4QW2A

Fmrp n-terminal domain (r138q)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
200
structure length
198
Chain Sequence
EELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACTYNEIVTIERLRSVNPNKPATKDTFHKIKLDVPEDLQQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human FMRP contains an integral tandem Agenet (Tudor) and KH motif in the amino terminal domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Fragile X mental retardation protein 1
total genus 41
structure length 198
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF17904 KH_9 FMRP KH0 domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qw2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4qw2A02
4A4GA 2MWPA 3NTHA 2DIGA 2EQKA 2HQXA 3OS2A 2IG0A 3FEOA 2L8DA 4FL6A 2M16A 2RJCA 2B8AA 2R5AA 2YRVA 3MP6A 3PNWC 2CKKA 2GFUA 3DB3A 2O4XB 3Q1JA 5KCHA 4FU6A 4IUVA 4QQ6A 5J26A 3BDLA 3QIIA 3GOXA 4E7LA 1WGSA 4ZTFA 4OVAA 3S3MA 2RJEA 2EKOA 3QJ6A 1RI0A 3UT1A 5D6WA 2NLUA 2P0KA 2RI5A 3L42A 2M0OA 3OYNA 4B9WA 2E6NA 4II1A 2R5MA 2VYTA 5KE2A 4NS5A 1H3ZA 2E5QA 4PL6A 1XNIA 3MEWA 3S6WA 4E7KA 2BIVA 3OYJA 4HCZA 4C5GA 2RO0A 3O8VA 3OA6A 3PMIA 4A4EA 2LVMA 2LCCA 3OMGA 2X4YA 3KUFA 5KH6A 4QW2A 2MWOA 2D9TA 2RI3A 2RHUA 3MEAA 3H8ZA 4UC4A 3UWNA 3CEYA 3H6ZA 2X35A 3ME9A 4C5IA 3M9QA 4E7JA 1SSFA 4C5EA 3P8DA 2JTFA 2F5KA 2GFAA 2LRQA 3OYBA 2DAQA 3MP8A 1G5VA 4BDYA 3SD4A 4IUUA 1WJQA 2RHXA 3EAEA 5FROA 5IN1A 1OYXA 3OMCA 3S3OA 2LDMA 2RI2A 2EQUA 1WJSA 4CRIA 3LLRA 3MEUA 1OZ3A 4QQDA 2EFIA 5M9OA 3OYHA 3ASKA 3P8HA 3MP1A 4N4IA 3L2VA 3S3NA 2PQWA 3OS1A 3L2RA 4GY5A 4LD6A 4IUPA 2X4XA 3OYLA 2O4XA 3OYGA 2RHIA 4BE0A 4C5HA 3QKJA 5FRNA 3OQ5A 4A4HA 5KE3A 3E9GA 2JZ2A 2EQJA 2RJFA 2L3RA 3DB4A 3MEVA 4Q5WA 5IAYA 2DIQA 3OYIA 4L59A 3OS0A 4Z02A 3NTKA 3OY9A 2M1HA 3E9FA 5C6SA 3OYDA 3OYFA 3L2QA 2L89A 3LGFA 4B9XA 4N4HA 3FDRA 4RG2A 4N4GA 3OYCA 2BUDA 4BDZA 2K3YA 1WJRA 2XK0A 3L2WA 2FHDA 3PFSA 5D6YA 1MHNA 1OZ2A 3META 3LX7A 3FLGA 2RJDA 4QVZA 4X34A 4EDUA 3LH0A 2K3XA 5D6XA 4IUTA 1N27A 3LGLA 4QQGA 3PMTA 4IURA 3ZEHA 3C4SA 4BACA 3OYKA 4BE1A 5KCOA 3L2UA 2R57A 3LYIA 3MO8A 2HQEA 3FC3A 2GF7A 4IKFA 3OYAA 3OYEA 2X4WA 2EQMA 2QQSA 3OYMA 5C0MA 2LTOA 2RHZA 4IUQA 4BD3A 4BE2A 2BKDN 4PLLA 5J39A 2R58A 3DLMA 4A4FA 5CIUA 4PLIA 2XDPA 2QQRA 1OI1A 4E7IA 4ZTJA 3F70A 1KHCA 3OB9A 4E7HA 2G3RA 3NTIA 5FRMA 3QBYA 2WACA 2RHYA
chains in the Genus database with same CATH superfamily
1M90U 2ZAEA 1QQJA 4K11A 2ESWA 4RTVA 1VYVA 2B8AA 3MP6A 1QCOA 3M58A 2YRCA 2KAFA 3HTRA 2K2VA 5CVIA 4IUVA 1YHQT 4JZ3A 1G83A 2QK0A 4J6YA 1VQ8A 2EKHA 1YJ9T 4XK8E 2OTLA 1M5Q1 2CT4A 4TVRA 3CCEA 4II1A 1D09B 2DXBA 4PJOB 2L0AA 2LZ6B 2X4YA 1I07A 2D9TA 3VUBA 4M7AF 5GANf 3OYBA 2DAQA 1TXQA 1VIEA 1MMAA 1NE8A 4C8QG 2A7YA 1M90R 3X25B 1R8OB 5KYYA 3VS7A 2RK1A 3JCMc 4Y91A 1I4K1 2FZGB 2YUQA 3CCSA 4MMKA 4BE0A 2ZPGB 2E3HA 4EIKA 2RMOA 3X20B 3JCMW 4RUGA 1VQKA 1UGSB 1VQ7A 2J6FA 1VQ4Q 4C92B 4M75C 3RNJA 5LJ5h 5IHKA 2ROLA 4ESRA 4RG2A 1IO6A 2RQUA 3G6EQ 2CUBA 4MDWA 2JT4A 1YJWA 2K4YA 1N9SA 2J06A 1WYXA 4HCCA 5KYYB 1OZ2A 2M0YA 4X34A 2LQKA 1X27A 4RCCA 4JZ4A 2EVRA 4BACA 1AHJB 1KD1R 3JB9H 5GAOr 4XU0A 1UFFA 4FW1A 3RBBB 4PJOD 3TVTA 2RHZA 4OB3B 1G3YA 3A5ZB 3CCRT 2HKQB 1QP3A 1TUGB 4LXCA 3V8LA 1JRIA 5LJ3g 1MMNA 2G3RA 3CCMT 5KYUB 1M2OA 4LDYA 2VB6A 2RB6A 5KYXB 2ABLA 4M7AE 1V1CA 5A0GA 2RM4A 1KSWA 2EYWA 1VQNQ 1A0NB 2BTTA 1KQ2A 1Q7YR 4MDXA 2JM9A 2X3WD 1UJYA 4M7DB 4HCZA 1AD5A 1R0BG 5KYNA 2QEXA 1N9RA 4UC4A 2RHUA 1KQ1A 4FW2A 1XQHA 2CS7A 4Y28E 4PJNA 1KC8R 3H0FA 4A4KA 2JVVA 3JCMh 2H8HA 2RD1A 1QKXA 3QZ9B 3VU3C 3H0HA 3S3OA 2RI2A 3LH5A 1UGVA 4JRKA 3M59A 3I56T 1Q82U 2JOYA 2PQWA 1QVGS 3OYLA 4OMFB 2CSQA 2E1HA 3QKJA 2E41A 3FIFA 2DK3A 3E9GA 4C0DC 5GMKi 4M78D 5HCKA 1B7TA 3E9FA 2CDTA 3TSZA 3OYYA 3JB9F 3EGDA 1RAGB 3G71A 3CC7A 2BUDA 3QWXX 2KGTA 2BE9B 3C12A 1RAEB 2NYSA 2QA4Q 1WZOA 4IIMA 1BI3A 2VUBA 2E5KA 1IREB 1LJOA 4ANJA 4PJMA 3C4SA 3OSSC 1U8RA 1NPPA 1IXDA 4XTXA 3CCLT 1X2KA 3CBOA 2DL5A 4JLGA 2K3BA 2DPPB 3V7CA 3KFVA 5IT9E 2MWPA 3NTHA 1ARKA 1RUWA 4M7AG 2EWNA 2L8DA 1GL5A 3C94A 5CAIA 1YI2Q 1VQ9A 5HK3A 2CH4W 1WXTA 4J9HA 5EG2A 4E7LA 5GJVB 2RJEA 4DBFA 2YLCA 1O9SA 1EIFA 2YHTA 2ZPHB 4KBMB 2K5FA 2CP3A 2JW4A 2AT1B 2R5MA 4HT9A 4PL6A 1H8KA 1RAIB 1XNIA 3VRYA 4QVCA 1X2QA 3PMIA 3UATA 2HD0A 4J83A 1JXOA 3OMGA 1BK2A 3TEEA 5ECAA 3M9QA 3PIOA 1S1NA 1WHLA 1YIJA 3O5ZA 2BZ8A 1WJQA 2JN0A 3LW5E 4L5GA 1WHJA 3LWIA 1I0CA 1G3TA 1HYOA 3ZFJA 2KE9A 4M4ZA 5FU6B 4PJLA 2DZCA 1SKUB 1NEBA 4N0AA 3FJ5A 3CCRA 2EW3A 3G4SA 3CXCA 1FXXA 4KRTA 1VQMA 2DIQA 4OMLA 1Q81C 1QVGP 4AFQC 3VV0A 3CCUQ 5CKFA 4N4GA 3JV3A 4BDZA 1ABQA 1PM3A 1Q7YC 2A3LA 5HKCA 2VVKA 2MF2A 2K3XA 1WQWA 4OF1A 1NG2A 1KG1A 2MYSA 4FSSA 2ROTA 3TREA 4BB7A 1UGPB 1UB4A 1D0YA 2JMAA 3RKXA 1M3AA 1N6AA 1VQNT 1T3LA 2LQNA 4QVDA 5CIUA 4PJJA 3UPUA 3CCMA 4HKEA 4O5VA 3M0SA 3FEOA 1RAAB 2R5AA 5J3BA 1WPYA 1ZUUA 3EFSA 3KXTA 2OJ2A 2F69A 4FU6A 1YCSB 3BY7A 3QJYA 3E2UA 1G2BA 1Y07A 3UT1A 4F04B 3FJPA 4F7UB 1ACMB 1GBRA 2ENMA 2LQWA 4CC7A 3OYJA 1PWTA 3WVDB 1H641 1VQ5A 2HBWA 3JCMX 3RKYA 3A8MB 2CZ1B 3ZL7C 2LJ0A 1VQLQ 3E1SA 3FRNA 2J05A 1PNJA 4F7UA 1N8RR 3ASKA 3VYGA 2KDSA 1N8RC 3G7ZA 1RI9A 2NUZA 4BY6B 4C0GA 3OYGA 1OX8A 1TH7A 2FVUA 2RJFA 3MEVA 3UA7A 4C8QA 4DOVA 1H92A 1NEGA 3JCMe 4KUDK 3OYCA 1K9MU 1NLPC 3CCUA 3UA6A 4NOYA 2OX7A 2C06A 3LGLA 4QQGA 2HMAA 4DOWA 1D0XA 3VS0A 4Z88A 4AMCA 1W70A 2HQEA 3OSVA 3FC3A 3A8OB 4IKFA 2QQSA 1M1GA 3EFOA 4OMMA 4J9GA 1DJ7B 4F7UE 1OV3A 1OX9A 2QQRA 2RH2A 5GANg 4LDVA 1JU5C 2XI9A 4M75E 2LC4A 2GQIA 3JSCA 1SPKA 1VQ9T 1CSKA 4XU2A 2VXFA 2JXBA 1GCQC 3QJ6A 2VC8A 2JNGA 1FYNA 4M7AC 4B9WA 1KJWA 1TTHB 3EHRA 1AZGB 2DL3A 4JJBA 5KYWA 1ZQ1A 3BW1A 3QSUA 4M75G 4AT1B 1OU8A 4ZN1A 2KSSA 2DNUA 3P8DA 1ZHIA 4XTUA 1MMGA 3VRZA 3SD4A 1M90C 2CH4A 1HK9A 4XQ3A 2LJ3A 1X01A 2EQUA 4C0ZA 3GIBA 2VXEA 2E64A 5IHIA 2VGNA 4GLKA 3VJPA 2I2LA 3OYHA 1S72Q 4M75A 1J3TA 1NBEB 3MP1A 1AZEA 2EYZA 5CKEA 3G4ST 1PKSA 2W0ZA 2RHIA 1GFDA 3R6NA 5DLQE 2EJFA 2HSEB 3OYIA 1UE9A 3QG1A 5C6SA 4PK4A 2QA4A 1K73R 1VQLT 2HKNA 2E70A 3I56A 3HRSA 3EHQA 2DKGA 4EDUA 1N27A 3HFNA 2PVOB 3PMTA 3VS4A 4BI4A 4ORZA 1TS9A 1QWFA 1GCQA 1KD1C 3LYIA 3J7AF 1UDLA 4AFUC 3JCMP 3A8LB 3PT9A 4F7UG 4CI0C 1YITT 2DMOA 5C0MA 4BE2A 3VS2A 5GAMd 2KMTA 1KQSS 1LPLA 2W10A 3MJXA 2K57A 1LNXA 2O9SA 2XDPA 3QDRB 3PTAA 1HXDA 1AVZC 3JB9G 2HSPA 2O31A 9ATCB 1BCOA 3OS2A 4V2SA 4JLIA 1QVFA 2RJCA 4KUIA 3BFMA 1D1CA 4E7SA 1CKAA 4C8QF 2KXCA 2DEQA 2DLPA 4RTXA 2SRCA 4ZTFA 1PSFA 3M53A 2EKOA 2QEXQ 2A37A 2KYMA 2E65A 5GANh 2FRYA 2KRNA 5IXFA 3ZBDA 1YCYA 3V8KA 4OB1B 2ZPIB 1AT1B 1BCMA 3H8ZA 3DKMA 2MOXA 1KC8C 1MGQA 1WX6A 5LJ5j 1NPRA 2A36A 3CCUT 3WVEB 4D6WA 1WLPB 1JJ2S 1IHVA 2VWFA 2MCNA 4KH0B 1OULA 1KHIA 1G3SA 5LJ5g 4OGCA 4OMPA 3OS1A 2I0NA 1K76A 1PKTA 2JJ9A 4JJDA 4KULA 5FRNA 2LX7A 2B86A 3N5BB 3CPWA 5KYUA 2L3PA 3THKA 4J9BA 2MAMA 2SEMA 3I9QA 4PFZA 1YJWQ 1XJWB 2XK0A 2LT4A 4D8KA 3LX7A 2X4JA 5CR2A 2YSQA 3RMSA 3CXCP 1VQ7Q 2RF0A 3RIRA 3OYKA 5GAMf 1QLYA 2QI2A 2DRKA 2XIDA 4J9DA 2EQMA 3QO3A 3I55Q 4M78F 1M2VA 4FIBA 3RERA 2E12A 5D7UA 3QWYA 4E47A 3M55A 4PFOA 1PRMC 1D3BB 2L3SA 2EQKA 3EGXB 2KQWA 2FPEA 5LJ3e 1AOJA 2DYIA 2ZZDA 2EPDA 3CMAT 2LT1A 3EG9A 2IVWA 1W2BS 2ZCFB 2D1XA 4X1VA 1K8AR 3SFMA 2F5TX 3M54A 1BI0A 3J80E 2HNIA 5FU6C 2CGHA 5GMKj 3RR6A 4M77G 2MWOA 2F2XA 4R0KA 2LCLA 1NLOC 2ZGWA 3CQTA 1SSFA 1WHKA 3NMZC 2JTFA 1ZSZC 2BZXA 5CCAA 4R56A 2PTKA 1QW1A 1QP2A 2DZ9A 2NUTA 2VASA 4P5NA 1PD0A 4ZGEB 1VQOQ 2AK5A 2V1RA 2FYKA 1U1SA 4QQDA 2EFIA 4HT8A 4A63B 2DXUA 2QAZA 5KYXA 3JCMg 4CC4B 2QTXA 2Y4XA 5CO7A 4C5HA 4XAXB 1Q81R 3I56Q 2L3RA 4HVVA 3CD6A 4ELZC 3CMEA 1VQLA 3L2QA 1MV0B 5CQXA 4OMOA 3L1AA 1JQQA 4FYVB 2OTJA 5CK9A 2RJDA 2EGCA 4C92C 2KRMA 4BE1A 1S72A 5KCOA 1VQOT 2GF7A 2HEQA 2Y4YA 2YDLA 2EGEA 2QGGA 3RKWA 5CKBA 4PFPA 4DA4A 4A53A 2CP7A 2DL7A 4J7FA 4EMKA 1XTDA 2D0QB 2RHYA 2HQXA 3EH1A 2KT1A 4JJNK 2ED0A 3CCMQ 4GBQA 1EX4A 5J26A 4Z8AA 3QIIA 1X75C 3HFOA 3JCMf 2HL3A 4OVAA 2J6OA 3VKIA 2EAYA 3X28B 2NLUA 2E6NA 4JRIA 2VYTA 2DBMA 3OA6A 4J9CA 4E2FB 2CZ7B 2LCCA 3EFRA 2FZKB 3UWNA 4ME7A 4ELYC 3QHSA 2J6KA 3SHWA 4M77B 2EJGA 2RN8A 2AZVA 4C5EA 1G5VA 1UTIA 2KR3A 3G6ET 1JBMA 2KY9A 4PJOA 2LNHB 4AFSC 4IUUA 1VQ8T 2DD4A 5IN1A 1ZUKA 1M4ZA 1VQ4T 2O88A 1VQMQ 4M7DC 4AG1C 2PUKB 4ZGDB 4C0DB 3OBYA 1OZ3A 2PVDB 3EG1A 1YIJT 5GAN7 3TU4K 1M3BA 2ECZA 1K8AU 1Z9QA 3L2RA 2K2MA 3J81E 4M78C 3EG3A 1F1BB 1Q95G 1ZSGA 8AT1B 3AHUA 1YJWT 1TUCA 2JUFA 2CYZB 2EYXA 5GJWB 1VYTA 4RCBA 3M0PA 1JEGA 2YUPA 4HCKA 3T9NA 4XTVA 1Y7XA 2DJZA 3JCMJ 2COZA 1UUEA 1WJRA 1RADB 3PVQA 3FLGA 1RL2A 2HL5C 3HL8A 2HAXA 2DF6A 3ZEHA 3NHNA 3CCST 1SHFA 4DQ2A 3L2UA 5A0DA 4M77D 4J8OA 1VOMA 4LDXA 2RQVA 1U06A 2P84A 2LNVA 4PLLA 1RAFB 4M75F 2V8JA 2WSCE 4J6WA 4E7HA 2LQ8A 4EMKC 4M75D 5LJ3f 3META 1LVKA 2CP5A 3NPFA 4LUDA 3C0CA 2WSFE 3CCJA 2KT8A 3EH2A 3PE0A 3QPHA 1AWJA 1P92A 4C8QD 3LWHA 2YUOA 3S3MA 1ZBJA 4M7DF 1QVFS 2YRDA 1AWWA 3L42A 3MPUB 1WA7A 3JCMb 2DTHA 2OTJQ 3S6WA 2EIFA 4EMHA 3PIPA 1UECA 2KK4A 2MIOA 1QVFP 2LJ1A 4QW2A 3CMEQ 5GAOq 4X9CA 3GNGA 4RTYA 3G71Q 3CC7Q 4C92D 2L3QA 2O01E 1M3CA 4PNOA 2X9HA 1U3OA 5LJ5e 1B34A 4DBRA 2PU9B 2KROA 1OYXA 2AZSA 2C0OA 2JM8A 2LDMA 1VQ5T 2KEAA 3TSWA 3AT1B 3DLLA 4NL2A 1PD1A 5M9OA 1VQOA 2MI6A 4BY6C 1ZA2B 1ZLMA 1YWOA 1GXIE 3GP8A 5CKDA 5LJ3d 4WF2A 2FL7A 3CCVT 5KE3A 4A4HA 4RTUA 4FCYA 3M5AA 4KT0E 2VV5A 4Z02A 5CKHA 1K73C 3OYFA 2OAUA 3M57A 1E6GA 3A1PA 1K1ZA 3HRTA 2DFUA 1WHGA 1TSFA 2FHDA 3C95A 2OAWA 5FWBA 3EG0A 3G4SQ 3HRUA 2DETA 1BIBA 1M2VB 4MZPA 1QWEA 1S72T 4PJOC 1D0ZA 1K4US 2X51A 4J5YA 3OYMA 3MHXA 1VQNA 3CPFA 1ZUYA 3FB9A 3V7SA 1M9SA 3G71T 3CC7T 1B3QA 3OBWA 3URGA 3F70A 1D1AA 2IPOB 4KH1B 2XG8D 4A4GA 1BI2A 4OMNA 2GNCA 3I55A 1M1KR 3DB3A 4M7AB 1M1KC 5LJ5d 1KK7A 5CQYA 1FMVA 2GTOA 3ER0A 5DLOA 1QCFA 1T3SA 1X43A 2DERA 2DYBA 2ATCB 2XU8A 5I22A 2VKNA 4ZN3A 4GLMA 2E5QA 1VQ9Q 2AIRB 3MEWA 5IXBA 1R77A 1ZX6A 2L5QA 3VS3A 4C5GA 4M7DE 2DBKA 1X6OA 2KI7A 1YJ9A 3KUFA 2GQVA 1TG0A 1Q86U 1MUZA 4M77C 2QQAA 1PHTA 3G6EA 2F1LA 5FROA 2MMPA 5FU7B 4CRIA 1SRLA 4PJOE 2HCKA 4CC3A 3CCSQ 3RESA 1KIKA 2JS0A 2DE0X 3CCQT 3A8HB 4LDUA 1M27C 4GY5A 1R0CB 3HHTB 4C92G 2DRMA 1C1AA 2FZCB 4Q5WA 2DL8A 1RACB 4OP0A 3RUXA 3MCAB 1Y71A 5I2MA 4RTZA 2HZYA 4LN2A 2AKKA 5GMKe 1Y57A 1M30A 1FWZA 5LJ3h 2DO3A 2H3EB 3JB9I 1TOVA 2NUPB 1ZSZA 1K0SA 2CZ0B 4A54A 3CCEQ 4FYWB 2A0FB 1WNLA 3HSBA 2ZPEB 4C92E 2LTOA 1VQ8Q 1W1FA 1O75A 4EPCA 4ZTJA 1KHCA 2PZ1A 2WACA 1U5SA 1MNDA 3M0UA 1W2BP 5GAMj 2JTEA 1VQ6A 1GFCA 2HQHA 2GFUA 1UJ0A 1K8AC 2QDYB 1G8XA 1PCXA 3CC4Q 3GOXA 1WGSA 2DL4A 3EG9B 3EGXA 2QYZA 4M7DG 4XTWA 2CUDA 3JCMd 1BBZA 2RO0A 3O8VA 4KGZB 3ULRB 5GANe 1UGRB 1K9MR 4FYYB 1BI1A 3X26B 2XICA 1K9MC 3OW2P 2PVGB 2VGMA 1LCKA 2QASA 2QTVA 1YBYA 1T0JA 1RLPC 2M51A 5I2SA 3LLRA 3L2ZA 1ZBXA 3QDFA 4HCBA 3M0TA 1M1KU 2H3JA 1SSHA 4Y92A 5GAN4 2X3XD 1KFZA 4FT4A 3L2VA 2GTJA 2GBQA 1YJNT 3CCQQ 3GF5A 3EGDB 2O4XA 1GCPA 3CCLA 2YLBA 2EQJA 3EGUA 2QGFB 1WXUA 1G3WA 2LCSA 1PRLC 1IZ6A 2AHJB 4ZNXA 3P8BB 4QVZA 3INZA 2DVJA 4XU3A 3LH0A 1WDXA 1K9AA 3VS1A 3H41A 3EFOB 1IB8A 3G1JA 2C0TA 2EJ9A 3VS6A 4JS4A 2K9GA 4J7IA 2D8JA 3H0IA 2C0IA 3X24B 1JJ2P 5FU7C 3QXEB 4FT2A 1BB9A 3JRZA 2CSIA 3QYHB 4PLIA 1OI1A 4PKCC 5FRMA 1EZZB 4XTYA 4F7UF 2DX1A 1IRXA 1KQSA 2QDLA 2KBTA 4FL6A 5AT1B 2CKKA 2EGAA 3REBB 2GCXA 4C8QB 2YXYA 3SB2A 5KCHA 4WTOB 4F16A 5GAN6 1RI0A 1Y96B 4JUVA 2L2PA 3CMAA 5D6WA 1YN8A 1YFNA 2P0KA 2RI5A 1WFWA 2M0OA 1YI2T 4NS5A 5AYFA 3CMAQ 5GAOp 2XHCA 5KH6A 1JJ2A 4HA8A 4OB0B 2EBPA 4C5IA 5GAMh 5DM7R 2CP2A 2RPNA 4RTWA 4DBHA 2LRQA 2J7IA 4QT7A 1RLQC 2MPXC 2AKLA 2QQBA 3OMCA 2EQIA 4RKUE 5GAMe 2A08A 3M0QA 1KD1U 1KQSP 1WJSA 2XMFA 2HDAA 4RTTA 3HPWA 3UF4A 3HKSA 3PGGA 1Y96A 4M78E 1VQ7T 5GAN3 4M78B 2F2VA 2RA2A 4Z89A 4LD6A 2X4XA 4YTLA 1MMDA 3U23A 3GNFB 3DB4A 3REAB 2YT6A 4L59A 1VQ5Q 2DILA 2YWWA 2L89A 3V8JA 3FDRA 4VUBA 1X6GA 1VQ6T 3A8GB 5GAN5 3L2WA 1NYFA 1VQPA 3PFSA 1MHNA 1D3BA 2V8IA 1ABOA 4M7DD 3CMET 1Q7YU 5GAOn 2YUNA 1VA7A 3CCVA 2Z0WA 1MV3A 3OYEA 1OU9A 2X4WA 3CCQA 4IUQA 1GRIA 2M02A 4ZGJB 1KC8U 3OW2A 1OPLA 5L23A 2XDDA 4E7IA 1OOTA 1UHCA 3NGPA 3QBYA 1QVPA 1Q81U 2DIGA 4M7AA 2PNIA 4M77F 4MZMA 2O4XB 1PC0A 1OQKA 1Q82C 3I35A 1JXMA 4FSXA 4AFZC 2KVQG 2KXDA 1Q82R 1SG5A 4HVUA 4PJOG 5LJ5f 2DJQA 5GAOm 2K79A 3OYNA 1B07A 1H3ZA 4E7KA 3JAME 1WHMA 4A4EA 1MNEA 3CC4A 3MEAA 3CEYA 4IIOA 3VS5A 4C8QE 5GAN2 2F5KA 2ED1A 1VQ6Q 1IGQA 2RNAA 3CCRQ 4BDYA 3QZ5B 5IH2A 3MEUA 3M4YA 2DTOA 5HK0A 3PVLA 4KGXB 1YJNA 4QKUA 1I81A 1U1TA 2RQTA 3QYGB 1YIJQ 2CZ6B 2CT3A 3OQ5A 4C8QC 4N0AC 1NM7A 5IAYA 5LL6S 1VQMT 2E3IA 3JB9J 3EG2A 1JO8A 3LGFA 4B9XA 1UG1A 3CXCS 1B34B 1V76A 4NL3A 4DEYA 4IUTA 2E4HA 4J6XA 4F14A 3UDCA 6AT1B 4J9EA 2R57A 5HY6A 2LMJA 4KGVB 1YI2A 4M77A 1LOJA 4XU1A 4BD3A 2BKDN 1Q86R 1OPKA 1Q86C 3DLMA 4PJOF 1OEBA 2LX9A 5A2QE 1BYMA 5EC7A 5GMKl 2IG0A 2BE7D 4C92F 3SEMA 3SWNB 4OMQA 3VUZA 4BI3A 3OS5A 2K5IA 4QQ6A 1AWXA 5GAOl 3HP9A 2LP5A 1WQ7A 1YJ9Q 1PG5B 1YHQQ 3RDVA 5KE2A 3SWNC 2OI3A 4RMOA 3CPWP 2RQRA 4F17A 2DVEA 2XKOC 4M75B 3BE3A 1BU1A 1C6VX 1QMCA 4CC2A 3WXMB 1X69A 3H6ZA 4LNPA 4E7JA 4C0FA 4M77E 1M1FA 2V8KA 2DEUA 4WCIA 3MP8A 1GBQA 3EAEA 3A98A 4JJCA 1IGUA 5DY9A 2KNBB 1NJIU 4MZTA 4LD9K 1X6BA 3CD6T 3P8HA 1YJNQ 2ZPBB 1W4SA 2EYYA 3IQLA 4IUPA 2PUOB 4M78A 3GLXA 3OYDA 2EYQA 3CC2T 4N4HA 2IIMA 1VQPT 2D6FA 4DEXA 3H9NA 5GMKm 1TUDA 1Z9ZA 2DXTA 1YNZA 2KYBA 2XDBA 2P0PA 4DBQA 1NJIR 4J9FA 5LJ3j 1NJIC 1VIFA 5J39A 4BUGA 2R58A 3CC4T 3KBGA 2K7AA 3QUIA 1WHHA 4OB2B 5GANj 5GAN8 1N5ZA 2D0NA 1CKBA 2E6ZA 2P4TA 5GAMg 2M16A 2V1QA 2YRVA 3PNWC 3GPLA 1VUBA 1K73U 2K5LA 1WI7A 3Q1JA 2COWA 3JCMQ 1YHQA 1M8VA 3I55T 1SF9A 3CCET 2BIVA 4OGEA 2FEIA 4XTZA 3TQ7P 2LVMA 2DM1A 1I8FA 2RI3A 1UGQB 2FRWA 1VQ4A 3CCJQ 2E10A 2X35A 4FM4B 1I1JA 1NZ9A 1VQKQ 2GFAA 3I5RA 1E6HA 2JMCA 1IHWA 2RHXA 4MMLA 2K6DA 3M0RA 5KYWB 2XD0A 1VYUA 1FX7A 1H3HA 1XOVA 4J9IA 1FMWA 4AG2C 8ATCB 2OTLT 3D7SB 3S3NA 4LE9A 4LDWA 2P0QA 2JZ2A 3M56A 3OS0A 3OY9A 2DA9A 3V7RA 1QVGA 3I5SA 4BI8B 2NUTB 1K0XA 1SEMA 5D6YA 5FWCA 5A0LA 1NYGA 2OTLQ 7AT1B 1JB0E 2RK2A 3NFCA 4IURA 2CP0A 3OW2S 1UEBA 1ZA1B 3VYHB 5IHNA 1QKWA 3BDUA 3JCMV 3CBMA 1UHFA 2FPFA 2QEXT 4ATOA 4A4FA 4EMGA 1VQKT 2FB7A 4M7DA 2QG9B 3CCJT 3OB9A 4JPBW 3NTIA 2GGRA 2F2WA 1RABB 2O9VA 4M7AD 1HJDA 1WIEA 4FYXB 4E7ZA 2JTMA 1EFNA 2A28A 1QCNA 2DD5A 4E6RA 3CBPA 4R55A 3BDLA 4O6JA 4JRPA 1Y0MA 3JB9D 5I21A 1YP5A 2CP6A 2Y90A 3SWNA 4HXJA 2MK5A 1YWPA 1YITQ 4HVWA 1AWOA 2ZPFB 1PSEA 4RG8A 1ZSZB 1E7OA 2COYA 3R6OA 3CC2A 2NUPA 3ME9A 2WSEE 5FLXE 2D8HA 2V26A 3MKDA 1I5LA 1FMKA 2DXCA 2FPDA 4L6V5 3CCLQ 1M8MA 4LUEA 3CCVQ 4JDSA 4B6MA 1BIAA 4N4IA 2P4RA 4D8DA 1I5OB 1WXBA 2QA4T 4M78G 1V29B 2QQ9A 2KRSA 1VQPQ 4C92A 2DTIA 3CC2Q 2G6FX 2HBPA 3NTKA 3E19A 2M1HA 2FO0A 1BKBA 2M9UA 2CREA 4EMKB 2BZYA 1C0MA 2K3YA 2NWMA 1RAHB 5GANd 1YITA 3SDZA 2QXFA 2RQWA 1AEYA 5D6XA 2FG0A 3CPWS 5I11A 5GMKh 3CD6Q 2JS2A 1D1BA 4JRQA 1HSQA 1T0HA 4JS5A 3GBQA 3MO8A 2OTJT 4X9DA 5L8RE 3OYAA 3M4GA 1N8RU 1W6XA 2O2OA 1SRMA 3TCJA 1TU0B 1HD3A 1SHGA 5FW9A 3RMQA 1W2BA 1TWBA
chains in the Genus database with same CATH topology
1M90U 1Q81U 2DIGA 4M7AA 2XI9A 4M75E 2LC4A 3JSCA 2B8AA 3MP6A 4M77F 3M58A 4MZMA 1VQ9T 2KAFA 2WSFE 2O4XB 2K2VA 3CCJA 4XU2A 1Q82C 4C8QD 5CVIA 2VXFA 3QPHA 4IUVA 1P92A 1YHQT 3LWHA 4FSXA 2KVQG 4J6YA 3S3MA 1VQ8A 3QJ6A 1YJ9T 4M7DF 4XK8E 1QVFS 2OTLA 4PJOG 5LJ5f 5GAOm 1M5Q1 2VC8A 3L42A 2JNGA 3OYNA 4TVRA 4B9WA 4M7AC 3CCEA 4II1A 1H3ZA 3JCMb 2DTHA 3S6WA 2EIFA 2DXBA 4E7KA 4EMHA 3PIPA 4PJOB 2KK4A 3JAME 4A4EA 1ZQ1A 2X4YA 3CC4A 4QW2A 2D9TA 3MEAA 5GAOq 3VUBA 4M7AF 5GANf 3BW1A 4X9CA 3CEYA 3GNGA 4M75G 3QSUA 4C8QE 4ZN1A 5GAN2 2KSSA 3P8DA 4C92D 1ZHIA 2F5KA 2O01E 4XTUA 3OYBA 2DAQA 1VIEA 4PNOA 4BDYA 3SD4A 5LJ5e 1M90C 1B34A 1NE8A 2PU9B 3QZ5B 1HK9A 4XQ3A 4C8QG 2A7YA 1OYXA 3X25B 2LDMA 1X01A 1R8OB 1VQ5T 2EQUA 4C0ZA 3GIBA 2VXEA 2E64A 2VGNA 3MEUA 4GLKA 3VJPA 4NL2A 3DLLA 2I2LA 2RK1A 3OYHA 5M9OA 3M4YA 1VQOA 4M75A 2MI6A 4BY6C 2DTOA 5HK0A 3MP1A 1YJNA 5CKEA 3JCMc 4Y91A 1I4K1 1I81A 1GXIE 3G4ST 1U1TA 3QYGB 5CKDA 5LJ3d 4MMKA 3GP8A 3CCSA 4BE0A 2RHIA 2ZPGB 4WF2A 2FL7A 2EJFA 5DLQE 2CZ6B 3OQ5A 3X20B 4A4HA 4C8QC 5KE3A 3CCVT 4N0AC 5IAYA 3OYIA 3JCMW 1VQKA 1UGSB 3M5AA 1VQ7A 4KT0E 5LL6S 2VV5A 4Z02A 1VQMT 3QG1A 5CKHA 4C92B 3JB9J 1K73C 4M75C 5C6SA 3OYFA 2OAUA 4B9XA 3LGFA 3M57A 5LJ5h 2QA4A 4RG2A 3HRTA 1VQLT 4MDWA 2E70A 3CXCS 2K4YA 1YJWA 1N9SA 1B34B 3I56A 3HRSA 4HCCA 2FHDA 3C95A 1OZ2A 2DKGA 4X34A 4NL3A 2LQKA 4EDUA 3HRUA 4IUTA 1N27A 3HFNA 1BIBA 4RCCA 2PVOB 4MZPA 4J6XA 3PMTA 4BI4A 1S72T 3UDCA 4BACA 1KD1C 4PJOC 1AHJB 2R57A 3LYIA 5HY6A 5GAOr 4XU0A 3J7AF 3JCMP 3JB9H 1YI2A 3A8LB 3PT9A 4J5YA 4M77A 1LOJA 4F7UG 3MHXA 4XU1A 5C0MA 4CI0C 3OYMA 2RHZA 3CPFA 4BD3A 4OB3B 2KMTA 1G3YA 2BKDN 3A5ZB 5GAMd 4BE2A 1KQSS 3CCRT 3FB9A 3V7SA 1QP3A 1Q86C 1M9SA 3DLMA 2K57A 4PJOF 1LNXA 3G71T 3V8LA 3CC7T 2LX9A 1JRIA 2XDPA 3OBWA 3URGA 5LJ3g 3QDRB 3F70A 2G3RA 3CCMT 3PTAA 1HXDA 3JB9G 5A2QE 2XG8D 4A4GA 1BI2A 1BYMA 3OS2A 4LDYA 5GMKl 4JLIA 4V2SA 2IG0A 1QVFA 2RJCA 4KUIA 3BFMA 2RB6A 3I55A 4C92F 3SWNB 4C8QF 2DEQA 3DB3A 4M7AB 3VUZA 4BI3A 1M1KC 5LJ5d 3OS5A 2K5IA 4QQ6A 5CQYA 5A0GA 4M7AE 5GAOl 4ZTFA 3HP9A 2RM4A 3ER0A 1WQ7A 5DLOA 1PSFA 3M53A 2EKOA 2E65A 5GANh 1KQ2A 2XU8A 4ZN3A 4MDXA 5KE2A 2E5QA 3SWNC 3ZBDA 1YCYA 3MEWA 3V8KA 4RMOA 2L5QA 4OB1B 4M7DB 2DVEA 2XKOC 2ZPIB 4HCZA 1X6OA 4M75B 4C5GA 4M7DE 2QEXA 1YJ9A 1N9RA 2GQVA 3KUFA 4UC4A 2RHUA 1KQ1A 3H8ZA 1XQHA 3DKMA 2CS7A 3WXMB 1KC8C 1Q86U 3H6ZA 1MGQA 4Y28E 5LJ5j 4M77C 4A4KA 2JVVA 2QQAA 4M77E 1M1FA 1NPRA 4C0FA 3G6EA 4E7JA 2V8KA 3MP8A 3JCMh 3CCUT 3EAEA 2RD1A 2MMPA 5FU7B 5FROA 3QZ9B 3VU3C 3S3OA 2RI2A 3WVEB 5DY9A 4D6WA 1JJ2S 4CRIA 4JRKA 3M59A 1NJIU 3I56T 4PJOE 3RESA 4MZTA 4LD9K 3CD6T 1KHIA 3P8HA 1G3SA 5LJ5g 3CCQT 3A8HB 4OGCA 1Q82U 2ZPBB 2JOYA 2PQWA 1W4SA 4LDUA 3OS1A 4GY5A 1QVGS 4IUPA 3OYLA 4OMFB 3HHTB 4KULA 2E1HA 3QKJA 2PUOB 4C92G 5FRNA 2E41A 4M78A 3FIFA 2DK3A 3E9GA 4C0DC 4Q5WA 4OP0A 3RUXA 5GMKi 3MCAB 3N5BB 1Y71A 3CPWA 4M78D 5I2MA 3E9FA 3GLXA 3OYDA 2EYQA 3OYYA 3CC2T 3JB9F 4N4HA 3G71A 5GMKe 3CC7A 2BUDA 2MAMA 1VQPT 2D6FA 3C12A 1FWZA 2XK0A 2LT4A 3LX7A 2DO3A 1BI3A 2VUBA 5LJ3h 5GMKm 2X4JA 1IREB 5CR2A 3JB9I 3RMSA 1LJOA 3C4SA 3OSSC 3RIRA 1U8RA 2DXTA 3OYKA 5GAMf 1NPPA 2CZ0B 2QI2A 4XTXA 4A54A 3CCLT 1WNLA 2XIDA 2XDBA 2P0PA 2EQMA 3HSBA 5LJ3j 2ZPEB 3QO3A 3CBOA 4C92E 1VIFA 2LTOA 1NJIC 4JLGA 4M78F 4IKFA 1O75A 5J39A 4EPCA 4BUGA 4FIBA 2R58A 3CC4T 3KBGA 3QUIA 5GANj 4OB2B 4ZTJA 3RERA 2E12A 2DPPB 1KHCA 3V7CA 5GAN8 2WACA 4E47A 3M55A 5IT9E 2MWPA 3NTHA 1D3BB 2EQKA 2E6ZA 5GAMj 2KQWA 4M7AG 5LJ3e 2EWNA 2P4TA 5GAMg 2L8DA 1VQ6A 2ZZDA 2M16A 2YRVA 3PNWC 3CMAT 2LT1A 2GFUA 3C94A 1VUBA 5CAIA 3GPLA 1K73U 2K5LA 2IVWA 3Q1JA 1W2BS 1K8AC 2QDYB 5HK3A 1VQ9A 2ZCFB 5EG2A 3GOXA 3JCMQ 1WGSA 3SFMA 4E7LA 1YHQA 2F5TX 2RJEA 3M54A 1BI0A 2YLCA 3J80E 1O9SA 1EIFA 2HNIA 2YHTA 2ZPHB 2K5FA 4KBMB 5FU6C 3I55T 4M7DG 4XTWA 2CGHA 3JCMd 2R5MA 4HT9A 4PL6A 5GMKj 1XNIA 3CCET 2BIVA 4OGEA 4XTZA 4QVCA 2RO0A 3O8VA 3PMIA 2HD0A 4J83A 2LVMA 4M77G 1UGRB 5GANe 3OMGA 2MWOA 1I8FA 2RI3A 1UGQB 1VQ4A 1BI1A 3X26B 2XICA 1K9MC 2E10A 2LCLA 2X35A 3TEEA 2ZGWA 4FM4B 3M9QA 1NZ9A 3PIOA 1SSFA 2JTFA 2GFAA 1YIJA 2PVGB 2VGMA 5CCAA 1WJQA 2JN0A 2RHXA 1YBYA 3LW5E 4L5GA 4R56A 3LWIA 4MMLA 1QW1A 1QP2A 2XD0A 2DZ9A 1FX7A 4P5NA 1XOVA 3LLRA 3L2ZA 5I2SA 1G3TA 4ZGEB 1ZBXA 2FYKA 1U1SA 4QQDA 2EFIA 3ZFJA 2H3JA 1M1KU 5FU6B 4HCBA 4HT8A 5GAN4 2DZCA 2OTLT 4FT4A 2DXUA 3L2VA 3S3NA 4N0AA 3JCMg 1YJNT 3GF5A 3CCRA 4LDWA 2O4XA 3G4SA 2QTXA 2P0QA 2Y4XA 5CO7A 4C5HA 3CXCA 3CCLA 4XAXB 1FXXA 2JZ2A 2EQJA 2YLBA 2L3RA 1VQMA 2DIQA 3M56A 1Q81C 3CD6A 3OS0A 4ELZC 3OY9A 3VV0A 3CMEA 1G3WA 3V7RA 1VQLA 3L2QA 1QVGA 5CQXA 1VQNA 5CKFA 4N4GA 1IZ6A 4BI8B 4BDZA 3L1AA 2AHJB 1Q7YC 2A3LA 2OTJA 5D6YA 5A0LA 3P8BB 2RJDA 4QVZA 5CK9A 5HKCA 2MF2A 3INZA 4XU3A 3LH0A 2K3XA 1WQWA 4OF1A 1JB0E 2RK2A 3NFCA 4IURA 4C92C 1KG1A 3OW2S 1UEBA 3VYHB 2EJ9A 3TREA 4BB7A 5KCOA 1UGPB 4BE1A 1VQOT 1S72A 1M8VA 1UB4A 4JS4A 2GF7A 3RKXA 3BDUA 4J7IA 3X24B 2Y4YA 3JCMV 3CBMA 5FU7C 1N6AA 3RKWA 1VQNT 3QXEB 4FT2A 5CKBA 2QEXT 3JRZA 4DA4A 4A53A 4QVDA 4A4FA 5CIUA 4EMGA 3UPUA 1VQKT 3QYHB 4ATOA 4PLIA 3CCMA 1OI1A 2FB7A 4J7FA 4PKCC 4EMKA 4M7DA 5FRMA 3CCJT 3OB9A 1XTDA 2D0QB 3NTIA 4HKEA 4O5VA 4XTYA 2RHYA 4F7UF 4M7AD 2HQXA 1KQSA 3FEOA 4FL6A 2JTMA 2R5AA 5J3BA 1WPYA 2CKKA 4JJNK 2DD5A 3EFSA 2GCXA 3KXTA 4C8QB 3CBPA 2F69A 3SB2A 5KCHA 4FU6A 5J26A 3BDLA 3BY7A 3QIIA 4O6JA 1X75C 3QJYA 4R55A 5GAN6 3HFOA 3JCMf 4JRPA 4OVAA 3JB9D 1RI0A 1Y96B 4JUVA 3VKIA 5I21A 1Y07A 2Y90A 3UT1A 2EAYA 3X28B 3CMAA 5D6WA 3SWNA 2NLUA 2P0KA 2RI5A 3FJPA 2M0OA 4F7UB 2E6NA 4JRIA 2VYTA 1YI2T 4NS5A 5AYFA 4M75D 5LJ3f 3OYJA 2ZPFB 1PSEA 3OA6A 2CZ7B 2LCCA 5GAOp 3EFRA 4RG8A 2XHCA 5KH6A 3WVDB 1H641 3UWNA 4ME7A 3R6OA 3JCMX 4ELYC 1JJ2A 4HA8A 3QHSA 1VQ5A 4OB0B 3CC2A 4C5IA 3ME9A 5GAMh 4M77B 3RKYA 3A8MB 2EJGA 5DM7R 2CZ1B 4C5EA 2WSEE 5FLXE 1G5VA 2LRQA 3E1SA 3G6ET 1JBMA 2KY9A 3FRNA 4PJOA 4IUUA 1VQ8T 1I5LA 2DD4A 5IN1A 2QQBA 2DXCA 3OMCA 4RKUE 1M4ZA 5GAMe 4L6V5 1VQ4T 1KD1U 4M7DC 1WJSA 2PUKB 4ZGDB 4C0DB 3OBYA 4F7UA 1OZ3A 3HPWA 2PVDB 3ASKA 3HKSA 3PGGA 3VYGA 1Y96A 4JDSA 1YIJT 1BIAA 4M78E 1VQ7T 2KDSA 5GAN3 1N8RC 4M78B 4N4IA 3G7ZA 5GAN7 3TU4K 2RA2A 1K8AU 3L2RA 4LD6A 3J81E 4M78C 4BY6B 2X4XA 4YTLA 2QA4T 4C0GA 3OYGA 4M78G 3AHUA 2QQ9A 1V29B 1YJWT 2JUFA 2CYZB 3GNFB 4C92A 1TH7A 2FVUA 2RJFA 3DB4A 3MEVA 4C8QA 4RCBA 4DOVA 2DTIA 4L59A 3NTKA 2HBPA 3T9NA 3E19A 2M1HA 3JCMe 1BKBA 2L89A 2M9UA 3V8JA 3FDRA 4VUBA 3OYCA 4KUDK 4XTVA 1Y7XA 2DJZA 4EMKB 3JCMJ 1K9MU 1VQ6T 3A8GB 2K3YA 1WJRA 5GAN5 3L2WA 1VQPA 3PFSA 1MHNA 1D3BA 3CCUA 5GANd 2V8IA 3FLGA 1RL2A 4NOYA 3SDZA 2QXFA 1YITA 5D6XA 2C06A 3CPWS 4M7DD 3HL8A 3LGLA 3CMET 1Q7YU 4QQGA 5GAOn 2HAXA 5GMKh 3ZEHA 4DOWA 3CCST 4JRQA 4DQ2A 3L2UA 3CCVA 4JS5A 3MO8A 2OTJT 2HQEA 4X9DA 3OSVA 3FC3A 3A8OB 5A0DA 4M77D 5L8RE 3OYAA 2X4WA 2QQSA 4J8OA 3OYEA 3CCQA 4PJOD 4LDXA 1M1GA 3M4GA 4IUQA 1N8RU 2LNVA 4PLLA 3TCJA 4ZGJB 1KC8U 4M75F 3OW2A 2V8JA 1DJ7B 4F7UE 2WSCE 2QQRA 4J6WA 2XDDA 2RH2A 5GANg 4E7IA 3RMQA 4E7HA 1W2BA 1YITT 2LQ8A 4LDVA 3QBYA 4EMKC 1QVPA 3META
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4G A;  2MWP A;  3NTH A;  2DIG A;  2EQK A;  2HQX A;  3OS2 A;  2IG0 A;  3FEO A;  2L8D A;  4FL6 A;  2M16 A;  2RJC A;  2B8A A;  2R5A A;  2YRV A;  3MP6 A;  3PNW C;  2CKK A;  2GFU A;  3DB3 A;  2O4X B;  3Q1J A;  5KCH A;  4FU6 A;  4IUV A;  4QQ6 A;  5J26 A;  3BDL A;  3QII A;  3GOX A;  4E7L A;  1WGS A;  4ZTF A;  4OVA A;  3S3M A;  2RJE A;  2EKO A;  3QJ6 A;  1RI0 A;  3UT1 A;  5D6W A;  2NLU A;  2P0K A;  2RI5 A;  3L42 A;  2M0O A;  3OYN A;  4B9W A;  2E6N A;  4II1 A;  2R5M A;  2VYT A;  5KE2 A;  4NS5 A;  1H3Z A;  2E5Q A;  4PL6 A;  1XNI A;  3MEW A;  3S6W A;  4E7K A;  2BIV A;  3OYJ A;  4HCZ A;  4C5G A;  2RO0 A;  3O8V A;  3OA6 A;  3PMI A;  4A4E A;  2LVM A;  2LCC A;  3OMG A;  2X4Y A;  3KUF A;  5KH6 A;  4QW2 A;  2MWO A;  2D9T A;  2RI3 A;  2RHU A;  3MEA A;  3H8Z A;  4UC4 A;  3UWN A;  3CEY A;  3H6Z A;  2X35 A;  3ME9 A;  4C5I A;  3M9Q A;  4E7J A;  1SSF A;  4C5E A;  3P8D A;  2JTF A;  2F5K A;  2GFA A;  2LRQ A;  3OYB A;  2DAQ A;  3MP8 A;  1G5V A;  4BDY A;  3SD4 A;  4IUU A;  1WJQ A;  2RHX A;  3EAE A;  5FRO A;  5IN1 A;  1OYX A;  3OMC A;  3S3O A;  2LDM A;  2RI2 A;  2EQU A;  1WJS A;  4CRI A;  3LLR A;  3MEU A;  1OZ3 A;  4QQD A;  2EFI A;  5M9O A;  3OYH A;  3ASK A;  3P8H A;  3MP1 A;  4N4I A;  3L2V A;  3S3N A;  2PQW A;  3OS1 A;  3L2R A;  4GY5 A;  4LD6 A;  4IUP A;  2X4X A;  3OYL A;  2O4X A;  3OYG A;  2RHI A;  4BE0 A;  4C5H A;  3QKJ A;  5FRN A;  3OQ5 A;  4A4H A;  5KE3 A;  3E9G A;  2JZ2 A;  2EQJ A;  2RJF A;  2L3R A;  3DB4 A;  3MEV A;  4Q5W A;  5IAY A;  2DIQ A;  3OYI A;  4L59 A;  3OS0 A;  4Z02 A;  3NTK A;  3OY9 A;  2M1H A;  3E9F A;  5C6S A;  3OYD A;  3OYF A;  3L2Q A;  2L89 A;  3LGF A;  4B9X A;  4N4H A;  3FDR A;  4RG2 A;  4N4G A;  3OYC A;  2BUD A;  4BDZ A;  2K3Y A;  1WJR A;  2XK0 A;  3L2W A;  2FHD A;  3PFS A;  5D6Y A;  1MHN A;  1OZ2 A;  3MET A;  3LX7 A;  3FLG A;  2RJD A;  4QVZ A;  4X34 A;  4EDU A;  3LH0 A;  2K3X A;  5D6X A;  4IUT A;  1N27 A;  3LGL A;  4QQG A;  3PMT A;  4IUR A;  3ZEH A;  3C4S A;  4BAC A;  3OYK A;  4BE1 A;  5KCO A;  3L2U A;  2R57 A;  3LYI A;  3MO8 A;  2HQE A;  3FC3 A;  2GF7 A;  4IKF A;  3OYA A;  3OYE A;  2X4W A;  2EQM A;  2QQS A;  3OYM A;  5C0M A;  2LTO A;  2RHZ A;  4IUQ A;  4BD3 A;  4BE2 A;  2BKD N;  4PLL A;  5J39 A;  2R58 A;  3DLM A;  4A4F A;  5CIU A;  4PLI A;  2XDP A;  2QQR A;  1OI1 A;  4E7I A;  4ZTJ A;  3F70 A;  1KHC A;  3OB9 A;  4E7H A;  2G3R A;  3NTI A;  5FRM A;  3QBY A;  2WAC A;  2RHY A; 
#chains in the Genus database with same CATH topology
 1M90 U;  2ZAE A;  1QQJ A;  4K11 A;  2ESW A;  4RTV A;  1VYV A;  2B8A A;  3MP6 A;  1QCO A;  3M58 A;  2YRC A;  2KAF A;  3HTR A;  2K2V A;  5CVI A;  4IUV A;  1YHQ T;  4JZ3 A;  1G83 A;  2QK0 A;  4J6Y A;  1VQ8 A;  2EKH A;  1YJ9 T;  4XK8 E;  2OTL A;  1M5Q 1;  2CT4 A;  4TVR A;  3CCE A;  4II1 A;  1D09 B;  2DXB A;  4PJO B;  2L0A A;  2LZ6 B;  2X4Y A;  1I07 A;  2D9T A;  3VUB A;  4M7A F;  5GAN f;  3OYB A;  2DAQ A;  1TXQ A;  1VIE A;  1MMA A;  1NE8 A;  4C8Q G;  2A7Y A;  1M90 R;  3X25 B;  1R8O B;  5KYY A;  3VS7 A;  2RK1 A;  3JCM c;  4Y91 A;  1I4K 1;  2FZG B;  2YUQ A;  3CCS A;  4MMK A;  4BE0 A;  2ZPG B;  2E3H A;  4EIK A;  2RMO A;  3X20 B;  3JCM W;  4RUG A;  1VQK A;  1UGS B;  1VQ7 A;  2J6F A;  1VQ4 Q;  4C92 B;  4M75 C;  3RNJ A;  5LJ5 h;  5IHK A;  2ROL A;  4ESR A;  4RG2 A;  1IO6 A;  2RQU A;  3G6E Q;  2CUB A;  4MDW A;  2JT4 A;  1YJW A;  2K4Y A;  1N9S A;  2J06 A;  1WYX A;  4HCC A;  5KYY B;  1OZ2 A;  2M0Y A;  4X34 A;  2LQK A;  1X27 A;  4RCC A;  4JZ4 A;  2EVR A;  4BAC A;  1AHJ B;  1KD1 R;  3JB9 H;  5GAO r;  4XU0 A;  1UFF A;  4FW1 A;  3RBB B;  4PJO D;  3TVT A;  2RHZ A;  4OB3 B;  1G3Y A;  3A5Z B;  3CCR T;  2HKQ B;  1QP3 A;  1TUG B;  4LXC A;  3V8L A;  1JRI A;  5LJ3 g;  1MMN A;  2G3R A;  3CCM T;  5KYU B;  1M2O A;  4LDY A;  2VB6 A;  2RB6 A;  5KYX B;  2ABL A;  4M7A E;  1V1C A;  5A0G A;  2RM4 A;  1KSW A;  2EYW A;  1VQN Q;  1A0N B;  2BTT A;  1KQ2 A;  1Q7Y R;  4MDX A;  2JM9 A;  2X3W D;  1UJY A;  4M7D B;  4HCZ A;  1AD5 A;  1R0B G;  5KYN A;  2QEX A;  1N9R A;  4UC4 A;  2RHU A;  1KQ1 A;  4FW2 A;  1XQH A;  2CS7 A;  4Y28 E;  4PJN A;  1KC8 R;  3H0F A;  4A4K A;  2JVV A;  3JCM h;  2H8H A;  2RD1 A;  1QKX A;  3QZ9 B;  3VU3 C;  3H0H A;  3S3O A;  2RI2 A;  3LH5 A;  1UGV A;  4JRK A;  3M59 A;  3I56 T;  1Q82 U;  2JOY A;  2PQW A;  1QVG S;  3OYL A;  4OMF B;  2CSQ A;  2E1H A;  3QKJ A;  2E41 A;  3FIF A;  2DK3 A;  3E9G A;  4C0D C;  5GMK i;  4M78 D;  5HCK A;  1B7T A;  3E9F A;  2CDT A;  3TSZ A;  3OYY A;  3JB9 F;  3EGD A;  1RAG B;  3G71 A;  3CC7 A;  2BUD A;  3QWX X;  2KGT A;  2BE9 B;  3C12 A;  1RAE B;  2NYS A;  2QA4 Q;  1WZO A;  4IIM A;  1BI3 A;  2VUB A;  2E5K A;  1IRE B;  1LJO A;  4ANJ A;  4PJM A;  3C4S A;  3OSS C;  1U8R A;  1NPP A;  1IXD A;  4XTX A;  3CCL T;  1X2K A;  3CBO A;  2DL5 A;  4JLG A;  2K3B A;  2DPP B;  3V7C A;  3KFV A;  5IT9 E;  2MWP A;  3NTH A;  1ARK A;  1RUW A;  4M7A G;  2EWN A;  2L8D A;  1GL5 A;  3C94 A;  5CAI A;  1YI2 Q;  1VQ9 A;  5HK3 A;  2CH4 W;  1WXT A;  4J9H A;  5EG2 A;  4E7L A;  5GJV B;  2RJE A;  4DBF A;  2YLC A;  1O9S A;  1EIF A;  2YHT A;  2ZPH B;  4KBM B;  2K5F A;  2CP3 A;  2JW4 A;  2AT1 B;  2R5M A;  4HT9 A;  4PL6 A;  1H8K A;  1RAI B;  1XNI A;  3VRY A;  4QVC A;  1X2Q A;  3PMI A;  3UAT A;  2HD0 A;  4J83 A;  1JXO A;  3OMG A;  1BK2 A;  3TEE A;  5ECA A;  3M9Q A;  3PIO A;  1S1N A;  1WHL A;  1YIJ A;  3O5Z A;  2BZ8 A;  1WJQ A;  2JN0 A;  3LW5 E;  4L5G A;  1WHJ A;  3LWI A;  1I0C A;  1G3T A;  1HYO A;  3ZFJ A;  2KE9 A;  4M4Z A;  5FU6 B;  4PJL A;  2DZC A;  1SKU B;  1NEB A;  4N0A A;  3FJ5 A;  3CCR A;  2EW3 A;  3G4S A;  3CXC A;  1FXX A;  4KRT A;  1VQM A;  2DIQ A;  4OML A;  1Q81 C;  1QVG P;  4AFQ C;  3VV0 A;  3CCU Q;  5CKF A;  4N4G A;  3JV3 A;  4BDZ A;  1ABQ A;  1PM3 A;  1Q7Y C;  2A3L A;  5HKC A;  2VVK A;  2MF2 A;  2K3X A;  1WQW A;  4OF1 A;  1NG2 A;  1KG1 A;  2MYS A;  4FSS A;  2ROT A;  3TRE A;  4BB7 A;  1UGP B;  1UB4 A;  1D0Y A;  2JMA A;  3RKX A;  1M3A A;  1N6A A;  1VQN T;  1T3L A;  2LQN A;  4QVD A;  5CIU A;  4PJJ A;  3UPU A;  3CCM A;  4HKE A;  4O5V A;  3M0S A;  3FEO A;  1RAA B;  2R5A A;  5J3B A;  1WPY A;  1ZUU A;  3EFS A;  3KXT A;  2OJ2 A;  2F69 A;  4FU6 A;  1YCS B;  3BY7 A;  3QJY A;  3E2U A;  1G2B A;  1Y07 A;  3UT1 A;  4F04 B;  3FJP A;  4F7U B;  1ACM B;  1GBR A;  2ENM A;  2LQW A;  4CC7 A;  3OYJ A;  1PWT A;  3WVD B;  1H64 1;  1VQ5 A;  2HBW A;  3JCM X;  3RKY A;  3A8M B;  2CZ1 B;  3ZL7 C;  2LJ0 A;  1VQL Q;  3E1S A;  3FRN A;  2J05 A;  1PNJ A;  4F7U A;  1N8R R;  3ASK A;  3VYG A;  2KDS A;  1N8R C;  3G7Z A;  1RI9 A;  2NUZ A;  4BY6 B;  4C0G A;  3OYG A;  1OX8 A;  1TH7 A;  2FVU A;  2RJF A;  3MEV A;  3UA7 A;  4C8Q A;  4DOV A;  1H92 A;  1NEG A;  3JCM e;  4KUD K;  3OYC A;  1K9M U;  1NLP C;  3CCU A;  3UA6 A;  4NOY A;  2OX7 A;  2C06 A;  3LGL A;  4QQG A;  2HMA A;  4DOW A;  1D0X A;  3VS0 A;  4Z88 A;  4AMC A;  1W70 A;  2HQE A;  3OSV A;  3FC3 A;  3A8O B;  4IKF A;  2QQS A;  1M1G A;  3EFO A;  4OMM A;  4J9G A;  1DJ7 B;  4F7U E;  1OV3 A;  1OX9 A;  2QQR A;  2RH2 A;  5GAN g;  4LDV A;  1JU5 C;  2XI9 A;  4M75 E;  2LC4 A;  2GQI A;  3JSC A;  1SPK A;  1VQ9 T;  1CSK A;  4XU2 A;  2VXF A;  2JXB A;  1GCQ C;  3QJ6 A;  2VC8 A;  2JNG A;  1FYN A;  4M7A C;  4B9W A;  1KJW A;  1TTH B;  3EHR A;  1AZG B;  2DL3 A;  4JJB A;  5KYW A;  1ZQ1 A;  3BW1 A;  3QSU A;  4M75 G;  4AT1 B;  1OU8 A;  4ZN1 A;  2KSS A;  2DNU A;  3P8D A;  1ZHI A;  4XTU A;  1MMG A;  3VRZ A;  3SD4 A;  1M90 C;  2CH4 A;  1HK9 A;  4XQ3 A;  2LJ3 A;  1X01 A;  2EQU A;  4C0Z A;  3GIB A;  2VXE A;  2E64 A;  5IHI A;  2VGN A;  4GLK A;  3VJP A;  2I2L A;  3OYH A;  1S72 Q;  4M75 A;  1J3T A;  1NBE B;  3MP1 A;  1AZE A;  2EYZ A;  5CKE A;  3G4S T;  1PKS A;  2W0Z A;  2RHI A;  1GFD A;  3R6N A;  5DLQ E;  2EJF A;  2HSE B;  3OYI A;  1UE9 A;  3QG1 A;  5C6S A;  4PK4 A;  2QA4 A;  1K73 R;  1VQL T;  2HKN A;  2E70 A;  3I56 A;  3HRS A;  3EHQ A;  2DKG A;  4EDU A;  1N27 A;  3HFN A;  2PVO B;  3PMT A;  3VS4 A;  4BI4 A;  4ORZ A;  1TS9 A;  1QWF A;  1GCQ A;  1KD1 C;  3LYI A;  3J7A F;  1UDL A;  4AFU C;  3JCM P;  3A8L B;  3PT9 A;  4F7U G;  4CI0 C;  1YIT T;  2DMO A;  5C0M A;  4BE2 A;  3VS2 A;  5GAM d;  2KMT A;  1KQS S;  1LPL A;  2W10 A;  3MJX A;  2K57 A;  1LNX A;  2O9S A;  2XDP A;  3QDR B;  3PTA A;  1HXD A;  1AVZ C;  3JB9 G;  2HSP A;  2O31 A;  9ATC B;  1BCO A;  3OS2 A;  4V2S A;  4JLI A;  1QVF A;  2RJC A;  4KUI A;  3BFM A;  1D1C A;  4E7S A;  1CKA A;  4C8Q F;  2KXC A;  2DEQ A;  2DLP A;  4RTX A;  2SRC A;  4ZTF A;  1PSF A;  3M53 A;  2EKO A;  2QEX Q;  2A37 A;  2KYM A;  2E65 A;  5GAN h;  2FRY A;  2KRN A;  5IXF A;  3ZBD A;  1YCY A;  3V8K A;  4OB1 B;  2ZPI B;  1AT1 B;  1BCM A;  3H8Z A;  3DKM A;  2MOX A;  1KC8 C;  1MGQ A;  1WX6 A;  5LJ5 j;  1NPR A;  2A36 A;  3CCU T;  3WVE B;  4D6W A;  1WLP B;  1JJ2 S;  1IHV A;  2VWF A;  2MCN A;  4KH0 B;  1OUL A;  1KHI A;  1G3S A;  5LJ5 g;  4OGC A;  4OMP A;  3OS1 A;  2I0N A;  1K76 A;  1PKT A;  2JJ9 A;  4JJD A;  4KUL A;  5FRN A;  2LX7 A;  2B86 A;  3N5B B;  3CPW A;  5KYU A;  2L3P A;  3THK A;  4J9B A;  2MAM A;  2SEM A;  3I9Q A;  4PFZ A;  1YJW Q;  1XJW B;  2XK0 A;  2LT4 A;  4D8K A;  3LX7 A;  2X4J A;  5CR2 A;  2YSQ A;  3RMS A;  3CXC P;  1VQ7 Q;  2RF0 A;  3RIR A;  3OYK A;  5GAM f;  1QLY A;  2QI2 A;  2DRK A;  2XID A;  4J9D A;  2EQM A;  3QO3 A;  3I55 Q;  4M78 F;  1M2V A;  4FIB A;  3RER A;  2E12 A;  5D7U A;  3QWY A;  4E47 A;  3M55 A;  4PFO A;  1PRM C;  1D3B B;  2L3S A;  2EQK A;  3EGX B;  2KQW A;  2FPE A;  5LJ3 e;  1AOJ A;  2DYI A;  2ZZD A;  2EPD A;  3CMA T;  2LT1 A;  3EG9 A;  2IVW A;  1W2B S;  2ZCF B;  2D1X A;  4X1V A;  1K8A R;  3SFM A;  2F5T X;  3M54 A;  1BI0 A;  3J80 E;  2HNI A;  5FU6 C;  2CGH A;  5GMK j;  3RR6 A;  4M77 G;  2MWO A;  2F2X A;  4R0K A;  2LCL A;  1NLO C;  2ZGW A;  3CQT A;  1SSF A;  1WHK A;  3NMZ C;  2JTF A;  1ZSZ C;  2BZX A;  5CCA A;  4R56 A;  2PTK A;  1QW1 A;  1QP2 A;  2DZ9 A;  2NUT A;  2VAS A;  4P5N A;  1PD0 A;  4ZGE B;  1VQO Q;  2AK5 A;  2V1R A;  2FYK A;  1U1S A;  4QQD A;  2EFI A;  4HT8 A;  4A63 B;  2DXU A;  2QAZ A;  5KYX A;  3JCM g;  4CC4 B;  2QTX A;  2Y4X A;  5CO7 A;  4C5H A;  4XAX B;  1Q81 R;  3I56 Q;  2L3R A;  4HVV A;  3CD6 A;  4ELZ C;  3CME A;  1VQL A;  3L2Q A;  1MV0 B;  5CQX A;  4OMO A;  3L1A A;  1JQQ A;  4FYV B;  2OTJ A;  5CK9 A;  2RJD A;  2EGC A;  4C92 C;  2KRM A;  4BE1 A;  1S72 A;  5KCO A;  1VQO T;  2GF7 A;  2HEQ A;  2Y4Y A;  2YDL A;  2EGE A;  2QGG A;  3RKW A;  5CKB A;  4PFP A;  4DA4 A;  4A53 A;  2CP7 A;  2DL7 A;  4J7F A;  4EMK A;  1XTD A;  2D0Q B;  2RHY A;  2HQX A;  3EH1 A;  2KT1 A;  4JJN K;  2ED0 A;  3CCM Q;  4GBQ A;  1EX4 A;  5J26 A;  4Z8A A;  3QII A;  1X75 C;  3HFO A;  3JCM f;  2HL3 A;  4OVA A;  2J6O A;  3VKI A;  2EAY A;  3X28 B;  2NLU A;  2E6N A;  4JRI A;  2VYT A;  2DBM A;  3OA6 A;  4J9C A;  4E2F B;  2CZ7 B;  2LCC A;  3EFR A;  2FZK B;  3UWN A;  4ME7 A;  4ELY C;  3QHS A;  2J6K A;  3SHW A;  4M77 B;  2EJG A;  2RN8 A;  2AZV A;  4C5E A;  1G5V A;  1UTI A;  2KR3 A;  3G6E T;  1JBM A;  2KY9 A;  4PJO A;  2LNH B;  4AFS C;  4IUU A;  1VQ8 T;  2DD4 A;  5IN1 A;  1ZUK A;  1M4Z A;  1VQ4 T;  2O88 A;  1VQM Q;  4M7D C;  4AG1 C;  2PUK B;  4ZGD B;  4C0D B;  3OBY A;  1OZ3 A;  2PVD B;  3EG1 A;  1YIJ T;  5GAN 7;  3TU4 K;  1M3B A;  2ECZ A;  1K8A U;  1Z9Q A;  3L2R A;  2K2M A;  3J81 E;  4M78 C;  3EG3 A;  1F1B B;  1Q95 G;  1ZSG A;  8AT1 B;  3AHU A;  1YJW T;  1TUC A;  2JUF A;  2CYZ B;  2EYX A;  5GJW B;  1VYT A;  4RCB A;  3M0P A;  1JEG A;  2YUP A;  4HCK A;  3T9N A;  4XTV A;  1Y7X A;  2DJZ A;  3JCM J;  2COZ A;  1UUE A;  1WJR A;  1RAD B;  3PVQ A;  3FLG A;  1RL2 A;  2HL5 C;  3HL8 A;  2HAX A;  2DF6 A;  3ZEH A;  3NHN A;  3CCS T;  1SHF A;  4DQ2 A;  3L2U A;  5A0D A;  4M77 D;  4J8O A;  1VOM A;  4LDX A;  2RQV A;  1U06 A;  2P84 A;  2LNV A;  4PLL A;  1RAF B;  4M75 F;  2V8J A;  2WSC E;  4J6W A;  4E7H A;  2LQ8 A;  4EMK C;  4M75 D;  5LJ3 f;  3MET A;  1LVK A;  2CP5 A;  3NPF A;  4LUD A;  3C0C A;  2WSF E;  3CCJ A;  2KT8 A;  3EH2 A;  3PE0 A;  3QPH A;  1AWJ A;  1P92 A;  4C8Q D;  3LWH A;  2YUO A;  3S3M A;  1ZBJ A;  4M7D F;  1QVF S;  2YRD A;  1AWW A;  3L42 A;  3MPU B;  1WA7 A;  3JCM b;  2DTH A;  2OTJ Q;  3S6W A;  2EIF A;  4EMH A;  3PIP A;  1UEC A;  2KK4 A;  2MIO A;  1QVF P;  2LJ1 A;  4QW2 A;  3CME Q;  5GAO q;  4X9C A;  3GNG A;  4RTY A;  3G71 Q;  3CC7 Q;  4C92 D;  2L3Q A;  2O01 E;  1M3C A;  4PNO A;  2X9H A;  1U3O A;  5LJ5 e;  1B34 A;  4DBR A;  2PU9 B;  2KRO A;  1OYX A;  2AZS A;  2C0O A;  2JM8 A;  2LDM A;  1VQ5 T;  2KEA A;  3TSW A;  3AT1 B;  3DLL A;  4NL2 A;  1PD1 A;  5M9O A;  1VQO A;  2MI6 A;  4BY6 C;  1ZA2 B;  1ZLM A;  1YWO A;  1GXI E;  3GP8 A;  5CKD A;  5LJ3 d;  4WF2 A;  2FL7 A;  3CCV T;  5KE3 A;  4A4H A;  4RTU A;  4FCY A;  3M5A A;  4KT0 E;  2VV5 A;  4Z02 A;  5CKH A;  1K73 C;  3OYF A;  2OAU A;  3M57 A;  1E6G A;  3A1P A;  1K1Z A;  3HRT A;  2DFU A;  1WHG A;  1TSF A;  2FHD A;  3C95 A;  2OAW A;  5FWB A;  3EG0 A;  3G4S Q;  3HRU A;  2DET A;  1BIB A;  1M2V B;  4MZP A;  1QWE A;  1S72 T;  4PJO C;  1D0Z A;  1K4U S;  2X51 A;  4J5Y A;  3OYM A;  3MHX A;  1VQN A;  3CPF A;  1ZUY A;  3FB9 A;  3V7S A;  1M9S A;  3G71 T;  3CC7 T;  1B3Q A;  3OBW A;  3URG A;  3F70 A;  1D1A A;  2IPO B;  4KH1 B;  2XG8 D;  4A4G A;  1BI2 A;  4OMN A;  2GNC A;  3I55 A;  1M1K R;  3DB3 A;  4M7A B;  1M1K C;  5LJ5 d;  1KK7 A;  5CQY A;  1FMV A;  2GTO A;  3ER0 A;  5DLO A;  1QCF A;  1T3S A;  1X43 A;  2DER A;  2DYB A;  2ATC B;  2XU8 A;  5I22 A;  2VKN A;  4ZN3 A;  4GLM A;  2E5Q A;  1VQ9 Q;  2AIR B;  3MEW A;  5IXB A;  1R77 A;  1ZX6 A;  2L5Q A;  3VS3 A;  4C5G A;  4M7D E;  2DBK A;  1X6O A;  2KI7 A;  1YJ9 A;  3KUF A;  2GQV A;  1TG0 A;  1Q86 U;  1MUZ A;  4M77 C;  2QQA A;  1PHT A;  3G6E A;  2F1L A;  5FRO A;  2MMP A;  5FU7 B;  4CRI A;  1SRL A;  4PJO E;  2HCK A;  4CC3 A;  3CCS Q;  3RES A;  1KIK A;  2JS0 A;  2DE0 X;  3CCQ T;  3A8H B;  4LDU A;  1M27 C;  4GY5 A;  1R0C B;  3HHT B;  4C92 G;  2DRM A;  1C1A A;  2FZC B;  4Q5W A;  2DL8 A;  1RAC B;  4OP0 A;  3RUX A;  3MCA B;  1Y71 A;  5I2M A;  4RTZ A;  2HZY A;  4LN2 A;  2AKK A;  5GMK e;  1Y57 A;  1M30 A;  1FWZ A;  5LJ3 h;  2DO3 A;  2H3E B;  3JB9 I;  1TOV A;  2NUP B;  1ZSZ A;  1K0S A;  2CZ0 B;  4A54 A;  3CCE Q;  4FYW B;  2A0F B;  1WNL A;  3HSB A;  2ZPE B;  4C92 E;  2LTO A;  1VQ8 Q;  1W1F A;  1O75 A;  4EPC A;  4ZTJ A;  1KHC A;  2PZ1 A;  2WAC A;  1U5S A;  1MND A;  3M0U A;  1W2B P;  5GAM j;  2JTE A;  1VQ6 A;  1GFC A;  2HQH A;  2GFU A;  1UJ0 A;  1K8A C;  2QDY B;  1G8X A;  1PCX A;  3CC4 Q;  3GOX A;  1WGS A;  2DL4 A;  3EG9 B;  3EGX A;  2QYZ A;  4M7D G;  4XTW A;  2CUD A;  3JCM d;  1BBZ A;  2RO0 A;  3O8V A;  4KGZ B;  3ULR B;  5GAN e;  1UGR B;  1K9M R;  4FYY B;  1BI1 A;  3X26 B;  2XIC A;  1K9M C;  3OW2 P;  2PVG B;  2VGM A;  1LCK A;  2QAS A;  2QTV A;  1YBY A;  1T0J A;  1RLP C;  2M51 A;  5I2S A;  3LLR A;  3L2Z A;  1ZBX A;  3QDF A;  4HCB A;  3M0T A;  1M1K U;  2H3J A;  1SSH A;  4Y92 A;  5GAN 4;  2X3X D;  1KFZ A;  4FT4 A;  3L2V A;  2GTJ A;  2GBQ A;  1YJN T;  3CCQ Q;  3GF5 A;  3EGD B;  2O4X A;  1GCP A;  3CCL A;  2YLB A;  2EQJ A;  3EGU A;  2QGF B;  1WXU A;  1G3W A;  2LCS A;  1PRL C;  1IZ6 A;  2AHJ B;  4ZNX A;  3P8B B;  4QVZ A;  3INZ A;  2DVJ A;  4XU3 A;  3LH0 A;  1WDX A;  1K9A A;  3VS1 A;  3H41 A;  3EFO B;  1IB8 A;  3G1J A;  2C0T A;  2EJ9 A;  3VS6 A;  4JS4 A;  2K9G A;  4J7I A;  2D8J A;  3H0I A;  2C0I A;  3X24 B;  1JJ2 P;  5FU7 C;  3QXE B;  4FT2 A;  1BB9 A;  3JRZ A;  2CSI A;  3QYH B;  4PLI A;  1OI1 A;  4PKC C;  5FRM A;  1EZZ B;  4XTY A;  4F7U F;  2DX1 A;  1IRX A;  1KQS A;  2QDL A;  2KBT A;  4FL6 A;  5AT1 B;  2CKK A;  2EGA A;  3REB B;  2GCX A;  4C8Q B;  2YXY A;  3SB2 A;  5KCH A;  4WTO B;  4F16 A;  5GAN 6;  1RI0 A;  1Y96 B;  4JUV A;  2L2P A;  3CMA A;  5D6W A;  1YN8 A;  1YFN A;  2P0K A;  2RI5 A;  1WFW A;  2M0O A;  1YI2 T;  4NS5 A;  5AYF A;  3CMA Q;  5GAO p;  2XHC A;  5KH6 A;  1JJ2 A;  4HA8 A;  4OB0 B;  2EBP A;  4C5I A;  5GAM h;  5DM7 R;  2CP2 A;  2RPN A;  4RTW A;  4DBH A;  2LRQ A;  2J7I A;  4QT7 A;  1RLQ C;  2MPX C;  2AKL A;  2QQB A;  3OMC A;  2EQI A;  4RKU E;  5GAM e;  2A08 A;  3M0Q A;  1KD1 U;  1KQS P;  1WJS A;  2XMF A;  2HDA A;  4RTT A;  3HPW A;  3UF4 A;  3HKS A;  3PGG A;  1Y96 A;  4M78 E;  1VQ7 T;  5GAN 3;  4M78 B;  2F2V A;  2RA2 A;  4Z89 A;  4LD6 A;  2X4X A;  4YTL A;  1MMD A;  3U23 A;  3GNF B;  3DB4 A;  3REA B;  2YT6 A;  4L59 A;  1VQ5 Q;  2DIL A;  2YWW A;  2L89 A;  3V8J A;  3FDR A;  4VUB A;  1X6G A;  1VQ6 T;  3A8G B;  5GAN 5;  3L2W A;  1NYF A;  1VQP A;  3PFS A;  1MHN A;  1D3B A;  2V8I A;  1ABO A;  4M7D D;  3CME T;  1Q7Y U;  5GAO n;  2YUN A;  1VA7 A;  3CCV A;  2Z0W A;  1MV3 A;  3OYE A;  1OU9 A;  2X4W A;  3CCQ A;  4IUQ A;  1GRI A;  2M02 A;  4ZGJ B;  1KC8 U;  3OW2 A;  1OPL A;  5L23 A;  2XDD A;  4E7I A;  1OOT A;  1UHC A;  3NGP A;  3QBY A;  1QVP A;  1Q81 U;  2DIG A;  4M7A A;  2PNI A;  4M77 F;  4MZM A;  2O4X B;  1PC0 A;  1OQK A;  1Q82 C;  3I35 A;  1JXM A;  4FSX A;  4AFZ C;  2KVQ G;  2KXD A;  1Q82 R;  1SG5 A;  4HVU A;  4PJO G;  5LJ5 f;  2DJQ A;  5GAO m;  2K79 A;  3OYN A;  1B07 A;  1H3Z A;  4E7K A;  3JAM E;  1WHM A;  4A4E A;  1MNE A;  3CC4 A;  3MEA A;  3CEY A;  4IIO A;  3VS5 A;  4C8Q E;  5GAN 2;  2F5K A;  2ED1 A;  1VQ6 Q;  1IGQ A;  2RNA A;  3CCR Q;  4BDY A;  3QZ5 B;  5IH2 A;  3MEU A;  3M4Y A;  2DTO A;  5HK0 A;  3PVL A;  4KGX B;  1YJN A;  4QKU A;  1I81 A;  1U1T A;  2RQT A;  3QYG B;  1YIJ Q;  2CZ6 B;  2CT3 A;  3OQ5 A;  4C8Q C;  4N0A C;  1NM7 A;  5IAY A;  5LL6 S;  1VQM T;  2E3I A;  3JB9 J;  3EG2 A;  1JO8 A;  3LGF A;  4B9X A;  1UG1 A;  3CXC S;  1B34 B;  1V76 A;  4NL3 A;  4DEY A;  4IUT A;  2E4H A;  4J6X A;  4F14 A;  3UDC A;  6AT1 B;  4J9E A;  2R57 A;  5HY6 A;  2LMJ A;  4KGV B;  1YI2 A;  4M77 A;  1LOJ A;  4XU1 A;  4BD3 A;  2BKD N;  1Q86 R;  1OPK A;  1Q86 C;  3DLM A;  4PJO F;  1OEB A;  2LX9 A;  5A2Q E;  1BYM A;  5EC7 A;  5GMK l;  2IG0 A;  2BE7 D;  4C92 F;  3SEM A;  3SWN B;  4OMQ A;  3VUZ A;  4BI3 A;  3OS5 A;  2K5I A;  4QQ6 A;  1AWX A;  5GAO l;  3HP9 A;  2LP5 A;  1WQ7 A;  1YJ9 Q;  1PG5 B;  1YHQ Q;  3RDV A;  5KE2 A;  3SWN C;  2OI3 A;  4RMO A;  3CPW P;  2RQR A;  4F17 A;  2DVE A;  2XKO C;  4M75 B;  3BE3 A;  1BU1 A;  1C6V X;  1QMC A;  4CC2 A;  3WXM B;  1X69 A;  3H6Z A;  4LNP A;  4E7J A;  4C0F A;  4M77 E;  1M1F A;  2V8K A;  2DEU A;  4WCI A;  3MP8 A;  1GBQ A;  3EAE A;  3A98 A;  4JJC A;  1IGU A;  5DY9 A;  2KNB B;  1NJI U;  4MZT A;  4LD9 K;  1X6B A;  3CD6 T;  3P8H A;  1YJN Q;  2ZPB B;  1W4S A;  2EYY A;  3IQL A;  4IUP A;  2PUO B;  4M78 A;  3GLX A;  3OYD A;  2EYQ A;  3CC2 T;  4N4H A;  2IIM A;  1VQP T;  2D6F A;  4DEX A;  3H9N A;  5GMK m;  1TUD A;  1Z9Z A;  2DXT A;  1YNZ A;  2KYB A;  2XDB A;  2P0P A;  4DBQ A;  1NJI R;  4J9F A;  5LJ3 j;  1NJI C;  1VIF A;  5J39 A;  4BUG A;  2R58 A;  3CC4 T;  3KBG A;  2K7A A;  3QUI A;  1WHH A;  4OB2 B;  5GAN j;  5GAN 8;  1N5Z A;  2D0N A;  1CKB A;  2E6Z A;  2P4T A;  5GAM g;  2M16 A;  2V1Q A;  2YRV A;  3PNW C;  3GPL A;  1VUB A;  1K73 U;  2K5L A;  1WI7 A;  3Q1J A;  2COW A;  3JCM Q;  1YHQ A;  1M8V A;  3I55 T;  1SF9 A;  3CCE T;  2BIV A;  4OGE A;  2FEI A;  4XTZ A;  3TQ7 P;  2LVM A;  2DM1 A;  1I8F A;  2RI3 A;  1UGQ B;  2FRW A;  1VQ4 A;  3CCJ Q;  2E10 A;  2X35 A;  4FM4 B;  1I1J A;  1NZ9 A;  1VQK Q;  2GFA A;  3I5R A;  1E6H A;  2JMC A;  1IHW A;  2RHX A;  4MML A;  2K6D A;  3M0R A;  5KYW B;  2XD0 A;  1VYU A;  1FX7 A;  1H3H A;  1XOV A;  4J9I A;  1FMW A;  4AG2 C;  8ATC B;  2OTL T;  3D7S B;  3S3N A;  4LE9 A;  4LDW A;  2P0Q A;  2JZ2 A;  3M56 A;  3OS0 A;  3OY9 A;  2DA9 A;  3V7R A;  1QVG A;  3I5S A;  4BI8 B;  2NUT B;  1K0X A;  1SEM A;  5D6Y A;  5FWC A;  5A0L A;  1NYG A;  2OTL Q;  7AT1 B;  1JB0 E;  2RK2 A;  3NFC A;  4IUR A;  2CP0 A;  3OW2 S;  1UEB A;  1ZA1 B;  3VYH B;  5IHN A;  1QKW A;  3BDU A;  3JCM V;  3CBM A;  1UHF A;  2FPF A;  2QEX T;  4ATO A;  4A4F A;  4EMG A;  1VQK T;  2FB7 A;  4M7D A;  2QG9 B;  3CCJ T;  3OB9 A;  4JPB W;  3NTI A;  2GGR A;  2F2W A;  1RAB B;  2O9V A;  4M7A D;  1HJD A;  1WIE A;  4FYX B;  4E7Z A;  2JTM A;  1EFN A;  2A28 A;  1QCN A;  2DD5 A;  4E6R A;  3CBP A;  4R55 A;  3BDL A;  4O6J A;  4JRP A;  1Y0M A;  3JB9 D;  5I21 A;  1YP5 A;  2CP6 A;  2Y90 A;  3SWN A;  4HXJ A;  2MK5 A;  1YWP A;  1YIT Q;  4HVW A;  1AWO A;  2ZPF B;  1PSE A;  4RG8 A;  1ZSZ B;  1E7O A;  2COY A;  3R6O A;  3CC2 A;  2NUP A;  3ME9 A;  2WSE E;  5FLX E;  2D8H A;  2V26 A;  3MKD A;  1I5L A;  1FMK A;  2DXC A;  2FPD A;  4L6V 5;  3CCL Q;  1M8M A;  4LUE A;  3CCV Q;  4JDS A;  4B6M A;  1BIA A;  4N4I A;  2P4R A;  4D8D A;  1I5O B;  1WXB A;  2QA4 T;  4M78 G;  1V29 B;  2QQ9 A;  2KRS A;  1VQP Q;  4C92 A;  2DTI A;  3CC2 Q;  2G6F X;  2HBP A;  3NTK A;  3E19 A;  2M1H A;  2FO0 A;  1BKB A;  2M9U A;  2CRE A;  4EMK B;  2BZY A;  1C0M A;  2K3Y A;  2NWM A;  1RAH B;  5GAN d;  1YIT A;  3SDZ A;  2QXF A;  2RQW A;  1AEY A;  5D6X A;  2FG0 A;  3CPW S;  5I11 A;  5GMK h;  3CD6 Q;  2JS2 A;  1D1B A;  4JRQ A;  1HSQ A;  1T0H A;  4JS5 A;  3GBQ A;  3MO8 A;  2OTJ T;  4X9D A;  5L8R E;  3OYA A;  3M4G A;  1N8R U;  1W6X A;  2O2O A;  1SRM A;  3TCJ A;  1TU0 B;  1HD3 A;  1SHG A;  5FW9 A;  3RMQ A;  1W2B A;  1TWB A; 
#chains in the Genus database with same CATH homology
 1M90 U;  1Q81 U;  2DIG A;  4M7A A;  2XI9 A;  4M75 E;  2LC4 A;  3JSC A;  2B8A A;  3MP6 A;  4M77 F;  3M58 A;  4MZM A;  1VQ9 T;  2KAF A;  2WSF E;  2O4X B;  2K2V A;  3CCJ A;  4XU2 A;  1Q82 C;  4C8Q D;  5CVI A;  2VXF A;  3QPH A;  4IUV A;  1P92 A;  1YHQ T;  3LWH A;  4FSX A;  2KVQ G;  4J6Y A;  3S3M A;  1VQ8 A;  3QJ6 A;  1YJ9 T;  4M7D F;  4XK8 E;  1QVF S;  2OTL A;  4PJO G;  5LJ5 f;  5GAO m;  1M5Q 1;  2VC8 A;  3L42 A;  2JNG A;  3OYN A;  4TVR A;  4B9W A;  4M7A C;  3CCE A;  4II1 A;  1H3Z A;  3JCM b;  2DTH A;  3S6W A;  2EIF A;  2DXB A;  4E7K A;  4EMH A;  3PIP A;  4PJO B;  2KK4 A;  3JAM E;  4A4E A;  1ZQ1 A;  2X4Y A;  3CC4 A;  4QW2 A;  2D9T A;  3MEA A;  5GAO q;  3VUB A;  4M7A F;  5GAN f;  3BW1 A;  4X9C A;  3CEY A;  3GNG A;  4M75 G;  3QSU A;  4C8Q E;  4ZN1 A;  5GAN 2;  2KSS A;  3P8D A;  4C92 D;  1ZHI A;  2F5K A;  2O01 E;  4XTU A;  3OYB A;  2DAQ A;  1VIE A;  4PNO A;  4BDY A;  3SD4 A;  5LJ5 e;  1M90 C;  1B34 A;  1NE8 A;  2PU9 B;  3QZ5 B;  1HK9 A;  4XQ3 A;  4C8Q G;  2A7Y A;  1OYX A;  3X25 B;  2LDM A;  1X01 A;  1R8O B;  1VQ5 T;  2EQU A;  4C0Z A;  3GIB A;  2VXE A;  2E64 A;  2VGN A;  3MEU A;  4GLK A;  3VJP A;  4NL2 A;  3DLL A;  2I2L A;  2RK1 A;  3OYH A;  5M9O A;  3M4Y A;  1VQO A;  4M75 A;  2MI6 A;  4BY6 C;  2DTO A;  5HK0 A;  3MP1 A;  1YJN A;  5CKE A;  3JCM c;  4Y91 A;  1I4K 1;  1I81 A;  1GXI E;  3G4S T;  1U1T A;  3QYG B;  5CKD A;  5LJ3 d;  4MMK A;  3GP8 A;  3CCS A;  4BE0 A;  2RHI A;  2ZPG B;  4WF2 A;  2FL7 A;  2EJF A;  5DLQ E;  2CZ6 B;  3OQ5 A;  3X20 B;  4A4H A;  4C8Q C;  5KE3 A;  3CCV T;  4N0A C;  5IAY A;  3OYI A;  3JCM W;  1VQK A;  1UGS B;  3M5A A;  1VQ7 A;  4KT0 E;  5LL6 S;  2VV5 A;  4Z02 A;  1VQM T;  3QG1 A;  5CKH A;  4C92 B;  3JB9 J;  1K73 C;  4M75 C;  5C6S A;  3OYF A;  2OAU A;  4B9X A;  3LGF A;  3M57 A;  5LJ5 h;  2QA4 A;  4RG2 A;  3HRT A;  1VQL T;  4MDW A;  2E70 A;  3CXC S;  2K4Y A;  1YJW A;  1N9S A;  1B34 B;  3I56 A;  3HRS A;  4HCC A;  2FHD A;  3C95 A;  1OZ2 A;  2DKG A;  4X34 A;  4NL3 A;  2LQK A;  4EDU A;  3HRU A;  4IUT A;  1N27 A;  3HFN A;  1BIB A;  4RCC A;  2PVO B;  4MZP A;  4J6X A;  3PMT A;  4BI4 A;  1S72 T;  3UDC A;  4BAC A;  1KD1 C;  4PJO C;  1AHJ B;  2R57 A;  3LYI A;  5HY6 A;  5GAO r;  4XU0 A;  3J7A F;  3JCM P;  3JB9 H;  1YI2 A;  3A8L B;  3PT9 A;  4J5Y A;  4M77 A;  1LOJ A;  4F7U G;  3MHX A;  4XU1 A;  5C0M A;  4CI0 C;  3OYM A;  2RHZ A;  3CPF A;  4BD3 A;  4OB3 B;  2KMT A;  1G3Y A;  2BKD N;  3A5Z B;  5GAM d;  4BE2 A;  1KQS S;  3CCR T;  3FB9 A;  3V7S A;  1QP3 A;  1Q86 C;  1M9S A;  3DLM A;  2K57 A;  4PJO F;  1LNX A;  3G71 T;  3V8L A;  3CC7 T;  2LX9 A;  1JRI A;  2XDP A;  3OBW A;  3URG A;  5LJ3 g;  3QDR B;  3F70 A;  2G3R A;  3CCM T;  3PTA A;  1HXD A;  3JB9 G;  5A2Q E;  2XG8 D;  4A4G A;  1BI2 A;  1BYM A;  3OS2 A;  4LDY A;  5GMK l;  4JLI A;  4V2S A;  2IG0 A;  1QVF A;  2RJC A;  4KUI A;  3BFM A;  2RB6 A;  3I55 A;  4C92 F;  3SWN B;  4C8Q F;  2DEQ A;  3DB3 A;  4M7A B;  3VUZ A;  4BI3 A;  1M1K C;  5LJ5 d;  3OS5 A;  2K5I A;  4QQ6 A;  5CQY A;  5A0G A;  4M7A E;  5GAO l;  4ZTF A;  3HP9 A;  2RM4 A;  3ER0 A;  1WQ7 A;  5DLO A;  1PSF A;  3M53 A;  2EKO A;  2E65 A;  5GAN h;  1KQ2 A;  2XU8 A;  4ZN3 A;  4MDX A;  5KE2 A;  2E5Q A;  3SWN C;  3ZBD A;  1YCY A;  3MEW A;  3V8K A;  4RMO A;  2L5Q A;  4OB1 B;  4M7D B;  2DVE A;  2XKO C;  2ZPI B;  4HCZ A;  1X6O A;  4M75 B;  4C5G A;  4M7D E;  2QEX A;  1YJ9 A;  1N9R A;  2GQV A;  3KUF A;  4UC4 A;  2RHU A;  1KQ1 A;  3H8Z A;  1XQH A;  3DKM A;  2CS7 A;  3WXM B;  1KC8 C;  1Q86 U;  3H6Z A;  1MGQ A;  4Y28 E;  5LJ5 j;  4M77 C;  4A4K A;  2JVV A;  2QQA A;  4M77 E;  1M1F A;  1NPR A;  4C0F A;  3G6E A;  4E7J A;  2V8K A;  3MP8 A;  3JCM h;  3CCU T;  3EAE A;  2RD1 A;  2MMP A;  5FU7 B;  5FRO A;  3QZ9 B;  3VU3 C;  3S3O A;  2RI2 A;  3WVE B;  5DY9 A;  4D6W A;  1JJ2 S;  4CRI A;  4JRK A;  3M59 A;  1NJI U;  3I56 T;  4PJO E;  3RES A;  4MZT A;  4LD9 K;  3CD6 T;  1KHI A;  3P8H A;  1G3S A;  5LJ5 g;  3CCQ T;  3A8H B;  4OGC A;  1Q82 U;  2ZPB B;  2JOY A;  2PQW A;  1W4S A;  4LDU A;  3OS1 A;  4GY5 A;  1QVG S;  4IUP A;  3OYL A;  4OMF B;  3HHT B;  4KUL A;  2E1H A;  3QKJ A;  2PUO B;  4C92 G;  5FRN A;  2E41 A;  4M78 A;  3FIF A;  2DK3 A;  3E9G A;  4C0D C;  4Q5W A;  4OP0 A;  3RUX A;  5GMK i;  3MCA B;  3N5B B;  1Y71 A;  3CPW A;  4M78 D;  5I2M A;  3E9F A;  3GLX A;  3OYD A;  2EYQ A;  3OYY A;  3CC2 T;  3JB9 F;  4N4H A;  3G71 A;  5GMK e;  3CC7 A;  2BUD A;  2MAM A;  1VQP T;  2D6F A;  3C12 A;  1FWZ A;  2XK0 A;  2LT4 A;  3LX7 A;  2DO3 A;  1BI3 A;  2VUB A;  5LJ3 h;  5GMK m;  2X4J A;  1IRE B;  5CR2 A;  3JB9 I;  3RMS A;  1LJO A;  3C4S A;  3OSS C;  3RIR A;  1U8R A;  2DXT A;  3OYK A;  5GAM f;  1NPP A;  2CZ0 B;  2QI2 A;  4XTX A;  4A54 A;  3CCL T;  1WNL A;  2XID A;  2XDB A;  2P0P A;  2EQM A;  3HSB A;  5LJ3 j;  2ZPE B;  3QO3 A;  3CBO A;  4C92 E;  1VIF A;  2LTO A;  1NJI C;  4JLG A;  4M78 F;  4IKF A;  1O75 A;  5J39 A;  4EPC A;  4BUG A;  4FIB A;  2R58 A;  3CC4 T;  3KBG A;  3QUI A;  5GAN j;  4OB2 B;  4ZTJ A;  3RER A;  2E12 A;  2DPP B;  1KHC A;  3V7C A;  5GAN 8;  2WAC A;  4E47 A;  3M55 A;  5IT9 E;  2MWP A;  3NTH A;  1D3B B;  2EQK A;  2E6Z A;  5GAM j;  2KQW A;  4M7A G;  5LJ3 e;  2EWN A;  2P4T A;  5GAM g;  2L8D A;  1VQ6 A;  2ZZD A;  2M16 A;  2YRV A;  3PNW C;  3CMA T;  2LT1 A;  2GFU A;  3C94 A;  1VUB A;  5CAI A;  3GPL A;  1K73 U;  2K5L A;  2IVW A;  3Q1J A;  1W2B S;  1K8A C;  2QDY B;  5HK3 A;  1VQ9 A;  2ZCF B;  5EG2 A;  3GOX A;  3JCM Q;  1WGS A;  3SFM A;  4E7L A;  1YHQ A;  2F5T X;  2RJE A;  3M54 A;  1BI0 A;  2YLC A;  3J80 E;  1O9S A;  1EIF A;  2HNI A;  2YHT A;  2ZPH B;  2K5F A;  4KBM B;  5FU6 C;  3I55 T;  4M7D G;  4XTW A;  2CGH A;  3JCM d;  2R5M A;  4HT9 A;  4PL6 A;  5GMK j;  1XNI A;  3CCE T;  2BIV A;  4OGE A;  4XTZ A;  4QVC A;  2RO0 A;  3O8V A;  3PMI A;  2HD0 A;  4J83 A;  2LVM A;  4M77 G;  1UGR B;  5GAN e;  3OMG A;  2MWO A;  1I8F A;  2RI3 A;  1UGQ B;  1VQ4 A;  1BI1 A;  3X26 B;  2XIC A;  1K9M C;  2E10 A;  2LCL A;  2X35 A;  3TEE A;  2ZGW A;  4FM4 B;  3M9Q A;  1NZ9 A;  3PIO A;  1SSF A;  2JTF A;  2GFA A;  1YIJ A;  2PVG B;  2VGM A;  5CCA A;  1WJQ A;  2JN0 A;  2RHX A;  1YBY A;  3LW5 E;  4L5G A;  4R56 A;  3LWI A;  4MML A;  1QW1 A;  1QP2 A;  2XD0 A;  2DZ9 A;  1FX7 A;  4P5N A;  1XOV A;  3LLR A;  3L2Z A;  5I2S A;  1G3T A;  4ZGE B;  1ZBX A;  2FYK A;  1U1S A;  4QQD A;  2EFI A;  3ZFJ A;  2H3J A;  1M1K U;  5FU6 B;  4HCB A;  4HT8 A;  5GAN 4;  2DZC A;  2OTL T;  4FT4 A;  2DXU A;  3L2V A;  3S3N A;  4N0A A;  3JCM g;  1YJN T;  3GF5 A;  3CCR A;  4LDW A;  2O4X A;  3G4S A;  2QTX A;  2P0Q A;  2Y4X A;  5CO7 A;  4C5H A;  3CXC A;  3CCL A;  4XAX B;  1FXX A;  2JZ2 A;  2EQJ A;  2YLB A;  2L3R A;  1VQM A;  2DIQ A;  3M56 A;  1Q81 C;  3CD6 A;  3OS0 A;  4ELZ C;  3OY9 A;  3VV0 A;  3CME A;  1G3W A;  3V7R A;  1VQL A;  3L2Q A;  1QVG A;  5CQX A;  1VQN A;  5CKF A;  4N4G A;  1IZ6 A;  4BI8 B;  4BDZ A;  3L1A A;  2AHJ B;  1Q7Y C;  2A3L A;  2OTJ A;  5D6Y A;  5A0L A;  3P8B B;  2RJD A;  4QVZ A;  5CK9 A;  5HKC A;  2MF2 A;  3INZ A;  4XU3 A;  3LH0 A;  2K3X A;  1WQW A;  4OF1 A;  1JB0 E;  2RK2 A;  3NFC A;  4IUR A;  4C92 C;  1KG1 A;  3OW2 S;  1UEB A;  3VYH B;  2EJ9 A;  3TRE A;  4BB7 A;  5KCO A;  1UGP B;  4BE1 A;  1VQO T;  1S72 A;  1M8V A;  1UB4 A;  4JS4 A;  2GF7 A;  3RKX A;  3BDU A;  4J7I A;  3X24 B;  2Y4Y A;  3JCM V;  3CBM A;  5FU7 C;  1N6A A;  3RKW A;  1VQN T;  3QXE B;  4FT2 A;  5CKB A;  2QEX T;  3JRZ A;  4DA4 A;  4A53 A;  4QVD A;  4A4F A;  5CIU A;  4EMG A;  3UPU A;  1VQK T;  3QYH B;  4ATO A;  4PLI A;  3CCM A;  1OI1 A;  2FB7 A;  4J7F A;  4PKC C;  4EMK A;  4M7D A;  5FRM A;  3CCJ T;  3OB9 A;  1XTD A;  2D0Q B;  3NTI A;  4HKE A;  4O5V A;  4XTY A;  2RHY A;  4F7U F;  4M7A D;  2HQX A;  1KQS A;  3FEO A;  4FL6 A;  2JTM A;  2R5A A;  5J3B A;  1WPY A;  2CKK A;  4JJN K;  2DD5 A;  3EFS A;  2GCX A;  3KXT A;  4C8Q B;  3CBP A;  2F69 A;  3SB2 A;  5KCH A;  4FU6 A;  5J26 A;  3BDL A;  3BY7 A;  3QII A;  4O6J A;  1X75 C;  3QJY A;  4R55 A;  5GAN 6;  3HFO A;  3JCM f;  4JRP A;  4OVA A;  3JB9 D;  1RI0 A;  1Y96 B;  4JUV A;  3VKI A;  5I21 A;  1Y07 A;  2Y90 A;  3UT1 A;  2EAY A;  3X28 B;  3CMA A;  5D6W A;  3SWN A;  2NLU A;  2P0K A;  2RI5 A;  3FJP A;  2M0O A;  4F7U B;  2E6N A;  4JRI A;  2VYT A;  1YI2 T;  4NS5 A;  5AYF A;  4M75 D;  5LJ3 f;  3OYJ A;  2ZPF B;  1PSE A;  3OA6 A;  2CZ7 B;  2LCC A;  5GAO p;  3EFR A;  4RG8 A;  2XHC A;  5KH6 A;  3WVD B;  1H64 1;  3UWN A;  4ME7 A;  3R6O A;  3JCM X;  4ELY C;  1JJ2 A;  4HA8 A;  3QHS A;  1VQ5 A;  4OB0 B;  3CC2 A;  4C5I A;  3ME9 A;  5GAM h;  4M77 B;  3RKY A;  3A8M B;  2EJG A;  5DM7 R;  2CZ1 B;  4C5E A;  2WSE E;  5FLX E;  1G5V A;  2LRQ A;  3E1S A;  3G6E T;  1JBM A;  2KY9 A;  3FRN A;  4PJO A;  4IUU A;  1VQ8 T;  1I5L A;  2DD4 A;  5IN1 A;  2QQB A;  2DXC A;  3OMC A;  4RKU E;  1M4Z A;  5GAM e;  4L6V 5;  1VQ4 T;  1KD1 U;  4M7D C;  1WJS A;  2PUK B;  4ZGD B;  4C0D B;  3OBY A;  4F7U A;  1OZ3 A;  3HPW A;  2PVD B;  3ASK A;  3HKS A;  3PGG A;  3VYG A;  1Y96 A;  4JDS A;  1YIJ T;  1BIA A;  4M78 E;  1VQ7 T;  2KDS A;  5GAN 3;  1N8R C;  4M78 B;  4N4I A;  3G7Z A;  5GAN 7;  3TU4 K;  2RA2 A;  1K8A U;  3L2R A;  4LD6 A;  3J81 E;  4M78 C;  4BY6 B;  2X4X A;  4YTL A;  2QA4 T;  4C0G A;  3OYG A;  4M78 G;  3AHU A;  2QQ9 A;  1V29 B;  1YJW T;  2JUF A;  2CYZ B;  3GNF B;  4C92 A;  1TH7 A;  2FVU A;  2RJF A;  3DB4 A;  3MEV A;  4C8Q A;  4RCB A;  4DOV A;  2DTI A;  4L59 A;  3NTK A;  2HBP A;  3T9N A;  3E19 A;  2M1H A;  3JCM e;  1BKB A;  2L89 A;  2M9U A;  3V8J A;  3FDR A;  4VUB A;  3OYC A;  4KUD K;  4XTV A;  1Y7X A;  2DJZ A;  4EMK B;  3JCM J;  1K9M U;  1VQ6 T;  3A8G B;  2K3Y A;  1WJR A;  5GAN 5;  3L2W A;  1VQP A;  3PFS A;  1MHN A;  1D3B A;  3CCU A;  5GAN d;  2V8I A;  3FLG A;  1RL2 A;  4NOY A;  3SDZ A;  2QXF A;  1YIT A;  5D6X A;  2C06 A;  3CPW S;  4M7D D;  3HL8 A;  3LGL A;  3CME T;  1Q7Y U;  4QQG A;  5GAO n;  2HAX A;  5GMK h;  3ZEH A;  4DOW A;  3CCS T;  4JRQ A;  4DQ2 A;  3L2U A;  3CCV A;  4JS5 A;  3MO8 A;  2OTJ T;  2HQE A;  4X9D A;  3OSV A;  3FC3 A;  3A8O B;  5A0D A;  4M77 D;  5L8R E;  3OYA A;  2X4W A;  2QQS A;  4J8O A;  3OYE A;  3CCQ A;  4PJO D;  4LDX A;  1M1G A;  3M4G A;  4IUQ A;  1N8R U;  2LNV A;  4PLL A;  3TCJ A;  4ZGJ B;  1KC8 U;  4M75 F;  3OW2 A;  2V8J A;  1DJ7 B;  4F7U E;  2WSC E;  2QQR A;  4J6W A;  2XDD A;  2RH2 A;  5GAN g;  4E7I A;  3RMQ A;  4E7H A;  1W2B A;  1YIT T;  2LQ8 A;  4LDV A;  3QBY A;  4EMK C;  1QVP A;  3MET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...