2QAZA

Structure of c. crescentus sspb ortholog
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
EDLMQYEAMAQDALRGVVKAALKKAAAPGGLPEPHHLYITFKTKAAGVSGPQDLLSKYPDEMTIVLQHQYWDLAPGETFFSVTLKFGGQPKRLSVPYAALTRFYDPSVQFALQFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SspB Protein
publication title Structure of C. crescentus SspB ortholog
rcsb
source organism Caulobacter vibrioides
molecule tags Hydrolase activator
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2qazA00
2QASA 1YFNA 1OX9A 1OU8A 1TWBA 1ZSZA 1OU9A 1ZSZC 2QAZA 2NYSA 1ZSZB 1OX8A 1OULA
chains in the Genus database with same CATH superfamily
1D0XA 5L23A 3I55Q 3JB9I 2CZ6B 5KCHA 2FB7A 2XIDA 3MEUA 4HA8A 4ZTJA 3CPWS 3QPHA 3S3NA 3OBYA 3LH5A 3QZ5B 2YSQA 4BE0A 1QMCA 1Q86U 4P5NA 4JZ3A 3D7SB 2HQXA 3G4SQ 3P8BB 1QVGS 2X35A 1RLQC 1K9MR 4F7UF 1PD0A 1NYGA 5I22A 2D0NA 4EMHA 5A0DA 1UEBA 2QA4Q 1X01A 1H92A 4C5EA 2B86A 2KRNA 4WCIA 1UHFA 3OW2P 2JTFA 4BACA 1O75A 3LH0A 4E7IA 1JJ2A 3JCMc 3OYJA 5GAMd 2COYA 1VIEA 2BIVA 1OPKA 1VQLQ 2PU9B 4N0AC 4JLIA 2VVKA 1AT1B 3LGFA 5IXFA 2F2VA 3MJXA 4QQ6A 5GMKh 3QG1A 1M1KC 4C8QB 1RUWA 5FRMA 4JRKA 1WGSA 2J6OA 2ED0A 3I9QA 3PIPA 4J9FA 1VQ6T 2JS0A 4QT7A 3CCLT 2DD5A 1Q7YC 1QQJA 4J7IA 1PCXA 1VQKT 3GIBA 3H41A 2YRCA 2PUOB 2QEXA 2A3LA 1UGSB 2YWWA 1TH7A 2AIRB 3QJ6A 4FYVB 4Z02A 1SRLA 2E5QA 5LL6S 3M5AA 5GANe 3JCMe 1MHNA 4NL2A 3CCUQ 2X3XD 3WXMB 3QYGB 1UGQB 1JXOA 2LQ8A 4N0AA 4DQ2A 4DEYA 1JB0E 2YUPA 1H8KA 2JXBA 3MKDA 5I2SA 4BE2A 3OQ5A 3VS7A 1SHGA 3CQTA 2PVDB 1PWTA 4K11A 4M75B 1OOTA 5CAIA 1AWXA 4AFSC 4PFZA 1G5VA 2OTJQ 4IUQA 1EZZB 1GCPA 1JJ2S 3C0CA 4XTZA 5CR2A 2QASA 1KFZA 3LLRA 2DFUA 2DE0X 4RTTA 4IIMA 2A36A 1VQNA 2JTEA 4L59A 1AWJA 2EJ9A 1BB9A 3SDZA 1VQLT 2K5LA 3X26B 3L2WA 1R77A 3CD6Q 3EFOA 2XDPA 2A08A 5GMKl 2AK5A 2KYMA 1JXMA 2QTVA 2SRCA 3OYMA 1WHKA 4DEXA 3A5ZB 3OA6A 3J81E 3CCVQ 1CKAA 4J9GA 2HKNA 3M4GA 2EVRA 3NTHA 2C06A 2QAZA 2HNIA 3EAEA 2L3PA 1Q81R 2MPXC 2Y90A 5LJ5j 2EKOA 2Z0WA 1I5LA 2X3WD 1HXDA 2EW3A 3OYDA 5KCOA 2KE9A 4HVVA 2EQKA 1QVPA 3MPUB 2AKLA 2GF7A 4LUDA 3CPFA 1PRLC 1MUZA 3EG2A 4C8QE 4E7HA 4OGCA 3CCJA 1ZA1B 2CP2A 2ESWA 5GAOr 2EYZA 3QWXX 2GQVA 1IRXA 3OW2A 3LWIA 3WVEB 2OI3A 2R57A 3DLMA 2RHXA 2KYBA 2E65A 2CZ7B 1C6VX 3QIIA 4JJCA 4RKUE 1R0BG 3OSVA 1UHCA 2EGCA 3QJYA 1QVFA 3L1AA 3LW5E 2L3SA 3CD6T 2ZPIB 4LDWA 1N8RR 3CC4A 1T0HA 3TSZA 2DJZA 2HBWA 4B6MA 1X27A 3SEMA 4ZGEB 1M8MA 2B8AA 2FPFA 1Y0MA 5FU7C 3JCMJ 1OPLA 4PLLA 4QQDA 4FM4B 1ZUKA 5KYWB 4NOYA 3CCVT 1W6XA 4JZ4A 4M75E 3CXCP 3CC7A 2RJDA 2YRVA 2QGGA 1KC8C 2OTLQ 3OS1A 4L5GA 2XG8D 2Y4XA 5GANd 4M78C 2HQHA 4PJOC 3JCMd 3V7SA 1GCQC 4UC4A 4M7DB 3CEYA 4HCZA 2HDAA 3QYHB 5I11A 4C8QG 2KNBB 3UF4A 4C8QD 4C92B 4FW2A 1K8AR 2ZPHB 2F5KA 5GAN6 4MMKA 1H3HA 1RAHB 2F5TX 3HRUA 3Q1JA 1XOVA 3JB9D 1B07A 4RTUA 5KH6A 1X75C 5GAOm 3MEWA 1M8VA 1YN8A 3NGPA 2ECZA 5GAN3 1K73U 1M4ZA 1YJNQ 1AHJB 1OV3A 3VS1A 4O5VA 2MCNA 1FMVA 2H3EB 3EGDB 1XQHA 1D0YA 5IAYA 1VQ7A 2M9UA 4CI0C 2DTOA 5FU6B 1FMWA 2L3QA 5GAN4 1KQ1A 4PJOA 2EJGA 4ORZA 3CMEA 1UB4A 4ZTFA 2K57A 1QVFS 3S3OA 4OB0B 4DBRA 2K79A 1XNIA 3ZEHA 1PKTA 2L8DA 2DK3A 4M75G 4IUPA 2CP6A 4AG2C 4M7AC 1N5ZA 3CPWP 3OY9A 3G6EA 4KBMB 1B3QA 4LE9A 4LN2A 3M9QA 4ZGDB 1IZ6A 4LDVA 2K9GA 4LDYA 2ZCFB 1KHCA 4EMGA 4ZN3A 4BI8B 3CMAA 1T0JA 1LVKA 3VS5A 3VS4A 4JS5A 3V7CA 2GTOA 1ZBXA 3GBQA 3CCQT 3V7RA 4LDUA 1QVGP 3UWNA 2DPPB 2V1QA 2RO0A 4B9XA 1G83A 2ZGWA 1ZQ1A 2DTIA 4X9DA 1RAFB 2COWA 3O8VA 5J3BA 1PSFA 2ABLA 1UJYA 3RKXA 2L5QA 4F16A 1BCOA 5GAOp 5IH2A 3CC2A 3GF5A 1Q95G 3RMSA 4AFZC 1Y57A 1HYOA 1VQ9T 1YJNT 2GTJA 5DY9A 1YFNA 2FZGB 3S3MA 2D9TA 2EGAA 3INZA 2JJ9A 1FYNA 3FLGA 1VQPA 4MMLA 2R58A 4CC2A 1X69A 6AT1B 5KYUB 2NUTA 1YI2Q 4BDZA 1YCYA 5LJ5h 4M7DE 3A8HB 1N9RA 1YIJA 2P4TA 2RF0A 5FW9A 1T3SA 3V8LA 4C92E 1PNJA 1SPKA 2HD0A 2M16A 3HL8A 3SWNA 4C0FA 3G71Q 2ED1A 1BYMA 4A4EA 2RJFA 2RI2A 4AG1C 1JQQA 1GFCA 4HVWA 1E6GA 2DF6A 1GFDA 2JNGA 3M4YA 1K76A 4J9DA 1VQOT 2MAMA 1JBMA 2WACA 1IGQA 3G7ZA 1H641 1D0ZA 4XTWA 2GCXA 5M9OA 4KH0B 2O4XA 5KYYB 4PKCC 5CKEA 2JMCA 2CT4A 1YITT 2LQWA 4D8DA 1M1KU 2NYSA 2OAWA 5FRNA 2M02A 2LVMA 1KK7A 1KD1C 2D8HA 1Q86R 4AFUC 1JJ2P 4XTVA 1QCOA 1IB8A 2EYQA 1NEGA 3URGA 1Q7YU 4E7KA 1WJRA 3ZBDA 3PT9A 4JUVA 2QG9B 4M77E 1YJ9A 2DZ9A 1AWWA 2KXCA 1AVZC 4JLGA 1JEGA 4M77F 1UGRB 2CP0A 2EFIA 1VQMA 5GMKm 2LTOA 5KYXB 2LDMA 4M7DG 5CCAA 4M7DD 2DMOA 4M78D 3V8KA 2M51A 4CC3A 3FJPA 1KQ2A 2KY9A 4C92D 3E9GA 4N4GA 4KT0E 1YI2T 3I55A 1KJWA 5IT9E 3VRZA 4ZGJB 4BD3A 3AHUA 3HTRA 1OZ2A 4X1VA 2QYZA 1BKBA 4PJJA 2DX1A 3L2RA 1VQ4A 1JU5C 1VQ5Q 2YUNA 5D6XA 1VQ8A 2HCKA 4IUVA 3CBMA 2VGMA 2LC4A 2QI2A 2FG0A 1N27A 3JRZA 4OB2B 3FB9A 3G4SA 2EYXA 2ROLA 5GAN5 2ZPGB 1K9AA 3CCMQ 1OX8A 2DA9A 4JJNK 4FYWB 2FPEA 2QA4A 3H8ZA 2JW4A 1R0CB 3M54A 2F69A 2HMAA 5GAOq 4J83A 2LT4A 3PNWC 3LWHA 4R56A 4M77G 4DOWA 1OQKA 1QWEA 2C0OA 2NUPA 5A0GA 2L3RA 4N4IA 1WLPB 1WFWA 1Q81C 4R0KA 4IUTA 2DRKA 2V1RA 2VV5A 1NJIC 1G3YA 4E7LA 1ZSZB 2A0FB 3THKA 1P92A 4J9BA 3R6NA 3AT1B 2LJ1A 4BI4A 3JAME 3HHTB 2LJ3A 2LJ0A 4Z88A 1Y7XA 3CCRA 4JRPA 1K1ZA 1S72T 1GBRA 1B7TA 1WYXA 1VQKQ 2DXTA 2RPNA 1LNXA 2X51A 4ATOA 2CYZB 4F04B 2DJQA 3JCMP 2EGEA 1RAIB 1OI1A 1KQSA 2E64A 3TVTA 5AYFA 4EMKB 5DM7R 2YXYA 1NPPA 3CCUA 2VXEA 4EPCA 2M0YA 1LCKA 1VQ5T 1VQPT 4RG8A 1Y96A 3HKSA 2C0TA 4M4ZA 4O6JA 2VWFA 4JRIA 1N8RC 1SHFA 4JJBA 4PL6A 4C5HA 1ZUUA 1XJWB 2YRDA 3L42A 2CUBA 3CCMT 3HFOA 2LQKA 2EQIA 2ENMA 4JS4A 1IGUA 2DL4A 2OTJA 5CKHA 3I56T 2CT3A 2RHUA 2ROTA 4J6XA 3VS2A 2CP3A 2MYSA 1WZOA 1CSKA 2M1HA 2WSFE 2CZ1B 2KMTA 3A8LB 3SB2A 3META 1JRIA 1SEMA 1MV3A 1WXBA 1TUCA 3EFRA 1KC8U 3HPWA 1K8AC 1M90R 1QVFP 4XU3A 5GAN7 2OX7A 1IHWA 1IREB 4KGXB 3NFCA 3JCMW 1M2VB 2CGHA 1YNZA 2DBMA 3CCSA 1KQSS 2MWPA 5C0MA 1YJWA 5LJ3e 1SG5A 2HAXA 1NPRA 1I81A 2D1XA 3NMZC 2DXUA 2RQTA 1QP2A 2DEQA 1ZBJA 2MOXA 4AMCA 2HSPA 4LD9K 3OB9A 2DL5A 5KE2A 1HK9A 2LCSA 1WHLA 3UPUA 3L2ZA 4IIOA 2HBPA 5GAOn 3L2QA 1W1FA 4Y92A 3PVLA 1B34B 4OMLA 1WHMA 2FRYA 4GLKA 4C8QA 5FWCA 1UG1A 3CCEA 1AWOA 1I5OB 3M55A 3OYFA 4YTLA 5HK0A 1LJOA 5A0LA 2KT1A 4A4HA 5CO7A 1TG0A 1U1SA 1NLOC 2E1HA 4RCCA 2FZCB 5GAMj 3EH1A 3SHWA 1YBYA 4A4FA 1MMAA 2IVWA 2D0QB 2CS7A 1GXIE 2DNUA 2E6NA 3H0HA 4Q5WA 2G6FX 2DIGA 2A37A 3M53A 3QSUA 1BIBA 2QQ9A 1NYFA 4Z89A 4M75A 3QDFA 5GMKe 1BBZA 1RL2A 3MEAA 1YHQT 3MP6A 2K7AA 4KULA 1Q82R 2D6FA 1G3SA 4PK4A 3FEOA 3O5ZA 2YT6A 7AT1B 1OX9A 5LJ5g 3ASKA 2QEXQ 5LJ5f 1QP3A 1G3WA 2QQRA 3OYGA 2LCLA 3NTIA 4FCYA 1F1BB 2EAYA 2VKNA 2LMJA 2FHDA 2QDYB 4J8OA 4C8QF 1ZLMA 3PGGA 3VYGA 3JB9J 5CKDA 2FPDA 1TXQA 3RESA 1HJDA 5D6YA 1FWZA 5IHKA 2K2MA 1ZA2B 4FT4A 3BW1A 3VS3A 3OYEA 3DB4A 2WSEE 4WF2A 5ECAA 2DETA 1VUBA 4F17A 2KI7A 3PMTA 1UFFA 4ME7A 3VYHB 3GP8A 1VQNQ 1KSWA 2JZ2A 2J6FA 4KUIA 1KD1U 1WX6A 1MMGA 2FYKA 1AOJA 5FU7B 5LJ3d 1QW1A 3CCQQ 4LNPA 2JMAA 4M75F 2H8HA 2MWOA 1I1JA 2EJFA 1C1AA 2CDTA 4M78B 4NL3A 4PJOB 4HKEA 3PTAA 2C0IA 3UDCA 2RMOA 3JB9G 2L2PA 4GLMA 1QCNA 2QEXT 3RKWA 2K2VA 1WQ7A 1ZSGA 3SD4A 2EQMA 1YJWT 3ULRB 2ATCB 1VQ9Q 2FZKB 3J80E 2XDBA 2X4YA 3RNJA 3NHNA 4FL6A 2K5IA 1WHJA 4MZMA 1OU8A 4PNOA 1UGVA 1YCSB 2XMFA 1CKBA 4AFQC 2GBQA 4QQGA 4OMFB 1M3AA 1BI3A 2J06A 5KE3A 2KR3A 3M59A 5KYWA 5IN1A 4BI3A 2LX7A 1Z9ZA 3PE0A 2JS2A 4A54A 2KK4A 4N4HA 3VV0A 1VYTA 3ME9A 4XTXA 2V26A 3G71A 4MZTA 2Y4YA 2GGRA 2BE7D 3A8MB 4HT8A 4M7DA 1X6OA 1PSEA 1TU0B 4BY6B 4E47A 1RI9A 1ZX6A 4PLIA 3F70A 3HFNA 4M7AB 1VQOQ 2P0KA 1VQNT 4HCCA 4LUEA 4KGVB 1Q81U 3SFMA 2F1LA 4M77C 1ABQA 5A2QE 3C4SA 2BUDA 4RMOA 1NJIU 1D1BA 1JO8A 3MP8A 3P8DA 2MK5A 1YITQ 2LT1A 3S6WA 1SSHA 3ER0A 1RAGB 4GY5A 3TSWA 3OYCA 3RERA 5GANj 3UATA 1WJSA 3DKMA 3SWNC 1SRMA 5GMKi 1YWOA 3FJ5A 4WTOB 5GAMh 2GFUA 3H6ZA 3VUZA 1IHVA 1TSFA 2EIFA 4X34A 2VGNA 2COZA 4FT2A 4A4KA 4FU6A 2G3RA 2RQVA 4XTUA 3GNFB 5IXBA 3M58A 2RQUA 2J7IA 1K9MC 1TUDA 4M77A 2AT1B 4OMMA 1EX4A 5DLQE 1VYUA 3PVQA 2DM1A 1LOJA 1WDXA 1N8RU 2ZAEA 2RHIA 2DL7A 3CCJT 2YLBA 1NM7A 1VIFA 4M78E 1KHIA 1QLYA 5CQXA 1DJ7B 4M7DF 2RHYA 3I35A 1KQSP 4B9WA 2LZ6B 4C92F 4MDXA 4CC4B 2FEIA 4QW2A 5CVIA 1NG2A 4FSSA 2O31A 2RI5A 1WXUA 1M1GA 3CMEQ 1M90C 2GQIA 2DLPA 3EH2A 1M2OA 2O88A 1YWPA 4ZN1A 1M3CA 4C0ZA 2R5MA 2IPOB 2YDLA 2M0OA 4OGEA 3CC4T 4J5YA 3M0RA 1HD3A 3G6EQ 1D09B 3GOXA 3OS5A 3KBGA 4A63B 1PKSA 3CMAQ 2AKKA 4F14A 1WIEA 5GAN2 4PFPA 3CC7T 5IHIA 2RHZA 2L0AA 1X2QA 1M5Q1 2KBTA 5KYUA 4JRQA 2JN0A 3KFVA 3QDRB 1ABOA 4LDXA 1FX7A 3HP9A 3NTKA 2JVVA 4XAXB 2KXDA 2XHCA 1WQWA 4M7AE 2KEAA 2JTMA 3M0SA 1TOVA 4M78G 2HQEA 1VQ6A 4PJOD 4E6RA 3CCLA 1S72Q 4C92G 2AZVA 1MMNA 2A28A 2A7YA 3TCJA 3L2VA 4F7UB 2O01E 2FRWA 5J26A 5J39A 1KC8R 4LD6A 1FMKA 3VKIA 4ZNXA 2E4HA 1J3TA 3M0UA 3GPLA 4IKFA 3X24B 1VQ7T 1VQPQ 1UUEA 4C0DC 3CMET 2K6DA 4BB7A 2XI9A 4ELYC 4J9EA 3EG9B 4C5IA 5LJ5e 1BI1A 3M57A 1U5SA 1SF9A 1TUGB 2KSSA 2KROA 2KDSA 3PFSA 2E5KA 3OYLA 3I56Q 3OYYA 3G6ET 3QBYA 1KG1A 5HKCA 5KYXA 1X6BA 1W2BA 3CMAT 1MNEA 3OYNA 4M7AG 3VRYA 4M7AD 1VQLA 1HSQA 2QK0A 1D3BA 3PIOA 1Q82C 3QWYA 5HY6A 2CP7A 4XK8E 5I2MA 5FLXE 1BCMA 3BFMA 1RADB 3E2UA 1X43A 2BTTA 3H0FA 3TU4K 1AEYA 3U23A 1YP5A 1XTDA 2LCCA 5GAOl 2HKQB 2JOYA 1RAEB 4RTYA 2E6ZA 3QUIA 1D1AA 2E3IA 3CC2T 2V8IA 2PVOB 5GANh 4BDYA 3C95A 2EBPA 3JCMh 2JM9A 2RNAA 1RI0A 3VU3C 4C0GA 1KIKA 1PM3A 3FRNA 2LNHB 4BE1A 2RJEA 4EMKC 1NE8A 4HCBA 4FIBA 1MNDA 3HSBA 3FDRA 2OJ2A 1YIJT 3BY7A 2WSCE 3MEVA 2KRMA 2LRQA 2JUFA 4J6YA 1ZSZA 1OU9A 3OYBA 1VQ4Q 3V8JA 3OBWA 4JPBW 1VQ8Q 3EGXA 1K0XA 2FVUA 3TQ7P 2D8JA 3GNGA 4F7UE 2K3BA 2RM4A 5C6SA 2ZPEB 1W2BS 4V2SA 2E10A 3E19A 3JV3A 1OEBA 1LPLA 1AZEA 4OMNA 2I2LA 4QVZA 1WI7A 2KVQG 2RH2A 3CD6A 5CIUA 2P4RA 4CRIA 3M0QA 4E7ZA 4EMKA 3X25B 3LGLA 3CCVA 1Y71A 3ZL7C 8ATCB 2CKKA 2PUKB 4C8QC 2JM8A 2HEQA 3RDVA 3REBB 1YJ9T 2IG0A 3BDLA 2QQAA 1NEBA 3EHQA 4FW1A 4Z8AA 4AT1B 1N6AA 5EG2A 1VQMT 3C12A 1PHTA 2RK1A 1WHGA 2E12A 3VUBA 1YHQQ 1ACMB 1QWFA 3CCRQ 1A0NB 2DXBA 3R6OA 4J9HA 5LJ5d 3MHXA 3REAB 3I55T 4J9CA 3EFOB 2NUZA 1KD1R 3RR6A 1M3BA 4F7UG 2DL8A 1QKXA 4E7SA 1QCFA 2O9SA 2ZPFB 3M0PA 2HSEB 4MZPA 1VQ4T 1VQ8T 4IURA 4L6V5 3TEEA 2MI6A 2XK0A 4II1A 4M75C 4XU1A 1OULA 3G4ST 2PQWA 3LX7A 2CZ0B 3EGUA 3UA7A 5HCKA 1BI0A 1R8OB 2P0PA 1M2VA 2QA4T 2RJCA 2BZYA 4CC7A 1WA7A 1K73R 1RACB 3NPFA 2K3YA 5GAMg 5GAMf 4PJLA 4EIKA 2OTLA 1TWBA 3CCQA 1PC0A 2DXCA 2QQSA 3CBOA 4RTVA 3FC3A 1OYXA 1Y07A 2X4WA 1V76A 3I5RA 3CCRT 5FROA 1K9MU 1B34A 3JSCA 3M56A 3FIFA 2DL3A 4HXJA 1NLPC 2LNVA 1GBQA 4IUUA 1E7OA 2O9VA 3CCSQ 3JB9H 1BI2A 1M30A 1I8FA 1YJWQ 2R5AA 1U1TA 2E70A 1VQ9A 4HVUA 5CK9A 1YJNA 3ZFJA 1WNLA 2EQJA 1NJIR 3A1PA 3TREA 3X28B 1TTHB 3CCUT 3GLXA 4RCBA 3H0IA 3JB9F 2YHTA 1EIFA 4QVCA 2QDLA 3EG3A 1M90U 4ANJA 4HCKA 2YLCA 3BE3A 2BKDN 8AT1B 2DTHA 2NLUA 2KQWA 5CKFA 4MDWA 2OTJT 1Q86C 4JDSA 1WXTA 2DILA 4KUDK 3CCEQ 3E1SA 1VQOA 3T9NA 2RD1A 1U8RA 4QKUA 4RG2A 2J6KA 2DERA 3I5SA 4OMOA 3OYHA 4DA4A 1BU1A 2CSQA 1V1CA 2P0QA 3OYKA 2EYWA 1GL5A 4LXCA 1YITA 1RAAB 2XKOC 4OVAA 2CREA 4PJMA 4J7FA 3OMGA 3N5BB 2EPDA 1W70A 4M7DC 3JCMQ 4TVRA 4PJNA 3CCST 9ATCB 1ZHIA 2DAQA 1TS9A 4XU0A 4KH1B 4C92C 2DRMA 2W10A 4VUBA 1C0MA 5CQYA 2DVEA 4PFOA 2O2OA 2CH4W 2P84A 2PNIA 1N9SA 2RB6A 1H3ZA 2XICA 1UJ0A 3C94A 2DYIA 4ELZC 2E3HA 2KGTA 5AT1B 1M1KR 1G8XA 1SKUB 2FO0A 1GRIA 1YI2A 2VXFA 1MGQA 1M9SA 5GJWB 1T3LA 2MF2A 4FSXA 3CCJQ 2VB6A 2EQUA 1Q7YR 3OW2S 3MP1A 1UDLA 2EKHA 5FU6C 5D7UA 2QXFA 4C5GA 4J9IA 4A4GA 2F2XA 3PMIA 4XTYA 2H3JA 1PG5B 3CCET 3OSSC 4M78A 4KGZB 5D6WA 2HL5C 1UGPB 4C92A 2DZCA 1GCQA 4JJDA 3MCAB 2PZ1A 4HT9A 2K3XA 5IHNA 3WVDB 2HL3A 4GBQA 1W4SA 4RTWA 1QKWA 4BY6C 1U3OA 4DOVA 2LX9A 4M75D 2HZYA 3JCMV 3CC4Q 2K5FA 1Q82U 4M77B 1OZ3A 4DBFA 4QVDA 3E9FA 2PVGB 2RA2A 4RUGA 2XDDA 2RK2A 4KRTA 5L8RE 5LJ3j 2NUTB 4A53A 3EGDA 2KAFA 5GAN8 3CC7Q 2OTLT 5LJ3g 1W2BP 1VA7A 3OYAA 5LJ3f 2AHJB 1FXXA 2BZ8A 5GANg 3SWNB 3DLLA 3JCMg 5GANf 1EFNA 3JCMf 2VC8A 2V8KA 3M0TA 4E7JA 2BE9B 2VASA 1BK2A 4RTXA 4RTZA 1ZUYA 1S1NA 2V8JA 2DBKA 1S72A 5GJVB 2YUQA 1K0SA 2O4XB 1NZ9A 2CH4A 3LYIA 3UT1A 1V29B 1Z9QA 2RN8A 4NS5A 4M7AA 4EDUA 2X4XA 5DLOA 1I0CA 2XD0A 2EYYA 3EG1A 1G3TA 4PJOE 4OMQA 5EC7A 5KYNA 4M78F 2X9HA 4PJOF 2YUOA 1G2BA 1VQ7Q 3L2UA 1VQ5A 2DIQA 4OP0A 2JT4A 2QGFB 4Y91A 3HRSA 3MO8A 1PRMC 2FL7A 2MMPA 3J7AF 1AZGB 1ARKA 2DEUA 2QQBA 1M27C 3JCMX 2X4JA 3CCMA 2KT8A 2RQRA 3VS0A 1UE9A 1MMDA 1K8AU 3OS2A 3I56A 1SSFA 4OB1B 3QO3A 1U06A 1WPYA 2RI3A 1UTIA 4OB3B 3EHRA 3CXCA 5GMKj 3RMQA 2AZSA 2E41A 2J05A 4DBQA 1NBEB 1O9SA 3EG0A 2CSIA 3X20B 1UECA 1IO6A 4Y28E 1D1CA 2IIMA 3IQLA 1K4US 2DKGA 2EWNA 2SEMA 3KXTA 4PJOG 5CKBA 1I4K1 4M7AF 2VUBA 2DO3A 1VQKA 2L89A 3RIRA 5GAMe 1PD1A 3CC2Q 1E6HA 2BZXA 4D6WA 2VYTA 3EFSA 1IXDA 3H9NA 2DYBA 2NUPB 4OMPA 5KYYA 2KRSA 1D3BB 2RQWA 4E2FB 1K73C 1X6GA 1BIAA 3A8OB 4ESRA 1WHHA 1YIJQ 2CUDA 2LQNA 4C0DB 3RBBB 2MIOA 2XU8A 3CPWA 4XQ3A 3DB3A 3A98A 3G71T 2K4YA 3CXCS 4FYYB 3A8GB 2ZPBB 3UA6A 3KUFA 2DVJA 1VYVA 2QTXA 3OMCA 5FWBA 3RKYA 2GNCA 1RLPC 1QVGA 1MV0B 3OYIA 3VS6A 2OAUA 3QHSA 4OF1A 4F7UA 1X2KA 1I07A 3P8HA 3HRTA 1Y96B 4M77D 3RUXA 2PTKA 4J6WA 2I0NA 3QZ9B 1ZSZC 1AD5A 2NWMA 3QKJA 1WJQA 2LP5A 1M1FA 2F2WA 2W0ZA 4X9CA 1RABB 5LJ3h 1YJ9Q 3G1JA 3EG9A 3OS0A 3EGXB 5I21A 3VJPA 1VQMQ 4FYXB 4BUGA 2DD4A 2CP5A 3JCMb 2GFAA 1YHQA 1VQ6Q 4D8KA 4R55A 3CCLQ 3BDUA 3QXEB 3CBPA 5HK3A 2ZZDA 4DBHA 1VOMA 4XU2A
chains in the Genus database with same CATH topology
2QASA 1YFNA 1OX9A 1OU8A 1TWBA 1ZSZA 1OU9A 1ZSZC 2QAZA 2NYSA 1ZSZB 1OX8A 1OULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAS A;  1YFN A;  1OX9 A;  1OU8 A;  1TWB A;  1ZSZ A;  1OU9 A;  1ZSZ C;  2QAZ A;  2NYS A;  1ZSZ B;  1OX8 A;  1OUL A; 
#chains in the Genus database with same CATH topology
 1D0X A;  5L23 A;  3I55 Q;  3JB9 I;  2CZ6 B;  5KCH A;  2FB7 A;  2XID A;  3MEU A;  4HA8 A;  4ZTJ A;  3CPW S;  3QPH A;  3S3N A;  3OBY A;  3LH5 A;  3QZ5 B;  2YSQ A;  4BE0 A;  1QMC A;  1Q86 U;  4P5N A;  4JZ3 A;  3D7S B;  2HQX A;  3G4S Q;  3P8B B;  1QVG S;  2X35 A;  1RLQ C;  1K9M R;  4F7U F;  1PD0 A;  1NYG A;  5I22 A;  2D0N A;  4EMH A;  5A0D A;  1UEB A;  2QA4 Q;  1X01 A;  1H92 A;  4C5E A;  2B86 A;  2KRN A;  4WCI A;  1UHF A;  3OW2 P;  2JTF A;  4BAC A;  1O75 A;  3LH0 A;  4E7I A;  1JJ2 A;  3JCM c;  3OYJ A;  5GAM d;  2COY A;  1VIE A;  2BIV A;  1OPK A;  1VQL Q;  2PU9 B;  4N0A C;  4JLI A;  2VVK A;  1AT1 B;  3LGF A;  5IXF A;  2F2V A;  3MJX A;  4QQ6 A;  5GMK h;  3QG1 A;  1M1K C;  4C8Q B;  1RUW A;  5FRM A;  4JRK A;  1WGS A;  2J6O A;  2ED0 A;  3I9Q A;  3PIP A;  4J9F A;  1VQ6 T;  2JS0 A;  4QT7 A;  3CCL T;  2DD5 A;  1Q7Y C;  1QQJ A;  4J7I A;  1PCX A;  1VQK T;  3GIB A;  3H41 A;  2YRC A;  2PUO B;  2QEX A;  2A3L A;  1UGS B;  2YWW A;  1TH7 A;  2AIR B;  3QJ6 A;  4FYV B;  4Z02 A;  1SRL A;  2E5Q A;  5LL6 S;  3M5A A;  5GAN e;  3JCM e;  1MHN A;  4NL2 A;  3CCU Q;  2X3X D;  3WXM B;  3QYG B;  1UGQ B;  1JXO A;  2LQ8 A;  4N0A A;  4DQ2 A;  4DEY A;  1JB0 E;  2YUP A;  1H8K A;  2JXB A;  3MKD A;  5I2S A;  4BE2 A;  3OQ5 A;  3VS7 A;  1SHG A;  3CQT A;  2PVD B;  1PWT A;  4K11 A;  4M75 B;  1OOT A;  5CAI A;  1AWX A;  4AFS C;  4PFZ A;  1G5V A;  2OTJ Q;  4IUQ A;  1EZZ B;  1GCP A;  1JJ2 S;  3C0C A;  4XTZ A;  5CR2 A;  2QAS A;  1KFZ A;  3LLR A;  2DFU A;  2DE0 X;  4RTT A;  4IIM A;  2A36 A;  1VQN A;  2JTE A;  4L59 A;  1AWJ A;  2EJ9 A;  1BB9 A;  3SDZ A;  1VQL T;  2K5L A;  3X26 B;  3L2W A;  1R77 A;  3CD6 Q;  3EFO A;  2XDP A;  2A08 A;  5GMK l;  2AK5 A;  2KYM A;  1JXM A;  2QTV A;  2SRC A;  3OYM A;  1WHK A;  4DEX A;  3A5Z B;  3OA6 A;  3J81 E;  3CCV Q;  1CKA A;  4J9G A;  2HKN A;  3M4G A;  2EVR A;  3NTH A;  2C06 A;  2QAZ A;  2HNI A;  3EAE A;  2L3P A;  1Q81 R;  2MPX C;  2Y90 A;  5LJ5 j;  2EKO A;  2Z0W A;  1I5L A;  2X3W D;  1HXD A;  2EW3 A;  3OYD A;  5KCO A;  2KE9 A;  4HVV A;  2EQK A;  1QVP A;  3MPU B;  2AKL A;  2GF7 A;  4LUD A;  3CPF A;  1PRL C;  1MUZ A;  3EG2 A;  4C8Q E;  4E7H A;  4OGC A;  3CCJ A;  1ZA1 B;  2CP2 A;  2ESW A;  5GAO r;  2EYZ A;  3QWX X;  2GQV A;  1IRX A;  3OW2 A;  3LWI A;  3WVE B;  2OI3 A;  2R57 A;  3DLM A;  2RHX A;  2KYB A;  2E65 A;  2CZ7 B;  1C6V X;  3QII A;  4JJC A;  4RKU E;  1R0B G;  3OSV A;  1UHC A;  2EGC A;  3QJY A;  1QVF A;  3L1A A;  3LW5 E;  2L3S A;  3CD6 T;  2ZPI B;  4LDW A;  1N8R R;  3CC4 A;  1T0H A;  3TSZ A;  2DJZ A;  2HBW A;  4B6M A;  1X27 A;  3SEM A;  4ZGE B;  1M8M A;  2B8A A;  2FPF A;  1Y0M A;  5FU7 C;  3JCM J;  1OPL A;  4PLL A;  4QQD A;  4FM4 B;  1ZUK A;  5KYW B;  4NOY A;  3CCV T;  1W6X A;  4JZ4 A;  4M75 E;  3CXC P;  3CC7 A;  2RJD A;  2YRV A;  2QGG A;  1KC8 C;  2OTL Q;  3OS1 A;  4L5G A;  2XG8 D;  2Y4X A;  5GAN d;  4M78 C;  2HQH A;  4PJO C;  3JCM d;  3V7S A;  1GCQ C;  4UC4 A;  4M7D B;  3CEY A;  4HCZ A;  2HDA A;  3QYH B;  5I11 A;  4C8Q G;  2KNB B;  3UF4 A;  4C8Q D;  4C92 B;  4FW2 A;  1K8A R;  2ZPH B;  2F5K A;  5GAN 6;  4MMK A;  1H3H A;  1RAH B;  2F5T X;  3HRU A;  3Q1J A;  1XOV A;  3JB9 D;  1B07 A;  4RTU A;  5KH6 A;  1X75 C;  5GAO m;  3MEW A;  1M8V A;  1YN8 A;  3NGP A;  2ECZ A;  5GAN 3;  1K73 U;  1M4Z A;  1YJN Q;  1AHJ B;  1OV3 A;  3VS1 A;  4O5V A;  2MCN A;  1FMV A;  2H3E B;  3EGD B;  1XQH A;  1D0Y A;  5IAY A;  1VQ7 A;  2M9U A;  4CI0 C;  2DTO A;  5FU6 B;  1FMW A;  2L3Q A;  5GAN 4;  1KQ1 A;  4PJO A;  2EJG A;  4ORZ A;  3CME A;  1UB4 A;  4ZTF A;  2K57 A;  1QVF S;  3S3O A;  4OB0 B;  4DBR A;  2K79 A;  1XNI A;  3ZEH A;  1PKT A;  2L8D A;  2DK3 A;  4M75 G;  4IUP A;  2CP6 A;  4AG2 C;  4M7A C;  1N5Z A;  3CPW P;  3OY9 A;  3G6E A;  4KBM B;  1B3Q A;  4LE9 A;  4LN2 A;  3M9Q A;  4ZGD B;  1IZ6 A;  4LDV A;  2K9G A;  4LDY A;  2ZCF B;  1KHC A;  4EMG A;  4ZN3 A;  4BI8 B;  3CMA A;  1T0J A;  1LVK A;  3VS5 A;  3VS4 A;  4JS5 A;  3V7C A;  2GTO A;  1ZBX A;  3GBQ A;  3CCQ T;  3V7R A;  4LDU A;  1QVG P;  3UWN A;  2DPP B;  2V1Q A;  2RO0 A;  4B9X A;  1G83 A;  2ZGW A;  1ZQ1 A;  2DTI A;  4X9D A;  1RAF B;  2COW A;  3O8V A;  5J3B A;  1PSF A;  2ABL A;  1UJY A;  3RKX A;  2L5Q A;  4F16 A;  1BCO A;  5GAO p;  5IH2 A;  3CC2 A;  3GF5 A;  1Q95 G;  3RMS A;  4AFZ C;  1Y57 A;  1HYO A;  1VQ9 T;  1YJN T;  2GTJ A;  5DY9 A;  1YFN A;  2FZG B;  3S3M A;  2D9T A;  2EGA A;  3INZ A;  2JJ9 A;  1FYN A;  3FLG A;  1VQP A;  4MML A;  2R58 A;  4CC2 A;  1X69 A;  6AT1 B;  5KYU B;  2NUT A;  1YI2 Q;  4BDZ A;  1YCY A;  5LJ5 h;  4M7D E;  3A8H B;  1N9R A;  1YIJ A;  2P4T A;  2RF0 A;  5FW9 A;  1T3S A;  3V8L A;  4C92 E;  1PNJ A;  1SPK A;  2HD0 A;  2M16 A;  3HL8 A;  3SWN A;  4C0F A;  3G71 Q;  2ED1 A;  1BYM A;  4A4E A;  2RJF A;  2RI2 A;  4AG1 C;  1JQQ A;  1GFC A;  4HVW A;  1E6G A;  2DF6 A;  1GFD A;  2JNG A;  3M4Y A;  1K76 A;  4J9D A;  1VQO T;  2MAM A;  1JBM A;  2WAC A;  1IGQ A;  3G7Z A;  1H64 1;  1D0Z A;  4XTW A;  2GCX A;  5M9O A;  4KH0 B;  2O4X A;  5KYY B;  4PKC C;  5CKE A;  2JMC A;  2CT4 A;  1YIT T;  2LQW A;  4D8D A;  1M1K U;  2NYS A;  2OAW A;  5FRN A;  2M02 A;  2LVM A;  1KK7 A;  1KD1 C;  2D8H A;  1Q86 R;  4AFU C;  1JJ2 P;  4XTV A;  1QCO A;  1IB8 A;  2EYQ A;  1NEG A;  3URG A;  1Q7Y U;  4E7K A;  1WJR A;  3ZBD A;  3PT9 A;  4JUV A;  2QG9 B;  4M77 E;  1YJ9 A;  2DZ9 A;  1AWW A;  2KXC A;  1AVZ C;  4JLG A;  1JEG A;  4M77 F;  1UGR B;  2CP0 A;  2EFI A;  1VQM A;  5GMK m;  2LTO A;  5KYX B;  2LDM A;  4M7D G;  5CCA A;  4M7D D;  2DMO A;  4M78 D;  3V8K A;  2M51 A;  4CC3 A;  3FJP A;  1KQ2 A;  2KY9 A;  4C92 D;  3E9G A;  4N4G A;  4KT0 E;  1YI2 T;  3I55 A;  1KJW A;  5IT9 E;  3VRZ A;  4ZGJ B;  4BD3 A;  3AHU A;  3HTR A;  1OZ2 A;  4X1V A;  2QYZ A;  1BKB A;  4PJJ A;  2DX1 A;  3L2R A;  1VQ4 A;  1JU5 C;  1VQ5 Q;  2YUN A;  5D6X A;  1VQ8 A;  2HCK A;  4IUV A;  3CBM A;  2VGM A;  2LC4 A;  2QI2 A;  2FG0 A;  1N27 A;  3JRZ A;  4OB2 B;  3FB9 A;  3G4S A;  2EYX A;  2ROL A;  5GAN 5;  2ZPG B;  1K9A A;  3CCM Q;  1OX8 A;  2DA9 A;  4JJN K;  4FYW B;  2FPE A;  2QA4 A;  3H8Z A;  2JW4 A;  1R0C B;  3M54 A;  2F69 A;  2HMA A;  5GAO q;  4J83 A;  2LT4 A;  3PNW C;  3LWH A;  4R56 A;  4M77 G;  4DOW A;  1OQK A;  1QWE A;  2C0O A;  2NUP A;  5A0G A;  2L3R A;  4N4I A;  1WLP B;  1WFW A;  1Q81 C;  4R0K A;  4IUT A;  2DRK A;  2V1R A;  2VV5 A;  1NJI C;  1G3Y A;  4E7L A;  1ZSZ B;  2A0F B;  3THK A;  1P92 A;  4J9B A;  3R6N A;  3AT1 B;  2LJ1 A;  4BI4 A;  3JAM E;  3HHT B;  2LJ3 A;  2LJ0 A;  4Z88 A;  1Y7X A;  3CCR A;  4JRP A;  1K1Z A;  1S72 T;  1GBR A;  1B7T A;  1WYX A;  1VQK Q;  2DXT A;  2RPN A;  1LNX A;  2X51 A;  4ATO A;  2CYZ B;  4F04 B;  2DJQ A;  3JCM P;  2EGE A;  1RAI B;  1OI1 A;  1KQS A;  2E64 A;  3TVT A;  5AYF A;  4EMK B;  5DM7 R;  2YXY A;  1NPP A;  3CCU A;  2VXE A;  4EPC A;  2M0Y A;  1LCK A;  1VQ5 T;  1VQP T;  4RG8 A;  1Y96 A;  3HKS A;  2C0T A;  4M4Z A;  4O6J A;  2VWF A;  4JRI A;  1N8R C;  1SHF A;  4JJB A;  4PL6 A;  4C5H A;  1ZUU A;  1XJW B;  2YRD A;  3L42 A;  2CUB A;  3CCM T;  3HFO A;  2LQK A;  2EQI A;  2ENM A;  4JS4 A;  1IGU A;  2DL4 A;  2OTJ A;  5CKH A;  3I56 T;  2CT3 A;  2RHU A;  2ROT A;  4J6X A;  3VS2 A;  2CP3 A;  2MYS A;  1WZO A;  1CSK A;  2M1H A;  2WSF E;  2CZ1 B;  2KMT A;  3A8L B;  3SB2 A;  3MET A;  1JRI A;  1SEM A;  1MV3 A;  1WXB A;  1TUC A;  3EFR A;  1KC8 U;  3HPW A;  1K8A C;  1M90 R;  1QVF P;  4XU3 A;  5GAN 7;  2OX7 A;  1IHW A;  1IRE B;  4KGX B;  3NFC A;  3JCM W;  1M2V B;  2CGH A;  1YNZ A;  2DBM A;  3CCS A;  1KQS S;  2MWP A;  5C0M A;  1YJW A;  5LJ3 e;  1SG5 A;  2HAX A;  1NPR A;  1I81 A;  2D1X A;  3NMZ C;  2DXU A;  2RQT A;  1QP2 A;  2DEQ A;  1ZBJ A;  2MOX A;  4AMC A;  2HSP A;  4LD9 K;  3OB9 A;  2DL5 A;  5KE2 A;  1HK9 A;  2LCS A;  1WHL A;  3UPU A;  3L2Z A;  4IIO A;  2HBP A;  5GAO n;  3L2Q A;  1W1F A;  4Y92 A;  3PVL A;  1B34 B;  4OML A;  1WHM A;  2FRY A;  4GLK A;  4C8Q A;  5FWC A;  1UG1 A;  3CCE A;  1AWO A;  1I5O B;  3M55 A;  3OYF A;  4YTL A;  5HK0 A;  1LJO A;  5A0L A;  2KT1 A;  4A4H A;  5CO7 A;  1TG0 A;  1U1S A;  1NLO C;  2E1H A;  4RCC A;  2FZC B;  5GAM j;  3EH1 A;  3SHW A;  1YBY A;  4A4F A;  1MMA A;  2IVW A;  2D0Q B;  2CS7 A;  1GXI E;  2DNU A;  2E6N A;  3H0H A;  4Q5W A;  2G6F X;  2DIG A;  2A37 A;  3M53 A;  3QSU A;  1BIB A;  2QQ9 A;  1NYF A;  4Z89 A;  4M75 A;  3QDF A;  5GMK e;  1BBZ A;  1RL2 A;  3MEA A;  1YHQ T;  3MP6 A;  2K7A A;  4KUL A;  1Q82 R;  2D6F A;  1G3S A;  4PK4 A;  3FEO A;  3O5Z A;  2YT6 A;  7AT1 B;  1OX9 A;  5LJ5 g;  3ASK A;  2QEX Q;  5LJ5 f;  1QP3 A;  1G3W A;  2QQR A;  3OYG A;  2LCL A;  3NTI A;  4FCY A;  1F1B B;  2EAY A;  2VKN A;  2LMJ A;  2FHD A;  2QDY B;  4J8O A;  4C8Q F;  1ZLM A;  3PGG A;  3VYG A;  3JB9 J;  5CKD A;  2FPD A;  1TXQ A;  3RES A;  1HJD A;  5D6Y A;  1FWZ A;  5IHK A;  2K2M A;  1ZA2 B;  4FT4 A;  3BW1 A;  3VS3 A;  3OYE A;  3DB4 A;  2WSE E;  4WF2 A;  5ECA A;  2DET A;  1VUB A;  4F17 A;  2KI7 A;  3PMT A;  1UFF A;  4ME7 A;  3VYH B;  3GP8 A;  1VQN Q;  1KSW A;  2JZ2 A;  2J6F A;  4KUI A;  1KD1 U;  1WX6 A;  1MMG A;  2FYK A;  1AOJ A;  5FU7 B;  5LJ3 d;  1QW1 A;  3CCQ Q;  4LNP A;  2JMA A;  4M75 F;  2H8H A;  2MWO A;  1I1J A;  2EJF A;  1C1A A;  2CDT A;  4M78 B;  4NL3 A;  4PJO B;  4HKE A;  3PTA A;  2C0I A;  3UDC A;  2RMO A;  3JB9 G;  2L2P A;  4GLM A;  1QCN A;  2QEX T;  3RKW A;  2K2V A;  1WQ7 A;  1ZSG A;  3SD4 A;  2EQM A;  1YJW T;  3ULR B;  2ATC B;  1VQ9 Q;  2FZK B;  3J80 E;  2XDB A;  2X4Y A;  3RNJ A;  3NHN A;  4FL6 A;  2K5I A;  1WHJ A;  4MZM A;  1OU8 A;  4PNO A;  1UGV A;  1YCS B;  2XMF A;  1CKB A;  4AFQ C;  2GBQ A;  4QQG A;  4OMF B;  1M3A A;  1BI3 A;  2J06 A;  5KE3 A;  2KR3 A;  3M59 A;  5KYW A;  5IN1 A;  4BI3 A;  2LX7 A;  1Z9Z A;  3PE0 A;  2JS2 A;  4A54 A;  2KK4 A;  4N4H A;  3VV0 A;  1VYT A;  3ME9 A;  4XTX A;  2V26 A;  3G71 A;  4MZT A;  2Y4Y A;  2GGR A;  2BE7 D;  3A8M B;  4HT8 A;  4M7D A;  1X6O A;  1PSE A;  1TU0 B;  4BY6 B;  4E47 A;  1RI9 A;  1ZX6 A;  4PLI A;  3F70 A;  3HFN A;  4M7A B;  1VQO Q;  2P0K A;  1VQN T;  4HCC A;  4LUE A;  4KGV B;  1Q81 U;  3SFM A;  2F1L A;  4M77 C;  1ABQ A;  5A2Q E;  3C4S A;  2BUD A;  4RMO A;  1NJI U;  1D1B A;  1JO8 A;  3MP8 A;  3P8D A;  2MK5 A;  1YIT Q;  2LT1 A;  3S6W A;  1SSH A;  3ER0 A;  1RAG B;  4GY5 A;  3TSW A;  3OYC A;  3RER A;  5GAN j;  3UAT A;  1WJS A;  3DKM A;  3SWN C;  1SRM A;  5GMK i;  1YWO A;  3FJ5 A;  4WTO B;  5GAM h;  2GFU A;  3H6Z A;  3VUZ A;  1IHV A;  1TSF A;  2EIF A;  4X34 A;  2VGN A;  2COZ A;  4FT2 A;  4A4K A;  4FU6 A;  2G3R A;  2RQV A;  4XTU A;  3GNF B;  5IXB A;  3M58 A;  2RQU A;  2J7I A;  1K9M C;  1TUD A;  4M77 A;  2AT1 B;  4OMM A;  1EX4 A;  5DLQ E;  1VYU A;  3PVQ A;  2DM1 A;  1LOJ A;  1WDX A;  1N8R U;  2ZAE A;  2RHI A;  2DL7 A;  3CCJ T;  2YLB A;  1NM7 A;  1VIF A;  4M78 E;  1KHI A;  1QLY A;  5CQX A;  1DJ7 B;  4M7D F;  2RHY A;  3I35 A;  1KQS P;  4B9W A;  2LZ6 B;  4C92 F;  4MDX A;  4CC4 B;  2FEI A;  4QW2 A;  5CVI A;  1NG2 A;  4FSS A;  2O31 A;  2RI5 A;  1WXU A;  1M1G A;  3CME Q;  1M90 C;  2GQI A;  2DLP A;  3EH2 A;  1M2O A;  2O88 A;  1YWP A;  4ZN1 A;  1M3C A;  4C0Z A;  2R5M A;  2IPO B;  2YDL A;  2M0O A;  4OGE A;  3CC4 T;  4J5Y A;  3M0R A;  1HD3 A;  3G6E Q;  1D09 B;  3GOX A;  3OS5 A;  3KBG A;  4A63 B;  1PKS A;  3CMA Q;  2AKK A;  4F14 A;  1WIE A;  5GAN 2;  4PFP A;  3CC7 T;  5IHI A;  2RHZ A;  2L0A A;  1X2Q A;  1M5Q 1;  2KBT A;  5KYU A;  4JRQ A;  2JN0 A;  3KFV A;  3QDR B;  1ABO A;  4LDX A;  1FX7 A;  3HP9 A;  3NTK A;  2JVV A;  4XAX B;  2KXD A;  2XHC A;  1WQW A;  4M7A E;  2KEA A;  2JTM A;  3M0S A;  1TOV A;  4M78 G;  2HQE A;  1VQ6 A;  4PJO D;  4E6R A;  3CCL A;  1S72 Q;  4C92 G;  2AZV A;  1MMN A;  2A28 A;  2A7Y A;  3TCJ A;  3L2V A;  4F7U B;  2O01 E;  2FRW A;  5J26 A;  5J39 A;  1KC8 R;  4LD6 A;  1FMK A;  3VKI A;  4ZNX A;  2E4H A;  1J3T A;  3M0U A;  3GPL A;  4IKF A;  3X24 B;  1VQ7 T;  1VQP Q;  1UUE A;  4C0D C;  3CME T;  2K6D A;  4BB7 A;  2XI9 A;  4ELY C;  4J9E A;  3EG9 B;  4C5I A;  5LJ5 e;  1BI1 A;  3M57 A;  1U5S A;  1SF9 A;  1TUG B;  2KSS A;  2KRO A;  2KDS A;  3PFS A;  2E5K A;  3OYL A;  3I56 Q;  3OYY A;  3G6E T;  3QBY A;  1KG1 A;  5HKC A;  5KYX A;  1X6B A;  1W2B A;  3CMA T;  1MNE A;  3OYN A;  4M7A G;  3VRY A;  4M7A D;  1VQL A;  1HSQ A;  2QK0 A;  1D3B A;  3PIO A;  1Q82 C;  3QWY A;  5HY6 A;  2CP7 A;  4XK8 E;  5I2M A;  5FLX E;  1BCM A;  3BFM A;  1RAD B;  3E2U A;  1X43 A;  2BTT A;  3H0F A;  3TU4 K;  1AEY A;  3U23 A;  1YP5 A;  1XTD A;  2LCC A;  5GAO l;  2HKQ B;  2JOY A;  1RAE B;  4RTY A;  2E6Z A;  3QUI A;  1D1A A;  2E3I A;  3CC2 T;  2V8I A;  2PVO B;  5GAN h;  4BDY A;  3C95 A;  2EBP A;  3JCM h;  2JM9 A;  2RNA A;  1RI0 A;  3VU3 C;  4C0G A;  1KIK A;  1PM3 A;  3FRN A;  2LNH B;  4BE1 A;  2RJE A;  4EMK C;  1NE8 A;  4HCB A;  4FIB A;  1MND A;  3HSB A;  3FDR A;  2OJ2 A;  1YIJ T;  3BY7 A;  2WSC E;  3MEV A;  2KRM A;  2LRQ A;  2JUF A;  4J6Y A;  1ZSZ A;  1OU9 A;  3OYB A;  1VQ4 Q;  3V8J A;  3OBW A;  4JPB W;  1VQ8 Q;  3EGX A;  1K0X A;  2FVU A;  3TQ7 P;  2D8J A;  3GNG A;  4F7U E;  2K3B A;  2RM4 A;  5C6S A;  2ZPE B;  1W2B S;  4V2S A;  2E10 A;  3E19 A;  3JV3 A;  1OEB A;  1LPL A;  1AZE A;  4OMN A;  2I2L A;  4QVZ A;  1WI7 A;  2KVQ G;  2RH2 A;  3CD6 A;  5CIU A;  2P4R A;  4CRI A;  3M0Q A;  4E7Z A;  4EMK A;  3X25 B;  3LGL A;  3CCV A;  1Y71 A;  3ZL7 C;  8ATC B;  2CKK A;  2PUK B;  4C8Q C;  2JM8 A;  2HEQ A;  3RDV A;  3REB B;  1YJ9 T;  2IG0 A;  3BDL A;  2QQA A;  1NEB A;  3EHQ A;  4FW1 A;  4Z8A A;  4AT1 B;  1N6A A;  5EG2 A;  1VQM T;  3C12 A;  1PHT A;  2RK1 A;  1WHG A;  2E12 A;  3VUB A;  1YHQ Q;  1ACM B;  1QWF A;  3CCR Q;  1A0N B;  2DXB A;  3R6O A;  4J9H A;  5LJ5 d;  3MHX A;  3REA B;  3I55 T;  4J9C A;  3EFO B;  2NUZ A;  1KD1 R;  3RR6 A;  1M3B A;  4F7U G;  2DL8 A;  1QKX A;  4E7S A;  1QCF A;  2O9S A;  2ZPF B;  3M0P A;  2HSE B;  4MZP A;  1VQ4 T;  1VQ8 T;  4IUR A;  4L6V 5;  3TEE A;  2MI6 A;  2XK0 A;  4II1 A;  4M75 C;  4XU1 A;  1OUL A;  3G4S T;  2PQW A;  3LX7 A;  2CZ0 B;  3EGU A;  3UA7 A;  5HCK A;  1BI0 A;  1R8O B;  2P0P A;  1M2V A;  2QA4 T;  2RJC A;  2BZY A;  4CC7 A;  1WA7 A;  1K73 R;  1RAC B;  3NPF A;  2K3Y A;  5GAM g;  5GAM f;  4PJL A;  4EIK A;  2OTL A;  1TWB A;  3CCQ A;  1PC0 A;  2DXC A;  2QQS A;  3CBO A;  4RTV A;  3FC3 A;  1OYX A;  1Y07 A;  2X4W A;  1V76 A;  3I5R A;  3CCR T;  5FRO A;  1K9M U;  1B34 A;  3JSC A;  3M56 A;  3FIF A;  2DL3 A;  4HXJ A;  1NLP C;  2LNV A;  1GBQ A;  4IUU A;  1E7O A;  2O9V A;  3CCS Q;  3JB9 H;  1BI2 A;  1M30 A;  1I8F A;  1YJW Q;  2R5A A;  1U1T A;  2E70 A;  1VQ9 A;  4HVU A;  5CK9 A;  1YJN A;  3ZFJ A;  1WNL A;  2EQJ A;  1NJI R;  3A1P A;  3TRE A;  3X28 B;  1TTH B;  3CCU T;  3GLX A;  4RCB A;  3H0I A;  3JB9 F;  2YHT A;  1EIF A;  4QVC A;  2QDL A;  3EG3 A;  1M90 U;  4ANJ A;  4HCK A;  2YLC A;  3BE3 A;  2BKD N;  8AT1 B;  2DTH A;  2NLU A;  2KQW A;  5CKF A;  4MDW A;  2OTJ T;  1Q86 C;  4JDS A;  1WXT A;  2DIL A;  4KUD K;  3CCE Q;  3E1S A;  1VQO A;  3T9N A;  2RD1 A;  1U8R A;  4QKU A;  4RG2 A;  2J6K A;  2DER A;  3I5S A;  4OMO A;  3OYH A;  4DA4 A;  1BU1 A;  2CSQ A;  1V1C A;  2P0Q A;  3OYK A;  2EYW A;  1GL5 A;  4LXC A;  1YIT A;  1RAA B;  2XKO C;  4OVA A;  2CRE A;  4PJM A;  4J7F A;  3OMG A;  3N5B B;  2EPD A;  1W70 A;  4M7D C;  3JCM Q;  4TVR A;  4PJN A;  3CCS T;  9ATC B;  1ZHI A;  2DAQ A;  1TS9 A;  4XU0 A;  4KH1 B;  4C92 C;  2DRM A;  2W10 A;  4VUB A;  1C0M A;  5CQY A;  2DVE A;  4PFO A;  2O2O A;  2CH4 W;  2P84 A;  2PNI A;  1N9S A;  2RB6 A;  1H3Z A;  2XIC A;  1UJ0 A;  3C94 A;  2DYI A;  4ELZ C;  2E3H A;  2KGT A;  5AT1 B;  1M1K R;  1G8X A;  1SKU B;  2FO0 A;  1GRI A;  1YI2 A;  2VXF A;  1MGQ A;  1M9S A;  5GJW B;  1T3L A;  2MF2 A;  4FSX A;  3CCJ Q;  2VB6 A;  2EQU A;  1Q7Y R;  3OW2 S;  3MP1 A;  1UDL A;  2EKH A;  5FU6 C;  5D7U A;  2QXF A;  4C5G A;  4J9I A;  4A4G A;  2F2X A;  3PMI A;  4XTY A;  2H3J A;  1PG5 B;  3CCE T;  3OSS C;  4M78 A;  4KGZ B;  5D6W A;  2HL5 C;  1UGP B;  4C92 A;  2DZC A;  1GCQ A;  4JJD A;  3MCA B;  2PZ1 A;  4HT9 A;  2K3X A;  5IHN A;  3WVD B;  2HL3 A;  4GBQ A;  1W4S A;  4RTW A;  1QKW A;  4BY6 C;  1U3O A;  4DOV A;  2LX9 A;  4M75 D;  2HZY A;  3JCM V;  3CC4 Q;  2K5F A;  1Q82 U;  4M77 B;  1OZ3 A;  4DBF A;  4QVD A;  3E9F A;  2PVG B;  2RA2 A;  4RUG A;  2XDD A;  2RK2 A;  4KRT A;  5L8R E;  5LJ3 j;  2NUT B;  4A53 A;  3EGD A;  2KAF A;  5GAN 8;  3CC7 Q;  2OTL T;  5LJ3 g;  1W2B P;  1VA7 A;  3OYA A;  5LJ3 f;  2AHJ B;  1FXX A;  2BZ8 A;  5GAN g;  3SWN B;  3DLL A;  3JCM g;  5GAN f;  1EFN A;  3JCM f;  2VC8 A;  2V8K A;  3M0T A;  4E7J A;  2BE9 B;  2VAS A;  1BK2 A;  4RTX A;  4RTZ A;  1ZUY A;  1S1N A;  2V8J A;  2DBK A;  1S72 A;  5GJV B;  2YUQ A;  1K0S A;  2O4X B;  1NZ9 A;  2CH4 A;  3LYI A;  3UT1 A;  1V29 B;  1Z9Q A;  2RN8 A;  4NS5 A;  4M7A A;  4EDU A;  2X4X A;  5DLO A;  1I0C A;  2XD0 A;  2EYY A;  3EG1 A;  1G3T A;  4PJO E;  4OMQ A;  5EC7 A;  5KYN A;  4M78 F;  2X9H A;  4PJO F;  2YUO A;  1G2B A;  1VQ7 Q;  3L2U A;  1VQ5 A;  2DIQ A;  4OP0 A;  2JT4 A;  2QGF B;  4Y91 A;  3HRS A;  3MO8 A;  1PRM C;  2FL7 A;  2MMP A;  3J7A F;  1AZG B;  1ARK A;  2DEU A;  2QQB A;  1M27 C;  3JCM X;  2X4J A;  3CCM A;  2KT8 A;  2RQR A;  3VS0 A;  1UE9 A;  1MMD A;  1K8A U;  3OS2 A;  3I56 A;  1SSF A;  4OB1 B;  3QO3 A;  1U06 A;  1WPY A;  2RI3 A;  1UTI A;  4OB3 B;  3EHR A;  3CXC A;  5GMK j;  3RMQ A;  2AZS A;  2E41 A;  2J05 A;  4DBQ A;  1NBE B;  1O9S A;  3EG0 A;  2CSI A;  3X20 B;  1UEC A;  1IO6 A;  4Y28 E;  1D1C A;  2IIM A;  3IQL A;  1K4U S;  2DKG A;  2EWN A;  2SEM A;  3KXT A;  4PJO G;  5CKB A;  1I4K 1;  4M7A F;  2VUB A;  2DO3 A;  1VQK A;  2L89 A;  3RIR A;  5GAM e;  1PD1 A;  3CC2 Q;  1E6H A;  2BZX A;  4D6W A;  2VYT A;  3EFS A;  1IXD A;  3H9N A;  2DYB A;  2NUP B;  4OMP A;  5KYY A;  2KRS A;  1D3B B;  2RQW A;  4E2F B;  1K73 C;  1X6G A;  1BIA A;  3A8O B;  4ESR A;  1WHH A;  1YIJ Q;  2CUD A;  2LQN A;  4C0D B;  3RBB B;  2MIO A;  2XU8 A;  3CPW A;  4XQ3 A;  3DB3 A;  3A98 A;  3G71 T;  2K4Y A;  3CXC S;  4FYY B;  3A8G B;  2ZPB B;  3UA6 A;  3KUF A;  2DVJ A;  1VYV A;  2QTX A;  3OMC A;  5FWB A;  3RKY A;  2GNC A;  1RLP C;  1QVG A;  1MV0 B;  3OYI A;  3VS6 A;  2OAU A;  3QHS A;  4OF1 A;  4F7U A;  1X2K A;  1I07 A;  3P8H A;  3HRT A;  1Y96 B;  4M77 D;  3RUX A;  2PTK A;  4J6W A;  2I0N A;  3QZ9 B;  1ZSZ C;  1AD5 A;  2NWM A;  3QKJ A;  1WJQ A;  2LP5 A;  1M1F A;  2F2W A;  2W0Z A;  4X9C A;  1RAB B;  5LJ3 h;  1YJ9 Q;  3G1J A;  3EG9 A;  3OS0 A;  3EGX B;  5I21 A;  3VJP A;  1VQM Q;  4FYX B;  4BUG A;  2DD4 A;  2CP5 A;  3JCM b;  2GFA A;  1YHQ A;  1VQ6 Q;  4D8K A;  4R55 A;  3CCL Q;  3BDU A;  3QXE B;  3CBP A;  5HK3 A;  2ZZD A;  4DBH A;  1VOM A;  4XU2 A; 
#chains in the Genus database with same CATH homology
 2QAS A;  1YFN A;  1OX9 A;  1OU8 A;  1TWB A;  1ZSZ A;  1OU9 A;  1ZSZ C;  2QAZ A;  2NYS A;  1ZSZ B;  1OX8 A;  1OUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...