2P0QA

Calcium binding protein in the calcium-binding form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr1010 protein
publication title Solution Structures of Ccbp from Anabaena Reveals a New Fold and Novel Calcium Binding Sites
rcsb
source organism Nostoc sp.
molecule tags Metal binding protein
total genus 38
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0qA02
2K2VA 2P0QA 2P0PA 3URGA
chains in the Genus database with same CATH superfamily
3MP8A 5CCAA 1KJWA 3I9QA 1WGSA 1AZEA 4KH0B 2A7YA 1WFWA 5GANd 1BIBA 2DX1A 4C5GA 2GNCA 3NFCA 3JCMd 3TCJA 3OYYA 3CBMA 2ZCFB 4IUQA 1M2VA 1EZZB 1ARKA 3M0SA 1K9MC 1WJSA 4EMKB 5I11A 1W4SA 3L2ZA 3E19A 5I2SA 4M77E 4C8QB 4O5VA 1M90R 3CCUA 1MMGA 4HCCA 3CEYA 4PKCC 5KYXA 2M1HA 3G71A 4FSXA 3L2RA 3M0QA 3OYKA 3QG1A 2DE0X 3J7AF 5GJVB 1IXDA 4JZ3A 4M75E 1UGQB 3G6ET 4CC4B 1GBRA 3TEEA 2R5MA 2XIDA 3CCRQ 2HD0A 2QQBA 1NJIU 2DXBA 5FU7B 3FEOA 4J9CA 3LW5E 2JT4A 4E2FB 2QASA 2DO3A 8ATCB 1SHGA 1TUCA 4OMQA 4LXCA 2ZPIB 4ELZC 3A98A 3CCVQ 1VQMQ 4LD9K 1QCOA 2J7IA 4FL6A 3TSZA 1WJRA 1QVGS 3OW2A 3P8BB 4F7UG 3QUIA 1AHJB 2VC8A 1K9MR 3OB9A 4BI4A 5GAOp 2MWOA 3EGDA 4J5YA 2XU8A 1KQSA 4HT9A 2DYBA 1Y57A 1SPKA 4MZPA 3BY7A 3NHNA 1OULA 2EQIA 3I56Q 1EX4A 2RI2A 1YHQT 4N4IA 1D1CA 3OYEA 3JAME 1BI2A 1JJ2A 3AHUA 4XTWA 4E7LA 1I5OB 2A08A 1RAIB 1TUGB 2MMPA 4GY5A 2KROA 3HKSA 3EGXB 1GCQC 1D0XA 1UG1A 4EPCA 2VGMA 1QCNA 2Y90A 3VU3C 2CKKA 3HRUA 3REBB 1TS9A 4M75B 2DXUA 1VQ6T 1K9MU 3I35A 1WXBA 3CC2Q 2FG0A 3VV0A 2B86A 4KBMB 1RLPC 1DJ7B 1GXIE 3J81E 4QQDA 3CMEQ 2DM1A 3WXMB 4M7DB 1IHVA 4PFZA 5LJ3d 1TTHB 2X4JA 3JSCA 4MDXA 2QA4Q 1VQ5Q 3NTIA 4HT8A 4C92D 2QEXA 1BU1A 1BK2A 2W10A 2JM9A 1E6GA 5FU6C 5GJWB 4OMPA 1RAEB 5CQYA 3JCMJ 2V8JA 2RK2A 1OX8A 1G2BA 4JRIA 2OTLQ 3HP9A 2LZ6B 4CC7A 3CCET 5GAMh 4CI0C 2RQUA 3EFOA 2BZXA 5LJ5h 4BB7A 1JXMA 1Z9QA 2CUDA 2ECZA 3M56A 1KK7A 2A0FB 4PJOB 3M54A 1OV3A 2XICA 1VQ7Q 1ZSZC 2P4TA 2KSSA 3BFMA 1OU8A 1FWZA 4L5GA 4RTVA 4IIOA 1C6VX 2NUZA 3PNWC 2JM8A 3VS6A 2NUPB 4N0AA 2OI3A 1VQ8A 2DZ9A 1BI0A 1K0XA 3NPFA 2MCNA 2CZ7B 5J3BA 1A0NB 1VQPT 2EYQA 2QAZA 2Z0WA 2GTOA 3CCST 2SEMA 3CQTA 1AWJA 2CREA 2XHCA 5KYXB 1I8FA 2V1QA 3O5ZA 4ANJA 4EMKC 5KYYB 2E10A 3LGFA 3VKIA 4C8QC 3H0IA 1G8XA 1RLQC 3L2VA 4F7UF 2DTIA 5GAN3 4M7AD 2DETA 4JJNK 2JN0A 3PFSA 3X26B 3M57A 4C92E 5GANh 2LQNA 2YDLA 4HCKA 2OJ2A 4BACA 2CH4A 4QKUA 3JCMh 1PC0A 2LCSA 3EG3A 5FU7C 2OTJT 3CCRA 4AMCA 5FRMA 1RACB 3KUFA 3VRYA 4OB2B 5GMKl 2LCLA 2P0KA 3CMAT 2DFUA 1GFDA 3GP8A 4KUDK 3LWIA 2VXEA 1IGUA 2E6ZA 1LPLA 1PG5B 1QKXA 4ORZA 3VS4A 1PD0A 3CCVA 2QQAA 2E3HA 5GAOq 1YJNQ 3PTAA 1VQMA 1WQWA 5GAOn 4MMKA 1YCSB 1R77A 4HKEA 3OMGA 1NPRA 1VQLT 2K7AA 1U5SA 3E1SA 4B6MA 1ZBJA 2K4YA 2KMTA 1KD1C 1ABOA 2CP7A 4PJLA 2RI3A 3CC7T 3M4YA 2DXCA 2HQXA 2LQKA 3CC4T 3JB9I 1G3SA 1M3CA 2DERA 4LDWA 2EIFA 3ZBDA 4HA8A 4DEXA 1Y0MA 4EIKA 2RHZA 2HNIA 3AT1B 4PK4A 4JDSA 3VS2A 4N4HA 2LTOA 3SWNB 3X24B 2K5FA 2YRDA 3C94A 2K5LA 3QBYA 4M75C 4TVRA 3JCMc 2QGFB 4LD6A 4C0FA 3CC2A 1MUZA 4M7AE 1ZBXA 1ZLMA 3NTHA 1OZ3A 3CD6A 4M7DC 2E5KA 4M78E 1QW1A 1V29B 1YJ9T 3META 3CCMA 2EGAA 1ZA2B 2KXCA 2O4XA 2EYYA 1VQ5A 1GRIA 2FPFA 1Y07A 2J06A 1OPKA 4GLKA 1KD1R 1XTDA 1HD3A 2COWA 3L2QA 1VUBA 2OAUA 1QWFA 3FRNA 4LDUA 5KYNA 2FL7A 1MHNA 2GQIA 2DBKA 1M9SA 1AD5A 2BKDN 1NBEB 4J9EA 4RUGA 2OTLA 4A4KA 3A8HB 1X6GA 2YUNA 1M1KR 3OW2S 4A63B 4PJOC 3JB9D 1VQKT 3QJYA 1ZSZA 1AZGB 1KQSS 5LJ3h 2RHXA 1OYXA 3FJ5A 1R0CB 3RNJA 1NPPA 5GANj 3JCMX 4RTZA 1JJ2S 3A5ZB 1M4ZA 2AZSA 2PVGB 1VIEA 1MV3A 1M3BA 1IGQA 5GAN5 1X01A 4E6RA 5CKHA 5GAOl 2BE9B 2YWWA 3LX7A 4F14A 4OMLA 4E7HA 4ZTJA 3EG1A 4C5EA 3H0FA 4EMKA 2MPXC 1YNZA 3P8DA 1D09B 4M78B 1T0HA 2C0OA 4QQGA 3JCMV 2DXTA 4C8QA 1D1BA 2LDMA 1WHHA 5DLOA 3OY9A 2FZCB 4Z89A 1TUDA 3F70A 3RKXA 4EMHA 2DL7A 4XU3A 1YJWQ 2RB6A 5KYWB 1K8AC 2A36A 5KCOA 1JEGA 1HK9A 4D8KA 3JB9G 3OYJA 1NEBA 1G3YA 2MI6A 2KT1A 4C0ZA 1UDLA 4DOWA 2G3RA 3OYIA 4L6V5 1VQOQ 1U1SA 3R6OA 5I22A 5GANf 4X34A 2CT4A 3JCMf 5EC7A 1OX9A 2DIQA 2P84A 3TREA 4EMGA 2CS7A 1OPLA 2F2WA 3DKMA 2B8AA 1AWWA 2FPDA 3C12A 3G7ZA 3SB2A 3E2UA 3H8ZA 3EFSA 1UUEA 2DD4A 4DOVA 1MNEA 2K3XA 2L3SA 5CKBA 4OB0B 2ROTA 2YUOA 3PGGA 2KGTA 2LRQA 3MKDA 3H9NA 1K8AR 2ESWA 5GAMd 3CCLT 2CH4W 4NOYA 2HBWA 4M77A 5LJ5d 3JB9J 2L3RA 2DVJA 1TXQA 4J7FA 4KULA 2L3PA 3EH1A 1E6HA 4LDVA 2IIMA 2E41A 4J9FA 2RO0A 1Q7YC 3SWNC 4BE0A 4M75A 1PCXA 2IG0A 4C8QG 4A4GA 3RMQA 2AZVA 3G4ST 5AYFA 2LJ3A 4M7DA 5LJ3j 3S6WA 2DZCA 1YWOA 2MWPA 1VQ9A 5GAMg 1K8AU 1PM3A 5D7UA 5LJ5g 1UEBA 1YITT 1CKBA 3OS2A 2LNHB 3URGA 5I2MA 2EW3A 3UT1A 4J8OA 5J26A 4XTUA 1ZHIA 4B9WA 4JZ4A 3HHTB 5C0MA 2A28A 2PTKA 2DTOA 3X28B 1VQ8Q 4PJOA 2LNVA 2FRWA 2D0QB 3CCJT 1Q7YR 4WTOB 2ZPGB 4Z02A 4N0AC 1UFFA 1WLPB 3JB9H 3G6EQ 1UTIA 3CBPA 9ATCB 4JS4A 1PD1A 4E7IA 4IURA 4ESRA 1QVFP 1XJWB 2A37A 4BE1A 4QVCA 2NUPA 2YHTA 4OMFB 3LYIA 4AFQC 2DEUA 3VUBA 1I81A 4QVZA 2PQWA 2RJCA 2R57A 4QW2A 5LJ3f 2DEQA 1LCKA 3V8LA 1PSEA 1X6BA 3JB9F 1JU5C 3I55T 1LJOA 4IUVA 3FJPA 2HZYA 3TQ7P 1YN8A 1K73C 3VS7A 1HJDA 1BI1A 1YIJA 5KYYA 4M78C 2Y4YA 2EYZA 5GANg 5GAMe 2BZYA 1PKSA 1BIAA 1GFCA 3QSUA 1YHQQ 3JCMg 5LJ5e 2F5KA 1X27A 4LDYA 4ZN1A 3QKJA 4M7DG 4ZN3A 1PRLC 1YJWA 4AT1B 4WF2A 1Q86C 4ZNXA 2RN8A 2DL5A 1KQ1A 1FMWA 3RKWA 2DJZA 1WYXA 4FM4B 1M90U 1R0BG 4XU1A 4RMOA 2EYWA 3CCQA 1WNLA 1VQ6Q 3I5RA 1VQ4T 4LNPA 5CO7A 2M0OA 1VQOA 2JTFA 3BDUA 1TSFA 3GNGA 3EG2A 3SHWA 1RI9A 2LCCA 1V76A 2KR3A 1K73R 4PJOG 3BW1A 4II1A 4JUVA 1TOVA 4F7UE 3SD4A 2RQVA 4M77B 4C8QF 5GAN7 3H0HA 1O75A 1JB0E 1PWTA 4OVAA 3A8MB 2RQWA 2AIRB 3V8KA 3RIRA 3PVLA 3T9NA 2L5QA 3M59A 4IUPA 2K5IA 1KSWA 1VIFA 4J6YA 5GANe 4PJJA 1Q86R 1W2BP 5GAOr 3JV3A 3GPLA 3JCMe 3CD6Q 3EHQA 2CP6A 2HSEB 1Y7XA 3SWNA 2MYSA 4JPBW 2KDSA 4JLGA 3CCMQ 3TU4K 1N8RR 2E4HA 4C92A 3M0PA 3MPUB 2QDYB 2CGHA 1QP2A 2XI9A 1RL2A 2GFAA 3UF4A 1S72T 4C5HA 4E47A 4XTZA 5A0DA 5CKFA 3I56T 1NZ9A 1VQNT 2DRKA 1VYUA 3ZL7C 1B7TA 4XAXB 3FB9A 5L8RE 1C1AA 2HDAA 2CYZB 5FWBA 1F1BB 1GCPA 1X2KA 4OP0A 4BE2A 5J39A 2LJ0A 5LJ3g 1G5VA 1G83A 4HVVA 1ZUYA 5L23A 3FDRA 3HFOA 5CK9A 3E9FA 2QQRA 3GNFB 4BY6B 1JO8A 3GLXA 3HL8A 3UA7A 4OMMA 4B9XA 1FX7A 4AFZC 2XKOC 2YRVA 3SEMA 5IAYA 4E7JA 2A3LA 3L2WA 2GQVA 3CMET 3G6EA 2QA4T 1I5LA 3EHRA 3EGUA 3ZFJA 2EYXA 4M7DF 2BZ8A 4QQ6A 1SRMA 3J80E 1Q81C 1D1AA 4KH1B 5FROA 1U8RA 4FSSA 1VQLQ 4M78A 4RTWA 3M53A 1I1JA 2K6DA 2LC4A 4DBFA 1VQ7T 2L2PA 2K9GA 1M27C 3E9GA 4AFUC 2NYSA 2O9VA 4LE9A 2H3EB 4PJOF 2EVRA 2GTJA 5KYWA 2M0YA 5CKEA 1YHQA 1CKAA 2RK1A 2ED0A 1JRIA 1QLYA 4FYWB 2ZAEA 1WHGA 2KYMA 5LJ3e 2BUDA 1M5Q1 3RDVA 1H3ZA 2O31A 2RHYA 3QWXX 5CAIA 5LL6S 3GOXA 2M51A 3H41A 2RI5A 2RM4A 2VYTA 4J9HA 5GAN6 1Y96B 2EJ9A 2EBPA 1Q81R 1VQ6A 1Q82C 4BDYA 4PFPA 2FB7A 2JOYA 4KGZB 3CXCP 3JCMP 5GMKm 2EWNA 2CSQA 1YJ9Q 1YI2T 4XTVA 2VGNA 2HBPA 4HVWA 1PHTA 3LWHA 3QJ6A 3BE3A 1KC8C 4M77C 1IO6A 2CP3A 2DK3A 1B3QA 3IQLA 1X2QA 4GLMA 2HAXA 4OGCA 3QZ5B 1M1KC 5GAMj 3OBYA 1QVFA 4RG8A 1ZUKA 4ATOA 5LJ5j 4C92B 5GMKi 4F16A 3CCEA 1SRLA 2RHIA 4FIBA 1KFZA 3OSSC 3RMSA 1UECA 1TG0A 1VQ9Q 3CPWP 2EQMA 1QCFA 1YJNT 1BI3A 1Q82R 5FLXE 1X69A 1AEYA 1M3AA 2E6NA 2LVMA 4VUBA 1W70A 1WHKA 4M4ZA 4XU0A 2L0AA 2GF7A 2OX7A 1K76A 2CZ1B 2ZGWA 4CC2A 1LVKA 2JJ9A 1NLPC 2YUQA 1VYVA 4D6WA 1KC8R 2PU9B 2F69A 2K57A 2AK5A 1VQPA 4RG2A 3CBOA 2KI7A 2VVKA 4JRKA 1UB4A 4RKUE 3OYFA 3CCSA 2M02A 1XOVA 2VUBA 1TH7A 3CPFA 2KBTA 4FW1A 1SEMA 3EG0A 3VRZA 5GAMf 1T0JA 4RTYA 2J6FA 4NL2A 2DIGA 1WDXA 2F2VA 5LJ5f 3I5SA 1KG1A 4YTLA 2KK4A 2LQWA 4BY6C 2K79A 4HCZA 3MHXA 3V8JA 4D8DA 2SRCA 2IVWA 3JCMQ 3P8HA 5KE3A 5GMKh 3V7RA 3FLGA 1KD1U 4F04B 1M2OA 2PVDB 4IUTA 1N27A 2HEQA 2KRMA 4V2SA 4OB3B 2R58A 1YIJQ 4ZGEB 1EIFA 2D1XA 4M7AB 2OTJA 5IHKA 3EFRA 4FW2A 4C0DB 3EH2A 5HCKA 3CMAA 1M1KU 4CC3A 1IZ6A 1UJYA 2DL4A 2QGGA 5M9OA 1QKWA 1KQ2A 2EAYA 4OB1B 2HKNA 2RQTA 2VXFA 5D6WA 1Y71A 2K3YA 1WHLA 2F1LA 1W2BA 2FHDA 1H92A 2HSPA 2XG8D 2LT1A 5HKCA 3C95A 5GAOm 1VQLA 1Q95G 2VWFA 4R0KA 1ZA1B 3NGPA 1T3SA 3CCQQ 4C8QD 3CCLQ 4J83A 3S3NA 4NS5A 2HL3A 1H3HA 3THKA 1MNDA 3CC7A 1PNJA 2OAWA 1HXDA 4PLLA 1R8OB 3EG9A 3CC4A 4QVDA 1N9RA 2DD5A 2RNAA 2LP5A 1E7OA 2DRMA 2DYIA 1IREB 1AWXA 2W0ZA 4OMOA 3CCUT 1D0YA 2QYZA 2QTVA 3M9QA 4ZGDB 3UPUA 3G71T 4FCYA 1UGVA 5FW9A 4C5IA 2DF6A 4BDZA 2MIOA 4BI8B 1ACMB 2QTXA 3PMTA 2MF2A 3G4SQ 1LNXA 1RI0A 5DLQE 2MK5A 3VS0A 4IIMA 3OS1A 1AVZC 1N5ZA 3QO3A 2JNGA 3HRTA 5HY6A 2COYA 1YJ9A 1SSFA 4Z88A 1YITQ 4A4FA 3GF5A 2JVVA 2O88A 1WA7A 4KRTA 1JXOA 5FWCA 2YSQA 1IB8A 2V8IA 4FU6A 1U06A 4C92C 3QYGB 1MMAA 1O9SA 2DJQA 3CCJQ 1BCMA 4RTXA 5ECAA 1VQKA 1T3LA 2GGRA 2O01E 1PRMC 4XTXA 1CSKA 1WHMA 2F2XA 4JRPA 4RCCA 4Y92A 1RAAB 2FEIA 3L2UA 2CP0A 5AT1B 2XDPA 2P0PA 3ZEHA 3INZA 4C8QE 5GMKj 1NJIC 3UA6A 4M75D 1QMCA 4Y28E 3ME9A 4ZGJB 3RBBB 5KCHA 3M5AA 2I2LA 2D8JA 2CP5A 1SSHA 4BD3A 2J05A 3BDLA 5GAN8 4J6WA 4M7DD 1UHFA 4F17A 5A0GA 2K3BA 4F7UA 1SHFA 2D8HA 3TVTA 1YP5A 3MEAA 2DA9A 4OF1A 3A1PA 2X4XA 3OYMA 1MGQA 3HTRA 4MZMA 3OYCA 1XNIA 1B07A 2JW4A 3R6NA 4KUIA 3OYLA 2XK0A 2QEXT 3RKYA 2JXBA 3RERA 2X9HA 2CP2A 2AKKA 3EAEA 2LX7A 4PJMA 1UGSB 4PJOD 3CXCA 5GAN4 4M77G 3FIFA 2E5QA 1NJIR 3HFNA 3GIBA 4JJDA 1SKUB 4R55A 5HK0A 4M7AC 1VQ4Q 1QVFS 2ZZDA 4C0DC 4P5NA 1UJ0A 2R5AA 1Q7YU 4M75G 2GCXA 4J9DA 4BI3A 4ZTFA 1WX6A 2D9TA 1WZOA 2DKGA 3OSVA 3Q1JA 2K2MA 4JJBA 3L1AA 4E7ZA 1H641 3VYHB 1ABQA 1VQ8T 1MMNA 2QQSA 3QDRB 2DTHA 3NTKA 3HSBA 1OU9A 3EG9B 1QVGP 3CPWA 2EGEA 3RESA 2CZ0B 4RCBA 5IT9E 3MEWA 1UGRB 3LH0A 2KRNA 4LUDA 3CCLA 5DM7R 2EFIA 4X9CA 1N8RC 4M7DE 1HYOA 1OEBA 4JLIA 4K11A 3VYGA 1D3BB 4L59A 3OS0A 3LGLA 2ROLA 2VASA 2DNUA 1AWOA 3A8OB 1Y96A 3MCAB 2CZ6B 2BTTA 4FT4A 4JS5A 1S72Q 3M4GA 2CDTA 3G4SA 2H3JA 1U3OA 3MEVA 1SF9A 4PJOE 1YCYA 3CCEQ 1NYFA 2J6KA 3CCRT 1YWPA 2CUBA 1VQNQ 4R56A 2EPDA 1WIEA 2XMFA 1S1NA 4PJNA 2H8HA 2ZPFB 1YITA 2QK0A 3PE0A 1M1FA 2DLPA 2KE9A 4J9BA 3CCVT 1VOMA 1VQMT 2NWMA 4KGVB 3LLRA 5IH2A 4IUUA 2O2OA 3S3OA 1K73U 1D0ZA 2CSIA 2KAFA 2YRCA 1N6AA 4J7IA 2C0TA 2HL5C 1VA7A 1BKBA 2IPOB 2KYBA 2RD1A 3CCJA 1W2BS 4PLIA 4CRIA 4EDUA 1NM7A 5IN1A 1VQPQ 3M0UA 3MP1A 1NLOC 3M0RA 4OMNA 3JRZA 2HQEA 3CCSQ 1OOTA 2RMOA 4WCIA 1Q86U 1K4US 3GBQA 4F7UB 3M58A 5D6YA 3KFVA 4M77F 3WVEB 1JQQA 1N8RU 2XDBA 3VS1A 2P4RA 3I55A 4DBQA 1C0MA 1B34A 1ZUUA 2C06A 3CC2T 2XDDA 4FYVB 3CD6T 1PSFA 4AG1C 5GAN2 4M75F 1M1GA 3VS5A 1BYMA 3MJXA 1N9SA 3CCMT 1V1CA 2OTJQ 1VQ5T 3MO8A 1WI7A 2JMCA 2KT8A 2M16A 3QIIA 5I21A 2D0NA 3CMAQ 4DBHA 2E3IA 1SG5A 1M2VB 2C0IA 3ULRB 3N5BB 1P92A 2LQ8A 2KVQG 4Q5WA 4XTYA 3JCMb 4M7AA 2OTLT 3PIPA 2KNBB 2NUTA 1J3TA 1VQ4A 5KH6A 2EJFA 4C92G 2I0NA 2RJDA 3V7SA 2ED1A 5HK3A 4X9DA 2AT1B 1YI2Q 3CC7Q 5CQXA 1MV0B 1AOJA 4DQ2A 2VV5A 1TWBA 3DLMA 3CC4Q 3SFMA 2JZ2A 5KYUA 1ZX6A 1QQJA 2FVUA 5IXFA 5IHIA 1HSQA 4Z8AA 4M78D 4QT7A 1UGPB 4Y91A 2E64A 4N4GA 2E1HA 3C0CA 1H8KA 2HQHA 2DILA 2X4WA 3JCMW 3D7SB 5GMKe 2DL8A 3UDCA 1EFNA 4PFOA 3EGDB 2LT4A 2YXYA 3OYHA 1GBQA 3QHSA 2F5TX 2FZGB 3OA6A 2O9SA 4HCBA 2DL3A 3QXEB 2L3QA 2K2VA 3PT9A 2JTEA 2L89A 1G3TA 4HXJA 1S72A 2M9UA 1VYTA 1WJQA 5CKDA 3CXCS 2ABLA 3I56A 5KE2A 1X6OA 2JUFA 1VQNA 1VQKQ 1WXTA 4DBRA 2EJGA 1NEGA 5D6XA 3REAB 4A4HA 2QXFA 1Q81U 4M7AG 3L42A 1GCQA 4FT2A 3ER0A 1RAHB 4M78G 1XQHA 2ATCB 1K0SA 2DBMA 3UATA 2EQUA 4A4EA 4KT0E 2RQRA 1TU0B 1QWEA 2E65A 2PUOB 4FYYB 1MMDA 1OI1A 1RUWA 4O6JA 3UWNA 4X1VA 3RUXA 1RABB 2RPNA 2X51A 2G6FX 3QZ9B 4A53A 4LDXA 3PVQA 2JTMA 3QDFA 1G3WA 2V26A 3CMEA 2D6FA 4LN2A 3X25B 3M0TA 3OYDA 3OW2P 1WXUA 1W1FA 3M55A 3CPWS 2QA4A 2VKNA 3VUZA 3EFOB 3DB3A 1YFNA 3KBGA 1B34B 3RR6A 1QVGA 1KQSP 1Z9ZA 3G1JA 1WPYA 2EQKA 2X3WD 7AT1B 4E7KA 3OMCA 2LJ1A 2RJEA 4MDWA 1M8MA 3NMZC 2LMJA 4IKFA 1JJ2P 4RTUA 1I4K1 2QDLA 3A8GB 1WHJA 2DVEA 1Q82U 2VB6A 4MMLA 1FMKA 2X3XD 1FYNA 2ENMA 4C92F 5CVIA 1NE8A 3OBWA 1I0CA 4JJCA 2X35A 1ZSGA 5CR2A 1VQ9T 1VQ7A 2EGCA 2GFUA 3DLLA 2WSCE 2ZPHB 1KC8U 2Y4XA 2P0QA 3DB4A 4AFSC 1FXXA 2QQ9A 3OQ5A 2KY9A 3HRSA 2FO0A 2NUTB 1AT1B 2YT6A 8AT1B 4DA4A 3CCUQ 3X20B 1M8VA 2YLBA 5A2QE 2X4YA 4RTTA 5FRNA 3OYGA 1PKTA 3G71Q 2RA2A 1IHWA 2KRSA 3A8LB 2E12A 2J6OA 4PL6A 4MZTA 3U23A 1OZ2A 5KYUB 2ZPEB 1ZQ1A 5IXBA 2CT3A 3QWYA 4PNOA 2FPEA 2BE7D 2LX9A 5DY9A 2KQWA 2PUKB 1YI2A 1M30A 1UHCA 5A0LA 2COZA 5EG2A 4XK8E 4HVUA 2V1RA 3OYNA 2AKLA 4XU2A 2YUPA 3H6ZA 3TSWA 4FYXB 2QG9B 2WSFE 3SDZA 1YIJT 1QVPA 2WACA 1GL5A 3MEUA 1D3BA 4J6XA 1QP3A 1RADB 4AG2C 1BCOA 3OYBA 5IHNA 2HCKA 4M7AF 2MAMA 3OYAA 3WVDB 3QPHA 2PZ1A 4M78F 1RAFB 2L8DA 4KGXB 1LOJA 1X75C 3QYHB 4ELYC 1YJNA 1YJWT 3VS3A 3C4SA 1X43A 4LUEA 4JRQA 1BBZA 1KIKA 3MP6A 2JS0A 1U1TA 4XQ3A 2EKOA 2KXDA 4BUGA 2DPPB 2RJFA 2EQJA 3VJPA 5CIUA 3OS5A 4ME7A 2XD0A 3LH5A 4NL3A 4J9GA 3CCQT 1FMVA 4DEYA 3ASKA 1VQOT 2RH2A 4GBQA 5C6SA 1KHCA 2DMOA 2MOXA 4M77D 3EGXA 2RF0A 1I07A 1IRXA 2GBQA 2FZKB 1NYGA 2QEXQ 4UC4A 1KHIA 1NG2A 2PVOB 3KXTA 1JBMA 2HMAA 2JS2A 2FRYA 2QI2A 1UE9A 2O4XB 1RAGB 3PIOA 1W6XA 4E7SA 4C0GA 5FU6B 2JMAA 1WQ7A 2EKHA 3PMIA 2ZPBB 1BB9A 3HPWA 2HKQB 3I55Q 1K9AA 2PNIA 2FYKA 4OGEA 1K1ZA 2YLCA 6AT1B 1YBYA 2E70A 1M90C 1OQKA 2WSEE 4A54A 3S3MA 2NLUA 2V8KA 1ZSZB 3FC3A 2KEAA 2AHJB 4J9IA 2BIVA 2RHUA 3O8VA 3V7CA 2DAQA
chains in the Genus database with same CATH topology
1N6AA 3MP8A 4J7IA 2FB7A 2JOYA 5CCAA 3F70A 3RKXA 4EMHA 2RD1A 1BKBA 1WGSA 4XU3A 3CCJA 1W2BS 4PLIA 4CRIA 4EDUA 5GMKm 2EWNA 3JCMP 2A7YA 2RB6A 5GANd 1YI2T 1K8AC 4XTVA 1BIBA 2VGNA 5IN1A 2HBPA 4C5GA 5KCOA 3MP1A 3NFCA 3QJ6A 3JCMd 3LWHA 3TCJA 1HK9A 4M77C 1KC8C 3JRZA 2HQEA 2DK3A 3OYYA 3CBMA 3JB9G 3OYJA 2ZCFB 2HAXA 4OGCA 1G3YA 2MI6A 4IUQA 1Q86U 3QZ5B 4C0ZA 4DOWA 4BDYA 1M1KC 2G3RA 5GAMj 3OBYA 3OYIA 1QVFA 4F7UB 4L6V5 4RG8A 3M58A 1K9MC 1WJSA 4ATOA 1U1SA 4EMKB 5LJ5j 3R6OA 5GANf 4C92B 5GMKi 4X34A 1W4SA 3L2ZA 5D6YA 3CCEA 3E19A 4M77F 3WVEB 5I2SA 4M77E 4C8QB 1N8RU 2XDBA 4O5VA 3JCMf 3CCUA 2DIQA 3I55A 4HCCA 2RHIA 1B34A 3TREA 4EMGA 2CS7A 4FIBA 3CEYA 4PKCC 3OSSC 3RMSA 2C06A 3DKMA 3CC2T 2M1HA 2XDDA 4FSXA 2B8AA 3L2RA 3G71A 3OYKA 3CD6T 1PSFA 3QG1A 3C12A 3G7ZA 3J7AF 2EQMA 3SB2A 3H8ZA 4M75F 5GAN2 1YJNT 1M1GA 3EFSA 1BI3A 1BYMA 4M75E 5FLXE 1N9SA 2DD4A 4DOVA 1UGQB 2E6NA 2LVMA 4VUBA 3G6ET 3CCMT 1YJWT 2K3XA 4XU0A 5CKBA 4OB0B 1VQ5T 3MO8A 3TEEA 2GF7A 2R5MA 2XIDA 2M16A 3PGGA 3QIIA 5I21A 2QQBA 2HD0A 2CZ1B 2LRQA 1NJIU 2DXBA 2ZGWA 3FEOA 5FU7B 3LW5E 5GAMd 3CCLT 4D6WA 2DO3A 3N5BB 2PU9B 4NOYA 2F69A 1P92A 4M77A 5LJ5d 3JB9J 2K57A 2ZPIB 4ELZC 2LQ8A 2KVQG 2L3RA 4Q5WA 4XTYA 4J7FA 1VQPA 4RG2A 3JCMb 4LD9K 4KULA 3CBOA 4M7AA 2OTLT 4FL6A 4JRKA 1UB4A 3PIPA 4RKUE 4LDVA 3OYFA 3CCSA 2E41A 1WJRA 1QVGS 3OW2A 1XOVA 2RO0A 2VUBA 3P8BB 4F7UG 1Q7YC 1TH7A 3CPFA 3QUIA 1AHJB 2VC8A 3OB9A 4BI4A 3SWNC 4BE0A 5GAOp 2MWOA 1VQ4A 5KH6A 2EJFA 4M75A 4C92G 4J5YA 5GAMf 2XU8A 2RJDA 2IG0A 3V7SA 5HK3A 1KQSA 4HT9A 4C8QG 4NL2A 2DIGA 5LJ5f 4X9DA 4A4GA 4MZPA 3RMQA 3HSBA 1KG1A 5CQXA 3BY7A 4YTLA 4DQ2A 3G4ST 2KK4A 5AYFA 2VV5A 4BY6C 4HCZA 3DLMA 4M7DA 2RI2A 3MHXA 3V8JA 1YHQT 4N4IA 3SFMA 2IVWA 3S6WA 5LJ3j 2JZ2A 3JCMQ 3P8HA 2DZCA 5KE3A 5GMKh 1BI2A 3JAME 3V7RA 3OYEA 1JJ2A 3FLGA 3AHUA 1KD1U 2FVUA 2MWPA 4XTWA 2PVDB 4IUTA 4E7LA 1N27A 1VQ9A 5GAMg 4M78D 1K8AU 2MMPA 1UGPB 4Y91A 4GY5A 4V2SA 3HKSA 2E64A 1UEBA 2E1HA 4N4GA 2R58A 4OB3B 4ZGEB 5LJ5g 1YITT 2X4WA 1EIFA 4M7AB 3URGA 3OS2A 2OTJA 5I2MA 3UT1A 3JCMW 4J8OA 5J26A 4EPCA 5GMKe 2VGMA 4XTUA 2Y90A 3EFRA 3VU3C 2CKKA 4C0DB 3HRUA 1ZHIA 3UDCA 4B9WA 1M1KU 3CMAA 3HHTB 1IZ6A 5C0MA 4M75B 2LT4A 2DXUA 5M9OA 1K9MU 1VQ6T 1KQ2A 2EAYA 3OYHA 4OB1B 3VV0A 2DTOA 3X28B 4PJOA 2VXFA 4KBMB 5D6WA 1Q81U 1DJ7B 3QHSA 4M7AG 1Y71A 2F5TX 2K3YA 2LNVA 3J81E 1GXIE 2D0QB 3OA6A 3CCJT 1W2BA 2FHDA 2ZPGB 4QQDA 4HCBA 4Z02A 2XG8D 4N0AC 3WXMB 4DA4A 4M7DB 3JB9H 5LJ3d 2X4JA 2LT1A 5HKCA 3JSCA 3QXEB 3C95A 5GAOm 4MDXA 3CBPA 1VQLA 4JS4A 2K2VA 3PT9A 3NTIA 4E7IA 4IURA 4HT8A 4C92D 2QEXA 4BE1A 2L89A 1G3TA 4QVCA 1S72A 2M9UA 4C8QD 3S3NA 4J83A 2YHTA 4OMFB 4NS5A 3LYIA 3VUBA 1I81A 1WJQA 4QVZA 5CKDA 3CC7A 2PQWA 2RJCA 5FU6C 1HXDA 4PLLA 1R8OB 3CXCS 5CQYA 3JCMJ 2V8JA 3I56A 5KE2A 2RK2A 1X6OA 2R57A 1N9RA 4JRIA 2DD5A 4QW2A 4QVDA 2JUFA 5LJ3f 2DEQA 3HP9A 3CCET 5GAMh 3V8LA 4CI0C 1VQNA 1IREB 1PSEA 3JB9F 3CCUT 2EJGA 5LJ5h 3I55T 5D6XA 1LJOA 2QXFA 4A4HA 3FJPA 3M56A 3M9QA 3L42A 4FT2A 4IUVA 4BB7A 4ZGDB 3UPUA 1K73C 4PJOB 3ER0A 1BI1A 3M54A 3G71T 1YIJA 4M78G 1XQHA 2XICA 4M78C 4C5IA 4BDZA 2Y4YA 4BI8B 5GANg 2QTXA 2P4TA 2MF2A 3PMTA 2KSSA 2EQUA 4A4EA 3BFMA 1LNXA 5GAMe 1RI0A 4KT0E 5DLQE 1BIAA 1FWZA 2E65A 3QSUA 2PUOB 4L5GA 3JCMg 1OI1A 5LJ5e 4O6JA 3UWNA 2F5KA 4LDYA 3PNWC 3OS1A 4ZN1A 3RUXA 3QO3A 2JNGA 3HRTA 4N0AA 5HY6A 3QKJA 1VQ8A 4M7DG 4ZN3A 2DZ9A 4A53A 3QZ9B 4LDXA 1BI0A 2JTMA 1YJWA 1YJ9A 1SSFA 1G3WA 4A4FA 3CMEA 2D6FA 3X25B 3GF5A 3OYDA 2CZ7B 5J3BA 4WF2A 2JVVA 3CPWS 3M55A 1Q86C 2QA4A 1VQPT 3VUZA 2EYQA 1KQ1A 3RKWA 2DJZA 3DB3A 3KBGA 1B34B 3CCST 1QVGA 4FM4B 1M90U 4XU1A 4RMOA 2XHCA 1WPYA 1I8FA 3CCQA 1WNLA 2EQKA 2V8IA 4FU6A 4EMKC 4E7KA 1VQ4T 4C92C 2E10A 3OMCA 2M0OA 3LGFA 3QYGB 2RJEA 2JTFA 3BDUA 5CO7A 3VKIA 3GNGA 4MDWA 1VQOA 1O9SA 4C8QC 4IKFA 1I4K1 3A8GB 2LCCA 2DVEA 3L2VA 1Q82U 4PJOG 3BW1A 1VQKA 4II1A 4JUVA 4F7UF 2DTIA 2O01E 4MMLA 5GAN3 4F7UE 3SD4A 4M7AD 4XTXA 4JJNK 4JRPA 2JN0A 3PFSA 3X26B 4C92F 5CVIA 1NE8A 3OBWA 4RCCA 3M57A 4C92E 2X35A 5GANh 4M77B 3L2UA 4C8QF 5CR2A 1VQ9T 1VQ7A 2GFUA 2P0PA 2WSCE 2XDPA 3INZA 3ZEHA 4C8QE 2ZPHB 5GMKj 5GAN7 1NJIC 4M75D 3JCMh 1KC8U 2Y4XA 2P0QA 3DB4A 4Y28E 1O75A 1FXXA 2QQ9A 3OQ5A 3ME9A 1JB0E 4ZGJB 5KCHA 4OVAA 2KY9A 3A8MB 3M5AA 5FU7C 2OTJT 2I2LA 3CCRA 3V8KA 3HRSA 3RIRA 3T9NA 4BD3A 2L5QA 3M59A 3BDLA 5FRMA 3KUFA 4IUPA 5GAN8 2K5IA 4OB2B 4J6YA 1VIFA 3X20B 2LCLA 2P0KA 2YLBA 4J6WA 5GANe 5GMKl 3CMAT 4M7DD 1M8VA 3GP8A 1YJNA 5A2QE 4KUDK 2X4YA 2VXEA 3LWIA 5GAOr 2E6ZA 5FRNA 3GPLA 3JCMe 3OYGA 5A0GA 2RA2A 3A8LB 3CCVA 2QQAA 4F7UA 5GAOq 1Y7XA 3PTAA 2E12A 1VQMA 4PL6A 3MEAA 3SWNA 1WQWA 4MZTA 2KDSA 4JLGA 5GAOn 1OZ2A 3TU4K 4MMKA 4OF1A 4C92A 2X4XA 2ZPEB 4HKEA 1MGQA 3OYMA 1ZQ1A 3OMGA 1NPRA 3CC4A 4MZMA 2QDYB 3OYCA 1VQLT 2CGHA 1QP2A 1XNIA 2XI9A 1RL2A 4KUIA 3OYLA 2XK0A 4PNOA 2QEXT 3E1SA 3RKYA 2GFAA 2LX9A 5DY9A 2KQWA 3RERA 1S72T 2PUKB 2K4YA 2KMTA 1KD1C 4C5HA 4E47A 4XTZA 1YI2A 5A0DA 3EAEA 2RI3A 5A0LA 1UGSB 3CC7T 4PJOD 3M4YA 2DXCA 5CKFA 5EG2A 4XK8E 5GAN4 3CXCA 2HQXA 2LQKA 3I56T 3CC4T 3OYNA 4M77G 3FIFA 2E5QA 1NZ9A 4XU2A 3HFNA 3GIBA 1VQNT 3JB9I 1G3SA 4LDWA 2EIFA 4R55A 3ZBDA 3H6ZA 4XAXB 5HK0A 3FB9A 4HA8A 5L8RE 4M7AC 2RHZA 2HNIA 1QVFS 4JDSA 2WSFE 2ZZDA 2CYZB 4C0DC 4P5NA 4N4HA 2LTOA 4OP0A 3SDZA 3SWNB 1QVPA 4BE2A 2WACA 2R5AA 3X24B 1YIJT 5J39A 2K5FA 3C94A 1Q7YU 2K5LA 3MEUA 3QBYA 4M75G 2GCXA 1D3BA 4M75C 5LJ3g 4J6XA 1QP3A 4BI3A 4ZTFA 1G5VA 2D9TA 4TVRA 3JCMc 2DKGA 3FDRA 3OSVA 3HFOA 3Q1JA 3OYBA 4LD6A 3L1AA 4C0FA 5CK9A 4M7AF 1H641 2QQRA 3E9FA 3GNFB 3VYHB 4BY6B 3CC2A 2MAMA 1ZBXA 3NTHA 3OYAA 4M7AE 3WVDB 1OZ3A 3QPHA 3CD6A 4M7DC 3GLXA 4M78F 3HL8A 2L8DA 1VQ8T 2QQSA 1LOJA 1X75C 4M78E 1QW1A 3QDRB 1V29B 1FX7A 2DTHA 2XKOC 3NTKA 3QYHB 2YRVA 4B9XA 4ELYC 3DLLA 5IAYA 3C4SA 4E7JA 1YJ9T 3META 2A3LA 3L2WA 2GQVA 3CCMA 3CMET 3G6EA 2O4XA 4JRQA 3CPWA 1VQ5A 3MP6A 2QA4T 1Y07A 3RESA 1U1TA 2CZ0B 4RCBA 2EKOA 4XQ3A 4BUGA 3MEWA 5IT9E 1I5LA 4GLKA 1XTDA 2DPPB 2RJFA 1UGRB 2EQJA 3LH0A 5CIUA 3VJPA 3L2QA 3ZFJA 4BACA 1VUBA 2OAUA 3OS5A 4ME7A 3FRNA 3CCLA 2XD0A 4M7DF 5DM7R 2EFIA 4X9CA 4NL3A 3CCQT 1N8RC 4LDUA 4M7DE 2FL7A 1MHNA 4JLIA 4QQ6A 3ASKA 1VQOT 1M9SA 3J80E 2RH2A 3VYGA 5C6SA 1Q81C 1D3BB 1KHCA 2BKDN 4L59A 3OS0A 2OTLA 3LGLA 4M77D 4A4KA 3A8HB 5FROA 1U8RA 4PJOC 3OW2S 3A8OB 3JB9D 1VQKT 3QJYA 4M78A 1Y96A 3MCAB 3M53A 2CZ6B 2LC4A 4UC4A 1KQSS 4FT4A 1KHIA 2PVOB 3KXTA 1JBMA 4JS5A 3M4GA 5LJ3h 2RHXA 1VQ7T 1OYXA 2QI2A 3E9GA 2O4XB 3G4SA 3PIOA 2H3JA 4PJOF 1NPPA 3MEVA 1YHQA 5CKEA 5GANj 4PJOE 1YCYA 3JCMX 1JJ2S 3CCRT 2RK1A 3A5ZB 5FU6B 4C0GA 3PMIA 1M4ZA 1JRIA 1WQ7A 2ZPBB 3HPWA 4R56A 5LJ3e 2FYKA 2PVGB 1VIEA 2BUDA 4OGEA 1M5Q1 2YLCA 2ZPFB 1YBYA 2E70A 1X01A 5GAN5 5CKHA 5GAOl 1YITA 1M90C 2WSEE 4A54A 1H3ZA 4E7HA 3LX7A 1M1FA 2RHYA 4ZTJA 3S3MA 2NLUA 4C5EA 5CAIA 5LL6S 3GOXA 3CCVT 2V8KA 1VQMT 2RI5A 3LLRA 4EMKA 4IUUA 3P8DA 4M78B 3S3OA 2RM4A 2VYTA 5GAN6 3FC3A 1K73U 1Y96B 2AHJB 4QQGA 3JCMV 2DXTA 2EJ9A 4C8QA 2LDMA 5DLOA 1VQ6A 3OY9A 1Q82C 2KAFA 2BIVA 2RHUA 3O8VA 3V7CA 2DAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2V A;  2P0Q A;  2P0P A;  3URG A; 
#chains in the Genus database with same CATH topology
 3MP8 A;  5CCA A;  1KJW A;  3I9Q A;  1WGS A;  1AZE A;  4KH0 B;  2A7Y A;  1WFW A;  5GAN d;  1BIB A;  2DX1 A;  4C5G A;  2GNC A;  3NFC A;  3JCM d;  3TCJ A;  3OYY A;  3CBM A;  2ZCF B;  4IUQ A;  1M2V A;  1EZZ B;  1ARK A;  3M0S A;  1K9M C;  1WJS A;  4EMK B;  5I11 A;  1W4S A;  3L2Z A;  3E19 A;  5I2S A;  4M77 E;  4C8Q B;  4O5V A;  1M90 R;  3CCU A;  1MMG A;  4HCC A;  3CEY A;  4PKC C;  5KYX A;  2M1H A;  3G71 A;  4FSX A;  3L2R A;  3M0Q A;  3OYK A;  3QG1 A;  2DE0 X;  3J7A F;  5GJV B;  1IXD A;  4JZ3 A;  4M75 E;  1UGQ B;  3G6E T;  4CC4 B;  1GBR A;  3TEE A;  2R5M A;  2XID A;  3CCR Q;  2HD0 A;  2QQB A;  1NJI U;  2DXB A;  5FU7 B;  3FEO A;  4J9C A;  3LW5 E;  2JT4 A;  4E2F B;  2QAS A;  2DO3 A;  8ATC B;  1SHG A;  1TUC A;  4OMQ A;  4LXC A;  2ZPI B;  4ELZ C;  3A98 A;  3CCV Q;  1VQM Q;  4LD9 K;  1QCO A;  2J7I A;  4FL6 A;  3TSZ A;  1WJR A;  1QVG S;  3OW2 A;  3P8B B;  4F7U G;  3QUI A;  1AHJ B;  2VC8 A;  1K9M R;  3OB9 A;  4BI4 A;  5GAO p;  2MWO A;  3EGD A;  4J5Y A;  2XU8 A;  1KQS A;  4HT9 A;  2DYB A;  1Y57 A;  1SPK A;  4MZP A;  3BY7 A;  3NHN A;  1OUL A;  2EQI A;  3I56 Q;  1EX4 A;  2RI2 A;  1YHQ T;  4N4I A;  1D1C A;  3OYE A;  3JAM E;  1BI2 A;  1JJ2 A;  3AHU A;  4XTW A;  4E7L A;  1I5O B;  2A08 A;  1RAI B;  1TUG B;  2MMP A;  4GY5 A;  2KRO A;  3HKS A;  3EGX B;  1GCQ C;  1D0X A;  1UG1 A;  4EPC A;  2VGM A;  1QCN A;  2Y90 A;  3VU3 C;  2CKK A;  3HRU A;  3REB B;  1TS9 A;  4M75 B;  2DXU A;  1VQ6 T;  1K9M U;  3I35 A;  1WXB A;  3CC2 Q;  2FG0 A;  3VV0 A;  2B86 A;  4KBM B;  1RLP C;  1DJ7 B;  1GXI E;  3J81 E;  4QQD A;  3CME Q;  2DM1 A;  3WXM B;  4M7D B;  1IHV A;  4PFZ A;  5LJ3 d;  1TTH B;  2X4J A;  3JSC A;  4MDX A;  2QA4 Q;  1VQ5 Q;  3NTI A;  4HT8 A;  4C92 D;  2QEX A;  1BU1 A;  1BK2 A;  2W10 A;  2JM9 A;  1E6G A;  5FU6 C;  5GJW B;  4OMP A;  1RAE B;  5CQY A;  3JCM J;  2V8J A;  2RK2 A;  1OX8 A;  1G2B A;  4JRI A;  2OTL Q;  3HP9 A;  2LZ6 B;  4CC7 A;  3CCE T;  5GAM h;  4CI0 C;  2RQU A;  3EFO A;  2BZX A;  5LJ5 h;  4BB7 A;  1JXM A;  1Z9Q A;  2CUD A;  2ECZ A;  3M56 A;  1KK7 A;  2A0F B;  4PJO B;  3M54 A;  1OV3 A;  2XIC A;  1VQ7 Q;  1ZSZ C;  2P4T A;  2KSS A;  3BFM A;  1OU8 A;  1FWZ A;  4L5G A;  4RTV A;  4IIO A;  1C6V X;  2NUZ A;  3PNW C;  2JM8 A;  3VS6 A;  2NUP B;  4N0A A;  2OI3 A;  1VQ8 A;  2DZ9 A;  1BI0 A;  1K0X A;  3NPF A;  2MCN A;  2CZ7 B;  5J3B A;  1A0N B;  1VQP T;  2EYQ A;  2QAZ A;  2Z0W A;  2GTO A;  3CCS T;  2SEM A;  3CQT A;  1AWJ A;  2CRE A;  2XHC A;  5KYX B;  1I8F A;  2V1Q A;  3O5Z A;  4ANJ A;  4EMK C;  5KYY B;  2E10 A;  3LGF A;  3VKI A;  4C8Q C;  3H0I A;  1G8X A;  1RLQ C;  3L2V A;  4F7U F;  2DTI A;  5GAN 3;  4M7A D;  2DET A;  4JJN K;  2JN0 A;  3PFS A;  3X26 B;  3M57 A;  4C92 E;  5GAN h;  2LQN A;  2YDL A;  4HCK A;  2OJ2 A;  4BAC A;  2CH4 A;  4QKU A;  3JCM h;  1PC0 A;  2LCS A;  3EG3 A;  5FU7 C;  2OTJ T;  3CCR A;  4AMC A;  5FRM A;  1RAC B;  3KUF A;  3VRY A;  4OB2 B;  5GMK l;  2LCL A;  2P0K A;  3CMA T;  2DFU A;  1GFD A;  3GP8 A;  4KUD K;  3LWI A;  2VXE A;  1IGU A;  2E6Z A;  1LPL A;  1PG5 B;  1QKX A;  4ORZ A;  3VS4 A;  1PD0 A;  3CCV A;  2QQA A;  2E3H A;  5GAO q;  1YJN Q;  3PTA A;  1VQM A;  1WQW A;  5GAO n;  4MMK A;  1YCS B;  1R77 A;  4HKE A;  3OMG A;  1NPR A;  1VQL T;  2K7A A;  1U5S A;  3E1S A;  4B6M A;  1ZBJ A;  2K4Y A;  2KMT A;  1KD1 C;  1ABO A;  2CP7 A;  4PJL A;  2RI3 A;  3CC7 T;  3M4Y A;  2DXC A;  2HQX A;  2LQK A;  3CC4 T;  3JB9 I;  1G3S A;  1M3C A;  2DER A;  4LDW A;  2EIF A;  3ZBD A;  4HA8 A;  4DEX A;  1Y0M A;  4EIK A;  2RHZ A;  2HNI A;  3AT1 B;  4PK4 A;  4JDS A;  3VS2 A;  4N4H A;  2LTO A;  3SWN B;  3X24 B;  2K5F A;  2YRD A;  3C94 A;  2K5L A;  3QBY A;  4M75 C;  4TVR A;  3JCM c;  2QGF B;  4LD6 A;  4C0F A;  3CC2 A;  1MUZ A;  4M7A E;  1ZBX A;  1ZLM A;  3NTH A;  1OZ3 A;  3CD6 A;  4M7D C;  2E5K A;  4M78 E;  1QW1 A;  1V29 B;  1YJ9 T;  3MET A;  3CCM A;  2EGA A;  1ZA2 B;  2KXC A;  2O4X A;  2EYY A;  1VQ5 A;  1GRI A;  2FPF A;  1Y07 A;  2J06 A;  1OPK A;  4GLK A;  1KD1 R;  1XTD A;  1HD3 A;  2COW A;  3L2Q A;  1VUB A;  2OAU A;  1QWF A;  3FRN A;  4LDU A;  5KYN A;  2FL7 A;  1MHN A;  2GQI A;  2DBK A;  1M9S A;  1AD5 A;  2BKD N;  1NBE B;  4J9E A;  4RUG A;  2OTL A;  4A4K A;  3A8H B;  1X6G A;  2YUN A;  1M1K R;  3OW2 S;  4A63 B;  4PJO C;  3JB9 D;  1VQK T;  3QJY A;  1ZSZ A;  1AZG B;  1KQS S;  5LJ3 h;  2RHX A;  1OYX A;  3FJ5 A;  1R0C B;  3RNJ A;  1NPP A;  5GAN j;  3JCM X;  4RTZ A;  1JJ2 S;  3A5Z B;  1M4Z A;  2AZS A;  2PVG B;  1VIE A;  1MV3 A;  1M3B A;  1IGQ A;  5GAN 5;  1X01 A;  4E6R A;  5CKH A;  5GAO l;  2BE9 B;  2YWW A;  3LX7 A;  4F14 A;  4OML A;  4E7H A;  4ZTJ A;  3EG1 A;  4C5E A;  3H0F A;  4EMK A;  2MPX C;  1YNZ A;  3P8D A;  1D09 B;  4M78 B;  1T0H A;  2C0O A;  4QQG A;  3JCM V;  2DXT A;  4C8Q A;  1D1B A;  2LDM A;  1WHH A;  5DLO A;  3OY9 A;  2FZC B;  4Z89 A;  1TUD A;  3F70 A;  3RKX A;  4EMH A;  2DL7 A;  4XU3 A;  1YJW Q;  2RB6 A;  5KYW B;  1K8A C;  2A36 A;  5KCO A;  1JEG A;  1HK9 A;  4D8K A;  3JB9 G;  3OYJ A;  1NEB A;  1G3Y A;  2MI6 A;  2KT1 A;  4C0Z A;  1UDL A;  4DOW A;  2G3R A;  3OYI A;  4L6V 5;  1VQO Q;  1U1S A;  3R6O A;  5I22 A;  5GAN f;  4X34 A;  2CT4 A;  3JCM f;  5EC7 A;  1OX9 A;  2DIQ A;  2P84 A;  3TRE A;  4EMG A;  2CS7 A;  1OPL A;  2F2W A;  3DKM A;  2B8A A;  1AWW A;  2FPD A;  3C12 A;  3G7Z A;  3SB2 A;  3E2U A;  3H8Z A;  3EFS A;  1UUE A;  2DD4 A;  4DOV A;  1MNE A;  2K3X A;  2L3S A;  5CKB A;  4OB0 B;  2ROT A;  2YUO A;  3PGG A;  2KGT A;  2LRQ A;  3MKD A;  3H9N A;  1K8A R;  2ESW A;  5GAM d;  3CCL T;  2CH4 W;  4NOY A;  2HBW A;  4M77 A;  5LJ5 d;  3JB9 J;  2L3R A;  2DVJ A;  1TXQ A;  4J7F A;  4KUL A;  2L3P A;  3EH1 A;  1E6H A;  4LDV A;  2IIM A;  2E41 A;  4J9F A;  2RO0 A;  1Q7Y C;  3SWN C;  4BE0 A;  4M75 A;  1PCX A;  2IG0 A;  4C8Q G;  4A4G A;  3RMQ A;  2AZV A;  3G4S T;  5AYF A;  2LJ3 A;  4M7D A;  5LJ3 j;  3S6W A;  2DZC A;  1YWO A;  2MWP A;  1VQ9 A;  5GAM g;  1K8A U;  1PM3 A;  5D7U A;  5LJ5 g;  1UEB A;  1YIT T;  1CKB A;  3OS2 A;  2LNH B;  3URG A;  5I2M A;  2EW3 A;  3UT1 A;  4J8O A;  5J26 A;  4XTU A;  1ZHI A;  4B9W A;  4JZ4 A;  3HHT B;  5C0M A;  2A28 A;  2PTK A;  2DTO A;  3X28 B;  1VQ8 Q;  4PJO A;  2LNV A;  2FRW A;  2D0Q B;  3CCJ T;  1Q7Y R;  4WTO B;  2ZPG B;  4Z02 A;  4N0A C;  1UFF A;  1WLP B;  3JB9 H;  3G6E Q;  1UTI A;  3CBP A;  9ATC B;  4JS4 A;  1PD1 A;  4E7I A;  4IUR A;  4ESR A;  1QVF P;  1XJW B;  2A37 A;  4BE1 A;  4QVC A;  2NUP A;  2YHT A;  4OMF B;  3LYI A;  4AFQ C;  2DEU A;  3VUB A;  1I81 A;  4QVZ A;  2PQW A;  2RJC A;  2R57 A;  4QW2 A;  5LJ3 f;  2DEQ A;  1LCK A;  3V8L A;  1PSE A;  1X6B A;  3JB9 F;  1JU5 C;  3I55 T;  1LJO A;  4IUV A;  3FJP A;  2HZY A;  3TQ7 P;  1YN8 A;  1K73 C;  3VS7 A;  1HJD A;  1BI1 A;  1YIJ A;  5KYY A;  4M78 C;  2Y4Y A;  2EYZ A;  5GAN g;  5GAM e;  2BZY A;  1PKS A;  1BIA A;  1GFC A;  3QSU A;  1YHQ Q;  3JCM g;  5LJ5 e;  2F5K A;  1X27 A;  4LDY A;  4ZN1 A;  3QKJ A;  4M7D G;  4ZN3 A;  1PRL C;  1YJW A;  4AT1 B;  4WF2 A;  1Q86 C;  4ZNX A;  2RN8 A;  2DL5 A;  1KQ1 A;  1FMW A;  3RKW A;  2DJZ A;  1WYX A;  4FM4 B;  1M90 U;  1R0B G;  4XU1 A;  4RMO A;  2EYW A;  3CCQ A;  1WNL A;  1VQ6 Q;  3I5R A;  1VQ4 T;  4LNP A;  5CO7 A;  2M0O A;  1VQO A;  2JTF A;  3BDU A;  1TSF A;  3GNG A;  3EG2 A;  3SHW A;  1RI9 A;  2LCC A;  1V76 A;  2KR3 A;  1K73 R;  4PJO G;  3BW1 A;  4II1 A;  4JUV A;  1TOV A;  4F7U E;  3SD4 A;  2RQV A;  4M77 B;  4C8Q F;  5GAN 7;  3H0H A;  1O75 A;  1JB0 E;  1PWT A;  4OVA A;  3A8M B;  2RQW A;  2AIR B;  3V8K A;  3RIR A;  3PVL A;  3T9N A;  2L5Q A;  3M59 A;  4IUP A;  2K5I A;  1KSW A;  1VIF A;  4J6Y A;  5GAN e;  4PJJ A;  1Q86 R;  1W2B P;  5GAO r;  3JV3 A;  3GPL A;  3JCM e;  3CD6 Q;  3EHQ A;  2CP6 A;  2HSE B;  1Y7X A;  3SWN A;  2MYS A;  4JPB W;  2KDS A;  4JLG A;  3CCM Q;  3TU4 K;  1N8R R;  2E4H A;  4C92 A;  3M0P A;  3MPU B;  2QDY B;  2CGH A;  1QP2 A;  2XI9 A;  1RL2 A;  2GFA A;  3UF4 A;  1S72 T;  4C5H A;  4E47 A;  4XTZ A;  5A0D A;  5CKF A;  3I56 T;  1NZ9 A;  1VQN T;  2DRK A;  1VYU A;  3ZL7 C;  1B7T A;  4XAX B;  3FB9 A;  5L8R E;  1C1A A;  2HDA A;  2CYZ B;  5FWB A;  1F1B B;  1GCP A;  1X2K A;  4OP0 A;  4BE2 A;  5J39 A;  2LJ0 A;  5LJ3 g;  1G5V A;  1G83 A;  4HVV A;  1ZUY A;  5L23 A;  3FDR A;  3HFO A;  5CK9 A;  3E9F A;  2QQR A;  3GNF B;  4BY6 B;  1JO8 A;  3GLX A;  3HL8 A;  3UA7 A;  4OMM A;  4B9X A;  1FX7 A;  4AFZ C;  2XKO C;  2YRV A;  3SEM A;  5IAY A;  4E7J A;  2A3L A;  3L2W A;  2GQV A;  3CME T;  3G6E A;  2QA4 T;  1I5L A;  3EHR A;  3EGU A;  3ZFJ A;  2EYX A;  4M7D F;  2BZ8 A;  4QQ6 A;  1SRM A;  3J80 E;  1Q81 C;  1D1A A;  4KH1 B;  5FRO A;  1U8R A;  4FSS A;  1VQL Q;  4M78 A;  4RTW A;  3M53 A;  1I1J A;  2K6D A;  2LC4 A;  4DBF A;  1VQ7 T;  2L2P A;  2K9G A;  1M27 C;  3E9G A;  4AFU C;  2NYS A;  2O9V A;  4LE9 A;  2H3E B;  4PJO F;  2EVR A;  2GTJ A;  5KYW A;  2M0Y A;  5CKE A;  1YHQ A;  1CKA A;  2RK1 A;  2ED0 A;  1JRI A;  1QLY A;  4FYW B;  2ZAE A;  1WHG A;  2KYM A;  5LJ3 e;  2BUD A;  1M5Q 1;  3RDV A;  1H3Z A;  2O31 A;  2RHY A;  3QWX X;  5CAI A;  5LL6 S;  3GOX A;  2M51 A;  3H41 A;  2RI5 A;  2RM4 A;  2VYT A;  4J9H A;  5GAN 6;  1Y96 B;  2EJ9 A;  2EBP A;  1Q81 R;  1VQ6 A;  1Q82 C;  4BDY A;  4PFP A;  2FB7 A;  2JOY A;  4KGZ B;  3CXC P;  3JCM P;  5GMK m;  2EWN A;  2CSQ A;  1YJ9 Q;  1YI2 T;  4XTV A;  2VGN A;  2HBP A;  4HVW A;  1PHT A;  3LWH A;  3QJ6 A;  3BE3 A;  1KC8 C;  4M77 C;  1IO6 A;  2CP3 A;  2DK3 A;  1B3Q A;  3IQL A;  1X2Q A;  4GLM A;  2HAX A;  4OGC A;  3QZ5 B;  1M1K C;  5GAM j;  3OBY A;  1QVF A;  4RG8 A;  1ZUK A;  4ATO A;  5LJ5 j;  4C92 B;  5GMK i;  4F16 A;  3CCE A;  1SRL A;  2RHI A;  4FIB A;  1KFZ A;  3OSS C;  3RMS A;  1UEC A;  1TG0 A;  1VQ9 Q;  3CPW P;  2EQM A;  1QCF A;  1YJN T;  1BI3 A;  1Q82 R;  5FLX E;  1X69 A;  1AEY A;  1M3A A;  2E6N A;  2LVM A;  4VUB A;  1W70 A;  1WHK A;  4M4Z A;  4XU0 A;  2L0A A;  2GF7 A;  2OX7 A;  1K76 A;  2CZ1 B;  2ZGW A;  4CC2 A;  1LVK A;  2JJ9 A;  1NLP C;  2YUQ A;  1VYV A;  4D6W A;  1KC8 R;  2PU9 B;  2F69 A;  2K57 A;  2AK5 A;  1VQP A;  4RG2 A;  3CBO A;  2KI7 A;  2VVK A;  4JRK A;  1UB4 A;  4RKU E;  3OYF A;  3CCS A;  2M02 A;  1XOV A;  2VUB A;  1TH7 A;  3CPF A;  2KBT A;  4FW1 A;  1SEM A;  3EG0 A;  3VRZ A;  5GAM f;  1T0J A;  4RTY A;  2J6F A;  4NL2 A;  2DIG A;  1WDX A;  2F2V A;  5LJ5 f;  3I5S A;  1KG1 A;  4YTL A;  2KK4 A;  2LQW A;  4BY6 C;  2K79 A;  4HCZ A;  3MHX A;  3V8J A;  4D8D A;  2SRC A;  2IVW A;  3JCM Q;  3P8H A;  5KE3 A;  5GMK h;  3V7R A;  3FLG A;  1KD1 U;  4F04 B;  1M2O A;  2PVD B;  4IUT A;  1N27 A;  2HEQ A;  2KRM A;  4V2S A;  4OB3 B;  2R58 A;  1YIJ Q;  4ZGE B;  1EIF A;  2D1X A;  4M7A B;  2OTJ A;  5IHK A;  3EFR A;  4FW2 A;  4C0D B;  3EH2 A;  5HCK A;  3CMA A;  1M1K U;  4CC3 A;  1IZ6 A;  1UJY A;  2DL4 A;  2QGG A;  5M9O A;  1QKW A;  1KQ2 A;  2EAY A;  4OB1 B;  2HKN A;  2RQT A;  2VXF A;  5D6W A;  1Y71 A;  2K3Y A;  1WHL A;  2F1L A;  1W2B A;  2FHD A;  1H92 A;  2HSP A;  2XG8 D;  2LT1 A;  5HKC A;  3C95 A;  5GAO m;  1VQL A;  1Q95 G;  2VWF A;  4R0K A;  1ZA1 B;  3NGP A;  1T3S A;  3CCQ Q;  4C8Q D;  3CCL Q;  4J83 A;  3S3N A;  4NS5 A;  2HL3 A;  1H3H A;  3THK A;  1MND A;  3CC7 A;  1PNJ A;  2OAW A;  1HXD A;  4PLL A;  1R8O B;  3EG9 A;  3CC4 A;  4QVD A;  1N9R A;  2DD5 A;  2RNA A;  2LP5 A;  1E7O A;  2DRM A;  2DYI A;  1IRE B;  1AWX A;  2W0Z A;  4OMO A;  3CCU T;  1D0Y A;  2QYZ A;  2QTV A;  3M9Q A;  4ZGD B;  3UPU A;  3G71 T;  4FCY A;  1UGV A;  5FW9 A;  4C5I A;  2DF6 A;  4BDZ A;  2MIO A;  4BI8 B;  1ACM B;  2QTX A;  3PMT A;  2MF2 A;  3G4S Q;  1LNX A;  1RI0 A;  5DLQ E;  2MK5 A;  3VS0 A;  4IIM A;  3OS1 A;  1AVZ C;  1N5Z A;  3QO3 A;  2JNG A;  3HRT A;  5HY6 A;  2COY A;  1YJ9 A;  1SSF A;  4Z88 A;  1YIT Q;  4A4F A;  3GF5 A;  2JVV A;  2O88 A;  1WA7 A;  4KRT A;  1JXO A;  5FWC A;  2YSQ A;  1IB8 A;  2V8I A;  4FU6 A;  1U06 A;  4C92 C;  3QYG B;  1MMA A;  1O9S A;  2DJQ A;  3CCJ Q;  1BCM A;  4RTX A;  5ECA A;  1VQK A;  1T3L A;  2GGR A;  2O01 E;  1PRM C;  4XTX A;  1CSK A;  1WHM A;  2F2X A;  4JRP A;  4RCC A;  4Y92 A;  1RAA B;  2FEI A;  3L2U A;  2CP0 A;  5AT1 B;  2XDP A;  2P0P A;  3ZEH A;  3INZ A;  4C8Q E;  5GMK j;  1NJI C;  3UA6 A;  4M75 D;  1QMC A;  4Y28 E;  3ME9 A;  4ZGJ B;  3RBB B;  5KCH A;  3M5A A;  2I2L A;  2D8J A;  2CP5 A;  1SSH A;  4BD3 A;  2J05 A;  3BDL A;  5GAN 8;  4J6W A;  4M7D D;  1UHF A;  4F17 A;  5A0G A;  2K3B A;  4F7U A;  1SHF A;  2D8H A;  3TVT A;  1YP5 A;  3MEA A;  2DA9 A;  4OF1 A;  3A1P A;  2X4X A;  3OYM A;  1MGQ A;  3HTR A;  4MZM A;  3OYC A;  1XNI A;  1B07 A;  2JW4 A;  3R6N A;  4KUI A;  3OYL A;  2XK0 A;  2QEX T;  3RKY A;  2JXB A;  3RER A;  2X9H A;  2CP2 A;  2AKK A;  3EAE A;  2LX7 A;  4PJM A;  1UGS B;  4PJO D;  3CXC A;  5GAN 4;  4M77 G;  3FIF A;  2E5Q A;  1NJI R;  3HFN A;  3GIB A;  4JJD A;  1SKU B;  4R55 A;  5HK0 A;  4M7A C;  1VQ4 Q;  1QVF S;  2ZZD A;  4C0D C;  4P5N A;  1UJ0 A;  2R5A A;  1Q7Y U;  4M75 G;  2GCX A;  4J9D A;  4BI3 A;  4ZTF A;  1WX6 A;  2D9T A;  1WZO A;  2DKG A;  3OSV A;  3Q1J A;  2K2M A;  4JJB A;  3L1A A;  4E7Z A;  1H64 1;  3VYH B;  1ABQ A;  1VQ8 T;  1MMN A;  2QQS A;  3QDR B;  2DTH A;  3NTK A;  3HSB A;  1OU9 A;  3EG9 B;  1QVG P;  3CPW A;  2EGE A;  3RES A;  2CZ0 B;  4RCB A;  5IT9 E;  3MEW A;  1UGR B;  3LH0 A;  2KRN A;  4LUD A;  3CCL A;  5DM7 R;  2EFI A;  4X9C A;  1N8R C;  4M7D E;  1HYO A;  1OEB A;  4JLI A;  4K11 A;  3VYG A;  1D3B B;  4L59 A;  3OS0 A;  3LGL A;  2ROL A;  2VAS A;  2DNU A;  1AWO A;  3A8O B;  1Y96 A;  3MCA B;  2CZ6 B;  2BTT A;  4FT4 A;  4JS5 A;  1S72 Q;  3M4G A;  2CDT A;  3G4S A;  2H3J A;  1U3O A;  3MEV A;  1SF9 A;  4PJO E;  1YCY A;  3CCE Q;  1NYF A;  2J6K A;  3CCR T;  1YWP A;  2CUB A;  1VQN Q;  4R56 A;  2EPD A;  1WIE A;  2XMF A;  1S1N A;  4PJN A;  2H8H A;  2ZPF B;  1YIT A;  2QK0 A;  3PE0 A;  1M1F A;  2DLP A;  2KE9 A;  4J9B A;  3CCV T;  1VOM A;  1VQM T;  2NWM A;  4KGV B;  3LLR A;  5IH2 A;  4IUU A;  2O2O A;  3S3O A;  1K73 U;  1D0Z A;  2CSI A;  2KAF A;  2YRC A;  1N6A A;  4J7I A;  2C0T A;  2HL5 C;  1VA7 A;  1BKB A;  2IPO B;  2KYB A;  2RD1 A;  3CCJ A;  1W2B S;  4PLI A;  4CRI A;  4EDU A;  1NM7 A;  5IN1 A;  1VQP Q;  3M0U A;  3MP1 A;  1NLO C;  3M0R A;  4OMN A;  3JRZ A;  2HQE A;  3CCS Q;  1OOT A;  2RMO A;  4WCI A;  1Q86 U;  1K4U S;  3GBQ A;  4F7U B;  3M58 A;  5D6Y A;  3KFV A;  4M77 F;  3WVE B;  1JQQ A;  1N8R U;  2XDB A;  3VS1 A;  2P4R A;  3I55 A;  4DBQ A;  1C0M A;  1B34 A;  1ZUU A;  2C06 A;  3CC2 T;  2XDD A;  4FYV B;  3CD6 T;  1PSF A;  4AG1 C;  5GAN 2;  4M75 F;  1M1G A;  3VS5 A;  1BYM A;  3MJX A;  1N9S A;  3CCM T;  1V1C A;  2OTJ Q;  1VQ5 T;  3MO8 A;  1WI7 A;  2JMC A;  2KT8 A;  2M16 A;  3QII A;  5I21 A;  2D0N A;  3CMA Q;  4DBH A;  2E3I A;  1SG5 A;  1M2V B;  2C0I A;  3ULR B;  3N5B B;  1P92 A;  2LQ8 A;  2KVQ G;  4Q5W A;  4XTY A;  3JCM b;  4M7A A;  2OTL T;  3PIP A;  2KNB B;  2NUT A;  1J3T A;  1VQ4 A;  5KH6 A;  2EJF A;  4C92 G;  2I0N A;  2RJD A;  3V7S A;  2ED1 A;  5HK3 A;  4X9D A;  2AT1 B;  1YI2 Q;  3CC7 Q;  5CQX A;  1MV0 B;  1AOJ A;  4DQ2 A;  2VV5 A;  1TWB A;  3DLM A;  3CC4 Q;  3SFM A;  2JZ2 A;  5KYU A;  1ZX6 A;  1QQJ A;  2FVU A;  5IXF A;  5IHI A;  1HSQ A;  4Z8A A;  4M78 D;  4QT7 A;  1UGP B;  4Y91 A;  2E64 A;  4N4G A;  2E1H A;  3C0C A;  1H8K A;  2HQH A;  2DIL A;  2X4W A;  3JCM W;  3D7S B;  5GMK e;  2DL8 A;  3UDC A;  1EFN A;  4PFO A;  3EGD B;  2LT4 A;  2YXY A;  3OYH A;  1GBQ A;  3QHS A;  2F5T X;  2FZG B;  3OA6 A;  2O9S A;  4HCB A;  2DL3 A;  3QXE B;  2L3Q A;  2K2V A;  3PT9 A;  2JTE A;  2L89 A;  1G3T A;  4HXJ A;  1S72 A;  2M9U A;  1VYT A;  1WJQ A;  5CKD A;  3CXC S;  2ABL A;  3I56 A;  5KE2 A;  1X6O A;  2JUF A;  1VQN A;  1VQK Q;  1WXT A;  4DBR A;  2EJG A;  1NEG A;  5D6X A;  3REA B;  4A4H A;  2QXF A;  1Q81 U;  4M7A G;  3L42 A;  1GCQ A;  4FT2 A;  3ER0 A;  1RAH B;  4M78 G;  1XQH A;  2ATC B;  1K0S A;  2DBM A;  3UAT A;  2EQU A;  4A4E A;  4KT0 E;  2RQR A;  1TU0 B;  1QWE A;  2E65 A;  2PUO B;  4FYY B;  1MMD A;  1OI1 A;  1RUW A;  4O6J A;  3UWN A;  4X1V A;  3RUX A;  1RAB B;  2RPN A;  2X51 A;  2G6F X;  3QZ9 B;  4A53 A;  4LDX A;  3PVQ A;  2JTM A;  3QDF A;  1G3W A;  2V26 A;  3CME A;  2D6F A;  4LN2 A;  3X25 B;  3M0T A;  3OYD A;  3OW2 P;  1WXU A;  1W1F A;  3M55 A;  3CPW S;  2QA4 A;  2VKN A;  3VUZ A;  3EFO B;  3DB3 A;  1YFN A;  3KBG A;  1B34 B;  3RR6 A;  1QVG A;  1KQS P;  1Z9Z A;  3G1J A;  1WPY A;  2EQK A;  2X3W D;  7AT1 B;  4E7K A;  3OMC A;  2LJ1 A;  2RJE A;  4MDW A;  1M8M A;  3NMZ C;  2LMJ A;  4IKF A;  1JJ2 P;  4RTU A;  1I4K 1;  2QDL A;  3A8G B;  1WHJ A;  2DVE A;  1Q82 U;  2VB6 A;  4MML A;  1FMK A;  2X3X D;  1FYN A;  2ENM A;  4C92 F;  5CVI A;  1NE8 A;  3OBW A;  1I0C A;  4JJC A;  2X35 A;  1ZSG A;  5CR2 A;  1VQ9 T;  1VQ7 A;  2EGC A;  2GFU A;  3DLL A;  2WSC E;  2ZPH B;  1KC8 U;  2Y4X A;  2P0Q A;  3DB4 A;  4AFS C;  1FXX A;  2QQ9 A;  3OQ5 A;  2KY9 A;  3HRS A;  2FO0 A;  2NUT B;  1AT1 B;  2YT6 A;  8AT1 B;  4DA4 A;  3CCU Q;  3X20 B;  1M8V A;  2YLB A;  5A2Q E;  2X4Y A;  4RTT A;  5FRN A;  3OYG A;  1PKT A;  3G71 Q;  2RA2 A;  1IHW A;  2KRS A;  3A8L B;  2E12 A;  2J6O A;  4PL6 A;  4MZT A;  3U23 A;  1OZ2 A;  5KYU B;  2ZPE B;  1ZQ1 A;  5IXB A;  2CT3 A;  3QWY A;  4PNO A;  2FPE A;  2BE7 D;  2LX9 A;  5DY9 A;  2KQW A;  2PUK B;  1YI2 A;  1M30 A;  1UHC A;  5A0L A;  2COZ A;  5EG2 A;  4XK8 E;  4HVU A;  2V1R A;  3OYN A;  2AKL A;  4XU2 A;  2YUP A;  3H6Z A;  3TSW A;  4FYX B;  2QG9 B;  2WSF E;  3SDZ A;  1YIJ T;  1QVP A;  2WAC A;  1GL5 A;  3MEU A;  1D3B A;  4J6X A;  1QP3 A;  1RAD B;  4AG2 C;  1BCO A;  3OYB A;  5IHN A;  2HCK A;  4M7A F;  2MAM A;  3OYA A;  3WVD B;  3QPH A;  2PZ1 A;  4M78 F;  1RAF B;  2L8D A;  4KGX B;  1LOJ A;  1X75 C;  3QYH B;  4ELY C;  1YJN A;  1YJW T;  3VS3 A;  3C4S A;  1X43 A;  4LUE A;  4JRQ A;  1BBZ A;  1KIK A;  3MP6 A;  2JS0 A;  1U1T A;  4XQ3 A;  2EKO A;  2KXD A;  4BUG A;  2DPP B;  2RJF A;  2EQJ A;  3VJP A;  5CIU A;  3OS5 A;  4ME7 A;  2XD0 A;  3LH5 A;  4NL3 A;  4J9G A;  3CCQ T;  1FMV A;  4DEY A;  3ASK A;  1VQO T;  2RH2 A;  4GBQ A;  5C6S A;  1KHC A;  2DMO A;  2MOX A;  4M77 D;  3EGX A;  2RF0 A;  1I07 A;  1IRX A;  2GBQ A;  2FZK B;  1NYG A;  2QEX Q;  4UC4 A;  1KHI A;  1NG2 A;  2PVO B;  3KXT A;  1JBM A;  2HMA A;  2JS2 A;  2FRY A;  2QI2 A;  1UE9 A;  2O4X B;  1RAG B;  3PIO A;  1W6X A;  4E7S A;  4C0G A;  5FU6 B;  2JMA A;  1WQ7 A;  2EKH A;  3PMI A;  2ZPB B;  1BB9 A;  3HPW A;  2HKQ B;  3I55 Q;  1K9A A;  2PNI A;  2FYK A;  4OGE A;  1K1Z A;  2YLC A;  6AT1 B;  1YBY A;  2E70 A;  1M90 C;  1OQK A;  2WSE E;  4A54 A;  3S3M A;  2NLU A;  2V8K A;  1ZSZ B;  3FC3 A;  2KEA A;  2AHJ B;  4J9I A;  2BIV A;  2RHU A;  3O8V A;  3V7C A;  2DAQ A; 
#chains in the Genus database with same CATH homology
 1N6A A;  3MP8 A;  4J7I A;  2FB7 A;  2JOY A;  5CCA A;  3F70 A;  3RKX A;  4EMH A;  2RD1 A;  1BKB A;  1WGS A;  4XU3 A;  3CCJ A;  1W2B S;  4PLI A;  4CRI A;  4EDU A;  5GMK m;  2EWN A;  3JCM P;  2A7Y A;  2RB6 A;  5GAN d;  1YI2 T;  1K8A C;  4XTV A;  1BIB A;  2VGN A;  5IN1 A;  2HBP A;  4C5G A;  5KCO A;  3MP1 A;  3NFC A;  3QJ6 A;  3JCM d;  3LWH A;  3TCJ A;  1HK9 A;  4M77 C;  1KC8 C;  3JRZ A;  2HQE A;  2DK3 A;  3OYY A;  3CBM A;  3JB9 G;  3OYJ A;  2ZCF B;  2HAX A;  4OGC A;  1G3Y A;  2MI6 A;  4IUQ A;  1Q86 U;  3QZ5 B;  4C0Z A;  4DOW A;  4BDY A;  1M1K C;  2G3R A;  5GAM j;  3OBY A;  3OYI A;  1QVF A;  4F7U B;  4L6V 5;  4RG8 A;  3M58 A;  1K9M C;  1WJS A;  4ATO A;  1U1S A;  4EMK B;  5LJ5 j;  3R6O A;  5GAN f;  4C92 B;  5GMK i;  4X34 A;  1W4S A;  3L2Z A;  5D6Y A;  3CCE A;  3E19 A;  4M77 F;  3WVE B;  5I2S A;  4M77 E;  4C8Q B;  1N8R U;  2XDB A;  4O5V A;  3JCM f;  3CCU A;  2DIQ A;  3I55 A;  4HCC A;  2RHI A;  1B34 A;  3TRE A;  4EMG A;  2CS7 A;  4FIB A;  3CEY A;  4PKC C;  3OSS C;  3RMS A;  2C06 A;  3DKM A;  3CC2 T;  2M1H A;  2XDD A;  4FSX A;  2B8A A;  3L2R A;  3G71 A;  3OYK A;  3CD6 T;  1PSF A;  3QG1 A;  3C12 A;  3G7Z A;  3J7A F;  2EQM A;  3SB2 A;  3H8Z A;  4M75 F;  5GAN 2;  1YJN T;  1M1G A;  3EFS A;  1BI3 A;  1BYM A;  4M75 E;  5FLX E;  1N9S A;  2DD4 A;  4DOV A;  1UGQ B;  2E6N A;  2LVM A;  4VUB A;  3G6E T;  3CCM T;  1YJW T;  2K3X A;  4XU0 A;  5CKB A;  4OB0 B;  1VQ5 T;  3MO8 A;  3TEE A;  2GF7 A;  2R5M A;  2XID A;  2M16 A;  3PGG A;  3QII A;  5I21 A;  2QQB A;  2HD0 A;  2CZ1 B;  2LRQ A;  1NJI U;  2DXB A;  2ZGW A;  3FEO A;  5FU7 B;  3LW5 E;  5GAM d;  3CCL T;  4D6W A;  2DO3 A;  3N5B B;  2PU9 B;  4NOY A;  2F69 A;  1P92 A;  4M77 A;  5LJ5 d;  3JB9 J;  2K57 A;  2ZPI B;  4ELZ C;  2LQ8 A;  2KVQ G;  2L3R A;  4Q5W A;  4XTY A;  4J7F A;  1VQP A;  4RG2 A;  3JCM b;  4LD9 K;  4KUL A;  3CBO A;  4M7A A;  2OTL T;  4FL6 A;  4JRK A;  1UB4 A;  3PIP A;  4RKU E;  4LDV A;  3OYF A;  3CCS A;  2E41 A;  1WJR A;  1QVG S;  3OW2 A;  1XOV A;  2RO0 A;  2VUB A;  3P8B B;  4F7U G;  1Q7Y C;  1TH7 A;  3CPF A;  3QUI A;  1AHJ B;  2VC8 A;  3OB9 A;  4BI4 A;  3SWN C;  4BE0 A;  5GAO p;  2MWO A;  1VQ4 A;  5KH6 A;  2EJF A;  4M75 A;  4C92 G;  4J5Y A;  5GAM f;  2XU8 A;  2RJD A;  2IG0 A;  3V7S A;  5HK3 A;  1KQS A;  4HT9 A;  4C8Q G;  4NL2 A;  2DIG A;  5LJ5 f;  4X9D A;  4A4G A;  4MZP A;  3RMQ A;  3HSB A;  1KG1 A;  5CQX A;  3BY7 A;  4YTL A;  4DQ2 A;  3G4S T;  2KK4 A;  5AYF A;  2VV5 A;  4BY6 C;  4HCZ A;  3DLM A;  4M7D A;  2RI2 A;  3MHX A;  3V8J A;  1YHQ T;  4N4I A;  3SFM A;  2IVW A;  3S6W A;  5LJ3 j;  2JZ2 A;  3JCM Q;  3P8H A;  2DZC A;  5KE3 A;  5GMK h;  1BI2 A;  3JAM E;  3V7R A;  3OYE A;  1JJ2 A;  3FLG A;  3AHU A;  1KD1 U;  2FVU A;  2MWP A;  4XTW A;  2PVD B;  4IUT A;  4E7L A;  1N27 A;  1VQ9 A;  5GAM g;  4M78 D;  1K8A U;  2MMP A;  1UGP B;  4Y91 A;  4GY5 A;  4V2S A;  3HKS A;  2E64 A;  1UEB A;  2E1H A;  4N4G A;  2R58 A;  4OB3 B;  4ZGE B;  5LJ5 g;  1YIT T;  2X4W A;  1EIF A;  4M7A B;  3URG A;  3OS2 A;  2OTJ A;  5I2M A;  3UT1 A;  3JCM W;  4J8O A;  5J26 A;  4EPC A;  5GMK e;  2VGM A;  4XTU A;  2Y90 A;  3EFR A;  3VU3 C;  2CKK A;  4C0D B;  3HRU A;  1ZHI A;  3UDC A;  4B9W A;  1M1K U;  3CMA A;  3HHT B;  1IZ6 A;  5C0M A;  4M75 B;  2LT4 A;  2DXU A;  5M9O A;  1K9M U;  1VQ6 T;  1KQ2 A;  2EAY A;  3OYH A;  4OB1 B;  3VV0 A;  2DTO A;  3X28 B;  4PJO A;  2VXF A;  4KBM B;  5D6W A;  1Q81 U;  1DJ7 B;  3QHS A;  4M7A G;  1Y71 A;  2F5T X;  2K3Y A;  2LNV A;  3J81 E;  1GXI E;  2D0Q B;  3OA6 A;  3CCJ T;  1W2B A;  2FHD A;  2ZPG B;  4QQD A;  4HCB A;  4Z02 A;  2XG8 D;  4N0A C;  3WXM B;  4DA4 A;  4M7D B;  3JB9 H;  5LJ3 d;  2X4J A;  2LT1 A;  5HKC A;  3JSC A;  3QXE B;  3C95 A;  5GAO m;  4MDX A;  3CBP A;  1VQL A;  4JS4 A;  2K2V A;  3PT9 A;  3NTI A;  4E7I A;  4IUR A;  4HT8 A;  4C92 D;  2QEX A;  4BE1 A;  2L89 A;  1G3T A;  4QVC A;  1S72 A;  2M9U A;  4C8Q D;  3S3N A;  4J83 A;  2YHT A;  4OMF B;  4NS5 A;  3LYI A;  3VUB A;  1I81 A;  1WJQ A;  4QVZ A;  5CKD A;  3CC7 A;  2PQW A;  2RJC A;  5FU6 C;  1HXD A;  4PLL A;  1R8O B;  3CXC S;  5CQY A;  3JCM J;  2V8J A;  3I56 A;  5KE2 A;  2RK2 A;  1X6O A;  2R57 A;  1N9R A;  4JRI A;  2DD5 A;  4QW2 A;  4QVD A;  2JUF A;  5LJ3 f;  2DEQ A;  3HP9 A;  3CCE T;  5GAM h;  3V8L A;  4CI0 C;  1VQN A;  1IRE B;  1PSE A;  3JB9 F;  3CCU T;  2EJG A;  5LJ5 h;  3I55 T;  5D6X A;  1LJO A;  2QXF A;  4A4H A;  3FJP A;  3M56 A;  3M9Q A;  3L42 A;  4FT2 A;  4IUV A;  4BB7 A;  4ZGD B;  3UPU A;  1K73 C;  4PJO B;  3ER0 A;  1BI1 A;  3M54 A;  3G71 T;  1YIJ A;  4M78 G;  1XQH A;  2XIC A;  4M78 C;  4C5I A;  4BDZ A;  2Y4Y A;  4BI8 B;  5GAN g;  2QTX A;  2P4T A;  2MF2 A;  3PMT A;  2KSS A;  2EQU A;  4A4E A;  3BFM A;  1LNX A;  5GAM e;  1RI0 A;  4KT0 E;  5DLQ E;  1BIA A;  1FWZ A;  2E65 A;  3QSU A;  2PUO B;  4L5G A;  3JCM g;  1OI1 A;  5LJ5 e;  4O6J A;  3UWN A;  2F5K A;  4LDY A;  3PNW C;  3OS1 A;  4ZN1 A;  3RUX A;  3QO3 A;  2JNG A;  3HRT A;  4N0A A;  5HY6 A;  3QKJ A;  1VQ8 A;  4M7D G;  4ZN3 A;  2DZ9 A;  4A53 A;  3QZ9 B;  4LDX A;  1BI0 A;  2JTM A;  1YJW A;  1YJ9 A;  1SSF A;  1G3W A;  4A4F A;  3CME A;  2D6F A;  3X25 B;  3GF5 A;  3OYD A;  2CZ7 B;  5J3B A;  4WF2 A;  2JVV A;  3CPW S;  3M55 A;  1Q86 C;  2QA4 A;  1VQP T;  3VUZ A;  2EYQ A;  1KQ1 A;  3RKW A;  2DJZ A;  3DB3 A;  3KBG A;  1B34 B;  3CCS T;  1QVG A;  4FM4 B;  1M90 U;  4XU1 A;  4RMO A;  2XHC A;  1WPY A;  1I8F A;  3CCQ A;  1WNL A;  2EQK A;  2V8I A;  4FU6 A;  4EMK C;  4E7K A;  1VQ4 T;  4C92 C;  2E10 A;  3OMC A;  2M0O A;  3LGF A;  3QYG B;  2RJE A;  2JTF A;  3BDU A;  5CO7 A;  3VKI A;  3GNG A;  4MDW A;  1VQO A;  1O9S A;  4C8Q C;  4IKF A;  1I4K 1;  3A8G B;  2LCC A;  2DVE A;  3L2V A;  1Q82 U;  4PJO G;  3BW1 A;  1VQK A;  4II1 A;  4JUV A;  4F7U F;  2DTI A;  2O01 E;  4MML A;  5GAN 3;  4F7U E;  3SD4 A;  4M7A D;  4XTX A;  4JJN K;  4JRP A;  2JN0 A;  3PFS A;  3X26 B;  4C92 F;  5CVI A;  1NE8 A;  3OBW A;  4RCC A;  3M57 A;  4C92 E;  2X35 A;  5GAN h;  4M77 B;  3L2U A;  4C8Q F;  5CR2 A;  1VQ9 T;  1VQ7 A;  2GFU A;  2P0P A;  2WSC E;  2XDP A;  3INZ A;  3ZEH A;  4C8Q E;  2ZPH B;  5GMK j;  5GAN 7;  1NJI C;  4M75 D;  3JCM h;  1KC8 U;  2Y4X A;  2P0Q A;  3DB4 A;  4Y28 E;  1O75 A;  1FXX A;  2QQ9 A;  3OQ5 A;  3ME9 A;  1JB0 E;  4ZGJ B;  5KCH A;  4OVA A;  2KY9 A;  3A8M B;  3M5A A;  5FU7 C;  2OTJ T;  2I2L A;  3CCR A;  3V8K A;  3HRS A;  3RIR A;  3T9N A;  4BD3 A;  2L5Q A;  3M59 A;  3BDL A;  5FRM A;  3KUF A;  4IUP A;  5GAN 8;  2K5I A;  4OB2 B;  4J6Y A;  1VIF A;  3X20 B;  2LCL A;  2P0K A;  2YLB A;  4J6W A;  5GAN e;  5GMK l;  3CMA T;  4M7D D;  1M8V A;  3GP8 A;  1YJN A;  5A2Q E;  4KUD K;  2X4Y A;  2VXE A;  3LWI A;  5GAO r;  2E6Z A;  5FRN A;  3GPL A;  3JCM e;  3OYG A;  5A0G A;  2RA2 A;  3A8L B;  3CCV A;  2QQA A;  4F7U A;  5GAO q;  1Y7X A;  3PTA A;  2E12 A;  1VQM A;  4PL6 A;  3MEA A;  3SWN A;  1WQW A;  4MZT A;  2KDS A;  4JLG A;  5GAO n;  1OZ2 A;  3TU4 K;  4MMK A;  4OF1 A;  4C92 A;  2X4X A;  2ZPE B;  4HKE A;  1MGQ A;  3OYM A;  1ZQ1 A;  3OMG A;  1NPR A;  3CC4 A;  4MZM A;  2QDY B;  3OYC A;  1VQL T;  2CGH A;  1QP2 A;  1XNI A;  2XI9 A;  1RL2 A;  4KUI A;  3OYL A;  2XK0 A;  4PNO A;  2QEX T;  3E1S A;  3RKY A;  2GFA A;  2LX9 A;  5DY9 A;  2KQW A;  3RER A;  1S72 T;  2PUK B;  2K4Y A;  2KMT A;  1KD1 C;  4C5H A;  4E47 A;  4XTZ A;  1YI2 A;  5A0D A;  3EAE A;  2RI3 A;  5A0L A;  1UGS B;  3CC7 T;  4PJO D;  3M4Y A;  2DXC A;  5CKF A;  5EG2 A;  4XK8 E;  5GAN 4;  3CXC A;  2HQX A;  2LQK A;  3I56 T;  3CC4 T;  3OYN A;  4M77 G;  3FIF A;  2E5Q A;  1NZ9 A;  4XU2 A;  3HFN A;  3GIB A;  1VQN T;  3JB9 I;  1G3S A;  4LDW A;  2EIF A;  4R55 A;  3ZBD A;  3H6Z A;  4XAX B;  5HK0 A;  3FB9 A;  4HA8 A;  5L8R E;  4M7A C;  2RHZ A;  2HNI A;  1QVF S;  4JDS A;  2WSF E;  2ZZD A;  2CYZ B;  4C0D C;  4P5N A;  4N4H A;  2LTO A;  4OP0 A;  3SDZ A;  3SWN B;  1QVP A;  4BE2 A;  2WAC A;  2R5A A;  3X24 B;  1YIJ T;  5J39 A;  2K5F A;  3C94 A;  1Q7Y U;  2K5L A;  3MEU A;  3QBY A;  4M75 G;  2GCX A;  1D3B A;  4M75 C;  5LJ3 g;  4J6X A;  1QP3 A;  4BI3 A;  4ZTF A;  1G5V A;  2D9T A;  4TVR A;  3JCM c;  2DKG A;  3FDR A;  3OSV A;  3HFO A;  3Q1J A;  3OYB A;  4LD6 A;  3L1A A;  4C0F A;  5CK9 A;  4M7A F;  1H64 1;  2QQR A;  3E9F A;  3GNF B;  3VYH B;  4BY6 B;  3CC2 A;  2MAM A;  1ZBX A;  3NTH A;  3OYA A;  4M7A E;  3WVD B;  1OZ3 A;  3QPH A;  3CD6 A;  4M7D C;  3GLX A;  4M78 F;  3HL8 A;  2L8D A;  1VQ8 T;  2QQS A;  1LOJ A;  1X75 C;  4M78 E;  1QW1 A;  3QDR B;  1V29 B;  1FX7 A;  2DTH A;  2XKO C;  3NTK A;  3QYH B;  2YRV A;  4B9X A;  4ELY C;  3DLL A;  5IAY A;  3C4S A;  4E7J A;  1YJ9 T;  3MET A;  2A3L A;  3L2W A;  2GQV A;  3CCM A;  3CME T;  3G6E A;  2O4X A;  4JRQ A;  3CPW A;  1VQ5 A;  3MP6 A;  2QA4 T;  1Y07 A;  3RES A;  1U1T A;  2CZ0 B;  4RCB A;  2EKO A;  4XQ3 A;  4BUG A;  3MEW A;  5IT9 E;  1I5L A;  4GLK A;  1XTD A;  2DPP B;  2RJF A;  1UGR B;  2EQJ A;  3LH0 A;  5CIU A;  3VJP A;  3L2Q A;  3ZFJ A;  4BAC A;  1VUB A;  2OAU A;  3OS5 A;  4ME7 A;  3FRN A;  3CCL A;  2XD0 A;  4M7D F;  5DM7 R;  2EFI A;  4X9C A;  4NL3 A;  3CCQ T;  1N8R C;  4LDU A;  4M7D E;  2FL7 A;  1MHN A;  4JLI A;  4QQ6 A;  3ASK A;  1VQO T;  1M9S A;  3J80 E;  2RH2 A;  3VYG A;  5C6S A;  1Q81 C;  1D3B B;  1KHC A;  2BKD N;  4L59 A;  3OS0 A;  2OTL A;  3LGL A;  4M77 D;  4A4K A;  3A8H B;  5FRO A;  1U8R A;  4PJO C;  3OW2 S;  3A8O B;  3JB9 D;  1VQK T;  3QJY A;  4M78 A;  1Y96 A;  3MCA B;  3M53 A;  2CZ6 B;  2LC4 A;  4UC4 A;  1KQS S;  4FT4 A;  1KHI A;  2PVO B;  3KXT A;  1JBM A;  4JS5 A;  3M4G A;  5LJ3 h;  2RHX A;  1VQ7 T;  1OYX A;  2QI2 A;  3E9G A;  2O4X B;  3G4S A;  3PIO A;  2H3J A;  4PJO F;  1NPP A;  3MEV A;  1YHQ A;  5CKE A;  5GAN j;  4PJO E;  1YCY A;  3JCM X;  1JJ2 S;  3CCR T;  2RK1 A;  3A5Z B;  5FU6 B;  4C0G A;  3PMI A;  1M4Z A;  1JRI A;  1WQ7 A;  2ZPB B;  3HPW A;  4R56 A;  5LJ3 e;  2FYK A;  2PVG B;  1VIE A;  2BUD A;  4OGE A;  1M5Q 1;  2YLC A;  2ZPF B;  1YBY A;  2E70 A;  1X01 A;  5GAN 5;  5CKH A;  5GAO l;  1YIT A;  1M90 C;  2WSE E;  4A54 A;  1H3Z A;  4E7H A;  3LX7 A;  1M1F A;  2RHY A;  4ZTJ A;  3S3M A;  2NLU A;  4C5E A;  5CAI A;  5LL6 S;  3GOX A;  3CCV T;  2V8K A;  1VQM T;  2RI5 A;  3LLR A;  4EMK A;  4IUU A;  3P8D A;  4M78 B;  3S3O A;  2RM4 A;  2VYT A;  5GAN 6;  3FC3 A;  1K73 U;  1Y96 B;  2AHJ B;  4QQG A;  3JCM V;  2DXT A;  2EJ9 A;  4C8Q A;  2LDM A;  5DLO A;  1VQ6 A;  3OY9 A;  1Q82 C;  2KAF A;  2BIV A;  2RHU A;  3O8V A;  3V7C A;  2DAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...