2QAZA

Structure of c. crescentus sspb ortholog
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
EDLMQYEAMAQDALRGVVKAALKKAAAPGGLPEPHHLYITFKTKAAGVSGPQDLLSKYPDEMTIVLQHQYWDLAPGETFFSVTLKFGGQPKRLSVPYAALTRFYDPSVQFALQFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of C. crescentus SspB ortholog
rcsb
source organism Caulobacter vibrioides
molecule tags Hydrolase activator
molecule keywords SspB Protein
total genus 25
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 2qazA00
1TWBA 2QASA 1OULA 2NYSA 1ZSZB 1YFNA 1OX8A 1OU9A 1OX9A 1ZSZC 1ZSZA 2QAZA 1OU8A
chains in the Genus database with same CATH superfamily
5AYFA 1UGPB 4DBQA 1I1JA 2X3XD 4DBHA 2BTTA 3GBQA 1M1KR 2E3IA 5CO7A 1TUDA 1N9RA 3O8VA 4PJOE 3JSCA 3CEYA 4JS5A 2RB6A 1VQ4Q 2QEXQ 2X4JA 2Y90A 2O01E 3X25B 2VC8A 5D6WA 4OB3B 4OMOA 3JCMh 2DE0X 1ACMB 1JXMA 2L8DA 2GBQA 2E3HA 1Q86R 4FYWB 5I2SA 4XTUA 5KCOA 2L5QA 1PSEA 4EIKA 4PFZA 1Y96B 2HCKA 1VQPA 3E19A 1ABOA 5GAOp 3J80E 2V8KA 1K73C 2KRSA 3ZBDA 2CGHA 2X4XA 2IG0A 2ZGWA 2LJ3A 2MMPA 2AKKA 3CCST 3CMAA 2D8JA 2E10A 2LT4A 5HCKA 2HDAA 2PUOB 2KGTA 2VASA 4L6V5 3FB9A 4OMQA 2RMOA 4R56A 4RTXA 7AT1B 5CKDA 2X35A 1GRIA 4C5EA 2D9TA 3EGXA 5CIUA 1C0MA 5A0LA 1B7TA 1BI1A 2DYIA 2K2VA 4ZGJB 2F2WA 1ZBJA 4M7AA 2M02A 3M0SA 4LD9K 4WF2A 4M77B 1VQLA 1VQOQ 4JRKA 6AT1B 2JUFA 2DFUA 2DVEA 4M7DA 2E6ZA 4JJDA 1OPLA 4C0DC 5KYUB 3PVQA 5KYNA 1NE8A 2BE9B 3QG1A 1OU9A 1YHQT 3OBYA 3CXCP 3OYAA 5HY6A 1WDXA 4QKUA 2MF2A 3QKJA 3A8OB 2ROTA 1LJOA 1VA7A 4A63B 4E7LA 4M7AG 2I2LA 1SG5A 3FDRA 4IIOA 3CPWS 1AWJA 1X6BA 2JS2A 4OB2B 1VQMA 1M2VB 2JT4A 2RK2A 2ZPEB 2EYYA 3OS0A 3H6ZA 5CKEA 2VGMA 1VIEA 4FL6A 2DYBA 3RKXA 1PRLC 2NUZA 1VQ7Q 1VQ8Q 2EYXA 2D6FA 1M30A 1WHLA 4IUVA 4QVDA 1H3HA 2QDLA 1VYTA 1YBYA 4FT4A 1KJWA 4XTZA 1W2BA 1QWFA 4PJOF 2JTFA 4DOVA 1H8KA 4Z88A 4EMGA 1J3TA 4A53A 3QBYA 2ZAEA 3BW1A 3PGGA 4J6WA 1OU8A 1XJWB 3JCMf 4BY6B 2LQKA 5GANf 3M54A 2CUDA 1K9MC 4BI3A 1SHFA 4C0GA 3QXEB 1JJ2P 3CCQA 4LDXA 5IH2A 5CCAA 2J7IA 1WXUA 1AEYA 3LGLA 2J6KA 3CCUT 2XHCA 3RBBB 2RO0A 3FJPA 2E64A 1WXBA 1U5SA 4QVCA 1ARKA 4ZTFA 5IHKA 2HEQA 4HCKA 1MMNA 3KUFA 3OB9A 2RJEA 2K5IA 3CC2A 1YITQ 1KC8C 3JB9J 2LVMA 2YRVA 3L2UA 4LE9A 3OYYA 1MHNA 2V1RA 3VS6A 3VS3A 3I5SA 3VRYA 1RLPC 1WZOA 2VXFA 5CK9A 4IUUA 1QMCA 4OMPA 3REAB 1WYXA 1D1BA 3H8ZA 3HP9A 1W6XA 3QWXX 2DX1A 4J7FA 2YUNA 3NTIA 3G7ZA 3H0HA 3CCSQ 2NUPB 4JPBW 5GAMd 5DM7R 5J26A 4LXCA 1NPPA 1YJ9Q 3PNWC 1K0SA 3M0PA 2CP2A 4KGZB 3JCMV 1K9AA 3PT9A 1C1AA 1MGQA 5CQXA 1T0JA 2QK0A 1SF9A 1KIKA 1UTIA 2YRDA 3JCMb 4HCBA 4NOYA 1AT1B 2YRCA 4PJJA 1Y07A 3PTAA 1VQ4T 3L2VA 1A0NB 2HSEB 4M77D 3CXCA 2XDDA 4HCCA 4A4KA 2JOYA 8ATCB 4M7DE 2MWPA 3EFOB 1YJWT 4C92D 4IIMA 4PK4A 5A0DA 5FRNA 2HKQB 2DL7A 1WIEA 1N27A 5FRMA 2RJCA 5GANe 2EWNA 5IT9E 1FWZA 1NEBA 1WHMA 3HRTA 4PJMA 1V1CA 1AHJB 2CYZB 1Q7YC 1YI2T 3S3OA 4QW2A 2BUDA 5I21A 3M56A 1N8RU 1K8AR 3CCQQ 2EIFA 3OYKA 4YTLA 4OB1B 2DXUA 3I56A 2CSIA 4LDYA 3ASKA 1X43A 4FCYA 4LNPA 4J9FA 4C8QE 3P8DA 3S6WA 1OOTA 2YUOA 2VVKA 1KQ2A 1ZX6A 1AWOA 3JB9F 1W1FA 1AZGB 2KT1A 5GAN8 2CP7A 1KHIA 3L42A 4AMCA 3CD6A 5D7UA 3DB3A 3JCMQ 4IKFA 3CCJA 3DB4A 5GANd 2HQEA 1TTHB 1IZ6A 2GCXA 3GP8A 1U1TA 1Q82U 3E1SA 5FW9A 3M53A 3TCJA 4DQ2A 2LC4A 1M1KU 2COWA 2EGEA 4ZGDB 2DERA 2EQKA 1PWTA 3HRUA 5LJ3g 1BK2A 3UATA 2O4XA 2COZA 2KYMA 3M0QA 2CZ6B 5CVIA 3UA6A 3EGDA 2FEIA 1PKSA 3EFSA 3C12A 1NM7A 2BE7D 3RKYA 4M7AF 3CCJT 1SSFA 4C8QA 1LPLA 2FPEA 1NLOC 4D8DA 2O4XB 3EHRA 3CC7T 2KE9A 3EGDB 1SEMA 2ED0A 5GMKj 2EQJA 3L2QA 4Q5WA 1R0CB 1YWPA 3V8LA 3MKDA 3A8GB 3CC4T 1M4ZA 5GAMf 4L5GA 3OW2A 5LJ3e 1KC8R 3L1AA 4QQDA 5LJ5e 1VYUA 1WNLA 2A08A 4UC4A 1UGQB 1T0HA 2DPPB 4HKEA 2OAUA 1IHVA 2A0FB 1LNXA 4QT7A 4Y92A 2XDBA 1OZ2A 4NS5A 3VS0A 2O2OA 3LW5E 3PE0A 1Q81U 1EFNA 3LLRA 2CH4W 2LQNA 3OYJA 4MZMA 2MWOA 3G71Q 1N5ZA 4CC3A 1E6GA 1KK7A 4HVWA 1HYOA 2HQHA 1N6AA 3ER0A 1UB4A 1OX8A 2XI9A 2DXTA 4F04B 5AT1B 1N8RR 1TG0A 1H3ZA 2EJFA 4BI4A 1PG5B 1OYXA 5GMKi 2OAWA 4FU6A 1G3WA 3CCLQ 1K9MU 1KFZA 3OYEA 4IUQA 2DXCA 3VS2A 2OTJQ 2FZGB 3MP1A 4OP0A 2G3RA 4KH0B 1IHWA 4C8QG 4M78E 4XTYA 4GY5A 2KVQG 2ZPFB 2KMTA 3PMIA 2GFAA 1QCOA 2P0QA 1WLPB 2M0OA 2DBMA 1PKTA 3CCMA 2MPXC 1AVZC 3LH5A 3MP6A 3G4SA 4M7DD 3HFOA 3EFOA 4M7AD 2OX7A 4DOWA 1D0XA 2EBPA 2ZPGB 1TU0B 3QZ9B 4E7SA 2RN8A 3H0FA 4B9WA 1MMGA 2P0PA 5GMKe 2CP6A 2YXYA 1B3QA 4M7AE 2P4TA 5EG2A 2KEAA 2QYZA 1M90U 2K5LA 1MV0B 3Q1JA 3G1JA 3P8BB 1GXIE 1ZUKA 1HXDA 2R58A 1M3CA 3MEVA 4F7UG 3NTKA 4FYXB 2P84A 2YT6A 3VUBA 4RMOA 1DJ7B 2DLPA 2HKNA 2LX7A 1BI3A 2RQRA 3JRZA 1WQ7A 2DTIA 4C0ZA 1I5OB 1VQ9T 3M4GA 5LL6S 4C92A 2JNGA 2VYTA 5GAMh 3H9NA 3EG0A 4FYYB 2RM4A 4Y91A 5LJ5h 4J83A 1ZUUA 4OF1A 1VQPT 3J81E 1NEGA 2E6NA 3JCMg 1K1ZA 2W10A 4J9EA 2XIDA 1VUBA 1T3SA 2LZ6B 4OGEA 3EGXB 2JM9A 1HD3A 4R55A 3OYGA 2MIOA 2JW4A 4O6JA 3CCEA 1VQNA 3JAME 4M75E 2J05A 2E12A 4ELYC 1VQ6A 1U06A 2DRMA 2JMCA 2K5FA 1RUWA 2RHUA 2OI3A 1PD0A 5CKHA 2F5KA 1JXOA 2K9GA 4F7UF 1H92A 2G6FX 1K9MR 2DKGA 1QP2A 1JO8A 5FU6C 1Q95G 2K3YA 3EAEA 2FO0A 3OYBA 2NYSA 4AT1B 2QG9B 4N0AA 4M78F 3QJYA 4PJOA 5GAN5 3CCVT 4PJOD 1G5VA 3UF4A 1WJRA 2PVGB 4PLIA 2L89A 2KNBB 4J9GA 3RESA 3GIBA 2JXBA 4OMFB 3CCMT 4KH1B 4EMKA 2YUQA 2H3EB 2HL5C 2ESWA 1YIJQ 1M3AA 1TSFA 1ZLMA 3RMQA 1UFFA 3CCVQ 5EC7A 2L3RA 3G6ET 3GNFB 4C8QB 4RG2A 4RTTA 2KXCA 4C5HA 3LGFA 3R6OA 1MV3A 5GAOn 2KRMA 1VQKT 4C92E 2DF6A 1YI2A 1NLPC 4ZGEB 5CKBA 4EDUA 2DAQA 2AZVA 1YJWQ 1UHCA 2I0NA 2AIRB 2L2PA 1P92A 2EJ9A 4C8QC 4M78G 3SEMA 1Q82R 1WJQA 1Y57A 1X6GA 4J6XA 5CKFA 5DY9A 3N5BB 4PL6A 2EYQA 1D09B 1JRIA 1Q81C 1BI2A 2OJ2A 4N4HA 3OA6A 3U23A 2LX9A 1FX7A 3VS5A 1WPYA 4HVVA 5FU7B 1MNEA 1TUCA 1GBQA 1KQSS 1LCKA 1G3SA 1VQ9A 2EGCA 1VQ6Q 2K57A 3CCUA 2E70A 2ECZA 3D7SB 1I07A 3SWNA 1PCXA 5GMKm 1RAIB 3OBWA 2J6OA 2X4YA 4KT0E 3CPFA 1HK9A 5KYWB 4BB7A 2CUBA 1K0XA 2RF0A 2LP5A 3META 1RI9A 2P0KA 2YWWA 1BI0A 3CCRT 3M9QA 1UGSB 3BFMA 3EHQA 3RIRA 1O9SA 1W2BP 3S3MA 2F1LA 2YLCA 3OYIA 1QW1A 4EMHA 1VQ7A 4N4GA 1K73U 3M0RA 3HL8A 3L2ZA 1RAFB 1IRXA 4RTYA 5FROA 5GMKl 1Z9ZA 2QTXA 2JMAA 3DLLA 3JB9I 3JCMX 2RD1A 3UPUA 1LVKA 4OMLA 4AG1C 2FRWA 3CC2Q 4V2SA 5FWCA 2M9UA 3EG9B 3TSZA 1EIFA 2JM8A 2C06A 2DD5A 1SRMA 4LN2A 2JVVA 2RQWA 2XG8D 4OGCA 3I35A 1WQWA 2J6FA 3I55T 4JS4A 1VQ4A 3OS1A 2QQ9A 3VS4A 2LJ0A 1IREB 1AZEA 4GLKA 1VQMQ 4XU3A 4C8QF 5HKCA 3HFNA 2JTEA 4C92F 5IN1A 2CP0A 2DJZA 3LX7A 4PKCC 4A4GA 3EG1A 5LJ5j 3QJ6A 5GMKh 2HMAA 4C0FA 3HTRA 3OYMA 4JRIA 4E7JA 1I0CA 3M59A 1NZ9A 2GGRA 4IUPA 5A2QE 1C6VX 1SKUB 1TXQA 2M16A 2KT8A 1ZSZB 2DEQA 1QKWA 2RHXA 1B34A 2VXEA 3RMSA 3I56T 3GLXA 3WVDB 5GAN7 2QDYB 3QWYA 2XU8A 4JDSA 4JLIA 1VQMT 2A7YA 3CXCS 4ZTJA 2RHYA 1VIFA 4QQGA 2K2MA 2YDLA 4QQ6A 1OPKA 1QVFP 3QZ5B 4CC7A 1Q86U 1ZBXA 4J9BA 5KCHA 2KAFA 3G71A 1NJIC 1GBRA 4OMMA 5GAMe 4C8QD 3SB2A 1VQKQ 3P8HA 1CKAA 4RCBA 5KYXB 2EKHA 4BDZA 2PZ1A 1TH7A 1IGUA 3L2RA 3CMEQ 3SWNC 4A4FA 1OEBA 1V76A 1UE9A 1S1NA 2QQSA 2GQVA 3BDUA 1BYMA 2P4RA 1TOVA 4RTVA 1WHJA 5M9OA 1QVGS 4QVZA 3E9FA 2E1HA 2V1QA 3QSUA 4ATOA 5ECAA 4KGVB 1RACB 1IGQA 4X9DA 4XTXA 4AFZC 3L2WA 4MZTA 3CC7A 5LJ3h 2KY9A 3NPFA 1JJ2S 2PVDB 1KQSP 2BZYA 4E7ZA 3JCMW 4XTVA 1EZZB 4J9DA 4VUBA 4PLLA 2FYKA 5IXFA 2Y4YA 2KQWA 4DEYA 3I9QA 3CCRQ 3H0IA 1VQOT 3IQLA 4E47A 2DO3A 2CT4A 5LJ5f 1YJWA 4DA4A 5LJ3f 2A3LA 2KROA 1Q82C 2V26A 1VQ6T 2ZZDA 1JBMA 3QYHB 4JZ4A 1Y71A 9ATCB 1PC0A 4M78C 2A28A 3MCAB 3AHUA 3SD4A 3MEUA 1QP3A 2EPDA 2JN0A 4ZNXA 1W2BS 2DTOA 1M9SA 2JTMA 5KYXA 3OS5A 2JZ2A 4JRQA 1M27C 4N4IA 1R0BG 3LWIA 3PFSA 4P5NA 5KH6A 2K3BA 2QQAA 2LT1A 3JCMc 4WCIA 5IXBA 5C6SA 2AK5A 1BKBA 2BKDN 4M7AC 4CRIA 1I8FA 2COYA 2SRCA 3I55A 4HXJA 4PJOC 4BD3A 1GCPA 3EG2A 3QIIA 4N0AC 4E6RA 2PTKA 2J06A 4CI0C 4ME7A 3A8MB 1VQLT 1M2VA 2K4YA 5IHNA 4JJNK 4BY6C 4FIBA 1U8RA 1RAAB 5C0MA 1PHTA 1VQ8T 3UT1A 3OYFA 2RQTA 4LD6A 4L59A 1VQ8A 5J3BA 3C94A 1M8MA 1ZQ1A 3OW2P 3OMGA 4MDXA 1X2KA 5FWBA 1QLYA 4C92C 2FZKB 1ZUYA 3V7CA 2CSQA 2FG0A 3DLMA 1TUGB 4BE2A 3VV0A 2MI6A 3EGUA 3M5AA 5LJ3j 3EG9A 1PRMC 3VU3C 2KXDA 3AT1B 3HSBA 3C4SA 2MAMA 4M75C 3HKSA 2ZCFB 3JCMJ 1WHHA 1Q7YR 4EMKB 3DKMA 4C92G 1PM3A 1Z9QA 2B86A 3CC4A 4F7UE 1WJSA 4K11A 2NWMA 1M90R 2RNAA 3CMAQ 2QEXA 1IXDA 4LDWA 4KUDK 4BE1A 3NFCA 2AT1B 1SSHA 3T9NA 4JRPA 4BUGA 2O9SA 2R57A 2BZ8A 2EYZA 2QA4A 1YCYA 5D6YA 1TWBA 4C0DB 4MMKA 2DIGA 2LQWA 3BY7A 2CZ7B 1D3BA 1X6OA 3A98A 1R8OB 4M77G 5CQYA 2LCLA 2QQRA 2RI3A 2E65A 1RAGB 4DBFA 1NG2A 3M0UA 4FM4B 2H3JA 2QEXT 3MO8A 4OMNA 2V8JA 2CS7A 2QASA 2Y4XA 4RTWA 2FHDA 2F2XA 4FSXA 1YITA 1GCQC 2IPOB 2EVRA 1M1GA 2HBPA 1KHCA 3URGA 3VRZA 2AKLA 2DRKA 3PMTA 2RQUA 3CCLA 4XTWA 3H41A 2E41A 5KE2A 2HSPA 4M77C 2HZYA 1I81A 2JS0A 3V8KA 4FSSA 3UWNA 4ZN1A 3REBB 3MEAA 4XU2A 2L3SA 4CC4B 3JCMd 3A5ZB 1KQSA 1QVFA 3RUXA 5GAN2 2CZ0B 1AWWA 4HA8A 2DVJA 4BI8B 4F7UB 4M77E 4JJCA 1K4US 1ZA1B 3OYLA 3QDRB 5DLOA 3LWHA 1GFDA 2XICA 1LOJA 2D0NA 2GF7A 3JB9H 1E6HA 3MP8A 1U3OA 4OB0B 1F1BB 1HJDA 1M2OA 5KYYB 3FRNA 1KG1A 4O5VA 3KBGA 4JJBA 4XU0A 2YUPA 1D0ZA 4ORZA 2QTVA 2SEMA 1I4K1 1VQLQ 3X28B 4TVRA 2RH2A 2EAYA 1MMDA 1VOMA 5KYUA 3I55Q 3SWNB 1UECA 2KDSA 2RK1A 1B34B 5LJ5d 1QWEA 4M4ZA 1VQ5A 4LDUA 3X26B 4JLGA 1UJ0A 2C0OA 2B8AA 1WA7A 2F5TX 4M7DF 2QI2A 5HK0A 1I5LA 2D1XA 2RI5A 2RQVA 3FIFA 3M4YA 4M7AB 3JB9D 3WXMB 2PU9B 2X3WD 3MJXA 1ZSZA 1FYNA 2E5KA 3MPUB 4XAXB 3JCMP 2EW3A 1M5Q1 2HNIA 3R6NA 1BIAA 1WHGA 4KBMB 1VQPQ 3JV3A 1YHQA 3S3NA 1YFNA 2RA2A 4ELZC 1VQ9Q 3EH2A 4XK8E 1XTDA 3M55A 3M58A 3RDVA 2RPNA 5FU6B 2O9VA 2PNIA 2VB6A 3EFRA 2F69A 1IO6A 1YJNT 3FEOA 4BE0A 1HSQA 3NTHA 3PIPA 1WXTA 1D1CA 1G3TA 2ZPBB 4X34A 3LH0A 3E2UA 2HL3A 3FLGA 3VYGA 2QA4T 4NL2A 4DBRA 5GAOr 4PJOB 2AHJB 2GTJA 4II1A 1T3LA 2ABLA 1VQ7T 2FRYA 1OI1A 2FB7A 1UHFA 3O5ZA 2DK3A 2LRQA 5IAYA 2MYSA 4ZN3A 2DZCA 2OTLQ 4CC2A 3J7AF 1RLQC 1XNIA 1BIBA 2QA4Q 2CZ1B 2CP3A 3I56Q 1FXXA 1NJIU 2KRNA 2DL4A 2VUBA 2R5AA 4E2FB 4RCCA 2GNCA 3CPWA 3CPWP 3CCLT 1Q7YU 1GL5A 3NGPA 2HBWA 3HRSA 1V29B 3GNGA 1O75A 3KXTA 2Z0WA 3UA7A 1BU1A 1UG1A 4PJNA 2OTJT 3RERA 1UEBA 3SHWA 1K73R 2KI7A 1YN8A 2NUPA 2XD0A 5I2MA 4WTOB 4F7UA 4IUTA 1QVGA 3TQ7P 5FU7C 4F16A 4Y28E 4MMLA 1U1SA 4C5IA 3G4ST 4AFQC 3INZA 2D0QB 4M77F 3OY9A 3ULRB 2CT3A 3RKWA 3X24B 3VKIA 5GANj 3VS1A 2DL3A 5FLXE 3TEEA 3JB9G 4BDYA 3LYIA 1JEGA 4MZPA 3C95A 4Z8AA 3PVLA 2NUTA 1S72A 3C0CA 2PUKB 2O88A 2ROLA 2CH4A 1KC8U 5GAOq 4HVUA 4DEXA 2XKOC 4EMKC 4J9HA 5LJ5g 2YLBA 3CMEA 3EH1A 2FZCB 4F14A 3NHNA 4RUGA 5I11A 2XK0A 1RADB 1OZ3A 2K6DA 1RI0A 2M51A 2IIMA 4M75F 2HAXA 2V8IA 2KBTA 2ED1A 1K76A 1YIJA 1YHQQ 2DMOA 5GANg 3VS7A 4X1VA 2DIQA 4KUIA 1BBZA 2GTOA 4E7HA 4HT8A 2K3XA 2LCSA 3MHXA 3VUZA 1Y7XA 2MCNA 1GCQA 2L3QA 2LQ8A 2M0YA 4ANJA 4Z89A 1Y0MA 1G83A 2W0ZA 1YI2Q 2LNHB 4GLMA 1CKBA 1M8VA 1N9SA 4F17A 4M77A 1B07A 2JJ9A 3E9GA 4D8KA 2EQIA 4E7IA 4FYVB 3A1PA 4HCZA 1Q81R 1SHGA 4X9CA 5GAN3 2LTOA 1NPRA 4J9CA 1OULA 1OQKA 3QDFA 5CR2A 1OV3A 4J9IA 1MMAA 1SPKA 1ZA2B 2MOXA 3CC2T 2GFUA 5GANh 3CMAT 5I22A 2DETA 2CDTA 2DTHA 1YJNA 1G3YA 4EPCA 2QXFA 3CBOA 3GOXA 1QKXA 2FPDA 1VQ5Q 3WVEB 3ZEHA 4M7DC 2M1HA 1UGRB 2LJ1A 2NUTB 4M7DB 2L3PA 3EG3A 4FW2A 1K8AC 1RAHB 2OTJA 4NL3A 2LNVA 1VYVA 3QO3A 2XDPA 1QQJA 1QVGP 2A37A 4IURA 4M75A 8AT1B 3THKA 4R0KA 3PIOA 4FT2A 2EGAA 3HPWA 1S72Q 2GQIA 2VGNA 5HK3A 1QCFA 4RTUA 1K8AU 2XMFA 3CD6T 4KRTA 3CMET 2AZSA 3TVTA 1YITT 1D0YA 1MUZA 2PVOB 4LDVA 3OYCA 1X2QA 3QHSA 2BZXA 4KULA 3ZL7C 1S72T 4GBQA 2YHTA 1EX4A 1UUEA 2X4WA 3A8HB 2BIVA 5D6XA 1G8XA 2FPFA 2QQBA 3X20B 1ABQA 2ATCB 1YCSB 2DL8A 5GJWB 4J8OA 3V7SA 2DEUA 3SFMA 1RL2A 1M1KC 3OYDA 1YJ9T 2CKKA 1Q86C 1ZSGA 1R77A 1AOJA 3OYNA 3JCMe 1YJ9A 1X27A 4PFPA 3FC3A 4M7DG 2KK4A 5LJ3d 2DL5A 2CP5A 4XU1A 3ME9A 1GFCA 2DA9A 2K7AA 4E7KA 1YNZA 3F70A 1UDLA 1UJYA 1XQHA 3G6EQ 3TSWA 4JZ3A 3OYHA 1RAEB 1WFWA 2X51A 5CAIA 2E4HA 1OX9A 2DBKA 2HQXA 1WGSA 1H641 4RG8A 3CCQT 4M78A 4HT9A 3M57A 1ZSZC 2D8HA 3CCRA 1FMKA 1W4SA 3OSSC 3TU4K 5GAN4 1Y96A 2EQUA 3BDLA 4A4EA 2KR3A 2VWFA 3SDZA 2O31A 2E5QA 3G4SQ 1WX6A 2DNUA 2NLUA 2EQMA 2C0IA 1AWXA 1KSWA 1SRLA 1QVFS 4M78B 4Z02A 3VJPA 2QGFB 1NJIR 4PJOG 3OW2S 3VYHB 1KD1R 2R5MA 1X01A 3GF5A 3ZFJA 2ZPIB 5L8RE 1FMVA 3CQTA 3QUIA 4C5GA 1M1FA 1FMWA 4RTZA 2CREA 2QAZA 4OVAA 4AG2C 2RHZA 2L0AA 4A4HA 2H8HA 2X9HA 4M75D 2K79A 3CCET 1VQNT 1PNJA 3OMCA 3V8JA 4AFUC 5DLQE 5GJVB 5GAMj 3RR6A 1NYGA 1VQOA 1NBEB 3A8LB 5A0GA 3CCVA 2C0TA 2EKOA 3QPHA 2WSEE 2WACA 3OS2A 1N8RC 2DZ9A 3OQ5A 4PJLA 1RABB 5IHIA 2RJFA 3BE3A 4AFSC 2A36A 2DD4A 1M90C 1PSFA 3KFVA 4FW1A 4B6MA 1BCMA 1D1AA 1IB8A 3I5RA 3NMZC 4M75G 5L23A 4J7IA 1AD5A 2HD0A 1JQQA 2ZPHB 4XQ3A 3V7RA 2MK5A 2PQWA 1G2BA 5J39A 2LCCA 4BACA 3CC7Q 2VV5A 2DILA 3RNJA 4LUEA 1D3BB 2WSCE 5KYYA 3CCSA 4ESRA 2EYWA 3CCEQ 1VQNQ 1UGVA 5GAOl 3CD6Q 3CC4Q 1X75C 3CBMA 1YJNQ 1BB9A 1JU5C 1CSKA 4PFOA 1PD1A 1YWOA 5GAN6 2RI2A 3CBPA 2YSQA 3CCMQ 1WHKA 5KYWA 1E7OA 2LDMA 1YP5A 5GAMg 1JB0E 2RHIA 3HHTB 4JUVA 2FL7A 4M75B 3UDCA 2VKNA 3CCUQ 2KYBA 2DM1A 1XOVA 1JJ2A 1VQ5T 1X69A 3G71T 1VQKA 3QYGB 2OTLT 1MNDA 4A54A 4J6YA 1M3BA 4D6WA 2LMJA 3FJ5A 2OTLA 4B9XA 2ENMA 3TREA 1QVPA 1TS9A 2FVUA 4M78D 2RJDA 1WI7A 5GAOm 4C92B 2KSSA 1KD1U 2WSFE 2EJGA 5KE3A 4PNOA 3OSVA 2EFIA 1QCNA 2DJQA 4KGXB 4LUDA 3GPLA 4MDWA 2DXBA 4J5YA 1BCOA 3CCJQ 3G6EA 4RKUE 2F2VA 1W70A 3MEWA 1KQ1A 2QGGA 3M0TA 1KD1C 1NYFA 1YIJT 2IVWA 1ZHIA
chains in the Genus database with same CATH topology
1TWBA 2QASA 1OULA 2NYSA 1ZSZB 1YFNA 1OX8A 1OU9A 1OX9A 1ZSZC 1ZSZA 2QAZA 1OU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWB A;  2QAS A;  1OUL A;  2NYS A;  1ZSZ B;  1YFN A;  1OX8 A;  1OU9 A;  1OX9 A;  1ZSZ C;  1ZSZ A;  2QAZ A;  1OU8 A; 
#chains in the Genus database with same CATH topology
 5AYF A;  1UGP B;  4DBQ A;  1I1J A;  2X3X D;  4DBH A;  2BTT A;  3GBQ A;  1M1K R;  2E3I A;  5CO7 A;  1TUD A;  1N9R A;  3O8V A;  4PJO E;  3JSC A;  3CEY A;  4JS5 A;  2RB6 A;  1VQ4 Q;  2QEX Q;  2X4J A;  2Y90 A;  2O01 E;  3X25 B;  2VC8 A;  5D6W A;  4OB3 B;  4OMO A;  3JCM h;  2DE0 X;  1ACM B;  1JXM A;  2L8D A;  2GBQ A;  2E3H A;  1Q86 R;  4FYW B;  5I2S A;  4XTU A;  5KCO A;  2L5Q A;  1PSE A;  4EIK A;  4PFZ A;  1Y96 B;  2HCK A;  1VQP A;  3E19 A;  1ABO A;  5GAO p;  3J80 E;  2V8K A;  1K73 C;  2KRS A;  3ZBD A;  2CGH A;  2X4X A;  2IG0 A;  2ZGW A;  2LJ3 A;  2MMP A;  2AKK A;  3CCS T;  3CMA A;  2D8J A;  2E10 A;  2LT4 A;  5HCK A;  2HDA A;  2PUO B;  2KGT A;  2VAS A;  4L6V 5;  3FB9 A;  4OMQ A;  2RMO A;  4R56 A;  4RTX A;  7AT1 B;  5CKD A;  2X35 A;  1GRI A;  4C5E A;  2D9T A;  3EGX A;  5CIU A;  1C0M A;  5A0L A;  1B7T A;  1BI1 A;  2DYI A;  2K2V A;  4ZGJ B;  2F2W A;  1ZBJ A;  4M7A A;  2M02 A;  3M0S A;  4LD9 K;  4WF2 A;  4M77 B;  1VQL A;  1VQO Q;  4JRK A;  6AT1 B;  2JUF A;  2DFU A;  2DVE A;  4M7D A;  2E6Z A;  4JJD A;  1OPL A;  4C0D C;  5KYU B;  3PVQ A;  5KYN A;  1NE8 A;  2BE9 B;  3QG1 A;  1OU9 A;  1YHQ T;  3OBY A;  3CXC P;  3OYA A;  5HY6 A;  1WDX A;  4QKU A;  2MF2 A;  3QKJ A;  3A8O B;  2ROT A;  1LJO A;  1VA7 A;  4A63 B;  4E7L A;  4M7A G;  2I2L A;  1SG5 A;  3FDR A;  4IIO A;  3CPW S;  1AWJ A;  1X6B A;  2JS2 A;  4OB2 B;  1VQM A;  1M2V B;  2JT4 A;  2RK2 A;  2ZPE B;  2EYY A;  3OS0 A;  3H6Z A;  5CKE A;  2VGM A;  1VIE A;  4FL6 A;  2DYB A;  3RKX A;  1PRL C;  2NUZ A;  1VQ7 Q;  1VQ8 Q;  2EYX A;  2D6F A;  1M30 A;  1WHL A;  4IUV A;  4QVD A;  1H3H A;  2QDL A;  1VYT A;  1YBY A;  4FT4 A;  1KJW A;  4XTZ A;  1W2B A;  1QWF A;  4PJO F;  2JTF A;  4DOV A;  1H8K A;  4Z88 A;  4EMG A;  1J3T A;  4A53 A;  3QBY A;  2ZAE A;  3BW1 A;  3PGG A;  4J6W A;  1OU8 A;  1XJW B;  3JCM f;  4BY6 B;  2LQK A;  5GAN f;  3M54 A;  2CUD A;  1K9M C;  4BI3 A;  1SHF A;  4C0G A;  3QXE B;  1JJ2 P;  3CCQ A;  4LDX A;  5IH2 A;  5CCA A;  2J7I A;  1WXU A;  1AEY A;  3LGL A;  2J6K A;  3CCU T;  2XHC A;  3RBB B;  2RO0 A;  3FJP A;  2E64 A;  1WXB A;  1U5S A;  4QVC A;  1ARK A;  4ZTF A;  5IHK A;  2HEQ A;  4HCK A;  1MMN A;  3KUF A;  3OB9 A;  2RJE A;  2K5I A;  3CC2 A;  1YIT Q;  1KC8 C;  3JB9 J;  2LVM A;  2YRV A;  3L2U A;  4LE9 A;  3OYY A;  1MHN A;  2V1R A;  3VS6 A;  3VS3 A;  3I5S A;  3VRY A;  1RLP C;  1WZO A;  2VXF A;  5CK9 A;  4IUU A;  1QMC A;  4OMP A;  3REA B;  1WYX A;  1D1B A;  3H8Z A;  3HP9 A;  1W6X A;  3QWX X;  2DX1 A;  4J7F A;  2YUN A;  3NTI A;  3G7Z A;  3H0H A;  3CCS Q;  2NUP B;  4JPB W;  5GAM d;  5DM7 R;  5J26 A;  4LXC A;  1NPP A;  1YJ9 Q;  3PNW C;  1K0S A;  3M0P A;  2CP2 A;  4KGZ B;  3JCM V;  1K9A A;  3PT9 A;  1C1A A;  1MGQ A;  5CQX A;  1T0J A;  2QK0 A;  1SF9 A;  1KIK A;  1UTI A;  2YRD A;  3JCM b;  4HCB A;  4NOY A;  1AT1 B;  2YRC A;  4PJJ A;  1Y07 A;  3PTA A;  1VQ4 T;  3L2V A;  1A0N B;  2HSE B;  4M77 D;  3CXC A;  2XDD A;  4HCC A;  4A4K A;  2JOY A;  8ATC B;  4M7D E;  2MWP A;  3EFO B;  1YJW T;  4C92 D;  4IIM A;  4PK4 A;  5A0D A;  5FRN A;  2HKQ B;  2DL7 A;  1WIE A;  1N27 A;  5FRM A;  2RJC A;  5GAN e;  2EWN A;  5IT9 E;  1FWZ A;  1NEB A;  1WHM A;  3HRT A;  4PJM A;  1V1C A;  1AHJ B;  2CYZ B;  1Q7Y C;  1YI2 T;  3S3O A;  4QW2 A;  2BUD A;  5I21 A;  3M56 A;  1N8R U;  1K8A R;  3CCQ Q;  2EIF A;  3OYK A;  4YTL A;  4OB1 B;  2DXU A;  3I56 A;  2CSI A;  4LDY A;  3ASK A;  1X43 A;  4FCY A;  4LNP A;  4J9F A;  4C8Q E;  3P8D A;  3S6W A;  1OOT A;  2YUO A;  2VVK A;  1KQ2 A;  1ZX6 A;  1AWO A;  3JB9 F;  1W1F A;  1AZG B;  2KT1 A;  5GAN 8;  2CP7 A;  1KHI A;  3L42 A;  4AMC A;  3CD6 A;  5D7U A;  3DB3 A;  3JCM Q;  4IKF A;  3CCJ A;  3DB4 A;  5GAN d;  2HQE A;  1TTH B;  1IZ6 A;  2GCX A;  3GP8 A;  1U1T A;  1Q82 U;  3E1S A;  5FW9 A;  3M53 A;  3TCJ A;  4DQ2 A;  2LC4 A;  1M1K U;  2COW A;  2EGE A;  4ZGD B;  2DER A;  2EQK A;  1PWT A;  3HRU A;  5LJ3 g;  1BK2 A;  3UAT A;  2O4X A;  2COZ A;  2KYM A;  3M0Q A;  2CZ6 B;  5CVI A;  3UA6 A;  3EGD A;  2FEI A;  1PKS A;  3EFS A;  3C12 A;  1NM7 A;  2BE7 D;  3RKY A;  4M7A F;  3CCJ T;  1SSF A;  4C8Q A;  1LPL A;  2FPE A;  1NLO C;  4D8D A;  2O4X B;  3EHR A;  3CC7 T;  2KE9 A;  3EGD B;  1SEM A;  2ED0 A;  5GMK j;  2EQJ A;  3L2Q A;  4Q5W A;  1R0C B;  1YWP A;  3V8L A;  3MKD A;  3A8G B;  3CC4 T;  1M4Z A;  5GAM f;  4L5G A;  3OW2 A;  5LJ3 e;  1KC8 R;  3L1A A;  4QQD A;  5LJ5 e;  1VYU A;  1WNL A;  2A08 A;  4UC4 A;  1UGQ B;  1T0H A;  2DPP B;  4HKE A;  2OAU A;  1IHV A;  2A0F B;  1LNX A;  4QT7 A;  4Y92 A;  2XDB A;  1OZ2 A;  4NS5 A;  3VS0 A;  2O2O A;  3LW5 E;  3PE0 A;  1Q81 U;  1EFN A;  3LLR A;  2CH4 W;  2LQN A;  3OYJ A;  4MZM A;  2MWO A;  3G71 Q;  1N5Z A;  4CC3 A;  1E6G A;  1KK7 A;  4HVW A;  1HYO A;  2HQH A;  1N6A A;  3ER0 A;  1UB4 A;  1OX8 A;  2XI9 A;  2DXT A;  4F04 B;  5AT1 B;  1N8R R;  1TG0 A;  1H3Z A;  2EJF A;  4BI4 A;  1PG5 B;  1OYX A;  5GMK i;  2OAW A;  4FU6 A;  1G3W A;  3CCL Q;  1K9M U;  1KFZ A;  3OYE A;  4IUQ A;  2DXC A;  3VS2 A;  2OTJ Q;  2FZG B;  3MP1 A;  4OP0 A;  2G3R A;  4KH0 B;  1IHW A;  4C8Q G;  4M78 E;  4XTY A;  4GY5 A;  2KVQ G;  2ZPF B;  2KMT A;  3PMI A;  2GFA A;  1QCO A;  2P0Q A;  1WLP B;  2M0O A;  2DBM A;  1PKT A;  3CCM A;  2MPX C;  1AVZ C;  3LH5 A;  3MP6 A;  3G4S A;  4M7D D;  3HFO A;  3EFO A;  4M7A D;  2OX7 A;  4DOW A;  1D0X A;  2EBP A;  2ZPG B;  1TU0 B;  3QZ9 B;  4E7S A;  2RN8 A;  3H0F A;  4B9W A;  1MMG A;  2P0P A;  5GMK e;  2CP6 A;  2YXY A;  1B3Q A;  4M7A E;  2P4T A;  5EG2 A;  2KEA A;  2QYZ A;  1M90 U;  2K5L A;  1MV0 B;  3Q1J A;  3G1J A;  3P8B B;  1GXI E;  1ZUK A;  1HXD A;  2R58 A;  1M3C A;  3MEV A;  4F7U G;  3NTK A;  4FYX B;  2P84 A;  2YT6 A;  3VUB A;  4RMO A;  1DJ7 B;  2DLP A;  2HKN A;  2LX7 A;  1BI3 A;  2RQR A;  3JRZ A;  1WQ7 A;  2DTI A;  4C0Z A;  1I5O B;  1VQ9 T;  3M4G A;  5LL6 S;  4C92 A;  2JNG A;  2VYT A;  5GAM h;  3H9N A;  3EG0 A;  4FYY B;  2RM4 A;  4Y91 A;  5LJ5 h;  4J83 A;  1ZUU A;  4OF1 A;  1VQP T;  3J81 E;  1NEG A;  2E6N A;  3JCM g;  1K1Z A;  2W10 A;  4J9E A;  2XID A;  1VUB A;  1T3S A;  2LZ6 B;  4OGE A;  3EGX B;  2JM9 A;  1HD3 A;  4R55 A;  3OYG A;  2MIO A;  2JW4 A;  4O6J A;  3CCE A;  1VQN A;  3JAM E;  4M75 E;  2J05 A;  2E12 A;  4ELY C;  1VQ6 A;  1U06 A;  2DRM A;  2JMC A;  2K5F A;  1RUW A;  2RHU A;  2OI3 A;  1PD0 A;  5CKH A;  2F5K A;  1JXO A;  2K9G A;  4F7U F;  1H92 A;  2G6F X;  1K9M R;  2DKG A;  1QP2 A;  1JO8 A;  5FU6 C;  1Q95 G;  2K3Y A;  3EAE A;  2FO0 A;  3OYB A;  2NYS A;  4AT1 B;  2QG9 B;  4N0A A;  4M78 F;  3QJY A;  4PJO A;  5GAN 5;  3CCV T;  4PJO D;  1G5V A;  3UF4 A;  1WJR A;  2PVG B;  4PLI A;  2L89 A;  2KNB B;  4J9G A;  3RES A;  3GIB A;  2JXB A;  4OMF B;  3CCM T;  4KH1 B;  4EMK A;  2YUQ A;  2H3E B;  2HL5 C;  2ESW A;  1YIJ Q;  1M3A A;  1TSF A;  1ZLM A;  3RMQ A;  1UFF A;  3CCV Q;  5EC7 A;  2L3R A;  3G6E T;  3GNF B;  4C8Q B;  4RG2 A;  4RTT A;  2KXC A;  4C5H A;  3LGF A;  3R6O A;  1MV3 A;  5GAO n;  2KRM A;  1VQK T;  4C92 E;  2DF6 A;  1YI2 A;  1NLP C;  4ZGE B;  5CKB A;  4EDU A;  2DAQ A;  2AZV A;  1YJW Q;  1UHC A;  2I0N A;  2AIR B;  2L2P A;  1P92 A;  2EJ9 A;  4C8Q C;  4M78 G;  3SEM A;  1Q82 R;  1WJQ A;  1Y57 A;  1X6G A;  4J6X A;  5CKF A;  5DY9 A;  3N5B B;  4PL6 A;  2EYQ A;  1D09 B;  1JRI A;  1Q81 C;  1BI2 A;  2OJ2 A;  4N4H A;  3OA6 A;  3U23 A;  2LX9 A;  1FX7 A;  3VS5 A;  1WPY A;  4HVV A;  5FU7 B;  1MNE A;  1TUC A;  1GBQ A;  1KQS S;  1LCK A;  1G3S A;  1VQ9 A;  2EGC A;  1VQ6 Q;  2K57 A;  3CCU A;  2E70 A;  2ECZ A;  3D7S B;  1I07 A;  3SWN A;  1PCX A;  5GMK m;  1RAI B;  3OBW A;  2J6O A;  2X4Y A;  4KT0 E;  3CPF A;  1HK9 A;  5KYW B;  4BB7 A;  2CUB A;  1K0X A;  2RF0 A;  2LP5 A;  3MET A;  1RI9 A;  2P0K A;  2YWW A;  1BI0 A;  3CCR T;  3M9Q A;  1UGS B;  3BFM A;  3EHQ A;  3RIR A;  1O9S A;  1W2B P;  3S3M A;  2F1L A;  2YLC A;  3OYI A;  1QW1 A;  4EMH A;  1VQ7 A;  4N4G A;  1K73 U;  3M0R A;  3HL8 A;  3L2Z A;  1RAF B;  1IRX A;  4RTY A;  5FRO A;  5GMK l;  1Z9Z A;  2QTX A;  2JMA A;  3DLL A;  3JB9 I;  3JCM X;  2RD1 A;  3UPU A;  1LVK A;  4OML A;  4AG1 C;  2FRW A;  3CC2 Q;  4V2S A;  5FWC A;  2M9U A;  3EG9 B;  3TSZ A;  1EIF A;  2JM8 A;  2C06 A;  2DD5 A;  1SRM A;  4LN2 A;  2JVV A;  2RQW A;  2XG8 D;  4OGC A;  3I35 A;  1WQW A;  2J6F A;  3I55 T;  4JS4 A;  1VQ4 A;  3OS1 A;  2QQ9 A;  3VS4 A;  2LJ0 A;  1IRE B;  1AZE A;  4GLK A;  1VQM Q;  4XU3 A;  4C8Q F;  5HKC A;  3HFN A;  2JTE A;  4C92 F;  5IN1 A;  2CP0 A;  2DJZ A;  3LX7 A;  4PKC C;  4A4G A;  3EG1 A;  5LJ5 j;  3QJ6 A;  5GMK h;  2HMA A;  4C0F A;  3HTR A;  3OYM A;  4JRI A;  4E7J A;  1I0C A;  3M59 A;  1NZ9 A;  2GGR A;  4IUP A;  5A2Q E;  1C6V X;  1SKU B;  1TXQ A;  2M16 A;  2KT8 A;  1ZSZ B;  2DEQ A;  1QKW A;  2RHX A;  1B34 A;  2VXE A;  3RMS A;  3I56 T;  3GLX A;  3WVD B;  5GAN 7;  2QDY B;  3QWY A;  2XU8 A;  4JDS A;  4JLI A;  1VQM T;  2A7Y A;  3CXC S;  4ZTJ A;  2RHY A;  1VIF A;  4QQG A;  2K2M A;  2YDL A;  4QQ6 A;  1OPK A;  1QVF P;  3QZ5 B;  4CC7 A;  1Q86 U;  1ZBX A;  4J9B A;  5KCH A;  2KAF A;  3G71 A;  1NJI C;  1GBR A;  4OMM A;  5GAM e;  4C8Q D;  3SB2 A;  1VQK Q;  3P8H A;  1CKA A;  4RCB A;  5KYX B;  2EKH A;  4BDZ A;  2PZ1 A;  1TH7 A;  1IGU A;  3L2R A;  3CME Q;  3SWN C;  4A4F A;  1OEB A;  1V76 A;  1UE9 A;  1S1N A;  2QQS A;  2GQV A;  3BDU A;  1BYM A;  2P4R A;  1TOV A;  4RTV A;  1WHJ A;  5M9O A;  1QVG S;  4QVZ A;  3E9F A;  2E1H A;  2V1Q A;  3QSU A;  4ATO A;  5ECA A;  4KGV B;  1RAC B;  1IGQ A;  4X9D A;  4XTX A;  4AFZ C;  3L2W A;  4MZT A;  3CC7 A;  5LJ3 h;  2KY9 A;  3NPF A;  1JJ2 S;  2PVD B;  1KQS P;  2BZY A;  4E7Z A;  3JCM W;  4XTV A;  1EZZ B;  4J9D A;  4VUB A;  4PLL A;  2FYK A;  5IXF A;  2Y4Y A;  2KQW A;  4DEY A;  3I9Q A;  3CCR Q;  3H0I A;  1VQO T;  3IQL A;  4E47 A;  2DO3 A;  2CT4 A;  5LJ5 f;  1YJW A;  4DA4 A;  5LJ3 f;  2A3L A;  2KRO A;  1Q82 C;  2V26 A;  1VQ6 T;  2ZZD A;  1JBM A;  3QYH B;  4JZ4 A;  1Y71 A;  9ATC B;  1PC0 A;  4M78 C;  2A28 A;  3MCA B;  3AHU A;  3SD4 A;  3MEU A;  1QP3 A;  2EPD A;  2JN0 A;  4ZNX A;  1W2B S;  2DTO A;  1M9S A;  2JTM A;  5KYX A;  3OS5 A;  2JZ2 A;  4JRQ A;  1M27 C;  4N4I A;  1R0B G;  3LWI A;  3PFS A;  4P5N A;  5KH6 A;  2K3B A;  2QQA A;  2LT1 A;  3JCM c;  4WCI A;  5IXB A;  5C6S A;  2AK5 A;  1BKB A;  2BKD N;  4M7A C;  4CRI A;  1I8F A;  2COY A;  2SRC A;  3I55 A;  4HXJ A;  4PJO C;  4BD3 A;  1GCP A;  3EG2 A;  3QII A;  4N0A C;  4E6R A;  2PTK A;  2J06 A;  4CI0 C;  4ME7 A;  3A8M B;  1VQL T;  1M2V A;  2K4Y A;  5IHN A;  4JJN K;  4BY6 C;  4FIB A;  1U8R A;  1RAA B;  5C0M A;  1PHT A;  1VQ8 T;  3UT1 A;  3OYF A;  2RQT A;  4LD6 A;  4L59 A;  1VQ8 A;  5J3B A;  3C94 A;  1M8M A;  1ZQ1 A;  3OW2 P;  3OMG A;  4MDX A;  1X2K A;  5FWB A;  1QLY A;  4C92 C;  2FZK B;  1ZUY A;  3V7C A;  2CSQ A;  2FG0 A;  3DLM A;  1TUG B;  4BE2 A;  3VV0 A;  2MI6 A;  3EGU A;  3M5A A;  5LJ3 j;  3EG9 A;  1PRM C;  3VU3 C;  2KXD A;  3AT1 B;  3HSB A;  3C4S A;  2MAM A;  4M75 C;  3HKS A;  2ZCF B;  3JCM J;  1WHH A;  1Q7Y R;  4EMK B;  3DKM A;  4C92 G;  1PM3 A;  1Z9Q A;  2B86 A;  3CC4 A;  4F7U E;  1WJS A;  4K11 A;  2NWM A;  1M90 R;  2RNA A;  3CMA Q;  2QEX A;  1IXD A;  4LDW A;  4KUD K;  4BE1 A;  3NFC A;  2AT1 B;  1SSH A;  3T9N A;  4JRP A;  4BUG A;  2O9S A;  2R57 A;  2BZ8 A;  2EYZ A;  2QA4 A;  1YCY A;  5D6Y A;  1TWB A;  4C0D B;  4MMK A;  2DIG A;  2LQW A;  3BY7 A;  2CZ7 B;  1D3B A;  1X6O A;  3A98 A;  1R8O B;  4M77 G;  5CQY A;  2LCL A;  2QQR A;  2RI3 A;  2E65 A;  1RAG B;  4DBF A;  1NG2 A;  3M0U A;  4FM4 B;  2H3J A;  2QEX T;  3MO8 A;  4OMN A;  2V8J A;  2CS7 A;  2QAS A;  2Y4X A;  4RTW A;  2FHD A;  2F2X A;  4FSX A;  1YIT A;  1GCQ C;  2IPO B;  2EVR A;  1M1G A;  2HBP A;  1KHC A;  3URG A;  3VRZ A;  2AKL A;  2DRK A;  3PMT A;  2RQU A;  3CCL A;  4XTW A;  3H41 A;  2E41 A;  5KE2 A;  2HSP A;  4M77 C;  2HZY A;  1I81 A;  2JS0 A;  3V8K A;  4FSS A;  3UWN A;  4ZN1 A;  3REB B;  3MEA A;  4XU2 A;  2L3S A;  4CC4 B;  3JCM d;  3A5Z B;  1KQS A;  1QVF A;  3RUX A;  5GAN 2;  2CZ0 B;  1AWW A;  4HA8 A;  2DVJ A;  4BI8 B;  4F7U B;  4M77 E;  4JJC A;  1K4U S;  1ZA1 B;  3OYL A;  3QDR B;  5DLO A;  3LWH A;  1GFD A;  2XIC A;  1LOJ A;  2D0N A;  2GF7 A;  3JB9 H;  1E6H A;  3MP8 A;  1U3O A;  4OB0 B;  1F1B B;  1HJD A;  1M2O A;  5KYY B;  3FRN A;  1KG1 A;  4O5V A;  3KBG A;  4JJB A;  4XU0 A;  2YUP A;  1D0Z A;  4ORZ A;  2QTV A;  2SEM A;  1I4K 1;  1VQL Q;  3X28 B;  4TVR A;  2RH2 A;  2EAY A;  1MMD A;  1VOM A;  5KYU A;  3I55 Q;  3SWN B;  1UEC A;  2KDS A;  2RK1 A;  1B34 B;  5LJ5 d;  1QWE A;  4M4Z A;  1VQ5 A;  4LDU A;  3X26 B;  4JLG A;  1UJ0 A;  2C0O A;  2B8A A;  1WA7 A;  2F5T X;  4M7D F;  2QI2 A;  5HK0 A;  1I5L A;  2D1X A;  2RI5 A;  2RQV A;  3FIF A;  3M4Y A;  4M7A B;  3JB9 D;  3WXM B;  2PU9 B;  2X3W D;  3MJX A;  1ZSZ A;  1FYN A;  2E5K A;  3MPU B;  4XAX B;  3JCM P;  2EW3 A;  1M5Q 1;  2HNI A;  3R6N A;  1BIA A;  1WHG A;  4KBM B;  1VQP Q;  3JV3 A;  1YHQ A;  3S3N A;  1YFN A;  2RA2 A;  4ELZ C;  1VQ9 Q;  3EH2 A;  4XK8 E;  1XTD A;  3M55 A;  3M58 A;  3RDV A;  2RPN A;  5FU6 B;  2O9V A;  2PNI A;  2VB6 A;  3EFR A;  2F69 A;  1IO6 A;  1YJN T;  3FEO A;  4BE0 A;  1HSQ A;  3NTH A;  3PIP A;  1WXT A;  1D1C A;  1G3T A;  2ZPB B;  4X34 A;  3LH0 A;  3E2U A;  2HL3 A;  3FLG A;  3VYG A;  2QA4 T;  4NL2 A;  4DBR A;  5GAO r;  4PJO B;  2AHJ B;  2GTJ A;  4II1 A;  1T3L A;  2ABL A;  1VQ7 T;  2FRY A;  1OI1 A;  2FB7 A;  1UHF A;  3O5Z A;  2DK3 A;  2LRQ A;  5IAY A;  2MYS A;  4ZN3 A;  2DZC A;  2OTL Q;  4CC2 A;  3J7A F;  1RLQ C;  1XNI A;  1BIB A;  2QA4 Q;  2CZ1 B;  2CP3 A;  3I56 Q;  1FXX A;  1NJI U;  2KRN A;  2DL4 A;  2VUB A;  2R5A A;  4E2F B;  4RCC A;  2GNC A;  3CPW A;  3CPW P;  3CCL T;  1Q7Y U;  1GL5 A;  3NGP A;  2HBW A;  3HRS A;  1V29 B;  3GNG A;  1O75 A;  3KXT A;  2Z0W A;  3UA7 A;  1BU1 A;  1UG1 A;  4PJN A;  2OTJ T;  3RER A;  1UEB A;  3SHW A;  1K73 R;  2KI7 A;  1YN8 A;  2NUP A;  2XD0 A;  5I2M A;  4WTO B;  4F7U A;  4IUT A;  1QVG A;  3TQ7 P;  5FU7 C;  4F16 A;  4Y28 E;  4MML A;  1U1S A;  4C5I A;  3G4S T;  4AFQ C;  3INZ A;  2D0Q B;  4M77 F;  3OY9 A;  3ULR B;  2CT3 A;  3RKW A;  3X24 B;  3VKI A;  5GAN j;  3VS1 A;  2DL3 A;  5FLX E;  3TEE A;  3JB9 G;  4BDY A;  3LYI A;  1JEG A;  4MZP A;  3C95 A;  4Z8A A;  3PVL A;  2NUT A;  1S72 A;  3C0C A;  2PUK B;  2O88 A;  2ROL A;  2CH4 A;  1KC8 U;  5GAO q;  4HVU A;  4DEX A;  2XKO C;  4EMK C;  4J9H A;  5LJ5 g;  2YLB A;  3CME A;  3EH1 A;  2FZC B;  4F14 A;  3NHN A;  4RUG A;  5I11 A;  2XK0 A;  1RAD B;  1OZ3 A;  2K6D A;  1RI0 A;  2M51 A;  2IIM A;  4M75 F;  2HAX A;  2V8I A;  2KBT A;  2ED1 A;  1K76 A;  1YIJ A;  1YHQ Q;  2DMO A;  5GAN g;  3VS7 A;  4X1V A;  2DIQ A;  4KUI A;  1BBZ A;  2GTO A;  4E7H A;  4HT8 A;  2K3X A;  2LCS A;  3MHX A;  3VUZ A;  1Y7X A;  2MCN A;  1GCQ A;  2L3Q A;  2LQ8 A;  2M0Y A;  4ANJ A;  4Z89 A;  1Y0M A;  1G83 A;  2W0Z A;  1YI2 Q;  2LNH B;  4GLM A;  1CKB A;  1M8V A;  1N9S A;  4F17 A;  4M77 A;  1B07 A;  2JJ9 A;  3E9G A;  4D8K A;  2EQI A;  4E7I A;  4FYV B;  3A1P A;  4HCZ A;  1Q81 R;  1SHG A;  4X9C A;  5GAN 3;  2LTO A;  1NPR A;  4J9C A;  1OUL A;  1OQK A;  3QDF A;  5CR2 A;  1OV3 A;  4J9I A;  1MMA A;  1SPK A;  1ZA2 B;  2MOX A;  3CC2 T;  2GFU A;  5GAN h;  3CMA T;  5I22 A;  2DET A;  2CDT A;  2DTH A;  1YJN A;  1G3Y A;  4EPC A;  2QXF A;  3CBO A;  3GOX A;  1QKX A;  2FPD A;  1VQ5 Q;  3WVE B;  3ZEH A;  4M7D C;  2M1H A;  1UGR B;  2LJ1 A;  2NUT B;  4M7D B;  2L3P A;  3EG3 A;  4FW2 A;  1K8A C;  1RAH B;  2OTJ A;  4NL3 A;  2LNV A;  1VYV A;  3QO3 A;  2XDP A;  1QQJ A;  1QVG P;  2A37 A;  4IUR A;  4M75 A;  8AT1 B;  3THK A;  4R0K A;  3PIO A;  4FT2 A;  2EGA A;  3HPW A;  1S72 Q;  2GQI A;  2VGN A;  5HK3 A;  1QCF A;  4RTU A;  1K8A U;  2XMF A;  3CD6 T;  4KRT A;  3CME T;  2AZS A;  3TVT A;  1YIT T;  1D0Y A;  1MUZ A;  2PVO B;  4LDV A;  3OYC A;  1X2Q A;  3QHS A;  2BZX A;  4KUL A;  3ZL7 C;  1S72 T;  4GBQ A;  2YHT A;  1EX4 A;  1UUE A;  2X4W A;  3A8H B;  2BIV A;  5D6X A;  1G8X A;  2FPF A;  2QQB A;  3X20 B;  1ABQ A;  2ATC B;  1YCS B;  2DL8 A;  5GJW B;  4J8O A;  3V7S A;  2DEU A;  3SFM A;  1RL2 A;  1M1K C;  3OYD A;  1YJ9 T;  2CKK A;  1Q86 C;  1ZSG A;  1R77 A;  1AOJ A;  3OYN A;  3JCM e;  1YJ9 A;  1X27 A;  4PFP A;  3FC3 A;  4M7D G;  2KK4 A;  5LJ3 d;  2DL5 A;  2CP5 A;  4XU1 A;  3ME9 A;  1GFC A;  2DA9 A;  2K7A A;  4E7K A;  1YNZ A;  3F70 A;  1UDL A;  1UJY A;  1XQH A;  3G6E Q;  3TSW A;  4JZ3 A;  3OYH A;  1RAE B;  1WFW A;  2X51 A;  5CAI A;  2E4H A;  1OX9 A;  2DBK A;  2HQX A;  1WGS A;  1H64 1;  4RG8 A;  3CCQ T;  4M78 A;  4HT9 A;  3M57 A;  1ZSZ C;  2D8H A;  3CCR A;  1FMK A;  1W4S A;  3OSS C;  3TU4 K;  5GAN 4;  1Y96 A;  2EQU A;  3BDL A;  4A4E A;  2KR3 A;  2VWF A;  3SDZ A;  2O31 A;  2E5Q A;  3G4S Q;  1WX6 A;  2DNU A;  2NLU A;  2EQM A;  2C0I A;  1AWX A;  1KSW A;  1SRL A;  1QVF S;  4M78 B;  4Z02 A;  3VJP A;  2QGF B;  1NJI R;  4PJO G;  3OW2 S;  3VYH B;  1KD1 R;  2R5M A;  1X01 A;  3GF5 A;  3ZFJ A;  2ZPI B;  5L8R E;  1FMV A;  3CQT A;  3QUI A;  4C5G A;  1M1F A;  1FMW A;  4RTZ A;  2CRE A;  2QAZ A;  4OVA A;  4AG2 C;  2RHZ A;  2L0A A;  4A4H A;  2H8H A;  2X9H A;  4M75 D;  2K79 A;  3CCE T;  1VQN T;  1PNJ A;  3OMC A;  3V8J A;  4AFU C;  5DLQ E;  5GJV B;  5GAM j;  3RR6 A;  1NYG A;  1VQO A;  1NBE B;  3A8L B;  5A0G A;  3CCV A;  2C0T A;  2EKO A;  3QPH A;  2WSE E;  2WAC A;  3OS2 A;  1N8R C;  2DZ9 A;  3OQ5 A;  4PJL A;  1RAB B;  5IHI A;  2RJF A;  3BE3 A;  4AFS C;  2A36 A;  2DD4 A;  1M90 C;  1PSF A;  3KFV A;  4FW1 A;  4B6M A;  1BCM A;  1D1A A;  1IB8 A;  3I5R A;  3NMZ C;  4M75 G;  5L23 A;  4J7I A;  1AD5 A;  2HD0 A;  1JQQ A;  2ZPH B;  4XQ3 A;  3V7R A;  2MK5 A;  2PQW A;  1G2B A;  5J39 A;  2LCC A;  4BAC A;  3CC7 Q;  2VV5 A;  2DIL A;  3RNJ A;  4LUE A;  1D3B B;  2WSC E;  5KYY A;  3CCS A;  4ESR A;  2EYW A;  3CCE Q;  1VQN Q;  1UGV A;  5GAO l;  3CD6 Q;  3CC4 Q;  1X75 C;  3CBM A;  1YJN Q;  1BB9 A;  1JU5 C;  1CSK A;  4PFO A;  1PD1 A;  1YWO A;  5GAN 6;  2RI2 A;  3CBP A;  2YSQ A;  3CCM Q;  1WHK A;  5KYW A;  1E7O A;  2LDM A;  1YP5 A;  5GAM g;  1JB0 E;  2RHI A;  3HHT B;  4JUV A;  2FL7 A;  4M75 B;  3UDC A;  2VKN A;  3CCU Q;  2KYB A;  2DM1 A;  1XOV A;  1JJ2 A;  1VQ5 T;  1X69 A;  3G71 T;  1VQK A;  3QYG B;  2OTL T;  1MND A;  4A54 A;  4J6Y A;  1M3B A;  4D6W A;  2LMJ A;  3FJ5 A;  2OTL A;  4B9X A;  2ENM A;  3TRE A;  1QVP A;  1TS9 A;  2FVU A;  4M78 D;  2RJD A;  1WI7 A;  5GAO m;  4C92 B;  2KSS A;  1KD1 U;  2WSF E;  2EJG A;  5KE3 A;  4PNO A;  3OSV A;  2EFI A;  1QCN A;  2DJQ A;  4KGX B;  4LUD A;  3GPL A;  4MDW A;  2DXB A;  4J5Y A;  1BCO A;  3CCJ Q;  3G6E A;  4RKU E;  2F2V A;  1W70 A;  3MEW A;  1KQ1 A;  2QGG A;  3M0T A;  1KD1 C;  1NYF A;  1YIJ T;  2IVW A;  1ZHI A; 
#chains in the Genus database with same CATH homology
 1TWB A;  2QAS A;  1OUL A;  2NYS A;  1ZSZ B;  1YFN A;  1OX8 A;  1OU9 A;  1OX9 A;  1ZSZ C;  1ZSZ A;  2QAZ A;  1OU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...