4OMPA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128k
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGKTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ompA00
2AKLA 1WXUA 2AKKA 2RQWA 2KGTA 2EGEA 2KE9A 2RF0A 4CC4B 2J6OA 1YWOA 4LUEA 3EHQA 2M51A 5IXFA 1QKXA 1M30A 3O5ZA 1WXBA 1X69A 2A08A 2EGAA 3VRZA 2LNHB 4F16A 4RTTA 1UUEA 2HSPA 1T3LA 4AG2C 1QWEA 3SHWA 2RN8A 1UFFA 1WA7A 2AZSA 2FPDA 3NMZC 1WXTA 1M27C 1E6HA 1KJWA 2GTJA 2DNUA 2KXCA 2JTEA 5GJWB 3M0RA 2YT6A 1BK2A 2DL7A 2V1QA 1AWXA 2AZVA 2HDAA 4D8DA 2CH4A 2G6FX 3EG0A 2DA9A 2GBQA 2KEAA 2LJ3A 3LH5A 1AWOA 1BBZA 2K6DA 4A63B 1QLYA 1U3OA 4AFQC 4M4ZA 1HSQA 2DL8A 4AG1C 2J6KA 1EFNA 1UHFA 1JU5C 1X2QA 1SRMA 1NEBA 1A0NB 2D0NA 4ZNXA 1HD3A 1SPKA 4JJCA 3H0FA 2K79A 2SEMA 4HXJA 1GFCA 2EBPA 1KSWA 2LQNA 5IH2A 2J7IA 3I5SA 4R0KA 2CSIA 2J05A 4JJDA 2D8JA 2OAWA 1I07A 2EQIA 1WDXA 4J9IA 4J9DA 1PKSA 1QWFA 1GBRA 4HVUA 2EYYA 3CQTA 4J9GA 2ROTA 4ESRA 1UGVA 2GTOA 1MV3A 2O9VA 4JPBW 2OI3A 3M0PA 4JZ4A 5ECAA 1X2KA 1Y0MA 1ZUYA 3RBBB 1UG1A 4GBQA 4Z88A 2DILA 3ULRB 1AOJA 2MCNA 3H0IA 2KT8A 4OMOA 1WX6A 1W6XA 2CH4W 1Y57A 2L2PA 3FJ5A 1H3HA 1YP5A 2FPFA 2KNBB 1X43A 1UECA 1UHCA 1PHTA 4Z89A 1BB9A 2RQRA 3JV3A 2F2VA 2KRSA 1RLPC 2GQIA 1AD5A 5L23A 5IHKA 1AZGB 5HCKA 1CSKA 1KFZA 2HEQA 2K3BA 2EKHA 1T0JA 4LNPA 2LX7A 2BTTA 3EG2A 1JXMA 2CUBA 1K1ZA 2DVJA 2CSQA 1K0SA 1JO8A 2CT3A 2DL5A 3VS5A 2DRKA 4EIKA 5IXBA 1NYGA 2KR3A 3UA6A 1AZEA 4IIMA 2YSQA 2CDTA 1ZBJA 1PRMC 1X27A 2RQUA 1QCFA 1N5ZA 4CC7A 1GCQC 3M0SA 2JS2A 5I11A 2FO0A 2J6FA 2K2MA 2ED1A 1VYVA 1OV3A 3VS3A 4FSSA 1RLQC 3THKA 2LQWA 1NLOC 2DX1A 3M0TA 3EG1A 2AK5A 4LE9A 1XOVA 2O88A 2RNAA 1Z9ZA 4JJBA 3QWYA 2DL3A 1CKBA 4F17A 2LP5A 2BZXA 1B07A 4OMQA 3VRYA 3IQLA 1GRIA 2ECZA 4JZ3A 2EYZA 4F14A 1ABOA 1FMKA 1M3BA 2E5KA 2DF6A 2VWFA 3RNJA 1T3SA 2PNIA 2H8HA 2ABLA 5FW9A 2NWMA 3EGUA 1M8MA 2DJQA 4RUGA 2VVKA 2JXBA 1HJDA 1RUWA 4QT7A 1PRLC 1B3QA 1NG2A 3TSWA 5IHIA 1VYTA 2HCKA 2PZ1A 4RTWA 3VS1A 5FWCA 2P4RA 1WYXA 1YCSB 4J9CA 2L3QA 2LCSA 1ZSGA 4ORZA 3PVLA 1J3TA 3VS4A 2A28A 2GNCA 2X3XD 3I9QA 1WI7A 2C0TA 1PWTA 2EW3A 2K7AA 2OJ2A 3QWXX 2JT4A 2YDLA 3C0CA 1UE9A 5IHNA 2KRNA 3ZL7C 3I35A 1YWPA 2QDLA 1K76A 2W10A 1I0CA 4CC3A 4K11A 2MIOA 2JW4A 1GFDA 1M3AA 2FEIA 1WIEA 1U06A 1G83A 3U23A 2MOXA 1FYNA 3VS2A 2HBWA 3A98A 1S1NA 1NLPC 2ROLA 3VS7A 1VYUA 2FRWA 1CKAA 2JMCA 2KRMA 2KT1A 2JM8A 4AFSC 1OOTA 2RQVA 1ZUUA 1ARKA 2O9SA 2D1XA 1SHFA 1Z9QA 2YUQA 3UATA 1OEBA 1UTIA 1V1CA 2FRYA 3NPFA 2LJ0A 3SEMA 1MV0B 4OMPA 1ZX6A 1NEGA 1WFWA 2BZYA 2GGRA 1IO6A 1E6GA 1YN8A 2DBMA 4HVVA 5I22A 4Z8AA 5GJVB 2XMFA 2DYBA 1U5SA 2KROA 3NHNA 3R6NA 2YUOA 2D8HA 4HVWA 2FG0A 2ENMA 4X1VA 1YNZA 4RTZA 1UDLA 1UJYA 2ED0A 2EYWA 2O2OA 1NYFA 5EC7A 2EGCA 3M0UA 2X3WD 2I0NA 1ZUKA 2V1RA 2DBKA 3TSZA 4KRTA 1GBQA 3VS6A 2FPEA 2DE0X 3I5RA 4RTVA 4RTYA 1SEMA 1ABQA 2KBTA 1SHGA 2LZ6B 1MUZA 2L0AA 2RPNA 2L3PA 3PVQA 1X6BA 1AWJA 1JEGA 2K9GA 2YUPA 4RTUA 4J9EA 2C0OA 2NUZA 1H8KA 2L3SA 1I1JA 3TVTA 4RTXA 4Y92A 1JXOA 1JQQA 4HCKA 3H41A 4AFZC 1K9AA 2CREA 4D8KA 4AFUC 1W1FA 2JM9A 1TUDA 1K4US 2KYMA 3EHRA 4LUDA 1WLPB 2A37A 4J9FA 1QKWA 1PKTA 2IIMA 1AWWA 1OPLA 3KFVA 4OMLA 2SRCA 2EVRA 1SRLA 2EPDA 2C0IA 1AVZC 2A36A 2RMOA 2M0YA 2PTKA 2F2XA 4WCIA 1KIKA 1RI9A 1W70A 2W0ZA 2BZ8A 4J9HA 4E6RA 4OMMA 1UJ0A 3GBQA 1GCPA 2JMAA 5FWBA 2DRMA 2DM1A 1BU1A 1GCQA 2LJ1A 3H0HA 1ZLMA 1NM7A 4J9BA 4LN2A 2CUDA 1T0HA 1AEYA 3EG3A 3REBB 2KYBA 2O31A 2JS0A 2VKNA 2EYXA 1M3CA 2B86A 1K0XA 4DEYA 1G2BA 1E7OA 2DL4A 3VS0A 2KXDA 1SSHA 3UA7A 1TUCA 2YUNA 2ESWA 3UF4A 1X6GA 3REAB 4CC2A 2DMOA 2RQTA 1LCKA 2CT4A 4DEXA 2DLPA 3PE0A 4GLMA 1PNJA 3NGPA 4IIOA 2F2WA 1VA7A 1OPKA 3M0QA 4OMNA 1H92A 2LMJA 1GL5A 1TG0A 2J06A
chains in the Genus database with same CATH superfamily
5J39A 3L1AA 4BI3A 2EGEA 4OP0A 4E2FB 4M78F 5IXFA 1XQHA 1QKXA 2CZ1B 1M30A 3HHTB 4C8QD 3OYCA 5HKCA 4KH0B 1UUEA 3GF5A 4AG2C 3SB2A 3SHWA 4A4KA 4FU6A 1WA7A 5IAYA 4JRPA 2JTEA 1ZA1B 1D09B 2DNUA 2YT6A 4XU1A 5FU7B 3FEOA 3CCQA 2DL7A 1AWXA 2AZVA 3ZEHA 3VU3C 1FXXA 1TS9A 3MEUA 3EG0A 2EKOA 2XDBA 3JCMe 2XDDA 2R5MA 1VQ4Q 3JCMc 3CPWS 3LH5A 4EDUA 4PJMA 4C5GA 2K6DA 1M2VA 2X4YA 3P8DA 4FW2A 3CC7A 4ME7A 4AFQC 1FWZA 3CC2A 3META 1HSQA 4EPCA 2DL8A 1EFNA 3M9QA 2DETA 1RAHB 2K3XA 4JJCA 2SEMA 2NYSA 3QG1A 1QVGP 2EBPA 1KSWA 3EG9B 5IH2A 3CD6Q 1NPPA 2J7IA 2J05A 4MZTA 3CC7T 4C92A 4M7DA 1MNEA 3M54A 3WVEB 4BDYA 5D6YA 1YBYA 2MAMA 3CQTA 4J9GA 3L42A 3M57A 3LWIA 1MV3A 4JPBW 2OI3A 3M0PA 2V8KA 3MP8A 4JZ4A 5ECAA 1ZUYA 2DILA 5C0MA 5CQXA 2XDPA 3OSSC 5J3BA 3I55A 2DVEA 4M7DE 2LDMA 4JRIA 1N8RC 1H3HA 1YP5A 1WQ7A 2FPFA 4BE2A 2DTIA 1X43A 1Q86R 3M58A 5GAOr 4FT2A 4A4EA 3ZBDA 5GANd 4IUUA 3S3OA 3JV3A 4C92D 5GAN7 1ZA2B 5A0DA 1TUGB 2HMAA 2COWA 3G6EA 1K9MR 1ZSZB 2LX7A 1WHLA 2BTTA 3X26B 1K0SA 3C12A 1Q7YR 4UC4A 1RAAB 1YJNT 1I5OB 2DXTA 2DRKA 5CKBA 5KYWB 1NYGA 1K73U 2QYZA 1X27A 1VQ8A 1OX9A 1QCFA 4BDZA 3M0SA 3QYHB 3MJXA 5I11A 2FO0A 4PK4A 2J6FA 2K2MA 1Y71A 2ED1A 1EIFA 3TQ7P 1D1BA 3QJ6A 3CPWA 5CIUA 4IUQA 1OX8A 3THKA 3CCLT 3G71A 1YI2Q 3FIFA 4QVZA 1PSEA 3CCVA 4DBHA 3EG1A 2AK5A 2F5KA 4LE9A 2A0FB 3GOXA 1XOVA 3CMAA 3CCST 2D6FA 1X6OA 1GXIE 1CKBA 2O01E 3OA6A 3FDRA 4QVCA 4M7DF 1M1KU 3I55T 4LD6A 4WTOB 2E5KA 3GPLA 2VWFA 2XD0A 3BFMA 4E7HA 2JUFA 2PNIA 4IUTA 1M8VA 3RDVA 1X75C 5GAN6 1H3ZA 5GMKh 1RADB 5GAN5 3WVDB 3JCMb 4HCZA 1UGSB 3JCMJ 3S6WA 3CCMQ 1VYTA 2HCKA 2PZ1A 4RTWA 4J5YA 3VS1A 1KD1R 1VUBA 3L2ZA 1VQKT 4ZTFA 1KHIA 1V76A 3RMSA 2G3RA 2WSFE 2O4XA 4LDWA 4N4IA 2B8AA 1PWTA 3QO3A 3QWXX 4M77D 2IG0A 2YDLA 4F7UG 4M75E 2DIQA 2P84A 3TCJA 4DBRA 1YI2T 5GAMf 4CC3A 5KH6A 3PTAA 2JW4A 4KGZB 1M3AA 2FEIA 1QQJA 2MOXA 4M78A 3OBYA 2LQKA 3RERA 1NLPC 1VYUA 2FRWA 3VUZA 2KRMA 2YHTA 2Y4XA 3SWNB 2GF7A 1NBEB 1ACMB 4AFSC 1VQLT 1ZUUA 2GFUA 2VGNA 1K73C 4A53A 4WF2A 1UTIA 4C5EA 4M75C 4Y91A 3SEMA 2R57A 1VQ6A 3DB3A 1G3WA 4PLIA 3OW2S 1YHQA 2K5IA 2GGRA 1N8RR 2GFAA 3CPWP 1E6GA 3OYJA 4ZGJB 2A3LA 4QVDA 3MP6A 2XMFA 4QQDA 1MHNA 2HL5C 4KULA 2R58A 2E70A 5GAOp 2EQUA 4HVWA 2ENMA 1VQMQ 1R77A 1M90C 2PVDB 4KUIA 4NS5A 3J80E 1UJYA 2ED0A 3JB9J 1S72Q 2O2OA 1BI0A 2QAZA 6AT1B 2EGCA 3C94A 3OYBA 1ZUKA 1D1AA 4P5NA 4BACA 1TTHB 2A7YA 2DE0X 3NFCA 5IT9E 2LZ6B 1MUZA 3JB9I 1IB8A 3EG9A 2ZAEA 2L3PA 4RTUA 4J9EA 3CC4T 3A8OB 2RI5A 3V8JA 5IN1A 3L2VA 1PC0A 4ZN1A 1WPYA 4DOWA 5KE3A 3CCUA 4RTXA 1Q82U 2V8JA 3QYGB 4HCKA 2EJGA 1TWBA 1Q86C 1UGPB 3H8ZA 1RAGB 2JM9A 3JCMW 1MMDA 2E1HA 1KQ1A 4LUDA 3EHRA 3HRTA 1WLPB 4M7DG 1QKWA 1AWWA 1QCOA 4M75G 4OMLA 3CCQQ 2SRCA 2RHIA 3L2RA 4DQ2A 2RI3A 3QUIA 1AVZC 2A36A 4PJOD 2PTKA 5KYXA 5A0LA 1RABB 1SSFA 5C6SA 1YCYA 1VQ7T 3RESA 4J6XA 1IREB 1UJ0A 4ZN3A 1M5Q1 3GBQA 3E9GA 3CCMT 1B34B 1BU1A 5LJ3e 4BI4A 5GMKm 3H0HA 1ZLMA 2HAXA 4EMKB 1OI1A 4Q5WA 4C8QB 3OS5A 3PMTA 2NLUA 2X4WA 3X24B 1M3CA 2QQAA 1K0XA 1VQLA 1KD1U 1VQ9A 1G2BA 3VV0A 2QEXA 4BD3A 3OY9A 1E7OA 2KXDA 1TUCA 5KYUA 1C1AA 3HRSA 3MPUB 2OTJT 1MNDA 2DLPA 4ZGEB 2VC8A 4E7LA 1IHWA 1VA7A 4C0DB 3WXMB 1H92A 5CO7A 2J06A 1N9SA 2DK3A 2DXCA 3CCLQ 2MF2A 5FU6B 2EJFA 4OVAA 2KGTA 1FX7A 2KE9A 5AYFA 4CC4B 3MO8A 1KC8C 4FM4B 5KYXB 1EZZB 2EGAA 2HD0A 2M9UA 3VRZA 3N5BB 5GMKl 1KC8R 2HSPA 3J7AF 1T3LA 1QWEA 1KQSA 2QXFA 2RHUA 2FPDA 3HP9A 3NMZC 1G8XA 1E6HA 1KJWA 4FCYA 3M0RA 3OYAA 3H9NA 3V7RA 1PM3A 2LRQA 3LW5E 2DZ9A 1PG5B 3HRUA 3RKXA 4C92E 3QZ5B 4OB1B 2G6FX 2DA9A 3PFSA 1OU8A 1Y07A 2MPXC 2DJZA 2QI2A 2MK5A 1U3OA 2DXUA 3G71Q 2MYSA 1YI2A 2DKGA 3CBPA 3S3NA 1UHFA 1NEBA 3G4SA 1A0NB 3I56Q 3PNWC 4ZNXA 1N27A 3H0FA 8ATCB 2CZ6B 4HXJA 1QVFA 3EAEA 2LQNA 1VQ5Q 3I5SA 2CSIA 4XAXB 4TVRA 5D7UA 3LX7A 3QPHA 4IUPA 1D1CA 4C5HA 4EMGA 2EQIA 1AT1B 1WDXA 4C8QC 3OYIA 3NTHA 1PKSA 1ZSZC 2FYKA 3JAME 4R55A 2E65A 2JJ9A 4C8QG 5GMKe 3TEEA 3A8MB 1VQOQ 2RM4A 2O9VA 3L2UA 2X9HA 1Y0MA 3RBBB 1UG1A 5GANj 3ULRB 2E12A 2HL3A 3CCMA 4LDYA 4OB3B 3VUBA 4C5IA 1Y57A 2L2PA 4M77B 1QMCA 3JCMP 2KNBB 3MP1A 1UECA 1LJOA 4EMHA 2OTJQ 4M78G 1BB9A 2E64A 2CS7A 1F1BB 4PFOA 2F2VA 2KRSA 4FSXA 3M4GA 5L23A 5IHKA 2EKHA 3RKWA 2RD1A 4Y28E 1KC8U 4LNPA 1VQKA 1K1ZA 4F7UA 2CSQA 4CRIA 1UGRB 2DL5A 2KSSA 4EMKA 5IXBA 4FT4A 4A4GA 1AZEA 4IIMA 3V8LA 4B9WA 1RAEB 1NJIU 1FMVA 4GY5A 1M90R 3QBYA 2M16A 3DB4A 5LJ3f 1RLQC 4JS4A 5CVIA 3RMQA 3CC4Q 2DX1A 1YHQQ 1IXDA 2LCLA 4FW1A 5I2SA 1YJ9T 2RNAA 1Z9ZA 2I2LA 1RL2A 3QWYA 4DBFA 3RUXA 4A4FA 4O6JA 3EGDB 1B07A 3VRYA 4JZ3A 1Y7XA 4JRKA 1FMKA 4NL2A 3RNJA 3CCJT 1TH7A 2ABLA 2H3JA 3HFNA 5KCHA 3EGUA 3V8KA 2HSEB 4M78D 2DIGA 4RUGA 1I5LA 4IURA 1G5VA 2DXBA 2NUTA 1QP3A 4QT7A 1QVFP 1B3QA 2K2VA 2P4TA 4PFZA 2HQXA 5LJ3g 2K4YA 5FWCA 1R0BG 1WYXA 3OS1A 4EMKC 4L59A 4C8QF 4JUVA 2GNCA 2EW3A 2OJ2A 2VXFA 1SKUB 1YIJA 2KRNA 3ZL7C 1RAFB 1MMGA 1VQ9T 3C4SA 2W10A 1I0CA 2DYIA 4K11A 2MIOA 3ME9A 2QGFB 3OYMA 1LVKA 1WIEA 1U06A 1G83A 4PJOE 4PJOA 1WZOA 3VS2A 1S1NA 1KD1C 4C0FA 1I4K1 2JMCA 2OTLA 3CCQT 2H3EB 3L2WA 1VQ6T 1C6VX 2RQVA 1YJ9A 2O9SA 3Q1JA 2PVGB 2YUQA 2DD5A 2PU9B 1OEBA 4NL3A 2QA4A 2FRYA 2JTFA 2MMPA 2QASA 4M77A 3LYIA 4OMPA 4PJOG 4C0DC 2BZYA 1M4ZA 4RG8A 2DBMA 3JSCA 3UT1A 2KAFA 2RK1A 3I56T 1M2OA 4HVVA 2ZCFB 1IGQA 1YJNA 1VQ4T 1M1KR 2JOYA 3NHNA 1TU0B 4N0AC 2YUOA 3X28B 1QVGA 2NUPA 1YNZA 1MMAA 5GAOm 2EWNA 1O9SA 5KYYB 1UDLA 2Z0WA 2CP6A 1NYFA 3M0UA 4C0ZA 2E41A 3CXCS 3TSZA 5M9OA 1D0YA 4KRTA 5FU6C 3VS6A 3I5RA 3OYLA 4FYXB 2KBTA 1EX4A 2QK0A 2RPNA 3PVQA 4X9CA 1AWJA 2K9GA 2EQKA 3CCRA 1H8KA 2L3SA 4HT8A 2YLCA 3ASKA 4M77F 4Y92A 4HCCA 1QVGS 1JQQA 3EGXB 3DLMA 3M4YA 4D8KA 2LT4A 2RHXA 1P92A 2DEUA 3RIRA 1LOJA 5LJ5j 3OSVA 4KH1B 4GLKA 1RAIB 2A37A 3BDLA 1PKTA 5HY6A 3AHUA 1OPLA 1YITT 5GANh 2AT1B 5GANe 2HKQB 4PLLA 1JRIA 5D6WA 5CR2A 4QQGA 3EFOA 2F2XA 1B7TA 1VQ4A 4RCCA 4XTYA 2BZ8A 4J9HA 2JN0A 2GCXA 5GAN2 4E7IA 2BKDN 3CMEA 4V2SA 4M77E 1N6AA 3QZ9B 4FYYB 2M02A 4LN2A 4PL6A 4MDWA 4LD9K 1AEYA 3EG3A 2KYBA 1HYOA 2JS0A 2VKNA 2EYXA 2B86A 5GAOl 4QQ6A 3CCSQ 4QW2A 3JCMh 3VS0A 3UA7A 3UF4A 2EFIA 3O8VA 2KQWA 3GLXA 1LCKA 2RA2A 2E6NA 3NGPA 4IIOA 4J6YA 1Q81R 2F2WA 1WHJA 4M77C 3JCMQ 2RJFA 3I55Q 3M5AA 2LMJA 3A8LB 4M7AG 3FRNA 2DPPB 3QHSA 2YXYA 3A5ZB 2QQBA 2X4XA 2AKLA 5GMKi 3OYHA 2JNGA 1Y96A 3OW2P 2VUBA 2KMTA 2KVQG 1YWOA 4M78C 1YJWA 3EHQA 4FYVB 4BE1A 3O5ZA 1WXBA 3M53A 1X69A 3JB9G 4F16A 4X34A 4MDXA 1W2BS 2RN8A 1UFFA 2EIFA 1VQKQ 2AZSA 4B6MA 5CKFA 2YRDA 2K5FA 5GJWB 3J81E 3HPWA 1BK2A 1IGUA 2V1QA 3OYDA 5AT1B 1C0MA 2CH4A 2KEAA 2LJ3A 2VXEA 1BBZA 5HK3A 1QLYA 3DLLA 4AG1C 2J6KA 2YRVA 1X2QA 1NE8A 4FYWB 3CXCA 1OU9A 4ZGDB 1SPKA 2RH2A 3V7SA 1GFCA 5LJ3h 2M0OA 3JCMV 2C06A 3EFOB 4R0KA 3PIOA 4JJDA 3F70A 2D8JA 1X01A 5FRNA 2OAWA 3QDFA 5GAOq 1I07A 3G6ET 5GAN3 2R5AA 4OF1A 4J9IA 4J9DA 1QWFA 5L8RE 2COZA 4M7AC 1GBRA 2LCCA 2EYYA 2CP5A 1VQ5T 1UGVA 1B34A 2GTOA 3VJPA 2ZPFB 1X2KA 4GBQA 1Y96B 5HK0A 3JCMd 2MCNA 5FROA 2DTOA 3H0IA 4OMOA 1VQ7Q 1WX6A 5J26A 2CP7A 3JCMg 3FB9A 2CH4W 2CKKA 1UHCA 1PHTA 4Z89A 1NJIC 4C92B 1WNLA 4XTWA 2RK2A 2AHJB 3JCMX 4JS5A 2EQJA 3CCVT 2RQRA 3BE3A 2DFUA 3PIPA 1QP2A 4M7DD 2VB6A 2GQIA 4QKUA 4M7AE 1KFZA 1T0JA 1VQPQ 4R56A 1K73R 1Q81C 4MZMA 3EG2A 1JXMA 2CUBA 2DVJA 4F04B 3VS5A 4LDUA 2E10A 1K8AC 4EIKA 2KR3A 1D3BA 1RI0A 2YSQA 4ZTJA 4IKFA 2RI2A 1ZBJA 1PRMC 2RQUA 3EH2A 4Z02A 2E6ZA 1U1SA 2IPOB 3CBOA 1OULA 4NOYA 1W2BP 1BI3A 1M9SA 3LGFA 1VYVA 3JRZA 3CC7Q 1VQ6Q 3TU4K 1ZBXA 4E47A 1G3TA 1YHQT 2GQVA 2YLBA 3ZFJA 4C0GA 3ER0A 2V8IA 2DL3A 4F17A 1YJNQ 1TSFA 2LP5A 1YITA 2HQEA 2LC4A 4OMQA 2HBPA 3CEYA 3IQLA 1GRIA 2ECZA 2EYZA 4F14A 1ABOA 2VYTA 5LJ3d 4MZPA 1QCNA 4M75A 5GAMj 2QQRA 3HTRA 3SD4A 2H8HA 1HK9A 4FL6A 5FW9A 1H641 2YWWA 1BYMA 4DA4A 2DJQA 2QQ9A 3QSUA 2F69A 4RG2A 2VVKA 4FIBA 2JXBA 1HJDA 4RKUE 2DERA 1VIEA 3TSWA 2L3RA 4LXCA 5GAMd 4MMLA 2LCSA 2P4RA 4J9CA 3PVLA 1K8AR 2RO0A 3SWNA 4JRQA 3FC3A 2QGGA 3EGDA 2X3XD 3I9QA 1JJ2A 1WI7A 2K7AA 3CCRQ 4KGVB 1UE9A 5IHNA 2DO3A 3CCUT 2PQWA 2BE9B 1W4SA 4RCBA 1Q95G 1YWPA 3OQ5A 1K76A 3CBMA 3UPUA 3G6EQ 1I8FA 1GFDA 1OQKA 1D0ZA 1D3BB 3U23A 1NJIR 3OS0A 1FYNA 1RACB 2HBWA 5DM7R 2ROLA 1CKAA 1XTDA 3CCJA 1OOTA 1ARKA 3EFRA 1VQ8Q 3RR6A 1VQ8T 2D1XA 2EAYA 2JZ2A 2RHZA 3L2QA 1G3YA 1VOMA 5DLOA 2XU8A 1ZX6A 3CMEQ 1SF9A 1NEGA 1WFWA 4PJLA 4II1A 1O75A 3D7SB 4JDSA 3CCVQ 2LNVA 4JLIA 5FU7C 2CZ7B 4Z8AA 1PCXA 3CPFA 2DYBA 1U5SA 4PKCC 4ELYC 1PSFA 3R6NA 1WHKA 3PT9A 4AT1B 4L6V5 3SFMA 3V7CA 3CCSA 3OMCA 1VQ9Q 2MWOA 1K8AU 2PUOB 4PJOB 4RTZA 2OX7A 1Q82C 1QVPA 1QVFS 5I21A 1KK7A 2XKOC 2P0QA 3A8HB 2VGMA 3RKYA 3MEAA 1GBQA 3UWNA 2OAUA 4C92C 3HL8A 4HT9A 2QTVA 3MHXA 1SHGA 2LTOA 1Q82R 2JVVA 2L0AA 3PGGA 2QDYB 4KUDK 4M7AF 1UB4A 1X6BA 1G3SA 1JEGA 2YUPA 2F1LA 2LX9A 2AIRB 2C0OA 2EQMA 2HZYA 2ZPBB 1I1JA 1R8OB 1M90U 3G7ZA 4C8QE 4MMKA 2KDSA 4AFZC 2CREA 3MEVA 3LLRA 2VV5A 2DEQA 1TUDA 1XJWB 1WJQA 1BKBA 1KQSP 2IIMA 5I2MA 3E19A 2VASA 2EVRA 1OZ2A 1SRLA 2C0IA 2RMOA 2Y4YA 2M0YA 2XHCA 2RB6A 2DZCA 1S72T 1KIKA 3A1PA 1FMWA 4JJNK 1RI9A 2W0ZA 1V29B 4OMMA 3GIBA 3URGA 3MEWA 5FWBA 2DRMA 2DM1A 1R0CB 3CMAT 4BE0A 2ATCB 4J9BA 1NM7A 2XG8D 3JB9F 4J8OA 2CUDA 3JCMf 3OYNA 1VQMA 3A8GB 3JB9D 4XQ3A 1SSHA 2ESWA 3REAB 4AMCA 1VQOA 2DMOA 1JJ2S 2K3YA 1U8RA 2CT4A 1WGSA 1WHGA 4O5VA 1Q86U 3M0QA 4OMNA 1VQ7A 1M2VB 1GL5A 1TXQA 2ZPIB 2LQ8A 4XK8E 2JTMA 5LJ5f 1IZ6A 1M1GA 1WXUA 2AKKA 2RQWA 2OTJA 2RF0A 2NUPB 4ELZC 3INZA 2J6OA 1VQOT 4LUEA 2M51A 3OBWA 1BIBA 3OB9A 3P8HA 1BIAA 3CCUQ 2A08A 3OYKA 3CC2T 2LNHB 4RTTA 5D6XA 3SWNC 1VQPA 3GNFB 4M7AB 4D6WA 5GMKj 4OGEA 1WXTA 5GAMh 1M27C 2GTJA 2EJ9A 2KXCA 3QXEB 4CI0C 4J83A 2LVMA 3OS2A 5LL6S 2X4JA 4DBQA 3EGXA 3E9FA 2ZZDA 2KI7A 5LJ5h 2OTLT 2K5LA 3OMGA 5KYUB 4BY6C 1I81A 2HDAA 4D8DA 2RJCA 3CCEQ 3NTIA 2GBQA 4M7DB 2P0PA 1AWOA 4A63B 2L8DA 3UDCA 4N0AA 4M4ZA 9ATCB 4N4GA 1JU5C 2PVOB 1SRMA 4J6WA 2D0NA 1HD3A 4M75F 5KYWA 3PMIA 1YJWT 1M1KC 2K79A 4M75D 1ZHIA 1YITQ 5GAN8 3KXTA 3JB9H 1VQLQ 4B9XA 1LNXA 2QEXQ 1KG1A 4XTZA 4OB0B 1AHJB 4HVUA 2CP3A 1VQNQ 2Y90A 2ROTA 4ESRA 3CXCP 1Q81U 2QQSA 2RJDA 4XTUA 4Z88A 3OW2A 1AOJA 2O4XB 2KT8A 4BB7A 1W6XA 3CCLA 3FJ5A 5CCAA 1XNIA 4HCBA 4N4HA 3QKJA 2XI9A 5KE2A 2HQHA 2LT1A 3HKSA 3C95A 5A0GA 1RLPC 2CP2A 3KBGA 1AD5A 1AZGB 5HCKA 1CSKA 2HEQA 2K3BA 4LDVA 2DAQA 1Q7YU 3OYFA 1WHHA 2CYZB 4E7JA 1JO8A 2CT3A 1K9MU 2FVUA 2FZCB 4C92G 2QA4T 3VYGA 3UA6A 2OTLQ 1JJ2P 3CCJQ 2CDTA 2RHYA 1YJ9Q 5DY9A 4E7KA 1JBMA 3FJPA 1N5ZA 1M1FA 4CC7A 1GCQC 2JS2A 8AT1B 5FRMA 3QDRB 4DOVA 3QJYA 3SDZA 4M7AD 2WSCE 5LJ3j 1OV3A 3VS3A 4FSSA 2LQWA 3CC2Q 1NLOC 3M0TA 2BUDA 2E3HA 4ANJA 1SG5A 2NUTB 3G4SQ 3I56A 1VQNT 2O88A 5KYNA 3S3MA 4JJBA 1YIJT 1VQ5A 1LPLA 5CKDA 3CD6A 2BZXA 1JB0E 5CKEA 3LGLA 1W2BA 3QIIA 1M3BA 2DF6A 4X9DA 2ZPHB 2QTXA 1T3SA 1WJRA 1NPRA 2NWMA 3M56A 4M77G 1UEBA 4XU0A 1M8MA 4M7AA 5GANg 4PNOA 1RUWA 3LH0A 2HKNA 7AT1B 1WQWA 4M78B 3KUFA 1PRLC 2L89A 1NG2A 2RJEA 5IHIA 2CP0A 2BIVA 2FB7A 1YCSB 2L3QA 1ZSGA 4LDXA 4ORZA 1J3TA 3CCET 1IRXA 2COYA 2XIDA 3VS4A 5CK9A 2A28A 2FL7A 2C0TA 4ATOA 3BY7A 2JT4A 3C0CA 2DTHA 4VUBA 4PFPA 4E7SA 1BI2A 2DD4A 3I35A 2HNIA 1VQMT 5GANf 2QDLA 4XU2A 5GAOn 1HXDA 2L5QA 3MCAB 4BI8B 2E4HA 3A98A 3VYHB 2MI6A 3VS7A 5LJ5g 2KK4A 4C92F 2P0KA 3HSBA 1Q7YC 2KT1A 5LJ5e 3GP8A 4F7UB 2JM8A 4PJJA 1K9MC 4J7IA 3GNGA 2CZ0B 3E2UA 3CMET 2QEXT 1SHFA 2X35A 1Z9QA 2BE7D 3UATA 4IUVA 1V1CA 3DKMA 5GAMe 3NPFA 1MMNA 2LJ0A 4A4HA 5EG2A 1BCMA 2V26A 2X51A 1MV0B 5CQYA 4KBMB 3CC4A 4BY6B 3EFSA 4KGXB 1IO6A 1YN8A 3CMAQ 4M78E 5LJ5d 5I22A 5GJVB 4XTVA 3OYGA 1D0XA 2KROA 3FLGA 3P8BB 3OYEA 2D8HA 4HA8A 1U1TA 2FG0A 4X1VA 2KY9A 4KT0E 1PD1A 1BCOA 2EYWA 2F5TX 5CAIA 5EC7A 2XK0A 2X3WD 2I0NA 2V1RA 2DBKA 5FLXE 4BUGA 2E5QA 2FPEA 4PJOF 4RTVA 4RTYA 4C8QA 1SEMA 1ABQA 3H6ZA 1WHMA 2D9TA 4XTXA 4F7UE 4M75B 2CGHA 2M1HA 3E1SA 1YJWQ 1OYXA 3BW1A 2WACA 2NUZA 2FZGB 1YIJQ 1KQ2A 5KYYA 3TVTA 1YFNA 4PJNA 1JXOA 3G71T 2WSEE 3H41A 2ZPGB 1K9AA 2EYQA 1ZQ1A 3LWHA 3G4ST 5CKHA 4AFUC 2D0QB 1W1FA 4YTLA 1K4US 3CCRT 2KYMA 4J7FA 1VIFA 2ZPEB 4J9FA 1IHVA 1TOVA 1MGQA 1KQSS 2XICA 3BDUA 4M7DC 3KFVA 3M59A 2EPDA 2QG9B 3VKIA 5GAN4 3CCEA 5DLQE 1VQPT 4WCIA 2YRCA 1QW1A 1KHCA 3G1JA 4OGCA 1NZ9A 1W70A 2QA4Q 2FZKB 4E6RA 2IVWA 1BI1A 4HKEA 1WJSA 4XU3A 1GCPA 2JMAA 3T9NA 2MWPA 4RMOA 5A2QE 1N8RU 3EH1A 4L5GA 3R6OA 4OMFB 1GCQA 1PD0A 2LJ1A 4E7ZA 3OYYA 2E3IA 1T0HA 2PUKB 3REBB 4F7UF 2O31A 5KCOA 4PJOC 5GAMg 1ZSZA 2ZGWA 1N9RA 4DEYA 3AT1B 1UGQB 3X25B 1OZ3A 2DL4A 3HFOA 2YUNA 1VQNA 1S72A 1X6GA 4OB2B 4JLGA 4CC2A 2K57A 3X20B 2RQTA 3MKDA 4DEXA 3PE0A 2FHDA 4GLMA 1PNJA 3TREA 1DJ7B 3CD6T 1OPKA 3M55A 1TG0A 4A54A 3NTKA
chains in the Genus database with same CATH topology
2AKLA 1WXUA 2AKKA 2RQWA 2KGTA 2EGEA 2KE9A 2RF0A 4CC4B 2J6OA 1YWOA 4LUEA 3EHQA 2M51A 5IXFA 1QKXA 1M30A 3O5ZA 1WXBA 1X69A 2A08A 2EGAA 3VRZA 2LNHB 4F16A 4RTTA 1UUEA 2HSPA 1T3LA 4AG2C 1QWEA 3SHWA 2RN8A 1UFFA 1WA7A 2AZSA 2FPDA 3NMZC 1WXTA 1M27C 1E6HA 1KJWA 2GTJA 2DNUA 2KXCA 2JTEA 5GJWB 3M0RA 2YT6A 1BK2A 2DL7A 2V1QA 1AWXA 2AZVA 2HDAA 4D8DA 2CH4A 2G6FX 3EG0A 2DA9A 2GBQA 2KEAA 2LJ3A 3LH5A 1AWOA 1BBZA 2K6DA 4A63B 1QLYA 1U3OA 4AFQC 4M4ZA 1HSQA 2DL8A 4AG1C 2J6KA 1EFNA 1UHFA 1JU5C 1X2QA 1SRMA 1NEBA 1A0NB 2D0NA 4ZNXA 1HD3A 1SPKA 4JJCA 3H0FA 2K79A 2SEMA 4HXJA 1GFCA 2EBPA 1KSWA 2LQNA 5IH2A 2J7IA 3I5SA 4R0KA 2CSIA 2J05A 4JJDA 2D8JA 2OAWA 1I07A 2EQIA 1WDXA 4J9IA 4J9DA 1PKSA 1QWFA 1GBRA 4HVUA 2EYYA 3CQTA 4J9GA 2ROTA 4ESRA 1UGVA 2GTOA 1MV3A 2O9VA 4JPBW 2OI3A 3M0PA 4JZ4A 5ECAA 1X2KA 1Y0MA 1ZUYA 3RBBB 1UG1A 4GBQA 4Z88A 2DILA 3ULRB 1AOJA 2MCNA 3H0IA 2KT8A 4OMOA 1WX6A 1W6XA 2CH4W 1Y57A 2L2PA 3FJ5A 1H3HA 1YP5A 2FPFA 2KNBB 1X43A 1UECA 1UHCA 1PHTA 4Z89A 1BB9A 2RQRA 3JV3A 2F2VA 2KRSA 1RLPC 2GQIA 1AD5A 5L23A 5IHKA 1AZGB 5HCKA 1CSKA 1KFZA 2HEQA 2K3BA 2EKHA 1T0JA 4LNPA 2LX7A 2BTTA 3EG2A 1JXMA 2CUBA 1K1ZA 2DVJA 2CSQA 1K0SA 1JO8A 2CT3A 2DL5A 3VS5A 2DRKA 4EIKA 5IXBA 1NYGA 2KR3A 3UA6A 1AZEA 4IIMA 2YSQA 2CDTA 1ZBJA 1PRMC 1X27A 2RQUA 1QCFA 1N5ZA 4CC7A 1GCQC 3M0SA 2JS2A 5I11A 2FO0A 2J6FA 2K2MA 2ED1A 1VYVA 1OV3A 3VS3A 4FSSA 1RLQC 3THKA 2LQWA 1NLOC 2DX1A 3M0TA 3EG1A 2AK5A 4LE9A 1XOVA 2O88A 2RNAA 1Z9ZA 4JJBA 3QWYA 2DL3A 1CKBA 4F17A 2LP5A 2BZXA 1B07A 4OMQA 3VRYA 3IQLA 1GRIA 2ECZA 4JZ3A 2EYZA 4F14A 1ABOA 1FMKA 1M3BA 2E5KA 2DF6A 2VWFA 3RNJA 1T3SA 2PNIA 2H8HA 2ABLA 5FW9A 2NWMA 3EGUA 1M8MA 2DJQA 4RUGA 2VVKA 2JXBA 1HJDA 1RUWA 4QT7A 1PRLC 1B3QA 1NG2A 3TSWA 5IHIA 1VYTA 2HCKA 2PZ1A 4RTWA 3VS1A 5FWCA 2P4RA 1WYXA 1YCSB 4J9CA 2L3QA 2LCSA 1ZSGA 4ORZA 3PVLA 1J3TA 3VS4A 2A28A 2GNCA 2X3XD 3I9QA 1WI7A 2C0TA 1PWTA 2EW3A 2K7AA 2OJ2A 3QWXX 2JT4A 2YDLA 3C0CA 1UE9A 5IHNA 2KRNA 3ZL7C 3I35A 1YWPA 2QDLA 1K76A 2W10A 1I0CA 4CC3A 4K11A 2MIOA 2JW4A 1GFDA 1M3AA 2FEIA 1WIEA 1U06A 1G83A 3U23A 2MOXA 1FYNA 3VS2A 2HBWA 3A98A 1S1NA 1NLPC 2ROLA 3VS7A 1VYUA 2FRWA 1CKAA 2JMCA 2KRMA 2KT1A 2JM8A 4AFSC 1OOTA 2RQVA 1ZUUA 1ARKA 2O9SA 2D1XA 1SHFA 1Z9QA 2YUQA 3UATA 1OEBA 1UTIA 1V1CA 2FRYA 3NPFA 2LJ0A 3SEMA 1MV0B 4OMPA 1ZX6A 1NEGA 1WFWA 2BZYA 2GGRA 1IO6A 1E6GA 1YN8A 2DBMA 4HVVA 5I22A 4Z8AA 5GJVB 2XMFA 2DYBA 1U5SA 2KROA 3NHNA 3R6NA 2YUOA 2D8HA 4HVWA 2FG0A 2ENMA 4X1VA 1YNZA 4RTZA 1UDLA 1UJYA 2ED0A 2EYWA 2O2OA 1NYFA 5EC7A 2EGCA 3M0UA 2X3WD 2I0NA 1ZUKA 2V1RA 2DBKA 3TSZA 4KRTA 1GBQA 3VS6A 2FPEA 2DE0X 3I5RA 4RTVA 4RTYA 1SEMA 1ABQA 2KBTA 1SHGA 2LZ6B 1MUZA 2L0AA 2RPNA 2L3PA 3PVQA 1X6BA 1AWJA 1JEGA 2K9GA 2YUPA 4RTUA 4J9EA 2C0OA 2NUZA 1H8KA 2L3SA 1I1JA 3TVTA 4RTXA 4Y92A 1JXOA 1JQQA 4HCKA 3H41A 4AFZC 1K9AA 2CREA 4D8KA 4AFUC 1W1FA 2JM9A 1TUDA 1K4US 2KYMA 3EHRA 4LUDA 1WLPB 2A37A 4J9FA 1QKWA 1PKTA 2IIMA 1AWWA 1OPLA 3KFVA 4OMLA 2SRCA 2EVRA 1SRLA 2EPDA 2C0IA 1AVZC 2A36A 2RMOA 2M0YA 2PTKA 2F2XA 4WCIA 1KIKA 1RI9A 1W70A 2W0ZA 2BZ8A 4J9HA 4E6RA 4OMMA 1UJ0A 3GBQA 1GCPA 2JMAA 5FWBA 2DRMA 2DM1A 1BU1A 1GCQA 2LJ1A 3H0HA 1ZLMA 1NM7A 4J9BA 4LN2A 2CUDA 1T0HA 1AEYA 3EG3A 3REBB 2KYBA 2O31A 2JS0A 2VKNA 2EYXA 1M3CA 2B86A 1K0XA 4DEYA 1G2BA 1E7OA 2DL4A 3VS0A 2KXDA 1SSHA 3UA7A 1TUCA 2YUNA 2ESWA 3UF4A 1X6GA 3REAB 4CC2A 2DMOA 2RQTA 1LCKA 2CT4A 4DEXA 2DLPA 3PE0A 4GLMA 1PNJA 3NGPA 4IIOA 2F2WA 1VA7A 1OPKA 3M0QA 4OMNA 1H92A 2LMJA 1GL5A 1TG0A 2J06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKL A;  1WXU A;  2AKK A;  2RQW A;  2KGT A;  2EGE A;  2KE9 A;  2RF0 A;  4CC4 B;  2J6O A;  1YWO A;  4LUE A;  3EHQ A;  2M51 A;  5IXF A;  1QKX A;  1M30 A;  3O5Z A;  1WXB A;  1X69 A;  2A08 A;  2EGA A;  3VRZ A;  2LNH B;  4F16 A;  4RTT A;  1UUE A;  2HSP A;  1T3L A;  4AG2 C;  1QWE A;  3SHW A;  2RN8 A;  1UFF A;  1WA7 A;  2AZS A;  2FPD A;  3NMZ C;  1WXT A;  1M27 C;  1E6H A;  1KJW A;  2GTJ A;  2DNU A;  2KXC A;  2JTE A;  5GJW B;  3M0R A;  2YT6 A;  1BK2 A;  2DL7 A;  2V1Q A;  1AWX A;  2AZV A;  2HDA A;  4D8D A;  2CH4 A;  2G6F X;  3EG0 A;  2DA9 A;  2GBQ A;  2KEA A;  2LJ3 A;  3LH5 A;  1AWO A;  1BBZ A;  2K6D A;  4A63 B;  1QLY A;  1U3O A;  4AFQ C;  4M4Z A;  1HSQ A;  2DL8 A;  4AG1 C;  2J6K A;  1EFN A;  1UHF A;  1JU5 C;  1X2Q A;  1SRM A;  1NEB A;  1A0N B;  2D0N A;  4ZNX A;  1HD3 A;  1SPK A;  4JJC A;  3H0F A;  2K79 A;  2SEM A;  4HXJ A;  1GFC A;  2EBP A;  1KSW A;  2LQN A;  5IH2 A;  2J7I A;  3I5S A;  4R0K A;  2CSI A;  2J05 A;  4JJD A;  2D8J A;  2OAW A;  1I07 A;  2EQI A;  1WDX A;  4J9I A;  4J9D A;  1PKS A;  1QWF A;  1GBR A;  4HVU A;  2EYY A;  3CQT A;  4J9G A;  2ROT A;  4ESR A;  1UGV A;  2GTO A;  1MV3 A;  2O9V A;  4JPB W;  2OI3 A;  3M0P A;  4JZ4 A;  5ECA A;  1X2K A;  1Y0M A;  1ZUY A;  3RBB B;  1UG1 A;  4GBQ A;  4Z88 A;  2DIL A;  3ULR B;  1AOJ A;  2MCN A;  3H0I A;  2KT8 A;  4OMO A;  1WX6 A;  1W6X A;  2CH4 W;  1Y57 A;  2L2P A;  3FJ5 A;  1H3H A;  1YP5 A;  2FPF A;  2KNB B;  1X43 A;  1UEC A;  1UHC A;  1PHT A;  4Z89 A;  1BB9 A;  2RQR A;  3JV3 A;  2F2V A;  2KRS A;  1RLP C;  2GQI A;  1AD5 A;  5L23 A;  5IHK A;  1AZG B;  5HCK A;  1CSK A;  1KFZ A;  2HEQ A;  2K3B A;  2EKH A;  1T0J A;  4LNP A;  2LX7 A;  2BTT A;  3EG2 A;  1JXM A;  2CUB A;  1K1Z A;  2DVJ A;  2CSQ A;  1K0S A;  1JO8 A;  2CT3 A;  2DL5 A;  3VS5 A;  2DRK A;  4EIK A;  5IXB A;  1NYG A;  2KR3 A;  3UA6 A;  1AZE A;  4IIM A;  2YSQ A;  2CDT A;  1ZBJ A;  1PRM C;  1X27 A;  2RQU A;  1QCF A;  1N5Z A;  4CC7 A;  1GCQ C;  3M0S A;  2JS2 A;  5I11 A;  2FO0 A;  2J6F A;  2K2M A;  2ED1 A;  1VYV A;  1OV3 A;  3VS3 A;  4FSS A;  1RLQ C;  3THK A;  2LQW A;  1NLO C;  2DX1 A;  3M0T A;  3EG1 A;  2AK5 A;  4LE9 A;  1XOV A;  2O88 A;  2RNA A;  1Z9Z A;  4JJB A;  3QWY A;  2DL3 A;  1CKB A;  4F17 A;  2LP5 A;  2BZX A;  1B07 A;  4OMQ A;  3VRY A;  3IQL A;  1GRI A;  2ECZ A;  4JZ3 A;  2EYZ A;  4F14 A;  1ABO A;  1FMK A;  1M3B A;  2E5K A;  2DF6 A;  2VWF A;  3RNJ A;  1T3S A;  2PNI A;  2H8H A;  2ABL A;  5FW9 A;  2NWM A;  3EGU A;  1M8M A;  2DJQ A;  4RUG A;  2VVK A;  2JXB A;  1HJD A;  1RUW A;  4QT7 A;  1PRL C;  1B3Q A;  1NG2 A;  3TSW A;  5IHI A;  1VYT A;  2HCK A;  2PZ1 A;  4RTW A;  3VS1 A;  5FWC A;  2P4R A;  1WYX A;  1YCS B;  4J9C A;  2L3Q A;  2LCS A;  1ZSG A;  4ORZ A;  3PVL A;  1J3T A;  3VS4 A;  2A28 A;  2GNC A;  2X3X D;  3I9Q A;  1WI7 A;  2C0T A;  1PWT A;  2EW3 A;  2K7A A;  2OJ2 A;  3QWX X;  2JT4 A;  2YDL A;  3C0C A;  1UE9 A;  5IHN A;  2KRN A;  3ZL7 C;  3I35 A;  1YWP A;  2QDL A;  1K76 A;  2W10 A;  1I0C A;  4CC3 A;  4K11 A;  2MIO A;  2JW4 A;  1GFD A;  1M3A A;  2FEI A;  1WIE A;  1U06 A;  1G83 A;  3U23 A;  2MOX A;  1FYN A;  3VS2 A;  2HBW A;  3A98 A;  1S1N A;  1NLP C;  2ROL A;  3VS7 A;  1VYU A;  2FRW A;  1CKA A;  2JMC A;  2KRM A;  2KT1 A;  2JM8 A;  4AFS C;  1OOT A;  2RQV A;  1ZUU A;  1ARK A;  2O9S A;  2D1X A;  1SHF A;  1Z9Q A;  2YUQ A;  3UAT A;  1OEB A;  1UTI A;  1V1C A;  2FRY A;  3NPF A;  2LJ0 A;  3SEM A;  1MV0 B;  4OMP A;  1ZX6 A;  1NEG A;  1WFW A;  2BZY A;  2GGR A;  1IO6 A;  1E6G A;  1YN8 A;  2DBM A;  4HVV A;  5I22 A;  4Z8A A;  5GJV B;  2XMF A;  2DYB A;  1U5S A;  2KRO A;  3NHN A;  3R6N A;  2YUO A;  2D8H A;  4HVW A;  2FG0 A;  2ENM A;  4X1V A;  1YNZ A;  4RTZ A;  1UDL A;  1UJY A;  2ED0 A;  2EYW A;  2O2O A;  1NYF A;  5EC7 A;  2EGC A;  3M0U A;  2X3W D;  2I0N A;  1ZUK A;  2V1R A;  2DBK A;  3TSZ A;  4KRT A;  1GBQ A;  3VS6 A;  2FPE A;  2DE0 X;  3I5R A;  4RTV A;  4RTY A;  1SEM A;  1ABQ A;  2KBT A;  1SHG A;  2LZ6 B;  1MUZ A;  2L0A A;  2RPN A;  2L3P A;  3PVQ A;  1X6B A;  1AWJ A;  1JEG A;  2K9G A;  2YUP A;  4RTU A;  4J9E A;  2C0O A;  2NUZ A;  1H8K A;  2L3S A;  1I1J A;  3TVT A;  4RTX A;  4Y92 A;  1JXO A;  1JQQ A;  4HCK A;  3H41 A;  4AFZ C;  1K9A A;  2CRE A;  4D8K A;  4AFU C;  1W1F A;  2JM9 A;  1TUD A;  1K4U S;  2KYM A;  3EHR A;  4LUD A;  1WLP B;  2A37 A;  4J9F A;  1QKW A;  1PKT A;  2IIM A;  1AWW A;  1OPL A;  3KFV A;  4OML A;  2SRC A;  2EVR A;  1SRL A;  2EPD A;  2C0I A;  1AVZ C;  2A36 A;  2RMO A;  2M0Y A;  2PTK A;  2F2X A;  4WCI A;  1KIK A;  1RI9 A;  1W70 A;  2W0Z A;  2BZ8 A;  4J9H A;  4E6R A;  4OMM A;  1UJ0 A;  3GBQ A;  1GCP A;  2JMA A;  5FWB A;  2DRM A;  2DM1 A;  1BU1 A;  1GCQ A;  2LJ1 A;  3H0H A;  1ZLM A;  1NM7 A;  4J9B A;  4LN2 A;  2CUD A;  1T0H A;  1AEY A;  3EG3 A;  3REB B;  2KYB A;  2O31 A;  2JS0 A;  2VKN A;  2EYX A;  1M3C A;  2B86 A;  1K0X A;  4DEY A;  1G2B A;  1E7O A;  2DL4 A;  3VS0 A;  2KXD A;  1SSH A;  3UA7 A;  1TUC A;  2YUN A;  2ESW A;  3UF4 A;  1X6G A;  3REA B;  4CC2 A;  2DMO A;  2RQT A;  1LCK A;  2CT4 A;  4DEX A;  2DLP A;  3PE0 A;  4GLM A;  1PNJ A;  3NGP A;  4IIO A;  2F2W A;  1VA7 A;  1OPK A;  3M0Q A;  4OMN A;  1H92 A;  2LMJ A;  1GL5 A;  1TG0 A;  2J06 A; 
#chains in the Genus database with same CATH topology
 5J39 A;  3L1A A;  4BI3 A;  2EGE A;  4OP0 A;  4E2F B;  4M78 F;  5IXF A;  1XQH A;  1QKX A;  2CZ1 B;  1M30 A;  3HHT B;  4C8Q D;  3OYC A;  5HKC A;  4KH0 B;  1UUE A;  3GF5 A;  4AG2 C;  3SB2 A;  3SHW A;  4A4K A;  4FU6 A;  1WA7 A;  5IAY A;  4JRP A;  2JTE A;  1ZA1 B;  1D09 B;  2DNU A;  2YT6 A;  4XU1 A;  5FU7 B;  3FEO A;  3CCQ A;  2DL7 A;  1AWX A;  2AZV A;  3ZEH A;  3VU3 C;  1FXX A;  1TS9 A;  3MEU A;  3EG0 A;  2EKO A;  2XDB A;  3JCM e;  2XDD A;  2R5M A;  1VQ4 Q;  3JCM c;  3CPW S;  3LH5 A;  4EDU A;  4PJM A;  4C5G A;  2K6D A;  1M2V A;  2X4Y A;  3P8D A;  4FW2 A;  3CC7 A;  4ME7 A;  4AFQ C;  1FWZ A;  3CC2 A;  3MET A;  1HSQ A;  4EPC A;  2DL8 A;  1EFN A;  3M9Q A;  2DET A;  1RAH B;  2K3X A;  4JJC A;  2SEM A;  2NYS A;  3QG1 A;  1QVG P;  2EBP A;  1KSW A;  3EG9 B;  5IH2 A;  3CD6 Q;  1NPP A;  2J7I A;  2J05 A;  4MZT A;  3CC7 T;  4C92 A;  4M7D A;  1MNE A;  3M54 A;  3WVE B;  4BDY A;  5D6Y A;  1YBY A;  2MAM A;  3CQT A;  4J9G A;  3L42 A;  3M57 A;  3LWI A;  1MV3 A;  4JPB W;  2OI3 A;  3M0P A;  2V8K A;  3MP8 A;  4JZ4 A;  5ECA A;  1ZUY A;  2DIL A;  5C0M A;  5CQX A;  2XDP A;  3OSS C;  5J3B A;  3I55 A;  2DVE A;  4M7D E;  2LDM A;  4JRI A;  1N8R C;  1H3H A;  1YP5 A;  1WQ7 A;  2FPF A;  4BE2 A;  2DTI A;  1X43 A;  1Q86 R;  3M58 A;  5GAO r;  4FT2 A;  4A4E A;  3ZBD A;  5GAN d;  4IUU A;  3S3O A;  3JV3 A;  4C92 D;  5GAN 7;  1ZA2 B;  5A0D A;  1TUG B;  2HMA A;  2COW A;  3G6E A;  1K9M R;  1ZSZ B;  2LX7 A;  1WHL A;  2BTT A;  3X26 B;  1K0S A;  3C12 A;  1Q7Y R;  4UC4 A;  1RAA B;  1YJN T;  1I5O B;  2DXT A;  2DRK A;  5CKB A;  5KYW B;  1NYG A;  1K73 U;  2QYZ A;  1X27 A;  1VQ8 A;  1OX9 A;  1QCF A;  4BDZ A;  3M0S A;  3QYH B;  3MJX A;  5I11 A;  2FO0 A;  4PK4 A;  2J6F A;  2K2M A;  1Y71 A;  2ED1 A;  1EIF A;  3TQ7 P;  1D1B A;  3QJ6 A;  3CPW A;  5CIU A;  4IUQ A;  1OX8 A;  3THK A;  3CCL T;  3G71 A;  1YI2 Q;  3FIF A;  4QVZ A;  1PSE A;  3CCV A;  4DBH A;  3EG1 A;  2AK5 A;  2F5K A;  4LE9 A;  2A0F B;  3GOX A;  1XOV A;  3CMA A;  3CCS T;  2D6F A;  1X6O A;  1GXI E;  1CKB A;  2O01 E;  3OA6 A;  3FDR A;  4QVC A;  4M7D F;  1M1K U;  3I55 T;  4LD6 A;  4WTO B;  2E5K A;  3GPL A;  2VWF A;  2XD0 A;  3BFM A;  4E7H A;  2JUF A;  2PNI A;  4IUT A;  1M8V A;  3RDV A;  1X75 C;  5GAN 6;  1H3Z A;  5GMK h;  1RAD B;  5GAN 5;  3WVD B;  3JCM b;  4HCZ A;  1UGS B;  3JCM J;  3S6W A;  3CCM Q;  1VYT A;  2HCK A;  2PZ1 A;  4RTW A;  4J5Y A;  3VS1 A;  1KD1 R;  1VUB A;  3L2Z A;  1VQK T;  4ZTF A;  1KHI A;  1V76 A;  3RMS A;  2G3R A;  2WSF E;  2O4X A;  4LDW A;  4N4I A;  2B8A A;  1PWT A;  3QO3 A;  3QWX X;  4M77 D;  2IG0 A;  2YDL A;  4F7U G;  4M75 E;  2DIQ A;  2P84 A;  3TCJ A;  4DBR A;  1YI2 T;  5GAM f;  4CC3 A;  5KH6 A;  3PTA A;  2JW4 A;  4KGZ B;  1M3A A;  2FEI A;  1QQJ A;  2MOX A;  4M78 A;  3OBY A;  2LQK A;  3RER A;  1NLP C;  1VYU A;  2FRW A;  3VUZ A;  2KRM A;  2YHT A;  2Y4X A;  3SWN B;  2GF7 A;  1NBE B;  1ACM B;  4AFS C;  1VQL T;  1ZUU A;  2GFU A;  2VGN A;  1K73 C;  4A53 A;  4WF2 A;  1UTI A;  4C5E A;  4M75 C;  4Y91 A;  3SEM A;  2R57 A;  1VQ6 A;  3DB3 A;  1G3W A;  4PLI A;  3OW2 S;  1YHQ A;  2K5I A;  2GGR A;  1N8R R;  2GFA A;  3CPW P;  1E6G A;  3OYJ A;  4ZGJ B;  2A3L A;  4QVD A;  3MP6 A;  2XMF A;  4QQD A;  1MHN A;  2HL5 C;  4KUL A;  2R58 A;  2E70 A;  5GAO p;  2EQU A;  4HVW A;  2ENM A;  1VQM Q;  1R77 A;  1M90 C;  2PVD B;  4KUI A;  4NS5 A;  3J80 E;  1UJY A;  2ED0 A;  3JB9 J;  1S72 Q;  2O2O A;  1BI0 A;  2QAZ A;  6AT1 B;  2EGC A;  3C94 A;  3OYB A;  1ZUK A;  1D1A A;  4P5N A;  4BAC A;  1TTH B;  2A7Y A;  2DE0 X;  3NFC A;  5IT9 E;  2LZ6 B;  1MUZ A;  3JB9 I;  1IB8 A;  3EG9 A;  2ZAE A;  2L3P A;  4RTU A;  4J9E A;  3CC4 T;  3A8O B;  2RI5 A;  3V8J A;  5IN1 A;  3L2V A;  1PC0 A;  4ZN1 A;  1WPY A;  4DOW A;  5KE3 A;  3CCU A;  4RTX A;  1Q82 U;  2V8J A;  3QYG B;  4HCK A;  2EJG A;  1TWB A;  1Q86 C;  1UGP B;  3H8Z A;  1RAG B;  2JM9 A;  3JCM W;  1MMD A;  2E1H A;  1KQ1 A;  4LUD A;  3EHR A;  3HRT A;  1WLP B;  4M7D G;  1QKW A;  1AWW A;  1QCO A;  4M75 G;  4OML A;  3CCQ Q;  2SRC A;  2RHI A;  3L2R A;  4DQ2 A;  2RI3 A;  3QUI A;  1AVZ C;  2A36 A;  4PJO D;  2PTK A;  5KYX A;  5A0L A;  1RAB B;  1SSF A;  5C6S A;  1YCY A;  1VQ7 T;  3RES A;  4J6X A;  1IRE B;  1UJ0 A;  4ZN3 A;  1M5Q 1;  3GBQ A;  3E9G A;  3CCM T;  1B34 B;  1BU1 A;  5LJ3 e;  4BI4 A;  5GMK m;  3H0H A;  1ZLM A;  2HAX A;  4EMK B;  1OI1 A;  4Q5W A;  4C8Q B;  3OS5 A;  3PMT A;  2NLU A;  2X4W A;  3X24 B;  1M3C A;  2QQA A;  1K0X A;  1VQL A;  1KD1 U;  1VQ9 A;  1G2B A;  3VV0 A;  2QEX A;  4BD3 A;  3OY9 A;  1E7O A;  2KXD A;  1TUC A;  5KYU A;  1C1A A;  3HRS A;  3MPU B;  2OTJ T;  1MND A;  2DLP A;  4ZGE B;  2VC8 A;  4E7L A;  1IHW A;  1VA7 A;  4C0D B;  3WXM B;  1H92 A;  5CO7 A;  2J06 A;  1N9S A;  2DK3 A;  2DXC A;  3CCL Q;  2MF2 A;  5FU6 B;  2EJF A;  4OVA A;  2KGT A;  1FX7 A;  2KE9 A;  5AYF A;  4CC4 B;  3MO8 A;  1KC8 C;  4FM4 B;  5KYX B;  1EZZ B;  2EGA A;  2HD0 A;  2M9U A;  3VRZ A;  3N5B B;  5GMK l;  1KC8 R;  2HSP A;  3J7A F;  1T3L A;  1QWE A;  1KQS A;  2QXF A;  2RHU A;  2FPD A;  3HP9 A;  3NMZ C;  1G8X A;  1E6H A;  1KJW A;  4FCY A;  3M0R A;  3OYA A;  3H9N A;  3V7R A;  1PM3 A;  2LRQ A;  3LW5 E;  2DZ9 A;  1PG5 B;  3HRU A;  3RKX A;  4C92 E;  3QZ5 B;  4OB1 B;  2G6F X;  2DA9 A;  3PFS A;  1OU8 A;  1Y07 A;  2MPX C;  2DJZ A;  2QI2 A;  2MK5 A;  1U3O A;  2DXU A;  3G71 Q;  2MYS A;  1YI2 A;  2DKG A;  3CBP A;  3S3N A;  1UHF A;  1NEB A;  3G4S A;  1A0N B;  3I56 Q;  3PNW C;  4ZNX A;  1N27 A;  3H0F A;  8ATC B;  2CZ6 B;  4HXJ A;  1QVF A;  3EAE A;  2LQN A;  1VQ5 Q;  3I5S A;  2CSI A;  4XAX B;  4TVR A;  5D7U A;  3LX7 A;  3QPH A;  4IUP A;  1D1C A;  4C5H A;  4EMG A;  2EQI A;  1AT1 B;  1WDX A;  4C8Q C;  3OYI A;  3NTH A;  1PKS A;  1ZSZ C;  2FYK A;  3JAM E;  4R55 A;  2E65 A;  2JJ9 A;  4C8Q G;  5GMK e;  3TEE A;  3A8M B;  1VQO Q;  2RM4 A;  2O9V A;  3L2U A;  2X9H A;  1Y0M A;  3RBB B;  1UG1 A;  5GAN j;  3ULR B;  2E12 A;  2HL3 A;  3CCM A;  4LDY A;  4OB3 B;  3VUB A;  4C5I A;  1Y57 A;  2L2P A;  4M77 B;  1QMC A;  3JCM P;  2KNB B;  3MP1 A;  1UEC A;  1LJO A;  4EMH A;  2OTJ Q;  4M78 G;  1BB9 A;  2E64 A;  2CS7 A;  1F1B B;  4PFO A;  2F2V A;  2KRS A;  4FSX A;  3M4G A;  5L23 A;  5IHK A;  2EKH A;  3RKW A;  2RD1 A;  4Y28 E;  1KC8 U;  4LNP A;  1VQK A;  1K1Z A;  4F7U A;  2CSQ A;  4CRI A;  1UGR B;  2DL5 A;  2KSS A;  4EMK A;  5IXB A;  4FT4 A;  4A4G A;  1AZE A;  4IIM A;  3V8L A;  4B9W A;  1RAE B;  1NJI U;  1FMV A;  4GY5 A;  1M90 R;  3QBY A;  2M16 A;  3DB4 A;  5LJ3 f;  1RLQ C;  4JS4 A;  5CVI A;  3RMQ A;  3CC4 Q;  2DX1 A;  1YHQ Q;  1IXD A;  2LCL A;  4FW1 A;  5I2S A;  1YJ9 T;  2RNA A;  1Z9Z A;  2I2L A;  1RL2 A;  3QWY A;  4DBF A;  3RUX A;  4A4F A;  4O6J A;  3EGD B;  1B07 A;  3VRY A;  4JZ3 A;  1Y7X A;  4JRK A;  1FMK A;  4NL2 A;  3RNJ A;  3CCJ T;  1TH7 A;  2ABL A;  2H3J A;  3HFN A;  5KCH A;  3EGU A;  3V8K A;  2HSE B;  4M78 D;  2DIG A;  4RUG A;  1I5L A;  4IUR A;  1G5V A;  2DXB A;  2NUT A;  1QP3 A;  4QT7 A;  1QVF P;  1B3Q A;  2K2V A;  2P4T A;  4PFZ A;  2HQX A;  5LJ3 g;  2K4Y A;  5FWC A;  1R0B G;  1WYX A;  3OS1 A;  4EMK C;  4L59 A;  4C8Q F;  4JUV A;  2GNC A;  2EW3 A;  2OJ2 A;  2VXF A;  1SKU B;  1YIJ A;  2KRN A;  3ZL7 C;  1RAF B;  1MMG A;  1VQ9 T;  3C4S A;  2W10 A;  1I0C A;  2DYI A;  4K11 A;  2MIO A;  3ME9 A;  2QGF B;  3OYM A;  1LVK A;  1WIE A;  1U06 A;  1G83 A;  4PJO E;  4PJO A;  1WZO A;  3VS2 A;  1S1N A;  1KD1 C;  4C0F A;  1I4K 1;  2JMC A;  2OTL A;  3CCQ T;  2H3E B;  3L2W A;  1VQ6 T;  1C6V X;  2RQV A;  1YJ9 A;  2O9S A;  3Q1J A;  2PVG B;  2YUQ A;  2DD5 A;  2PU9 B;  1OEB A;  4NL3 A;  2QA4 A;  2FRY A;  2JTF A;  2MMP A;  2QAS A;  4M77 A;  3LYI A;  4OMP A;  4PJO G;  4C0D C;  2BZY A;  1M4Z A;  4RG8 A;  2DBM A;  3JSC A;  3UT1 A;  2KAF A;  2RK1 A;  3I56 T;  1M2O A;  4HVV A;  2ZCF B;  1IGQ A;  1YJN A;  1VQ4 T;  1M1K R;  2JOY A;  3NHN A;  1TU0 B;  4N0A C;  2YUO A;  3X28 B;  1QVG A;  2NUP A;  1YNZ A;  1MMA A;  5GAO m;  2EWN A;  1O9S A;  5KYY B;  1UDL A;  2Z0W A;  2CP6 A;  1NYF A;  3M0U A;  4C0Z A;  2E41 A;  3CXC S;  3TSZ A;  5M9O A;  1D0Y A;  4KRT A;  5FU6 C;  3VS6 A;  3I5R A;  3OYL A;  4FYX B;  2KBT A;  1EX4 A;  2QK0 A;  2RPN A;  3PVQ A;  4X9C A;  1AWJ A;  2K9G A;  2EQK A;  3CCR A;  1H8K A;  2L3S A;  4HT8 A;  2YLC A;  3ASK A;  4M77 F;  4Y92 A;  4HCC A;  1QVG S;  1JQQ A;  3EGX B;  3DLM A;  3M4Y A;  4D8K A;  2LT4 A;  2RHX A;  1P92 A;  2DEU A;  3RIR A;  1LOJ A;  5LJ5 j;  3OSV A;  4KH1 B;  4GLK A;  1RAI B;  2A37 A;  3BDL A;  1PKT A;  5HY6 A;  3AHU A;  1OPL A;  1YIT T;  5GAN h;  2AT1 B;  5GAN e;  2HKQ B;  4PLL A;  1JRI A;  5D6W A;  5CR2 A;  4QQG A;  3EFO A;  2F2X A;  1B7T A;  1VQ4 A;  4RCC A;  4XTY A;  2BZ8 A;  4J9H A;  2JN0 A;  2GCX A;  5GAN 2;  4E7I A;  2BKD N;  3CME A;  4V2S A;  4M77 E;  1N6A A;  3QZ9 B;  4FYY B;  2M02 A;  4LN2 A;  4PL6 A;  4MDW A;  4LD9 K;  1AEY A;  3EG3 A;  2KYB A;  1HYO A;  2JS0 A;  2VKN A;  2EYX A;  2B86 A;  5GAO l;  4QQ6 A;  3CCS Q;  4QW2 A;  3JCM h;  3VS0 A;  3UA7 A;  3UF4 A;  2EFI A;  3O8V A;  2KQW A;  3GLX A;  1LCK A;  2RA2 A;  2E6N A;  3NGP A;  4IIO A;  4J6Y A;  1Q81 R;  2F2W A;  1WHJ A;  4M77 C;  3JCM Q;  2RJF A;  3I55 Q;  3M5A A;  2LMJ A;  3A8L B;  4M7A G;  3FRN A;  2DPP B;  3QHS A;  2YXY A;  3A5Z B;  2QQB A;  2X4X A;  2AKL A;  5GMK i;  3OYH A;  2JNG A;  1Y96 A;  3OW2 P;  2VUB A;  2KMT A;  2KVQ G;  1YWO A;  4M78 C;  1YJW A;  3EHQ A;  4FYV B;  4BE1 A;  3O5Z A;  1WXB A;  3M53 A;  1X69 A;  3JB9 G;  4F16 A;  4X34 A;  4MDX A;  1W2B S;  2RN8 A;  1UFF A;  2EIF A;  1VQK Q;  2AZS A;  4B6M A;  5CKF A;  2YRD A;  2K5F A;  5GJW B;  3J81 E;  3HPW A;  1BK2 A;  1IGU A;  2V1Q A;  3OYD A;  5AT1 B;  1C0M A;  2CH4 A;  2KEA A;  2LJ3 A;  2VXE A;  1BBZ A;  5HK3 A;  1QLY A;  3DLL A;  4AG1 C;  2J6K A;  2YRV A;  1X2Q A;  1NE8 A;  4FYW B;  3CXC A;  1OU9 A;  4ZGD B;  1SPK A;  2RH2 A;  3V7S A;  1GFC A;  5LJ3 h;  2M0O A;  3JCM V;  2C06 A;  3EFO B;  4R0K A;  3PIO A;  4JJD A;  3F70 A;  2D8J A;  1X01 A;  5FRN A;  2OAW A;  3QDF A;  5GAO q;  1I07 A;  3G6E T;  5GAN 3;  2R5A A;  4OF1 A;  4J9I A;  4J9D A;  1QWF A;  5L8R E;  2COZ A;  4M7A C;  1GBR A;  2LCC A;  2EYY A;  2CP5 A;  1VQ5 T;  1UGV A;  1B34 A;  2GTO A;  3VJP A;  2ZPF B;  1X2K A;  4GBQ A;  1Y96 B;  5HK0 A;  3JCM d;  2MCN A;  5FRO A;  2DTO A;  3H0I A;  4OMO A;  1VQ7 Q;  1WX6 A;  5J26 A;  2CP7 A;  3JCM g;  3FB9 A;  2CH4 W;  2CKK A;  1UHC A;  1PHT A;  4Z89 A;  1NJI C;  4C92 B;  1WNL A;  4XTW A;  2RK2 A;  2AHJ B;  3JCM X;  4JS5 A;  2EQJ A;  3CCV T;  2RQR A;  3BE3 A;  2DFU A;  3PIP A;  1QP2 A;  4M7D D;  2VB6 A;  2GQI A;  4QKU A;  4M7A E;  1KFZ A;  1T0J A;  1VQP Q;  4R56 A;  1K73 R;  1Q81 C;  4MZM A;  3EG2 A;  1JXM A;  2CUB A;  2DVJ A;  4F04 B;  3VS5 A;  4LDU A;  2E10 A;  1K8A C;  4EIK A;  2KR3 A;  1D3B A;  1RI0 A;  2YSQ A;  4ZTJ A;  4IKF A;  2RI2 A;  1ZBJ A;  1PRM C;  2RQU A;  3EH2 A;  4Z02 A;  2E6Z A;  1U1S A;  2IPO B;  3CBO A;  1OUL A;  4NOY A;  1W2B P;  1BI3 A;  1M9S A;  3LGF A;  1VYV A;  3JRZ A;  3CC7 Q;  1VQ6 Q;  3TU4 K;  1ZBX A;  4E47 A;  1G3T A;  1YHQ T;  2GQV A;  2YLB A;  3ZFJ A;  4C0G A;  3ER0 A;  2V8I A;  2DL3 A;  4F17 A;  1YJN Q;  1TSF A;  2LP5 A;  1YIT A;  2HQE A;  2LC4 A;  4OMQ A;  2HBP A;  3CEY A;  3IQL A;  1GRI A;  2ECZ A;  2EYZ A;  4F14 A;  1ABO A;  2VYT A;  5LJ3 d;  4MZP A;  1QCN A;  4M75 A;  5GAM j;  2QQR A;  3HTR A;  3SD4 A;  2H8H A;  1HK9 A;  4FL6 A;  5FW9 A;  1H64 1;  2YWW A;  1BYM A;  4DA4 A;  2DJQ A;  2QQ9 A;  3QSU A;  2F69 A;  4RG2 A;  2VVK A;  4FIB A;  2JXB A;  1HJD A;  4RKU E;  2DER A;  1VIE A;  3TSW A;  2L3R A;  4LXC A;  5GAM d;  4MML A;  2LCS A;  2P4R A;  4J9C A;  3PVL A;  1K8A R;  2RO0 A;  3SWN A;  4JRQ A;  3FC3 A;  2QGG A;  3EGD A;  2X3X D;  3I9Q A;  1JJ2 A;  1WI7 A;  2K7A A;  3CCR Q;  4KGV B;  1UE9 A;  5IHN A;  2DO3 A;  3CCU T;  2PQW A;  2BE9 B;  1W4S A;  4RCB A;  1Q95 G;  1YWP A;  3OQ5 A;  1K76 A;  3CBM A;  3UPU A;  3G6E Q;  1I8F A;  1GFD A;  1OQK A;  1D0Z A;  1D3B B;  3U23 A;  1NJI R;  3OS0 A;  1FYN A;  1RAC B;  2HBW A;  5DM7 R;  2ROL A;  1CKA A;  1XTD A;  3CCJ A;  1OOT A;  1ARK A;  3EFR A;  1VQ8 Q;  3RR6 A;  1VQ8 T;  2D1X A;  2EAY A;  2JZ2 A;  2RHZ A;  3L2Q A;  1G3Y A;  1VOM A;  5DLO A;  2XU8 A;  1ZX6 A;  3CME Q;  1SF9 A;  1NEG A;  1WFW A;  4PJL A;  4II1 A;  1O75 A;  3D7S B;  4JDS A;  3CCV Q;  2LNV A;  4JLI A;  5FU7 C;  2CZ7 B;  4Z8A A;  1PCX A;  3CPF A;  2DYB A;  1U5S A;  4PKC C;  4ELY C;  1PSF A;  3R6N A;  1WHK A;  3PT9 A;  4AT1 B;  4L6V 5;  3SFM A;  3V7C A;  3CCS A;  3OMC A;  1VQ9 Q;  2MWO A;  1K8A U;  2PUO B;  4PJO B;  4RTZ A;  2OX7 A;  1Q82 C;  1QVP A;  1QVF S;  5I21 A;  1KK7 A;  2XKO C;  2P0Q A;  3A8H B;  2VGM A;  3RKY A;  3MEA A;  1GBQ A;  3UWN A;  2OAU A;  4C92 C;  3HL8 A;  4HT9 A;  2QTV A;  3MHX A;  1SHG A;  2LTO A;  1Q82 R;  2JVV A;  2L0A A;  3PGG A;  2QDY B;  4KUD K;  4M7A F;  1UB4 A;  1X6B A;  1G3S A;  1JEG A;  2YUP A;  2F1L A;  2LX9 A;  2AIR B;  2C0O A;  2EQM A;  2HZY A;  2ZPB B;  1I1J A;  1R8O B;  1M90 U;  3G7Z A;  4C8Q E;  4MMK A;  2KDS A;  4AFZ C;  2CRE A;  3MEV A;  3LLR A;  2VV5 A;  2DEQ A;  1TUD A;  1XJW B;  1WJQ A;  1BKB A;  1KQS P;  2IIM A;  5I2M A;  3E19 A;  2VAS A;  2EVR A;  1OZ2 A;  1SRL A;  2C0I A;  2RMO A;  2Y4Y A;  2M0Y A;  2XHC A;  2RB6 A;  2DZC A;  1S72 T;  1KIK A;  3A1P A;  1FMW A;  4JJN K;  1RI9 A;  2W0Z A;  1V29 B;  4OMM A;  3GIB A;  3URG A;  3MEW A;  5FWB A;  2DRM A;  2DM1 A;  1R0C B;  3CMA T;  4BE0 A;  2ATC B;  4J9B A;  1NM7 A;  2XG8 D;  3JB9 F;  4J8O A;  2CUD A;  3JCM f;  3OYN A;  1VQM A;  3A8G B;  3JB9 D;  4XQ3 A;  1SSH A;  2ESW A;  3REA B;  4AMC A;  1VQO A;  2DMO A;  1JJ2 S;  2K3Y A;  1U8R A;  2CT4 A;  1WGS A;  1WHG A;  4O5V A;  1Q86 U;  3M0Q A;  4OMN A;  1VQ7 A;  1M2V B;  1GL5 A;  1TXQ A;  2ZPI B;  2LQ8 A;  4XK8 E;  2JTM A;  5LJ5 f;  1IZ6 A;  1M1G A;  1WXU A;  2AKK A;  2RQW A;  2OTJ A;  2RF0 A;  2NUP B;  4ELZ C;  3INZ A;  2J6O A;  1VQO T;  4LUE A;  2M51 A;  3OBW A;  1BIB A;  3OB9 A;  3P8H A;  1BIA A;  3CCU Q;  2A08 A;  3OYK A;  3CC2 T;  2LNH B;  4RTT A;  5D6X A;  3SWN C;  1VQP A;  3GNF B;  4M7A B;  4D6W A;  5GMK j;  4OGE A;  1WXT A;  5GAM h;  1M27 C;  2GTJ A;  2EJ9 A;  2KXC A;  3QXE B;  4CI0 C;  4J83 A;  2LVM A;  3OS2 A;  5LL6 S;  2X4J A;  4DBQ A;  3EGX A;  3E9F A;  2ZZD A;  2KI7 A;  5LJ5 h;  2OTL T;  2K5L A;  3OMG A;  5KYU B;  4BY6 C;  1I81 A;  2HDA A;  4D8D A;  2RJC A;  3CCE Q;  3NTI A;  2GBQ A;  4M7D B;  2P0P A;  1AWO A;  4A63 B;  2L8D A;  3UDC A;  4N0A A;  4M4Z A;  9ATC B;  4N4G A;  1JU5 C;  2PVO B;  1SRM A;  4J6W A;  2D0N A;  1HD3 A;  4M75 F;  5KYW A;  3PMI A;  1YJW T;  1M1K C;  2K79 A;  4M75 D;  1ZHI A;  1YIT Q;  5GAN 8;  3KXT A;  3JB9 H;  1VQL Q;  4B9X A;  1LNX A;  2QEX Q;  1KG1 A;  4XTZ A;  4OB0 B;  1AHJ B;  4HVU A;  2CP3 A;  1VQN Q;  2Y90 A;  2ROT A;  4ESR A;  3CXC P;  1Q81 U;  2QQS A;  2RJD A;  4XTU A;  4Z88 A;  3OW2 A;  1AOJ A;  2O4X B;  2KT8 A;  4BB7 A;  1W6X A;  3CCL A;  3FJ5 A;  5CCA A;  1XNI A;  4HCB A;  4N4H A;  3QKJ A;  2XI9 A;  5KE2 A;  2HQH A;  2LT1 A;  3HKS A;  3C95 A;  5A0G A;  1RLP C;  2CP2 A;  3KBG A;  1AD5 A;  1AZG B;  5HCK A;  1CSK A;  2HEQ A;  2K3B A;  4LDV A;  2DAQ A;  1Q7Y U;  3OYF A;  1WHH A;  2CYZ B;  4E7J A;  1JO8 A;  2CT3 A;  1K9M U;  2FVU A;  2FZC B;  4C92 G;  2QA4 T;  3VYG A;  3UA6 A;  2OTL Q;  1JJ2 P;  3CCJ Q;  2CDT A;  2RHY A;  1YJ9 Q;  5DY9 A;  4E7K A;  1JBM A;  3FJP A;  1N5Z A;  1M1F A;  4CC7 A;  1GCQ C;  2JS2 A;  8AT1 B;  5FRM A;  3QDR B;  4DOV A;  3QJY A;  3SDZ A;  4M7A D;  2WSC E;  5LJ3 j;  1OV3 A;  3VS3 A;  4FSS A;  2LQW A;  3CC2 Q;  1NLO C;  3M0T A;  2BUD A;  2E3H A;  4ANJ A;  1SG5 A;  2NUT B;  3G4S Q;  3I56 A;  1VQN T;  2O88 A;  5KYN A;  3S3M A;  4JJB A;  1YIJ T;  1VQ5 A;  1LPL A;  5CKD A;  3CD6 A;  2BZX A;  1JB0 E;  5CKE A;  3LGL A;  1W2B A;  3QII A;  1M3B A;  2DF6 A;  4X9D A;  2ZPH B;  2QTX A;  1T3S A;  1WJR A;  1NPR A;  2NWM A;  3M56 A;  4M77 G;  1UEB A;  4XU0 A;  1M8M A;  4M7A A;  5GAN g;  4PNO A;  1RUW A;  3LH0 A;  2HKN A;  7AT1 B;  1WQW A;  4M78 B;  3KUF A;  1PRL C;  2L89 A;  1NG2 A;  2RJE A;  5IHI A;  2CP0 A;  2BIV A;  2FB7 A;  1YCS B;  2L3Q A;  1ZSG A;  4LDX A;  4ORZ A;  1J3T A;  3CCE T;  1IRX A;  2COY A;  2XID A;  3VS4 A;  5CK9 A;  2A28 A;  2FL7 A;  2C0T A;  4ATO A;  3BY7 A;  2JT4 A;  3C0C A;  2DTH A;  4VUB A;  4PFP A;  4E7S A;  1BI2 A;  2DD4 A;  3I35 A;  2HNI A;  1VQM T;  5GAN f;  2QDL A;  4XU2 A;  5GAO n;  1HXD A;  2L5Q A;  3MCA B;  4BI8 B;  2E4H A;  3A98 A;  3VYH B;  2MI6 A;  3VS7 A;  5LJ5 g;  2KK4 A;  4C92 F;  2P0K A;  3HSB A;  1Q7Y C;  2KT1 A;  5LJ5 e;  3GP8 A;  4F7U B;  2JM8 A;  4PJJ A;  1K9M C;  4J7I A;  3GNG A;  2CZ0 B;  3E2U A;  3CME T;  2QEX T;  1SHF A;  2X35 A;  1Z9Q A;  2BE7 D;  3UAT A;  4IUV A;  1V1C A;  3DKM A;  5GAM e;  3NPF A;  1MMN A;  2LJ0 A;  4A4H A;  5EG2 A;  1BCM A;  2V26 A;  2X51 A;  1MV0 B;  5CQY A;  4KBM B;  3CC4 A;  4BY6 B;  3EFS A;  4KGX B;  1IO6 A;  1YN8 A;  3CMA Q;  4M78 E;  5LJ5 d;  5I22 A;  5GJV B;  4XTV A;  3OYG A;  1D0X A;  2KRO A;  3FLG A;  3P8B B;  3OYE A;  2D8H A;  4HA8 A;  1U1T A;  2FG0 A;  4X1V A;  2KY9 A;  4KT0 E;  1PD1 A;  1BCO A;  2EYW A;  2F5T X;  5CAI A;  5EC7 A;  2XK0 A;  2X3W D;  2I0N A;  2V1R A;  2DBK A;  5FLX E;  4BUG A;  2E5Q A;  2FPE A;  4PJO F;  4RTV A;  4RTY A;  4C8Q A;  1SEM A;  1ABQ A;  3H6Z A;  1WHM A;  2D9T A;  4XTX A;  4F7U E;  4M75 B;  2CGH A;  2M1H A;  3E1S A;  1YJW Q;  1OYX A;  3BW1 A;  2WAC A;  2NUZ A;  2FZG B;  1YIJ Q;  1KQ2 A;  5KYY A;  3TVT A;  1YFN A;  4PJN A;  1JXO A;  3G71 T;  2WSE E;  3H41 A;  2ZPG B;  1K9A A;  2EYQ A;  1ZQ1 A;  3LWH A;  3G4S T;  5CKH A;  4AFU C;  2D0Q B;  1W1F A;  4YTL A;  1K4U S;  3CCR T;  2KYM A;  4J7F A;  1VIF A;  2ZPE B;  4J9F A;  1IHV A;  1TOV A;  1MGQ A;  1KQS S;  2XIC A;  3BDU A;  4M7D C;  3KFV A;  3M59 A;  2EPD A;  2QG9 B;  3VKI A;  5GAN 4;  3CCE A;  5DLQ E;  1VQP T;  4WCI A;  2YRC A;  1QW1 A;  1KHC A;  3G1J A;  4OGC A;  1NZ9 A;  1W70 A;  2QA4 Q;  2FZK B;  4E6R A;  2IVW A;  1BI1 A;  4HKE A;  1WJS A;  4XU3 A;  1GCP A;  2JMA A;  3T9N A;  2MWP A;  4RMO A;  5A2Q E;  1N8R U;  3EH1 A;  4L5G A;  3R6O A;  4OMF B;  1GCQ A;  1PD0 A;  2LJ1 A;  4E7Z A;  3OYY A;  2E3I A;  1T0H A;  2PUK B;  3REB B;  4F7U F;  2O31 A;  5KCO A;  4PJO C;  5GAM g;  1ZSZ A;  2ZGW A;  1N9R A;  4DEY A;  3AT1 B;  1UGQ B;  3X25 B;  1OZ3 A;  2DL4 A;  3HFO A;  2YUN A;  1VQN A;  1S72 A;  1X6G A;  4OB2 B;  4JLG A;  4CC2 A;  2K57 A;  3X20 B;  2RQT A;  3MKD A;  4DEX A;  3PE0 A;  2FHD A;  4GLM A;  1PNJ A;  3TRE A;  1DJ7 B;  3CD6 T;  1OPK A;  3M55 A;  1TG0 A;  4A54 A;  3NTK A; 
#chains in the Genus database with same CATH homology
 2AKL A;  1WXU A;  2AKK A;  2RQW A;  2KGT A;  2EGE A;  2KE9 A;  2RF0 A;  4CC4 B;  2J6O A;  1YWO A;  4LUE A;  3EHQ A;  2M51 A;  5IXF A;  1QKX A;  1M30 A;  3O5Z A;  1WXB A;  1X69 A;  2A08 A;  2EGA A;  3VRZ A;  2LNH B;  4F16 A;  4RTT A;  1UUE A;  2HSP A;  1T3L A;  4AG2 C;  1QWE A;  3SHW A;  2RN8 A;  1UFF A;  1WA7 A;  2AZS A;  2FPD A;  3NMZ C;  1WXT A;  1M27 C;  1E6H A;  1KJW A;  2GTJ A;  2DNU A;  2KXC A;  2JTE A;  5GJW B;  3M0R A;  2YT6 A;  1BK2 A;  2DL7 A;  2V1Q A;  1AWX A;  2AZV A;  2HDA A;  4D8D A;  2CH4 A;  2G6F X;  3EG0 A;  2DA9 A;  2GBQ A;  2KEA A;  2LJ3 A;  3LH5 A;  1AWO A;  1BBZ A;  2K6D A;  4A63 B;  1QLY A;  1U3O A;  4AFQ C;  4M4Z A;  1HSQ A;  2DL8 A;  4AG1 C;  2J6K A;  1EFN A;  1UHF A;  1JU5 C;  1X2Q A;  1SRM A;  1NEB A;  1A0N B;  2D0N A;  4ZNX A;  1HD3 A;  1SPK A;  4JJC A;  3H0F A;  2K79 A;  2SEM A;  4HXJ A;  1GFC A;  2EBP A;  1KSW A;  2LQN A;  5IH2 A;  2J7I A;  3I5S A;  4R0K A;  2CSI A;  2J05 A;  4JJD A;  2D8J A;  2OAW A;  1I07 A;  2EQI A;  1WDX A;  4J9I A;  4J9D A;  1PKS A;  1QWF A;  1GBR A;  4HVU A;  2EYY A;  3CQT A;  4J9G A;  2ROT A;  4ESR A;  1UGV A;  2GTO A;  1MV3 A;  2O9V A;  4JPB W;  2OI3 A;  3M0P A;  4JZ4 A;  5ECA A;  1X2K A;  1Y0M A;  1ZUY A;  3RBB B;  1UG1 A;  4GBQ A;  4Z88 A;  2DIL A;  3ULR B;  1AOJ A;  2MCN A;  3H0I A;  2KT8 A;  4OMO A;  1WX6 A;  1W6X A;  2CH4 W;  1Y57 A;  2L2P A;  3FJ5 A;  1H3H A;  1YP5 A;  2FPF A;  2KNB B;  1X43 A;  1UEC A;  1UHC A;  1PHT A;  4Z89 A;  1BB9 A;  2RQR A;  3JV3 A;  2F2V A;  2KRS A;  1RLP C;  2GQI A;  1AD5 A;  5L23 A;  5IHK A;  1AZG B;  5HCK A;  1CSK A;  1KFZ A;  2HEQ A;  2K3B A;  2EKH A;  1T0J A;  4LNP A;  2LX7 A;  2BTT A;  3EG2 A;  1JXM A;  2CUB A;  1K1Z A;  2DVJ A;  2CSQ A;  1K0S A;  1JO8 A;  2CT3 A;  2DL5 A;  3VS5 A;  2DRK A;  4EIK A;  5IXB A;  1NYG A;  2KR3 A;  3UA6 A;  1AZE A;  4IIM A;  2YSQ A;  2CDT A;  1ZBJ A;  1PRM C;  1X27 A;  2RQU A;  1QCF A;  1N5Z A;  4CC7 A;  1GCQ C;  3M0S A;  2JS2 A;  5I11 A;  2FO0 A;  2J6F A;  2K2M A;  2ED1 A;  1VYV A;  1OV3 A;  3VS3 A;  4FSS A;  1RLQ C;  3THK A;  2LQW A;  1NLO C;  2DX1 A;  3M0T A;  3EG1 A;  2AK5 A;  4LE9 A;  1XOV A;  2O88 A;  2RNA A;  1Z9Z A;  4JJB A;  3QWY A;  2DL3 A;  1CKB A;  4F17 A;  2LP5 A;  2BZX A;  1B07 A;  4OMQ A;  3VRY A;  3IQL A;  1GRI A;  2ECZ A;  4JZ3 A;  2EYZ A;  4F14 A;  1ABO A;  1FMK A;  1M3B A;  2E5K A;  2DF6 A;  2VWF A;  3RNJ A;  1T3S A;  2PNI A;  2H8H A;  2ABL A;  5FW9 A;  2NWM A;  3EGU A;  1M8M A;  2DJQ A;  4RUG A;  2VVK A;  2JXB A;  1HJD A;  1RUW A;  4QT7 A;  1PRL C;  1B3Q A;  1NG2 A;  3TSW A;  5IHI A;  1VYT A;  2HCK A;  2PZ1 A;  4RTW A;  3VS1 A;  5FWC A;  2P4R A;  1WYX A;  1YCS B;  4J9C A;  2L3Q A;  2LCS A;  1ZSG A;  4ORZ A;  3PVL A;  1J3T A;  3VS4 A;  2A28 A;  2GNC A;  2X3X D;  3I9Q A;  1WI7 A;  2C0T A;  1PWT A;  2EW3 A;  2K7A A;  2OJ2 A;  3QWX X;  2JT4 A;  2YDL A;  3C0C A;  1UE9 A;  5IHN A;  2KRN A;  3ZL7 C;  3I35 A;  1YWP A;  2QDL A;  1K76 A;  2W10 A;  1I0C A;  4CC3 A;  4K11 A;  2MIO A;  2JW4 A;  1GFD A;  1M3A A;  2FEI A;  1WIE A;  1U06 A;  1G83 A;  3U23 A;  2MOX A;  1FYN A;  3VS2 A;  2HBW A;  3A98 A;  1S1N A;  1NLP C;  2ROL A;  3VS7 A;  1VYU A;  2FRW A;  1CKA A;  2JMC A;  2KRM A;  2KT1 A;  2JM8 A;  4AFS C;  1OOT A;  2RQV A;  1ZUU A;  1ARK A;  2O9S A;  2D1X A;  1SHF A;  1Z9Q A;  2YUQ A;  3UAT A;  1OEB A;  1UTI A;  1V1C A;  2FRY A;  3NPF A;  2LJ0 A;  3SEM A;  1MV0 B;  4OMP A;  1ZX6 A;  1NEG A;  1WFW A;  2BZY A;  2GGR A;  1IO6 A;  1E6G A;  1YN8 A;  2DBM A;  4HVV A;  5I22 A;  4Z8A A;  5GJV B;  2XMF A;  2DYB A;  1U5S A;  2KRO A;  3NHN A;  3R6N A;  2YUO A;  2D8H A;  4HVW A;  2FG0 A;  2ENM A;  4X1V A;  1YNZ A;  4RTZ A;  1UDL A;  1UJY A;  2ED0 A;  2EYW A;  2O2O A;  1NYF A;  5EC7 A;  2EGC A;  3M0U A;  2X3W D;  2I0N A;  1ZUK A;  2V1R A;  2DBK A;  3TSZ A;  4KRT A;  1GBQ A;  3VS6 A;  2FPE A;  2DE0 X;  3I5R A;  4RTV A;  4RTY A;  1SEM A;  1ABQ A;  2KBT A;  1SHG A;  2LZ6 B;  1MUZ A;  2L0A A;  2RPN A;  2L3P A;  3PVQ A;  1X6B A;  1AWJ A;  1JEG A;  2K9G A;  2YUP A;  4RTU A;  4J9E A;  2C0O A;  2NUZ A;  1H8K A;  2L3S A;  1I1J A;  3TVT A;  4RTX A;  4Y92 A;  1JXO A;  1JQQ A;  4HCK A;  3H41 A;  4AFZ C;  1K9A A;  2CRE A;  4D8K A;  4AFU C;  1W1F A;  2JM9 A;  1TUD A;  1K4U S;  2KYM A;  3EHR A;  4LUD A;  1WLP B;  2A37 A;  4J9F A;  1QKW A;  1PKT A;  2IIM A;  1AWW A;  1OPL A;  3KFV A;  4OML A;  2SRC A;  2EVR A;  1SRL A;  2EPD A;  2C0I A;  1AVZ C;  2A36 A;  2RMO A;  2M0Y A;  2PTK A;  2F2X A;  4WCI A;  1KIK A;  1RI9 A;  1W70 A;  2W0Z A;  2BZ8 A;  4J9H A;  4E6R A;  4OMM A;  1UJ0 A;  3GBQ A;  1GCP A;  2JMA A;  5FWB A;  2DRM A;  2DM1 A;  1BU1 A;  1GCQ A;  2LJ1 A;  3H0H A;  1ZLM A;  1NM7 A;  4J9B A;  4LN2 A;  2CUD A;  1T0H A;  1AEY A;  3EG3 A;  3REB B;  2KYB A;  2O31 A;  2JS0 A;  2VKN A;  2EYX A;  1M3C A;  2B86 A;  1K0X A;  4DEY A;  1G2B A;  1E7O A;  2DL4 A;  3VS0 A;  2KXD A;  1SSH A;  3UA7 A;  1TUC A;  2YUN A;  2ESW A;  3UF4 A;  1X6G A;  3REA B;  4CC2 A;  2DMO A;  2RQT A;  1LCK A;  2CT4 A;  4DEX A;  2DLP A;  3PE0 A;  4GLM A;  1PNJ A;  3NGP A;  4IIO A;  2F2W A;  1VA7 A;  1OPK A;  3M0Q A;  4OMN A;  1H92 A;  2LMJ A;  1GL5 A;  1TG0 A;  2J06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...