2P0QA

Calcium binding protein in the calcium-binding form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Alr1010 protein
publication title Solution Structures of Ccbp from Anabaena Reveals a New Fold and Novel Calcium Binding Sites
rcsb
source organism Nostoc sp.
total genus 38
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0qA02
2P0PA 2K2VA 2P0QA 3URGA
chains in the Genus database with same CATH superfamily
1AD5A 1W6XA 4FT2A 3LH0A 3M0UA 1PRMC 2ED1A 2EQJA 1QVGP 5CQXA 1BCOA 3ASKA 1KC8R 4HCCA 5GAMh 4PJOD 1VYVA 4NS5A 2QXFA 2F2VA 2DFUA 5GAN3 1SKUB 5DLQE 5HK0A 4HVWA 5KE2A 2CP5A 1WIEA 4M78A 1EX4A 2EKOA 2HQHA 1VQ7Q 1BYMA 1WXTA 1OEBA 4RCBA 1YIJT 1ZBJA 3JCMX 2F69A 4HVUA 2FPFA 1YJ9Q 1YWOA 1I4K1 1NPPA 3M54A 3V8KA 2KEAA 3V7CA 3CBPA 2GFAA 2FEIA 2CP0A 1M1KC 3L2ZA 1YJ9T 2DLPA 4C8QA 4P5NA 4JLGA 1D0XA 3A8OB 2EBPA 1IXDA 4M75F 1M3BA 5GAMj 1WLPB 2JS2A 3DKMA 5KYWB 2HBPA 1LOJA 2F2WA 4JPBW 1PSFA 2FYKA 4J9GA 3NGPA 2VUBA 1QVGS 1UGPB 3JB9G 2MOXA 1VQOQ 2MK5A 1MV0B 1DJ7B 4PJOG 1M1GA 1NYFA 2K7AA 5GAN8 2BE9B 4XU2A 1B7TA 1M3AA 3G6EA 2ZPGB 1C1AA 2JZ2A 1UHFA 1NZ9A 5J39A 2MIOA 2JJ9A 5GANe 3RIRA 4DEXA 3VYHB 1YNZA 2QAZA 4B9WA 3RKWA 5D6XA 1UJ0A 3TQ7P 4BACA 3CBMA 4DA4A 2X4YA 1VQ6Q 1JU5C 2HQEA 1ZA1B 5FLXE 2KQWA 3I55A 2KE9A 3CEYA 3MEUA 4DOWA 3CD6Q 1VQ4T 1MMDA 1JRIA 4X9CA 1RABB 1WX6A 3D7SB 4J9FA 3OY9A 3MHXA 1QCFA 3P8DA 3QJ6A 3QPHA 1RL2A 1Q81C 1HXDA 1M8MA 1G3SA 2YRVA 2PTKA 1VOMA 2L3SA 4F17A 3NMZC 1W2BA 1WYXA 2HMAA 4M7AD 4J9DA 4C8QC 2KYMA 2DX1A 3C0CA 3OS5A 2GTJA 2A28A 2KRMA 4ZN3A 5KYWA 4GLKA 3PE0A 3REBB 3BDUA 2ROTA 1WGSA 3QDFA 1BI1A 1SHFA 2YHTA 4M7DB 1SF9A 4JJNK 2XD0A 3CC4Q 2KT8A 5GAN6 2EYQA 3IQLA 3VRZA 4DEYA 2MWOA 2RQUA 2LDMA 4YTLA 1OU8A 2E3HA 4OMNA 2AHJB 2L8DA 2KVQG 1X2QA 1LJOA 2C0OA 1Z9ZA 2RQWA 4PJOE 3CC4T 1G3YA 4KRTA 1X43A 2PVDB 4BE0A 3X20B 3MO8A 1Q86R 3A8MB 3CCRQ 2E10A 3FLGA 3JAME 2VGMA 1SHGA 1PCXA 3G6ET 1MMGA 2RHUA 2M0YA 2X9HA 3MCAB 1M90C 1SEMA 1UGRB 2YRCA 1IRXA 4HCZA 4M7AG 3PTAA 2BZXA 1OYXA 3T9NA 3CQTA 2P4RA 2KGTA 4C5HA 2O31A 4JJBA 3ZEHA 4MDWA 2GBQA 1M2VB 2IG0A 2VASA 4UC4A 1VQ9Q 3CMEQ 3OA6A 1G83A 2B8AA 3EAEA 3X26B 3HPWA 4Z8AA 3CCJA 4QVDA 3EFOB 4FIBA 1VQLA 4IUTA 4KGZB 1K8AC 4JRKA 2QASA 1QLYA 3JCMQ 1XJWB 3UDCA 4EMKC 2LZ6B 3GOXA 1NJIU 4M7DA 4DBHA 1MGQA 3A8LB 2D6FA 3RMQA 2HEQA 1VQNT 4EPCA 1QKXA 4XTXA 5LJ3d 3EGXB 3FC3A 1IHWA 2YT6A 2XU8A 3MP1A 3JCMb 3S3MA 5LJ5g 5J3BA 2VKNA 1B3QA 5CKBA 2D1XA 1OX8A 2NUPB 1TWBA 1Q7YR 4F14A 3E9GA 1ZUYA 1JJ2A 5FWCA 2MMPA 2QGFB 4QQ6A 4IIOA 4XK8E 1WQWA 4X34A 1YITQ 4C92C 2XMFA 2PVOB 5GAN4 4J6XA 1YCYA 4ZGDB 1KJWA 3VS2A 1F1BB 5LJ5f 1OPLA 1X6OA 3G71A 1GBQA 1K73R 3R6OA 2RQVA 1I07A 1TXQA 1KD1C 2CZ6B 4PLLA 1JEGA 4OMPA 2D8HA 4CRIA 1M2VA 4M7AE 2RK2A 2RHYA 1BI0A 3PMTA 2K79A 3VS3A 3OS2A 3OYLA 2QA4Q 2F2XA 2AKKA 4OMMA 2K5FA 3CXCS 1AVZC 4RKUE 4F16A 3EFOA 2IPOB 4E7HA 5FRMA 2WACA 1Y96B 2CUDA 2OAWA 3FJPA 2XI9A 3GF5A 4M7DD 4TVRA 4N4HA 2L3QA 1VQ5A 3JCMd 4IUVA 4C92F 2EAYA 3MPUB 2D9TA 3H0IA 5KYXB 4NL3A 2QQBA 2RH2A 3LGFA 1XNIA 5GANg 4Y91A 1YJNA 2NUPA 2L3PA 2HD0A 2K2MA 4F7UF 2MYSA 2DVJA 3L2UA 4PK4A 3E2UA 3UWNA 4M75B 1KQSA 2L5QA 2KMTA 5FU6C 5GMKm 3CCUA 5IHIA 4J7IA 3L2RA 1BB9A 2OJ2A 2DNUA 2E3IA 4RTUA 2VXEA 1WHGA 1X6BA 1RAEB 3CCLQ 2VV5A 3CCMA 8AT1B 3G4ST 1RI0A 1PKSA 3I56T 1IZ6A 5GAOp 2K5IA 2OTJA 1QMCA 2LJ3A 3DB3A 1NG2A 1K0XA 3RR6A 1WFWA 2F1LA 5CAIA 2LQ8A 3LWIA 3OYJA 1KD1R 2R5MA 4BDZA 2R57A 4JRQA 4PJNA 1E6HA 2X3XD 4V2SA 4KULA 1YI2A 4X9DA 1AT1B 2A36A 4HA8A 1TU0B 1VQKA 4BUGA 2J06A 2J7IA 2L2PA 2QDYB 3GIBA 2JTEA 1GFDA 1YHQQ 5J26A 1KK7A 1AEYA 5KYXA 3CCEQ 2XDBA 2AIRB 2EQIA 3N5BB 2G3RA 2HSPA 3OYCA 1TTHB 1PC0A 2H3EB 1ZBXA 1D1CA 4OVAA 3EGDB 1YJWQ 4FM4B 4OMOA 4A4EA 3GBQA 1WJQA 2QQAA 2XDPA 2CP3A 3GNGA 2LJ1A 5CR2A 1TUDA 5GAOm 1YHQT 1VQ5T 1YN8A 1M1KR 4M75A 3REAB 1U8RA 2FL7A 3QXEB 1X75C 3OYYA 3RBBB 1GFCA 5GANd 5I2MA 5IHNA 2E6ZA 1YJNT 1ZA2B 3VJPA 2ECZA 5KCOA 1VQ7A 2MF2A 2PUKB 3P8HA 4OGCA 2YSQA 5A0GA 3JCMV 4M77D 1W1FA 1YJ9A 2XG8D 3UPUA 1VQMT 1UE9A 2F5KA 1TOVA 1ABOA 3L2WA 2EYWA 3M0PA 1Q86U 3HFOA 4C0GA 3OYAA 1B34B 1QVFA 2DXUA 2COYA 3NTKA 3CCMT 1KG1A 4ELYC 2HL5C 2FPEA 2OTJT 4OB2B 4C8QB 2JN0A 2KXDA 2P4TA 1V29B 4JDSA 3JCMP 4RTZA 1D1BA 2MPXC 3MP6A 2P0KA 4PJJA 2FZKB 3M5AA 4PFZA 1K4US 2KROA 3JCMe 3A98A 3EG1A 2CGHA 1U1SA 2H8HA 1VQPQ 4RG8A 4PLIA 3EGDA 1Q81R 5GMKh 3VV0A 2LQKA 1MHNA 1I5LA 1Z9QA 1QCOA 4JZ3A 2WSCE 3UA6A 1I8FA 3OMCA 4M75C 2DL7A 3M57A 1RI9A 3OYEA 1MMNA 1VQ4A 4M77G 1RAHB 5FU7C 3OMGA 3U23A 2FZCB 1G8XA 2Y90A 1ZLMA 3VUBA 4QT7A 5IHKA 1AWOA 4OMQA 3CD6A 3EH1A 3VU3C 5CVIA 2J6FA 3CMAQ 2KXCA 1W2BS 3BDLA 1VUBA 1T3LA 2EFIA 2R5AA 1UDLA 4N4IA 1SSFA 4PNOA 1VYUA 5FWBA 1ZSZC 1O75A 2RMOA 4ZN1A 1Q7YU 2MAMA 2PU9B 3TCJA 2D8JA 3UT1A 2JM8A 1X6GA 2O01E 3META 1R77A 1VQ7T 2EYYA 5IXBA 5I2SA 2LMJA 2P0QA 2R58A 1B34A 1UGSB 3V7RA 3L2QA 3OBWA 1C0MA 1QCNA 2KAFA 2YWWA 2YLCA 2CS7A 1IB8A 1PHTA 3QIIA 2OTLQ 3FDRA 2LCLA 4MZMA 2QK0A 4VUBA 1K73U 4ZNXA 5C0MA 1TSFA 2ZPIB 1KQ1A 5GAOn 3M9QA 4HXJA 4RUGA 1M90R 2FRWA 3HRUA 1BK2A 1UECA 1WQ7A 3MEWA 4EMKB 4IIMA 4A54A 3CC4A 1QKWA 4IUUA 2OTLT 1OV3A 2LX9A 3EH2A 3RDVA 2DZ9A 3KBGA 1S72Q 1PKTA 1N6AA 1JQQA 3FEOA 3E19A 2B86A 1PNJA 3JB9F 1K9MU 1QQJA 4JLIA 1VQOT 4PJOF 3LYIA 3CCRA 4C0ZA 3BFMA 3AT1B 2DILA 4GLMA 1JJ2P 3OYGA 1K8AR 2IIMA 2LT1A 4B9XA 2D0NA 1NJIC 4M77E 1TH7A 1Q82C 2EGEA 4M78D 5HCKA 4C92B 5D7UA 1I5OB 1H641 4BE2A 3AHUA 2PZ1A 2ZPBB 3V8LA 2RI3A 3RKXA 2RJEA 2NUTB 1VQ6T 4ATOA 4L6V5 3CCSQ 2HCKA 1R8OB 2DXTA 3RESA 3CD6T 4F7UB 1VQ9A 2M16A 2LTOA 4ORZA 3OS1A 4Y28E 4C8QD 2XICA 2RHZA 3TSZA 1KQ2A 4EMGA 1VQNA 2I2LA 5GJVB 8ATCB 2WSFE 3MKDA 4A4FA 5LJ3g 2DF6A 2ZPFB 2O9VA 3QHSA 3PVLA 2JMCA 4J6YA 4D6WA 4PFPA 4EMKA 4RMOA 1OOTA 2PQWA 4M7AC 4N4GA 4OB3B 1KD1U 1OZ2A 2O4XA 1X69A 2RJCA 4DBRA 4IURA 4NOYA 5CK9A 1VQ8Q 4M78G 3CC2Q 1MMAA 3JSCA 5GAMd 4FL6A 2SRCA 5ECAA 2QG9B 5LJ3f 5FW9A 3UA7A 1KQSP 1JB0E 2BZYA 4JRPA 3SHWA 5FU6B 2HQXA 3LWHA 3GPLA 3CCQQ 4C92A 3QKJA 1PWTA 2RHXA 3OB9A 3UF4A 1OPKA 4C8QG 3CCRT 1GL5A 4FYXB 2HAXA 4PKCC 2NUTA 4FYVB 2RHIA 2M51A 1U1TA 3OW2P 1QVPA 1ZX6A 3OS0A 1BKBA 1UUEA 4F7UA 4E7IA 2CYZB 4WCIA 4OP0A 2EYXA 5LJ5h 3JB9I 4M7AF 1BI2A 2QA4A 2QI2A 3FB9A 4O5VA 3I55Q 1CKBA 1SRLA 2CZ0B 1H92A 1Y57A 2C0IA 3M58A 2BZ8A 2V8IA 1N9RA 3KUFA 3OYMA 1LPLA 2DL3A 5LL6S 2DK3A 3JCMg 2O2OA 4M4ZA 1VQ9T 3CMET 2DKGA 4C0FA 1ZHIA 3TVTA 2E12A 1RUWA 3DB4A 4Z88A 1EZZB 4FSXA 4XTUA 1KQSS 3H0HA 4ME7A 4XTYA 4XAXB 2DXBA 4C0DC 2COWA 3S3OA 1UTIA 4DQ2A 2DRMA 4WF2A 5LJ5j 2V1RA 2EIFA 1LVKA 1WHMA 4FYYB 1LCKA 2J6OA 1CSKA 3JCMf 3CCVQ 2YXYA 3G4SA 4M78E 4R0KA 3VS7A 3I56A 5HKCA 4WTOB 3QUIA 4C92D 4J9CA 5GAN7 3CCLA 1R0BG 1Q81U 1FMVA 3EG3A 4GBQA 5IN1A 4DOVA 2K3BA 1YITT 4CC3A 2DRKA 2FVUA 4J83A 2K2VA 2E64A 4C8QE 1D3BB 1XTDA 3ZL7C 4LD9K 1KC8U 4MZPA 1QVFP 2AZSA 2EQMA 3A5ZB 4Z89A 2CZ7B 1NM7A 3EHRA 2KY9A 4RTVA 3HHTB 2ATCB 2L0AA 2K4YA 2LJ0A 1QW1A 4BY6B 1IHVA 2QA4T 2OX7A 2GQVA 3JV3A 1OQKA 1YHQA 4OMFB 2J6KA 4X1VA 3H8ZA 2F5TX 5DY9A 4CC7A 3TU4K 5KE3A 1N8RC 1SPKA 3CCJQ 4OB0B 1ACMB 2HKNA 4OB1B 4LD6A 4QW2A 3HRTA 1VQLQ 3A1PA 5KYYB 1W70A 1U06A 5GAMe 5CKDA 4XTVA 2DEQA 4F04B 2K9GA 4AG2C 2GFUA 2CT3A 3HP9A 1GXIE 2RPNA 4HKEA 1WI7A 1FXXA 4XTWA 1WDXA 5CIUA 4J9HA 5GAN2 1NEBA 1M90U 1K9AA 2JW4A 5FU7B 1RLPC 2JXBA 4PJMA 5CKFA 2X51A 2RF0A 1VQMA 3FIFA 2ZZDA 2X4JA 3MP8A 3SB2A 4XU1A 1WHLA 2GQIA 1QVFS 2CH4W 2QTVA 5GMKl 2QEXQ 5GANf 4J9EA 4AT1B 2JS0A 4XTZA 3OW2A 2DYIA 3OQ5A 2K3YA 3V8JA 1ZSZB 1D3BA 5GAOr 2LVMA 2JMAA 3CCLT 4FCYA 1GCQA 3VKIA 4M7DG 4PJOB 5KYNA 1WJRA 4LXCA 2QEXT 1X01A 3PNWC 3JCMJ 1PD0A 2D0QB 1VIFA 3VYGA 4E7ZA 5DLOA 5GAN5 1QP3A 4RTTA 3F70A 2LNVA 4PJLA 1JXOA 3EGUA 2ZPEB 3QSUA 1H3HA 2LNHB 3EG9A 9ATCB 1AZEA 3OSSC 5FRNA 1FYNA 1FMWA 2VVKA 3A8HB 1FX7A 1AZGB 3S3NA 4J5YA 2VYTA 3M53A 2A08A 1IGQA 4A4HA 2K3XA 2CUBA 3X24B 1MUZA 5CKHA 2RJDA 5KYYA 1ZSGA 4J6WA 4BI3A 1JXMA 2E5KA 2MI6A 2MWPA 4C5IA 3CCET 3VS0A 2HBWA 2JM9A 2E41A 1YJWT 2V8KA 1ARKA 2ENMA 3I9QA 4HVVA 1Q95G 5GAOl 4LDVA 1GBRA 3J80E 3GLXA 1WZOA 4Z02A 2ROLA 3HRSA 1WPYA 4BB7A 2DZCA 2LRQA 5EG2A 2GF7A 1BIBA 3M4YA 1IREB 2DERA 2ZPHB 4CC2A 3Q1JA 3I5RA 3JRZA 1ZSZA 1BIAA 3CCUQ 3QBYA 1AWJA 1GCQC 4KH0B 1K9MC 2DIGA 4PJOA 2E70A 4A53A 4FT4A 2K57A 3QYGB 3CPWP 2EGAA 5C6SA 3CC7Q 1BCMA 3EHQA 3WVEB 4DBQA 5A2QE 3RNJA 2OTLA 4M7DE 2BE7D 4BY6C 1RLQC 1UHCA 4C5EA 1HK9A 1NJIR 5CQYA 4R55A 3DLLA 1Q82R 2LX7A 5AYFA 3CC7T 2LC4A 2YRDA 3H41A 2RA2A 4D8KA 3TEEA 1RAGB 1T0JA 1OULA 1VQOA 2BUDA 1S72A 1RAIB 3OYDA 4FW2A 4JJDA 3C4SA 3VRYA 4E47A 4M7AB 1BI3A 3E9FA 3GP8A 2QYZA 1YI2Q 2RM4A 4M75D 1UGVA 2ABLA 2V26A 1VQPT 1VQKQ 2DXCA 4N0AC 2KRSA 2DPPB 1KFZA 2EGCA 2EKHA 4MDXA 4EDUA 4AFZC 2BTTA 1VQ6A 1BU1A 3PT9A 3JCMW 1H3ZA 4J7FA 3SWNA 4M77F 1UJYA 5FROA 1K1ZA 3M0TA 1RAFB 3EG0A 4AFQC 3OYIA 2DTHA 3CCSA 2CP6A 3C94A 2DTOA 4LDUA 3JB9D 3J81E 1WHHA 2PNIA 3KFVA 2CSIA 1YIJQ 5GMKj 4PJOC 3CMAT 3X25B 4BI4A 1RACB 3CPFA 2XIDA 5A0DA 2BKDN 4HCBA 2L3RA 1KHIA 1QWFA 7AT1B 1KSWA 1I0CA 1E7OA 2FPDA 1P92A 1HD3A 4RG2A 3LX7A 3I35A 2VGNA 2X4WA 4ZGEB 1E6GA 3JB9H 2DL8A 2ZAEA 4IUPA 4AFUC 3QDRB 4M75G 2NLUA 2XHCA 1PD1A 1ABQA 2DO3A 3L42A 1ZUKA 4E7KA 4ZTFA 5GAMg 2KBTA 3LW5E 4M7AA 1N9SA 3URGA 1WHKA 2O4XB 2JT4A 1VQ8A 3PGGA 4C0DB 2VC8A 2BIVA 3CC2A 3QG1A 2HKQB 3QWYA 2FZGB 2CP7A 3EG2A 4HT9A 1A0NB 4GY5A 1S72T 4KGXB 1X27A 1SSHA 2DAQA 1M4ZA 4QVCA 2KK4A 1T3SA 4A4KA 1M1FA 3G7ZA 3CCQA 3SWNC 2QGGA 5CCAA 3H6ZA 3VS1A 1D09B 3M55A 5LJ3h 5GAMf 4AFSC 3OYNA 3QWXX 1N27A 2LCCA 3OYHA 1SRMA 3VUZA 1UEBA 5D6WA 2E4HA 2P84A 5CKEA 4NL2A 1VQ4Q 2GGRA 1GRIA 4RCCA 2ESWA 3FJ5A 1EFNA 2DM1A 2RB6A 3CMEA 2RO0A 3EFRA 1EIFA 4M78C 3CPWA 3JCMc 2VB6A 1JO8A 2LQNA 4J8OA 2RQRA 3M59A 3CCST 3M56A 1UGQB 4JS5A 2EVRA 2GCXA 2EQUA 2PUOB 1AWXA 3PVQA 2A37A 4LN2A 4LDYA 3MEAA 2RD1A 2DVEA 5LJ3j 3C95A 4FU6A 4E6RA 3NHNA 5GMKi 2A7YA 1JJ2S 3PFSA 3M4GA 1ZUUA 3QO3A 4M75E 4R56A 3THKA 3BW1A 2XK0A 3O5ZA 1KC8C 2XKOC 2CT4A 2RK1A 1U5SA 5L8RE 1I81A 4XU3A 3CCVA 1PG5B 1M2OA 2RNAA 3BE3A 3WXMB 1K0SA 4LUDA 1VQ8T 4M78F 1YITA 3SEMA 4ZGJB 2FHDA 2JNGA 3CC2T 5IXFA 1KIKA 1G3TA 2FG0A 2HL3A 3JCMh 3JB9J 2JOYA 1JBMA 1WA7A 2GTOA 2M1HA 3WVDB 3G6EQ 4II1A 1W4SA 2CP2A 4J9IA 6AT1B 1N8RR 2RQTA 1QVGA 1WJSA 2LQWA 2NUZA 3CCQT 1M1KU 4IKFA 1H8KA 3UATA 3E1SA 4C8QF 3LGLA 2HDAA 5L23A 2W0ZA 3FRNA 2JUFA 4A63B 3ULRB 2DD4A 5GAOq 4QVZA 2I0NA 4B6MA 2EJGA 3HL8A 2M02A 4E7LA 1AHJB 3I55T 5HY6A 4XQ3A 1TUCA 4MMKA 1WXBA 2Y4XA 4ZTJA 1PM3A 1C6VX 4RTXA 3VS6A 4BI8B 4MMLA 2NYSA 4KT0E 4O6JA 1G2BA 1Y7XA 4A4GA 1TS9A 1VQNQ 4IUQA 4JUVA 3S6WA 3SD4A 2ZCFB 2CSQA 1AWWA 5IAYA 4E2FB 1D0YA 1QWEA 1YP5A 4EMHA 3CBOA 1K76A 1Q82U 2DE0X 5KYUB 3CXCP 3HKSA 4HT8A 2E5QA 4L5GA 4ELZC 2EYZA 3OW2S 1N5ZA 2RN8A 1PSEA 2OAUA 4KUIA 4BD3A 3LH5A 3CCVT 1J3TA 2QEXA 1NYGA 2XDDA 4LE9A 3PIOA 1G5VA 2DIQA 4Y92A 2M0OA 1S1NA 2Y4YA 4JZ4A 2LT4A 2YDLA 3O8VA 1RAAB 2YUNA 3L1AA 5DM7R 4MZTA 1FWZA 3TSWA 1NPRA 2DBMA 2M9UA 4LDXA 1D0ZA 2O9SA 5GANh 2FB7A 4EIKA 1NLPC 3G1JA 3GNFB 3QYHB 3NTIA 3OYBA 1ZQ1A 2EQKA 3INZA 4M77B 4JS4A 3HSBA 4KH1B 1IO6A 4JRIA 1TUGB 4Q5WA 2QQRA 5GMKe 1M8VA 3EG9B 2X3WD 2OI3A 3M0RA 3HFNA 2V8JA 1I1JA 3CCEA 5D6YA 1AOJA 2EWNA 2AZVA 3OSVA 2DTIA 3C12A 1YJWA 1Q86C 1VA7A 3NFCA 2DYBA 2LP5A 2DD5A 2YUPA 4PFOA 1K9MR 4C92G 2CDTA 1M9SA 3DLMA 1HJDA 3RERA 1M5Q1 4M7DC 5GANj 2V1QA 1CKAA 5KYUA 2MCNA 3CCJT 5I21A 3EGXA 3M0SA 2HNIA 1X2KA 2HZYA 2J05A 2SEMA 4ANJA 4F7UG 1VQLT 2P0PA 3L2VA 1M27C 2C06A 1PRLC 3A8GB 3BY7A 1B07A 3PMIA 2KI7A 5A0LA 3R6NA 3OYFA 4FW1A 2DL5A 3LLRA 1T0HA 5LJ5d 3ME9A 4CC4B 2EJFA 2VWFA 4E7JA 3P8BB 2ZGWA 1NE8A 3SDZA 4C5GA 1LNXA 4DBFA 3G4SQ 3PIPA 3I56Q 2JTFA 4ESRA 4K11A 3CC7A 2YUQA 1UG1A 1K8AU 1WNLA 4LUEA 2H3JA 5IT9E 2AK5A 2E65A 3I5SA 2KRNA 2E1HA 4M77A 3G71Q 3V7SA 1Y07A 1NLOC 4M7DF 1O9SA 4CI0C 2EW3A 3VS4A 1YBYA 4BE1A 1V1CA 4RTWA 1D1AA 4L59A 5EC7A 3SFMA 3VS5A 3QZ9B 4PL6A 4BDYA 2YUOA 3QZ5B 2QTXA 3G71T 2K6DA 4FYWB 1VQPA 1Q7YC 2L89A 1Y0MA 1SG5A 2W10A 1NBEB 4XU0A 4AG1C 1Y96A 1R0CB 4FSSA 4QQGA 1M3CA 3MEVA 1GCPA 1YWPA 3ZFJA 1VIEA 2DL4A 5GJWB 5LJ3e 2KT1A 2C0TA 4QKUA 1OX9A 4C92E 4E7SA 2G6FX 3CXCA 1VQ5Q 4N0AA 1V76A 1K73C 3X28B 2O88A 2VXFA 2DJZA 1XQHA 2A0FB 1TG0A 2A3LA 2KR3A 4KUDK 1BBZA 1OU9A 3CMAA 3SWNB 4F7UE 2CKKA 2QDLA 1YJNQ 2DEUA 3NPFA 2E6NA 4D8DA 1U3OA 3M0QA 3RMSA 3H0FA 1YIJA 2DA9A 1M30A 5AT1B 4OF1A 2AKLA 4RTYA 1FMKA 2Z0WA 4QQDA 2AT1B 1VQMQ 1IGUA 1KHCA 3QJYA 2FRYA 1XOVA 4LDWA 2CREA 2KYBA 1UB4A 2PVGB 3EFSA 4KBMB 2KNBB 4M78B 1MNEA 1Y71A 5I11A 1QP2A 4M77C 3CCUT 1WHJA 1WXUA 3CCMQ 1RADB 1VYTA 2IVWA 2X4XA 3HTRA 2DBKA 2X35A 1NEGA 2LCSA 4HCKA 2OTJQ 2QQ9A 1N8RU 2DETA 4AMCA 5KCHA 3H9NA 3RKYA 2DMOA 2NWMA 5CO7A 1W2BP 4JJCA 1MV3A 2DJQA 2ED0A 2KDSA 2HSEB 4OGEA 1YCSB 3ZBDA 3OBYA 4LNPA 2RI5A 2KSSA 1HYOA 2CZ1B 2JVVA 1OI1A 1OZ3A 2COZA 2EJ9A 2CH4A 4J9BA 5KH6A 3OYKA 2K5LA 2RI2A 4KGVB 1MNDA 3RUXA 2YLBA 2QQSA 4OMLA 1UFFA 1YI2T 2FO0A 5I22A 3TREA 2JTMA 1VQKT 1YFNA 2WSEE 1G3WA 1HSQA 5IH2A 3MJXA 3NTHA 2RJFA 3ER0A 3CPWS 2EPDA 5LJ5e 2GNCA 5M9OA 3KXTA 3J7AF 5HK3A
chains in the Genus database with same CATH topology
2DVEA 3QUIA 4C92D 4FT2A 3LH0A 5LJ3j 3C95A 5GAN7 2EQJA 3CCLA 4V2SA 5CQXA 4KULA 1YI2A 4X9DA 3ASKA 1Q81U 4HCCA 4FU6A 4HA8A 5GAMh 4PJOD 5GMKi 4NS5A 1VQKA 2A7YA 1JJ2S 2QXFA 5IN1A 4BUGA 3PFSA 3M4GA 4M75E 3QO3A 4R56A 5GAN3 5DLQE 4DOVA 5HK0A 3BW1A 2QDYB 2XK0A 1KC8C 5KE2A 3GIBA 2XKOC 1YITT 2RK1A 5J26A 2FVUA 4J83A 2K2VA 2E64A 2EKOA 4M78A 5L8RE 1BYMA 2XDBA 4C8QE 1I81A 4RCBA 1D3BB 4XU3A 3CCVA 1XTDA 3N5BB 1YIJT 2G3RA 3OYCA 3JCMX 1ZBXA 4OVAA 2F69A 4LD9K 1KC8U 4FM4B 4MZPA 4A4EA 3WXMB 1WJQA 2QQAA 2XDPA 3GNGA 1I4K1 5CR2A 1NPPA 3M54A 5GAOm 1YHQT 3V8KA 2EQMA 1VQ5T 1VQ8T 4M78F 3A5ZB 1YITA 2CZ7B 4ZGJB 2FHDA 2JNGA 3V7CA 3CC2T 4M75A 1U8RA 2FL7A 3QXEB 1X75C 3OYYA 2KY9A 1G3TA 3HHTB 2K4YA 3CBPA 5I2MA 1QW1A 3JCMh 2GFAA 4BY6B 5GANd 3JB9J 2JOYA 1JBMA 1M1KC 3L2ZA 2M1HA 3WVDB 2E6ZA 1YJ9T 2QA4T 4C8QA 4II1A 4P5NA 1W4SA 4JLGA 1YJNT 3A8OB 2GQVA 1YHQA 3VJPA 4OMFB 4M75F 1QVGA 5GAMj 5KCOA 1VQ7A 1WJSA 3DKMA 3H8ZA 2F5TX 5DY9A 2MF2A 2PUKB 3CCQT 1M1KU 2HBPA 4IKFA 3P8HA 1LOJA 3TU4K 4OGCA 5KE3A 5A0GA 3JCMV 1N8RC 4M77D 3E1SA 4OB0B 4OB1B 4C8QF 1PSFA 2FYKA 4LD6A 4QW2A 3LGLA 1YJ9A 2XG8D 3UPUA 1VQMT 3HRTA 2F5KA 2VUBA 5GAMe 1QVGS 1UGPB 5CKDA 4XTVA 3L2WA 3FRNA 3JB9G 2DEQA 2JUFA 2GFUA 2DD4A 3HP9A 5GAOq 1Q86U 1DJ7B 3HFOA 4QVZA 4PJOG 1M1GA 4C0GA 4HKEA 5GAN8 1FXXA 2EJGA 4XU2A 4XTWA 3HL8A 5CIUA 3OYAA 1B34B 1QVFA 2DXUA 5GAN2 3G6EA 3NTKA 3CCMT 4E7LA 1M90U 2ZPGB 5FU7B 1AHJB 4ELYC 3I55T 1KG1A 5CKFA 1VQMA 5HY6A 2JZ2A 1NZ9A 5J39A 4OB2B 3FIFA 4XQ3A 2OTJT 5GANe 4C8QB 2JN0A 2ZZDA 4MMKA 2Y4XA 2X4JA 3RIRA 4ZTJA 2P4TA 1V29B 3MP8A 4JDSA 3VYHB 3SB2A 4B9WA 3JCMP 4XU1A 3RKWA 4BI8B 3MP6A 4MMLA 5D6XA 1QVFS 4KT0E 4O6JA 2P0KA 4BACA 3CBMA 3M5AA 2X4YA 4DA4A 1Y7XA 2HQEA 5GMKl 4A4GA 5GANf 5FLXE 2KQWA 4IUQA 3I55A 3JCMe 4JUVA 3CEYA 3S6WA 4XTZA 3SD4A 2CGHA 3MEUA 1U1SA 4DOWA 3OW2A 2ZCFB 3OQ5A 2K3YA 1VQ4T 1JRIA 3V8JA 5IAYA 5GAOr 1D3BA 2LVMA 4RG8A 3CCLT 4X9CA 4EMHA 3CBOA 4PLIA 3VKIA 3OY9A 5GMKh 3MHXA 3VV0A 4M7DG 4PJOB 2LQKA 1WJRA 1Q82U 1MHNA 3P8DA 2QEXT 1X01A 3PNWC 3JCMJ 2D0QB 3HKSA 1VIFA 3VYGA 5DLOA 1I5LA 4HT8A 3QJ6A 2WSCE 5GAN5 3QPHA 1QP3A 1RL2A 1Q81C 2E5QA 4L5GA 1I8FA 4ELZC 3OW2S 3F70A 2LNVA 1HXDA 1G3SA 3OMCA 2YRVA 4M75C 3M57A 3OYEA 1PSEA 2OAUA 4KUIA 1VQ4A 4M77G 5FU7C 3OMGA 2Y90A 4BD3A 3CCVT 3VUBA 1W2BA 2ZPEB 3QSUA 4M7AD 4C8QC 2QEXA 2XDDA 3PIOA 1G5VA 3OS5A 2DIQA 3OSSC 5FRNA 3CD6A 2M0OA 3VU3C 4ZN3A 2Y4YA 4GLKA 5CVIA 2LT4A 3A8HB 1FX7A 3O8VA 3S3NA 4J5YA 3L1AA 2VYTA 3M53A 5DM7R 4MZTA 1FWZA 4A4HA 3BDUA 1W2BS 2K3XA 3BDLA 1VUBA 1NPRA 2EFIA 2R5AA 4N4IA 2M9UA 1SSFA 1WGSA 4PNOA 3X24B 5CKHA 1BI1A 2YHTA 4LDXA 2RJDA 4M7DB 1O75A 4J6WA 5GANh 2FB7A 4BI3A 4ZN1A 1Q7YU 4JJNK 2XD0A 2MAMA 2PU9B 3GNFB 3TCJA 3QYHB 3NTIA 3UT1A 2O01E 3OYBA 3META 2MI6A 2MWPA 1ZQ1A 4C5IA 5GAN6 2EYQA 5I2SA 1VQ7T 3CCET 2P0QA 2EQKA 2MWOA 2R58A 1B34A 3INZA 4M77B 2E41A 1UGSB 4JS4A 3HSBA 3V7RA 2LDMA 2V8KA 3L2QA 1YJWT 3OBWA 4YTLA 2AHJB 2L8DA 4JRIA 2KVQG 2KAFA 1LJOA 4Q5WA 2QQRA 5GMKe 4PJOE 3CC4T 2YLCA 1G3YA 2CS7A 1M8VA 2PVDB 5GAOl 4LDVA 4BE0A 3X20B 3QIIA 3MO8A 3FDRA 3J80E 3GLXA 2LCLA 2V8JA 3HFNA 3A8MB 4Z02A 3HRSA 4MZMA 1WPYA 4VUBA 3CCEA 1K73U 2E10A 3FLGA 5D6YA 2ZPIB 5C0MA 2EWNA 3JAME 4BB7A 1KQ1A 2VGMA 5GAOn 2DZCA 2LRQA 3M9QA 2DTIA 3OSVA 5EG2A 3C12A 2GF7A 1YJWA 1BIBA 1Q86C 3M4YA 3NFCA 1IREB 3G6ET 3HRUA 2RHUA 2DD5A 2ZPHB 1WQ7A 3MEWA 3Q1JA 4C92G 3JRZA 3MCAB 4EMKB 4A54A 3CC4A 1M9SA 4IUUA 1M90C 2OTLT 1BIAA 2LX9A 1UGRB 4HCZA 3DLMA 3QBYA 4M7AG 3PTAA 3RERA 2DZ9A 1M5Q1 3KBGA 1K9MC 2DIGA 1N6AA 5GANj 4M7DC 4PJOA 1OYXA 2E70A 4A53A 3FEOA 4FT4A 3T9NA 3E19A 2K57A 3QYGB 5I21A 3CCJT 2HNIA 4C5HA 5C6SA 4F7UG 1VQLT 3ZEHA 2P0PA 4MDWA 3L2VA 3JB9F 2C06A 3WVEB 1K9MU 2IG0A 4JLIA 1VQOT 5A2QE 2OTLA 4M7DE 3A8GB 4UC4A 3LYIA 4PJOF 4BY6C 3BY7A 4C5EA 3CCRA 4C0ZA 1HK9A 3BFMA 3PMIA 5CQYA 3OA6A 2B8AA 5A0LA 4R55A 3DLLA 3EAEA 3OYFA 3X26B 3OYGA 5AYFA 3HPWA 3CCJA 2LT1A 2LC4A 4B9XA 3LLRA 3CC7T 5LJ5d 3ME9A 1NJIC 4M77E 2EJFA 4QVDA 1TH7A 4E7JA 3P8BB 4FIBA 1Q82C 1VQLA 2ZGWA 1NE8A 2RA2A 4IUTA 3TEEA 3SDZA 4C5GA 4M78D 1K8AC 1LNXA 4C92B 1VQOA 4JRKA 2BUDA 1S72A 1H641 3OYDA 4BE2A 3JCMQ 3AHUA 3C4SA 3PIPA 2JTFA 2ZPBB 3V8LA 4E47A 2RI3A 4M7AB 3UDCA 4EMKC 1BI3A 3GOXA 1NJIU 4M7DA 3RKXA 2RJEA 1MGQA 3E9FA 1VQ6T 3GP8A 4ATOA 3CC7A 3A8LB 2D6FA 3RMQA 4L6V5 1K8AU 1VQNT 1WNLA 4XTXA 2H3JA 5LJ3d 4EPCA 3FC3A 1R8OB 2XU8A 2DXTA 3MP1A 3RESA 3JCMb 5IT9E 4F7UB 3CD6T 2RM4A 3S3MA 4M75D 2E65A 5LJ5g 1VQ9A 5J3BA 2M16A 1VQPT 2LTOA 2E1HA 4M77A 2DXCA 4N0AC 3V7SA 1Y07A 5CKBA 4M7DF 2DPPB 1O9SA 3OS1A 4MDXA 4EDUA 4CI0C 4Y28E 4C8QD 2XICA 1VQ6A 1YBYA 3PT9A 3JCMW 4BE1A 2RHZA 1KQ2A 4EMGA 1VQNA 4L59A 1H3ZA 2I2LA 3E9GA 3SFMA 3QZ9B 4J7FA 4PL6A 3SWNA 4BDYA 3QZ5B 4M77F 2QTXA 2WSFE 3G71T 4A4FA 5LJ3g 5FROA 1JJ2A 1VQPA 1Q7YC 2ZPFB 2L89A 2MMPA 3QHSA 3OYIA 4QQ6A 4XK8E 1WQWA 4J6YA 2DTHA 4XU0A 4X34A 1Y96A 4C92C 4D6WA 3CCSA 4QQGA 2PVOB 3C94A 4EMKA 2DTOA 3MEVA 4RMOA 4LDUA 3JB9D 3J81E 5GAN4 4J6XA 1YCYA 4ZGDB 3ZFJA 2PQWA 4M7AC 1VIEA 5LJ5f 4N4GA 4OB3B 1KD1U 5GMKj 1OZ2A 2O4XA 4PJOC 1X6OA 3CMAT 2RJCA 3G71A 3X25B 4IURA 3R6OA 4NOYA 4BI4A 5LJ3e 3CPFA 2XIDA 5A0DA 4C92E 2BKDN 1KD1C 2CZ6B 4PLLA 5CK9A 3CXCA 4HCBA 4N0AA 2L3RA 1KHIA 4M78G 1GXIE 1K73C 3X28B 3JSCA 4M7AE 2VXFA 4CRIA 2DJZA 5GAMd 1XQHA 4FL6A 2RK2A 2RHYA 1BI0A 3PMTA 2A3LA 5LJ3f 1P92A 4RG2A 1JB0E 3LX7A 4KUDK 4JRPA 2VGNA 2X4WA 4ZGEB 3OS2A 3OYLA 3CMAA 3SWNB 4F7UE 2K5FA 3JB9H 2CKKA 3CXCS 4IUPA 2E6NA 3QDRB 5FU6B 4RKUE 4M75G 2HQXA 2NLUA 4E7HA 2XHCA 5FRMA 3LWHA 2WACA 3RMSA 3GPLA 1Y96B 2DO3A 4C92A 1YIJA 3QKJA 2RHXA 3FJPA 3L42A 2XI9A 3OB9A 4E7KA 4ZTFA 4OF1A 5GAMg 3GF5A 3LW5E 4C8QG 4M7AA 4QQDA 3CCRT 4TVRA 4M7DD 4N4HA 1N9SA 3URGA 1KHCA 2O4XB 4PKCC 2HAXA 1VQ5A 1VQ8A 3QJYA 2RHIA 3PGGA 4C0DB 2VC8A 1U1TA 1XOVA 1QVPA 2BIVA 4LDWA 3QG1A 3CC2A 3JCMd 4IUVA 3OS0A 1UB4A 4C92F 1BKBA 2PVGB 4F7UA 2EAYA 3EFSA 2D9TA 4KBMB 4E7IA 4M78B 2CYZB 4OP0A 1Y71A 5LJ5h 3JB9I 4NL3A 3CCUT 1QP2A 4M77C 4M7AF 4HT9A 4GY5A 2RH2A 2QQBA 1BI2A 1XNIA 3LGFA 2QI2A 3FB9A 4Y91A 5GANg 2QA4A 4O5VA 1S72T 2IVWA 1YJNA 2X4XA 2X35A 2CZ0B 2DAQA 1M4ZA 4QVCA 2QQ9A 2HD0A 2KK4A 1N8RU 4A4KA 3M58A 4F7UF 5KCHA 1M1FA 3G7ZA 3RKYA 3L2UA 3CCQA 2V8IA 1N9RA 3KUFA 3OYMA 3SWNC 3UWNA 4M75B 1KQSA 5CO7A 5CCAA 5LL6S 2DK3A 2L5QA 2KMTA 3H6ZA 3JCMg 3M55A 5LJ3h 5FU6C 5GAMf 5GMKm 3CMET 4J7IA 3OYNA 2DKGA 3CCUA 1VQ9T 1N27A 3L2RA 4C0FA 2LCCA 1ZHIA 2KDSA 3OYHA 3VUZA 2VXEA 1UEBA 5D6WA 2E12A 4OGEA 5CKEA 4NL2A 3DB4A 3OBYA 3ZBDA 2RI5A 4FSXA 2KSSA 4XTUA 1KQSS 2CZ1B 4RCCA 2JVVA 2VV5A 1OI1A 4ME7A 4XTYA 4XAXB 1OZ3A 2RB6A 2DXBA 2EJ9A 4C0DC 3G4ST 3CCMA 3CMEA 1RI0A 3I56T 1IZ6A 2RO0A 3EFRA 3S3OA 1EIFA 4DQ2A 5KH6A 5GAOp 2K5IA 2K5LA 4M78C 3OYKA 3CPWA 2OTJA 3DB3A 2RI2A 3JCMc 4WF2A 5LJ5j 3RUXA 4J8OA 3CCST 3M59A 2EIFA 2YLBA 3M56A 2QQSA 1UGQB 4JS5A 5CAIA 1YI2T 2LQ8A 3LWIA 3OYJA 3JCMf 3TREA 2JTMA 2R5MA 2GCXA 1VQKT 2WSEE 2EQUA 1G3WA 2PUOB 3G4SA 3NTHA 4M78E 2RJFA 3I56A 3ER0A 4BDZA 3CPWS 5HKCA 2R57A 5LJ5e 4LDYA 3MEAA 5M9OA 3KXTA 4JRQA 2RD1A 3J7AF 5HK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0P A;  2K2V A;  2P0Q A;  3URG A; 
#chains in the Genus database with same CATH topology
 1AD5 A;  1W6X A;  4FT2 A;  3LH0 A;  3M0U A;  1PRM C;  2ED1 A;  2EQJ A;  1QVG P;  5CQX A;  1BCO A;  3ASK A;  1KC8 R;  4HCC A;  5GAM h;  4PJO D;  1VYV A;  4NS5 A;  2QXF A;  2F2V A;  2DFU A;  5GAN 3;  1SKU B;  5DLQ E;  5HK0 A;  4HVW A;  5KE2 A;  2CP5 A;  1WIE A;  4M78 A;  1EX4 A;  2EKO A;  2HQH A;  1VQ7 Q;  1BYM A;  1WXT A;  1OEB A;  4RCB A;  1YIJ T;  1ZBJ A;  3JCM X;  2F69 A;  4HVU A;  2FPF A;  1YJ9 Q;  1YWO A;  1I4K 1;  1NPP A;  3M54 A;  3V8K A;  2KEA A;  3V7C A;  3CBP A;  2GFA A;  2FEI A;  2CP0 A;  1M1K C;  3L2Z A;  1YJ9 T;  2DLP A;  4C8Q A;  4P5N A;  4JLG A;  1D0X A;  3A8O B;  2EBP A;  1IXD A;  4M75 F;  1M3B A;  5GAM j;  1WLP B;  2JS2 A;  3DKM A;  5KYW B;  2HBP A;  1LOJ A;  2F2W A;  4JPB W;  1PSF A;  2FYK A;  4J9G A;  3NGP A;  2VUB A;  1QVG S;  1UGP B;  3JB9 G;  2MOX A;  1VQO Q;  2MK5 A;  1MV0 B;  1DJ7 B;  4PJO G;  1M1G A;  1NYF A;  2K7A A;  5GAN 8;  2BE9 B;  4XU2 A;  1B7T A;  1M3A A;  3G6E A;  2ZPG B;  1C1A A;  2JZ2 A;  1UHF A;  1NZ9 A;  5J39 A;  2MIO A;  2JJ9 A;  5GAN e;  3RIR A;  4DEX A;  3VYH B;  1YNZ A;  2QAZ A;  4B9W A;  3RKW A;  5D6X A;  1UJ0 A;  3TQ7 P;  4BAC A;  3CBM A;  4DA4 A;  2X4Y A;  1VQ6 Q;  1JU5 C;  2HQE A;  1ZA1 B;  5FLX E;  2KQW A;  3I55 A;  2KE9 A;  3CEY A;  3MEU A;  4DOW A;  3CD6 Q;  1VQ4 T;  1MMD A;  1JRI A;  4X9C A;  1RAB B;  1WX6 A;  3D7S B;  4J9F A;  3OY9 A;  3MHX A;  1QCF A;  3P8D A;  3QJ6 A;  3QPH A;  1RL2 A;  1Q81 C;  1HXD A;  1M8M A;  1G3S A;  2YRV A;  2PTK A;  1VOM A;  2L3S A;  4F17 A;  3NMZ C;  1W2B A;  1WYX A;  2HMA A;  4M7A D;  4J9D A;  4C8Q C;  2KYM A;  2DX1 A;  3C0C A;  3OS5 A;  2GTJ A;  2A28 A;  2KRM A;  4ZN3 A;  5KYW A;  4GLK A;  3PE0 A;  3REB B;  3BDU A;  2ROT A;  1WGS A;  3QDF A;  1BI1 A;  1SHF A;  2YHT A;  4M7D B;  1SF9 A;  4JJN K;  2XD0 A;  3CC4 Q;  2KT8 A;  5GAN 6;  2EYQ A;  3IQL A;  3VRZ A;  4DEY A;  2MWO A;  2RQU A;  2LDM A;  4YTL A;  1OU8 A;  2E3H A;  4OMN A;  2AHJ B;  2L8D A;  2KVQ G;  1X2Q A;  1LJO A;  2C0O A;  1Z9Z A;  2RQW A;  4PJO E;  3CC4 T;  1G3Y A;  4KRT A;  1X43 A;  2PVD B;  4BE0 A;  3X20 B;  3MO8 A;  1Q86 R;  3A8M B;  3CCR Q;  2E10 A;  3FLG A;  3JAM E;  2VGM A;  1SHG A;  1PCX A;  3G6E T;  1MMG A;  2RHU A;  2M0Y A;  2X9H A;  3MCA B;  1M90 C;  1SEM A;  1UGR B;  2YRC A;  1IRX A;  4HCZ A;  4M7A G;  3PTA A;  2BZX A;  1OYX A;  3T9N A;  3CQT A;  2P4R A;  2KGT A;  4C5H A;  2O31 A;  4JJB A;  3ZEH A;  4MDW A;  2GBQ A;  1M2V B;  2IG0 A;  2VAS A;  4UC4 A;  1VQ9 Q;  3CME Q;  3OA6 A;  1G83 A;  2B8A A;  3EAE A;  3X26 B;  3HPW A;  4Z8A A;  3CCJ A;  4QVD A;  3EFO B;  4FIB A;  1VQL A;  4IUT A;  4KGZ B;  1K8A C;  4JRK A;  2QAS A;  1QLY A;  3JCM Q;  1XJW B;  3UDC A;  4EMK C;  2LZ6 B;  3GOX A;  1NJI U;  4M7D A;  4DBH A;  1MGQ A;  3A8L B;  2D6F A;  3RMQ A;  2HEQ A;  1VQN T;  4EPC A;  1QKX A;  4XTX A;  5LJ3 d;  3EGX B;  3FC3 A;  1IHW A;  2YT6 A;  2XU8 A;  3MP1 A;  3JCM b;  3S3M A;  5LJ5 g;  5J3B A;  2VKN A;  1B3Q A;  5CKB A;  2D1X A;  1OX8 A;  2NUP B;  1TWB A;  1Q7Y R;  4F14 A;  3E9G A;  1ZUY A;  1JJ2 A;  5FWC A;  2MMP A;  2QGF B;  4QQ6 A;  4IIO A;  4XK8 E;  1WQW A;  4X34 A;  1YIT Q;  4C92 C;  2XMF A;  2PVO B;  5GAN 4;  4J6X A;  1YCY A;  4ZGD B;  1KJW A;  3VS2 A;  1F1B B;  5LJ5 f;  1OPL A;  1X6O A;  3G71 A;  1GBQ A;  1K73 R;  3R6O A;  2RQV A;  1I07 A;  1TXQ A;  1KD1 C;  2CZ6 B;  4PLL A;  1JEG A;  4OMP A;  2D8H A;  4CRI A;  1M2V A;  4M7A E;  2RK2 A;  2RHY A;  1BI0 A;  3PMT A;  2K79 A;  3VS3 A;  3OS2 A;  3OYL A;  2QA4 Q;  2F2X A;  2AKK A;  4OMM A;  2K5F A;  3CXC S;  1AVZ C;  4RKU E;  4F16 A;  3EFO A;  2IPO B;  4E7H A;  5FRM A;  2WAC A;  1Y96 B;  2CUD A;  2OAW A;  3FJP A;  2XI9 A;  3GF5 A;  4M7D D;  4TVR A;  4N4H A;  2L3Q A;  1VQ5 A;  3JCM d;  4IUV A;  4C92 F;  2EAY A;  3MPU B;  2D9T A;  3H0I A;  5KYX B;  4NL3 A;  2QQB A;  2RH2 A;  3LGF A;  1XNI A;  5GAN g;  4Y91 A;  1YJN A;  2NUP A;  2L3P A;  2HD0 A;  2K2M A;  4F7U F;  2MYS A;  2DVJ A;  3L2U A;  4PK4 A;  3E2U A;  3UWN A;  4M75 B;  1KQS A;  2L5Q A;  2KMT A;  5FU6 C;  5GMK m;  3CCU A;  5IHI A;  4J7I A;  3L2R A;  1BB9 A;  2OJ2 A;  2DNU A;  2E3I A;  4RTU A;  2VXE A;  1WHG A;  1X6B A;  1RAE B;  3CCL Q;  2VV5 A;  3CCM A;  8AT1 B;  3G4S T;  1RI0 A;  1PKS A;  3I56 T;  1IZ6 A;  5GAO p;  2K5I A;  2OTJ A;  1QMC A;  2LJ3 A;  3DB3 A;  1NG2 A;  1K0X A;  3RR6 A;  1WFW A;  2F1L A;  5CAI A;  2LQ8 A;  3LWI A;  3OYJ A;  1KD1 R;  2R5M A;  4BDZ A;  2R57 A;  4JRQ A;  4PJN A;  1E6H A;  2X3X D;  4V2S A;  4KUL A;  1YI2 A;  4X9D A;  1AT1 B;  2A36 A;  4HA8 A;  1TU0 B;  1VQK A;  4BUG A;  2J06 A;  2J7I A;  2L2P A;  2QDY B;  3GIB A;  2JTE A;  1GFD A;  1YHQ Q;  5J26 A;  1KK7 A;  1AEY A;  5KYX A;  3CCE Q;  2XDB A;  2AIR B;  2EQI A;  3N5B B;  2G3R A;  2HSP A;  3OYC A;  1TTH B;  1PC0 A;  2H3E B;  1ZBX A;  1D1C A;  4OVA A;  3EGD B;  1YJW Q;  4FM4 B;  4OMO A;  4A4E A;  3GBQ A;  1WJQ A;  2QQA A;  2XDP A;  2CP3 A;  3GNG A;  2LJ1 A;  5CR2 A;  1TUD A;  5GAO m;  1YHQ T;  1VQ5 T;  1YN8 A;  1M1K R;  4M75 A;  3REA B;  1U8R A;  2FL7 A;  3QXE B;  1X75 C;  3OYY A;  3RBB B;  1GFC A;  5GAN d;  5I2M A;  5IHN A;  2E6Z A;  1YJN T;  1ZA2 B;  3VJP A;  2ECZ A;  5KCO A;  1VQ7 A;  2MF2 A;  2PUK B;  3P8H A;  4OGC A;  2YSQ A;  5A0G A;  3JCM V;  4M77 D;  1W1F A;  1YJ9 A;  2XG8 D;  3UPU A;  1VQM T;  1UE9 A;  2F5K A;  1TOV A;  1ABO A;  3L2W A;  2EYW A;  3M0P A;  1Q86 U;  3HFO A;  4C0G A;  3OYA A;  1B34 B;  1QVF A;  2DXU A;  2COY A;  3NTK A;  3CCM T;  1KG1 A;  4ELY C;  2HL5 C;  2FPE A;  2OTJ T;  4OB2 B;  4C8Q B;  2JN0 A;  2KXD A;  2P4T A;  1V29 B;  4JDS A;  3JCM P;  4RTZ A;  1D1B A;  2MPX C;  3MP6 A;  2P0K A;  4PJJ A;  2FZK B;  3M5A A;  4PFZ A;  1K4U S;  2KRO A;  3JCM e;  3A98 A;  3EG1 A;  2CGH A;  1U1S A;  2H8H A;  1VQP Q;  4RG8 A;  4PLI A;  3EGD A;  1Q81 R;  5GMK h;  3VV0 A;  2LQK A;  1MHN A;  1I5L A;  1Z9Q A;  1QCO A;  4JZ3 A;  2WSC E;  3UA6 A;  1I8F A;  3OMC A;  4M75 C;  2DL7 A;  3M57 A;  1RI9 A;  3OYE A;  1MMN A;  1VQ4 A;  4M77 G;  1RAH B;  5FU7 C;  3OMG A;  3U23 A;  2FZC B;  1G8X A;  2Y90 A;  1ZLM A;  3VUB A;  4QT7 A;  5IHK A;  1AWO A;  4OMQ A;  3CD6 A;  3EH1 A;  3VU3 C;  5CVI A;  2J6F A;  3CMA Q;  2KXC A;  1W2B S;  3BDL A;  1VUB A;  1T3L A;  2EFI A;  2R5A A;  1UDL A;  4N4I A;  1SSF A;  4PNO A;  1VYU A;  5FWB A;  1ZSZ C;  1O75 A;  2RMO A;  4ZN1 A;  1Q7Y U;  2MAM A;  2PU9 B;  3TCJ A;  2D8J A;  3UT1 A;  2JM8 A;  1X6G A;  2O01 E;  3MET A;  1R77 A;  1VQ7 T;  2EYY A;  5IXB A;  5I2S A;  2LMJ A;  2P0Q A;  2R58 A;  1B34 A;  1UGS B;  3V7R A;  3L2Q A;  3OBW A;  1C0M A;  1QCN A;  2KAF A;  2YWW A;  2YLC A;  2CS7 A;  1IB8 A;  1PHT A;  3QII A;  2OTL Q;  3FDR A;  2LCL A;  4MZM A;  2QK0 A;  4VUB A;  1K73 U;  4ZNX A;  5C0M A;  1TSF A;  2ZPI B;  1KQ1 A;  5GAO n;  3M9Q A;  4HXJ A;  4RUG A;  1M90 R;  2FRW A;  3HRU A;  1BK2 A;  1UEC A;  1WQ7 A;  3MEW A;  4EMK B;  4IIM A;  4A54 A;  3CC4 A;  1QKW A;  4IUU A;  2OTL T;  1OV3 A;  2LX9 A;  3EH2 A;  3RDV A;  2DZ9 A;  3KBG A;  1S72 Q;  1PKT A;  1N6A A;  1JQQ A;  3FEO A;  3E19 A;  2B86 A;  1PNJ A;  3JB9 F;  1K9M U;  1QQJ A;  4JLI A;  1VQO T;  4PJO F;  3LYI A;  3CCR A;  4C0Z A;  3BFM A;  3AT1 B;  2DIL A;  4GLM A;  1JJ2 P;  3OYG A;  1K8A R;  2IIM A;  2LT1 A;  4B9X A;  2D0N A;  1NJI C;  4M77 E;  1TH7 A;  1Q82 C;  2EGE A;  4M78 D;  5HCK A;  4C92 B;  5D7U A;  1I5O B;  1H64 1;  4BE2 A;  3AHU A;  2PZ1 A;  2ZPB B;  3V8L A;  2RI3 A;  3RKX A;  2RJE A;  2NUT B;  1VQ6 T;  4ATO A;  4L6V 5;  3CCS Q;  2HCK A;  1R8O B;  2DXT A;  3RES A;  3CD6 T;  4F7U B;  1VQ9 A;  2M16 A;  2LTO A;  4ORZ A;  3OS1 A;  4Y28 E;  4C8Q D;  2XIC A;  2RHZ A;  3TSZ A;  1KQ2 A;  4EMG A;  1VQN A;  2I2L A;  5GJV B;  8ATC B;  2WSF E;  3MKD A;  4A4F A;  5LJ3 g;  2DF6 A;  2ZPF B;  2O9V A;  3QHS A;  3PVL A;  2JMC A;  4J6Y A;  4D6W A;  4PFP A;  4EMK A;  4RMO A;  1OOT A;  2PQW A;  4M7A C;  4N4G A;  4OB3 B;  1KD1 U;  1OZ2 A;  2O4X A;  1X69 A;  2RJC A;  4DBR A;  4IUR A;  4NOY A;  5CK9 A;  1VQ8 Q;  4M78 G;  3CC2 Q;  1MMA A;  3JSC A;  5GAM d;  4FL6 A;  2SRC A;  5ECA A;  2QG9 B;  5LJ3 f;  5FW9 A;  3UA7 A;  1KQS P;  1JB0 E;  2BZY A;  4JRP A;  3SHW A;  5FU6 B;  2HQX A;  3LWH A;  3GPL A;  3CCQ Q;  4C92 A;  3QKJ A;  1PWT A;  2RHX A;  3OB9 A;  3UF4 A;  1OPK A;  4C8Q G;  3CCR T;  1GL5 A;  4FYX B;  2HAX A;  4PKC C;  2NUT A;  4FYV B;  2RHI A;  2M51 A;  1U1T A;  3OW2 P;  1QVP A;  1ZX6 A;  3OS0 A;  1BKB A;  1UUE A;  4F7U A;  4E7I A;  2CYZ B;  4WCI A;  4OP0 A;  2EYX A;  5LJ5 h;  3JB9 I;  4M7A F;  1BI2 A;  2QA4 A;  2QI2 A;  3FB9 A;  4O5V A;  3I55 Q;  1CKB A;  1SRL A;  2CZ0 B;  1H92 A;  1Y57 A;  2C0I A;  3M58 A;  2BZ8 A;  2V8I A;  1N9R A;  3KUF A;  3OYM A;  1LPL A;  2DL3 A;  5LL6 S;  2DK3 A;  3JCM g;  2O2O A;  4M4Z A;  1VQ9 T;  3CME T;  2DKG A;  4C0F A;  1ZHI A;  3TVT A;  2E12 A;  1RUW A;  3DB4 A;  4Z88 A;  1EZZ B;  4FSX A;  4XTU A;  1KQS S;  3H0H A;  4ME7 A;  4XTY A;  4XAX B;  2DXB A;  4C0D C;  2COW A;  3S3O A;  1UTI A;  4DQ2 A;  2DRM A;  4WF2 A;  5LJ5 j;  2V1R A;  2EIF A;  1LVK A;  1WHM A;  4FYY B;  1LCK A;  2J6O A;  1CSK A;  3JCM f;  3CCV Q;  2YXY A;  3G4S A;  4M78 E;  4R0K A;  3VS7 A;  3I56 A;  5HKC A;  4WTO B;  3QUI A;  4C92 D;  4J9C A;  5GAN 7;  3CCL A;  1R0B G;  1Q81 U;  1FMV A;  3EG3 A;  4GBQ A;  5IN1 A;  4DOV A;  2K3B A;  1YIT T;  4CC3 A;  2DRK A;  2FVU A;  4J83 A;  2K2V A;  2E64 A;  4C8Q E;  1D3B B;  1XTD A;  3ZL7 C;  4LD9 K;  1KC8 U;  4MZP A;  1QVF P;  2AZS A;  2EQM A;  3A5Z B;  4Z89 A;  2CZ7 B;  1NM7 A;  3EHR A;  2KY9 A;  4RTV A;  3HHT B;  2ATC B;  2L0A A;  2K4Y A;  2LJ0 A;  1QW1 A;  4BY6 B;  1IHV A;  2QA4 T;  2OX7 A;  2GQV A;  3JV3 A;  1OQK A;  1YHQ A;  4OMF B;  2J6K A;  4X1V A;  3H8Z A;  2F5T X;  5DY9 A;  4CC7 A;  3TU4 K;  5KE3 A;  1N8R C;  1SPK A;  3CCJ Q;  4OB0 B;  1ACM B;  2HKN A;  4OB1 B;  4LD6 A;  4QW2 A;  3HRT A;  1VQL Q;  3A1P A;  5KYY B;  1W70 A;  1U06 A;  5GAM e;  5CKD A;  4XTV A;  2DEQ A;  4F04 B;  2K9G A;  4AG2 C;  2GFU A;  2CT3 A;  3HP9 A;  1GXI E;  2RPN A;  4HKE A;  1WI7 A;  1FXX A;  4XTW A;  1WDX A;  5CIU A;  4J9H A;  5GAN 2;  1NEB A;  1M90 U;  1K9A A;  2JW4 A;  5FU7 B;  1RLP C;  2JXB A;  4PJM A;  5CKF A;  2X51 A;  2RF0 A;  1VQM A;  3FIF A;  2ZZD A;  2X4J A;  3MP8 A;  3SB2 A;  4XU1 A;  1WHL A;  2GQI A;  1QVF S;  2CH4 W;  2QTV A;  5GMK l;  2QEX Q;  5GAN f;  4J9E A;  4AT1 B;  2JS0 A;  4XTZ A;  3OW2 A;  2DYI A;  3OQ5 A;  2K3Y A;  3V8J A;  1ZSZ B;  1D3B A;  5GAO r;  2LVM A;  2JMA A;  3CCL T;  4FCY A;  1GCQ A;  3VKI A;  4M7D G;  4PJO B;  5KYN A;  1WJR A;  4LXC A;  2QEX T;  1X01 A;  3PNW C;  3JCM J;  1PD0 A;  2D0Q B;  1VIF A;  3VYG A;  4E7Z A;  5DLO A;  5GAN 5;  1QP3 A;  4RTT A;  3F70 A;  2LNV A;  4PJL A;  1JXO A;  3EGU A;  2ZPE B;  3QSU A;  1H3H A;  2LNH B;  3EG9 A;  9ATC B;  1AZE A;  3OSS C;  5FRN A;  1FYN A;  1FMW A;  2VVK A;  3A8H B;  1FX7 A;  1AZG B;  3S3N A;  4J5Y A;  2VYT A;  3M53 A;  2A08 A;  1IGQ A;  4A4H A;  2K3X A;  2CUB A;  3X24 B;  1MUZ A;  5CKH A;  2RJD A;  5KYY A;  1ZSG A;  4J6W A;  4BI3 A;  1JXM A;  2E5K A;  2MI6 A;  2MWP A;  4C5I A;  3CCE T;  3VS0 A;  2HBW A;  2JM9 A;  2E41 A;  1YJW T;  2V8K A;  1ARK A;  2ENM A;  3I9Q A;  4HVV A;  1Q95 G;  5GAO l;  4LDV A;  1GBR A;  3J80 E;  3GLX A;  1WZO A;  4Z02 A;  2ROL A;  3HRS A;  1WPY A;  4BB7 A;  2DZC A;  2LRQ A;  5EG2 A;  2GF7 A;  1BIB A;  3M4Y A;  1IRE B;  2DER A;  2ZPH B;  4CC2 A;  3Q1J A;  3I5R A;  3JRZ A;  1ZSZ A;  1BIA A;  3CCU Q;  3QBY A;  1AWJ A;  1GCQ C;  4KH0 B;  1K9M C;  2DIG A;  4PJO A;  2E70 A;  4A53 A;  4FT4 A;  2K57 A;  3QYG B;  3CPW P;  2EGA A;  5C6S A;  3CC7 Q;  1BCM A;  3EHQ A;  3WVE B;  4DBQ A;  5A2Q E;  3RNJ A;  2OTL A;  4M7D E;  2BE7 D;  4BY6 C;  1RLQ C;  1UHC A;  4C5E A;  1HK9 A;  1NJI R;  5CQY A;  4R55 A;  3DLL A;  1Q82 R;  2LX7 A;  5AYF A;  3CC7 T;  2LC4 A;  2YRD A;  3H41 A;  2RA2 A;  4D8K A;  3TEE A;  1RAG B;  1T0J A;  1OUL A;  1VQO A;  2BUD A;  1S72 A;  1RAI B;  3OYD A;  4FW2 A;  4JJD A;  3C4S A;  3VRY A;  4E47 A;  4M7A B;  1BI3 A;  3E9F A;  3GP8 A;  2QYZ A;  1YI2 Q;  2RM4 A;  4M75 D;  1UGV A;  2ABL A;  2V26 A;  1VQP T;  1VQK Q;  2DXC A;  4N0A C;  2KRS A;  2DPP B;  1KFZ A;  2EGC A;  2EKH A;  4MDX A;  4EDU A;  4AFZ C;  2BTT A;  1VQ6 A;  1BU1 A;  3PT9 A;  3JCM W;  1H3Z A;  4J7F A;  3SWN A;  4M77 F;  1UJY A;  5FRO A;  1K1Z A;  3M0T A;  1RAF B;  3EG0 A;  4AFQ C;  3OYI A;  2DTH A;  3CCS A;  2CP6 A;  3C94 A;  2DTO A;  4LDU A;  3JB9 D;  3J81 E;  1WHH A;  2PNI A;  3KFV A;  2CSI A;  1YIJ Q;  5GMK j;  4PJO C;  3CMA T;  3X25 B;  4BI4 A;  1RAC B;  3CPF A;  2XID A;  5A0D A;  2BKD N;  4HCB A;  2L3R A;  1KHI A;  1QWF A;  7AT1 B;  1KSW A;  1I0C A;  1E7O A;  2FPD A;  1P92 A;  1HD3 A;  4RG2 A;  3LX7 A;  3I35 A;  2VGN A;  2X4W A;  4ZGE B;  1E6G A;  3JB9 H;  2DL8 A;  2ZAE A;  4IUP A;  4AFU C;  3QDR B;  4M75 G;  2NLU A;  2XHC A;  1PD1 A;  1ABQ A;  2DO3 A;  3L42 A;  1ZUK A;  4E7K A;  4ZTF A;  5GAM g;  2KBT A;  3LW5 E;  4M7A A;  1N9S A;  3URG A;  1WHK A;  2O4X B;  2JT4 A;  1VQ8 A;  3PGG A;  4C0D B;  2VC8 A;  2BIV A;  3CC2 A;  3QG1 A;  2HKQ B;  3QWY A;  2FZG B;  2CP7 A;  3EG2 A;  4HT9 A;  1A0N B;  4GY5 A;  1S72 T;  4KGX B;  1X27 A;  1SSH A;  2DAQ A;  1M4Z A;  4QVC A;  2KK4 A;  1T3S A;  4A4K A;  1M1F A;  3G7Z A;  3CCQ A;  3SWN C;  2QGG A;  5CCA A;  3H6Z A;  3VS1 A;  1D09 B;  3M55 A;  5LJ3 h;  5GAM f;  4AFS C;  3OYN A;  3QWX X;  1N27 A;  2LCC A;  3OYH A;  1SRM A;  3VUZ A;  1UEB A;  5D6W A;  2E4H A;  2P84 A;  5CKE A;  4NL2 A;  1VQ4 Q;  2GGR A;  1GRI A;  4RCC A;  2ESW A;  3FJ5 A;  1EFN A;  2DM1 A;  2RB6 A;  3CME A;  2RO0 A;  3EFR A;  1EIF A;  4M78 C;  3CPW A;  3JCM c;  2VB6 A;  1JO8 A;  2LQN A;  4J8O A;  2RQR A;  3M59 A;  3CCS T;  3M56 A;  1UGQ B;  4JS5 A;  2EVR A;  2GCX A;  2EQU A;  2PUO B;  1AWX A;  3PVQ A;  2A37 A;  4LN2 A;  4LDY A;  3MEA A;  2RD1 A;  2DVE A;  5LJ3 j;  3C95 A;  4FU6 A;  4E6R A;  3NHN A;  5GMK i;  2A7Y A;  1JJ2 S;  3PFS A;  3M4G A;  1ZUU A;  3QO3 A;  4M75 E;  4R56 A;  3THK A;  3BW1 A;  2XK0 A;  3O5Z A;  1KC8 C;  2XKO C;  2CT4 A;  2RK1 A;  1U5S A;  5L8R E;  1I81 A;  4XU3 A;  3CCV A;  1PG5 B;  1M2O A;  2RNA A;  3BE3 A;  3WXM B;  1K0S A;  4LUD A;  1VQ8 T;  4M78 F;  1YIT A;  3SEM A;  4ZGJ B;  2FHD A;  2JNG A;  3CC2 T;  5IXF A;  1KIK A;  1G3T A;  2FG0 A;  2HL3 A;  3JCM h;  3JB9 J;  2JOY A;  1JBM A;  1WA7 A;  2GTO A;  2M1H A;  3WVD B;  3G6E Q;  4II1 A;  1W4S A;  2CP2 A;  4J9I A;  6AT1 B;  1N8R R;  2RQT A;  1QVG A;  1WJS A;  2LQW A;  2NUZ A;  3CCQ T;  1M1K U;  4IKF A;  1H8K A;  3UAT A;  3E1S A;  4C8Q F;  3LGL A;  2HDA A;  5L23 A;  2W0Z A;  3FRN A;  2JUF A;  4A63 B;  3ULR B;  2DD4 A;  5GAO q;  4QVZ A;  2I0N A;  4B6M A;  2EJG A;  3HL8 A;  2M02 A;  4E7L A;  1AHJ B;  3I55 T;  5HY6 A;  4XQ3 A;  1TUC A;  4MMK A;  1WXB A;  2Y4X A;  4ZTJ A;  1PM3 A;  1C6V X;  4RTX A;  3VS6 A;  4BI8 B;  4MML A;  2NYS A;  4KT0 E;  4O6J A;  1G2B A;  1Y7X A;  4A4G A;  1TS9 A;  1VQN Q;  4IUQ A;  4JUV A;  3S6W A;  3SD4 A;  2ZCF B;  2CSQ A;  1AWW A;  5IAY A;  4E2F B;  1D0Y A;  1QWE A;  1YP5 A;  4EMH A;  3CBO A;  1K76 A;  1Q82 U;  2DE0 X;  5KYU B;  3CXC P;  3HKS A;  4HT8 A;  2E5Q A;  4L5G A;  4ELZ C;  2EYZ A;  3OW2 S;  1N5Z A;  2RN8 A;  1PSE A;  2OAU A;  4KUI A;  4BD3 A;  3LH5 A;  3CCV T;  1J3T A;  2QEX A;  1NYG A;  2XDD A;  4LE9 A;  3PIO A;  1G5V A;  2DIQ A;  4Y92 A;  2M0O A;  1S1N A;  2Y4Y A;  4JZ4 A;  2LT4 A;  2YDL A;  3O8V A;  1RAA B;  2YUN A;  3L1A A;  5DM7 R;  4MZT A;  1FWZ A;  3TSW A;  1NPR A;  2DBM A;  2M9U A;  4LDX A;  1D0Z A;  2O9S A;  5GAN h;  2FB7 A;  4EIK A;  1NLP C;  3G1J A;  3GNF B;  3QYH B;  3NTI A;  3OYB A;  1ZQ1 A;  2EQK A;  3INZ A;  4M77 B;  4JS4 A;  3HSB A;  4KH1 B;  1IO6 A;  4JRI A;  1TUG B;  4Q5W A;  2QQR A;  5GMK e;  1M8V A;  3EG9 B;  2X3W D;  2OI3 A;  3M0R A;  3HFN A;  2V8J A;  1I1J A;  3CCE A;  5D6Y A;  1AOJ A;  2EWN A;  2AZV A;  3OSV A;  2DTI A;  3C12 A;  1YJW A;  1Q86 C;  1VA7 A;  3NFC A;  2DYB A;  2LP5 A;  2DD5 A;  2YUP A;  4PFO A;  1K9M R;  4C92 G;  2CDT A;  1M9S A;  3DLM A;  1HJD A;  3RER A;  1M5Q 1;  4M7D C;  5GAN j;  2V1Q A;  1CKA A;  5KYU A;  2MCN A;  3CCJ T;  5I21 A;  3EGX A;  3M0S A;  2HNI A;  1X2K A;  2HZY A;  2J05 A;  2SEM A;  4ANJ A;  4F7U G;  1VQL T;  2P0P A;  3L2V A;  1M27 C;  2C06 A;  1PRL C;  3A8G B;  3BY7 A;  1B07 A;  3PMI A;  2KI7 A;  5A0L A;  3R6N A;  3OYF A;  4FW1 A;  2DL5 A;  3LLR A;  1T0H A;  5LJ5 d;  3ME9 A;  4CC4 B;  2EJF A;  2VWF A;  4E7J A;  3P8B B;  2ZGW A;  1NE8 A;  3SDZ A;  4C5G A;  1LNX A;  4DBF A;  3G4S Q;  3PIP A;  3I56 Q;  2JTF A;  4ESR A;  4K11 A;  3CC7 A;  2YUQ A;  1UG1 A;  1K8A U;  1WNL A;  4LUE A;  2H3J A;  5IT9 E;  2AK5 A;  2E65 A;  3I5S A;  2KRN A;  2E1H A;  4M77 A;  3G71 Q;  3V7S A;  1Y07 A;  1NLO C;  4M7D F;  1O9S A;  4CI0 C;  2EW3 A;  3VS4 A;  1YBY A;  4BE1 A;  1V1C A;  4RTW A;  1D1A A;  4L59 A;  5EC7 A;  3SFM A;  3VS5 A;  3QZ9 B;  4PL6 A;  4BDY A;  2YUO A;  3QZ5 B;  2QTX A;  3G71 T;  2K6D A;  4FYW B;  1VQP A;  1Q7Y C;  2L89 A;  1Y0M A;  1SG5 A;  2W10 A;  1NBE B;  4XU0 A;  4AG1 C;  1Y96 A;  1R0C B;  4FSS A;  4QQG A;  1M3C A;  3MEV A;  1GCP A;  1YWP A;  3ZFJ A;  1VIE A;  2DL4 A;  5GJW B;  5LJ3 e;  2KT1 A;  2C0T A;  4QKU A;  1OX9 A;  4C92 E;  4E7S A;  2G6F X;  3CXC A;  1VQ5 Q;  4N0A A;  1V76 A;  1K73 C;  3X28 B;  2O88 A;  2VXF A;  2DJZ A;  1XQH A;  2A0F B;  1TG0 A;  2A3L A;  2KR3 A;  4KUD K;  1BBZ A;  1OU9 A;  3CMA A;  3SWN B;  4F7U E;  2CKK A;  2QDL A;  1YJN Q;  2DEU A;  3NPF A;  2E6N A;  4D8D A;  1U3O A;  3M0Q A;  3RMS A;  3H0F A;  1YIJ A;  2DA9 A;  1M30 A;  5AT1 B;  4OF1 A;  2AKL A;  4RTY A;  1FMK A;  2Z0W A;  4QQD A;  2AT1 B;  1VQM Q;  1IGU A;  1KHC A;  3QJY A;  2FRY A;  1XOV A;  4LDW A;  2CRE A;  2KYB A;  1UB4 A;  2PVG B;  3EFS A;  4KBM B;  2KNB B;  4M78 B;  1MNE A;  1Y71 A;  5I11 A;  1QP2 A;  4M77 C;  3CCU T;  1WHJ A;  1WXU A;  3CCM Q;  1RAD B;  1VYT A;  2IVW A;  2X4X A;  3HTR A;  2DBK A;  2X35 A;  1NEG A;  2LCS A;  4HCK A;  2OTJ Q;  2QQ9 A;  1N8R U;  2DET A;  4AMC A;  5KCH A;  3H9N A;  3RKY A;  2DMO A;  2NWM A;  5CO7 A;  1W2B P;  4JJC A;  1MV3 A;  2DJQ A;  2ED0 A;  2KDS A;  2HSE B;  4OGE A;  1YCS B;  3ZBD A;  3OBY A;  4LNP A;  2RI5 A;  2KSS A;  1HYO A;  2CZ1 B;  2JVV A;  1OI1 A;  1OZ3 A;  2COZ A;  2EJ9 A;  2CH4 A;  4J9B A;  5KH6 A;  3OYK A;  2K5L A;  2RI2 A;  4KGV B;  1MND A;  3RUX A;  2YLB A;  2QQS A;  4OML A;  1UFF A;  1YI2 T;  2FO0 A;  5I22 A;  3TRE A;  2JTM A;  1VQK T;  1YFN A;  2WSE E;  1G3W A;  1HSQ A;  5IH2 A;  3MJX A;  3NTH A;  2RJF A;  3ER0 A;  3CPW S;  2EPD A;  5LJ5 e;  2GNC A;  5M9O A;  3KXT A;  3J7A F;  5HK3 A; 
#chains in the Genus database with same CATH homology
 2DVE A;  3QUI A;  4C92 D;  4FT2 A;  3LH0 A;  5LJ3 j;  3C95 A;  5GAN 7;  2EQJ A;  3CCL A;  4V2S A;  5CQX A;  4KUL A;  1YI2 A;  4X9D A;  3ASK A;  1Q81 U;  4HCC A;  4FU6 A;  4HA8 A;  5GAM h;  4PJO D;  5GMK i;  4NS5 A;  1VQK A;  2A7Y A;  1JJ2 S;  2QXF A;  5IN1 A;  4BUG A;  3PFS A;  3M4G A;  4M75 E;  3QO3 A;  4R56 A;  5GAN 3;  5DLQ E;  4DOV A;  5HK0 A;  3BW1 A;  2QDY B;  2XK0 A;  1KC8 C;  5KE2 A;  3GIB A;  2XKO C;  1YIT T;  2RK1 A;  5J26 A;  2FVU A;  4J83 A;  2K2V A;  2E64 A;  2EKO A;  4M78 A;  5L8R E;  1BYM A;  2XDB A;  4C8Q E;  1I81 A;  4RCB A;  1D3B B;  4XU3 A;  3CCV A;  1XTD A;  3N5B B;  1YIJ T;  2G3R A;  3OYC A;  3JCM X;  1ZBX A;  4OVA A;  2F69 A;  4LD9 K;  1KC8 U;  4FM4 B;  4MZP A;  4A4E A;  3WXM B;  1WJQ A;  2QQA A;  2XDP A;  3GNG A;  1I4K 1;  5CR2 A;  1NPP A;  3M54 A;  5GAO m;  1YHQ T;  3V8K A;  2EQM A;  1VQ5 T;  1VQ8 T;  4M78 F;  3A5Z B;  1YIT A;  2CZ7 B;  4ZGJ B;  2FHD A;  2JNG A;  3V7C A;  3CC2 T;  4M75 A;  1U8R A;  2FL7 A;  3QXE B;  1X75 C;  3OYY A;  2KY9 A;  1G3T A;  3HHT B;  2K4Y A;  3CBP A;  5I2M A;  1QW1 A;  3JCM h;  2GFA A;  4BY6 B;  5GAN d;  3JB9 J;  2JOY A;  1JBM A;  1M1K C;  3L2Z A;  2M1H A;  3WVD B;  2E6Z A;  1YJ9 T;  2QA4 T;  4C8Q A;  4II1 A;  4P5N A;  1W4S A;  4JLG A;  1YJN T;  3A8O B;  2GQV A;  1YHQ A;  3VJP A;  4OMF B;  4M75 F;  1QVG A;  5GAM j;  5KCO A;  1VQ7 A;  1WJS A;  3DKM A;  3H8Z A;  2F5T X;  5DY9 A;  2MF2 A;  2PUK B;  3CCQ T;  1M1K U;  2HBP A;  4IKF A;  3P8H A;  1LOJ A;  3TU4 K;  4OGC A;  5KE3 A;  5A0G A;  3JCM V;  1N8R C;  4M77 D;  3E1S A;  4OB0 B;  4OB1 B;  4C8Q F;  1PSF A;  2FYK A;  4LD6 A;  4QW2 A;  3LGL A;  1YJ9 A;  2XG8 D;  3UPU A;  1VQM T;  3HRT A;  2F5K A;  2VUB A;  5GAM e;  1QVG S;  1UGP B;  5CKD A;  4XTV A;  3L2W A;  3FRN A;  3JB9 G;  2DEQ A;  2JUF A;  2GFU A;  2DD4 A;  3HP9 A;  5GAO q;  1Q86 U;  1DJ7 B;  3HFO A;  4QVZ A;  4PJO G;  1M1G A;  4C0G A;  4HKE A;  5GAN 8;  1FXX A;  2EJG A;  4XU2 A;  4XTW A;  3HL8 A;  5CIU A;  3OYA A;  1B34 B;  1QVF A;  2DXU A;  5GAN 2;  3G6E A;  3NTK A;  3CCM T;  4E7L A;  1M90 U;  2ZPG B;  5FU7 B;  1AHJ B;  4ELY C;  3I55 T;  1KG1 A;  5CKF A;  1VQM A;  5HY6 A;  2JZ2 A;  1NZ9 A;  5J39 A;  4OB2 B;  3FIF A;  4XQ3 A;  2OTJ T;  5GAN e;  4C8Q B;  2JN0 A;  2ZZD A;  4MMK A;  2Y4X A;  2X4J A;  3RIR A;  4ZTJ A;  2P4T A;  1V29 B;  3MP8 A;  4JDS A;  3VYH B;  3SB2 A;  4B9W A;  3JCM P;  4XU1 A;  3RKW A;  4BI8 B;  3MP6 A;  4MML A;  5D6X A;  1QVF S;  4KT0 E;  4O6J A;  2P0K A;  4BAC A;  3CBM A;  3M5A A;  2X4Y A;  4DA4 A;  1Y7X A;  2HQE A;  5GMK l;  4A4G A;  5GAN f;  5FLX E;  2KQW A;  4IUQ A;  3I55 A;  3JCM e;  4JUV A;  3CEY A;  3S6W A;  4XTZ A;  3SD4 A;  2CGH A;  3MEU A;  1U1S A;  4DOW A;  3OW2 A;  2ZCF B;  3OQ5 A;  2K3Y A;  1VQ4 T;  1JRI A;  3V8J A;  5IAY A;  5GAO r;  1D3B A;  2LVM A;  4RG8 A;  3CCL T;  4X9C A;  4EMH A;  3CBO A;  4PLI A;  3VKI A;  3OY9 A;  5GMK h;  3MHX A;  3VV0 A;  4M7D G;  4PJO B;  2LQK A;  1WJR A;  1Q82 U;  1MHN A;  3P8D A;  2QEX T;  1X01 A;  3PNW C;  3JCM J;  2D0Q B;  3HKS A;  1VIF A;  3VYG A;  5DLO A;  1I5L A;  4HT8 A;  3QJ6 A;  2WSC E;  5GAN 5;  3QPH A;  1QP3 A;  1RL2 A;  1Q81 C;  2E5Q A;  4L5G A;  1I8F A;  4ELZ C;  3OW2 S;  3F70 A;  2LNV A;  1HXD A;  1G3S A;  3OMC A;  2YRV A;  4M75 C;  3M57 A;  3OYE A;  1PSE A;  2OAU A;  4KUI A;  1VQ4 A;  4M77 G;  5FU7 C;  3OMG A;  2Y90 A;  4BD3 A;  3CCV T;  3VUB A;  1W2B A;  2ZPE B;  3QSU A;  4M7A D;  4C8Q C;  2QEX A;  2XDD A;  3PIO A;  1G5V A;  3OS5 A;  2DIQ A;  3OSS C;  5FRN A;  3CD6 A;  2M0O A;  3VU3 C;  4ZN3 A;  2Y4Y A;  4GLK A;  5CVI A;  2LT4 A;  3A8H B;  1FX7 A;  3O8V A;  3S3N A;  4J5Y A;  3L1A A;  2VYT A;  3M53 A;  5DM7 R;  4MZT A;  1FWZ A;  4A4H A;  3BDU A;  1W2B S;  2K3X A;  3BDL A;  1VUB A;  1NPR A;  2EFI A;  2R5A A;  4N4I A;  2M9U A;  1SSF A;  1WGS A;  4PNO A;  3X24 B;  5CKH A;  1BI1 A;  2YHT A;  4LDX A;  2RJD A;  4M7D B;  1O75 A;  4J6W A;  5GAN h;  2FB7 A;  4BI3 A;  4ZN1 A;  1Q7Y U;  4JJN K;  2XD0 A;  2MAM A;  2PU9 B;  3GNF B;  3TCJ A;  3QYH B;  3NTI A;  3UT1 A;  2O01 E;  3OYB A;  3MET A;  2MI6 A;  2MWP A;  1ZQ1 A;  4C5I A;  5GAN 6;  2EYQ A;  5I2S A;  1VQ7 T;  3CCE T;  2P0Q A;  2EQK A;  2MWO A;  2R58 A;  1B34 A;  3INZ A;  4M77 B;  2E41 A;  1UGS B;  4JS4 A;  3HSB A;  3V7R A;  2LDM A;  2V8K A;  3L2Q A;  1YJW T;  3OBW A;  4YTL A;  2AHJ B;  2L8D A;  4JRI A;  2KVQ G;  2KAF A;  1LJO A;  4Q5W A;  2QQR A;  5GMK e;  4PJO E;  3CC4 T;  2YLC A;  1G3Y A;  2CS7 A;  1M8V A;  2PVD B;  5GAO l;  4LDV A;  4BE0 A;  3X20 B;  3QII A;  3MO8 A;  3FDR A;  3J80 E;  3GLX A;  2LCL A;  2V8J A;  3HFN A;  3A8M B;  4Z02 A;  3HRS A;  4MZM A;  1WPY A;  4VUB A;  3CCE A;  1K73 U;  2E10 A;  3FLG A;  5D6Y A;  2ZPI B;  5C0M A;  2EWN A;  3JAM E;  4BB7 A;  1KQ1 A;  2VGM A;  5GAO n;  2DZC A;  2LRQ A;  3M9Q A;  2DTI A;  3OSV A;  5EG2 A;  3C12 A;  2GF7 A;  1YJW A;  1BIB A;  1Q86 C;  3M4Y A;  3NFC A;  1IRE B;  3G6E T;  3HRU A;  2RHU A;  2DD5 A;  2ZPH B;  1WQ7 A;  3MEW A;  3Q1J A;  4C92 G;  3JRZ A;  3MCA B;  4EMK B;  4A54 A;  3CC4 A;  1M9S A;  4IUU A;  1M90 C;  2OTL T;  1BIA A;  2LX9 A;  1UGR B;  4HCZ A;  3DLM A;  3QBY A;  4M7A G;  3PTA A;  3RER A;  2DZ9 A;  1M5Q 1;  3KBG A;  1K9M C;  2DIG A;  1N6A A;  5GAN j;  4M7D C;  4PJO A;  1OYX A;  2E70 A;  4A53 A;  3FEO A;  4FT4 A;  3T9N A;  3E19 A;  2K57 A;  3QYG B;  5I21 A;  3CCJ T;  2HNI A;  4C5H A;  5C6S A;  4F7U G;  1VQL T;  3ZEH A;  2P0P A;  4MDW A;  3L2V A;  3JB9 F;  2C06 A;  3WVE B;  1K9M U;  2IG0 A;  4JLI A;  1VQO T;  5A2Q E;  2OTL A;  4M7D E;  3A8G B;  4UC4 A;  3LYI A;  4PJO F;  4BY6 C;  3BY7 A;  4C5E A;  3CCR A;  4C0Z A;  1HK9 A;  3BFM A;  3PMI A;  5CQY A;  3OA6 A;  2B8A A;  5A0L A;  4R55 A;  3DLL A;  3EAE A;  3OYF A;  3X26 B;  3OYG A;  5AYF A;  3HPW A;  3CCJ A;  2LT1 A;  2LC4 A;  4B9X A;  3LLR A;  3CC7 T;  5LJ5 d;  3ME9 A;  1NJI C;  4M77 E;  2EJF A;  4QVD A;  1TH7 A;  4E7J A;  3P8B B;  4FIB A;  1Q82 C;  1VQL A;  2ZGW A;  1NE8 A;  2RA2 A;  4IUT A;  3TEE A;  3SDZ A;  4C5G A;  4M78 D;  1K8A C;  1LNX A;  4C92 B;  1VQO A;  4JRK A;  2BUD A;  1S72 A;  1H64 1;  3OYD A;  4BE2 A;  3JCM Q;  3AHU A;  3C4S A;  3PIP A;  2JTF A;  2ZPB B;  3V8L A;  4E47 A;  2RI3 A;  4M7A B;  3UDC A;  4EMK C;  1BI3 A;  3GOX A;  1NJI U;  4M7D A;  3RKX A;  2RJE A;  1MGQ A;  3E9F A;  1VQ6 T;  3GP8 A;  4ATO A;  3CC7 A;  3A8L B;  2D6F A;  3RMQ A;  4L6V 5;  1K8A U;  1VQN T;  1WNL A;  4XTX A;  2H3J A;  5LJ3 d;  4EPC A;  3FC3 A;  1R8O B;  2XU8 A;  2DXT A;  3MP1 A;  3RES A;  3JCM b;  5IT9 E;  4F7U B;  3CD6 T;  2RM4 A;  3S3M A;  4M75 D;  2E65 A;  5LJ5 g;  1VQ9 A;  5J3B A;  2M16 A;  1VQP T;  2LTO A;  2E1H A;  4M77 A;  2DXC A;  4N0A C;  3V7S A;  1Y07 A;  5CKB A;  4M7D F;  2DPP B;  1O9S A;  3OS1 A;  4MDX A;  4EDU A;  4CI0 C;  4Y28 E;  4C8Q D;  2XIC A;  1VQ6 A;  1YBY A;  3PT9 A;  3JCM W;  4BE1 A;  2RHZ A;  1KQ2 A;  4EMG A;  1VQN A;  4L59 A;  1H3Z A;  2I2L A;  3E9G A;  3SFM A;  3QZ9 B;  4J7F A;  4PL6 A;  3SWN A;  4BDY A;  3QZ5 B;  4M77 F;  2QTX A;  2WSF E;  3G71 T;  4A4F A;  5LJ3 g;  5FRO A;  1JJ2 A;  1VQP A;  1Q7Y C;  2ZPF B;  2L89 A;  2MMP A;  3QHS A;  3OYI A;  4QQ6 A;  4XK8 E;  1WQW A;  4J6Y A;  2DTH A;  4XU0 A;  4X34 A;  1Y96 A;  4C92 C;  4D6W A;  3CCS A;  4QQG A;  2PVO B;  3C94 A;  4EMK A;  2DTO A;  3MEV A;  4RMO A;  4LDU A;  3JB9 D;  3J81 E;  5GAN 4;  4J6X A;  1YCY A;  4ZGD B;  3ZFJ A;  2PQW A;  4M7A C;  1VIE A;  5LJ5 f;  4N4G A;  4OB3 B;  1KD1 U;  5GMK j;  1OZ2 A;  2O4X A;  4PJO C;  1X6O A;  3CMA T;  2RJC A;  3G71 A;  3X25 B;  4IUR A;  3R6O A;  4NOY A;  4BI4 A;  5LJ3 e;  3CPF A;  2XID A;  5A0D A;  4C92 E;  2BKD N;  1KD1 C;  2CZ6 B;  4PLL A;  5CK9 A;  3CXC A;  4HCB A;  4N0A A;  2L3R A;  1KHI A;  4M78 G;  1GXI E;  1K73 C;  3X28 B;  3JSC A;  4M7A E;  2VXF A;  4CRI A;  2DJZ A;  5GAM d;  1XQH A;  4FL6 A;  2RK2 A;  2RHY A;  1BI0 A;  3PMT A;  2A3L A;  5LJ3 f;  1P92 A;  4RG2 A;  1JB0 E;  3LX7 A;  4KUD K;  4JRP A;  2VGN A;  2X4W A;  4ZGE B;  3OS2 A;  3OYL A;  3CMA A;  3SWN B;  4F7U E;  2K5F A;  3JB9 H;  2CKK A;  3CXC S;  4IUP A;  2E6N A;  3QDR B;  5FU6 B;  4RKU E;  4M75 G;  2HQX A;  2NLU A;  4E7H A;  2XHC A;  5FRM A;  3LWH A;  2WAC A;  3RMS A;  3GPL A;  1Y96 B;  2DO3 A;  4C92 A;  1YIJ A;  3QKJ A;  2RHX A;  3FJP A;  3L42 A;  2XI9 A;  3OB9 A;  4E7K A;  4ZTF A;  4OF1 A;  5GAM g;  3GF5 A;  3LW5 E;  4C8Q G;  4M7A A;  4QQD A;  3CCR T;  4TVR A;  4M7D D;  4N4H A;  1N9S A;  3URG A;  1KHC A;  2O4X B;  4PKC C;  2HAX A;  1VQ5 A;  1VQ8 A;  3QJY A;  2RHI A;  3PGG A;  4C0D B;  2VC8 A;  1U1T A;  1XOV A;  1QVP A;  2BIV A;  4LDW A;  3QG1 A;  3CC2 A;  3JCM d;  4IUV A;  3OS0 A;  1UB4 A;  4C92 F;  1BKB A;  2PVG B;  4F7U A;  2EAY A;  3EFS A;  2D9T A;  4KBM B;  4E7I A;  4M78 B;  2CYZ B;  4OP0 A;  1Y71 A;  5LJ5 h;  3JB9 I;  4NL3 A;  3CCU T;  1QP2 A;  4M77 C;  4M7A F;  4HT9 A;  4GY5 A;  2RH2 A;  2QQB A;  1BI2 A;  1XNI A;  3LGF A;  2QI2 A;  3FB9 A;  4Y91 A;  5GAN g;  2QA4 A;  4O5V A;  1S72 T;  2IVW A;  1YJN A;  2X4X A;  2X35 A;  2CZ0 B;  2DAQ A;  1M4Z A;  4QVC A;  2QQ9 A;  2HD0 A;  2KK4 A;  1N8R U;  4A4K A;  3M58 A;  4F7U F;  5KCH A;  1M1F A;  3G7Z A;  3RKY A;  3L2U A;  3CCQ A;  2V8I A;  1N9R A;  3KUF A;  3OYM A;  3SWN C;  3UWN A;  4M75 B;  1KQS A;  5CO7 A;  5CCA A;  5LL6 S;  2DK3 A;  2L5Q A;  2KMT A;  3H6Z A;  3JCM g;  3M55 A;  5LJ3 h;  5FU6 C;  5GAM f;  5GMK m;  3CME T;  4J7I A;  3OYN A;  2DKG A;  3CCU A;  1VQ9 T;  1N27 A;  3L2R A;  4C0F A;  2LCC A;  1ZHI A;  2KDS A;  3OYH A;  3VUZ A;  2VXE A;  1UEB A;  5D6W A;  2E12 A;  4OGE A;  5CKE A;  4NL2 A;  3DB4 A;  3OBY A;  3ZBD A;  2RI5 A;  4FSX A;  2KSS A;  4XTU A;  1KQS S;  2CZ1 B;  4RCC A;  2JVV A;  2VV5 A;  1OI1 A;  4ME7 A;  4XTY A;  4XAX B;  1OZ3 A;  2RB6 A;  2DXB A;  2EJ9 A;  4C0D C;  3G4S T;  3CCM A;  3CME A;  1RI0 A;  3I56 T;  1IZ6 A;  2RO0 A;  3EFR A;  3S3O A;  1EIF A;  4DQ2 A;  5KH6 A;  5GAO p;  2K5I A;  2K5L A;  4M78 C;  3OYK A;  3CPW A;  2OTJ A;  3DB3 A;  2RI2 A;  3JCM c;  4WF2 A;  5LJ5 j;  3RUX A;  4J8O A;  3CCS T;  3M59 A;  2EIF A;  2YLB A;  3M56 A;  2QQS A;  1UGQ B;  4JS5 A;  5CAI A;  1YI2 T;  2LQ8 A;  3LWI A;  3OYJ A;  3JCM f;  3TRE A;  2JTM A;  2R5M A;  2GCX A;  1VQK T;  2WSE E;  2EQU A;  1G3W A;  2PUO B;  3G4S A;  3NTH A;  4M78 E;  2RJF A;  3I56 A;  3ER0 A;  4BDZ A;  3CPW S;  5HKC A;  2R57 A;  5LJ5 e;  4LDY A;  3MEA A;  5M9O A;  3KXT A;  4JRQ A;  2RD1 A;  3J7A F;  5HK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...