2QAZA

Structure of c. crescentus sspb ortholog
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
EDLMQYEAMAQDALRGVVKAALKKAAAPGGLPEPHHLYITFKTKAAGVSGPQDLLSKYPDEMTIVLQHQYWDLAPGETFFSVTLKFGGQPKRLSVPYAALTRFYDPSVQFALQFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator
molecule keywords SspB Protein
publication title Structure of C. crescentus SspB ortholog
rcsb
source organism Caulobacter vibrioides
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2qazA00
2QAZA 1OU8A 1YFNA 2NYSA 1OX9A 1TWBA 1OU9A 1ZSZA 1ZSZC 1OULA 2QASA 1ZSZB 1OX8A
chains in the Genus database with same CATH superfamily
1KD1R 1Y0MA 1N8RR 1FXXA 1OULA 1D3BB 1ZUUA 1B34A 1FYNA 3THKA 1Z9ZA 4WF2A 3CXCS 4X9CA 2JS2A 2DK3A 5IN1A 1AHJB 3E1SA 3HL8A 5LJ3j 4E7SA 1K73C 2CP5A 5D6YA 3KUFA 4FCYA 4F7UA 1G3SA 3E9FA 4E7LA 3X24B 3L2WA 4J7FA 1M4ZA 2RHYA 1ABOA 4ZNXA 2LQKA 1M1GA 1HSQA 2X4XA 3CCRT 1FMWA 2K3YA 1RAIB 1SHFA 2XU8A 4FYWB 4HKEA 2HQEA 2COZA 2KXDA 5LJ3f 1TOVA 4F7UG 3JV3A 2LT4A 2K2MA 1SSFA 1VQPQ 2BTTA 3PIOA 3CD6T 1ZUKA 1S72A 3M55A 1J3TA 1B3QA 4J9BA 1K73U 1VQLQ 1ABQA 4DOVA 2E6ZA 2DAQA 1UEBA 4IIMA 4RTTA 2JOYA 4FYVB 4HT8A 2AKKA 3FJ5A 2RHIA 4PJJA 2EJ9A 4N4HA 2LCLA 1VQKA 2FPFA 4M7AC 1ZBJA 1UGRB 5GAN6 4XTZA 3AT1B 2IPOB 1UGVA 3MEVA 4GLMA 2QA4Q 7AT1B 2OTJT 2XMFA 1YHQT 2JT4A 2R5MA 3T9NA 4KH0B 1MMGA 1ZLMA 2NUPB 1MMDA 2XKOC 3SHWA 1SRLA 2CZ0B 2XG8D 1WHHA 3S3MA 2FRYA 4RTWA 1YI2T 3VS7A 1RAFB 5J3BA 5GAMg 1C6VX 4ELYC 2ATCB 2XHCA 2Y90A 3EHRA 5DM7R 5EC7A 1WDXA 2DXUA 2XI9A 2DL5A 4EMKB 1NPPA 1QVPA 4M75C 1PSFA 3A1PA 3OB9A 4QKUA 3RESA 2LJ1A 4X9DA 2QEXT 5GMKl 3CCRA 2A36A 3I5RA 4C8QG 3SFMA 3SWNA 1IRXA 1M2OA 1RLQC 3NTHA 3G71T 4MDWA 2Y4XA 1G3WA 2MK5A 1G83A 5AT1B 2QG9B 3WXMB 2ZPIB 2CP7A 2E70A 3CD6A 2CS7A 2CSIA 2D6FA 3CCET 2GQVA 3WVEB 4J8OA 3GF5A 2L3SA 2DTHA 2PVGB 4JS4A 2WSFE 3HRTA 1TS9A 4IKFA 4FYXB 4LDYA 4WTOB 1I81A 4LN2A 3O5ZA 1LOJA 2YHTA 2RJFA 3VYHB 3FEOA 1AZGB 3X28B 2EQKA 2O01E 2K3XA 2CZ7B 4L59A 2GF7A 2OTJA 2L5QA 2LT1A 2KYBA 4LUDA 5GMKm 3QO3A 1TWBA 4E2FB 1WHJA 4PNOA 1E6HA 5KYUB 5KYYB 2IG0A 3VV0A 1CKAA 2HMAA 1ZHIA 3CBPA 3S6WA 1YI2A 4CI0C 1D3BA 1W1FA 2DL4A 1VQMT 2GFAA 4M77C 1YITT 3G4ST 3OYNA 3CPWS 2FRWA 3QYHB 1YBYA 4A4HA 2RQUA 4RTYA 3EG9A 4AFSC 1X2QA 2EVRA 4J6YA 1VQLT 2QEXA 3RMQA 4IUTA 2EQJA 4KBMB 3HTRA 3M0RA 2COYA 4QVCA 5I21A 3G71A 4PKCC 5FU6C 5GMKe 2F1LA 1OPLA 3VS4A 2DL3A 5GJVB 3RUXA 3OS1A 4CC2A 3D7SB 3MKDA 1UHCA 1PKSA 2LCSA 1MV3A 2NUTA 1G3TA 2L3RA 3CCEA 1SRMA 2MWPA 1K0SA 1VQ7Q 3QZ9B 2DLPA 3DKMA 2P0QA 3HP9A 1UB4A 4Y92A 1Q86C 4J83A 2H8HA 2DBMA 2O2OA 2JMAA 3CEYA 4AG1C 2RM4A 3JCMe 4X34A 1VQ6Q 2CUDA 5CKDA 2JN0A 5FWBA 2CP6A 2M51A 4L5GA 1VQ8T 4ORZA 3CCJQ 2YSQA 3CXCP 1GL5A 3CCVQ 4HCBA 5KE3A 4V2SA 2W10A 3U23A 5IAYA 2EQUA 1KFZA 1WLPB 4XTVA 1PM3A 1UECA 1Q86U 1X01A 3VJPA 1K8AU 1VQMA 2NUPA 1YITA 2P84A 3G4SA 2X3XD 2JW4A 2RI2A 1WGSA 3LWHA 4C0DB 2EBPA 3GNFB 3A8GB 4NL3A 1VQLA 3LX7A 4PJOF 3OYIA 1ZSZB 5I2SA 3JCMP 2QASA 3TU4K 4VUBA 1SF9A 2BUDA 2F69A 4F16A 2LQWA 2CYZB 5IH2A 2KNBB 1I8FA 5L8RE 4M7DB 4C92B 1W2BA 2KROA 4NL2A 2DX1A 2L89A 2GNCA 2YUOA 2PQWA 4BUGA 4BY6B 5GAMh 4KUIA 1I4K1 5GAOq 1NEGA 4J6XA 1PWTA 1UG1A 3PNWC 2ZZDA 3OYYA 4M78E 3SD4A 1S72Q 4M78B 2NLUA 2QAZA 1TTHB 1RAGB 1BI2A 3OSSC 1UHFA 2B86A 1QCOA 2HQHA 3UA7A 2QK0A 1VQ8A 2IVWA 3EGXB 2ENMA 4PJMA 5HCKA 2A7YA 3FLGA 2M16A 2HL5C 2K5FA 2LX7A 2FEIA 4BB7A 4C5GA 4DOWA 3EH1A 4ZGJB 2D9TA 3FB9A 1UGQB 1X6BA 2F2XA 1G2BA 4C5HA 4KGZB 3JAME 1KIKA 2KRSA 5KYUA 4QQ6A 1NYFA 2HKQB 1R77A 1JQQA 2KMTA 1WFWA 1V1CA 3F70A 2VXFA 4ZGEB 3CMAT 2LNVA 1QVFP 1VQ7T 1OYXA 3TSZA 4FL6A 5A0LA 1QKXA 2LQNA 2M0YA 4RTUA 4N4GA 1TXQA 4E6RA 4BE1A 2E12A 4PJOD 1ZSGA 2CDTA 4A4FA 5M9OA 5I22A 4M77F 4JJBA 1X6GA 4Q5WA 2M9UA 1NG2A 5KCOA 3ZFJA 1UGSB 3EH2A 1K9AA 3CD6Q 2EGCA 5LJ5g 4PL6A 2DEQA 1G8XA 2K7AA 3A8LB 4RCBA 3ZL7C 5GMKh 4ZN1A 3FRNA 2ZCFB 4RTZA 1BCOA 2DL7A 4GLKA 5DLQE 4DQ2A 2AT1B 4A4GA 4BD3A 1KSWA 1D09B 4OGEA 3CMET 4R0KA 3VRZA 2I0NA 2HDAA 4M7AB 1UDLA 4JJNK 2OTJQ 1AZEA 1YHQQ 4PJOE 2ZPHB 5FRNA 1WHLA 1PSEA 5LJ5j 3CPWP 1FX7A 3I9QA 3G6ET 2OTLT 3A8MB 5IHIA 1W2BS 3OS2A 1N8RC 2F2WA 1QCNA 5CKEA 4AFQC 3PFSA 1QWFA 3CMAA 3QBYA 1NLPC 1VQ7A 1YI2Q 1D0ZA 2PVOB 3JCMd 3TCJA 1TH7A 1BIAA 2L2PA 3VUBA 1YCSB 3EGUA 4XTYA 3RDVA 2BIVA 4XTWA 5LJ5f 1QVGA 4E7KA 2QQSA 4YTLA 4M75B 2QEXQ 4FSXA 1Q7YU 3CC7T 1NEBA 5CIUA 3AHUA 3G71Q 4RMOA 1AVZC 5FRMA 5LJ3e 1N9RA 1YJWT 2DTIA 2QDYB 4M7DA 2EQIA 2LP5A 1KD1U 4C92A 4RUGA 2O9VA 1MGQA 3RNJA 2E3HA 1TG0A 2K79A 3URGA 3HSBA 3OBWA 1HK9A 4M77D 3JCMJ 2E5QA 4OB1B 3CCEQ 1R8OB 2VC8A 1WXTA 3PVLA 3JCMV 1K1ZA 4OMLA 1UE9A 1ZUYA 1VQOT 2LQ8A 3M4YA 4M7DG 1M3AA 2EKHA 1RADB 4C92G 3I5SA 5FLXE 4E47A 1VIFA 3CMEA 1C0MA 2VYTA 2MIOA 2V8IA 2DTOA 1WNLA 3QYGB 1H3HA 3CCQT 3J80E 4IIOA 2DD5A 2C06A 2BZXA 1Q95G 4M78G 2FL7A 2YDLA 1TU0B 2LC4A 2EJGA 2PNIA 3G6EA 2OTLA 4C5IA 4OF1A 1AT1B 1VA7A 2HD0A 1UJ0A 4NS5A 1AEYA 2DIGA 3LYIA 2WSCE 3CPFA 3NFCA 1M30A 1VQMQ 1G3YA 4M77E 1YITQ 4FM4B 2F2VA 3G4SQ 5J26A 4PFPA 4BI3A 4B9XA 1IHVA 1ZBXA 2FZKB 4J9EA 1KC8R 2RJEA 2LZ6B 2Y4YA 3QG1A 3CC7A 3ER0A 3M9QA 3TVTA 1D0YA 3O8VA 1IREB 2FZGB 4OB2B 1YJWA 5FU6B 1V29B 3JB9F 2BZYA 2YRDA 3QHSA 3TQ7P 2DVEA 3MJXA 2KGTA 1JXMA 2RI5A 1HYOA 3LLRA 4PJOC 3I56T 1QW1A 1VQOA 2GGRA 1AWOA 3OYEA 1PD1A 4UC4A 3L42A 1F1BB 1XOVA 1U5SA 3M56A 4OP0A 4C8QA 3FJPA 4RG2A 2A3LA 3CCQA 2YUPA 3V7RA 2KXCA 3PT9A 3SWNC 1VQ8Q 5GAMe 1LCKA 4CC4B 2A28A 2V8JA 3EFRA 1BKBA 2HCKA 3LWIA 2DRMA 5LJ5h 1LVKA 1M2VB 1KK7A 3HPWA 6AT1B 3M0PA 3GP8A 4C0GA 1QVFS 5D6WA 2YT6A 5FW9A 2R5AA 2QI2A 4B6MA 5CAIA 3A8OB 3GBQA 3FC3A 1M3CA 3X20B 4M7AG 2GFUA 3M0QA 1VQ9T 3C95A 2BKDN 4MMLA 2CH4A 4IUUA 1SKUB 3KXTA 4BDZA 2FVUA 3EFOA 3N5BB 4N0AC 2QDLA 2VWFA 2JJ9A 4AFZC 2LNHB 1PKTA 2EW3A 4LDXA 3CCUT 1WYXA 5EG2A 1JJ2A 4OMPA 1B7TA 5GAOn 1YHQA 2RQVA 3I56A 1YP5A 3EGDA 3JB9D 1S1NA 4HT9A 1W4SA 2NWMA 3VS6A 1BI1A 3OMGA 3M5AA 4M75G 1OX8A 1M1KR 2E41A 4ANJA 2YXYA 4R55A 2E65A 2PU9B 3QJ6A 4KT0E 2RQRA 4D6WA 4MZPA 1I1JA 2XK0A 2XDDA 4E7JA 5LJ3h 2RN8A 2RQTA 1R0BG 3LH5A 3NGPA 2F5KA 2K2VA 1QLYA 2PVDB 1X43A 5LJ3d 1W2BP 4A4EA 2DILA 1E6GA 3ME9A 3NMZC 4F7UF 3NTIA 4ESRA 1IGUA 1IB8A 4OB3B 4PK4A 1X2KA 2BE7D 3H0HA 1CSKA 4XU2A 3UF4A 2VVKA 4HVUA 3CCMT 1VQ9A 5D7UA 2RK1A 3KFVA 4R56A 2RJDA 4ZTFA 2NUZA 3CMAQ 5GAN3 4C0FA 2DNUA 3PMIA 2KVQG 2KAFA 2CH4W 2E3IA 3SB2A 3MP1A 1U1SA 2QYZA 5CR2A 1O75A 5GAN7 1BB9A 3QDFA 2V1QA 4BI4A 1BIBA 1X69A 2MCNA 1M8MA 5GAN4 3RERA 3CCUA 1KJWA 4GY5A 3EG2A 1WA7A 1IGQA 3MEAA 2FO0A 2L0AA 2O4XB 3ZEHA 1HD3A 3CC2T 2HSEB 2QQAA 2CREA 2LJ0A 3DLLA 4AT1B 1G5VA 2RQWA 2V26A 3BDLA 3S3OA 4JRIA 2JTFA 4J6WA 4MZMA 1EIFA 2D1XA 1D1AA 2EKOA 3QWXX 2HZYA 1RLPC 5FWCA 4Z02A 4JRKA 2QQBA 1H8KA 1MUZA 2R58A 4E7ZA 3CMEQ 4J9IA 4C8QF 3REBB 2VGMA 1OV3A 2K5IA 1I07A 2D0NA 2EJFA 2QGFB 1KQSA 1OQKA 4WCIA 2ZAEA 1TSFA 1KHCA 4EMKA 5J39A 5GANg 5A2QE 3QPHA 2VKNA 2A37A 3G6EQ 2OTLQ 3M57A 1XNIA 2DKGA 3CCMA 5D6XA 3OYFA 4EMGA 5GAN5 1QCFA 3FDRA 1JJ2S 2J6OA 4HVWA 4KULA 2CGHA 2K3BA 2RHZA 2DPPB 2DM1A 4OMOA 2VV5A 2EQMA 3RKWA 3PTAA 3JRZA 5KYXB 3CC4T 1RI0A 1UTIA 1JXOA 4ME7A 3E19A 4NOYA 3H6ZA 5GAMd 3OBYA 2K9GA 3X25B 3QXEB 1VQ4T 9ATCB 2SEMA 4KGVB 3CC7Q 5GANj 3H0FA 2GQIA 2ROTA 5ECAA 2KT1A 1YJWQ 1SG5A 4ELZC 3CC2A 1GBQA 4KRTA 4QQGA 4RCCA 1WI7A 3H0IA 1PC0A 2BZ8A 3JCMX 2V1RA 5DY9A 4J5YA 4K11A 1IXDA 1VYVA 3BFMA 3OYAA 1T0JA 3TEEA 1X6OA 1NJIC 2X3WD 4LNPA 3MHXA 4LDUA 4JJCA 4OB0B 3OYHA 2JVVA 1M9SA 1OX9A 2F5TX 1M90C 2ZPFB 4XAXB 3RBBB 5GANf 4F7UE 1VQOQ 3GIBA 4J9CA 4Y91A 5KYYA 3MCAB 3OW2A 2X9HA 3RKYA 2MMPA 3L2UA 2LTOA 4Z89A 1MV0B 4AMCA 2EYYA 3JB9H 3CCQQ 2PTKA 3OYBA 4J7IA 3V8LA 1NM7A 1JBMA 2KE9A 1BU1A 4EIKA 3CXCA 1K9MR 2DERA 4C8QD 3PIPA 1MMNA 3MP8A 2V8KA 4JUVA 1JRIA 4N4IA 4QVZA 1NJIR 3EHQA 1WJSA 1OPKA 1OI1A 3CC4A 3P8HA 1XTDA 3HRSA 2NYSA 2EYXA 2RO0A 1M90R 2DVJA 2JM9A 3V8JA 2RHUA 5LJ5e 1YNZA 4BE2A 2QXFA 3HFOA 1U1TA 2GCXA 3DLMA 1VQ4A 5FU7C 1MHNA 8AT1B 3UDCA 3GLXA 1RAAB 2RH2A 1EX4A 1OZ2A 4LE9A 2VUBA 4FT4A 4RKUE 4AFUC 4LD6A 4KUDK 4IUQA 1GCPA 2EGEA 2CZ6B 2O4XA 3Q1JA 1KQSS 4C8QE 4KGXB 2ZGWA 2XDPA 4J9DA 2CT4A 1EZZB 4PFZA 3HKSA 3I56Q 1BYMA 3QSUA 3CBOA 2O31A 4PJOB 3CCLQ 4BACA 2WACA 3I55T 1V76A 3NTKA 2D8HA 1N6AA 3ZBDA 2DETA 2M02A 1H92A 2E4HA 2X4JA 5HY6A 3SWNB 3CCST 2DF6A 1OZ3A 2VGNA 1WJQA 3JCMc 1PRMC 3NPFA 3QZ5B 1ZSZA 2XDBA 1ZX6A 2J6KA 5GAN2 4BY6C 2M0OA 3M58A 3J7AF 2D8JA 2LVMA 1T3LA 1GCQA 3JB9J 3OS5A 3EFSA 3OYKA 4BDYA 1N8RU 2KR3A 3WVDB 1VQ5T 4E7IA 1Q82R 1VQ9Q 1QWEA 2KDSA 2EGAA 4MZTA 2EWNA 2JUFA 5C0MA 1WPYA 4BE0A 1N27A 4OMFB 2LJ3A 4LXCA 2MF2A 5KYXA 2QQ9A 2LCCA 2W0ZA 5DLOA 3OYDA 1MNEA 1KC8C 5GANh 3JCMW 4M78A 2YRCA 3OW2S 1PHTA 3A5ZB 3L2VA 2E1HA 3CCUQ 1JEGA 3PMTA 2PUKB 1TUGB 1GBRA 3HHTB 1NZ9A 3EGXA 5CKFA 2DIQA 8ATCB 2O9SA 1TUDA 1Q81R 4JJDA 1WQWA 4RG8A 3I55A 2O88A 5HKCA 3IQLA 4D8DA 4J9FA 1BCMA 2RB6A 5KCHA 1K4US 1OU8A 3S3NA 3EG9B 1VQNT 1KC8U 1XJWB 2ECZA 2DXTA 4LDVA 1I0CA 4JLGA 1OOTA 3CCSA 2BE9B 3VUZA 2CT3A 2DMOA 4M77B 3LGFA 2KSSA 1DJ7B 1KG1A 2WSEE 1IZ6A 3VS3A 2JXBA 3QWYA 1JJ2P 4MMKA 1M8VA 2JZ2A 4JZ4A 1AOJA 2NUTB 5IHKA 4GBQA 1YJ9T 4IUVA 5GAOr 2A08A 2JTEA 4DBHA 3CPWA 1UJYA 1U8RA 5KE2A 3OYCA 1VQ5A 4JS5A 2FPDA 4XU3A 4KH1B 1RUWA 3CCMQ 2KI7A 2HBWA 4A53A 2AZSA 4X1VA 3BW1A 3RMSA 4C5EA 4C8QC 1FMVA 2DBKA 4OGCA 3REAB 3X26B 1M27C 2RF0A 3CCLT 2EYZA 1K73R 1WHKA 4F14A 1RAHB 2M1HA 3SEMA 1GXIE 3QJYA 1JU5C 1VUBA 4LUEA 3LH0A 2C0OA 4HVVA 2K6DA 4RTXA 1N9SA 2MYSA 4O5VA 5GMKi 1Z9QA 2X4WA 2KRMA 3J81E 4DEXA 1Y07A 3LGLA 3CQTA 2X51A 3CC2Q 4DBRA 2FG0A 2RNAA 1K76A 1NLOC 1UUEA 1QVGS 4M7AA 2L3PA 2ED0A 4TVRA 3E9GA 2HEQA 1T0HA 4XK8E 1VQNA 1GRIA 3RKXA 1YJNT 2EPDA 3NHNA 4PJOA 3L2QA 3BY7A 1ZA1B 4Z88A 4P5NA 5LJ5d 1YIJT 1M1KC 2YUNA 1Y7XA 1JB0E 2VXEA 3MPUB 2J06A 4PLLA 2ROLA 4A54A 1IHWA 2KT8A 2E10A 2I2LA 3E2UA 4OVAA 1WZOA 1BK2A 1CKBA 2OI3A 3VS0A 4F04B 1RABB 4QQDA 4EPCA 3V8KA 4PJOG 3L2RA 2YRVA 3P8DA 1YJ9A 3PVQA 1QP3A 4Z8AA 2ZPBB 3M0SA 4M75A 2OAWA 2PZ1A 1D1BA 1NE8A 4F17A 5GAMj 2J7IA 1WXUA 1M1KU 3C4SA 1VIEA 4AG2C 4QVDA 5CK9A 2ED1A 1KQ1A 4M7DF 3OS0A 4C92F 1X75C 3CC4Q 3CCLA 3EAEA 2EFIA 3OYLA 2DJZA 2L8DA 1WJRA 3JCMb 2GTJA 2HKNA 2MI6A 3GPLA 3OQ5A 4FYYB 2VB6A 4O6JA 3EG1A 1VQ4Q 1KQSP 2D0QB 1WHMA 5GAMf 3HRUA 4N0AA 2HL3A 3JCMQ 4M78F 1R0CB 3MEUA 2DL8A 3OYJA 1T3SA 2RD1A 2KEAA 3G7ZA 2G6FX 2H3JA 3UT1A 2JNGA 3GOXA 1M5Q1 4PLIA 4J9HA 3M53A 3GNGA 4A63B 3JB9I 1P92A 2ABLA 4M4ZA 1MNDA 1YJNA 1YIJA 1RAEB 3MO8A 2ZPEB 4E7HA 1VQPT 2YWWA 3M0UA 4Y28E 3HFNA 2RHXA 2MAMA 3VS5A 1HJDA 2MWOA 5KYNA 1NYGA 1WQ7A 4DEYA 4XQ3A 4JLIA 3SDZA 2E6NA 4M77A 2KBTA 3MEWA 2H3EB 3V7SA 2VASA 4HCKA 2DD4A 2KRNA 1M3BA 5GAOl 1MMAA 4PJNA 4XTXA 2C0TA 3FIFA 4OMQA 1FMKA 2Z0WA 4OMMA 1ZA2B 3TREA 1VOMA 2HBPA 2QA4T 5AYFA 4BI8B 2P0PA 4M77G 2RPNA 4RTVA 3BE3A 4DA4A 3OW2P 1EFNA 3DB3A 1AD5A 1NBEB 1K8AC 3OY9A 1QQJA 3JCMg 1LPLA 5CO7A 1PG5B 2RMOA 4QW2A 1H3ZA 4QT7A 5GMKj 2LDMA 4II1A 3H8ZA 3I35A 4CC3A 4M7DD 1QMCA 3OSVA 4C92D 5FU7B 1WXBA 1UGPB 2SRCA 1D1CA 2AKLA 4EMKC 5KH6A 1B07A 2QGGA 2CP3A 4CC7A 1PNJA 4C0ZA 3VKIA 1H641 2FB7A 3H41A 1O9SA 1GFDA 3R6OA 4HXJA 5GJWB 1U06A 5GAOm 4ZGDB 4M78D 1Y96B 4D8KA 2PUOB 2R57A 3P8BB 3C12A 1KQ2A 3ASKA 4J9GA 2K4YA 1M2VA 1VQPA 5GANe 4M7AF 1YFNA 3I55Q 5CKHA 2YLBA 1Q86R 5KYWB 4EDUA 2IIMA 4JZ3A 1HXDA 2J6FA 4LDWA 3OYGA 1K8AR 1LJOA 5CQYA 3QIIA 4HA8A 5I11A 3RIRA 5LL6S 5CCAA 4ATOA 1RACB 3A8HB 3CCSQ 5A0DA 2YLCA 3VS1A 2RJCA 2K57A 4M7DE 4HCCA 3JCMf 1YWPA 4C92E 2DJQA 2DYBA 4IURA 2LMJA 1UFFA 2COWA 2AK5A 2J05A 3V7CA 2XIDA 4B9WA 2QA4A 3L1AA 3OYMA 2JMCA 1D0XA 1WHGA 3QKJA 1K9MC 4M75F 2DFUA 4FW2A 4XU0A 1YWOA 2FHDA 1VQ5Q 3RR6A 1FWZA 3H9NA 1B34B 2HAXA 4PJLA 1ZQ1A 4JRPA 2DYIA 2RI3A 1WIEA 4FSSA 3M59A 2DZ9A 3OMCA 3JSCA 5CKBA 1E7OA 1M1FA 1RL2A 4F7UB 3UPUA 2RA2A 1VQKQ 1AWWA 1QVGP 3OA6A 1XQHA 1OU9A 1BI3A 2JTMA 1K9MU 4DBQA 2EYWA 5L23A 2DE0X 2ZPGB 2RK2A 1NPRA 4HCZA 2QTXA 4FT2A 1ARKA 3M54A 3KBGA 4FW1A 2CUBA 1NJIU 5A0GA 2AHJB 4JDSA 2XICA 2CP0A 1M90U 2FPEA 1VQNQ 2XD0A 1PD0A 1PCXA 1PRLC 5HK0A 2QTVA 5GAOp 1QKWA 2E5KA 4M7AD 2DRKA 4CRIA 4JRQA 2ESWA 1VYTA 4ZTJA 2CZ1B 2LX9A 3VS2A 3META 1AWJA 1VQ6T 3CCRQ 5C6SA 3L2ZA 2A0FB 2P4RA 2MOXA 4XTUA 1BI0A 3M0TA 4DBFA 2DEUA 2DXBA 2DXCA 4JPBW 2C0IA 1YJ9Q 2JM8A 3CCJT 5HK3A 5CQXA 1QP2A 3UWNA 3CCVT 1YN8A 2P0KA 3JB9G 1LNXA 2OX7A 2KK4A 4A4KA 2MPXC 2GTOA 1W70A 2HSPA 4FU6A 2X4YA 2EIFA 1AWXA 3ULRB 2K5LA 2CKKA 3CBMA 3MP6A 3LW5E 1IO6A 3DB4A 2CSQA 4M75D 4C8QB 2QQRA 2L3QA 1N5ZA 5IXFA 1Q82C 2DZCA 4L6V5 3VYGA 4C0DC 2FZCB 5IXBA 2P4TA 4EMHA 1U3OA 3C94A 5GAN8 2B8AA 3INZA 4M7AE 1SEMA 1ZSZC 3R6NA 1VYUA 3C0CA 1I5OB 1Y71A 4ZN3A 1Q7YC 1GCQC 1SPKA 1X27A 3UA6A 2YUQA 4M7DC 1TUCA 1K0XA 3JCMh 4C92C 4MDXA 2GBQA 1KD1C 2E64A 2X35A 4FIBA 1Y96A 1Q81C 2CP2A 3PGGA 1WX6A 1Y57A 3EG0A 1W6XA 1YJNQ 5I2MA 1Q82U 4IUPA 2KQWA 2HQXA 1YIJQ 1BBZA 2DA9A 2OJ2A 5KYWA 3EFOB 1RI9A 4M78C 3QUIA 2AZVA 2G3RA 3UATA 1S72T 5FROA 4M75E 1SSHA 3G1JA 5CVIA 2KYMA 1SHGA 3BDUA 3A98A 2DO3A 1VQ6A 2KY9A 3PE0A 1YCYA 2AIRB 1GFCA 2JS0A 5IHNA 3QDRB 1QVFA 1JO8A 5LJ3g 1C1AA 1OEBA 4PFOA 3CCJA 1I5LA 2EYQA 3VRYA 3VU3C 2HNIA 3EGDB 3CCVA 1VQKT 2EAYA 1Q81U 1Q7YR 1ACMB 3TSWA 3M4GA 3EG3A 2OAUA 5IT9E 2LRQA 1KHIA 1A0NB 4XU1A 4LD9K 5GANd 4OMNA 2FYKA
chains in the Genus database with same CATH topology
2QAZA 1OU8A 1YFNA 2NYSA 1OX9A 1TWBA 1OU9A 1ZSZA 1ZSZC 1OULA 2QASA 1ZSZB 1OX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAZ A;  1OU8 A;  1YFN A;  2NYS A;  1OX9 A;  1TWB A;  1OU9 A;  1ZSZ A;  1ZSZ C;  1OUL A;  2QAS A;  1ZSZ B;  1OX8 A; 
#chains in the Genus database with same CATH topology
 1KD1 R;  1Y0M A;  1N8R R;  1FXX A;  1OUL A;  1D3B B;  1ZUU A;  1B34 A;  1FYN A;  3THK A;  1Z9Z A;  4WF2 A;  3CXC S;  4X9C A;  2JS2 A;  2DK3 A;  5IN1 A;  1AHJ B;  3E1S A;  3HL8 A;  5LJ3 j;  4E7S A;  1K73 C;  2CP5 A;  5D6Y A;  3KUF A;  4FCY A;  4F7U A;  1G3S A;  3E9F A;  4E7L A;  3X24 B;  3L2W A;  4J7F A;  1M4Z A;  2RHY A;  1ABO A;  4ZNX A;  2LQK A;  1M1G A;  1HSQ A;  2X4X A;  3CCR T;  1FMW A;  2K3Y A;  1RAI B;  1SHF A;  2XU8 A;  4FYW B;  4HKE A;  2HQE A;  2COZ A;  2KXD A;  5LJ3 f;  1TOV A;  4F7U G;  3JV3 A;  2LT4 A;  2K2M A;  1SSF A;  1VQP Q;  2BTT A;  3PIO A;  3CD6 T;  1ZUK A;  1S72 A;  3M55 A;  1J3T A;  1B3Q A;  4J9B A;  1K73 U;  1VQL Q;  1ABQ A;  4DOV A;  2E6Z A;  2DAQ A;  1UEB A;  4IIM A;  4RTT A;  2JOY A;  4FYV B;  4HT8 A;  2AKK A;  3FJ5 A;  2RHI A;  4PJJ A;  2EJ9 A;  4N4H A;  2LCL A;  1VQK A;  2FPF A;  4M7A C;  1ZBJ A;  1UGR B;  5GAN 6;  4XTZ A;  3AT1 B;  2IPO B;  1UGV A;  3MEV A;  4GLM A;  2QA4 Q;  7AT1 B;  2OTJ T;  2XMF A;  1YHQ T;  2JT4 A;  2R5M A;  3T9N A;  4KH0 B;  1MMG A;  1ZLM A;  2NUP B;  1MMD A;  2XKO C;  3SHW A;  1SRL A;  2CZ0 B;  2XG8 D;  1WHH A;  3S3M A;  2FRY A;  4RTW A;  1YI2 T;  3VS7 A;  1RAF B;  5J3B A;  5GAM g;  1C6V X;  4ELY C;  2ATC B;  2XHC A;  2Y90 A;  3EHR A;  5DM7 R;  5EC7 A;  1WDX A;  2DXU A;  2XI9 A;  2DL5 A;  4EMK B;  1NPP A;  1QVP A;  4M75 C;  1PSF A;  3A1P A;  3OB9 A;  4QKU A;  3RES A;  2LJ1 A;  4X9D A;  2QEX T;  5GMK l;  3CCR A;  2A36 A;  3I5R A;  4C8Q G;  3SFM A;  3SWN A;  1IRX A;  1M2O A;  1RLQ C;  3NTH A;  3G71 T;  4MDW A;  2Y4X A;  1G3W A;  2MK5 A;  1G83 A;  5AT1 B;  2QG9 B;  3WXM B;  2ZPI B;  2CP7 A;  2E70 A;  3CD6 A;  2CS7 A;  2CSI A;  2D6F A;  3CCE T;  2GQV A;  3WVE B;  4J8O A;  3GF5 A;  2L3S A;  2DTH A;  2PVG B;  4JS4 A;  2WSF E;  3HRT A;  1TS9 A;  4IKF A;  4FYX B;  4LDY A;  4WTO B;  1I81 A;  4LN2 A;  3O5Z A;  1LOJ A;  2YHT A;  2RJF A;  3VYH B;  3FEO A;  1AZG B;  3X28 B;  2EQK A;  2O01 E;  2K3X A;  2CZ7 B;  4L59 A;  2GF7 A;  2OTJ A;  2L5Q A;  2LT1 A;  2KYB A;  4LUD A;  5GMK m;  3QO3 A;  1TWB A;  4E2F B;  1WHJ A;  4PNO A;  1E6H A;  5KYU B;  5KYY B;  2IG0 A;  3VV0 A;  1CKA A;  2HMA A;  1ZHI A;  3CBP A;  3S6W A;  1YI2 A;  4CI0 C;  1D3B A;  1W1F A;  2DL4 A;  1VQM T;  2GFA A;  4M77 C;  1YIT T;  3G4S T;  3OYN A;  3CPW S;  2FRW A;  3QYH B;  1YBY A;  4A4H A;  2RQU A;  4RTY A;  3EG9 A;  4AFS C;  1X2Q A;  2EVR A;  4J6Y A;  1VQL T;  2QEX A;  3RMQ A;  4IUT A;  2EQJ A;  4KBM B;  3HTR A;  3M0R A;  2COY A;  4QVC A;  5I21 A;  3G71 A;  4PKC C;  5FU6 C;  5GMK e;  2F1L A;  1OPL A;  3VS4 A;  2DL3 A;  5GJV B;  3RUX A;  3OS1 A;  4CC2 A;  3D7S B;  3MKD A;  1UHC A;  1PKS A;  2LCS A;  1MV3 A;  2NUT A;  1G3T A;  2L3R A;  3CCE A;  1SRM A;  2MWP A;  1K0S A;  1VQ7 Q;  3QZ9 B;  2DLP A;  3DKM A;  2P0Q A;  3HP9 A;  1UB4 A;  4Y92 A;  1Q86 C;  4J83 A;  2H8H A;  2DBM A;  2O2O A;  2JMA A;  3CEY A;  4AG1 C;  2RM4 A;  3JCM e;  4X34 A;  1VQ6 Q;  2CUD A;  5CKD A;  2JN0 A;  5FWB A;  2CP6 A;  2M51 A;  4L5G A;  1VQ8 T;  4ORZ A;  3CCJ Q;  2YSQ A;  3CXC P;  1GL5 A;  3CCV Q;  4HCB A;  5KE3 A;  4V2S A;  2W10 A;  3U23 A;  5IAY A;  2EQU A;  1KFZ A;  1WLP B;  4XTV A;  1PM3 A;  1UEC A;  1Q86 U;  1X01 A;  3VJP A;  1K8A U;  1VQM A;  2NUP A;  1YIT A;  2P84 A;  3G4S A;  2X3X D;  2JW4 A;  2RI2 A;  1WGS A;  3LWH A;  4C0D B;  2EBP A;  3GNF B;  3A8G B;  4NL3 A;  1VQL A;  3LX7 A;  4PJO F;  3OYI A;  1ZSZ B;  5I2S A;  3JCM P;  2QAS A;  3TU4 K;  4VUB A;  1SF9 A;  2BUD A;  2F69 A;  4F16 A;  2LQW A;  2CYZ B;  5IH2 A;  2KNB B;  1I8F A;  5L8R E;  4M7D B;  4C92 B;  1W2B A;  2KRO A;  4NL2 A;  2DX1 A;  2L89 A;  2GNC A;  2YUO A;  2PQW A;  4BUG A;  4BY6 B;  5GAM h;  4KUI A;  1I4K 1;  5GAO q;  1NEG A;  4J6X A;  1PWT A;  1UG1 A;  3PNW C;  2ZZD A;  3OYY A;  4M78 E;  3SD4 A;  1S72 Q;  4M78 B;  2NLU A;  2QAZ A;  1TTH B;  1RAG B;  1BI2 A;  3OSS C;  1UHF A;  2B86 A;  1QCO A;  2HQH A;  3UA7 A;  2QK0 A;  1VQ8 A;  2IVW A;  3EGX B;  2ENM A;  4PJM A;  5HCK A;  2A7Y A;  3FLG A;  2M16 A;  2HL5 C;  2K5F A;  2LX7 A;  2FEI A;  4BB7 A;  4C5G A;  4DOW A;  3EH1 A;  4ZGJ B;  2D9T A;  3FB9 A;  1UGQ B;  1X6B A;  2F2X A;  1G2B A;  4C5H A;  4KGZ B;  3JAM E;  1KIK A;  2KRS A;  5KYU A;  4QQ6 A;  1NYF A;  2HKQ B;  1R77 A;  1JQQ A;  2KMT A;  1WFW A;  1V1C A;  3F70 A;  2VXF A;  4ZGE B;  3CMA T;  2LNV A;  1QVF P;  1VQ7 T;  1OYX A;  3TSZ A;  4FL6 A;  5A0L A;  1QKX A;  2LQN A;  2M0Y A;  4RTU A;  4N4G A;  1TXQ A;  4E6R A;  4BE1 A;  2E12 A;  4PJO D;  1ZSG A;  2CDT A;  4A4F A;  5M9O A;  5I22 A;  4M77 F;  4JJB A;  1X6G A;  4Q5W A;  2M9U A;  1NG2 A;  5KCO A;  3ZFJ A;  1UGS B;  3EH2 A;  1K9A A;  3CD6 Q;  2EGC A;  5LJ5 g;  4PL6 A;  2DEQ A;  1G8X A;  2K7A A;  3A8L B;  4RCB A;  3ZL7 C;  5GMK h;  4ZN1 A;  3FRN A;  2ZCF B;  4RTZ A;  1BCO A;  2DL7 A;  4GLK A;  5DLQ E;  4DQ2 A;  2AT1 B;  4A4G A;  4BD3 A;  1KSW A;  1D09 B;  4OGE A;  3CME T;  4R0K A;  3VRZ A;  2I0N A;  2HDA A;  4M7A B;  1UDL A;  4JJN K;  2OTJ Q;  1AZE A;  1YHQ Q;  4PJO E;  2ZPH B;  5FRN A;  1WHL A;  1PSE A;  5LJ5 j;  3CPW P;  1FX7 A;  3I9Q A;  3G6E T;  2OTL T;  3A8M B;  5IHI A;  1W2B S;  3OS2 A;  1N8R C;  2F2W A;  1QCN A;  5CKE A;  4AFQ C;  3PFS A;  1QWF A;  3CMA A;  3QBY A;  1NLP C;  1VQ7 A;  1YI2 Q;  1D0Z A;  2PVO B;  3JCM d;  3TCJ A;  1TH7 A;  1BIA A;  2L2P A;  3VUB A;  1YCS B;  3EGU A;  4XTY A;  3RDV A;  2BIV A;  4XTW A;  5LJ5 f;  1QVG A;  4E7K A;  2QQS A;  4YTL A;  4M75 B;  2QEX Q;  4FSX A;  1Q7Y U;  3CC7 T;  1NEB A;  5CIU A;  3AHU A;  3G71 Q;  4RMO A;  1AVZ C;  5FRM A;  5LJ3 e;  1N9R A;  1YJW T;  2DTI A;  2QDY B;  4M7D A;  2EQI A;  2LP5 A;  1KD1 U;  4C92 A;  4RUG A;  2O9V A;  1MGQ A;  3RNJ A;  2E3H A;  1TG0 A;  2K79 A;  3URG A;  3HSB A;  3OBW A;  1HK9 A;  4M77 D;  3JCM J;  2E5Q A;  4OB1 B;  3CCE Q;  1R8O B;  2VC8 A;  1WXT A;  3PVL A;  3JCM V;  1K1Z A;  4OML A;  1UE9 A;  1ZUY A;  1VQO T;  2LQ8 A;  3M4Y A;  4M7D G;  1M3A A;  2EKH A;  1RAD B;  4C92 G;  3I5S A;  5FLX E;  4E47 A;  1VIF A;  3CME A;  1C0M A;  2VYT A;  2MIO A;  2V8I A;  2DTO A;  1WNL A;  3QYG B;  1H3H A;  3CCQ T;  3J80 E;  4IIO A;  2DD5 A;  2C06 A;  2BZX A;  1Q95 G;  4M78 G;  2FL7 A;  2YDL A;  1TU0 B;  2LC4 A;  2EJG A;  2PNI A;  3G6E A;  2OTL A;  4C5I A;  4OF1 A;  1AT1 B;  1VA7 A;  2HD0 A;  1UJ0 A;  4NS5 A;  1AEY A;  2DIG A;  3LYI A;  2WSC E;  3CPF A;  3NFC A;  1M30 A;  1VQM Q;  1G3Y A;  4M77 E;  1YIT Q;  4FM4 B;  2F2V A;  3G4S Q;  5J26 A;  4PFP A;  4BI3 A;  4B9X A;  1IHV A;  1ZBX A;  2FZK B;  4J9E A;  1KC8 R;  2RJE A;  2LZ6 B;  2Y4Y A;  3QG1 A;  3CC7 A;  3ER0 A;  3M9Q A;  3TVT A;  1D0Y A;  3O8V A;  1IRE B;  2FZG B;  4OB2 B;  1YJW A;  5FU6 B;  1V29 B;  3JB9 F;  2BZY A;  2YRD A;  3QHS A;  3TQ7 P;  2DVE A;  3MJX A;  2KGT A;  1JXM A;  2RI5 A;  1HYO A;  3LLR A;  4PJO C;  3I56 T;  1QW1 A;  1VQO A;  2GGR A;  1AWO A;  3OYE A;  1PD1 A;  4UC4 A;  3L42 A;  1F1B B;  1XOV A;  1U5S A;  3M56 A;  4OP0 A;  4C8Q A;  3FJP A;  4RG2 A;  2A3L A;  3CCQ A;  2YUP A;  3V7R A;  2KXC A;  3PT9 A;  3SWN C;  1VQ8 Q;  5GAM e;  1LCK A;  4CC4 B;  2A28 A;  2V8J A;  3EFR A;  1BKB A;  2HCK A;  3LWI A;  2DRM A;  5LJ5 h;  1LVK A;  1M2V B;  1KK7 A;  3HPW A;  6AT1 B;  3M0P A;  3GP8 A;  4C0G A;  1QVF S;  5D6W A;  2YT6 A;  5FW9 A;  2R5A A;  2QI2 A;  4B6M A;  5CAI A;  3A8O B;  3GBQ A;  3FC3 A;  1M3C A;  3X20 B;  4M7A G;  2GFU A;  3M0Q A;  1VQ9 T;  3C95 A;  2BKD N;  4MML A;  2CH4 A;  4IUU A;  1SKU B;  3KXT A;  4BDZ A;  2FVU A;  3EFO A;  3N5B B;  4N0A C;  2QDL A;  2VWF A;  2JJ9 A;  4AFZ C;  2LNH B;  1PKT A;  2EW3 A;  4LDX A;  3CCU T;  1WYX A;  5EG2 A;  1JJ2 A;  4OMP A;  1B7T A;  5GAO n;  1YHQ A;  2RQV A;  3I56 A;  1YP5 A;  3EGD A;  3JB9 D;  1S1N A;  4HT9 A;  1W4S A;  2NWM A;  3VS6 A;  1BI1 A;  3OMG A;  3M5A A;  4M75 G;  1OX8 A;  1M1K R;  2E41 A;  4ANJ A;  2YXY A;  4R55 A;  2E65 A;  2PU9 B;  3QJ6 A;  4KT0 E;  2RQR A;  4D6W A;  4MZP A;  1I1J A;  2XK0 A;  2XDD A;  4E7J A;  5LJ3 h;  2RN8 A;  2RQT A;  1R0B G;  3LH5 A;  3NGP A;  2F5K A;  2K2V A;  1QLY A;  2PVD B;  1X43 A;  5LJ3 d;  1W2B P;  4A4E A;  2DIL A;  1E6G A;  3ME9 A;  3NMZ C;  4F7U F;  3NTI A;  4ESR A;  1IGU A;  1IB8 A;  4OB3 B;  4PK4 A;  1X2K A;  2BE7 D;  3H0H A;  1CSK A;  4XU2 A;  3UF4 A;  2VVK A;  4HVU A;  3CCM T;  1VQ9 A;  5D7U A;  2RK1 A;  3KFV A;  4R56 A;  2RJD A;  4ZTF A;  2NUZ A;  3CMA Q;  5GAN 3;  4C0F A;  2DNU A;  3PMI A;  2KVQ G;  2KAF A;  2CH4 W;  2E3I A;  3SB2 A;  3MP1 A;  1U1S A;  2QYZ A;  5CR2 A;  1O75 A;  5GAN 7;  1BB9 A;  3QDF A;  2V1Q A;  4BI4 A;  1BIB A;  1X69 A;  2MCN A;  1M8M A;  5GAN 4;  3RER A;  3CCU A;  1KJW A;  4GY5 A;  3EG2 A;  1WA7 A;  1IGQ A;  3MEA A;  2FO0 A;  2L0A A;  2O4X B;  3ZEH A;  1HD3 A;  3CC2 T;  2HSE B;  2QQA A;  2CRE A;  2LJ0 A;  3DLL A;  4AT1 B;  1G5V A;  2RQW A;  2V26 A;  3BDL A;  3S3O A;  4JRI A;  2JTF A;  4J6W A;  4MZM A;  1EIF A;  2D1X A;  1D1A A;  2EKO A;  3QWX X;  2HZY A;  1RLP C;  5FWC A;  4Z02 A;  4JRK A;  2QQB A;  1H8K A;  1MUZ A;  2R58 A;  4E7Z A;  3CME Q;  4J9I A;  4C8Q F;  3REB B;  2VGM A;  1OV3 A;  2K5I A;  1I07 A;  2D0N A;  2EJF A;  2QGF B;  1KQS A;  1OQK A;  4WCI A;  2ZAE A;  1TSF A;  1KHC A;  4EMK A;  5J39 A;  5GAN g;  5A2Q E;  3QPH A;  2VKN A;  2A37 A;  3G6E Q;  2OTL Q;  3M57 A;  1XNI A;  2DKG A;  3CCM A;  5D6X A;  3OYF A;  4EMG A;  5GAN 5;  1QCF A;  3FDR A;  1JJ2 S;  2J6O A;  4HVW A;  4KUL A;  2CGH A;  2K3B A;  2RHZ A;  2DPP B;  2DM1 A;  4OMO A;  2VV5 A;  2EQM A;  3RKW A;  3PTA A;  3JRZ A;  5KYX B;  3CC4 T;  1RI0 A;  1UTI A;  1JXO A;  4ME7 A;  3E19 A;  4NOY A;  3H6Z A;  5GAM d;  3OBY A;  2K9G A;  3X25 B;  3QXE B;  1VQ4 T;  9ATC B;  2SEM A;  4KGV B;  3CC7 Q;  5GAN j;  3H0F A;  2GQI A;  2ROT A;  5ECA A;  2KT1 A;  1YJW Q;  1SG5 A;  4ELZ C;  3CC2 A;  1GBQ A;  4KRT A;  4QQG A;  4RCC A;  1WI7 A;  3H0I A;  1PC0 A;  2BZ8 A;  3JCM X;  2V1R A;  5DY9 A;  4J5Y A;  4K11 A;  1IXD A;  1VYV A;  3BFM A;  3OYA A;  1T0J A;  3TEE A;  1X6O A;  1NJI C;  2X3W D;  4LNP A;  3MHX A;  4LDU A;  4JJC A;  4OB0 B;  3OYH A;  2JVV A;  1M9S A;  1OX9 A;  2F5T X;  1M90 C;  2ZPF B;  4XAX B;  3RBB B;  5GAN f;  4F7U E;  1VQO Q;  3GIB A;  4J9C A;  4Y91 A;  5KYY A;  3MCA B;  3OW2 A;  2X9H A;  3RKY A;  2MMP A;  3L2U A;  2LTO A;  4Z89 A;  1MV0 B;  4AMC A;  2EYY A;  3JB9 H;  3CCQ Q;  2PTK A;  3OYB A;  4J7I A;  3V8L A;  1NM7 A;  1JBM A;  2KE9 A;  1BU1 A;  4EIK A;  3CXC A;  1K9M R;  2DER A;  4C8Q D;  3PIP A;  1MMN A;  3MP8 A;  2V8K A;  4JUV A;  1JRI A;  4N4I A;  4QVZ A;  1NJI R;  3EHQ A;  1WJS A;  1OPK A;  1OI1 A;  3CC4 A;  3P8H A;  1XTD A;  3HRS A;  2NYS A;  2EYX A;  2RO0 A;  1M90 R;  2DVJ A;  2JM9 A;  3V8J A;  2RHU A;  5LJ5 e;  1YNZ A;  4BE2 A;  2QXF A;  3HFO A;  1U1T A;  2GCX A;  3DLM A;  1VQ4 A;  5FU7 C;  1MHN A;  8AT1 B;  3UDC A;  3GLX A;  1RAA B;  2RH2 A;  1EX4 A;  1OZ2 A;  4LE9 A;  2VUB A;  4FT4 A;  4RKU E;  4AFU C;  4LD6 A;  4KUD K;  4IUQ A;  1GCP A;  2EGE A;  2CZ6 B;  2O4X A;  3Q1J A;  1KQS S;  4C8Q E;  4KGX B;  2ZGW A;  2XDP A;  4J9D A;  2CT4 A;  1EZZ B;  4PFZ A;  3HKS A;  3I56 Q;  1BYM A;  3QSU A;  3CBO A;  2O31 A;  4PJO B;  3CCL Q;  4BAC A;  2WAC A;  3I55 T;  1V76 A;  3NTK A;  2D8H A;  1N6A A;  3ZBD A;  2DET A;  2M02 A;  1H92 A;  2E4H A;  2X4J A;  5HY6 A;  3SWN B;  3CCS T;  2DF6 A;  1OZ3 A;  2VGN A;  1WJQ A;  3JCM c;  1PRM C;  3NPF A;  3QZ5 B;  1ZSZ A;  2XDB A;  1ZX6 A;  2J6K A;  5GAN 2;  4BY6 C;  2M0O A;  3M58 A;  3J7A F;  2D8J A;  2LVM A;  1T3L A;  1GCQ A;  3JB9 J;  3OS5 A;  3EFS A;  3OYK A;  4BDY A;  1N8R U;  2KR3 A;  3WVD B;  1VQ5 T;  4E7I A;  1Q82 R;  1VQ9 Q;  1QWE A;  2KDS A;  2EGA A;  4MZT A;  2EWN A;  2JUF A;  5C0M A;  1WPY A;  4BE0 A;  1N27 A;  4OMF B;  2LJ3 A;  4LXC A;  2MF2 A;  5KYX A;  2QQ9 A;  2LCC A;  2W0Z A;  5DLO A;  3OYD A;  1MNE A;  1KC8 C;  5GAN h;  3JCM W;  4M78 A;  2YRC A;  3OW2 S;  1PHT A;  3A5Z B;  3L2V A;  2E1H A;  3CCU Q;  1JEG A;  3PMT A;  2PUK B;  1TUG B;  1GBR A;  3HHT B;  1NZ9 A;  3EGX A;  5CKF A;  2DIQ A;  8ATC B;  2O9S A;  1TUD A;  1Q81 R;  4JJD A;  1WQW A;  4RG8 A;  3I55 A;  2O88 A;  5HKC A;  3IQL A;  4D8D A;  4J9F A;  1BCM A;  2RB6 A;  5KCH A;  1K4U S;  1OU8 A;  3S3N A;  3EG9 B;  1VQN T;  1KC8 U;  1XJW B;  2ECZ A;  2DXT A;  4LDV A;  1I0C A;  4JLG A;  1OOT A;  3CCS A;  2BE9 B;  3VUZ A;  2CT3 A;  2DMO A;  4M77 B;  3LGF A;  2KSS A;  1DJ7 B;  1KG1 A;  2WSE E;  1IZ6 A;  3VS3 A;  2JXB A;  3QWY A;  1JJ2 P;  4MMK A;  1M8V A;  2JZ2 A;  4JZ4 A;  1AOJ A;  2NUT B;  5IHK A;  4GBQ A;  1YJ9 T;  4IUV A;  5GAO r;  2A08 A;  2JTE A;  4DBH A;  3CPW A;  1UJY A;  1U8R A;  5KE2 A;  3OYC A;  1VQ5 A;  4JS5 A;  2FPD A;  4XU3 A;  4KH1 B;  1RUW A;  3CCM Q;  2KI7 A;  2HBW A;  4A53 A;  2AZS A;  4X1V A;  3BW1 A;  3RMS A;  4C5E A;  4C8Q C;  1FMV A;  2DBK A;  4OGC A;  3REA B;  3X26 B;  1M27 C;  2RF0 A;  3CCL T;  2EYZ A;  1K73 R;  1WHK A;  4F14 A;  1RAH B;  2M1H A;  3SEM A;  1GXI E;  3QJY A;  1JU5 C;  1VUB A;  4LUE A;  3LH0 A;  2C0O A;  4HVV A;  2K6D A;  4RTX A;  1N9S A;  2MYS A;  4O5V A;  5GMK i;  1Z9Q A;  2X4W A;  2KRM A;  3J81 E;  4DEX A;  1Y07 A;  3LGL A;  3CQT A;  2X51 A;  3CC2 Q;  4DBR A;  2FG0 A;  2RNA A;  1K76 A;  1NLO C;  1UUE A;  1QVG S;  4M7A A;  2L3P A;  2ED0 A;  4TVR A;  3E9G A;  2HEQ A;  1T0H A;  4XK8 E;  1VQN A;  1GRI A;  3RKX A;  1YJN T;  2EPD A;  3NHN A;  4PJO A;  3L2Q A;  3BY7 A;  1ZA1 B;  4Z88 A;  4P5N A;  5LJ5 d;  1YIJ T;  1M1K C;  2YUN A;  1Y7X A;  1JB0 E;  2VXE A;  3MPU B;  2J06 A;  4PLL A;  2ROL A;  4A54 A;  1IHW A;  2KT8 A;  2E10 A;  2I2L A;  3E2U A;  4OVA A;  1WZO A;  1BK2 A;  1CKB A;  2OI3 A;  3VS0 A;  4F04 B;  1RAB B;  4QQD A;  4EPC A;  3V8K A;  4PJO G;  3L2R A;  2YRV A;  3P8D A;  1YJ9 A;  3PVQ A;  1QP3 A;  4Z8A A;  2ZPB B;  3M0S A;  4M75 A;  2OAW A;  2PZ1 A;  1D1B A;  1NE8 A;  4F17 A;  5GAM j;  2J7I A;  1WXU A;  1M1K U;  3C4S A;  1VIE A;  4AG2 C;  4QVD A;  5CK9 A;  2ED1 A;  1KQ1 A;  4M7D F;  3OS0 A;  4C92 F;  1X75 C;  3CC4 Q;  3CCL A;  3EAE A;  2EFI A;  3OYL A;  2DJZ A;  2L8D A;  1WJR A;  3JCM b;  2GTJ A;  2HKN A;  2MI6 A;  3GPL A;  3OQ5 A;  4FYY B;  2VB6 A;  4O6J A;  3EG1 A;  1VQ4 Q;  1KQS P;  2D0Q B;  1WHM A;  5GAM f;  3HRU A;  4N0A A;  2HL3 A;  3JCM Q;  4M78 F;  1R0C B;  3MEU A;  2DL8 A;  3OYJ A;  1T3S A;  2RD1 A;  2KEA A;  3G7Z A;  2G6F X;  2H3J A;  3UT1 A;  2JNG A;  3GOX A;  1M5Q 1;  4PLI A;  4J9H A;  3M53 A;  3GNG A;  4A63 B;  3JB9 I;  1P92 A;  2ABL A;  4M4Z A;  1MND A;  1YJN A;  1YIJ A;  1RAE B;  3MO8 A;  2ZPE B;  4E7H A;  1VQP T;  2YWW A;  3M0U A;  4Y28 E;  3HFN A;  2RHX A;  2MAM A;  3VS5 A;  1HJD A;  2MWO A;  5KYN A;  1NYG A;  1WQ7 A;  4DEY A;  4XQ3 A;  4JLI A;  3SDZ A;  2E6N A;  4M77 A;  2KBT A;  3MEW A;  2H3E B;  3V7S A;  2VAS A;  4HCK A;  2DD4 A;  2KRN A;  1M3B A;  5GAO l;  1MMA A;  4PJN A;  4XTX A;  2C0T A;  3FIF A;  4OMQ A;  1FMK A;  2Z0W A;  4OMM A;  1ZA2 B;  3TRE A;  1VOM A;  2HBP A;  2QA4 T;  5AYF A;  4BI8 B;  2P0P A;  4M77 G;  2RPN A;  4RTV A;  3BE3 A;  4DA4 A;  3OW2 P;  1EFN A;  3DB3 A;  1AD5 A;  1NBE B;  1K8A C;  3OY9 A;  1QQJ A;  3JCM g;  1LPL A;  5CO7 A;  1PG5 B;  2RMO A;  4QW2 A;  1H3Z A;  4QT7 A;  5GMK j;  2LDM A;  4II1 A;  3H8Z A;  3I35 A;  4CC3 A;  4M7D D;  1QMC A;  3OSV A;  4C92 D;  5FU7 B;  1WXB A;  1UGP B;  2SRC A;  1D1C A;  2AKL A;  4EMK C;  5KH6 A;  1B07 A;  2QGG A;  2CP3 A;  4CC7 A;  1PNJ A;  4C0Z A;  3VKI A;  1H64 1;  2FB7 A;  3H41 A;  1O9S A;  1GFD A;  3R6O A;  4HXJ A;  5GJW B;  1U06 A;  5GAO m;  4ZGD B;  4M78 D;  1Y96 B;  4D8K A;  2PUO B;  2R57 A;  3P8B B;  3C12 A;  1KQ2 A;  3ASK A;  4J9G A;  2K4Y A;  1M2V A;  1VQP A;  5GAN e;  4M7A F;  1YFN A;  3I55 Q;  5CKH A;  2YLB A;  1Q86 R;  5KYW B;  4EDU A;  2IIM A;  4JZ3 A;  1HXD A;  2J6F A;  4LDW A;  3OYG A;  1K8A R;  1LJO A;  5CQY A;  3QII A;  4HA8 A;  5I11 A;  3RIR A;  5LL6 S;  5CCA A;  4ATO A;  1RAC B;  3A8H B;  3CCS Q;  5A0D A;  2YLC A;  3VS1 A;  2RJC A;  2K57 A;  4M7D E;  4HCC A;  3JCM f;  1YWP A;  4C92 E;  2DJQ A;  2DYB A;  4IUR A;  2LMJ A;  1UFF A;  2COW A;  2AK5 A;  2J05 A;  3V7C A;  2XID A;  4B9W A;  2QA4 A;  3L1A A;  3OYM A;  2JMC A;  1D0X A;  1WHG A;  3QKJ A;  1K9M C;  4M75 F;  2DFU A;  4FW2 A;  4XU0 A;  1YWO A;  2FHD A;  1VQ5 Q;  3RR6 A;  1FWZ A;  3H9N A;  1B34 B;  2HAX A;  4PJL A;  1ZQ1 A;  4JRP A;  2DYI A;  2RI3 A;  1WIE A;  4FSS A;  3M59 A;  2DZ9 A;  3OMC A;  3JSC A;  5CKB A;  1E7O A;  1M1F A;  1RL2 A;  4F7U B;  3UPU A;  2RA2 A;  1VQK Q;  1AWW A;  1QVG P;  3OA6 A;  1XQH A;  1OU9 A;  1BI3 A;  2JTM A;  1K9M U;  4DBQ A;  2EYW A;  5L23 A;  2DE0 X;  2ZPG B;  2RK2 A;  1NPR A;  4HCZ A;  2QTX A;  4FT2 A;  1ARK A;  3M54 A;  3KBG A;  4FW1 A;  2CUB A;  1NJI U;  5A0G A;  2AHJ B;  4JDS A;  2XIC A;  2CP0 A;  1M90 U;  2FPE A;  1VQN Q;  2XD0 A;  1PD0 A;  1PCX A;  1PRL C;  5HK0 A;  2QTV A;  5GAO p;  1QKW A;  2E5K A;  4M7A D;  2DRK A;  4CRI A;  4JRQ A;  2ESW A;  1VYT A;  4ZTJ A;  2CZ1 B;  2LX9 A;  3VS2 A;  3MET A;  1AWJ A;  1VQ6 T;  3CCR Q;  5C6S A;  3L2Z A;  2A0F B;  2P4R A;  2MOX A;  4XTU A;  1BI0 A;  3M0T A;  4DBF A;  2DEU A;  2DXB A;  2DXC A;  4JPB W;  2C0I A;  1YJ9 Q;  2JM8 A;  3CCJ T;  5HK3 A;  5CQX A;  1QP2 A;  3UWN A;  3CCV T;  1YN8 A;  2P0K A;  3JB9 G;  1LNX A;  2OX7 A;  2KK4 A;  4A4K A;  2MPX C;  2GTO A;  1W70 A;  2HSP A;  4FU6 A;  2X4Y A;  2EIF A;  1AWX A;  3ULR B;  2K5L A;  2CKK A;  3CBM A;  3MP6 A;  3LW5 E;  1IO6 A;  3DB4 A;  2CSQ A;  4M75 D;  4C8Q B;  2QQR A;  2L3Q A;  1N5Z A;  5IXF A;  1Q82 C;  2DZC A;  4L6V 5;  3VYG A;  4C0D C;  2FZC B;  5IXB A;  2P4T A;  4EMH A;  1U3O A;  3C94 A;  5GAN 8;  2B8A A;  3INZ A;  4M7A E;  1SEM A;  1ZSZ C;  3R6N A;  1VYU A;  3C0C A;  1I5O B;  1Y71 A;  4ZN3 A;  1Q7Y C;  1GCQ C;  1SPK A;  1X27 A;  3UA6 A;  2YUQ A;  4M7D C;  1TUC A;  1K0X A;  3JCM h;  4C92 C;  4MDX A;  2GBQ A;  1KD1 C;  2E64 A;  2X35 A;  4FIB A;  1Y96 A;  1Q81 C;  2CP2 A;  3PGG A;  1WX6 A;  1Y57 A;  3EG0 A;  1W6X A;  1YJN Q;  5I2M A;  1Q82 U;  4IUP A;  2KQW A;  2HQX A;  1YIJ Q;  1BBZ A;  2DA9 A;  2OJ2 A;  5KYW A;  3EFO B;  1RI9 A;  4M78 C;  3QUI A;  2AZV A;  2G3R A;  3UAT A;  1S72 T;  5FRO A;  4M75 E;  1SSH A;  3G1J A;  5CVI A;  2KYM A;  1SHG A;  3BDU A;  3A98 A;  2DO3 A;  1VQ6 A;  2KY9 A;  3PE0 A;  1YCY A;  2AIR B;  1GFC A;  2JS0 A;  5IHN A;  3QDR B;  1QVF A;  1JO8 A;  5LJ3 g;  1C1A A;  1OEB A;  4PFO A;  3CCJ A;  1I5L A;  2EYQ A;  3VRY A;  3VU3 C;  2HNI A;  3EGD B;  3CCV A;  1VQK T;  2EAY A;  1Q81 U;  1Q7Y R;  1ACM B;  3TSW A;  3M4G A;  3EG3 A;  2OAU A;  5IT9 E;  2LRQ A;  1KHI A;  1A0N B;  4XU1 A;  4LD9 K;  5GAN d;  4OMN A;  2FYK A; 
#chains in the Genus database with same CATH homology
 2QAZ A;  1OU8 A;  1YFN A;  2NYS A;  1OX9 A;  1TWB A;  1OU9 A;  1ZSZ A;  1ZSZ C;  1OUL A;  2QAS A;  1ZSZ B;  1OX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...