4OMPA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128k
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGKTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ompA00
2KXDA 1SEMA 1KIKA 5FWCA 1SHGA 1SPKA 1ZUYA 2J6OA 1H8KA 5IXFA 2LNHB 4OMMA 2M0YA 2G6FX 1OPLA 1SHFA 1AWOA 2C0IA 3M0SA 1OEBA 2EYYA 3VS7A 4ORZA 3R6NA 4CC2A 2D1XA 4D8KA 1M27C 2DRMA 2YDLA 2BTTA 1T3LA 1X6GA 2DL5A 1TUCA 2LJ0A 1WFWA 3H41A 1GBQA 1JU5C 1ZBJA 2CT4A 1HD3A 1K9AA 4RTVA 1AWJA 2DM1A 2FEIA 2YUOA 4K11A 1WA7A 1PKSA 3I5SA 2FPFA 1YCSB 2JM9A 1UECA 2FPEA 2O9SA 2CUDA 1ZSGA 3JV3A 4EIKA 3SHWA 1NM7A 2KNBB 2FRWA 3EGUA 2ENMA 2DNUA 4JJBA 2PNIA 2AZSA 4RTUA 2J7IA 2ROTA 3UF4A 3I9QA 5I11A 1Y57A 1U06A 2D8JA 4OMNA 2RMOA 1E7OA 3UA7A 2DL4A 2EW3A 1OOTA 1WLPB 2M51A 2ESWA 1X2QA 3IQLA 4Z88A 1I0CA 2K9GA 3NPFA 3I35A 1S1NA 1K4US 1K76A 1YN8A 3VS0A 4HVVA 2LCSA 1PRMC 4HCKA 1BBZA 3VS3A 1U5SA 1GRIA 4AFZC 3NHNA 2VKNA 2YT6A 1ZUUA 1NYFA 1MV0B 1RLQC 4LE9A 2L3SA 2CSIA 2GQIA 1UHFA 2XMFA 1ZX6A 4LN2A 1G83A 1FYNA 4AFQC 3EG2A 4ESRA 2A37A 4JJCA 1U3OA 3CQTA 3EHQA 4OMPA 1JXOA 2F2XA 2L2PA 1AEYA 5GJVB 4AG1C 3REAB 3ULRB 2J6KA 2FPDA 3C0CA 1WYXA 2HSPA 2CREA 2KRNA 3NGPA 4J9IA 5EC7A 2EKHA 4F17A 3O5ZA 2IIMA 1UJYA 2X3WD 4RTZA 2V1RA 4AFSC 1T0HA 4WCIA 1JXMA 1RUWA 4RTXA 3VS5A 2DL3A 2NWMA 1E6HA 4IIOA 2JTEA 2HEQA 2ED0A 2LMJA 2OAWA 1QKXA 2JMAA 3QWXX 2A28A 2K3BA 2D0NA 2AKKA 2DL7A 1W70A 4ZNXA 2X3XD 1QKWA 1QWFA 2CSQA 2EBPA 2LP5A 3QWYA 2HDAA 1NLOC 1UFFA 2SRCA 2YUPA 2EYZA 2LQNA 5IHNA 2K6DA 1H92A 2LQWA 1K0SA 4RTTA 3M0TA 3U23A 1T3SA 2NUZA 4LUEA 2ABLA 4LUDA 3H0IA 1K1ZA 2MCNA 1AZEA 2YUNA 1WXTA 3VS4A 2E5KA 2EYWA 1PRLC 2ECZA 3ZL7C 1M3BA 5FW9A 3VS1A 2MOXA 4GBQA 2EYXA 1NYGA 2F2WA 1UHCA 2SEMA 2DL8A 4GLMA 5IXBA 4CC7A 4F16A 2J05A 2B86A 1JEGA 2RQUA 1MUZA 3PE0A 2V1QA 2DA9A 2J06A 2KGTA 2F2VA 4OMLA 1TUDA 2AK5A 2KXCA 2JW4A 3KFVA 4LNPA 1ARKA 2O2OA 2RPNA 2O88A 1VYUA 2EGAA 4E6RA 1PNJA 1GBRA 2KT8A 2W0ZA 4M4ZA 2ED1A 2EPDA 5IHIA 2DE0X 2GGRA 2RQRA 1RI9A 2LX7A 1GCQC 2KRMA 1CKBA 4HVUA 2I0NA 1VA7A 2OJ2A 1LCKA 3THKA 4CC3A 1J3TA 3FJ5A 1WXUA 1PWTA 2EQIA 2KROA 3H0HA 2K2MA 1Z9QA 2CDTA 4IIMA 2EGEA 4J9HA 2RQTA 2RF0A 3REBB 1OPKA 2L3PA 1EFNA 1N5ZA 1G2BA 1NG2A 4HVWA 4R0KA 1X6BA 2PZ1A 2YUQA 2GNCA 2BZXA 3RBBB 3SEMA 2KYBA 4DEYA 1Y0MA 1UJ0A 1BK2A 1H3HA 2FG0A 3UA6A 3M0PA 5FWBA 1AWXA 2CT3A 1GL5A 1AVZC 1X69A 2D8HA 3TVTA 4JJDA 2DBMA 2DMOA 3PVQA 3VS2A 1SSHA 1FMKA 4JPBW 4RTYA 5IH2A 3TSZA 2VWFA 1ABOA 1B3QA 1GFCA 1QCFA 3TSWA 2HCKA 1T0JA 3LH5A 2GTJA 1WX6A 3NMZC 1NEGA 2AZVA 2YSQA 3M0UA 1KJWA 1W6XA 1HJDA 3VRYA 2DVJA 1CSKA 1AD5A 4AFUC 5GJWB 1AOJA 2O9VA 4RTWA 4J9GA 1UUEA 2CUBA 2KRSA 1KSWA 3RNJA 3M0RA 1AZGB 1WXBA 4D8DA 1JO8A 3H0FA 2OI3A 1KFZA 1WIEA 2DBKA 1RLPC 2CH4A 1PKTA 3EG0A 2C0OA 1W1FA 5HCKA 2A08A 1JQQA 2MIOA 2J6FA 3M0QA 1UTIA 1A0NB 1AWWA 2L0AA 1K0XA 2RQVA 2GBQA 1ZUKA 1M3AA 1TG0A 2FO0A 5I22A 2KR3A 2DLPA 1M30A 1PHTA 2RN8A 2H8HA 2A36A 2KT1A 4J9BA 1X43A 2HBWA 4HXJA 4DEXA 2VVKA 4J9CA 1HSQA 4RUGA 1BB9A 2JS2A 2BZYA 2DYBA 4JZ4A 1VYTA 4Y92A 1Z9ZA 2KYMA 1GCPA 2PTKA 4A63B 2KEAA 4JZ3A 2LJ3A 2K7AA 1IO6A 2LZ6B 1I07A 2O31A 1QLYA 2JM8A 1UG1A 1UE9A 3EG1A 4J9DA 1CKAA 4CC4B 4F14A 2DRKA 1GCQA 1YWPA 1X2KA 2KE9A 3EHRA 2EGCA 3PVLA 1V1CA 2RNAA 1M8MA 2C0TA 3VS6A 5IHKA 4Z8AA 2RQWA 1QWEA 4Z89A 1SRLA 1YWOA 2K79A 2CH4W 2BZ8A 1OV3A 2P4RA 1NEBA 3UATA 2EVRA 2JS0A 2ROLA 1YNZA 4OMOA 3I5RA 1GFDA 3A98A 2GTOA 1YP5A 2AKLA 4FSSA 1NLPC 1M3CA 2L3QA 2FRYA 4X1VA 4KRTA 1BU1A 4J9FA 1ZLMA 2JXBA 2JT4A 2DILA 4AG2C 3EG3A 4J9EA 5L23A 1MV3A 3GBQA 2W10A 3VRZA 1E6GA 1B07A 1I1JA 2DJQA 2DX1A 5ECAA 2DF6A 1SRMA 4OMQA 1X27A 4QT7A 2QDLA 1UDLA 1WI7A 2LJ1A 2KBTA 1XOVA 1WDXA 2JMCA 1ABQA 1UGVA 1VYVA
chains in the Genus database with same CATH superfamily
1SEMA 2M02A 4C8QF 3TEEA 3NTIA 3OY9A 1ZUYA 2E5QA 3E9FA 1YI2T 3HFNA 1YITT 4YTLA 3VKIA 4B9XA 4FYVB 3M58A 3META 1C0MA 3VYGA 5CCAA 1VQNQ 1T3LA 1HK9A 3JCMb 2ZPIB 1N27A 4F7UE 5LJ3e 3H41A 2XIDA 2OTLT 1QMCA 1TH7A 4C5HA 5KYWB 3OA6A 3CCRQ 1AWJA 1WA7A 4QQ6A 4XK8E 1QVPA 2FPFA 3JCMc 5A0GA 4XTZA 2JM9A 2EQMA 3GP8A 2B8AA 3WVEB 3MEVA 4EMKC 3M56A 1S72T 1RI0A 2ENMA 1K73U 1KD1U 2ZCFB 1WQWA 3A8MB 3CCJT 2WACA 3UF4A 3I9QA 3I56Q 1YHQA 2HAXA 2YRCA 4AT1B 2D8JA 4EMKA 1E7OA 1RAIB 3UA7A 2QQ9A 2DL4A 1QCNA 2EW3A 1MGQA 4JRQA 1VQ6A 1G3SA 2ESWA 1X2QA 4JLGA 4PJJA 1I0CA 2FHDA 4MZTA 4XTWA 1S1NA 3VS0A 2MF2A 2QGGA 1BI1A 1MNDA 4HVVA 2LCSA 1PRMC 4BY6B 5KYUB 2EIFA 3SDZA 3D7SB 2QA4T 3CCUT 1QVFA 1GRIA 3NHNA 2VKNA 4M7AG 2ZPBB 2YT6A 5D6WA 2RK1A 1M2VA 5GAN4 4Y28E 1YJ9T 1M90U 3V8LA 5FU7C 3GOXA 1U3OA 3M59A 4N4IA 2DZ9A 3CQTA 1NJIC 5FLXE 1JXOA 4M78D 1WJRA 4DBRA 2J6KA 1YJWQ 2HSEB 4J9IA 4AMCA 1KQ1A 2EKHA 4FIBA 4QQGA 2IIMA 4RTZA 4XQ3A 3QHSA 3CPWS 1T0HA 2BKDN 2E6ZA 4RTXA 3CD6A 5GMKl 4IIOA 2MAMA 5IT9E 2ED0A 3QWXX 2FYKA 2D0NA 3HHTB 1NPPA 1BI2A 2XKOC 1W70A 4ZNXA 3FB9A 2RH2A 1OZ2A 1VQ9Q 1VQ7T 2LP5A 4C92C 2HDAA 5IHNA 2LQNA 5LJ5d 1WQ7A 2LQWA 4E7KA 2E6NA 4RTTA 2R58A 2QI2A 4LUDA 3M4YA 2AHJB 3MP8A 1AZEA 5GAOp 4C92A 2WSFE 2E4HA 5HKCA 5FW9A 5KCOA 4M7DC 3CCLA 2ZPEB 2EYXA 1H3ZA 1KD1R 6AT1B 4M75E 4PJOB 1B34A 4C8QG 1G5VA 4F16A 4RCBA 2BIVA 5GANf 2V8KA 1O9SA 5GANg 2X35A 4M77C 4M7DA 2FZCB 4OMLA 3EG9B 2AK5A 1IGQA 2JW4A 3CPWA 2RPNA 5LJ5h 4E6RA 3SFMA 4R55A 2ED1A 2EPDA 2YLBA 3OS2A 4M77A 3VUBA 2DD4A 1RI9A 3OYLA 1R77A 1GCQC 1YHQT 3BY7A 4PJOF 3S6WA 3V8KA 2I0NA 1VA7A 3THKA 3H0HA 5HK3A 3E19A 2EGEA 2X51A 5A0LA 2L3PA 1M90R 1EFNA 1G2BA 2HQXA 5GAN2 2YUQA 3MP6A 2RA2A 2BZXA 4ELZC 3SEMA 2DVEA 1Y0MA 3JCMV 1VQOT 2ZAEA 1D09B 4PJLA 3M0PA 3P8HA 5FWBA 2CT3A 1Y71A 1GL5A 2DIQA 4XTXA 1X69A 2EFIA 5GMKe 3JB9I 1MNEA 3CXCP 2M16A 2DFUA 2HQHA 4RTYA 1VQ5A 2LQKA 2VWFA 2NUTA 1UB4A 1QCFA 2NYSA 1T0JA 3LH5A 1WX6A 3BDLA 1NEGA 2YSQA 4J83A 4ME7A 4N4HA 4LDWA 2DVJA 3EAEA 3CC4Q 3JB9F 2O9VA 3OW2P 1JJ2P 1Y07A 4KT0E 3CMET 5GAMd 1KSWA 4HA8A 5GMKj 3CCMQ 3WXMB 4XTVA 1QW1A 1AZGB 1WXBA 1JO8A 3EH2A 1KFZA 1OYXA 1RLPC 1PSFA 2LT1A 1BIBA 1W1FA 2A08A 2O01E 4RG2A 3H8ZA 2PQWA 2J6FA 2HKNA 4F04B 1UTIA 5A2QE 3L2RA 2CZ7B 3HPWA 4JLIA 2COZA 2GFUA 1M3AA 1QVGA 2VXFA 4A53A 5I22A 3OYMA 2RJEA 2PU9B 4F7UA 3CC2Q 2RN8A 1VQ5Q 2HL3A 4L59A 4M78B 5GAMh 1D1CA 2HBWA 4CRIA 3JCMe 2VVKA 3FDRA 3O8VA 3QJYA 3ZFJA 4J9CA 2XG8D 3KXTA 4OB0B 3MEWA 2E1HA 2KYMA 1KK7A 2QAZA 1GCPA 4IUUA 2KEAA 2RM4A 1IO6A 3M53A 1PM3A 3G4SA 2DETA 2PVOB 5FU6B 1SF9A 2E41A 4M78F 3CXCS 4E7LA 1WPYA 4J9DA 4C5IA 2RB6A 1CKAA 4FYXB 2PVDB 2RNAA 3GLXA 2C0TA 4OB3B 1HYOA 3VS6A 5CAIA 3CCET 4BE0A 3H6ZA 4Z89A 2DXUA 1YWOA 1Q81C 2QQRA 2BZ8A 7AT1B 1NEBA 3UATA 5L8RE 4FT2A 2JS0A 4LDXA 2NUPA 4OMOA 1WHMA 1C6VX 3C12A 4NL3A 1K9MU 4JJNK 5I21A 4PJOG 1V29B 3GNGA 3UPUA 2FRYA 2ZPHB 4KRTA 4X1VA 5KCHA 2JUFA 2L3RA 5GAOq 1VQKT 2DILA 2YHTA 5LJ3g 1P92A 2P84A 3PIOA 5L23A 3DLMA 2W10A 3VRZA 3OYEA 1B07A 5ECAA 2DF6A 3CC7A 2KI7A 3FIFA 4QT7A 1FWZA 1WI7A 3QXEB 1VIFA 4P5NA 2JMCA 4R56A 1ABQA 1UGVA 2IPOB 3A8LB 1B7TA 1KIKA 1SPKA 1H8KA 5IXFA 2RHZA 4OMMA 3MPUB 2G6FX 1B34B 5I2SA 1SHFA 3DB3A 4JUVA 4A54A 1G8XA 2COYA 1SSFA 3R6NA 1M8VA 2D1XA 4D8KA 2OAUA 1RABB 2OTLA 2DRMA 2DJZA 3HP9A 2K5FA 2I2LA 2WSEE 3QPHA 2IG0A 3E1SA 3JB9G 1QP2A 5GAN3 2PUOB 1QP3A 3CCVQ 2MYSA 2CT4A 1UGQB 4JS4A 2YUOA 4M75A 5CVIA 1PKSA 3I5SA 3MEUA 5CK9A 4J5YA 3ER0A 1YCSB 1UECA 3CC7Q 2CUDA 1DJ7B 1D1AA 4KUDK 2JNGA 3JV3A 2L8DA 2DTOA 1NM7A 4M77E 1YI2Q 1YITQ 2FRWA 3EGUA 3OBWA 2P0QA 2AZSA 4RTUA 1QVFP 5I11A 1VQ4T 1N9SA 2QGFB 2RHIA 4XAXB 2RMOA 2R5MA 1TS9A 2XK0A 3JCMX 2M51A 2OTLQ 1I4K1 1RADB 1MMNA 3IQLA 2K57A 4Z88A 2K9GA 1Q82C 2QA4A 1K9MR 2E12A 3CCUA 2K2VA 3BDUA 2ZPGB 2VV5A 4HCKA 4XTYA 4J6XA 1KC8U 1VOMA 2RK2A 2HNIA 2EJGA 1YJ9A 2DYIA 3G6ET 1NYFA 1MV0B 2CP7A 1S72Q 4DBHA 2L3SA 2DZCA 3CC7T 1XNIA 1D3BA 4M78G 3CCJQ 1BYMA 4QVZA 3TQ7P 1G83A 4C0FA 3QO3A 2CP5A 3L2UA 2OTJT 2XU8A 3L1AA 4ZGDB 1M1KU 4OMPA 2F2XA 2XHCA 3N5BB 1AEYA 5GJVB 2YWWA 3OQ5A 3ULRB 2HMAA 1ZBXA 2FPDA 1VQLQ 2CKKA 3NGPA 3EGXA 3CBMA 1Q86U 1OX8A 1NBEB 4F17A 3RMQA 3LLRA 4AFSC 2V1RA 4GLKA 1YIJT 3NFCA 4WCIA 1JXMA 3UDCA 3CCUQ 3HL8A 1VQ7A 3EFOA 2A28A 2DIGA 4C8QE 3QYGB 4CI0C 3QIIA 1M9SA 2YUPA 1NLOC 1UFFA 2Y4YA 1LJOA 3RERA 5KYYB 1TTHB 3ZBDA 1VQMT 2ABLA 4J7FA 3VS4A 1QVFS 1Q7YU 4OB1B 4PKCC 4KGXB 3CPWP 4NL2A 4ATOA 2JOYA 3QKJA 5CKBA 1VIEA 2ECZA 3ZL7C 2IVWA 1UGSB 3L2VA 3CCQT 3R6OA 4GBQA 1RAGB 3JB9D 3CPFA 5AT1B 1NYGA 5LJ5e 2DL8A 5IXBA 1N8RC 5EG2A 4CC7A 1V76A 2B86A 2DD5A 2FB7A 4J6YA 3LGFA 2V1QA 5CIUA 2KGTA 3QUIA 2DXTA 3OYBA 5LJ3j 1ZHIA 1D0ZA 1TUDA 4J7IA 4LNPA 1KQSS 5KYNA 2HZYA 2KT8A 2QTXA 3DLLA 1RAAB 3NTHA 4O5VA 1BI0A 2LVMA 3LX7A 1KC8R 3CMAA 5IN1A 3V7RA 3DB4A 4CC3A 3FJ5A 4OB2B 4IIMA 4J9HA 2DTIA 3GF5A 4EMHA 1VQOA 2HD0A 4HVWA 1X6BA 2LT4A 5KYXA 1KG1A 3DKMA 1M1KR 2M9UA 1BK2A 4A4FA 1TSFA 1OULA 4HCBA 2FG0A 1I5LA 5GAOn 5GAN7 1Q86R 1M4ZA 2XI9A 3A5ZB 3PVQA 2F1LA 2RD1A 2F69A 3VS2A 1FMKA 1YHQQ 5IH2A 3TSZA 1ZQ1A 1KQSA 1B3QA 3TSWA 4EMGA 2HCKA 1VQ6Q 3VYHB 3CMEA 3NMZC 1VQNT 1YBYA 2DK3A 1ACMB 1W6XA 1HJDA 1TWBA 2R57A 5I2MA 3JCMf 4FW1A 5GJWB 3OBYA 3JCMg 3RR6A 2CUBA 2KRSA 1QVGP 3CCRT 4C0DC 3M0RA 4N0AC 3JSCA 1Q7YR 3H0FA 2OI3A 1WIEA 3X25B 3JCMW 2DBKA 2LX9A 2RHXA 2H3EB 1PKTA 3EG0A 3EFRA 4M75B 5HCKA 3L2ZA 1WGSA 3J7AF 4N0AA 1RAHB 5GAMe 1AWWA 2A0FB 2OX7A 2GCXA 1ZUKA 2JZ2A 3I56T 1XJWB 1TG0A 2KR3A 1RL2A 1Y96A 1K73R 1N6AA 3LWIA 3WVDB 2A36A 2KT1A 1I8FA 2E3IA 2X4WA 4HXJA 4DEXA 2QQSA 3CD6Q 4M75F 4ZGJB 3HTRA 2K5IA 1YJNA 4ZGEB 3A8OB 8AT1B 4M7AC 2BZYA 2DYBA 5J3BA 2BE7D 4ZN3A 4E2FB 5GAOm 4LD6A 4JZ3A 3PTAA 4E47A 2K7AA 1G3TA 2LZ6B 2VGNA 4A4GA 2X4YA 2E10A 1UE9A 2L5QA 1WHHA 2CYZB 4J8OA 8ATCB 4C92D 4PJOE 3CCEA 3CMAT 2DRKA 1D3BB 3S3NA 1GCQA 2X9HA 1X2KA 3PVLA 1V1CA 3CCLQ 1BI3A 1M8MA 4NOYA 4L6V5 4LDVA 5IHKA 2AIRB 1MHNA 5D6YA 2P0PA 3RKXA 4LDYA 2DERA 4M7DD 2CH4W 2P4RA 3VUZA 2LTOA 1ZSZC 1QVGS 1Q95G 3A98A 3SWNC 5FRNA 1YP5A 2MPXC 2VUBA 4M77D 5GAN8 1VQKA 1NLPC 1M3CA 2ATCB 4KH1B 4OMFB 4BDYA 1ZSZA 1VQ9T 3BE3A 5GAN5 3SWNA 1MMDA 3J80E 2JT4A 4QKUA 1IXDA 2QTVA 4J9EA 4Z02A 2HBPA 3FRNA 4FCYA 1MV3A 3J81E 2CZ6B 1E6GA 2DJQA 1I1JA 3CCEQ 2DX1A 2FL7A 3OYCA 1X27A 2MI6A 5KH6A 4C8QC 3OYJA 1UDLA 2X4XA 2LJ1A 3OYAA 2KY9A 1PSEA 4BB7A 1VYVA 2KXDA 4BUGA 1UGPB 5FWCA 1SHGA 1Q7YC 2J6OA 1R8OB 2XDPA 4C8QA 2LNHB 2R5AA 1OPLA 5CKEA 5HY6A 1AWOA 2C0IA 1QQJA 2YLCA 3VS7A 4CC2A 2K3XA 3OSSC 4RG8A 1M27C 4C5GA 2YDLA 2BTTA 2GFAA 4E7SA 4ELYC 2DL5A 1I5OB 1WJSA 1MMAA 1WFWA 4WTOB 1GBQA 3EFSA 1RAFB 1VQ8A 3EGDA 1KD1C 4EMKB 1K73C 4PL6A 1K9AA 4A4HA 4RTVA 3OSVA 4K11A 1W2BS 4FYYB 5CKDA 1VQPT 4HCZA 4L5GA 2FPEA 4ZN1A 1YJNT 2KK4A 4EIKA 2LRQA 2EYQA 4EPCA 1VQ4A 3M5AA 2HL5C 1TUGB 2A7YA 2E65A 1M2VB 4MMLA 5KYWA 1Y7XA 3QYHB 3I55A 1OOTA 3PIPA 3OS5A 4RCCA 1OZ3A 4DQ2A 4M75G 3NPFA 2YRVA 3I35A 1M90C 4FT4A 1M2OA 2DKGA 2DEUA 2RJDA 3G6EA 1RACB 3C95A 5FU7B 1KQ2A 4BI3A 1BBZA 3CC4T 3VS3A 1U5SA 4OGCA 5FRMA 4II1A 2OTJA 4IUTA 4HCCA 1W2BA 3MP1A 4RMOA 2CSIA 2O4XA 2XDBA 2GQIA 2XMFA 4D6WA 2VB6A 1ZX6A 4FM4B 4LN2A 4AFQC 2JTMA 4JRPA 4HKEA 5LJ3f 1IRXA 2JVVA 4ESRA 2A37A 3G4SQ 3CBPA 4FL6A 1WHJA 1OI1A 4AG1C 3REAB 1YIJA 1WYXA 4BE2A 4OP0A 2YXYA 1WJQA 2QXFA 2HSPA 2CREA 2DXCA 5EC7A 2RHUA 3VJPA 1IREB 3O5ZA 1FMWA 2X3WD 4PK4A 4C92B 5FROA 3CC2T 1RUWA 1BCOA 2NWMA 3H9NA 4JRIA 1E6HA 2JTEA 2HEQA 4DBFA 2LMJA 4DA4A 2OAWA 1NJIU 2JMAA 4MDXA 2K3BA 2AKKA 3L2WA 2DL7A 3QBYA 2JTFA 4DOWA 1QWFA 4KGZB 1VQMA 4M7DB 2SRCA 1G3YA 1K0SA 1WHGA 3M0TA 1T3SA 2NUZA 4LUEA 4FYWB 3CCQA 1K1ZA 2YUNA 4C92F 1FXXA 3CCSA 2E5KA 3OB9A 2EYWA 4M77B 3JCMd 1PRLC 2LCCA 3QZ9B 4BD3A 3Q1JA 4MZMA 3M4GA 3OYNA 1VQ8T 4A4EA 2VC8A 2F2WA 4E7JA 1UHCA 2XDDA 4QVDA 2SEMA 3BW1A 5HK0A 4M7DF 1MUZA 3PE0A 3G7ZA 2DA9A 2K3YA 2KVQG 3P8BB 3OYGA 2KXCA 3V7CA 4M7AE 2O88A 1VYUA 4X34A 2L89A 1PNJA 4M77F 2KAFA 4PJOC 4M4ZA 4ZTFA 1PG5B 2QQBA 3HKSA 2DE0X 1VQMQ 3INZA 1M1GA 3JCMh 2RQRA 2LX7A 2KRMA 1G3WA 4A4KA 2OJ2A 2VXEA 5GANd 3A1PA 3S3OA 3LH0A 4PJOA 1J3TA 3I55T 1PWTA 2GF7A 1BIAA 3SD4A 1Z9QA 4PFZA 1XTDA 2NUTB 2RQTA 2Z0WA 2QK0A 4M75D 4OF1A 5LL6S 1IGUA 4J6WA 1KQSP 2GNCA 5KE3A 3QSUA 2KYBA 4DEYA 5C6SA 2Y90A 1UJ0A 4BACA 3VU3C 2M1HA 4XTUA 2LC4A 3UA6A 4BI4A 1AWXA 1EIFA 1AVZC 2CS7A 2DMOA 2V8JA 1SSHA 2EKOA 4C0ZA 5GANh 1LPLA 1VQNA 2QASA 3OMGA 4IURA 1ABOA 5GMKi 1TOVA 4LXCA 1OU9A 2RJFA 4IUVA 2CP3A 3M0UA 1KJWA 2CGHA 3X28B 3CCRA 2LQ8A 2QA4Q 3VRYA 4KBMB 1D0YA 2JN0A 4F7UB 2K5LA 1K8AU 4J9GA 3CCVT 4PFPA 2EQKA 2RHYA 3FEOA 3EGDB 1MMGA 1TXQA 2VGMA 1YJ9Q 1SG5A 5J39A 1R0CB 2CH4A 2GQVA 2C0OA 3HFOA 1JQQA 3BFMA 3M0QA 3I56A 1A0NB 3OS1A 1EX4A 1M5Q1 2L0AA 2MK5A 3LGLA 1IHVA 3G71T 2GBQA 4F7UF 1WNLA 3NTKA 3CCST 2FO0A 2BUDA 2DLPA 4JRKA 4OVAA 1PD1A 4KGVB 2H8HA 4J9BA 2JJ9A 1X43A 1NE8A 3GPLA 1HSQA 4RUGA 1VQ7Q 2QQAA 1BB9A 4JZ4A 4Y92A 2YRDA 3PFSA 3ZEHA 4A63B 3V8JA 4M78C 4C92G 5LJ5j 2CZ1B 2NUPB 3X24B 1I07A 2O31A 2JM8A 1D1BA 1AT1B 1UG1A 4DOVA 4IKFA 1X6OA 3RESA 5CQXA 4X9DA 2MMPA 1D0XA 4M78A 5D7UA 4F14A 4CC4B 5GAOr 3A8GB 1YJWA 1C1AA 2O4XB 1YWPA 3EHRA 2EGCA 1K9MC 4M7DG 2FVUA 1EZZB 2QEXT 1GXIE 4Z8AA 2RQWA 1QWEA 5FU6C 2BE9B 2DEQA 2EQUA 2K4YA 1VQLT 1KHCA 2K79A 2CP6A 2VYTA 1JRIA 3E9GA 3ME9A 4C5EA 4M77G 2D6FA 2ROLA 4XU3A 3I5RA 2GTOA 1VQ9A 2KQWA 4MMKA 1YFNA 2AKLA 4FSSA 2A3LA 3OYIA 2L3QA 1OU8A 1BU1A 1K8AR 1Q81U 1KHIA 3CMAQ 3KUFA 3EG3A 4WF2A 1QCOA 3FJPA 3X26B 1OQKA 4Y91A 3GBQA 9ATCB 1JB0E 4OMQA 1VQOQ 2KBTA 1XOVA 4O6JA 1WDXA 3PT9A 2WSCE 1N9RA 5A0DA 5LJ3d 2X4JA 2M0YA 4E7IA 3OYHA 2H3JA 1UGRB 3M0SA 3P8DA 2CZ0B 1OEBA 2EYYA 4ORZA 1ZA1B 2LNVA 3RIRA 3C94A 3JRZA 3QG1A 4PJNA 4B9WA 1OX9A 5GAOl 1X6GA 1TUCA 2LJ0A 5GMKm 1XQHA 3TCJA 1JU5C 1ZBJA 3CMEQ 1VQPA 1HD3A 2DM1A 2FEIA 1NZ9A 2RI5A 1O75A 4QW2A 5GAMj 2VASA 2MWOA 3RUXA 5LJ3h 2O9SA 1ZSGA 3SHWA 2KNBB 1I81A 3QZ5B 4M7AA 5DLQE 2DNUA 4JJBA 2PNIA 4F7UG 2J7IA 2ROTA 1Y57A 1U06A 1KC8C 4OMNA 3MJXA 4FW2A 2HQEA 1LNXA 1W2BP 2DTHA 1WLPB 3M9QA 2EQJA 4MDWA 1YJWT 4KUIA 5GAN6 2F5TX 3S3MA 3CC4A 1K4US 1VQ6T 1K76A 1YN8A 3MEAA 1ZA2B 5DM7R 1VQPQ 4HT8A 1M1KC 3OYDA 3CCMA 1Q81R 3EGXB 3JCMJ 1YJNQ 4AFZC 2C06A 1ZUUA 4N4GA 1W4SA 2LDMA 3T9NA 1RLQC 2FZGB 4LE9A 3EFOB 1Q86C 1Q82U 1UHFA 4M7AD 1FYNA 3EH1A 4JDSA 3EG2A 4JJCA 2XICA 5M9OA 2G3RA 3RKWA 3EHQA 1K8AC 2L2PA 4C0GA 4UC4A 2EWNA 3CC2A 2DAQA 3C0CA 2KRNA 4E7HA 4E7ZA 2ZGWA 1UJYA 3VS5A 2DL3A 1FX7A 2RI3A 3QJ6A 3L42A 1QKXA 3KBGA 2KDSA 2DPPB 3QDRB 2KMTA 4LDUA 3JAME 3CD6T 2X3XD 1QKWA 1BCMA 3MKDA 2CSQA 2EBPA 2EJFA 3QWYA 2EYZA 3G1JA 1VQKQ 2K6DA 4V2SA 1H92A 3MHXA 3U23A 4X9CA 3SB2A 3H0IA 2MCNA 1WXTA 2F5KA 3JB9J 1WHLA 3PMTA 1M3BA 1U1TA 3VS1A 2MOXA 3JCMP 3AT1B 4LD9K 3PMIA 4GLMA 4NS5A 3CCLT 1JEGA 2J05A 3X20B 2RQUA 1WHKA 2J06A 1IHWA 2ZPFB 2F2VA 4EDUA 2EJ9A 3GIBA 3HRSA 5KYYA 4C8QD 3KFVA 1ARKA 2O2OA 5KYXB 3TU4K 4KH0B 2XD0A 2EGAA 3RDVA 1SKUB 1GBRA 3OYFA 2W0ZA 1VUBA 2QG9B 4BE1A 5IHIA 3PNWC 4M78E 4TVRA 4Q5WA 1N8RU 3A8HB 2GGRA 3M54A 1CKBA 4HVUA 2AT1B 1LCKA 1FMVA 2DXBA 3LW5E 1WXUA 2EQIA 2KROA 2K2MA 1VQ8Q 2CDTA 3LWHA 1HXDA 2RF0A 3OMCA 3REBB 1OPKA 1Q82R 5DLOA 1NG2A 1N5ZA 4FU6A 4R0KA 4QVCA 2PZ1A 4HT9A 3RBBB 1X75C 2P4TA 5GANe 3CEYA 3CCMT 3MCAB 4GY5A 3FLGA 1H3HA 3OW2S 1JJ2S 1R0BG 4BY6C 1VQ4Q 2V26A 3HRUA 3VV0A 2D8HA 3TVTA 4JJDA 5KE2A 2DBMA 1RAEB 2FZKB 4JPBW 2D9TA 3MO8A 1IB8A 5KYUA 4VUBA 3C4SA 4C0DB 2M0OA 5LJ5f 2ZZDA 1GFCA 5LJ5g 3I55Q 5DY9A 4BDZA 2GTJA 2D0QB 5GANj 2AZVA 1VQ5T 3CCVA 5GMKh 3E2UA 1CSKA 1AD5A 4AFUC 1Y96B 1AOJA 3QDFA 4RTWA 5CKFA 5CO7A 3OYYA 4ZTJA 3G6EQ 1PD0A 1UUEA 1TU0B 3RNJA 3CXCA 1AHJB 3V7SA 5CR2A 4D8DA 3M55A 1YI2A 5C0MA 1YITA 1PCXA 2OTJQ 2QYZA 5AYFA 3UWNA 3G71A 3FC3A 2MIOA 4RKUE 2PVGB 3RKYA 3PGGA 2E64A 1K0XA 1LOJA 2RQVA 3OW2A 1JJ2A 4C92E 4M7AB 1YIJQ 1M30A 1PHTA 2E70A 4M75C 2Y4XA 3RMSA 3LYIA 4KULA 2EAYA 1PC0A 3M57A 2E3HA 4OGEA 5IAYA 4PFOA 1N8RR 4M7DE 4MZPA 3URGA 4IUPA 1BKBA 1X01A 2JS2A 1VYTA 1IZ6A 1Z9ZA 4PNOA 1WZOA 2CP0A 4DBQA 1NPRA 2PTKA 1S72A 3HRTA 4IUQA 1F1BB 3CBOA 2LJ3A 3CCJA 1JBMA 3L2QA 3OS0A 4M7AF 2DO3A 2QDYB 2RI2A 4PLLA 4PLIA 1QLYA 4FSXA 3AHUA 4BI8B 3G71Q 3CCQQ 4XU1A 3EG1A 3CCSQ 2QEXA 4B6MA 2NLUA 1LVKA 1H641 3G4ST 1ZSZB 2CP2A 1VQLA 2KE9A 3SWNB 3EG9A 2RJCA 1U8RA 3JB9H 3HSBA 4ANJA 1SRLA 5J26A 4PJMA 2PUKB 1OV3A 5D6XA 4XU0A 1YCYA 2EVRA 1YNZA 3OYKA 1GFDA 5CQYA 5GAMf 5GAMg 2RO0A 1U1SA 4XU2A 2HKQB 2P0KA 3JCMQ 1NJIR 4C8QB 3UT1A 4J9FA 1ZLMA 2JXBA 2V8IA 3ASKA 4PJOD 4AG2C 2COWA 2MWPA 3F70A 4JS5A 4QQDA 1M1FA 2QEXQ 2LCLA 1SRMA 2QDLA 2KSSA 3TREA 3GNFB 1UEBA 5CKHA
chains in the Genus database with same CATH topology
2KXDA 1SEMA 1KIKA 5FWCA 1SHGA 1SPKA 1ZUYA 2J6OA 1H8KA 5IXFA 2LNHB 4OMMA 2M0YA 2G6FX 1OPLA 1SHFA 1AWOA 2C0IA 3M0SA 1OEBA 2EYYA 3VS7A 4ORZA 3R6NA 4CC2A 2D1XA 4D8KA 1M27C 2DRMA 2YDLA 2BTTA 1T3LA 1X6GA 2DL5A 1TUCA 2LJ0A 1WFWA 3H41A 1GBQA 1JU5C 1ZBJA 2CT4A 1HD3A 1K9AA 4RTVA 1AWJA 2DM1A 2FEIA 2YUOA 4K11A 1WA7A 1PKSA 3I5SA 2FPFA 1YCSB 2JM9A 1UECA 2FPEA 2O9SA 2CUDA 1ZSGA 3JV3A 4EIKA 3SHWA 1NM7A 2KNBB 2FRWA 3EGUA 2ENMA 2DNUA 4JJBA 2PNIA 2AZSA 4RTUA 2J7IA 2ROTA 3UF4A 3I9QA 5I11A 1Y57A 1U06A 2D8JA 4OMNA 2RMOA 1E7OA 3UA7A 2DL4A 2EW3A 1OOTA 1WLPB 2M51A 2ESWA 1X2QA 3IQLA 4Z88A 1I0CA 2K9GA 3NPFA 3I35A 1S1NA 1K4US 1K76A 1YN8A 3VS0A 4HVVA 2LCSA 1PRMC 4HCKA 1BBZA 3VS3A 1U5SA 1GRIA 4AFZC 3NHNA 2VKNA 2YT6A 1ZUUA 1NYFA 1MV0B 1RLQC 4LE9A 2L3SA 2CSIA 2GQIA 1UHFA 2XMFA 1ZX6A 4LN2A 1G83A 1FYNA 4AFQC 3EG2A 4ESRA 2A37A 4JJCA 1U3OA 3CQTA 3EHQA 4OMPA 1JXOA 2F2XA 2L2PA 1AEYA 5GJVB 4AG1C 3REAB 3ULRB 2J6KA 2FPDA 3C0CA 1WYXA 2HSPA 2CREA 2KRNA 3NGPA 4J9IA 5EC7A 2EKHA 4F17A 3O5ZA 2IIMA 1UJYA 2X3WD 4RTZA 2V1RA 4AFSC 1T0HA 4WCIA 1JXMA 1RUWA 4RTXA 3VS5A 2DL3A 2NWMA 1E6HA 4IIOA 2JTEA 2HEQA 2ED0A 2LMJA 2OAWA 1QKXA 2JMAA 3QWXX 2A28A 2K3BA 2D0NA 2AKKA 2DL7A 1W70A 4ZNXA 2X3XD 1QKWA 1QWFA 2CSQA 2EBPA 2LP5A 3QWYA 2HDAA 1NLOC 1UFFA 2SRCA 2YUPA 2EYZA 2LQNA 5IHNA 2K6DA 1H92A 2LQWA 1K0SA 4RTTA 3M0TA 3U23A 1T3SA 2NUZA 4LUEA 2ABLA 4LUDA 3H0IA 1K1ZA 2MCNA 1AZEA 2YUNA 1WXTA 3VS4A 2E5KA 2EYWA 1PRLC 2ECZA 3ZL7C 1M3BA 5FW9A 3VS1A 2MOXA 4GBQA 2EYXA 1NYGA 2F2WA 1UHCA 2SEMA 2DL8A 4GLMA 5IXBA 4CC7A 4F16A 2J05A 2B86A 1JEGA 2RQUA 1MUZA 3PE0A 2V1QA 2DA9A 2J06A 2KGTA 2F2VA 4OMLA 1TUDA 2AK5A 2KXCA 2JW4A 3KFVA 4LNPA 1ARKA 2O2OA 2RPNA 2O88A 1VYUA 2EGAA 4E6RA 1PNJA 1GBRA 2KT8A 2W0ZA 4M4ZA 2ED1A 2EPDA 5IHIA 2DE0X 2GGRA 2RQRA 1RI9A 2LX7A 1GCQC 2KRMA 1CKBA 4HVUA 2I0NA 1VA7A 2OJ2A 1LCKA 3THKA 4CC3A 1J3TA 3FJ5A 1WXUA 1PWTA 2EQIA 2KROA 3H0HA 2K2MA 1Z9QA 2CDTA 4IIMA 2EGEA 4J9HA 2RQTA 2RF0A 3REBB 1OPKA 2L3PA 1EFNA 1N5ZA 1G2BA 1NG2A 4HVWA 4R0KA 1X6BA 2PZ1A 2YUQA 2GNCA 2BZXA 3RBBB 3SEMA 2KYBA 4DEYA 1Y0MA 1UJ0A 1BK2A 1H3HA 2FG0A 3UA6A 3M0PA 5FWBA 1AWXA 2CT3A 1GL5A 1AVZC 1X69A 2D8HA 3TVTA 4JJDA 2DBMA 2DMOA 3PVQA 3VS2A 1SSHA 1FMKA 4JPBW 4RTYA 5IH2A 3TSZA 2VWFA 1ABOA 1B3QA 1GFCA 1QCFA 3TSWA 2HCKA 1T0JA 3LH5A 2GTJA 1WX6A 3NMZC 1NEGA 2AZVA 2YSQA 3M0UA 1KJWA 1W6XA 1HJDA 3VRYA 2DVJA 1CSKA 1AD5A 4AFUC 5GJWB 1AOJA 2O9VA 4RTWA 4J9GA 1UUEA 2CUBA 2KRSA 1KSWA 3RNJA 3M0RA 1AZGB 1WXBA 4D8DA 1JO8A 3H0FA 2OI3A 1KFZA 1WIEA 2DBKA 1RLPC 2CH4A 1PKTA 3EG0A 2C0OA 1W1FA 5HCKA 2A08A 1JQQA 2MIOA 2J6FA 3M0QA 1UTIA 1A0NB 1AWWA 2L0AA 1K0XA 2RQVA 2GBQA 1ZUKA 1M3AA 1TG0A 2FO0A 5I22A 2KR3A 2DLPA 1M30A 1PHTA 2RN8A 2H8HA 2A36A 2KT1A 4J9BA 1X43A 2HBWA 4HXJA 4DEXA 2VVKA 4J9CA 1HSQA 4RUGA 1BB9A 2JS2A 2BZYA 2DYBA 4JZ4A 1VYTA 4Y92A 1Z9ZA 2KYMA 1GCPA 2PTKA 4A63B 2KEAA 4JZ3A 2LJ3A 2K7AA 1IO6A 2LZ6B 1I07A 2O31A 1QLYA 2JM8A 1UG1A 1UE9A 3EG1A 4J9DA 1CKAA 4CC4B 4F14A 2DRKA 1GCQA 1YWPA 1X2KA 2KE9A 3EHRA 2EGCA 3PVLA 1V1CA 2RNAA 1M8MA 2C0TA 3VS6A 5IHKA 4Z8AA 2RQWA 1QWEA 4Z89A 1SRLA 1YWOA 2K79A 2CH4W 2BZ8A 1OV3A 2P4RA 1NEBA 3UATA 2EVRA 2JS0A 2ROLA 1YNZA 4OMOA 3I5RA 1GFDA 3A98A 2GTOA 1YP5A 2AKLA 4FSSA 1NLPC 1M3CA 2L3QA 2FRYA 4X1VA 4KRTA 1BU1A 4J9FA 1ZLMA 2JXBA 2JT4A 2DILA 4AG2C 3EG3A 4J9EA 5L23A 1MV3A 3GBQA 2W10A 3VRZA 1E6GA 1B07A 1I1JA 2DJQA 2DX1A 5ECAA 2DF6A 1SRMA 4OMQA 1X27A 4QT7A 2QDLA 1UDLA 1WI7A 2LJ1A 2KBTA 1XOVA 1WDXA 2JMCA 1ABQA 1UGVA 1VYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXD A;  1SEM A;  1KIK A;  5FWC A;  1SHG A;  1SPK A;  1ZUY A;  2J6O A;  1H8K A;  5IXF A;  2LNH B;  4OMM A;  2M0Y A;  2G6F X;  1OPL A;  1SHF A;  1AWO A;  2C0I A;  3M0S A;  1OEB A;  2EYY A;  3VS7 A;  4ORZ A;  3R6N A;  4CC2 A;  2D1X A;  4D8K A;  1M27 C;  2DRM A;  2YDL A;  2BTT A;  1T3L A;  1X6G A;  2DL5 A;  1TUC A;  2LJ0 A;  1WFW A;  3H41 A;  1GBQ A;  1JU5 C;  1ZBJ A;  2CT4 A;  1HD3 A;  1K9A A;  4RTV A;  1AWJ A;  2DM1 A;  2FEI A;  2YUO A;  4K11 A;  1WA7 A;  1PKS A;  3I5S A;  2FPF A;  1YCS B;  2JM9 A;  1UEC A;  2FPE A;  2O9S A;  2CUD A;  1ZSG A;  3JV3 A;  4EIK A;  3SHW A;  1NM7 A;  2KNB B;  2FRW A;  3EGU A;  2ENM A;  2DNU A;  4JJB A;  2PNI A;  2AZS A;  4RTU A;  2J7I A;  2ROT A;  3UF4 A;  3I9Q A;  5I11 A;  1Y57 A;  1U06 A;  2D8J A;  4OMN A;  2RMO A;  1E7O A;  3UA7 A;  2DL4 A;  2EW3 A;  1OOT A;  1WLP B;  2M51 A;  2ESW A;  1X2Q A;  3IQL A;  4Z88 A;  1I0C A;  2K9G A;  3NPF A;  3I35 A;  1S1N A;  1K4U S;  1K76 A;  1YN8 A;  3VS0 A;  4HVV A;  2LCS A;  1PRM C;  4HCK A;  1BBZ A;  3VS3 A;  1U5S A;  1GRI A;  4AFZ C;  3NHN A;  2VKN A;  2YT6 A;  1ZUU A;  1NYF A;  1MV0 B;  1RLQ C;  4LE9 A;  2L3S A;  2CSI A;  2GQI A;  1UHF A;  2XMF A;  1ZX6 A;  4LN2 A;  1G83 A;  1FYN A;  4AFQ C;  3EG2 A;  4ESR A;  2A37 A;  4JJC A;  1U3O A;  3CQT A;  3EHQ A;  4OMP A;  1JXO A;  2F2X A;  2L2P A;  1AEY A;  5GJV B;  4AG1 C;  3REA B;  3ULR B;  2J6K A;  2FPD A;  3C0C A;  1WYX A;  2HSP A;  2CRE A;  2KRN A;  3NGP A;  4J9I A;  5EC7 A;  2EKH A;  4F17 A;  3O5Z A;  2IIM A;  1UJY A;  2X3W D;  4RTZ A;  2V1R A;  4AFS C;  1T0H A;  4WCI A;  1JXM A;  1RUW A;  4RTX A;  3VS5 A;  2DL3 A;  2NWM A;  1E6H A;  4IIO A;  2JTE A;  2HEQ A;  2ED0 A;  2LMJ A;  2OAW A;  1QKX A;  2JMA A;  3QWX X;  2A28 A;  2K3B A;  2D0N A;  2AKK A;  2DL7 A;  1W70 A;  4ZNX A;  2X3X D;  1QKW A;  1QWF A;  2CSQ A;  2EBP A;  2LP5 A;  3QWY A;  2HDA A;  1NLO C;  1UFF A;  2SRC A;  2YUP A;  2EYZ A;  2LQN A;  5IHN A;  2K6D A;  1H92 A;  2LQW A;  1K0S A;  4RTT A;  3M0T A;  3U23 A;  1T3S A;  2NUZ A;  4LUE A;  2ABL A;  4LUD A;  3H0I A;  1K1Z A;  2MCN A;  1AZE A;  2YUN A;  1WXT A;  3VS4 A;  2E5K A;  2EYW A;  1PRL C;  2ECZ A;  3ZL7 C;  1M3B A;  5FW9 A;  3VS1 A;  2MOX A;  4GBQ A;  2EYX A;  1NYG A;  2F2W A;  1UHC A;  2SEM A;  2DL8 A;  4GLM A;  5IXB A;  4CC7 A;  4F16 A;  2J05 A;  2B86 A;  1JEG A;  2RQU A;  1MUZ A;  3PE0 A;  2V1Q A;  2DA9 A;  2J06 A;  2KGT A;  2F2V A;  4OML A;  1TUD A;  2AK5 A;  2KXC A;  2JW4 A;  3KFV A;  4LNP A;  1ARK A;  2O2O A;  2RPN A;  2O88 A;  1VYU A;  2EGA A;  4E6R A;  1PNJ A;  1GBR A;  2KT8 A;  2W0Z A;  4M4Z A;  2ED1 A;  2EPD A;  5IHI A;  2DE0 X;  2GGR A;  2RQR A;  1RI9 A;  2LX7 A;  1GCQ C;  2KRM A;  1CKB A;  4HVU A;  2I0N A;  1VA7 A;  2OJ2 A;  1LCK A;  3THK A;  4CC3 A;  1J3T A;  3FJ5 A;  1WXU A;  1PWT A;  2EQI A;  2KRO A;  3H0H A;  2K2M A;  1Z9Q A;  2CDT A;  4IIM A;  2EGE A;  4J9H A;  2RQT A;  2RF0 A;  3REB B;  1OPK A;  2L3P A;  1EFN A;  1N5Z A;  1G2B A;  1NG2 A;  4HVW A;  4R0K A;  1X6B A;  2PZ1 A;  2YUQ A;  2GNC A;  2BZX A;  3RBB B;  3SEM A;  2KYB A;  4DEY A;  1Y0M A;  1UJ0 A;  1BK2 A;  1H3H A;  2FG0 A;  3UA6 A;  3M0P A;  5FWB A;  1AWX A;  2CT3 A;  1GL5 A;  1AVZ C;  1X69 A;  2D8H A;  3TVT A;  4JJD A;  2DBM A;  2DMO A;  3PVQ A;  3VS2 A;  1SSH A;  1FMK A;  4JPB W;  4RTY A;  5IH2 A;  3TSZ A;  2VWF A;  1ABO A;  1B3Q A;  1GFC A;  1QCF A;  3TSW A;  2HCK A;  1T0J A;  3LH5 A;  2GTJ A;  1WX6 A;  3NMZ C;  1NEG A;  2AZV A;  2YSQ A;  3M0U A;  1KJW A;  1W6X A;  1HJD A;  3VRY A;  2DVJ A;  1CSK A;  1AD5 A;  4AFU C;  5GJW B;  1AOJ A;  2O9V A;  4RTW A;  4J9G A;  1UUE A;  2CUB A;  2KRS A;  1KSW A;  3RNJ A;  3M0R A;  1AZG B;  1WXB A;  4D8D A;  1JO8 A;  3H0F A;  2OI3 A;  1KFZ A;  1WIE A;  2DBK A;  1RLP C;  2CH4 A;  1PKT A;  3EG0 A;  2C0O A;  1W1F A;  5HCK A;  2A08 A;  1JQQ A;  2MIO A;  2J6F A;  3M0Q A;  1UTI A;  1A0N B;  1AWW A;  2L0A A;  1K0X A;  2RQV A;  2GBQ A;  1ZUK A;  1M3A A;  1TG0 A;  2FO0 A;  5I22 A;  2KR3 A;  2DLP A;  1M30 A;  1PHT A;  2RN8 A;  2H8H A;  2A36 A;  2KT1 A;  4J9B A;  1X43 A;  2HBW A;  4HXJ A;  4DEX A;  2VVK A;  4J9C A;  1HSQ A;  4RUG A;  1BB9 A;  2JS2 A;  2BZY A;  2DYB A;  4JZ4 A;  1VYT A;  4Y92 A;  1Z9Z A;  2KYM A;  1GCP A;  2PTK A;  4A63 B;  2KEA A;  4JZ3 A;  2LJ3 A;  2K7A A;  1IO6 A;  2LZ6 B;  1I07 A;  2O31 A;  1QLY A;  2JM8 A;  1UG1 A;  1UE9 A;  3EG1 A;  4J9D A;  1CKA A;  4CC4 B;  4F14 A;  2DRK A;  1GCQ A;  1YWP A;  1X2K A;  2KE9 A;  3EHR A;  2EGC A;  3PVL A;  1V1C A;  2RNA A;  1M8M A;  2C0T A;  3VS6 A;  5IHK A;  4Z8A A;  2RQW A;  1QWE A;  4Z89 A;  1SRL A;  1YWO A;  2K79 A;  2CH4 W;  2BZ8 A;  1OV3 A;  2P4R A;  1NEB A;  3UAT A;  2EVR A;  2JS0 A;  2ROL A;  1YNZ A;  4OMO A;  3I5R A;  1GFD A;  3A98 A;  2GTO A;  1YP5 A;  2AKL A;  4FSS A;  1NLP C;  1M3C A;  2L3Q A;  2FRY A;  4X1V A;  4KRT A;  1BU1 A;  4J9F A;  1ZLM A;  2JXB A;  2JT4 A;  2DIL A;  4AG2 C;  3EG3 A;  4J9E A;  5L23 A;  1MV3 A;  3GBQ A;  2W10 A;  3VRZ A;  1E6G A;  1B07 A;  1I1J A;  2DJQ A;  2DX1 A;  5ECA A;  2DF6 A;  1SRM A;  4OMQ A;  1X27 A;  4QT7 A;  2QDL A;  1UDL A;  1WI7 A;  2LJ1 A;  2KBT A;  1XOV A;  1WDX A;  2JMC A;  1ABQ A;  1UGV A;  1VYV A; 
#chains in the Genus database with same CATH topology
 1SEM A;  2M02 A;  4C8Q F;  3TEE A;  3NTI A;  3OY9 A;  1ZUY A;  2E5Q A;  3E9F A;  1YI2 T;  3HFN A;  1YIT T;  4YTL A;  3VKI A;  4B9X A;  4FYV B;  3M58 A;  3MET A;  1C0M A;  3VYG A;  5CCA A;  1VQN Q;  1T3L A;  1HK9 A;  3JCM b;  2ZPI B;  1N27 A;  4F7U E;  5LJ3 e;  3H41 A;  2XID A;  2OTL T;  1QMC A;  1TH7 A;  4C5H A;  5KYW B;  3OA6 A;  3CCR Q;  1AWJ A;  1WA7 A;  4QQ6 A;  4XK8 E;  1QVP A;  2FPF A;  3JCM c;  5A0G A;  4XTZ A;  2JM9 A;  2EQM A;  3GP8 A;  2B8A A;  3WVE B;  3MEV A;  4EMK C;  3M56 A;  1S72 T;  1RI0 A;  2ENM A;  1K73 U;  1KD1 U;  2ZCF B;  1WQW A;  3A8M B;  3CCJ T;  2WAC A;  3UF4 A;  3I9Q A;  3I56 Q;  1YHQ A;  2HAX A;  2YRC A;  4AT1 B;  2D8J A;  4EMK A;  1E7O A;  1RAI B;  3UA7 A;  2QQ9 A;  2DL4 A;  1QCN A;  2EW3 A;  1MGQ A;  4JRQ A;  1VQ6 A;  1G3S A;  2ESW A;  1X2Q A;  4JLG A;  4PJJ A;  1I0C A;  2FHD A;  4MZT A;  4XTW A;  1S1N A;  3VS0 A;  2MF2 A;  2QGG A;  1BI1 A;  1MND A;  4HVV A;  2LCS A;  1PRM C;  4BY6 B;  5KYU B;  2EIF A;  3SDZ A;  3D7S B;  2QA4 T;  3CCU T;  1QVF A;  1GRI A;  3NHN A;  2VKN A;  4M7A G;  2ZPB B;  2YT6 A;  5D6W A;  2RK1 A;  1M2V A;  5GAN 4;  4Y28 E;  1YJ9 T;  1M90 U;  3V8L A;  5FU7 C;  3GOX A;  1U3O A;  3M59 A;  4N4I A;  2DZ9 A;  3CQT A;  1NJI C;  5FLX E;  1JXO A;  4M78 D;  1WJR A;  4DBR A;  2J6K A;  1YJW Q;  2HSE B;  4J9I A;  4AMC A;  1KQ1 A;  2EKH A;  4FIB A;  4QQG A;  2IIM A;  4RTZ A;  4XQ3 A;  3QHS A;  3CPW S;  1T0H A;  2BKD N;  2E6Z A;  4RTX A;  3CD6 A;  5GMK l;  4IIO A;  2MAM A;  5IT9 E;  2ED0 A;  3QWX X;  2FYK A;  2D0N A;  3HHT B;  1NPP A;  1BI2 A;  2XKO C;  1W70 A;  4ZNX A;  3FB9 A;  2RH2 A;  1OZ2 A;  1VQ9 Q;  1VQ7 T;  2LP5 A;  4C92 C;  2HDA A;  5IHN A;  2LQN A;  5LJ5 d;  1WQ7 A;  2LQW A;  4E7K A;  2E6N A;  4RTT A;  2R58 A;  2QI2 A;  4LUD A;  3M4Y A;  2AHJ B;  3MP8 A;  1AZE A;  5GAO p;  4C92 A;  2WSF E;  2E4H A;  5HKC A;  5FW9 A;  5KCO A;  4M7D C;  3CCL A;  2ZPE B;  2EYX A;  1H3Z A;  1KD1 R;  6AT1 B;  4M75 E;  4PJO B;  1B34 A;  4C8Q G;  1G5V A;  4F16 A;  4RCB A;  2BIV A;  5GAN f;  2V8K A;  1O9S A;  5GAN g;  2X35 A;  4M77 C;  4M7D A;  2FZC B;  4OML A;  3EG9 B;  2AK5 A;  1IGQ A;  2JW4 A;  3CPW A;  2RPN A;  5LJ5 h;  4E6R A;  3SFM A;  4R55 A;  2ED1 A;  2EPD A;  2YLB A;  3OS2 A;  4M77 A;  3VUB A;  2DD4 A;  1RI9 A;  3OYL A;  1R77 A;  1GCQ C;  1YHQ T;  3BY7 A;  4PJO F;  3S6W A;  3V8K A;  2I0N A;  1VA7 A;  3THK A;  3H0H A;  5HK3 A;  3E19 A;  2EGE A;  2X51 A;  5A0L A;  2L3P A;  1M90 R;  1EFN A;  1G2B A;  2HQX A;  5GAN 2;  2YUQ A;  3MP6 A;  2RA2 A;  2BZX A;  4ELZ C;  3SEM A;  2DVE A;  1Y0M A;  3JCM V;  1VQO T;  2ZAE A;  1D09 B;  4PJL A;  3M0P A;  3P8H A;  5FWB A;  2CT3 A;  1Y71 A;  1GL5 A;  2DIQ A;  4XTX A;  1X69 A;  2EFI A;  5GMK e;  3JB9 I;  1MNE A;  3CXC P;  2M16 A;  2DFU A;  2HQH A;  4RTY A;  1VQ5 A;  2LQK A;  2VWF A;  2NUT A;  1UB4 A;  1QCF A;  2NYS A;  1T0J A;  3LH5 A;  1WX6 A;  3BDL A;  1NEG A;  2YSQ A;  4J83 A;  4ME7 A;  4N4H A;  4LDW A;  2DVJ A;  3EAE A;  3CC4 Q;  3JB9 F;  2O9V A;  3OW2 P;  1JJ2 P;  1Y07 A;  4KT0 E;  3CME T;  5GAM d;  1KSW A;  4HA8 A;  5GMK j;  3CCM Q;  3WXM B;  4XTV A;  1QW1 A;  1AZG B;  1WXB A;  1JO8 A;  3EH2 A;  1KFZ A;  1OYX A;  1RLP C;  1PSF A;  2LT1 A;  1BIB A;  1W1F A;  2A08 A;  2O01 E;  4RG2 A;  3H8Z A;  2PQW A;  2J6F A;  2HKN A;  4F04 B;  1UTI A;  5A2Q E;  3L2R A;  2CZ7 B;  3HPW A;  4JLI A;  2COZ A;  2GFU A;  1M3A A;  1QVG A;  2VXF A;  4A53 A;  5I22 A;  3OYM A;  2RJE A;  2PU9 B;  4F7U A;  3CC2 Q;  2RN8 A;  1VQ5 Q;  2HL3 A;  4L59 A;  4M78 B;  5GAM h;  1D1C A;  2HBW A;  4CRI A;  3JCM e;  2VVK A;  3FDR A;  3O8V A;  3QJY A;  3ZFJ A;  4J9C A;  2XG8 D;  3KXT A;  4OB0 B;  3MEW A;  2E1H A;  2KYM A;  1KK7 A;  2QAZ A;  1GCP A;  4IUU A;  2KEA A;  2RM4 A;  1IO6 A;  3M53 A;  1PM3 A;  3G4S A;  2DET A;  2PVO B;  5FU6 B;  1SF9 A;  2E41 A;  4M78 F;  3CXC S;  4E7L A;  1WPY A;  4J9D A;  4C5I A;  2RB6 A;  1CKA A;  4FYX B;  2PVD B;  2RNA A;  3GLX A;  2C0T A;  4OB3 B;  1HYO A;  3VS6 A;  5CAI A;  3CCE T;  4BE0 A;  3H6Z A;  4Z89 A;  2DXU A;  1YWO A;  1Q81 C;  2QQR A;  2BZ8 A;  7AT1 B;  1NEB A;  3UAT A;  5L8R E;  4FT2 A;  2JS0 A;  4LDX A;  2NUP A;  4OMO A;  1WHM A;  1C6V X;  3C12 A;  4NL3 A;  1K9M U;  4JJN K;  5I21 A;  4PJO G;  1V29 B;  3GNG A;  3UPU A;  2FRY A;  2ZPH B;  4KRT A;  4X1V A;  5KCH A;  2JUF A;  2L3R A;  5GAO q;  1VQK T;  2DIL A;  2YHT A;  5LJ3 g;  1P92 A;  2P84 A;  3PIO A;  5L23 A;  3DLM A;  2W10 A;  3VRZ A;  3OYE A;  1B07 A;  5ECA A;  2DF6 A;  3CC7 A;  2KI7 A;  3FIF A;  4QT7 A;  1FWZ A;  1WI7 A;  3QXE B;  1VIF A;  4P5N A;  2JMC A;  4R56 A;  1ABQ A;  1UGV A;  2IPO B;  3A8L B;  1B7T A;  1KIK A;  1SPK A;  1H8K A;  5IXF A;  2RHZ A;  4OMM A;  3MPU B;  2G6F X;  1B34 B;  5I2S A;  1SHF A;  3DB3 A;  4JUV A;  4A54 A;  1G8X A;  2COY A;  1SSF A;  3R6N A;  1M8V A;  2D1X A;  4D8K A;  2OAU A;  1RAB B;  2OTL A;  2DRM A;  2DJZ A;  3HP9 A;  2K5F A;  2I2L A;  2WSE E;  3QPH A;  2IG0 A;  3E1S A;  3JB9 G;  1QP2 A;  5GAN 3;  2PUO B;  1QP3 A;  3CCV Q;  2MYS A;  2CT4 A;  1UGQ B;  4JS4 A;  2YUO A;  4M75 A;  5CVI A;  1PKS A;  3I5S A;  3MEU A;  5CK9 A;  4J5Y A;  3ER0 A;  1YCS B;  1UEC A;  3CC7 Q;  2CUD A;  1DJ7 B;  1D1A A;  4KUD K;  2JNG A;  3JV3 A;  2L8D A;  2DTO A;  1NM7 A;  4M77 E;  1YI2 Q;  1YIT Q;  2FRW A;  3EGU A;  3OBW A;  2P0Q A;  2AZS A;  4RTU A;  1QVF P;  5I11 A;  1VQ4 T;  1N9S A;  2QGF B;  2RHI A;  4XAX B;  2RMO A;  2R5M A;  1TS9 A;  2XK0 A;  3JCM X;  2M51 A;  2OTL Q;  1I4K 1;  1RAD B;  1MMN A;  3IQL A;  2K57 A;  4Z88 A;  2K9G A;  1Q82 C;  2QA4 A;  1K9M R;  2E12 A;  3CCU A;  2K2V A;  3BDU A;  2ZPG B;  2VV5 A;  4HCK A;  4XTY A;  4J6X A;  1KC8 U;  1VOM A;  2RK2 A;  2HNI A;  2EJG A;  1YJ9 A;  2DYI A;  3G6E T;  1NYF A;  1MV0 B;  2CP7 A;  1S72 Q;  4DBH A;  2L3S A;  2DZC A;  3CC7 T;  1XNI A;  1D3B A;  4M78 G;  3CCJ Q;  1BYM A;  4QVZ A;  3TQ7 P;  1G83 A;  4C0F A;  3QO3 A;  2CP5 A;  3L2U A;  2OTJ T;  2XU8 A;  3L1A A;  4ZGD B;  1M1K U;  4OMP A;  2F2X A;  2XHC A;  3N5B B;  1AEY A;  5GJV B;  2YWW A;  3OQ5 A;  3ULR B;  2HMA A;  1ZBX A;  2FPD A;  1VQL Q;  2CKK A;  3NGP A;  3EGX A;  3CBM A;  1Q86 U;  1OX8 A;  1NBE B;  4F17 A;  3RMQ A;  3LLR A;  4AFS C;  2V1R A;  4GLK A;  1YIJ T;  3NFC A;  4WCI A;  1JXM A;  3UDC A;  3CCU Q;  3HL8 A;  1VQ7 A;  3EFO A;  2A28 A;  2DIG A;  4C8Q E;  3QYG B;  4CI0 C;  3QII A;  1M9S A;  2YUP A;  1NLO C;  1UFF A;  2Y4Y A;  1LJO A;  3RER A;  5KYY B;  1TTH B;  3ZBD A;  1VQM T;  2ABL A;  4J7F A;  3VS4 A;  1QVF S;  1Q7Y U;  4OB1 B;  4PKC C;  4KGX B;  3CPW P;  4NL2 A;  4ATO A;  2JOY A;  3QKJ A;  5CKB A;  1VIE A;  2ECZ A;  3ZL7 C;  2IVW A;  1UGS B;  3L2V A;  3CCQ T;  3R6O A;  4GBQ A;  1RAG B;  3JB9 D;  3CPF A;  5AT1 B;  1NYG A;  5LJ5 e;  2DL8 A;  5IXB A;  1N8R C;  5EG2 A;  4CC7 A;  1V76 A;  2B86 A;  2DD5 A;  2FB7 A;  4J6Y A;  3LGF A;  2V1Q A;  5CIU A;  2KGT A;  3QUI A;  2DXT A;  3OYB A;  5LJ3 j;  1ZHI A;  1D0Z A;  1TUD A;  4J7I A;  4LNP A;  1KQS S;  5KYN A;  2HZY A;  2KT8 A;  2QTX A;  3DLL A;  1RAA B;  3NTH A;  4O5V A;  1BI0 A;  2LVM A;  3LX7 A;  1KC8 R;  3CMA A;  5IN1 A;  3V7R A;  3DB4 A;  4CC3 A;  3FJ5 A;  4OB2 B;  4IIM A;  4J9H A;  2DTI A;  3GF5 A;  4EMH A;  1VQO A;  2HD0 A;  4HVW A;  1X6B A;  2LT4 A;  5KYX A;  1KG1 A;  3DKM A;  1M1K R;  2M9U A;  1BK2 A;  4A4F A;  1TSF A;  1OUL A;  4HCB A;  2FG0 A;  1I5L A;  5GAO n;  5GAN 7;  1Q86 R;  1M4Z A;  2XI9 A;  3A5Z B;  3PVQ A;  2F1L A;  2RD1 A;  2F69 A;  3VS2 A;  1FMK A;  1YHQ Q;  5IH2 A;  3TSZ A;  1ZQ1 A;  1KQS A;  1B3Q A;  3TSW A;  4EMG A;  2HCK A;  1VQ6 Q;  3VYH B;  3CME A;  3NMZ C;  1VQN T;  1YBY A;  2DK3 A;  1ACM B;  1W6X A;  1HJD A;  1TWB A;  2R57 A;  5I2M A;  3JCM f;  4FW1 A;  5GJW B;  3OBY A;  3JCM g;  3RR6 A;  2CUB A;  2KRS A;  1QVG P;  3CCR T;  4C0D C;  3M0R A;  4N0A C;  3JSC A;  1Q7Y R;  3H0F A;  2OI3 A;  1WIE A;  3X25 B;  3JCM W;  2DBK A;  2LX9 A;  2RHX A;  2H3E B;  1PKT A;  3EG0 A;  3EFR A;  4M75 B;  5HCK A;  3L2Z A;  1WGS A;  3J7A F;  4N0A A;  1RAH B;  5GAM e;  1AWW A;  2A0F B;  2OX7 A;  2GCX A;  1ZUK A;  2JZ2 A;  3I56 T;  1XJW B;  1TG0 A;  2KR3 A;  1RL2 A;  1Y96 A;  1K73 R;  1N6A A;  3LWI A;  3WVD B;  2A36 A;  2KT1 A;  1I8F A;  2E3I A;  2X4W A;  4HXJ A;  4DEX A;  2QQS A;  3CD6 Q;  4M75 F;  4ZGJ B;  3HTR A;  2K5I A;  1YJN A;  4ZGE B;  3A8O B;  8AT1 B;  4M7A C;  2BZY A;  2DYB A;  5J3B A;  2BE7 D;  4ZN3 A;  4E2F B;  5GAO m;  4LD6 A;  4JZ3 A;  3PTA A;  4E47 A;  2K7A A;  1G3T A;  2LZ6 B;  2VGN A;  4A4G A;  2X4Y A;  2E10 A;  1UE9 A;  2L5Q A;  1WHH A;  2CYZ B;  4J8O A;  8ATC B;  4C92 D;  4PJO E;  3CCE A;  3CMA T;  2DRK A;  1D3B B;  3S3N A;  1GCQ A;  2X9H A;  1X2K A;  3PVL A;  1V1C A;  3CCL Q;  1BI3 A;  1M8M A;  4NOY A;  4L6V 5;  4LDV A;  5IHK A;  2AIR B;  1MHN A;  5D6Y A;  2P0P A;  3RKX A;  4LDY A;  2DER A;  4M7D D;  2CH4 W;  2P4R A;  3VUZ A;  2LTO A;  1ZSZ C;  1QVG S;  1Q95 G;  3A98 A;  3SWN C;  5FRN A;  1YP5 A;  2MPX C;  2VUB A;  4M77 D;  5GAN 8;  1VQK A;  1NLP C;  1M3C A;  2ATC B;  4KH1 B;  4OMF B;  4BDY A;  1ZSZ A;  1VQ9 T;  3BE3 A;  5GAN 5;  3SWN A;  1MMD A;  3J80 E;  2JT4 A;  4QKU A;  1IXD A;  2QTV A;  4J9E A;  4Z02 A;  2HBP A;  3FRN A;  4FCY A;  1MV3 A;  3J81 E;  2CZ6 B;  1E6G A;  2DJQ A;  1I1J A;  3CCE Q;  2DX1 A;  2FL7 A;  3OYC A;  1X27 A;  2MI6 A;  5KH6 A;  4C8Q C;  3OYJ A;  1UDL A;  2X4X A;  2LJ1 A;  3OYA A;  2KY9 A;  1PSE A;  4BB7 A;  1VYV A;  2KXD A;  4BUG A;  1UGP B;  5FWC A;  1SHG A;  1Q7Y C;  2J6O A;  1R8O B;  2XDP A;  4C8Q A;  2LNH B;  2R5A A;  1OPL A;  5CKE A;  5HY6 A;  1AWO A;  2C0I A;  1QQJ A;  2YLC A;  3VS7 A;  4CC2 A;  2K3X A;  3OSS C;  4RG8 A;  1M27 C;  4C5G A;  2YDL A;  2BTT A;  2GFA A;  4E7S A;  4ELY C;  2DL5 A;  1I5O B;  1WJS A;  1MMA A;  1WFW A;  4WTO B;  1GBQ A;  3EFS A;  1RAF B;  1VQ8 A;  3EGD A;  1KD1 C;  4EMK B;  1K73 C;  4PL6 A;  1K9A A;  4A4H A;  4RTV A;  3OSV A;  4K11 A;  1W2B S;  4FYY B;  5CKD A;  1VQP T;  4HCZ A;  4L5G A;  2FPE A;  4ZN1 A;  1YJN T;  2KK4 A;  4EIK A;  2LRQ A;  2EYQ A;  4EPC A;  1VQ4 A;  3M5A A;  2HL5 C;  1TUG B;  2A7Y A;  2E65 A;  1M2V B;  4MML A;  5KYW A;  1Y7X A;  3QYH B;  3I55 A;  1OOT A;  3PIP A;  3OS5 A;  4RCC A;  1OZ3 A;  4DQ2 A;  4M75 G;  3NPF A;  2YRV A;  3I35 A;  1M90 C;  4FT4 A;  1M2O A;  2DKG A;  2DEU A;  2RJD A;  3G6E A;  1RAC B;  3C95 A;  5FU7 B;  1KQ2 A;  4BI3 A;  1BBZ A;  3CC4 T;  3VS3 A;  1U5S A;  4OGC A;  5FRM A;  4II1 A;  2OTJ A;  4IUT A;  4HCC A;  1W2B A;  3MP1 A;  4RMO A;  2CSI A;  2O4X A;  2XDB A;  2GQI A;  2XMF A;  4D6W A;  2VB6 A;  1ZX6 A;  4FM4 B;  4LN2 A;  4AFQ C;  2JTM A;  4JRP A;  4HKE A;  5LJ3 f;  1IRX A;  2JVV A;  4ESR A;  2A37 A;  3G4S Q;  3CBP A;  4FL6 A;  1WHJ A;  1OI1 A;  4AG1 C;  3REA B;  1YIJ A;  1WYX A;  4BE2 A;  4OP0 A;  2YXY A;  1WJQ A;  2QXF A;  2HSP A;  2CRE A;  2DXC A;  5EC7 A;  2RHU A;  3VJP A;  1IRE B;  3O5Z A;  1FMW A;  2X3W D;  4PK4 A;  4C92 B;  5FRO A;  3CC2 T;  1RUW A;  1BCO A;  2NWM A;  3H9N A;  4JRI A;  1E6H A;  2JTE A;  2HEQ A;  4DBF A;  2LMJ A;  4DA4 A;  2OAW A;  1NJI U;  2JMA A;  4MDX A;  2K3B A;  2AKK A;  3L2W A;  2DL7 A;  3QBY A;  2JTF A;  4DOW A;  1QWF A;  4KGZ B;  1VQM A;  4M7D B;  2SRC A;  1G3Y A;  1K0S A;  1WHG A;  3M0T A;  1T3S A;  2NUZ A;  4LUE A;  4FYW B;  3CCQ A;  1K1Z A;  2YUN A;  4C92 F;  1FXX A;  3CCS A;  2E5K A;  3OB9 A;  2EYW A;  4M77 B;  3JCM d;  1PRL C;  2LCC A;  3QZ9 B;  4BD3 A;  3Q1J A;  4MZM A;  3M4G A;  3OYN A;  1VQ8 T;  4A4E A;  2VC8 A;  2F2W A;  4E7J A;  1UHC A;  2XDD A;  4QVD A;  2SEM A;  3BW1 A;  5HK0 A;  4M7D F;  1MUZ A;  3PE0 A;  3G7Z A;  2DA9 A;  2K3Y A;  2KVQ G;  3P8B B;  3OYG A;  2KXC A;  3V7C A;  4M7A E;  2O88 A;  1VYU A;  4X34 A;  2L89 A;  1PNJ A;  4M77 F;  2KAF A;  4PJO C;  4M4Z A;  4ZTF A;  1PG5 B;  2QQB A;  3HKS A;  2DE0 X;  1VQM Q;  3INZ A;  1M1G A;  3JCM h;  2RQR A;  2LX7 A;  2KRM A;  1G3W A;  4A4K A;  2OJ2 A;  2VXE A;  5GAN d;  3A1P A;  3S3O A;  3LH0 A;  4PJO A;  1J3T A;  3I55 T;  1PWT A;  2GF7 A;  1BIA A;  3SD4 A;  1Z9Q A;  4PFZ A;  1XTD A;  2NUT B;  2RQT A;  2Z0W A;  2QK0 A;  4M75 D;  4OF1 A;  5LL6 S;  1IGU A;  4J6W A;  1KQS P;  2GNC A;  5KE3 A;  3QSU A;  2KYB A;  4DEY A;  5C6S A;  2Y90 A;  1UJ0 A;  4BAC A;  3VU3 C;  2M1H A;  4XTU A;  2LC4 A;  3UA6 A;  4BI4 A;  1AWX A;  1EIF A;  1AVZ C;  2CS7 A;  2DMO A;  2V8J A;  1SSH A;  2EKO A;  4C0Z A;  5GAN h;  1LPL A;  1VQN A;  2QAS A;  3OMG A;  4IUR A;  1ABO A;  5GMK i;  1TOV A;  4LXC A;  1OU9 A;  2RJF A;  4IUV A;  2CP3 A;  3M0U A;  1KJW A;  2CGH A;  3X28 B;  3CCR A;  2LQ8 A;  2QA4 Q;  3VRY A;  4KBM B;  1D0Y A;  2JN0 A;  4F7U B;  2K5L A;  1K8A U;  4J9G A;  3CCV T;  4PFP A;  2EQK A;  2RHY A;  3FEO A;  3EGD B;  1MMG A;  1TXQ A;  2VGM A;  1YJ9 Q;  1SG5 A;  5J39 A;  1R0C B;  2CH4 A;  2GQV A;  2C0O A;  3HFO A;  1JQQ A;  3BFM A;  3M0Q A;  3I56 A;  1A0N B;  3OS1 A;  1EX4 A;  1M5Q 1;  2L0A A;  2MK5 A;  3LGL A;  1IHV A;  3G71 T;  2GBQ A;  4F7U F;  1WNL A;  3NTK A;  3CCS T;  2FO0 A;  2BUD A;  2DLP A;  4JRK A;  4OVA A;  1PD1 A;  4KGV B;  2H8H A;  4J9B A;  2JJ9 A;  1X43 A;  1NE8 A;  3GPL A;  1HSQ A;  4RUG A;  1VQ7 Q;  2QQA A;  1BB9 A;  4JZ4 A;  4Y92 A;  2YRD A;  3PFS A;  3ZEH A;  4A63 B;  3V8J A;  4M78 C;  4C92 G;  5LJ5 j;  2CZ1 B;  2NUP B;  3X24 B;  1I07 A;  2O31 A;  2JM8 A;  1D1B A;  1AT1 B;  1UG1 A;  4DOV A;  4IKF A;  1X6O A;  3RES A;  5CQX A;  4X9D A;  2MMP A;  1D0X A;  4M78 A;  5D7U A;  4F14 A;  4CC4 B;  5GAO r;  3A8G B;  1YJW A;  1C1A A;  2O4X B;  1YWP A;  3EHR A;  2EGC A;  1K9M C;  4M7D G;  2FVU A;  1EZZ B;  2QEX T;  1GXI E;  4Z8A A;  2RQW A;  1QWE A;  5FU6 C;  2BE9 B;  2DEQ A;  2EQU A;  2K4Y A;  1VQL T;  1KHC A;  2K79 A;  2CP6 A;  2VYT A;  1JRI A;  3E9G A;  3ME9 A;  4C5E A;  4M77 G;  2D6F A;  2ROL A;  4XU3 A;  3I5R A;  2GTO A;  1VQ9 A;  2KQW A;  4MMK A;  1YFN A;  2AKL A;  4FSS A;  2A3L A;  3OYI A;  2L3Q A;  1OU8 A;  1BU1 A;  1K8A R;  1Q81 U;  1KHI A;  3CMA Q;  3KUF A;  3EG3 A;  4WF2 A;  1QCO A;  3FJP A;  3X26 B;  1OQK A;  4Y91 A;  3GBQ A;  9ATC B;  1JB0 E;  4OMQ A;  1VQO Q;  2KBT A;  1XOV A;  4O6J A;  1WDX A;  3PT9 A;  2WSC E;  1N9R A;  5A0D A;  5LJ3 d;  2X4J A;  2M0Y A;  4E7I A;  3OYH A;  2H3J A;  1UGR B;  3M0S A;  3P8D A;  2CZ0 B;  1OEB A;  2EYY A;  4ORZ A;  1ZA1 B;  2LNV A;  3RIR A;  3C94 A;  3JRZ A;  3QG1 A;  4PJN A;  4B9W A;  1OX9 A;  5GAO l;  1X6G A;  1TUC A;  2LJ0 A;  5GMK m;  1XQH A;  3TCJ A;  1JU5 C;  1ZBJ A;  3CME Q;  1VQP A;  1HD3 A;  2DM1 A;  2FEI A;  1NZ9 A;  2RI5 A;  1O75 A;  4QW2 A;  5GAM j;  2VAS A;  2MWO A;  3RUX A;  5LJ3 h;  2O9S A;  1ZSG A;  3SHW A;  2KNB B;  1I81 A;  3QZ5 B;  4M7A A;  5DLQ E;  2DNU A;  4JJB A;  2PNI A;  4F7U G;  2J7I A;  2ROT A;  1Y57 A;  1U06 A;  1KC8 C;  4OMN A;  3MJX A;  4FW2 A;  2HQE A;  1LNX A;  1W2B P;  2DTH A;  1WLP B;  3M9Q A;  2EQJ A;  4MDW A;  1YJW T;  4KUI A;  5GAN 6;  2F5T X;  3S3M A;  3CC4 A;  1K4U S;  1VQ6 T;  1K76 A;  1YN8 A;  3MEA A;  1ZA2 B;  5DM7 R;  1VQP Q;  4HT8 A;  1M1K C;  3OYD A;  3CCM A;  1Q81 R;  3EGX B;  3JCM J;  1YJN Q;  4AFZ C;  2C06 A;  1ZUU A;  4N4G A;  1W4S A;  2LDM A;  3T9N A;  1RLQ C;  2FZG B;  4LE9 A;  3EFO B;  1Q86 C;  1Q82 U;  1UHF A;  4M7A D;  1FYN A;  3EH1 A;  4JDS A;  3EG2 A;  4JJC A;  2XIC A;  5M9O A;  2G3R A;  3RKW A;  3EHQ A;  1K8A C;  2L2P A;  4C0G A;  4UC4 A;  2EWN A;  3CC2 A;  2DAQ A;  3C0C A;  2KRN A;  4E7H A;  4E7Z A;  2ZGW A;  1UJY A;  3VS5 A;  2DL3 A;  1FX7 A;  2RI3 A;  3QJ6 A;  3L42 A;  1QKX A;  3KBG A;  2KDS A;  2DPP B;  3QDR B;  2KMT A;  4LDU A;  3JAM E;  3CD6 T;  2X3X D;  1QKW A;  1BCM A;  3MKD A;  2CSQ A;  2EBP A;  2EJF A;  3QWY A;  2EYZ A;  3G1J A;  1VQK Q;  2K6D A;  4V2S A;  1H92 A;  3MHX A;  3U23 A;  4X9C A;  3SB2 A;  3H0I A;  2MCN A;  1WXT A;  2F5K A;  3JB9 J;  1WHL A;  3PMT A;  1M3B A;  1U1T A;  3VS1 A;  2MOX A;  3JCM P;  3AT1 B;  4LD9 K;  3PMI A;  4GLM A;  4NS5 A;  3CCL T;  1JEG A;  2J05 A;  3X20 B;  2RQU A;  1WHK A;  2J06 A;  1IHW A;  2ZPF B;  2F2V A;  4EDU A;  2EJ9 A;  3GIB A;  3HRS A;  5KYY A;  4C8Q D;  3KFV A;  1ARK A;  2O2O A;  5KYX B;  3TU4 K;  4KH0 B;  2XD0 A;  2EGA A;  3RDV A;  1SKU B;  1GBR A;  3OYF A;  2W0Z A;  1VUB A;  2QG9 B;  4BE1 A;  5IHI A;  3PNW C;  4M78 E;  4TVR A;  4Q5W A;  1N8R U;  3A8H B;  2GGR A;  3M54 A;  1CKB A;  4HVU A;  2AT1 B;  1LCK A;  1FMV A;  2DXB A;  3LW5 E;  1WXU A;  2EQI A;  2KRO A;  2K2M A;  1VQ8 Q;  2CDT A;  3LWH A;  1HXD A;  2RF0 A;  3OMC A;  3REB B;  1OPK A;  1Q82 R;  5DLO A;  1NG2 A;  1N5Z A;  4FU6 A;  4R0K A;  4QVC A;  2PZ1 A;  4HT9 A;  3RBB B;  1X75 C;  2P4T A;  5GAN e;  3CEY A;  3CCM T;  3MCA B;  4GY5 A;  3FLG A;  1H3H A;  3OW2 S;  1JJ2 S;  1R0B G;  4BY6 C;  1VQ4 Q;  2V26 A;  3HRU A;  3VV0 A;  2D8H A;  3TVT A;  4JJD A;  5KE2 A;  2DBM A;  1RAE B;  2FZK B;  4JPB W;  2D9T A;  3MO8 A;  1IB8 A;  5KYU A;  4VUB A;  3C4S A;  4C0D B;  2M0O A;  5LJ5 f;  2ZZD A;  1GFC A;  5LJ5 g;  3I55 Q;  5DY9 A;  4BDZ A;  2GTJ A;  2D0Q B;  5GAN j;  2AZV A;  1VQ5 T;  3CCV A;  5GMK h;  3E2U A;  1CSK A;  1AD5 A;  4AFU C;  1Y96 B;  1AOJ A;  3QDF A;  4RTW A;  5CKF A;  5CO7 A;  3OYY A;  4ZTJ A;  3G6E Q;  1PD0 A;  1UUE A;  1TU0 B;  3RNJ A;  3CXC A;  1AHJ B;  3V7S A;  5CR2 A;  4D8D A;  3M55 A;  1YI2 A;  5C0M A;  1YIT A;  1PCX A;  2OTJ Q;  2QYZ A;  5AYF A;  3UWN A;  3G71 A;  3FC3 A;  2MIO A;  4RKU E;  2PVG B;  3RKY A;  3PGG A;  2E64 A;  1K0X A;  1LOJ A;  2RQV A;  3OW2 A;  1JJ2 A;  4C92 E;  4M7A B;  1YIJ Q;  1M30 A;  1PHT A;  2E70 A;  4M75 C;  2Y4X A;  3RMS A;  3LYI A;  4KUL A;  2EAY A;  1PC0 A;  3M57 A;  2E3H A;  4OGE A;  5IAY A;  4PFO A;  1N8R R;  4M7D E;  4MZP A;  3URG A;  4IUP A;  1BKB A;  1X01 A;  2JS2 A;  1VYT A;  1IZ6 A;  1Z9Z A;  4PNO A;  1WZO A;  2CP0 A;  4DBQ A;  1NPR A;  2PTK A;  1S72 A;  3HRT A;  4IUQ A;  1F1B B;  3CBO A;  2LJ3 A;  3CCJ A;  1JBM A;  3L2Q A;  3OS0 A;  4M7A F;  2DO3 A;  2QDY B;  2RI2 A;  4PLL A;  4PLI A;  1QLY A;  4FSX A;  3AHU A;  4BI8 B;  3G71 Q;  3CCQ Q;  4XU1 A;  3EG1 A;  3CCS Q;  2QEX A;  4B6M A;  2NLU A;  1LVK A;  1H64 1;  3G4S T;  1ZSZ B;  2CP2 A;  1VQL A;  2KE9 A;  3SWN B;  3EG9 A;  2RJC A;  1U8R A;  3JB9 H;  3HSB A;  4ANJ A;  1SRL A;  5J26 A;  4PJM A;  2PUK B;  1OV3 A;  5D6X A;  4XU0 A;  1YCY A;  2EVR A;  1YNZ A;  3OYK A;  1GFD A;  5CQY A;  5GAM f;  5GAM g;  2RO0 A;  1U1S A;  4XU2 A;  2HKQ B;  2P0K A;  3JCM Q;  1NJI R;  4C8Q B;  3UT1 A;  4J9F A;  1ZLM A;  2JXB A;  2V8I A;  3ASK A;  4PJO D;  4AG2 C;  2COW A;  2MWP A;  3F70 A;  4JS5 A;  4QQD A;  1M1F A;  2QEX Q;  2LCL A;  1SRM A;  2QDL A;  2KSS A;  3TRE A;  3GNF B;  1UEB A;  5CKH A; 
#chains in the Genus database with same CATH homology
 2KXD A;  1SEM A;  1KIK A;  5FWC A;  1SHG A;  1SPK A;  1ZUY A;  2J6O A;  1H8K A;  5IXF A;  2LNH B;  4OMM A;  2M0Y A;  2G6F X;  1OPL A;  1SHF A;  1AWO A;  2C0I A;  3M0S A;  1OEB A;  2EYY A;  3VS7 A;  4ORZ A;  3R6N A;  4CC2 A;  2D1X A;  4D8K A;  1M27 C;  2DRM A;  2YDL A;  2BTT A;  1T3L A;  1X6G A;  2DL5 A;  1TUC A;  2LJ0 A;  1WFW A;  3H41 A;  1GBQ A;  1JU5 C;  1ZBJ A;  2CT4 A;  1HD3 A;  1K9A A;  4RTV A;  1AWJ A;  2DM1 A;  2FEI A;  2YUO A;  4K11 A;  1WA7 A;  1PKS A;  3I5S A;  2FPF A;  1YCS B;  2JM9 A;  1UEC A;  2FPE A;  2O9S A;  2CUD A;  1ZSG A;  3JV3 A;  4EIK A;  3SHW A;  1NM7 A;  2KNB B;  2FRW A;  3EGU A;  2ENM A;  2DNU A;  4JJB A;  2PNI A;  2AZS A;  4RTU A;  2J7I A;  2ROT A;  3UF4 A;  3I9Q A;  5I11 A;  1Y57 A;  1U06 A;  2D8J A;  4OMN A;  2RMO A;  1E7O A;  3UA7 A;  2DL4 A;  2EW3 A;  1OOT A;  1WLP B;  2M51 A;  2ESW A;  1X2Q A;  3IQL A;  4Z88 A;  1I0C A;  2K9G A;  3NPF A;  3I35 A;  1S1N A;  1K4U S;  1K76 A;  1YN8 A;  3VS0 A;  4HVV A;  2LCS A;  1PRM C;  4HCK A;  1BBZ A;  3VS3 A;  1U5S A;  1GRI A;  4AFZ C;  3NHN A;  2VKN A;  2YT6 A;  1ZUU A;  1NYF A;  1MV0 B;  1RLQ C;  4LE9 A;  2L3S A;  2CSI A;  2GQI A;  1UHF A;  2XMF A;  1ZX6 A;  4LN2 A;  1G83 A;  1FYN A;  4AFQ C;  3EG2 A;  4ESR A;  2A37 A;  4JJC A;  1U3O A;  3CQT A;  3EHQ A;  4OMP A;  1JXO A;  2F2X A;  2L2P A;  1AEY A;  5GJV B;  4AG1 C;  3REA B;  3ULR B;  2J6K A;  2FPD A;  3C0C A;  1WYX A;  2HSP A;  2CRE A;  2KRN A;  3NGP A;  4J9I A;  5EC7 A;  2EKH A;  4F17 A;  3O5Z A;  2IIM A;  1UJY A;  2X3W D;  4RTZ A;  2V1R A;  4AFS C;  1T0H A;  4WCI A;  1JXM A;  1RUW A;  4RTX A;  3VS5 A;  2DL3 A;  2NWM A;  1E6H A;  4IIO A;  2JTE A;  2HEQ A;  2ED0 A;  2LMJ A;  2OAW A;  1QKX A;  2JMA A;  3QWX X;  2A28 A;  2K3B A;  2D0N A;  2AKK A;  2DL7 A;  1W70 A;  4ZNX A;  2X3X D;  1QKW A;  1QWF A;  2CSQ A;  2EBP A;  2LP5 A;  3QWY A;  2HDA A;  1NLO C;  1UFF A;  2SRC A;  2YUP A;  2EYZ A;  2LQN A;  5IHN A;  2K6D A;  1H92 A;  2LQW A;  1K0S A;  4RTT A;  3M0T A;  3U23 A;  1T3S A;  2NUZ A;  4LUE A;  2ABL A;  4LUD A;  3H0I A;  1K1Z A;  2MCN A;  1AZE A;  2YUN A;  1WXT A;  3VS4 A;  2E5K A;  2EYW A;  1PRL C;  2ECZ A;  3ZL7 C;  1M3B A;  5FW9 A;  3VS1 A;  2MOX A;  4GBQ A;  2EYX A;  1NYG A;  2F2W A;  1UHC A;  2SEM A;  2DL8 A;  4GLM A;  5IXB A;  4CC7 A;  4F16 A;  2J05 A;  2B86 A;  1JEG A;  2RQU A;  1MUZ A;  3PE0 A;  2V1Q A;  2DA9 A;  2J06 A;  2KGT A;  2F2V A;  4OML A;  1TUD A;  2AK5 A;  2KXC A;  2JW4 A;  3KFV A;  4LNP A;  1ARK A;  2O2O A;  2RPN A;  2O88 A;  1VYU A;  2EGA A;  4E6R A;  1PNJ A;  1GBR A;  2KT8 A;  2W0Z A;  4M4Z A;  2ED1 A;  2EPD A;  5IHI A;  2DE0 X;  2GGR A;  2RQR A;  1RI9 A;  2LX7 A;  1GCQ C;  2KRM A;  1CKB A;  4HVU A;  2I0N A;  1VA7 A;  2OJ2 A;  1LCK A;  3THK A;  4CC3 A;  1J3T A;  3FJ5 A;  1WXU A;  1PWT A;  2EQI A;  2KRO A;  3H0H A;  2K2M A;  1Z9Q A;  2CDT A;  4IIM A;  2EGE A;  4J9H A;  2RQT A;  2RF0 A;  3REB B;  1OPK A;  2L3P A;  1EFN A;  1N5Z A;  1G2B A;  1NG2 A;  4HVW A;  4R0K A;  1X6B A;  2PZ1 A;  2YUQ A;  2GNC A;  2BZX A;  3RBB B;  3SEM A;  2KYB A;  4DEY A;  1Y0M A;  1UJ0 A;  1BK2 A;  1H3H A;  2FG0 A;  3UA6 A;  3M0P A;  5FWB A;  1AWX A;  2CT3 A;  1GL5 A;  1AVZ C;  1X69 A;  2D8H A;  3TVT A;  4JJD A;  2DBM A;  2DMO A;  3PVQ A;  3VS2 A;  1SSH A;  1FMK A;  4JPB W;  4RTY A;  5IH2 A;  3TSZ A;  2VWF A;  1ABO A;  1B3Q A;  1GFC A;  1QCF A;  3TSW A;  2HCK A;  1T0J A;  3LH5 A;  2GTJ A;  1WX6 A;  3NMZ C;  1NEG A;  2AZV A;  2YSQ A;  3M0U A;  1KJW A;  1W6X A;  1HJD A;  3VRY A;  2DVJ A;  1CSK A;  1AD5 A;  4AFU C;  5GJW B;  1AOJ A;  2O9V A;  4RTW A;  4J9G A;  1UUE A;  2CUB A;  2KRS A;  1KSW A;  3RNJ A;  3M0R A;  1AZG B;  1WXB A;  4D8D A;  1JO8 A;  3H0F A;  2OI3 A;  1KFZ A;  1WIE A;  2DBK A;  1RLP C;  2CH4 A;  1PKT A;  3EG0 A;  2C0O A;  1W1F A;  5HCK A;  2A08 A;  1JQQ A;  2MIO A;  2J6F A;  3M0Q A;  1UTI A;  1A0N B;  1AWW A;  2L0A A;  1K0X A;  2RQV A;  2GBQ A;  1ZUK A;  1M3A A;  1TG0 A;  2FO0 A;  5I22 A;  2KR3 A;  2DLP A;  1M30 A;  1PHT A;  2RN8 A;  2H8H A;  2A36 A;  2KT1 A;  4J9B A;  1X43 A;  2HBW A;  4HXJ A;  4DEX A;  2VVK A;  4J9C A;  1HSQ A;  4RUG A;  1BB9 A;  2JS2 A;  2BZY A;  2DYB A;  4JZ4 A;  1VYT A;  4Y92 A;  1Z9Z A;  2KYM A;  1GCP A;  2PTK A;  4A63 B;  2KEA A;  4JZ3 A;  2LJ3 A;  2K7A A;  1IO6 A;  2LZ6 B;  1I07 A;  2O31 A;  1QLY A;  2JM8 A;  1UG1 A;  1UE9 A;  3EG1 A;  4J9D A;  1CKA A;  4CC4 B;  4F14 A;  2DRK A;  1GCQ A;  1YWP A;  1X2K A;  2KE9 A;  3EHR A;  2EGC A;  3PVL A;  1V1C A;  2RNA A;  1M8M A;  2C0T A;  3VS6 A;  5IHK A;  4Z8A A;  2RQW A;  1QWE A;  4Z89 A;  1SRL A;  1YWO A;  2K79 A;  2CH4 W;  2BZ8 A;  1OV3 A;  2P4R A;  1NEB A;  3UAT A;  2EVR A;  2JS0 A;  2ROL A;  1YNZ A;  4OMO A;  3I5R A;  1GFD A;  3A98 A;  2GTO A;  1YP5 A;  2AKL A;  4FSS A;  1NLP C;  1M3C A;  2L3Q A;  2FRY A;  4X1V A;  4KRT A;  1BU1 A;  4J9F A;  1ZLM A;  2JXB A;  2JT4 A;  2DIL A;  4AG2 C;  3EG3 A;  4J9E A;  5L23 A;  1MV3 A;  3GBQ A;  2W10 A;  3VRZ A;  1E6G A;  1B07 A;  1I1J A;  2DJQ A;  2DX1 A;  5ECA A;  2DF6 A;  1SRM A;  4OMQ A;  1X27 A;  4QT7 A;  2QDL A;  1UDL A;  1WI7 A;  2LJ1 A;  2KBT A;  1XOV A;  1WDX A;  2JMC A;  1ABQ A;  1UGV A;  1VYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...