2COYA

Solution structure of the cap-gly domain in human dynactin 1
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
112
structure length
112
Chain Sequence
GSSGSSGMAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynactin-1
publication title Solution structure of the CAP-Gly domain in human Dynactin 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 8
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2coyA01
1WHHA 1TXQA 3TQ7P 2CP2A 2CP5A 2E3IA 2HQHA 2COZA 2HKQB 3RDVA 3E2UA 4B6MA 2CP7A 2QK0A 2CP3A 2HKNA 2HL5C 2COYA 1TOVA 2HL3A 1WHKA 1WHMA 1IXDA 2Z0WA 1WHJA 2M02A 2CP6A 1LPLA 2E4HA 1WHLA 1WHGA 2COWA 2MPXC 2E3HA 2CP0A
chains in the Genus database with same CATH superfamily
2GQIA 3VS3A 1AEYA 1T0JA 3INZA 1N8RR 5L23A 4C5GA 1TS9A 1VQNA 2RQUA 4CC2A 1ZSGA 1ZQ1A 2P0PA 4A4GA 3GBQA 4N4HA 1BCMA 2RHUA 4M7DA 3OYEA 2NYSA 2LX9A 3VUZA 4E6RA 1VQLA 2RI3A 1GRIA 4RG2A 4BY6C 1IZ6A 1ZUUA 5GAMj 3OYNA 2KNBB 3CCVA 4A4FA 4EMGA 4M78B 2ROLA 1VQ8Q 4PJOD 1KHIA 2QAZA 2G6FX 2QI2A 4PKCC 2YRVA 2FZGB 3X24B 3L2RA 1I5LA 4C92A 3CD6T 1CKBA 1AZGB 4J5YA 3OYAA 3ASKA 1QLYA 3JCMJ 1MUZA 2QEXA 4PJMA 3CMET 4AG1C 2ENMA 3JB9H 4FW1A 2VXEA 4WF2A 4PL6A 2JVVA 4Y91A 3A8OB 1ZBXA 4VUBA 5GAMd 2DM1A 1KK7A 2B8AA 1BIAA 1VYUA 4JJDA 1OYXA 4PJOE 5CR2A 2KMTA 1ZX6A 3PT9A 3CCQA 2EGCA 2EJ9A 1H8KA 4L5GA 4DOVA 4KUDK 3CC7T 2EGAA 3MHXA 2RI5A 1YJWQ 1RAGB 4JS5A 2KY9A 1WHHA 5FLXE 3TQ7P 1YWOA 4V2SA 2VYTA 4QQDA 5HY6A 1QW1A 2PVDB 1X01A 1UJ0A 1M2OA 4C8QD 3BDUA 2DERA 4ATOA 1B7TA 1GCPA 4J7FA 4RTXA 4JS4A 5D6YA 3WVEB 2KSSA 4LDUA 3OS0A 2J05A 1S72A 1BB9A 3G4SA 3NTIA 1V1CA 4JRQA 3A5ZB 2D0QB 4ZN1A 2PZ1A 2ZGWA 4J9DA 2DIQA 2DF6A 4NL3A 3SD4A 2KAFA 2YDLA 1AZEA 2D8HA 2EVRA 1SHFA 3DB3A 1EZZB 3M0RA 4A54A 4M75B 3MEVA 1SF9A 2DE0X 2NUTB 3GNGA 4RTUA 2OTJA 2L3QA 4Z8AA 2YRDA 4C0DC 2QTVA 2QQSA 4Z02A 4RTWA 2BUDA 1X6OA 2GTJA 5CKBA 4C8QE 3X20B 1X27A 5KYWA 1VQ4T 1ZBJA 2EAYA 2JTMA 2DIGA 3CCSA 2XDDA 4KH1B 1KQSS 1EX4A 3JB9J 2O9SA 1YBYA 3A8GB 2RF0A 2PTKA 2F2VA 3G71Q 3OYMA 1VYTA 1VQ9Q 2V8JA 3PMIA 3OYIA 1IXDA 3P8BB 3JCMV 1S1NA 1B3QA 1PWTA 1Y57A 3QPHA 2RQWA 1OZ2A 2HKQB 4EMKB 3TSZA 4J7IA 2W0ZA 2HQXA 1KC8U 3EFRA 1FWZA 3BDLA 4E47A 3VYGA 4RCCA 2RB6A 2KGTA 1MHNA 1VQNQ 1GFCA 4PJJA 4X9CA 1LOJA 2EYYA 1HK9A 2J06A 4XQ3A 3EG2A 3BE3A 3AT1B 5GAN2 1WIEA 1XOVA 1ZLMA 2L89A 2X51A 1W4SA 4JLGA 3TSWA 2PVOB 1FYNA 3MPUB 2F5TX 2XDBA 3M0TA 1UGPB 3R6NA 2DXBA 2FYKA 2IG0A 4LXCA 1VQLQ 1T3LA 2DMOA 1FX7A 1WFWA 3RIRA 1JBMA 4M77A 1IGUA 3CPWA 2NWMA 2ZPEB 2QASA 3CCVQ 2DKGA 1JJ2A 4IUUA 4FYYB 1KQ2A 1LNXA 1VIFA 2CP3A 3PGGA 1VQ6A 1YI2T 1A0NB 4QQGA 2C0TA 3KBGA 3JB9I 3NHNA 3PVLA 2CZ0B 1WLPB 4YTLA 3JSCA 4MMLA 1YHQA 4GBQA 3S3NA 3JCMQ 2IIMA 3ER0A 3RMQA 1YIJA 3QDFA 4Y92A 3V7RA 3MEUA 2LTOA 4GLMA 4IUQA 1K9MU 1Y96A 3OSVA 2QEXQ 2DL3A 2QQBA 1G3WA 1B34A 4LN2A 1Q81C 2Y4XA 1T0HA 1ZSZC 3JCMP 2I0NA 2I2LA 4ZNXA 4II1A 1WGSA 2HD0A 1X43A 2QYZA 1SSFA 4XAXB 4PNOA 4Y28E 4BI8B 2XI9A 2RK1A 4A63B 4ZGDB 1K0SA 4C0DB 2L0AA 2X35A 1KQ1A 1K1ZA 5L8RE 2ECZA 2L3SA 5GAOm 3PTAA 2KXDA 2ROTA 3CCQQ 1SKUB 3H6ZA 4FU6A 5KCOA 2CP6A 2E5KA 1X6GA 3RUXA 4F16A 4XK8E 3VUBA 1GCQA 1G83A 2QGFB 4J6YA 1RAAB 4JRIA 4DEXA 4PJOG 4M78G 1K73U 4ZN3A 2QQRA 4IURA 2X4YA 2F5KA 2M9UA 3OB9A 4J9BA 3MEWA 2HQEA 1M2VB 6AT1B 5GMKh 2FVUA 4AT1B 2CH4W 1Y0MA 3QUIA 3MP1A 9ATCB 3C0CA 1MMGA 2FB7A 1BK2A 2OX7A 1YITT 5IH2A 5GANd 4J6XA 1S72Q 3HRSA 4EMHA 2DZ9A 2KK4A 2A37A 4BE0A 4C92C 1JO8A 4OGEA 1HSQA 2KT1A 3OYDA 1M90C 2H3EB 3GNFB 3CXCA 1SRLA 2RJCA 2KR3A 4F04B 3HPWA 2CKKA 5FW9A 2O88A 4CC7A 1UFFA 2QK0A 3S6WA 5J3BA 1K0XA 4EPCA 2EW3A 2LDMA 2MF2A 2OTJQ 1WHJA 2O31A 2DK3A 1C1AA 2ZPFB 4FSSA 4X9DA 5I21A 3OS1A 4BE1A 2DD4A 3HFOA 1QVGA 3EFOB 4BUGA 2EKHA 2HQHA 1AVZC 2ED0A 1RAFB 3ZBDA 5GAMe 1ZA1B 4OMMA 2P84A 3CCSQ 5GAN3 3HKSA 1NM7A 1HJDA 3DKMA 2RNAA 1Z9QA 4PJOF 2RH2A 1OULA 1WXBA 1D3BA 2M0YA 4JJBA 1QWEA 2JJ9A 1WDXA 4C8QG 2ZPHB 3EAEA 4XU0A 2IVWA 4XTZA 1ZUKA 4F7UE 2JUFA 3EGXB 4M7AB 5KYUB 3CMAT 2EBPA 1W70A 5HK3A 5I2SA 2X4XA 1AT1B 2D8JA 1BIBA 4A4HA 5CKFA 4ELZC 1IHWA 3V8LA 1X75C 3GOXA 1W2BA 1M5Q1 3D7SB 5HKCA 1W6XA 2L5QA 4P5NA 3M0QA 4M75G 4FYVB 1M8MA 3DLMA 2LQ8A 1PKTA 2JM8A 1M90U 2AZSA 5KH6A 1K8AC 4D8KA 5I2MA 4E7ZA 1U1TA 5C6SA 3L1AA 1U3OA 2HBPA 3HFNA 2JT4A 2LNHB 2LCLA 4M7DB 4FSXA 1VQ7T 1CSKA 2FHDA 2CZ1B 3VS7A 4J9GA 4D8DA 4EDUA 2QXFA 4N0AC 5LJ3h 5CKEA 3OYBA 4HT9A 4C8QF 2DL4A 1WJSA 5CKHA 2GFUA 3OW2S 3GIBA 5DLQE 2ZPGB 4TVRA 2XD0A 2P4RA 1M3AA 3UA6A 2RQTA 1MMNA 2Y4YA 3RMSA 3CPWP 1VQ6Q 4QW2A 1YJ9T 2RN8A 3JCMd 1YP5A 1YHQQ 1JJ2P 1YIJQ 2RD1A 3CCJT 1YJNQ 2DVEA 3QKJA 4C92B 2DXUA 2MI6A 2K79A 2CH4A 4F17A 1KC8R 1QMCA 2PUOB 1G3YA 2OJ2A 2JS2A 3C94A 1O75A 3CC4A 4RCBA 2A3LA 3M58A 3VYHB 1RADB 1IRXA 1KJWA 1AOJA 1ABOA 3JCMX 7AT1B 3I5SA 2EYWA 3QG1A 1Q86C 2K2VA 5FU7B 2PUKB 1PD0A 2A28A 4J83A 3CCLA 1M1GA 1Z9ZA 2CZ6B 3E19A 1D1BA 1OQKA 2NUPA 5LJ3g 2DTOA 4F14A 4M75C 1VIEA 1AWJA 3CCUA 1KIKA 1PG5B 2QA4A 4M77C 4Z88A 3HHTB 4MZTA 3OS2A 1VQ8T 1TUCA 3M5AA 1PNJA 1Q95G 1MMDA 3Q1JA 2KROA 2XIDA 3VRZA 4AG2C 2K5IA 3JCMb 1E7OA 4KGVB 4OVAA 1QVFA 1K9MR 1V76A 3CBPA 4DQ2A 5GAN7 3THKA 4ORZA 2B86A 3VS1A 2HCKA 1U8RA 5FRMA 1WHLA 1UEBA 1LVKA 4M78D 4Z89A 4IUTA 1JQQA 2DXCA 2LQKA 3QXEB 4J9IA 1M1KC 2V26A 2JN0A 1I81A 3CXCP 2OI3A 2P0KA 2OTLA 4FIBA 1VQ5A 3SWNA 2YLCA 2K7AA 4HCZA 2H8HA 3EG9A 3NGPA 3CC2A 3N5BB 4EMKC 5KYNA 4OGCA 1VQOT 2RPNA 4KRTA 4AFUC 1O9SA 1YJWT 4ME7A 5KYWB 1QVGP 3RERA 4LD6A 1Q86U 5KE3A 5GANf 1KD1C 3JB9D 4PJNA 1K73R 2JTEA 4FT2A 3RR6A 3KUFA 5CIUA 3VV0A 4J8OA 1N9RA 4M78E 5DM7R 2IPOB 2BE9B 1NLOC 1AWWA 3CCET 1WJRA 2V1RA 1AWXA 4QVZA 4LDWA 3H41A 1IGQA 2M0OA 4KULA 1D09B 2KEAA 5GAOn 1JB0E 2QQ9A 3CEYA 5CKDA 3S3OA 4XTUA 5FU6C 2O4XA 4BI3A 1N6AA 3JCMc 4J9HA 4E2FB 2JW4A 1MNDA 2Y90A 4F7UG 4R55A 1YWPA 2EQUA 5J39A 1RAIB 1OZ3A 5GANe 2LRQA 4PFZA 4BACA 3TREA 1W2BP 2HSEB 1TG0A 4B9XA 3UDCA 3OMGA 2DBMA 2MAMA 1RI9A 5GMKm 3LH0A 1PD1A 1M1KU 2JOYA 2FEIA 2XICA 4PLLA 3OW2P 1UJYA 3OA6A 3PNWC 1WYXA 3OYGA 2QTXA 5CQXA 1X2QA 1VYVA 1Q82C 1M8VA 1UTIA 2RM4A 4M75D 2YRCA 2ESWA 1NYGA 4DBRA 4M77B 4PJOA 2EQIA 1M27C 2EQMA 4LUDA 4ZGEB 1GL5A 3CPFA 3HRUA 2FPEA 1OPKA 1K4US 2DJQA 1M4ZA 3EG3A 3VS5A 2YUOA 2BIVA 3NTKA 2RJDA 3LYIA 3M9QA 3CCRA 1YITA 4LDVA 2DJZA 4AFSC 2KI7A 1UB4A 1QKWA 1RAHB 2K5FA 1E6GA 4F7UF 1N8RC 4DA4A 4BE2A 1Y96B 2LQNA 1IHVA 4IKFA 2OAWA 4HA8A 2HSPA 3VRYA 3OQ5A 2GBQA 2Z0WA 1B34B 3RESA 5HCKA 4M75E 3V8KA 2WSCE 3OYKA 3CC4Q 1M90R 1XTDA 4K11A 1EFNA 2D1XA 2MIOA 5KYXA 3V7SA 2KRSA 3DB4A 1IB8A 2DRKA 1X6BA 1P92A 1TSFA 3I5RA 1NYFA 4LD9K 2A0FB 2CT3A 3QHSA 2RHZA 3CCLQ 5GAOp 5LJ5h 1VQ4Q 4OMLA 3JCMf 4R56A 1VQLT 2YUPA 4E7HA 3R6OA 2BZXA 1NPRA 1E6HA 1YNZA 1VQPA 2BKDN 3CCUQ 3CCVT 4HVWA 5GJWB 4C8QA 3E2UA 2QA4Q 5GMKj 4OMQA 2FL7A 5EC7A 2E6ZA 4Q5WA 4J9EA 1LCKA 1B07A 1D0XA 4HT8A 5FU6B 4C92G 4JPBW 4BDZA 1X69A 4ZTFA 1RI0A 2DX1A 2PVGB 1KG1A 3O8VA 4J9CA 5IHKA 2VV5A 2QEXT 3GPLA 4ZTJA 1PM3A 2MCNA 1QQJA 3SB2A 1WZOA 4B6MA 1BYMA 5GAN4 1NZ9A 3JCMe 4N4GA 2W10A 3QJYA 2EQKA 4M7AC 3TEEA 5A0DA 4RTTA 5GAOl 4O6JA 1CKAA 2EIFA 1YJNA 2ZZDA 1R0CB 2OTLQ 2AZVA 1VQ5Q 1I0CA 2KRMA 1SG5A 3PIPA 3CC2Q 3CCQT 3GF5A 3CPWS 3LX7A 5LJ5g 2YSQA 1JJ2S 2GF7A 1VQMA 4OB3B 2C0OA 4E7KA 3FB9A 4HVUA 1NE8A 3I56A 1N5ZA 1OU9A 3VS4A 3J80E 4RUGA 4RG8A 3LGFA 2CS7A 3I55A 1VQKA 1PKSA 2CSQA 1QP2A 2YWWA 1D3BB 1VA7A 3FDRA 2GFAA 2RO0A 2GQVA 1NJIC 2R57A 5IT9E 4M7DC 4J9FA 3UATA 3CCMA 3CBMA 1S72T 3G4ST 4PK4A 4MDXA 3OMCA 3O5ZA 2JZ2A 2A7YA 3G6EA 2DAQA 4C5HA 4AFQC 1XJWB 2AHJB 4PFPA 2GNCA 2X9HA 4DBQA 3OBYA 3OBWA 2OTJT 5GAMf 3RNJA 3QSUA 2DEUA 1RACB 4IIOA 2F1LA 3A1PA 4JUVA 5M9OA 4XTWA 8AT1B 2LNVA 1Q86R 1OU8A 2FO0A 5LJ3j 3JB9G 4O5VA 3CCST 2JNGA 2KRNA 1JRIA 2BTTA 2A36A 1M3CA 4JJNK 4R0KA 2MWPA 3QZ5B 1Q81U 2ABLA 3EGDA 4A4KA 4CI0C 4ESRA 5FU7C 1YN8A 5GAOr 4QT7A 2AKLA 2JM9A 3CXCS 1X2KA 4N4IA 3HRTA 3CCRQ 1YITQ 2KQWA 3EG0A 4M78F 1WHGA 5FROA 2LCSA 4AMCA 1EIFA 3RDVA 2C06A 2ATCB 1QVGS 1PHTA 5LJ3d 4M7AD 4OMOA 2F2WA 3A8HB 4JJCA 2DL7A 3UPUA 1KSWA 3CD6A 3M53A 1H3HA 2F2XA 5GANh 1M1KR 3CQTA 2ZPIB 2AIRB 2YUQA 2LZ6B 3V8JA 3CMEA 2KDSA 2OAUA 5IAYA 3H0FA 8ATCB 3AHUA 3EFSA 3M4YA 2KBTA 3M0PA 3OYHA 1QCNA 2X3WD 1RAEB 3C12A 3RKXA 5GJVB 1VQPQ 4RMOA 4M77G 2NUPB 2PNIA 3EGUA 4LUEA 2HMAA 1JU5C 2CREA 4DEYA 3TCJA 2AT1B 3JCMW 1UGSB 4M7AE 3CC7A 4M7DD 1Y7XA 2BE7D 4OMPA 1VQ6T 1AWOA 1GFDA 2DYBA 3IQLA 1PRLC 1W2BS 1YHQT 2DLPA 1YIJT 2VC8A 1G3SA 2E65A 3MCAB 3LW5E 3X26B 4F7UA 2HEQA 1Q7YC 2DXTA 4OB1B 3H0HA 1BCOA 2MMPA 1R77A 2LMJA 1D1CA 3L42A 2FZKB 5IXFA 2F69A 2GGRA 4C5IA 3M57A 4JLIA 4ANJA 2C0IA 5GANg 2JTFA 2CSIA 3G1JA 4C92D 2K6DA 3MEAA 3EG1A 3E1SA 3SWNB 2DD5A 5LL6S 1NLPC 2DVJA 1ZA2B 4M7DE 4M75F 3EG9B 2NLUA 5EG2A 5GAOq 2EJFA 2L3PA 3QWYA 1VQMQ 2EYQA 1W1FA 2KT8A 3VS0A 2CUBA 3I35A 3I56Q 2RHIA 3I55Q 1VQKQ 1RUWA 1FMKA 2YHTA 3OY9A 2VVKA 2RQRA 2DZCA 1WXUA 1RL2A 1K8AU 3FIFA 4GLKA 3M0UA 1VQ4A 1HD3A 1MV3A 4OMFB 3CCMQ 3CBOA 4C92E 1JXOA 1N27A 2RI2A 2AK5A 1ZSZA 2HDAA 2O4XB 2RA2A 2FRYA 2EYZA 2KYBA 2E4HA 3G6EQ 2COWA 2VGMA 2CP2A 5ECAA 3RKYA 3HL8A 3JCMh 3J81E 4HCKA 4ZGJB 1QP3A 4QKUA 1Q7YU 2VWFA 3UA7A 5FWCA 1TOVA 3META 1ZUYA 1WI7A 1WXTA 2K3XA 5IHIA 3S3MA 4HXJA 1OEBA 3UWNA 2A08A 3NFCA 5IN1A 2HZYA 4IIMA 1D0YA 3FLGA 3ZFJA 5GAN8 2COYA 3OYJA 5GMKe 1QVFS 2HL3A 4PJOB 2EYXA 4XU3A 1OI1A 3MJXA 3URGA 5GMKi 4QQ6A 1NEGA 2O01E 2V1QA 3TVTA 3U23A 2L8DA 3ZL7C 4RKUE 3UT1A 2FRWA 2CZ7B 2R58A 2LQWA 2DPPB 2CT4A 2RK2A 2CYZB 4A4EA 5A0LA 1IREB 2E10A 2XG8D 4KT0E 4IUVA 2DTHA 1AD5A 2SRCA 2V8KA 1GCQC 1Y07A 3E9GA 4CC4B 3MKDA 5GMKl 3EHRA 3L2VA 1YI2A 4XTVA 5KYYA 3JCMg 4X1VA 3M0SA 3M55A 4L59A 3CD6Q 2VXFA 1MV0B 2EFIA 3VS6A 2O9VA 5KYXB 1PC0A 5A0GA 4E7JA 3CMEQ 2CGHA 1VQOQ 2JS0A 5LJ5j 1K9AA 4PJLA 2YXYA 1GBQA 2XMFA 2QGGA 1Q81R 2XU8A 3RBBB 5CVIA 3BFMA 1XQHA 3M54A 3JV3A 1UECA 4BD3A 2CP7A 3QYGB 2RJFA 4A53A 4DBFA 2VASA 1RLPC 2LJ1A 2FG0A 3H0IA 3PVQA 3MP6A 4C8QB 3CCEQ 1LJOA 1I1JA 2J7IA 4B9WA 3CC7Q 2KVQG 2RJEA 5LJ3f 4FM4B 1KC8C 1WQWA 3QDRB 2J6KA 1NJIR 3FJPA 2SEMA 5GAMh 2X4WA 4X34A 4OMNA 4M78A 3L2WA 3G71T 4KBMB 3E9FA 4M77D 1VQ9T 1C6VX 2M1HA 2K4YA 1F1BB 2KE9A 2R5MA 5LJ5d 4M7AG 1KQSA 1R8OB 3P8DA 1R0BG 2L2PA 4LDXA 1QVPA 1KD1U 3CC4T 4DBHA 2EJGA 4MMKA 4L6V5 1G3TA 1TUDA 4MZPA 2K5LA 1UGRB 2ZPBB 3QYHB 1G8XA 2K9GA 2AKKA 3LGLA 1TU0B 4LNPA 4OF1A 2K2MA 4JZ4A 2DL8A 1FMWA 5LJ3e 3CCLT 4N0AA 1OPLA 4XTYA 1BI2A 4C0ZA 4BY6B 2MYSA 1JXMA 1VQNT 2CP0A 1I07A 1UG1A 3A8MB 1HXDA 1TXQA 2LCCA 2QG9B 2VUBA 2LP5A 4M77E 3CCUT 3H8ZA 2QA4T 4OB2B 4M7DG 4KGZB 1K9MC 2YT6A 3GLXA 3OSSC 2X3XD 3VKIA 2JXBA 4GY5A 4NL2A 3I9QA 4JRPA 1YCYA 2LVMA 3REAB 3A98A 3HTRA 1TH7A 4MZMA 2E70A 2P4TA 2M51A 2WSFE 5GAMg 3C4SA 1OV3A 1DJ7B 2O2OA 2VKNA 3VU3C 4UC4A 3QZ9B 2LT4A 4M7AF 2JMAA 1SEMA 4HCBA 1Q82U 3SEMA 2HL5C 2D6FA 4LDYA 2E12A 2R5AA 1LPLA 2LJ0A 3CMAA 2DL5A 2V8IA 4C0FA 1U06A 2E3HA 3DLLA 2E64A 3G7ZA 2OTLT 2H3JA 3EH1A 1VQ5T 1I5OB 1G5VA 3PE0A 2COZA 2QDLA 4ELYC 3CC2T 3L2QA 2JMCA 5KCHA 1QVFP 1JEGA 4M75A 4J6WA 1K73C 2NUTA 1WHMA 3OYFA 2DA9A 2E41A 2NUZA 2E6NA 1N8RU 3FJ5A 5CQYA 4QVDA 3TU4K 1BI1A 4M7DF 2FPDA 1NPPA 3C95A 3V7CA 1U5SA 3EGDB 1K8AR 3WXMB 4BI4A 3P8HA 3MO8A 1VQ7A 2MOXA 2KXCA 3LLRA 1WHKA 4E7IA 3EH2A 1BU1A 1SRMA 1UGQB 1FMVA 2YUNA 5HK0A 3EHQA 1NBEB 1UUEA 2E5QA 4KUIA 2DYIA 1TUGB 2DTIA 1YI2Q 3GP8A 1YJ9A 4C92F 4FCYA 1Q7YR 2M16A 2GTOA 5CK9A 2LT1A 5GANj 3CCJA 4EIKA 1U1SA 4EMKA 2RHXA 1VOMA 3QO3A 1SHGA 3QJ6A 3RKWA 4RTVA 5CAIA 4MDWA 1WJQA 1Y71A 1OX8A 2DILA 4C0GA 1FXXA 4BDYA 1XNIA 3OS5A 1RLQC 5GAN6 1WA7A 1BI3A 2EGEA 3FRNA 3PIOA 1BKBA 5AYFA 4CRIA 1WX6A 2XHCA 3PMTA 2FZCB 3SWNC 4HVVA 3BY7A 2WACA 1VUBA 1GXIE 3CCRT 3M59A 5D6XA 1OOTA 2GCXA 3G4SQ 2L3RA 5C0MA 4PFOA 1N9SA 2XDPA 2EKOA 1YFNA 3VS2A 4OB0B 3F70A 3X28B 3L2UA 1YCSB 1H3ZA 2K3YA 2EQJA 2E3IA 2ZCFB 1VQ8A 4FW2A 4NS5A 4F7UB 2PU9B 1M1FA 4RTYA 1PSEA 4FYXB 3ME9A 2VB6A 1D1AA 5IXBA 2K3BA 2G3RA 2RHYA 3KFVA 1KQSP 1QKXA 1PRMC 1ZHIA 1NJIU 1M9SA 2HKNA 2BZYA 2LX7A 4HCCA 1KFZA 3SHWA 5D6WA 3KXTA 1V29B 3QIIA 4RTZA 1J3TA 1PSFA 5D7UA 1UHCA 3FEOA 1UGVA 5KE2A 4WCIA 1VQPT 2M02A 4QVCA 1TWBA 1M30A 2LJ3A 2FPFA 3NPFA 1H641 1K76A 1D0ZA 4JZ3A 2MK5A 5LJ5f 2K57A 4CC3A 1VQOA 5A2QE 3ULRB 1MMAA 3M56A 4FT4A 3ZEHA 2DNUA 3JB9F 3QWXX 5CCAA 1YJWA 2YLBA 1ACMB 2ZAEA 5FRNA 1UE9A 3NTHA 4HKEA 3LWIA 1MNEA 1UDLA 4JRKA 2HAXA 2DEQA 2BZ8A 3LWHA 2DRMA 3T9NA 1G2BA 1WNLA 4D6WA 3QBYA 5DLOA 1I4K1 1ZSZB 1KD1R 1M2VA 5CO7A 1QWFA 2PQWA 4DOWA 4M78C 2RMOA 3CCEA 4PJOC 1M3BA 1IO6A 1HYOA 4OP0A 4FL6A 4E7SA 4KGXB 2X4JA 3CMAQ 5DY9A 3OW2A 4KH0B 3L2ZA 1NEBA 1NG2A 3M4GA 3H9NA 1YJNT 3JAME 1T3SA 5J26A 2QDYB 5IHNA 3VJPA 1SPKA 5LJ5e 4XU2A 2WSEE 1UHFA 2XKOC 3J7AF 2EWNA 3FC3A 2CDTA 1I8FA 2VGNA 1OX9A 3NMZC 1VQMT 3X25B 2D0NA 4XU1A 3JRZA 4AFZC 4E7LA 3BW1A 3SDZA 3I56T 2DFUA 3I55T 4JDSA 1QCOA 1VQKT 3EFOA 1SSHA 3OYYA 4IUPA 4LE9A 1MGQA 5AT1B 1WQ7A 5FWBA 2HNIA 1BBZA 2CUDA 3OYCA 4PLIA 2J6FA 4M4ZA 2ED1A 1VQ7Q 2DETA 3HSBA 1AHJB 3MP8A 1PCXA 4WTOB 4XTXA 2J6OA 2EPDA 3A8LB 2D9TA 3CCMT 4M77F 1ABQA 1WPYA 2QQAA 5GAN5 1ARKA 1TTHB 2MWOA 2DBKA 3LH5A 4FYWB 5I22A 3WVDB 1BI0A 3G71A 1Q82R 1VQ9A 2LC4A 4NOYA 2DO3A 3G6ET 2XK0A 2MPXC 3EGXA 4M7AA 3HP9A 5I11A 5KYUA 4C8QC 2HBWA 2E1HA 2CP5A 1YJ9Q 4C5EA 3OYLA 2P0QA 4BB7A 1GBRA 5KYYB 3CCJQ 3UF4A 2KYMA 3SFMA 3PFSA 2RQVA 1KHCA 1C0MA 1QCFA 1H92A 3REBB 1RABB
chains in the Genus database with same CATH topology
1WHHA 1TXQA 3TQ7P 2CP2A 2CP5A 2E3IA 2HQHA 2COZA 2HKQB 3RDVA 3E2UA 4B6MA 2CP7A 2QK0A 2CP3A 2HKNA 2HL5C 2COYA 1TOVA 2HL3A 1WHKA 1WHMA 1IXDA 2Z0WA 1WHJA 2M02A 2CP6A 1LPLA 2E4HA 1WHLA 1WHGA 2COWA 2MPXC 2E3HA 2CP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHH A;  1TXQ A;  3TQ7 P;  2CP2 A;  2CP5 A;  2E3I A;  2HQH A;  2COZ A;  2HKQ B;  3RDV A;  3E2U A;  4B6M A;  2CP7 A;  2QK0 A;  2CP3 A;  2HKN A;  2HL5 C;  2COY A;  1TOV A;  2HL3 A;  1WHK A;  1WHM A;  1IXD A;  2Z0W A;  1WHJ A;  2M02 A;  2CP6 A;  1LPL A;  2E4H A;  1WHL A;  1WHG A;  2COW A;  2MPX C;  2E3H A;  2CP0 A; 
#chains in the Genus database with same CATH topology
 2GQI A;  3VS3 A;  1AEY A;  1T0J A;  3INZ A;  1N8R R;  5L23 A;  4C5G A;  1TS9 A;  1VQN A;  2RQU A;  4CC2 A;  1ZSG A;  1ZQ1 A;  2P0P A;  4A4G A;  3GBQ A;  4N4H A;  1BCM A;  2RHU A;  4M7D A;  3OYE A;  2NYS A;  2LX9 A;  3VUZ A;  4E6R A;  1VQL A;  2RI3 A;  1GRI A;  4RG2 A;  4BY6 C;  1IZ6 A;  1ZUU A;  5GAM j;  3OYN A;  2KNB B;  3CCV A;  4A4F A;  4EMG A;  4M78 B;  2ROL A;  1VQ8 Q;  4PJO D;  1KHI A;  2QAZ A;  2G6F X;  2QI2 A;  4PKC C;  2YRV A;  2FZG B;  3X24 B;  3L2R A;  1I5L A;  4C92 A;  3CD6 T;  1CKB A;  1AZG B;  4J5Y A;  3OYA A;  3ASK A;  1QLY A;  3JCM J;  1MUZ A;  2QEX A;  4PJM A;  3CME T;  4AG1 C;  2ENM A;  3JB9 H;  4FW1 A;  2VXE A;  4WF2 A;  4PL6 A;  2JVV A;  4Y91 A;  3A8O B;  1ZBX A;  4VUB A;  5GAM d;  2DM1 A;  1KK7 A;  2B8A A;  1BIA A;  1VYU A;  4JJD A;  1OYX A;  4PJO E;  5CR2 A;  2KMT A;  1ZX6 A;  3PT9 A;  3CCQ A;  2EGC A;  2EJ9 A;  1H8K A;  4L5G A;  4DOV A;  4KUD K;  3CC7 T;  2EGA A;  3MHX A;  2RI5 A;  1YJW Q;  1RAG B;  4JS5 A;  2KY9 A;  1WHH A;  5FLX E;  3TQ7 P;  1YWO A;  4V2S A;  2VYT A;  4QQD A;  5HY6 A;  1QW1 A;  2PVD B;  1X01 A;  1UJ0 A;  1M2O A;  4C8Q D;  3BDU A;  2DER A;  4ATO A;  1B7T A;  1GCP A;  4J7F A;  4RTX A;  4JS4 A;  5D6Y A;  3WVE B;  2KSS A;  4LDU A;  3OS0 A;  2J05 A;  1S72 A;  1BB9 A;  3G4S A;  3NTI A;  1V1C A;  4JRQ A;  3A5Z B;  2D0Q B;  4ZN1 A;  2PZ1 A;  2ZGW A;  4J9D A;  2DIQ A;  2DF6 A;  4NL3 A;  3SD4 A;  2KAF A;  2YDL A;  1AZE A;  2D8H A;  2EVR A;  1SHF A;  3DB3 A;  1EZZ B;  3M0R A;  4A54 A;  4M75 B;  3MEV A;  1SF9 A;  2DE0 X;  2NUT B;  3GNG A;  4RTU A;  2OTJ A;  2L3Q A;  4Z8A A;  2YRD A;  4C0D C;  2QTV A;  2QQS A;  4Z02 A;  4RTW A;  2BUD A;  1X6O A;  2GTJ A;  5CKB A;  4C8Q E;  3X20 B;  1X27 A;  5KYW A;  1VQ4 T;  1ZBJ A;  2EAY A;  2JTM A;  2DIG A;  3CCS A;  2XDD A;  4KH1 B;  1KQS S;  1EX4 A;  3JB9 J;  2O9S A;  1YBY A;  3A8G B;  2RF0 A;  2PTK A;  2F2V A;  3G71 Q;  3OYM A;  1VYT A;  1VQ9 Q;  2V8J A;  3PMI A;  3OYI A;  1IXD A;  3P8B B;  3JCM V;  1S1N A;  1B3Q A;  1PWT A;  1Y57 A;  3QPH A;  2RQW A;  1OZ2 A;  2HKQ B;  4EMK B;  3TSZ A;  4J7I A;  2W0Z A;  2HQX A;  1KC8 U;  3EFR A;  1FWZ A;  3BDL A;  4E47 A;  3VYG A;  4RCC A;  2RB6 A;  2KGT A;  1MHN A;  1VQN Q;  1GFC A;  4PJJ A;  4X9C A;  1LOJ A;  2EYY A;  1HK9 A;  2J06 A;  4XQ3 A;  3EG2 A;  3BE3 A;  3AT1 B;  5GAN 2;  1WIE A;  1XOV A;  1ZLM A;  2L89 A;  2X51 A;  1W4S A;  4JLG A;  3TSW A;  2PVO B;  1FYN A;  3MPU B;  2F5T X;  2XDB A;  3M0T A;  1UGP B;  3R6N A;  2DXB A;  2FYK A;  2IG0 A;  4LXC A;  1VQL Q;  1T3L A;  2DMO A;  1FX7 A;  1WFW A;  3RIR A;  1JBM A;  4M77 A;  1IGU A;  3CPW A;  2NWM A;  2ZPE B;  2QAS A;  3CCV Q;  2DKG A;  1JJ2 A;  4IUU A;  4FYY B;  1KQ2 A;  1LNX A;  1VIF A;  2CP3 A;  3PGG A;  1VQ6 A;  1YI2 T;  1A0N B;  4QQG A;  2C0T A;  3KBG A;  3JB9 I;  3NHN A;  3PVL A;  2CZ0 B;  1WLP B;  4YTL A;  3JSC A;  4MML A;  1YHQ A;  4GBQ A;  3S3N A;  3JCM Q;  2IIM A;  3ER0 A;  3RMQ A;  1YIJ A;  3QDF A;  4Y92 A;  3V7R A;  3MEU A;  2LTO A;  4GLM A;  4IUQ A;  1K9M U;  1Y96 A;  3OSV A;  2QEX Q;  2DL3 A;  2QQB A;  1G3W A;  1B34 A;  4LN2 A;  1Q81 C;  2Y4X A;  1T0H A;  1ZSZ C;  3JCM P;  2I0N A;  2I2L A;  4ZNX A;  4II1 A;  1WGS A;  2HD0 A;  1X43 A;  2QYZ A;  1SSF A;  4XAX B;  4PNO A;  4Y28 E;  4BI8 B;  2XI9 A;  2RK1 A;  4A63 B;  4ZGD B;  1K0S A;  4C0D B;  2L0A A;  2X35 A;  1KQ1 A;  1K1Z A;  5L8R E;  2ECZ A;  2L3S A;  5GAO m;  3PTA A;  2KXD A;  2ROT A;  3CCQ Q;  1SKU B;  3H6Z A;  4FU6 A;  5KCO A;  2CP6 A;  2E5K A;  1X6G A;  3RUX A;  4F16 A;  4XK8 E;  3VUB A;  1GCQ A;  1G83 A;  2QGF B;  4J6Y A;  1RAA B;  4JRI A;  4DEX A;  4PJO G;  4M78 G;  1K73 U;  4ZN3 A;  2QQR A;  4IUR A;  2X4Y A;  2F5K A;  2M9U A;  3OB9 A;  4J9B A;  3MEW A;  2HQE A;  1M2V B;  6AT1 B;  5GMK h;  2FVU A;  4AT1 B;  2CH4 W;  1Y0M A;  3QUI A;  3MP1 A;  9ATC B;  3C0C A;  1MMG A;  2FB7 A;  1BK2 A;  2OX7 A;  1YIT T;  5IH2 A;  5GAN d;  4J6X A;  1S72 Q;  3HRS A;  4EMH A;  2DZ9 A;  2KK4 A;  2A37 A;  4BE0 A;  4C92 C;  1JO8 A;  4OGE A;  1HSQ A;  2KT1 A;  3OYD A;  1M90 C;  2H3E B;  3GNF B;  3CXC A;  1SRL A;  2RJC A;  2KR3 A;  4F04 B;  3HPW A;  2CKK A;  5FW9 A;  2O88 A;  4CC7 A;  1UFF A;  2QK0 A;  3S6W A;  5J3B A;  1K0X A;  4EPC A;  2EW3 A;  2LDM A;  2MF2 A;  2OTJ Q;  1WHJ A;  2O31 A;  2DK3 A;  1C1A A;  2ZPF B;  4FSS A;  4X9D A;  5I21 A;  3OS1 A;  4BE1 A;  2DD4 A;  3HFO A;  1QVG A;  3EFO B;  4BUG A;  2EKH A;  2HQH A;  1AVZ C;  2ED0 A;  1RAF B;  3ZBD A;  5GAM e;  1ZA1 B;  4OMM A;  2P84 A;  3CCS Q;  5GAN 3;  3HKS A;  1NM7 A;  1HJD A;  3DKM A;  2RNA A;  1Z9Q A;  4PJO F;  2RH2 A;  1OUL A;  1WXB A;  1D3B A;  2M0Y A;  4JJB A;  1QWE A;  2JJ9 A;  1WDX A;  4C8Q G;  2ZPH B;  3EAE A;  4XU0 A;  2IVW A;  4XTZ A;  1ZUK A;  4F7U E;  2JUF A;  3EGX B;  4M7A B;  5KYU B;  3CMA T;  2EBP A;  1W70 A;  5HK3 A;  5I2S A;  2X4X A;  1AT1 B;  2D8J A;  1BIB A;  4A4H A;  5CKF A;  4ELZ C;  1IHW A;  3V8L A;  1X75 C;  3GOX A;  1W2B A;  1M5Q 1;  3D7S B;  5HKC A;  1W6X A;  2L5Q A;  4P5N A;  3M0Q A;  4M75 G;  4FYV B;  1M8M A;  3DLM A;  2LQ8 A;  1PKT A;  2JM8 A;  1M90 U;  2AZS A;  5KH6 A;  1K8A C;  4D8K A;  5I2M A;  4E7Z A;  1U1T A;  5C6S A;  3L1A A;  1U3O A;  2HBP A;  3HFN A;  2JT4 A;  2LNH B;  2LCL A;  4M7D B;  4FSX A;  1VQ7 T;  1CSK A;  2FHD A;  2CZ1 B;  3VS7 A;  4J9G A;  4D8D A;  4EDU A;  2QXF A;  4N0A C;  5LJ3 h;  5CKE A;  3OYB A;  4HT9 A;  4C8Q F;  2DL4 A;  1WJS A;  5CKH A;  2GFU A;  3OW2 S;  3GIB A;  5DLQ E;  2ZPG B;  4TVR A;  2XD0 A;  2P4R A;  1M3A A;  3UA6 A;  2RQT A;  1MMN A;  2Y4Y A;  3RMS A;  3CPW P;  1VQ6 Q;  4QW2 A;  1YJ9 T;  2RN8 A;  3JCM d;  1YP5 A;  1YHQ Q;  1JJ2 P;  1YIJ Q;  2RD1 A;  3CCJ T;  1YJN Q;  2DVE A;  3QKJ A;  4C92 B;  2DXU A;  2MI6 A;  2K79 A;  2CH4 A;  4F17 A;  1KC8 R;  1QMC A;  2PUO B;  1G3Y A;  2OJ2 A;  2JS2 A;  3C94 A;  1O75 A;  3CC4 A;  4RCB A;  2A3L A;  3M58 A;  3VYH B;  1RAD B;  1IRX A;  1KJW A;  1AOJ A;  1ABO A;  3JCM X;  7AT1 B;  3I5S A;  2EYW A;  3QG1 A;  1Q86 C;  2K2V A;  5FU7 B;  2PUK B;  1PD0 A;  2A28 A;  4J83 A;  3CCL A;  1M1G A;  1Z9Z A;  2CZ6 B;  3E19 A;  1D1B A;  1OQK A;  2NUP A;  5LJ3 g;  2DTO A;  4F14 A;  4M75 C;  1VIE A;  1AWJ A;  3CCU A;  1KIK A;  1PG5 B;  2QA4 A;  4M77 C;  4Z88 A;  3HHT B;  4MZT A;  3OS2 A;  1VQ8 T;  1TUC A;  3M5A A;  1PNJ A;  1Q95 G;  1MMD A;  3Q1J A;  2KRO A;  2XID A;  3VRZ A;  4AG2 C;  2K5I A;  3JCM b;  1E7O A;  4KGV B;  4OVA A;  1QVF A;  1K9M R;  1V76 A;  3CBP A;  4DQ2 A;  5GAN 7;  3THK A;  4ORZ A;  2B86 A;  3VS1 A;  2HCK A;  1U8R A;  5FRM A;  1WHL A;  1UEB A;  1LVK A;  4M78 D;  4Z89 A;  4IUT A;  1JQQ A;  2DXC A;  2LQK A;  3QXE B;  4J9I A;  1M1K C;  2V26 A;  2JN0 A;  1I81 A;  3CXC P;  2OI3 A;  2P0K A;  2OTL A;  4FIB A;  1VQ5 A;  3SWN A;  2YLC A;  2K7A A;  4HCZ A;  2H8H A;  3EG9 A;  3NGP A;  3CC2 A;  3N5B B;  4EMK C;  5KYN A;  4OGC A;  1VQO T;  2RPN A;  4KRT A;  4AFU C;  1O9S A;  1YJW T;  4ME7 A;  5KYW B;  1QVG P;  3RER A;  4LD6 A;  1Q86 U;  5KE3 A;  5GAN f;  1KD1 C;  3JB9 D;  4PJN A;  1K73 R;  2JTE A;  4FT2 A;  3RR6 A;  3KUF A;  5CIU A;  3VV0 A;  4J8O A;  1N9R A;  4M78 E;  5DM7 R;  2IPO B;  2BE9 B;  1NLO C;  1AWW A;  3CCE T;  1WJR A;  2V1R A;  1AWX A;  4QVZ A;  4LDW A;  3H41 A;  1IGQ A;  2M0O A;  4KUL A;  1D09 B;  2KEA A;  5GAO n;  1JB0 E;  2QQ9 A;  3CEY A;  5CKD A;  3S3O A;  4XTU A;  5FU6 C;  2O4X A;  4BI3 A;  1N6A A;  3JCM c;  4J9H A;  4E2F B;  2JW4 A;  1MND A;  2Y90 A;  4F7U G;  4R55 A;  1YWP A;  2EQU A;  5J39 A;  1RAI B;  1OZ3 A;  5GAN e;  2LRQ A;  4PFZ A;  4BAC A;  3TRE A;  1W2B P;  2HSE B;  1TG0 A;  4B9X A;  3UDC A;  3OMG A;  2DBM A;  2MAM A;  1RI9 A;  5GMK m;  3LH0 A;  1PD1 A;  1M1K U;  2JOY A;  2FEI A;  2XIC A;  4PLL A;  3OW2 P;  1UJY A;  3OA6 A;  3PNW C;  1WYX A;  3OYG A;  2QTX A;  5CQX A;  1X2Q A;  1VYV A;  1Q82 C;  1M8V A;  1UTI A;  2RM4 A;  4M75 D;  2YRC A;  2ESW A;  1NYG A;  4DBR A;  4M77 B;  4PJO A;  2EQI A;  1M27 C;  2EQM A;  4LUD A;  4ZGE B;  1GL5 A;  3CPF A;  3HRU A;  2FPE A;  1OPK A;  1K4U S;  2DJQ A;  1M4Z A;  3EG3 A;  3VS5 A;  2YUO A;  2BIV A;  3NTK A;  2RJD A;  3LYI A;  3M9Q A;  3CCR A;  1YIT A;  4LDV A;  2DJZ A;  4AFS C;  2KI7 A;  1UB4 A;  1QKW A;  1RAH B;  2K5F A;  1E6G A;  4F7U F;  1N8R C;  4DA4 A;  4BE2 A;  1Y96 B;  2LQN A;  1IHV A;  4IKF A;  2OAW A;  4HA8 A;  2HSP A;  3VRY A;  3OQ5 A;  2GBQ A;  2Z0W A;  1B34 B;  3RES A;  5HCK A;  4M75 E;  3V8K A;  2WSC E;  3OYK A;  3CC4 Q;  1M90 R;  1XTD A;  4K11 A;  1EFN A;  2D1X A;  2MIO A;  5KYX A;  3V7S A;  2KRS A;  3DB4 A;  1IB8 A;  2DRK A;  1X6B A;  1P92 A;  1TSF A;  3I5R A;  1NYF A;  4LD9 K;  2A0F B;  2CT3 A;  3QHS A;  2RHZ A;  3CCL Q;  5GAO p;  5LJ5 h;  1VQ4 Q;  4OML A;  3JCM f;  4R56 A;  1VQL T;  2YUP A;  4E7H A;  3R6O A;  2BZX A;  1NPR A;  1E6H A;  1YNZ A;  1VQP A;  2BKD N;  3CCU Q;  3CCV T;  4HVW A;  5GJW B;  4C8Q A;  3E2U A;  2QA4 Q;  5GMK j;  4OMQ A;  2FL7 A;  5EC7 A;  2E6Z A;  4Q5W A;  4J9E A;  1LCK A;  1B07 A;  1D0X A;  4HT8 A;  5FU6 B;  4C92 G;  4JPB W;  4BDZ A;  1X69 A;  4ZTF A;  1RI0 A;  2DX1 A;  2PVG B;  1KG1 A;  3O8V A;  4J9C A;  5IHK A;  2VV5 A;  2QEX T;  3GPL A;  4ZTJ A;  1PM3 A;  2MCN A;  1QQJ A;  3SB2 A;  1WZO A;  4B6M A;  1BYM A;  5GAN 4;  1NZ9 A;  3JCM e;  4N4G A;  2W10 A;  3QJY A;  2EQK A;  4M7A C;  3TEE A;  5A0D A;  4RTT A;  5GAO l;  4O6J A;  1CKA A;  2EIF A;  1YJN A;  2ZZD A;  1R0C B;  2OTL Q;  2AZV A;  1VQ5 Q;  1I0C A;  2KRM A;  1SG5 A;  3PIP A;  3CC2 Q;  3CCQ T;  3GF5 A;  3CPW S;  3LX7 A;  5LJ5 g;  2YSQ A;  1JJ2 S;  2GF7 A;  1VQM A;  4OB3 B;  2C0O A;  4E7K A;  3FB9 A;  4HVU A;  1NE8 A;  3I56 A;  1N5Z A;  1OU9 A;  3VS4 A;  3J80 E;  4RUG A;  4RG8 A;  3LGF A;  2CS7 A;  3I55 A;  1VQK A;  1PKS A;  2CSQ A;  1QP2 A;  2YWW A;  1D3B B;  1VA7 A;  3FDR A;  2GFA A;  2RO0 A;  2GQV A;  1NJI C;  2R57 A;  5IT9 E;  4M7D C;  4J9F A;  3UAT A;  3CCM A;  3CBM A;  1S72 T;  3G4S T;  4PK4 A;  4MDX A;  3OMC A;  3O5Z A;  2JZ2 A;  2A7Y A;  3G6E A;  2DAQ A;  4C5H A;  4AFQ C;  1XJW B;  2AHJ B;  4PFP A;  2GNC A;  2X9H A;  4DBQ A;  3OBY A;  3OBW A;  2OTJ T;  5GAM f;  3RNJ A;  3QSU A;  2DEU A;  1RAC B;  4IIO A;  2F1L A;  3A1P A;  4JUV A;  5M9O A;  4XTW A;  8AT1 B;  2LNV A;  1Q86 R;  1OU8 A;  2FO0 A;  5LJ3 j;  3JB9 G;  4O5V A;  3CCS T;  2JNG A;  2KRN A;  1JRI A;  2BTT A;  2A36 A;  1M3C A;  4JJN K;  4R0K A;  2MWP A;  3QZ5 B;  1Q81 U;  2ABL A;  3EGD A;  4A4K A;  4CI0 C;  4ESR A;  5FU7 C;  1YN8 A;  5GAO r;  4QT7 A;  2AKL A;  2JM9 A;  3CXC S;  1X2K A;  4N4I A;  3HRT A;  3CCR Q;  1YIT Q;  2KQW A;  3EG0 A;  4M78 F;  1WHG A;  5FRO A;  2LCS A;  4AMC A;  1EIF A;  3RDV A;  2C06 A;  2ATC B;  1QVG S;  1PHT A;  5LJ3 d;  4M7A D;  4OMO A;  2F2W A;  3A8H B;  4JJC A;  2DL7 A;  3UPU A;  1KSW A;  3CD6 A;  3M53 A;  1H3H A;  2F2X A;  5GAN h;  1M1K R;  3CQT A;  2ZPI B;  2AIR B;  2YUQ A;  2LZ6 B;  3V8J A;  3CME A;  2KDS A;  2OAU A;  5IAY A;  3H0F A;  8ATC B;  3AHU A;  3EFS A;  3M4Y A;  2KBT A;  3M0P A;  3OYH A;  1QCN A;  2X3W D;  1RAE B;  3C12 A;  3RKX A;  5GJV B;  1VQP Q;  4RMO A;  4M77 G;  2NUP B;  2PNI A;  3EGU A;  4LUE A;  2HMA A;  1JU5 C;  2CRE A;  4DEY A;  3TCJ A;  2AT1 B;  3JCM W;  1UGS B;  4M7A E;  3CC7 A;  4M7D D;  1Y7X A;  2BE7 D;  4OMP A;  1VQ6 T;  1AWO A;  1GFD A;  2DYB A;  3IQL A;  1PRL C;  1W2B S;  1YHQ T;  2DLP A;  1YIJ T;  2VC8 A;  1G3S A;  2E65 A;  3MCA B;  3LW5 E;  3X26 B;  4F7U A;  2HEQ A;  1Q7Y C;  2DXT A;  4OB1 B;  3H0H A;  1BCO A;  2MMP A;  1R77 A;  2LMJ A;  1D1C A;  3L42 A;  2FZK B;  5IXF A;  2F69 A;  2GGR A;  4C5I A;  3M57 A;  4JLI A;  4ANJ A;  2C0I A;  5GAN g;  2JTF A;  2CSI A;  3G1J A;  4C92 D;  2K6D A;  3MEA A;  3EG1 A;  3E1S A;  3SWN B;  2DD5 A;  5LL6 S;  1NLP C;  2DVJ A;  1ZA2 B;  4M7D E;  4M75 F;  3EG9 B;  2NLU A;  5EG2 A;  5GAO q;  2EJF A;  2L3P A;  3QWY A;  1VQM Q;  2EYQ A;  1W1F A;  2KT8 A;  3VS0 A;  2CUB A;  3I35 A;  3I56 Q;  2RHI A;  3I55 Q;  1VQK Q;  1RUW A;  1FMK A;  2YHT A;  3OY9 A;  2VVK A;  2RQR A;  2DZC A;  1WXU A;  1RL2 A;  1K8A U;  3FIF A;  4GLK A;  3M0U A;  1VQ4 A;  1HD3 A;  1MV3 A;  4OMF B;  3CCM Q;  3CBO A;  4C92 E;  1JXO A;  1N27 A;  2RI2 A;  2AK5 A;  1ZSZ A;  2HDA A;  2O4X B;  2RA2 A;  2FRY A;  2EYZ A;  2KYB A;  2E4H A;  3G6E Q;  2COW A;  2VGM A;  2CP2 A;  5ECA A;  3RKY A;  3HL8 A;  3JCM h;  3J81 E;  4HCK A;  4ZGJ B;  1QP3 A;  4QKU A;  1Q7Y U;  2VWF A;  3UA7 A;  5FWC A;  1TOV A;  3MET A;  1ZUY A;  1WI7 A;  1WXT A;  2K3X A;  5IHI A;  3S3M A;  4HXJ A;  1OEB A;  3UWN A;  2A08 A;  3NFC A;  5IN1 A;  2HZY A;  4IIM A;  1D0Y A;  3FLG A;  3ZFJ A;  5GAN 8;  2COY A;  3OYJ A;  5GMK e;  1QVF S;  2HL3 A;  4PJO B;  2EYX A;  4XU3 A;  1OI1 A;  3MJX A;  3URG A;  5GMK i;  4QQ6 A;  1NEG A;  2O01 E;  2V1Q A;  3TVT A;  3U23 A;  2L8D A;  3ZL7 C;  4RKU E;  3UT1 A;  2FRW A;  2CZ7 B;  2R58 A;  2LQW A;  2DPP B;  2CT4 A;  2RK2 A;  2CYZ B;  4A4E A;  5A0L A;  1IRE B;  2E10 A;  2XG8 D;  4KT0 E;  4IUV A;  2DTH A;  1AD5 A;  2SRC A;  2V8K A;  1GCQ C;  1Y07 A;  3E9G A;  4CC4 B;  3MKD A;  5GMK l;  3EHR A;  3L2V A;  1YI2 A;  4XTV A;  5KYY A;  3JCM g;  4X1V A;  3M0S A;  3M55 A;  4L59 A;  3CD6 Q;  2VXF A;  1MV0 B;  2EFI A;  3VS6 A;  2O9V A;  5KYX B;  1PC0 A;  5A0G A;  4E7J A;  3CME Q;  2CGH A;  1VQO Q;  2JS0 A;  5LJ5 j;  1K9A A;  4PJL A;  2YXY A;  1GBQ A;  2XMF A;  2QGG A;  1Q81 R;  2XU8 A;  3RBB B;  5CVI A;  3BFM A;  1XQH A;  3M54 A;  3JV3 A;  1UEC A;  4BD3 A;  2CP7 A;  3QYG B;  2RJF A;  4A53 A;  4DBF A;  2VAS A;  1RLP C;  2LJ1 A;  2FG0 A;  3H0I A;  3PVQ A;  3MP6 A;  4C8Q B;  3CCE Q;  1LJO A;  1I1J A;  2J7I A;  4B9W A;  3CC7 Q;  2KVQ G;  2RJE A;  5LJ3 f;  4FM4 B;  1KC8 C;  1WQW A;  3QDR B;  2J6K A;  1NJI R;  3FJP A;  2SEM A;  5GAM h;  2X4W A;  4X34 A;  4OMN A;  4M78 A;  3L2W A;  3G71 T;  4KBM B;  3E9F A;  4M77 D;  1VQ9 T;  1C6V X;  2M1H A;  2K4Y A;  1F1B B;  2KE9 A;  2R5M A;  5LJ5 d;  4M7A G;  1KQS A;  1R8O B;  3P8D A;  1R0B G;  2L2P A;  4LDX A;  1QVP A;  1KD1 U;  3CC4 T;  4DBH A;  2EJG A;  4MMK A;  4L6V 5;  1G3T A;  1TUD A;  4MZP A;  2K5L A;  1UGR B;  2ZPB B;  3QYH B;  1G8X A;  2K9G A;  2AKK A;  3LGL A;  1TU0 B;  4LNP A;  4OF1 A;  2K2M A;  4JZ4 A;  2DL8 A;  1FMW A;  5LJ3 e;  3CCL T;  4N0A A;  1OPL A;  4XTY A;  1BI2 A;  4C0Z A;  4BY6 B;  2MYS A;  1JXM A;  1VQN T;  2CP0 A;  1I07 A;  1UG1 A;  3A8M B;  1HXD A;  1TXQ A;  2LCC A;  2QG9 B;  2VUB A;  2LP5 A;  4M77 E;  3CCU T;  3H8Z A;  2QA4 T;  4OB2 B;  4M7D G;  4KGZ B;  1K9M C;  2YT6 A;  3GLX A;  3OSS C;  2X3X D;  3VKI A;  2JXB A;  4GY5 A;  4NL2 A;  3I9Q A;  4JRP A;  1YCY A;  2LVM A;  3REA B;  3A98 A;  3HTR A;  1TH7 A;  4MZM A;  2E70 A;  2P4T A;  2M51 A;  2WSF E;  5GAM g;  3C4S A;  1OV3 A;  1DJ7 B;  2O2O A;  2VKN A;  3VU3 C;  4UC4 A;  3QZ9 B;  2LT4 A;  4M7A F;  2JMA A;  1SEM A;  4HCB A;  1Q82 U;  3SEM A;  2HL5 C;  2D6F A;  4LDY A;  2E12 A;  2R5A A;  1LPL A;  2LJ0 A;  3CMA A;  2DL5 A;  2V8I A;  4C0F A;  1U06 A;  2E3H A;  3DLL A;  2E64 A;  3G7Z A;  2OTL T;  2H3J A;  3EH1 A;  1VQ5 T;  1I5O B;  1G5V A;  3PE0 A;  2COZ A;  2QDL A;  4ELY C;  3CC2 T;  3L2Q A;  2JMC A;  5KCH A;  1QVF P;  1JEG A;  4M75 A;  4J6W A;  1K73 C;  2NUT A;  1WHM A;  3OYF A;  2DA9 A;  2E41 A;  2NUZ A;  2E6N A;  1N8R U;  3FJ5 A;  5CQY A;  4QVD A;  3TU4 K;  1BI1 A;  4M7D F;  2FPD A;  1NPP A;  3C95 A;  3V7C A;  1U5S A;  3EGD B;  1K8A R;  3WXM B;  4BI4 A;  3P8H A;  3MO8 A;  1VQ7 A;  2MOX A;  2KXC A;  3LLR A;  1WHK A;  4E7I A;  3EH2 A;  1BU1 A;  1SRM A;  1UGQ B;  1FMV A;  2YUN A;  5HK0 A;  3EHQ A;  1NBE B;  1UUE A;  2E5Q A;  4KUI A;  2DYI A;  1TUG B;  2DTI A;  1YI2 Q;  3GP8 A;  1YJ9 A;  4C92 F;  4FCY A;  1Q7Y R;  2M16 A;  2GTO A;  5CK9 A;  2LT1 A;  5GAN j;  3CCJ A;  4EIK A;  1U1S A;  4EMK A;  2RHX A;  1VOM A;  3QO3 A;  1SHG A;  3QJ6 A;  3RKW A;  4RTV A;  5CAI A;  4MDW A;  1WJQ A;  1Y71 A;  1OX8 A;  2DIL A;  4C0G A;  1FXX A;  4BDY A;  1XNI A;  3OS5 A;  1RLQ C;  5GAN 6;  1WA7 A;  1BI3 A;  2EGE A;  3FRN A;  3PIO A;  1BKB A;  5AYF A;  4CRI A;  1WX6 A;  2XHC A;  3PMT A;  2FZC B;  3SWN C;  4HVV A;  3BY7 A;  2WAC A;  1VUB A;  1GXI E;  3CCR T;  3M59 A;  5D6X A;  1OOT A;  2GCX A;  3G4S Q;  2L3R A;  5C0M A;  4PFO A;  1N9S A;  2XDP A;  2EKO A;  1YFN A;  3VS2 A;  4OB0 B;  3F70 A;  3X28 B;  3L2U A;  1YCS B;  1H3Z A;  2K3Y A;  2EQJ A;  2E3I A;  2ZCF B;  1VQ8 A;  4FW2 A;  4NS5 A;  4F7U B;  2PU9 B;  1M1F A;  4RTY A;  1PSE A;  4FYX B;  3ME9 A;  2VB6 A;  1D1A A;  5IXB A;  2K3B A;  2G3R A;  2RHY A;  3KFV A;  1KQS P;  1QKX A;  1PRM C;  1ZHI A;  1NJI U;  1M9S A;  2HKN A;  2BZY A;  2LX7 A;  4HCC A;  1KFZ A;  3SHW A;  5D6W A;  3KXT A;  1V29 B;  3QII A;  4RTZ A;  1J3T A;  1PSF A;  5D7U A;  1UHC A;  3FEO A;  1UGV A;  5KE2 A;  4WCI A;  1VQP T;  2M02 A;  4QVC A;  1TWB A;  1M30 A;  2LJ3 A;  2FPF A;  3NPF A;  1H64 1;  1K76 A;  1D0Z A;  4JZ3 A;  2MK5 A;  5LJ5 f;  2K57 A;  4CC3 A;  1VQO A;  5A2Q E;  3ULR B;  1MMA A;  3M56 A;  4FT4 A;  3ZEH A;  2DNU A;  3JB9 F;  3QWX X;  5CCA A;  1YJW A;  2YLB A;  1ACM B;  2ZAE A;  5FRN A;  1UE9 A;  3NTH A;  4HKE A;  3LWI A;  1MNE A;  1UDL A;  4JRK A;  2HAX A;  2DEQ A;  2BZ8 A;  3LWH A;  2DRM A;  3T9N A;  1G2B A;  1WNL A;  4D6W A;  3QBY A;  5DLO A;  1I4K 1;  1ZSZ B;  1KD1 R;  1M2V A;  5CO7 A;  1QWF A;  2PQW A;  4DOW A;  4M78 C;  2RMO A;  3CCE A;  4PJO C;  1M3B A;  1IO6 A;  1HYO A;  4OP0 A;  4FL6 A;  4E7S A;  4KGX B;  2X4J A;  3CMA Q;  5DY9 A;  3OW2 A;  4KH0 B;  3L2Z A;  1NEB A;  1NG2 A;  3M4G A;  3H9N A;  1YJN T;  3JAM E;  1T3S A;  5J26 A;  2QDY B;  5IHN A;  3VJP A;  1SPK A;  5LJ5 e;  4XU2 A;  2WSE E;  1UHF A;  2XKO C;  3J7A F;  2EWN A;  3FC3 A;  2CDT A;  1I8F A;  2VGN A;  1OX9 A;  3NMZ C;  1VQM T;  3X25 B;  2D0N A;  4XU1 A;  3JRZ A;  4AFZ C;  4E7L A;  3BW1 A;  3SDZ A;  3I56 T;  2DFU A;  3I55 T;  4JDS A;  1QCO A;  1VQK T;  3EFO A;  1SSH A;  3OYY A;  4IUP A;  4LE9 A;  1MGQ A;  5AT1 B;  1WQ7 A;  5FWB A;  2HNI A;  1BBZ A;  2CUD A;  3OYC A;  4PLI A;  2J6F A;  4M4Z A;  2ED1 A;  1VQ7 Q;  2DET A;  3HSB A;  1AHJ B;  3MP8 A;  1PCX A;  4WTO B;  4XTX A;  2J6O A;  2EPD A;  3A8L B;  2D9T A;  3CCM T;  4M77 F;  1ABQ A;  1WPY A;  2QQA A;  5GAN 5;  1ARK A;  1TTH B;  2MWO A;  2DBK A;  3LH5 A;  4FYW B;  5I22 A;  3WVD B;  1BI0 A;  3G71 A;  1Q82 R;  1VQ9 A;  2LC4 A;  4NOY A;  2DO3 A;  3G6E T;  2XK0 A;  2MPX C;  3EGX A;  4M7A A;  3HP9 A;  5I11 A;  5KYU A;  4C8Q C;  2HBW A;  2E1H A;  2CP5 A;  1YJ9 Q;  4C5E A;  3OYL A;  2P0Q A;  4BB7 A;  1GBR A;  5KYY B;  3CCJ Q;  3UF4 A;  2KYM A;  3SFM A;  3PFS A;  2RQV A;  1KHC A;  1C0M A;  1QCF A;  1H92 A;  3REB B;  1RAB B; 
#chains in the Genus database with same CATH homology
 1WHH A;  1TXQ A;  3TQ7 P;  2CP2 A;  2CP5 A;  2E3I A;  2HQH A;  2COZ A;  2HKQ B;  3RDV A;  3E2U A;  4B6M A;  2CP7 A;  2QK0 A;  2CP3 A;  2HKN A;  2HL5 C;  2COY A;  1TOV A;  2HL3 A;  1WHK A;  1WHM A;  1IXD A;  2Z0W A;  1WHJ A;  2M02 A;  2CP6 A;  1LPL A;  2E4H A;  1WHL A;  1WHG A;  2COW A;  2MPX C;  2E3H A;  2CP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...