4OMPA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128k
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGKTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ompA00
1I07A 4J9HA 5IHIA 1SRLA 4F14A 4J9EA 3M0UA 1TUDA 1T3SA 4ESRA 1V1CA 2ABLA 1SSHA 2LJ1A 1GL5A 5GJWB 1YWPA 4RTXA 2KGTA 1K76A 1Y57A 1OPLA 2K79A 4CC4B 2LNHB 1BU1A 2JMAA 4QT7A 1UDLA 1YWOA 2LJ0A 2RMOA 1FMKA 2L3QA 1B07A 1ZX6A 1K0SA 2GQIA 1CKAA 1WI7A 1SHFA 1I1JA 1E6GA 2EGAA 4ORZA 3VRZA 2KRMA 2IIMA 2L3SA 3VS0A 3H0FA 3ULRB 2DL3A 2PTKA 1UUEA 3VS4A 1M3CA 4J9IA 3CQTA 4RTUA 1UGVA 4OMQA 2RF0A 4HVWA 3M0SA 2KEAA 1RLQC 4HVUA 1G2BA 1ZUYA 1H8KA 2HDAA 1NLOC 2OI3A 1SHGA 1YCSB 4RUGA 2DILA 1AWWA 2JW4A 1WLPB 2GTJA 4JJBA 3NGPA 1UG1A 1OV3A 2ESWA 2M51A 1SPKA 2FRWA 1KJWA 2W0ZA 2YUNA 1X69A 3VS7A 1PKSA 2CH4A 3VS1A 2F2VA 1VYTA 5IXBA 2JM9A 1XOVA 2K6DA 2LMJA 1G83A 1X6BA 2JMCA 4DEYA 1YNZA 2E5KA 3M0PA 4OMNA 2KE9A 1AZGB 2RQWA 2ROTA 2GTOA 2KT1A 1W70A 2A36A 1A0NB 4E6RA 2RQVA 2HSPA 2RQTA 2FPDA 1NLPC 1ABOA 4IIOA 2M0YA 4J9GA 2G6FX 1B3QA 3I5SA 2A08A 4AFQC 4F16A 2FPEA 2KXDA 1AZEA 1EFNA 5FW9A 2DVJA 1X43A 2RQUA 1GCQC 1NYGA 4Z8AA 4GLMA 1JEGA 2AZSA 2DBKA 3PVQA 1CKBA 1MV0B 1AOJA 2I0NA 4HCKA 3EG2A 1H3HA 1JU5C 3RNJA 3I9QA 1PWTA 2J7IA 2HEQA 2ED0A 1JQQA 1PNJA 3PVLA 1K0XA 2YSQA 2K9GA 3IQLA 1JO8A 1WDXA 2YUOA 2OJ2A 1K4US 1WX6A 4OMLA 2A37A 2KYMA 4R0KA 1WXBA 2CREA 4Y92A 2J6FA 2PZ1A 3TSZA 1AVZC 2O31A 2JTEA 2DM1A 4AFUC 2DLPA 3UF4A 5HCKA 4RTZA 2CT3A 1PRMC 2ECZA 1AWOA 2AKLA 4DEXA 1ARKA 1WYXA 2LZ6B 3TSWA 3THKA 2RQRA 2GGRA 1J3TA 2YUPA 4X1VA 1HJDA 3GBQA 2EPDA 2OAWA 2J05A 4JZ3A 2EW3A 2KRNA 1GBRA 1Y0MA 3O5ZA 2CUDA 2JS2A 2AZVA 2CDTA 4OMPA 1CSKA 3I5RA 2KRSA 5ECAA 1QWFA 2EVRA 3R6NA 2DJQA 2CUBA 2VKNA 3SEMA 3KFVA 1N5ZA 4GBQA 1GFCA 2J6KA 3C0CA 3EHQA 1QKXA 2DBMA 3NPFA 4JPBW 2FRYA 1KIKA 4RTYA 2A28A 3RBBB 2CH4W 3UA6A 1BB9A 1JXOA 3U23A 1AEYA 3I35A 2D0NA 2LQNA 1QCFA 2H8HA 2F2XA 3EG1A 4K11A 1UJYA 2GNCA 5IHKA 3A98A 3NMZC 2EGCA 4HXJA 2F2WA 2EYZA 2FEIA 3VS6A 1S1NA 2KBTA 3SHWA 2O2OA 4AG2C 1T3LA 2L2PA 2P4RA 1VYUA 4JJCA 1VA7A 1UECA 2EBPA 2KROA 2L0AA 1GRIA 2KT8A 1RI9A 2FPFA 2O9VA 1HD3A 2BZXA 2C0IA 4OMMA 3UATA 1PRLC 4Z88A 1WFWA 2YDLA 4AG1C 4CC2A 2DNUA 1W6XA 5I22A 4Z89A 3JV3A 1M3AA 2DRMA 2QDLA 4EIKA 4JZ4A 1RUWA 3M0RA 1KFZA 1GCQA 1QWEA 2O88A 1YP5A 2B86A 4LUDA 1AWXA 2LJ3A 2VVKA 4M4ZA 3VRYA 2DYBA 2RNAA 2YT6A 2LP5A 1UHCA 3EG3A 2DRKA 4KRTA 1E6HA 1QLYA 3ZL7C 3TVTA 3QWYA 2DMOA 2DL7A 4AFZC 1OEBA 1RLPC 1K1ZA 4D8KA 1H92A 1OPKA 3EG0A 1NEBA 2EYYA 1OOTA 4FSSA 1U3OA 1M30A 2CT4A 2KR3A 2JM8A 2XMFA 1ABQA 1X6GA 2BZ8A 2D8HA 2K2MA 2HCKA 1I0CA 1U5SA 3VS5A 1UE9A 1X2QA 1BBZA 2DX1A 1MV3A 1WXUA 2DL8A 1NG2A 2BZYA 4J9DA 2CSIA 3EHRA 2AKKA 2PNIA 2L3PA 3H0HA 4LUEA 2JT4A 1WIEA 1T0HA 1K9AA 3REBB 3H41A 2CSQA 2LQWA 2DA9A 2D1XA 1PKTA 2X3WD 4CC3A 2DL5A 2LCSA 2J6OA 2SRCA 4LN2A 1UHFA 3VS3A 3PE0A 3H0IA 1M3BA 1SEMA 4D8DA 5IHNA 5I11A 1ZUKA 2AK5A 2NUZA 5GJVB 1NYFA 2GBQA 3QWXX 5L23A 2YUQA 5FWBA 1X2KA 1UTIA 4CC7A 2MCNA 1TG0A 1U06A 1AD5A 1HSQA 2BTTA 1W1FA 2HBWA 2W10A 1Z9QA 1ZUUA 5IXFA 1BK2A 4LNPA 1NM7A 5IH2A 1E7OA 2ED1A 4RTWA 1WA7A 2FO0A 1WXTA 2FG0A 2DE0X 2X3XD 1M8MA 1AWJA 1Z9ZA 4J9CA 2NWMA 5FWCA 1UJ0A 3REAB 2V1RA 2JS0A 1UFFA 5EC7A 4RTTA 2V1QA 2VWFA 3UA7A 2EYWA 1JXMA 2EGEA 1T0JA 1GCPA 1SRMA 2MOXA 2KNBB 4AFSC 1ZSGA 2KYBA 1X27A 2C0TA 1QKWA 1IO6A 1KSWA 2EQIA 3FJ5A 1LCKA 1FYNA 2EYXA 4RTVA 4A63B 2ROLA 4IIMA 4LE9A 2K7AA 4WCIA 1NEGA 2LX7A 2DF6A 4HVVA 1PHTA 2SEMA 1GBQA 3M0TA 1VYVA 2ENMA 3EGUA 2EKHA 1ZLMA 2RN8A 4J9BA 1M27C 2KXCA 2K3BA 4ZNXA 3VS2A 2J06A 2RPNA 2C0OA 1TUCA 4F17A 2DL4A 1GFDA 1YN8A 1MUZA 2JXBA 2MIOA 4OMOA 3NHNA 3LH5A 2O9SA 3M0QA 4JJDA 2D8JA 4J9FA 1ZBJA
chains in the Genus database with same CATH superfamily
3QHSA 5IHIA 4J9EA 3M0UA 1M1KC 2CP5A 3HPWA 1T3SA 3M55A 2ABLA 2LJ1A 1IZ6A 5GAMe 2K5FA 1MMDA 2K79A 4N4IA 1YHQA 1Q7YU 4EMKB 3CCVQ 4FM4B 4BE1A 1BI3A 1M1GA 2VUBA 5GMKi 3SDZA 1VQLT 1CKAA 1WI7A 4F7UF 2OTLQ 2EGAA 4ORZA 2L3SA 3EG9B 1FX7A 4C0GA 2EFIA 4KULA 1UUEA 1U1SA 4J9IA 3CBOA 3OS0A 2LCCA 2QEXQ 1VQ5T 2KEAA 4XTUA 1G2BA 1ZUYA 3UPUA 4PJOE 3C12A 3CC2Q 1WLPB 9ATCB 2GTJA 1UG1A 3BE3A 2M51A 1SPKA 2QAZA 4IUPA 2CP6A 5L8RE 5CQXA 4M75C 4NL2A 3RKWA 2HZYA 2LMJA 1PD0A 3EH1A 1X6BA 5HK0A 3JAME 1YNZA 2E5KA 4OB1B 4N4GA 3M0PA 3LGFA 1AZGB 4XTZA 2ROTA 2RI2A 2HBPA 2RJCA 2KT1A 2QGGA 1W70A 1LJOA 3G71A 4E47A 3PIPA 4C92C 2KSSA 3MO8A 4ZN1A 2HSPA 2RQTA 5D6YA 5GANg 1NLPC 3TU4K 1Q82R 1RABB 4XU2A 1BI2A 3ZFJA 2CKKA 1AZEA 1G3TA 2QXFA 1D0YA 4X34A 5KH6A 3Q1JA 2LCLA 2DVJA 4O6JA 2DKGA 4M75F 3CCVA 1M8VA 1YCYA 4GLMA 1JEGA 2I0NA 2M1HA 3C4SA 3EG2A 5KE3A 1W4SA 4KUDK 1SKUB 1NE8A 5GANj 1PWTA 2DJZA 5D7UA 2E5QA 3PVLA 4C92F 1JO8A 4F7UG 2YUOA 2OJ2A 1M2VB 1YIJQ 2DIGA 4M78C 2DD5A 3AHUA 1N9SA 1WXBA 4Y92A 2J6FA 2PZ1A 3TSZA 1AVZC 4QVCA 2O31A 4RTZA 1Q82C 4J5YA 1OULA 1FMVA 2DERA 2FVUA 4JS5A 2AKLA 2R5AA 1IRXA 4Z02A 2ZPBB 3CCRA 1VQ9Q 1K9MC 2HSEB 1M5Q1 1TTHB 4P5NA 1VQMT 5KE2A 2KRNA 1Q81R 1QVPA 2P0QA 4M78F 2RB6A 2QQBA 1WHGA 3R6NA 2EVRA 5FU6B 2CUBA 2ZPGB 1UGQB 2M9UA 2JZ2A 3L2ZA 3P8HA 1VQ6A 1QKXA 2E6ZA 5GAOm 3NPFA 2EWNA 1NBEB 2DK3A 2DAQA 3CCUQ 4JPBW 4KH0B 3CCMT 4C8QC 2CH4W 1KQSP 1QVFA 3U23A 4PK4A 2D0NA 4WF2A 1QP3A 2KMTA 4M75A 3OS2A 1QCFA 2H8HA 2X4XA 4L59A 2GF7A 3EG1A 1BIBA 4K11A 3FEOA 1KD1R 2FL7A 5IHKA 3JCMV 5KYUA 3JCMJ 3A98A 2EYZA 4FIBA 4M75G 2Y4YA 2O4XB 3SHWA 3OSSC 1JJ2A 1K73C 5GANe 1RAAB 3ME9A 2L2PA 2VB6A 4C92A 1UECA 3PTAA 2DEQA 2RO0A 2D0QB 4L5GA 2KROA 3QSUA 3CC4T 1VQPQ 3QUIA 1R77A 4Z88A 3EFSA 1WFWA 4Z89A 4C8QF 1MHNA 4L6V5 1QVFS 3UDCA 3MEUA 1BI1A 4FYVB 1PC0A 4RG2A 4KGZB 4BI4A 1IGUA 3E1SA 1VQ9A 2RI3A 2YT6A 1UHCA 1E6HA 4BD3A 3QWYA 2LNVA 2RJEA 2DL7A 3E2UA 1K1ZA 4D8KA 2V8KA 2NUPA 1LPLA 3CC7T 4M78A 1NJIU 2RI5A 2OTJQ 4DA4A 1K8AU 2XU8A 4C92D 2JM8A 1X6GA 1VQ5Q 4FYXB 3C95A 4DBRA 2HCKA 1I0CA 2HQXA 1ZA1B 1VQOA 3CD6T 2FYKA 5GAN6 4JJNK 2DX1A 4M78G 4FSXA 1GXIE 1WXUA 2DL8A 3CCUA 3L2VA 3X26B 2CSIA 4BDZA 3UT1A 2XI9A 1M90C 5LJ3g 2VC8A 2L3PA 4N4HA 1I4K1 2I2LA 3FIFA 1UGSB 3HRTA 1B34B 5GAMf 3HKSA 2DA9A 1VQ8Q 2D1XA 4JRPA 2X3WD 2X4WA 2QA4T 2SRCA 2QASA 4LN2A 3VS3A 1SEMA 5I11A 2PUOB 3NTKA 4QQ6A 3QWXX 2YUQA 4E7JA 4J6XA 2DO3A 3CXCA 4M78D 4PJJA 2K5IA 2PVGB 5LJ3j 1VQPA 1HSQA 3BY7A 3OY9A 3FJPA 2ATCB 5IXFA 1OI1A 3JCMb 2FO0A 4HCZA 3QDRB 1OU8A 2DYIA 4RKUE 5FWCA 2MWPA 4FT2A 4C8QG 4EMKC 4R56A 3G4SA 2JS0A 4JRKA 4RTTA 3UA7A 2EYWA 1JXMA 2QTVA 1U8RA 2MOXA 2KNBB 2DXUA 4AFSC 2KYBA 1RI0A 2XDBA 1TXQA 2JUFA 1KSWA 4A63B 4RTVA 4LE9A 1VQKT 1KQ2A 3CXCS 4HVVA 2DF6A 5GAN7 3G6ET 2OTJA 4BACA 5CKFA 1FMWA 3DB4A 3EGUA 4J6WA 1ZLMA 4J9BA 3CMAT 1KHCA 2RPNA 3MP6A 2DXTA 1YN8A 3V7RA 1MUZA 2MIOA 3OYNA 3LGLA 1D1BA 4BB7A 4PLLA 1U1TA 2QTXA 2CZ0B 2D8JA 2XK0A 1OU9A 1QW1A 3LLRA 1SRLA 4F14A 3A5ZB 3L2UA 1LOJA 1V1CA 4PKCC 5GJWB 1YWPA 2ZPHB 4AT1B 1SSFA 4BE0A 5AYFA 4EPCA 1YJ9T 1VQMQ 2HQHA 3CMET 3NTHA 4B9WA 4QT7A 4GY5A 1UDLA 1YWOA 4FL6A 4LDVA 4NS5A 2LJ0A 4M7DE 4A4FA 3I55Q 5CKEA 4C5IA 2F1LA 4OVAA 1SHFA 1E6GA 1I1JA 3VRZA 2KRMA 2IIMA 1C1AA 3HFOA 5CAIA 3H0FA 4A4HA 4DOWA 5LJ3e 1AT1B 3HTRA 3OS1A 2IPOB 1KQ1A 1X6OA 4JUVA 2BKDN 3CQTA 2V26A 3PT9A 4RTUA 3QJ6A 4A4GA 1UGVA 1VQNA 2LQKA 4FYWB 2BE7D 1MGQA 4HVUA 4M77E 1NLOC 2OI3A 2YLCA 5C6SA 4RUGA 2V8IA 4B9XA 1HK9A 1AWWA 2JW4A 3KUFA 2DZCA 2ZPIB 2E3IA 2L8DA 4ZTFA 4FU6A 1WHKA 1P92A 2YUNA 5DM7R 3HP9A 2CH4A 1O9SA 1VYTA 3L2QA 5IXBA 2JM9A 5GAN8 3OYJA 2K6DA 3QZ9B 5GMKj 2DETA 4DEYA 1VQ7T 1Q7YR 4OB0B 4OMNA 2KE9A 2LX9A 5LJ5g 1VIFA 2A36A 3S3MA 4XTXA 4M7AD 1V29B 4M7AB 4EMKA 6AT1B 4E6RA 4ME7A 4LDYA 1ABOA 4IIOA 5A0GA 4J9GA 5I21A 1B3QA 3EG9A 3QYHB 1S72T 2A08A 4AFQC 4J8OA 5CO7A 2LC4A 1WJSA 4JS4A 3F70A 5A2QE 2ZPFB 2PU9B 2RHIA 3CCEQ 3R6OA 3NFCA 5LJ5j 3I55A 4ELYC 3PVQA 5FU6C 5GAN5 4E7ZA 4HCKA 5GANf 1RL2A 2RM4A 3I9QA 3OMGA 5CK9A 4DOVA 2J7IA 2YRCA 2HEQA 1JQQA 1WJRA 4M77B 3I56T 3M5AA 1K0XA 1ACMB 3IQLA 2K9GA 1WDXA 2P84A 1K4US 1QVGP 3WVDB 3LYIA 2E1HA 2QYZA 4OMLA 1XTDA 3DKMA 2KYMA 2CREA 3FRNA 2HQEA 2DD4A 2JTEA 2DM1A 2X9HA 4IUVA 3A1PA 4ELZC 3BDUA 5FRNA 2KK4A 2ZCFB 4ZGDB 2MYSA 4DEXA 1AWOA 3V7SA 2CP3A 1KC8U 2YRVA 3OBWA 2GGRA 4AMCA 2YUPA 3LW5E 1M1KU 1HJDA 5I2MA 3BW1A 3JCMP 2KVQG 5CKHA 4DBHA 1RAEB 2KAFA 5GMKe 3LH0A 2NYSA 3O5ZA 1YITT 3EFRA 2LQ8A 1H641 2CUDA 1RAHB 4OMPA 3JCMc 3I5RA 2M16A 3CCLQ 3HSBA 4RMOA 2KRSA 1WHJA 3SEMA 3INZA 3M54A 4GBQA 1RAIB 2DBMA 3CCJA 2JTFA 1ZBXA 1Y96A 5GAOl 3CCQA 2FRYA 1KIKA 4RTYA 3G7ZA 3MEAA 3TREA 1D09B 2QQ9A 2H3JA 4BY6B 4D6WA 1OZ3A 2EJGA 2LQNA 1M2VA 2VASA 4EMGA 3SWNA 3CCEA 1YI2T 3HL8A 1VQKQ 2L5QA 2GNCA 5LJ5e 1BI0A 2RK1A 2RHUA 2AHJB 2LVMA 1PCXA 2FEIA 3ASKA 1RAFB 1VQ4T 2LTOA 2VGMA 4AG2C 5FU7B 1IHVA 3VYGA 2COZA 3CMAQ 2EIFA 4XU3A 4JJCA 1VA7A 2L0AA 2A7YA 1W2BP 3QZ5B 4F7UE 1YJNT 2YDLA 4CC2A 2DNUA 5I22A 3M58A 2RJDA 3JV3A 1M3AA 3H9NA 3L2WA 4HA8A 2QDLA 1Y96B 2OTLA 1RUWA 4Q5WA 2JOYA 2K5LA 4ZGJB 3QIIA 1QWEA 3MEWA 1OX9A 2MPXC 1YJ9Q 2O88A 2R58A 4PJOD 1WGSA 1AWXA 3VRYA 4PJOB 2COYA 2DRKA 2QEXA 3SWNB 2CS7A 3OSVA 2R57A 2CYZB 1OEBA 1H92A 1OPKA 3CC2A 3V8JA 2EYYA 3CCLA 3META 5GAMh 1U3OA 1M30A 2XMFA 1PSEA 1IB8A 2WSCE 1X2QA 3EH2A 1BBZA 1JJ2P 1NG2A 3EGXA 3GNFB 1TWBA 2A0FB 2O4XA 3JB9D 2AKKA 1D1AA 2F5TX 1WPYA 5CR2A 2JT4A 4A53A 3LWHA 1PSFA 2EQUA 3H41A 1Q82U 2CSQA 2PQWA 2RHYA 2DL5A 2LCSA 5GAMd 4JDSA 5KYYA 4HCBA 4IUUA 3PE0A 2MI6A 2QGFB 1M3BA 2IG0A 4D8DA 5IHNA 1K9MU 3CCST 3UWNA 5GJVB 1YJWT 1VQ7Q 4XK8E 4M75E 2DXBA 5FWBA 3M9QA 3JCMg 1X2KA 5LJ3f 4GLKA 1TG0A 1AHJB 2BTTA 1W1FA 4JLGA 1TUGB 1I5OB 1NJIR 3QKJA 2HNIA 4RTWA 1K8AR 1WXTA 3EGXB 3OW2P 1Z9ZA 4J9CA 1YHQT 2NWMA 2V1RA 3OB9A 1Q81C 2NUTB 1YIJA 3OYHA 1V76A 1GCPA 1SRMA 2RHZA 2RHXA 1ZSGA 1N8RR 1X27A 1QKWA 2DTOA 1IO6A 5KYYB 3FJ5A 1JBMA 1FYNA 4C92G 5D6WA 2ROLA 4HKEA 4OF1A 4WCIA 1NEGA 1I5LA 2LX7A 4BI3A 1Y71A 2JN0A 3I56Q 1JRIA 2HL5C 1GBQA 3E9GA 3E19A 2ENMA 1B34A 1IHWA 2EKHA 2RN8A 1K73U 5CVIA 1SF9A 4ZNXA 2K3BA 5LL6S 2J06A 1BCMA 2PVOB 3V8LA 4M78E 1KD1C 1VQLQ 2E10A 3OYYA 5HY6A 4J9FA 4J9HA 1RADB 2ZPEB 1MMNA 4CRIA 2KGTA 5DY9A 5GAOn 4A54A 1OPLA 4J83A 1QCOA 3HHTB 4C5HA 1BU1A 1N8RC 1YITQ 1FMKA 1ZX6A 4M7AC 3G71T 4ATOA 4OMFB 2E12A 4NOYA 2MF2A 3VS0A 3ULRB 3L1AA 3MHXA 3N5BB 1BIAA 2PTKA 4LDUA 5HKCA 3MP8A 1WJQA 4OMQA 3J7AF 2EQMA 4HVWA 1G3WA 1RLQC 3OYLA 1H8KA 3J81E 2CGHA 3CCVT 2HMAA 2DILA 1LNXA 1XQHA 1KQSS 5GAOq 4E7SA 4C8QE 1YI2Q 2VXEA 4E7HA 2QG9B 1M90U 3RMQA 3GIBA 1UB4A 3NGPA 1OV3A 3JCMe 5D6XA 2IVWA 2GFUA 1HYOA 2FRWA 1KJWA 3X25B 2W0ZA 1VQ4Q 3DLLA 1D3BA 4M77C 1G8XA 1PG5B 1X69A 5KYNA 4IKFA 3VS7A 4M7AF 4XTVA 1QCNA 3VS1A 3LX7A 1XOVA 7AT1B 1G83A 2E41A 2JMCA 1YBYA 2A3LA 5KCOA 2MWOA 4KUIA 4LD6A 1YJNQ 5FRMA 4FT4A 5GMKm 2RQWA 2BE9B 1QQJA 1NPPA 4MZMA 4DBFA 1VQLA 1XNIA 2X35A 4RCCA 1EIFA 1A0NB 3P8DA 3CPWP 2EKOA 3CCRT 3RIRA 1M2OA 2RQVA 2FPDA 2DTHA 5GANh 1XJWB 3PMIA 2M0YA 4ANJA 2G6FX 5KYWB 2COWA 4N0AC 4PFPA 1WZOA 3HRSA 4F16A 4XU1A 1BKBA 1VQ5A 2LT4A 4X9CA 4M77F 5FW9A 4VUBA 3MPUB 1X43A 2K3YA 1GCQC 2RQUA 1NYGA 3SD4A 5LJ5f 4BUGA 2AZSA 2DBKA 1D3BB 1MV0B 1AOJA 1R0CB 3BFMA 1JU5C 3RNJA 3S3OA 5KCHA 1VQ6T 4O5VA 5A0LA 5GANd 1VQ8A 4DQ2A 2RA2A 2YSQA 2NLUA 4BY6C 2A37A 1OQKA 2EQKA 1Q86R 2E65A 1RAGB 3X20B 3UF4A 2VGNA 1LVKA 1PRMC 2JNGA 2LZ6B 5CIUA 3TSWA 3X28B 3RKYA 4C5EA 3THKA 2RQRA 2JVVA 5FU7C 4M7AA 3M57A 3GNGA 3GBQA 3GP8A 3JB9I 3CCMQ 3FB9A 3CBMA 4IURA 1Q95G 2E64A 2DPPB 2B8AA 2ZZDA 1GBRA 2HD0A 2DIQA 4M7AG 1WHLA 2PVDB 4OB2B 2CDTA 4LD9K 3OYDA 4KGXB 1QWFA 5ECAA 2XD0A 2VKNA 3KFVA 1N5ZA 3HRUA 4XTWA 1GFCA 4MMKA 3C0CA 1VQ9T 1UEBA 1YHQQ 4PJOC 2E4HA 3M56A 3DB3A 3RUXA 3M53A 4PJNA 2A28A 3SWNC 3RBBB 1QP2A 1BB9A 3UA6A 3CC4Q 4M77A 4C0DB 1SG5A 3I35A 3QO3A 2F2XA 3EFOB 3GF5A 2YLBA 2BUDA 1TOVA 3NMZC 4QW2A 2EGCA 5GAOp 4HXJA 2F2WA 3PFSA 1WQWA 1KC8R 4JRIA 1VQOT 2F5KA 5CQYA 4HCCA 4C5GA 2QQAA 3EAEA 1M1KR 4XTYA 3CCUT 1T3LA 3H6ZA 2P4RA 4M7DD 4M7DB 2QQSA 1M1FA 2EBPA 1GRIA 2KT8A 4PJOF 1N9RA 2O9VA 1VQMA 2ZAEA 1HD3A 3CEYA 1N6AA 2C0IA 4OMMA 4AG1C 2X51A 1W6XA 1KG1A 1ZA2B 4N0AA 1TU0B 1VUBA 3LWIA 3CC7Q 2DRMA 2P4TA 1KFZA 1QMCA 1GCQA 4ZTJA 8ATCB 3CD6Q 1YP5A 2B86A 2EQJA 4LUDA 4M77D 5J3BA 3OYEA 4MDWA 1Q7YC 2DYBA 2RNAA 3MJXA 4LDWA 4KRTA 3CCMA 1QLYA 3ZL7C 3TVTA 1IREB 1VQPT 3G71Q 2CZ1B 5IN1A 4AFZC 1MNDA 1ZHIA 1RLPC 4X9DA 3TQ7P 2QK0A 1NEBA 3JB9F 1OOTA 4WTOB 3JCMQ 4FSSA 5GAOr 2QA4Q 4E7LA 2KR3A 1ABQA 1BYMA 3VYHB 3ZBDA 4QVDA 1G3YA 1ZSZC 3OYBA 2HAXA 3G4ST 2LRQA 1KHIA 3L2RA 3EGDA 3T9NA 3EHRA 3CC4A 5LJ3h 2XDPA 2PNIA 1WIEA 1T0HA 1K9AA 5M9OA 1PKTA 5CCAA 4CC3A 2WACA 1EX4A 2OTJT 1R0BG 2K3XA 2AT1B 3H0IA 3URGA 1ZUKA 2NUZA 1NYFA 4A4KA 2BIVA 5CKDA 2VXFA 3VU3C 2HKNA 5L23A 2L89A 3OYIA 3PNWC 1UGPB 1U06A 1AD5A 4PJOA 2HBWA 2W10A 5LJ3d 1Z9QA 3QJYA 3CCRQ 1ZUUA 1C0MA 2FZKB 1G3SA 1VQ8T 2V8JA 3MCAB 3CC7A 1WA7A 3G6EQ 2X3XD 2DE0X 4PJOG 4PFOA 4LDXA 1QVGA 3EGDB 2EAYA 5CKBA 1AWJA 1YFNA 3CD6A 2YHTA 2O01E 4KH1B 3JCMf 1UFFA 1VOMA 2MAMA 4FYYB 1I81A 2GCXA 2M02A 2EGEA 3DLMA 1D0XA 2AIRB 2YRDA 2EQIA 1LCKA 5AT1B 1VQ6Q 4RCBA 4IIMA 2K7AA 3BDLA 4XAXB 3RKXA 2VYTA 2QA4A 4OP0A 4KGVB 2SEMA 1VQNT 3SB2A 2EYQA 1VYVA 3M4YA 1K9MR 3CMEQ 3JRZA 1M27C 1B7TA 3JB9G 2KXCA 3VS2A 2C0OA 1QVGS 1TUCA 1D1CA 2DL4A 2WSEE 1GFDA 2G3RA 1QVFP 4OMOA 3NHNA 4F7UA 1OX8A 3G1JA 1C6VX 2DVEA 1ZBJA 1I07A 4EMHA 1TUDA 4E7IA 4ESRA 1GL5A 1SSHA 4FCYA 4RTXA 1K76A 1Y57A 2DXCA 1F1BB 4MDXA 4CC4B 2LNHB 2RD1A 2CP2A 2JMAA 4MZTA 2RMOA 2L3QA 1B07A 2Y4XA 1K0SA 2GQIA 1X01A 1ZSZA 3OYAA 3PMTA 2X4YA 2NUTA 4C0ZA 2DL3A 3VUBA 3OYCA 1VQKA 1MMAA 3VS4A 1M3CA 3OYGA 3A8MB 4QQGA 2K4YA 3M4GA 1HXDA 3G6EA 5GMKh 5KYXA 2RF0A 1W2BA 3SFMA 1O75A 3M0SA 3FLGA 3OMCA 4IUQA 2HDAA 1K73R 3GOXA 4F7UB 1SHGA 1YCSB 3CMAA 3I55T 4JJBA 2ESWA 2FZGB 3OA6A 3S3NA 1VQOQ 1PKSA 2XDDA 2F2VA 4JRQA 4C92E 1S72Q 4F04B 3OYFA 2KQWA 3OYMA 2EJFA 1YJ9A 4PLIA 4QKUA 3CMEA 3TCJA 2K2VA 1ZSZB 1PM3A 1NPRA 5FLXE 3QDFA 2GTOA 5LJ5h 5GMKl 3VJPA 5I2SA 3JB9J 2DFUA 1W2BS 5EG2A 1IXDA 1RACB 1PD1A 2LT1A 2ZGWA 3GPLA 5KYXB 3S6WA 1FXXA 1EZZB 3I5SA 4XU0A 1NZ9A 2FPEA 3ER0A 2KXDA 2KY9A 3MKDA 1EFNA 3QPHA 1Q81U 4ZGEB 2QQRA 1MNEA 3OQ5A 4Z8AA 2JTMA 2X4JA 3CXCP 1M90R 1CKBA 3QXEB 4QVZA 5LJ5d 1NJIC 1VIEA 4RG8A 1K8AC 4OGCA 1H3HA 3V7CA 4UC4A 1OYXA 2XICA 3CCJT 4OB3B 2DZ9A 1M4ZA 2QI2A 3QG1A 2ED0A 1PNJA 3CCQT 3G4SQ 3JB9H 4OGEA 2R5MA 4M75D 3MEVA 4ZN3A 4M75B 1KQSA 2H3EB 5J26A 5C0MA 1ZQ1A 1WX6A 4C0DC 4R0KA 4Y28E 5KYUB 1JJ2S 1VQ7A 2FB7A 4AFUC 2DLPA 5HCKA 3VKIA 4NL3A 3CCET 2P0PA 4PFZA 4J6YA 2CT3A 1KD1U 2RJFA 2ECZA 2KI7A 4A4EA 4BDYA 1ARKA 1WYXA 3KBGA 3OW2A 4C92B 2XKOC 3FC3A 3ZEHA 1J3TA 3PGGA 4X1VA 4BI8B 2DEUA 5A0DA 4M7DC 1N27A 1S72A 2EPDA 5J39A 2OAWA 2J05A 5DLOA 4JZ3A 4PJMA 4DBQA 2EW3A 3AT1B 2XG8D 1N8RU 5KYWA 1Y0MA 3QYGB 2YWWA 2EJ9A 2JS2A 2AZVA 1CSKA 1UGRB 1I8FA 2OTLT 2JJ9A 5GAN4 2DJQA 4QQDA 1MMGA 3L42A 3M59A 2J6KA 3CPFA 3EHQA 2E70A 3WVEB 5GAN3 2HKQB 3JCMX 3I56A 2PUKB 2HL3A 2OAUA 2QEXT 1WHMA 3OW2S 2NUPB 4EDUA 1JXOA 3D7SB 1AEYA 4M78B 2FHDA 2XIDA 5DLQE 4M7DF 3CC2T 1UJYA 4C8QA 3CCLT 4E7KA 2M0OA 2MMPA 1WNLA 1VQNQ 3VS6A 1S1NA 2KBTA 3JSCA 2D9TA 4IUTA 3X24B 2O2OA 3H8ZA 2WSFE 2CP7A 4PJLA 1VYUA 4PNOA 5FROA 3JCMW 2RH2A 1RI9A 2FPFA 2L3RA 2BZXA 3UATA 1PRLC 1YITA 2RK2A 4BE2A 4EIKA 4JZ4A 3M0RA 4YTLA 3QBYA 2E6NA 2LJ3A 2VVKA 4M4ZA 2LP5A 3EG3A 4C8QD 4C8QB 3HFNA 2KDSA 2DMOA 4J7FA 1IGQA 4MZPA 4CI0C 1KK7A 1R8OB 3EG0A 4KBMB 1YI2A 4JLIA 4KT0E 4LXCA 5GAMg 4M7AE 3RESA 2CT4A 2BZ8A 3MP1A 3EFOA 2D8HA 2D6FA 2Y90A 2K2MA 2MK5A 3O8VA 4C0FA 1VQ4A 1U5SA 1JB0E 1UE9A 2YXYA 3VS5A 3E9FA 3CCSQ 1YJWQ 1MV3A 3PIOA 5GAN2 2BZYA 1YIJT 4J9DA 2QDYB 1X75C 2GQVA 1WQ7A 3J80E 2GFAA 3H0HA 8AT1B 3CPWA 4LUEA 3VUZA 1YJNA 3A8LB 4M7DA 3REBB 4B6MA 4II1A 4J7IA 2LQWA 3RR6A 5GAMj 2J6OA 5IT9E 1UHFA 4M7DG 2AK5A 4HT8A 2GBQA 1Q86C 1FWZA 3RMSA 2CZ6B 4PL6A 3TEEA 3OYKA 3JCMh 2Z0WA 1UTIA 4CC7A 2MCNA 2CZ7B 2XHCA 3V8KA 2C06A 1TSFA 4MMLA 1BK2A 4LNPA 1NM7A 5IH2A 1E7OA 1TS9A 2ED1A 3FDRA 2F69A 4M77G 4HT9A 2FG0A 3CPWS 1M8MA 4XQ3A 1WHHA 1UJ0A 2P0KA 3GLXA 3OBYA 3REAB 1Q86U 1OZ2A 5EC7A 2V1QA 2VWFA 1G5VA 3JCMd 1T0JA 3C94A 3NTIA 2OX7A 2C0TA 3P8BB 2EYXA 3CBPA 3CCJQ 3RERA 1Y7XA 1DJ7B 1Y07A 3CCQQ 1TH7A 3A8GB 1PHTA 4FW2A 1M9SA 3M0TA 4V2SA 4Y91A 1BCOA 2DTIA 4FW1A 3CCSA 1YJWA 3WXMB 2LDMA 2VV5A 2CP0A 4E2FB 4F17A 3A8HB 4TVRA 2FZCB 1H3ZA 3KXTA 2JXBA 5HK3A 3VV0A 5IAYA 3LH5A 2O9SA 2E3HA 3A8OB 3RDVA 3OS5A 4R55A 1D0ZA 3M0QA 4JJDA 1KC8C 2K57A
chains in the Genus database with same CATH topology
1I07A 4J9HA 5IHIA 1SRLA 4F14A 4J9EA 3M0UA 1TUDA 1T3SA 4ESRA 1V1CA 2ABLA 1SSHA 2LJ1A 1GL5A 5GJWB 1YWPA 4RTXA 2KGTA 1K76A 1Y57A 1OPLA 2K79A 4CC4B 2LNHB 1BU1A 2JMAA 4QT7A 1UDLA 1YWOA 2LJ0A 2RMOA 1FMKA 2L3QA 1B07A 1ZX6A 1K0SA 2GQIA 1CKAA 1WI7A 1SHFA 1I1JA 1E6GA 2EGAA 4ORZA 3VRZA 2KRMA 2IIMA 2L3SA 3VS0A 3H0FA 3ULRB 2DL3A 2PTKA 1UUEA 3VS4A 1M3CA 4J9IA 3CQTA 4RTUA 1UGVA 4OMQA 2RF0A 4HVWA 3M0SA 2KEAA 1RLQC 4HVUA 1G2BA 1ZUYA 1H8KA 2HDAA 1NLOC 2OI3A 1SHGA 1YCSB 4RUGA 2DILA 1AWWA 2JW4A 1WLPB 2GTJA 4JJBA 3NGPA 1UG1A 1OV3A 2ESWA 2M51A 1SPKA 2FRWA 1KJWA 2W0ZA 2YUNA 1X69A 3VS7A 1PKSA 2CH4A 3VS1A 2F2VA 1VYTA 5IXBA 2JM9A 1XOVA 2K6DA 2LMJA 1G83A 1X6BA 2JMCA 4DEYA 1YNZA 2E5KA 3M0PA 4OMNA 2KE9A 1AZGB 2RQWA 2ROTA 2GTOA 2KT1A 1W70A 2A36A 1A0NB 4E6RA 2RQVA 2HSPA 2RQTA 2FPDA 1NLPC 1ABOA 4IIOA 2M0YA 4J9GA 2G6FX 1B3QA 3I5SA 2A08A 4AFQC 4F16A 2FPEA 2KXDA 1AZEA 1EFNA 5FW9A 2DVJA 1X43A 2RQUA 1GCQC 1NYGA 4Z8AA 4GLMA 1JEGA 2AZSA 2DBKA 3PVQA 1CKBA 1MV0B 1AOJA 2I0NA 4HCKA 3EG2A 1H3HA 1JU5C 3RNJA 3I9QA 1PWTA 2J7IA 2HEQA 2ED0A 1JQQA 1PNJA 3PVLA 1K0XA 2YSQA 2K9GA 3IQLA 1JO8A 1WDXA 2YUOA 2OJ2A 1K4US 1WX6A 4OMLA 2A37A 2KYMA 4R0KA 1WXBA 2CREA 4Y92A 2J6FA 2PZ1A 3TSZA 1AVZC 2O31A 2JTEA 2DM1A 4AFUC 2DLPA 3UF4A 5HCKA 4RTZA 2CT3A 1PRMC 2ECZA 1AWOA 2AKLA 4DEXA 1ARKA 1WYXA 2LZ6B 3TSWA 3THKA 2RQRA 2GGRA 1J3TA 2YUPA 4X1VA 1HJDA 3GBQA 2EPDA 2OAWA 2J05A 4JZ3A 2EW3A 2KRNA 1GBRA 1Y0MA 3O5ZA 2CUDA 2JS2A 2AZVA 2CDTA 4OMPA 1CSKA 3I5RA 2KRSA 5ECAA 1QWFA 2EVRA 3R6NA 2DJQA 2CUBA 2VKNA 3SEMA 3KFVA 1N5ZA 4GBQA 1GFCA 2J6KA 3C0CA 3EHQA 1QKXA 2DBMA 3NPFA 4JPBW 2FRYA 1KIKA 4RTYA 2A28A 3RBBB 2CH4W 3UA6A 1BB9A 1JXOA 3U23A 1AEYA 3I35A 2D0NA 2LQNA 1QCFA 2H8HA 2F2XA 3EG1A 4K11A 1UJYA 2GNCA 5IHKA 3A98A 3NMZC 2EGCA 4HXJA 2F2WA 2EYZA 2FEIA 3VS6A 1S1NA 2KBTA 3SHWA 2O2OA 4AG2C 1T3LA 2L2PA 2P4RA 1VYUA 4JJCA 1VA7A 1UECA 2EBPA 2KROA 2L0AA 1GRIA 2KT8A 1RI9A 2FPFA 2O9VA 1HD3A 2BZXA 2C0IA 4OMMA 3UATA 1PRLC 4Z88A 1WFWA 2YDLA 4AG1C 4CC2A 2DNUA 1W6XA 5I22A 4Z89A 3JV3A 1M3AA 2DRMA 2QDLA 4EIKA 4JZ4A 1RUWA 3M0RA 1KFZA 1GCQA 1QWEA 2O88A 1YP5A 2B86A 4LUDA 1AWXA 2LJ3A 2VVKA 4M4ZA 3VRYA 2DYBA 2RNAA 2YT6A 2LP5A 1UHCA 3EG3A 2DRKA 4KRTA 1E6HA 1QLYA 3ZL7C 3TVTA 3QWYA 2DMOA 2DL7A 4AFZC 1OEBA 1RLPC 1K1ZA 4D8KA 1H92A 1OPKA 3EG0A 1NEBA 2EYYA 1OOTA 4FSSA 1U3OA 1M30A 2CT4A 2KR3A 2JM8A 2XMFA 1ABQA 1X6GA 2BZ8A 2D8HA 2K2MA 2HCKA 1I0CA 1U5SA 3VS5A 1UE9A 1X2QA 1BBZA 2DX1A 1MV3A 1WXUA 2DL8A 1NG2A 2BZYA 4J9DA 2CSIA 3EHRA 2AKKA 2PNIA 2L3PA 3H0HA 4LUEA 2JT4A 1WIEA 1T0HA 1K9AA 3REBB 3H41A 2CSQA 2LQWA 2DA9A 2D1XA 1PKTA 2X3WD 4CC3A 2DL5A 2LCSA 2J6OA 2SRCA 4LN2A 1UHFA 3VS3A 3PE0A 3H0IA 1M3BA 1SEMA 4D8DA 5IHNA 5I11A 1ZUKA 2AK5A 2NUZA 5GJVB 1NYFA 2GBQA 3QWXX 5L23A 2YUQA 5FWBA 1X2KA 1UTIA 4CC7A 2MCNA 1TG0A 1U06A 1AD5A 1HSQA 2BTTA 1W1FA 2HBWA 2W10A 1Z9QA 1ZUUA 5IXFA 1BK2A 4LNPA 1NM7A 5IH2A 1E7OA 2ED1A 4RTWA 1WA7A 2FO0A 1WXTA 2FG0A 2DE0X 2X3XD 1M8MA 1AWJA 1Z9ZA 4J9CA 2NWMA 5FWCA 1UJ0A 3REAB 2V1RA 2JS0A 1UFFA 5EC7A 4RTTA 2V1QA 2VWFA 3UA7A 2EYWA 1JXMA 2EGEA 1T0JA 1GCPA 1SRMA 2MOXA 2KNBB 4AFSC 1ZSGA 2KYBA 1X27A 2C0TA 1QKWA 1IO6A 1KSWA 2EQIA 3FJ5A 1LCKA 1FYNA 2EYXA 4RTVA 4A63B 2ROLA 4IIMA 4LE9A 2K7AA 4WCIA 1NEGA 2LX7A 2DF6A 4HVVA 1PHTA 2SEMA 1GBQA 3M0TA 1VYVA 2ENMA 3EGUA 2EKHA 1ZLMA 2RN8A 4J9BA 1M27C 2KXCA 2K3BA 4ZNXA 3VS2A 2J06A 2RPNA 2C0OA 1TUCA 4F17A 2DL4A 1GFDA 1YN8A 1MUZA 2JXBA 2MIOA 4OMOA 3NHNA 3LH5A 2O9SA 3M0QA 4JJDA 2D8JA 4J9FA 1ZBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I07 A;  4J9H A;  5IHI A;  1SRL A;  4F14 A;  4J9E A;  3M0U A;  1TUD A;  1T3S A;  4ESR A;  1V1C A;  2ABL A;  1SSH A;  2LJ1 A;  1GL5 A;  5GJW B;  1YWP A;  4RTX A;  2KGT A;  1K76 A;  1Y57 A;  1OPL A;  2K79 A;  4CC4 B;  2LNH B;  1BU1 A;  2JMA A;  4QT7 A;  1UDL A;  1YWO A;  2LJ0 A;  2RMO A;  1FMK A;  2L3Q A;  1B07 A;  1ZX6 A;  1K0S A;  2GQI A;  1CKA A;  1WI7 A;  1SHF A;  1I1J A;  1E6G A;  2EGA A;  4ORZ A;  3VRZ A;  2KRM A;  2IIM A;  2L3S A;  3VS0 A;  3H0F A;  3ULR B;  2DL3 A;  2PTK A;  1UUE A;  3VS4 A;  1M3C A;  4J9I A;  3CQT A;  4RTU A;  1UGV A;  4OMQ A;  2RF0 A;  4HVW A;  3M0S A;  2KEA A;  1RLQ C;  4HVU A;  1G2B A;  1ZUY A;  1H8K A;  2HDA A;  1NLO C;  2OI3 A;  1SHG A;  1YCS B;  4RUG A;  2DIL A;  1AWW A;  2JW4 A;  1WLP B;  2GTJ A;  4JJB A;  3NGP A;  1UG1 A;  1OV3 A;  2ESW A;  2M51 A;  1SPK A;  2FRW A;  1KJW A;  2W0Z A;  2YUN A;  1X69 A;  3VS7 A;  1PKS A;  2CH4 A;  3VS1 A;  2F2V A;  1VYT A;  5IXB A;  2JM9 A;  1XOV A;  2K6D A;  2LMJ A;  1G83 A;  1X6B A;  2JMC A;  4DEY A;  1YNZ A;  2E5K A;  3M0P A;  4OMN A;  2KE9 A;  1AZG B;  2RQW A;  2ROT A;  2GTO A;  2KT1 A;  1W70 A;  2A36 A;  1A0N B;  4E6R A;  2RQV A;  2HSP A;  2RQT A;  2FPD A;  1NLP C;  1ABO A;  4IIO A;  2M0Y A;  4J9G A;  2G6F X;  1B3Q A;  3I5S A;  2A08 A;  4AFQ C;  4F16 A;  2FPE A;  2KXD A;  1AZE A;  1EFN A;  5FW9 A;  2DVJ A;  1X43 A;  2RQU A;  1GCQ C;  1NYG A;  4Z8A A;  4GLM A;  1JEG A;  2AZS A;  2DBK A;  3PVQ A;  1CKB A;  1MV0 B;  1AOJ A;  2I0N A;  4HCK A;  3EG2 A;  1H3H A;  1JU5 C;  3RNJ A;  3I9Q A;  1PWT A;  2J7I A;  2HEQ A;  2ED0 A;  1JQQ A;  1PNJ A;  3PVL A;  1K0X A;  2YSQ A;  2K9G A;  3IQL A;  1JO8 A;  1WDX A;  2YUO A;  2OJ2 A;  1K4U S;  1WX6 A;  4OML A;  2A37 A;  2KYM A;  4R0K A;  1WXB A;  2CRE A;  4Y92 A;  2J6F A;  2PZ1 A;  3TSZ A;  1AVZ C;  2O31 A;  2JTE A;  2DM1 A;  4AFU C;  2DLP A;  3UF4 A;  5HCK A;  4RTZ A;  2CT3 A;  1PRM C;  2ECZ A;  1AWO A;  2AKL A;  4DEX A;  1ARK A;  1WYX A;  2LZ6 B;  3TSW A;  3THK A;  2RQR A;  2GGR A;  1J3T A;  2YUP A;  4X1V A;  1HJD A;  3GBQ A;  2EPD A;  2OAW A;  2J05 A;  4JZ3 A;  2EW3 A;  2KRN A;  1GBR A;  1Y0M A;  3O5Z A;  2CUD A;  2JS2 A;  2AZV A;  2CDT A;  4OMP A;  1CSK A;  3I5R A;  2KRS A;  5ECA A;  1QWF A;  2EVR A;  3R6N A;  2DJQ A;  2CUB A;  2VKN A;  3SEM A;  3KFV A;  1N5Z A;  4GBQ A;  1GFC A;  2J6K A;  3C0C A;  3EHQ A;  1QKX A;  2DBM A;  3NPF A;  4JPB W;  2FRY A;  1KIK A;  4RTY A;  2A28 A;  3RBB B;  2CH4 W;  3UA6 A;  1BB9 A;  1JXO A;  3U23 A;  1AEY A;  3I35 A;  2D0N A;  2LQN A;  1QCF A;  2H8H A;  2F2X A;  3EG1 A;  4K11 A;  1UJY A;  2GNC A;  5IHK A;  3A98 A;  3NMZ C;  2EGC A;  4HXJ A;  2F2W A;  2EYZ A;  2FEI A;  3VS6 A;  1S1N A;  2KBT A;  3SHW A;  2O2O A;  4AG2 C;  1T3L A;  2L2P A;  2P4R A;  1VYU A;  4JJC A;  1VA7 A;  1UEC A;  2EBP A;  2KRO A;  2L0A A;  1GRI A;  2KT8 A;  1RI9 A;  2FPF A;  2O9V A;  1HD3 A;  2BZX A;  2C0I A;  4OMM A;  3UAT A;  1PRL C;  4Z88 A;  1WFW A;  2YDL A;  4AG1 C;  4CC2 A;  2DNU A;  1W6X A;  5I22 A;  4Z89 A;  3JV3 A;  1M3A A;  2DRM A;  2QDL A;  4EIK A;  4JZ4 A;  1RUW A;  3M0R A;  1KFZ A;  1GCQ A;  1QWE A;  2O88 A;  1YP5 A;  2B86 A;  4LUD A;  1AWX A;  2LJ3 A;  2VVK A;  4M4Z A;  3VRY A;  2DYB A;  2RNA A;  2YT6 A;  2LP5 A;  1UHC A;  3EG3 A;  2DRK A;  4KRT A;  1E6H A;  1QLY A;  3ZL7 C;  3TVT A;  3QWY A;  2DMO A;  2DL7 A;  4AFZ C;  1OEB A;  1RLP C;  1K1Z A;  4D8K A;  1H92 A;  1OPK A;  3EG0 A;  1NEB A;  2EYY A;  1OOT A;  4FSS A;  1U3O A;  1M30 A;  2CT4 A;  2KR3 A;  2JM8 A;  2XMF A;  1ABQ A;  1X6G A;  2BZ8 A;  2D8H A;  2K2M A;  2HCK A;  1I0C A;  1U5S A;  3VS5 A;  1UE9 A;  1X2Q A;  1BBZ A;  2DX1 A;  1MV3 A;  1WXU A;  2DL8 A;  1NG2 A;  2BZY A;  4J9D A;  2CSI A;  3EHR A;  2AKK A;  2PNI A;  2L3P A;  3H0H A;  4LUE A;  2JT4 A;  1WIE A;  1T0H A;  1K9A A;  3REB B;  3H41 A;  2CSQ A;  2LQW A;  2DA9 A;  2D1X A;  1PKT A;  2X3W D;  4CC3 A;  2DL5 A;  2LCS A;  2J6O A;  2SRC A;  4LN2 A;  1UHF A;  3VS3 A;  3PE0 A;  3H0I A;  1M3B A;  1SEM A;  4D8D A;  5IHN A;  5I11 A;  1ZUK A;  2AK5 A;  2NUZ A;  5GJV B;  1NYF A;  2GBQ A;  3QWX X;  5L23 A;  2YUQ A;  5FWB A;  1X2K A;  1UTI A;  4CC7 A;  2MCN A;  1TG0 A;  1U06 A;  1AD5 A;  1HSQ A;  2BTT A;  1W1F A;  2HBW A;  2W10 A;  1Z9Q A;  1ZUU A;  5IXF A;  1BK2 A;  4LNP A;  1NM7 A;  5IH2 A;  1E7O A;  2ED1 A;  4RTW A;  1WA7 A;  2FO0 A;  1WXT A;  2FG0 A;  2DE0 X;  2X3X D;  1M8M A;  1AWJ A;  1Z9Z A;  4J9C A;  2NWM A;  5FWC A;  1UJ0 A;  3REA B;  2V1R A;  2JS0 A;  1UFF A;  5EC7 A;  4RTT A;  2V1Q A;  2VWF A;  3UA7 A;  2EYW A;  1JXM A;  2EGE A;  1T0J A;  1GCP A;  1SRM A;  2MOX A;  2KNB B;  4AFS C;  1ZSG A;  2KYB A;  1X27 A;  2C0T A;  1QKW A;  1IO6 A;  1KSW A;  2EQI A;  3FJ5 A;  1LCK A;  1FYN A;  2EYX A;  4RTV A;  4A63 B;  2ROL A;  4IIM A;  4LE9 A;  2K7A A;  4WCI A;  1NEG A;  2LX7 A;  2DF6 A;  4HVV A;  1PHT A;  2SEM A;  1GBQ A;  3M0T A;  1VYV A;  2ENM A;  3EGU A;  2EKH A;  1ZLM A;  2RN8 A;  4J9B A;  1M27 C;  2KXC A;  2K3B A;  4ZNX A;  3VS2 A;  2J06 A;  2RPN A;  2C0O A;  1TUC A;  4F17 A;  2DL4 A;  1GFD A;  1YN8 A;  1MUZ A;  2JXB A;  2MIO A;  4OMO A;  3NHN A;  3LH5 A;  2O9S A;  3M0Q A;  4JJD A;  2D8J A;  4J9F A;  1ZBJ A; 
#chains in the Genus database with same CATH topology
 3QHS A;  5IHI A;  4J9E A;  3M0U A;  1M1K C;  2CP5 A;  3HPW A;  1T3S A;  3M55 A;  2ABL A;  2LJ1 A;  1IZ6 A;  5GAM e;  2K5F A;  1MMD A;  2K79 A;  4N4I A;  1YHQ A;  1Q7Y U;  4EMK B;  3CCV Q;  4FM4 B;  4BE1 A;  1BI3 A;  1M1G A;  2VUB A;  5GMK i;  3SDZ A;  1VQL T;  1CKA A;  1WI7 A;  4F7U F;  2OTL Q;  2EGA A;  4ORZ A;  2L3S A;  3EG9 B;  1FX7 A;  4C0G A;  2EFI A;  4KUL A;  1UUE A;  1U1S A;  4J9I A;  3CBO A;  3OS0 A;  2LCC A;  2QEX Q;  1VQ5 T;  2KEA A;  4XTU A;  1G2B A;  1ZUY A;  3UPU A;  4PJO E;  3C12 A;  3CC2 Q;  1WLP B;  9ATC B;  2GTJ A;  1UG1 A;  3BE3 A;  2M51 A;  1SPK A;  2QAZ A;  4IUP A;  2CP6 A;  5L8R E;  5CQX A;  4M75 C;  4NL2 A;  3RKW A;  2HZY A;  2LMJ A;  1PD0 A;  3EH1 A;  1X6B A;  5HK0 A;  3JAM E;  1YNZ A;  2E5K A;  4OB1 B;  4N4G A;  3M0P A;  3LGF A;  1AZG B;  4XTZ A;  2ROT A;  2RI2 A;  2HBP A;  2RJC A;  2KT1 A;  2QGG A;  1W70 A;  1LJO A;  3G71 A;  4E47 A;  3PIP A;  4C92 C;  2KSS A;  3MO8 A;  4ZN1 A;  2HSP A;  2RQT A;  5D6Y A;  5GAN g;  1NLP C;  3TU4 K;  1Q82 R;  1RAB B;  4XU2 A;  1BI2 A;  3ZFJ A;  2CKK A;  1AZE A;  1G3T A;  2QXF A;  1D0Y A;  4X34 A;  5KH6 A;  3Q1J A;  2LCL A;  2DVJ A;  4O6J A;  2DKG A;  4M75 F;  3CCV A;  1M8V A;  1YCY A;  4GLM A;  1JEG A;  2I0N A;  2M1H A;  3C4S A;  3EG2 A;  5KE3 A;  1W4S A;  4KUD K;  1SKU B;  1NE8 A;  5GAN j;  1PWT A;  2DJZ A;  5D7U A;  2E5Q A;  3PVL A;  4C92 F;  1JO8 A;  4F7U G;  2YUO A;  2OJ2 A;  1M2V B;  1YIJ Q;  2DIG A;  4M78 C;  2DD5 A;  3AHU A;  1N9S A;  1WXB A;  4Y92 A;  2J6F A;  2PZ1 A;  3TSZ A;  1AVZ C;  4QVC A;  2O31 A;  4RTZ A;  1Q82 C;  4J5Y A;  1OUL A;  1FMV A;  2DER A;  2FVU A;  4JS5 A;  2AKL A;  2R5A A;  1IRX A;  4Z02 A;  2ZPB B;  3CCR A;  1VQ9 Q;  1K9M C;  2HSE B;  1M5Q 1;  1TTH B;  4P5N A;  1VQM T;  5KE2 A;  2KRN A;  1Q81 R;  1QVP A;  2P0Q A;  4M78 F;  2RB6 A;  2QQB A;  1WHG A;  3R6N A;  2EVR A;  5FU6 B;  2CUB A;  2ZPG B;  1UGQ B;  2M9U A;  2JZ2 A;  3L2Z A;  3P8H A;  1VQ6 A;  1QKX A;  2E6Z A;  5GAO m;  3NPF A;  2EWN A;  1NBE B;  2DK3 A;  2DAQ A;  3CCU Q;  4JPB W;  4KH0 B;  3CCM T;  4C8Q C;  2CH4 W;  1KQS P;  1QVF A;  3U23 A;  4PK4 A;  2D0N A;  4WF2 A;  1QP3 A;  2KMT A;  4M75 A;  3OS2 A;  1QCF A;  2H8H A;  2X4X A;  4L59 A;  2GF7 A;  3EG1 A;  1BIB A;  4K11 A;  3FEO A;  1KD1 R;  2FL7 A;  5IHK A;  3JCM V;  5KYU A;  3JCM J;  3A98 A;  2EYZ A;  4FIB A;  4M75 G;  2Y4Y A;  2O4X B;  3SHW A;  3OSS C;  1JJ2 A;  1K73 C;  5GAN e;  1RAA B;  3ME9 A;  2L2P A;  2VB6 A;  4C92 A;  1UEC A;  3PTA A;  2DEQ A;  2RO0 A;  2D0Q B;  4L5G A;  2KRO A;  3QSU A;  3CC4 T;  1VQP Q;  3QUI A;  1R77 A;  4Z88 A;  3EFS A;  1WFW A;  4Z89 A;  4C8Q F;  1MHN A;  4L6V 5;  1QVF S;  3UDC A;  3MEU A;  1BI1 A;  4FYV B;  1PC0 A;  4RG2 A;  4KGZ B;  4BI4 A;  1IGU A;  3E1S A;  1VQ9 A;  2RI3 A;  2YT6 A;  1UHC A;  1E6H A;  4BD3 A;  3QWY A;  2LNV A;  2RJE A;  2DL7 A;  3E2U A;  1K1Z A;  4D8K A;  2V8K A;  2NUP A;  1LPL A;  3CC7 T;  4M78 A;  1NJI U;  2RI5 A;  2OTJ Q;  4DA4 A;  1K8A U;  2XU8 A;  4C92 D;  2JM8 A;  1X6G A;  1VQ5 Q;  4FYX B;  3C95 A;  4DBR A;  2HCK A;  1I0C A;  2HQX A;  1ZA1 B;  1VQO A;  3CD6 T;  2FYK A;  5GAN 6;  4JJN K;  2DX1 A;  4M78 G;  4FSX A;  1GXI E;  1WXU A;  2DL8 A;  3CCU A;  3L2V A;  3X26 B;  2CSI A;  4BDZ A;  3UT1 A;  2XI9 A;  1M90 C;  5LJ3 g;  2VC8 A;  2L3P A;  4N4H A;  1I4K 1;  2I2L A;  3FIF A;  1UGS B;  3HRT A;  1B34 B;  5GAM f;  3HKS A;  2DA9 A;  1VQ8 Q;  2D1X A;  4JRP A;  2X3W D;  2X4W A;  2QA4 T;  2SRC A;  2QAS A;  4LN2 A;  3VS3 A;  1SEM A;  5I11 A;  2PUO B;  3NTK A;  4QQ6 A;  3QWX X;  2YUQ A;  4E7J A;  4J6X A;  2DO3 A;  3CXC A;  4M78 D;  4PJJ A;  2K5I A;  2PVG B;  5LJ3 j;  1VQP A;  1HSQ A;  3BY7 A;  3OY9 A;  3FJP A;  2ATC B;  5IXF A;  1OI1 A;  3JCM b;  2FO0 A;  4HCZ A;  3QDR B;  1OU8 A;  2DYI A;  4RKU E;  5FWC A;  2MWP A;  4FT2 A;  4C8Q G;  4EMK C;  4R56 A;  3G4S A;  2JS0 A;  4JRK A;  4RTT A;  3UA7 A;  2EYW A;  1JXM A;  2QTV A;  1U8R A;  2MOX A;  2KNB B;  2DXU A;  4AFS C;  2KYB A;  1RI0 A;  2XDB A;  1TXQ A;  2JUF A;  1KSW A;  4A63 B;  4RTV A;  4LE9 A;  1VQK T;  1KQ2 A;  3CXC S;  4HVV A;  2DF6 A;  5GAN 7;  3G6E T;  2OTJ A;  4BAC A;  5CKF A;  1FMW A;  3DB4 A;  3EGU A;  4J6W A;  1ZLM A;  4J9B A;  3CMA T;  1KHC A;  2RPN A;  3MP6 A;  2DXT A;  1YN8 A;  3V7R A;  1MUZ A;  2MIO A;  3OYN A;  3LGL A;  1D1B A;  4BB7 A;  4PLL A;  1U1T A;  2QTX A;  2CZ0 B;  2D8J A;  2XK0 A;  1OU9 A;  1QW1 A;  3LLR A;  1SRL A;  4F14 A;  3A5Z B;  3L2U A;  1LOJ A;  1V1C A;  4PKC C;  5GJW B;  1YWP A;  2ZPH B;  4AT1 B;  1SSF A;  4BE0 A;  5AYF A;  4EPC A;  1YJ9 T;  1VQM Q;  2HQH A;  3CME T;  3NTH A;  4B9W A;  4QT7 A;  4GY5 A;  1UDL A;  1YWO A;  4FL6 A;  4LDV A;  4NS5 A;  2LJ0 A;  4M7D E;  4A4F A;  3I55 Q;  5CKE A;  4C5I A;  2F1L A;  4OVA A;  1SHF A;  1E6G A;  1I1J A;  3VRZ A;  2KRM A;  2IIM A;  1C1A A;  3HFO A;  5CAI A;  3H0F A;  4A4H A;  4DOW A;  5LJ3 e;  1AT1 B;  3HTR A;  3OS1 A;  2IPO B;  1KQ1 A;  1X6O A;  4JUV A;  2BKD N;  3CQT A;  2V26 A;  3PT9 A;  4RTU A;  3QJ6 A;  4A4G A;  1UGV A;  1VQN A;  2LQK A;  4FYW B;  2BE7 D;  1MGQ A;  4HVU A;  4M77 E;  1NLO C;  2OI3 A;  2YLC A;  5C6S A;  4RUG A;  2V8I A;  4B9X A;  1HK9 A;  1AWW A;  2JW4 A;  3KUF A;  2DZC A;  2ZPI B;  2E3I A;  2L8D A;  4ZTF A;  4FU6 A;  1WHK A;  1P92 A;  2YUN A;  5DM7 R;  3HP9 A;  2CH4 A;  1O9S A;  1VYT A;  3L2Q A;  5IXB A;  2JM9 A;  5GAN 8;  3OYJ A;  2K6D A;  3QZ9 B;  5GMK j;  2DET A;  4DEY A;  1VQ7 T;  1Q7Y R;  4OB0 B;  4OMN A;  2KE9 A;  2LX9 A;  5LJ5 g;  1VIF A;  2A36 A;  3S3M A;  4XTX A;  4M7A D;  1V29 B;  4M7A B;  4EMK A;  6AT1 B;  4E6R A;  4ME7 A;  4LDY A;  1ABO A;  4IIO A;  5A0G A;  4J9G A;  5I21 A;  1B3Q A;  3EG9 A;  3QYH B;  1S72 T;  2A08 A;  4AFQ C;  4J8O A;  5CO7 A;  2LC4 A;  1WJS A;  4JS4 A;  3F70 A;  5A2Q E;  2ZPF B;  2PU9 B;  2RHI A;  3CCE Q;  3R6O A;  3NFC A;  5LJ5 j;  3I55 A;  4ELY C;  3PVQ A;  5FU6 C;  5GAN 5;  4E7Z A;  4HCK A;  5GAN f;  1RL2 A;  2RM4 A;  3I9Q A;  3OMG A;  5CK9 A;  4DOV A;  2J7I A;  2YRC A;  2HEQ A;  1JQQ A;  1WJR A;  4M77 B;  3I56 T;  3M5A A;  1K0X A;  1ACM B;  3IQL A;  2K9G A;  1WDX A;  2P84 A;  1K4U S;  1QVG P;  3WVD B;  3LYI A;  2E1H A;  2QYZ A;  4OML A;  1XTD A;  3DKM A;  2KYM A;  2CRE A;  3FRN A;  2HQE A;  2DD4 A;  2JTE A;  2DM1 A;  2X9H A;  4IUV A;  3A1P A;  4ELZ C;  3BDU A;  5FRN A;  2KK4 A;  2ZCF B;  4ZGD B;  2MYS A;  4DEX A;  1AWO A;  3V7S A;  2CP3 A;  1KC8 U;  2YRV A;  3OBW A;  2GGR A;  4AMC A;  2YUP A;  3LW5 E;  1M1K U;  1HJD A;  5I2M A;  3BW1 A;  3JCM P;  2KVQ G;  5CKH A;  4DBH A;  1RAE B;  2KAF A;  5GMK e;  3LH0 A;  2NYS A;  3O5Z A;  1YIT T;  3EFR A;  2LQ8 A;  1H64 1;  2CUD A;  1RAH B;  4OMP A;  3JCM c;  3I5R A;  2M16 A;  3CCL Q;  3HSB A;  4RMO A;  2KRS A;  1WHJ A;  3SEM A;  3INZ A;  3M54 A;  4GBQ A;  1RAI B;  2DBM A;  3CCJ A;  2JTF A;  1ZBX A;  1Y96 A;  5GAO l;  3CCQ A;  2FRY A;  1KIK A;  4RTY A;  3G7Z A;  3MEA A;  3TRE A;  1D09 B;  2QQ9 A;  2H3J A;  4BY6 B;  4D6W A;  1OZ3 A;  2EJG A;  2LQN A;  1M2V A;  2VAS A;  4EMG A;  3SWN A;  3CCE A;  1YI2 T;  3HL8 A;  1VQK Q;  2L5Q A;  2GNC A;  5LJ5 e;  1BI0 A;  2RK1 A;  2RHU A;  2AHJ B;  2LVM A;  1PCX A;  2FEI A;  3ASK A;  1RAF B;  1VQ4 T;  2LTO A;  2VGM A;  4AG2 C;  5FU7 B;  1IHV A;  3VYG A;  2COZ A;  3CMA Q;  2EIF A;  4XU3 A;  4JJC A;  1VA7 A;  2L0A A;  2A7Y A;  1W2B P;  3QZ5 B;  4F7U E;  1YJN T;  2YDL A;  4CC2 A;  2DNU A;  5I22 A;  3M58 A;  2RJD A;  3JV3 A;  1M3A A;  3H9N A;  3L2W A;  4HA8 A;  2QDL A;  1Y96 B;  2OTL A;  1RUW A;  4Q5W A;  2JOY A;  2K5L A;  4ZGJ B;  3QII A;  1QWE A;  3MEW A;  1OX9 A;  2MPX C;  1YJ9 Q;  2O88 A;  2R58 A;  4PJO D;  1WGS A;  1AWX A;  3VRY A;  4PJO B;  2COY A;  2DRK A;  2QEX A;  3SWN B;  2CS7 A;  3OSV A;  2R57 A;  2CYZ B;  1OEB A;  1H92 A;  1OPK A;  3CC2 A;  3V8J A;  2EYY A;  3CCL A;  3MET A;  5GAM h;  1U3O A;  1M30 A;  2XMF A;  1PSE A;  1IB8 A;  2WSC E;  1X2Q A;  3EH2 A;  1BBZ A;  1JJ2 P;  1NG2 A;  3EGX A;  3GNF B;  1TWB A;  2A0F B;  2O4X A;  3JB9 D;  2AKK A;  1D1A A;  2F5T X;  1WPY A;  5CR2 A;  2JT4 A;  4A53 A;  3LWH A;  1PSF A;  2EQU A;  3H41 A;  1Q82 U;  2CSQ A;  2PQW A;  2RHY A;  2DL5 A;  2LCS A;  5GAM d;  4JDS A;  5KYY A;  4HCB A;  4IUU A;  3PE0 A;  2MI6 A;  2QGF B;  1M3B A;  2IG0 A;  4D8D A;  5IHN A;  1K9M U;  3CCS T;  3UWN A;  5GJV B;  1YJW T;  1VQ7 Q;  4XK8 E;  4M75 E;  2DXB A;  5FWB A;  3M9Q A;  3JCM g;  1X2K A;  5LJ3 f;  4GLK A;  1TG0 A;  1AHJ B;  2BTT A;  1W1F A;  4JLG A;  1TUG B;  1I5O B;  1NJI R;  3QKJ A;  2HNI A;  4RTW A;  1K8A R;  1WXT A;  3EGX B;  3OW2 P;  1Z9Z A;  4J9C A;  1YHQ T;  2NWM A;  2V1R A;  3OB9 A;  1Q81 C;  2NUT B;  1YIJ A;  3OYH A;  1V76 A;  1GCP A;  1SRM A;  2RHZ A;  2RHX A;  1ZSG A;  1N8R R;  1X27 A;  1QKW A;  2DTO A;  1IO6 A;  5KYY B;  3FJ5 A;  1JBM A;  1FYN A;  4C92 G;  5D6W A;  2ROL A;  4HKE A;  4OF1 A;  4WCI A;  1NEG A;  1I5L A;  2LX7 A;  4BI3 A;  1Y71 A;  2JN0 A;  3I56 Q;  1JRI A;  2HL5 C;  1GBQ A;  3E9G A;  3E19 A;  2ENM A;  1B34 A;  1IHW A;  2EKH A;  2RN8 A;  1K73 U;  5CVI A;  1SF9 A;  4ZNX A;  2K3B A;  5LL6 S;  2J06 A;  1BCM A;  2PVO B;  3V8L A;  4M78 E;  1KD1 C;  1VQL Q;  2E10 A;  3OYY A;  5HY6 A;  4J9F A;  4J9H A;  1RAD B;  2ZPE B;  1MMN A;  4CRI A;  2KGT A;  5DY9 A;  5GAO n;  4A54 A;  1OPL A;  4J83 A;  1QCO A;  3HHT B;  4C5H A;  1BU1 A;  1N8R C;  1YIT Q;  1FMK A;  1ZX6 A;  4M7A C;  3G71 T;  4ATO A;  4OMF B;  2E12 A;  4NOY A;  2MF2 A;  3VS0 A;  3ULR B;  3L1A A;  3MHX A;  3N5B B;  1BIA A;  2PTK A;  4LDU A;  5HKC A;  3MP8 A;  1WJQ A;  4OMQ A;  3J7A F;  2EQM A;  4HVW A;  1G3W A;  1RLQ C;  3OYL A;  1H8K A;  3J81 E;  2CGH A;  3CCV T;  2HMA A;  2DIL A;  1LNX A;  1XQH A;  1KQS S;  5GAO q;  4E7S A;  4C8Q E;  1YI2 Q;  2VXE A;  4E7H A;  2QG9 B;  1M90 U;  3RMQ A;  3GIB A;  1UB4 A;  3NGP A;  1OV3 A;  3JCM e;  5D6X A;  2IVW A;  2GFU A;  1HYO A;  2FRW A;  1KJW A;  3X25 B;  2W0Z A;  1VQ4 Q;  3DLL A;  1D3B A;  4M77 C;  1G8X A;  1PG5 B;  1X69 A;  5KYN A;  4IKF A;  3VS7 A;  4M7A F;  4XTV A;  1QCN A;  3VS1 A;  3LX7 A;  1XOV A;  7AT1 B;  1G83 A;  2E41 A;  2JMC A;  1YBY A;  2A3L A;  5KCO A;  2MWO A;  4KUI A;  4LD6 A;  1YJN Q;  5FRM A;  4FT4 A;  5GMK m;  2RQW A;  2BE9 B;  1QQJ A;  1NPP A;  4MZM A;  4DBF A;  1VQL A;  1XNI A;  2X35 A;  4RCC A;  1EIF A;  1A0N B;  3P8D A;  3CPW P;  2EKO A;  3CCR T;  3RIR A;  1M2O A;  2RQV A;  2FPD A;  2DTH A;  5GAN h;  1XJW B;  3PMI A;  2M0Y A;  4ANJ A;  2G6F X;  5KYW B;  2COW A;  4N0A C;  4PFP A;  1WZO A;  3HRS A;  4F16 A;  4XU1 A;  1BKB A;  1VQ5 A;  2LT4 A;  4X9C A;  4M77 F;  5FW9 A;  4VUB A;  3MPU B;  1X43 A;  2K3Y A;  1GCQ C;  2RQU A;  1NYG A;  3SD4 A;  5LJ5 f;  4BUG A;  2AZS A;  2DBK A;  1D3B B;  1MV0 B;  1AOJ A;  1R0C B;  3BFM A;  1JU5 C;  3RNJ A;  3S3O A;  5KCH A;  1VQ6 T;  4O5V A;  5A0L A;  5GAN d;  1VQ8 A;  4DQ2 A;  2RA2 A;  2YSQ A;  2NLU A;  4BY6 C;  2A37 A;  1OQK A;  2EQK A;  1Q86 R;  2E65 A;  1RAG B;  3X20 B;  3UF4 A;  2VGN A;  1LVK A;  1PRM C;  2JNG A;  2LZ6 B;  5CIU A;  3TSW A;  3X28 B;  3RKY A;  4C5E A;  3THK A;  2RQR A;  2JVV A;  5FU7 C;  4M7A A;  3M57 A;  3GNG A;  3GBQ A;  3GP8 A;  3JB9 I;  3CCM Q;  3FB9 A;  3CBM A;  4IUR A;  1Q95 G;  2E64 A;  2DPP B;  2B8A A;  2ZZD A;  1GBR A;  2HD0 A;  2DIQ A;  4M7A G;  1WHL A;  2PVD B;  4OB2 B;  2CDT A;  4LD9 K;  3OYD A;  4KGX B;  1QWF A;  5ECA A;  2XD0 A;  2VKN A;  3KFV A;  1N5Z A;  3HRU A;  4XTW A;  1GFC A;  4MMK A;  3C0C A;  1VQ9 T;  1UEB A;  1YHQ Q;  4PJO C;  2E4H A;  3M56 A;  3DB3 A;  3RUX A;  3M53 A;  4PJN A;  2A28 A;  3SWN C;  3RBB B;  1QP2 A;  1BB9 A;  3UA6 A;  3CC4 Q;  4M77 A;  4C0D B;  1SG5 A;  3I35 A;  3QO3 A;  2F2X A;  3EFO B;  3GF5 A;  2YLB A;  2BUD A;  1TOV A;  3NMZ C;  4QW2 A;  2EGC A;  5GAO p;  4HXJ A;  2F2W A;  3PFS A;  1WQW A;  1KC8 R;  4JRI A;  1VQO T;  2F5K A;  5CQY A;  4HCC A;  4C5G A;  2QQA A;  3EAE A;  1M1K R;  4XTY A;  3CCU T;  1T3L A;  3H6Z A;  2P4R A;  4M7D D;  4M7D B;  2QQS A;  1M1F A;  2EBP A;  1GRI A;  2KT8 A;  4PJO F;  1N9R A;  2O9V A;  1VQM A;  2ZAE A;  1HD3 A;  3CEY A;  1N6A A;  2C0I A;  4OMM A;  4AG1 C;  2X51 A;  1W6X A;  1KG1 A;  1ZA2 B;  4N0A A;  1TU0 B;  1VUB A;  3LWI A;  3CC7 Q;  2DRM A;  2P4T A;  1KFZ A;  1QMC A;  1GCQ A;  4ZTJ A;  8ATC B;  3CD6 Q;  1YP5 A;  2B86 A;  2EQJ A;  4LUD A;  4M77 D;  5J3B A;  3OYE A;  4MDW A;  1Q7Y C;  2DYB A;  2RNA A;  3MJX A;  4LDW A;  4KRT A;  3CCM A;  1QLY A;  3ZL7 C;  3TVT A;  1IRE B;  1VQP T;  3G71 Q;  2CZ1 B;  5IN1 A;  4AFZ C;  1MND A;  1ZHI A;  1RLP C;  4X9D A;  3TQ7 P;  2QK0 A;  1NEB A;  3JB9 F;  1OOT A;  4WTO B;  3JCM Q;  4FSS A;  5GAO r;  2QA4 Q;  4E7L A;  2KR3 A;  1ABQ A;  1BYM A;  3VYH B;  3ZBD A;  4QVD A;  1G3Y A;  1ZSZ C;  3OYB A;  2HAX A;  3G4S T;  2LRQ A;  1KHI A;  3L2R A;  3EGD A;  3T9N A;  3EHR A;  3CC4 A;  5LJ3 h;  2XDP A;  2PNI A;  1WIE A;  1T0H A;  1K9A A;  5M9O A;  1PKT A;  5CCA A;  4CC3 A;  2WAC A;  1EX4 A;  2OTJ T;  1R0B G;  2K3X A;  2AT1 B;  3H0I A;  3URG A;  1ZUK A;  2NUZ A;  1NYF A;  4A4K A;  2BIV A;  5CKD A;  2VXF A;  3VU3 C;  2HKN A;  5L23 A;  2L89 A;  3OYI A;  3PNW C;  1UGP B;  1U06 A;  1AD5 A;  4PJO A;  2HBW A;  2W10 A;  5LJ3 d;  1Z9Q A;  3QJY A;  3CCR Q;  1ZUU A;  1C0M A;  2FZK B;  1G3S A;  1VQ8 T;  2V8J A;  3MCA B;  3CC7 A;  1WA7 A;  3G6E Q;  2X3X D;  2DE0 X;  4PJO G;  4PFO A;  4LDX A;  1QVG A;  3EGD B;  2EAY A;  5CKB A;  1AWJ A;  1YFN A;  3CD6 A;  2YHT A;  2O01 E;  4KH1 B;  3JCM f;  1UFF A;  1VOM A;  2MAM A;  4FYY B;  1I81 A;  2GCX A;  2M02 A;  2EGE A;  3DLM A;  1D0X A;  2AIR B;  2YRD A;  2EQI A;  1LCK A;  5AT1 B;  1VQ6 Q;  4RCB A;  4IIM A;  2K7A A;  3BDL A;  4XAX B;  3RKX A;  2VYT A;  2QA4 A;  4OP0 A;  4KGV B;  2SEM A;  1VQN T;  3SB2 A;  2EYQ A;  1VYV A;  3M4Y A;  1K9M R;  3CME Q;  3JRZ A;  1M27 C;  1B7T A;  3JB9 G;  2KXC A;  3VS2 A;  2C0O A;  1QVG S;  1TUC A;  1D1C A;  2DL4 A;  2WSE E;  1GFD A;  2G3R A;  1QVF P;  4OMO A;  3NHN A;  4F7U A;  1OX8 A;  3G1J A;  1C6V X;  2DVE A;  1ZBJ A;  1I07 A;  4EMH A;  1TUD A;  4E7I A;  4ESR A;  1GL5 A;  1SSH A;  4FCY A;  4RTX A;  1K76 A;  1Y57 A;  2DXC A;  1F1B B;  4MDX A;  4CC4 B;  2LNH B;  2RD1 A;  2CP2 A;  2JMA A;  4MZT A;  2RMO A;  2L3Q A;  1B07 A;  2Y4X A;  1K0S A;  2GQI A;  1X01 A;  1ZSZ A;  3OYA A;  3PMT A;  2X4Y A;  2NUT A;  4C0Z A;  2DL3 A;  3VUB A;  3OYC A;  1VQK A;  1MMA A;  3VS4 A;  1M3C A;  3OYG A;  3A8M B;  4QQG A;  2K4Y A;  3M4G A;  1HXD A;  3G6E A;  5GMK h;  5KYX A;  2RF0 A;  1W2B A;  3SFM A;  1O75 A;  3M0S A;  3FLG A;  3OMC A;  4IUQ A;  2HDA A;  1K73 R;  3GOX A;  4F7U B;  1SHG A;  1YCS B;  3CMA A;  3I55 T;  4JJB A;  2ESW A;  2FZG B;  3OA6 A;  3S3N A;  1VQO Q;  1PKS A;  2XDD A;  2F2V A;  4JRQ A;  4C92 E;  1S72 Q;  4F04 B;  3OYF A;  2KQW A;  3OYM A;  2EJF A;  1YJ9 A;  4PLI A;  4QKU A;  3CME A;  3TCJ A;  2K2V A;  1ZSZ B;  1PM3 A;  1NPR A;  5FLX E;  3QDF A;  2GTO A;  5LJ5 h;  5GMK l;  3VJP A;  5I2S A;  3JB9 J;  2DFU A;  1W2B S;  5EG2 A;  1IXD A;  1RAC B;  1PD1 A;  2LT1 A;  2ZGW A;  3GPL A;  5KYX B;  3S6W A;  1FXX A;  1EZZ B;  3I5S A;  4XU0 A;  1NZ9 A;  2FPE A;  3ER0 A;  2KXD A;  2KY9 A;  3MKD A;  1EFN A;  3QPH A;  1Q81 U;  4ZGE B;  2QQR A;  1MNE A;  3OQ5 A;  4Z8A A;  2JTM A;  2X4J A;  3CXC P;  1M90 R;  1CKB A;  3QXE B;  4QVZ A;  5LJ5 d;  1NJI C;  1VIE A;  4RG8 A;  1K8A C;  4OGC A;  1H3H A;  3V7C A;  4UC4 A;  1OYX A;  2XIC A;  3CCJ T;  4OB3 B;  2DZ9 A;  1M4Z A;  2QI2 A;  3QG1 A;  2ED0 A;  1PNJ A;  3CCQ T;  3G4S Q;  3JB9 H;  4OGE A;  2R5M A;  4M75 D;  3MEV A;  4ZN3 A;  4M75 B;  1KQS A;  2H3E B;  5J26 A;  5C0M A;  1ZQ1 A;  1WX6 A;  4C0D C;  4R0K A;  4Y28 E;  5KYU B;  1JJ2 S;  1VQ7 A;  2FB7 A;  4AFU C;  2DLP A;  5HCK A;  3VKI A;  4NL3 A;  3CCE T;  2P0P A;  4PFZ A;  4J6Y A;  2CT3 A;  1KD1 U;  2RJF A;  2ECZ A;  2KI7 A;  4A4E A;  4BDY A;  1ARK A;  1WYX A;  3KBG A;  3OW2 A;  4C92 B;  2XKO C;  3FC3 A;  3ZEH A;  1J3T A;  3PGG A;  4X1V A;  4BI8 B;  2DEU A;  5A0D A;  4M7D C;  1N27 A;  1S72 A;  2EPD A;  5J39 A;  2OAW A;  2J05 A;  5DLO A;  4JZ3 A;  4PJM A;  4DBQ A;  2EW3 A;  3AT1 B;  2XG8 D;  1N8R U;  5KYW A;  1Y0M A;  3QYG B;  2YWW A;  2EJ9 A;  2JS2 A;  2AZV A;  1CSK A;  1UGR B;  1I8F A;  2OTL T;  2JJ9 A;  5GAN 4;  2DJQ A;  4QQD A;  1MMG A;  3L42 A;  3M59 A;  2J6K A;  3CPF A;  3EHQ A;  2E70 A;  3WVE B;  5GAN 3;  2HKQ B;  3JCM X;  3I56 A;  2PUK B;  2HL3 A;  2OAU A;  2QEX T;  1WHM A;  3OW2 S;  2NUP B;  4EDU A;  1JXO A;  3D7S B;  1AEY A;  4M78 B;  2FHD A;  2XID A;  5DLQ E;  4M7D F;  3CC2 T;  1UJY A;  4C8Q A;  3CCL T;  4E7K A;  2M0O A;  2MMP A;  1WNL A;  1VQN Q;  3VS6 A;  1S1N A;  2KBT A;  3JSC A;  2D9T A;  4IUT A;  3X24 B;  2O2O A;  3H8Z A;  2WSF E;  2CP7 A;  4PJL A;  1VYU A;  4PNO A;  5FRO A;  3JCM W;  2RH2 A;  1RI9 A;  2FPF A;  2L3R A;  2BZX A;  3UAT A;  1PRL C;  1YIT A;  2RK2 A;  4BE2 A;  4EIK A;  4JZ4 A;  3M0R A;  4YTL A;  3QBY A;  2E6N A;  2LJ3 A;  2VVK A;  4M4Z A;  2LP5 A;  3EG3 A;  4C8Q D;  4C8Q B;  3HFN A;  2KDS A;  2DMO A;  4J7F A;  1IGQ A;  4MZP A;  4CI0 C;  1KK7 A;  1R8O B;  3EG0 A;  4KBM B;  1YI2 A;  4JLI A;  4KT0 E;  4LXC A;  5GAM g;  4M7A E;  3RES A;  2CT4 A;  2BZ8 A;  3MP1 A;  3EFO A;  2D8H A;  2D6F A;  2Y90 A;  2K2M A;  2MK5 A;  3O8V A;  4C0F A;  1VQ4 A;  1U5S A;  1JB0 E;  1UE9 A;  2YXY A;  3VS5 A;  3E9F A;  3CCS Q;  1YJW Q;  1MV3 A;  3PIO A;  5GAN 2;  2BZY A;  1YIJ T;  4J9D A;  2QDY B;  1X75 C;  2GQV A;  1WQ7 A;  3J80 E;  2GFA A;  3H0H A;  8AT1 B;  3CPW A;  4LUE A;  3VUZ A;  1YJN A;  3A8L B;  4M7D A;  3REB B;  4B6M A;  4II1 A;  4J7I A;  2LQW A;  3RR6 A;  5GAM j;  2J6O A;  5IT9 E;  1UHF A;  4M7D G;  2AK5 A;  4HT8 A;  2GBQ A;  1Q86 C;  1FWZ A;  3RMS A;  2CZ6 B;  4PL6 A;  3TEE A;  3OYK A;  3JCM h;  2Z0W A;  1UTI A;  4CC7 A;  2MCN A;  2CZ7 B;  2XHC A;  3V8K A;  2C06 A;  1TSF A;  4MML A;  1BK2 A;  4LNP A;  1NM7 A;  5IH2 A;  1E7O A;  1TS9 A;  2ED1 A;  3FDR A;  2F69 A;  4M77 G;  4HT9 A;  2FG0 A;  3CPW S;  1M8M A;  4XQ3 A;  1WHH A;  1UJ0 A;  2P0K A;  3GLX A;  3OBY A;  3REA B;  1Q86 U;  1OZ2 A;  5EC7 A;  2V1Q A;  2VWF A;  1G5V A;  3JCM d;  1T0J A;  3C94 A;  3NTI A;  2OX7 A;  2C0T A;  3P8B B;  2EYX A;  3CBP A;  3CCJ Q;  3RER A;  1Y7X A;  1DJ7 B;  1Y07 A;  3CCQ Q;  1TH7 A;  3A8G B;  1PHT A;  4FW2 A;  1M9S A;  3M0T A;  4V2S A;  4Y91 A;  1BCO A;  2DTI A;  4FW1 A;  3CCS A;  1YJW A;  3WXM B;  2LDM A;  2VV5 A;  2CP0 A;  4E2F B;  4F17 A;  3A8H B;  4TVR A;  2FZC B;  1H3Z A;  3KXT A;  2JXB A;  5HK3 A;  3VV0 A;  5IAY A;  3LH5 A;  2O9S A;  2E3H A;  3A8O B;  3RDV A;  3OS5 A;  4R55 A;  1D0Z A;  3M0Q A;  4JJD A;  1KC8 C;  2K57 A; 
#chains in the Genus database with same CATH homology
 1I07 A;  4J9H A;  5IHI A;  1SRL A;  4F14 A;  4J9E A;  3M0U A;  1TUD A;  1T3S A;  4ESR A;  1V1C A;  2ABL A;  1SSH A;  2LJ1 A;  1GL5 A;  5GJW B;  1YWP A;  4RTX A;  2KGT A;  1K76 A;  1Y57 A;  1OPL A;  2K79 A;  4CC4 B;  2LNH B;  1BU1 A;  2JMA A;  4QT7 A;  1UDL A;  1YWO A;  2LJ0 A;  2RMO A;  1FMK A;  2L3Q A;  1B07 A;  1ZX6 A;  1K0S A;  2GQI A;  1CKA A;  1WI7 A;  1SHF A;  1I1J A;  1E6G A;  2EGA A;  4ORZ A;  3VRZ A;  2KRM A;  2IIM A;  2L3S A;  3VS0 A;  3H0F A;  3ULR B;  2DL3 A;  2PTK A;  1UUE A;  3VS4 A;  1M3C A;  4J9I A;  3CQT A;  4RTU A;  1UGV A;  4OMQ A;  2RF0 A;  4HVW A;  3M0S A;  2KEA A;  1RLQ C;  4HVU A;  1G2B A;  1ZUY A;  1H8K A;  2HDA A;  1NLO C;  2OI3 A;  1SHG A;  1YCS B;  4RUG A;  2DIL A;  1AWW A;  2JW4 A;  1WLP B;  2GTJ A;  4JJB A;  3NGP A;  1UG1 A;  1OV3 A;  2ESW A;  2M51 A;  1SPK A;  2FRW A;  1KJW A;  2W0Z A;  2YUN A;  1X69 A;  3VS7 A;  1PKS A;  2CH4 A;  3VS1 A;  2F2V A;  1VYT A;  5IXB A;  2JM9 A;  1XOV A;  2K6D A;  2LMJ A;  1G83 A;  1X6B A;  2JMC A;  4DEY A;  1YNZ A;  2E5K A;  3M0P A;  4OMN A;  2KE9 A;  1AZG B;  2RQW A;  2ROT A;  2GTO A;  2KT1 A;  1W70 A;  2A36 A;  1A0N B;  4E6R A;  2RQV A;  2HSP A;  2RQT A;  2FPD A;  1NLP C;  1ABO A;  4IIO A;  2M0Y A;  4J9G A;  2G6F X;  1B3Q A;  3I5S A;  2A08 A;  4AFQ C;  4F16 A;  2FPE A;  2KXD A;  1AZE A;  1EFN A;  5FW9 A;  2DVJ A;  1X43 A;  2RQU A;  1GCQ C;  1NYG A;  4Z8A A;  4GLM A;  1JEG A;  2AZS A;  2DBK A;  3PVQ A;  1CKB A;  1MV0 B;  1AOJ A;  2I0N A;  4HCK A;  3EG2 A;  1H3H A;  1JU5 C;  3RNJ A;  3I9Q A;  1PWT A;  2J7I A;  2HEQ A;  2ED0 A;  1JQQ A;  1PNJ A;  3PVL A;  1K0X A;  2YSQ A;  2K9G A;  3IQL A;  1JO8 A;  1WDX A;  2YUO A;  2OJ2 A;  1K4U S;  1WX6 A;  4OML A;  2A37 A;  2KYM A;  4R0K A;  1WXB A;  2CRE A;  4Y92 A;  2J6F A;  2PZ1 A;  3TSZ A;  1AVZ C;  2O31 A;  2JTE A;  2DM1 A;  4AFU C;  2DLP A;  3UF4 A;  5HCK A;  4RTZ A;  2CT3 A;  1PRM C;  2ECZ A;  1AWO A;  2AKL A;  4DEX A;  1ARK A;  1WYX A;  2LZ6 B;  3TSW A;  3THK A;  2RQR A;  2GGR A;  1J3T A;  2YUP A;  4X1V A;  1HJD A;  3GBQ A;  2EPD A;  2OAW A;  2J05 A;  4JZ3 A;  2EW3 A;  2KRN A;  1GBR A;  1Y0M A;  3O5Z A;  2CUD A;  2JS2 A;  2AZV A;  2CDT A;  4OMP A;  1CSK A;  3I5R A;  2KRS A;  5ECA A;  1QWF A;  2EVR A;  3R6N A;  2DJQ A;  2CUB A;  2VKN A;  3SEM A;  3KFV A;  1N5Z A;  4GBQ A;  1GFC A;  2J6K A;  3C0C A;  3EHQ A;  1QKX A;  2DBM A;  3NPF A;  4JPB W;  2FRY A;  1KIK A;  4RTY A;  2A28 A;  3RBB B;  2CH4 W;  3UA6 A;  1BB9 A;  1JXO A;  3U23 A;  1AEY A;  3I35 A;  2D0N A;  2LQN A;  1QCF A;  2H8H A;  2F2X A;  3EG1 A;  4K11 A;  1UJY A;  2GNC A;  5IHK A;  3A98 A;  3NMZ C;  2EGC A;  4HXJ A;  2F2W A;  2EYZ A;  2FEI A;  3VS6 A;  1S1N A;  2KBT A;  3SHW A;  2O2O A;  4AG2 C;  1T3L A;  2L2P A;  2P4R A;  1VYU A;  4JJC A;  1VA7 A;  1UEC A;  2EBP A;  2KRO A;  2L0A A;  1GRI A;  2KT8 A;  1RI9 A;  2FPF A;  2O9V A;  1HD3 A;  2BZX A;  2C0I A;  4OMM A;  3UAT A;  1PRL C;  4Z88 A;  1WFW A;  2YDL A;  4AG1 C;  4CC2 A;  2DNU A;  1W6X A;  5I22 A;  4Z89 A;  3JV3 A;  1M3A A;  2DRM A;  2QDL A;  4EIK A;  4JZ4 A;  1RUW A;  3M0R A;  1KFZ A;  1GCQ A;  1QWE A;  2O88 A;  1YP5 A;  2B86 A;  4LUD A;  1AWX A;  2LJ3 A;  2VVK A;  4M4Z A;  3VRY A;  2DYB A;  2RNA A;  2YT6 A;  2LP5 A;  1UHC A;  3EG3 A;  2DRK A;  4KRT A;  1E6H A;  1QLY A;  3ZL7 C;  3TVT A;  3QWY A;  2DMO A;  2DL7 A;  4AFZ C;  1OEB A;  1RLP C;  1K1Z A;  4D8K A;  1H92 A;  1OPK A;  3EG0 A;  1NEB A;  2EYY A;  1OOT A;  4FSS A;  1U3O A;  1M30 A;  2CT4 A;  2KR3 A;  2JM8 A;  2XMF A;  1ABQ A;  1X6G A;  2BZ8 A;  2D8H A;  2K2M A;  2HCK A;  1I0C A;  1U5S A;  3VS5 A;  1UE9 A;  1X2Q A;  1BBZ A;  2DX1 A;  1MV3 A;  1WXU A;  2DL8 A;  1NG2 A;  2BZY A;  4J9D A;  2CSI A;  3EHR A;  2AKK A;  2PNI A;  2L3P A;  3H0H A;  4LUE A;  2JT4 A;  1WIE A;  1T0H A;  1K9A A;  3REB B;  3H41 A;  2CSQ A;  2LQW A;  2DA9 A;  2D1X A;  1PKT A;  2X3W D;  4CC3 A;  2DL5 A;  2LCS A;  2J6O A;  2SRC A;  4LN2 A;  1UHF A;  3VS3 A;  3PE0 A;  3H0I A;  1M3B A;  1SEM A;  4D8D A;  5IHN A;  5I11 A;  1ZUK A;  2AK5 A;  2NUZ A;  5GJV B;  1NYF A;  2GBQ A;  3QWX X;  5L23 A;  2YUQ A;  5FWB A;  1X2K A;  1UTI A;  4CC7 A;  2MCN A;  1TG0 A;  1U06 A;  1AD5 A;  1HSQ A;  2BTT A;  1W1F A;  2HBW A;  2W10 A;  1Z9Q A;  1ZUU A;  5IXF A;  1BK2 A;  4LNP A;  1NM7 A;  5IH2 A;  1E7O A;  2ED1 A;  4RTW A;  1WA7 A;  2FO0 A;  1WXT A;  2FG0 A;  2DE0 X;  2X3X D;  1M8M A;  1AWJ A;  1Z9Z A;  4J9C A;  2NWM A;  5FWC A;  1UJ0 A;  3REA B;  2V1R A;  2JS0 A;  1UFF A;  5EC7 A;  4RTT A;  2V1Q A;  2VWF A;  3UA7 A;  2EYW A;  1JXM A;  2EGE A;  1T0J A;  1GCP A;  1SRM A;  2MOX A;  2KNB B;  4AFS C;  1ZSG A;  2KYB A;  1X27 A;  2C0T A;  1QKW A;  1IO6 A;  1KSW A;  2EQI A;  3FJ5 A;  1LCK A;  1FYN A;  2EYX A;  4RTV A;  4A63 B;  2ROL A;  4IIM A;  4LE9 A;  2K7A A;  4WCI A;  1NEG A;  2LX7 A;  2DF6 A;  4HVV A;  1PHT A;  2SEM A;  1GBQ A;  3M0T A;  1VYV A;  2ENM A;  3EGU A;  2EKH A;  1ZLM A;  2RN8 A;  4J9B A;  1M27 C;  2KXC A;  2K3B A;  4ZNX A;  3VS2 A;  2J06 A;  2RPN A;  2C0O A;  1TUC A;  4F17 A;  2DL4 A;  1GFD A;  1YN8 A;  1MUZ A;  2JXB A;  2MIO A;  4OMO A;  3NHN A;  3LH5 A;  2O9S A;  3M0Q A;  4JJD A;  2D8J A;  4J9F A;  1ZBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...