4OMPA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128k
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGKTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ompA00
2EW3A 2YUOA 3M0PA 4HVWA 2RQTA 2CH4A 2DL7A 2J06A 1ZLMA 5EC7A 4A63B 3EG2A 4F16A 1JXMA 3M0QA 1N5ZA 4JZ4A 2DJQA 1MV3A 2LQNA 1YWPA 2DRKA 4HXJA 1KFZA 2FPEA 1AVZC 1G83A 5IXFA 3VS4A 4IIMA 3UF4A 3TVTA 2CSQA 2EYYA 3FJ5A 1B07A 1K4US 2PZ1A 2DLPA 1OOTA 1QKXA 2HEQA 1Z9ZA 1ZX6A 2AKKA 3REAB 1W70A 2CH4W 2BZYA 3M0TA 4E6RA 2VVKA 1JO8A 4CC4B 2FG0A 4ORZA 2DL4A 2FPFA 2EGEA 1QKWA 1ARKA 1SHFA 2RNAA 1CKBA 2W10A 2X3WD 1J3TA 2DL5A 2JS0A 5IXBA 1BU1A 3VS5A 2LJ3A 3M0RA 4RTYA 4EIKA 4JZ3A 2OI3A 4J9FA 1WXBA 3I9QA 2LJ0A 2KXCA 1KSWA 1UFFA 1BBZA 3PVLA 3LH5A 1RLQC 1M8MA 1X2KA 4DEYA 1WA7A 2LZ6B 1V1CA 1GCPA 2RQRA 3EHRA 1SPKA 4AFSC 2FO0A 3RBBB 4LUDA 2GQIA 2NWMA 3VS7A 3PVQA 4M4ZA 4RUGA 2B86A 2KBTA 1LCKA 1PWTA 1K9AA 1WFWA 1NYFA 1M30A 2V1QA 1QLYA 4HCKA 1M3AA 3R6NA 2EQIA 1JQQA 1RI9A 4AFQC 1GL5A 1SHGA 4RTWA 2J6OA 1K0SA 2EYWA 2KROA 2YDLA 2SRCA 1SRLA 4ZNXA 2VKNA 2EGCA 2EKHA 2HBWA 2VWFA 3M0UA 3VS0A 1MUZA 4RTZA 2LMJA 1BK2A 2KRMA 2A28A 3I35A 2G6FX 2RMOA 3NHNA 2J6FA 1OPLA 1GCQA 1U06A 1QWEA 2K7AA 4CC3A 2CREA 4KRTA 1B3QA 1WIEA 3REBB 2PTKA 3EGUA 2F2XA 1CKAA 2EYXA 1HSQA 2D0NA 5I11A 2RQWA 2DYBA 4GLMA 1ZUKA 1TUDA 4J9DA 1WLPB 2X3XD 2NUZA 2EPDA 1GFDA 2BZ8A 1BB9A 2L2PA 2L0AA 2O2OA 1X2QA 5FWBA 5HCKA 1OV3A 5L23A 4AG1C 1NM7A 4Z89A 2FPDA 1ABOA 2QDLA 1AZEA 2KYMA 2CSIA 2BTTA 4OMPA 1WXTA 4OMQA 2J6KA 2O88A 1KIKA 2RQUA 2J05A 2HSPA 3SHWA 1GCQC 1PRLC 2D1XA 4X1VA 5IH2A 4QT7A 1HD3A 5IHKA 2ED0A 1YCSB 2F2VA 1PKSA 3VRZA 4FSSA 2L3SA 2DM1A 1E6HA 4RTUA 1ZSGA 1A0NB 4OMNA 2ENMA 1WX6A 1VYVA 4J9IA 1X6BA 2JXBA 1Y0MA 4R0KA 3RNJA 2GBQA 4JJCA 1JEGA 1AWJA 4CC2A 5GJVB 1MV0B 2AK5A 1U3OA 1H8KA 2AZVA 2OJ2A 3U23A 4AFUC 4J9GA 4D8DA 2FRWA 4IIOA 3VS1A 2K3BA 1UGVA 4CC7A 2O9SA 2ROTA 4OMMA 2DF6A 3QWXX 3O5ZA 1PNJA 2H8HA 3H41A 4D8KA 1IO6A 1QCFA 3QWYA 2C0OA 2DL3A 2KEAA 2O9VA 1UTIA 2KR3A 1I07A 1NLPC 2DBKA 2MOXA 3VRYA 4Z8AA 1NEGA 1K76A 1ABQA 4JJDA 2XMFA 2HCKA 2GNCA 1ZUYA 4F14A 2LJ1A 2KRNA 1T3LA 1UHFA 2DL8A 2GGRA 3THKA 1X27A 1K0XA 2DX1A 1W6XA 2EBPA 2I0NA 1H92A 2M0YA 1SRMA 3H0IA 2CT3A 1EFNA 1SEMA 2J7IA 3ZL7C 2LQWA 2PNIA 1AWXA 2YSQA 1NLOC 3NGPA 1GRIA 3CQTA 2DVJA 2JTEA 1UJ0A 2YUPA 1PKTA 3H0HA 4K11A 3TSZA 1VA7A 3ULRB 2A08A 2DNUA 2L3PA 1WDXA 4Y92A 2SEMA 1T3SA 1OEBA 2EYZA 1XOVA 1NYGA 2JMAA 2O31A 1ZUUA 2MCNA 2CDTA 3PE0A 1UJYA 3NPFA 2FRYA 2YUQA 1UECA 5GJWB 2F2WA 2GTJA 1AWOA 1GBRA 3NMZC 1FMKA 2KNBB 1H3HA 4LN2A 4ESRA 3KFVA 3H0FA 2W0ZA 2LCSA 1KJWA 5I22A 2JMCA 3JV3A 2K9GA 3EG0A 4WCIA 2LX7A 1X69A 4AG2C 1NEBA 1UDLA 2KYBA 3EG3A 3UA7A 2RQVA 1YNZA 3EHQA 1HJDA 4RTVA 1UG1A 1OPKA 2DRMA 2KXDA 1AEYA 3I5SA 2JM8A 2K79A 2AZSA 2LNHB 1UE9A 2HDAA 1WXUA 1PHTA 1SSHA 3I5RA 2KGTA 4OMLA 2ABLA 2ED1A 2A36A 2BZXA 2JT4A 2DILA 1QWFA 1ZBJA 4JJBA 3TSWA 2P4RA 2CT4A 1AWWA 2M51A 3UA6A 2DE0X 4LNPA 1T0JA 4HVUA 1TG0A 1Y57A 2KT1A 2JM9A 4J9BA 1G2BA 2DA9A 1UHCA 1AZGB 1UUEA 2L3QA 2ROLA 1E6GA 4DEXA 1JU5C 2RF0A 5FW9A 1AD5A 1AOJA 1TUCA 3EG1A 1FYNA 1YN8A 1JXOA 2MIOA 1YP5A 2AKLA 4LE9A 2E5KA 4J9EA 2K2MA 2LP5A 2CUBA 2YUNA 2C0TA 3IQLA 3VS2A 1M3BA 2D8HA 1M27C 3SEMA 2DMOA 3M0SA 1YWOA 2GTOA 1VYTA 1K1ZA 1M3CA 4RTTA 1E7OA 1VYUA 2IIMA 3C0CA 2ESWA 2YT6A 2JS2A 2DBMA 4Z88A 5FWCA 1I0CA 2RPNA 1PRMC 2KT8A 5ECAA 1GFCA 2EVRA 3A98A 1Z9QA 4JPBW 2D8JA 4J9CA 2A37A 4LUEA 4J9HA 2KRSA 4AFZC 1X6GA 1I1JA 2K6DA 2C0IA 1CSKA 2V1RA 1NG2A 4GBQA 4RTXA 1T0HA 2FEIA 5IHNA 1RLPC 2KE9A 3GBQA 4OMOA 2OAWA 4HVVA 2RN8A 1W1FA 4F17A 1U5SA 2JW4A 1X43A 3VS6A 5IHIA 1RUWA 2ECZA 2EGAA 3UATA 1WI7A 2CUDA 1WYXA 1S1NA 3VS3A 1GBQA
chains in the Genus database with same CATH superfamily
2EW3A 3M0PA 4BUGA 1WJRA 2K4YA 5EC7A 3EG2A 4M78D 4FCYA 1VQOT 4M77D 1WHLA 2LQNA 5CKEA 3OYHA 1YWPA 2DRKA 1KD1U 1VQNA 2ZPFB 1AVZC 1G83A 3CCMA 5IXFA 2DTOA 3VS4A 3TVTA 1OX9A 2CSQA 4M77E 2QAZA 1B07A 1VQ4Q 3CC2A 2PZ1A 5I21A 5M9OA 1OOTA 3OYEA 2EIFA 2QQBA 1NPPA 1K8AU 3FEOA 3CBOA 1JO8A 3CMEA 3CCLT 3CCET 2FG0A 2LDMA 4ORZA 4M75A 1IHVA 5DLQE 2EGEA 4C8QB 1BI3A 1X6OA 3C94A 2BE7D 1OI1A 1WJQA 3ZBDA 5CCAA 2RNAA 1W2BP 2O4XB 5GANj 2VUBA 2W10A 2X3WD 3OS5A 2JS0A 2JNGA 3BDUA 3BY7A 3S3OA 4EIKA 2RHXA 2OI3A 1D1CA 1N8RR 3PMTA 2KXCA 1XTDA 2DIGA 1VQKA 1KSWA 1UFFA 3PVLA 2O4XA 2K57A 4DEYA 1WA7A 4QQ6A 3MEUA 1R77A 1GCPA 2OTLT 2GFUA 1M90U 2EQKA 2RHZA 3QSUA 2E6NA 4AFSC 3MJXA 2VV5A 1Q81R 2GQIA 1VQ8A 3PVQA 3CCRQ 4M7DD 1WJSA 2HQXA 3MEVA 4M4ZA 1VQ9Q 5LJ5g 3RMSA 2P0QA 1PWTA 1K9AA 3TEEA 2A3LA 4IURA 4PJOG 1RI9A 2QXFA 3P8HA 5LJ5e 3L42A 3CEYA 2MWOA 5EG2A 3CC4Q 4RTWA 2J6OA 3TCJA 5IT9E 4MZMA 1SRLA 3CCQQ 1YI2Q 3SWNC 3J81E 4V2SA 2ZPIB 4IUQA 4KT0E 3RKWA 1Q81U 1S72T 3VS0A 5GAN3 2DIQA 2LMJA 3CCUA 1Q86R 2G6FX 5D6WA 2V26A 1VQ4T 2HKQB 1MMNA 2K7AA 4KULA 4BE0A 4N4HA 1NPRA 2YRCA 3ZFJA 3V8LA 3JCMP 5D6YA 5KE2A 2QQAA 3EGUA 1CKAA 2H3EB 1HSQA 3OYDA 3PT9A 3EFSA 1IXDA 1TH7A 4XU3A 3EH2A 2CS7A 4PJOF 3SFMA 4HCZA 2L2PA 1X75C 1Q86U 2L0AA 2O2OA 1X2QA 1SSFA 4Z89A 3RDVA 4ELZC 4J83A 4XAXB 1TS9A 1RAGB 1WXTA 2ZPBB 2O88A 1KIKA 2KAFA 4BE2A 3QZ5B 3G4SA 2D1XA 4X1VA 4QT7A 5IHKA 1RAIB 3M56A 2ED0A 1YCSB 2F2VA 4M78B 2LT4A 2DM1A 3CXCS 1U1TA 2PQWA 2M02A 3JSCA 1Y0MA 1AWJA 4CC2A 5HKCA 1U3OA 1Y7XA 2Y4YA 4J9GA 4D8DA 5LJ3g 3VS1A 4KBMB 2K3BA 3TREA 3X20B 4CC7A 2O9SA 3SD4A 1LNXA 3QDFA 4JS4A 2DF6A 2RJFA 4Z02A 4N4IA 3H41A 1IO6A 5GANg 1QCFA 2EQJA 3QWYA 2DL3A 1UTIA 3CD6T 2MOXA 1WGSA 3E9FA 2X4WA 1K76A 3LH0A 2LJ1A 2QEXQ 2DL8A 2XDDA 2DX1A 2I0NA 2M0YA 2HL5C 1BYMA 2PVDB 1BCOA 4KGZB 1IB8A 1YJWA 2PNIA 3OW2S 1NLOC 3GNGA 1M5Q1 3A8MB 2DEUA 3DB3A 4C5EA 3VKIA 3CQTA 3M53A 2QQSA 5GAMd 3H0HA 4K11A 3TSZA 1WHKA 1MNDA 2L3PA 4M78G 4MZPA 2SEMA 1T3SA 1OEBA 3A1PA 3JCMQ 1KK7A 5LJ3d 1RAAB 1ZHIA 4E7HA 1XOVA 1HYOA 2JMAA 2LTOA 2K3YA 2MCNA 3MP8A 3NPFA 3PE0A 3SB2A 4MZTA 2Z0WA 3OBWA 5GJWB 2F2WA 4C5IA 4UC4A 1Q7YC 2X9HA 1FMKA 2KNBB 1SF9A 2R58A 4LN2A 3KFVA 1WHGA 1KQSA 2FZKB 2LCSA 5I22A 3RKXA 3ASKA 2K5FA 1WQ7A 2K2VA 4M75G 3EG0A 5CKDA 3OYJA 2RK2A 3LGLA 2QASA 3V8JA 4QQDA 1YIJQ 4A4EA 3OYMA 1KG1A 4LD9K 4RTVA 1OPKA 4P5NA 3I5SA 3OB9A 1Q82C 2MAMA 4VUBA 3CCSQ 1WXUA 3UWNA 3I5RA 2QK0A 5CVIA 1Q86C 4OMLA 2A36A 4EMGA 2BZXA 2JT4A 1YJNA 1ZBJA 2D9TA 3E9GA 3A8OB 1AWWA 5GAMf 3UA6A 2DE0X 4OVAA 1OU9A 1T0JA 1WZOA 2QTVA 4HVUA 3CCLQ 3CCEQ 3E2UA 3X25B 2EJGA 2QA4Q 4J9BA 1G2BA 1YBYA 3E19A 1UHCA 1YITQ 4M7DG 1AT1B 2YLBA 3HPWA 2RJDA 2ROLA 2ATCB 4DEXA 3N5BB 1AD5A 1AOJA 3EG1A 3HP9A 5HY6A 1FYNA 1JXOA 1LPLA 3L1AA 4TVRA 2AKLA 4PJOD 1BI1A 3JRZA 3F70A 3VUZA 4J9EA 4FM4B 2CP0A 2CUBA 2YUNA 1OX8A 3VS2A 2XG8D 2D8HA 3AT1B 4J5YA 2E6ZA 1C0MA 3CC7Q 2E12A 1TWBA 4A4KA 4L5GA 1M1KU 4R55A 2PUKB 2EYQA 3FJPA 1C6VX 1F1BB 1IREB 2QQRA 4C0DC 3MP6A 2RM4A 1YJWQ 1Q82U 3EAEA 2MYSA 5FWCA 2RPNA 8ATCB 1GFCA 4IKFA 4KH1B 1Z9QA 4JPBW 4AT1B 2A37A 4AFZC 1JJ2S 2K6DA 4MDWA 2PUOB 2C0IA 1B34A 1VQKQ 2JTFA 2A0FB 4ZN1A 5KYUB 3AHUA 1UGPB 3I55T 4RTXA 1ZA1B 2QA4A 5LL6S 7AT1B 2RN8A 1KC8C 2JW4A 1X43A 1RUWA 3WVDB 4F7UF 2RI5A 3DB4A 2EGAA 4DBHA 2E5QA 1VQKT 1S1NA 5GAN2 3JB9G 2HD0A 5GANe 2MWPA 1M2OA 4HVWA 4PFPA 3CMET 1PSFA 3SDZA 4ME7A 4C0FA 3CCEA 3CCLA 2DL7A 4F16A 1JXMA 3OA6A 1N5ZA 1MV3A 3OYGA 3TQ7P 1K9MU 2EWNA 2XU8A 3HRUA 1KFZA 2D6FA 1N6AA 4E2FB 2FPEA 1B7TA 1OYXA 1XQHA 4IIMA 2EYYA 1K4US 4C5GA 4RG8A 1QKXA 5A0GA 1Z9ZA 3CPWS 2QGGA 1JB0E 1Y71A 2ZAEA 3REAB 1W70A 2CH4W 3FB9A 2D0QB 2VVKA 3PFSA 4FYWB 2FPFA 4EMKA 3G7ZA 1QKWA 2L89A 1WHMA 1MHNA 1SHFA 2L8DA 4F7UA 2DTHA 4FU6A 3TU4K 1J3TA 3EFOB 3S3NA 3S3MA 4EMKC 4J9FA 1WXBA 1S72Q 2COYA 1VQMT 2LJ0A 4PLIA 3A5ZB 4OB2B 1BBZA 2IPOB 5IAYA 1X2KA 5J3BA 1BKBA 3QJ6A 1V1CA 2EJFA 3OMCA 3EHRA 1M2VA 5KYYB 3M9QA 2GQVA 3G71T 3A8LB 2B86A 2FZCB 5GANd 3X24B 1VQ6Q 1TOVA 2LRQA 1WFWA 1NYFA 3HRTA 2V1QA 1QLYA 4JRPA 4M78A 1JQQA 2YRDA 4AFQC 1GL5A 4N0AC 1ZBXA 3QYGB 2AHJB 1YFNA 3Q1JA 4ELYC 4C92E 2KROA 1VQ9A 4M78C 3QJYA 4PK4A 1G3WA 2HQEA 4QQGA 2VKNA 4R56A 3CCRA 2X4YA 2EKHA 4C0ZA 2VWFA 3M0UA 1BIAA 3E1SA 1BK2A 2KRMA 5KH6A 3VU3C 2YXYA 5CIUA 2JTMA 2J6FA 3NHNA 2LT1A 3EGDB 2CZ1B 3VUBA 2KDSA 1QWEA 4CC3A 3OQ5A 2CREA 5LJ3j 1PSEA 1UEBA 1B3QA 5GMKh 1VQ8T 1N9RA 3OS0A 2PTKA 2F2XA 4OB3B 4Y28E 1TXQA 2NYSA 4C92G 2P0PA 1X01A 4GLMA 3SWNB 1QVGS 1Y96B 4J9DA 1PM3A 4JUVA 5GAN5 2X3XD 1GFDA 4FYYB 2DEQA 4CI0C 5FWBA 1OV3A 4AG1C 3M55A 1K8AR 1ABOA 4PJJA 4B6MA 1LJOA 1TTHB 3CCJQ 4OMPA 1VQ9T 2RHIA 2CP3A 2J05A 3JCMc 4QVZA 5IH2A 1VQPA 1HD3A 1UGQB 1PC0A 3VRZA 4FSSA 3L2WA 1E6HA 1A0NB 2XHCA 3CCVA 2ENMA 5DM7R 2M9UA 1YJ9Q 4ZTJA 4DOVA 3RNJA 1JEGA 1YI2T 5CQYA 4AFUC 4E7IA 4IIOA 1YITT 1VQPT 1D3BB 4IUTA 3GP8A 2ZZDA 2FVUA 4A4HA 1PNJA 4J6YA 4FYVB 1KC8R 2C0OA 1M4ZA 1GXIE 3OYLA 2RJCA 2KEAA 2O9VA 2KR3A 4J7IA 1RAFB 2CZ0B 2DBKA 3HTRA 3MEWA 4JJDA 2XMFA 5GAMh 2CZ6B 4ZGJB 2KRNA 1T3LA 1RL2A 2ZCFB 2VGNA 3THKA 4BDZA 1K0XA 5FROA 2XD0A 1W6XA 1H92A 1D1AA 3BW1A 5KYXB 2ZPHB 4PLLA 2J7IA 3ZL7C 3CCQT 1Y07A 4JJNK 1VQ5A 4C8QF 3NGPA 3OSVA 4JLIA 3X26B 1WHJA 5LJ3e 4LDWA 1KC8U 1M2VB 2V8JA 1VA7A 5KYXA 3FDRA 1WDXA 1M1FA 5CQXA 4M78F 3JCMW 5LJ3h 2OTJA 4OMFB 2XICA 2EYZA 2EFIA 3VJPA 1NYGA 4O5VA 4O6JA 2HBPA 2DTIA 2BKDN 1UB4A 4FT4A 4OGCA 3CPFA 3CMEQ 2GTJA 1AWOA 3MKDA 5FRMA 3NMZC 1H3HA 3NTKA 2P84A 4FW2A 4JDSA 1G3SA 3JAME 3CC2Q 3L2ZA 1KJWA 2Y90A 3GLXA 5A0DA 3FC3A 2JJ9A 2F5KA 3JV3A 3CCJT 4AG2C 1YIJA 2E41A 3J7AF 1YNZA 4LXCA 1FX7A 3C4SA 2VXEA 1QW1A 2KXDA 1AEYA 4PNOA 4DBFA 3D7SB 1PHTA 1FMVA 2E4HA 2KGTA 2ED1A 4E7ZA 3JCMf 4KUIA 3TSWA 3JB9F 3OYAA 3HRSA 3OYCA 4LNPA 4LDYA 3CC7T 2KT1A 1M90R 3M58A 4QVCA 2XK0A 1PD0A 2DA9A 4FSXA 1UUEA 3V7RA 4JLGA 1ZSZA 2MK5A 1JU5C 1EIFA 2KQWA 1TUCA 4IUPA 2FB7A 4HA8A 2KSSA 4PKCC 2KK4A 3KXTA 2FZGB 2X51A 1TU0B 1G5VA 3OYIA 3IQLA 2R57A 5CK9A 4PJOE 3M0SA 3NTIA 1YWOA 4XU1A 1M1KR 1VYTA 1M3CA 4FYXB 4ZGEB 4M77C 2HMAA 3CCJA 1E7OA 2IIMA 1KQSS 1U8RA 2ESWA 3G71Q 2YT6A 3JCMV 1Q82R 4OB1B 5DLOA 3CD6A 4ZTFA 2KT8A 1C1AA 5ECAA 3RMQA 3A98A 3EFOA 2NUPA 2OAUA 4PJMA 3QYHB 2D8JA 4J9CA 3QUIA 1X6GA 1K8AC 1MMAA 3P8BB 2FEIA 5IHNA 3JB9J 2KE9A 2OAWA 2LC4A 3MEAA 3VS6A 5LJ5d 2ECZA 4JRQA 5LJ5f 2CUDA 4L59A 1GBQA 1Q95G 2YUOA 2P4TA 2CH4A 1VQMQ 1K9MR 2X4JA 2LVMA 1WNLA 2LQ8A 4IUVA 3G1JA 4HXJA 3M54A 4MDXA 1NBEB 4X9DA 4MMKA 3RESA 2ZPEB 4EMHA 2HKNA 3RKYA 2HEQA 2QA4T 4E6RA 1TSFA 3UDCA 2JVVA 3OS2A 2IG0A 3M5AA 4NOYA 1QCNA 4C92F 4PJOA 1ZQ1A 2E1HA 4C8QG 5A2QE 3OBYA 3VS5A 2LJ3A 3M0RA 4RTYA 4JZ3A 1YJ9A 3CMAQ 4M7AE 1S72A 2EKOA 1RACB 3CCVQ 1YJNQ 2YWWA 4C92B 1ZA2B 2XDBA 3CXCP 2LZ6B 3V8KA 2RQRA 2R5MA 4E7KA 4BY6C 4HT9A 5KYWA 5GMKi 3RBBB 3VS7A 2NWMA 5GMKl 3VV0A 4QKUA 2E10A 2M16A 4II1A 4A54A 3EGXA 3KBGA 3H8ZA 2DYIA 2LX9A 5L8RE 5I2SA 5GAN7 1M30A 1M3AA 2EQIA 4MMLA 4NL3A 1I5LA 1SHGA 3UT1A 4ZN3A 1H641 4BY6B 5GAN4 4FIBA 2EYWA 2SRCA 4F7UE 2DZCA 3VYHB 2CYZB 2EGCA 3OYKA 1MMGA 4NS5A 1MUZA 1ZSZB 3PMIA 2VYTA 2RMOA 3M59A 3HFOA 1IGQA 2BIVA 1GCQA 4M7DB 2VC8A 4M7AA 1U06A 1OU8A 4KRTA 3X28B 1NJIU 1WIEA 3REBB 2EYXA 5HK0A 4M7DF 4XTZA 2D0NA 2RQWA 1Q7YU 3GNFB 1Q81C 3PIOA 4M7AC 2DYBA 3A8GB 3LWIA 1N8RU 3I56Q 1VQ4A 2NUZA 1UGSB 2BZ8A 1R8OB 4M77A 1AHJB 3QO3A 3CCUT 5AYFA 5CO7A 2HSEB 5HCKA 3V7CA 4FL6A 5C0MA 5L23A 2DD4A 5GAOm 1M90C 3HHTB 2FPDA 2QDLA 2KYMA 1VQOA 4OMQA 3CC7A 1D0ZA 2RQUA 2XDPA 3BE3A 3SHWA 2RI3A 1O75A 1KD1R 1QVFA 4M7AB 3M4YA 4B9WA 1PKSA 4E7LA 2L3SA 2MI6A 3WVEB 2CKKA 2JUFA 2RI2A 4OMNA 1WX6A 1VQLT 4E7JA 1VYVA 4BI8B 1D1BA 4J9IA 3RIRA 2M0OA 4R0KA 2VGMA 1MV0B 5GJVB 5IN1A 2AK5A 3EGDA 2OJ2A 4DBRA 2WSCE 2A7YA 3UPUA 2JN0A 1UGVA 3G4SQ 2K5LA 5A0LA 4OMMA 1Y96A 4WF2A 2RH2A 3EFRA 3QWXX 3O5ZA 4EDUA 1R0CB 3QZ9B 4D8KA 3JCMe 2QQ9A 1VQ7Q 1I07A 4C8QA 3VRYA 5GAMe 5C6SA 1NEGA 4JS5A 1ABQA 4AMCA 3JCMX 2HCKA 2GNCA 3G4ST 1ZUYA 4F14A 3CCST 2XIDA 3I55Q 1UHFA 1R0BG 2ZPGB 4RCCA 3OYFA 2GGRA 5GAMg 2XI9A 3CPWP 1SRMA 4BI3A 4WTOB 3GPLA 1SEMA 2GF7A 3JB9H 2F69A 2CGHA 1AWXA 3OMGA 2IVWA 1QQJA 2YSQA 4EPCA 1M8VA 3OSSC 2B8AA 2DXTA 2JTEA 5KCHA 1PKTA 4N4GA 3ULRB 3OYYA 1OZ2A 4HCCA 1FWZA 3JCMb 2OTJQ 5GAOl 4Q5WA 4C5HA 2HNIA 4OF1A 4M78E 2COWA 5D7UA 5GAOq 1YI2A 2CDTA 2LCCA 4C8QC 3BFMA 1UJYA 3R6OA 1UECA 3RERA 3MO8A 1V76A 1GBRA 3CC4T 3CBMA 5HK3A 4GLKA 2E64A 5KYNA 4A4GA 2BE9B 1I8FA 2K9GA 4ANJA 2LX7A 2RD1A 4XU2A 2GCXA 4GY5A 2KYBA 3EG3A 1JRIA 4HCBA 1MMDA 1YJWT 2RQVA 1HK9A 3O8VA 4C8QD 4M77F 1PD1A 3H9NA 4IUUA 1UG1A 2DRMA 2QEXT 1KQ2A 2E65A 4A53A 2KY9A 2AZSA 2LNHB 1UE9A 3EG9A 2ABLA 1QVFS 3JCMg 1LVKA 4M75C 2DILA 1QWFA 5DY9A 2RHYA 2CT4A 3JCMh 1WQWA 2Y4XA 4M7DC 1QP2A 2JM9A 3DKMA 4KGXB 3CCVT 4FT2A 4D6WA 3H6ZA 3HFNA 5GAMj 2PVGB 3RR6A 3HSBA 2L3QA 3LX7A 2RO0A 2RF0A 5FW9A 3NTHA 1D09B 1YN8A 2V8KA 1MGQA 2OX7A 2MIOA 2QTXA 3QDRB 1YHQA 4DOWA 2E5KA 4M75D 2CP7A 2K2MA 3KUFA 2LP5A 2C06A 1KHIA 3JB9D 2C0TA 1M3BA 1M27C 4M77B 1JBMA 3I55A 2DPPB 2DMOA 2QYZA 1D0XA 3SEMA 4LDVA 1IHWA 2GTOA 4J7FA 2YRVA 2JZ2A 1K1ZA 2DXUA 4RTTA 2QGFB 2DD5A 2JS2A 5CKBA 2DKGA 2DBMA 1SKUB 4PJOB 1I81A 3PNWC 1PRMC 3QG1A 4OGEA 5KYYA 1VQNT 1RAEB 2EVRA 2EQMA 1I4K1 4PL6A 4M7AD 3C12A 4LUEA 1IZ6A 2DFUA 1YHQT 1I1JA 3LLRA 1CSKA 1M9SA 2DXBA 4XTWA 2DVEA 2V1RA 4GBQA 1T0HA 1QVFP 2EAYA 3LYIA 1RLPC 1QP3A 4BB7A 3L2QA 5GAOr 2VB6A 1W1FA 5CKFA 3NFCA 5CKHA 3CC2T 3CBPA 4XTVA 3CXCA 3UATA 1WI7A 3QIIA 3VS3A 1EX4A 3QKJA 3EGXB 4M75F 1D0YA 2RA2A 1YJ9T 2KI7A 2RQTA 4F7UB 4J8OA 2J06A 1ZLMA 4A63B 1DJ7B 3M0QA 5KYWB 1FXXA 4JZ4A 2DJQA 2MF2A 4A4FA 1VQ6T 2OTLA 2RB6A 5GANf 5LJ5h 1VIFA 3I56A 4XTUA 1Q7YR 3UF4A 3MPUB 3FJ5A 5AT1B 3JCMJ 4M7DE 5KYUA 2HZYA 2DLPA 2HQHA 4F04B 5FLXE 1ZX6A 2AKKA 2JOYA 2DERA 3L2RA 1VQMA 2BZYA 3M0TA 3QBYA 5J26A 5GAOn 4CC4B 5FU6C 2DL4A 2COZA 2QDYB 3OY9A 2QI2A 1ARKA 1KHCA 4BDYA 3PIPA 1LOJA 1N27A 1CKBA 2DL5A 1P92A 1YITA 5IXBA 3OS1A 1BU1A 4BE1A 3J80E 2MMPA 4DQ2A 2GFAA 3I9QA 1N8RC 5KE3A 1SG5A 3CCMT 5GAN8 3LH5A 1RLQC 1M8MA 5GMKe 1SPKA 1N9SA 4RMOA 2FO0A 4LDUA 1EZZB 4LUDA 4C92D 4PFOA 2WSFE 1HXDA 4RUGA 3ER0A 5GMKm 2KBTA 1VQ7A 4F7UG 1LCKA 2HL3A 1D3BA 4PJOC 4HCKA 3CCSA 3R6NA 3V7SA 4C92C 3WXMB 1O9SA 2I2LA 4M75E 1RAHB 1I5OB 2X4XA 2PU9B 4E7SA 4XTXA 1QMCA 1K0SA 3BDLA 4OP0A 2YDLA 1M1KC 3VYGA 2NLUA 2R5AA 4ZNXA 4XK8E 2HBWA 1WHHA 5FU7B 1KQSP 2L5QA 4RTZA 5J39A 2E3IA 2A28A 3I35A 4L6V5 4C0GA 4E47A 1OPLA 2K5IA 3SWNA 2QEXA 3OW2P 2EQUA 2ZGWA 1VUBA 4J6XA 1XJWB 3HL8A 1JJ2P 2FHDA 3LGFA 2WACA 3CCRT 2M1HA 4ZGDB 2MPXC 1IGUA 5I11A 3CC4A 3HKSA 1YJNT 1IRXA 1ZUKA 1TUDA 3L2UA 4C8QE 1WLPB 2FL7A 4EMKB 2EPDA 4KGVB 2DXCA 2EJ9A 1BB9A 1VQOQ 1NM7A 5CAIA 6AT1B 1V29B 1MNEA 1AZEA 2CSIA 2K3XA 1QCOA 4J6WA 2BTTA 2J6KA 1RI0A 2HSPA 2P0KA 1GCQC 1PRLC 3MP1A 4X9CA 1KD1C 4X34A 1G3YA 2NUPB 4Y91A 1QVGP 2G3RA 4RTUA 5GMKj 1ZSGA 3ME9A 1BIBA 1OULA 1W2BA 4ATOA 1UGRB 4XU0A 5FU7C 2RHUA 1X6BA 2JXBA 1OZ3A 1VIEA 2GBQA 4JJCA 1NZ9A 2HAXA 3RUXA 2AZVA 1H8KA 3U23A 2OTJT 2FRWA 1RABB 4YTLA 2X35A 2ROTA 2H3JA 2H8HA 1QVPA 9ATCB 1QVGA 4C0DB 1W2BS 4BACA 1NLPC 3PTAA 4Z8AA 4M7AG 3EH1A 4DBQA 1U1SA 1XNIA 4HT8A 1PG5B 1X27A 2FYKA 3DLMA 2EBPA 3G6EQ 5GAN6 4RCBA 2L3RA 3H0IA 2CT3A 3OYNA 1EFNA 2LQWA 5D6XA 2F1LA 1NE8A 2LQKA 4N0AA 4RKUE 2VASA 4LDXA 1GRIA 2NUTA 2DVJA 3QPHA 4BD3A 4XQ3A 1UJ0A 2YUPA 2F5TX 4JRKA 4DA4A 1YHQQ 3CMAA 2LCLA 3QXEB 2A08A 2DNUA 4Y92A 1G3TA 1JJ2A 3T9NA 2DO3A 3M4GA 2O01E 3GF5A 1ACMB 2O31A 5I2MA 1NJIC 1ZUUA 3INZA 1NJIR 3OW2A 4PJLA 3FIFA 5KCOA 4PJNA 1BI0A 2FRYA 2YUQA 3CCQA 4QVDA 2CP6A 3LW5E 2KVQG 4ESRA 3H0FA 2W0ZA 1VQPQ 3CCUQ 2XKOC 2JMCA 1M1GA 2VXFA 4BI4A 2E70A 3MHXA 4WCIA 1RADB 1X69A 3M57A 1G8XA 1NEBA 4LD6A 1UDLA 1VQLQ 3JCMd 3UA7A 3JB9I 3EHQA 1K73R 1HJDA 3G6EA 3CMAT 1VQ8Q 4FW1A 2JM8A 4KH0B 4C92A 2K79A 2HDAA 5GAOp 2WSEE 1SSHA 3OYBA 4NL2A 2BUDA 4QW2A 4JJBA 2QG9B 2P4RA 4CRIA 2M51A 2DETA 1B34B 2DAQA 3GIBA 3MCAB 5FRNA 1TG0A 1Y57A 3FLGA 4JRIA 4XTYA 3QHSA 3CPWA 1AZGB 4PFZA 1WPYA 2AT1B 2E3HA 5FU6B 1E6GA 1K73U 1YIJT 2RK1A 3CCMQ 2V8IA 1PCXA 1VQ7T 1VQNQ 1YP5A 8AT1B 1H3ZA 4LE9A 5GANh 2DJZA 1VQLA 3G6ET 2CP5A 3A8HB 2NUTB 3P8DA 1BCMA 5LJ3f 1W4SA 1K9MC 1OQKA 2YHTA 2KMTA 4M77G 4OB0B 3URGA 2OTLQ 3C95A 1K73C 3CD6Q 3EG9B 1VQ6A 1VYUA 3C0CA 1YCYA 1KQ1A 3G71A 4M7DA 1VQ5Q 2AIRB 1FMWA 4Z88A 1I0CA 3I56T 1BI2A 1VOMA 2DK3A 1ZSZC 4M7AF 3GOXA 3ZEHA 2YLCA 4J9HA 2KRSA 2CZ7B 1VQ5T 2LNVA 5CR2A 1NG2A 2RJEA 1TUGB 4OMOA 3GBQA 4HVVA 4HKEA 3DLLA 3L2VA 5LJ5j 4F17A 1U5SA 3FRNA 4RG2A 2CP2A 5IHIA 3META 2DZ9A 2PVOB 3PGGA 4M75B 4KUDK 1WYXA 4B9XA 3S6WA 3LWHA
chains in the Genus database with same CATH topology
2EW3A 2YUOA 3M0PA 4HVWA 2RQTA 2CH4A 2DL7A 2J06A 1ZLMA 5EC7A 4A63B 3EG2A 4F16A 1JXMA 3M0QA 1N5ZA 4JZ4A 2DJQA 1MV3A 2LQNA 1YWPA 2DRKA 4HXJA 1KFZA 2FPEA 1AVZC 1G83A 5IXFA 3VS4A 4IIMA 3UF4A 3TVTA 2CSQA 2EYYA 3FJ5A 1B07A 1K4US 2PZ1A 2DLPA 1OOTA 1QKXA 2HEQA 1Z9ZA 1ZX6A 2AKKA 3REAB 1W70A 2CH4W 2BZYA 3M0TA 4E6RA 2VVKA 1JO8A 4CC4B 2FG0A 4ORZA 2DL4A 2FPFA 2EGEA 1QKWA 1ARKA 1SHFA 2RNAA 1CKBA 2W10A 2X3WD 1J3TA 2DL5A 2JS0A 5IXBA 1BU1A 3VS5A 2LJ3A 3M0RA 4RTYA 4EIKA 4JZ3A 2OI3A 4J9FA 1WXBA 3I9QA 2LJ0A 2KXCA 1KSWA 1UFFA 1BBZA 3PVLA 3LH5A 1RLQC 1M8MA 1X2KA 4DEYA 1WA7A 2LZ6B 1V1CA 1GCPA 2RQRA 3EHRA 1SPKA 4AFSC 2FO0A 3RBBB 4LUDA 2GQIA 2NWMA 3VS7A 3PVQA 4M4ZA 4RUGA 2B86A 2KBTA 1LCKA 1PWTA 1K9AA 1WFWA 1NYFA 1M30A 2V1QA 1QLYA 4HCKA 1M3AA 3R6NA 2EQIA 1JQQA 1RI9A 4AFQC 1GL5A 1SHGA 4RTWA 2J6OA 1K0SA 2EYWA 2KROA 2YDLA 2SRCA 1SRLA 4ZNXA 2VKNA 2EGCA 2EKHA 2HBWA 2VWFA 3M0UA 3VS0A 1MUZA 4RTZA 2LMJA 1BK2A 2KRMA 2A28A 3I35A 2G6FX 2RMOA 3NHNA 2J6FA 1OPLA 1GCQA 1U06A 1QWEA 2K7AA 4CC3A 2CREA 4KRTA 1B3QA 1WIEA 3REBB 2PTKA 3EGUA 2F2XA 1CKAA 2EYXA 1HSQA 2D0NA 5I11A 2RQWA 2DYBA 4GLMA 1ZUKA 1TUDA 4J9DA 1WLPB 2X3XD 2NUZA 2EPDA 1GFDA 2BZ8A 1BB9A 2L2PA 2L0AA 2O2OA 1X2QA 5FWBA 5HCKA 1OV3A 5L23A 4AG1C 1NM7A 4Z89A 2FPDA 1ABOA 2QDLA 1AZEA 2KYMA 2CSIA 2BTTA 4OMPA 1WXTA 4OMQA 2J6KA 2O88A 1KIKA 2RQUA 2J05A 2HSPA 3SHWA 1GCQC 1PRLC 2D1XA 4X1VA 5IH2A 4QT7A 1HD3A 5IHKA 2ED0A 1YCSB 2F2VA 1PKSA 3VRZA 4FSSA 2L3SA 2DM1A 1E6HA 4RTUA 1ZSGA 1A0NB 4OMNA 2ENMA 1WX6A 1VYVA 4J9IA 1X6BA 2JXBA 1Y0MA 4R0KA 3RNJA 2GBQA 4JJCA 1JEGA 1AWJA 4CC2A 5GJVB 1MV0B 2AK5A 1U3OA 1H8KA 2AZVA 2OJ2A 3U23A 4AFUC 4J9GA 4D8DA 2FRWA 4IIOA 3VS1A 2K3BA 1UGVA 4CC7A 2O9SA 2ROTA 4OMMA 2DF6A 3QWXX 3O5ZA 1PNJA 2H8HA 3H41A 4D8KA 1IO6A 1QCFA 3QWYA 2C0OA 2DL3A 2KEAA 2O9VA 1UTIA 2KR3A 1I07A 1NLPC 2DBKA 2MOXA 3VRYA 4Z8AA 1NEGA 1K76A 1ABQA 4JJDA 2XMFA 2HCKA 2GNCA 1ZUYA 4F14A 2LJ1A 2KRNA 1T3LA 1UHFA 2DL8A 2GGRA 3THKA 1X27A 1K0XA 2DX1A 1W6XA 2EBPA 2I0NA 1H92A 2M0YA 1SRMA 3H0IA 2CT3A 1EFNA 1SEMA 2J7IA 3ZL7C 2LQWA 2PNIA 1AWXA 2YSQA 1NLOC 3NGPA 1GRIA 3CQTA 2DVJA 2JTEA 1UJ0A 2YUPA 1PKTA 3H0HA 4K11A 3TSZA 1VA7A 3ULRB 2A08A 2DNUA 2L3PA 1WDXA 4Y92A 2SEMA 1T3SA 1OEBA 2EYZA 1XOVA 1NYGA 2JMAA 2O31A 1ZUUA 2MCNA 2CDTA 3PE0A 1UJYA 3NPFA 2FRYA 2YUQA 1UECA 5GJWB 2F2WA 2GTJA 1AWOA 1GBRA 3NMZC 1FMKA 2KNBB 1H3HA 4LN2A 4ESRA 3KFVA 3H0FA 2W0ZA 2LCSA 1KJWA 5I22A 2JMCA 3JV3A 2K9GA 3EG0A 4WCIA 2LX7A 1X69A 4AG2C 1NEBA 1UDLA 2KYBA 3EG3A 3UA7A 2RQVA 1YNZA 3EHQA 1HJDA 4RTVA 1UG1A 1OPKA 2DRMA 2KXDA 1AEYA 3I5SA 2JM8A 2K79A 2AZSA 2LNHB 1UE9A 2HDAA 1WXUA 1PHTA 1SSHA 3I5RA 2KGTA 4OMLA 2ABLA 2ED1A 2A36A 2BZXA 2JT4A 2DILA 1QWFA 1ZBJA 4JJBA 3TSWA 2P4RA 2CT4A 1AWWA 2M51A 3UA6A 2DE0X 4LNPA 1T0JA 4HVUA 1TG0A 1Y57A 2KT1A 2JM9A 4J9BA 1G2BA 2DA9A 1UHCA 1AZGB 1UUEA 2L3QA 2ROLA 1E6GA 4DEXA 1JU5C 2RF0A 5FW9A 1AD5A 1AOJA 1TUCA 3EG1A 1FYNA 1YN8A 1JXOA 2MIOA 1YP5A 2AKLA 4LE9A 2E5KA 4J9EA 2K2MA 2LP5A 2CUBA 2YUNA 2C0TA 3IQLA 3VS2A 1M3BA 2D8HA 1M27C 3SEMA 2DMOA 3M0SA 1YWOA 2GTOA 1VYTA 1K1ZA 1M3CA 4RTTA 1E7OA 1VYUA 2IIMA 3C0CA 2ESWA 2YT6A 2JS2A 2DBMA 4Z88A 5FWCA 1I0CA 2RPNA 1PRMC 2KT8A 5ECAA 1GFCA 2EVRA 3A98A 1Z9QA 4JPBW 2D8JA 4J9CA 2A37A 4LUEA 4J9HA 2KRSA 4AFZC 1X6GA 1I1JA 2K6DA 2C0IA 1CSKA 2V1RA 1NG2A 4GBQA 4RTXA 1T0HA 2FEIA 5IHNA 1RLPC 2KE9A 3GBQA 4OMOA 2OAWA 4HVVA 2RN8A 1W1FA 4F17A 1U5SA 2JW4A 1X43A 3VS6A 5IHIA 1RUWA 2ECZA 2EGAA 3UATA 1WI7A 2CUDA 1WYXA 1S1NA 3VS3A 1GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EW3 A;  2YUO A;  3M0P A;  4HVW A;  2RQT A;  2CH4 A;  2DL7 A;  2J06 A;  1ZLM A;  5EC7 A;  4A63 B;  3EG2 A;  4F16 A;  1JXM A;  3M0Q A;  1N5Z A;  4JZ4 A;  2DJQ A;  1MV3 A;  2LQN A;  1YWP A;  2DRK A;  4HXJ A;  1KFZ A;  2FPE A;  1AVZ C;  1G83 A;  5IXF A;  3VS4 A;  4IIM A;  3UF4 A;  3TVT A;  2CSQ A;  2EYY A;  3FJ5 A;  1B07 A;  1K4U S;  2PZ1 A;  2DLP A;  1OOT A;  1QKX A;  2HEQ A;  1Z9Z A;  1ZX6 A;  2AKK A;  3REA B;  1W70 A;  2CH4 W;  2BZY A;  3M0T A;  4E6R A;  2VVK A;  1JO8 A;  4CC4 B;  2FG0 A;  4ORZ A;  2DL4 A;  2FPF A;  2EGE A;  1QKW A;  1ARK A;  1SHF A;  2RNA A;  1CKB A;  2W10 A;  2X3W D;  1J3T A;  2DL5 A;  2JS0 A;  5IXB A;  1BU1 A;  3VS5 A;  2LJ3 A;  3M0R A;  4RTY A;  4EIK A;  4JZ3 A;  2OI3 A;  4J9F A;  1WXB A;  3I9Q A;  2LJ0 A;  2KXC A;  1KSW A;  1UFF A;  1BBZ A;  3PVL A;  3LH5 A;  1RLQ C;  1M8M A;  1X2K A;  4DEY A;  1WA7 A;  2LZ6 B;  1V1C A;  1GCP A;  2RQR A;  3EHR A;  1SPK A;  4AFS C;  2FO0 A;  3RBB B;  4LUD A;  2GQI A;  2NWM A;  3VS7 A;  3PVQ A;  4M4Z A;  4RUG A;  2B86 A;  2KBT A;  1LCK A;  1PWT A;  1K9A A;  1WFW A;  1NYF A;  1M30 A;  2V1Q A;  1QLY A;  4HCK A;  1M3A A;  3R6N A;  2EQI A;  1JQQ A;  1RI9 A;  4AFQ C;  1GL5 A;  1SHG A;  4RTW A;  2J6O A;  1K0S A;  2EYW A;  2KRO A;  2YDL A;  2SRC A;  1SRL A;  4ZNX A;  2VKN A;  2EGC A;  2EKH A;  2HBW A;  2VWF A;  3M0U A;  3VS0 A;  1MUZ A;  4RTZ A;  2LMJ A;  1BK2 A;  2KRM A;  2A28 A;  3I35 A;  2G6F X;  2RMO A;  3NHN A;  2J6F A;  1OPL A;  1GCQ A;  1U06 A;  1QWE A;  2K7A A;  4CC3 A;  2CRE A;  4KRT A;  1B3Q A;  1WIE A;  3REB B;  2PTK A;  3EGU A;  2F2X A;  1CKA A;  2EYX A;  1HSQ A;  2D0N A;  5I11 A;  2RQW A;  2DYB A;  4GLM A;  1ZUK A;  1TUD A;  4J9D A;  1WLP B;  2X3X D;  2NUZ A;  2EPD A;  1GFD A;  2BZ8 A;  1BB9 A;  2L2P A;  2L0A A;  2O2O A;  1X2Q A;  5FWB A;  5HCK A;  1OV3 A;  5L23 A;  4AG1 C;  1NM7 A;  4Z89 A;  2FPD A;  1ABO A;  2QDL A;  1AZE A;  2KYM A;  2CSI A;  2BTT A;  4OMP A;  1WXT A;  4OMQ A;  2J6K A;  2O88 A;  1KIK A;  2RQU A;  2J05 A;  2HSP A;  3SHW A;  1GCQ C;  1PRL C;  2D1X A;  4X1V A;  5IH2 A;  4QT7 A;  1HD3 A;  5IHK A;  2ED0 A;  1YCS B;  2F2V A;  1PKS A;  3VRZ A;  4FSS A;  2L3S A;  2DM1 A;  1E6H A;  4RTU A;  1ZSG A;  1A0N B;  4OMN A;  2ENM A;  1WX6 A;  1VYV A;  4J9I A;  1X6B A;  2JXB A;  1Y0M A;  4R0K A;  3RNJ A;  2GBQ A;  4JJC A;  1JEG A;  1AWJ A;  4CC2 A;  5GJV B;  1MV0 B;  2AK5 A;  1U3O A;  1H8K A;  2AZV A;  2OJ2 A;  3U23 A;  4AFU C;  4J9G A;  4D8D A;  2FRW A;  4IIO A;  3VS1 A;  2K3B A;  1UGV A;  4CC7 A;  2O9S A;  2ROT A;  4OMM A;  2DF6 A;  3QWX X;  3O5Z A;  1PNJ A;  2H8H A;  3H41 A;  4D8K A;  1IO6 A;  1QCF A;  3QWY A;  2C0O A;  2DL3 A;  2KEA A;  2O9V A;  1UTI A;  2KR3 A;  1I07 A;  1NLP C;  2DBK A;  2MOX A;  3VRY A;  4Z8A A;  1NEG A;  1K76 A;  1ABQ A;  4JJD A;  2XMF A;  2HCK A;  2GNC A;  1ZUY A;  4F14 A;  2LJ1 A;  2KRN A;  1T3L A;  1UHF A;  2DL8 A;  2GGR A;  3THK A;  1X27 A;  1K0X A;  2DX1 A;  1W6X A;  2EBP A;  2I0N A;  1H92 A;  2M0Y A;  1SRM A;  3H0I A;  2CT3 A;  1EFN A;  1SEM A;  2J7I A;  3ZL7 C;  2LQW A;  2PNI A;  1AWX A;  2YSQ A;  1NLO C;  3NGP A;  1GRI A;  3CQT A;  2DVJ A;  2JTE A;  1UJ0 A;  2YUP A;  1PKT A;  3H0H A;  4K11 A;  3TSZ A;  1VA7 A;  3ULR B;  2A08 A;  2DNU A;  2L3P A;  1WDX A;  4Y92 A;  2SEM A;  1T3S A;  1OEB A;  2EYZ A;  1XOV A;  1NYG A;  2JMA A;  2O31 A;  1ZUU A;  2MCN A;  2CDT A;  3PE0 A;  1UJY A;  3NPF A;  2FRY A;  2YUQ A;  1UEC A;  5GJW B;  2F2W A;  2GTJ A;  1AWO A;  1GBR A;  3NMZ C;  1FMK A;  2KNB B;  1H3H A;  4LN2 A;  4ESR A;  3KFV A;  3H0F A;  2W0Z A;  2LCS A;  1KJW A;  5I22 A;  2JMC A;  3JV3 A;  2K9G A;  3EG0 A;  4WCI A;  2LX7 A;  1X69 A;  4AG2 C;  1NEB A;  1UDL A;  2KYB A;  3EG3 A;  3UA7 A;  2RQV A;  1YNZ A;  3EHQ A;  1HJD A;  4RTV A;  1UG1 A;  1OPK A;  2DRM A;  2KXD A;  1AEY A;  3I5S A;  2JM8 A;  2K79 A;  2AZS A;  2LNH B;  1UE9 A;  2HDA A;  1WXU A;  1PHT A;  1SSH A;  3I5R A;  2KGT A;  4OML A;  2ABL A;  2ED1 A;  2A36 A;  2BZX A;  2JT4 A;  2DIL A;  1QWF A;  1ZBJ A;  4JJB A;  3TSW A;  2P4R A;  2CT4 A;  1AWW A;  2M51 A;  3UA6 A;  2DE0 X;  4LNP A;  1T0J A;  4HVU A;  1TG0 A;  1Y57 A;  2KT1 A;  2JM9 A;  4J9B A;  1G2B A;  2DA9 A;  1UHC A;  1AZG B;  1UUE A;  2L3Q A;  2ROL A;  1E6G A;  4DEX A;  1JU5 C;  2RF0 A;  5FW9 A;  1AD5 A;  1AOJ A;  1TUC A;  3EG1 A;  1FYN A;  1YN8 A;  1JXO A;  2MIO A;  1YP5 A;  2AKL A;  4LE9 A;  2E5K A;  4J9E A;  2K2M A;  2LP5 A;  2CUB A;  2YUN A;  2C0T A;  3IQL A;  3VS2 A;  1M3B A;  2D8H A;  1M27 C;  3SEM A;  2DMO A;  3M0S A;  1YWO A;  2GTO A;  1VYT A;  1K1Z A;  1M3C A;  4RTT A;  1E7O A;  1VYU A;  2IIM A;  3C0C A;  2ESW A;  2YT6 A;  2JS2 A;  2DBM A;  4Z88 A;  5FWC A;  1I0C A;  2RPN A;  1PRM C;  2KT8 A;  5ECA A;  1GFC A;  2EVR A;  3A98 A;  1Z9Q A;  4JPB W;  2D8J A;  4J9C A;  2A37 A;  4LUE A;  4J9H A;  2KRS A;  4AFZ C;  1X6G A;  1I1J A;  2K6D A;  2C0I A;  1CSK A;  2V1R A;  1NG2 A;  4GBQ A;  4RTX A;  1T0H A;  2FEI A;  5IHN A;  1RLP C;  2KE9 A;  3GBQ A;  4OMO A;  2OAW A;  4HVV A;  2RN8 A;  1W1F A;  4F17 A;  1U5S A;  2JW4 A;  1X43 A;  3VS6 A;  5IHI A;  1RUW A;  2ECZ A;  2EGA A;  3UAT A;  1WI7 A;  2CUD A;  1WYX A;  1S1N A;  3VS3 A;  1GBQ A; 
#chains in the Genus database with same CATH topology
 2EW3 A;  3M0P A;  4BUG A;  1WJR A;  2K4Y A;  5EC7 A;  3EG2 A;  4M78 D;  4FCY A;  1VQO T;  4M77 D;  1WHL A;  2LQN A;  5CKE A;  3OYH A;  1YWP A;  2DRK A;  1KD1 U;  1VQN A;  2ZPF B;  1AVZ C;  1G83 A;  3CCM A;  5IXF A;  2DTO A;  3VS4 A;  3TVT A;  1OX9 A;  2CSQ A;  4M77 E;  2QAZ A;  1B07 A;  1VQ4 Q;  3CC2 A;  2PZ1 A;  5I21 A;  5M9O A;  1OOT A;  3OYE A;  2EIF A;  2QQB A;  1NPP A;  1K8A U;  3FEO A;  3CBO A;  1JO8 A;  3CME A;  3CCL T;  3CCE T;  2FG0 A;  2LDM A;  4ORZ A;  4M75 A;  1IHV A;  5DLQ E;  2EGE A;  4C8Q B;  1BI3 A;  1X6O A;  3C94 A;  2BE7 D;  1OI1 A;  1WJQ A;  3ZBD A;  5CCA A;  2RNA A;  1W2B P;  2O4X B;  5GAN j;  2VUB A;  2W10 A;  2X3W D;  3OS5 A;  2JS0 A;  2JNG A;  3BDU A;  3BY7 A;  3S3O A;  4EIK A;  2RHX A;  2OI3 A;  1D1C A;  1N8R R;  3PMT A;  2KXC A;  1XTD A;  2DIG A;  1VQK A;  1KSW A;  1UFF A;  3PVL A;  2O4X A;  2K57 A;  4DEY A;  1WA7 A;  4QQ6 A;  3MEU A;  1R77 A;  1GCP A;  2OTL T;  2GFU A;  1M90 U;  2EQK A;  2RHZ A;  3QSU A;  2E6N A;  4AFS C;  3MJX A;  2VV5 A;  1Q81 R;  2GQI A;  1VQ8 A;  3PVQ A;  3CCR Q;  4M7D D;  1WJS A;  2HQX A;  3MEV A;  4M4Z A;  1VQ9 Q;  5LJ5 g;  3RMS A;  2P0Q A;  1PWT A;  1K9A A;  3TEE A;  2A3L A;  4IUR A;  4PJO G;  1RI9 A;  2QXF A;  3P8H A;  5LJ5 e;  3L42 A;  3CEY A;  2MWO A;  5EG2 A;  3CC4 Q;  4RTW A;  2J6O A;  3TCJ A;  5IT9 E;  4MZM A;  1SRL A;  3CCQ Q;  1YI2 Q;  3SWN C;  3J81 E;  4V2S A;  2ZPI B;  4IUQ A;  4KT0 E;  3RKW A;  1Q81 U;  1S72 T;  3VS0 A;  5GAN 3;  2DIQ A;  2LMJ A;  3CCU A;  1Q86 R;  2G6F X;  5D6W A;  2V26 A;  1VQ4 T;  2HKQ B;  1MMN A;  2K7A A;  4KUL A;  4BE0 A;  4N4H A;  1NPR A;  2YRC A;  3ZFJ A;  3V8L A;  3JCM P;  5D6Y A;  5KE2 A;  2QQA A;  3EGU A;  1CKA A;  2H3E B;  1HSQ A;  3OYD A;  3PT9 A;  3EFS A;  1IXD A;  1TH7 A;  4XU3 A;  3EH2 A;  2CS7 A;  4PJO F;  3SFM A;  4HCZ A;  2L2P A;  1X75 C;  1Q86 U;  2L0A A;  2O2O A;  1X2Q A;  1SSF A;  4Z89 A;  3RDV A;  4ELZ C;  4J83 A;  4XAX B;  1TS9 A;  1RAG B;  1WXT A;  2ZPB B;  2O88 A;  1KIK A;  2KAF A;  4BE2 A;  3QZ5 B;  3G4S A;  2D1X A;  4X1V A;  4QT7 A;  5IHK A;  1RAI B;  3M56 A;  2ED0 A;  1YCS B;  2F2V A;  4M78 B;  2LT4 A;  2DM1 A;  3CXC S;  1U1T A;  2PQW A;  2M02 A;  3JSC A;  1Y0M A;  1AWJ A;  4CC2 A;  5HKC A;  1U3O A;  1Y7X A;  2Y4Y A;  4J9G A;  4D8D A;  5LJ3 g;  3VS1 A;  4KBM B;  2K3B A;  3TRE A;  3X20 B;  4CC7 A;  2O9S A;  3SD4 A;  1LNX A;  3QDF A;  4JS4 A;  2DF6 A;  2RJF A;  4Z02 A;  4N4I A;  3H41 A;  1IO6 A;  5GAN g;  1QCF A;  2EQJ A;  3QWY A;  2DL3 A;  1UTI A;  3CD6 T;  2MOX A;  1WGS A;  3E9F A;  2X4W A;  1K76 A;  3LH0 A;  2LJ1 A;  2QEX Q;  2DL8 A;  2XDD A;  2DX1 A;  2I0N A;  2M0Y A;  2HL5 C;  1BYM A;  2PVD B;  1BCO A;  4KGZ B;  1IB8 A;  1YJW A;  2PNI A;  3OW2 S;  1NLO C;  3GNG A;  1M5Q 1;  3A8M B;  2DEU A;  3DB3 A;  4C5E A;  3VKI A;  3CQT A;  3M53 A;  2QQS A;  5GAM d;  3H0H A;  4K11 A;  3TSZ A;  1WHK A;  1MND A;  2L3P A;  4M78 G;  4MZP A;  2SEM A;  1T3S A;  1OEB A;  3A1P A;  3JCM Q;  1KK7 A;  5LJ3 d;  1RAA B;  1ZHI A;  4E7H A;  1XOV A;  1HYO A;  2JMA A;  2LTO A;  2K3Y A;  2MCN A;  3MP8 A;  3NPF A;  3PE0 A;  3SB2 A;  4MZT A;  2Z0W A;  3OBW A;  5GJW B;  2F2W A;  4C5I A;  4UC4 A;  1Q7Y C;  2X9H A;  1FMK A;  2KNB B;  1SF9 A;  2R58 A;  4LN2 A;  3KFV A;  1WHG A;  1KQS A;  2FZK B;  2LCS A;  5I22 A;  3RKX A;  3ASK A;  2K5F A;  1WQ7 A;  2K2V A;  4M75 G;  3EG0 A;  5CKD A;  3OYJ A;  2RK2 A;  3LGL A;  2QAS A;  3V8J A;  4QQD A;  1YIJ Q;  4A4E A;  3OYM A;  1KG1 A;  4LD9 K;  4RTV A;  1OPK A;  4P5N A;  3I5S A;  3OB9 A;  1Q82 C;  2MAM A;  4VUB A;  3CCS Q;  1WXU A;  3UWN A;  3I5R A;  2QK0 A;  5CVI A;  1Q86 C;  4OML A;  2A36 A;  4EMG A;  2BZX A;  2JT4 A;  1YJN A;  1ZBJ A;  2D9T A;  3E9G A;  3A8O B;  1AWW A;  5GAM f;  3UA6 A;  2DE0 X;  4OVA A;  1OU9 A;  1T0J A;  1WZO A;  2QTV A;  4HVU A;  3CCL Q;  3CCE Q;  3E2U A;  3X25 B;  2EJG A;  2QA4 Q;  4J9B A;  1G2B A;  1YBY A;  3E19 A;  1UHC A;  1YIT Q;  4M7D G;  1AT1 B;  2YLB A;  3HPW A;  2RJD A;  2ROL A;  2ATC B;  4DEX A;  3N5B B;  1AD5 A;  1AOJ A;  3EG1 A;  3HP9 A;  5HY6 A;  1FYN A;  1JXO A;  1LPL A;  3L1A A;  4TVR A;  2AKL A;  4PJO D;  1BI1 A;  3JRZ A;  3F70 A;  3VUZ A;  4J9E A;  4FM4 B;  2CP0 A;  2CUB A;  2YUN A;  1OX8 A;  3VS2 A;  2XG8 D;  2D8H A;  3AT1 B;  4J5Y A;  2E6Z A;  1C0M A;  3CC7 Q;  2E12 A;  1TWB A;  4A4K A;  4L5G A;  1M1K U;  4R55 A;  2PUK B;  2EYQ A;  3FJP A;  1C6V X;  1F1B B;  1IRE B;  2QQR A;  4C0D C;  3MP6 A;  2RM4 A;  1YJW Q;  1Q82 U;  3EAE A;  2MYS A;  5FWC A;  2RPN A;  8ATC B;  1GFC A;  4IKF A;  4KH1 B;  1Z9Q A;  4JPB W;  4AT1 B;  2A37 A;  4AFZ C;  1JJ2 S;  2K6D A;  4MDW A;  2PUO B;  2C0I A;  1B34 A;  1VQK Q;  2JTF A;  2A0F B;  4ZN1 A;  5KYU B;  3AHU A;  1UGP B;  3I55 T;  4RTX A;  1ZA1 B;  2QA4 A;  5LL6 S;  7AT1 B;  2RN8 A;  1KC8 C;  2JW4 A;  1X43 A;  1RUW A;  3WVD B;  4F7U F;  2RI5 A;  3DB4 A;  2EGA A;  4DBH A;  2E5Q A;  1VQK T;  1S1N A;  5GAN 2;  3JB9 G;  2HD0 A;  5GAN e;  2MWP A;  1M2O A;  4HVW A;  4PFP A;  3CME T;  1PSF A;  3SDZ A;  4ME7 A;  4C0F A;  3CCE A;  3CCL A;  2DL7 A;  4F16 A;  1JXM A;  3OA6 A;  1N5Z A;  1MV3 A;  3OYG A;  3TQ7 P;  1K9M U;  2EWN A;  2XU8 A;  3HRU A;  1KFZ A;  2D6F A;  1N6A A;  4E2F B;  2FPE A;  1B7T A;  1OYX A;  1XQH A;  4IIM A;  2EYY A;  1K4U S;  4C5G A;  4RG8 A;  1QKX A;  5A0G A;  1Z9Z A;  3CPW S;  2QGG A;  1JB0 E;  1Y71 A;  2ZAE A;  3REA B;  1W70 A;  2CH4 W;  3FB9 A;  2D0Q B;  2VVK A;  3PFS A;  4FYW B;  2FPF A;  4EMK A;  3G7Z A;  1QKW A;  2L89 A;  1WHM A;  1MHN A;  1SHF A;  2L8D A;  4F7U A;  2DTH A;  4FU6 A;  3TU4 K;  1J3T A;  3EFO B;  3S3N A;  3S3M A;  4EMK C;  4J9F A;  1WXB A;  1S72 Q;  2COY A;  1VQM T;  2LJ0 A;  4PLI A;  3A5Z B;  4OB2 B;  1BBZ A;  2IPO B;  5IAY A;  1X2K A;  5J3B A;  1BKB A;  3QJ6 A;  1V1C A;  2EJF A;  3OMC A;  3EHR A;  1M2V A;  5KYY B;  3M9Q A;  2GQV A;  3G71 T;  3A8L B;  2B86 A;  2FZC B;  5GAN d;  3X24 B;  1VQ6 Q;  1TOV A;  2LRQ A;  1WFW A;  1NYF A;  3HRT A;  2V1Q A;  1QLY A;  4JRP A;  4M78 A;  1JQQ A;  2YRD A;  4AFQ C;  1GL5 A;  4N0A C;  1ZBX A;  3QYG B;  2AHJ B;  1YFN A;  3Q1J A;  4ELY C;  4C92 E;  2KRO A;  1VQ9 A;  4M78 C;  3QJY A;  4PK4 A;  1G3W A;  2HQE A;  4QQG A;  2VKN A;  4R56 A;  3CCR A;  2X4Y A;  2EKH A;  4C0Z A;  2VWF A;  3M0U A;  1BIA A;  3E1S A;  1BK2 A;  2KRM A;  5KH6 A;  3VU3 C;  2YXY A;  5CIU A;  2JTM A;  2J6F A;  3NHN A;  2LT1 A;  3EGD B;  2CZ1 B;  3VUB A;  2KDS A;  1QWE A;  4CC3 A;  3OQ5 A;  2CRE A;  5LJ3 j;  1PSE A;  1UEB A;  1B3Q A;  5GMK h;  1VQ8 T;  1N9R A;  3OS0 A;  2PTK A;  2F2X A;  4OB3 B;  4Y28 E;  1TXQ A;  2NYS A;  4C92 G;  2P0P A;  1X01 A;  4GLM A;  3SWN B;  1QVG S;  1Y96 B;  4J9D A;  1PM3 A;  4JUV A;  5GAN 5;  2X3X D;  1GFD A;  4FYY B;  2DEQ A;  4CI0 C;  5FWB A;  1OV3 A;  4AG1 C;  3M55 A;  1K8A R;  1ABO A;  4PJJ A;  4B6M A;  1LJO A;  1TTH B;  3CCJ Q;  4OMP A;  1VQ9 T;  2RHI A;  2CP3 A;  2J05 A;  3JCM c;  4QVZ A;  5IH2 A;  1VQP A;  1HD3 A;  1UGQ B;  1PC0 A;  3VRZ A;  4FSS A;  3L2W A;  1E6H A;  1A0N B;  2XHC A;  3CCV A;  2ENM A;  5DM7 R;  2M9U A;  1YJ9 Q;  4ZTJ A;  4DOV A;  3RNJ A;  1JEG A;  1YI2 T;  5CQY A;  4AFU C;  4E7I A;  4IIO A;  1YIT T;  1VQP T;  1D3B B;  4IUT A;  3GP8 A;  2ZZD A;  2FVU A;  4A4H A;  1PNJ A;  4J6Y A;  4FYV B;  1KC8 R;  2C0O A;  1M4Z A;  1GXI E;  3OYL A;  2RJC A;  2KEA A;  2O9V A;  2KR3 A;  4J7I A;  1RAF B;  2CZ0 B;  2DBK A;  3HTR A;  3MEW A;  4JJD A;  2XMF A;  5GAM h;  2CZ6 B;  4ZGJ B;  2KRN A;  1T3L A;  1RL2 A;  2ZCF B;  2VGN A;  3THK A;  4BDZ A;  1K0X A;  5FRO A;  2XD0 A;  1W6X A;  1H92 A;  1D1A A;  3BW1 A;  5KYX B;  2ZPH B;  4PLL A;  2J7I A;  3ZL7 C;  3CCQ T;  1Y07 A;  4JJN K;  1VQ5 A;  4C8Q F;  3NGP A;  3OSV A;  4JLI A;  3X26 B;  1WHJ A;  5LJ3 e;  4LDW A;  1KC8 U;  1M2V B;  2V8J A;  1VA7 A;  5KYX A;  3FDR A;  1WDX A;  1M1F A;  5CQX A;  4M78 F;  3JCM W;  5LJ3 h;  2OTJ A;  4OMF B;  2XIC A;  2EYZ A;  2EFI A;  3VJP A;  1NYG A;  4O5V A;  4O6J A;  2HBP A;  2DTI A;  2BKD N;  1UB4 A;  4FT4 A;  4OGC A;  3CPF A;  3CME Q;  2GTJ A;  1AWO A;  3MKD A;  5FRM A;  3NMZ C;  1H3H A;  3NTK A;  2P84 A;  4FW2 A;  4JDS A;  1G3S A;  3JAM E;  3CC2 Q;  3L2Z A;  1KJW A;  2Y90 A;  3GLX A;  5A0D A;  3FC3 A;  2JJ9 A;  2F5K A;  3JV3 A;  3CCJ T;  4AG2 C;  1YIJ A;  2E41 A;  3J7A F;  1YNZ A;  4LXC A;  1FX7 A;  3C4S A;  2VXE A;  1QW1 A;  2KXD A;  1AEY A;  4PNO A;  4DBF A;  3D7S B;  1PHT A;  1FMV A;  2E4H A;  2KGT A;  2ED1 A;  4E7Z A;  3JCM f;  4KUI A;  3TSW A;  3JB9 F;  3OYA A;  3HRS A;  3OYC A;  4LNP A;  4LDY A;  3CC7 T;  2KT1 A;  1M90 R;  3M58 A;  4QVC A;  2XK0 A;  1PD0 A;  2DA9 A;  4FSX A;  1UUE A;  3V7R A;  4JLG A;  1ZSZ A;  2MK5 A;  1JU5 C;  1EIF A;  2KQW A;  1TUC A;  4IUP A;  2FB7 A;  4HA8 A;  2KSS A;  4PKC C;  2KK4 A;  3KXT A;  2FZG B;  2X51 A;  1TU0 B;  1G5V A;  3OYI A;  3IQL A;  2R57 A;  5CK9 A;  4PJO E;  3M0S A;  3NTI A;  1YWO A;  4XU1 A;  1M1K R;  1VYT A;  1M3C A;  4FYX B;  4ZGE B;  4M77 C;  2HMA A;  3CCJ A;  1E7O A;  2IIM A;  1KQS S;  1U8R A;  2ESW A;  3G71 Q;  2YT6 A;  3JCM V;  1Q82 R;  4OB1 B;  5DLO A;  3CD6 A;  4ZTF A;  2KT8 A;  1C1A A;  5ECA A;  3RMQ A;  3A98 A;  3EFO A;  2NUP A;  2OAU A;  4PJM A;  3QYH B;  2D8J A;  4J9C A;  3QUI A;  1X6G A;  1K8A C;  1MMA A;  3P8B B;  2FEI A;  5IHN A;  3JB9 J;  2KE9 A;  2OAW A;  2LC4 A;  3MEA A;  3VS6 A;  5LJ5 d;  2ECZ A;  4JRQ A;  5LJ5 f;  2CUD A;  4L59 A;  1GBQ A;  1Q95 G;  2YUO A;  2P4T A;  2CH4 A;  1VQM Q;  1K9M R;  2X4J A;  2LVM A;  1WNL A;  2LQ8 A;  4IUV A;  3G1J A;  4HXJ A;  3M54 A;  4MDX A;  1NBE B;  4X9D A;  4MMK A;  3RES A;  2ZPE B;  4EMH A;  2HKN A;  3RKY A;  2HEQ A;  2QA4 T;  4E6R A;  1TSF A;  3UDC A;  2JVV A;  3OS2 A;  2IG0 A;  3M5A A;  4NOY A;  1QCN A;  4C92 F;  4PJO A;  1ZQ1 A;  2E1H A;  4C8Q G;  5A2Q E;  3OBY A;  3VS5 A;  2LJ3 A;  3M0R A;  4RTY A;  4JZ3 A;  1YJ9 A;  3CMA Q;  4M7A E;  1S72 A;  2EKO A;  1RAC B;  3CCV Q;  1YJN Q;  2YWW A;  4C92 B;  1ZA2 B;  2XDB A;  3CXC P;  2LZ6 B;  3V8K A;  2RQR A;  2R5M A;  4E7K A;  4BY6 C;  4HT9 A;  5KYW A;  5GMK i;  3RBB B;  3VS7 A;  2NWM A;  5GMK l;  3VV0 A;  4QKU A;  2E10 A;  2M16 A;  4II1 A;  4A54 A;  3EGX A;  3KBG A;  3H8Z A;  2DYI A;  2LX9 A;  5L8R E;  5I2S A;  5GAN 7;  1M30 A;  1M3A A;  2EQI A;  4MML A;  4NL3 A;  1I5L A;  1SHG A;  3UT1 A;  4ZN3 A;  1H64 1;  4BY6 B;  5GAN 4;  4FIB A;  2EYW A;  2SRC A;  4F7U E;  2DZC A;  3VYH B;  2CYZ B;  2EGC A;  3OYK A;  1MMG A;  4NS5 A;  1MUZ A;  1ZSZ B;  3PMI A;  2VYT A;  2RMO A;  3M59 A;  3HFO A;  1IGQ A;  2BIV A;  1GCQ A;  4M7D B;  2VC8 A;  4M7A A;  1U06 A;  1OU8 A;  4KRT A;  3X28 B;  1NJI U;  1WIE A;  3REB B;  2EYX A;  5HK0 A;  4M7D F;  4XTZ A;  2D0N A;  2RQW A;  1Q7Y U;  3GNF B;  1Q81 C;  3PIO A;  4M7A C;  2DYB A;  3A8G B;  3LWI A;  1N8R U;  3I56 Q;  1VQ4 A;  2NUZ A;  1UGS B;  2BZ8 A;  1R8O B;  4M77 A;  1AHJ B;  3QO3 A;  3CCU T;  5AYF A;  5CO7 A;  2HSE B;  5HCK A;  3V7C A;  4FL6 A;  5C0M A;  5L23 A;  2DD4 A;  5GAO m;  1M90 C;  3HHT B;  2FPD A;  2QDL A;  2KYM A;  1VQO A;  4OMQ A;  3CC7 A;  1D0Z A;  2RQU A;  2XDP A;  3BE3 A;  3SHW A;  2RI3 A;  1O75 A;  1KD1 R;  1QVF A;  4M7A B;  3M4Y A;  4B9W A;  1PKS A;  4E7L A;  2L3S A;  2MI6 A;  3WVE B;  2CKK A;  2JUF A;  2RI2 A;  4OMN A;  1WX6 A;  1VQL T;  4E7J A;  1VYV A;  4BI8 B;  1D1B A;  4J9I A;  3RIR A;  2M0O A;  4R0K A;  2VGM A;  1MV0 B;  5GJV B;  5IN1 A;  2AK5 A;  3EGD A;  2OJ2 A;  4DBR A;  2WSC E;  2A7Y A;  3UPU A;  2JN0 A;  1UGV A;  3G4S Q;  2K5L A;  5A0L A;  4OMM A;  1Y96 A;  4WF2 A;  2RH2 A;  3EFR A;  3QWX X;  3O5Z A;  4EDU A;  1R0C B;  3QZ9 B;  4D8K A;  3JCM e;  2QQ9 A;  1VQ7 Q;  1I07 A;  4C8Q A;  3VRY A;  5GAM e;  5C6S A;  1NEG A;  4JS5 A;  1ABQ A;  4AMC A;  3JCM X;  2HCK A;  2GNC A;  3G4S T;  1ZUY A;  4F14 A;  3CCS T;  2XID A;  3I55 Q;  1UHF A;  1R0B G;  2ZPG B;  4RCC A;  3OYF A;  2GGR A;  5GAM g;  2XI9 A;  3CPW P;  1SRM A;  4BI3 A;  4WTO B;  3GPL A;  1SEM A;  2GF7 A;  3JB9 H;  2F69 A;  2CGH A;  1AWX A;  3OMG A;  2IVW A;  1QQJ A;  2YSQ A;  4EPC A;  1M8V A;  3OSS C;  2B8A A;  2DXT A;  2JTE A;  5KCH A;  1PKT A;  4N4G A;  3ULR B;  3OYY A;  1OZ2 A;  4HCC A;  1FWZ A;  3JCM b;  2OTJ Q;  5GAO l;  4Q5W A;  4C5H A;  2HNI A;  4OF1 A;  4M78 E;  2COW A;  5D7U A;  5GAO q;  1YI2 A;  2CDT A;  2LCC A;  4C8Q C;  3BFM A;  1UJY A;  3R6O A;  1UEC A;  3RER A;  3MO8 A;  1V76 A;  1GBR A;  3CC4 T;  3CBM A;  5HK3 A;  4GLK A;  2E64 A;  5KYN A;  4A4G A;  2BE9 B;  1I8F A;  2K9G A;  4ANJ A;  2LX7 A;  2RD1 A;  4XU2 A;  2GCX A;  4GY5 A;  2KYB A;  3EG3 A;  1JRI A;  4HCB A;  1MMD A;  1YJW T;  2RQV A;  1HK9 A;  3O8V A;  4C8Q D;  4M77 F;  1PD1 A;  3H9N A;  4IUU A;  1UG1 A;  2DRM A;  2QEX T;  1KQ2 A;  2E65 A;  4A53 A;  2KY9 A;  2AZS A;  2LNH B;  1UE9 A;  3EG9 A;  2ABL A;  1QVF S;  3JCM g;  1LVK A;  4M75 C;  2DIL A;  1QWF A;  5DY9 A;  2RHY A;  2CT4 A;  3JCM h;  1WQW A;  2Y4X A;  4M7D C;  1QP2 A;  2JM9 A;  3DKM A;  4KGX B;  3CCV T;  4FT2 A;  4D6W A;  3H6Z A;  3HFN A;  5GAM j;  2PVG B;  3RR6 A;  3HSB A;  2L3Q A;  3LX7 A;  2RO0 A;  2RF0 A;  5FW9 A;  3NTH A;  1D09 B;  1YN8 A;  2V8K A;  1MGQ A;  2OX7 A;  2MIO A;  2QTX A;  3QDR B;  1YHQ A;  4DOW A;  2E5K A;  4M75 D;  2CP7 A;  2K2M A;  3KUF A;  2LP5 A;  2C06 A;  1KHI A;  3JB9 D;  2C0T A;  1M3B A;  1M27 C;  4M77 B;  1JBM A;  3I55 A;  2DPP B;  2DMO A;  2QYZ A;  1D0X A;  3SEM A;  4LDV A;  1IHW A;  2GTO A;  4J7F A;  2YRV A;  2JZ2 A;  1K1Z A;  2DXU A;  4RTT A;  2QGF B;  2DD5 A;  2JS2 A;  5CKB A;  2DKG A;  2DBM A;  1SKU B;  4PJO B;  1I81 A;  3PNW C;  1PRM C;  3QG1 A;  4OGE A;  5KYY A;  1VQN T;  1RAE B;  2EVR A;  2EQM A;  1I4K 1;  4PL6 A;  4M7A D;  3C12 A;  4LUE A;  1IZ6 A;  2DFU A;  1YHQ T;  1I1J A;  3LLR A;  1CSK A;  1M9S A;  2DXB A;  4XTW A;  2DVE A;  2V1R A;  4GBQ A;  1T0H A;  1QVF P;  2EAY A;  3LYI A;  1RLP C;  1QP3 A;  4BB7 A;  3L2Q A;  5GAO r;  2VB6 A;  1W1F A;  5CKF A;  3NFC A;  5CKH A;  3CC2 T;  3CBP A;  4XTV A;  3CXC A;  3UAT A;  1WI7 A;  3QII A;  3VS3 A;  1EX4 A;  3QKJ A;  3EGX B;  4M75 F;  1D0Y A;  2RA2 A;  1YJ9 T;  2KI7 A;  2RQT A;  4F7U B;  4J8O A;  2J06 A;  1ZLM A;  4A63 B;  1DJ7 B;  3M0Q A;  5KYW B;  1FXX A;  4JZ4 A;  2DJQ A;  2MF2 A;  4A4F A;  1VQ6 T;  2OTL A;  2RB6 A;  5GAN f;  5LJ5 h;  1VIF A;  3I56 A;  4XTU A;  1Q7Y R;  3UF4 A;  3MPU B;  3FJ5 A;  5AT1 B;  3JCM J;  4M7D E;  5KYU A;  2HZY A;  2DLP A;  2HQH A;  4F04 B;  5FLX E;  1ZX6 A;  2AKK A;  2JOY A;  2DER A;  3L2R A;  1VQM A;  2BZY A;  3M0T A;  3QBY A;  5J26 A;  5GAO n;  4CC4 B;  5FU6 C;  2DL4 A;  2COZ A;  2QDY B;  3OY9 A;  2QI2 A;  1ARK A;  1KHC A;  4BDY A;  3PIP A;  1LOJ A;  1N27 A;  1CKB A;  2DL5 A;  1P92 A;  1YIT A;  5IXB A;  3OS1 A;  1BU1 A;  4BE1 A;  3J80 E;  2MMP A;  4DQ2 A;  2GFA A;  3I9Q A;  1N8R C;  5KE3 A;  1SG5 A;  3CCM T;  5GAN 8;  3LH5 A;  1RLQ C;  1M8M A;  5GMK e;  1SPK A;  1N9S A;  4RMO A;  2FO0 A;  4LDU A;  1EZZ B;  4LUD A;  4C92 D;  4PFO A;  2WSF E;  1HXD A;  4RUG A;  3ER0 A;  5GMK m;  2KBT A;  1VQ7 A;  4F7U G;  1LCK A;  2HL3 A;  1D3B A;  4PJO C;  4HCK A;  3CCS A;  3R6N A;  3V7S A;  4C92 C;  3WXM B;  1O9S A;  2I2L A;  4M75 E;  1RAH B;  1I5O B;  2X4X A;  2PU9 B;  4E7S A;  4XTX A;  1QMC A;  1K0S A;  3BDL A;  4OP0 A;  2YDL A;  1M1K C;  3VYG A;  2NLU A;  2R5A A;  4ZNX A;  4XK8 E;  2HBW A;  1WHH A;  5FU7 B;  1KQS P;  2L5Q A;  4RTZ A;  5J39 A;  2E3I A;  2A28 A;  3I35 A;  4L6V 5;  4C0G A;  4E47 A;  1OPL A;  2K5I A;  3SWN A;  2QEX A;  3OW2 P;  2EQU A;  2ZGW A;  1VUB A;  4J6X A;  1XJW B;  3HL8 A;  1JJ2 P;  2FHD A;  3LGF A;  2WAC A;  3CCR T;  2M1H A;  4ZGD B;  2MPX C;  1IGU A;  5I11 A;  3CC4 A;  3HKS A;  1YJN T;  1IRX A;  1ZUK A;  1TUD A;  3L2U A;  4C8Q E;  1WLP B;  2FL7 A;  4EMK B;  2EPD A;  4KGV B;  2DXC A;  2EJ9 A;  1BB9 A;  1VQO Q;  1NM7 A;  5CAI A;  6AT1 B;  1V29 B;  1MNE A;  1AZE A;  2CSI A;  2K3X A;  1QCO A;  4J6W A;  2BTT A;  2J6K A;  1RI0 A;  2HSP A;  2P0K A;  1GCQ C;  1PRL C;  3MP1 A;  4X9C A;  1KD1 C;  4X34 A;  1G3Y A;  2NUP B;  4Y91 A;  1QVG P;  2G3R A;  4RTU A;  5GMK j;  1ZSG A;  3ME9 A;  1BIB A;  1OUL A;  1W2B A;  4ATO A;  1UGR B;  4XU0 A;  5FU7 C;  2RHU A;  1X6B A;  2JXB A;  1OZ3 A;  1VIE A;  2GBQ A;  4JJC A;  1NZ9 A;  2HAX A;  3RUX A;  2AZV A;  1H8K A;  3U23 A;  2OTJ T;  2FRW A;  1RAB B;  4YTL A;  2X35 A;  2ROT A;  2H3J A;  2H8H A;  1QVP A;  9ATC B;  1QVG A;  4C0D B;  1W2B S;  4BAC A;  1NLP C;  3PTA A;  4Z8A A;  4M7A G;  3EH1 A;  4DBQ A;  1U1S A;  1XNI A;  4HT8 A;  1PG5 B;  1X27 A;  2FYK A;  3DLM A;  2EBP A;  3G6E Q;  5GAN 6;  4RCB A;  2L3R A;  3H0I A;  2CT3 A;  3OYN A;  1EFN A;  2LQW A;  5D6X A;  2F1L A;  1NE8 A;  2LQK A;  4N0A A;  4RKU E;  2VAS A;  4LDX A;  1GRI A;  2NUT A;  2DVJ A;  3QPH A;  4BD3 A;  4XQ3 A;  1UJ0 A;  2YUP A;  2F5T X;  4JRK A;  4DA4 A;  1YHQ Q;  3CMA A;  2LCL A;  3QXE B;  2A08 A;  2DNU A;  4Y92 A;  1G3T A;  1JJ2 A;  3T9N A;  2DO3 A;  3M4G A;  2O01 E;  3GF5 A;  1ACM B;  2O31 A;  5I2M A;  1NJI C;  1ZUU A;  3INZ A;  1NJI R;  3OW2 A;  4PJL A;  3FIF A;  5KCO A;  4PJN A;  1BI0 A;  2FRY A;  2YUQ A;  3CCQ A;  4QVD A;  2CP6 A;  3LW5 E;  2KVQ G;  4ESR A;  3H0F A;  2W0Z A;  1VQP Q;  3CCU Q;  2XKO C;  2JMC A;  1M1G A;  2VXF A;  4BI4 A;  2E70 A;  3MHX A;  4WCI A;  1RAD B;  1X69 A;  3M57 A;  1G8X A;  1NEB A;  4LD6 A;  1UDL A;  1VQL Q;  3JCM d;  3UA7 A;  3JB9 I;  3EHQ A;  1K73 R;  1HJD A;  3G6E A;  3CMA T;  1VQ8 Q;  4FW1 A;  2JM8 A;  4KH0 B;  4C92 A;  2K79 A;  2HDA A;  5GAO p;  2WSE E;  1SSH A;  3OYB A;  4NL2 A;  2BUD A;  4QW2 A;  4JJB A;  2QG9 B;  2P4R A;  4CRI A;  2M51 A;  2DET A;  1B34 B;  2DAQ A;  3GIB A;  3MCA B;  5FRN A;  1TG0 A;  1Y57 A;  3FLG A;  4JRI A;  4XTY A;  3QHS A;  3CPW A;  1AZG B;  4PFZ A;  1WPY A;  2AT1 B;  2E3H A;  5FU6 B;  1E6G A;  1K73 U;  1YIJ T;  2RK1 A;  3CCM Q;  2V8I A;  1PCX A;  1VQ7 T;  1VQN Q;  1YP5 A;  8AT1 B;  1H3Z A;  4LE9 A;  5GAN h;  2DJZ A;  1VQL A;  3G6E T;  2CP5 A;  3A8H B;  2NUT B;  3P8D A;  1BCM A;  5LJ3 f;  1W4S A;  1K9M C;  1OQK A;  2YHT A;  2KMT A;  4M77 G;  4OB0 B;  3URG A;  2OTL Q;  3C95 A;  1K73 C;  3CD6 Q;  3EG9 B;  1VQ6 A;  1VYU A;  3C0C A;  1YCY A;  1KQ1 A;  3G71 A;  4M7D A;  1VQ5 Q;  2AIR B;  1FMW A;  4Z88 A;  1I0C A;  3I56 T;  1BI2 A;  1VOM A;  2DK3 A;  1ZSZ C;  4M7A F;  3GOX A;  3ZEH A;  2YLC A;  4J9H A;  2KRS A;  2CZ7 B;  1VQ5 T;  2LNV A;  5CR2 A;  1NG2 A;  2RJE A;  1TUG B;  4OMO A;  3GBQ A;  4HVV A;  4HKE A;  3DLL A;  3L2V A;  5LJ5 j;  4F17 A;  1U5S A;  3FRN A;  4RG2 A;  2CP2 A;  5IHI A;  3MET A;  2DZ9 A;  2PVO B;  3PGG A;  4M75 B;  4KUD K;  1WYX A;  4B9X A;  3S6W A;  3LWH A; 
#chains in the Genus database with same CATH homology
 2EW3 A;  2YUO A;  3M0P A;  4HVW A;  2RQT A;  2CH4 A;  2DL7 A;  2J06 A;  1ZLM A;  5EC7 A;  4A63 B;  3EG2 A;  4F16 A;  1JXM A;  3M0Q A;  1N5Z A;  4JZ4 A;  2DJQ A;  1MV3 A;  2LQN A;  1YWP A;  2DRK A;  4HXJ A;  1KFZ A;  2FPE A;  1AVZ C;  1G83 A;  5IXF A;  3VS4 A;  4IIM A;  3UF4 A;  3TVT A;  2CSQ A;  2EYY A;  3FJ5 A;  1B07 A;  1K4U S;  2PZ1 A;  2DLP A;  1OOT A;  1QKX A;  2HEQ A;  1Z9Z A;  1ZX6 A;  2AKK A;  3REA B;  1W70 A;  2CH4 W;  2BZY A;  3M0T A;  4E6R A;  2VVK A;  1JO8 A;  4CC4 B;  2FG0 A;  4ORZ A;  2DL4 A;  2FPF A;  2EGE A;  1QKW A;  1ARK A;  1SHF A;  2RNA A;  1CKB A;  2W10 A;  2X3W D;  1J3T A;  2DL5 A;  2JS0 A;  5IXB A;  1BU1 A;  3VS5 A;  2LJ3 A;  3M0R A;  4RTY A;  4EIK A;  4JZ3 A;  2OI3 A;  4J9F A;  1WXB A;  3I9Q A;  2LJ0 A;  2KXC A;  1KSW A;  1UFF A;  1BBZ A;  3PVL A;  3LH5 A;  1RLQ C;  1M8M A;  1X2K A;  4DEY A;  1WA7 A;  2LZ6 B;  1V1C A;  1GCP A;  2RQR A;  3EHR A;  1SPK A;  4AFS C;  2FO0 A;  3RBB B;  4LUD A;  2GQI A;  2NWM A;  3VS7 A;  3PVQ A;  4M4Z A;  4RUG A;  2B86 A;  2KBT A;  1LCK A;  1PWT A;  1K9A A;  1WFW A;  1NYF A;  1M30 A;  2V1Q A;  1QLY A;  4HCK A;  1M3A A;  3R6N A;  2EQI A;  1JQQ A;  1RI9 A;  4AFQ C;  1GL5 A;  1SHG A;  4RTW A;  2J6O A;  1K0S A;  2EYW A;  2KRO A;  2YDL A;  2SRC A;  1SRL A;  4ZNX A;  2VKN A;  2EGC A;  2EKH A;  2HBW A;  2VWF A;  3M0U A;  3VS0 A;  1MUZ A;  4RTZ A;  2LMJ A;  1BK2 A;  2KRM A;  2A28 A;  3I35 A;  2G6F X;  2RMO A;  3NHN A;  2J6F A;  1OPL A;  1GCQ A;  1U06 A;  1QWE A;  2K7A A;  4CC3 A;  2CRE A;  4KRT A;  1B3Q A;  1WIE A;  3REB B;  2PTK A;  3EGU A;  2F2X A;  1CKA A;  2EYX A;  1HSQ A;  2D0N A;  5I11 A;  2RQW A;  2DYB A;  4GLM A;  1ZUK A;  1TUD A;  4J9D A;  1WLP B;  2X3X D;  2NUZ A;  2EPD A;  1GFD A;  2BZ8 A;  1BB9 A;  2L2P A;  2L0A A;  2O2O A;  1X2Q A;  5FWB A;  5HCK A;  1OV3 A;  5L23 A;  4AG1 C;  1NM7 A;  4Z89 A;  2FPD A;  1ABO A;  2QDL A;  1AZE A;  2KYM A;  2CSI A;  2BTT A;  4OMP A;  1WXT A;  4OMQ A;  2J6K A;  2O88 A;  1KIK A;  2RQU A;  2J05 A;  2HSP A;  3SHW A;  1GCQ C;  1PRL C;  2D1X A;  4X1V A;  5IH2 A;  4QT7 A;  1HD3 A;  5IHK A;  2ED0 A;  1YCS B;  2F2V A;  1PKS A;  3VRZ A;  4FSS A;  2L3S A;  2DM1 A;  1E6H A;  4RTU A;  1ZSG A;  1A0N B;  4OMN A;  2ENM A;  1WX6 A;  1VYV A;  4J9I A;  1X6B A;  2JXB A;  1Y0M A;  4R0K A;  3RNJ A;  2GBQ A;  4JJC A;  1JEG A;  1AWJ A;  4CC2 A;  5GJV B;  1MV0 B;  2AK5 A;  1U3O A;  1H8K A;  2AZV A;  2OJ2 A;  3U23 A;  4AFU C;  4J9G A;  4D8D A;  2FRW A;  4IIO A;  3VS1 A;  2K3B A;  1UGV A;  4CC7 A;  2O9S A;  2ROT A;  4OMM A;  2DF6 A;  3QWX X;  3O5Z A;  1PNJ A;  2H8H A;  3H41 A;  4D8K A;  1IO6 A;  1QCF A;  3QWY A;  2C0O A;  2DL3 A;  2KEA A;  2O9V A;  1UTI A;  2KR3 A;  1I07 A;  1NLP C;  2DBK A;  2MOX A;  3VRY A;  4Z8A A;  1NEG A;  1K76 A;  1ABQ A;  4JJD A;  2XMF A;  2HCK A;  2GNC A;  1ZUY A;  4F14 A;  2LJ1 A;  2KRN A;  1T3L A;  1UHF A;  2DL8 A;  2GGR A;  3THK A;  1X27 A;  1K0X A;  2DX1 A;  1W6X A;  2EBP A;  2I0N A;  1H92 A;  2M0Y A;  1SRM A;  3H0I A;  2CT3 A;  1EFN A;  1SEM A;  2J7I A;  3ZL7 C;  2LQW A;  2PNI A;  1AWX A;  2YSQ A;  1NLO C;  3NGP A;  1GRI A;  3CQT A;  2DVJ A;  2JTE A;  1UJ0 A;  2YUP A;  1PKT A;  3H0H A;  4K11 A;  3TSZ A;  1VA7 A;  3ULR B;  2A08 A;  2DNU A;  2L3P A;  1WDX A;  4Y92 A;  2SEM A;  1T3S A;  1OEB A;  2EYZ A;  1XOV A;  1NYG A;  2JMA A;  2O31 A;  1ZUU A;  2MCN A;  2CDT A;  3PE0 A;  1UJY A;  3NPF A;  2FRY A;  2YUQ A;  1UEC A;  5GJW B;  2F2W A;  2GTJ A;  1AWO A;  1GBR A;  3NMZ C;  1FMK A;  2KNB B;  1H3H A;  4LN2 A;  4ESR A;  3KFV A;  3H0F A;  2W0Z A;  2LCS A;  1KJW A;  5I22 A;  2JMC A;  3JV3 A;  2K9G A;  3EG0 A;  4WCI A;  2LX7 A;  1X69 A;  4AG2 C;  1NEB A;  1UDL A;  2KYB A;  3EG3 A;  3UA7 A;  2RQV A;  1YNZ A;  3EHQ A;  1HJD A;  4RTV A;  1UG1 A;  1OPK A;  2DRM A;  2KXD A;  1AEY A;  3I5S A;  2JM8 A;  2K79 A;  2AZS A;  2LNH B;  1UE9 A;  2HDA A;  1WXU A;  1PHT A;  1SSH A;  3I5R A;  2KGT A;  4OML A;  2ABL A;  2ED1 A;  2A36 A;  2BZX A;  2JT4 A;  2DIL A;  1QWF A;  1ZBJ A;  4JJB A;  3TSW A;  2P4R A;  2CT4 A;  1AWW A;  2M51 A;  3UA6 A;  2DE0 X;  4LNP A;  1T0J A;  4HVU A;  1TG0 A;  1Y57 A;  2KT1 A;  2JM9 A;  4J9B A;  1G2B A;  2DA9 A;  1UHC A;  1AZG B;  1UUE A;  2L3Q A;  2ROL A;  1E6G A;  4DEX A;  1JU5 C;  2RF0 A;  5FW9 A;  1AD5 A;  1AOJ A;  1TUC A;  3EG1 A;  1FYN A;  1YN8 A;  1JXO A;  2MIO A;  1YP5 A;  2AKL A;  4LE9 A;  2E5K A;  4J9E A;  2K2M A;  2LP5 A;  2CUB A;  2YUN A;  2C0T A;  3IQL A;  3VS2 A;  1M3B A;  2D8H A;  1M27 C;  3SEM A;  2DMO A;  3M0S A;  1YWO A;  2GTO A;  1VYT A;  1K1Z A;  1M3C A;  4RTT A;  1E7O A;  1VYU A;  2IIM A;  3C0C A;  2ESW A;  2YT6 A;  2JS2 A;  2DBM A;  4Z88 A;  5FWC A;  1I0C A;  2RPN A;  1PRM C;  2KT8 A;  5ECA A;  1GFC A;  2EVR A;  3A98 A;  1Z9Q A;  4JPB W;  2D8J A;  4J9C A;  2A37 A;  4LUE A;  4J9H A;  2KRS A;  4AFZ C;  1X6G A;  1I1J A;  2K6D A;  2C0I A;  1CSK A;  2V1R A;  1NG2 A;  4GBQ A;  4RTX A;  1T0H A;  2FEI A;  5IHN A;  1RLP C;  2KE9 A;  3GBQ A;  4OMO A;  2OAW A;  4HVV A;  2RN8 A;  1W1F A;  4F17 A;  1U5S A;  2JW4 A;  1X43 A;  3VS6 A;  5IHI A;  1RUW A;  2ECZ A;  2EGA A;  3UAT A;  1WI7 A;  2CUD A;  1WYX A;  1S1N A;  3VS3 A;  1GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...