 3EGUA 4YTLA 1FX7A 4LDUA 4A53A 5M9OA 2RI5A 3ME9A 1YCYA 1WZOA 3VS6A 1M1KR 1QP2A 1PWTA 2V1QA 1W4SA 1IB8A 3G1JA 3RKWA 4GBQA 4XTYA 3A1PA 4N4HA 4XK8E 2GTOA 2V8KA 1IO6A 3ZFJA 2H8HA 1SHFA 4ANJA 3X25B 4JJCA 3CCLT 3PT9A 2ABLA 2NLUA 1MGQA 3PGGA 2HQXA 3C12A 2CSQA 3LLRA 4L6V5 5GAN7 4M7AF 3CPWS 1XNIA 1WQWA 1IRXA 1R0BG 2HDAA 3MKDA 4OGEA 2QI2A 4XAXB 4M7DA 1NE8A 4M7DD 4FSXA 2R5AA 5J26A 1IXDA 2KSSA 2OAWA 4PFPA 1VQMA 1VQ4T 4CC7A 2DBKA 2KMTA 1M90U 2RHZA 4JJBA 2X35A 5IXFA 1RUWA 1W70A 4FT2A 3QWYA 1M8VA 2C0IA 5L23A 1MUZA 1ZBXA 3CC2A 2MIOA 3C94A 3ZEHA 1Y0MA 3N5BB 2A3LA 2RB6A 1KD1C 5HK0A 1PNJA 2K9GA 2LP5A 1VQOQ 1K8AR 3EG1A 1WI7A 3NHNA 2LT4A 2EPDA 2V26A 2NUTB 1TUGB 1RAEB 4XTVA 2JW4A 3HRTA 4JLGA 3AHUA 3EG3A 4RMOA 5IHIA 2F69A 2KK4A 3CPWP 3OYAA 4ZTJA 1YHQA 3CMAT 2FZGB 3H6ZA 1P92A 2KRSA 4IIMA 5D6XA 5LJ3h 1ZSGA 5FU6C 1MHNA 1QCNA 1V1CA 3SB2A 4F16A 3RERA 1MV3A 1X6GA 4J9FA 2EGAA 1BB9A 2M0YA 3HPWA 4EMKA 3M58A 2MOXA 1VQPA 1WNLA 3UDCA 2F2XA 2XDBA 3OA6A 2IIMA 4E7ZA 3CBPA 1NBEB 1ZSZC 3QZ9B 3G6EA 1OPLA 1NJIC 2EKOA 2AZVA 5DLOA 2RQRA 4XTZA 1OYXA 3CCSA 5GJWB 1JXMA 1ZQ1A 3VS1A 4ATOA 1B34B 1D1BA 2ED1A 4XTXA 1S72A 5CAIA 1WHLA 2ZAEA 2HZYA 2K5LA 3QKJA 1PD0A 4XU1A 3JCMP 3FC3A 4WCIA 2DX1A 4PFZA 2B8AA 2W10A 4KRTA 4C92A 4C92D 4HXJA 4A63B 4PJOA 4PJOD 3MJXA 4J9EA 2DL4A 2I0NA 5FW9A 3EG0A 2M51A 3UA6A 1G83A 1QWEA 4HCCA 3H9NA 4OMMA 5EG2A 2BZ8A 2MPXC 1WQ7A 1G8XA 1QWFA 4C5IA 3TSZA 1M4ZA 2OTLA 2PNIA 3JRZA 1BKBA 2XDPA 4JZ3A 2DK3A 3LW5E 1VQNA 1YJNT 4ZGJB 5CKHA 1ZA2B 5LJ5d 3J81E 4Z89A 5KYYB 4DEYA 1E6GA 1QLYA 1D0XA 4MZTA 1GCQA 1YCSB 2YUNA 2MCNA 1WHJA 2LQ8A 2VGMA 2X3XD 3M57A 3RMSA 4IUQA 5IAYA 2E5KA 2RN8A 3OYHA 1VUBA 3R6NA 4D8DA 4HCKA 2A08A 2CP3A 5GAOq 4OB0B 1Q82R 3E1SA 4HCBA 3CMEQ 2HAXA 2DLPA 2KXDA 3BE3A 3M54A 2F2VA 4JS5A 1CKBA 3CCUQ 1YHQT 4QVZA 1ZUKA 2ZPFB 4BI8B 2CYZB 4WTOB 1YWOA 2R5MA 2DYBA 4X9DA 3D7SB 4CRIA 2RQTA 1Q86R 2VXEA 1D1CA 1V29B 3LYIA 2O88A 2G6FX 5CIUA 7AT1B 2ZCFB 1N6AA 1UG1A 2JS2A 4A4EA 3I5RA 1JQQA 1NM7A 3G4SA 5GMKj 1VQPT 1KD1U 3HFNA 2D0QB 2QA4Q 2DE0X 3HFOA 3MEVA 3CCQA 1TS9A 2LJ0A 1PSFA 2EQMA 2CSIA 1WJQA 1AOJA 3QXEB 3CXCS 1G3SA 2AKKA 5CR2A 1Q7YU 3DLLA 3CCST 3EG9B 3A8MB 3L2VA 1UGVA 1S72T 1GCPA 5A0LA 3OBWA 1VQKA 4HT8A 4FU6A 3CCEQ 4TVRA 1TG0A 2DL5A 4MMLA 4M4ZA 3ULRB 3VUZA 4F7UG 1K0XA 1EFNA 3OYEA 1M30A 1WHKA 3P8DA 2KXCA 1LVKA 4BE1A 2E12A 1YN8A 4EPCA 4F7UB 2O9VA 4M7DE 1NJIU 4LUEA 4DQ2A 2OI3A 2FRWA 4J83A 2OTLT 1N8RC 4V2SA 2C06A 4LDWA 2AZSA 2DRKA 1VQNT 2COWA 2AK5A 1E6HA 2JOYA 1M1KC 3E9GA 5IXBA 1VQ9A 1SHGA 3JCMX 5FLXE 3CXCP 5LJ3g 1EX4A 4F7UF 3M4YA 1MMGA 2K6DA 2DRMA 1E7OA 1X2KA 4RTUA 2JTEA 2PU9B 3SFMA 3V7RA 3CCLQ 3PIOA 4C8QG 5J3BA 2L3PA 1VOMA 2VC8A 1OQKA 2EYQA 2FHDA 3H0IA 1MMNA 2XI9A 1VYTA 3OS5A 3R6OA 1NZ9A 4C8QB 2LCLA 2QQRA 9ATCB 1ZUUA 3ER0A 3QG1A 4NS5A 3M0TA 1IGQA 3QSUA 3M4GA 4JUVA 4PLIA 1WX6A 3PFSA 1VQ4Q 3OYNA 1ZHIA 2GFAA 1AZEA 4OMOA 1M3BA 1RL2A 3JAME 2DZCA 5KYUA 1TXQA 2FZKB 3CC4A 4C8QF 1Q81R 3EH2A 3G4ST 1HSQA 2KEAA 2VV5A 2PUKB 3V8JA 3CCMA 4LN2A 2K3XA 3MP6A 3CCQT 2COZA 2QQAA 2ED0A 3S3OA 4N0AA 3L42A 3OYIA 3GNGA 4Z88A 1DJ7B 1OZ3A 2GQIA 2GCXA 3PVQA 2ATCB 2LCCA 4M7DB 4AFUC 2E1HA 4M78G 1VQKT 3CMAQ 3QYGB 4Y92A 1OU8A 1JXOA 3OSSC 2JZ2A 1K0SA 3VYHB 4B9XA 3MO8A 2LX7A 5GANd 4QQ6A 2KR3A 4PJOE 3RKXA 4RTXA 1I07A 1OU9A 3VS0A 3JCMd 3C0CA 2ZPHB 4M78B 4R55A 1TOVA 5GAN5 4LUDA 5CKBA 4E6RA 2YLCA 1KSWA 2D8JA 4OMLA 1ABQA 3MPUB 3QZ5B 5L8RE 5A2QE 2KDSA 1VQ6A 3GP8A 2ZZDA 2F2WA 4QT7A 1Y96A 3VS3A 1PHTA 2QDLA 4LDVA 1UE9A 4X1VA 5GAMd 2NUPB 1OI1A 4M78F 3CMET 4JJDA 1KG1A 1RLQC 2BE9B 2IVWA 2L3QA 1MMAA 1VQ9T 1PRLC 2LTOA 2O01E 3CCRA 2VVKA 1YITA 2R58A 1BI0A 1GFCA 2D9TA 2O4XA 4A4KA 1K76A 5GAOm 4FYVB 2HBPA 2YUQA 1B7TA 2WSFE 2MYSA 3VYGA 1OOTA 4D8KA 1IHWA 1IGUA 4BD3A 3UT1A 4C5HA 4QVDA 2DZ9A 4EMKB 2XKOC 3E9FA 3JCMb 2KROA 4A4GA 4M75A 3OQ5A 4M75D 4IURA 3L2UA 2L5QA 4JPBW 2RHXA 4FL6A 3SWNA 1G3YA 4BY6B 1WHGA 4QKUA 1KQSP 3GNFB 4UC4A 4BDYA 1VQMQ 1M1KU 1UDLA 4PK4A 4C92G 3NTIA 4PFOA 3M5AA 4Z02A 2R57A 2P0QA 2LZ6B 1VQ5A 3CC2Q 1RADB 2HQEA 3CC4T 1I8FA 2GBQA 4C92B 4J5YA 1RAGB 2RK2A 1YJ9A 1BCOA 4OP0A 1WXUA 1G3TA 4Y28E 2YUOA 2X51A 5CVIA 4F14A 1QP3A 5I2MA 3LGLA 2CP7A 1Y7XA 1TTHB 3G7ZA 5GMKe 2J7IA 1D0YA 5J39A 2WSEE 1YHQQ 3UF4A 4C5EA 1D0ZA 2CZ6B 4ZN1A 3JB9G 3OYBA 5HK3A 3BDUA 3TU4K 1BCMA 2YHTA 5GAOn 8AT1B 2RNAA 1UJ0A 1VQPQ 1ARKA 1D09B 1QKWA 2HNIA 3C95A 2K57A 4F04B 1B3QA 1K8AU 4KH0B 1VQ6T 1R0CB 2CREA 3EFRA 4HVVA 3G6EQ 5C6SA 1YJWA 3CCSQ 1IHVA 2GF7A 1S72Q 4IIOA 1X27A 3L2WA 3JB9F 2Y4XA 5LJ5f 3CCRT 1YITT 2X9HA 4C8QC 2ZPGB 1BI2A 3JV3A 3GLXA 3REBB 2CT4A 1I4K1 3PMIA 3TSWA 2KQWA 4P5NA 5KCOA 4RCCA 4OGCA 1J3TA 1MMDA 4PJMA 2OTJA 1KQSA 1EZZB 4OMPA 2A0FB 4PKCC 2OTLQ 2EYZA 3L2ZA 1JO8A 1YWPA 3QIIA 1ZSZA 3MEWA 1VQNQ 2CH4W 5I21A 2FPFA 1N9RA 1Q7YC 2K3BA 3OYKA 3EGXA 4FCYA 4HVUA 1T0JA 1VQ5T 4JS4A 1OX9A 2A36A 1VQ7A 5GMKh 1OV3A 1UTIA 1X01A 1BYMA 5FU7B 3CD6A 3KXTA 1YJ9T 2F5TX 2RD1A 2GGRA 4HCZA 5DM7R 3X28B 4DOVA 1Z9QA 1A0NB 1SKUB 4M78C 5KYWA 8ATCB 2CZ1B 4A4FA 2KT1A 4LD6A 2E4HA 4KT0E 1PG5B 2FVUA 3EG2A 1AT1B 2FEIA 3ZBDA 3RBBB 1M90R 3A8HB 3OYJA 1LNXA 1AWXA 3M0UA 5D7UA 2DIQA 5GJVB 5GAN2 4AMCA 4ORZA 2O31A 1K9AA 5CK9A 4HA8A 4PLLA 2X4WA 1IZ6A 1PRMC 2CUDA 3G4SQ 1Q81C 3CPFA 1WHMA 4IUUA 3JSCA 1Q82U 3GF5A 1ZX6A 1Q95G 3CCQQ 2XDDA 2NWMA 1WXTA 2DTOA 4XU3A 3E19A 5CQYA 1YJWT 2DILA 4J9HA 4DBFA 4M77A 4LNPA 4M77D 5C0MA 3JCMQ 1WPYA 2DTIA 4RTTA 1YP5A 3CEYA 3NGPA 3M9QA 2L3SA 1RABB 2KY9A 1UB4A 5IN1A 4J7FA 2EJ9A 4RG8A 1VQKQ 1M2OA 4J6WA 2J6KA 1VQMT 2QEXA 2DBMA 4BY6C 2E3HA 4EDUA 4C0ZA 4L59A 5AYFA 3OS2A 2CS7A 2E70A 4E7IA 1M3CA 2QGFB 4XU0A 3CC2T 4M75E 2X4XA 1U8RA 1RAAB 1LOJA 2OTJT 4R0KA 4OMFB 2KT8A 2XHCA 3RDVA 4M7AA 3A5ZB 4M7AD 1SSHA 1TUDA 4QQGA 4JZ4A 5I22A 2KBTA 4MDWA 3J7AF 4C92C 2X4JA 1ZUYA 1NG2A 2V8JA 5LJ3d 3OY9A 3QJYA 3TVTA 1VQ9Q 4JJNK 1UHCA 2EFIA 1Z9ZA 2VB6A 2RHIA 1K73R 5LJ5j 2P84A 1WXBA 1VQ7T 1TU0B 4BACA 1KC8C 2SRCA 1QVPA 4FT4A 3CD6T 4E7LA 3UPUA 1M2VB 1T3LA 5FROA 1U3OA 2DA9A 1D1AA 1H92A 3PTAA 3VS5A 3VUBA 2J6FA 3HRSA 3NFCA 4E47A 1UUEA 2KVQG 3M0QA 3G6ET 1Y96B 4N4GA 4K11A 4AFQC 3I56A 3HSBA 2XG8D 2KAFA 4A54A 3PVLA 2DL3A 4DBRA 5CQXA 2CKKA 3CCJA 1YIJA 2KYBA 3OW2P 4ZGEB 5GANf 2D1XA 4BB7A 3JCMf 3CC4Q 3EHQA 2O4XB 2FPEA 3C4SA 2LQKA 2E5QA 2JTFA 5CCAA 4MMKA 2J06A 3CCMQ 1PM3A 1NLPC 2YXYA 4O5VA 4NL2A 1TH7A 4AFSC 4ME7A 2QTXA 3HP9A 4EIKA 2YSQA 4M75B 1X6OA 4IUPA 2ESWA 2VXFA 1H641 3OMGA 5FWCA 5GAMf 3I55A 3JB9J 1FMVA 4FYWB 2DIGA 5LJ5g 2QEXT 1M1FA 1QMCA 4J9BA 2FYKA 3MCAB 1AD5A 1VYUA 2JM9A 2DAQA 1KD1R 4KGXB 1Q81U 1NYFA 3M56A 2GQVA 1VQ8A 3P8HA 3M55A 4OB2B 1BI3A 2GTJA 2ECZA 1TWBA 1HK9A 1VQ6Q 4OMQA 5GMKm 3WVEB 2DTHA 1JB0E 3EGDA 2FL7A 3I35A 2JS0A 3L2QA 1KIKA 5FU7C 2G3RA 3CCVA 2P0KA 2DJZA 3BFMA 1GRIA 3CCRQ 1YITQ 1WFWA 3FJPA 1RAFB 2JMCA 5I11A 1OPKA 4OVAA 4O6JA 2K4YA 4BE2A 5GMKl 4IKFA 2E6NA 3VRYA 3FJ5A 2I2LA 2YDLA 3OSVA 3OYYA 1QVFA 2WACA 3FB9A 3J80E 2RHUA 2CP6A 2ZPEB 3HKSA 2JMAA 2LVMA 4M7DG 3SDZA 2LNHB 3E2UA 1K8AC 2A37A 3P8BB 2YRCA 3I56T 3OW2A 2PQWA 1W6XA 1PCXA 1WLPB 3QDFA 3CCJT 4R56A 1YIJT 4BE0A 2CGHA 1PSEA 1UGPB 3DKMA 1VQ5Q 2JXBA 2L2PA 1NLOC 1KC8U 3QDRB 5D6WA 4E2FB 1QQJA 2AT1B 3REAB 4KUIA 1YJ9Q 1NYGA 3O8VA 2CZ0B 3EFOA 2RA2A 4HKEA 1ZBJA 3A8GB 3MEUA 2QYZA 4M77E 4M7DF 1KQSS 1OX8A 2HQHA 2VYTA 1R8OB 3RNJA
chains in the Genus database with same CATH topology
2COYA 2E4HA 2QK0A 3TQ7P 2M02A 1WHGA 2CP3A 2E3IA 2CP6A 2CP2A 1WHMA 3RDVA 2CP5A 2COZA 2COWA 3E2UA 1WHHA 1WHKA 1TOVA 1WHLA 2E3HA 2HKNA 4B6MA 1WHJA 2Z0WA 2MPXC 1TXQA 2HL3A 1IXDA 2CP0A 1LPLA 2CP7A 2HQHA 2HKQB 2HL5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COY A;  2E4H A;  2QK0 A;  3TQ7 P;  2M02 A;  1WHG A;  2CP3 A;  2E3I A;  2CP6 A;  2CP2 A;  1WHM A;  3RDV A;  2CP5 A;  2COZ A;  2COW A;  3E2U A;  1WHH A;  1WHK A;  1TOV A;  1WHL A;  2E3H A;  2HKN A;  4B6M A;  1WHJ A;  2Z0W A;  2MPX C;  1TXQ A;  2HL3 A;  1IXD A;  2CP0 A;  1LPL A;  2CP7 A;  2HQH A;  2HKQ B;  2HL5 C; 
#chains in the Genus database with same CATH topology
 2X3W D;  2DM1 A;  3H41 A;  4F17 A;  1VYV A;  1FMK A;  2DMO A;  1K1Z A;  1N27 A;  3UA7 A;  3I55 T;  4XQ3 A;  1JRI A;  3PNW C;  5GAN 4;  2LQW A;  3PE0 A;  3FEO A;  4CC4 B;  4DOW A;  1PC0 A;  1XOV A;  3QYH B;  5FRM A;  3BDL A;  5GAN 8;  3QO3 A;  2DXU A;  4C5G A;  2VGN A;  4CI0 C;  1VQ8 T;  5GMK i;  1GXI E;  1RAC B;  1AWJ A;  1UHF A;  2AIR B;  4M7A E;  1FXX A;  1G5V A;  1YI2 A;  1AEY A;  2RK1 A;  4RTZ A;  2DO3 A;  4B6M A;  2MWP A;  1X75 C;  1YJW Q;  3M59 A;  5DLQ E;  2FG0 A;  2O2O A;  4OB3 B;  1ZA1 B;  2E6Z A;  1UGQ B;  2EVR A;  3VKI A;  4MZM A;  3CCV T;  2PVO B;  3I9Q A;  1UJY A;  5GAM j;  1SRM A;  1BIA A;  1QW1 A;  1KHI A;  5FWB A;  3H8Z A;  2VWF A;  5IT9 E;  1JJ2 P;  2CH4 A;  3EH1 A;  2DEQ A;  4JRK A;  5I2S A;  3PMT A;  5KE3 A;  1M1G A;  4ZN3 A;  3LX7 A;  1T3S A;  3OB9 A;  4F7U A;  3RMQ A;  3OYM A;  2MMP A;  2XK0 A;  4PJO G;  2DVE A;  3QHS A;  1W2B A;  2HMA A;  2HKQ B;  2LCS A;  3MEA A;  4E7K A;  5IHK A;  2ROT A;  3NTH A;  2M02 A;  2ENM A;  2OTJ Q;  1X43 A;  2C0O A;  4BDZ A;  4PJO B;  3CCM T;  2D8H A;  2DFU A;  4KBM B;  5LJ5 e;  3ZL7 C;  2QDY B;  3OMC A;  2RM4 A;  3OYD A;  1Q82 C;  2RJE A;  4CC2 A;  2PZ1 A;  1YBY A;  2OAU A;  5FRN A;  2KGT A;  4M77 B;  2DET A;  2CP0 A;  4AT1 B;  1HJD A;  3OYG A;  4GLM A;  1KFZ A;  1SF9 A;  4C92 F;  2YT6 A;  4M75 C;  3TRE A;  1WYX A;  4J6X A;  3VS7 A;  3THK A;  4ZGD B;  2EBP A;  4PJO F;  2RF0 A;  3JB9 H;  2NYS A;  3H0H A;  2KRM A;  1VQ7 Q;  2GFU A;  1N5Z A;  1Q86 C;  6AT1 B;  3AT1 B;  4C8Q A;  4C8Q D;  2RJF A;  1VQL A;  3CD6 Q;  1BBZ A;  3G71 A;  4RKU E;  1FMW A;  2HL3 A;  1NPR A;  1N8R R;  1I81 A;  1X2Q A;  5KH6 A;  1M9S A;  5GAO p;  2COY A;  1QCF A;  2QGG A;  2O9S A;  2RQU A;  1X6B A;  1AHJ B;  4M7A B;  4DBH A;  3UWN A;  1CSK A;  1GBQ A;  5GAM g;  2PVG B;  2EQK A;  3BW1 A;  2E64 A;  2BKD N;  1WA7 A;  2DER A;  4E7H A;  2K2V A;  2L89 A;  1K9M R;  5GAO r;  3S3N A;  2EAY A;  1AZG B;  1SEM A;  3CC7 A;  2HSP A;  3VU3 C;  4BUG A;  3QWX X;  4ZNX A;  2ZPI B;  2VAS A;  2M16 A;  1YNZ A;  4DA4 A;  3MP1 A;  4FW2 A;  3V8L A;  1YI2 T;  1OZ2 A;  1WJR A;  5CKE A;  2EQJ A;  4PJL A;  5CO7 A;  2J6O A;  5AT1 B;  1YJN A;  2KE9 A;  3A98 A;  4MDX A;  3GIB A;  2RQV A;  1JJ2 A;  1K4U S;  2P4R A;  3URG A;  4ZTF A;  1D3B A;  4M78 A;  2RJC A;  4M78 D;  5LJ3 f;  2LT1 A;  2ZPB B;  1H3Z A;  1JU5 C;  2DVJ A;  2QEX Q;  1QVG A;  5LJ5 h;  4LDX A;  2Z0W A;  3VS4 A;  3EAE A;  2EIF A;  2K3Y A;  2KNB B;  1PD1 A;  3O5Z A;  1UGS B;  1VIF A;  1B07 A;  3LH5 A;  2QK0 A;  4J9D A;  3TQ7 P;  1Y71 A;  2A7Y A;  4X9C A;  5DY9 A;  4M7D C;  2RHY A;  2VKN A;  2NUP A;  1NPP A;  4KUL A;  1UGR B;  2Y4Y A;  2EYX A;  1MV0 B;  2JUF A;  4QQD A;  4RTW A;  3HTR A;  3DLM A;  1M27 C;  2MWO A;  1GBR A;  2KYM A;  1I1J A;  4XTW A;  2F5K A;  1U1T A;  1PKT A;  4J7I A;  2LDM A;  2LJ3 A;  2P0P A;  2LC4 A;  1O9S A;  3EFS A;  1N9S A;  2YRD A;  3RUX A;  3A8O B;  3LGF A;  1KQ1 A;  5KYX A;  4PNO A;  4JRP A;  1UEB A;  1VA7 A;  1VQL T;  4ELY C;  3G71 T;  3X26 B;  2ZGW A;  4KGV B;  2BIV A;  3FRN A;  2E3I A;  2FB7 A;  3GPL A;  3WXM B;  1JBM A;  1LJO A;  3L1A A;  3OS0 A;  1ACM B;  2FRY A;  1UEC A;  4A4H A;  2EW3 A;  3OYL A;  3VV0 A;  3BY7 A;  3I56 Q;  4RUG A;  1I5O B;  3EGD B;  5EC7 A;  3KUF A;  2HD0 A;  1ZLM A;  2EYW A;  2OX7 A;  3F70 A;  3CCJ Q;  1OUL A;  2K5F A;  1YIJ Q;  4EMK C;  3RR6 A;  1K73 U;  4ESR A;  3GBQ A;  1Q86 U;  3U23 A;  2DYI A;  3CC7 T;  3RKY A;  1U5S A;  3WVD B;  4E7S A;  2K79 A;  2DJQ A;  2XIC A;  1RAH B;  2CDT A;  2P4T A;  5KE2 A;  5KYU B;  1QVF S;  1VQO A;  2YRV A;  3RIR A;  1F1B B;  2PVD B;  4FM4 B;  4J9I A;  3QPH A;  2OJ2 A;  4JLI A;  3OYF A;  5CKD A;  4CC3 A;  5GAN e;  2DD4 A;  2IPO B;  2QXF A;  1RI0 A;  2QQS A;  1Y07 A;  3JCM e;  4J8O A;  3I55 Q;  3OW2 S;  1LCK A;  4OB1 B;  2H3J A;  4JDS A;  2EGC A;  4PJO C;  2B86 A;  3JB9 D;  4F7U E;  1W1F A;  5D6Y A;  2ROL A;  2YUP A;  2JNG A;  2CT3 A;  1PKS A;  4M77 C;  4FSS A;  1TSF A;  1VQ8 Q;  3JB9 I;  2RH2 A;  4J9C A;  3MP8 A;  5GAM e;  1XQH A;  2AHJ B;  3CPW A;  2M1H A;  2HKN A;  4LD9 K;  2DXT A;  1EIF A;  1BIB A;  2K2M A;  2C0T A;  3EFO B;  1KHC A;  4N4I A;  2K7A A;  1FWZ A;  3GOX A;  1Y57 A;  1GCQ C;  4KUD K;  2L3R A;  3QJ6 A;  3CCV Q;  1QVF P;  2E65 A;  2MF2 A;  3QUI A;  2HSE B;  5LJ3 j;  4AG2 C;  2A28 A;  4M7A C;  4RCB A;  4C8Q E;  2JM8 A;  2JTM A;  2DEU A;  4KGZ B;  3M0P A;  3PIP A;  4Z8A A;  3DB4 A;  2YWW A;  2FZC B;  1SRL A;  2NUT A;  1I5L A;  3KFV A;  2DXC A;  4J6Y A;  3X24 B;  4LDY A;  4M75 G;  4C0F A;  3A8L B;  3HHT B;  4L5G A;  2L0A A;  1CKA A;  3V7S A;  2RO0 A;  1G3W A;  3JCM V;  4C0D B;  4DEX A;  4RG2 A;  2J05 A;  3S3M A;  2M0O A;  5KYN A;  4PJN A;  4OF1 A;  1HYO A;  2E41 A;  3SWN B;  2EJG A;  2AKL A;  1WJS A;  1BK2 A;  3H0F A;  2EGE A;  4IUT A;  5GAN h;  3EHR A;  1C0M A;  1KQ2 A;  3JCM h;  2DL7 A;  2WSC E;  1W2B S;  1RI9 A;  1SSF A;  1IRE B;  2RPN A;  1C6V X;  4M75 F;  2EWN A;  4BI4 A;  1V76 A;  1VQO T;  3SD4 A;  3FDR A;  1OEB A;  3X20 B;  1RAI B;  3SHW A;  4WF2 A;  3L2R A;  2PTK A;  3CME A;  2DPP B;  2CP5 A;  1QCO A;  1B34 A;  2SEM A;  1Q7Y R;  4M78 E;  2RI2 A;  3QBY A;  5GAM h;  3CCU A;  2JN0 A;  4X34 A;  1R77 A;  4DBQ A;  3LH0 A;  4Y91 A;  1BU1 A;  2KI7 A;  2E10 A;  4JRI A;  3MET A;  1KK7 A;  2QAS A;  4HT9 A;  1K9M C;  2K5I A;  5CKF A;  3V8K A;  2RI3 A;  2MK5 A;  4FW1 A;  3M0R A;  1U1S A;  1BI1 A;  2QA4 A;  2NUZ A;  3NMZ C;  4EMH A;  4AG1 C;  1YI2 Q;  5HKC A;  2XU8 A;  1NJI R;  5KCH A;  1WGS A;  3JCM J;  3RES A;  1H3H A;  2M9U A;  5A0G A;  1FYN A;  3LWI A;  4PJJ A;  1H8K A;  1NEG A;  2JT4 A;  1W2B P;  2Y90 A;  4E7J A;  5KYY A;  4FIB A;  1GFD A;  2QAZ A;  3CBM A;  5GAN 3;  3KBG A;  3CCE A;  3DB3 A;  5A0D A;  3OYC A;  2BZX A;  1LPL A;  1AWW A;  4HVW A;  4RTV A;  1KJW A;  4FYX B;  2CZ7 B;  3MHX A;  1VIE A;  2HBW A;  4LXC A;  2VUB A;  5GAN 6;  2QQ9 A;  4KH1 B;  1WIE A;  2X4Y A;  1MND A;  2GNC A;  4BI3 A;  3JCM W;  5FU6 B;  4C0G A;  2LRQ A;  2D0N A;  2HEQ A;  5LL6 S;  3VJP A;  3NPF A;  3M53 A;  1SG5 A;  2JVV A;  3LWH A;  1JJ2 S;  4PL6 A;  4C92 E;  2V8I A;  1YFN A;  5HCK A;  2DD5 A;  2BE7 D;  1I0C A;  2LNV A;  2H3E B;  3OS1 A;  2D6F A;  2L8D A;  1T0H A;  1D3B B;  2FO0 A;  4VUB A;  2XMF A;  2DKG A;  1QVG S;  1M90 C;  1ZSZ B;  1M2V A;  4XTU A;  2RQW A;  2EQI A;  1QKX A;  4Q5W A;  1JEG A;  3TCJ A;  4J9G A;  3CCL A;  2XID A;  4RTY A;  2BUD A;  1O75 A;  4JRQ A;  4EMG A;  3EGX B;  4N0A C;  4XU2 A;  3T9N A;  1VQL Q;  3G71 Q;  1X69 A;  3SEM A;  4LE9 A;  4FYY B;  5GAN j;  1RLP C;  2QQB A;  2LX9 A;  3EG9 A;  2DXB A;  3HRU A;  2DNU A;  3CXC A;  1XTD A;  2FPD A;  1HXD A;  2DF6 A;  1S1N A;  1M3A A;  2RMO A;  1AWO A;  4QVC A;  3Q1J A;  3FIF A;  4ELZ C;  3CCU T;  2MI6 A;  1GL5 A;  1VQ4 A;  1C1A A;  2EYY A;  2PUO B;  5KYW B;  2W0Z A;  2QTV A;  1XJW B;  4GLK A;  1KC8 R;  2LJ1 A;  1HD3 A;  1M5Q 1;  3CC7 Q;  4NOY A;  5KYX B;  4QW2 A;  3CBO A;  1ABO A;  1N8R U;  2QA4 T;  3FLG A;  1QVG P;  4NL3 A;  1NEB A;  5HY6 A;  2YLB A;  2QG9 B;  4MZP A;  3M0S A;  2EQU A;  2HCK A;  2BZY A;  2IG0 A;  3INZ A;  2EKH A;  3NTK A;  2RJD A;  1YJN Q;  3VRZ A;  4M77 G;  5GAO l;  1M8M A;  1WHH A;  1TUC A;  4OMN A;  4AFZ C;  4B9W A;  5ECA A;  4II1 A;  2XD0 A;  4D6W A;  1AVZ C;  3CMA A;  4GY5 A;  2CUB A;  3ASK A;  4IUV A;  3CCE T;  1G2B A;  2HL5 C;  3CQT A;  1SPK A;  3JCM c;  3HL8 A;  3UAT A;  3IQL A;  1K9M U;  3OBY A;  5IH2 A;  4C0D C;  2CP2 A;  3V7C A;  2DL8 A;  5IHN A;  5GAN g;  1K73 C;  1MNE A;  1WDX A;  3I5S A;  3JCM g;  2LQN A;  2BTT A;  2LMJ A;  3VS2 A;  3SWN C;  3S6W A;  1U06 A;  5LJ3 e;  2F1L A;  2EJF A;  4M7A G;  4M77 F;  2KRN A;  2MAM A;  3TEE A;  2V1R A;  2JJ9 A;  1UFF A;  3EGU A;  4YTL A;  1FX7 A;  4LDU A;  4A53 A;  5M9O A;  2RI5 A;  3ME9 A;  1YCY A;  1WZO A;  3VS6 A;  1M1K R;  1QP2 A;  1PWT A;  2V1Q A;  1W4S A;  1IB8 A;  3G1J A;  3RKW A;  4GBQ A;  4XTY A;  3A1P A;  4N4H A;  4XK8 E;  2GTO A;  2V8K A;  1IO6 A;  3ZFJ A;  2H8H A;  1SHF A;  4ANJ A;  3X25 B;  4JJC A;  3CCL T;  3PT9 A;  2ABL A;  2NLU A;  1MGQ A;  3PGG A;  2HQX A;  3C12 A;  2CSQ A;  3LLR A;  4L6V 5;  5GAN 7;  4M7A F;  3CPW S;  1XNI A;  1WQW A;  1IRX A;  1R0B G;  2HDA A;  3MKD A;  4OGE A;  2QI2 A;  4XAX B;  4M7D A;  1NE8 A;  4M7D D;  4FSX A;  2R5A A;  5J26 A;  1IXD A;  2KSS A;  2OAW A;  4PFP A;  1VQM A;  1VQ4 T;  4CC7 A;  2DBK A;  2KMT A;  1M90 U;  2RHZ A;  4JJB A;  2X35 A;  5IXF A;  1RUW A;  1W70 A;  4FT2 A;  3QWY A;  1M8V A;  2C0I A;  5L23 A;  1MUZ A;  1ZBX A;  3CC2 A;  2MIO A;  3C94 A;  3ZEH A;  1Y0M A;  3N5B B;  2A3L A;  2RB6 A;  1KD1 C;  5HK0 A;  1PNJ A;  2K9G A;  2LP5 A;  1VQO Q;  1K8A R;  3EG1 A;  1WI7 A;  3NHN A;  2LT4 A;  2EPD A;  2V26 A;  2NUT B;  1TUG B;  1RAE B;  4XTV A;  2JW4 A;  3HRT A;  4JLG A;  3AHU A;  3EG3 A;  4RMO A;  5IHI A;  2F69 A;  2KK4 A;  3CPW P;  3OYA A;  4ZTJ A;  1YHQ A;  3CMA T;  2FZG B;  3H6Z A;  1P92 A;  2KRS A;  4IIM A;  5D6X A;  5LJ3 h;  1ZSG A;  5FU6 C;  1MHN A;  1QCN A;  1V1C A;  3SB2 A;  4F16 A;  3RER A;  1MV3 A;  1X6G A;  4J9F A;  2EGA A;  1BB9 A;  2M0Y A;  3HPW A;  4EMK A;  3M58 A;  2MOX A;  1VQP A;  1WNL A;  3UDC A;  2F2X A;  2XDB A;  3OA6 A;  2IIM A;  4E7Z A;  3CBP A;  1NBE B;  1ZSZ C;  3QZ9 B;  3G6E A;  1OPL A;  1NJI C;  2EKO A;  2AZV A;  5DLO A;  2RQR A;  4XTZ A;  1OYX A;  3CCS A;  5GJW B;  1JXM A;  1ZQ1 A;  3VS1 A;  4ATO A;  1B34 B;  1D1B A;  2ED1 A;  4XTX A;  1S72 A;  5CAI A;  1WHL A;  2ZAE A;  2HZY A;  2K5L A;  3QKJ A;  1PD0 A;  4XU1 A;  3JCM P;  3FC3 A;  4WCI A;  2DX1 A;  4PFZ A;  2B8A A;  2W10 A;  4KRT A;  4C92 A;  4C92 D;  4HXJ A;  4A63 B;  4PJO A;  4PJO D;  3MJX A;  4J9E A;  2DL4 A;  2I0N A;  5FW9 A;  3EG0 A;  2M51 A;  3UA6 A;  1G83 A;  1QWE A;  4HCC A;  3H9N A;  4OMM A;  5EG2 A;  2BZ8 A;  2MPX C;  1WQ7 A;  1G8X A;  1QWF A;  4C5I A;  3TSZ A;  1M4Z A;  2OTL A;  2PNI A;  3JRZ A;  1BKB A;  2XDP A;  4JZ3 A;  2DK3 A;  3LW5 E;  1VQN A;  1YJN T;  4ZGJ B;  5CKH A;  1ZA2 B;  5LJ5 d;  3J81 E;  4Z89 A;  5KYY B;  4DEY A;  1E6G A;  1QLY A;  1D0X A;  4MZT A;  1GCQ A;  1YCS B;  2YUN A;  2MCN A;  1WHJ A;  2LQ8 A;  2VGM A;  2X3X D;  3M57 A;  3RMS A;  4IUQ A;  5IAY A;  2E5K A;  2RN8 A;  3OYH A;  1VUB A;  3R6N A;  4D8D A;  4HCK A;  2A08 A;  2CP3 A;  5GAO q;  4OB0 B;  1Q82 R;  3E1S A;  4HCB A;  3CME Q;  2HAX A;  2DLP A;  2KXD A;  3BE3 A;  3M54 A;  2F2V A;  4JS5 A;  1CKB A;  3CCU Q;  1YHQ T;  4QVZ A;  1ZUK A;  2ZPF B;  4BI8 B;  2CYZ B;  4WTO B;  1YWO A;  2R5M A;  2DYB A;  4X9D A;  3D7S B;  4CRI A;  2RQT A;  1Q86 R;  2VXE A;  1D1C A;  1V29 B;  3LYI A;  2O88 A;  2G6F X;  5CIU A;  7AT1 B;  2ZCF B;  1N6A A;  1UG1 A;  2JS2 A;  4A4E A;  3I5R A;  1JQQ A;  1NM7 A;  3G4S A;  5GMK j;  1VQP T;  1KD1 U;  3HFN A;  2D0Q B;  2QA4 Q;  2DE0 X;  3HFO A;  3MEV A;  3CCQ A;  1TS9 A;  2LJ0 A;  1PSF A;  2EQM A;  2CSI A;  1WJQ A;  1AOJ A;  3QXE B;  3CXC S;  1G3S A;  2AKK A;  5CR2 A;  1Q7Y U;  3DLL A;  3CCS T;  3EG9 B;  3A8M B;  3L2V A;  1UGV A;  1S72 T;  1GCP A;  5A0L A;  3OBW A;  1VQK A;  4HT8 A;  4FU6 A;  3CCE Q;  4TVR A;  1TG0 A;  2DL5 A;  4MML A;  4M4Z A;  3ULR B;  3VUZ A;  4F7U G;  1K0X A;  1EFN A;  3OYE A;  1M30 A;  1WHK A;  3P8D A;  2KXC A;  1LVK A;  4BE1 A;  2E12 A;  1YN8 A;  4EPC A;  4F7U B;  2O9V A;  4M7D E;  1NJI U;  4LUE A;  4DQ2 A;  2OI3 A;  2FRW A;  4J83 A;  2OTL T;  1N8R C;  4V2S A;  2C06 A;  4LDW A;  2AZS A;  2DRK A;  1VQN T;  2COW A;  2AK5 A;  1E6H A;  2JOY A;  1M1K C;  3E9G A;  5IXB A;  1VQ9 A;  1SHG A;  3JCM X;  5FLX E;  3CXC P;  5LJ3 g;  1EX4 A;  4F7U F;  3M4Y A;  1MMG A;  2K6D A;  2DRM A;  1E7O A;  1X2K A;  4RTU A;  2JTE A;  2PU9 B;  3SFM A;  3V7R A;  3CCL Q;  3PIO A;  4C8Q G;  5J3B A;  2L3P A;  1VOM A;  2VC8 A;  1OQK A;  2EYQ A;  2FHD A;  3H0I A;  1MMN A;  2XI9 A;  1VYT A;  3OS5 A;  3R6O A;  1NZ9 A;  4C8Q B;  2LCL A;  2QQR A;  9ATC B;  1ZUU A;  3ER0 A;  3QG1 A;  4NS5 A;  3M0T A;  1IGQ A;  3QSU A;  3M4G A;  4JUV A;  4PLI A;  1WX6 A;  3PFS A;  1VQ4 Q;  3OYN A;  1ZHI A;  2GFA A;  1AZE A;  4OMO A;  1M3B A;  1RL2 A;  3JAM E;  2DZC A;  5KYU A;  1TXQ A;  2FZK B;  3CC4 A;  4C8Q F;  1Q81 R;  3EH2 A;  3G4S T;  1HSQ A;  2KEA A;  2VV5 A;  2PUK B;  3V8J A;  3CCM A;  4LN2 A;  2K3X A;  3MP6 A;  3CCQ T;  2COZ A;  2QQA A;  2ED0 A;  3S3O A;  4N0A A;  3L42 A;  3OYI A;  3GNG A;  4Z88 A;  1DJ7 B;  1OZ3 A;  2GQI A;  2GCX A;  3PVQ A;  2ATC B;  2LCC A;  4M7D B;  4AFU C;  2E1H A;  4M78 G;  1VQK T;  3CMA Q;  3QYG B;  4Y92 A;  1OU8 A;  1JXO A;  3OSS C;  2JZ2 A;  1K0S A;  3VYH B;  4B9X A;  3MO8 A;  2LX7 A;  5GAN d;  4QQ6 A;  2KR3 A;  4PJO E;  3RKX A;  4RTX A;  1I07 A;  1OU9 A;  3VS0 A;  3JCM d;  3C0C A;  2ZPH B;  4M78 B;  4R55 A;  1TOV A;  5GAN 5;  4LUD A;  5CKB A;  4E6R A;  2YLC A;  1KSW A;  2D8J A;  4OML A;  1ABQ A;  3MPU B;  3QZ5 B;  5L8R E;  5A2Q E;  2KDS A;  1VQ6 A;  3GP8 A;  2ZZD A;  2F2W A;  4QT7 A;  1Y96 A;  3VS3 A;  1PHT A;  2QDL A;  4LDV A;  1UE9 A;  4X1V A;  5GAM d;  2NUP B;  1OI1 A;  4M78 F;  3CME T;  4JJD A;  1KG1 A;  1RLQ C;  2BE9 B;  2IVW A;  2L3Q A;  1MMA A;  1VQ9 T;  1PRL C;  2LTO A;  2O01 E;  3CCR A;  2VVK A;  1YIT A;  2R58 A;  1BI0 A;  1GFC A;  2D9T A;  2O4X A;  4A4K A;  1K76 A;  5GAO m;  4FYV B;  2HBP A;  2YUQ A;  1B7T A;  2WSF E;  2MYS A;  3VYG A;  1OOT A;  4D8K A;  1IHW A;  1IGU A;  4BD3 A;  3UT1 A;  4C5H A;  4QVD A;  2DZ9 A;  4EMK B;  2XKO C;  3E9F A;  3JCM b;  2KRO A;  4A4G A;  4M75 A;  3OQ5 A;  4M75 D;  4IUR A;  3L2U A;  2L5Q A;  4JPB W;  2RHX A;  4FL6 A;  3SWN A;  1G3Y A;  4BY6 B;  1WHG A;  4QKU A;  1KQS P;  3GNF B;  4UC4 A;  4BDY A;  1VQM Q;  1M1K U;  1UDL A;  4PK4 A;  4C92 G;  3NTI A;  4PFO A;  3M5A A;  4Z02 A;  2R57 A;  2P0Q A;  2LZ6 B;  1VQ5 A;  3CC2 Q;  1RAD B;  2HQE A;  3CC4 T;  1I8F A;  2GBQ A;  4C92 B;  4J5Y A;  1RAG B;  2RK2 A;  1YJ9 A;  1BCO A;  4OP0 A;  1WXU A;  1G3T A;  4Y28 E;  2YUO A;  2X51 A;  5CVI A;  4F14 A;  1QP3 A;  5I2M A;  3LGL A;  2CP7 A;  1Y7X A;  1TTH B;  3G7Z A;  5GMK e;  2J7I A;  1D0Y A;  5J39 A;  2WSE E;  1YHQ Q;  3UF4 A;  4C5E A;  1D0Z A;  2CZ6 B;  4ZN1 A;  3JB9 G;  3OYB A;  5HK3 A;  3BDU A;  3TU4 K;  1BCM A;  2YHT A;  5GAO n;  8AT1 B;  2RNA A;  1UJ0 A;  1VQP Q;  1ARK A;  1D09 B;  1QKW A;  2HNI A;  3C95 A;  2K57 A;  4F04 B;  1B3Q A;  1K8A U;  4KH0 B;  1VQ6 T;  1R0C B;  2CRE A;  3EFR A;  4HVV A;  3G6E Q;  5C6S A;  1YJW A;  3CCS Q;  1IHV A;  2GF7 A;  1S72 Q;  4IIO A;  1X27 A;  3L2W A;  3JB9 F;  2Y4X A;  5LJ5 f;  3CCR T;  1YIT T;  2X9H A;  4C8Q C;  2ZPG B;  1BI2 A;  3JV3 A;  3GLX A;  3REB B;  2CT4 A;  1I4K 1;  3PMI A;  3TSW A;  2KQW A;  4P5N A;  5KCO A;  4RCC A;  4OGC A;  1J3T A;  1MMD A;  4PJM A;  2OTJ A;  1KQS A;  1EZZ B;  4OMP A;  2A0F B;  4PKC C;  2OTL Q;  2EYZ A;  3L2Z A;  1JO8 A;  1YWP A;  3QII A;  1ZSZ A;  3MEW A;  1VQN Q;  2CH4 W;  5I21 A;  2FPF A;  1N9R A;  1Q7Y C;  2K3B A;  3OYK A;  3EGX A;  4FCY A;  4HVU A;  1T0J A;  1VQ5 T;  4JS4 A;  1OX9 A;  2A36 A;  1VQ7 A;  5GMK h;  1OV3 A;  1UTI A;  1X01 A;  1BYM A;  5FU7 B;  3CD6 A;  3KXT A;  1YJ9 T;  2F5T X;  2RD1 A;  2GGR A;  4HCZ A;  5DM7 R;  3X28 B;  4DOV A;  1Z9Q A;  1A0N B;  1SKU B;  4M78 C;  5KYW A;  8ATC B;  2CZ1 B;  4A4F A;  2KT1 A;  4LD6 A;  2E4H A;  4KT0 E;  1PG5 B;  2FVU A;  3EG2 A;  1AT1 B;  2FEI A;  3ZBD A;  3RBB B;  1M90 R;  3A8H B;  3OYJ A;  1LNX A;  1AWX A;  3M0U A;  5D7U A;  2DIQ A;  5GJV B;  5GAN 2;  4AMC A;  4ORZ A;  2O31 A;  1K9A A;  5CK9 A;  4HA8 A;  4PLL A;  2X4W A;  1IZ6 A;  1PRM C;  2CUD A;  3G4S Q;  1Q81 C;  3CPF A;  1WHM A;  4IUU A;  3JSC A;  1Q82 U;  3GF5 A;  1ZX6 A;  1Q95 G;  3CCQ Q;  2XDD A;  2NWM A;  1WXT A;  2DTO A;  4XU3 A;  3E19 A;  5CQY A;  1YJW T;  2DIL A;  4J9H A;  4DBF A;  4M77 A;  4LNP A;  4M77 D;  5C0M A;  3JCM Q;  1WPY A;  2DTI A;  4RTT A;  1YP5 A;  3CEY A;  3NGP A;  3M9Q A;  2L3S A;  1RAB B;  2KY9 A;  1UB4 A;  5IN1 A;  4J7F A;  2EJ9 A;  4RG8 A;  1VQK Q;  1M2O A;  4J6W A;  2J6K A;  1VQM T;  2QEX A;  2DBM A;  4BY6 C;  2E3H A;  4EDU A;  4C0Z A;  4L59 A;  5AYF A;  3OS2 A;  2CS7 A;  2E70 A;  4E7I A;  1M3C A;  2QGF B;  4XU0 A;  3CC2 T;  4M75 E;  2X4X A;  1U8R A;  1RAA B;  1LOJ A;  2OTJ T;  4R0K A;  4OMF B;  2KT8 A;  2XHC A;  3RDV A;  4M7A A;  3A5Z B;  4M7A D;  1SSH A;  1TUD A;  4QQG A;  4JZ4 A;  5I22 A;  2KBT A;  4MDW A;  3J7A F;  4C92 C;  2X4J A;  1ZUY A;  1NG2 A;  2V8J A;  5LJ3 d;  3OY9 A;  3QJY A;  3TVT A;  1VQ9 Q;  4JJN K;  1UHC A;  2EFI A;  1Z9Z A;  2VB6 A;  2RHI A;  1K73 R;  5LJ5 j;  2P84 A;  1WXB A;  1VQ7 T;  1TU0 B;  4BAC A;  1KC8 C;  2SRC A;  1QVP A;  4FT4 A;  3CD6 T;  4E7L A;  3UPU A;  1M2V B;  1T3L A;  5FRO A;  1U3O A;  2DA9 A;  1D1A A;  1H92 A;  3PTA A;  3VS5 A;  3VUB A;  2J6F A;  3HRS A;  3NFC A;  4E47 A;  1UUE A;  2KVQ G;  3M0Q A;  3G6E T;  1Y96 B;  4N4G A;  4K11 A;  4AFQ C;  3I56 A;  3HSB A;  2XG8 D;  2KAF A;  4A54 A;  3PVL A;  2DL3 A;  4DBR A;  5CQX A;  2CKK A;  3CCJ A;  1YIJ A;  2KYB A;  3OW2 P;  4ZGE B;  5GAN f;  2D1X A;  4BB7 A;  3JCM f;  3CC4 Q;  3EHQ A;  2O4X B;  2FPE A;  3C4S A;  2LQK A;  2E5Q A;  2JTF A;  5CCA A;  4MMK A;  2J06 A;  3CCM Q;  1PM3 A;  1NLP C;  2YXY A;  4O5V A;  4NL2 A;  1TH7 A;  4AFS C;  4ME7 A;  2QTX A;  3HP9 A;  4EIK A;  2YSQ A;  4M75 B;  1X6O A;  4IUP A;  2ESW A;  2VXF A;  1H64 1;  3OMG A;  5FWC A;  5GAM f;  3I55 A;  3JB9 J;  1FMV A;  4FYW B;  2DIG A;  5LJ5 g;  2QEX T;  1M1F A;  1QMC A;  4J9B A;  2FYK A;  3MCA B;  1AD5 A;  1VYU A;  2JM9 A;  2DAQ A;  1KD1 R;  4KGX B;  1Q81 U;  1NYF A;  3M56 A;  2GQV A;  1VQ8 A;  3P8H A;  3M55 A;  4OB2 B;  1BI3 A;  2GTJ A;  2ECZ A;  1TWB A;  1HK9 A;  1VQ6 Q;  4OMQ A;  5GMK m;  3WVE B;  2DTH A;  1JB0 E;  3EGD A;  2FL7 A;  3I35 A;  2JS0 A;  3L2Q A;  1KIK A;  5FU7 C;  2G3R A;  3CCV A;  2P0K A;  2DJZ A;  3BFM A;  1GRI A;  3CCR Q;  1YIT Q;  1WFW A;  3FJP A;  1RAF B;  2JMC A;  5I11 A;  1OPK A;  4OVA A;  4O6J A;  2K4Y A;  4BE2 A;  5GMK l;  4IKF A;  2E6N A;  3VRY A;  3FJ5 A;  2I2L A;  2YDL A;  3OSV A;  3OYY A;  1QVF A;  2WAC A;  3FB9 A;  3J80 E;  2RHU A;  2CP6 A;  2ZPE B;  3HKS A;  2JMA A;  2LVM A;  4M7D G;  3SDZ A;  2LNH B;  3E2U A;  1K8A C;  2A37 A;  3P8B B;  2YRC A;  3I56 T;  3OW2 A;  2PQW A;  1W6X A;  1PCX A;  1WLP B;  3QDF A;  3CCJ T;  4R56 A;  1YIJ T;  4BE0 A;  2CGH A;  1PSE A;  1UGP B;  3DKM A;  1VQ5 Q;  2JXB A;  2L2P A;  1NLO C;  1KC8 U;  3QDR B;  5D6W A;  4E2F B;  1QQJ A;  2AT1 B;  3REA B;  4KUI A;  1YJ9 Q;  1NYG A;  3O8V A;  2CZ0 B;  3EFO A;  2RA2 A;  4HKE A;  1ZBJ A;  3A8G B;  3MEU A;  2QYZ A;  4M77 E;  4M7D F;  1KQS S;  1OX8 A;  2HQH A;  2VYT A;  1R8O B;  3RNJ A; 
#chains in the Genus database with same CATH homology
 2COY A;  2E4H A;  2QK0 A;  3TQ7 P;  2M02 A;  1WHG A;  2CP3 A;  2E3I A;  2CP6 A;  2CP2 A;  1WHM A;  3RDV A;  2CP5 A;  2COZ A;  2COW A;  3E2U A;  1WHH A;  1WHK A;  1TOV A;  1WHL A;  2E3H A;  2HKN A;  4B6M A;  1WHJ A;  2Z0W A;  2MPX C;  1TXQ A;  2HL3 A;  1IXD A;  2CP0 A;  1LPL A;  2CP7 A;  2HQH A;  2HKQ B;  2HL5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...