5GANf

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ganf00
3L1AA 4DQ2A 4X9CA 4EMKC 5GAOm 5LJ3h 5GMKe 2K57A 4M77G 4M7DB 5GAN3 1WQ7A 3RKYA 5GAN8 2VC8A 4JRKA 2E64A 4V2SA 5GAMf 4NL2A 2Y90A 4C92C 4EMKA 3JB9G 3JB9F 4XU1A 2EAYA 3JCMV 5LJ5d 2DXUA 2E41A 4M77B 2DTIA 1U1SA 5GAN7 4XTVA 4XU2A 4PJOD 4XTWA 4PJOC 4M7DC 3HFOA 3V7RA 5GAMj 1LJOA 1M8VA 4C92F 3JB9H 5LJ5f 1M5Q1 2JN0A 4XU0A 1JRIA 3EFSA 3FIFA 3QSUA 3L2ZA 4PJOA 4WF2A 3SB2A 4M7DA 3JCMe 3PGGA 4M77C 4JLIA 4M75B 2DZCA 4M78B 3SWNB 4M7DF 2EJFA 2FYKA 3JCMW 5GAOq 3M4GA 5LJ5j 5GAMg 4QVCA 3RESA 1B34B 3V7SA 1Y96A 1YCYA 3BY7A 4C92D 2DEQA 1N9RA 4M77F 4C92E 4HT9A 3JCMX 5GANg 4F7UG 1TH7A 3INZA 3V7CA 1H641 4A53A 2E1HA 3BDUA 3QO3A 5DY9A 4M7DD 4PJOE 5LJ5g 4M7DE 5GAN2 4PNOA 3QHSA 2E65A 4N0AC 5LJ3e 1I8FA 5GAN4 3JCMQ 4J5YA 5GANf 2RB6A 4F7UB 4M75G 2YLCA 4M75F 4M78G 4C92A 5GAOn 3JB9J 4C8QG 1I5LA 1WQWA 4N0AA 2EJ9A 4M77E 4X9DA 3HSBA 4J6WA 1X01A 3V8KA 3JCMc 5GAMd 1U1TA 5GANj 4QVDA 3JB9D 3RUXA 4C8QB 2YHTA 5GAMh 2YLBA 1N9SA 2DKGA 2EWNA 3JCMb 2DXTA 4M77A 3AHUA 4XTUA 4M7AG 4NL3A 5GMKj 5LJ3f 3HFNA 2DTHA 4F7UA 5CAIA 1HXDA 4A54A 4EMGA 3RIRA 5GMKi 4F7UF 4M75C 3FJPA 4M78C 3SWNC 3JCMg 1KQ1A 4OP0A 4C8QC 2DJZA 5LJ5h 5GAOr 1D3BB 4M7AB 1WPYA 1I81A 4EMKB 5LJ3j 3GIBA 4XQ3A 3JB9I 4M75A 2RM4A 4M78A 3SWNA 3RERA 3FB9A 3JCMf 5GMKh 2DVEA 4M78F 2I2LA 3VU3C 1BIAA 1BIBA 1JBMA 4M77D 4C8QF 2ZGWA 3BW1A 2HNIA 2E10A 1B34A 5GAN6 1WNLA 4J6XA 1I4K1 4XTXA 4NOYA 2DZ9A 4F7UE 5GMKl 5GAN5 3V8LA 4J6YA 4M7AC 5LJ3g 2EJGA 4PJOB 3RKWA 5GAOl 4HT8A 4RCCA 4M75D 1D3BA 3BFMA 3QUIA 4M78D 2DTOA 4JRIA 4M75E 4XTZA 4M78E 3JCMd 4C8QD 5GANd 2VXEA 3JCMJ 4M7AF 3V8JA 4C8QE 3EFRA 4Y91A 4RCBA 3RKXA 5GANh 1Y96B 3JCMh 1HK9A 5I21A 5GAMe 1MGQA 4MMLA 2RA2A 2QTXA 4C92G 4M7AA 4XTYA 1LNXA 4JUVA 4MMKA 1KQ2A 4HA8A 4EMHA 2RD1A 2CGHA 5GANe 4C8QA 4XU3A 1LOJA 4M7AD 4PJOG 4M7DG 2VXFA 4PJOF 4M7AE 5GAOp 3JCMP 4C92B 5LJ3d 5GMKm 5LJ5e 2FB7A
chains in the Genus database with same CATH superfamily
4EMKC 3RBBB 1Q86U 2EQUA 1KQSA 1UHCA 2GNCA 2KYMA 3JB9G 2EAYA 4N4IA 4MDXA 1VQ4Q 3H0HA 3PNWC 1LJOA 2YSQA 4OMOA 1T3LA 3X26B 1YCSB 4PJOA 3CBOA 2RK2A 2EJFA 3GOXA 3M4GA 2HL5C 2OTJT 2LJ0A 2NUPB 5KYWA 1BI0A 4BI4A 5KE2A 3G6EQ 2X9HA 2OI3A 4L6V5 3CC2Q 2CP0A 3GLXA 2E1HA 1K8AC 2HQHA 2E5QA 2DXCA 4M75F 1MMNA 1I5LA 2EFIA 1NYFA 1U1TA 4J8OA 4OMQA 1M3AA 4JJNK 1YI2Q 5DLQE 5J39A 2AKKA 2DXTA 4IUQA 4XTUA 3VS2A 4M7AG 4VUBA 2DL4A 4BUGA 1MMAA 1TTHB 2LRQA 1KC8R 3H9NA 1HYOA 2MWPA 1K9MC 4M7AB 4AMCA 2RM4A 1YWOA 1OOTA 4M78F 3BW1A 2HNIA 2V1RA 3CMET 4F7UE 1I4K1 3HTRA 4ZTJA 2LT1A 4BE2A 4PJOB 1XOVA 1DJ7B 4QKUA 3VUZA 3S3MA 1D3BA 1X2KA 1K73R 1UGSB 3THKA 5KYWB 1D1AA 5FU6B 1M2VB 1KQ2A 4HA8A 1D0XA 4RTVA 3G6EA 2P0PA 2MI6A 2F2XA 3QYGB 4KH1B 1B3QA 5GMKm 2QQSA 2RQTA 2HQEA 1QVFP 2LVMA 2EQMA 5HCKA 2L5QA 1WQ7A 2JXBA 3I55Q 2EGEA 2YUQA 1YITA 2LJ3A 1FX7A 4XTVA 1E7OA 5FRNA 4AG1C 1M30A 1UEBA 2LC4A 3D7SB 1TU0B 2JOYA 3L2ZA 4M7DA 1RABB 2DXBA 4JLIA 2FG0A 2DNUA 3JCMW 1KQSP 1ZBJA 3CCRA 4E7LA 1ZSZA 3CBMA 2KK4A 1QP3A 2XKOC 3JSCA 2GBQA 2YRVA 3G71Q 1D09B 1K9AA 4BACA 4M77E 2RI2A 2ZPGB 3T9NA 3PIPA 5CKHA 3WXMB 1KJWA 4F17A 4DOVA 4IKFA 3J7AF 4DBRA 5CAIA 1BK2A 2EYZA 3CCVT 1VYTA 3OW2A 2RF0A 1M9SA 1F1BB 3I55A 3E9GA 2L3RA 1VQNQ 2ZZDA 1FMKA 1G3TA 1QVPA 5IT9E 4M7AC 1YP5A 4KUIA 3KUFA 5CR2A 1O75A 3QZ5B 6AT1B 1WLPB 3E9FA 1YJWA 2CSIA 2KRNA 1BYMA 3VS4A 2X35A 2WSFE 2DRMA 1W6XA 2RHZA 2JS0A 3FEOA 2CGHA 3CC7Q 4C8QA 3HHTB 2VVKA 1Q86R 1GBQA 5A0GA 1GRIA 3ZFJA 3G71A 2K6DA 4ATOA 4HCCA 5GAOm 3NMZC 3QBYA 1W2BS 3QJ6A 1YBYA 1UFFA 2LMJA 2JVVA 1VIFA 2G6FX 1VQMT 5A2QE 3OYHA 3GF5A 4A4GA 3X25B 4C0DC 1YIJT 1W4SA 1M5Q1 3ME9A 3I56A 4KUDK 2K5LA 2FRWA 2YWWA 3QG1A 4ZTFA 3RDVA 5CO7A 1VQ9T 4JZ4A 1NEGA 3S3NA 2LT4A 2YT6A 2E6ZA 2CH4W 3HRUA 1RI9A 2XICA 2F69A 2X3WD 3CBPA 1RLQC 1VQNA 3QO3A 4ZGJB 5LJ3e 1I8FA 1TUGB 2DMOA 1QMCA 4CC2A 4RG8A 2VYTA 4C8QG 1M27C 1QWFA 3CPWS 4LE9A 2GFUA 1V1CA 5FW9A 4C8QB 1VQ5T 2FO0A 3MP8A 5A0DA 2E5KA 2DE0X 3JCMb 3CC7A 2OAUA 3S3OA 1UTIA 3EG0A 1K76A 1HXDA 1NG2A 1MV0B 2JW4A 2KI7A 1I81A 3OYLA 3JB9I 3SWNA 2QGFB 2XHCA 3CCQQ 1B34A 3MEVA 2XMFA 4J6YA 2M16A 1WA7A 2RHUA 2CH4A 1K4US 2GTJA 3OS1A 2HSPA 4M7AF 3PVLA 2YRCA 1VQ4T 3NHNA 1WGSA 2CUBA 3DLLA 1LPLA 8ATCB 5GANe 4M4ZA 4PJOF 3NPFA 3KXTA 3JCMP 3SD4A 4D6WA 4PFPA 1PHTA 3OSSC 2QXFA 4PJJA 2ZPIB 5GMKe 1ZLMA 2X51A 1C1AA 1YJNA 3CC2T 5GAN3 1RACB 5FU7C 2M51A 2QA4T 2RI5A 4XU1A 2RI3A 3LYIA 5GAN7 1RAGB 4LN2A 2RHXA 3EHQA 2VKNA 5IN1A 2FZGB 1OZ3A 1CKAA 3FIFA 1YI2T 1R8OB 2DZCA 3SWNB 1OU9A 2ZPFB 4QVCA 2BZYA 1AEYA 1M2OA 1B34B 3OYFA 2OTLQ 2DEQA 1N9RA 2RJCA 3G1JA 1TH7A 1H641 4PNOA 2DD5A 4M75G 4C92A 3P8DA 1VQLT 5FRMA 5GJVB 3LH5A 1VYUA 2AK5A 4RUGA 4J9CA 4X1VA 4FSXA 1YHQA 2PU9B 1FXXA 2YLBA 1TXQA 1ZHIA 3CQTA 2K4YA 1GXIE 5CKEA 2GCXA 2RH2A 5D6YA 4C8QC 4DBHA 1KK7A 3L2RA 2QEXA 2CSQA 3FB9A 4FW2A 1CKBA 3KBGA 3BDLA 4NOYA 4FW1A 4PFOA 9ATCB 1NLOC 3TSZA 4HVVA 1W70A 1UGVA 5FLXE 3LGLA 4A4EA 4J7FA 1EZZB 4FYYB 4Y91A 5GANh 4MMLA 2V8JA 4C92G 1EFNA 5C0MA 1Y7XA 2RD1A 2EVRA 1KC8U 4ELZC 3VS7A 2PVOB 4C92B 4ZN1A 4F04B 7AT1B 2ZPHB 2KQWA 4C0GA 2SRCA 2VC8A 1YJ9Q 2DO3A 2KDSA 1K73U 3OS5A 2HZYA 5GAMj 1P92A 4OB2B 1K8AR 2BUDA 4BDZA 4LDYA 2AZVA 3MEUA 1SSHA 1GCQA 4BB7A 5LJ5j 5GAMg 1M3CA 2E6NA 4XAXB 1OPLA 2C0OA 4A4HA 1G83A 3OYEA 5LJ5g 1XQHA 1ZA1B 5LL6S 1AWOA 3CCJQ 2O9SA 3QZ9B 4DA4A 2LCCA 4LUDA 4MZPA 1M1KC 2NWMA 1FYNA 2R58A 2XIDA 3CXCS 4FIBA 2RHYA 1QKXA 1C0MA 4OMMA 1RUWA 4F7UA 4EMGA 4M75C 1GL5A 4X34A 4HKEA 3QWXX 2YXYA 3LGFA 3Q1JA 3JCMf 2ENMA 1YJ9A 1E6GA 5M9OA 1BB9A 4BY6B 4C8QF 2CP3A 4J6XA 1QLYA 5GMKl 3V8LA 1JEGA 3R6OA 1BI1A 4MZTA 2LQWA 3TSWA 4M78D 2JTMA 2YUNA 1VQPA 4M78E 2QYZA 1VYVA 1Q7YC 2K5FA 3EG9A 1G3WA 4IUUA 4MDWA 1VQOA 2PTKA 3JCMh 2CREA 2M1HA 1IB8A 2DJQA 2ROLA 2J6KA 1WXTA 1RAIB 2EYYA 5CKDA 2CKKA 2ZPBB 1U5SA 3L1AA 1QVFA 2C0IA 5GAN8 2VB6A 2GGRA 2L3QA 3OW2S 4C92C 2DYBA 2D6FA 5GJWB 1MNDA 2CUDA 3J80E 2D0QB 1PRMC 1Z9ZA 3UDCA 2JZ2A 1M8VA 4AFZC 4EPCA 1JRIA 2LQKA 1VQ6A 4C5GA 5ECAA 2RK1A 2DVJA 3RESA 4R56A 1WJQA 4RMOA 4C0ZA 1M90R 3INZA 3OBWA 3BDUA 1RAEB 4A4KA 3QHSA 2E65A 2M9UA 3U23A 2RB6A 5DLOA 1RADB 4J9IA 3EG9B 3FJ5A 3CCQT 1AWXA 4FT4A 4N0AA 2ZAEA 5DM7R 3OSVA 1MUZA 2CT4A 1TG0A 2P4RA 2JTFA 3H0FA 3JCMc 5GAMd 2JS2A 3VS0A 3RUXA 1CSKA 3OMCA 5CIUA 3MCAB 2YRDA 2DAQA 1NM7A 1OEBA 1WHJA 2DTHA 5LJ5d 3S6WA 2PVGB 1GFDA 2DLPA 2KE9A 4DBQA 5IAYA 2IPOB 2R5AA 1VOMA 1VQ8Q 2RJDA 1YITQ 4A4FA 2DBKA 1G2BA 1X6BA 5GAOl 2XK0A 3OYGA 1PG5B 3M53A 3BFMA 4XTZA 4DEYA 1ZSGA 1QW1A 3JCMJ 1WDXA 1VA7A 1NLPC 2NLUA 4JUVA 8AT1B 3L2UA 3CCRQ 2CDTA 4PJOG 2RQRA 1U06A 4ZNXA 3OYMA 2OTLT 4IUTA 2D9TA 4FYXB 4CC3A 4EIKA 2VGMA 3CCST 5GAMf 2MAMA 3MJXA 4IURA 1QVGP 1QCFA 1M1GA 2RQVA 3P8HA 1KD1C 2HMAA 2ATCB 1U1SA 3VV0A 4E7KA 4HXJA 3M0QA 3MO8A 4C92F 2P0QA 3JB9H 1GBRA 2KVQG 5IHNA 5LJ5f 1MMDA 1PM3A 2DFUA 1T0HA 1NPRA 2D8HA 3FRNA 4BI3A 2FYKA 1G3YA 3DB3A 4JPBW 3CCEA 3URGA 3N5BB 1YCYA 3QDRB 2XD0A 2H8HA 5L23A 3TQ7P 4C5HA 5HKCA 2C0TA 1VQ8A 4C5IA 2DIQA 3EGDA 3JCMQ 3O8VA 3RMSA 4ELYC 1VQ7T 5GAOn 2FPDA 1Q82C 1PKSA 1R0CB 2QQBA 5IHIA 4WTOB 3JB9D 1V29B 1YJWQ 1V76A 5I2MA 4HCZA 1N9SA 1JXMA 1H92A 3CMAA 1S72T 2LDMA 3FJPA 4OB1B 1U3OA 1D3BB 1OYXA 5LJ3j 1GFCA 2H3EB 4XQ3A 3CCMQ 3NFCA 4M77D 2J6OA 2AZSA 3VS1A 2P0KA 2MCNA 1UG1A 3RR6A 5LJ3g 3A98A 2L89A 5J3BA 1AZGB 1ZBXA 1VQKT 5HK0A 3I56Q 1SHFA 4JDSA 1BCOA 3A8LB 3FDRA 2WSEE 1D1CA 4RKUE 2RN8A 3EGDB 4M7AD 4M7DG 1ABOA 4M7AE 2HSEB 5KYXA 4X9CA 2WACA 4M7DB 2YUOA 4GBQA 4R0KA 2MIOA 4OF1A 2XDBA 3SHWA 3CCJT 3G4SQ 3NTIA 1ZQ1A 2JUFA 1ZSZB 4PJOC 1SKUB 3L2WA 3OYAA 4Y92A 4E2FB 3EH2A 3VUBA 2G3RA 2P4TA 1JU5C 1WZOA 4BE1A 3LWHA 2O31A 1AD5A 2FRYA 5FU6C 3BY7A 3UPUA 2I0NA 3CCMA 1UJYA 2JTEA 3MEAA 1AVZC 4JJDA 4WCIA 3CD6Q 3M57A 2A36A 5GAN4 1N8RC 3HRSA 2DL8A 1JJ2P 1IXDA 1VIEA 4J5YA 3E1SA 2DK3A 4PKCC 4FYVB 3RNJA 1TS9A 1Q81C 1JQQA 1R0BG 3H6ZA 3VRZA 2EBPA 1AZEA 1K8AU 2YHTA 1MHNA 2XDPA 3I9QA 1LCKA 2EWNA 5KYXB 1JB0E 2COZA 2ESWA 5D7UA 3LH0A 1BU1A 1QQJA 4A54A 5GMKi 1MMGA 1X6GA 3M56A 3PFSA 1UGQB 3GBQA 3VRYA 1G8XA 2K3YA 2RMOA 4Z02A 1YJNQ 4LDUA 4MZMA 2ED0A 2LX9A 3A8GB 4ORZA 2JT4A 3EGXA 1JXOA 2XDDA 3G4SA 4CC4B 1E6HA 1HSQA 2DZ9A 5GAN5 3EAEA 3CCUQ 4JRPA 2CP2A 4QQDA 1K9MU 2EQJA 3X28B 2O4XA 3V8JA 2OX7A 1IZ6A 3QYHB 3MP1A 3OYDA 5L8RE 2CZ1B 4MMKA 4C0FA 1OQKA 3CD6A 1YNZA 4YTLA 1N6AA 1OX9A 2VXFA 4O5VA 2CZ0B 2RHIA 5LJ3d 2PUOB 1SG5A 3UWNA 1X27A 3RKYA 1FMWA 3I35A 1EX4A 2JJ9A 2MPXC 1AHJB 2DXUA 4R55A 1K0SA 2VUBA 1YHQQ 1IHVA 4M7DC 3A8MB 1KG1A 2CZ7B 2EYWA 4LD6A 5KYYA 3QXEB 3EFSA 1S1NA 1ZSZC 4IIOA 4CC7A 4J9BA 3G6ET 1B07A 3EGXB 1H3HA 2QEXQ 1M1KR 1KHCA 4A53A 3CC4A 5DY9A 4OGEA 4TVRA 1NJIC 2O4XB 3CCUA 2HAXA 4B9XA 2YLCA 2MWOA 3L2VA 1QVFS 2EYXA 3DB4A 4JS5A 1YITT 2C06A 2LTOA 1UUEA 3HRTA 1UGPB 4KH0B 1I1JA 2AT1B 1ZUKA 2O2OA 5IXBA 2IG0A 3H41A 1UHFA 2K2VA 5LJ3f 4HCKA 4LXCA 1KQ1A 5KYUA 4E7ZA 4LDVA 1M90U 2KRMA 3CCLA 2CYZB 3GIBA 4M78A 2EKOA 2V1QA 3VS5A 1Q7YR 2E3HA 4A63B 2KY9A 2VV5A 4RTXA 5CK9A 4AT1B 1KQSS 4Q5WA 2FVUA 5GAN6 2L0AA 3C4SA 5KYYB 3PMIA 4CRIA 1R77A 3J81E 1FWZA 1X6OA 3ZBDA 4C8QD 4LDWA 4C8QE 1WHMA 4N4GA 1Q86C 2CT3A 2F2WA 2K3XA 4OB3B 1HD3A 2A0FB 2OTJA 1WXUA 1ZUUA 5GAOp 3I55T 3META 3A8HB 1BI3A 1D0YA 4V2SA 2D0NA 1OPKA 2GQIA 4NL2A 1RAAB 4D8DA 1O9SA 4EMKA 1IRXA 5IHKA 4PJLA 2HCKA 3HFOA 5KYUB 2JN0A 3PIOA 4OMPA 2CP5A 1OZ2A 1YJWT 3JCMe 3OYJA 4M7DF 4LDXA 4M78B 4PLIA 3SDZA 2XG8D 2KT8A 2E3IA 2AIRB 3M0SA 1Y96A 2PZ1A 2EW3A 2QQAA 2LCSA 3G71T 3PT9A 1AWWA 1HJDA 1PKTA 1W2BA 2E12A 3CMEA 1EIFA 1OI1A 2RJEA 4UC4A 1T0JA 3M0UA 1PSFA 3I5SA 2DYIA 1VQPQ 1SSFA 1X01A 2K3BA 4N4HA 4QVDA 4KGXB 1VQOQ 1ACMB 1ARKA 4F14A 3I56T 1QKWA 2L3PA 1NZ9A 1AT1B 4RG2A 4NS5A 2EIFA 4OMLA 3RIRA 5D6WA 3SWNC 3QJYA 1PD1A 1WJRA 3VS3A 4EMKB 3CCVQ 1PD0A 3VJPA 1VQNT 1UGRB 1JBMA 4LD9K 1JO8A 2MMPA 3E19A 1K9MR 2HBWA 1Y71A 1M1FA 4E6RA 4M75D 2FEIA 4BD3A 3OB9A 1RL2A 4M75E 1K0XA 1PC0A 3LW5E 2O88A 3F70A 4RCBA 3OYYA 3R6NA 1Y96B 3JRZA 2HDAA 5KCHA 1VQ6Q 2RA2A 2GQVA 3UA7A 3CC7T 3GP8A 4QVZA 1WJSA 4XTYA 4KULA 4PK4A 2A08A 1A0NB 3OYIA 3TREA 3M0TA 1M8MA 2OJ2A 4E7IA 3A1PA 2DL5A 2XI9A 2A37A 3QKJA 3UA6A 3LLRA 1G5VA 2FPFA 2E41A 1QVGA 1VQMQ 4XU2A 3OYNA 2M02A 3HL8A 3O5ZA 2E70A 2EPDA 2NYSA 4FYWB 1M3BA 1TUCA 3ER0A 4KRTA 3UATA 4FSSA 2DRKA 5D6XA 1LVKA 1VQ9Q 1ZX6A 3CCVA 4C92D 1Q82R 4C92E 3CPFA 2BE9B 4F7UG 4OGCA 2K2MA 4RTYA 3V7CA 4J83A 2A3LA 3OQ5A 1W1FA 3MHXA 3UF4A 1YJNT 2CS7A 2QI2A 2O01E 4F7UB 2EJ9A 2CP6A 1UDLA 1SEMA 4GY5A 1RAFB 4J9GA 2IIMA 4FM4B 3M59A 4JJCA 4M77A 2DILA 3UT1A 2LCLA 3HFNA 2DERA 2V26A 2RNAA 1W2BP 3LX7A 2XU8A 4F16A 3OY9A 2I2LA 3GNGA 3HP9A 3RMQA 1VQMA 3RKWA 1I0CA 1NEBA 4RCCA 1YIJA 3QUIA 2OAWA 4M7AA 4AFSC 3M54A 1YHQT 3EFRA 1BBZA 2RO0A 4AFUC 1VQ9A 4RTWA 3OBYA 3CCEQ 1LNXA 4HVUA 3ZEHA 4XU3A 1LOJA 1WFWA 2ZPEB 2QEXT 2FZKB 2RQWA 4M77G 2KXCA 3CPWP 1IHWA 2KROA 4BY6C 3WVDB 1M2VA 2Y90A 1Q95G 3PVQA 2HKNA 1RAHB 4M77B 2QA4Q 4BDYA 1UECA 5I22A 1VQ5A 4HCBA 1GCQC 3CMAQ 4P5NA 1N8RR 3C12A 2CP7A 3L2QA 3OS0A 3OYBA 4PJMA 1QCOA 3EFOA 1Q81R 4PL6A 4GLMA 2WSCE 1H8KA 4BE0A 2EQIA 3G7ZA 2QAZA 1JJ2A 2VGNA 3ULRB 4ZGDB 1NYGA 5I2SA 1VQLQ 2A28A 3V8KA 1VQ4A 2KYBA 3AT1B 5GAMh 3SFMA 2LJ1A 3P8BB 2EKHA 3AHUA 1TWBA 3M5AA 3REAB 4J9EA 1YN8A 4QW2A 2ABLA 5LJ5h 1M1KU 2BTTA 1WPYA 1N5ZA 3PTAA 1BIAA 3CC2A 3DKMA 3EG3A 2F5KA 1NPPA 3GNFB 4E7JA 4HVWA 2QA4A 4XTXA 3A5ZB 5IXFA 2QTVA 3HPWA 4C0DB 3DLMA 1UB4A 2RJFA 2PQWA 3EFOB 4RTUA 4FL6A 3MP6A 3CXCA 1YI2A 2ROTA 4E47A 1OX8A 2M0OA 2L2PA 1T3SA 4ZGEB 2GFAA 1IGQA 2JMCA 1Q7YU 1UE9A 2FB7A 1ZA2B 1YJ9T 4JRKA 2K79A 1VQLA 3H0IA 2DTIA 2YDLA 2BE7D 4XTWA 1VQPT 4XU0A 1VQOT 2O9VA 2DBMA 2A7YA 4WF2A 1M90C 1Z9QA 4M77C 1NJIR 1FMVA 5FWBA 2RPNA 5J26A 4AG2C 4L5GA 2X4YA 3V7SA 3IQLA 4AFQC 1WHGA 1C6VX 5CVIA 4PJOD 2HL3A 4IUVA 4JRQA 4PJOE 5GAN2 2FZCB 1SRMA 4N0AC 1Y57A 4PFZA 2GF7A 2EGCA 3KFVA 4DOWA 4OMFB 4X9DA 3HSBA 4J6WA 1PSEA 1KFZA 4GLKA 5GANj 1TOVA 2GTOA 2FL7A 2DEUA 2LX7A 3TU4K 2K7AA 4J9FA 1Y0MA 2KMTA 4IUPA 1MNEA 3QWYA 5GMKj 2E4HA 3EHRA 5GANg 1VQ6T 1IREB 3ZL7C 4F7UF 5KYNA 4OP0A 2JMAA 1MV3A 1BCMA 1YWPA 2P84A 2Y4XA 4J7IA 4Z8AA 3CEYA 5FU7B 3OA6A 5I11A 4OMNA 1KC8C 1M4ZA 2DL7A 5CQYA 1D1BA 2KT1A 2R57A 3VKIA 4EDUA 1WHHA 4ANJA 2VXEA 4B9WA 4RTTA 5A0LA 2W10A 3RKXA 2DETA 4Z88A 1MGQA 2MOXA 2LQ8A 3MKDA 1X75C 2AKLA 3NTHA 4DBFA 5C6SA 1K73C 1PNJA 1U8RA 3CC4Q 1J3TA 2D8JA 2K57A 4JJBA 2KSSA 1UJ0A 2SEMA 4Z89A 2QGGA 3NGPA 3EGUA 2DA9A 3ASKA 3JB9F 3CXCP 2ZCFB 1PCXA 2BIVA 2L3SA 1NE8A 3X24B 3V7RA 3JV3A 3H8ZA 4J9HA 2QK0A 4B6MA 2PNIA 2QDYB 1PRLC 5GAOq 1KD1U 2QQRA 4CI0C 3FLGA 2HQXA 2Z0WA 4JZ3A 3CCLQ 3SEMA 2DX1A 3QIIA 2BKDN 4FCYA 4M77F 4JS4A 3A8OB 4HT9A 3JCMX 3M0RA 3M55A 4M7DD 5CQXA 1ZUYA 4M7DE 5KCOA 5AT1B 1QWEA 5FWCA 4KGVB 1WI7A 2KBTA 1XNIA 1N27A 3EG2A 1B7TA 2R5MA 2HEQA 1H3ZA 4LUEA 4FT2A 1QVGS 2HD0A 2DKGA 2F2VA 1TUDA 4NL3A 2H3JA 2K5IA 2OTJQ 2ECZA 2W0ZA 5KH6A 1Q82U 3JCMg 3CCET 2FHDA 4OB0B 3REBB 3TVTA 2L8DA 3OW2P 2KEAA 4M75A 3RERA 4XK8E 2BZXA 3X20B 1BIBA 1IGUA 1VQ8T 2E10A 2DPPB 2X4XA 1XTDA 4PLLA 2QQ9A 5GANd 1WHLA 1WYXA 4O6JA 2NUTA 4C5EA 4PJNA 2J06A 5I21A 4KGZB 1KHIA 5CKBA 5EG2A 2QTXA 3CMAT 1WX6A 1QCNA 2J7IA 3CCRT 2K9GA 1SF9A 3L42A 1IO6A 2KNBB 2QDLA 4DQ2A 3C95A 5LJ3h 3CMEQ 4QQGA 2JM8A 2E64A 3CCQA 1BKBA 3CCSQ 4D8KA 2LQNA 3JCMV 2HBPA 3FC3A 3I5RA 3E2UA 1WIEA 3TCJA 3QSUA 2JNGA 2PUKB 3SB2A 1RI0A 4M75B 2M0YA 3TEEA 4BI8B 2V8IA 4DEXA 2X4JA 1SHGA 3PMTA 2J6FA 3NTKA 4JLGA 5GANf 2KGTA 2NUTB 4M78G 5IH2A 3JB9J 3M9QA 2B86A 3OYCA 2JM9A 1VQ7Q 2AHJB 2X3XD 4L59A 2Y4YA 1D0ZA 2VASA 1N8RU 5FROA 1XJWB 1KSWA 2EQKA 3M4YA 1S72Q 1Q81U 1PWTA 1WXBA 1X69A 3MPUB 2DJZA 5GAOr 2EYQA 2OTLA 2QG9B 3CCMT 3QDFA 2QASA 1AOJA 5GMKh 2DVEA 3VU3C 3C94A 3CCSA 2ZGWA 2DM1A 1WNLA 5AYFA 1SRLA 4HT8A 2LNVA 3C0CA 2NUZA 2V8KA 4ME7A 2COWA 1JJ2S 4JRIA 5HK3A 4KBMB 3JCMd 3WVEB 4Y28E 4II1A 1VQKQ 4FU6A 3M58A 4KT0E 3OYKA 1Y07A 2F1LA 5CCAA 4EMHA 2KXDA 3OMGA 4E7SA 4QQ6A 2COYA 2KRSA 2FPEA 4ESRA 3M0PA 2CZ6B 5KE3A 2MK5A 3QPHA 1VQ7A 1KIKA 3VYHB 3G4ST 1QP2A 3CPWA 4E7HA 1AWJA 4J9DA 2LP5A 3GPLA 4IIMA 3VYGA 1KD1R 4QT7A 1X43A 1S72A 3PGGA 1TSFA 3VS6A 2D1XA 1G3SA 2PVDB 2HKQB 3CD6T 1OU8A 1OV3A 3PE0A 3EG1A 3LWIA 1K1ZA 3EH1A 5CKFA 4ZN3A 1GCPA 2B8AA 1WHKA 4RTZA 1WQWA 2VWFA 2MYSA 1YIJQ 1VQKA 5EC7A 2X4WA 1NBEB 3BE3A 1VUBA 1NJIU 2DD4A 2F5TX 4M78C 1ABQA 2RQUA 2BZ8A 2J05A 2MF2A 1SPKA 1RLPC 3CC4T 1I5OB 1X2QA 2KR3A 2NUPA 4OVAA 3CCUT 3CCJA 2EJGA 2DIGA 2DL3A 2ED1A 3JAME 2DTOA 1VQ5Q 1I07A 3HKSA 2KAFA 2LNHB 3OS2A 1HK9A 5GAMe 2IVWA 1YFNA 4K11A 5HY6A 2YUPA 4LNPA 2EGAA 3MEWA 1OULA 1BI2A 2LZ6B 5LJ5e 2DF6A 3CCLT
chains in the Genus database with same CATH topology
4EMKC 1Q86U 2ZPHB 2KQWA 1YJ9T 2EQUA 3UWNA 4C0GA 3RKYA 1KQSA 2VC8A 4JRKA 1VQLA 2DO3A 3JB9G 2KDSA 2EAYA 1AHJB 4N4IA 2DXUA 2DTIA 4R55A 1K73U 3OS5A 2VUBA 4XTWA 4M7DC 4MDXA 3A8MB 3PNWC 5GAMj 1LJOA 1P92A 2CZ7B 1KG1A 1VQPT 4LD6A 4OB2B 3X26B 4XU0A 3QXEB 3EFSA 1VQOT 2A7YA 2BUDA 4WF2A 4PJOA 4BDZA 1M90C 4LDYA 4M77C 3CBOA 2RK2A 5J26A 3MEUA 2EJFA 4BB7A 3GOXA 3M4GA 5LJ5j 5GAMg 4L5GA 2X4YA 2E6NA 3G6ET 4XAXB 2OTJT 3V7SA 1BI0A 4BI4A 5KE2A 4A4HA 1KHCA 4L6V5 4A53A 5CVIA 3GLXA 2E1HA 3CC4A 4IUVA 5DY9A 3OYEA 4JRQA 5LJ5g 4OGEA 4TVRA 5GAN2 1XQHA 1K8AC 4N0AC 5LL6S 2E5QA 2O4XB 1NJIC 2GF7A 3CCUA 2HAXA 4B9XA 2DXCA 3QZ9B 2YLCA 4M75F 4DA4A 2MWOA 2LCCA 3L2VA 1I5LA 4DOWA 4OMFB 1QVFS 4JS5A 3DB4A 2EFIA 1YITT 4X9DA 2C06A 3HSBA 2LTOA 4J6WA 1PSEA 4GLKA 4MZPA 5GANj 1U1TA 1M1KC 2FL7A 3HRTA 2R58A 4J8OA 1UGPB 4JJNK 5DLQE 2XIDA 3CXCS 4FIBA 3TU4K 5J39A 2KMTA 4IUPA 2RHYA 2DXTA 4IUQA 4XTUA 4M7AG 4VUBA 2IG0A 5LJ3f 2K2VA 5GMKj 4BUGA 4F7UA 4EMGA 5GANg 1VQ6T 1IREB 4M75C 4F7UF 1KQ1A 4OP0A 2LRQA 4X34A 4LDVA 2MWPA 4HKEA 1M90U 1K9MC 4M7AB 3CCLA 2CYZB 3GIBA 2RM4A 4M78A 2EKOA 3LGFA 3Q1JA 3JCMf 4M78F 2Y4XA 4J7IA 1YJ9A 2KY9A 3CEYA 2VV5A 5FU7B 4BY6B 4C8QF 5CK9A 3BW1A 2HNIA 5M9OA 3OA6A 4Q5WA 1KQSS 2FVUA 5GAN6 3CMET 4F7UE 4J6XA 1I4K1 3C4SA 4ZTJA 5GMKl 2LT1A 3V8LA 3PMIA 4CRIA 3R6OA 4BE2A 4PJOB 1KC8C 1XOVA 1BI1A 1DJ7B 1M4ZA 4MZTA 3J81E 5CQYA 3VUZA 2R57A 1FWZA 1D3BA 4M78D 2JTMA 3VKIA 3S3MA 1VQPA 4EDUA 4M78E 1X6OA 3ZBDA 4C8QD 2VXEA 4LDWA 4B9WA 5A0LA 4C8QE 1Q7YC 2K5FA 4IUUA 1G3WA 4MDWA 3RKXA 1UGSB 1VQOA 4N4GA 3JCMh 1Q86C 2M1HA 1MGQA 5FU6B 2K3XA 2LQ8A 4HA8A 4OB3B 1KQ2A 1X75C 3G6EA 2OTJA 2P0PA 2MI6A 3NTHA 5C6SA 1K73C 3QYGB 5GAOp 5GMKm 2QQSA 2HQEA 1U8RA 5CKDA 2CKKA 2ZPBB 3L1AA 2LVMA 2EQMA 2K57A 2L5QA 1QVFA 3I55T 3META 1WQ7A 3A8HB 5GAN8 2KSSA 1BI3A 4V2SA 3OW2S 4NL2A 4C92C 4EMKA 1O9SA 3ASKA 3JB9F 1YITA 1FX7A 2ZCFB 4XTVA 5FRNA 2BIVA 2D6FA 3X24B 1NE8A 3HFOA 1UEBA 2LC4A 3V7RA 3J80E 2D0QB 3UDCA 1M8VA 2JZ2A 3H8ZA 2JN0A 2JOYA 4EPCA 3PIOA 1JRIA 4PJOE 3L2ZA 1OZ2A 1YJWT 4M7DA 2DXBA 3JCMe 3OYJA 4JLIA 2LQKA 4LDXA 4M78B 4M7DF 2QDYB 4PLIA 1VQ6A 3SDZA 3JCMW 2XG8D 5GAOq 1KD1U 4C5GA 2QQRA 4CI0C 3FLGA 2HQXA 2RK1A 3RESA 4R56A 1Y96A 3QIIA 2BKDN 1WJQA 3CCRA 4M77F 4RMOA 4E7LA 4JS4A 3A8OB 4HT9A 3CBMA 3JCMX 2QQAA 4C0ZA 2KK4A 1QP3A 3M55A 3INZA 3OBWA 3G71T 4M7DD 3BDUA 5CQXA 3PT9A 2XKOC 4A4KA 3JSCA 4M7DE 3QHSA 2E65A 5KCOA 2E12A 1W2BA 2YRVA 3CMEA 1EIFA 2M9UA 2RB6A 5DLOA 1OI1A 2RJEA 3CCQT 4UC4A 4BACA 1PSFA 4FT4A 4M77E 4N0AA 2RI2A 1XNIA 1N27A 2R5MA 1SSFA 5DM7R 1X01A 3OSVA 2ZPGB 3T9NA 3JCMc 2JTFA 4N4HA 4QVDA 5GAMd 3PIPA 5CKHA 3WXMB 4FT2A 1H3ZA 3RUXA 1QVGS 4DOVA 3OMCA 3I56T 2HD0A 5CIUA 4IKFA 3MCAB 1NZ9A 2DKGA 2DAQA 3J7AF 4RG2A 4NL3A 2H3JA 2K5IA 5CAIA 2DTHA 4NS5A 5LJ5d 2EIFA 3RIRA 5KH6A 5D6WA 1Q82U 3JCMg 3SWNC 3S6WA 3QJYA 3CCET 2FHDA 4OB0B 2PVGB 1WJRA 3CCVT 2L8DA 4EMKB 4M75A 3RERA 4XK8E 3OW2A 3VJPA 1M9SA 3X20B 1VQNT 1UGRB 1BIBA 1JBMA 5IAYA 3E9GA 2L3RA 3I55A 4LD9K 1VQ8T 2E10A 2MMPA 2R5AA 3E19A 2ZZDA 1G3TA 2RJDA 1QVPA 5IT9E 4M7AC 4A4FA 1Y71A 2DPPB 2X4XA 1M1FA 4KUIA 1XTDA 2XK0A 3KUFA 5GAOl 4PLLA 3M53A 5CR2A 3OYGA 2QQ9A 1O75A 4M75D 3BFMA 4BD3A 4XTZA 5GANd 3OB9A 1RL2A 3QZ5B 4M75E 1QW1A 3JCMJ 3LW5E 3F70A 3E9FA 3OYYA 4O6JA 4RCBA 1Y96B 1YJWA 4C5EA 3JRZA 5I21A 5KCHA 1BYMA 2RA2A 1KHIA 5CKBA 2GQVA 2QTXA 5EG2A 2X35A 3CC7T 2NLUA 1WJSA 2WSFE 4QVZA 4JUVA 4XTYA 3GP8A 3CCRT 3CMAT 2RHZA 4KULA 3L2UA 3L42A 3FEOA 2CGHA 4C8QA 4PJOG 3OYIA 3TREA 3HHTB 3OYMA 5A0GA 2OTLT 4IUTA 2D9TA 3ZFJA 3G71A 4DQ2A 4ATOA 3C95A 5GAOm 4E7IA 4HCCA 5LJ3h 3QBYA 1W2BS 3QJ6A 1YBYA 2XI9A 2VGMA 3CCST 3QKJA 2JVVA 4QQGA 1VIFA 2E64A 1S72A 5GAMf 2MAMA 3LLRA 1BKBA 4IURA 3CCQA 1G5VA 1VQMT 1M1GA 5A2QE 3P8HA 3OYHA 3GF5A 3JCMV 1KD1C 4A4GA 2E41A 2HBPA 1QVGA 1U1SA 3X25B 3FC3A 4XU2A 4PJOD 3VV0A 4E7KA 4C0DC 3OYNA 1YIJT 3HL8A 1W4SA 3MO8A 4C92F 2P0QA 3JB9H 2KVQG 5LJ5f 1M5Q1 2E70A 3ME9A 3TCJA 3I56A 4KUDK 2K5LA 3QSUA 2JNGA 2PUKB 1NPRA 3SB2A 3FRNA 3QG1A 1RI0A 4M75B 3ER0A 4BI3A 4ZTFA 5CO7A 1VQ9T 3TEEA 4BI8B 2FYKA 1G3YA 3DB3A 2V8IA 2LT4A 5D6XA 3CCEA 3URGA 3S3NA 3N5BB 3CCVA 2X4JA 1YCYA 2E6ZA 3HRUA 3QDRB 4C92D 2XICA 4C92E 2XD0A 2F69A 3CPFA 3PMTA 3CBPA 4F7UG 4OGCA 1VQNA 3V7CA 4C5HA 4J83A 3NTKA 2A3LA 3OQ5A 3QO3A 5HKCA 3MHXA 4ZGJB 1VQ8A 4C5IA 4JLGA 5LJ3e 1I8FA 1YJNT 2CS7A 2DIQA 3JCMQ 2QI2A 5GANf 3O8VA 2O01E 3RMSA 4ELYC 4F7UB 4M78G 4RG8A 1VQ7T 5GAOn 2VYTA 3JB9J 4C8QG 3M9QA 3OYCA 2EJ9A 2QQBA 1Q82C 4GY5A 2AHJB 3CPWS 3JB9D 4L59A 2GFUA 1V29B 2Y4YA 4C8QB 5I2MA 4HCZA 1N8RU 1VQ5T 1N9SA 5FROA 3MP8A 4FM4B 5A0DA 3M59A 3JCMb 3CC7A 2EQKA 4M77A 3CMAA 2OAUA 3S3OA 1S72T 3UT1A 2LCLA 3HFNA 1HXDA 3M4YA 2LDMA 3FJPA 4OB1B 1Q81U 3LX7A 2DJZA 5GAOr 1D3BB 2XU8A 1OYXA 2EYQA 2OTLA 3CCMT 1I81A 5LJ3j 3OYLA 4XQ3A 3JB9I 3SWNA 5GMKh 2DVEA 2XHCA 2I2LA 3NFCA 3VU3C 3OY9A 4M77D 3C94A 3CCSA 2ZGWA 3GNGA 3HP9A 1B34A 3RMQA 1WNLA 2P0KA 5AYFA 3MEVA 1VQMA 4J6YA 5LJ3g 2L89A 2M16A 3RKWA 4HT8A 2LNVA 2RHUA 5J3BA 1ZBXA 3OS1A 4RCCA 2V8KA 5HK0A 4ME7A 1YIJA 1JJ2S 3QUIA 1VQKT 4JRIA 5HK3A 4KBMB 4M7AA 3JCMd 3WVEB 3M54A 4Y28E 4II1A 4M7AF 4FU6A 3EFRA 4JDSA 1YHQT 3M58A 1VQ4T 3A8LB 4KT0E 3OYKA 1Y07A 3FDRA 2RO0A 1VQ9A 1WGSA 3OBYA 5CCAA 2WSEE 1LNXA 4EMHA 3ZEHA 3DLLA 4RKUE 5GANe 4XU3A 1LOJA 3OMGA 4M7AD 4M7DG 4PJOF 4M7AE 3KXTA 4QQ6A 3JCMP 3SD4A 4D6WA 2ZPEB 2QEXT 3OSSC 4X9CA 2QXFA 2ZPIB 2CZ6B 2WACA 5GMKe 1YJNA 4M77G 3CC2T 5GAN3 4M7DB 5KE3A 3QPHA 5FU7C 1VQ7A 4BY6C 4OF1A 3VYHB 3WVDB 3G4ST 1QP2A 2Y90A 3CPWA 2QA4T 2RI5A 4XU1A 2XDBA 3CCJT 3NTIA 1ZQ1A 2JUFA 2RI3A 3LYIA 4M77B 5GAN7 4E7HA 4BDYA 2RHXA 4PJOC 3L2WA 5IN1A 3OYAA 1VQ5A 3GPLA 4HCBA 1OZ3A 3FIFA 3VYGA 4P5NA 3VUBA 2G3RA 2P4TA 3PGGA 1R8OB 3C12A 4BE1A 2DZCA 1YI2T 3SWNB 3L2QA 3OS0A 3LWHA 3OYBA 2ZPFB 4QVCA 1G3SA 2PVDB 5FU6C 1B34B 3OYFA 3BY7A 3UPUA 3CD6T 3CCMA 2DEQA 1N9RA 3MEAA 2RJCA 4PL6A 3LWIA 2WSCE 1Q7YU 3M57A 1TH7A 1H641 5CKFA 5GAN4 4PNOA 4ZN3A 4BE0A 3HRSA 1N8RC 2B8AA 1VIEA 4J5YA 3E1SA 3G7ZA 2DD5A 4M75G 4C92A 1JJ2A 2DK3A 3P8DA 1VQLT 2VGNA 5FRMA 4PKCC 4ZGDB 1WQWA 1Q81C 5I2SA 1VQKA 3V8KA 3H6ZA 2X4WA 4FSXA 1YHQA 1VQ4A 2PU9B 1FXXA 1K8AU 1VUBA 1MHNA 2YHTA 5GAMh 2YLBA 3SFMA 1NJIU 2XDPA 3P8BB 1ZHIA 2EWNA 3AHUA 1JB0E 2K4YA 3LH0A 3M5AA 1GXIE 5CKEA 4A54A 2DD4A 5GMKi 2F5TX 4QW2A 4M78C 2GCXA 2RH2A 3M56A 1UGQB 3PFSA 5D6YA 4C8QC 5LJ5h 1M1KU 3L2RA 1WPYA 2QEXA 2K3YA 4Z02A 2MF2A 3FB9A 3PTAA 4LDUA 4MZMA 1BIAA 3CC2A 3DKMA 2LX9A 3CC4T 2F5KA 1NPPA 3A8GB 3GNFB 3KBGA 2XDDA 4E7JA 3G4SA 4OVAA 3CCUT 2QA4A 3BDLA 4NOYA 2DZ9A 3A5ZB 4XTXA 5GAN5 3EAEA 2EJGA 2DIGA 3CCJA 4JRPA 3HPWA 4C0DB 4QQDA 1K9MU 2EQJA 5FLXE 3DLMA 3X28B 3LGLA 1UB4A 4J7FA 2DTOA 2O4XA 2RJFA 4A4EA 3JAME 2PQWA 3V8JA 3HKSA 4Y91A 2KAFA 5GANh 4FL6A 3OS2A 1IZ6A 3QYHB 3MP6A 3CXCA 1HK9A 1YI2A 3MP1A 5GAMe 3OYDA 4MMLA 5L8RE 2IVWA 2V8JA 4C92G 2CZ1B 5C0MA 1Y7XA 4MMKA 4E47A 4C0FA 2RD1A 2M0OA 5HY6A 1KC8U 3MEWA 3CD6A 4YTLA 1N6AA 1BI2A 2VXFA 4O5VA 4ELZC 2CZ0B 2RHIA 2PVOB 4C92B 5LJ3d 2GFAA 4ZGEB 2PUOB 5LJ5e 3CCLT 4ZN1A 2FB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1A A;  4DQ2 A;  4X9C A;  4EMK C;  5GAO m;  5LJ3 h;  5GMK e;  2K57 A;  4M77 G;  4M7D B;  5GAN 3;  1WQ7 A;  3RKY A;  5GAN 8;  2VC8 A;  4JRK A;  2E64 A;  4V2S A;  5GAM f;  4NL2 A;  2Y90 A;  4C92 C;  4EMK A;  3JB9 G;  3JB9 F;  4XU1 A;  2EAY A;  3JCM V;  5LJ5 d;  2DXU A;  2E41 A;  4M77 B;  2DTI A;  1U1S A;  5GAN 7;  4XTV A;  4XU2 A;  4PJO D;  4XTW A;  4PJO C;  4M7D C;  3HFO A;  3V7R A;  5GAM j;  1LJO A;  1M8V A;  4C92 F;  3JB9 H;  5LJ5 f;  1M5Q 1;  2JN0 A;  4XU0 A;  1JRI A;  3EFS A;  3FIF A;  3QSU A;  3L2Z A;  4PJO A;  4WF2 A;  3SB2 A;  4M7D A;  3JCM e;  3PGG A;  4M77 C;  4JLI A;  4M75 B;  2DZC A;  4M78 B;  3SWN B;  4M7D F;  2EJF A;  2FYK A;  3JCM W;  5GAO q;  3M4G A;  5LJ5 j;  5GAM g;  4QVC A;  3RES A;  1B34 B;  3V7S A;  1Y96 A;  1YCY A;  3BY7 A;  4C92 D;  2DEQ A;  1N9R A;  4M77 F;  4C92 E;  4HT9 A;  3JCM X;  5GAN g;  4F7U G;  1TH7 A;  3INZ A;  3V7C A;  1H64 1;  4A53 A;  2E1H A;  3BDU A;  3QO3 A;  5DY9 A;  4M7D D;  4PJO E;  5LJ5 g;  4M7D E;  5GAN 2;  4PNO A;  3QHS A;  2E65 A;  4N0A C;  5LJ3 e;  1I8F A;  5GAN 4;  3JCM Q;  4J5Y A;  5GAN f;  2RB6 A;  4F7U B;  4M75 G;  2YLC A;  4M75 F;  4M78 G;  4C92 A;  5GAO n;  3JB9 J;  4C8Q G;  1I5L A;  1WQW A;  4N0A A;  2EJ9 A;  4M77 E;  4X9D A;  3HSB A;  4J6W A;  1X01 A;  3V8K A;  3JCM c;  5GAM d;  1U1T A;  5GAN j;  4QVD A;  3JB9 D;  3RUX A;  4C8Q B;  2YHT A;  5GAM h;  2YLB A;  1N9S A;  2DKG A;  2EWN A;  3JCM b;  2DXT A;  4M77 A;  3AHU A;  4XTU A;  4M7A G;  4NL3 A;  5GMK j;  5LJ3 f;  3HFN A;  2DTH A;  4F7U A;  5CAI A;  1HXD A;  4A54 A;  4EMG A;  3RIR A;  5GMK i;  4F7U F;  4M75 C;  3FJP A;  4M78 C;  3SWN C;  3JCM g;  1KQ1 A;  4OP0 A;  4C8Q C;  2DJZ A;  5LJ5 h;  5GAO r;  1D3B B;  4M7A B;  1WPY A;  1I81 A;  4EMK B;  5LJ3 j;  3GIB A;  4XQ3 A;  3JB9 I;  4M75 A;  2RM4 A;  4M78 A;  3SWN A;  3RER A;  3FB9 A;  3JCM f;  5GMK h;  2DVE A;  4M78 F;  2I2L A;  3VU3 C;  1BIA A;  1BIB A;  1JBM A;  4M77 D;  4C8Q F;  2ZGW A;  3BW1 A;  2HNI A;  2E10 A;  1B34 A;  5GAN 6;  1WNL A;  4J6X A;  1I4K 1;  4XTX A;  4NOY A;  2DZ9 A;  4F7U E;  5GMK l;  5GAN 5;  3V8L A;  4J6Y A;  4M7A C;  5LJ3 g;  2EJG A;  4PJO B;  3RKW A;  5GAO l;  4HT8 A;  4RCC A;  4M75 D;  1D3B A;  3BFM A;  3QUI A;  4M78 D;  2DTO A;  4JRI A;  4M75 E;  4XTZ A;  4M78 E;  3JCM d;  4C8Q D;  5GAN d;  2VXE A;  3JCM J;  4M7A F;  3V8J A;  4C8Q E;  3EFR A;  4Y91 A;  4RCB A;  3RKX A;  5GAN h;  1Y96 B;  3JCM h;  1HK9 A;  5I21 A;  5GAM e;  1MGQ A;  4MML A;  2RA2 A;  2QTX A;  4C92 G;  4M7A A;  4XTY A;  1LNX A;  4JUV A;  4MMK A;  1KQ2 A;  4HA8 A;  4EMH A;  2RD1 A;  2CGH A;  5GAN e;  4C8Q A;  4XU3 A;  1LOJ A;  4M7A D;  4PJO G;  4M7D G;  2VXF A;  4PJO F;  4M7A E;  5GAO p;  3JCM P;  4C92 B;  5LJ3 d;  5GMK m;  5LJ5 e;  2FB7 A; 
#chains in the Genus database with same CATH topology
 4EMK C;  3RBB B;  1Q86 U;  2EQU A;  1KQS A;  1UHC A;  2GNC A;  2KYM A;  3JB9 G;  2EAY A;  4N4I A;  4MDX A;  1VQ4 Q;  3H0H A;  3PNW C;  1LJO A;  2YSQ A;  4OMO A;  1T3L A;  3X26 B;  1YCS B;  4PJO A;  3CBO A;  2RK2 A;  2EJF A;  3GOX A;  3M4G A;  2HL5 C;  2OTJ T;  2LJ0 A;  2NUP B;  5KYW A;  1BI0 A;  4BI4 A;  5KE2 A;  3G6E Q;  2X9H A;  2OI3 A;  4L6V 5;  3CC2 Q;  2CP0 A;  3GLX A;  2E1H A;  1K8A C;  2HQH A;  2E5Q A;  2DXC A;  4M75 F;  1MMN A;  1I5L A;  2EFI A;  1NYF A;  1U1T A;  4J8O A;  4OMQ A;  1M3A A;  4JJN K;  1YI2 Q;  5DLQ E;  5J39 A;  2AKK A;  2DXT A;  4IUQ A;  4XTU A;  3VS2 A;  4M7A G;  4VUB A;  2DL4 A;  4BUG A;  1MMA A;  1TTH B;  2LRQ A;  1KC8 R;  3H9N A;  1HYO A;  2MWP A;  1K9M C;  4M7A B;  4AMC A;  2RM4 A;  1YWO A;  1OOT A;  4M78 F;  3BW1 A;  2HNI A;  2V1R A;  3CME T;  4F7U E;  1I4K 1;  3HTR A;  4ZTJ A;  2LT1 A;  4BE2 A;  4PJO B;  1XOV A;  1DJ7 B;  4QKU A;  3VUZ A;  3S3M A;  1D3B A;  1X2K A;  1K73 R;  1UGS B;  3THK A;  5KYW B;  1D1A A;  5FU6 B;  1M2V B;  1KQ2 A;  4HA8 A;  1D0X A;  4RTV A;  3G6E A;  2P0P A;  2MI6 A;  2F2X A;  3QYG B;  4KH1 B;  1B3Q A;  5GMK m;  2QQS A;  2RQT A;  2HQE A;  1QVF P;  2LVM A;  2EQM A;  5HCK A;  2L5Q A;  1WQ7 A;  2JXB A;  3I55 Q;  2EGE A;  2YUQ A;  1YIT A;  2LJ3 A;  1FX7 A;  4XTV A;  1E7O A;  5FRN A;  4AG1 C;  1M30 A;  1UEB A;  2LC4 A;  3D7S B;  1TU0 B;  2JOY A;  3L2Z A;  4M7D A;  1RAB B;  2DXB A;  4JLI A;  2FG0 A;  2DNU A;  3JCM W;  1KQS P;  1ZBJ A;  3CCR A;  4E7L A;  1ZSZ A;  3CBM A;  2KK4 A;  1QP3 A;  2XKO C;  3JSC A;  2GBQ A;  2YRV A;  3G71 Q;  1D09 B;  1K9A A;  4BAC A;  4M77 E;  2RI2 A;  2ZPG B;  3T9N A;  3PIP A;  5CKH A;  3WXM B;  1KJW A;  4F17 A;  4DOV A;  4IKF A;  3J7A F;  4DBR A;  5CAI A;  1BK2 A;  2EYZ A;  3CCV T;  1VYT A;  3OW2 A;  2RF0 A;  1M9S A;  1F1B B;  3I55 A;  3E9G A;  2L3R A;  1VQN Q;  2ZZD A;  1FMK A;  1G3T A;  1QVP A;  5IT9 E;  4M7A C;  1YP5 A;  4KUI A;  3KUF A;  5CR2 A;  1O75 A;  3QZ5 B;  6AT1 B;  1WLP B;  3E9F A;  1YJW A;  2CSI A;  2KRN A;  1BYM A;  3VS4 A;  2X35 A;  2WSF E;  2DRM A;  1W6X A;  2RHZ A;  2JS0 A;  3FEO A;  2CGH A;  3CC7 Q;  4C8Q A;  3HHT B;  2VVK A;  1Q86 R;  1GBQ A;  5A0G A;  1GRI A;  3ZFJ A;  3G71 A;  2K6D A;  4ATO A;  4HCC A;  5GAO m;  3NMZ C;  3QBY A;  1W2B S;  3QJ6 A;  1YBY A;  1UFF A;  2LMJ A;  2JVV A;  1VIF A;  2G6F X;  1VQM T;  5A2Q E;  3OYH A;  3GF5 A;  4A4G A;  3X25 B;  4C0D C;  1YIJ T;  1W4S A;  1M5Q 1;  3ME9 A;  3I56 A;  4KUD K;  2K5L A;  2FRW A;  2YWW A;  3QG1 A;  4ZTF A;  3RDV A;  5CO7 A;  1VQ9 T;  4JZ4 A;  1NEG A;  3S3N A;  2LT4 A;  2YT6 A;  2E6Z A;  2CH4 W;  3HRU A;  1RI9 A;  2XIC A;  2F69 A;  2X3W D;  3CBP A;  1RLQ C;  1VQN A;  3QO3 A;  4ZGJ B;  5LJ3 e;  1I8F A;  1TUG B;  2DMO A;  1QMC A;  4CC2 A;  4RG8 A;  2VYT A;  4C8Q G;  1M27 C;  1QWF A;  3CPW S;  4LE9 A;  2GFU A;  1V1C A;  5FW9 A;  4C8Q B;  1VQ5 T;  2FO0 A;  3MP8 A;  5A0D A;  2E5K A;  2DE0 X;  3JCM b;  3CC7 A;  2OAU A;  3S3O A;  1UTI A;  3EG0 A;  1K76 A;  1HXD A;  1NG2 A;  1MV0 B;  2JW4 A;  2KI7 A;  1I81 A;  3OYL A;  3JB9 I;  3SWN A;  2QGF B;  2XHC A;  3CCQ Q;  1B34 A;  3MEV A;  2XMF A;  4J6Y A;  2M16 A;  1WA7 A;  2RHU A;  2CH4 A;  1K4U S;  2GTJ A;  3OS1 A;  2HSP A;  4M7A F;  3PVL A;  2YRC A;  1VQ4 T;  3NHN A;  1WGS A;  2CUB A;  3DLL A;  1LPL A;  8ATC B;  5GAN e;  4M4Z A;  4PJO F;  3NPF A;  3KXT A;  3JCM P;  3SD4 A;  4D6W A;  4PFP A;  1PHT A;  3OSS C;  2QXF A;  4PJJ A;  2ZPI B;  5GMK e;  1ZLM A;  2X51 A;  1C1A A;  1YJN A;  3CC2 T;  5GAN 3;  1RAC B;  5FU7 C;  2M51 A;  2QA4 T;  2RI5 A;  4XU1 A;  2RI3 A;  3LYI A;  5GAN 7;  1RAG B;  4LN2 A;  2RHX A;  3EHQ A;  2VKN A;  5IN1 A;  2FZG B;  1OZ3 A;  1CKA A;  3FIF A;  1YI2 T;  1R8O B;  2DZC A;  3SWN B;  1OU9 A;  2ZPF B;  4QVC A;  2BZY A;  1AEY A;  1M2O A;  1B34 B;  3OYF A;  2OTL Q;  2DEQ A;  1N9R A;  2RJC A;  3G1J A;  1TH7 A;  1H64 1;  4PNO A;  2DD5 A;  4M75 G;  4C92 A;  3P8D A;  1VQL T;  5FRM A;  5GJV B;  3LH5 A;  1VYU A;  2AK5 A;  4RUG A;  4J9C A;  4X1V A;  4FSX A;  1YHQ A;  2PU9 B;  1FXX A;  2YLB A;  1TXQ A;  1ZHI A;  3CQT A;  2K4Y A;  1GXI E;  5CKE A;  2GCX A;  2RH2 A;  5D6Y A;  4C8Q C;  4DBH A;  1KK7 A;  3L2R A;  2QEX A;  2CSQ A;  3FB9 A;  4FW2 A;  1CKB A;  3KBG A;  3BDL A;  4NOY A;  4FW1 A;  4PFO A;  9ATC B;  1NLO C;  3TSZ A;  4HVV A;  1W70 A;  1UGV A;  5FLX E;  3LGL A;  4A4E A;  4J7F A;  1EZZ B;  4FYY B;  4Y91 A;  5GAN h;  4MML A;  2V8J A;  4C92 G;  1EFN A;  5C0M A;  1Y7X A;  2RD1 A;  2EVR A;  1KC8 U;  4ELZ C;  3VS7 A;  2PVO B;  4C92 B;  4ZN1 A;  4F04 B;  7AT1 B;  2ZPH B;  2KQW A;  4C0G A;  2SRC A;  2VC8 A;  1YJ9 Q;  2DO3 A;  2KDS A;  1K73 U;  3OS5 A;  2HZY A;  5GAM j;  1P92 A;  4OB2 B;  1K8A R;  2BUD A;  4BDZ A;  4LDY A;  2AZV A;  3MEU A;  1SSH A;  1GCQ A;  4BB7 A;  5LJ5 j;  5GAM g;  1M3C A;  2E6N A;  4XAX B;  1OPL A;  2C0O A;  4A4H A;  1G83 A;  3OYE A;  5LJ5 g;  1XQH A;  1ZA1 B;  5LL6 S;  1AWO A;  3CCJ Q;  2O9S A;  3QZ9 B;  4DA4 A;  2LCC A;  4LUD A;  4MZP A;  1M1K C;  2NWM A;  1FYN A;  2R58 A;  2XID A;  3CXC S;  4FIB A;  2RHY A;  1QKX A;  1C0M A;  4OMM A;  1RUW A;  4F7U A;  4EMG A;  4M75 C;  1GL5 A;  4X34 A;  4HKE A;  3QWX X;  2YXY A;  3LGF A;  3Q1J A;  3JCM f;  2ENM A;  1YJ9 A;  1E6G A;  5M9O A;  1BB9 A;  4BY6 B;  4C8Q F;  2CP3 A;  4J6X A;  1QLY A;  5GMK l;  3V8L A;  1JEG A;  3R6O A;  1BI1 A;  4MZT A;  2LQW A;  3TSW A;  4M78 D;  2JTM A;  2YUN A;  1VQP A;  4M78 E;  2QYZ A;  1VYV A;  1Q7Y C;  2K5F A;  3EG9 A;  1G3W A;  4IUU A;  4MDW A;  1VQO A;  2PTK A;  3JCM h;  2CRE A;  2M1H A;  1IB8 A;  2DJQ A;  2ROL A;  2J6K A;  1WXT A;  1RAI B;  2EYY A;  5CKD A;  2CKK A;  2ZPB B;  1U5S A;  3L1A A;  1QVF A;  2C0I A;  5GAN 8;  2VB6 A;  2GGR A;  2L3Q A;  3OW2 S;  4C92 C;  2DYB A;  2D6F A;  5GJW B;  1MND A;  2CUD A;  3J80 E;  2D0Q B;  1PRM C;  1Z9Z A;  3UDC A;  2JZ2 A;  1M8V A;  4AFZ C;  4EPC A;  1JRI A;  2LQK A;  1VQ6 A;  4C5G A;  5ECA A;  2RK1 A;  2DVJ A;  3RES A;  4R56 A;  1WJQ A;  4RMO A;  4C0Z A;  1M90 R;  3INZ A;  3OBW A;  3BDU A;  1RAE B;  4A4K A;  3QHS A;  2E65 A;  2M9U A;  3U23 A;  2RB6 A;  5DLO A;  1RAD B;  4J9I A;  3EG9 B;  3FJ5 A;  3CCQ T;  1AWX A;  4FT4 A;  4N0A A;  2ZAE A;  5DM7 R;  3OSV A;  1MUZ A;  2CT4 A;  1TG0 A;  2P4R A;  2JTF A;  3H0F A;  3JCM c;  5GAM d;  2JS2 A;  3VS0 A;  3RUX A;  1CSK A;  3OMC A;  5CIU A;  3MCA B;  2YRD A;  2DAQ A;  1NM7 A;  1OEB A;  1WHJ A;  2DTH A;  5LJ5 d;  3S6W A;  2PVG B;  1GFD A;  2DLP A;  2KE9 A;  4DBQ A;  5IAY A;  2IPO B;  2R5A A;  1VOM A;  1VQ8 Q;  2RJD A;  1YIT Q;  4A4F A;  2DBK A;  1G2B A;  1X6B A;  5GAO l;  2XK0 A;  3OYG A;  1PG5 B;  3M53 A;  3BFM A;  4XTZ A;  4DEY A;  1ZSG A;  1QW1 A;  3JCM J;  1WDX A;  1VA7 A;  1NLP C;  2NLU A;  4JUV A;  8AT1 B;  3L2U A;  3CCR Q;  2CDT A;  4PJO G;  2RQR A;  1U06 A;  4ZNX A;  3OYM A;  2OTL T;  4IUT A;  2D9T A;  4FYX B;  4CC3 A;  4EIK A;  2VGM A;  3CCS T;  5GAM f;  2MAM A;  3MJX A;  4IUR A;  1QVG P;  1QCF A;  1M1G A;  2RQV A;  3P8H A;  1KD1 C;  2HMA A;  2ATC B;  1U1S A;  3VV0 A;  4E7K A;  4HXJ A;  3M0Q A;  3MO8 A;  4C92 F;  2P0Q A;  3JB9 H;  1GBR A;  2KVQ G;  5IHN A;  5LJ5 f;  1MMD A;  1PM3 A;  2DFU A;  1T0H A;  1NPR A;  2D8H A;  3FRN A;  4BI3 A;  2FYK A;  1G3Y A;  3DB3 A;  4JPB W;  3CCE A;  3URG A;  3N5B B;  1YCY A;  3QDR B;  2XD0 A;  2H8H A;  5L23 A;  3TQ7 P;  4C5H A;  5HKC A;  2C0T A;  1VQ8 A;  4C5I A;  2DIQ A;  3EGD A;  3JCM Q;  3O8V A;  3RMS A;  4ELY C;  1VQ7 T;  5GAO n;  2FPD A;  1Q82 C;  1PKS A;  1R0C B;  2QQB A;  5IHI A;  4WTO B;  3JB9 D;  1V29 B;  1YJW Q;  1V76 A;  5I2M A;  4HCZ A;  1N9S A;  1JXM A;  1H92 A;  3CMA A;  1S72 T;  2LDM A;  3FJP A;  4OB1 B;  1U3O A;  1D3B B;  1OYX A;  5LJ3 j;  1GFC A;  2H3E B;  4XQ3 A;  3CCM Q;  3NFC A;  4M77 D;  2J6O A;  2AZS A;  3VS1 A;  2P0K A;  2MCN A;  1UG1 A;  3RR6 A;  5LJ3 g;  3A98 A;  2L89 A;  5J3B A;  1AZG B;  1ZBX A;  1VQK T;  5HK0 A;  3I56 Q;  1SHF A;  4JDS A;  1BCO A;  3A8L B;  3FDR A;  2WSE E;  1D1C A;  4RKU E;  2RN8 A;  3EGD B;  4M7A D;  4M7D G;  1ABO A;  4M7A E;  2HSE B;  5KYX A;  4X9C A;  2WAC A;  4M7D B;  2YUO A;  4GBQ A;  4R0K A;  2MIO A;  4OF1 A;  2XDB A;  3SHW A;  3CCJ T;  3G4S Q;  3NTI A;  1ZQ1 A;  2JUF A;  1ZSZ B;  4PJO C;  1SKU B;  3L2W A;  3OYA A;  4Y92 A;  4E2F B;  3EH2 A;  3VUB A;  2G3R A;  2P4T A;  1JU5 C;  1WZO A;  4BE1 A;  3LWH A;  2O31 A;  1AD5 A;  2FRY A;  5FU6 C;  3BY7 A;  3UPU A;  2I0N A;  3CCM A;  1UJY A;  2JTE A;  3MEA A;  1AVZ C;  4JJD A;  4WCI A;  3CD6 Q;  3M57 A;  2A36 A;  5GAN 4;  1N8R C;  3HRS A;  2DL8 A;  1JJ2 P;  1IXD A;  1VIE A;  4J5Y A;  3E1S A;  2DK3 A;  4PKC C;  4FYV B;  3RNJ A;  1TS9 A;  1Q81 C;  1JQQ A;  1R0B G;  3H6Z A;  3VRZ A;  2EBP A;  1AZE A;  1K8A U;  2YHT A;  1MHN A;  2XDP A;  3I9Q A;  1LCK A;  2EWN A;  5KYX B;  1JB0 E;  2COZ A;  2ESW A;  5D7U A;  3LH0 A;  1BU1 A;  1QQJ A;  4A54 A;  5GMK i;  1MMG A;  1X6G A;  3M56 A;  3PFS A;  1UGQ B;  3GBQ A;  3VRY A;  1G8X A;  2K3Y A;  2RMO A;  4Z02 A;  1YJN Q;  4LDU A;  4MZM A;  2ED0 A;  2LX9 A;  3A8G B;  4ORZ A;  2JT4 A;  3EGX A;  1JXO A;  2XDD A;  3G4S A;  4CC4 B;  1E6H A;  1HSQ A;  2DZ9 A;  5GAN 5;  3EAE A;  3CCU Q;  4JRP A;  2CP2 A;  4QQD A;  1K9M U;  2EQJ A;  3X28 B;  2O4X A;  3V8J A;  2OX7 A;  1IZ6 A;  3QYH B;  3MP1 A;  3OYD A;  5L8R E;  2CZ1 B;  4MMK A;  4C0F A;  1OQK A;  3CD6 A;  1YNZ A;  4YTL A;  1N6A A;  1OX9 A;  2VXF A;  4O5V A;  2CZ0 B;  2RHI A;  5LJ3 d;  2PUO B;  1SG5 A;  3UWN A;  1X27 A;  3RKY A;  1FMW A;  3I35 A;  1EX4 A;  2JJ9 A;  2MPX C;  1AHJ B;  2DXU A;  4R55 A;  1K0S A;  2VUB A;  1YHQ Q;  1IHV A;  4M7D C;  3A8M B;  1KG1 A;  2CZ7 B;  2EYW A;  4LD6 A;  5KYY A;  3QXE B;  3EFS A;  1S1N A;  1ZSZ C;  4IIO A;  4CC7 A;  4J9B A;  3G6E T;  1B07 A;  3EGX B;  1H3H A;  2QEX Q;  1M1K R;  1KHC A;  4A53 A;  3CC4 A;  5DY9 A;  4OGE A;  4TVR A;  1NJI C;  2O4X B;  3CCU A;  2HAX A;  4B9X A;  2YLC A;  2MWO A;  3L2V A;  1QVF S;  2EYX A;  3DB4 A;  4JS5 A;  1YIT T;  2C06 A;  2LTO A;  1UUE A;  3HRT A;  1UGP B;  4KH0 B;  1I1J A;  2AT1 B;  1ZUK A;  2O2O A;  5IXB A;  2IG0 A;  3H41 A;  1UHF A;  2K2V A;  5LJ3 f;  4HCK A;  4LXC A;  1KQ1 A;  5KYU A;  4E7Z A;  4LDV A;  1M90 U;  2KRM A;  3CCL A;  2CYZ B;  3GIB A;  4M78 A;  2EKO A;  2V1Q A;  3VS5 A;  1Q7Y R;  2E3H A;  4A63 B;  2KY9 A;  2VV5 A;  4RTX A;  5CK9 A;  4AT1 B;  1KQS S;  4Q5W A;  2FVU A;  5GAN 6;  2L0A A;  3C4S A;  5KYY B;  3PMI A;  4CRI A;  1R77 A;  3J81 E;  1FWZ A;  1X6O A;  3ZBD A;  4C8Q D;  4LDW A;  4C8Q E;  1WHM A;  4N4G A;  1Q86 C;  2CT3 A;  2F2W A;  2K3X A;  4OB3 B;  1HD3 A;  2A0F B;  2OTJ A;  1WXU A;  1ZUU A;  5GAO p;  3I55 T;  3MET A;  3A8H B;  1BI3 A;  1D0Y A;  4V2S A;  2D0N A;  1OPK A;  2GQI A;  4NL2 A;  1RAA B;  4D8D A;  1O9S A;  4EMK A;  1IRX A;  5IHK A;  4PJL A;  2HCK A;  3HFO A;  5KYU B;  2JN0 A;  3PIO A;  4OMP A;  2CP5 A;  1OZ2 A;  1YJW T;  3JCM e;  3OYJ A;  4M7D F;  4LDX A;  4M78 B;  4PLI A;  3SDZ A;  2XG8 D;  2KT8 A;  2E3I A;  2AIR B;  3M0S A;  1Y96 A;  2PZ1 A;  2EW3 A;  2QQA A;  2LCS A;  3G71 T;  3PT9 A;  1AWW A;  1HJD A;  1PKT A;  1W2B A;  2E12 A;  3CME A;  1EIF A;  1OI1 A;  2RJE A;  4UC4 A;  1T0J A;  3M0U A;  1PSF A;  3I5S A;  2DYI A;  1VQP Q;  1SSF A;  1X01 A;  2K3B A;  4N4H A;  4QVD A;  4KGX B;  1VQO Q;  1ACM B;  1ARK A;  4F14 A;  3I56 T;  1QKW A;  2L3P A;  1NZ9 A;  1AT1 B;  4RG2 A;  4NS5 A;  2EIF A;  4OML A;  3RIR A;  5D6W A;  3SWN C;  3QJY A;  1PD1 A;  1WJR A;  3VS3 A;  4EMK B;  3CCV Q;  1PD0 A;  3VJP A;  1VQN T;  1UGR B;  1JBM A;  4LD9 K;  1JO8 A;  2MMP A;  3E19 A;  1K9M R;  2HBW A;  1Y71 A;  1M1F A;  4E6R A;  4M75 D;  2FEI A;  4BD3 A;  3OB9 A;  1RL2 A;  4M75 E;  1K0X A;  1PC0 A;  3LW5 E;  2O88 A;  3F70 A;  4RCB A;  3OYY A;  3R6N A;  1Y96 B;  3JRZ A;  2HDA A;  5KCH A;  1VQ6 Q;  2RA2 A;  2GQV A;  3UA7 A;  3CC7 T;  3GP8 A;  4QVZ A;  1WJS A;  4XTY A;  4KUL A;  4PK4 A;  2A08 A;  1A0N B;  3OYI A;  3TRE A;  3M0T A;  1M8M A;  2OJ2 A;  4E7I A;  3A1P A;  2DL5 A;  2XI9 A;  2A37 A;  3QKJ A;  3UA6 A;  3LLR A;  1G5V A;  2FPF A;  2E41 A;  1QVG A;  1VQM Q;  4XU2 A;  3OYN A;  2M02 A;  3HL8 A;  3O5Z A;  2E70 A;  2EPD A;  2NYS A;  4FYW B;  1M3B A;  1TUC A;  3ER0 A;  4KRT A;  3UAT A;  4FSS A;  2DRK A;  5D6X A;  1LVK A;  1VQ9 Q;  1ZX6 A;  3CCV A;  4C92 D;  1Q82 R;  4C92 E;  3CPF A;  2BE9 B;  4F7U G;  4OGC A;  2K2M A;  4RTY A;  3V7C A;  4J83 A;  2A3L A;  3OQ5 A;  1W1F A;  3MHX A;  3UF4 A;  1YJN T;  2CS7 A;  2QI2 A;  2O01 E;  4F7U B;  2EJ9 A;  2CP6 A;  1UDL A;  1SEM A;  4GY5 A;  1RAF B;  4J9G A;  2IIM A;  4FM4 B;  3M59 A;  4JJC A;  4M77 A;  2DIL A;  3UT1 A;  2LCL A;  3HFN A;  2DER A;  2V26 A;  2RNA A;  1W2B P;  3LX7 A;  2XU8 A;  4F16 A;  3OY9 A;  2I2L A;  3GNG A;  3HP9 A;  3RMQ A;  1VQM A;  3RKW A;  1I0C A;  1NEB A;  4RCC A;  1YIJ A;  3QUI A;  2OAW A;  4M7A A;  4AFS C;  3M54 A;  1YHQ T;  3EFR A;  1BBZ A;  2RO0 A;  4AFU C;  1VQ9 A;  4RTW A;  3OBY A;  3CCE Q;  1LNX A;  4HVU A;  3ZEH A;  4XU3 A;  1LOJ A;  1WFW A;  2ZPE B;  2QEX T;  2FZK B;  2RQW A;  4M77 G;  2KXC A;  3CPW P;  1IHW A;  2KRO A;  4BY6 C;  3WVD B;  1M2V A;  2Y90 A;  1Q95 G;  3PVQ A;  2HKN A;  1RAH B;  4M77 B;  2QA4 Q;  4BDY A;  1UEC A;  5I22 A;  1VQ5 A;  4HCB A;  1GCQ C;  3CMA Q;  4P5N A;  1N8R R;  3C12 A;  2CP7 A;  3L2Q A;  3OS0 A;  3OYB A;  4PJM A;  1QCO A;  3EFO A;  1Q81 R;  4PL6 A;  4GLM A;  2WSC E;  1H8K A;  4BE0 A;  2EQI A;  3G7Z A;  2QAZ A;  1JJ2 A;  2VGN A;  3ULR B;  4ZGD B;  1NYG A;  5I2S A;  1VQL Q;  2A28 A;  3V8K A;  1VQ4 A;  2KYB A;  3AT1 B;  5GAM h;  3SFM A;  2LJ1 A;  3P8B B;  2EKH A;  3AHU A;  1TWB A;  3M5A A;  3REA B;  4J9E A;  1YN8 A;  4QW2 A;  2ABL A;  5LJ5 h;  1M1K U;  2BTT A;  1WPY A;  1N5Z A;  3PTA A;  1BIA A;  3CC2 A;  3DKM A;  3EG3 A;  2F5K A;  1NPP A;  3GNF B;  4E7J A;  4HVW A;  2QA4 A;  4XTX A;  3A5Z B;  5IXF A;  2QTV A;  3HPW A;  4C0D B;  3DLM A;  1UB4 A;  2RJF A;  2PQW A;  3EFO B;  4RTU A;  4FL6 A;  3MP6 A;  3CXC A;  1YI2 A;  2ROT A;  4E47 A;  1OX8 A;  2M0O A;  2L2P A;  1T3S A;  4ZGE B;  2GFA A;  1IGQ A;  2JMC A;  1Q7Y U;  1UE9 A;  2FB7 A;  1ZA2 B;  1YJ9 T;  4JRK A;  2K79 A;  1VQL A;  3H0I A;  2DTI A;  2YDL A;  2BE7 D;  4XTW A;  1VQP T;  4XU0 A;  1VQO T;  2O9V A;  2DBM A;  2A7Y A;  4WF2 A;  1M90 C;  1Z9Q A;  4M77 C;  1NJI R;  1FMV A;  5FWB A;  2RPN A;  5J26 A;  4AG2 C;  4L5G A;  2X4Y A;  3V7S A;  3IQL A;  4AFQ C;  1WHG A;  1C6V X;  5CVI A;  4PJO D;  2HL3 A;  4IUV A;  4JRQ A;  4PJO E;  5GAN 2;  2FZC B;  1SRM A;  4N0A C;  1Y57 A;  4PFZ A;  2GF7 A;  2EGC A;  3KFV A;  4DOW A;  4OMF B;  4X9D A;  3HSB A;  4J6W A;  1PSE A;  1KFZ A;  4GLK A;  5GAN j;  1TOV A;  2GTO A;  2FL7 A;  2DEU A;  2LX7 A;  3TU4 K;  2K7A A;  4J9F A;  1Y0M A;  2KMT A;  4IUP A;  1MNE A;  3QWY A;  5GMK j;  2E4H A;  3EHR A;  5GAN g;  1VQ6 T;  1IRE B;  3ZL7 C;  4F7U F;  5KYN A;  4OP0 A;  2JMA A;  1MV3 A;  1BCM A;  1YWP A;  2P84 A;  2Y4X A;  4J7I A;  4Z8A A;  3CEY A;  5FU7 B;  3OA6 A;  5I11 A;  4OMN A;  1KC8 C;  1M4Z A;  2DL7 A;  5CQY A;  1D1B A;  2KT1 A;  2R57 A;  3VKI A;  4EDU A;  1WHH A;  4ANJ A;  2VXE A;  4B9W A;  4RTT A;  5A0L A;  2W10 A;  3RKX A;  2DET A;  4Z88 A;  1MGQ A;  2MOX A;  2LQ8 A;  3MKD A;  1X75 C;  2AKL A;  3NTH A;  4DBF A;  5C6S A;  1K73 C;  1PNJ A;  1U8R A;  3CC4 Q;  1J3T A;  2D8J A;  2K57 A;  4JJB A;  2KSS A;  1UJ0 A;  2SEM A;  4Z89 A;  2QGG A;  3NGP A;  3EGU A;  2DA9 A;  3ASK A;  3JB9 F;  3CXC P;  2ZCF B;  1PCX A;  2BIV A;  2L3S A;  1NE8 A;  3X24 B;  3V7R A;  3JV3 A;  3H8Z A;  4J9H A;  2QK0 A;  4B6M A;  2PNI A;  2QDY B;  1PRL C;  5GAO q;  1KD1 U;  2QQR A;  4CI0 C;  3FLG A;  2HQX A;  2Z0W A;  4JZ3 A;  3CCL Q;  3SEM A;  2DX1 A;  3QII A;  2BKD N;  4FCY A;  4M77 F;  4JS4 A;  3A8O B;  4HT9 A;  3JCM X;  3M0R A;  3M55 A;  4M7D D;  5CQX A;  1ZUY A;  4M7D E;  5KCO A;  5AT1 B;  1QWE A;  5FWC A;  4KGV B;  1WI7 A;  2KBT A;  1XNI A;  1N27 A;  3EG2 A;  1B7T A;  2R5M A;  2HEQ A;  1H3Z A;  4LUE A;  4FT2 A;  1QVG S;  2HD0 A;  2DKG A;  2F2V A;  1TUD A;  4NL3 A;  2H3J A;  2K5I A;  2OTJ Q;  2ECZ A;  2W0Z A;  5KH6 A;  1Q82 U;  3JCM g;  3CCE T;  2FHD A;  4OB0 B;  3REB B;  3TVT A;  2L8D A;  3OW2 P;  2KEA A;  4M75 A;  3RER A;  4XK8 E;  2BZX A;  3X20 B;  1BIB A;  1IGU A;  1VQ8 T;  2E10 A;  2DPP B;  2X4X A;  1XTD A;  4PLL A;  2QQ9 A;  5GAN d;  1WHL A;  1WYX A;  4O6J A;  2NUT A;  4C5E A;  4PJN A;  2J06 A;  5I21 A;  4KGZ B;  1KHI A;  5CKB A;  5EG2 A;  2QTX A;  3CMA T;  1WX6 A;  1QCN A;  2J7I A;  3CCR T;  2K9G A;  1SF9 A;  3L42 A;  1IO6 A;  2KNB B;  2QDL A;  4DQ2 A;  3C95 A;  5LJ3 h;  3CME Q;  4QQG A;  2JM8 A;  2E64 A;  3CCQ A;  1BKB A;  3CCS Q;  4D8K A;  2LQN A;  3JCM V;  2HBP A;  3FC3 A;  3I5R A;  3E2U A;  1WIE A;  3TCJ A;  3QSU A;  2JNG A;  2PUK B;  3SB2 A;  1RI0 A;  4M75 B;  2M0Y A;  3TEE A;  4BI8 B;  2V8I A;  4DEX A;  2X4J A;  1SHG A;  3PMT A;  2J6F A;  3NTK A;  4JLG A;  5GAN f;  2KGT A;  2NUT B;  4M78 G;  5IH2 A;  3JB9 J;  3M9Q A;  2B86 A;  3OYC A;  2JM9 A;  1VQ7 Q;  2AHJ B;  2X3X D;  4L59 A;  2Y4Y A;  1D0Z A;  2VAS A;  1N8R U;  5FRO A;  1XJW B;  1KSW A;  2EQK A;  3M4Y A;  1S72 Q;  1Q81 U;  1PWT A;  1WXB A;  1X69 A;  3MPU B;  2DJZ A;  5GAO r;  2EYQ A;  2OTL A;  2QG9 B;  3CCM T;  3QDF A;  2QAS A;  1AOJ A;  5GMK h;  2DVE A;  3VU3 C;  3C94 A;  3CCS A;  2ZGW A;  2DM1 A;  1WNL A;  5AYF A;  1SRL A;  4HT8 A;  2LNV A;  3C0C A;  2NUZ A;  2V8K A;  4ME7 A;  2COW A;  1JJ2 S;  4JRI A;  5HK3 A;  4KBM B;  3JCM d;  3WVE B;  4Y28 E;  4II1 A;  1VQK Q;  4FU6 A;  3M58 A;  4KT0 E;  3OYK A;  1Y07 A;  2F1L A;  5CCA A;  4EMH A;  2KXD A;  3OMG A;  4E7S A;  4QQ6 A;  2COY A;  2KRS A;  2FPE A;  4ESR A;  3M0P A;  2CZ6 B;  5KE3 A;  2MK5 A;  3QPH A;  1VQ7 A;  1KIK A;  3VYH B;  3G4S T;  1QP2 A;  3CPW A;  4E7H A;  1AWJ A;  4J9D A;  2LP5 A;  3GPL A;  4IIM A;  3VYG A;  1KD1 R;  4QT7 A;  1X43 A;  1S72 A;  3PGG A;  1TSF A;  3VS6 A;  2D1X A;  1G3S A;  2PVD B;  2HKQ B;  3CD6 T;  1OU8 A;  1OV3 A;  3PE0 A;  3EG1 A;  3LWI A;  1K1Z A;  3EH1 A;  5CKF A;  4ZN3 A;  1GCP A;  2B8A A;  1WHK A;  4RTZ A;  1WQW A;  2VWF A;  2MYS A;  1YIJ Q;  1VQK A;  5EC7 A;  2X4W A;  1NBE B;  3BE3 A;  1VUB A;  1NJI U;  2DD4 A;  2F5T X;  4M78 C;  1ABQ A;  2RQU A;  2BZ8 A;  2J05 A;  2MF2 A;  1SPK A;  1RLP C;  3CC4 T;  1I5O B;  1X2Q A;  2KR3 A;  2NUP A;  4OVA A;  3CCU T;  3CCJ A;  2EJG A;  2DIG A;  2DL3 A;  2ED1 A;  3JAM E;  2DTO A;  1VQ5 Q;  1I07 A;  3HKS A;  2KAF A;  2LNH B;  3OS2 A;  1HK9 A;  5GAM e;  2IVW A;  1YFN A;  4K11 A;  5HY6 A;  2YUP A;  4LNP A;  2EGA A;  3MEW A;  1OUL A;  1BI2 A;  2LZ6 B;  5LJ5 e;  2DF6 A;  3CCL T; 
#chains in the Genus database with same CATH homology
 4EMK C;  1Q86 U;  2ZPH B;  2KQW A;  1YJ9 T;  2EQU A;  3UWN A;  4C0G A;  3RKY A;  1KQS A;  2VC8 A;  4JRK A;  1VQL A;  2DO3 A;  3JB9 G;  2KDS A;  2EAY A;  1AHJ B;  4N4I A;  2DXU A;  2DTI A;  4R55 A;  1K73 U;  3OS5 A;  2VUB A;  4XTW A;  4M7D C;  4MDX A;  3A8M B;  3PNW C;  5GAM j;  1LJO A;  1P92 A;  2CZ7 B;  1KG1 A;  1VQP T;  4LD6 A;  4OB2 B;  3X26 B;  4XU0 A;  3QXE B;  3EFS A;  1VQO T;  2A7Y A;  2BUD A;  4WF2 A;  4PJO A;  4BDZ A;  1M90 C;  4LDY A;  4M77 C;  3CBO A;  2RK2 A;  5J26 A;  3MEU A;  2EJF A;  4BB7 A;  3GOX A;  3M4G A;  5LJ5 j;  5GAM g;  4L5G A;  2X4Y A;  2E6N A;  3G6E T;  4XAX B;  2OTJ T;  3V7S A;  1BI0 A;  4BI4 A;  5KE2 A;  4A4H A;  1KHC A;  4L6V 5;  4A53 A;  5CVI A;  3GLX A;  2E1H A;  3CC4 A;  4IUV A;  5DY9 A;  3OYE A;  4JRQ A;  5LJ5 g;  4OGE A;  4TVR A;  5GAN 2;  1XQH A;  1K8A C;  4N0A C;  5LL6 S;  2E5Q A;  2O4X B;  1NJI C;  2GF7 A;  3CCU A;  2HAX A;  4B9X A;  2DXC A;  3QZ9 B;  2YLC A;  4M75 F;  4DA4 A;  2MWO A;  2LCC A;  3L2V A;  1I5L A;  4DOW A;  4OMF B;  1QVF S;  4JS5 A;  3DB4 A;  2EFI A;  1YIT T;  4X9D A;  2C06 A;  3HSB A;  2LTO A;  4J6W A;  1PSE A;  4GLK A;  4MZP A;  5GAN j;  1U1T A;  1M1K C;  2FL7 A;  3HRT A;  2R58 A;  4J8O A;  1UGP B;  4JJN K;  5DLQ E;  2XID A;  3CXC S;  4FIB A;  3TU4 K;  5J39 A;  2KMT A;  4IUP A;  2RHY A;  2DXT A;  4IUQ A;  4XTU A;  4M7A G;  4VUB A;  2IG0 A;  5LJ3 f;  2K2V A;  5GMK j;  4BUG A;  4F7U A;  4EMG A;  5GAN g;  1VQ6 T;  1IRE B;  4M75 C;  4F7U F;  1KQ1 A;  4OP0 A;  2LRQ A;  4X34 A;  4LDV A;  2MWP A;  4HKE A;  1M90 U;  1K9M C;  4M7A B;  3CCL A;  2CYZ B;  3GIB A;  2RM4 A;  4M78 A;  2EKO A;  3LGF A;  3Q1J A;  3JCM f;  4M78 F;  2Y4X A;  4J7I A;  1YJ9 A;  2KY9 A;  3CEY A;  2VV5 A;  5FU7 B;  4BY6 B;  4C8Q F;  5CK9 A;  3BW1 A;  2HNI A;  5M9O A;  3OA6 A;  4Q5W A;  1KQS S;  2FVU A;  5GAN 6;  3CME T;  4F7U E;  4J6X A;  1I4K 1;  3C4S A;  4ZTJ A;  5GMK l;  2LT1 A;  3V8L A;  3PMI A;  4CRI A;  3R6O A;  4BE2 A;  4PJO B;  1KC8 C;  1XOV A;  1BI1 A;  1DJ7 B;  1M4Z A;  4MZT A;  3J81 E;  5CQY A;  3VUZ A;  2R57 A;  1FWZ A;  1D3B A;  4M78 D;  2JTM A;  3VKI A;  3S3M A;  1VQP A;  4EDU A;  4M78 E;  1X6O A;  3ZBD A;  4C8Q D;  2VXE A;  4LDW A;  4B9W A;  5A0L A;  4C8Q E;  1Q7Y C;  2K5F A;  4IUU A;  1G3W A;  4MDW A;  3RKX A;  1UGS B;  1VQO A;  4N4G A;  3JCM h;  1Q86 C;  2M1H A;  1MGQ A;  5FU6 B;  2K3X A;  2LQ8 A;  4HA8 A;  4OB3 B;  1KQ2 A;  1X75 C;  3G6E A;  2OTJ A;  2P0P A;  2MI6 A;  3NTH A;  5C6S A;  1K73 C;  3QYG B;  5GAO p;  5GMK m;  2QQS A;  2HQE A;  1U8R A;  5CKD A;  2CKK A;  2ZPB B;  3L1A A;  2LVM A;  2EQM A;  2K57 A;  2L5Q A;  1QVF A;  3I55 T;  3MET A;  1WQ7 A;  3A8H B;  5GAN 8;  2KSS A;  1BI3 A;  4V2S A;  3OW2 S;  4NL2 A;  4C92 C;  4EMK A;  1O9S A;  3ASK A;  3JB9 F;  1YIT A;  1FX7 A;  2ZCF B;  4XTV A;  5FRN A;  2BIV A;  2D6F A;  3X24 B;  1NE8 A;  3HFO A;  1UEB A;  2LC4 A;  3V7R A;  3J80 E;  2D0Q B;  3UDC A;  1M8V A;  2JZ2 A;  3H8Z A;  2JN0 A;  2JOY A;  4EPC A;  3PIO A;  1JRI A;  4PJO E;  3L2Z A;  1OZ2 A;  1YJW T;  4M7D A;  2DXB A;  3JCM e;  3OYJ A;  4JLI A;  2LQK A;  4LDX A;  4M78 B;  4M7D F;  2QDY B;  4PLI A;  1VQ6 A;  3SDZ A;  3JCM W;  2XG8 D;  5GAO q;  1KD1 U;  4C5G A;  2QQR A;  4CI0 C;  3FLG A;  2HQX A;  2RK1 A;  3RES A;  4R56 A;  1Y96 A;  3QII A;  2BKD N;  1WJQ A;  3CCR A;  4M77 F;  4RMO A;  4E7L A;  4JS4 A;  3A8O B;  4HT9 A;  3CBM A;  3JCM X;  2QQA A;  4C0Z A;  2KK4 A;  1QP3 A;  3M55 A;  3INZ A;  3OBW A;  3G71 T;  4M7D D;  3BDU A;  5CQX A;  3PT9 A;  2XKO C;  4A4K A;  3JSC A;  4M7D E;  3QHS A;  2E65 A;  5KCO A;  2E12 A;  1W2B A;  2YRV A;  3CME A;  1EIF A;  2M9U A;  2RB6 A;  5DLO A;  1OI1 A;  2RJE A;  3CCQ T;  4UC4 A;  4BAC A;  1PSF A;  4FT4 A;  4M77 E;  4N0A A;  2RI2 A;  1XNI A;  1N27 A;  2R5M A;  1SSF A;  5DM7 R;  1X01 A;  3OSV A;  2ZPG B;  3T9N A;  3JCM c;  2JTF A;  4N4H A;  4QVD A;  5GAM d;  3PIP A;  5CKH A;  3WXM B;  4FT2 A;  1H3Z A;  3RUX A;  1QVG S;  4DOV A;  3OMC A;  3I56 T;  2HD0 A;  5CIU A;  4IKF A;  3MCA B;  1NZ9 A;  2DKG A;  2DAQ A;  3J7A F;  4RG2 A;  4NL3 A;  2H3J A;  2K5I A;  5CAI A;  2DTH A;  4NS5 A;  5LJ5 d;  2EIF A;  3RIR A;  5KH6 A;  5D6W A;  1Q82 U;  3JCM g;  3SWN C;  3S6W A;  3QJY A;  3CCE T;  2FHD A;  4OB0 B;  2PVG B;  1WJR A;  3CCV T;  2L8D A;  4EMK B;  4M75 A;  3RER A;  4XK8 E;  3OW2 A;  3VJP A;  1M9S A;  3X20 B;  1VQN T;  1UGR B;  1BIB A;  1JBM A;  5IAY A;  3E9G A;  2L3R A;  3I55 A;  4LD9 K;  1VQ8 T;  2E10 A;  2MMP A;  2R5A A;  3E19 A;  2ZZD A;  1G3T A;  2RJD A;  1QVP A;  5IT9 E;  4M7A C;  4A4F A;  1Y71 A;  2DPP B;  2X4X A;  1M1F A;  4KUI A;  1XTD A;  2XK0 A;  3KUF A;  5GAO l;  4PLL A;  3M53 A;  5CR2 A;  3OYG A;  2QQ9 A;  1O75 A;  4M75 D;  3BFM A;  4BD3 A;  4XTZ A;  5GAN d;  3OB9 A;  1RL2 A;  3QZ5 B;  4M75 E;  1QW1 A;  3JCM J;  3LW5 E;  3F70 A;  3E9F A;  3OYY A;  4O6J A;  4RCB A;  1Y96 B;  1YJW A;  4C5E A;  3JRZ A;  5I21 A;  5KCH A;  1BYM A;  2RA2 A;  1KHI A;  5CKB A;  2GQV A;  2QTX A;  5EG2 A;  2X35 A;  3CC7 T;  2NLU A;  1WJS A;  2WSF E;  4QVZ A;  4JUV A;  4XTY A;  3GP8 A;  3CCR T;  3CMA T;  2RHZ A;  4KUL A;  3L2U A;  3L42 A;  3FEO A;  2CGH A;  4C8Q A;  4PJO G;  3OYI A;  3TRE A;  3HHT B;  3OYM A;  5A0G A;  2OTL T;  4IUT A;  2D9T A;  3ZFJ A;  3G71 A;  4DQ2 A;  4ATO A;  3C95 A;  5GAO m;  4E7I A;  4HCC A;  5LJ3 h;  3QBY A;  1W2B S;  3QJ6 A;  1YBY A;  2XI9 A;  2VGM A;  3CCS T;  3QKJ A;  2JVV A;  4QQG A;  1VIF A;  2E64 A;  1S72 A;  5GAM f;  2MAM A;  3LLR A;  1BKB A;  4IUR A;  3CCQ A;  1G5V A;  1VQM T;  1M1G A;  5A2Q E;  3P8H A;  3OYH A;  3GF5 A;  3JCM V;  1KD1 C;  4A4G A;  2E41 A;  2HBP A;  1QVG A;  1U1S A;  3X25 B;  3FC3 A;  4XU2 A;  4PJO D;  3VV0 A;  4E7K A;  4C0D C;  3OYN A;  1YIJ T;  3HL8 A;  1W4S A;  3MO8 A;  4C92 F;  2P0Q A;  3JB9 H;  2KVQ G;  5LJ5 f;  1M5Q 1;  2E70 A;  3ME9 A;  3TCJ A;  3I56 A;  4KUD K;  2K5L A;  3QSU A;  2JNG A;  2PUK B;  1NPR A;  3SB2 A;  3FRN A;  3QG1 A;  1RI0 A;  4M75 B;  3ER0 A;  4BI3 A;  4ZTF A;  5CO7 A;  1VQ9 T;  3TEE A;  4BI8 B;  2FYK A;  1G3Y A;  3DB3 A;  2V8I A;  2LT4 A;  5D6X A;  3CCE A;  3URG A;  3S3N A;  3N5B B;  3CCV A;  2X4J A;  1YCY A;  2E6Z A;  3HRU A;  3QDR B;  4C92 D;  2XIC A;  4C92 E;  2XD0 A;  2F69 A;  3CPF A;  3PMT A;  3CBP A;  4F7U G;  4OGC A;  1VQN A;  3V7C A;  4C5H A;  4J83 A;  3NTK A;  2A3L A;  3OQ5 A;  3QO3 A;  5HKC A;  3MHX A;  4ZGJ B;  1VQ8 A;  4C5I A;  4JLG A;  5LJ3 e;  1I8F A;  1YJN T;  2CS7 A;  2DIQ A;  3JCM Q;  2QI2 A;  5GAN f;  3O8V A;  2O01 E;  3RMS A;  4ELY C;  4F7U B;  4M78 G;  4RG8 A;  1VQ7 T;  5GAO n;  2VYT A;  3JB9 J;  4C8Q G;  3M9Q A;  3OYC A;  2EJ9 A;  2QQB A;  1Q82 C;  4GY5 A;  2AHJ B;  3CPW S;  3JB9 D;  4L59 A;  2GFU A;  1V29 B;  2Y4Y A;  4C8Q B;  5I2M A;  4HCZ A;  1N8R U;  1VQ5 T;  1N9S A;  5FRO A;  3MP8 A;  4FM4 B;  5A0D A;  3M59 A;  3JCM b;  3CC7 A;  2EQK A;  4M77 A;  3CMA A;  2OAU A;  3S3O A;  1S72 T;  3UT1 A;  2LCL A;  3HFN A;  1HXD A;  3M4Y A;  2LDM A;  3FJP A;  4OB1 B;  1Q81 U;  3LX7 A;  2DJZ A;  5GAO r;  1D3B B;  2XU8 A;  1OYX A;  2EYQ A;  2OTL A;  3CCM T;  1I81 A;  5LJ3 j;  3OYL A;  4XQ3 A;  3JB9 I;  3SWN A;  5GMK h;  2DVE A;  2XHC A;  2I2L A;  3NFC A;  3VU3 C;  3OY9 A;  4M77 D;  3C94 A;  3CCS A;  2ZGW A;  3GNG A;  3HP9 A;  1B34 A;  3RMQ A;  1WNL A;  2P0K A;  5AYF A;  3MEV A;  1VQM A;  4J6Y A;  5LJ3 g;  2L89 A;  2M16 A;  3RKW A;  4HT8 A;  2LNV A;  2RHU A;  5J3B A;  1ZBX A;  3OS1 A;  4RCC A;  2V8K A;  5HK0 A;  4ME7 A;  1YIJ A;  1JJ2 S;  3QUI A;  1VQK T;  4JRI A;  5HK3 A;  4KBM B;  4M7A A;  3JCM d;  3WVE B;  3M54 A;  4Y28 E;  4II1 A;  4M7A F;  4FU6 A;  3EFR A;  4JDS A;  1YHQ T;  3M58 A;  1VQ4 T;  3A8L B;  4KT0 E;  3OYK A;  1Y07 A;  3FDR A;  2RO0 A;  1VQ9 A;  1WGS A;  3OBY A;  5CCA A;  2WSE E;  1LNX A;  4EMH A;  3ZEH A;  3DLL A;  4RKU E;  5GAN e;  4XU3 A;  1LOJ A;  3OMG A;  4M7A D;  4M7D G;  4PJO F;  4M7A E;  3KXT A;  4QQ6 A;  3JCM P;  3SD4 A;  4D6W A;  2ZPE B;  2QEX T;  3OSS C;  4X9C A;  2QXF A;  2ZPI B;  2CZ6 B;  2WAC A;  5GMK e;  1YJN A;  4M77 G;  3CC2 T;  5GAN 3;  4M7D B;  5KE3 A;  3QPH A;  5FU7 C;  1VQ7 A;  4BY6 C;  4OF1 A;  3VYH B;  3WVD B;  3G4S T;  1QP2 A;  2Y90 A;  3CPW A;  2QA4 T;  2RI5 A;  4XU1 A;  2XDB A;  3CCJ T;  3NTI A;  1ZQ1 A;  2JUF A;  2RI3 A;  3LYI A;  4M77 B;  5GAN 7;  4E7H A;  4BDY A;  2RHX A;  4PJO C;  3L2W A;  5IN1 A;  3OYA A;  1VQ5 A;  3GPL A;  4HCB A;  1OZ3 A;  3FIF A;  3VYG A;  4P5N A;  3VUB A;  2G3R A;  2P4T A;  3PGG A;  1R8O B;  3C12 A;  4BE1 A;  2DZC A;  1YI2 T;  3SWN B;  3L2Q A;  3OS0 A;  3LWH A;  3OYB A;  2ZPF B;  4QVC A;  1G3S A;  2PVD B;  5FU6 C;  1B34 B;  3OYF A;  3BY7 A;  3UPU A;  3CD6 T;  3CCM A;  2DEQ A;  1N9R A;  3MEA A;  2RJC A;  4PL6 A;  3LWI A;  2WSC E;  1Q7Y U;  3M57 A;  1TH7 A;  1H64 1;  5CKF A;  5GAN 4;  4PNO A;  4ZN3 A;  4BE0 A;  3HRS A;  1N8R C;  2B8A A;  1VIE A;  4J5Y A;  3E1S A;  3G7Z A;  2DD5 A;  4M75 G;  4C92 A;  1JJ2 A;  2DK3 A;  3P8D A;  1VQL T;  2VGN A;  5FRM A;  4PKC C;  4ZGD B;  1WQW A;  1Q81 C;  5I2S A;  1VQK A;  3V8K A;  3H6Z A;  2X4W A;  4FSX A;  1YHQ A;  1VQ4 A;  2PU9 B;  1FXX A;  1K8A U;  1VUB A;  1MHN A;  2YHT A;  5GAM h;  2YLB A;  3SFM A;  1NJI U;  2XDP A;  3P8B B;  1ZHI A;  2EWN A;  3AHU A;  1JB0 E;  2K4Y A;  3LH0 A;  3M5A A;  1GXI E;  5CKE A;  4A54 A;  2DD4 A;  5GMK i;  2F5T X;  4QW2 A;  4M78 C;  2GCX A;  2RH2 A;  3M56 A;  1UGQ B;  3PFS A;  5D6Y A;  4C8Q C;  5LJ5 h;  1M1K U;  3L2R A;  1WPY A;  2QEX A;  2K3Y A;  4Z02 A;  2MF2 A;  3FB9 A;  3PTA A;  4LDU A;  4MZM A;  1BIA A;  3CC2 A;  3DKM A;  2LX9 A;  3CC4 T;  2F5K A;  1NPP A;  3A8G B;  3GNF B;  3KBG A;  2XDD A;  4E7J A;  3G4S A;  4OVA A;  3CCU T;  2QA4 A;  3BDL A;  4NOY A;  2DZ9 A;  3A5Z B;  4XTX A;  5GAN 5;  3EAE A;  2EJG A;  2DIG A;  3CCJ A;  4JRP A;  3HPW A;  4C0D B;  4QQD A;  1K9M U;  2EQJ A;  5FLX E;  3DLM A;  3X28 B;  3LGL A;  1UB4 A;  4J7F A;  2DTO A;  2O4X A;  2RJF A;  4A4E A;  3JAM E;  2PQW A;  3V8J A;  3HKS A;  4Y91 A;  2KAF A;  5GAN h;  4FL6 A;  3OS2 A;  1IZ6 A;  3QYH B;  3MP6 A;  3CXC A;  1HK9 A;  1YI2 A;  3MP1 A;  5GAM e;  3OYD A;  4MML A;  5L8R E;  2IVW A;  2V8J A;  4C92 G;  2CZ1 B;  5C0M A;  1Y7X A;  4MMK A;  4E47 A;  4C0F A;  2RD1 A;  2M0O A;  5HY6 A;  1KC8 U;  3MEW A;  3CD6 A;  4YTL A;  1N6A A;  1BI2 A;  2VXF A;  4O5V A;  4ELZ C;  2CZ0 B;  2RHI A;  2PVO B;  4C92 B;  5LJ3 d;  2GFA A;  4ZGE B;  2PUO B;  5LJ5 e;  3CCL T;  4ZN1 A;  2FB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...