2P0QA

Calcium binding protein in the calcium-binding form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr1010 protein
publication title Solution Structures of Ccbp from Anabaena Reveals a New Fold and Novel Calcium Binding Sites
rcsb
source organism Nostoc sp.
molecule tags Metal binding protein
total genus 38
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0qA02
2P0QA 2P0PA 2K2VA 3URGA
chains in the Genus database with same CATH superfamily
1MMGA 2DVEA 3OBYA 1MHNA 2DRKA 2EKHA 2EWNA 1MNDA 2DAQA 1GFDA 4OMLA 5I21A 5IHNA 2RI2A 4HA8A 2PUOB 2NUTA 2EQJA 4KH1B 4M78D 2DIGA 1IXDA 2DX1A 1TU0B 3ZFJA 4F7UB 5LJ5f 1OULA 1M1KC 4CC4B 1I07A 4A4KA 1UGPB 1BCOA 5IHKA 2D8HA 3CC2Q 2QTVA 1C6VX 4M78C 4PKCC 4P5NA 4BDZA 2K5FA 2M1HA 3L2WA 1BI2A 2YUNA 2OTJA 3V7SA 3VYGA 3N5BB 2H3EB 3JCMh 1YFNA 2KE9A 3HSBA 2DRMA 4HKEA 1JJ2S 1VIEA 1YCSB 2GCXA 3G4SA 3UDCA 1VQ4A 1Q82R 1Q81U 3CPFA 4N0AC 1M2VA 4M75D 1YJWT 2DF6A 1M30A 1PKSA 2HD0A 3GNGA 2KY9A 4ZGDB 8AT1B 4KGXB 1SSHA 5GAOp 3GOXA 2JM9A 1FMKA 4Z8AA 1X2QA 3NHNA 3M56A 2NUTB 3LGLA 1BIBA 3JSCA 2EKOA 4M75C 3EG9A 3KFVA 2LQWA 2RK2A 4AG2C 1YN8A 1B7TA 4J9FA 3CC4Q 4LDYA 2JMCA 1KQSA 3VS4A 5LJ3h 3NTHA 1ZQ1A 2V8IA 1Q7YR 4C0DC 2EJGA 5CKEA 1PRLC 1HXDA 2RQUA 2J7IA 1WDXA 4AFZC 5GANh 4LDWA 3CD6A 2XDPA 2C06A 3I56A 2E65A 1W6XA 3OMGA 2QEXT 2FZGB 1NJIU 2OJ2A 2E4HA 4R0KA 3FJ5A 1PD0A 2XIDA 2R57A 1M2VB 2D8JA 5LJ5d 1QVGS 4PJLA 4C8QD 1OU9A 4DBQA 2E12A 4B9XA 5KYXA 2DEQA 1N8RC 4J8OA 3UA7A 4FT4A 3AT1B 4JDSA 2R5AA 1SHFA 3JV3A 5IHIA 5GAN2 3CXCP 1BU1A 1QVPA 4A53A 4KH0B 2FG0A 2L5QA 3CXCA 3DB4A 1IHVA 3CCVA 1U5SA 3QUIA 2KI7A 2JJ9A 5GJVB 4DOWA 1J3TA 1CKAA 7AT1B 3M4GA 2RHXA 2DE0X 5GMKl 3GNFB 2PQWA 3ZEHA 3FEOA 3S3MA 1M90R 2OTJT 3DB3A 5KYWB 2PNIA 3RKYA 1QCNA 1U8RA 3EGUA 1I1JA 2JNGA 2Y4XA 4IUPA 2QI2A 3L2VA 2VB6A 3H0HA 3VUBA 4HVVA 1VQMQ 1TG0A 2MWOA 3SFMA 1QCFA 2HSEB 2FYKA 2EVRA 5KYXB 4ZGJB 3MHXA 1RAFB 2KGTA 1EFNA 3JRZA 1JJ2A 2DXCA 1BK2A 2FO0A 2CT4A 1Y0MA 1NPRA 2VVKA 3QPHA 2PU9B 3EFOB 2LJ0A 5GAMg 2OAUA 4HCCA 1NYGA 2AZVA 3M53A 4V2SA 3META 4Z89A 4J9CA 2OTLA 1QMCA 1NYFA 4M75A 2C0OA 4E7JA 3OS2A 1MUZA 2EYXA 1XQHA 3CD6T 1ZX6A 1ABQA 1SHGA 2DL7A 2E3IA 4OGCA 4ESRA 3OYIA 2VGNA 2ED1A 2F5TX 4M78B 1E6GA 1S72A 1Q81C 3CCUQ 1G3WA 1O75A 5GAN8 1MMDA 2EYYA 3H8ZA 1SEMA 1BKBA 2BZ8A 2FL7A 2J6OA 2D0QB 1AVZC 2AIRB 3VS1A 4R55A 1F1BB 1X2KA 2DEUA 1YITT 2RJCA 3D7SB 2HQXA 3CCET 2MIOA 3QYHB 3FC3A 2LRQA 1RI0A 2HCKA 5CQYA 1RACB 1KQ1A 2CKKA 4OB2B 3JCMb 2AKLA 1VQPQ 1QVGA 4L5GA 2CT3A 4KRTA 3G6ET 4M75B 4X1VA 1VOMA 3VV0A 3CCSA 1HD3A 3PTAA 2W0ZA 1JEGA 2ZPHB 4J7FA 1PHTA 2V26A 3LWHA 4BE1A 2DXTA 3CCRT 1NJIC 4XK8E 2DD4A 3OS0A 5CKFA 1VQNQ 1P92A 3BDUA 3SB2A 3TEEA 2IG0A 4OMQA 1LCKA 5L8RE 3C12A 3HTRA 1I5OB 4Y92A 3CMEA 4JZ3A 2RJDA 5FROA 2VV5A 5CR2A 3Q1JA 5IT9E 1Q86U 2SRCA 2AK5A 3RNJA 1VQOT 4M4ZA 5CKBA 3CMAA 1H8KA 4C5EA 3G4SQ 4WCIA 3I5RA 4EMKC 5C6SA 4EDUA 1BB9A 2MI6A 4Y91A 2A36A 4XAXB 4D8KA 2DERA 1VQLA 1ZA1B 1PCXA 1WJRA 2IPOB 4MDXA 2P0KA 5CIUA 2X4YA 3L1AA 4O5VA 4PLLA 1RABB 3JCMg 3J81E 4J9IA 1PM3A 3CBOA 2KR3A 3QSUA 2RHIA 1M4ZA 3HL8A 3JB9G 2X4WA 3QDRB 1KC8U 1OYXA 1EIFA 3NFCA 4C5GA 2GFUA 3OW2S 1AWOA 2QYZA 5GAN6 2J06A 1M1FA 1NZ9A 2F1LA 1Y96A 2DK3A 2KDSA 3RUXA 1YCYA 1I5LA 2EBPA 4OMOA 2CP5A 2O2OA 2GNCA 2MWPA 5LJ5h 2COZA 4C92F 3CC7T 2NWMA 1M1GA 2FHDA 2LQNA 1OZ2A 1KD1C 4XU0A 1VQ5Q 1QQJA 4E7IA 2LX7A 1XOVA 1RLPC 4PFOA 2QDYB 2CP3A 4OMNA 3OYNA 3EG3A 3OSVA 4E7ZA 4EIKA 2R58A 1VQ7A 1QLYA 1JO8A 1FMVA 4X9DA 1WI7A 4LDXA 3OYLA 1SRMA 4J83A 3WVDB 2VXFA 2YXYA 1OU8A 3FJPA 4ZNXA 4NOYA 1Y96B 4A4EA 3EG0A 2DL8A 4A4HA 3L2QA 5EC7A 1K9MR 3UF4A 2K3YA 3LLRA 4ME7A 3THKA 1OQKA 3CCMT 3HKSA 3RIRA 1WLPB 2L3RA 2CP2A 5DY9A 5FW9A 4ANJA 3A8HB 1YHQT 3RBBB 1Z9QA 1Y57A 5FU7C 3EHRA 4F7UF 1M3CA 1K73R 3CC2T 4XTUA 3LH5A 1X01A 3A5ZB 1OEBA 3HP9A 1I4K1 2I2LA 2JUFA 2KEAA 4GLMA 3VS0A 2B8AA 3MKDA 4C92A 3DLLA 3ME9A 3L2RA 3PVQA 1QCOA 2CUBA 5HY6A 5A2QE 4E2FB 1BBZA 1Q86C 2C0IA 1NLOC 3M58A 1UHFA 1MMNA 2X4XA 3CCLQ 4OB0B 4XU1A 2EGCA 2DKGA 3SWNC 2QA4T 2WACA 3QJYA 4DEYA 3OS1A 3LW5E 3OW2P 1YJNQ 1W70A 1N27A 2O01E 1Q82U 4JJCA 1WJSA 2KT8A 3CPWP 2L0AA 3HRUA 3M59A 3OW2A 4EMKB 1AWJA 3T9NA 2B86A 1GCQA 3URGA 4E7LA 2EQKA 5J3BA 4M7DA 3CC4T 1AZEA 1WPYA 3BY7A 4OMMA 3RKXA 2QQRA 1E7OA 1V29B 2YHTA 3I5SA 3LYIA 3A8LB 2GGRA 1DJ7B 1KC8C 3A8GB 5I22A 4BACA 4M77C 2XD0A 3CCJT 2YT6A 2ZZDA 4KBMB 1TUDA 1RADB 1SRLA 3CCUA 1VQ8A 1N9RA 4F7UA 1H92A 3VS2A 3ZBDA 3PVLA 1KHCA 1VQ9Q 2KXDA 1FMWA 2XMFA 1ACMB 4OB1B 1UGSB 2OI3A 2M51A 2HQEA 2F2WA 1YWOA 2F69A 2LTOA 1R0CB 4NL3A 4C92E 4M7DB 3VS7A 3REAB 4O6JA 2JW4A 1VQ6T 5DLOA 5GAOn 3OS5A 2JTMA 5IAYA 2KQWA 1KSWA 5KYUB 2J6FA 1OI1A 2RK1A 4A4GA 5C0MA 5LJ3j 4FCYA 3FRNA 2HSPA 2HKNA 1UFFA 4C92G 1D1BA 2P4RA 1VQLQ 2D6FA 2M16A 2O31A 2ENMA 3G71Q 1NE8A 5GANj 1UB4A 3OSSC 2K5IA 3EG1A 1VQNA 2CP7A 2V8JA 4RG8A 2Z0WA 4M7AD 1M2OA 1OV3A 4IIMA 1GXIE 4QT7A 3JCMX 1VQMT 2JXBA 5GAN3 3V8KA 2FPDA 2LCSA 4J6YA 4M7AC 3SEMA 2QGFB 2XU8A 1JU5C 3RDVA 2O9VA 2ED0A 5CQXA 2M0YA 2VKNA 2ROTA 2DNUA 3MP1A 1YJ9A 5GAMe 2EGAA 2XI9A 1LJOA 9ATCB 2AKKA 2XDDA 3H41A 2XDBA 2RQTA 2BZXA 4F7UE 2K6DA 4J7IA 1RI9A 3JAME 2WSEE 2DM1A 3P8BB 1W2BP 4ZTJA 1VQKQ 1D0XA 3MEWA 1QWFA 2YDLA 2FRYA 5FU7B 2FZCB 3ASKA 3QKJA 3PMIA 3CCQA 2DL3A 2KAFA 4F7UG 4EPCA 4ZTFA 4M78F 1X6BA 4M77A 3A8OB 2KT1A 1KQ2A 4RUGA 2LNVA 1Q82C 1C1AA 3GIBA 4JZ4A 5KYWA 1VQ7Q 3E9GA 4J5YA 3TSWA 3SWNB 3JB9D 4J6WA 1IB8A 1VQPT 2WSCE 1YIJA 1EZZB 3C94A 4AMCA 4ZN3A 2DTIA 2BE7D 1WA7A 1W4SA 4M75F 5GAMf 3JCMP 2CP0A 2HNIA 1Q7YC 4C8QC 1M3BA 1VQ5A 1WHLA 2XICA 3EFOA 3O8VA 4MZTA 3EFRA 2BTTA 3MPUB 1NPPA 1X75C 1KK7A 4JS4A 1I0CA 4M77B 3I35A 2PVDB 3VKIA 1Z9ZA 1NLPC 2F2VA 2JOYA 2E6NA 2PVGB 4KUDK 2RH2A 1K0SA 2X51A 3NTIA 4J9HA 1B34A 2D9TA 1ZUKA 4JRQA 2LX9A 3MO8A 5CAIA 2K2MA 1JXOA 2CDTA 1X43A 3I55Q 1X6OA 1QWEA 1XJWB 2JVVA 4L6V5 3S3NA 4M78A 2ZGWA 4E7SA 3G4ST 1AT1B 2RA2A 1VQ4T 3M55A 4M7AA 2QQAA 2E10A 3FDRA 4C0ZA 2K79A 1WZOA 1WJQA 1G8XA 1ZBXA 5I2MA 2ZPEB 2RJEA 1IGQA 1IO6A 1WHHA 3NPFA 2DTOA 2DO3A 1ABOA 2LT4A 4FT2A 1ZSZC 2A28A 4BI8B 4N0AA 4PJOD 4JLIA 4FSSA 3JCMe 3HHTB 4FIBA 2RB6A 3BE3A 2ABLA 2X35A 5ECAA 3M4YA 3M9QA 3X24B 1M90C 3JCMc 2JT4A 2RQWA 2D1XA 3M0TA 4PJOC 1B34B 3PE0A 5GMKe 1HYOA 3CCLA 5GAMd 2K3BA 1UEBA 3I56T 1KD1U 1YJWQ 2IIMA 1M8VA 3V7CA 1M27C 1VQ8Q 2EQUA 2G6FX 3L42A 4M7AB 4JJNK 1YJNA 1GBRA 3VJPA 2X9HA 3HFOA 1UGQB 3MJXA 5LJ3e 1YI2Q 1U1TA 2F5KA 2JTFA 1FWZA 4GLKA 1BIAA 4LD6A 1UDLA 2YRCA 2H8HA 4AFQC 4F14A 1WX6A 2F2XA 2HKQB 5D6XA 2ZPBB 1T0JA 2CYZB 4IUTA 3RMQA 2FB7A 4KULA 4M78E 2L8DA 3CCVT 1WFWA 2KMTA 5IXFA 2DYBA 4HCZA 2BIVA 2GQIA 2W10A 1YP5A 4C8QA 2HDAA 1Y71A 1QKWA 2QEXQ 2E70A 4RCBA 4CRIA 2YWWA 4C0DB 2DL4A 4AG1C 2YSQA 2E5QA 1H3ZA 4M78G 1VQ9A 1AWWA 5GAOr 1GRIA 4WTOB 1W1FA 2LQ8A 2YUQA 4PJNA 1M8MA 2AZSA 3G7ZA 2LMJA 3QYGB 3CEYA 3M0RA 1ZUUA 1QW1A 4M75E 4XTXA 4XU3A 5I2SA 2KRMA 5LJ5j 4FU6A 2FZKB 3H0IA 1K9MU 1RAAB 1YJ9Q 2P0QA 5AYFA 4F04B 1T3SA 3OYYA 4J9GA 1WQ7A 2XHCA 3HRSA 2HAXA 2GFAA 1EX4A 3VRYA 4C8QB 1BCMA 2OTLT 4M75G 4JRIA 4BB7A 4QQDA 4CC7A 3G71A 1OX8A 1K73U 2G3RA 3CCQQ 2GTJA 1MV3A 4PJOA 4B6MA 1S72T 2ZPFB 1RAHB 2LC4A 1UTIA 1KHIA 2CZ1B 5M9OA 1D3BB 2EYWA 4DBRA 1G3SA 3M0UA 2GTOA 3KBGA 2KSSA 4QQ6A 2RF0A 3JCMd 3CPWS 2X3WD 1Y07A 5KE3A 2LJ1A 2JS0A 1YIJQ 5IN1A 2ZAEA 1MV0B 3M54A 2QGGA 2DL5A 1VQKA 5LJ3g 1QP3A 3A1PA 4F17A 4QVCA 1PKTA 1VA7A 2L89A 2QK0A 2CH4A 3CCST 1UECA 3EGDB 1UGRB 3GLXA 1IZ6A 5CCAA 2PVOB 5GANg 1QVFP 4PJOB 1H641 4II1A 4BY6C 2NUZA 2A0FB 3GPLA 1YITQ 5DM7R 5KH6A 3CCEQ 3CMET 1CSKA 2GQVA 5KE2A 4QKUA 3SDZA 3SHWA 3R6OA 3CMAT 3TREA 1M5Q1 1TH7A 4M7DF 3OYFA 4A4FA 3TCJA 4KUIA 3X28B 1D1AA 2ESWA 4MMKA 2CH4W 2QQSA 3OBWA 3OYGA 2PTKA 4FW2A 2QQBA 3CCRQ 4HVWA 1VQLT 1OOTA 5FLXE 4EMKA 5KYYB 3BW1A 3WVEB 1WXBA 1ZHIA 4J9DA 1KJWA 5D7UA 1LNXA 3PIPA 4OMFB 2L3SA 2YUPA 3I55A 2E1HA 4IUQA 4OMPA 3TQ7P 4R56A 1TOVA 1LOJA 4RCCA 2K5LA 2DTHA 2A08A 1K9MC 2K7AA 4GBQA 1SPKA 4IUUA 3TVTA 2DFUA 2A37A 1TWBA 4Z02A 2KROA 2BZYA 3V8LA 5GAMh 1IHWA 1T0HA 2DJQA 1KFZA 1TSFA 3S3OA 2QQ9A 1UUEA 4LXCA 1UGVA 3QZ5B 2IVWA 4AFSC 4OF1A 3M0PA 4E7HA 3F70A 1K8AR 3L2UA 1K73C 4D6WA 3CPWA 2FEIA 4DA4A 4PLIA 5GMKi 1W2BS 4BUGA 3UATA 4RTWA 3RERA 1V1CA 2DD5A 2NYSA 5FU6C 3V8JA 3H0FA 3OB9A 3ER0A 3ZL7C 5KYUA 3BFMA 2DMOA 4FW1A 4A54A 1G3YA 5GAN7 2O9SA 3FLGA 4ELYC 3EG2A 3RMSA 1Q7YU 1G5VA 1VQ7T 1YJWA 1WIEA 3L2ZA 4OGEA 1KQSS 1U06A 2CSIA 3LWIA 1D0ZA 1WHGA 1VUBA 2MF2A 2KNBB 2L3QA 5L23A 1YI2A 2LQKA 4RTXA 5CK9A 3E1SA 4E47A 1YNZA 1VYTA 4RTZA 4BDYA 1S1NA 2H3JA 1SG5A 3CC7Q 1CKBA 4PNOA 1Y7XA 2ATCB 3UPUA 4RMOA 1R0BG 3MEAA 1G83A 2EAYA 3J80E 2GBQA 1M1KR 5GAOm 2CZ7B 1MNEA 2EQIA 4EMHA 3V7RA 3OYJA 1FYNA 4HCKA 4K11A 4OP0A 4LE9A 4RG2A 2QEXA 3H9NA 2MCNA 4M77F 2YUOA 5GAOq 1K4US 4AT1B 4LUEA 3I55T 2P84A 5J26A 1R77A 4E7KA 4WF2A 3VS3A 1TUGB 3M5AA 4RTUA 2KYMA 1M90U 3CQTA 4IIOA 4M7DE 2JMAA 4XTZA 2DBKA 3CCMQ 3C95A 2DVJA 2DETA 5IH2A 4IURA 4DEXA 1YHQQ 5FRMA 4PJMA 2FRWA 1IRXA 1TTHB 2HL5C 4ELZC 3UT1A 1U3OA 3P8DA 3SWNA 1KIKA 2EYZA 2HQHA 1MMAA 4EMGA 4M7DG 1M9SA 4MDWA 2QTXA 2YRDA 2O4XA 5GAN4 4IUVA 3RESA 2RJFA 4RTVA 3PIOA 4PK4A 1Q95G 4BI4A 1K76A 5IXBA 1AD5A 4JJBA 2D0NA 4JJDA 2ZPIB 1IGUA 3KXTA 1W2BA 1V76A 2HL3A 3OMCA 1N6AA 2QA4Q 2RMOA 4UC4A 1HK9A 5GMKh 3TU4K 2EIFA 3CCUT 1RL2A 1VQ8T 2KXCA 1NM7A 2EYQA 2FPFA 2DXBA 4LNPA 4XTVA 4M7AF 2OAWA 1YI2T 1KQSP 2DA9A 1OPLA 1N8RR 2QG9B 4ZGEB 5HCKA 6AT1B 2LT1A 3CBPA 4MZPA 1AWXA 5LJ5g 2HBPA 2PZ1A 1N9SA 3PNWC 2O4XB 2R5MA 2K9GA 3CCJQ 2VWFA 2P0PA 3A8MB 2NLUA 2K57A 3FB9A 2KRNA 2MYSA 1AZGB 4X9CA 5HKCA 5FU6B 4Z88A 5DLQE 1QKXA 3LGFA 1ZSGA 2L2PA 1VQNT 2I0NA 1G3TA 2Y4YA 1YITA 3CCEA 4CI0C 2RN8A 1GBQA 3EG9B 1ZBJA 3I9QA 2VYTA 1VYVA 2AHJB 3OQ5A 3VS5A 3EAEA 1OPKA 2QXFA 1VQ6Q 3O5ZA 3G6EA 2RPNA 3H6ZA 1YJ9T 5HK3A 2X4JA 2DJZA 2EJFA 2LZ6B 3JB9F 4JS5A 1K1ZA 4J6XA 2EW3A 1X69A 3JCMW 1WYXA 2WSFE 3CCRA 5HK0A 1TUCA 4VUBA 3MCAB 4M77E 4C8QF 3M0QA 2XK0A 2JN0A 4F16A 2RHYA 1SSFA 3NGPA 2PUKB 1PRMC 4DBFA 4Y28E 5CO7A 2E41A 3CCQT 1JJ2P 1Q81R 2ROLA 1N5ZA 3MP8A 2CZ6B 1VQOA 3OYHA 1UE9A 2K4YA 4M77G 2LDMA 2YRVA 3REBB 2COWA 3E9FA 3MEUA 1RAGB 2LJ3A 1WHMA 4N4HA 1C0MA 3OYCA 4NL2A 1X6GA 3UWNA 1U1SA 1VIFA 2LP5A 3OYKA 3OA6A 2DXUA 2DLPA 1RLQC 1YIJT 5D6WA 3C0CA 2K3XA 4DQ2A 2X3XD 2DZCA 3VU3C 2E5KA 2RD1A 3PFSA 4HCBA 1JB0E 2C0TA 2CP6A 2KVQG 3M57A 3JCMV 5GANe 2RI3A 3QIIA 4NS5A 5CKHA 2SEMA 2KK4A 2RHUA 1NJIR 1VQ5T 3HPWA 1PD1A 3JB9H 1R8OB 2MPXC 3QDFA 4PJOF 1QVFS 2RHZA 4N4IA 4C0GA 2AT1B 2V1QA 3JCMJ 1QVGP 4M7AE 2HZYA 4PL6A 3JCMf 3X26B 5A0LA 3QXEB 3OYBA 2CREA 4TVRA 4BE2A 3MP6A 4XTWA 3VRZA 4J9BA 3DLMA 1OX9A 3NTKA 2GF7A 1NEBA 1H3HA 2M0OA 4M7AG 1PSEA 2E64A 4MMLA 4QQGA 1NG2A 5EG2A 1BI0A 1WXTA 3CC7A 4LUDA 2DPPB 3EGXA 3SD4A 4HVUA 3U23A 3VYHB 2DZ9A 5A0DA 2Y90A 2ZCFB 1D3BA 3GBQA 2DBMA 3LH0A 1HSQA 4GY5A 4FSXA 3QG1A 4OB3B 1ZUYA 2CUDA 4PFPA 5LJ3f 1G2BA 1OZ3A 2QAZA 4KT0E 2J6KA 2ZPGB 2OTJQ 4LDUA 1UJ0A 5A0GA 3M0SA 1AOJA 1ZSZA 1I81A 5GANf 1PC0A 5J39A 3NMZC 2YLBA 4XQ3A 3HFNA 3OY9A 1I8FA 3EGDA 1VQ4Q 2HEQA 3QHSA 3WXMB 3CCLT 4C92D 3VUZA 4ATOA 3OYDA 3KUFA 2JS2A 4MZMA 1LVKA 4ORZA 1JXMA 3CCMA 2M02A 3PT9A 3X20B 2CS7A 1YJNT 4D8DA 3EGXB 4FL6A 4C92C 5GAOl 1YHQA 3FIFA 1YBYA 2KBTA 1UJYA 3RR6A 1NBEB 3EFSA 4PJJA 3J7AF 3CC2A 2JTEA 1AHJB 5D6YA 1FXXA 4FYVB 4B9WA 4C8QE 4RKUE 4JUVA 1GL5A 4LN2A 3EH2A 1RAIB 1KD1R 1HJDA 2QASA 4BE0A 2LCLA 3OYAA 1QP2A 2EQMA 1K8AU 5CVIA 3CD6Q 4M7DD 1ZSZB 3TSZA 2BE9B 2VXEA 1JQQA 4LDVA 3I56Q 3QWXX 3RKWA 4C8QG 3JB9J 1ZLMA 2QA4A 4N4GA 4X34A 5KYYA 5GMKm 2NUPA 3QO3A 3VS6A 1GCQC 1RUWA 1SF9A 4KGVB 4M7DC 5FWCA 3JCMQ 1BI3A 1YWPA 3DKMA 4PFZA 1QVFA 1SKUB 2CZ0B 4BD3A 1VQ9T 2MMPA 5LJ3d 5GAN5 5KYNA 3CBMA 1WQWA 5AT1B 4JRKA 2MOXA 3CC4A 2MK5A 2CSQA 5GAMj 3BDLA 1IREB 2CGHA 2HBWA 4QVDA 4HT8A 5GANd 1B3QA 1VYUA 4FYYB 1X27A 1PNJA 1FX7A 3X25B 3G6EQ 1E6HA 4LD9K 2EPDA 3CCVQ 2RM4A 4FYXB 3CCJA 3EHQA 4HT9A 2YLCA 3G1JA 2VUBA 4FYWB 4J9EA 3INZA 4PJOE 2DIQA 1GFCA 2K2VA 4DOVA 1MGQA 1M1KU 1Q86R 2NUPB 3AHUA 3G71T 2P4TA 1JRIA 2XG8D 4IKFA 3C4SA 1PG5B 1XNIA 1XTDA 3S6WA 4XU2A 4RTTA 4PJOG 4CC2A 2A7YA 3IQLA 4JLGA 2EJ9A 1BI1A 1VQOQ 3A98A 2FPEA 1PSFA 4AFUC 8ATCB 1VQ6A 4Q5WA 2E3HA 2DYIA 2HMAA 3E19A 4QW2A 3HRTA 3PMTA 2RQRA 2OTLQ 4C5IA 2KYBA 4YTLA 4QVZA 1M3AA 2DILA 2BKDN 3QBYA 3OYMA 1LPLA 1KC8R 1VQKT 5KCHA 2FVUA 1WNLA 1VQMA 5I11A 2OX7A 4ZN1A 5KCOA 1S72Q 1TS9A 4HXJA 1A0NB 4DBHA 4RTYA 3E2UA 1GCPA 1WHJA 2RQVA 4BI3A 1RAEB 3MEVA 2VGMA 3QJ6A 5GJWB 3R6NA 2COYA 4L59A 1K0XA 3QZ9B 1TXQA 1O9SA 1JBMA 1WHKA 2KRSA 1AEYA 3LX7A 4M77D 2JZ2A 4KGZB 5LJ5e 2LVMA 3ULRB 2M9UA 1UG1A 4XTYA 5FRNA 4C92B 1D0YA 2O88A 1PWTA 1N8RU 1ARKA 3EH1A 3CCSQ 1B07A 1K8AC 4JRPA 2BUDA 2V1RA 3GF5A 3JB9I 3UA6A 2L3PA 1K9AA 2RNAA 2JM8A 2VC8A 1BYMA 2QDLA 2E6ZA 3OYEA 1WGSA 1D1CA 5FWBA 2A3LA 1UHCA 2EGEA 4E6RA 3P8HA 2RI5A 5CKDA 4FM4B 2ECZA 2V8KA 2XKOC 5LL6S 3CMEQ 3GP8A 4JPBW 2EFIA 5GMKj 1ZA2B 2RO0A 1T3LA 3PGGA 1D09B 2LNHB 1KG1A 2VASA 1VQPA 3QWYA 4C5HA 3CMAQ 4OVAA 4A63B 1NEGA 2J05A 4BY6B 4C0FA 2LCCA 4CC3A 3CXCS 1WXUA 2MAMA
chains in the Genus database with same CATH topology
2DVEA 3OBYA 1MHNA 1QW1A 4ME7A 2EWNA 4M75E 3H6ZA 2DAQA 4XTXA 4XU3A 3HKSA 5I2SA 3CCMT 3RIRA 1YJ9T 5HK3A 2L3RA 2X4JA 5LJ5j 4FU6A 5I21A 1K9MU 5DY9A 2RI2A 2DJZA 4HA8A 2EJFA 2P0QA 3JB9F 2PUOB 2EQJA 4M78D 5AYFA 2DIGA 4JS5A 3A8HB 3OYYA 1YHQT 1WQ7A 4J6XA 2XHCA 3HRSA 3JCMW 2WSFE 5FU7C 3ZFJA 4F7UB 5LJ5f 3CCRA 2HAXA 2GFAA 4F7UF 1M1KC 5HK0A 3CC2T 4VUBA 4XTUA 1X01A 3MCAB 3A5ZB 4C8QB 4A4KA 1UGPB 3HP9A 4M77E 4C8QF 1I4K1 4M75G 2OTLT 4JRIA 2XK0A 2I2LA 2JN0A 2JUFA 2RHYA 4QQDA 2B8AA 4BB7A 1SSFA 4M78C 4PKCC 4P5NA 3G71A 2PUKB 4C92A 3DLLA 3ME9A 4BDZA 3L2RA 1K73U 2K5FA 2M1HA 4Y28E 1BI2A 5CO7A 5HY6A 5A2QE 3L2WA 1Q86C 3V7SA 2OTJA 2G3RA 2E41A 3VYGA 3N5BB 3CCQT 3M58A 3JCMh 3MP8A 3HSBA 2CZ6B 2X4XA 1VQOA 4HKEA 3OYHA 1JJ2S 4PJOA 4OB0B 1VIEA 2GCXA 2K4YA 4M77G 1S72T 2LDMA 4XU1A 3G4SA 2DKGA 3UDCA 2ZPFB 3SWNC 1VQ4A 2QA4T 2YRVA 1Q81U 2LC4A 3CPFA 2WACA 3QJYA 3E9FA 4N0AC 3MEUA 4M75D 3OS1A 3LW5E 1YJWT 4N4HA 1KHIA 2HD0A 2CZ1B 2KY9A 3GNGA 1D3BB 4NL2A 3UWNA 4ZGDB 1G3SA 1N27A 5M9OA 2O01E 1U1SA 1Q82U 1VIFA 1WJSA 2KSSA 3KBGA 4QQ6A 3HRUA 3M59A 5GAOp 3OW2A 3OYKA 4EMKB 2DXUA 3OA6A 3GOXA 3JCMd 3T9NA 3CPWS 1YIJT 3M56A 3LGLA 1BIBA 1Y07A 5KE3A 3URGA 3JSCA 2EKOA 2EQKA 4M75C 5D6WA 5J3BA 4E7LA 4M7DA 3CC4T 1WPYA 3BY7A 2RK2A 5IN1A 2K3XA 4DQ2A 3RKXA 2QQRA 3M54A 2DZCA 4LDYA 1V29B 2YHTA 3VU3C 1KQSA 2RD1A 3LYIA 3PFSA 5LJ3h 1VQKA 1JB0E 3NTHA 4HCBA 1ZQ1A 2V8IA 2KVQG 3M57A 5LJ3g 1QP3A 2EJGA 3A8LB 5CKEA 4C0DC 4QVCA 1DJ7B 3JCMV 1HXDA 2RI3A 3QIIA 4NS5A 5CKHA 5GANe 1KC8C 3A8GB 2L89A 3CCST 4BACA 4M77C 1UGRB 2XD0A 3GLXA 2KK4A 1IZ6A 2RHUA 5GANh 3CCJT 5CCAA 2PVOB 5GANg 4LDWA 1VQ5T 3CD6A 2XDPA 2ZZDA 4KBMB 3HPWA 2C06A 3JB9H 1R8OB 3I56A 4PJOB 3CCUA 2E65A 1N9RA 2RHZA 4PJOF 4F7UA 1H641 1VQ8A 1QVFS 4N4IA 3OMGA 4II1A 4C0GA 2QEXT 4BY6C 3JCMJ 3GPLA 1NJIU 3ZBDA 4M7AE 3OYCA 1KHCA 5DM7R 5KH6A 2XIDA 2R57A 4OB1B 4PL6A 1UGSB 3JCMf 5LJ5d 1QVGS 3X26B 5A0LA 3QXEB 3OYBA 3CMET 4TVRA 4BE2A 4C8QD 2HQEA 2GQVA 3MP6A 5KE2A 2F69A 2E12A 4XTWA 4B9XA 2LTOA 2DEQA 3DLMA 1N8RC 3SDZA 3NTKA 4NL3A 3R6OA 4J8OA 2GF7A 3TREA 3CMAT 4C92E 1M5Q1 4FT4A 2QEXA 2M0OA 4M7DB 4M7AG 1TH7A 4M7DF 1PSEA 2E64A 4MMLA 4A4FA 3OYFA 3TCJA 4KUIA 4QQGA 4JDSA 4O6JA 5EG2A 1BI0A 3X28B 2R5AA 3CC7A 5GAN2 4MMKA 1VQ6T 5DLOA 1QVPA 2DPPB 2QQSA 3OS5A 4A53A 5GAOn 3SD4A 3VYHB 2JTMA 5IAYA 2DZ9A 3OBWA 5A0DA 3OYGA 2KQWA 2L5QA 2Y90A 3CXCA 2ZCFB 1OI1A 1D3BA 2QQBA 2RK1A 3DB4A 4A4GA 5C0MA 5LJ3j 3CCVA 3LH0A 3QUIA 3FRNA 1VQLT 4DOWA 5FLXE 4EMKA 4GY5A 4C92G 3M4GA 2RHXA 4FSXA 3BW1A 3WVEB 5GMKl 2D6FA 3GNFB 3QG1A 4OB3B 2M16A 2PQWA 1ZHIA 5LJ3f 3FEOA 3ZEHA 1NE8A 5GANj 1UB4A 3S3MA 3OSSC 2OTJT 1OZ3A 3DB3A 2K5IA 1VQNA 2V8JA 4RG8A 4M7AD 3RKYA 4KT0E 2ZPGB 1U8RA 1LNXA 3PIPA 4LDUA 1GXIE 5A0GA 2Y4XA 2JNGA 3JCMX 4IUPA 1I81A 4OMFB 5GANf 2QI2A 1VQMT 3L2VA 3I55A 2E1HA 5J39A 5GAN3 2YLBA 4IUQA 3V8KA 4XQ3A 3VUBA 3HFNA 4R56A 3OY9A 1I8FA 4J6YA 3QHSA 4M7AC 3WXMB 2MWOA 2XU8A 3SFMA 2FYKA 3CCLT 4C92D 3VUZA 4ZGJB 4ATOA 3MHXA 5CQXA 1LOJA 4RCCA 2K5LA 3KUFA 3OYDA 1JJ2A 3JRZA 2DTHA 4MZMA 1K9MC 2DXCA 3MP1A 3CCMA 1YJ9A 5GAMe 4IUUA 2XI9A 3PT9A 4Z02A 1LJOA 1NPRA 3QPHA 3V8LA 3X20B 2CS7A 2XDDA 1YJNT 2PU9B 5GAMh 4FL6A 2XDBA 4C92C 5GAMg 2OAUA 5GAOl 1YHQA 3FIFA 4HCCA 1YBYA 3S3OA 2QQ9A 3EFSA 4F7UE 3M53A 3J7AF 4V2SA 3META 3QZ5B 4J7IA 2IVWA 3JAME 3CC2A 1AHJB 5D6YA 1FXXA 2WSEE 3P8BB 4OF1A 4B9WA 2OTLA 4C8QE 4E7HA 3F70A 4ZTJA 4RKUE 4JUVA 3G6EA 3L2UA 1K73C 4M75A 4D6WA 3CPWA 4DA4A 3MEWA 4PLIA 5GMKi 1W2BS 4BUGA 5FU7B 4E7JA 3OS2A 3ASKA 3RERA 3QKJA 4BE0A 2DD5A 2LCLA 3PMIA 1XQHA 3CCQA 3OYAA 5FU6C 3CD6T 1QP2A 3V8JA 2EQMA 3OB9A 4OGCA 1K8AU 2KAFA 5CVIA 4F7UG 4M7DD 3OYIA 3ER0A 2VGNA 2F5TX 4M78B 4EPCA 4ZTFA 2VXEA 4M78F 4LDVA 1S72A 3RKWA 3BFMA 4C8QG 1Q81C 1G3WA 3JB9J 1O75A 4M77A 5GAN8 3A8OB 2QA4A 4A54A 1G3YA 4N4GA 4X34A 5GMKm 5GAN7 1KQ2A 3FLGA 3QO3A 3H8ZA 2LNVA 1BKBA 2FL7A 3RMSA 4ELYC 1Q7YU 1VQ7T 2D0QB 1Q82C 4M7DC 1G5VA 1YJWA 3JCMQ 3L2ZA 3GIBA 1BI3A 4OGEA 4R55A 1KQSS 3E9GA 3DKMA 4J5YA 1QVFA 3LWIA 3SWNB 3JB9D 1YITT 2RJCA 1VUBA 2CZ0B 2HQXA 4J6WA 4BD3A 1VQ9T 2MMPA 2MF2A 3QYHB 3FC3A 3CCET 5LJ3d 2LRQA 1RI0A 1VQPT 2WSCE 5CQYA 1YIJA 5GAN5 1KQ1A 2CKKA 4OB2B 3CBMA 1WQWA 1YI2A 3C94A 4JRKA 3JCMb 3CC4A 2LQKA 5CK9A 1QVGA 4L5GA 3E1SA 4E47A 5GAMj 3BDLA 1IREB 2CGHA 4BDYA 2H3JA 4ZN3A 2DTIA 4QVDA 5GANd 4HT8A 4PNOA 1Y7XA 3G6ET 1W4SA 3UPUA 4RMOA 4M75B 1FX7A 4M75F 3MEAA 3X25B 5GAMf 3JCMP 3VV0A 4LD9K 3CCSA 2HNIA 3PTAA 2RM4A 1Q7YC 4C8QC 2EAYA 3CCJA 3J80E 2ZPHB 4J7FA 5GAOm 1VQ5A 4HT9A 2YLCA 2CZ7B 2XICA 3O8VA 4MZTA 3EFRA 2VUBA 3LWHA 4BE1A 2DXTA 3CCRT 1NPPA 3INZA 4EMHA 1NJIC 1X75C 4XK8E 3V7RA 4PJOE 3OYJA 2DD4A 3OS0A 4RG2A 5CKFA 4OP0A 4JS4A 1P92A 2DIQA 3BDUA 4M77B 3SB2A 2PVDB 2K2VA 4M77F 3TEEA 1MGQA 2IG0A 3VKIA 4DOVA 1M1KU 5GAOq 2JOYA 2E6NA 2PVGB 4KUDK 2RH2A 3NTIA 3AHUA 3G71T 2P4TA 1B34A 2D9TA 3C12A 5L8RE 3I55T 1JRIA 2XG8D 4JRQA 2LX9A 3MO8A 5CAIA 5J26A 2RJDA 5FROA 3CMEA 2VV5A 5CR2A 4IKFA 3C4SA 1XTDA 1XNIA 3S6WA 4E7KA 4WF2A 4XU2A 1X6OA 3Q1JA 5IT9E 1Q86U 3M5AA 4PJOG 2JVVA 2A7YA 1VQOT 4L6V5 3S3NA 4JLGA 4M78A 2EJ9A 1BI1A 2ZGWA 5CKBA 3CMAA 3G4ST 1M90U 2RA2A 4C5EA 1VQ4T 4M7DE 4XTZA 3M55A 4EMKC 2QQAA 4M7AA 2E10A 5C6SA 1PSFA 4EDUA 3FDRA 1VQ6A 4C0ZA 3C95A 4Q5WA 1WJQA 4IURA 2MI6A 4Y91A 1ZBXA 5I2MA 2ZPEB 2RJEA 3E19A 5FRMA 4QW2A 4XAXB 4ELZC 3UT1A 3SWNA 3P8DA 1VQLA 2DTOA 2DO3A 2LT4A 1WJRA 4FT2A 4MDXA 3HRTA 3PMTA 4BI8B 4C5IA 2P0KA 1M9SA 4MDWA 2QTXA 4N0AA 4EMGA 4YTLA 4M7DG 4PJOD 4QVZA 5CIUA 4JLIA 2X4YA 2O4XA 3JCMe 3L1AA 5GAN4 4IUVA 2BKDN 3HHTB 3QBYA 4FIBA 3RESA 3OYMA 2RB6A 4O5VA 2RJFA 4PLLA 2X35A 3M4YA 3PIOA 1VQKT 3M9QA 3JCMg 3X24B 5KCHA 4BI4A 2FVUA 3J81E 1M90C 3JCMc 1WNLA 3CBOA 1B34B 1VQMA 4PJOC 2ZPIB 3QSUA 4ZN1A 2RHIA 1M4ZA 5KCOA 3HL8A 3KXTA 1W2BA 3JB9G 2X4WA 3QDRB 3OMCA 5GMKe 1KC8U 1N6AA 1OYXA 1EIFA 4UC4A 3CCLA 1HK9A 3NFCA 4BI3A 5GAMd 5GMKh 1UEBA 2EIFA 3I56T 4C5GA 3TU4K 2GFUA 3CCUT 1RL2A 1VQ8T 1KD1U 3MEVA 1M8VA 3OW2S 3V7CA 2VGMA 2EQUA 3L42A 2EYQA 4M7AB 2DXBA 4XTVA 5GAN6 4JJNK 3QJ6A 4M7AF 1M1FA 4L59A 1NZ9A 1YJNA 1YI2T 3QZ9B 3VJPA 1Y96A 1O9SA 2DK3A 1JBMA 1UGQB 2KDSA 3HFOA 3RUXA 3LX7A 4M77D 5LJ3e 1YCYA 1U1TA 2JZ2A 2F5KA 2JTFA 1I5LA 1FWZA 4ZGEB 5LJ5e 2LVMA 4GLKA 1BIAA 2M9UA 2LT1A 2MWPA 3CBPA 4LD6A 4XTYA 4MZPA 5LJ5h 5FRNA 4C92B 4C92F 5LJ5g 2HBPA 1N8RU 1N9SA 3PNWC 2O4XB 2R5MA 3CC7T 1M1GA 1K8AC 2FHDA 5D6XA 4JRPA 1OZ2A 2BUDA 2ZPBB 1KD1C 3GF5A 2CYZB 4XU0A 4IUTA 3JB9I 3RMQA 2P0PA 3A8MB 2FB7A 4E7IA 1XOVA 4KULA 4M78E 2L8DA 3CCVT 2VC8A 2KMTA 2K57A 2NLUA 3FB9A 1BYMA 2BIVA 2E6ZA 2QDYB 4HCZA 3OYEA 4C8QA 1WGSA 3OYNA 4X9CA 5HKCA 1Y71A 3OSVA 5FU6B 2E70A 2A3LA 2R58A 5DLQE 3LGFA 4RCBA 1VQ7A 3P8HA 2RI5A 4CRIA 5CKDA 4C0DB 4FM4B 4X9DA 1VQNT 2V8KA 2XKOC 5LL6S 4LDXA 3GP8A 3OYLA 4J83A 1G3TA 2EFIA 2E5QA 2Y4YA 5GMKj 2RO0A 3WVDB 1YITA 1H3ZA 2VXFA 4M78G 3CCEA 1VQ9A 3PGGA 5GAOr 4CI0C 1KG1A 1VQPA 3FJPA 4NOYA 1Y96B 4A4EA 2VYTA 4C5HA 2LQ8A 2AHJB 3OQ5A 4OVAA 3EAEA 4A4HA 3L2QA 3G7ZA 2QXFA 3QYGB 2LCCA 3CEYA 4BY6B 4C0FA 3CXCS 2K3YA 2MAMA 3LLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0Q A;  2P0P A;  2K2V A;  3URG A; 
#chains in the Genus database with same CATH topology
 1MMG A;  2DVE A;  3OBY A;  1MHN A;  2DRK A;  2EKH A;  2EWN A;  1MND A;  2DAQ A;  1GFD A;  4OML A;  5I21 A;  5IHN A;  2RI2 A;  4HA8 A;  2PUO B;  2NUT A;  2EQJ A;  4KH1 B;  4M78 D;  2DIG A;  1IXD A;  2DX1 A;  1TU0 B;  3ZFJ A;  4F7U B;  5LJ5 f;  1OUL A;  1M1K C;  4CC4 B;  1I07 A;  4A4K A;  1UGP B;  1BCO A;  5IHK A;  2D8H A;  3CC2 Q;  2QTV A;  1C6V X;  4M78 C;  4PKC C;  4P5N A;  4BDZ A;  2K5F A;  2M1H A;  3L2W A;  1BI2 A;  2YUN A;  2OTJ A;  3V7S A;  3VYG A;  3N5B B;  2H3E B;  3JCM h;  1YFN A;  2KE9 A;  3HSB A;  2DRM A;  4HKE A;  1JJ2 S;  1VIE A;  1YCS B;  2GCX A;  3G4S A;  3UDC A;  1VQ4 A;  1Q82 R;  1Q81 U;  3CPF A;  4N0A C;  1M2V A;  4M75 D;  1YJW T;  2DF6 A;  1M30 A;  1PKS A;  2HD0 A;  3GNG A;  2KY9 A;  4ZGD B;  8AT1 B;  4KGX B;  1SSH A;  5GAO p;  3GOX A;  2JM9 A;  1FMK A;  4Z8A A;  1X2Q A;  3NHN A;  3M56 A;  2NUT B;  3LGL A;  1BIB A;  3JSC A;  2EKO A;  4M75 C;  3EG9 A;  3KFV A;  2LQW A;  2RK2 A;  4AG2 C;  1YN8 A;  1B7T A;  4J9F A;  3CC4 Q;  4LDY A;  2JMC A;  1KQS A;  3VS4 A;  5LJ3 h;  3NTH A;  1ZQ1 A;  2V8I A;  1Q7Y R;  4C0D C;  2EJG A;  5CKE A;  1PRL C;  1HXD A;  2RQU A;  2J7I A;  1WDX A;  4AFZ C;  5GAN h;  4LDW A;  3CD6 A;  2XDP A;  2C06 A;  3I56 A;  2E65 A;  1W6X A;  3OMG A;  2QEX T;  2FZG B;  1NJI U;  2OJ2 A;  2E4H A;  4R0K A;  3FJ5 A;  1PD0 A;  2XID A;  2R57 A;  1M2V B;  2D8J A;  5LJ5 d;  1QVG S;  4PJL A;  4C8Q D;  1OU9 A;  4DBQ A;  2E12 A;  4B9X A;  5KYX A;  2DEQ A;  1N8R C;  4J8O A;  3UA7 A;  4FT4 A;  3AT1 B;  4JDS A;  2R5A A;  1SHF A;  3JV3 A;  5IHI A;  5GAN 2;  3CXC P;  1BU1 A;  1QVP A;  4A53 A;  4KH0 B;  2FG0 A;  2L5Q A;  3CXC A;  3DB4 A;  1IHV A;  3CCV A;  1U5S A;  3QUI A;  2KI7 A;  2JJ9 A;  5GJV B;  4DOW A;  1J3T A;  1CKA A;  7AT1 B;  3M4G A;  2RHX A;  2DE0 X;  5GMK l;  3GNF B;  2PQW A;  3ZEH A;  3FEO A;  3S3M A;  1M90 R;  2OTJ T;  3DB3 A;  5KYW B;  2PNI A;  3RKY A;  1QCN A;  1U8R A;  3EGU A;  1I1J A;  2JNG A;  2Y4X A;  4IUP A;  2QI2 A;  3L2V A;  2VB6 A;  3H0H A;  3VUB A;  4HVV A;  1VQM Q;  1TG0 A;  2MWO A;  3SFM A;  1QCF A;  2HSE B;  2FYK A;  2EVR A;  5KYX B;  4ZGJ B;  3MHX A;  1RAF B;  2KGT A;  1EFN A;  3JRZ A;  1JJ2 A;  2DXC A;  1BK2 A;  2FO0 A;  2CT4 A;  1Y0M A;  1NPR A;  2VVK A;  3QPH A;  2PU9 B;  3EFO B;  2LJ0 A;  5GAM g;  2OAU A;  4HCC A;  1NYG A;  2AZV A;  3M53 A;  4V2S A;  3MET A;  4Z89 A;  4J9C A;  2OTL A;  1QMC A;  1NYF A;  4M75 A;  2C0O A;  4E7J A;  3OS2 A;  1MUZ A;  2EYX A;  1XQH A;  3CD6 T;  1ZX6 A;  1ABQ A;  1SHG A;  2DL7 A;  2E3I A;  4OGC A;  4ESR A;  3OYI A;  2VGN A;  2ED1 A;  2F5T X;  4M78 B;  1E6G A;  1S72 A;  1Q81 C;  3CCU Q;  1G3W A;  1O75 A;  5GAN 8;  1MMD A;  2EYY A;  3H8Z A;  1SEM A;  1BKB A;  2BZ8 A;  2FL7 A;  2J6O A;  2D0Q B;  1AVZ C;  2AIR B;  3VS1 A;  4R55 A;  1F1B B;  1X2K A;  2DEU A;  1YIT T;  2RJC A;  3D7S B;  2HQX A;  3CCE T;  2MIO A;  3QYH B;  3FC3 A;  2LRQ A;  1RI0 A;  2HCK A;  5CQY A;  1RAC B;  1KQ1 A;  2CKK A;  4OB2 B;  3JCM b;  2AKL A;  1VQP Q;  1QVG A;  4L5G A;  2CT3 A;  4KRT A;  3G6E T;  4M75 B;  4X1V A;  1VOM A;  3VV0 A;  3CCS A;  1HD3 A;  3PTA A;  2W0Z A;  1JEG A;  2ZPH B;  4J7F A;  1PHT A;  2V26 A;  3LWH A;  4BE1 A;  2DXT A;  3CCR T;  1NJI C;  4XK8 E;  2DD4 A;  3OS0 A;  5CKF A;  1VQN Q;  1P92 A;  3BDU A;  3SB2 A;  3TEE A;  2IG0 A;  4OMQ A;  1LCK A;  5L8R E;  3C12 A;  3HTR A;  1I5O B;  4Y92 A;  3CME A;  4JZ3 A;  2RJD A;  5FRO A;  2VV5 A;  5CR2 A;  3Q1J A;  5IT9 E;  1Q86 U;  2SRC A;  2AK5 A;  3RNJ A;  1VQO T;  4M4Z A;  5CKB A;  3CMA A;  1H8K A;  4C5E A;  3G4S Q;  4WCI A;  3I5R A;  4EMK C;  5C6S A;  4EDU A;  1BB9 A;  2MI6 A;  4Y91 A;  2A36 A;  4XAX B;  4D8K A;  2DER A;  1VQL A;  1ZA1 B;  1PCX A;  1WJR A;  2IPO B;  4MDX A;  2P0K A;  5CIU A;  2X4Y A;  3L1A A;  4O5V A;  4PLL A;  1RAB B;  3JCM g;  3J81 E;  4J9I A;  1PM3 A;  3CBO A;  2KR3 A;  3QSU A;  2RHI A;  1M4Z A;  3HL8 A;  3JB9 G;  2X4W A;  3QDR B;  1KC8 U;  1OYX A;  1EIF A;  3NFC A;  4C5G A;  2GFU A;  3OW2 S;  1AWO A;  2QYZ A;  5GAN 6;  2J06 A;  1M1F A;  1NZ9 A;  2F1L A;  1Y96 A;  2DK3 A;  2KDS A;  3RUX A;  1YCY A;  1I5L A;  2EBP A;  4OMO A;  2CP5 A;  2O2O A;  2GNC A;  2MWP A;  5LJ5 h;  2COZ A;  4C92 F;  3CC7 T;  2NWM A;  1M1G A;  2FHD A;  2LQN A;  1OZ2 A;  1KD1 C;  4XU0 A;  1VQ5 Q;  1QQJ A;  4E7I A;  2LX7 A;  1XOV A;  1RLP C;  4PFO A;  2QDY B;  2CP3 A;  4OMN A;  3OYN A;  3EG3 A;  3OSV A;  4E7Z A;  4EIK A;  2R58 A;  1VQ7 A;  1QLY A;  1JO8 A;  1FMV A;  4X9D A;  1WI7 A;  4LDX A;  3OYL A;  1SRM A;  4J83 A;  3WVD B;  2VXF A;  2YXY A;  1OU8 A;  3FJP A;  4ZNX A;  4NOY A;  1Y96 B;  4A4E A;  3EG0 A;  2DL8 A;  4A4H A;  3L2Q A;  5EC7 A;  1K9M R;  3UF4 A;  2K3Y A;  3LLR A;  4ME7 A;  3THK A;  1OQK A;  3CCM T;  3HKS A;  3RIR A;  1WLP B;  2L3R A;  2CP2 A;  5DY9 A;  5FW9 A;  4ANJ A;  3A8H B;  1YHQ T;  3RBB B;  1Z9Q A;  1Y57 A;  5FU7 C;  3EHR A;  4F7U F;  1M3C A;  1K73 R;  3CC2 T;  4XTU A;  3LH5 A;  1X01 A;  3A5Z B;  1OEB A;  3HP9 A;  1I4K 1;  2I2L A;  2JUF A;  2KEA A;  4GLM A;  3VS0 A;  2B8A A;  3MKD A;  4C92 A;  3DLL A;  3ME9 A;  3L2R A;  3PVQ A;  1QCO A;  2CUB A;  5HY6 A;  5A2Q E;  4E2F B;  1BBZ A;  1Q86 C;  2C0I A;  1NLO C;  3M58 A;  1UHF A;  1MMN A;  2X4X A;  3CCL Q;  4OB0 B;  4XU1 A;  2EGC A;  2DKG A;  3SWN C;  2QA4 T;  2WAC A;  3QJY A;  4DEY A;  3OS1 A;  3LW5 E;  3OW2 P;  1YJN Q;  1W70 A;  1N27 A;  2O01 E;  1Q82 U;  4JJC A;  1WJS A;  2KT8 A;  3CPW P;  2L0A A;  3HRU A;  3M59 A;  3OW2 A;  4EMK B;  1AWJ A;  3T9N A;  2B86 A;  1GCQ A;  3URG A;  4E7L A;  2EQK A;  5J3B A;  4M7D A;  3CC4 T;  1AZE A;  1WPY A;  3BY7 A;  4OMM A;  3RKX A;  2QQR A;  1E7O A;  1V29 B;  2YHT A;  3I5S A;  3LYI A;  3A8L B;  2GGR A;  1DJ7 B;  1KC8 C;  3A8G B;  5I22 A;  4BAC A;  4M77 C;  2XD0 A;  3CCJ T;  2YT6 A;  2ZZD A;  4KBM B;  1TUD A;  1RAD B;  1SRL A;  3CCU A;  1VQ8 A;  1N9R A;  4F7U A;  1H92 A;  3VS2 A;  3ZBD A;  3PVL A;  1KHC A;  1VQ9 Q;  2KXD A;  1FMW A;  2XMF A;  1ACM B;  4OB1 B;  1UGS B;  2OI3 A;  2M51 A;  2HQE A;  2F2W A;  1YWO A;  2F69 A;  2LTO A;  1R0C B;  4NL3 A;  4C92 E;  4M7D B;  3VS7 A;  3REA B;  4O6J A;  2JW4 A;  1VQ6 T;  5DLO A;  5GAO n;  3OS5 A;  2JTM A;  5IAY A;  2KQW A;  1KSW A;  5KYU B;  2J6F A;  1OI1 A;  2RK1 A;  4A4G A;  5C0M A;  5LJ3 j;  4FCY A;  3FRN A;  2HSP A;  2HKN A;  1UFF A;  4C92 G;  1D1B A;  2P4R A;  1VQL Q;  2D6F A;  2M16 A;  2O31 A;  2ENM A;  3G71 Q;  1NE8 A;  5GAN j;  1UB4 A;  3OSS C;  2K5I A;  3EG1 A;  1VQN A;  2CP7 A;  2V8J A;  4RG8 A;  2Z0W A;  4M7A D;  1M2O A;  1OV3 A;  4IIM A;  1GXI E;  4QT7 A;  3JCM X;  1VQM T;  2JXB A;  5GAN 3;  3V8K A;  2FPD A;  2LCS A;  4J6Y A;  4M7A C;  3SEM A;  2QGF B;  2XU8 A;  1JU5 C;  3RDV A;  2O9V A;  2ED0 A;  5CQX A;  2M0Y A;  2VKN A;  2ROT A;  2DNU A;  3MP1 A;  1YJ9 A;  5GAM e;  2EGA A;  2XI9 A;  1LJO A;  9ATC B;  2AKK A;  2XDD A;  3H41 A;  2XDB A;  2RQT A;  2BZX A;  4F7U E;  2K6D A;  4J7I A;  1RI9 A;  3JAM E;  2WSE E;  2DM1 A;  3P8B B;  1W2B P;  4ZTJ A;  1VQK Q;  1D0X A;  3MEW A;  1QWF A;  2YDL A;  2FRY A;  5FU7 B;  2FZC B;  3ASK A;  3QKJ A;  3PMI A;  3CCQ A;  2DL3 A;  2KAF A;  4F7U G;  4EPC A;  4ZTF A;  4M78 F;  1X6B A;  4M77 A;  3A8O B;  2KT1 A;  1KQ2 A;  4RUG A;  2LNV A;  1Q82 C;  1C1A A;  3GIB A;  4JZ4 A;  5KYW A;  1VQ7 Q;  3E9G A;  4J5Y A;  3TSW A;  3SWN B;  3JB9 D;  4J6W A;  1IB8 A;  1VQP T;  2WSC E;  1YIJ A;  1EZZ B;  3C94 A;  4AMC A;  4ZN3 A;  2DTI A;  2BE7 D;  1WA7 A;  1W4S A;  4M75 F;  5GAM f;  3JCM P;  2CP0 A;  2HNI A;  1Q7Y C;  4C8Q C;  1M3B A;  1VQ5 A;  1WHL A;  2XIC A;  3EFO A;  3O8V A;  4MZT A;  3EFR A;  2BTT A;  3MPU B;  1NPP A;  1X75 C;  1KK7 A;  4JS4 A;  1I0C A;  4M77 B;  3I35 A;  2PVD B;  3VKI A;  1Z9Z A;  1NLP C;  2F2V A;  2JOY A;  2E6N A;  2PVG B;  4KUD K;  2RH2 A;  1K0S A;  2X51 A;  3NTI A;  4J9H A;  1B34 A;  2D9T A;  1ZUK A;  4JRQ A;  2LX9 A;  3MO8 A;  5CAI A;  2K2M A;  1JXO A;  2CDT A;  1X43 A;  3I55 Q;  1X6O A;  1QWE A;  1XJW B;  2JVV A;  4L6V 5;  3S3N A;  4M78 A;  2ZGW A;  4E7S A;  3G4S T;  1AT1 B;  2RA2 A;  1VQ4 T;  3M55 A;  4M7A A;  2QQA A;  2E10 A;  3FDR A;  4C0Z A;  2K79 A;  1WZO A;  1WJQ A;  1G8X A;  1ZBX A;  5I2M A;  2ZPE B;  2RJE A;  1IGQ A;  1IO6 A;  1WHH A;  3NPF A;  2DTO A;  2DO3 A;  1ABO A;  2LT4 A;  4FT2 A;  1ZSZ C;  2A28 A;  4BI8 B;  4N0A A;  4PJO D;  4JLI A;  4FSS A;  3JCM e;  3HHT B;  4FIB A;  2RB6 A;  3BE3 A;  2ABL A;  2X35 A;  5ECA A;  3M4Y A;  3M9Q A;  3X24 B;  1M90 C;  3JCM c;  2JT4 A;  2RQW A;  2D1X A;  3M0T A;  4PJO C;  1B34 B;  3PE0 A;  5GMK e;  1HYO A;  3CCL A;  5GAM d;  2K3B A;  1UEB A;  3I56 T;  1KD1 U;  1YJW Q;  2IIM A;  1M8V A;  3V7C A;  1M27 C;  1VQ8 Q;  2EQU A;  2G6F X;  3L42 A;  4M7A B;  4JJN K;  1YJN A;  1GBR A;  3VJP A;  2X9H A;  3HFO A;  1UGQ B;  3MJX A;  5LJ3 e;  1YI2 Q;  1U1T A;  2F5K A;  2JTF A;  1FWZ A;  4GLK A;  1BIA A;  4LD6 A;  1UDL A;  2YRC A;  2H8H A;  4AFQ C;  4F14 A;  1WX6 A;  2F2X A;  2HKQ B;  5D6X A;  2ZPB B;  1T0J A;  2CYZ B;  4IUT A;  3RMQ A;  2FB7 A;  4KUL A;  4M78 E;  2L8D A;  3CCV T;  1WFW A;  2KMT A;  5IXF A;  2DYB A;  4HCZ A;  2BIV A;  2GQI A;  2W10 A;  1YP5 A;  4C8Q A;  2HDA A;  1Y71 A;  1QKW A;  2QEX Q;  2E70 A;  4RCB A;  4CRI A;  2YWW A;  4C0D B;  2DL4 A;  4AG1 C;  2YSQ A;  2E5Q A;  1H3Z A;  4M78 G;  1VQ9 A;  1AWW A;  5GAO r;  1GRI A;  4WTO B;  1W1F A;  2LQ8 A;  2YUQ A;  4PJN A;  1M8M A;  2AZS A;  3G7Z A;  2LMJ A;  3QYG B;  3CEY A;  3M0R A;  1ZUU A;  1QW1 A;  4M75 E;  4XTX A;  4XU3 A;  5I2S A;  2KRM A;  5LJ5 j;  4FU6 A;  2FZK B;  3H0I A;  1K9M U;  1RAA B;  1YJ9 Q;  2P0Q A;  5AYF A;  4F04 B;  1T3S A;  3OYY A;  4J9G A;  1WQ7 A;  2XHC A;  3HRS A;  2HAX A;  2GFA A;  1EX4 A;  3VRY A;  4C8Q B;  1BCM A;  2OTL T;  4M75 G;  4JRI A;  4BB7 A;  4QQD A;  4CC7 A;  3G71 A;  1OX8 A;  1K73 U;  2G3R A;  3CCQ Q;  2GTJ A;  1MV3 A;  4PJO A;  4B6M A;  1S72 T;  2ZPF B;  1RAH B;  2LC4 A;  1UTI A;  1KHI A;  2CZ1 B;  5M9O A;  1D3B B;  2EYW A;  4DBR A;  1G3S A;  3M0U A;  2GTO A;  3KBG A;  2KSS A;  4QQ6 A;  2RF0 A;  3JCM d;  3CPW S;  2X3W D;  1Y07 A;  5KE3 A;  2LJ1 A;  2JS0 A;  1YIJ Q;  5IN1 A;  2ZAE A;  1MV0 B;  3M54 A;  2QGG A;  2DL5 A;  1VQK A;  5LJ3 g;  1QP3 A;  3A1P A;  4F17 A;  4QVC A;  1PKT A;  1VA7 A;  2L89 A;  2QK0 A;  2CH4 A;  3CCS T;  1UEC A;  3EGD B;  1UGR B;  3GLX A;  1IZ6 A;  5CCA A;  2PVO B;  5GAN g;  1QVF P;  4PJO B;  1H64 1;  4II1 A;  4BY6 C;  2NUZ A;  2A0F B;  3GPL A;  1YIT Q;  5DM7 R;  5KH6 A;  3CCE Q;  3CME T;  1CSK A;  2GQV A;  5KE2 A;  4QKU A;  3SDZ A;  3SHW A;  3R6O A;  3CMA T;  3TRE A;  1M5Q 1;  1TH7 A;  4M7D F;  3OYF A;  4A4F A;  3TCJ A;  4KUI A;  3X28 B;  1D1A A;  2ESW A;  4MMK A;  2CH4 W;  2QQS A;  3OBW A;  3OYG A;  2PTK A;  4FW2 A;  2QQB A;  3CCR Q;  4HVW A;  1VQL T;  1OOT A;  5FLX E;  4EMK A;  5KYY B;  3BW1 A;  3WVE B;  1WXB A;  1ZHI A;  4J9D A;  1KJW A;  5D7U A;  1LNX A;  3PIP A;  4OMF B;  2L3S A;  2YUP A;  3I55 A;  2E1H A;  4IUQ A;  4OMP A;  3TQ7 P;  4R56 A;  1TOV A;  1LOJ A;  4RCC A;  2K5L A;  2DTH A;  2A08 A;  1K9M C;  2K7A A;  4GBQ A;  1SPK A;  4IUU A;  3TVT A;  2DFU A;  2A37 A;  1TWB A;  4Z02 A;  2KRO A;  2BZY A;  3V8L A;  5GAM h;  1IHW A;  1T0H A;  2DJQ A;  1KFZ A;  1TSF A;  3S3O A;  2QQ9 A;  1UUE A;  4LXC A;  1UGV A;  3QZ5 B;  2IVW A;  4AFS C;  4OF1 A;  3M0P A;  4E7H A;  3F70 A;  1K8A R;  3L2U A;  1K73 C;  4D6W A;  3CPW A;  2FEI A;  4DA4 A;  4PLI A;  5GMK i;  1W2B S;  4BUG A;  3UAT A;  4RTW A;  3RER A;  1V1C A;  2DD5 A;  2NYS A;  5FU6 C;  3V8J A;  3H0F A;  3OB9 A;  3ER0 A;  3ZL7 C;  5KYU A;  3BFM A;  2DMO A;  4FW1 A;  4A54 A;  1G3Y A;  5GAN 7;  2O9S A;  3FLG A;  4ELY C;  3EG2 A;  3RMS A;  1Q7Y U;  1G5V A;  1VQ7 T;  1YJW A;  1WIE A;  3L2Z A;  4OGE A;  1KQS S;  1U06 A;  2CSI A;  3LWI A;  1D0Z A;  1WHG A;  1VUB A;  2MF2 A;  2KNB B;  2L3Q A;  5L23 A;  1YI2 A;  2LQK A;  4RTX A;  5CK9 A;  3E1S A;  4E47 A;  1YNZ A;  1VYT A;  4RTZ A;  4BDY A;  1S1N A;  2H3J A;  1SG5 A;  3CC7 Q;  1CKB A;  4PNO A;  1Y7X A;  2ATC B;  3UPU A;  4RMO A;  1R0B G;  3MEA A;  1G83 A;  2EAY A;  3J80 E;  2GBQ A;  1M1K R;  5GAO m;  2CZ7 B;  1MNE A;  2EQI A;  4EMH A;  3V7R A;  3OYJ A;  1FYN A;  4HCK A;  4K11 A;  4OP0 A;  4LE9 A;  4RG2 A;  2QEX A;  3H9N A;  2MCN A;  4M77 F;  2YUO A;  5GAO q;  1K4U S;  4AT1 B;  4LUE A;  3I55 T;  2P84 A;  5J26 A;  1R77 A;  4E7K A;  4WF2 A;  3VS3 A;  1TUG B;  3M5A A;  4RTU A;  2KYM A;  1M90 U;  3CQT A;  4IIO A;  4M7D E;  2JMA A;  4XTZ A;  2DBK A;  3CCM Q;  3C95 A;  2DVJ A;  2DET A;  5IH2 A;  4IUR A;  4DEX A;  1YHQ Q;  5FRM A;  4PJM A;  2FRW A;  1IRX A;  1TTH B;  2HL5 C;  4ELZ C;  3UT1 A;  1U3O A;  3P8D A;  3SWN A;  1KIK A;  2EYZ A;  2HQH A;  1MMA A;  4EMG A;  4M7D G;  1M9S A;  4MDW A;  2QTX A;  2YRD A;  2O4X A;  5GAN 4;  4IUV A;  3RES A;  2RJF A;  4RTV A;  3PIO A;  4PK4 A;  1Q95 G;  4BI4 A;  1K76 A;  5IXB A;  1AD5 A;  4JJB A;  2D0N A;  4JJD A;  2ZPI B;  1IGU A;  3KXT A;  1W2B A;  1V76 A;  2HL3 A;  3OMC A;  1N6A A;  2QA4 Q;  2RMO A;  4UC4 A;  1HK9 A;  5GMK h;  3TU4 K;  2EIF A;  3CCU T;  1RL2 A;  1VQ8 T;  2KXC A;  1NM7 A;  2EYQ A;  2FPF A;  2DXB A;  4LNP A;  4XTV A;  4M7A F;  2OAW A;  1YI2 T;  1KQS P;  2DA9 A;  1OPL A;  1N8R R;  2QG9 B;  4ZGE B;  5HCK A;  6AT1 B;  2LT1 A;  3CBP A;  4MZP A;  1AWX A;  5LJ5 g;  2HBP A;  2PZ1 A;  1N9S A;  3PNW C;  2O4X B;  2R5M A;  2K9G A;  3CCJ Q;  2VWF A;  2P0P A;  3A8M B;  2NLU A;  2K57 A;  3FB9 A;  2KRN A;  2MYS A;  1AZG B;  4X9C A;  5HKC A;  5FU6 B;  4Z88 A;  5DLQ E;  1QKX A;  3LGF A;  1ZSG A;  2L2P A;  1VQN T;  2I0N A;  1G3T A;  2Y4Y A;  1YIT A;  3CCE A;  4CI0 C;  2RN8 A;  1GBQ A;  3EG9 B;  1ZBJ A;  3I9Q A;  2VYT A;  1VYV A;  2AHJ B;  3OQ5 A;  3VS5 A;  3EAE A;  1OPK A;  2QXF A;  1VQ6 Q;  3O5Z A;  3G6E A;  2RPN A;  3H6Z A;  1YJ9 T;  5HK3 A;  2X4J A;  2DJZ A;  2EJF A;  2LZ6 B;  3JB9 F;  4JS5 A;  1K1Z A;  4J6X A;  2EW3 A;  1X69 A;  3JCM W;  1WYX A;  2WSF E;  3CCR A;  5HK0 A;  1TUC A;  4VUB A;  3MCA B;  4M77 E;  4C8Q F;  3M0Q A;  2XK0 A;  2JN0 A;  4F16 A;  2RHY A;  1SSF A;  3NGP A;  2PUK B;  1PRM C;  4DBF A;  4Y28 E;  5CO7 A;  2E41 A;  3CCQ T;  1JJ2 P;  1Q81 R;  2ROL A;  1N5Z A;  3MP8 A;  2CZ6 B;  1VQO A;  3OYH A;  1UE9 A;  2K4Y A;  4M77 G;  2LDM A;  2YRV A;  3REB B;  2COW A;  3E9F A;  3MEU A;  1RAG B;  2LJ3 A;  1WHM A;  4N4H A;  1C0M A;  3OYC A;  4NL2 A;  1X6G A;  3UWN A;  1U1S A;  1VIF A;  2LP5 A;  3OYK A;  3OA6 A;  2DXU A;  2DLP A;  1RLQ C;  1YIJ T;  5D6W A;  3C0C A;  2K3X A;  4DQ2 A;  2X3X D;  2DZC A;  3VU3 C;  2E5K A;  2RD1 A;  3PFS A;  4HCB A;  1JB0 E;  2C0T A;  2CP6 A;  2KVQ G;  3M57 A;  3JCM V;  5GAN e;  2RI3 A;  3QII A;  4NS5 A;  5CKH A;  2SEM A;  2KK4 A;  2RHU A;  1NJI R;  1VQ5 T;  3HPW A;  1PD1 A;  3JB9 H;  1R8O B;  2MPX C;  3QDF A;  4PJO F;  1QVF S;  2RHZ A;  4N4I A;  4C0G A;  2AT1 B;  2V1Q A;  3JCM J;  1QVG P;  4M7A E;  2HZY A;  4PL6 A;  3JCM f;  3X26 B;  5A0L A;  3QXE B;  3OYB A;  2CRE A;  4TVR A;  4BE2 A;  3MP6 A;  4XTW A;  3VRZ A;  4J9B A;  3DLM A;  1OX9 A;  3NTK A;  2GF7 A;  1NEB A;  1H3H A;  2M0O A;  4M7A G;  1PSE A;  2E64 A;  4MML A;  4QQG A;  1NG2 A;  5EG2 A;  1BI0 A;  1WXT A;  3CC7 A;  4LUD A;  2DPP B;  3EGX A;  3SD4 A;  4HVU A;  3U23 A;  3VYH B;  2DZ9 A;  5A0D A;  2Y90 A;  2ZCF B;  1D3B A;  3GBQ A;  2DBM A;  3LH0 A;  1HSQ A;  4GY5 A;  4FSX A;  3QG1 A;  4OB3 B;  1ZUY A;  2CUD A;  4PFP A;  5LJ3 f;  1G2B A;  1OZ3 A;  2QAZ A;  4KT0 E;  2J6K A;  2ZPG B;  2OTJ Q;  4LDU A;  1UJ0 A;  5A0G A;  3M0S A;  1AOJ A;  1ZSZ A;  1I81 A;  5GAN f;  1PC0 A;  5J39 A;  3NMZ C;  2YLB A;  4XQ3 A;  3HFN A;  3OY9 A;  1I8F A;  3EGD A;  1VQ4 Q;  2HEQ A;  3QHS A;  3WXM B;  3CCL T;  4C92 D;  3VUZ A;  4ATO A;  3OYD A;  3KUF A;  2JS2 A;  4MZM A;  1LVK A;  4ORZ A;  1JXM A;  3CCM A;  2M02 A;  3PT9 A;  3X20 B;  2CS7 A;  1YJN T;  4D8D A;  3EGX B;  4FL6 A;  4C92 C;  5GAO l;  1YHQ A;  3FIF A;  1YBY A;  2KBT A;  1UJY A;  3RR6 A;  1NBE B;  3EFS A;  4PJJ A;  3J7A F;  3CC2 A;  2JTE A;  1AHJ B;  5D6Y A;  1FXX A;  4FYV B;  4B9W A;  4C8Q E;  4RKU E;  4JUV A;  1GL5 A;  4LN2 A;  3EH2 A;  1RAI B;  1KD1 R;  1HJD A;  2QAS A;  4BE0 A;  2LCL A;  3OYA A;  1QP2 A;  2EQM A;  1K8A U;  5CVI A;  3CD6 Q;  4M7D D;  1ZSZ B;  3TSZ A;  2BE9 B;  2VXE A;  1JQQ A;  4LDV A;  3I56 Q;  3QWX X;  3RKW A;  4C8Q G;  3JB9 J;  1ZLM A;  2QA4 A;  4N4G A;  4X34 A;  5KYY A;  5GMK m;  2NUP A;  3QO3 A;  3VS6 A;  1GCQ C;  1RUW A;  1SF9 A;  4KGV B;  4M7D C;  5FWC A;  3JCM Q;  1BI3 A;  1YWP A;  3DKM A;  4PFZ A;  1QVF A;  1SKU B;  2CZ0 B;  4BD3 A;  1VQ9 T;  2MMP A;  5LJ3 d;  5GAN 5;  5KYN A;  3CBM A;  1WQW A;  5AT1 B;  4JRK A;  2MOX A;  3CC4 A;  2MK5 A;  2CSQ A;  5GAM j;  3BDL A;  1IRE B;  2CGH A;  2HBW A;  4QVD A;  4HT8 A;  5GAN d;  1B3Q A;  1VYU A;  4FYY B;  1X27 A;  1PNJ A;  1FX7 A;  3X25 B;  3G6E Q;  1E6H A;  4LD9 K;  2EPD A;  3CCV Q;  2RM4 A;  4FYX B;  3CCJ A;  3EHQ A;  4HT9 A;  2YLC A;  3G1J A;  2VUB A;  4FYW B;  4J9E A;  3INZ A;  4PJO E;  2DIQ A;  1GFC A;  2K2V A;  4DOV A;  1MGQ A;  1M1K U;  1Q86 R;  2NUP B;  3AHU A;  3G71 T;  2P4T A;  1JRI A;  2XG8 D;  4IKF A;  3C4S A;  1PG5 B;  1XNI A;  1XTD A;  3S6W A;  4XU2 A;  4RTT A;  4PJO G;  4CC2 A;  2A7Y A;  3IQL A;  4JLG A;  2EJ9 A;  1BI1 A;  1VQO Q;  3A98 A;  2FPE A;  1PSF A;  4AFU C;  8ATC B;  1VQ6 A;  4Q5W A;  2E3H A;  2DYI A;  2HMA A;  3E19 A;  4QW2 A;  3HRT A;  3PMT A;  2RQR A;  2OTL Q;  4C5I A;  2KYB A;  4YTL A;  4QVZ A;  1M3A A;  2DIL A;  2BKD N;  3QBY A;  3OYM A;  1LPL A;  1KC8 R;  1VQK T;  5KCH A;  2FVU A;  1WNL A;  1VQM A;  5I11 A;  2OX7 A;  4ZN1 A;  5KCO A;  1S72 Q;  1TS9 A;  4HXJ A;  1A0N B;  4DBH A;  4RTY A;  3E2U A;  1GCP A;  1WHJ A;  2RQV A;  4BI3 A;  1RAE B;  3MEV A;  2VGM A;  3QJ6 A;  5GJW B;  3R6N A;  2COY A;  4L59 A;  1K0X A;  3QZ9 B;  1TXQ A;  1O9S A;  1JBM A;  1WHK A;  2KRS A;  1AEY A;  3LX7 A;  4M77 D;  2JZ2 A;  4KGZ B;  5LJ5 e;  2LVM A;  3ULR B;  2M9U A;  1UG1 A;  4XTY A;  5FRN A;  4C92 B;  1D0Y A;  2O88 A;  1PWT A;  1N8R U;  1ARK A;  3EH1 A;  3CCS Q;  1B07 A;  1K8A C;  4JRP A;  2BUD A;  2V1R A;  3GF5 A;  3JB9 I;  3UA6 A;  2L3P A;  1K9A A;  2RNA A;  2JM8 A;  2VC8 A;  1BYM A;  2QDL A;  2E6Z A;  3OYE A;  1WGS A;  1D1C A;  5FWB A;  2A3L A;  1UHC A;  2EGE A;  4E6R A;  3P8H A;  2RI5 A;  5CKD A;  4FM4 B;  2ECZ A;  2V8K A;  2XKO C;  5LL6 S;  3CME Q;  3GP8 A;  4JPB W;  2EFI A;  5GMK j;  1ZA2 B;  2RO0 A;  1T3L A;  3PGG A;  1D09 B;  2LNH B;  1KG1 A;  2VAS A;  1VQP A;  3QWY A;  4C5H A;  3CMA Q;  4OVA A;  4A63 B;  1NEG A;  2J05 A;  4BY6 B;  4C0F A;  2LCC A;  4CC3 A;  3CXC S;  1WXU A;  2MAM A; 
#chains in the Genus database with same CATH homology
 2DVE A;  3OBY A;  1MHN A;  1QW1 A;  4ME7 A;  2EWN A;  4M75 E;  3H6Z A;  2DAQ A;  4XTX A;  4XU3 A;  3HKS A;  5I2S A;  3CCM T;  3RIR A;  1YJ9 T;  5HK3 A;  2L3R A;  2X4J A;  5LJ5 j;  4FU6 A;  5I21 A;  1K9M U;  5DY9 A;  2RI2 A;  2DJZ A;  4HA8 A;  2EJF A;  2P0Q A;  3JB9 F;  2PUO B;  2EQJ A;  4M78 D;  5AYF A;  2DIG A;  4JS5 A;  3A8H B;  3OYY A;  1YHQ T;  1WQ7 A;  4J6X A;  2XHC A;  3HRS A;  3JCM W;  2WSF E;  5FU7 C;  3ZFJ A;  4F7U B;  5LJ5 f;  3CCR A;  2HAX A;  2GFA A;  4F7U F;  1M1K C;  5HK0 A;  3CC2 T;  4VUB A;  4XTU A;  1X01 A;  3MCA B;  3A5Z B;  4C8Q B;  4A4K A;  1UGP B;  3HP9 A;  4M77 E;  4C8Q F;  1I4K 1;  4M75 G;  2OTL T;  4JRI A;  2XK0 A;  2I2L A;  2JN0 A;  2JUF A;  2RHY A;  4QQD A;  2B8A A;  4BB7 A;  1SSF A;  4M78 C;  4PKC C;  4P5N A;  3G71 A;  2PUK B;  4C92 A;  3DLL A;  3ME9 A;  4BDZ A;  3L2R A;  1K73 U;  2K5F A;  2M1H A;  4Y28 E;  1BI2 A;  5CO7 A;  5HY6 A;  5A2Q E;  3L2W A;  1Q86 C;  3V7S A;  2OTJ A;  2G3R A;  2E41 A;  3VYG A;  3N5B B;  3CCQ T;  3M58 A;  3JCM h;  3MP8 A;  3HSB A;  2CZ6 B;  2X4X A;  1VQO A;  4HKE A;  3OYH A;  1JJ2 S;  4PJO A;  4OB0 B;  1VIE A;  2GCX A;  2K4Y A;  4M77 G;  1S72 T;  2LDM A;  4XU1 A;  3G4S A;  2DKG A;  3UDC A;  2ZPF B;  3SWN C;  1VQ4 A;  2QA4 T;  2YRV A;  1Q81 U;  2LC4 A;  3CPF A;  2WAC A;  3QJY A;  3E9F A;  4N0A C;  3MEU A;  4M75 D;  3OS1 A;  3LW5 E;  1YJW T;  4N4H A;  1KHI A;  2HD0 A;  2CZ1 B;  2KY9 A;  3GNG A;  1D3B B;  4NL2 A;  3UWN A;  4ZGD B;  1G3S A;  1N27 A;  5M9O A;  2O01 E;  1U1S A;  1Q82 U;  1VIF A;  1WJS A;  2KSS A;  3KBG A;  4QQ6 A;  3HRU A;  3M59 A;  5GAO p;  3OW2 A;  3OYK A;  4EMK B;  2DXU A;  3OA6 A;  3GOX A;  3JCM d;  3T9N A;  3CPW S;  1YIJ T;  3M56 A;  3LGL A;  1BIB A;  1Y07 A;  5KE3 A;  3URG A;  3JSC A;  2EKO A;  2EQK A;  4M75 C;  5D6W A;  5J3B A;  4E7L A;  4M7D A;  3CC4 T;  1WPY A;  3BY7 A;  2RK2 A;  5IN1 A;  2K3X A;  4DQ2 A;  3RKX A;  2QQR A;  3M54 A;  2DZC A;  4LDY A;  1V29 B;  2YHT A;  3VU3 C;  1KQS A;  2RD1 A;  3LYI A;  3PFS A;  5LJ3 h;  1VQK A;  1JB0 E;  3NTH A;  4HCB A;  1ZQ1 A;  2V8I A;  2KVQ G;  3M57 A;  5LJ3 g;  1QP3 A;  2EJG A;  3A8L B;  5CKE A;  4C0D C;  4QVC A;  1DJ7 B;  3JCM V;  1HXD A;  2RI3 A;  3QII A;  4NS5 A;  5CKH A;  5GAN e;  1KC8 C;  3A8G B;  2L89 A;  3CCS T;  4BAC A;  4M77 C;  1UGR B;  2XD0 A;  3GLX A;  2KK4 A;  1IZ6 A;  2RHU A;  5GAN h;  3CCJ T;  5CCA A;  2PVO B;  5GAN g;  4LDW A;  1VQ5 T;  3CD6 A;  2XDP A;  2ZZD A;  4KBM B;  3HPW A;  2C06 A;  3JB9 H;  1R8O B;  3I56 A;  4PJO B;  3CCU A;  2E65 A;  1N9R A;  2RHZ A;  4PJO F;  4F7U A;  1H64 1;  1VQ8 A;  1QVF S;  4N4I A;  3OMG A;  4II1 A;  4C0G A;  2QEX T;  4BY6 C;  3JCM J;  3GPL A;  1NJI U;  3ZBD A;  4M7A E;  3OYC A;  1KHC A;  5DM7 R;  5KH6 A;  2XID A;  2R57 A;  4OB1 B;  4PL6 A;  1UGS B;  3JCM f;  5LJ5 d;  1QVG S;  3X26 B;  5A0L A;  3QXE B;  3OYB A;  3CME T;  4TVR A;  4BE2 A;  4C8Q D;  2HQE A;  2GQV A;  3MP6 A;  5KE2 A;  2F69 A;  2E12 A;  4XTW A;  4B9X A;  2LTO A;  2DEQ A;  3DLM A;  1N8R C;  3SDZ A;  3NTK A;  4NL3 A;  3R6O A;  4J8O A;  2GF7 A;  3TRE A;  3CMA T;  4C92 E;  1M5Q 1;  4FT4 A;  2QEX A;  2M0O A;  4M7D B;  4M7A G;  1TH7 A;  4M7D F;  1PSE A;  2E64 A;  4MML A;  4A4F A;  3OYF A;  3TCJ A;  4KUI A;  4QQG A;  4JDS A;  4O6J A;  5EG2 A;  1BI0 A;  3X28 B;  2R5A A;  3CC7 A;  5GAN 2;  4MMK A;  1VQ6 T;  5DLO A;  1QVP A;  2DPP B;  2QQS A;  3OS5 A;  4A53 A;  5GAO n;  3SD4 A;  3VYH B;  2JTM A;  5IAY A;  2DZ9 A;  3OBW A;  5A0D A;  3OYG A;  2KQW A;  2L5Q A;  2Y90 A;  3CXC A;  2ZCF B;  1OI1 A;  1D3B A;  2QQB A;  2RK1 A;  3DB4 A;  4A4G A;  5C0M A;  5LJ3 j;  3CCV A;  3LH0 A;  3QUI A;  3FRN A;  1VQL T;  4DOW A;  5FLX E;  4EMK A;  4GY5 A;  4C92 G;  3M4G A;  2RHX A;  4FSX A;  3BW1 A;  3WVE B;  5GMK l;  2D6F A;  3GNF B;  3QG1 A;  4OB3 B;  2M16 A;  2PQW A;  1ZHI A;  5LJ3 f;  3FEO A;  3ZEH A;  1NE8 A;  5GAN j;  1UB4 A;  3S3M A;  3OSS C;  2OTJ T;  1OZ3 A;  3DB3 A;  2K5I A;  1VQN A;  2V8J A;  4RG8 A;  4M7A D;  3RKY A;  4KT0 E;  2ZPG B;  1U8R A;  1LNX A;  3PIP A;  4LDU A;  1GXI E;  5A0G A;  2Y4X A;  2JNG A;  3JCM X;  4IUP A;  1I81 A;  4OMF B;  5GAN f;  2QI2 A;  1VQM T;  3L2V A;  3I55 A;  2E1H A;  5J39 A;  5GAN 3;  2YLB A;  4IUQ A;  3V8K A;  4XQ3 A;  3VUB A;  3HFN A;  4R56 A;  3OY9 A;  1I8F A;  4J6Y A;  3QHS A;  4M7A C;  3WXM B;  2MWO A;  2XU8 A;  3SFM A;  2FYK A;  3CCL T;  4C92 D;  3VUZ A;  4ZGJ B;  4ATO A;  3MHX A;  5CQX A;  1LOJ A;  4RCC A;  2K5L A;  3KUF A;  3OYD A;  1JJ2 A;  3JRZ A;  2DTH A;  4MZM A;  1K9M C;  2DXC A;  3MP1 A;  3CCM A;  1YJ9 A;  5GAM e;  4IUU A;  2XI9 A;  3PT9 A;  4Z02 A;  1LJO A;  1NPR A;  3QPH A;  3V8L A;  3X20 B;  2CS7 A;  2XDD A;  1YJN T;  2PU9 B;  5GAM h;  4FL6 A;  2XDB A;  4C92 C;  5GAM g;  2OAU A;  5GAO l;  1YHQ A;  3FIF A;  4HCC A;  1YBY A;  3S3O A;  2QQ9 A;  3EFS A;  4F7U E;  3M53 A;  3J7A F;  4V2S A;  3MET A;  3QZ5 B;  4J7I A;  2IVW A;  3JAM E;  3CC2 A;  1AHJ B;  5D6Y A;  1FXX A;  2WSE E;  3P8B B;  4OF1 A;  4B9W A;  2OTL A;  4C8Q E;  4E7H A;  3F70 A;  4ZTJ A;  4RKU E;  4JUV A;  3G6E A;  3L2U A;  1K73 C;  4M75 A;  4D6W A;  3CPW A;  4DA4 A;  3MEW A;  4PLI A;  5GMK i;  1W2B S;  4BUG A;  5FU7 B;  4E7J A;  3OS2 A;  3ASK A;  3RER A;  3QKJ A;  4BE0 A;  2DD5 A;  2LCL A;  3PMI A;  1XQH A;  3CCQ A;  3OYA A;  5FU6 C;  3CD6 T;  1QP2 A;  3V8J A;  2EQM A;  3OB9 A;  4OGC A;  1K8A U;  2KAF A;  5CVI A;  4F7U G;  4M7D D;  3OYI A;  3ER0 A;  2VGN A;  2F5T X;  4M78 B;  4EPC A;  4ZTF A;  2VXE A;  4M78 F;  4LDV A;  1S72 A;  3RKW A;  3BFM A;  4C8Q G;  1Q81 C;  1G3W A;  3JB9 J;  1O75 A;  4M77 A;  5GAN 8;  3A8O B;  2QA4 A;  4A54 A;  1G3Y A;  4N4G A;  4X34 A;  5GMK m;  5GAN 7;  1KQ2 A;  3FLG A;  3QO3 A;  3H8Z A;  2LNV A;  1BKB A;  2FL7 A;  3RMS A;  4ELY C;  1Q7Y U;  1VQ7 T;  2D0Q B;  1Q82 C;  4M7D C;  1G5V A;  1YJW A;  3JCM Q;  3L2Z A;  3GIB A;  1BI3 A;  4OGE A;  4R55 A;  1KQS S;  3E9G A;  3DKM A;  4J5Y A;  1QVF A;  3LWI A;  3SWN B;  3JB9 D;  1YIT T;  2RJC A;  1VUB A;  2CZ0 B;  2HQX A;  4J6W A;  4BD3 A;  1VQ9 T;  2MMP A;  2MF2 A;  3QYH B;  3FC3 A;  3CCE T;  5LJ3 d;  2LRQ A;  1RI0 A;  1VQP T;  2WSC E;  5CQY A;  1YIJ A;  5GAN 5;  1KQ1 A;  2CKK A;  4OB2 B;  3CBM A;  1WQW A;  1YI2 A;  3C94 A;  4JRK A;  3JCM b;  3CC4 A;  2LQK A;  5CK9 A;  1QVG A;  4L5G A;  3E1S A;  4E47 A;  5GAM j;  3BDL A;  1IRE B;  2CGH A;  4BDY A;  2H3J A;  4ZN3 A;  2DTI A;  4QVD A;  5GAN d;  4HT8 A;  4PNO A;  1Y7X A;  3G6E T;  1W4S A;  3UPU A;  4RMO A;  4M75 B;  1FX7 A;  4M75 F;  3MEA A;  3X25 B;  5GAM f;  3JCM P;  3VV0 A;  4LD9 K;  3CCS A;  2HNI A;  3PTA A;  2RM4 A;  1Q7Y C;  4C8Q C;  2EAY A;  3CCJ A;  3J80 E;  2ZPH B;  4J7F A;  5GAO m;  1VQ5 A;  4HT9 A;  2YLC A;  2CZ7 B;  2XIC A;  3O8V A;  4MZT A;  3EFR A;  2VUB A;  3LWH A;  4BE1 A;  2DXT A;  3CCR T;  1NPP A;  3INZ A;  4EMH A;  1NJI C;  1X75 C;  4XK8 E;  3V7R A;  4PJO E;  3OYJ A;  2DD4 A;  3OS0 A;  4RG2 A;  5CKF A;  4OP0 A;  4JS4 A;  1P92 A;  2DIQ A;  3BDU A;  4M77 B;  3SB2 A;  2PVD B;  2K2V A;  4M77 F;  3TEE A;  1MGQ A;  2IG0 A;  3VKI A;  4DOV A;  1M1K U;  5GAO q;  2JOY A;  2E6N A;  2PVG B;  4KUD K;  2RH2 A;  3NTI A;  3AHU A;  3G71 T;  2P4T A;  1B34 A;  2D9T A;  3C12 A;  5L8R E;  3I55 T;  1JRI A;  2XG8 D;  4JRQ A;  2LX9 A;  3MO8 A;  5CAI A;  5J26 A;  2RJD A;  5FRO A;  3CME A;  2VV5 A;  5CR2 A;  4IKF A;  3C4S A;  1XTD A;  1XNI A;  3S6W A;  4E7K A;  4WF2 A;  4XU2 A;  1X6O A;  3Q1J A;  5IT9 E;  1Q86 U;  3M5A A;  4PJO G;  2JVV A;  2A7Y A;  1VQO T;  4L6V 5;  3S3N A;  4JLG A;  4M78 A;  2EJ9 A;  1BI1 A;  2ZGW A;  5CKB A;  3CMA A;  3G4S T;  1M90 U;  2RA2 A;  4C5E A;  1VQ4 T;  4M7D E;  4XTZ A;  3M55 A;  4EMK C;  2QQA A;  4M7A A;  2E10 A;  5C6S A;  1PSF A;  4EDU A;  3FDR A;  1VQ6 A;  4C0Z A;  3C95 A;  4Q5W A;  1WJQ A;  4IUR A;  2MI6 A;  4Y91 A;  1ZBX A;  5I2M A;  2ZPE B;  2RJE A;  3E19 A;  5FRM A;  4QW2 A;  4XAX B;  4ELZ C;  3UT1 A;  3SWN A;  3P8D A;  1VQL A;  2DTO A;  2DO3 A;  2LT4 A;  1WJR A;  4FT2 A;  4MDX A;  3HRT A;  3PMT A;  4BI8 B;  4C5I A;  2P0K A;  1M9S A;  4MDW A;  2QTX A;  4N0A A;  4EMG A;  4YTL A;  4M7D G;  4PJO D;  4QVZ A;  5CIU A;  4JLI A;  2X4Y A;  2O4X A;  3JCM e;  3L1A A;  5GAN 4;  4IUV A;  2BKD N;  3HHT B;  3QBY A;  4FIB A;  3RES A;  3OYM A;  2RB6 A;  4O5V A;  2RJF A;  4PLL A;  2X35 A;  3M4Y A;  3PIO A;  1VQK T;  3M9Q A;  3JCM g;  3X24 B;  5KCH A;  4BI4 A;  2FVU A;  3J81 E;  1M90 C;  3JCM c;  1WNL A;  3CBO A;  1B34 B;  1VQM A;  4PJO C;  2ZPI B;  3QSU A;  4ZN1 A;  2RHI A;  1M4Z A;  5KCO A;  3HL8 A;  3KXT A;  1W2B A;  3JB9 G;  2X4W A;  3QDR B;  3OMC A;  5GMK e;  1KC8 U;  1N6A A;  1OYX A;  1EIF A;  4UC4 A;  3CCL A;  1HK9 A;  3NFC A;  4BI3 A;  5GAM d;  5GMK h;  1UEB A;  2EIF A;  3I56 T;  4C5G A;  3TU4 K;  2GFU A;  3CCU T;  1RL2 A;  1VQ8 T;  1KD1 U;  3MEV A;  1M8V A;  3OW2 S;  3V7C A;  2VGM A;  2EQU A;  3L42 A;  2EYQ A;  4M7A B;  2DXB A;  4XTV A;  5GAN 6;  4JJN K;  3QJ6 A;  4M7A F;  1M1F A;  4L59 A;  1NZ9 A;  1YJN A;  1YI2 T;  3QZ9 B;  3VJP A;  1Y96 A;  1O9S A;  2DK3 A;  1JBM A;  1UGQ B;  2KDS A;  3HFO A;  3RUX A;  3LX7 A;  4M77 D;  5LJ3 e;  1YCY A;  1U1T A;  2JZ2 A;  2F5K A;  2JTF A;  1I5L A;  1FWZ A;  4ZGE B;  5LJ5 e;  2LVM A;  4GLK A;  1BIA A;  2M9U A;  2LT1 A;  2MWP A;  3CBP A;  4LD6 A;  4XTY A;  4MZP A;  5LJ5 h;  5FRN A;  4C92 B;  4C92 F;  5LJ5 g;  2HBP A;  1N8R U;  1N9S A;  3PNW C;  2O4X B;  2R5M A;  3CC7 T;  1M1G A;  1K8A C;  2FHD A;  5D6X A;  4JRP A;  1OZ2 A;  2BUD A;  2ZPB B;  1KD1 C;  3GF5 A;  2CYZ B;  4XU0 A;  4IUT A;  3JB9 I;  3RMQ A;  2P0P A;  3A8M B;  2FB7 A;  4E7I A;  1XOV A;  4KUL A;  4M78 E;  2L8D A;  3CCV T;  2VC8 A;  2KMT A;  2K57 A;  2NLU A;  3FB9 A;  1BYM A;  2BIV A;  2E6Z A;  2QDY B;  4HCZ A;  3OYE A;  4C8Q A;  1WGS A;  3OYN A;  4X9C A;  5HKC A;  1Y71 A;  3OSV A;  5FU6 B;  2E70 A;  2A3L A;  2R58 A;  5DLQ E;  3LGF A;  4RCB A;  1VQ7 A;  3P8H A;  2RI5 A;  4CRI A;  5CKD A;  4C0D B;  4FM4 B;  4X9D A;  1VQN T;  2V8K A;  2XKO C;  5LL6 S;  4LDX A;  3GP8 A;  3OYL A;  4J83 A;  1G3T A;  2EFI A;  2E5Q A;  2Y4Y A;  5GMK j;  2RO0 A;  3WVD B;  1YIT A;  1H3Z A;  2VXF A;  4M78 G;  3CCE A;  1VQ9 A;  3PGG A;  5GAO r;  4CI0 C;  1KG1 A;  1VQP A;  3FJP A;  4NOY A;  1Y96 B;  4A4E A;  2VYT A;  4C5H A;  2LQ8 A;  2AHJ B;  3OQ5 A;  4OVA A;  3EAE A;  4A4H A;  3L2Q A;  3G7Z A;  2QXF A;  3QYG B;  2LCC A;  3CEY A;  4BY6 B;  4C0F A;  3CXC S;  2K3Y A;  2MAM A;  3LLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...