4QW2A

Fmrp n-terminal domain (r138q)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
198
Chain Sequence
EELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACTYNEIVTIERLRSVNPNKPATKDTFHKIKLDVPEDLQQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human FMRP contains an integral tandem Agenet (Tudor) and KH motif in the amino terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Fragile X mental retardation protein 1
total genus 41
structure length 198
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF17904 KH_9 FMRP KH0 domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qw2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qw2A02
2RJCA 1N27A 5IAYA 2BUDA 2F5KA 1WGSA 4PLLA 2L3RA 2RHYA 3H6ZA 3OYMA 3OYKA 3DB4A 2LRQA 2R57A 3QBYA 2E6NA 3L42A 2RI5A 2RHZA 2EQMA 5KH6A 3C4SA 2RHXA 3P8DA 4QQDA 3OB9A 2RJDA 3MP1A 4IUTA 5IN1A 4LD6A 2GF7A 4IUVA 2EKOA 2EQUA 2DIGA 2EQKA 2O4XA 3LGFA 4A4EA 4A4HA 4BE1A 3S3NA 4E7IA 2RI3A 3PMTA 3NTHA 4OVAA 2R58A 4PL6A 3OMGA 2L8DA 3OYGA 4B9XA 3OYJA 1KHCA 2LDMA 2X4WA 3S3OA 3LGLA 4EDUA 3S3MA 2M0OA 2BKDN 3E9GA 3L2VA 3P8HA 5C0MA 3DB3A 3QJ6A 2JTFA 3EAEA 3OYBA 2P0KA 4CRIA 4BACA 5FRNA 5KCHA 3OS2A 4BE0A 3UT1A 4NS5A 3FC3A 2X4XA 1OZ2A 5D6WA 5M9OA 5KCOA 3FEOA 4E7HA 1OZ3A 2WACA 2HQXA 2MWOA 3L2RA 4X34A 3CEYA 2LVMA 4QQ6A 3S6WA 3OYHA 1H3ZA 4A4GA 4BE2A 3L2QA 3ZEHA 4ZTJA 2X35A 2YRVA 2E5QA 3SD4A 5KE3A 3OYNA 2RHUA 3MEAA 4L59A 3H8ZA 3PFSA 4Z02A 2CKKA 2DIQA 3META 4PLIA 2R5MA 3OS0A 2B8AA 2RHIA 2RJFA 3OYEA 3L2UA 2L89A 1WJRA 2MWPA 3O8VA 2R5AA 3MP8A 3OMCA 3OYCA 3OYIA 4C5IA 1G5VA 3MEWA 5J39A 3UWNA 3FLGA 4E7KA 4IUUA 4RG2A 3OYAA 5J26A 3OA6A 2EFIA 2GFAA 2O4XB 2XK0A 4FL6A 4UC4A 3Q1JA 3PNWC 5CIUA 3LX7A 2X4YA 2XDPA 4N4GA 2RI2A 3KUFA 3QKJA 4FU6A 4QQGA 2DAQA 4HCZA 2G3RA 3OS1A 1OI1A 2VYTA 5FROA 1MHNA 3ME9A 4IUPA 2LTOA 5KE2A 3QIIA 4IURA 4BDYA 1XNIA 2K3YA 5C6SA 3L2WA 2QQRA 4B9WA 4BDZA 2JZ2A 2HQEA 4BD3A 4C5HA 4E7LA 5FRMA 1WJQA 2BIVA 2IG0A 3GOXA 3PMIA 2LCCA 4N4HA 3F70A 4IKFA 3ASKA 3LLRA 4E7JA 1SSFA 3LYIA 2PQWA 2RO0A 1RI0A 2RJEA 4QW2A 4ZTFA 4II1A 3OYLA 1OYXA 3BDLA 4Q5WA 3E9FA 3MO8A 3NTIA 2GFUA 4A4FA 2FHDA 3MEUA 2M16A 2NLUA 2QQSA 4QVZA 2D9TA 5D6YA 3DLMA 4C5EA 3LH0A 2K3XA 4N4IA 3NTKA 5D6XA 3OYDA 3MEVA 3OQ5A 3OY9A 2EQJA 3MP6A 3FDRA 4C5GA 2M1HA 4GY5A 3OYFA 1WJSA 3M9QA 4IUQA
chains in the Genus database with same CATH superfamily
2RQTA 3VUBA 5IAYA 1B3QA 2EYQA 3M55A 1RAFB 1QWFA 2ZPEB 2CDTA 1TS9A 2KYBA 3WVEB 1G3WA 5LJ5h 1Q82C 1J3TA 1C6VX 4PL6A 4C92C 2DILA 2L8DA 4RTVA 3OYGA 3G4SA 2CUBA 3CCST 1VQ4T 5IHNA 3EAEA 2A36A 1WYXA 2RQWA 5FRNA 4RG8A 3HRUA 4F04B 4BI4A 1OZ3A 2RQRA 2AZSA 2NUZA 4PNOA 2LVMA 4WCIA 2DZ9A 3SD4A 4J9HA 1VQMQ 1VQ9Q 1R0BG 2CKKA 3META 2HSPA 3OS0A 1KC8C 3CMET 1JJ2S 1WI7A 3X20B 2F2WA 1X69A 3V8LA 3MEWA 5GAOn 3OBWA 5GANg 1IHVA 2EFIA 2EVRA 3J7AF 4A63B 1CKBA 3THKA 3QKJA 3EFOA 2SRCA 4M77D 1WQWA 1QVGA 2QK0A 1MGQA 2HQEA 2FO0A 2XU8A 1VQLA 1VYTA 5FWBA 3F70A 4OGEA 1ZSGA 1ZSZB 2RJEA 4JDSA 1Y07A 1Q7YC 1N9SA 1IB8A 1KIKA 1I0CA 3ULRB 3CCMA 4FYVB 2VWFA 1VQOT 1WDXA 2DNUA 3MKDA 5ECAA 1PKSA 4XTXA 2QQAA 3CCLQ 3OQ5A 3RERA 3EGXB 3UDCA 1TUCA 2NYSA 3M5AA 1V29B 2IPOB 5IXBA 2X51A 2IIMA 1JBMA 4A53A 4ESRA 2I2LA 2HL3A 1KQ1A 2J6FA 2RD1A 3T9NA 3QZ5B 4JRKA 4M7DC 2LNHB 3M0PA 4BY6B 1WHGA 4AFZC 5KH6A 3G7ZA 1QCOA 1QWEA 3OB9A 3PVQA 3OSSC 3JV3A 4A4HA 3JB9G 3A5ZB 2RMOA 3L2ZA 5CKDA 3GIBA 1V76A 1RAGB 3ZL7C 3CCQA 4OMNA 4RTTA 2BZXA 4J6WA 4ZGDB 1OU9A 3GNGA 2W10A 4LE9A 4PJLA 1ABOA 3VU3C 2XDDA 4M78C 2E12A 2YRCA 1OZ2A 2CREA 1VQ4Q 2LQKA 1QVFA 4M7DA 2E5QA 1UE9A 1Y0MA 1WXUA 3CXCP 1ZA1B 1Y96A 2CP6A 1PNJA 4YTLA 4C8QC 1M2VA 1NLOC 2YUQA 4LDWA 2DX1A 4E7SA 1O9SA 2HZYA 4J9FA 1YBYA 3BE3A 1DJ7B 3KUFA 2ZPBB 1M2OA 5I22A 1ZSZC 1M27C 4IURA 4XU2A 2DRMA 2FG0A 5KYYB 2F5TX 3JRZA 1YJNQ 1MMAA 3GOXA 2DJZA 4IKFA 1T0HA 4M7AC 3EG9B 4KULA 3NPFA 3E9FA 3CMAT 4DEYA 2COZA 2NLUA 1G3SA 1X6OA 2ZZDA 4QKUA 2XG8D 4M78B 2KRMA 1PWTA 2CS7A 1SHFA 3EG3A 4IUQA 1WQ7A 1ZSZA 3MCAB 3UPUA 1VQKT 4F14A 4JLIA 3REBB 4KRTA 3RR6A 2E64A 4JUVA 4PJOA 3X24B 4PJOE 3QDRB 1RAAB 4XQ3A 1WA7A 5LJ3j 3L1AA 2EKOA 4PK4A 4A4EA 3OW2S 4GBQA 5FU6C 2D6FA 4OB2B 4F7UE 1YI2Q 3V7RA 2OI3A 2R58A 2QXFA 2X4WA 4EDUA 4AFUC 2ZPHB 2P0KA 3KXTA 4BI8B 2JS2A 3G6EA 3PVLA 4R56A 2AHJB 3CMAQ 3VRZA 4RTWA 4FYWB 3VS4A 1RABB 2KR3A 1WNLA 1BCMA 2GGRA 1ZHIA 2DYBA 2QG9B 3RIRA 5LJ3e 1VQ8Q 4ZN1A 2K2MA 1VIFA 1QCNA 1VQ5A 3QHSA 2HEQA 2E3IA 2O2OA 1K73C 1X2QA 2CP0A 4AG1C 1YJWT 5LJ5d 1AWOA 1PKTA 2GFAA 2LJ3A 3E19A 2DK3A 1RUWA 1BI1A 2LQ8A 2C0IA 4OF1A 1KHIA 4BY6C 4KGXB 7AT1B 1QP2A 2KT1A 2RB6A 5FROA 1QP3A 3D7SB 1VA7A 2ZPIB 4BD3A 2LCCA 1SRLA 1RI0A 3I5RA 2C0OA 2D1XA 4II1A 1ZX6A 1KC8R 1HXDA 2GTOA 3NFCA 1VQMA 4N0AA 4QVZA 4AT1B 3GPLA 5HY6A 1OU8A 5LJ5f 5L23A 4M7AG 4O6JA 2CYZB 1X2KA 2YUNA 2A08A 1AZEA 1M1GA 3WXMB 1JJ2P 5GAN2 3DB4A 3CCRT 2E6NA 2RI5A 1AWXA 1WHHA 3MP1A 5IT9E 3SEMA 4XK8E 1Q81C 4RUGA 4IUVA 2O4XA 1XJWB 1AD5A 1M4ZA 2LX9A 4AMCA 1Q86C 1KD1R 5GJVB 2QA4Q 4OMQA 2VC8A 3OYYA 4OB0B 3SWNB 4HA8A 4AFQC 1H8KA 2FPFA 1KJWA 4EMKB 2F2XA 4J9GA 1XQHA 1YJNA 3M59A 1SG5A 2DFUA 2KK4A 1P92A 1GXIE 5GAMf 1D09B 4AFSC 3N5BB 4BE2A 2WSCE 1R8OB 1JU5C 4PJMA 4M7DF 4KGVB 2OTLA 3QUIA 3VS5A 1S72T 5J3BA 1B07A 1N8RC 2YHTA 4X1VA 4RCBA 4EPCA 1D3BA 1LVKA 1KQSA 1BK2A 4PFOA 1E7OA 4F7UF 4C8QD 2XDPA 1W70A 3A8MB 4MMKA 2YLCA 1M90C 1M8MA 3JB9J 2GTJA 4LNPA 4E7LA 2DLPA 4J7IA 2VKNA 3NGPA 4LN2A 1M90U 1RADB 3VS1A 1C1AA 2QTVA 5GAMd 3CCJA 1XTDA 2LT4A 2QDLA 2EKHA 2HCKA 2QQSA 4M7DE 3SWNC 2HQHA 2ROLA 1VQPT 4JS5A 1IO6A 3V7CA 1SEMA 4M78A 1HK9A 2V8JA 3CCVA 4JRPA 1RL2A 1WGSA 1VQ6Q 2LRQA 2DF6A 2PUOB 1IZ6A 3RMQA 3CCJT 3NHNA 4F17A 2RJDA 3LH5A 2O9SA 1LJOA 3CCEA 4Z88A 4HT9A 3VRYA 1YJ9A 2P0PA 5GMKi 5KYUA 5DY9A 3PE0A 1M1FA 2K3BA 1VQ9T 2JN0A 3R6NA 1JO8A 2PUKB 1YIJT 4R55A 3CXCA 1QVGP 2BTTA 2AK5A 3QYHB 3OYHA 4PFZA 4DBRA 1SRMA 5KYYA 2JXBA 1SF9A 4MZTA 1MMNA 1Y96B 2E65A 3PFSA 2PNIA 3CC4A 4Z02A 4Z8AA 4PLIA 1YN8A 1N6AA 1NPPA 1G5VA 3G71A 2QTXA 1MV3A 4FL6A 2DEUA 1UUEA 5GAN3 2EGCA 4N4GA 3TU4K 1M5Q1 3EG1A 1OI1A 3CPFA 3DKMA 4DQ2A 2HNIA 2JW4A 1TWBA 4M75G 4ANJA 4P5NA 4C5HA 3JCMW 2C06A 1YHQT 3OS5A 2RO0A 3KFVA 4QW2A 4ZTFA 1MMDA 2BZ8A 2ESWA 1BBZA 2M16A 4C5EA 3CC4Q 4M77F 4EMKC 3CCLT 2PVOB 3AHUA 1KK7A 2EQJA 1GL5A 2A3LA 2P4TA 3OYFA 4F7UB 2E70A 1RACB 2F5KA 4PLLA 1IGQA 1ZBJA 2NUPB 4FSSA 4AG2C 4CC2A 1Q86R 2P0QA 4WTOB 1ZUYA 2L3SA 5CVIA 1WPYA 2KXCA 5LJ5g 3M0TA 3M4GA 4XU1A 1ABQA 2KBTA 3PMTA 2ZAEA 5AYFA 4B9XA 2LDMA 1K0XA 2AKLA 4C92G 5IH2A 3CC7A 3A8LB 3UT1A 4JRQA 5D6WA 4F7UG 1QVGS 4E7HA 3KBGA 2LJ1A 2XD0A 4DBHA 1U8RA 1D0ZA 3E2UA 3EGDA 1Q82R 4J6XA 4L59A 3GF5A 2RHIA 1WJRA 1M1KU 3OMCA 3OYIA 2YLBA 2GQIA 3LWIA 3UWNA 5GMKj 1AHJB 2OX7A 3VS3A 1M3BA 3HHTB 2O88A 1TG0A 4HCZA 1I07A 3ZFJA 4RTZA 3INZA 3OW2P 5DM7R 4OGCA 2KSSA 1I5OB 4QVCA 3VS2A 1HYOA 4D6WA 1OOTA 1A0NB 1UB4A 2VXFA 4JJBA 4Q5WA 2YSQA 3FB9A 4M75D 4D8KA 1VQOQ 2K3XA 2AT1B 3BFMA 5AT1B 3H0IA 2CGHA 1G83A 1K8AC 3OY9A 2QEXA 1NJIR 3EFRA 1M8VA 1WIEA 2GNCA 1K8AU 1RI9A 2M9UA 1H3HA 1C0MA 5KYXA 3QXEB 4JJDA 3RBBB 1U5SA 2VV5A 4C8QB 1VQPA 2DBMA 3FJPA 2OTJA 5GAMh 2DIGA 3JCMV 3M54A 2LX7A 4OB3B 3X25B 5GANh 5GAOp 2QEXT 4ZN3A 3E9GA 2BKDN 3P8HA 2VB6A 2JNGA 4NOYA 4RTYA 5LJ3h 4FW1A 3M0SA 3CPWA 3EGDB 2BE7D 2OTJQ 4JS4A 3M0UA 3TSWA 3SB2A 2QAZA 1M1KR 2CUDA 1X6BA 4JJCA 4C92F 1YJ9Q 1PRLC 1K4US 1NLPC 5CKEA 1FMVA 3OYCA 5CO7A 2EJ9A 4FYXB 3QZ9B 3CCUA 4JRIA 4E7KA 1X01A 2V26A 3Q1JA 1UDLA 2QQBA 4Y28E 2V8IA 3SDZA 2KVQG 3FIFA 1ZA2B 1VQ7T 5IXFA 2RH2A 1XOVA 2YT6A 4Z89A 1OPLA 3MJXA 2KI7A 1PSEA 3MO8A 2GFUA 4ZGEB 4HVWA 3DLMA 5A0GA 4E47A 4FT4A 2F1LA 5FWCA 4IIOA 5HCKA 2H3EB 3QPHA 1WJSA 3JB9D 2K5FA 5GMKh 2LQNA 3I9QA 4KGZB 2DBKA 1U3OA 5GAMe 2LZ6B 2OTLQ 3VS0A 4C8QG 2LC4A 2FPDA 1JB0E 2LT1A 4ELZC 3REAB 1D1AA 1AEYA 5EG2A 5GMKl 4C0GA 5C0MA 3QJ6A 5D7UA 1S1NA 2YRDA 1T3LA 4C92B 2DJQA 2CZ7B 4C0DC 2JVVA 1WHMA 1NEGA 1PD1A 4E7ZA 2DZCA 3FEOA 3RESA 2MWOA 2AKKA 3ZEHA 1Q81R 4M7AF 1N8RR 2RQUA 1X6GA 3PT9A 2QASA 3LWHA 4PJOB 4M77G 4J9EA 3I55T 1UFFA 5A0DA 1UHFA 4J83A 4HCKA 5J39A 2IVWA 1N5ZA 2YXYA 3A8HB 5GANj 3PTAA 4M75F 4M77E 2O4XB 3RMSA 1K1ZA 1TTHB 4IUPA 1IXDA 1UJ0A 3JCMd 2KEAA 1WJQA 2BIVA 1OEBA 1YCYA 1WZOA 3HL8A 2EYYA 2CP5A 3C95A 3ZBDA 2PQWA 1RLPC 4RKUE 3J80E 3I5SA 3G4ST 3NTIA 2ATCB 5HK0A 3MEUA 1VQ7Q 5I11A 1V1CA 1O75A 4M75E 1KC8U 3EFSA 1K0SA 3V8KA 3X28B 2RA2A 1BI2A 2RNAA 3UA6A 5KYWA 2ED1A 1T3SA 1GBQA 2CZ6B 3JCMX 2EYXA 5CR2A 2L0AA 1VQNT 1ZUKA 1X75C 3P8DA 3H9NA 5KYXB 1EX4A 2GBQA 4IIMA 2E3HA 5FU7C 2ZGWA 4M7DB 1EIFA 4C0DB 2MF2A 5CAIA 3NTHA 2QA4T 2KRNA 2YUPA 2BE9B 5GAOq 3RKWA 4FYYB 3FRNA 1UEBA 1QW1A 2ROTA 2LCLA 2EGEA 2KNBB 3TEEA 3JCMb 4XTWA 2DTIA 4NS5A 2FRWA 3URGA 1QLYA 2YWWA 4XU0A 4ME7A 2RN8A 1NYGA 3CEYA 4QQ6A 2HBPA 4D8DA 4ZTJA 2ABLA 4O5VA 2KXDA 3CD6T 4LDUA 1IHWA 1G2BA 2RHUA 4M77B 2KAFA 1VQNQ 2JTEA 2V1RA 4B6MA 2PVGB 1VQPQ 2J6OA 4N0AC 1VQLQ 4C5IA 2L3PA 3M58A 1WXTA 1PM3A 4RG2A 3OYAA 4R0KA 1VIEA 5IHKA 3VS7A 2X4JA 2X4YA 4QQGA 1YITT 2MMPA 2LQWA 4LD9K 3ME9A 2JM8A 5C6SA 1W6XA 4M75B 2A37A 1KD1U 1Y71A 1Z9QA 3LLRA 4E7JA 3FJ5A 2DTHA 1BIAA 2PU9B 4XTZA 3CQTA 3A8GB 2OAUA 1WX6A 5GAN6 2COYA 3CXCS 3EH2A 2HMAA 2PTKA 4FM4B 4OMLA 4MDXA 1PC0A 2O31A 3CCRA 2HDAA 3OW2A 1AT1B 1W2BP 3PGGA 5GAOl 2BUDA 5L8RE 4E6RA 1MV0B 1K9MU 2K2VA 4C8QA 3I55Q 2KDSA 3TVTA 2J05A 1JQQA 2MAMA 2EIFA 3C4SA 5LJ3f 3CC7Q 4IUTA 1QCFA 5A0LA 1W1FA 5DLQE 2GF7A 1VQ4A 2EQKA 5KYNA 4E7IA 1JXMA 2EAYA 1Y7XA 8AT1B 1KHCA 1YJNT 3U23A 5A2QE 1ZQ1A 3OSVA 4XTVA 2RPNA 2M02A 5EC7A 2DD4A 3CBOA 1Q81U 5CK9A 1Q95G 2FVUA 1K9MC 3BDUA 3CC2Q 3RUXA 2HQXA 1H3ZA 3QDFA 1YHQA 1ARKA 2MPXC 3CMEA 2HL5C 4L5GA 2HKNA 1RAHB 1VQ7A 4HCBA 2DPPB 2MWPA 4ATOA 4DBFA 2JUFA 5CCAA 2XICA 2SEMA 2A7YA 2MOXA 1AOJA 5J26A 3CCVQ 3OA6A 1SHGA 3PNWC 5CIUA 3CCQQ 2CP2A 3I35A 1VQLT 2FYKA 3R6OA 1W4SA 2MIOA 3QIIA 3RDVA 1IREB 2E10A 1FWZA 4J6YA 1Q7YR 1OQKA 1Q82U 4C0ZA 3PMIA 4LUEA 3M0RA 1YHQQ 4ZNXA 2P84A 4J9IA 2MCNA 3RKXA 4N4IA 5LL6S 2KGTA 1F1BB 1WLPB 4C92D 3OYDA 1VQMT 1N8RU 1W2BS 4NL2A 1UGRB 4PFPA 3VS6A 3JB9H 3V7SA 2RJCA 1SKUB 4QT7A 2PVDB 2COWA 1NPRA 2XIDA 1IRXA 3OYMA 3HRSA 1QMCA 4FT2A 3HTRA 3VV0A 4A4KA 2RHZA 1PHTA 3M53A 2FZKB 2HBWA 1PCXA 1VQ5T 3H0HA 5I21A 2KY9A 2K4YA 3OMGA 3M56A 4PJJA 4M7AA 4BB7A 1SSHA 2F69A 4LDVA 1VQ9A 2C0TA 2KE9A 3L2VA 1YNZA 1VYVA 2LJ0A 2RF0A 5IHIA 4VUBA 3VJPA 1M2VB 3GBQA 4DA4A 4L6V5 2VVKA 4LXCA 8ATCB 3C94A 2QEXQ 2XMFA 5M9OA 2ED0A 1AWWA 3I56T 5GAOr 4HVUA 4E2FB 3HP9A 3C12A 5GAN5 5FLXE 3AT1B 1R0CB 1BU1A 1VQ8T 3HFOA 2FPEA 1NZ9A 3OYEA 3O8VA 5CKHA 2R5AA 4PJOC 3MP8A 2OTLT 1HD3A 1YI2A 3FLGA 1AVZC 2DXTA 4FW2A 4ORZA 2PZ1A 5GAOm 1M9SA 1PRMC 4C8QF 1FX7A 3MHXA 1QVPA 4FU6A 3OS1A 2DEQA 5HKCA 2DXCA 2B86A 2DYIA 4BI3A 4BDZA 2WSFE 2JZ2A 1KSWA 4OMOA 2Y4YA 2OTJT 2CZ1B 4M78F 4HT8A 1UGVA 4HXJA 1PD0A 1QKXA 4CC7A 2LCSA 1GCQC 3JCMc 2H3JA 4A4FA 3JB9I 1GFDA 2LP5A 5HK3A 1TXQA 3QSUA 1E6HA 3CBMA 4KT0E 3FDRA 4C5GA 3IQLA 4OMMA 1B7TA 2DO3A 2O9VA 2KMTA 3QWYA 2NUTA 1EFNA 2R57A 3JAME 3CCSA 1YITQ 2YDLA 3JCMe 2MI6A 4QQDA 1K73U 1MUZA 4TVRA 2XKOC 2CH4A 4BE1A 3JB9F 4K11A 4OVAA 5FU7B 1U1SA 4OMPA 3G6ET 4C0FA 4GLMA 3M4YA 1FYNA 2DKGA 3OYBA 1BIBA 1YIJQ 5KCHA 1T0JA 4BE0A 3I56Q 2VGMA 5CKFA 4EMGA 1NG2A 4MZPA 4HCCA 5KCOA 2DXUA 1BI0A 2CH4W 2CP7A 2EYWA 9ATCB 4A4GA 3L2QA 1YJWQ 5GAN7 3JCMJ 1TSFA 2H8HA 3M57A 4FIBA 1H92A 1I4K1 1WHJA 2LNVA 5GJWB 2JS0A 1VQKQ 2L89A 3EHRA 1BB9A 3UA7A 3RNJA 2DRKA 1EZZB 3MPUB 3CPWS 1JXOA 1G3TA 2KYMA 4IUUA 2RK2A 2XK0A 2DL5A 1CKAA 3GNFB 3CCVT 1Q7YU 4KUIA 2RI2A 4KBMB 2DAQA 2XHCA 2DMOA 1NJIC 2LTOA 3A1PA 1U1TA 2JM9A 4BDYA 1K8AR 2P4RA 3TSZA 2QQRA 1GRIA 5FRMA 1YCSB 3X26B 3G1JA 2ECZA 2EGAA 1D3BB 1D0XA 2FHDA 4M75C 4QVDA 1VYUA 4J5YA 1UG1A 2A0FB 1JJ2A 3CMAA 5CKBA 3HFNA 3E1SA 3CCEQ 4J7FA 2CSQA 2DVEA 5LJ5j 1R77A 1IGUA 1S72Q 1NBEB 2L3RA 1JEGA 3H6ZA 3TQ7P 1TH7A 3PIOA 3CCQT 1VQ6T 2X9HA 3QBYA 1W2BA 1U06A 2DTOA 3G6EQ 2Y90A 1VQ5Q 4RTXA 4CC4B 5IN1A 3LW5E 3QYGB 2RK1A 2EQUA 3EG2A 3CCUQ 4M78G 2HKQB 1KFZA 2I0NA 3OYJA 3GLXA 3S3OA 3LGLA 2M0OA 3EHQA 2Z0WA 1VQOA 4RMOA 5LJ5e 4BACA 4CC3A 1QQJA 2EJFA 4KH0B 3FC3A 1VOMA 3HSBA 2WACA 3G71Q 2E6ZA 5GAN8 3L2RA 1M3CA 5GANd 3QG1A 2OJ2A 2J6KA 5LJ3d 1S72A 2YRVA 1TUGB 2FEIA 3JSCA 4JLGA 1D1BA 4ELYC 4GLKA 1UTIA 1Z9ZA 1UECA 4M78E 3CCLA 1M3AA 1MMGA 5I2SA 1HSQA 2M0YA 2JT4A 1K9AA 4KUDK 1BI3A 1I5LA 4LDXA 1G8XA 5GANf 1H641 1VQ8A 2CSIA 3I55A 1MHNA 4PJOD 1YWPA 4C8QE 1VQNA 2JMCA 1BYMA 3M0QA 2ZPFB 4B9WA 3P8BB 4LDYA 3RKYA 5CQYA 1QVFS 2E1HA 2QGGA 2XI9A 4JPBW 2FRYA 4J9DA 2D0QB 2QA4A 4DEXA 1KQSS 2HSEB 4HVVA 2DL7A 1UJYA 1KQSP 5D6YA 2DM1A 2KRSA 4PJOF 3NTKA 3C0CA 1QKWA 3MEVA 4MZMA 3MP6A 2G6FX 2K7AA 2JJ9A 3G71T 4MDWA 3M9QA 2KT8A 2VGNA 1N9RA 1WFWA 1FXXA 1CSKA 3CMEQ 1Q86U 1K73R 2EBPA 3CPWP 4J9CA 4DBQA 3L42A 2CP3A 3QO3A 1NEBA 4RTUA 1UHCA 1TUDA 1X27A 4PKCC 1B34B 5GAMg 3S3NA 4M7AB 2RQVA 1UGSB 2M51A 2DXBA 4V2SA 3S3MA 1NJIU 2FL7A 3DB3A 1RAEB 3EG0A 3CCSQ 1YITA 3CCMQ 2BZYA 3EH1A 1K76A 1YI2T 3OS2A 2GCXA 1AWJA 1LPLA 2AZVA 3HPWA 4M4ZA 4X34A 2ENMA 1D0YA 2X35A 1X43A 4M75A 4JZ4A 1KQ2A 2JTMA 4J8OA 4NL3A 3OYNA 2L2PA 3H8ZA 1ZBXA 2RJFA 3EFOB 1GCQA 5GAMj 3A98A 2F2VA 4PJNA 1E6GA 3EG9A 2MYSA 1B34A 3J81E 2EW3A 3LX7A 2L3QA 3JCMP 2G3RA 2K79A 3JCMf 2X3XD 5KE2A 2J06A 4JZ3A 2ZCFB 3VYHB 4M77A 2EWNA 2W0ZA 3ER0A 1PSFA 1VUBA 2HAXA 2NUPA 2IG0A 2QGFB 1D1CA 3LYIA 4DOWA 1OX8A 4A54A 1GBRA 1OX9A 4F7UA 1YFNA 3BDLA 2DL4A 1YWOA 2OAWA 2D9TA 2DD5A 5D6XA 3UATA 1I81A 5KYWB 2M1HA 4GY5A 3SHWA 3UF4A 1N27A 1SPKA 1G3YA 2JMAA 4M77C 2E5KA 2RM4A 2L5QA 4PJOG 3HKSA 5GANe 2JOYA 2EQMA 4FCYA 3GP8A 1QVFP 5DLOA 1JRIA 6AT1B 3CCMT 5GMKm 3LGFA 1PG5B 2VUBA 2X3WD 2DVJA 5I2MA 3CCUT 1OV3A 3CC7T 1VQ6A 3TREA 4CRIA 4DOVA 2YUOA 1Y57A 5KYUB 2NWMA 1YJ9T 3A8OB 2KQWA 1GFCA 4EMHA 3CD6A 1TOVA 3DLLA 1RLQC 3G4SQ 4M7DD 3QJYA 3EGXA 3MEAA 4XTUA 2FB7A 1RAIB 2K5IA 3L2UA 1FMWA 2V1QA 4Y92A 2E4HA 4FSXA 1WXBA 2HD0A 3CCRQ 4M78D 4X9DA 1K9MR 2D8JA 4X9CA 4M7AE 1KG1A 3JCMg 2LMJA 1TU0B 4KH1B 2QYZA 2VYTA 4RCCA 4HKEA 1XNIA 2K3YA 2V8KA 2A28A 4XTYA 4EIKA 1UGPB 3JCMQ 4M7DG 2Y4XA 4N4HA 3BY7A 1YP5A 3H0FA 2CZ0B 4BUGA 3OYLA 2EYZA 2DERA 2WSEE 1NM7A 2QI2A 1I8FA 1LCKA 2EPDA 1KD1C 3NMZC 4OB1B 1NE8A 5GAN4 3TCJA 3VUZA 3CCET 2QDYB 1LNXA 2RHYA 4ZGJB 3BW1A 1M30A 3OYKA 1HJDA 5FU6B 2DE0X 2GQVA 1UGQB 2DL8A 2RHXA 5GMKe 4WF2A 4MMLA 1I1JA 4LD6A 1FMKA 2KROA 3OBYA 2RI3A 4XAXB 3VKIA 2EQIA 1ACMB 4XU3A 2JTFA 1MNDA 4LUDA 2ZPGB 1VQKA 3SWNA 2D0NA 1MNEA 2K5LA 4Y91A 3PIPA 3CC4T 3CBPA 2FZCB 2X4XA 1M1KC 3VYGA 2XDBA 1AZGB 2CT3A 2FZGB 3EGUA 3S6WA 1BKBA 4F16A 3QWXX 5KE3A 1ZUUA 4EMKA 2EJGA 1M90R 2DIQA 2R5MA 4JJNK 2B8AA 3CC2T 4CI0C 1BCOA 2DL3A 3I56A 2QQ9A 3HRTA 4OMFB 2DA9A 2AIRB 3CCJQ 4UC4A 4M7AD 2E41A 1WHKA 5CQXA 2K57A 4OP0A 1WHLA 2MK5A 1GCPA 1YIJA 3L2WA 1NYFA 2CT4A 2VASA 3V8JA 4J9BA 3ASKA 3CC2A 2DETA 1OPKA 1SSFA 2NUTB 2O01E 2VXEA 1ZLMA 1OYXA 1YJWA 3WVDB 4C92E 4C92A 2K6DA 3LH0A 3SFMA 2K9GA 3O5ZA 2J7IA 3H41A 2D8HA 5LJ3g 1OULA 3CD6Q 1LOJA 5FW9A 3JCMh
chains in the Genus database with same CATH topology
1HK9A 2V8JA 3VUBA 5IAYA 3CCVA 4JRPA 1RL2A 1WGSA 2CZ6B 2EYQA 2L3RA 3M55A 3JCMX 5GAMh 3H6ZA 5CR2A 1TH7A 2LRQA 2ZPEB 3PIOA 3CCQT 1VQ6T 2PUOB 1VQNT 3QBYA 1IZ6A 3RMQA 1W2BA 3WVEB 3CCJT 1X75C 2DTOA 3P8DA 2Y90A 2RJDA 1G3WA 5IN1A 5FU7C 3LW5E 1LJOA 2ZGWA 3QYGB 5LJ5h 2RK1A 4M7DB 1EIFA 2EQUA 4M78G 3CCEA 1Q82C 4C0DB 2MF2A 5CAIA 3NTHA 2QA4T 4HT9A 4PL6A 4C92C 3GLXA 2L8DA 3OYGA 3OYJA 3G4SA 5GAOq 3RKWA 3S3OA 3LGLA 1YJ9A 2P0PA 2M0OA 3FRNA 5GMKi 3CCST 1VQ4T 1UEBA 1VQOA 1QW1A 4RMOA 2LCLA 5DY9A 3EAEA 1M1FA 5LJ5e 4BACA 3TEEA 3JCMb 4XTWA 5FRNA 2EJFA 2DTIA 4RG8A 1VQ9T 3HRUA 4NS5A 2JN0A 3URGA 3FC3A 1YIJT 2PUKB 4BI4A 4R55A 3CXCA 3HSBA 1OZ3A 2WACA 4XU0A 4ME7A 2E6ZA 5GAN8 3L2RA 4PNOA 3CEYA 2LVMA 3QG1A 3QYHB 4QQ6A 5LJ3d 2HBPA 5GANd 3OYHA 1S72A 4ZTJA 2YRVA 4O5VA 2DZ9A 3SD4A 3JSCA 3CD6T 4JLGA 4LDUA 4ELYC 2RHUA 4M77B 2E65A 1Y96B 4MZTA 4GLKA 2KAFA 3PFSA 3CC4A 4Z02A 2CKKA 3META 4PLIA 3OS0A 1KC8C 3CMET 1JJ2S 2PVGB 1N6AA 4M78E 1NPPA 4N0AC 3CCLA 4C5IA 3M58A 3X20B 1G5VA 3V8LA 3MEWA 5GAOn 5I2SA 3G71A 3OBWA 5GANg 2QTXA 4RG2A 4KUDK 3OYAA 2EFIA 1BI3A 1VIEA 1I5LA 4FL6A 4LDXA 3J7AF 5GAN3 2X4JA 2X4YA 4N4GA 4QQGA 5GANf 3QKJA 3TU4K 1H641 1M5Q1 1YITT 1VQ8A 1OI1A 2MMPA 3CPFA 3DKMA 4M77D 1WQWA 1MHNA 4DQ2A 3ME9A 3I55A 4LD9K 4PJOD 4C8QE 2HNIA 4M7AD 1QVGA 1VQNA 5C6SA 1BYMA 2ZPFB 4B9WA 1MGQA 2HQEA 3P8BB 4M75G 4LDYA 2XU8A 4M75B 4P5NA 3RKYA 5CQYA 4C5HA 3JCMW 1Y71A 1KD1U 1VQLA 1QVFS 2E1HA 2C06A 3F70A 1YHQT 4OGEA 3LLRA 4E7JA 2XI9A 3OS5A 2RO0A 2RJEA 4QW2A 4ZTFA 4JDSA 1Y07A 1Q7YC 2QA4A 2D0QB 1N9SA 2DTHA 1BIAA 2PU9B 1KQSS 4XTZA 2M16A 3A8GB 2OAUA 5D6YA 4C5EA 3CCMA 4M77F 4EMKC 1VQOT 5GAN6 4PJOF 3CCLT 3NTKA 2PVOB 3AHUA 3CXCS 3MEVA 2QQAA 4MZMA 3OQ5A 4XTXA 3RERA 2EQJA 3MP6A 3G71T 2A3LA 4MDWA 4FM4B 3UDCA 4MDXA 2P4TA 3M5AA 1V29B 4F7UB 2E70A 3OYFA 3CCRA 3M9QA 3OW2A 3PGGA 2VGNA 1N9RA 1FXXA 1JBMA 4A53A 5GAOl 2BUDA 2F5KA 4PLLA 1Q86U 2I2LA 5L8RE 1KQ1A 2RD1A 3T9NA 1K9MU 2K2VA 4C8QA 3QZ5B 3L42A 2KDSA 4JRKA 4M7DC 3QO3A 4BY6B 2MAMA 5KH6A 2EIFA 3C4SA 5LJ3f 2P0QA 3G7ZA 3OB9A 4IUTA 5CVIA 5A0LA 1WPYA 3OSSC 5DLQE 2GF7A 5LJ5g 4PKCC 4A4HA 3JB9G 2EQKA 3A5ZB 1B34B 3M4GA 4XU1A 5GAMg 3S3NA 4M7AB 4E7IA 1UGSB 2EAYA 3L2ZA 3PMTA 1Y7XA 5AYFA 5CKDA 3GIBA 2DXBA 4B9XA 4V2SA 1KHCA 2LDMA 3S3MA 3CCQA 1YJNT 1NJIU 4J6WA 5A2QE 2FL7A 3DB3A 4ZGDB 1ZQ1A 1YITA 3OSVA 3GNGA 4XTVA 4C92G 3VU3C 1YI2T 2DD4A 3CBOA 2XDDA 3A8LB 4M78C 3UT1A 2GCXA 3OS2A 3CC7A 1Q81U 5CK9A 2E12A 4JRQA 2FVUA 1OZ2A 5D6WA 4F7UG 1QVGS 1K9MC 4E7HA 3BDUA 3HPWA 3KBGA 2HQXA 3RUXA 2XD0A 4X34A 2LQKA 1U8RA 1QVFA 1H3ZA 1YHQA 4M7DA 3CMEA 2X35A 2E5QA 4M75A 4L5GA 1KQ2A 1VQ7A 2JTMA 4J8OA 1Y96A 4NL3A 3OYNA 4J6XA 4L59A 3H8ZA 4YTLA 4C8QC 1ZBXA 4HCBA 3GF5A 2RHIA 2DPPB 2RJFA 2MWPA 1WJRA 4ATOA 5GAMj 1M1KU 3OMCA 3OYIA 2JUFA 2YLBA 4LDWA 5CCAA 1O9SA 2XICA 3UWNA 3LWIA 2A7YA 5J26A 5GMKj 1AHJB 1B34A 3OA6A 1VQ4A 3J81E 1YBYA 3PNWC 5CIUA 1DJ7B 3LX7A 3HHTB 3KUFA 3JCMP 2ZPBB 4HCZA 2G3RA 3ZFJA 1VQLT 3JCMf 2FYKA 3INZA 1W4SA 3R6OA 5KE2A 5DM7R 3QIIA 4IURA 4OGCA 2ZCFB 4XU2A 1IREB 2E10A 2KSSA 4M77A 1FWZA 2EWNA 3VYHB 4QVCA 2F5TX 3JRZA 4J6YA 3ER0A 1PSFA 4D6WA 1VUBA 1Q82U 2HAXA 4C0ZA 2IG0A 3GOXA 3PMIA 2DJZA 4IKFA 1UB4A 3LYIA 4DOWA 4M7AC 4A54A 4F7UA 2VXFA 4KULA 4Q5WA 3BDLA 3E9FA 3FB9A 3CMAT 4M75D 2NLUA 2D9TA 2DD5A 1G3SA 3RKXA 2K3XA 4N4IA 3BFMA 5LL6S 1X6OA 5D6XA 2ZZDA 2CGHA 4C92D 1I81A 3OYDA 1VQMT 1K8AC 2XG8D 3OY9A 4M78B 2QEXA 1N8RU 2M1HA 4GY5A 3EFRA 1W2BS 2CS7A 4NL2A 1UGRB 1M8VA 4IUQA 3JB9H 3V7SA 1WQ7A 1K8AU 2RJCA 3MCAB 1N27A 3UPUA 1VQKT 2M9UA 2PVDB 1G3YA 1NPRA 4M77C 2XIDA 3OYMA 3HRSA 4JLIA 4FT2A 2RM4A 2L5QA 4PJOG 2E64A 3HKSA 4JUVA 3QXEB 3VV0A 5GANe 4A4KA 2JOYA 2EQMA 2RHZA 4C8QB 2VV5A 4PJOA 3X24B 3M53A 3GP8A 4PJOE 5DLOA 3QDRB 1VQPA 3FJPA 1JRIA 4XQ3A 1VQ5T 5LJ3j 3CCMT 2OTJA 3L1AA 2EKOA 5GMKm 2DIGA 3LGFA 3M54A 3JCMV 2VUBA 5FU6C 4OB3B 4A4EA 5I21A 3OW2S 4OB2B 3X25B 4F7UE 2D6FA 5I2MA 3V7RA 3CCUT 2KY9A 2K4YA 2R58A 3OMGA 3M56A 5GANh 2QXFA 5GAOp 2QEXT 4BB7A 2X4WA 4M7AA 2F69A 4EDUA 4LDVA 3CC7T 4ZN3A 1VQ9A 3E9GA 2BKDN 3L2VA 1VQ6A 3P8HA 3TREA 2ZPHB 4VUBA 3VJPA 2P0KA 4CRIA 4DOVA 4DA4A 3KXTA 4L6V5 4BI8B 2JNGA 4NOYA 3G6EA 4R56A 5LJ3h 1YJ9T 2AHJB 3CPWA 3A8OB 2KQWA 3C94A 4EMHA 5M9OA 3CD6A 3I56T 5GAOr 4JS4A 1WNLA 3HP9A 3DLLA 3SB2A 3C12A 5GAN5 1ZHIA 4M7DD 3RIRA 5FLXE 5LJ3e 4C92F 3QJYA 3MEAA 4XTUA 1VQ8T 3HFOA 2FB7A 4ZN1A 1NZ9A 1VIFA 5CKEA 2K5IA 3L2UA 3OYEA 3O8VA 5CKHA 1VQ5A 2R5AA 3QHSA 4PJOC 3MP8A 3OYCA 1K73C 5CO7A 2EJ9A 2OTLT 4FSXA 1YJWT 2HD0A 3QZ9B 3CCUA 4M78D 5LJ5d 4X9DA 4JRIA 1YI2A 4X9CA 3FLGA 4E7KA 4M7AE 1KG1A 1X01A 3JCMg 2DXTA 2GFAA 2DK3A 3E19A 5GAOm 1M9SA 4C8QF 1BI1A 1FX7A 3Q1JA 2LQ8A 3MHXA 2QQBA 4OF1A 1QVPA 1KHIA 4FU6A 4Y28E 4BY6C 2V8IA 1QP2A 2RB6A 3OS1A 2DEQA 3SDZA 2VYTA 5FROA 5HKCA 2DXCA 1QP3A 4HKEA 4RCCA 1XNIA 2K3YA 2KVQG 2V8KA 3FIFA 4BI3A 4BDZA 2WSFE 1VQ7T 2JZ2A 2ZPIB 4BD3A 4XTYA 1UGPB 3JCMQ 4M7DG 2Y4XA 2LCCA 2RH2A 4N4HA 2Y4YA 3BY7A 1XOVA 2OTJT 2CZ1B 4M78F 2CZ0B 1RI0A 4HT8A 4II1A 4BUGA 1HXDA 3OYLA 3NFCA 1VQMA 1PSEA 3MO8A 3JCMc 2GFUA 2H3JA 4A4FA 2WSEE 2QI2A 4N0AA 3JB9I 4QVZA 4ZGEB 3DLMA 5A0GA 4E47A 1I8FA 4FT4A 5HK3A 3GPLA 5HY6A 1KD1C 5LJ5f 3QSUA 3CBMA 3QPHA 4KT0E 3FDRA 4OB1B 4C5GA 4M7AG 4O6JA 1WJSA 1NE8A 2CYZB 3JB9D 2DO3A 3TCJA 2KMTA 2K5FA 3VUZA 5GAN4 3CCET 2QDYB 1LNXA 5GMKh 1M1GA 3WXMB 2RHYA 4ZGJB 3BW1A 5GAMe 5GAN2 3OYKA 3DB4A 2R57A 3CCRT 5FU6B 3JAME 3CCSA 2GQVA 2E6NA 1UGQB 2RI5A 4C8QG 2RHXA 3JCMe 2MI6A 4QQDA 2LC4A 3MP1A 5IT9E 4XK8E 1K73U 5GMKe 4WF2A 1JB0E 4MMLA 2LT1A 4LD6A 1Q81C 4TVRA 2XKOC 2O4XA 4IUVA 4ELZC 3OBYA 4BE1A 1M4ZA 3JB9F 2LX9A 2RI3A 1Q86C 4XAXB 4OVAA 5FU7B 1U1SA 3VKIA 3G6ET 4XU3A 5EG2A 5GMKl 2VC8A 3OYYA 4C0GA 4OB0B 3SWNB 4HA8A 3QJ6A 4C0FA 5C0MA 2JTFA 3M4YA 2DKGA 4C92B 3OYBA 2ZPGB 1BIBA 3SWNA 2CZ7B 1VQKA 3PIPA 2K5LA 2JVVA 4Y91A 4C0DC 5KCHA 3CC4T 3CBPA 4EMKB 4BE0A 1YJNA 1XQHA 2VGMA 3M59A 5CKFA 2X4XA 4EMGA 1M1KC 2DZCA 3VYGA 4MZPA 2KK4A 4HCCA 5KCOA 2DXUA 1P92A 3FEOA 1GXIE 1BI0A 2XDBA 3RESA 2MWOA 5GAMf 3S6WA 1BKBA 3N5BB 4A4GA 4BE2A 2WSCE 3ZEHA 3L2QA 4M7AF 1R8OB 3PT9A 5KE3A 5GAN7 3JCMJ 3LWHA 4M7DF 3M57A 4M77G 4PJOB 4FIBA 4EMKA 2OTLA 1I4K1 2EJGA 3QUIA 2LNVA 2DIQA 3I55T 1S72T 2R5MA 5J3BA 2B8AA 4JJNK 3CC2T 2L89A 4CI0C 1N8RC 2YHTA 5A0DA 3I56A 2QQ9A 3HRTA 4OMFB 4RCBA 4J83A 4EPCA 3CPWS 5J39A 1D3BA 2IVWA 1KQSA 1G3TA 3A8HB 4IUUA 5GANj 2RK2A 3PTAA 4M75F 4M77E 2O4XB 2XK0A 4UC4A 3GNFB 4F7UF 4C8QD 2XDPA 2E41A 4KUIA 2RI2A 3RMSA 3CCVT 4KBMB 1Q7YU 2DAQA 3A8MB 2XHCA 4MMKA 5CQXA 1NJIC 2K57A 4OP0A 4IUPA 2LTOA 2YLCA 1U1TA 4BDYA 1M90C 1YIJA 3JB9J 3L2WA 2QQRA 3JCMd 4E7LA 4J7IA 1WJQA 2BIVA 5FRMA 1YCYA 3X26B 3HL8A 1M90U 3V8JA 3CC2A 3ASKA 3C95A 3ZBDA 1SSFA 2O01E 2VXEA 2PQWA 4RKUE 5GAMd 1D3BB 3J80E 3CCJA 1OYXA 1YJWA 3WVDB 1XTDA 2LT4A 3G4ST 3NTIA 5HK0A 2FHDA 3MEUA 4M75C 2QQSA 4QVDA 3SWNC 4C92E 4M7DE 4C92A 3LH0A 4J5YA 1O75A 4M75E 3SFMA 1KC8U 3EFSA 1JJ2A 3CMAA 5CKBA 3HFNA 3E1SA 5LJ3g 4JS5A 1VQPT 3V8KA 3X28B 1LOJA 2RA2A 4J7FA 1BI2A 2DVEA 3V7CA 5LJ5j 3JCMh 4M78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJC A;  1N27 A;  5IAY A;  2BUD A;  2F5K A;  1WGS A;  4PLL A;  2L3R A;  2RHY A;  3H6Z A;  3OYM A;  3OYK A;  3DB4 A;  2LRQ A;  2R57 A;  3QBY A;  2E6N A;  3L42 A;  2RI5 A;  2RHZ A;  2EQM A;  5KH6 A;  3C4S A;  2RHX A;  3P8D A;  4QQD A;  3OB9 A;  2RJD A;  3MP1 A;  4IUT A;  5IN1 A;  4LD6 A;  2GF7 A;  4IUV A;  2EKO A;  2EQU A;  2DIG A;  2EQK A;  2O4X A;  3LGF A;  4A4E A;  4A4H A;  4BE1 A;  3S3N A;  4E7I A;  2RI3 A;  3PMT A;  3NTH A;  4OVA A;  2R58 A;  4PL6 A;  3OMG A;  2L8D A;  3OYG A;  4B9X A;  3OYJ A;  1KHC A;  2LDM A;  2X4W A;  3S3O A;  3LGL A;  4EDU A;  3S3M A;  2M0O A;  2BKD N;  3E9G A;  3L2V A;  3P8H A;  5C0M A;  3DB3 A;  3QJ6 A;  2JTF A;  3EAE A;  3OYB A;  2P0K A;  4CRI A;  4BAC A;  5FRN A;  5KCH A;  3OS2 A;  4BE0 A;  3UT1 A;  4NS5 A;  3FC3 A;  2X4X A;  1OZ2 A;  5D6W A;  5M9O A;  5KCO A;  3FEO A;  4E7H A;  1OZ3 A;  2WAC A;  2HQX A;  2MWO A;  3L2R A;  4X34 A;  3CEY A;  2LVM A;  4QQ6 A;  3S6W A;  3OYH A;  1H3Z A;  4A4G A;  4BE2 A;  3L2Q A;  3ZEH A;  4ZTJ A;  2X35 A;  2YRV A;  2E5Q A;  3SD4 A;  5KE3 A;  3OYN A;  2RHU A;  3MEA A;  4L59 A;  3H8Z A;  3PFS A;  4Z02 A;  2CKK A;  2DIQ A;  3MET A;  4PLI A;  2R5M A;  3OS0 A;  2B8A A;  2RHI A;  2RJF A;  3OYE A;  3L2U A;  2L89 A;  1WJR A;  2MWP A;  3O8V A;  2R5A A;  3MP8 A;  3OMC A;  3OYC A;  3OYI A;  4C5I A;  1G5V A;  3MEW A;  5J39 A;  3UWN A;  3FLG A;  4E7K A;  4IUU A;  4RG2 A;  3OYA A;  5J26 A;  3OA6 A;  2EFI A;  2GFA A;  2O4X B;  2XK0 A;  4FL6 A;  4UC4 A;  3Q1J A;  3PNW C;  5CIU A;  3LX7 A;  2X4Y A;  2XDP A;  4N4G A;  2RI2 A;  3KUF A;  3QKJ A;  4FU6 A;  4QQG A;  2DAQ A;  4HCZ A;  2G3R A;  3OS1 A;  1OI1 A;  2VYT A;  5FRO A;  1MHN A;  3ME9 A;  4IUP A;  2LTO A;  5KE2 A;  3QII A;  4IUR A;  4BDY A;  1XNI A;  2K3Y A;  5C6S A;  3L2W A;  2QQR A;  4B9W A;  4BDZ A;  2JZ2 A;  2HQE A;  4BD3 A;  4C5H A;  4E7L A;  5FRM A;  1WJQ A;  2BIV A;  2IG0 A;  3GOX A;  3PMI A;  2LCC A;  4N4H A;  3F70 A;  4IKF A;  3ASK A;  3LLR A;  4E7J A;  1SSF A;  3LYI A;  2PQW A;  2RO0 A;  1RI0 A;  2RJE A;  4QW2 A;  4ZTF A;  4II1 A;  3OYL A;  1OYX A;  3BDL A;  4Q5W A;  3E9F A;  3MO8 A;  3NTI A;  2GFU A;  4A4F A;  2FHD A;  3MEU A;  2M16 A;  2NLU A;  2QQS A;  4QVZ A;  2D9T A;  5D6Y A;  3DLM A;  4C5E A;  3LH0 A;  2K3X A;  4N4I A;  3NTK A;  5D6X A;  3OYD A;  3MEV A;  3OQ5 A;  3OY9 A;  2EQJ A;  3MP6 A;  3FDR A;  4C5G A;  2M1H A;  4GY5 A;  3OYF A;  1WJS A;  3M9Q A;  4IUQ A; 
#chains in the Genus database with same CATH topology
 2RQT A;  3VUB A;  5IAY A;  1B3Q A;  2EYQ A;  3M55 A;  1RAF B;  1QWF A;  2ZPE B;  2CDT A;  1TS9 A;  2KYB A;  3WVE B;  1G3W A;  5LJ5 h;  1Q82 C;  1J3T A;  1C6V X;  4PL6 A;  4C92 C;  2DIL A;  2L8D A;  4RTV A;  3OYG A;  3G4S A;  2CUB A;  3CCS T;  1VQ4 T;  5IHN A;  3EAE A;  2A36 A;  1WYX A;  2RQW A;  5FRN A;  4RG8 A;  3HRU A;  4F04 B;  4BI4 A;  1OZ3 A;  2RQR A;  2AZS A;  2NUZ A;  4PNO A;  2LVM A;  4WCI A;  2DZ9 A;  3SD4 A;  4J9H A;  1VQM Q;  1VQ9 Q;  1R0B G;  2CKK A;  3MET A;  2HSP A;  3OS0 A;  1KC8 C;  3CME T;  1JJ2 S;  1WI7 A;  3X20 B;  2F2W A;  1X69 A;  3V8L A;  3MEW A;  5GAO n;  3OBW A;  5GAN g;  1IHV A;  2EFI A;  2EVR A;  3J7A F;  4A63 B;  1CKB A;  3THK A;  3QKJ A;  3EFO A;  2SRC A;  4M77 D;  1WQW A;  1QVG A;  2QK0 A;  1MGQ A;  2HQE A;  2FO0 A;  2XU8 A;  1VQL A;  1VYT A;  5FWB A;  3F70 A;  4OGE A;  1ZSG A;  1ZSZ B;  2RJE A;  4JDS A;  1Y07 A;  1Q7Y C;  1N9S A;  1IB8 A;  1KIK A;  1I0C A;  3ULR B;  3CCM A;  4FYV B;  2VWF A;  1VQO T;  1WDX A;  2DNU A;  3MKD A;  5ECA A;  1PKS A;  4XTX A;  2QQA A;  3CCL Q;  3OQ5 A;  3RER A;  3EGX B;  3UDC A;  1TUC A;  2NYS A;  3M5A A;  1V29 B;  2IPO B;  5IXB A;  2X51 A;  2IIM A;  1JBM A;  4A53 A;  4ESR A;  2I2L A;  2HL3 A;  1KQ1 A;  2J6F A;  2RD1 A;  3T9N A;  3QZ5 B;  4JRK A;  4M7D C;  2LNH B;  3M0P A;  4BY6 B;  1WHG A;  4AFZ C;  5KH6 A;  3G7Z A;  1QCO A;  1QWE A;  3OB9 A;  3PVQ A;  3OSS C;  3JV3 A;  4A4H A;  3JB9 G;  3A5Z B;  2RMO A;  3L2Z A;  5CKD A;  3GIB A;  1V76 A;  1RAG B;  3ZL7 C;  3CCQ A;  4OMN A;  4RTT A;  2BZX A;  4J6W A;  4ZGD B;  1OU9 A;  3GNG A;  2W10 A;  4LE9 A;  4PJL A;  1ABO A;  3VU3 C;  2XDD A;  4M78 C;  2E12 A;  2YRC A;  1OZ2 A;  2CRE A;  1VQ4 Q;  2LQK A;  1QVF A;  4M7D A;  2E5Q A;  1UE9 A;  1Y0M A;  1WXU A;  3CXC P;  1ZA1 B;  1Y96 A;  2CP6 A;  1PNJ A;  4YTL A;  4C8Q C;  1M2V A;  1NLO C;  2YUQ A;  4LDW A;  2DX1 A;  4E7S A;  1O9S A;  2HZY A;  4J9F A;  1YBY A;  3BE3 A;  1DJ7 B;  3KUF A;  2ZPB B;  1M2O A;  5I22 A;  1ZSZ C;  1M27 C;  4IUR A;  4XU2 A;  2DRM A;  2FG0 A;  5KYY B;  2F5T X;  3JRZ A;  1YJN Q;  1MMA A;  3GOX A;  2DJZ A;  4IKF A;  1T0H A;  4M7A C;  3EG9 B;  4KUL A;  3NPF A;  3E9F A;  3CMA T;  4DEY A;  2COZ A;  2NLU A;  1G3S A;  1X6O A;  2ZZD A;  4QKU A;  2XG8 D;  4M78 B;  2KRM A;  1PWT A;  2CS7 A;  1SHF A;  3EG3 A;  4IUQ A;  1WQ7 A;  1ZSZ A;  3MCA B;  3UPU A;  1VQK T;  4F14 A;  4JLI A;  3REB B;  4KRT A;  3RR6 A;  2E64 A;  4JUV A;  4PJO A;  3X24 B;  4PJO E;  3QDR B;  1RAA B;  4XQ3 A;  1WA7 A;  5LJ3 j;  3L1A A;  2EKO A;  4PK4 A;  4A4E A;  3OW2 S;  4GBQ A;  5FU6 C;  2D6F A;  4OB2 B;  4F7U E;  1YI2 Q;  3V7R A;  2OI3 A;  2R58 A;  2QXF A;  2X4W A;  4EDU A;  4AFU C;  2ZPH B;  2P0K A;  3KXT A;  4BI8 B;  2JS2 A;  3G6E A;  3PVL A;  4R56 A;  2AHJ B;  3CMA Q;  3VRZ A;  4RTW A;  4FYW B;  3VS4 A;  1RAB B;  2KR3 A;  1WNL A;  1BCM A;  2GGR A;  1ZHI A;  2DYB A;  2QG9 B;  3RIR A;  5LJ3 e;  1VQ8 Q;  4ZN1 A;  2K2M A;  1VIF A;  1QCN A;  1VQ5 A;  3QHS A;  2HEQ A;  2E3I A;  2O2O A;  1K73 C;  1X2Q A;  2CP0 A;  4AG1 C;  1YJW T;  5LJ5 d;  1AWO A;  1PKT A;  2GFA A;  2LJ3 A;  3E19 A;  2DK3 A;  1RUW A;  1BI1 A;  2LQ8 A;  2C0I A;  4OF1 A;  1KHI A;  4BY6 C;  4KGX B;  7AT1 B;  1QP2 A;  2KT1 A;  2RB6 A;  5FRO A;  1QP3 A;  3D7S B;  1VA7 A;  2ZPI B;  4BD3 A;  2LCC A;  1SRL A;  1RI0 A;  3I5R A;  2C0O A;  2D1X A;  4II1 A;  1ZX6 A;  1KC8 R;  1HXD A;  2GTO A;  3NFC A;  1VQM A;  4N0A A;  4QVZ A;  4AT1 B;  3GPL A;  5HY6 A;  1OU8 A;  5LJ5 f;  5L23 A;  4M7A G;  4O6J A;  2CYZ B;  1X2K A;  2YUN A;  2A08 A;  1AZE A;  1M1G A;  3WXM B;  1JJ2 P;  5GAN 2;  3DB4 A;  3CCR T;  2E6N A;  2RI5 A;  1AWX A;  1WHH A;  3MP1 A;  5IT9 E;  3SEM A;  4XK8 E;  1Q81 C;  4RUG A;  4IUV A;  2O4X A;  1XJW B;  1AD5 A;  1M4Z A;  2LX9 A;  4AMC A;  1Q86 C;  1KD1 R;  5GJV B;  2QA4 Q;  4OMQ A;  2VC8 A;  3OYY A;  4OB0 B;  3SWN B;  4HA8 A;  4AFQ C;  1H8K A;  2FPF A;  1KJW A;  4EMK B;  2F2X A;  4J9G A;  1XQH A;  1YJN A;  3M59 A;  1SG5 A;  2DFU A;  2KK4 A;  1P92 A;  1GXI E;  5GAM f;  1D09 B;  4AFS C;  3N5B B;  4BE2 A;  2WSC E;  1R8O B;  1JU5 C;  4PJM A;  4M7D F;  4KGV B;  2OTL A;  3QUI A;  3VS5 A;  1S72 T;  5J3B A;  1B07 A;  1N8R C;  2YHT A;  4X1V A;  4RCB A;  4EPC A;  1D3B A;  1LVK A;  1KQS A;  1BK2 A;  4PFO A;  1E7O A;  4F7U F;  4C8Q D;  2XDP A;  1W70 A;  3A8M B;  4MMK A;  2YLC A;  1M90 C;  1M8M A;  3JB9 J;  2GTJ A;  4LNP A;  4E7L A;  2DLP A;  4J7I A;  2VKN A;  3NGP A;  4LN2 A;  1M90 U;  1RAD B;  3VS1 A;  1C1A A;  2QTV A;  5GAM d;  3CCJ A;  1XTD A;  2LT4 A;  2QDL A;  2EKH A;  2HCK A;  2QQS A;  4M7D E;  3SWN C;  2HQH A;  2ROL A;  1VQP T;  4JS5 A;  1IO6 A;  3V7C A;  1SEM A;  4M78 A;  1HK9 A;  2V8J A;  3CCV A;  4JRP A;  1RL2 A;  1WGS A;  1VQ6 Q;  2LRQ A;  2DF6 A;  2PUO B;  1IZ6 A;  3RMQ A;  3CCJ T;  3NHN A;  4F17 A;  2RJD A;  3LH5 A;  2O9S A;  1LJO A;  3CCE A;  4Z88 A;  4HT9 A;  3VRY A;  1YJ9 A;  2P0P A;  5GMK i;  5KYU A;  5DY9 A;  3PE0 A;  1M1F A;  2K3B A;  1VQ9 T;  2JN0 A;  3R6N A;  1JO8 A;  2PUK B;  1YIJ T;  4R55 A;  3CXC A;  1QVG P;  2BTT A;  2AK5 A;  3QYH B;  3OYH A;  4PFZ A;  4DBR A;  1SRM A;  5KYY A;  2JXB A;  1SF9 A;  4MZT A;  1MMN A;  1Y96 B;  2E65 A;  3PFS A;  2PNI A;  3CC4 A;  4Z02 A;  4Z8A A;  4PLI A;  1YN8 A;  1N6A A;  1NPP A;  1G5V A;  3G71 A;  2QTX A;  1MV3 A;  4FL6 A;  2DEU A;  1UUE A;  5GAN 3;  2EGC A;  4N4G A;  3TU4 K;  1M5Q 1;  3EG1 A;  1OI1 A;  3CPF A;  3DKM A;  4DQ2 A;  2HNI A;  2JW4 A;  1TWB A;  4M75 G;  4ANJ A;  4P5N A;  4C5H A;  3JCM W;  2C06 A;  1YHQ T;  3OS5 A;  2RO0 A;  3KFV A;  4QW2 A;  4ZTF A;  1MMD A;  2BZ8 A;  2ESW A;  1BBZ A;  2M16 A;  4C5E A;  3CC4 Q;  4M77 F;  4EMK C;  3CCL T;  2PVO B;  3AHU A;  1KK7 A;  2EQJ A;  1GL5 A;  2A3L A;  2P4T A;  3OYF A;  4F7U B;  2E70 A;  1RAC B;  2F5K A;  4PLL A;  1IGQ A;  1ZBJ A;  2NUP B;  4FSS A;  4AG2 C;  4CC2 A;  1Q86 R;  2P0Q A;  4WTO B;  1ZUY A;  2L3S A;  5CVI A;  1WPY A;  2KXC A;  5LJ5 g;  3M0T A;  3M4G A;  4XU1 A;  1ABQ A;  2KBT A;  3PMT A;  2ZAE A;  5AYF A;  4B9X A;  2LDM A;  1K0X A;  2AKL A;  4C92 G;  5IH2 A;  3CC7 A;  3A8L B;  3UT1 A;  4JRQ A;  5D6W A;  4F7U G;  1QVG S;  4E7H A;  3KBG A;  2LJ1 A;  2XD0 A;  4DBH A;  1U8R A;  1D0Z A;  3E2U A;  3EGD A;  1Q82 R;  4J6X A;  4L59 A;  3GF5 A;  2RHI A;  1WJR A;  1M1K U;  3OMC A;  3OYI A;  2YLB A;  2GQI A;  3LWI A;  3UWN A;  5GMK j;  1AHJ B;  2OX7 A;  3VS3 A;  1M3B A;  3HHT B;  2O88 A;  1TG0 A;  4HCZ A;  1I07 A;  3ZFJ A;  4RTZ A;  3INZ A;  3OW2 P;  5DM7 R;  4OGC A;  2KSS A;  1I5O B;  4QVC A;  3VS2 A;  1HYO A;  4D6W A;  1OOT A;  1A0N B;  1UB4 A;  2VXF A;  4JJB A;  4Q5W A;  2YSQ A;  3FB9 A;  4M75 D;  4D8K A;  1VQO Q;  2K3X A;  2AT1 B;  3BFM A;  5AT1 B;  3H0I A;  2CGH A;  1G83 A;  1K8A C;  3OY9 A;  2QEX A;  1NJI R;  3EFR A;  1M8V A;  1WIE A;  2GNC A;  1K8A U;  1RI9 A;  2M9U A;  1H3H A;  1C0M A;  5KYX A;  3QXE B;  4JJD A;  3RBB B;  1U5S A;  2VV5 A;  4C8Q B;  1VQP A;  2DBM A;  3FJP A;  2OTJ A;  5GAM h;  2DIG A;  3JCM V;  3M54 A;  2LX7 A;  4OB3 B;  3X25 B;  5GAN h;  5GAO p;  2QEX T;  4ZN3 A;  3E9G A;  2BKD N;  3P8H A;  2VB6 A;  2JNG A;  4NOY A;  4RTY A;  5LJ3 h;  4FW1 A;  3M0S A;  3CPW A;  3EGD B;  2BE7 D;  2OTJ Q;  4JS4 A;  3M0U A;  3TSW A;  3SB2 A;  2QAZ A;  1M1K R;  2CUD A;  1X6B A;  4JJC A;  4C92 F;  1YJ9 Q;  1PRL C;  1K4U S;  1NLP C;  5CKE A;  1FMV A;  3OYC A;  5CO7 A;  2EJ9 A;  4FYX B;  3QZ9 B;  3CCU A;  4JRI A;  4E7K A;  1X01 A;  2V26 A;  3Q1J A;  1UDL A;  2QQB A;  4Y28 E;  2V8I A;  3SDZ A;  2KVQ G;  3FIF A;  1ZA2 B;  1VQ7 T;  5IXF A;  2RH2 A;  1XOV A;  2YT6 A;  4Z89 A;  1OPL A;  3MJX A;  2KI7 A;  1PSE A;  3MO8 A;  2GFU A;  4ZGE B;  4HVW A;  3DLM A;  5A0G A;  4E47 A;  4FT4 A;  2F1L A;  5FWC A;  4IIO A;  5HCK A;  2H3E B;  3QPH A;  1WJS A;  3JB9 D;  2K5F A;  5GMK h;  2LQN A;  3I9Q A;  4KGZ B;  2DBK A;  1U3O A;  5GAM e;  2LZ6 B;  2OTL Q;  3VS0 A;  4C8Q G;  2LC4 A;  2FPD A;  1JB0 E;  2LT1 A;  4ELZ C;  3REA B;  1D1A A;  1AEY A;  5EG2 A;  5GMK l;  4C0G A;  5C0M A;  3QJ6 A;  5D7U A;  1S1N A;  2YRD A;  1T3L A;  4C92 B;  2DJQ A;  2CZ7 B;  4C0D C;  2JVV A;  1WHM A;  1NEG A;  1PD1 A;  4E7Z A;  2DZC A;  3FEO A;  3RES A;  2MWO A;  2AKK A;  3ZEH A;  1Q81 R;  4M7A F;  1N8R R;  2RQU A;  1X6G A;  3PT9 A;  2QAS A;  3LWH A;  4PJO B;  4M77 G;  4J9E A;  3I55 T;  1UFF A;  5A0D A;  1UHF A;  4J83 A;  4HCK A;  5J39 A;  2IVW A;  1N5Z A;  2YXY A;  3A8H B;  5GAN j;  3PTA A;  4M75 F;  4M77 E;  2O4X B;  3RMS A;  1K1Z A;  1TTH B;  4IUP A;  1IXD A;  1UJ0 A;  3JCM d;  2KEA A;  1WJQ A;  2BIV A;  1OEB A;  1YCY A;  1WZO A;  3HL8 A;  2EYY A;  2CP5 A;  3C95 A;  3ZBD A;  2PQW A;  1RLP C;  4RKU E;  3J80 E;  3I5S A;  3G4S T;  3NTI A;  2ATC B;  5HK0 A;  3MEU A;  1VQ7 Q;  5I11 A;  1V1C A;  1O75 A;  4M75 E;  1KC8 U;  3EFS A;  1K0S A;  3V8K A;  3X28 B;  2RA2 A;  1BI2 A;  2RNA A;  3UA6 A;  5KYW A;  2ED1 A;  1T3S A;  1GBQ A;  2CZ6 B;  3JCM X;  2EYX A;  5CR2 A;  2L0A A;  1VQN T;  1ZUK A;  1X75 C;  3P8D A;  3H9N A;  5KYX B;  1EX4 A;  2GBQ A;  4IIM A;  2E3H A;  5FU7 C;  2ZGW A;  4M7D B;  1EIF A;  4C0D B;  2MF2 A;  5CAI A;  3NTH A;  2QA4 T;  2KRN A;  2YUP A;  2BE9 B;  5GAO q;  3RKW A;  4FYY B;  3FRN A;  1UEB A;  1QW1 A;  2ROT A;  2LCL A;  2EGE A;  2KNB B;  3TEE A;  3JCM b;  4XTW A;  2DTI A;  4NS5 A;  2FRW A;  3URG A;  1QLY A;  2YWW A;  4XU0 A;  4ME7 A;  2RN8 A;  1NYG A;  3CEY A;  4QQ6 A;  2HBP A;  4D8D A;  4ZTJ A;  2ABL A;  4O5V A;  2KXD A;  3CD6 T;  4LDU A;  1IHW A;  1G2B A;  2RHU A;  4M77 B;  2KAF A;  1VQN Q;  2JTE A;  2V1R A;  4B6M A;  2PVG B;  1VQP Q;  2J6O A;  4N0A C;  1VQL Q;  4C5I A;  2L3P A;  3M58 A;  1WXT A;  1PM3 A;  4RG2 A;  3OYA A;  4R0K A;  1VIE A;  5IHK A;  3VS7 A;  2X4J A;  2X4Y A;  4QQG A;  1YIT T;  2MMP A;  2LQW A;  4LD9 K;  3ME9 A;  2JM8 A;  5C6S A;  1W6X A;  4M75 B;  2A37 A;  1KD1 U;  1Y71 A;  1Z9Q A;  3LLR A;  4E7J A;  3FJ5 A;  2DTH A;  1BIA A;  2PU9 B;  4XTZ A;  3CQT A;  3A8G B;  2OAU A;  1WX6 A;  5GAN 6;  2COY A;  3CXC S;  3EH2 A;  2HMA A;  2PTK A;  4FM4 B;  4OML A;  4MDX A;  1PC0 A;  2O31 A;  3CCR A;  2HDA A;  3OW2 A;  1AT1 B;  1W2B P;  3PGG A;  5GAO l;  2BUD A;  5L8R E;  4E6R A;  1MV0 B;  1K9M U;  2K2V A;  4C8Q A;  3I55 Q;  2KDS A;  3TVT A;  2J05 A;  1JQQ A;  2MAM A;  2EIF A;  3C4S A;  5LJ3 f;  3CC7 Q;  4IUT A;  1QCF A;  5A0L A;  1W1F A;  5DLQ E;  2GF7 A;  1VQ4 A;  2EQK A;  5KYN A;  4E7I A;  1JXM A;  2EAY A;  1Y7X A;  8AT1 B;  1KHC A;  1YJN T;  3U23 A;  5A2Q E;  1ZQ1 A;  3OSV A;  4XTV A;  2RPN A;  2M02 A;  5EC7 A;  2DD4 A;  3CBO A;  1Q81 U;  5CK9 A;  1Q95 G;  2FVU A;  1K9M C;  3BDU A;  3CC2 Q;  3RUX A;  2HQX A;  1H3Z A;  3QDF A;  1YHQ A;  1ARK A;  2MPX C;  3CME A;  2HL5 C;  4L5G A;  2HKN A;  1RAH B;  1VQ7 A;  4HCB A;  2DPP B;  2MWP A;  4ATO A;  4DBF A;  2JUF A;  5CCA A;  2XIC A;  2SEM A;  2A7Y A;  2MOX A;  1AOJ A;  5J26 A;  3CCV Q;  3OA6 A;  1SHG A;  3PNW C;  5CIU A;  3CCQ Q;  2CP2 A;  3I35 A;  1VQL T;  2FYK A;  3R6O A;  1W4S A;  2MIO A;  3QII A;  3RDV A;  1IRE B;  2E10 A;  1FWZ A;  4J6Y A;  1Q7Y R;  1OQK A;  1Q82 U;  4C0Z A;  3PMI A;  4LUE A;  3M0R A;  1YHQ Q;  4ZNX A;  2P84 A;  4J9I A;  2MCN A;  3RKX A;  4N4I A;  5LL6 S;  2KGT A;  1F1B B;  1WLP B;  4C92 D;  3OYD A;  1VQM T;  1N8R U;  1W2B S;  4NL2 A;  1UGR B;  4PFP A;  3VS6 A;  3JB9 H;  3V7S A;  2RJC A;  1SKU B;  4QT7 A;  2PVD B;  2COW A;  1NPR A;  2XID A;  1IRX A;  3OYM A;  3HRS A;  1QMC A;  4FT2 A;  3HTR A;  3VV0 A;  4A4K A;  2RHZ A;  1PHT A;  3M53 A;  2FZK B;  2HBW A;  1PCX A;  1VQ5 T;  3H0H A;  5I21 A;  2KY9 A;  2K4Y A;  3OMG A;  3M56 A;  4PJJ A;  4M7A A;  4BB7 A;  1SSH A;  2F69 A;  4LDV A;  1VQ9 A;  2C0T A;  2KE9 A;  3L2V A;  1YNZ A;  1VYV A;  2LJ0 A;  2RF0 A;  5IHI A;  4VUB A;  3VJP A;  1M2V B;  3GBQ A;  4DA4 A;  4L6V 5;  2VVK A;  4LXC A;  8ATC B;  3C94 A;  2QEX Q;  2XMF A;  5M9O A;  2ED0 A;  1AWW A;  3I56 T;  5GAO r;  4HVU A;  4E2F B;  3HP9 A;  3C12 A;  5GAN 5;  5FLX E;  3AT1 B;  1R0C B;  1BU1 A;  1VQ8 T;  3HFO A;  2FPE A;  1NZ9 A;  3OYE A;  3O8V A;  5CKH A;  2R5A A;  4PJO C;  3MP8 A;  2OTL T;  1HD3 A;  1YI2 A;  3FLG A;  1AVZ C;  2DXT A;  4FW2 A;  4ORZ A;  2PZ1 A;  5GAO m;  1M9S A;  1PRM C;  4C8Q F;  1FX7 A;  3MHX A;  1QVP A;  4FU6 A;  3OS1 A;  2DEQ A;  5HKC A;  2DXC A;  2B86 A;  2DYI A;  4BI3 A;  4BDZ A;  2WSF E;  2JZ2 A;  1KSW A;  4OMO A;  2Y4Y A;  2OTJ T;  2CZ1 B;  4M78 F;  4HT8 A;  1UGV A;  4HXJ A;  1PD0 A;  1QKX A;  4CC7 A;  2LCS A;  1GCQ C;  3JCM c;  2H3J A;  4A4F A;  3JB9 I;  1GFD A;  2LP5 A;  5HK3 A;  1TXQ A;  3QSU A;  1E6H A;  3CBM A;  4KT0 E;  3FDR A;  4C5G A;  3IQL A;  4OMM A;  1B7T A;  2DO3 A;  2O9V A;  2KMT A;  3QWY A;  2NUT A;  1EFN A;  2R57 A;  3JAM E;  3CCS A;  1YIT Q;  2YDL A;  3JCM e;  2MI6 A;  4QQD A;  1K73 U;  1MUZ A;  4TVR A;  2XKO C;  2CH4 A;  4BE1 A;  3JB9 F;  4K11 A;  4OVA A;  5FU7 B;  1U1S A;  4OMP A;  3G6E T;  4C0F A;  4GLM A;  3M4Y A;  1FYN A;  2DKG A;  3OYB A;  1BIB A;  1YIJ Q;  5KCH A;  1T0J A;  4BE0 A;  3I56 Q;  2VGM A;  5CKF A;  4EMG A;  1NG2 A;  4MZP A;  4HCC A;  5KCO A;  2DXU A;  1BI0 A;  2CH4 W;  2CP7 A;  2EYW A;  9ATC B;  4A4G A;  3L2Q A;  1YJW Q;  5GAN 7;  3JCM J;  1TSF A;  2H8H A;  3M57 A;  4FIB A;  1H92 A;  1I4K 1;  1WHJ A;  2LNV A;  5GJW B;  2JS0 A;  1VQK Q;  2L89 A;  3EHR A;  1BB9 A;  3UA7 A;  3RNJ A;  2DRK A;  1EZZ B;  3MPU B;  3CPW S;  1JXO A;  1G3T A;  2KYM A;  4IUU A;  2RK2 A;  2XK0 A;  2DL5 A;  1CKA A;  3GNF B;  3CCV T;  1Q7Y U;  4KUI A;  2RI2 A;  4KBM B;  2DAQ A;  2XHC A;  2DMO A;  1NJI C;  2LTO A;  3A1P A;  1U1T A;  2JM9 A;  4BDY A;  1K8A R;  2P4R A;  3TSZ A;  2QQR A;  1GRI A;  5FRM A;  1YCS B;  3X26 B;  3G1J A;  2ECZ A;  2EGA A;  1D3B B;  1D0X A;  2FHD A;  4M75 C;  4QVD A;  1VYU A;  4J5Y A;  1UG1 A;  2A0F B;  1JJ2 A;  3CMA A;  5CKB A;  3HFN A;  3E1S A;  3CCE Q;  4J7F A;  2CSQ A;  2DVE A;  5LJ5 j;  1R77 A;  1IGU A;  1S72 Q;  1NBE B;  2L3R A;  1JEG A;  3H6Z A;  3TQ7 P;  1TH7 A;  3PIO A;  3CCQ T;  1VQ6 T;  2X9H A;  3QBY A;  1W2B A;  1U06 A;  2DTO A;  3G6E Q;  2Y90 A;  1VQ5 Q;  4RTX A;  4CC4 B;  5IN1 A;  3LW5 E;  3QYG B;  2RK1 A;  2EQU A;  3EG2 A;  3CCU Q;  4M78 G;  2HKQ B;  1KFZ A;  2I0N A;  3OYJ A;  3GLX A;  3S3O A;  3LGL A;  2M0O A;  3EHQ A;  2Z0W A;  1VQO A;  4RMO A;  5LJ5 e;  4BAC A;  4CC3 A;  1QQJ A;  2EJF A;  4KH0 B;  3FC3 A;  1VOM A;  3HSB A;  2WAC A;  3G71 Q;  2E6Z A;  5GAN 8;  3L2R A;  1M3C A;  5GAN d;  3QG1 A;  2OJ2 A;  2J6K A;  5LJ3 d;  1S72 A;  2YRV A;  1TUG B;  2FEI A;  3JSC A;  4JLG A;  1D1B A;  4ELY C;  4GLK A;  1UTI A;  1Z9Z A;  1UEC A;  4M78 E;  3CCL A;  1M3A A;  1MMG A;  5I2S A;  1HSQ A;  2M0Y A;  2JT4 A;  1K9A A;  4KUD K;  1BI3 A;  1I5L A;  4LDX A;  1G8X A;  5GAN f;  1H64 1;  1VQ8 A;  2CSI A;  3I55 A;  1MHN A;  4PJO D;  1YWP A;  4C8Q E;  1VQN A;  2JMC A;  1BYM A;  3M0Q A;  2ZPF B;  4B9W A;  3P8B B;  4LDY A;  3RKY A;  5CQY A;  1QVF S;  2E1H A;  2QGG A;  2XI9 A;  4JPB W;  2FRY A;  4J9D A;  2D0Q B;  2QA4 A;  4DEX A;  1KQS S;  2HSE B;  4HVV A;  2DL7 A;  1UJY A;  1KQS P;  5D6Y A;  2DM1 A;  2KRS A;  4PJO F;  3NTK A;  3C0C A;  1QKW A;  3MEV A;  4MZM A;  3MP6 A;  2G6F X;  2K7A A;  2JJ9 A;  3G71 T;  4MDW A;  3M9Q A;  2KT8 A;  2VGN A;  1N9R A;  1WFW A;  1FXX A;  1CSK A;  3CME Q;  1Q86 U;  1K73 R;  2EBP A;  3CPW P;  4J9C A;  4DBQ A;  3L42 A;  2CP3 A;  3QO3 A;  1NEB A;  4RTU A;  1UHC A;  1TUD A;  1X27 A;  4PKC C;  1B34 B;  5GAM g;  3S3N A;  4M7A B;  2RQV A;  1UGS B;  2M51 A;  2DXB A;  4V2S A;  3S3M A;  1NJI U;  2FL7 A;  3DB3 A;  1RAE B;  3EG0 A;  3CCS Q;  1YIT A;  3CCM Q;  2BZY A;  3EH1 A;  1K76 A;  1YI2 T;  3OS2 A;  2GCX A;  1AWJ A;  1LPL A;  2AZV A;  3HPW A;  4M4Z A;  4X34 A;  2ENM A;  1D0Y A;  2X35 A;  1X43 A;  4M75 A;  4JZ4 A;  1KQ2 A;  2JTM A;  4J8O A;  4NL3 A;  3OYN A;  2L2P A;  3H8Z A;  1ZBX A;  2RJF A;  3EFO B;  1GCQ A;  5GAM j;  3A98 A;  2F2V A;  4PJN A;  1E6G A;  3EG9 A;  2MYS A;  1B34 A;  3J81 E;  2EW3 A;  3LX7 A;  2L3Q A;  3JCM P;  2G3R A;  2K79 A;  3JCM f;  2X3X D;  5KE2 A;  2J06 A;  4JZ3 A;  2ZCF B;  3VYH B;  4M77 A;  2EWN A;  2W0Z A;  3ER0 A;  1PSF A;  1VUB A;  2HAX A;  2NUP A;  2IG0 A;  2QGF B;  1D1C A;  3LYI A;  4DOW A;  1OX8 A;  4A54 A;  1GBR A;  1OX9 A;  4F7U A;  1YFN A;  3BDL A;  2DL4 A;  1YWO A;  2OAW A;  2D9T A;  2DD5 A;  5D6X A;  3UAT A;  1I81 A;  5KYW B;  2M1H A;  4GY5 A;  3SHW A;  3UF4 A;  1N27 A;  1SPK A;  1G3Y A;  2JMA A;  4M77 C;  2E5K A;  2RM4 A;  2L5Q A;  4PJO G;  3HKS A;  5GAN e;  2JOY A;  2EQM A;  4FCY A;  3GP8 A;  1QVF P;  5DLO A;  1JRI A;  6AT1 B;  3CCM T;  5GMK m;  3LGF A;  1PG5 B;  2VUB A;  2X3W D;  2DVJ A;  5I2M A;  3CCU T;  1OV3 A;  3CC7 T;  1VQ6 A;  3TRE A;  4CRI A;  4DOV A;  2YUO A;  1Y57 A;  5KYU B;  2NWM A;  1YJ9 T;  3A8O B;  2KQW A;  1GFC A;  4EMH A;  3CD6 A;  1TOV A;  3DLL A;  1RLQ C;  3G4S Q;  4M7D D;  3QJY A;  3EGX A;  3MEA A;  4XTU A;  2FB7 A;  1RAI B;  2K5I A;  3L2U A;  1FMW A;  2V1Q A;  4Y92 A;  2E4H A;  4FSX A;  1WXB A;  2HD0 A;  3CCR Q;  4M78 D;  4X9D A;  1K9M R;  2D8J A;  4X9C A;  4M7A E;  1KG1 A;  3JCM g;  2LMJ A;  1TU0 B;  4KH1 B;  2QYZ A;  2VYT A;  4RCC A;  4HKE A;  1XNI A;  2K3Y A;  2V8K A;  2A28 A;  4XTY A;  4EIK A;  1UGP B;  3JCM Q;  4M7D G;  2Y4X A;  4N4H A;  3BY7 A;  1YP5 A;  3H0F A;  2CZ0 B;  4BUG A;  3OYL A;  2EYZ A;  2DER A;  2WSE E;  1NM7 A;  2QI2 A;  1I8F A;  1LCK A;  2EPD A;  1KD1 C;  3NMZ C;  4OB1 B;  1NE8 A;  5GAN 4;  3TCJ A;  3VUZ A;  3CCE T;  2QDY B;  1LNX A;  2RHY A;  4ZGJ B;  3BW1 A;  1M30 A;  3OYK A;  1HJD A;  5FU6 B;  2DE0 X;  2GQV A;  1UGQ B;  2DL8 A;  2RHX A;  5GMK e;  4WF2 A;  4MML A;  1I1J A;  4LD6 A;  1FMK A;  2KRO A;  3OBY A;  2RI3 A;  4XAX B;  3VKI A;  2EQI A;  1ACM B;  4XU3 A;  2JTF A;  1MND A;  4LUD A;  2ZPG B;  1VQK A;  3SWN A;  2D0N A;  1MNE A;  2K5L A;  4Y91 A;  3PIP A;  3CC4 T;  3CBP A;  2FZC B;  2X4X A;  1M1K C;  3VYG A;  2XDB A;  1AZG B;  2CT3 A;  2FZG B;  3EGU A;  3S6W A;  1BKB A;  4F16 A;  3QWX X;  5KE3 A;  1ZUU A;  4EMK A;  2EJG A;  1M90 R;  2DIQ A;  2R5M A;  4JJN K;  2B8A A;  3CC2 T;  4CI0 C;  1BCO A;  2DL3 A;  3I56 A;  2QQ9 A;  3HRT A;  4OMF B;  2DA9 A;  2AIR B;  3CCJ Q;  4UC4 A;  4M7A D;  2E41 A;  1WHK A;  5CQX A;  2K57 A;  4OP0 A;  1WHL A;  2MK5 A;  1GCP A;  1YIJ A;  3L2W A;  1NYF A;  2CT4 A;  2VAS A;  3V8J A;  4J9B A;  3ASK A;  3CC2 A;  2DET A;  1OPK A;  1SSF A;  2NUT B;  2O01 E;  2VXE A;  1ZLM A;  1OYX A;  1YJW A;  3WVD B;  4C92 E;  4C92 A;  2K6D A;  3LH0 A;  3SFM A;  2K9G A;  3O5Z A;  2J7I A;  3H41 A;  2D8H A;  5LJ3 g;  1OUL A;  3CD6 Q;  1LOJ A;  5FW9 A;  3JCM h; 
#chains in the Genus database with same CATH homology
 1HK9 A;  2V8J A;  3VUB A;  5IAY A;  3CCV A;  4JRP A;  1RL2 A;  1WGS A;  2CZ6 B;  2EYQ A;  2L3R A;  3M55 A;  3JCM X;  5GAM h;  3H6Z A;  5CR2 A;  1TH7 A;  2LRQ A;  2ZPE B;  3PIO A;  3CCQ T;  1VQ6 T;  2PUO B;  1VQN T;  3QBY A;  1IZ6 A;  3RMQ A;  1W2B A;  3WVE B;  3CCJ T;  1X75 C;  2DTO A;  3P8D A;  2Y90 A;  2RJD A;  1G3W A;  5IN1 A;  5FU7 C;  3LW5 E;  1LJO A;  2ZGW A;  3QYG B;  5LJ5 h;  2RK1 A;  4M7D B;  1EIF A;  2EQU A;  4M78 G;  3CCE A;  1Q82 C;  4C0D B;  2MF2 A;  5CAI A;  3NTH A;  2QA4 T;  4HT9 A;  4PL6 A;  4C92 C;  3GLX A;  2L8D A;  3OYG A;  3OYJ A;  3G4S A;  5GAO q;  3RKW A;  3S3O A;  3LGL A;  1YJ9 A;  2P0P A;  2M0O A;  3FRN A;  5GMK i;  3CCS T;  1VQ4 T;  1UEB A;  1VQO A;  1QW1 A;  4RMO A;  2LCL A;  5DY9 A;  3EAE A;  1M1F A;  5LJ5 e;  4BAC A;  3TEE A;  3JCM b;  4XTW A;  5FRN A;  2EJF A;  2DTI A;  4RG8 A;  1VQ9 T;  3HRU A;  4NS5 A;  2JN0 A;  3URG A;  3FC3 A;  1YIJ T;  2PUK B;  4BI4 A;  4R55 A;  3CXC A;  3HSB A;  1OZ3 A;  2WAC A;  4XU0 A;  4ME7 A;  2E6Z A;  5GAN 8;  3L2R A;  4PNO A;  3CEY A;  2LVM A;  3QG1 A;  3QYH B;  4QQ6 A;  5LJ3 d;  2HBP A;  5GAN d;  3OYH A;  1S72 A;  4ZTJ A;  2YRV A;  4O5V A;  2DZ9 A;  3SD4 A;  3JSC A;  3CD6 T;  4JLG A;  4LDU A;  4ELY C;  2RHU A;  4M77 B;  2E65 A;  1Y96 B;  4MZT A;  4GLK A;  2KAF A;  3PFS A;  3CC4 A;  4Z02 A;  2CKK A;  3MET A;  4PLI A;  3OS0 A;  1KC8 C;  3CME T;  1JJ2 S;  2PVG B;  1N6A A;  4M78 E;  1NPP A;  4N0A C;  3CCL A;  4C5I A;  3M58 A;  3X20 B;  1G5V A;  3V8L A;  3MEW A;  5GAO n;  5I2S A;  3G71 A;  3OBW A;  5GAN g;  2QTX A;  4RG2 A;  4KUD K;  3OYA A;  2EFI A;  1BI3 A;  1VIE A;  1I5L A;  4FL6 A;  4LDX A;  3J7A F;  5GAN 3;  2X4J A;  2X4Y A;  4N4G A;  4QQG A;  5GAN f;  3QKJ A;  3TU4 K;  1H64 1;  1M5Q 1;  1YIT T;  1VQ8 A;  1OI1 A;  2MMP A;  3CPF A;  3DKM A;  4M77 D;  1WQW A;  1MHN A;  4DQ2 A;  3ME9 A;  3I55 A;  4LD9 K;  4PJO D;  4C8Q E;  2HNI A;  4M7A D;  1QVG A;  1VQN A;  5C6S A;  1BYM A;  2ZPF B;  4B9W A;  1MGQ A;  2HQE A;  3P8B B;  4M75 G;  4LDY A;  2XU8 A;  4M75 B;  4P5N A;  3RKY A;  5CQY A;  4C5H A;  3JCM W;  1Y71 A;  1KD1 U;  1VQL A;  1QVF S;  2E1H A;  2C06 A;  3F70 A;  1YHQ T;  4OGE A;  3LLR A;  4E7J A;  2XI9 A;  3OS5 A;  2RO0 A;  2RJE A;  4QW2 A;  4ZTF A;  4JDS A;  1Y07 A;  1Q7Y C;  2QA4 A;  2D0Q B;  1N9S A;  2DTH A;  1BIA A;  2PU9 B;  1KQS S;  4XTZ A;  2M16 A;  3A8G B;  2OAU A;  5D6Y A;  4C5E A;  3CCM A;  4M77 F;  4EMK C;  1VQO T;  5GAN 6;  4PJO F;  3CCL T;  3NTK A;  2PVO B;  3AHU A;  3CXC S;  3MEV A;  2QQA A;  4MZM A;  3OQ5 A;  4XTX A;  3RER A;  2EQJ A;  3MP6 A;  3G71 T;  2A3L A;  4MDW A;  4FM4 B;  3UDC A;  4MDX A;  2P4T A;  3M5A A;  1V29 B;  4F7U B;  2E70 A;  3OYF A;  3CCR A;  3M9Q A;  3OW2 A;  3PGG A;  2VGN A;  1N9R A;  1FXX A;  1JBM A;  4A53 A;  5GAO l;  2BUD A;  2F5K A;  4PLL A;  1Q86 U;  2I2L A;  5L8R E;  1KQ1 A;  2RD1 A;  3T9N A;  1K9M U;  2K2V A;  4C8Q A;  3QZ5 B;  3L42 A;  2KDS A;  4JRK A;  4M7D C;  3QO3 A;  4BY6 B;  2MAM A;  5KH6 A;  2EIF A;  3C4S A;  5LJ3 f;  2P0Q A;  3G7Z A;  3OB9 A;  4IUT A;  5CVI A;  5A0L A;  1WPY A;  3OSS C;  5DLQ E;  2GF7 A;  5LJ5 g;  4PKC C;  4A4H A;  3JB9 G;  2EQK A;  3A5Z B;  1B34 B;  3M4G A;  4XU1 A;  5GAM g;  3S3N A;  4M7A B;  4E7I A;  1UGS B;  2EAY A;  3L2Z A;  3PMT A;  1Y7X A;  5AYF A;  5CKD A;  3GIB A;  2DXB A;  4B9X A;  4V2S A;  1KHC A;  2LDM A;  3S3M A;  3CCQ A;  1YJN T;  1NJI U;  4J6W A;  5A2Q E;  2FL7 A;  3DB3 A;  4ZGD B;  1ZQ1 A;  1YIT A;  3OSV A;  3GNG A;  4XTV A;  4C92 G;  3VU3 C;  1YI2 T;  2DD4 A;  3CBO A;  2XDD A;  3A8L B;  4M78 C;  3UT1 A;  2GCX A;  3OS2 A;  3CC7 A;  1Q81 U;  5CK9 A;  2E12 A;  4JRQ A;  2FVU A;  1OZ2 A;  5D6W A;  4F7U G;  1QVG S;  1K9M C;  4E7H A;  3BDU A;  3HPW A;  3KBG A;  2HQX A;  3RUX A;  2XD0 A;  4X34 A;  2LQK A;  1U8R A;  1QVF A;  1H3Z A;  1YHQ A;  4M7D A;  3CME A;  2X35 A;  2E5Q A;  4M75 A;  4L5G A;  1KQ2 A;  1VQ7 A;  2JTM A;  4J8O A;  1Y96 A;  4NL3 A;  3OYN A;  4J6X A;  4L59 A;  3H8Z A;  4YTL A;  4C8Q C;  1ZBX A;  4HCB A;  3GF5 A;  2RHI A;  2DPP B;  2RJF A;  2MWP A;  1WJR A;  4ATO A;  5GAM j;  1M1K U;  3OMC A;  3OYI A;  2JUF A;  2YLB A;  4LDW A;  5CCA A;  1O9S A;  2XIC A;  3UWN A;  3LWI A;  2A7Y A;  5J26 A;  5GMK j;  1AHJ B;  1B34 A;  3OA6 A;  1VQ4 A;  3J81 E;  1YBY A;  3PNW C;  5CIU A;  1DJ7 B;  3LX7 A;  3HHT B;  3KUF A;  3JCM P;  2ZPB B;  4HCZ A;  2G3R A;  3ZFJ A;  1VQL T;  3JCM f;  2FYK A;  3INZ A;  1W4S A;  3R6O A;  5KE2 A;  5DM7 R;  3QII A;  4IUR A;  4OGC A;  2ZCF B;  4XU2 A;  1IRE B;  2E10 A;  2KSS A;  4M77 A;  1FWZ A;  2EWN A;  3VYH B;  4QVC A;  2F5T X;  3JRZ A;  4J6Y A;  3ER0 A;  1PSF A;  4D6W A;  1VUB A;  1Q82 U;  2HAX A;  4C0Z A;  2IG0 A;  3GOX A;  3PMI A;  2DJZ A;  4IKF A;  1UB4 A;  3LYI A;  4DOW A;  4M7A C;  4A54 A;  4F7U A;  2VXF A;  4KUL A;  4Q5W A;  3BDL A;  3E9F A;  3FB9 A;  3CMA T;  4M75 D;  2NLU A;  2D9T A;  2DD5 A;  1G3S A;  3RKX A;  2K3X A;  4N4I A;  3BFM A;  5LL6 S;  1X6O A;  5D6X A;  2ZZD A;  2CGH A;  4C92 D;  1I81 A;  3OYD A;  1VQM T;  1K8A C;  2XG8 D;  3OY9 A;  4M78 B;  2QEX A;  1N8R U;  2M1H A;  4GY5 A;  3EFR A;  1W2B S;  2CS7 A;  4NL2 A;  1UGR B;  1M8V A;  4IUQ A;  3JB9 H;  3V7S A;  1WQ7 A;  1K8A U;  2RJC A;  3MCA B;  1N27 A;  3UPU A;  1VQK T;  2M9U A;  2PVD B;  1G3Y A;  1NPR A;  4M77 C;  2XID A;  3OYM A;  3HRS A;  4JLI A;  4FT2 A;  2RM4 A;  2L5Q A;  4PJO G;  2E64 A;  3HKS A;  4JUV A;  3QXE B;  3VV0 A;  5GAN e;  4A4K A;  2JOY A;  2EQM A;  2RHZ A;  4C8Q B;  2VV5 A;  4PJO A;  3X24 B;  3M53 A;  3GP8 A;  4PJO E;  5DLO A;  3QDR B;  1VQP A;  3FJP A;  1JRI A;  4XQ3 A;  1VQ5 T;  5LJ3 j;  3CCM T;  2OTJ A;  3L1A A;  2EKO A;  5GMK m;  2DIG A;  3LGF A;  3M54 A;  3JCM V;  2VUB A;  5FU6 C;  4OB3 B;  4A4E A;  5I21 A;  3OW2 S;  4OB2 B;  3X25 B;  4F7U E;  2D6F A;  5I2M A;  3V7R A;  3CCU T;  2KY9 A;  2K4Y A;  2R58 A;  3OMG A;  3M56 A;  5GAN h;  2QXF A;  5GAO p;  2QEX T;  4BB7 A;  2X4W A;  4M7A A;  2F69 A;  4EDU A;  4LDV A;  3CC7 T;  4ZN3 A;  1VQ9 A;  3E9G A;  2BKD N;  3L2V A;  1VQ6 A;  3P8H A;  3TRE A;  2ZPH B;  4VUB A;  3VJP A;  2P0K A;  4CRI A;  4DOV A;  4DA4 A;  3KXT A;  4L6V 5;  4BI8 B;  2JNG A;  4NOY A;  3G6E A;  4R56 A;  5LJ3 h;  1YJ9 T;  2AHJ B;  3CPW A;  3A8O B;  2KQW A;  3C94 A;  4EMH A;  5M9O A;  3CD6 A;  3I56 T;  5GAO r;  4JS4 A;  1WNL A;  3HP9 A;  3DLL A;  3SB2 A;  3C12 A;  5GAN 5;  1ZHI A;  4M7D D;  3RIR A;  5FLX E;  5LJ3 e;  4C92 F;  3QJY A;  3MEA A;  4XTU A;  1VQ8 T;  3HFO A;  2FB7 A;  4ZN1 A;  1NZ9 A;  1VIF A;  5CKE A;  2K5I A;  3L2U A;  3OYE A;  3O8V A;  5CKH A;  1VQ5 A;  2R5A A;  3QHS A;  4PJO C;  3MP8 A;  3OYC A;  1K73 C;  5CO7 A;  2EJ9 A;  2OTL T;  4FSX A;  1YJW T;  2HD0 A;  3QZ9 B;  3CCU A;  4M78 D;  5LJ5 d;  4X9D A;  4JRI A;  1YI2 A;  4X9C A;  3FLG A;  4E7K A;  4M7A E;  1KG1 A;  1X01 A;  3JCM g;  2DXT A;  2GFA A;  2DK3 A;  3E19 A;  5GAO m;  1M9S A;  4C8Q F;  1BI1 A;  1FX7 A;  3Q1J A;  2LQ8 A;  3MHX A;  2QQB A;  4OF1 A;  1QVP A;  1KHI A;  4FU6 A;  4Y28 E;  4BY6 C;  2V8I A;  1QP2 A;  2RB6 A;  3OS1 A;  2DEQ A;  3SDZ A;  2VYT A;  5FRO A;  5HKC A;  2DXC A;  1QP3 A;  4HKE A;  4RCC A;  1XNI A;  2K3Y A;  2KVQ G;  2V8K A;  3FIF A;  4BI3 A;  4BDZ A;  2WSF E;  1VQ7 T;  2JZ2 A;  2ZPI B;  4BD3 A;  4XTY A;  1UGP B;  3JCM Q;  4M7D G;  2Y4X A;  2LCC A;  2RH2 A;  4N4H A;  2Y4Y A;  3BY7 A;  1XOV A;  2OTJ T;  2CZ1 B;  4M78 F;  2CZ0 B;  1RI0 A;  4HT8 A;  4II1 A;  4BUG A;  1HXD A;  3OYL A;  3NFC A;  1VQM A;  1PSE A;  3MO8 A;  3JCM c;  2GFU A;  2H3J A;  4A4F A;  2WSE E;  2QI2 A;  4N0A A;  3JB9 I;  4QVZ A;  4ZGE B;  3DLM A;  5A0G A;  4E47 A;  1I8F A;  4FT4 A;  5HK3 A;  3GPL A;  5HY6 A;  1KD1 C;  5LJ5 f;  3QSU A;  3CBM A;  3QPH A;  4KT0 E;  3FDR A;  4OB1 B;  4C5G A;  4M7A G;  4O6J A;  1WJS A;  1NE8 A;  2CYZ B;  3JB9 D;  2DO3 A;  3TCJ A;  2KMT A;  2K5F A;  3VUZ A;  5GAN 4;  3CCE T;  2QDY B;  1LNX A;  5GMK h;  1M1G A;  3WXM B;  2RHY A;  4ZGJ B;  3BW1 A;  5GAM e;  5GAN 2;  3OYK A;  3DB4 A;  2R57 A;  3CCR T;  5FU6 B;  3JAM E;  3CCS A;  2GQV A;  2E6N A;  1UGQ B;  2RI5 A;  4C8Q G;  2RHX A;  3JCM e;  2MI6 A;  4QQD A;  2LC4 A;  3MP1 A;  5IT9 E;  4XK8 E;  1K73 U;  5GMK e;  4WF2 A;  1JB0 E;  4MML A;  2LT1 A;  4LD6 A;  1Q81 C;  4TVR A;  2XKO C;  2O4X A;  4IUV A;  4ELZ C;  3OBY A;  4BE1 A;  1M4Z A;  3JB9 F;  2LX9 A;  2RI3 A;  1Q86 C;  4XAX B;  4OVA A;  5FU7 B;  1U1S A;  3VKI A;  3G6E T;  4XU3 A;  5EG2 A;  5GMK l;  2VC8 A;  3OYY A;  4C0G A;  4OB0 B;  3SWN B;  4HA8 A;  3QJ6 A;  4C0F A;  5C0M A;  2JTF A;  3M4Y A;  2DKG A;  4C92 B;  3OYB A;  2ZPG B;  1BIB A;  3SWN A;  2CZ7 B;  1VQK A;  3PIP A;  2K5L A;  2JVV A;  4Y91 A;  4C0D C;  5KCH A;  3CC4 T;  3CBP A;  4EMK B;  4BE0 A;  1YJN A;  1XQH A;  2VGM A;  3M59 A;  5CKF A;  2X4X A;  4EMG A;  1M1K C;  2DZC A;  3VYG A;  4MZP A;  2KK4 A;  4HCC A;  5KCO A;  2DXU A;  1P92 A;  3FEO A;  1GXI E;  1BI0 A;  2XDB A;  3RES A;  2MWO A;  5GAM f;  3S6W A;  1BKB A;  3N5B B;  4A4G A;  4BE2 A;  2WSC E;  3ZEH A;  3L2Q A;  4M7A F;  1R8O B;  3PT9 A;  5KE3 A;  5GAN 7;  3JCM J;  3LWH A;  4M7D F;  3M57 A;  4M77 G;  4PJO B;  4FIB A;  4EMK A;  2OTL A;  1I4K 1;  2EJG A;  3QUI A;  2LNV A;  2DIQ A;  3I55 T;  1S72 T;  2R5M A;  5J3B A;  2B8A A;  4JJN K;  3CC2 T;  2L89 A;  4CI0 C;  1N8R C;  2YHT A;  5A0D A;  3I56 A;  2QQ9 A;  3HRT A;  4OMF B;  4RCB A;  4J83 A;  4EPC A;  3CPW S;  5J39 A;  1D3B A;  2IVW A;  1KQS A;  1G3T A;  3A8H B;  4IUU A;  5GAN j;  2RK2 A;  3PTA A;  4M75 F;  4M77 E;  2O4X B;  2XK0 A;  4UC4 A;  3GNF B;  4F7U F;  4C8Q D;  2XDP A;  2E41 A;  4KUI A;  2RI2 A;  3RMS A;  3CCV T;  4KBM B;  1Q7Y U;  2DAQ A;  3A8M B;  2XHC A;  4MMK A;  5CQX A;  1NJI C;  2K57 A;  4OP0 A;  4IUP A;  2LTO A;  2YLC A;  1U1T A;  4BDY A;  1M90 C;  1YIJ A;  3JB9 J;  3L2W A;  2QQR A;  3JCM d;  4E7L A;  4J7I A;  1WJQ A;  2BIV A;  5FRM A;  1YCY A;  3X26 B;  3HL8 A;  1M90 U;  3V8J A;  3CC2 A;  3ASK A;  3C95 A;  3ZBD A;  1SSF A;  2O01 E;  2VXE A;  2PQW A;  4RKU E;  5GAM d;  1D3B B;  3J80 E;  3CCJ A;  1OYX A;  1YJW A;  3WVD B;  1XTD A;  2LT4 A;  3G4S T;  3NTI A;  5HK0 A;  2FHD A;  3MEU A;  4M75 C;  2QQS A;  4QVD A;  3SWN C;  4C92 E;  4M7D E;  4C92 A;  3LH0 A;  4J5Y A;  1O75 A;  4M75 E;  3SFM A;  1KC8 U;  3EFS A;  1JJ2 A;  3CMA A;  5CKB A;  3HFN A;  3E1S A;  5LJ3 g;  4JS5 A;  1VQP T;  3V8K A;  3X28 B;  1LOJ A;  2RA2 A;  4J7F A;  1BI2 A;  2DVE A;  3V7C A;  5LJ5 j;  3JCM h;  4M78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...