4OMPA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128k
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGKTGYIPSNYVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 6
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4ompA00
2CUDA 4Y92A 4D8KA 1X6GA 4HVWA 4D8DA 3EHQA 2RF0A 1AWJA 2RMOA 5ECAA 3TVTA 1PRMC 1HSQA 5L23A 1YNZA 3NHNA 1NLOC 1QWFA 2SRCA 1GRIA 2LJ0A 1PNJA 2OJ2A 1MUZA 3VS2A 4HXJA 5IHIA 1Y0MA 1JXMA 2M51A 1ZUYA 2KXDA 1VA7A 1NG2A 1PHTA 1RUWA 3M0UA 4QT7A 1MV0B 1AEYA 2X3XD 1T0HA 3M0PA 4Z89A 1UG1A 1KIKA 2DNUA 2ABLA 3EG0A 4RTVA 1HJDA 2O31A 2CREA 1A0NB 2MCNA 2F2XA 2EGEA 1M3AA 1NYFA 1OV3A 2PTKA 4J9HA 1B07A 1AWXA 4ZNXA 1ZUUA 2AKKA 2K2MA 4AG1C 4LN2A 3M0QA 4JJBA 2M0YA 2J05A 4FSSA 4OMMA 1WFWA 5HCKA 1JXOA 2YUOA 2LZ6B 2ECZA 2KRNA 2L3QA 2CT3A 1WXUA 1SSHA 2DYBA 2EYWA 2LCSA 4JZ4A 2LQWA 2C0IA 1PRLC 1UJ0A 2DL8A 1OEBA 1Y57A 1AD5A 2K9GA 2D8JA 1ZBJA 4AG2C 1XOVA 2LJ3A 4HVVA 2O2OA 2DMOA 2RQWA 2KEAA 1NYGA 3TSZA 5IHNA 2I0NA 2JMCA 4E6RA 2BZXA 2W10A 2BTTA 1BB9A 2JT4A 4OMQA 2FPFA 3U23A 2MOXA 5I22A 3I5SA 1CSKA 1SRLA 2SEMA 4JPBW 5IH2A 2EQIA 1N5ZA 1M3BA 3EHRA 3VS4A 2AK5A 1GBQA 1S1NA 1TUCA 4Z88A 4OMOA 2LX7A 3UA6A 1GBRA 3O5ZA 2KE9A 2DA9A 1SHFA 1SHGA 3RBBB 4AFUC 2JM9A 2AZSA 1GCPA 4LNPA 1NM7A 1WXTA 4GBQA 2DL3A 1NEBA 2EPDA 2CSIA 2HBWA 1X43A 1ZUKA 1PKTA 2EYYA 3PVQA 1K1ZA 1QLYA 3QWYA 4M4ZA 1WYXA 4R0KA 2GNCA 4RTUA 1KFZA 1YCSB 1ABOA 2JTEA 1JO8A 2KXCA 4J9CA 1M27C 2J7IA 2C0TA 1FMKA 1I07A 2JW4A 5IHKA 4K11A 1UTIA 2X3WD 1UHFA 2MIOA 1AZGB 2EYXA 2NWMA 3I9QA 2DILA 2AKLA 2DRMA 1WDXA 1T3LA 1UE9A 1UDLA 4AFSC 2DLPA 1K0SA 2HSPA 3VS7A 1YWPA 4AFQC 4JJCA 2DBKA 2KNBB 2KGTA 2JMAA 1PWTA 1M3CA 1H3HA 4RTZA 2DL5A 4Z8AA 4AFZC 1H92A 2KROA 4RTTA 1ZSGA 2ED0A 2RQTA 1I0CA 2EGAA 1GL5A 4J9GA 2ESWA 1EFNA 1UUEA 1WLPB 2O88A 2L2PA 3VS3A 2CUBA 2ED1A 2A28A 1YP5A 4WCIA 4J9EA 2YUNA 1SRMA 1UGVA 4EIKA 2J6KA 1WA7A 2V1QA 2W0ZA 1VYVA 5FWCA 4J9IA 1AWOA 1YWOA 2YDLA 1QWEA 2FPEA 2LP5A 3FJ5A 2KBTA 2OAWA 2VVKA 1OOTA 1OPKA 1CKBA 1Z9QA 2GTJA 3KFVA 1AOJA 4CC7A 3R6NA 1VYUA 3I5RA 5I11A 1E6GA 1QKXA 2EW3A 1GFDA 1BK2A 3RNJA 2DL7A 4J9FA 2K6DA 1B3QA 1K4US 1QCFA 2DF6A 1NEGA 3H41A 3VRYA 2LQNA 2O9SA 4CC4B 3IQLA 1PKSA 5FWBA 1ZX6A 2RQUA 1UHCA 3UA7A 2DX1A 4J9BA 4ORZA 2KYBA 4OMNA 1W1FA 2XMFA 3A98A 4RTWA 1U06A 1E6HA 1OPLA 2KT8A 3JV3A 2DE0X 3REAB 2D1XA 2KT1A 3TSWA 3ULRB 1ABQA 1JU5C 3SHWA 3M0SA 2CH4W 2FO0A 1K9AA 1WI7A 3VS5A 2K7AA 1GCQC 1WX6A 2ROTA 1ARKA 1TUDA 1RLQC 1GCQA 1BU1A 1H8KA 2JS0A 2VWFA 5GJVB 2VKNA 5GJWB 1KSWA 2BZYA 2JM8A 2PZ1A 4RTXA 2EYZA 2E5KA 2A08A 2B86A 1RI9A 4KRTA 1LCKA 4OMLA 1M8MA 2G6FX 3EG1A 1E7OA 2J6OA 4LUDA 3EG3A 2C0OA 2CDTA 4ESRA 1BBZA 4JJDA 1AVZC 2RQVA 2DJQA 2O9VA 1CKAA 1MV3A 2J06A 4F17A 2V1RA 1M30A 2GGRA 1X2KA 3PE0A 2QDLA 4OMPA 1G83A 2D8HA 1GFCA 1QKWA 2F2WA 2EBPA 3NMZC 4DEYA 2LMJA 1X27A 2H8HA 4RTYA 2KYMA 2CSQA 5EC7A 1JEGA 2GBQA 5IXBA 3NPFA 4HVUA 2PNIA 3SEMA 2P4RA 1HD3A 2YSQA 2ROLA 2LNHB 3I35A 3REBB 2A36A 1K76A 4DEXA 3M0TA 4CC2A 1G2BA 3ZL7C 3LH5A 2EGCA 1KJWA 2YUPA 1TG0A 4F16A 1JQQA 2L3PA 4RUGA 3H0FA 2RPNA 3VRZA 2YT6A 2RN8A 2HDAA 2FPDA 1SEMA 3EGUA 2LJ1A 2CH4A 3THKA 4IIOA 3UATA 2OI3A 1UFFA 1WXBA 2JXBA 2HEQA 2CT4A 2A37A 4LUEA 3M0RA 1U3OA 4J9DA 1X69A 2KR3A 2RQRA 3VS6A 1K0XA 2D0NA 2YUQA 1I1JA 1U5SA 4HCKA 2KRMA 2EVRA 2K79A 3QWXX 2HCKA 1AWWA 4X1VA 1FYNA 2GTOA 3CQTA 2ENMA 5FW9A 1Z9ZA 2FEIA 2DBMA 1WIEA 1NLPC 5IXFA 1YN8A 2BZ8A 2DL4A 1SPKA 4F14A 2FG0A 1IO6A 1W70A 2RNAA 3H0IA 1X6BA 2L0AA 1T0JA 2FRWA 3VS1A 2GQIA 1T3SA 2J6FA 1AZEA 4GLMA 3UF4A 1X2QA 2DVJA 1RLPC 2FRYA 3EG2A 2F2VA 4A63B 2DM1A 1UJYA 3PVLA 2L3SA 1UECA 1W6XA 3C0CA 1VYTA 2IIMA 2AZVA 4LE9A 1J3TA 2KRSA 2DRKA 3VS0A 1V1CA 4CC3A 2EKHA 2NUZA 2K3BA 1ZLMA 3NGPA 2JS2A 4JZ3A 3H0HA 3GBQA 4IIMA
chains in the Genus database with same CATH superfamily
3MEWA 4Y92A 4D8KA 3OYNA 3QPHA 5I2SA 1B34A 1HSQA 2AIRB 3DB4A 3G4SQ 1JB0E 1NLOC 2K3YA 1GRIA 2LJ0A 2HL5C 1YI2Q 3V7RA 3VS2A 5KYWB 1VQ8Q 1FMWA 3M4YA 4FYWB 1YFNA 2GFUA 1BI1A 3HTRA 2DD4A 1SSFA 3X25B 1IRXA 4C92A 2X3XD 2P4TA 1VQ9T 1KIKA 1UGPB 3X28B 1YJNA 1WHKA 2CREA 5HK3A 2EGEA 4XTUA 2DTIA 1W2BP 1ZUUA 2RI5A 4HCBA 1VOMA 4LN2A 4PL6A 2M0YA 2JTFA 2JZ2A 1VQNA 2IPOB 3CBMA 2YUOA 3CCLT 3DLMA 2ECZA 3PGGA 3CPWP 1VQKT 2QEXQ 2LCSA 1O9SA 2F5KA 1WQ7A 2CZ0B 2LQWA 3VV0A 1PRLC 3QUIA 1UJ0A 3CCRQ 2DL8A 3QDFA 5GMKh 3OYBA 3CCEQ 2D8JA 1ZBJA 2O2OA 2LDMA 2M16A 1VQMT 4KBMB 2QK0A 3L2VA 5CVIA 2Z0WA 4E7JA 3EGDA 2JMCA 2KY9A 3GIBA 2RO0A 5FLXE 1BB9A 2QA4T 4A4EA 4CI0C 1MNEA 2SEMA 3S3OA 3EHRA 2DZ9A 2K2VA 1D09B 4M75F 1K9MU 1OX8A 1TUCA 3CMAT 3UA6A 5LJ5e 1GBRA 5GMKe 1R0CB 3O5ZA 3CPWS 2LX9A 4F7UF 2DA9A 1SHFA 1QCNA 1D0YA 1G3WA 3CCQA 3TEEA 2AZSA 4LNPA 4GBQA 1M5Q1 4FT2A 2F5TX 2HBWA 2QTXA 1RADB 1VQPQ 2JTMA 1WYXA 4R0KA 1KFZA 4EPCA 4QQGA 1GXIE 1K8AC 2J7IA 2C0TA 1FMKA 1I07A 4C8QA 3JCMf 2X3WD 2MIOA 2EYXA 1O75A 3OYLA 2NWMA 2DILA 2AKLA 1H3ZA 1K9MR 1UE9A 3RMQA 1UDLA 5IN1A 1OQKA 3RIRA 1YWPA 3FIFA 1RAHB 3OBWA 2DBKA 2M02A 2V8IA 4BD3A 1MMDA 4A4KA 1WJQA 2JN0A 2YRVA 4Z8AA 3UPUA 2H3JA 2RQTA 4C92F 1I0CA 2EGAA 2ESWA 3E1SA 5IT9E 4CRIA 2CZ7B 1YIJA 2E10A 2L2PA 1RAEB 4IURA 2MWOA 4WCIA 2BKDN 1SRMA 2RI2A 1QVFA 5CKDA 2GF7A 3E9FA 5KCOA 2DD5A 1X6OA 2V1QA 2YRDA 3AT1B 4TVRA 1AWOA 2COYA 2CS7A 3RUXA 1BYMA 2YDLA 2MAMA 1QWEA 2FPEA 2XI9A 3RKYA 4PJOB 4M7DC 5LL6S 3R6NA 1VYUA 2COZA 1M2VB 4X9DA 5I11A 1E6GA 1QKXA 1BK2A 3RNJA 3CMEA 1LJOA 4J9FA 2VXEA 2K6DA 1B3QA 4Y91A 1NEGA 1PD0A 3CCJA 4JRQA 1C6VX 3LYIA 3IQLA 3I56A 4MDXA 3G71T 4DOVA 5FWBA 4GLKA 1ZX6A 3EGXA 3OYKA 4OGEA 3UA7A 3L2ZA 5GAN4 1QVFP 4L59A 2CYZB 4OMNA 4WF2A 3CCUT 1D3BB 3HKSA 1PM3A 3JV3A 1X01A 2DXUA 3JB9F 2DE0X 2CP0A 1BIAA 2WACA 1KD1C 1K9MC 1JU5C 2CH4W 4E7LA 4AT1B 1WI7A 4LD9K 3EG9B 2ROTA 3E9GA 1TUDA 3T9NA 2X4XA 3L2WA 1BU1A 3JB9J 2EFIA 3OS0A 5GJVB 2FZKB 4PLIA 4JRPA 2PZ1A 2B86A 5KE2A 2J6OA 4C0ZA 1SG5A 4M75G 2CDTA 3EG3A 4ESRA 4JJDA 4IUVA 4C8QF 4OP0A 4L6V5 1QVFS 4F7UG 2DO3A 4D6WA 5J39A 3QXEB 1YI2T 4BI4A 1VQ8T 3NMZC 1WJRA 1VQ7Q 3RERA 4RTYA 2H8HA 4N0AA 2KYMA 2R57A 5EC7A 2GBQA 3NPFA 4E7HA 3QJ6A 3A8OB 3UT1A 3CD6Q 2CP3A 2ROLA 3I55A 3G1JA 4DEXA 3LH5A 3OQ5A 1YJWA 4F16A 1JQQA 5FROA 4II1A 4UC4A 1TXQA 1V29B 4EMHA 3QZ9B 2RN8A 3C12A 4A53A 2DIQA 3OBYA 3H8ZA 2JXBA 4QKUA 1NZ9A 3M0RA 3G4SA 1VQMQ 1X69A 4ZTFA 2RQRA 3J7AF 1K0XA 2DEUA 1I1JA 2NUTA 4C92G 3PNWC 4HCKA 3BDUA 2QEXT 3QWXX 3P8HA 4OVAA 3S3NA 4PJOD 3JCMP 2KK4A 3LWIA 2HCKA 2ZGWA 5GANd 2XD0A 4XTXA 7AT1B 1JBMA 4ZGEB 3AHUA 5GAMd 3TREA 3CCET 2DK3A 2FEIA 4J83A 3SB2A 3M56A 2Y90A 3HP9A 1SPKA 2FHDA 2FG0A 2RD1A 3H0IA 2E3HA 3V8JA 2L0AA 3OSVA 3VS1A 4ELYC 4FSXA 1EZZB 4RKUE 4RMOA 1T3SA 1AZEA 3FB9A 4C92D 2RK1A 1RLPC 1MHNA 1D1CA 5HK0A 1W6XA 4XTYA 1YBYA 1TS9A 4XU0A 2IIMA 3M5AA 2IG0A 3EFOA 4GY5A 1J3TA 2KRSA 2LNVA 5GMKi 2C06A 1VQLA 4M7DB 1M4ZA 2NUZA 1SKUB 3CBOA 3GBQA 3JSCA 1R77A 2FL7A 3EHQA 4V2SA 3CC7A 2RMOA 2ATCB 1VQ6A 3X20B 5L23A 1MMAA 3JB9G 3NHNA 2JUFA 2SRCA 2DEQA 5C6SA 3CCVQ 2HSEB 3MCAB 5GAOm 2GCXA 2M9UA 1RAAB 5GAOl 3TQ7P 5A0DA 1VIFA 1NG2A 1PHTA 4NL2A 4HT9A 1AEYA 4R56A 3QDRB 2QQ9A 4BACA 2E70A 5A0GA 1M2OA 2QGFB 2ABLA 2PU9B 4RTVA 1A0NB 1W4SA 5CKFA 2F2XA 3G6EA 1OV3A 3ZEHA 3DB3A 1VQPA 2QQSA 2K2MA 5D7UA 4C8QG 1AHJB 4AG1C 2LT4A 1N8RC 1WHGA 3BFMA 5I2MA 2RJCA 1HYOA 1ZHIA 3JCMJ 2J05A 4A4GA 4M7AA 2LZ6B 4ZGDB 3PT9A 2K4YA 1B7TA 2CT3A 3N5BB 4EMKB 5GAN8 1WXUA 2V26A 4JZ4A 1VQ5Q 2C0IA 1Y96B 4J8OA 2A0FB 2K57A 2E41A 2K9GA 4JLIA 3S3MA 4AG2C 3CCUQ 2LJ3A 2VC8A 2DMOA 2EYQA 2RQWA 3OYAA 4M75C 1NPPA 2LCLA 2M0OA 1VQ4A 5LJ3d 4OB3B 3NTKA 2JT4A 3U23A 3SWNA 1KC8U 3GOXA 1CSKA 5GANj 5IH2A 1N5ZA 1M3BA 3VS4A 3A8LB 4LD6A 3QHSA 5GAMj 2HQXA 4Z88A 4OMOA 2LX7A 4KT0E 3CXCA 1Q86U 1VQOA 3J81E 4KGZB 1SHGA 4AFUC 2OTLQ 2GQVA 1K8AU 3QZ5B 3QIIA 1UEBA 5KYUA 1PD1A 2MI6A 2EJFA 2CSIA 5GAOr 1X43A 2EYYA 1PKTA 4PJOE 1K1ZA 1RL2A 3OMCA 2V8KA 2YXYA 2GNCA 4KH0B 1YCSB 1V76A 1ABOA 2JTEA 1JO8A 3CC4A 1SF9A 3MP8A 2HQHA 3EH2A 1N27A 2DVEA 2OTJT 3NTHA 1UHFA 2NUPA 2DETA 4NL3A 1WJSA 4PFOA 5FRNA 1BCOA 3OYDA 4M7DD 3VU3C 3JB9I 4M77A 1YJ9A 4E7KA 2DRMA 3M54A 2YHTA 4AFSC 2DLPA 2F69A 4C92C 4AFQC 3OYJA 4JJCA 2KNBB 2JMAA 2QYZA 1PWTA 3CCSQ 4X9CA 1H3HA 1K8AR 3MEVA 2DL5A 2EWNA 4AFZC 5GAOn 2FZCB 2QQAA 2XIDA 1BIBA 2HAXA 4LDVA 2D0QB 4IUTA 4J9GA 3HHTB 1EFNA 2ZPFB 3VS3A 3J80E 1VQ7T 2CUBA 2A3LA 1G8XA 1UGVA 4EIKA 2PVDB 3PTAA 1YHQQ 1WA7A 3CD6T 3JB9H 1OZ3A 2W0ZA 3O8VA 5FWCA 2XDBA 2VVKA 4M7AF 1OPKA 1Z9QA 2GTJA 4CC7A 1VQ9A 1NE8A 3JRZA 3I5RA 5LJ5d 3UDCA 4KGXB 4QQDA 1DJ7B 1GFDA 2E5QA 2LC4A 3PMTA 3OYIA 3CXCS 4M78G 3HRUA 4LDYA 1K4US 1QCFA 4RG2A 3VRYA 2LQNA 2Y4XA 3RKWA 3HL8A 1PKSA 3CCLA 2K5LA 3R6OA 4C0DC 2RQUA 2G3RA 5CQYA 1TTHB 1VQKA 3SDZA 1KD1U 3OMGA 3QJYA 3OS1A 1W1FA 1U06A 5DM7R 1KC8C 2E64A 2DKGA 3REAB 5LJ3j 5D6XA 2VUBA 1RAGB 1IXDA 3ULRB 2JOYA 3JAME 4IUQA 2ZPBB 1VQMA 3LX7A 1Q86C 2QG9B 2QXFA 1GCQC 4MZTA 4FW2A 1GCQA 4C8QC 1H8KA 2QA4A 4J7IA 4IKFA 5GJWB 2O4XB 3RR6A 1Y07A 3OSSC 1XQHA 3GLXA 1XTDA 1KHCA 2A08A 2E5KA 2EYZA 4OMLA 2G6FX 3EG1A 2L3RA 1E7OA 2XHCA 3CMAA 2DXBA 2LTOA 1BI3A 5FU7B 1M9SA 1KD1R 1BBZA 2OAUA 2B8AA 2RQVA 2K3XA 3VKIA 4RCCA 2DJQA 2WSCE 2DJZA 5KYXA 4M75B 4M77F 1YITQ 2J06A 4J6WA 1HXDA 1M30A 4F7UB 1G83A 3CCVT 2D8HA 1GFCA 2DTOA 1QP3A 2F2WA 4OMFB 2EBPA 1EIFA 2CSQA 1KQ1A 1S72Q 4JS5A 3L2RA 2P4RA 2D9TA 1HD3A 3EFRA 1X75C 3CCMQ 3REBB 2PUOB 1K76A 4CC2A 1G2BA 2NYSA 3EH1A 3L42A 5KCHA 3DLLA 1UB4A 4QVCA 2KAFA 1MMGA 2L3PA 2VV5A 3VRZA 2YT6A 3OYFA 3M53A 1SEMA 4M7DE 3THKA 3VJPA 2HKNA 1B34B 1WXBA 1C1AA 2HEQA 2CT4A 1RAIB 4LUEA 2A37A 1I8FA 1TUGB 2GFAA 2KR3A 4E7SA 3VS6A 4N4GA 1D1AA 2D0NA 5DLOA 4QVDA 2P84A 1IHWA 3CC2T 2EVRA 2X9HA 2VXFA 1VQ5T 3H9NA 3BDLA 4C92B 1AWWA 4JUVA 1LVKA 2V8JA 5LJ5j 3JCMb 2E4HA 1ZA1B 4RCBA 5CCAA 2ENMA 2R58A 5FW9A 1KG1A 1OZ2A 5GAN2 1NLPC 4E7IA 2PUKB 2BIVA 4BE2A 4B9XA 1IO6A 2FYKA 1W70A 2RNAA 4M7AG 4MZMA 1X6BA 1T0JA 5DY9A 4KUDK 3MO8A 1IZ6A 4BI3A 1WPYA 1X2QA 2DVJA 4P5NA 3OYGA 2LCCA 3EG2A 2F2VA 2L3SA 5FU6C 4VUBA 3FDRA 4HKEA 3JCMc 2OTJQ 2EQKA 3G71A 2HBPA 2QI2A 2DRKA 3PIPA 2OTLT 2HNIA 2K3BA 3NGPA 1R8OB 1YJNQ 1UGQB 4JZ3A 5GANg 1JJ2A 2QAZA 4M7AD 4ZGJB 1M1KU 2CUDA 2RI3A 3TCJA 5J26A 1X6GA 4HVWA 1QMCA 2IVWA 3EGDB 1AWJA 2E12A 5ECAA 3TVTA 1PRMC 4QW2A 4E7ZA 4BDYA 2WSFE 1ZA2B 1VQNQ 2VASA 4DA4A 2XU8A 2OJ2A 5FRMA 1MUZA 2OX7A 4N0AC 3OYYA 4C0DB 1H641 4M78C 4KH1B 2HQEA 2KXDA 1WZOA 4L5GA 3M0UA 1U8RA 4M78A 2BE9B 1N8RU 3M0PA 4M75D 4Z89A 1KQSA 2DNUA 1ZSZC 3CCST 2ZCFB 3EG0A 4OGCA 1ACMB 1BKBA 2O31A 5CKEA 1ZSZA 4OF1A 2LQKA 4MZPA 4FT4A 1NYFA 2PTKA 1B07A 1AWXA 4ZNXA 2AKKA 1BCMA 1WHMA 4PFZA 4C5HA 5CIUA 3LLRA 1RI0A 4FSSA 4C8QB 4OMMA 1WFWA 4M77G 5HCKA 1JXOA 1N9SA 3JCMd 4FIBA 1YI2A 3KBGA 2CKKA 1IB8A 2ZAEA 1YHQT 1D0XA 1VQ8A 4BDZA 2DYBA 3V8LA 2EYWA 3VYGA 2RHYA 1U1SA 3CCQQ 1Y57A 1AD5A 1N8RR 2MF2A 2CZ1B 5AT1B 3VUBA 1M1FA 2KEAA 1NYGA 3A8GB 1MNDA 2XDDA 2ZPIB 4XAXB 3MP1A 4XU2A 5IHNA 2JJ9A 3TSZA 4E6RA 2BZXA 4JRKA 5KH6A 5GANh 4OMQA 2FPFA 3I5SA 1SRLA 1LOJA 4JPBW 2EQIA 1M90C 3RKXA 5KYWA 5GAMh 1JJ2S 5GAN7 1G3TA 3A1PA 1GBQA 1S1NA 4EDUA 4HCZA 2ZPEB 2QEXA 2KE9A 3V7SA 2DYIA 2VYTA 2JM9A 1GCPA 3CCRA 2ZZDA 1WXTA 5KE3A 1NJIU 2DL3A 3CCEA 2EPDA 1ZUKA 2DFUA 3PVQA 4QVZA 1QLYA 3QWYA 5GANe 4M4ZA 2RH2A 4Q5WA 2EKOA 1YIJQ 2KXCA 4J9CA 4PJNA 1M27C 5GAN3 2DAQA 3A8HB 5GAMe 3OS5A 5IHKA 4KUIA 4J5YA 4ME7A 1AZGB 3EGXB 2EIFA 1M1KC 2EQJA 3I9QA 1WQWA 3LGFA 1EX4A 1T3LA 2Y4YA 4AMCA 2HSPA 2BE7D 4LXCA 3VS7A 1BI0A 2ZPGB 2RA2A 3HRSA 1RAFB 3ASKA 8AT1B 4RTZA 3CMEQ 1OYXA 1YITT 1Y7XA 2KROA 4M78F 4RTTA 1ZSGA 2CP7A 1M8VA 4ANJA 3FC3A 4BE0A 3JB9D 3CCJQ 1GL5A 2YLCA 2CGHA 3JCMX 3I56Q 2A28A 2HMAA 5FU6B 3MKDA 4M7AC 4J9EA 2YUNA 4X34A 1S72T 3HPWA 9ATCB 2RK2A 1NBEB 1WGSA 3CCMT 1PG5B 3CC2Q 4JJNK 1YWOA 5CR2A 4C5EA 4LDUA 2DPPB 2R5AA 4ATOA 5AYFA 4PJLA 1AOJA 2BUDA 4XU1A 2RHIA 2QASA 4C8QD 2DL7A 4KULA 1Q7YC 1KK7A 3MJXA 3H41A 4M75E 2L8DA 1FX7A 3SWNC 3JCMW 3OA6A 2HL3A 4M78B 2JVVA 5L8RE 4F7UE 4R55A 2QTVA 1UHCA 4J9BA 2KYBA 4JLGA 3A5ZB 2VGNA 4KGVB 4YTLA 2RJDA 2XMFA 3A98A 4RTWA 1XJWB 4PLLA 5LJ3h 4A4FA 2KT8A 3MP6A 3GPLA 1R0BG 5HY6A 3OYCA 2D1XA 3TSWA 4FYYB 2QQBA 1ABQA 3SD4A 3SHWA 2LQ8A 4FCYA 2FO0A 3BE3A 3VS5A 2K7AA 3JCMQ 5DLQE 1I4K1 4OB0B 2QQRA 2YRCA 1RLQC 1Q82C 4IUPA 2NUTB 2L89A 4B9WA 5KYNA 1TH7A 2JS0A 1NJIC 2VKNA 1KSWA 2BZYA 3I55Q 1TWBA 2E6ZA 3PIOA 4RTXA 1KC8R 1RI9A 4M77C 1W2BA 4LDWA 1YJWQ 5LJ3e 1YJNT 4PJOA 3KUFA 1AVZC 3V7CA 3URGA 2O9VA 1Q86R 4C92E 1M2VA 3CXCP 3OYHA 3VYHB 5CK9A 3CPWA 1CKAA 3GNGA 4F17A 2V1RA 3PE0A 2QDLA 2AHJB 2MK5A 1VQNT 1K73C 2MMPA 3QYHB 1QKWA 1X27A 1NPRA 5IXBA 2OTJA 4HVUA 2PNIA 3ER0A 2YSQA 1RABB 2LNHB 3EFOB 1PSFA 3RESA 3ZL7C 4JDSA 1IHVA 1D3BA 2QGGA 1Q81C 3LH0A 2X4WA 2E3IA 2FPDA 3EGUA 2CH4A 3UATA 4IIOA 4EMGA 2E1HA 1UFFA 2OI3A 4PK4A 2KQWA 1U3OA 1U1TA 3CPFA 3EAEA 4J9DA 2RHXA 2E6NA 3EG9A 2EAYA 4BI8B 2YUQA 3D7SB 3GF5A 1U5SA 3MPUB 1VQ7A 1IREB 2RHZA 2X35A 5LJ5h 3CCQT 4ZN3A 1VQLQ 3CD6A 1FYNA 2GTOA 3CQTA 1OULA 3NTIA 5IXFA 2YWWA 1YN8A 2XG8D 2BZ8A 2DL4A 3CC7Q 4FW1A 1VQ6Q 4BUGA 1QVGA 1I5OB 1IGUA 2NLUA 1W2BS 2GQIA 1OI1A 4M78D 3L2QA 2DIGA 1JRIA 4GLMA 3UF4A 3HSBA 4M7AB 6AT1B 5CAIA 4A63B 1UJYA 3PVLA 3CEYA 2RJEA 1KHIA 2X4JA 1VYTA 4DQ2A 8ATCB 4C8QE 2AZVA 3ME9A 4LE9A 2CZ6B 5GAOp 1V1CA 4CC3A 5A2QE 1P92A 2FZGB 1TOVA 1ZLMA 4B6MA 4FM4B 3G6EQ 3H0HA 2RHUA 4BB7A 1HK9A 4IIMA 3LW5E 3M59A 4D8DA 2RF0A 1YIJT 1YNZA 3DKMA 4C5GA 4PJOF 1QVGP 1F1BB 1QWFA 3SWNB 1PNJA 4HXJA 5IHIA 4O5VA 1Y0MA 3OW2A 3OY9A 1JXMA 2M51A 1ZUYA 2FB7A 2K5IA 1VA7A 1RUWA 4QT7A 4FL6A 3WVEB 5GANf 1MV0B 3BW1A 1TU0B 2MPXC 1T0HA 3VUZA 5GAMf 1UG1A 1HJDA 5KYUB 3CMET 2MCNA 1G3YA 3INZA 1M3AA 4XTZA 2O01E 1MGQA 4J9HA 4DBRA 1VQ4Q 4QQ6A 1PSEA 3CCJT 4BE1A 2R5MA 2RJFA 3M0QA 2VGMA 4JJBA 2EQMA 2I2LA 3I56T 4BY6C 4JS4A 3CCVA 2NUPB 4DBQA 2KRNA 2L3QA 2VB6A 4PKCC 1SSHA 1QVGS 4M77B 1VQOQ 2P0KA 2D6FA 4FYVB 2A7YA 3OW2P 1OEBA 4M7DA 1QQJA 1WNLA 5GMKj 1XOVA 2DZCA 3LGLA 4HVVA 1BI2A 1ZQ1A 5I21A 1M90U 1WHLA 3M57A 3CC4Q 2I0NA 2W10A 2AT1B 5M9OA 5CKHA 2BTTA 4DOWA 1QW1A 3X24B 2MOXA 1D1BA 5I22A 1IGQA 3JCMV 4Y28E 2KVQG 2DERA 4J6YA 1YJ9Q 2AK5A 1PCXA 1I81A 5CQXA 3CC2A 2XDPA 2QDYB 3JCMg 3KXTA 1VQ5A 2PVOB 3BY7A 3RBBB 2EJ9A 4DBHA 1NM7A 3OW2S 1NEBA 4NS5A 3CCUA 4DBFA 3QG1A 3L1AA 2JNGA 2RB6A 3SFMA 1C0MA 3PMIA 4RTUA 4F04B 1M90R 4C0GA 2ZPHB 5GAMg 3ZBDA 1G3SA 2COWA 5GAN6 2JW4A 4K11A 1UTIA 4EMKC 5KYYA 3I55T 2KSSA 4EMKA 4FU6A 3M58A 3C4SA 1LNXA 1WDXA 1YJWT 1Y96A 3QBYA 1OU9A 1K0SA 4M78E 5IAYA 1VQ9Q 4HA8A 2KGTA 2OTLA 1M3CA 2LT1A 1OU8A 5D6YA 1D0ZA 3G4ST 4HCCA 1H92A 4XU3A 4XQ3A 2DTHA 2ED0A 1G5VA 2XK0A 5LJ3f 4MMLA 1M1KR 1UUEA 1WLPB 2KI7A 2O88A 1JJ2P 2ED1A 1KQ2A 1YP5A 3CCLQ 3GP8A 2J6KA 4PJOG 1VQKQ 1VYVA 2P0PA 4J9IA 4NOYA 1FWZA 2LP5A 2X4YA 2KBTA 2OAWA 3C95A 3FJ5A 2FVUA 1VIEA 4A4HA 4OB1B 1OOTA 3TU4K 1CKBA 3KFVA 1Q7YU 3E2UA 5CKBA 5KYXB 3CCSA 2CP2A 2EW3A 2XKOC 3JCMh 4JRIA 2L5QA 1FXXA 3QO3A 4IUUA 1KQSP 4ZTJA 4ELZC 4M7DF 2DF6A 2QA4Q 4M77D 4PNOA 1UGRB 1RACB 2O9SA 4CC4B 2WSEE 3F70A 3CCRT 1TSFA 3C94A 2DX1A 1YHQA 1VQLT 3CMAQ 4ORZA 1I5LA 2E65A 1E6HA 1QCOA 4XK8E 1QVPA 5GAOq 3QSUA 1OPLA 3MEUA 3JCMe 4MMKA 3CC7T 1Q82U 3OB9A 5C0MA 1Q7YR 1M1GA 1VQ6T 2KT1A 3WVDB 1N6AA 2MWPA 3EFSA 3M0SA 3S6WA 1AT1B 4RG8A 3FJPA 1K9AA 3NFCA 3M9QA 1N9RA 1WX6A 3M4GA 4BY6B 1ARKA 3OS2A 4C5IA 1FMVA 2HZYA 1QP2A 1UGSB 2VWFA 2X51A 1KQSS 4E2FB 2JM8A 1YCYA 4C0FA 4FYXB 4KRTA 5LJ3g 4E47A 1LCKA 1M8MA 5J3BA 3CBPA 4LUDA 1Q95G 2C0OA 3UWNA 3G6ET 3L2UA 2M1HA 1K73U 2XICA 1VQPT 2K5FA 5LJ5f 3ZFJA 4WTOB 4PFPA 4N4IA 3WXMB 1MV3A 1Q82R 1OX9A 3M55A 2GGRA 1X2KA 3P8DA 2P0QA 4OMPA 3RDVA 1NJIR 2PQWA 2RM4A 2CP5A 2YLBA 3V8KA 4DEYA 2LMJA 5A0LA 1JEGA 4N4HA 3X26B 1WHHA 3SEMA 2KDSA 1Q81U 3HFOA 4M7AE 3I35A 2KMTA 2A36A 3M0TA 1WHJA 2EGCA 1KJWA 2YUPA 1TG0A 3FEOA 3QYGB 4XTVA 1XNIA 4RUGA 3A8MB 3H0FA 2RPNA 1LPLA 1K73R 2DXTA 2CP6A 2HDAA 2HD0A 1VQ4T 2LJ1A 1ZBXA 4LDXA 2MYSA 3E19A 2LVMA 1YITA 3META 4MDWA 5CO7A 5KYYB 1MMNA 4PJMA 4J7FA 4A54A 3FLGA 2LRQA 4Z02A 4PJJA 5HKCA 2KRMA 3H6ZA 3G71Q 2K79A 1PC0A 1VQOT 2O4XA 2HKQB 1Y71A 1S72A 1Q81R 4X1VA 5FU7C 3CCMA 1Z9ZA 2DBMA 1VUBA 1WIEA 3Q1JA 1ZSZB 4OB2B 2EQUA 3MEAA 4F14A 4M75A 3MHXA 3CC4T 3G7ZA 2FRWA 3OYEA 5EG2A 2J6FA 2DXCA 4F7UA 5GAN5 5LJ5g 2FRYA 3GNFB 2DM1A 2EJGA 3HFNA 1UECA 1YJ9T 5GMKm 3OYMA 4M7DG 4J6XA 3C0CA 3RMSA 3P8BB 3PFSA 5GMKl 3HRTA 4HT8A 3VS0A 2PVGB 4ZN1A 2EKHA 3LWHA 5D6WA 2H3EB 3FRNA 2JS2A 4PJOC 4O6JA 4M77E 2F1LA 3QKJA 4XTWA
chains in the Genus database with same CATH topology
2CUDA 4Y92A 4D8KA 1X6GA 4HVWA 4D8DA 3EHQA 2RF0A 1AWJA 2RMOA 5ECAA 3TVTA 1PRMC 1HSQA 5L23A 1YNZA 3NHNA 1NLOC 1QWFA 2SRCA 1GRIA 2LJ0A 1PNJA 2OJ2A 1MUZA 3VS2A 4HXJA 5IHIA 1Y0MA 1JXMA 2M51A 1ZUYA 2KXDA 1VA7A 1NG2A 1PHTA 1RUWA 3M0UA 4QT7A 1MV0B 1AEYA 2X3XD 1T0HA 3M0PA 4Z89A 1UG1A 1KIKA 2DNUA 2ABLA 3EG0A 4RTVA 1HJDA 2O31A 2CREA 1A0NB 2MCNA 2F2XA 2EGEA 1M3AA 1NYFA 1OV3A 2PTKA 4J9HA 1B07A 1AWXA 4ZNXA 1ZUUA 2AKKA 2K2MA 4AG1C 4LN2A 3M0QA 4JJBA 2M0YA 2J05A 4FSSA 4OMMA 1WFWA 5HCKA 1JXOA 2YUOA 2LZ6B 2ECZA 2KRNA 2L3QA 2CT3A 1WXUA 1SSHA 2DYBA 2EYWA 2LCSA 4JZ4A 2LQWA 2C0IA 1PRLC 1UJ0A 2DL8A 1OEBA 1Y57A 1AD5A 2K9GA 2D8JA 1ZBJA 4AG2C 1XOVA 2LJ3A 4HVVA 2O2OA 2DMOA 2RQWA 2KEAA 1NYGA 3TSZA 5IHNA 2I0NA 2JMCA 4E6RA 2BZXA 2W10A 2BTTA 1BB9A 2JT4A 4OMQA 2FPFA 3U23A 2MOXA 5I22A 3I5SA 1CSKA 1SRLA 2SEMA 4JPBW 5IH2A 2EQIA 1N5ZA 1M3BA 3EHRA 3VS4A 2AK5A 1GBQA 1S1NA 1TUCA 4Z88A 4OMOA 2LX7A 3UA6A 1GBRA 3O5ZA 2KE9A 2DA9A 1SHFA 1SHGA 3RBBB 4AFUC 2JM9A 2AZSA 1GCPA 4LNPA 1NM7A 1WXTA 4GBQA 2DL3A 1NEBA 2EPDA 2CSIA 2HBWA 1X43A 1ZUKA 1PKTA 2EYYA 3PVQA 1K1ZA 1QLYA 3QWYA 4M4ZA 1WYXA 4R0KA 2GNCA 4RTUA 1KFZA 1YCSB 1ABOA 2JTEA 1JO8A 2KXCA 4J9CA 1M27C 2J7IA 2C0TA 1FMKA 1I07A 2JW4A 5IHKA 4K11A 1UTIA 2X3WD 1UHFA 2MIOA 1AZGB 2EYXA 2NWMA 3I9QA 2DILA 2AKLA 2DRMA 1WDXA 1T3LA 1UE9A 1UDLA 4AFSC 2DLPA 1K0SA 2HSPA 3VS7A 1YWPA 4AFQC 4JJCA 2DBKA 2KNBB 2KGTA 2JMAA 1PWTA 1M3CA 1H3HA 4RTZA 2DL5A 4Z8AA 4AFZC 1H92A 2KROA 4RTTA 1ZSGA 2ED0A 2RQTA 1I0CA 2EGAA 1GL5A 4J9GA 2ESWA 1EFNA 1UUEA 1WLPB 2O88A 2L2PA 3VS3A 2CUBA 2ED1A 2A28A 1YP5A 4WCIA 4J9EA 2YUNA 1SRMA 1UGVA 4EIKA 2J6KA 1WA7A 2V1QA 2W0ZA 1VYVA 5FWCA 4J9IA 1AWOA 1YWOA 2YDLA 1QWEA 2FPEA 2LP5A 3FJ5A 2KBTA 2OAWA 2VVKA 1OOTA 1OPKA 1CKBA 1Z9QA 2GTJA 3KFVA 1AOJA 4CC7A 3R6NA 1VYUA 3I5RA 5I11A 1E6GA 1QKXA 2EW3A 1GFDA 1BK2A 3RNJA 2DL7A 4J9FA 2K6DA 1B3QA 1K4US 1QCFA 2DF6A 1NEGA 3H41A 3VRYA 2LQNA 2O9SA 4CC4B 3IQLA 1PKSA 5FWBA 1ZX6A 2RQUA 1UHCA 3UA7A 2DX1A 4J9BA 4ORZA 2KYBA 4OMNA 1W1FA 2XMFA 3A98A 4RTWA 1U06A 1E6HA 1OPLA 2KT8A 3JV3A 2DE0X 3REAB 2D1XA 2KT1A 3TSWA 3ULRB 1ABQA 1JU5C 3SHWA 3M0SA 2CH4W 2FO0A 1K9AA 1WI7A 3VS5A 2K7AA 1GCQC 1WX6A 2ROTA 1ARKA 1TUDA 1RLQC 1GCQA 1BU1A 1H8KA 2JS0A 2VWFA 5GJVB 2VKNA 5GJWB 1KSWA 2BZYA 2JM8A 2PZ1A 4RTXA 2EYZA 2E5KA 2A08A 2B86A 1RI9A 4KRTA 1LCKA 4OMLA 1M8MA 2G6FX 3EG1A 1E7OA 2J6OA 4LUDA 3EG3A 2C0OA 2CDTA 4ESRA 1BBZA 4JJDA 1AVZC 2RQVA 2DJQA 2O9VA 1CKAA 1MV3A 2J06A 4F17A 2V1RA 1M30A 2GGRA 1X2KA 3PE0A 2QDLA 4OMPA 1G83A 2D8HA 1GFCA 1QKWA 2F2WA 2EBPA 3NMZC 4DEYA 2LMJA 1X27A 2H8HA 4RTYA 2KYMA 2CSQA 5EC7A 1JEGA 2GBQA 5IXBA 3NPFA 4HVUA 2PNIA 3SEMA 2P4RA 1HD3A 2YSQA 2ROLA 2LNHB 3I35A 3REBB 2A36A 1K76A 4DEXA 3M0TA 4CC2A 1G2BA 3ZL7C 3LH5A 2EGCA 1KJWA 2YUPA 1TG0A 4F16A 1JQQA 2L3PA 4RUGA 3H0FA 2RPNA 3VRZA 2YT6A 2RN8A 2HDAA 2FPDA 1SEMA 3EGUA 2LJ1A 2CH4A 3THKA 4IIOA 3UATA 2OI3A 1UFFA 1WXBA 2JXBA 2HEQA 2CT4A 2A37A 4LUEA 3M0RA 1U3OA 4J9DA 1X69A 2KR3A 2RQRA 3VS6A 1K0XA 2D0NA 2YUQA 1I1JA 1U5SA 4HCKA 2KRMA 2EVRA 2K79A 3QWXX 2HCKA 1AWWA 4X1VA 1FYNA 2GTOA 3CQTA 2ENMA 5FW9A 1Z9ZA 2FEIA 2DBMA 1WIEA 1NLPC 5IXFA 1YN8A 2BZ8A 2DL4A 1SPKA 4F14A 2FG0A 1IO6A 1W70A 2RNAA 3H0IA 1X6BA 2L0AA 1T0JA 2FRWA 3VS1A 2GQIA 1T3SA 2J6FA 1AZEA 4GLMA 3UF4A 1X2QA 2DVJA 1RLPC 2FRYA 3EG2A 2F2VA 4A63B 2DM1A 1UJYA 3PVLA 2L3SA 1UECA 1W6XA 3C0CA 1VYTA 2IIMA 2AZVA 4LE9A 1J3TA 2KRSA 2DRKA 3VS0A 1V1CA 4CC3A 2EKHA 2NUZA 2K3BA 1ZLMA 3NGPA 2JS2A 4JZ3A 3H0HA 3GBQA 4IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUD A;  4Y92 A;  4D8K A;  1X6G A;  4HVW A;  4D8D A;  3EHQ A;  2RF0 A;  1AWJ A;  2RMO A;  5ECA A;  3TVT A;  1PRM C;  1HSQ A;  5L23 A;  1YNZ A;  3NHN A;  1NLO C;  1QWF A;  2SRC A;  1GRI A;  2LJ0 A;  1PNJ A;  2OJ2 A;  1MUZ A;  3VS2 A;  4HXJ A;  5IHI A;  1Y0M A;  1JXM A;  2M51 A;  1ZUY A;  2KXD A;  1VA7 A;  1NG2 A;  1PHT A;  1RUW A;  3M0U A;  4QT7 A;  1MV0 B;  1AEY A;  2X3X D;  1T0H A;  3M0P A;  4Z89 A;  1UG1 A;  1KIK A;  2DNU A;  2ABL A;  3EG0 A;  4RTV A;  1HJD A;  2O31 A;  2CRE A;  1A0N B;  2MCN A;  2F2X A;  2EGE A;  1M3A A;  1NYF A;  1OV3 A;  2PTK A;  4J9H A;  1B07 A;  1AWX A;  4ZNX A;  1ZUU A;  2AKK A;  2K2M A;  4AG1 C;  4LN2 A;  3M0Q A;  4JJB A;  2M0Y A;  2J05 A;  4FSS A;  4OMM A;  1WFW A;  5HCK A;  1JXO A;  2YUO A;  2LZ6 B;  2ECZ A;  2KRN A;  2L3Q A;  2CT3 A;  1WXU A;  1SSH A;  2DYB A;  2EYW A;  2LCS A;  4JZ4 A;  2LQW A;  2C0I A;  1PRL C;  1UJ0 A;  2DL8 A;  1OEB A;  1Y57 A;  1AD5 A;  2K9G A;  2D8J A;  1ZBJ A;  4AG2 C;  1XOV A;  2LJ3 A;  4HVV A;  2O2O A;  2DMO A;  2RQW A;  2KEA A;  1NYG A;  3TSZ A;  5IHN A;  2I0N A;  2JMC A;  4E6R A;  2BZX A;  2W10 A;  2BTT A;  1BB9 A;  2JT4 A;  4OMQ A;  2FPF A;  3U23 A;  2MOX A;  5I22 A;  3I5S A;  1CSK A;  1SRL A;  2SEM A;  4JPB W;  5IH2 A;  2EQI A;  1N5Z A;  1M3B A;  3EHR A;  3VS4 A;  2AK5 A;  1GBQ A;  1S1N A;  1TUC A;  4Z88 A;  4OMO A;  2LX7 A;  3UA6 A;  1GBR A;  3O5Z A;  2KE9 A;  2DA9 A;  1SHF A;  1SHG A;  3RBB B;  4AFU C;  2JM9 A;  2AZS A;  1GCP A;  4LNP A;  1NM7 A;  1WXT A;  4GBQ A;  2DL3 A;  1NEB A;  2EPD A;  2CSI A;  2HBW A;  1X43 A;  1ZUK A;  1PKT A;  2EYY A;  3PVQ A;  1K1Z A;  1QLY A;  3QWY A;  4M4Z A;  1WYX A;  4R0K A;  2GNC A;  4RTU A;  1KFZ A;  1YCS B;  1ABO A;  2JTE A;  1JO8 A;  2KXC A;  4J9C A;  1M27 C;  2J7I A;  2C0T A;  1FMK A;  1I07 A;  2JW4 A;  5IHK A;  4K11 A;  1UTI A;  2X3W D;  1UHF A;  2MIO A;  1AZG B;  2EYX A;  2NWM A;  3I9Q A;  2DIL A;  2AKL A;  2DRM A;  1WDX A;  1T3L A;  1UE9 A;  1UDL A;  4AFS C;  2DLP A;  1K0S A;  2HSP A;  3VS7 A;  1YWP A;  4AFQ C;  4JJC A;  2DBK A;  2KNB B;  2KGT A;  2JMA A;  1PWT A;  1M3C A;  1H3H A;  4RTZ A;  2DL5 A;  4Z8A A;  4AFZ C;  1H92 A;  2KRO A;  4RTT A;  1ZSG A;  2ED0 A;  2RQT A;  1I0C A;  2EGA A;  1GL5 A;  4J9G A;  2ESW A;  1EFN A;  1UUE A;  1WLP B;  2O88 A;  2L2P A;  3VS3 A;  2CUB A;  2ED1 A;  2A28 A;  1YP5 A;  4WCI A;  4J9E A;  2YUN A;  1SRM A;  1UGV A;  4EIK A;  2J6K A;  1WA7 A;  2V1Q A;  2W0Z A;  1VYV A;  5FWC A;  4J9I A;  1AWO A;  1YWO A;  2YDL A;  1QWE A;  2FPE A;  2LP5 A;  3FJ5 A;  2KBT A;  2OAW A;  2VVK A;  1OOT A;  1OPK A;  1CKB A;  1Z9Q A;  2GTJ A;  3KFV A;  1AOJ A;  4CC7 A;  3R6N A;  1VYU A;  3I5R A;  5I11 A;  1E6G A;  1QKX A;  2EW3 A;  1GFD A;  1BK2 A;  3RNJ A;  2DL7 A;  4J9F A;  2K6D A;  1B3Q A;  1K4U S;  1QCF A;  2DF6 A;  1NEG A;  3H41 A;  3VRY A;  2LQN A;  2O9S A;  4CC4 B;  3IQL A;  1PKS A;  5FWB A;  1ZX6 A;  2RQU A;  1UHC A;  3UA7 A;  2DX1 A;  4J9B A;  4ORZ A;  2KYB A;  4OMN A;  1W1F A;  2XMF A;  3A98 A;  4RTW A;  1U06 A;  1E6H A;  1OPL A;  2KT8 A;  3JV3 A;  2DE0 X;  3REA B;  2D1X A;  2KT1 A;  3TSW A;  3ULR B;  1ABQ A;  1JU5 C;  3SHW A;  3M0S A;  2CH4 W;  2FO0 A;  1K9A A;  1WI7 A;  3VS5 A;  2K7A A;  1GCQ C;  1WX6 A;  2ROT A;  1ARK A;  1TUD A;  1RLQ C;  1GCQ A;  1BU1 A;  1H8K A;  2JS0 A;  2VWF A;  5GJV B;  2VKN A;  5GJW B;  1KSW A;  2BZY A;  2JM8 A;  2PZ1 A;  4RTX A;  2EYZ A;  2E5K A;  2A08 A;  2B86 A;  1RI9 A;  4KRT A;  1LCK A;  4OML A;  1M8M A;  2G6F X;  3EG1 A;  1E7O A;  2J6O A;  4LUD A;  3EG3 A;  2C0O A;  2CDT A;  4ESR A;  1BBZ A;  4JJD A;  1AVZ C;  2RQV A;  2DJQ A;  2O9V A;  1CKA A;  1MV3 A;  2J06 A;  4F17 A;  2V1R A;  1M30 A;  2GGR A;  1X2K A;  3PE0 A;  2QDL A;  4OMP A;  1G83 A;  2D8H A;  1GFC A;  1QKW A;  2F2W A;  2EBP A;  3NMZ C;  4DEY A;  2LMJ A;  1X27 A;  2H8H A;  4RTY A;  2KYM A;  2CSQ A;  5EC7 A;  1JEG A;  2GBQ A;  5IXB A;  3NPF A;  4HVU A;  2PNI A;  3SEM A;  2P4R A;  1HD3 A;  2YSQ A;  2ROL A;  2LNH B;  3I35 A;  3REB B;  2A36 A;  1K76 A;  4DEX A;  3M0T A;  4CC2 A;  1G2B A;  3ZL7 C;  3LH5 A;  2EGC A;  1KJW A;  2YUP A;  1TG0 A;  4F16 A;  1JQQ A;  2L3P A;  4RUG A;  3H0F A;  2RPN A;  3VRZ A;  2YT6 A;  2RN8 A;  2HDA A;  2FPD A;  1SEM A;  3EGU A;  2LJ1 A;  2CH4 A;  3THK A;  4IIO A;  3UAT A;  2OI3 A;  1UFF A;  1WXB A;  2JXB A;  2HEQ A;  2CT4 A;  2A37 A;  4LUE A;  3M0R A;  1U3O A;  4J9D A;  1X69 A;  2KR3 A;  2RQR A;  3VS6 A;  1K0X A;  2D0N A;  2YUQ A;  1I1J A;  1U5S A;  4HCK A;  2KRM A;  2EVR A;  2K79 A;  3QWX X;  2HCK A;  1AWW A;  4X1V A;  1FYN A;  2GTO A;  3CQT A;  2ENM A;  5FW9 A;  1Z9Z A;  2FEI A;  2DBM A;  1WIE A;  1NLP C;  5IXF A;  1YN8 A;  2BZ8 A;  2DL4 A;  1SPK A;  4F14 A;  2FG0 A;  1IO6 A;  1W70 A;  2RNA A;  3H0I A;  1X6B A;  2L0A A;  1T0J A;  2FRW A;  3VS1 A;  2GQI A;  1T3S A;  2J6F A;  1AZE A;  4GLM A;  3UF4 A;  1X2Q A;  2DVJ A;  1RLP C;  2FRY A;  3EG2 A;  2F2V A;  4A63 B;  2DM1 A;  1UJY A;  3PVL A;  2L3S A;  1UEC A;  1W6X A;  3C0C A;  1VYT A;  2IIM A;  2AZV A;  4LE9 A;  1J3T A;  2KRS A;  2DRK A;  3VS0 A;  1V1C A;  4CC3 A;  2EKH A;  2NUZ A;  2K3B A;  1ZLM A;  3NGP A;  2JS2 A;  4JZ3 A;  3H0H A;  3GBQ A;  4IIM A; 
#chains in the Genus database with same CATH topology
 3MEW A;  4Y92 A;  4D8K A;  3OYN A;  3QPH A;  5I2S A;  1B34 A;  1HSQ A;  2AIR B;  3DB4 A;  3G4S Q;  1JB0 E;  1NLO C;  2K3Y A;  1GRI A;  2LJ0 A;  2HL5 C;  1YI2 Q;  3V7R A;  3VS2 A;  5KYW B;  1VQ8 Q;  1FMW A;  3M4Y A;  4FYW B;  1YFN A;  2GFU A;  1BI1 A;  3HTR A;  2DD4 A;  1SSF A;  3X25 B;  1IRX A;  4C92 A;  2X3X D;  2P4T A;  1VQ9 T;  1KIK A;  1UGP B;  3X28 B;  1YJN A;  1WHK A;  2CRE A;  5HK3 A;  2EGE A;  4XTU A;  2DTI A;  1W2B P;  1ZUU A;  2RI5 A;  4HCB A;  1VOM A;  4LN2 A;  4PL6 A;  2M0Y A;  2JTF A;  2JZ2 A;  1VQN A;  2IPO B;  3CBM A;  2YUO A;  3CCL T;  3DLM A;  2ECZ A;  3PGG A;  3CPW P;  1VQK T;  2QEX Q;  2LCS A;  1O9S A;  2F5K A;  1WQ7 A;  2CZ0 B;  2LQW A;  3VV0 A;  1PRL C;  3QUI A;  1UJ0 A;  3CCR Q;  2DL8 A;  3QDF A;  5GMK h;  3OYB A;  3CCE Q;  2D8J A;  1ZBJ A;  2O2O A;  2LDM A;  2M16 A;  1VQM T;  4KBM B;  2QK0 A;  3L2V A;  5CVI A;  2Z0W A;  4E7J A;  3EGD A;  2JMC A;  2KY9 A;  3GIB A;  2RO0 A;  5FLX E;  1BB9 A;  2QA4 T;  4A4E A;  4CI0 C;  1MNE A;  2SEM A;  3S3O A;  3EHR A;  2DZ9 A;  2K2V A;  1D09 B;  4M75 F;  1K9M U;  1OX8 A;  1TUC A;  3CMA T;  3UA6 A;  5LJ5 e;  1GBR A;  5GMK e;  1R0C B;  3O5Z A;  3CPW S;  2LX9 A;  4F7U F;  2DA9 A;  1SHF A;  1QCN A;  1D0Y A;  1G3W A;  3CCQ A;  3TEE A;  2AZS A;  4LNP A;  4GBQ A;  1M5Q 1;  4FT2 A;  2F5T X;  2HBW A;  2QTX A;  1RAD B;  1VQP Q;  2JTM A;  1WYX A;  4R0K A;  1KFZ A;  4EPC A;  4QQG A;  1GXI E;  1K8A C;  2J7I A;  2C0T A;  1FMK A;  1I07 A;  4C8Q A;  3JCM f;  2X3W D;  2MIO A;  2EYX A;  1O75 A;  3OYL A;  2NWM A;  2DIL A;  2AKL A;  1H3Z A;  1K9M R;  1UE9 A;  3RMQ A;  1UDL A;  5IN1 A;  1OQK A;  3RIR A;  1YWP A;  3FIF A;  1RAH B;  3OBW A;  2DBK A;  2M02 A;  2V8I A;  4BD3 A;  1MMD A;  4A4K A;  1WJQ A;  2JN0 A;  2YRV A;  4Z8A A;  3UPU A;  2H3J A;  2RQT A;  4C92 F;  1I0C A;  2EGA A;  2ESW A;  3E1S A;  5IT9 E;  4CRI A;  2CZ7 B;  1YIJ A;  2E10 A;  2L2P A;  1RAE B;  4IUR A;  2MWO A;  4WCI A;  2BKD N;  1SRM A;  2RI2 A;  1QVF A;  5CKD A;  2GF7 A;  3E9F A;  5KCO A;  2DD5 A;  1X6O A;  2V1Q A;  2YRD A;  3AT1 B;  4TVR A;  1AWO A;  2COY A;  2CS7 A;  3RUX A;  1BYM A;  2YDL A;  2MAM A;  1QWE A;  2FPE A;  2XI9 A;  3RKY A;  4PJO B;  4M7D C;  5LL6 S;  3R6N A;  1VYU A;  2COZ A;  1M2V B;  4X9D A;  5I11 A;  1E6G A;  1QKX A;  1BK2 A;  3RNJ A;  3CME A;  1LJO A;  4J9F A;  2VXE A;  2K6D A;  1B3Q A;  4Y91 A;  1NEG A;  1PD0 A;  3CCJ A;  4JRQ A;  1C6V X;  3LYI A;  3IQL A;  3I56 A;  4MDX A;  3G71 T;  4DOV A;  5FWB A;  4GLK A;  1ZX6 A;  3EGX A;  3OYK A;  4OGE A;  3UA7 A;  3L2Z A;  5GAN 4;  1QVF P;  4L59 A;  2CYZ B;  4OMN A;  4WF2 A;  3CCU T;  1D3B B;  3HKS A;  1PM3 A;  3JV3 A;  1X01 A;  2DXU A;  3JB9 F;  2DE0 X;  2CP0 A;  1BIA A;  2WAC A;  1KD1 C;  1K9M C;  1JU5 C;  2CH4 W;  4E7L A;  4AT1 B;  1WI7 A;  4LD9 K;  3EG9 B;  2ROT A;  3E9G A;  1TUD A;  3T9N A;  2X4X A;  3L2W A;  1BU1 A;  3JB9 J;  2EFI A;  3OS0 A;  5GJV B;  2FZK B;  4PLI A;  4JRP A;  2PZ1 A;  2B86 A;  5KE2 A;  2J6O A;  4C0Z A;  1SG5 A;  4M75 G;  2CDT A;  3EG3 A;  4ESR A;  4JJD A;  4IUV A;  4C8Q F;  4OP0 A;  4L6V 5;  1QVF S;  4F7U G;  2DO3 A;  4D6W A;  5J39 A;  3QXE B;  1YI2 T;  4BI4 A;  1VQ8 T;  3NMZ C;  1WJR A;  1VQ7 Q;  3RER A;  4RTY A;  2H8H A;  4N0A A;  2KYM A;  2R57 A;  5EC7 A;  2GBQ A;  3NPF A;  4E7H A;  3QJ6 A;  3A8O B;  3UT1 A;  3CD6 Q;  2CP3 A;  2ROL A;  3I55 A;  3G1J A;  4DEX A;  3LH5 A;  3OQ5 A;  1YJW A;  4F16 A;  1JQQ A;  5FRO A;  4II1 A;  4UC4 A;  1TXQ A;  1V29 B;  4EMH A;  3QZ9 B;  2RN8 A;  3C12 A;  4A53 A;  2DIQ A;  3OBY A;  3H8Z A;  2JXB A;  4QKU A;  1NZ9 A;  3M0R A;  3G4S A;  1VQM Q;  1X69 A;  4ZTF A;  2RQR A;  3J7A F;  1K0X A;  2DEU A;  1I1J A;  2NUT A;  4C92 G;  3PNW C;  4HCK A;  3BDU A;  2QEX T;  3QWX X;  3P8H A;  4OVA A;  3S3N A;  4PJO D;  3JCM P;  2KK4 A;  3LWI A;  2HCK A;  2ZGW A;  5GAN d;  2XD0 A;  4XTX A;  7AT1 B;  1JBM A;  4ZGE B;  3AHU A;  5GAM d;  3TRE A;  3CCE T;  2DK3 A;  2FEI A;  4J83 A;  3SB2 A;  3M56 A;  2Y90 A;  3HP9 A;  1SPK A;  2FHD A;  2FG0 A;  2RD1 A;  3H0I A;  2E3H A;  3V8J A;  2L0A A;  3OSV A;  3VS1 A;  4ELY C;  4FSX A;  1EZZ B;  4RKU E;  4RMO A;  1T3S A;  1AZE A;  3FB9 A;  4C92 D;  2RK1 A;  1RLP C;  1MHN A;  1D1C A;  5HK0 A;  1W6X A;  4XTY A;  1YBY A;  1TS9 A;  4XU0 A;  2IIM A;  3M5A A;  2IG0 A;  3EFO A;  4GY5 A;  1J3T A;  2KRS A;  2LNV A;  5GMK i;  2C06 A;  1VQL A;  4M7D B;  1M4Z A;  2NUZ A;  1SKU B;  3CBO A;  3GBQ A;  3JSC A;  1R77 A;  2FL7 A;  3EHQ A;  4V2S A;  3CC7 A;  2RMO A;  2ATC B;  1VQ6 A;  3X20 B;  5L23 A;  1MMA A;  3JB9 G;  3NHN A;  2JUF A;  2SRC A;  2DEQ A;  5C6S A;  3CCV Q;  2HSE B;  3MCA B;  5GAO m;  2GCX A;  2M9U A;  1RAA B;  5GAO l;  3TQ7 P;  5A0D A;  1VIF A;  1NG2 A;  1PHT A;  4NL2 A;  4HT9 A;  1AEY A;  4R56 A;  3QDR B;  2QQ9 A;  4BAC A;  2E70 A;  5A0G A;  1M2O A;  2QGF B;  2ABL A;  2PU9 B;  4RTV A;  1A0N B;  1W4S A;  5CKF A;  2F2X A;  3G6E A;  1OV3 A;  3ZEH A;  3DB3 A;  1VQP A;  2QQS A;  2K2M A;  5D7U A;  4C8Q G;  1AHJ B;  4AG1 C;  2LT4 A;  1N8R C;  1WHG A;  3BFM A;  5I2M A;  2RJC A;  1HYO A;  1ZHI A;  3JCM J;  2J05 A;  4A4G A;  4M7A A;  2LZ6 B;  4ZGD B;  3PT9 A;  2K4Y A;  1B7T A;  2CT3 A;  3N5B B;  4EMK B;  5GAN 8;  1WXU A;  2V26 A;  4JZ4 A;  1VQ5 Q;  2C0I A;  1Y96 B;  4J8O A;  2A0F B;  2K57 A;  2E41 A;  2K9G A;  4JLI A;  3S3M A;  4AG2 C;  3CCU Q;  2LJ3 A;  2VC8 A;  2DMO A;  2EYQ A;  2RQW A;  3OYA A;  4M75 C;  1NPP A;  2LCL A;  2M0O A;  1VQ4 A;  5LJ3 d;  4OB3 B;  3NTK A;  2JT4 A;  3U23 A;  3SWN A;  1KC8 U;  3GOX A;  1CSK A;  5GAN j;  5IH2 A;  1N5Z A;  1M3B A;  3VS4 A;  3A8L B;  4LD6 A;  3QHS A;  5GAM j;  2HQX A;  4Z88 A;  4OMO A;  2LX7 A;  4KT0 E;  3CXC A;  1Q86 U;  1VQO A;  3J81 E;  4KGZ B;  1SHG A;  4AFU C;  2OTL Q;  2GQV A;  1K8A U;  3QZ5 B;  3QII A;  1UEB A;  5KYU A;  1PD1 A;  2MI6 A;  2EJF A;  2CSI A;  5GAO r;  1X43 A;  2EYY A;  1PKT A;  4PJO E;  1K1Z A;  1RL2 A;  3OMC A;  2V8K A;  2YXY A;  2GNC A;  4KH0 B;  1YCS B;  1V76 A;  1ABO A;  2JTE A;  1JO8 A;  3CC4 A;  1SF9 A;  3MP8 A;  2HQH A;  3EH2 A;  1N27 A;  2DVE A;  2OTJ T;  3NTH A;  1UHF A;  2NUP A;  2DET A;  4NL3 A;  1WJS A;  4PFO A;  5FRN A;  1BCO A;  3OYD A;  4M7D D;  3VU3 C;  3JB9 I;  4M77 A;  1YJ9 A;  4E7K A;  2DRM A;  3M54 A;  2YHT A;  4AFS C;  2DLP A;  2F69 A;  4C92 C;  4AFQ C;  3OYJ A;  4JJC A;  2KNB B;  2JMA A;  2QYZ A;  1PWT A;  3CCS Q;  4X9C A;  1H3H A;  1K8A R;  3MEV A;  2DL5 A;  2EWN A;  4AFZ C;  5GAO n;  2FZC B;  2QQA A;  2XID A;  1BIB A;  2HAX A;  4LDV A;  2D0Q B;  4IUT A;  4J9G A;  3HHT B;  1EFN A;  2ZPF B;  3VS3 A;  3J80 E;  1VQ7 T;  2CUB A;  2A3L A;  1G8X A;  1UGV A;  4EIK A;  2PVD B;  3PTA A;  1YHQ Q;  1WA7 A;  3CD6 T;  3JB9 H;  1OZ3 A;  2W0Z A;  3O8V A;  5FWC A;  2XDB A;  2VVK A;  4M7A F;  1OPK A;  1Z9Q A;  2GTJ A;  4CC7 A;  1VQ9 A;  1NE8 A;  3JRZ A;  3I5R A;  5LJ5 d;  3UDC A;  4KGX B;  4QQD A;  1DJ7 B;  1GFD A;  2E5Q A;  2LC4 A;  3PMT A;  3OYI A;  3CXC S;  4M78 G;  3HRU A;  4LDY A;  1K4U S;  1QCF A;  4RG2 A;  3VRY A;  2LQN A;  2Y4X A;  3RKW A;  3HL8 A;  1PKS A;  3CCL A;  2K5L A;  3R6O A;  4C0D C;  2RQU A;  2G3R A;  5CQY A;  1TTH B;  1VQK A;  3SDZ A;  1KD1 U;  3OMG A;  3QJY A;  3OS1 A;  1W1F A;  1U06 A;  5DM7 R;  1KC8 C;  2E64 A;  2DKG A;  3REA B;  5LJ3 j;  5D6X A;  2VUB A;  1RAG B;  1IXD A;  3ULR B;  2JOY A;  3JAM E;  4IUQ A;  2ZPB B;  1VQM A;  3LX7 A;  1Q86 C;  2QG9 B;  2QXF A;  1GCQ C;  4MZT A;  4FW2 A;  1GCQ A;  4C8Q C;  1H8K A;  2QA4 A;  4J7I A;  4IKF A;  5GJW B;  2O4X B;  3RR6 A;  1Y07 A;  3OSS C;  1XQH A;  3GLX A;  1XTD A;  1KHC A;  2A08 A;  2E5K A;  2EYZ A;  4OML A;  2G6F X;  3EG1 A;  2L3R A;  1E7O A;  2XHC A;  3CMA A;  2DXB A;  2LTO A;  1BI3 A;  5FU7 B;  1M9S A;  1KD1 R;  1BBZ A;  2OAU A;  2B8A A;  2RQV A;  2K3X A;  3VKI A;  4RCC A;  2DJQ A;  2WSC E;  2DJZ A;  5KYX A;  4M75 B;  4M77 F;  1YIT Q;  2J06 A;  4J6W A;  1HXD A;  1M30 A;  4F7U B;  1G83 A;  3CCV T;  2D8H A;  1GFC A;  2DTO A;  1QP3 A;  2F2W A;  4OMF B;  2EBP A;  1EIF A;  2CSQ A;  1KQ1 A;  1S72 Q;  4JS5 A;  3L2R A;  2P4R A;  2D9T A;  1HD3 A;  3EFR A;  1X75 C;  3CCM Q;  3REB B;  2PUO B;  1K76 A;  4CC2 A;  1G2B A;  2NYS A;  3EH1 A;  3L42 A;  5KCH A;  3DLL A;  1UB4 A;  4QVC A;  2KAF A;  1MMG A;  2L3P A;  2VV5 A;  3VRZ A;  2YT6 A;  3OYF A;  3M53 A;  1SEM A;  4M7D E;  3THK A;  3VJP A;  2HKN A;  1B34 B;  1WXB A;  1C1A A;  2HEQ A;  2CT4 A;  1RAI B;  4LUE A;  2A37 A;  1I8F A;  1TUG B;  2GFA A;  2KR3 A;  4E7S A;  3VS6 A;  4N4G A;  1D1A A;  2D0N A;  5DLO A;  4QVD A;  2P84 A;  1IHW A;  3CC2 T;  2EVR A;  2X9H A;  2VXF A;  1VQ5 T;  3H9N A;  3BDL A;  4C92 B;  1AWW A;  4JUV A;  1LVK A;  2V8J A;  5LJ5 j;  3JCM b;  2E4H A;  1ZA1 B;  4RCB A;  5CCA A;  2ENM A;  2R58 A;  5FW9 A;  1KG1 A;  1OZ2 A;  5GAN 2;  1NLP C;  4E7I A;  2PUK B;  2BIV A;  4BE2 A;  4B9X A;  1IO6 A;  2FYK A;  1W70 A;  2RNA A;  4M7A G;  4MZM A;  1X6B A;  1T0J A;  5DY9 A;  4KUD K;  3MO8 A;  1IZ6 A;  4BI3 A;  1WPY A;  1X2Q A;  2DVJ A;  4P5N A;  3OYG A;  2LCC A;  3EG2 A;  2F2V A;  2L3S A;  5FU6 C;  4VUB A;  3FDR A;  4HKE A;  3JCM c;  2OTJ Q;  2EQK A;  3G71 A;  2HBP A;  2QI2 A;  2DRK A;  3PIP A;  2OTL T;  2HNI A;  2K3B A;  3NGP A;  1R8O B;  1YJN Q;  1UGQ B;  4JZ3 A;  5GAN g;  1JJ2 A;  2QAZ A;  4M7A D;  4ZGJ B;  1M1K U;  2CUD A;  2RI3 A;  3TCJ A;  5J26 A;  1X6G A;  4HVW A;  1QMC A;  2IVW A;  3EGD B;  1AWJ A;  2E12 A;  5ECA A;  3TVT A;  1PRM C;  4QW2 A;  4E7Z A;  4BDY A;  2WSF E;  1ZA2 B;  1VQN Q;  2VAS A;  4DA4 A;  2XU8 A;  2OJ2 A;  5FRM A;  1MUZ A;  2OX7 A;  4N0A C;  3OYY A;  4C0D B;  1H64 1;  4M78 C;  4KH1 B;  2HQE A;  2KXD A;  1WZO A;  4L5G A;  3M0U A;  1U8R A;  4M78 A;  2BE9 B;  1N8R U;  3M0P A;  4M75 D;  4Z89 A;  1KQS A;  2DNU A;  1ZSZ C;  3CCS T;  2ZCF B;  3EG0 A;  4OGC A;  1ACM B;  1BKB A;  2O31 A;  5CKE A;  1ZSZ A;  4OF1 A;  2LQK A;  4MZP A;  4FT4 A;  1NYF A;  2PTK A;  1B07 A;  1AWX A;  4ZNX A;  2AKK A;  1BCM A;  1WHM A;  4PFZ A;  4C5H A;  5CIU A;  3LLR A;  1RI0 A;  4FSS A;  4C8Q B;  4OMM A;  1WFW A;  4M77 G;  5HCK A;  1JXO A;  1N9S A;  3JCM d;  4FIB A;  1YI2 A;  3KBG A;  2CKK A;  1IB8 A;  2ZAE A;  1YHQ T;  1D0X A;  1VQ8 A;  4BDZ A;  2DYB A;  3V8L A;  2EYW A;  3VYG A;  2RHY A;  1U1S A;  3CCQ Q;  1Y57 A;  1AD5 A;  1N8R R;  2MF2 A;  2CZ1 B;  5AT1 B;  3VUB A;  1M1F A;  2KEA A;  1NYG A;  3A8G B;  1MND A;  2XDD A;  2ZPI B;  4XAX B;  3MP1 A;  4XU2 A;  5IHN A;  2JJ9 A;  3TSZ A;  4E6R A;  2BZX A;  4JRK A;  5KH6 A;  5GAN h;  4OMQ A;  2FPF A;  3I5S A;  1SRL A;  1LOJ A;  4JPB W;  2EQI A;  1M90 C;  3RKX A;  5KYW A;  5GAM h;  1JJ2 S;  5GAN 7;  1G3T A;  3A1P A;  1GBQ A;  1S1N A;  4EDU A;  4HCZ A;  2ZPE B;  2QEX A;  2KE9 A;  3V7S A;  2DYI A;  2VYT A;  2JM9 A;  1GCP A;  3CCR A;  2ZZD A;  1WXT A;  5KE3 A;  1NJI U;  2DL3 A;  3CCE A;  2EPD A;  1ZUK A;  2DFU A;  3PVQ A;  4QVZ A;  1QLY A;  3QWY A;  5GAN e;  4M4Z A;  2RH2 A;  4Q5W A;  2EKO A;  1YIJ Q;  2KXC A;  4J9C A;  4PJN A;  1M27 C;  5GAN 3;  2DAQ A;  3A8H B;  5GAM e;  3OS5 A;  5IHK A;  4KUI A;  4J5Y A;  4ME7 A;  1AZG B;  3EGX B;  2EIF A;  1M1K C;  2EQJ A;  3I9Q A;  1WQW A;  3LGF A;  1EX4 A;  1T3L A;  2Y4Y A;  4AMC A;  2HSP A;  2BE7 D;  4LXC A;  3VS7 A;  1BI0 A;  2ZPG B;  2RA2 A;  3HRS A;  1RAF B;  3ASK A;  8AT1 B;  4RTZ A;  3CME Q;  1OYX A;  1YIT T;  1Y7X A;  2KRO A;  4M78 F;  4RTT A;  1ZSG A;  2CP7 A;  1M8V A;  4ANJ A;  3FC3 A;  4BE0 A;  3JB9 D;  3CCJ Q;  1GL5 A;  2YLC A;  2CGH A;  3JCM X;  3I56 Q;  2A28 A;  2HMA A;  5FU6 B;  3MKD A;  4M7A C;  4J9E A;  2YUN A;  4X34 A;  1S72 T;  3HPW A;  9ATC B;  2RK2 A;  1NBE B;  1WGS A;  3CCM T;  1PG5 B;  3CC2 Q;  4JJN K;  1YWO A;  5CR2 A;  4C5E A;  4LDU A;  2DPP B;  2R5A A;  4ATO A;  5AYF A;  4PJL A;  1AOJ A;  2BUD A;  4XU1 A;  2RHI A;  2QAS A;  4C8Q D;  2DL7 A;  4KUL A;  1Q7Y C;  1KK7 A;  3MJX A;  3H41 A;  4M75 E;  2L8D A;  1FX7 A;  3SWN C;  3JCM W;  3OA6 A;  2HL3 A;  4M78 B;  2JVV A;  5L8R E;  4F7U E;  4R55 A;  2QTV A;  1UHC A;  4J9B A;  2KYB A;  4JLG A;  3A5Z B;  2VGN A;  4KGV B;  4YTL A;  2RJD A;  2XMF A;  3A98 A;  4RTW A;  1XJW B;  4PLL A;  5LJ3 h;  4A4F A;  2KT8 A;  3MP6 A;  3GPL A;  1R0B G;  5HY6 A;  3OYC A;  2D1X A;  3TSW A;  4FYY B;  2QQB A;  1ABQ A;  3SD4 A;  3SHW A;  2LQ8 A;  4FCY A;  2FO0 A;  3BE3 A;  3VS5 A;  2K7A A;  3JCM Q;  5DLQ E;  1I4K 1;  4OB0 B;  2QQR A;  2YRC A;  1RLQ C;  1Q82 C;  4IUP A;  2NUT B;  2L89 A;  4B9W A;  5KYN A;  1TH7 A;  2JS0 A;  1NJI C;  2VKN A;  1KSW A;  2BZY A;  3I55 Q;  1TWB A;  2E6Z A;  3PIO A;  4RTX A;  1KC8 R;  1RI9 A;  4M77 C;  1W2B A;  4LDW A;  1YJW Q;  5LJ3 e;  1YJN T;  4PJO A;  3KUF A;  1AVZ C;  3V7C A;  3URG A;  2O9V A;  1Q86 R;  4C92 E;  1M2V A;  3CXC P;  3OYH A;  3VYH B;  5CK9 A;  3CPW A;  1CKA A;  3GNG A;  4F17 A;  2V1R A;  3PE0 A;  2QDL A;  2AHJ B;  2MK5 A;  1VQN T;  1K73 C;  2MMP A;  3QYH B;  1QKW A;  1X27 A;  1NPR A;  5IXB A;  2OTJ A;  4HVU A;  2PNI A;  3ER0 A;  2YSQ A;  1RAB B;  2LNH B;  3EFO B;  1PSF A;  3RES A;  3ZL7 C;  4JDS A;  1IHV A;  1D3B A;  2QGG A;  1Q81 C;  3LH0 A;  2X4W A;  2E3I A;  2FPD A;  3EGU A;  2CH4 A;  3UAT A;  4IIO A;  4EMG A;  2E1H A;  1UFF A;  2OI3 A;  4PK4 A;  2KQW A;  1U3O A;  1U1T A;  3CPF A;  3EAE A;  4J9D A;  2RHX A;  2E6N A;  3EG9 A;  2EAY A;  4BI8 B;  2YUQ A;  3D7S B;  3GF5 A;  1U5S A;  3MPU B;  1VQ7 A;  1IRE B;  2RHZ A;  2X35 A;  5LJ5 h;  3CCQ T;  4ZN3 A;  1VQL Q;  3CD6 A;  1FYN A;  2GTO A;  3CQT A;  1OUL A;  3NTI A;  5IXF A;  2YWW A;  1YN8 A;  2XG8 D;  2BZ8 A;  2DL4 A;  3CC7 Q;  4FW1 A;  1VQ6 Q;  4BUG A;  1QVG A;  1I5O B;  1IGU A;  2NLU A;  1W2B S;  2GQI A;  1OI1 A;  4M78 D;  3L2Q A;  2DIG A;  1JRI A;  4GLM A;  3UF4 A;  3HSB A;  4M7A B;  6AT1 B;  5CAI A;  4A63 B;  1UJY A;  3PVL A;  3CEY A;  2RJE A;  1KHI A;  2X4J A;  1VYT A;  4DQ2 A;  8ATC B;  4C8Q E;  2AZV A;  3ME9 A;  4LE9 A;  2CZ6 B;  5GAO p;  1V1C A;  4CC3 A;  5A2Q E;  1P92 A;  2FZG B;  1TOV A;  1ZLM A;  4B6M A;  4FM4 B;  3G6E Q;  3H0H A;  2RHU A;  4BB7 A;  1HK9 A;  4IIM A;  3LW5 E;  3M59 A;  4D8D A;  2RF0 A;  1YIJ T;  1YNZ A;  3DKM A;  4C5G A;  4PJO F;  1QVG P;  1F1B B;  1QWF A;  3SWN B;  1PNJ A;  4HXJ A;  5IHI A;  4O5V A;  1Y0M A;  3OW2 A;  3OY9 A;  1JXM A;  2M51 A;  1ZUY A;  2FB7 A;  2K5I A;  1VA7 A;  1RUW A;  4QT7 A;  4FL6 A;  3WVE B;  5GAN f;  1MV0 B;  3BW1 A;  1TU0 B;  2MPX C;  1T0H A;  3VUZ A;  5GAM f;  1UG1 A;  1HJD A;  5KYU B;  3CME T;  2MCN A;  1G3Y A;  3INZ A;  1M3A A;  4XTZ A;  2O01 E;  1MGQ A;  4J9H A;  4DBR A;  1VQ4 Q;  4QQ6 A;  1PSE A;  3CCJ T;  4BE1 A;  2R5M A;  2RJF A;  3M0Q A;  2VGM A;  4JJB A;  2EQM A;  2I2L A;  3I56 T;  4BY6 C;  4JS4 A;  3CCV A;  2NUP B;  4DBQ A;  2KRN A;  2L3Q A;  2VB6 A;  4PKC C;  1SSH A;  1QVG S;  4M77 B;  1VQO Q;  2P0K A;  2D6F A;  4FYV B;  2A7Y A;  3OW2 P;  1OEB A;  4M7D A;  1QQJ A;  1WNL A;  5GMK j;  1XOV A;  2DZC A;  3LGL A;  4HVV A;  1BI2 A;  1ZQ1 A;  5I21 A;  1M90 U;  1WHL A;  3M57 A;  3CC4 Q;  2I0N A;  2W10 A;  2AT1 B;  5M9O A;  5CKH A;  2BTT A;  4DOW A;  1QW1 A;  3X24 B;  2MOX A;  1D1B A;  5I22 A;  1IGQ A;  3JCM V;  4Y28 E;  2KVQ G;  2DER A;  4J6Y A;  1YJ9 Q;  2AK5 A;  1PCX A;  1I81 A;  5CQX A;  3CC2 A;  2XDP A;  2QDY B;  3JCM g;  3KXT A;  1VQ5 A;  2PVO B;  3BY7 A;  3RBB B;  2EJ9 A;  4DBH A;  1NM7 A;  3OW2 S;  1NEB A;  4NS5 A;  3CCU A;  4DBF A;  3QG1 A;  3L1A A;  2JNG A;  2RB6 A;  3SFM A;  1C0M A;  3PMI A;  4RTU A;  4F04 B;  1M90 R;  4C0G A;  2ZPH B;  5GAM g;  3ZBD A;  1G3S A;  2COW A;  5GAN 6;  2JW4 A;  4K11 A;  1UTI A;  4EMK C;  5KYY A;  3I55 T;  2KSS A;  4EMK A;  4FU6 A;  3M58 A;  3C4S A;  1LNX A;  1WDX A;  1YJW T;  1Y96 A;  3QBY A;  1OU9 A;  1K0S A;  4M78 E;  5IAY A;  1VQ9 Q;  4HA8 A;  2KGT A;  2OTL A;  1M3C A;  2LT1 A;  1OU8 A;  5D6Y A;  1D0Z A;  3G4S T;  4HCC A;  1H92 A;  4XU3 A;  4XQ3 A;  2DTH A;  2ED0 A;  1G5V A;  2XK0 A;  5LJ3 f;  4MML A;  1M1K R;  1UUE A;  1WLP B;  2KI7 A;  2O88 A;  1JJ2 P;  2ED1 A;  1KQ2 A;  1YP5 A;  3CCL Q;  3GP8 A;  2J6K A;  4PJO G;  1VQK Q;  1VYV A;  2P0P A;  4J9I A;  4NOY A;  1FWZ A;  2LP5 A;  2X4Y A;  2KBT A;  2OAW A;  3C95 A;  3FJ5 A;  2FVU A;  1VIE A;  4A4H A;  4OB1 B;  1OOT A;  3TU4 K;  1CKB A;  3KFV A;  1Q7Y U;  3E2U A;  5CKB A;  5KYX B;  3CCS A;  2CP2 A;  2EW3 A;  2XKO C;  3JCM h;  4JRI A;  2L5Q A;  1FXX A;  3QO3 A;  4IUU A;  1KQS P;  4ZTJ A;  4ELZ C;  4M7D F;  2DF6 A;  2QA4 Q;  4M77 D;  4PNO A;  1UGR B;  1RAC B;  2O9S A;  4CC4 B;  2WSE E;  3F70 A;  3CCR T;  1TSF A;  3C94 A;  2DX1 A;  1YHQ A;  1VQL T;  3CMA Q;  4ORZ A;  1I5L A;  2E65 A;  1E6H A;  1QCO A;  4XK8 E;  1QVP A;  5GAO q;  3QSU A;  1OPL A;  3MEU A;  3JCM e;  4MMK A;  3CC7 T;  1Q82 U;  3OB9 A;  5C0M A;  1Q7Y R;  1M1G A;  1VQ6 T;  2KT1 A;  3WVD B;  1N6A A;  2MWP A;  3EFS A;  3M0S A;  3S6W A;  1AT1 B;  4RG8 A;  3FJP A;  1K9A A;  3NFC A;  3M9Q A;  1N9R A;  1WX6 A;  3M4G A;  4BY6 B;  1ARK A;  3OS2 A;  4C5I A;  1FMV A;  2HZY A;  1QP2 A;  1UGS B;  2VWF A;  2X51 A;  1KQS S;  4E2F B;  2JM8 A;  1YCY A;  4C0F A;  4FYX B;  4KRT A;  5LJ3 g;  4E47 A;  1LCK A;  1M8M A;  5J3B A;  3CBP A;  4LUD A;  1Q95 G;  2C0O A;  3UWN A;  3G6E T;  3L2U A;  2M1H A;  1K73 U;  2XIC A;  1VQP T;  2K5F A;  5LJ5 f;  3ZFJ A;  4WTO B;  4PFP A;  4N4I A;  3WXM B;  1MV3 A;  1Q82 R;  1OX9 A;  3M55 A;  2GGR A;  1X2K A;  3P8D A;  2P0Q A;  4OMP A;  3RDV A;  1NJI R;  2PQW A;  2RM4 A;  2CP5 A;  2YLB A;  3V8K A;  4DEY A;  2LMJ A;  5A0L A;  1JEG A;  4N4H A;  3X26 B;  1WHH A;  3SEM A;  2KDS A;  1Q81 U;  3HFO A;  4M7A E;  3I35 A;  2KMT A;  2A36 A;  3M0T A;  1WHJ A;  2EGC A;  1KJW A;  2YUP A;  1TG0 A;  3FEO A;  3QYG B;  4XTV A;  1XNI A;  4RUG A;  3A8M B;  3H0F A;  2RPN A;  1LPL A;  1K73 R;  2DXT A;  2CP6 A;  2HDA A;  2HD0 A;  1VQ4 T;  2LJ1 A;  1ZBX A;  4LDX A;  2MYS A;  3E19 A;  2LVM A;  1YIT A;  3MET A;  4MDW A;  5CO7 A;  5KYY B;  1MMN A;  4PJM A;  4J7F A;  4A54 A;  3FLG A;  2LRQ A;  4Z02 A;  4PJJ A;  5HKC A;  2KRM A;  3H6Z A;  3G71 Q;  2K79 A;  1PC0 A;  1VQO T;  2O4X A;  2HKQ B;  1Y71 A;  1S72 A;  1Q81 R;  4X1V A;  5FU7 C;  3CCM A;  1Z9Z A;  2DBM A;  1VUB A;  1WIE A;  3Q1J A;  1ZSZ B;  4OB2 B;  2EQU A;  3MEA A;  4F14 A;  4M75 A;  3MHX A;  3CC4 T;  3G7Z A;  2FRW A;  3OYE A;  5EG2 A;  2J6F A;  2DXC A;  4F7U A;  5GAN 5;  5LJ5 g;  2FRY A;  3GNF B;  2DM1 A;  2EJG A;  3HFN A;  1UEC A;  1YJ9 T;  5GMK m;  3OYM A;  4M7D G;  4J6X A;  3C0C A;  3RMS A;  3P8B B;  3PFS A;  5GMK l;  3HRT A;  4HT8 A;  3VS0 A;  2PVG B;  4ZN1 A;  2EKH A;  3LWH A;  5D6W A;  2H3E B;  3FRN A;  2JS2 A;  4PJO C;  4O6J A;  4M77 E;  2F1L A;  3QKJ A;  4XTW A; 
#chains in the Genus database with same CATH homology
 2CUD A;  4Y92 A;  4D8K A;  1X6G A;  4HVW A;  4D8D A;  3EHQ A;  2RF0 A;  1AWJ A;  2RMO A;  5ECA A;  3TVT A;  1PRM C;  1HSQ A;  5L23 A;  1YNZ A;  3NHN A;  1NLO C;  1QWF A;  2SRC A;  1GRI A;  2LJ0 A;  1PNJ A;  2OJ2 A;  1MUZ A;  3VS2 A;  4HXJ A;  5IHI A;  1Y0M A;  1JXM A;  2M51 A;  1ZUY A;  2KXD A;  1VA7 A;  1NG2 A;  1PHT A;  1RUW A;  3M0U A;  4QT7 A;  1MV0 B;  1AEY A;  2X3X D;  1T0H A;  3M0P A;  4Z89 A;  1UG1 A;  1KIK A;  2DNU A;  2ABL A;  3EG0 A;  4RTV A;  1HJD A;  2O31 A;  2CRE A;  1A0N B;  2MCN A;  2F2X A;  2EGE A;  1M3A A;  1NYF A;  1OV3 A;  2PTK A;  4J9H A;  1B07 A;  1AWX A;  4ZNX A;  1ZUU A;  2AKK A;  2K2M A;  4AG1 C;  4LN2 A;  3M0Q A;  4JJB A;  2M0Y A;  2J05 A;  4FSS A;  4OMM A;  1WFW A;  5HCK A;  1JXO A;  2YUO A;  2LZ6 B;  2ECZ A;  2KRN A;  2L3Q A;  2CT3 A;  1WXU A;  1SSH A;  2DYB A;  2EYW A;  2LCS A;  4JZ4 A;  2LQW A;  2C0I A;  1PRL C;  1UJ0 A;  2DL8 A;  1OEB A;  1Y57 A;  1AD5 A;  2K9G A;  2D8J A;  1ZBJ A;  4AG2 C;  1XOV A;  2LJ3 A;  4HVV A;  2O2O A;  2DMO A;  2RQW A;  2KEA A;  1NYG A;  3TSZ A;  5IHN A;  2I0N A;  2JMC A;  4E6R A;  2BZX A;  2W10 A;  2BTT A;  1BB9 A;  2JT4 A;  4OMQ A;  2FPF A;  3U23 A;  2MOX A;  5I22 A;  3I5S A;  1CSK A;  1SRL A;  2SEM A;  4JPB W;  5IH2 A;  2EQI A;  1N5Z A;  1M3B A;  3EHR A;  3VS4 A;  2AK5 A;  1GBQ A;  1S1N A;  1TUC A;  4Z88 A;  4OMO A;  2LX7 A;  3UA6 A;  1GBR A;  3O5Z A;  2KE9 A;  2DA9 A;  1SHF A;  1SHG A;  3RBB B;  4AFU C;  2JM9 A;  2AZS A;  1GCP A;  4LNP A;  1NM7 A;  1WXT A;  4GBQ A;  2DL3 A;  1NEB A;  2EPD A;  2CSI A;  2HBW A;  1X43 A;  1ZUK A;  1PKT A;  2EYY A;  3PVQ A;  1K1Z A;  1QLY A;  3QWY A;  4M4Z A;  1WYX A;  4R0K A;  2GNC A;  4RTU A;  1KFZ A;  1YCS B;  1ABO A;  2JTE A;  1JO8 A;  2KXC A;  4J9C A;  1M27 C;  2J7I A;  2C0T A;  1FMK A;  1I07 A;  2JW4 A;  5IHK A;  4K11 A;  1UTI A;  2X3W D;  1UHF A;  2MIO A;  1AZG B;  2EYX A;  2NWM A;  3I9Q A;  2DIL A;  2AKL A;  2DRM A;  1WDX A;  1T3L A;  1UE9 A;  1UDL A;  4AFS C;  2DLP A;  1K0S A;  2HSP A;  3VS7 A;  1YWP A;  4AFQ C;  4JJC A;  2DBK A;  2KNB B;  2KGT A;  2JMA A;  1PWT A;  1M3C A;  1H3H A;  4RTZ A;  2DL5 A;  4Z8A A;  4AFZ C;  1H92 A;  2KRO A;  4RTT A;  1ZSG A;  2ED0 A;  2RQT A;  1I0C A;  2EGA A;  1GL5 A;  4J9G A;  2ESW A;  1EFN A;  1UUE A;  1WLP B;  2O88 A;  2L2P A;  3VS3 A;  2CUB A;  2ED1 A;  2A28 A;  1YP5 A;  4WCI A;  4J9E A;  2YUN A;  1SRM A;  1UGV A;  4EIK A;  2J6K A;  1WA7 A;  2V1Q A;  2W0Z A;  1VYV A;  5FWC A;  4J9I A;  1AWO A;  1YWO A;  2YDL A;  1QWE A;  2FPE A;  2LP5 A;  3FJ5 A;  2KBT A;  2OAW A;  2VVK A;  1OOT A;  1OPK A;  1CKB A;  1Z9Q A;  2GTJ A;  3KFV A;  1AOJ A;  4CC7 A;  3R6N A;  1VYU A;  3I5R A;  5I11 A;  1E6G A;  1QKX A;  2EW3 A;  1GFD A;  1BK2 A;  3RNJ A;  2DL7 A;  4J9F A;  2K6D A;  1B3Q A;  1K4U S;  1QCF A;  2DF6 A;  1NEG A;  3H41 A;  3VRY A;  2LQN A;  2O9S A;  4CC4 B;  3IQL A;  1PKS A;  5FWB A;  1ZX6 A;  2RQU A;  1UHC A;  3UA7 A;  2DX1 A;  4J9B A;  4ORZ A;  2KYB A;  4OMN A;  1W1F A;  2XMF A;  3A98 A;  4RTW A;  1U06 A;  1E6H A;  1OPL A;  2KT8 A;  3JV3 A;  2DE0 X;  3REA B;  2D1X A;  2KT1 A;  3TSW A;  3ULR B;  1ABQ A;  1JU5 C;  3SHW A;  3M0S A;  2CH4 W;  2FO0 A;  1K9A A;  1WI7 A;  3VS5 A;  2K7A A;  1GCQ C;  1WX6 A;  2ROT A;  1ARK A;  1TUD A;  1RLQ C;  1GCQ A;  1BU1 A;  1H8K A;  2JS0 A;  2VWF A;  5GJV B;  2VKN A;  5GJW B;  1KSW A;  2BZY A;  2JM8 A;  2PZ1 A;  4RTX A;  2EYZ A;  2E5K A;  2A08 A;  2B86 A;  1RI9 A;  4KRT A;  1LCK A;  4OML A;  1M8M A;  2G6F X;  3EG1 A;  1E7O A;  2J6O A;  4LUD A;  3EG3 A;  2C0O A;  2CDT A;  4ESR A;  1BBZ A;  4JJD A;  1AVZ C;  2RQV A;  2DJQ A;  2O9V A;  1CKA A;  1MV3 A;  2J06 A;  4F17 A;  2V1R A;  1M30 A;  2GGR A;  1X2K A;  3PE0 A;  2QDL A;  4OMP A;  1G83 A;  2D8H A;  1GFC A;  1QKW A;  2F2W A;  2EBP A;  3NMZ C;  4DEY A;  2LMJ A;  1X27 A;  2H8H A;  4RTY A;  2KYM A;  2CSQ A;  5EC7 A;  1JEG A;  2GBQ A;  5IXB A;  3NPF A;  4HVU A;  2PNI A;  3SEM A;  2P4R A;  1HD3 A;  2YSQ A;  2ROL A;  2LNH B;  3I35 A;  3REB B;  2A36 A;  1K76 A;  4DEX A;  3M0T A;  4CC2 A;  1G2B A;  3ZL7 C;  3LH5 A;  2EGC A;  1KJW A;  2YUP A;  1TG0 A;  4F16 A;  1JQQ A;  2L3P A;  4RUG A;  3H0F A;  2RPN A;  3VRZ A;  2YT6 A;  2RN8 A;  2HDA A;  2FPD A;  1SEM A;  3EGU A;  2LJ1 A;  2CH4 A;  3THK A;  4IIO A;  3UAT A;  2OI3 A;  1UFF A;  1WXB A;  2JXB A;  2HEQ A;  2CT4 A;  2A37 A;  4LUE A;  3M0R A;  1U3O A;  4J9D A;  1X69 A;  2KR3 A;  2RQR A;  3VS6 A;  1K0X A;  2D0N A;  2YUQ A;  1I1J A;  1U5S A;  4HCK A;  2KRM A;  2EVR A;  2K79 A;  3QWX X;  2HCK A;  1AWW A;  4X1V A;  1FYN A;  2GTO A;  3CQT A;  2ENM A;  5FW9 A;  1Z9Z A;  2FEI A;  2DBM A;  1WIE A;  1NLP C;  5IXF A;  1YN8 A;  2BZ8 A;  2DL4 A;  1SPK A;  4F14 A;  2FG0 A;  1IO6 A;  1W70 A;  2RNA A;  3H0I A;  1X6B A;  2L0A A;  1T0J A;  2FRW A;  3VS1 A;  2GQI A;  1T3S A;  2J6F A;  1AZE A;  4GLM A;  3UF4 A;  1X2Q A;  2DVJ A;  1RLP C;  2FRY A;  3EG2 A;  2F2V A;  4A63 B;  2DM1 A;  1UJY A;  3PVL A;  2L3S A;  1UEC A;  1W6X A;  3C0C A;  1VYT A;  2IIM A;  2AZV A;  4LE9 A;  1J3T A;  2KRS A;  2DRK A;  3VS0 A;  1V1C A;  4CC3 A;  2EKH A;  2NUZ A;  2K3B A;  1ZLM A;  3NGP A;  2JS2 A;  4JZ3 A;  3H0H A;  3GBQ A;  4IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...