2GTJA

Reduced form of adap hsh3-n-domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
EKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYN-binding protein
publication title Redox-Regulated Conformational Changes in an SH3 Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gtjA01
2EKHA 2XMFA 2ROLA 2GGRA 2LCSA 1RI9A 2RPNA 1UG1A 4AFZC 1AD5A 1RLQC 1GFDA 1ZUUA 1UJYA 2CT3A 2J6FA 1K0SA 3H0FA 2J7IA 1W70A 4AG2C 1NEBA 2B86A 2LMJA 2CT4A 2PNIA 2YUPA 4CC4B 4RTUA 3C0CA 2C0OA 2D0NA 3EHRA 2X3WD 1AZEA 2KXCA 4Z8AA 2RN8A 2FRYA 2EW3A 2KRNA 2ED1A 2KNBB 5FWCA 5L23A 3VS7A 1AWXA 1JQQA 1TG0A 1WYXA 1PRMC 2JTEA 1ZSGA 5I22A 1CKBA 2DL5A 2M51A 2ED0A 4HCKA 1EFNA 2DM1A 2IIMA 3VS4A 1JXOA 2LJ1A 2O2OA 2EYZA 1SEMA 2HSPA 3RBBB 1GCQC 3EG0A 1E6GA 2ROTA 1VYTA 3QWXX 2K9GA 4RTXA 3CQTA 2EYWA 1AWWA 4CC2A 2CREA 3UF4A 3KFVA 1B07A 4D8KA 2DA9A 3UA6A 1H92A 4EIKA 3I35A 2OI3A 2EBPA 4J9HA 1I07A 2L3QA 3ULRB 4OMNA 4IIMA 4QT7A 2X3XD 1UUEA 4AFUC 3VRZA 1ABQA 1WX6A 2FRWA 2KROA 4RTTA 3REAB 3U23A 4D8DA 2HEQA 4WCIA 2LQWA 2EQIA 4JJBA 4OMPA 3M0RA 5IHIA 2L3PA 1BU1A 2V1QA 2YUQA 2ABLA 2SRCA 1QKWA 1M30A 5IXBA 4AFQC 3EGUA 2OAWA 1M27C 1WXTA 2DL4A 2DBMA 1Z9ZA 4LNPA 2ECZA 3EG1A 1K0XA 1X6BA 2A08A 2P4RA 3IQLA 3NMZC 3O5ZA 1M3CA 2KBTA 3M0PA 1Z9QA 1JU5C 1WXUA 1WDXA 2YT6A 4Y92A 4X1VA 1T3LA 2DILA 1ARKA 4ESRA 3PE0A 2AZVA 2J6OA 4M4ZA 1NYFA 1MV0B 4E6RA 4CC3A 2G6FX 2FPEA 3H0IA 2DRKA 2HBWA 2DVJA 4RTVA 1SHGA 4K11A 4GLMA 2GTJA 1M8MA 2C0IA 4ZNXA 1X2QA 2MOXA 1FMKA 3M0TA 2KRSA 4Z88A 4R0KA 4AG1C 1H3HA 3EG3A 2D8HA 1AZGB 2V1RA 2DL3A 1NLOC 4J9FA 2O9SA 1BBZA 2LJ0A 4A63B 1B3QA 5IXFA 1YCSB 1SSHA 5IHKA 2L0AA 2DX1A 2PTKA 5FW9A 3H0HA 1E6HA 3QWYA 2K6DA 2KT1A 1WI7A 2AKLA 2JXBA 3RNJA 1WA7A 1ABOA 4OMLA 2QDLA 3EHQA 2KGTA 1YP5A 2EYYA 2SEMA 1NLPC 1X43A 4RUGA 1CSKA 3M0SA 2M0YA 1QLYA 2OJ2A 1GCQA 2DNUA 5IH2A 1U5SA 2GQIA 1QWFA 3VS1A 2RF0A 2RMOA 1AWOA 2L3SA 1N5ZA 3JV3A 2D8JA 1OOTA 4ORZA 2YSQA 5EC7A 1JXMA 2H8HA 1U06A 2RQUA 3PVQA 4J9BA 2KT8A 2BZ8A 2O9VA 1HJDA 4LE9A 2HDAA 2C0TA 2AZSA 3SHWA 3A98A 1H8KA 1UJ0A 1T0HA 2E5KA 3M0UA 2AKKA 1NM7A 1VYUA 3SEMA 2DMOA 1SRMA 2EVRA 4OMMA 2NUZA 2VWFA 1AOJA 2CUBA 1KJWA 2JW4A 1ZX6A 1KIKA 3VS6A 5GJWB 1X27A 1ZBJA 1TUCA 1U3OA 1W6XA 1KSWA 2ESWA 2KE9A 2F2VA 2FEIA 1SPKA 4LN2A 2GTOA 1SRLA 4JJDA 2K2MA 2FPFA 2PZ1A 4RTYA 4DEYA 2RQRA 1ZUKA 2BZXA 4JPBW 4RTWA 1A0NB 1TUDA 2JM8A 3H41A 2LZ6B 2MCNA 1OPLA 1AVZC 5ECAA 1PWTA 1QCFA 2O88A 3EG2A 2AK5A 4HVWA 4JZ4A 1YN8A 1I0CA 2BZYA 1VA7A 1QKXA 3FJ5A 2I0NA 4HVVA 1OV3A 2RQWA 1X2KA 1GBQA 2DL7A 5FWBA 3TVTA 4IIOA 2EGAA 4F14A 1GFCA 2CUDA 4LUEA 4KRTA 1LCKA 2LNHB 5I11A 1UTIA 2K3BA 2VVKA 5HCKA 2L2PA 3TSWA 2KEAA 2RQTA 2DRMA 2EYXA 2GNCA 1FYNA 4F16A 4OMQA 1V1CA 4OMOA 4JJCA 1WLPB 2YDLA 3NPFA 4JZ3A 3GBQA 3VS0A 1GBRA 2JMCA 1S1NA 2CH4W 1IO6A 1BK2A 1SHFA 3VS5A 1K4US 1I1JA 1T0JA 2LJ3A 3R6NA 2K7AA 3PVLA 3NGPA 5GJVB 2FO0A 1K9AA 4J9DA 1OPKA 2KYBA 2ENMA 3I5RA 2CH4A 1ZUYA 1PKTA 1UDLA 2A28A 1JO8A 2JS0A 1K1ZA 1T3SA 1JEGA 2D1XA 2DLPA 2HCKA 1X6GA 2DL8A 1PRLC 2JMAA 2GBQA 1Y57A 1MUZA 1UHCA 2CSIA 1PKSA 4RTZA 4HVUA 2YUOA 1AEYA 2FPDA 4GBQA 3UATA 1E7OA 1NYGA 4J9IA 2LP5A 2NWMA 2DF6A 2W0ZA 2J06A 2J05A 1WXBA 1BB9A 2J6KA 1PHTA 1WIEA 2F2XA 3ZL7C 2YUNA 1UE9A 1GL5A 3NHNA 2LQNA 4DEXA 1YWOA 2JS2A 4J9CA 2DJQA 1UHFA 2EGEA 4HXJA 2K79A 3VS3A 2MIOA 2A36A 1RLPC 1YWPA 5IHNA 2JT4A 2KYMA 1UECA 2KR3A 1MV3A 4F17A 1G83A 1X69A 2KXDA 1KFZA 2EGCA 1XOVA 2BTTA 1K76A 2O31A 2JM9A 3LH5A 3THKA 1AWJA 3REBB 3VS2A 1NG2A 4AFSC 2EPDA 2RQVA 1CKAA 2DE0X 1GRIA 2KRMA 1W1FA 1NEGA 2LX7A 3TSZA 2FG0A 4J9GA 2W10A 4J9EA 1WFWA 1HSQA 4FSSA 2RNAA 1J3TA 3M0QA 1UFFA 2VKNA 1ZLMA 4Z89A 2DYBA 1M3BA 2CDTA 1UGVA 1YNZA 2CSQA 2DBKA 3VRYA 1GCPA 1PNJA 3UA7A 1QWEA 2F2WA 4CC7A 2A37A 1M3AA 3I9QA 4LUDA 1VYVA 3I5SA 1Y0MA 1HD3A 1OEBA 1RUWA 1G2BA
chains in the Genus database with same CATH superfamily
5LL6S 2XMFA 2RPNA 1QVGA 2E10A 1BIAA 1PSEA 4IUVA 5CQYA 1AD5A 1ZUUA 3TREA 1QVFP 2CT3A 3S3NA 2ZPIB 1DJ7B 3EFOB 1BYMA 1K0SA 3LH0A 1W70A 3RIRA 2LMJA 5A0LA 2E64A 2YUPA 4CC4B 3M57A 3I56Q 5LJ5j 3L2VA 3GNGA 3G7ZA 2HQXA 3M55A 4C8QC 2JNGA 1OI1A 2RI5A 2FRYA 1YI2T 5FWCA 3VJPA 3CPWP 1M90R 3CC7Q 3JB9G 1TG0A 4MDXA 3PT9A 4M7DC 1PRMC 2JTEA 1ZSGA 5I22A 2M51A 3MP1A 1I81A 2HL3A 2WSEE 3QYHB 3GOXA 2DM1A 2MWPA 3V8JA 4HT9A 1JXOA 2LJ1A 2O2OA 3QG1A 3V7SA 2EWNA 3PIOA 1M4ZA 2DKGA 4XTVA 3EG0A 4QVDA 3OYHA 2ROTA 2OAUA 1C1AA 3QWXX 4DBQA 2QQSA 3JCMe 2DZCA 4CC2A 4PKCC 4WTOB 3KFVA 2DA9A 2OI3A 1K9MC 1LVKA 5LJ5g 1YIJA 2WSCE 1K73C 3UWNA 5FU7C 4M75A 3L2ZA 3VYHB 4M7DF 3KXTA 4D8DA 1R77A 4RG8A 4M78E 1RACB 1VQ5A 4MMLA 4JJBA 1KC8U 5IN1A 3CCMA 2XIDA 1WHJA 3G4ST 1Q86C 2SRCA 1QKWA 4KBMB 1UB4A 1OU8A 5IXBA 2RHXA 3META 5GAOp 4AFQC 3OYGA 2C06A 2RJEA 4MZPA 2DBMA 1Z9ZA 4C5IA 2OTLQ 1WHGA 4LNPA 5GAN8 5HK3A 1NJIR 1I8FA 3CC2A 5D6YA 1O75A 3C94A 1X6BA 3IQLA 2FYKA 3O5ZA 8AT1B 2KBTA 3G1JA 3H8ZA 4GY5A 2D6FA 2V8KA 1PD0A 1WJQA 1JU5C 3ME9A 4QQDA 4XK8E 1WDXA 2MK5A 4C0ZA 3OS2A 2DFUA 1M2VA 2K3YA 1NZ9A 4X9DA 4ESRA 4NL2A 1MMNA 5FLXE 4J83A 2QK0A 3RMQA 5C6SA 2RHYA 3LLRA 3MEUA 2DVJA 4RTVA 3A8GB 1M8MA 4LXCA 3CCRA 4FM4B 4C5EA 3QYGB 4KH1B 3QKJA 4AG1C 5CKFA 4M77A 3LWHA 2D8HA 4MZTA 3FDRA 1AZGB 4PJNA 2DL3A 1B3QA 1XQHA 4P5NA 1TOVA 5IXFA 3LX7A 3JB9I 4M7AE 1YCSB 3HFNA 3M4YA 1SSHA 5GAN7 4DBHA 2FL7A 1VQOQ 3JB9H 3A8LB 2JXBA 2WSFE 1ZSZB 4TVRA 2DD5A 1IGUA 1YP5A 4RUGA 3OYJA 2QQBA 1D0YA 2DNUA 2PVDB 4E47A 5IH2A 4IURA 2RF0A 1WGSA 1N5ZA 2F1LA 5FU6C 2D8JA 1OOTA 5GAN6 4XAXB 2CYZB 5CKDA 1UEBA 3QJYA 5EC7A 2H8HA 4C5GA 2KSSA 2L3RA 1EX4A 3URGA 2OTLT 1KK7A 1BIBA 2XDDA 2COWA 2C0TA 2AZSA 3EGDA 1VIFA 3M0UA 4N0AC 2XHCA 2AHJB 2AKKA 1VYUA 3SEMA 1LNXA 4B9XA 2VYTA 1IZ6A 1AOJA 2VASA 1RAAB 2CUBA 2V8IA 1K8AU 1ZBJA 3EFSA 4O5VA 2GFAA 1RAEB 4N4IA 3A8HB 1YITA 2FEIA 2GTOA 2CP6A 4JRKA 2VV5A 2K2MA 2JVVA 2PZ1A 3CC2Q 4HA8A 4DEYA 2RQRA 1M9SA 1U1SA 5I21A 4C92B 3OS1A 4RTWA 1A0NB 1RI0A 3H41A 2LZ6B 1Q81U 1OPLA 5KCOA 2O88A 3GIBA 2QQAA 1I5OB 2DK3A 2O01E 3LGFA 1X2KA 1N9SA 1GBQA 5FWBA 2I2LA 3CBMA 3TVTA 4OVAA 4C92E 2CUDA 4RG2A 2KDSA 2YRCA 3OSSC 5DM7R 4LUEA 1RAGB 2EKOA 4PL6A 3M54A 2K3BA 2KEAA 5LJ3d 2RQTA 4Z02A 2DRMA 1PSFA 2QQ9A 5KH6A 4OMQA 1BCOA 1IHVA 2M16A 1WLPB 2LCLA 4BI8B 1W2BP 1Y07A 5CAIA 4E7ZA 4FSXA 4ZGJB 3SD4A 2D0QB 1JB0E 4OB0B 1YIJT 2XKOC 3J81E 2ZPHB 3A5ZB 1IXDA 3FB9A 3QJ6A 1JJ2S 3BDUA 2KYBA 2COZA 2RI3A 5LJ5h 4DBRA 1N8RU 4PJOA 1VQ5T 2A28A 1JO8A 4BE0A 1TTHB 3CCMT 1X6GA 3M58A 3GNFB 4ZTFA 3JAME 4E7HA 2F69A 5KE2A 4RTZA 4QQ6A 3QIIA 2CZ7B 1AEYA 2FPDA 3UATA 1VQ8A 2QTXA 1OQKA 1QVFS 2LRQA 3JCMW 2LP5A 2DF6A 1YI2A 4L59A 4O6JA 1AHJB 4D6WA 4Y28E 1B7TA 1QP3A 1Y71A 4JJNK 3G6EA 3ZL7C 1UE9A 3DB4A 4BDYA 5IT9E 2DXCA 2LQNA 4DEXA 1NPPA 4FCYA 1IRXA 4M75C 1UHFA 5GAN2 2RK2A 3CPWS 3QHSA 2QGFB 1UECA 4N4GA 3CC4T 3HPWA 2YLBA 5A0GA 1QVGP 3V8LA 2QEXT 2KXDA 1S72A 2CP2A 2P0KA 3LH5A 1AWJA 2DD4A 1YITQ 4KUIA 4M7AF 5KYWB 1Q7YC 1CKAA 5LJ3h 4J7FA 3OYYA 3CCRT 4PNOA 3TQ7P 2QI2A 1W1FA 4EMKB 3CCSA 4M7DB 2QA4A 2LX7A 4BY6B 3PNWC 3OY9A 1WPYA 3QZ5B 4WF2A 3RMSA 1YHQA 2LCCA 2QAZA 2PUOB 2E70A 1UGVA 2CSQA 5GANe 3CMEA 1YBYA 3VRYA 1PNJA 2F2WA 2FZCB 4M7DE 3I9QA 1VQMA 1RUWA 1G2BA 1KD1R 2YRVA 2ROLA 5GAOq 3JCMb 1VQKT 1UG1A 3OS0A 1YCYA 1RLQC 1UJYA 3E9FA 4M77C 4AG2C 1KQSS 5I2SA 5GAN3 2PNIA 4RTUA 3C0CA 3EHRA 3SFMA 2GFUA 1AZEA 1VOMA 4KGXB 3R6OA 5CKBA 4Z8AA 2RN8A 3MP6A 1K8AR 2KNBB 3JCMX 1MMAA 1JQQA 3SWNA 1WYXA 4XTZA 3OYIA 3OA6A 4LDUA 5LJ5f 2ED0A 2B8AA 4RKUE 4ELYC 4C5HA 2E65A 5GAMj 3AT1B 2EYZA 3E9GA 1TS9A 4A4EA 5GMKi 3TEEA 1VYTA 4XU1A 1YITT 2LT1A 1R0BG 1YI2Q 1AWWA 2CP5A 2X4WA 2JZ2A 1K9MU 4EIKA 3M4GA 3G6EQ 2EBPA 1K73U 4A53A 2DERA 1I07A 4PJMA 4OMNA 4QT7A 5KYXB 1ZQ1A 2FRWA 2KROA 4F7UE 4BE2A 2CZ6B 4QVCA 4FYWB 2R5MA 3M0RA 3EFOA 3MHXA 1Q86U 1S72Q 2V1QA 2ABLA 5GAMg 4JS4A 1RABB 2H3JA 2Y4XA 1RAFB 2XI9A 4PJLA 5LJ3f 3CCSQ 1M90C 3ZEHA 2RH2A 1AT1B 2EFIA 2PU9B 9ATCB 2FZGB 2ECZA 4C0DC 4XTYA 3NMZC 2P4RA 3VU3C 1M3CA 3ZFJA 4XTXA 1Z9QA 1W4SA 1OZ2A 3G4SQ 2YHTA 1WXUA 2YT6A 1TH7A 3BFMA 4X1VA 3CXCA 2ZZDA 3CMEQ 2DEQA 3MPUB 4E6RA 4DBFA 4M4ZA 2G6FX 1VQMQ 2FPEA 2HBWA 5HK0A 4JDSA 2DYIA 1SHGA 5KCHA 4J8OA 2GTJA 2K57A 2C0IA 2E5QA 4Q5WA 1FMKA 2KRSA 3AHUA 4DOWA 4BDZA 4R0KA 4A54A 4NOYA 2QTVA 2RHIA 3QO3A 4J6XA 4M78D 2HZYA 1VQ8T 4J9FA 1BBZA 3CCEA 4J5YA 2VXFA 1G3TA 4E7KA 3DKMA 3G6ET 2DX1A 2PTKA 3CCVA 3H0HA 4A4KA 2VGNA 2ATCB 1WI7A 2EIFA 4KT0E 4OMLA 4FT4A 1NLPC 1KG1A 4PJOC 1CSKA 4M78B 4RCBA 2OJ2A 2ZPEB 1GCQA 4ELZC 4JUVA 2L8DA 1S72T 1AWOA 3JV3A 2YSQA 2Y4YA 3OS5A 4C8QF 3PVQA 3LWIA 2KT8A 3CCST 2QA4T 4NS5A 2BZ8A 1W2BS 3HL8A 1HJDA 1MNEA 2OX7A 2F5TX 4IUPA 4FU6A 4PLLA 2EJFA 3A98A 1H8KA 3QDFA 3FIFA 2AT1B 5J39A 2E5KA 3D7SB 4IUQA 5LJ3j 2P0QA 1YHQT 2DMOA 1VQNA 1SRMA 3TCJA 2A0FB 1Y96B 4OMMA 3M56A 2DTOA 2BKDN 1D0XA 1KJWA 1ZX6A 3CMET 1MMGA 5M9OA 2CGHA 5FROA 1TUCA 1KSWA 1VQMT 2KE9A 4BUGA 2F2VA 4M78G 1SPKA 2L5QA 1WHKA 1KQSP 2CP0A 2FPFA 1RL2A 8ATCB 3JCMd 5CKEA 2L89A 5GAMd 2BZXA 2NUPA 4JPBW 3HRUA 5KYUB 1OULA 2A7YA 3GLXA 2MCNA 1ZSZA 1AVZC 2H3EB 4XTWA 4A4FA 2AK5A 5LJ3g 1C0MA 3CC4A 1WJSA 4XU0A 2QEXA 4M7AB 4HVVA 1OV3A 3LGLA 3OYNA 3OQ5A 2LT4A 2DL7A 2EYQA 3C4SA 1BCMA 3E2UA 4F14A 2MMPA 4II1A 1GFCA 1QVGS 3HP9A 1M1KR 5HCKA 2GQVA 2GNCA 1K73R 4F16A 3EGXA 4F7UF 3HKSA 3J7AF 2GCXA 3VS0A 2JMCA 1S1NA 1IO6A 2RO0A 1K4US 2JJ9A 1C6VX 4XTUA 3PVLA 1D3BB 5GJVB 2EJ9A 2HAXA 3HTRA 2MAMA 2M9UA 4J9DA 4M75E 1R8OB 1VQKA 3SWNC 4M7AG 3NTKA 3LYIA 1T3SA 4C92A 1JEGA 4ATOA 2D1XA 3RUXA 5LJ5e 4ZGDB 2XU8A 2GBQA 2RD1A 1MUZA 5FRMA 5EG2A 3QUIA 4GBQA 1N27A 4FYYB 2V26A 1YIJQ 2E1HA 3OW2A 3JCMh 2DIGA 5GAMh 2HBPA 2W0ZA 2E3IA 1OYXA 1WXBA 2J6KA 2OTJA 1PHTA 3GP8A 4C92D 1WIEA 1SKUB 2F2XA 3P8HA 2YUNA 1VQ5Q 1QMCA 1GL5A 3V7RA 4LDXA 1D09B 2EQKA 1VQNQ 3CCMQ 3L2RA 4LDYA 2EGEA 2MIOA 1VQ6T 1X75C 5GAOm 2KYMA 4KUDK 1X01A 1MV3A 2EGCA 2O31A 4ZTJA 1KQ1A 4PJJA 3VS2A 1Q7YU 2X35A 4JS5A 3JB9F 2EPDA 2KRMA 4FL6A 2KK4A 1VUBA 1NEGA 4OB3B 3X25B 2CP7A 1NBEB 5AYFA 1VQLT 1YFNA 3JRZA 4J9GA 2E6ZA 5GANj 1I5LA 4FSSA 3CD6T 4M77E 2FB7A 3CCET 3M0QA 4EMHA 1UFFA 3CC4Q 3WVDB 1QQJA 4Z89A 4J6YA 2QEXQ 2V8JA 1EIFA 2CDTA 5I2MA 1M5Q1 3CCVT 4BE1A 3CCRQ 4CC7A 5J26A 3I5SA 2EKHA 3DLLA 4QVZA 2GGRA 1LOJA 1RI9A 4ME7A 2LCSA 3L2QA 5GMKj 1JBMA 2K5FA 1JRIA 4C92G 3H0FA 2J7IA 1NEBA 3OYDA 2YLCA 3QBYA 3X26B 1KC8R 2CT4A 4DOVA 1YJ9T 2MF2A 2R58A 2KXCA 4JLIA 1TU0B 2EW3A 3L42A 4FIBA 2BIVA 5L23A 2CZ0B 3CCJA 3VS7A 4A4HA 1AWXA 3C12A 5KYWA 3M5AA 4UC4A 1VQKQ 2EQJA 1YJNA 1VQNT 5D7UA 3L1AA 3RKWA 5HKCA 1CKBA 1TXQA 4EMKA 4J6WA 4HCKA 1EFNA 3VUBA 4OGCA 3MCAB 2IIMA 3VS4A 3JB9J 3MP8A 3C95A 2HSPA 3VV0A 3OYMA 1GCQC 3JSCA 1E6GA 3UDCA 2P4TA 3RESA 2K9GA 3CQTA 2EYWA 3JCMf 4KGZB 2CREA 3UF4A 5GAMf 5GAOl 1B07A 4D8KA 4LD6A 3OW2S 3UA6A 1H92A 1UGRB 3RDVA 2M02A 2BUDA 4BD3A 1NE8A 4M7DD 2NUTB 1KD1C 4PFPA 3KUFA 2L3QA 4ANJA 3CXCP 3ULRB 2LNVA 2DXUA 4KULA 4AFUC 1ABQA 4RTTA 3U23A 3CEYA 4WCIA 2KI7A 3PTAA 3MO8A 2LQWA 3CMAA 5IHIA 2L3PA 1PC0A 4C8QB 3OMCA 2XD0A 2YUQA 4E7JA 4QQGA 4BB7A 1BI0A 2PQWA 3VKIA 1WJRA 2RA2A 1K8AC 1M90U 1N9RA 2M0OA 4B6MA 4PLIA 2XK0A 3EGUA 1M27C 1WXTA 3M59A 2DL4A 2JUFA 3FRNA 2YWWA 3EG1A 3H9NA 4M75F 4Y91A 1VQ7T 1WHLA 2PVOB 3EAEA 3JCMc 4C8QE 1ZSZC 3ER0A 3M0PA 2O4XB 5CCAA 4Y92A 1V29B 4OMFB 5GAOr 2ZPFB 2E12A 1T3LA 2RM4A 1ARKA 1Q82C 5HY6A 3PE0A 2J6OA 1NYFA 1PCXA 2FZKB 2DRKA 5FU7B 3WXMB 3EG9B 4K11A 2XDBA 2FHDA 4ZNXA 4PJOE 2MOXA 2HKNA 3PMIA 5KYXA 4M7DG 3EG3A 1H3HA 3RKYA 1YJWA 2V1RA 1NLOC 3CBOA 4NL3A 2LJ0A 4A63B 2R5AA 2JTFA 4E7IA 1ZBXA 4B9WA 2DAQA 3A1PA 1OX8A 4LDWA 3HRSA 2E4HA 2OTJT 3A8OB 5IHKA 1B34B 5GAOn 1E6HA 2EJGA 2DIQA 2G3RA 5GANd 5KYYB 2YRDA 1WHHA 1QP2A 1ABOA 2HD0A 3G71A 2DEUA 3FC3A 4HCZA 4F7UB 2QDLA 2CP3A 3EHQA 2KGTA 4MMKA 3CC7A 2RK1A 2IG0A 1Q81R 3M0SA 4C92C 4RMOA 1VQ8Q 2M0YA 1U8RA 2K5IA 1QLYA 4M77F 3PGGA 2E3HA 5CQXA 2GQIA 1QWFA 3VS1A 4HCCA 3SDZA 3P8DA 2HMAA 1U06A 4C0FA 1V76A 3S6WA 4HKEA 2RI2A 2X4YA 5GAN5 3JCMQ 1VQ9A 1WNLA 2CZ1B 4OB2B 1NM7A 2KQWA 2X4XA 1VQPT 2NUZA 2VWFA 3JCMg 2KY9A 6AT1B 1QW1A 1H3ZA 2VUBA 1KIKA 2JTMA 5GJWB 3MEWA 1X27A 3RR6A 1W6XA 2QA4Q 4F7UG 2ESWA 4EPCA 4LN2A 4JJDA 1YHQQ 1F1BB 4MZMA 4X34A 2K2VA 3RKXA 2PVGB 2DTIA 1N8RR 5FU6B 1VQ6A 2E41A 4DQ2A 1SG5A 1RADB 3RERA 4M78A 3EG2A 5A2QE 4HVWA 1YN8A 1I0CA 2R57A 1HK9A 5GANh 1FWZA 2EQUA 3CCJT 3CCLT 1GXIE 3HFOA 3OBYA 4N4HA 3HRTA 1YJNT 1FMWA 1UGPB 3ZBDA 1VQLA 1H641 1LCKA 2KAFA 5I11A 1UTIA 2VVKA 2CS7A 2L2PA 1I4K1 1G8XA 1KHCA 1XJWB 2DO3A 3CD6A 3OW2P 2EYXA 2QGGA 1YJWQ 1UGSB 4OMOA 1IREB 1Y96A 5AT1B 3NPFA 2QASA 3X20B 2CH4W 2QDYB 1SHFA 3VS5A 5GMKh 1M1GA 1NJIC 5A0DA 3OYBA 3QPHA 1K9AA 3NFCA 1QCOA 3G71Q 4QKUA 3L2WA 2ENMA 4J7IA 2CH4A 1ZUYA 2RJDA 2X4JA 1PKTA 1D0ZA 1UDLA 1QCNA 4EMKC 1EZZB 3CMAT 4BY6C 1VQOA 3LW5E 5KYUA 2JMAA 2ZPBB 3PMTA 1Q95G 1Y57A 5DLOA 5D6XA 1PKSA 2ZGWA 4HVUA 1QVPA 1YJ9A 4FT2A 1E7OA 2LX9A 4V2SA 4M7AA 2QQRA 4CRIA 2XDPA 2RB6A 2X9HA 3PFSA 1VQ9Q 1BB9A 5KYNA 5GAMe 4R56A 3FLGA 1LPLA 2JN0A 1M1KC 5L8RE 2IPOB 3NHNA 3CCUA 4PJOF 1WQ7A 4IKFA 2K79A 3BDLA 3VS3A 4FW2A 3EH2A 4HT8A 4AMCA 1M1FA 3M9QA 3ASKA 5IHNA 2EQMA 2JT4A 3EFRA 1OZ3A 4M7AD 2KR3A 2QG9B 2DJZA 1X69A 3BE3A 2K4YA 2BTTA 3QSUA 1G3WA 1K76A 4AFSC 1VQ4T 3E1SA 4C0GA 2DPPB 1GRIA 1D3BA 1VIEA 3V8KA 3TSZA 2WACA 3Q1JA 2FG0A 4M75D 1WHMA 3MJXA 1WFWA 2DETA 2HQHA 1VQ6Q 2NLUA 1YJWT 3DLMA 3JCMV 3CXCS 2VKNA 2HKQB 5D6WA 4IUTA 3CCQA 2DYBA 2K3XA 2VXEA 4YTLA 5GANf 3I56T 3X28B 1BKBA 1RAIB 1M3AA 4X9CA 4LUDA 1BI1A 1OEBA 3G71T 1K9MR 1VQLQ 4M75B 3CC7T 3T9NA 3CD6Q 2AIRB 3OYKA 5C0MA 1VQ7A 2LVMA 4AFZC 1GFDA 3CCEQ 2J6FA 4LDVA 2F5KA 2QYZA 2B86A 3JCMP 3CCVQ 3OYEA 2C0OA 2D0NA 1Q86R 1M8VA 4L6V5 2DXTA 2X3WD 1VQ9T 5GMKm 2KRNA 2ED1A 1X6OA 1MHNA 1IB8A 2A3LA 4OGEA 4PFOA 1WZOA 3NTHA 2DL5A 1JJ2A 2NUPB 1IGQA 3F70A 4M77D 3INZA 3QDRB 4KH0B 1SEMA 3RBBB 1G5VA 1M2VB 4M75G 1YJ9Q 2M1HA 4OP0A 4RTXA 4XU2A 1SSFA 5DY9A 3JCMJ 1OU9A 1KD1U 1QVFA 3I35A 2HSEB 4J9HA 3KBGA 2DZ9A 3CCUQ 4IIMA 4BI3A 2DVEA 3HHTB 2X3XD 1UUEA 4M77B 3VRZA 5KE3A 1WX6A 3REAB 2HEQA 3S3MA 2EQIA 3EGXB 3CPWA 4OMPA 1BU1A 1KC8C 1FX7A 5LJ5d 1M30A 1ZA2B 2XICA 4L5GA 2BE7D 4ZGEB 5LJ3e 2MWOA 2OAWA 3I55A 2QXFA 5CKHA 2KVQG 3GPLA 3OYCA 1BI2A 1K0XA 2A08A 4R55A 3QZ9B 1VQPA 4E2FB 3TU4K 3CCQQ 3H6ZA 1G3SA 4A4GA 5CVIA 5CIUA 1MGQA 4M78C 1Q82U 2DILA 1XNIA 3OBWA 4M77G 2AZVA 1MV0B 4CC3A 5CK9A 3J80E 7AT1B 3H0IA 2VC8A 3EGDB 3HSBA 4GLMA 2NYSA 4PFZA 2K5LA 2NUTA 1X2QA 3GF5A 1VQ7Q 5GMKl 1VQOT 1ZA1B 4HCBA 3M0TA 1N6AA 4Z88A 2RHZA 3CPFA 1O9SA 5GANg 3M53A 3FJPA 5GAN4 4JLGA 2O9SA 1P92A 2P84A 1KQSA 4C8QA 5DLQE 4CI0C 3CCLA 4M78F 2KMTA 2L0AA 1NPRA 3L2UA 5FW9A 4M7DA 4C0DB 3QWYA 2K6DA 3CCUT 2KT1A 2AKLA 2HQEA 2RJCA 1PG5B 3RNJA 1WA7A 3OYFA 2ZAEA 4RCCA 2EYYA 2SEMA 3EH1A 1X43A 4XU3A 1SF9A 4C8QD 5IAYA 1U5SA 4E7SA 4VUBA 2RMOA 2L3SA 1KQ2A 2O4XA 4ORZA 1JXMA 2OTJQ 3CBPA 2RQUA 4J9BA 1PD1A 4M7AC 2O9VA 4LE9A 3A8MB 5CO7A 2LTOA 5CR2A 1IHWA 2HDAA 3SHWA 1LJOA 1UJ0A 1T0HA 3DB3A 3EG9A 3CC2T 4PJOD 2FVUA 1Y7XA 4ZN3A 4ZN1A 4JRIA 3MEVA 3CCQT 2EVRA 2HNIA 4KGVB 3MEAA 2JW4A 3X24B 3VS6A 3WVEB 2DTHA 1U3OA 3I55Q 4F04B 1SRLA 4OB1B 2Y90A 1B34A 2XG8D 4E7LA 4RTYA 4PJOB 1OX9A 3VUZA 1ZUKA 2COYA 2ZPGB 4DA4A 1TUDA 5KYYA 2JM8A 1VQPQ 1Q81C 5ECAA 4F7UA 2BE9B 1PWTA 1QCFA 2HL5C 4AT1B 1TUGB 4JZ4A 4QW2A 1G3YA 1HYOA 1TWBA 2BZYA 1VA7A 1QKXA 3FJ5A 1MMDA 2I0NA 3V7CA 1XTDA 1RAHB 2RQWA 2E6NA 2P0PA 3MKDA 3G4SA 1VQ4A 4C8QG 4IIOA 2EGAA 2CKKA 3FEOA 4KRTA 3N5BB 4MDWA 2LNHB 3TSWA 2MYSA 3UPUA 3O8VA 1BI3A 4IUUA 1U1TA 1FYNA 1UGQB 1V1CA 3E19A 4JJCA 2YDLA 4JZ3A 4BACA 3GBQA 4PJOG 1GBRA 1FXXA 3CCJQ 4FW1A 1BK2A 3CCLQ 3I56A 2ZCFB 1YJNQ 1NJIU 3OYAA 1I1JA 1T0JA 2LJ3A 4XQ3A 2K7AA 3R6NA 3NGPA 3OB9A 1WQWA 1Q7YR 2FO0A 5GMKe 4PK4A 2JOYA 1OPKA 1D1CA 4EDUA 3P8BB 3I5RA 3OSVA 1HXDA 2JS0A 1K1ZA 1N8RC 2DLPA 2HCKA 2Z0WA 2DL8A 3OMGA 3UT1A 1PRLC 1M2OA 3BW1A 2RHUA 1UHCA 2CSIA 2YUOA 2D9TA 3S3OA 2LDMA 2VGMA 1NYGA 3I55T 4J9IA 2NWMA 3BY7A 2J06A 2J05A 1Q82R 1M1KU 1PM3A 4N0AA 3QXEB 1W2BA 1YWOA 2JS2A 1ACMB 4J9CA 3SB2A 3CMAQ 3OYLA 2DJQA 4C92F 4HXJA 2PUKB 2A36A 1RLPC 1YWPA 2LQ8A 1FMVA 4GLKA 2EAYA 3JB9D 4F17A 1KHIA 1G83A 1KFZA 1XOVA 2JM9A 3THKA 2LQKA 3REBB 2YXYA 4BI4A 1NG2A 2VB6A 3SWNB 2RQVA 2DXBA 2DE0X 4FYVB 2LC4A 4EMGA 4JRQA 1D1AA 2OTLA 2W10A 4FYXB 3VYGA 4J9EA 1ZHIA 2IVWA 1HSQA 2RJFA 2X51A 2RNAA 1MNDA 1J3TA 2GF7A 1TSFA 1ZLMA 1D1BA 1M3BA 2MPXC 3PIPA 1YNZA 1JJ2P 2DBKA 4OF1A 5FRNA 1GCPA 1VQ4Q 1R0CB 3UA7A 1QWEA 5J3BA 2A37A 1VYVA 1Y0MA 1HD3A 4LD9K 4JRPA 2MI6A 3NTIA
chains in the Genus database with same CATH topology
2EKHA 2XMFA 2ROLA 2GGRA 2LCSA 1RI9A 2RPNA 1UG1A 4AFZC 1AD5A 1RLQC 1GFDA 1ZUUA 1UJYA 2CT3A 2J6FA 1K0SA 3H0FA 2J7IA 1W70A 4AG2C 1NEBA 2B86A 2LMJA 2CT4A 2PNIA 2YUPA 4CC4B 4RTUA 3C0CA 2C0OA 2D0NA 3EHRA 2X3WD 1AZEA 2KXCA 4Z8AA 2RN8A 2FRYA 2EW3A 2KRNA 2ED1A 2KNBB 5FWCA 5L23A 3VS7A 1AWXA 1JQQA 1TG0A 1WYXA 1PRMC 2JTEA 1ZSGA 5I22A 1CKBA 2DL5A 2M51A 2ED0A 4HCKA 1EFNA 2DM1A 2IIMA 3VS4A 1JXOA 2LJ1A 2O2OA 2EYZA 1SEMA 2HSPA 3RBBB 1GCQC 3EG0A 1E6GA 2ROTA 1VYTA 3QWXX 2K9GA 4RTXA 3CQTA 2EYWA 1AWWA 4CC2A 2CREA 3UF4A 3KFVA 1B07A 4D8KA 2DA9A 3UA6A 1H92A 4EIKA 3I35A 2OI3A 2EBPA 4J9HA 1I07A 2L3QA 3ULRB 4OMNA 4IIMA 4QT7A 2X3XD 1UUEA 4AFUC 3VRZA 1ABQA 1WX6A 2FRWA 2KROA 4RTTA 3REAB 3U23A 4D8DA 2HEQA 4WCIA 2LQWA 2EQIA 4JJBA 4OMPA 3M0RA 5IHIA 2L3PA 1BU1A 2V1QA 2YUQA 2ABLA 2SRCA 1QKWA 1M30A 5IXBA 4AFQC 3EGUA 2OAWA 1M27C 1WXTA 2DL4A 2DBMA 1Z9ZA 4LNPA 2ECZA 3EG1A 1K0XA 1X6BA 2A08A 2P4RA 3IQLA 3NMZC 3O5ZA 1M3CA 2KBTA 3M0PA 1Z9QA 1JU5C 1WXUA 1WDXA 2YT6A 4Y92A 4X1VA 1T3LA 2DILA 1ARKA 4ESRA 3PE0A 2AZVA 2J6OA 4M4ZA 1NYFA 1MV0B 4E6RA 4CC3A 2G6FX 2FPEA 3H0IA 2DRKA 2HBWA 2DVJA 4RTVA 1SHGA 4K11A 4GLMA 2GTJA 1M8MA 2C0IA 4ZNXA 1X2QA 2MOXA 1FMKA 3M0TA 2KRSA 4Z88A 4R0KA 4AG1C 1H3HA 3EG3A 2D8HA 1AZGB 2V1RA 2DL3A 1NLOC 4J9FA 2O9SA 1BBZA 2LJ0A 4A63B 1B3QA 5IXFA 1YCSB 1SSHA 5IHKA 2L0AA 2DX1A 2PTKA 5FW9A 3H0HA 1E6HA 3QWYA 2K6DA 2KT1A 1WI7A 2AKLA 2JXBA 3RNJA 1WA7A 1ABOA 4OMLA 2QDLA 3EHQA 2KGTA 1YP5A 2EYYA 2SEMA 1NLPC 1X43A 4RUGA 1CSKA 3M0SA 2M0YA 1QLYA 2OJ2A 1GCQA 2DNUA 5IH2A 1U5SA 2GQIA 1QWFA 3VS1A 2RF0A 2RMOA 1AWOA 2L3SA 1N5ZA 3JV3A 2D8JA 1OOTA 4ORZA 2YSQA 5EC7A 1JXMA 2H8HA 1U06A 2RQUA 3PVQA 4J9BA 2KT8A 2BZ8A 2O9VA 1HJDA 4LE9A 2HDAA 2C0TA 2AZSA 3SHWA 3A98A 1H8KA 1UJ0A 1T0HA 2E5KA 3M0UA 2AKKA 1NM7A 1VYUA 3SEMA 2DMOA 1SRMA 2EVRA 4OMMA 2NUZA 2VWFA 1AOJA 2CUBA 1KJWA 2JW4A 1ZX6A 1KIKA 3VS6A 5GJWB 1X27A 1ZBJA 1TUCA 1U3OA 1W6XA 1KSWA 2ESWA 2KE9A 2F2VA 2FEIA 1SPKA 4LN2A 2GTOA 1SRLA 4JJDA 2K2MA 2FPFA 2PZ1A 4RTYA 4DEYA 2RQRA 1ZUKA 2BZXA 4JPBW 4RTWA 1A0NB 1TUDA 2JM8A 3H41A 2LZ6B 2MCNA 1OPLA 1AVZC 5ECAA 1PWTA 1QCFA 2O88A 3EG2A 2AK5A 4HVWA 4JZ4A 1YN8A 1I0CA 2BZYA 1VA7A 1QKXA 3FJ5A 2I0NA 4HVVA 1OV3A 2RQWA 1X2KA 1GBQA 2DL7A 5FWBA 3TVTA 4IIOA 2EGAA 4F14A 1GFCA 2CUDA 4LUEA 4KRTA 1LCKA 2LNHB 5I11A 1UTIA 2K3BA 2VVKA 5HCKA 2L2PA 3TSWA 2KEAA 2RQTA 2DRMA 2EYXA 2GNCA 1FYNA 4F16A 4OMQA 1V1CA 4OMOA 4JJCA 1WLPB 2YDLA 3NPFA 4JZ3A 3GBQA 3VS0A 1GBRA 2JMCA 1S1NA 2CH4W 1IO6A 1BK2A 1SHFA 3VS5A 1K4US 1I1JA 1T0JA 2LJ3A 3R6NA 2K7AA 3PVLA 3NGPA 5GJVB 2FO0A 1K9AA 4J9DA 1OPKA 2KYBA 2ENMA 3I5RA 2CH4A 1ZUYA 1PKTA 1UDLA 2A28A 1JO8A 2JS0A 1K1ZA 1T3SA 1JEGA 2D1XA 2DLPA 2HCKA 1X6GA 2DL8A 1PRLC 2JMAA 2GBQA 1Y57A 1MUZA 1UHCA 2CSIA 1PKSA 4RTZA 4HVUA 2YUOA 1AEYA 2FPDA 4GBQA 3UATA 1E7OA 1NYGA 4J9IA 2LP5A 2NWMA 2DF6A 2W0ZA 2J06A 2J05A 1WXBA 1BB9A 2J6KA 1PHTA 1WIEA 2F2XA 3ZL7C 2YUNA 1UE9A 1GL5A 3NHNA 2LQNA 4DEXA 1YWOA 2JS2A 4J9CA 2DJQA 1UHFA 2EGEA 4HXJA 2K79A 3VS3A 2MIOA 2A36A 1RLPC 1YWPA 5IHNA 2JT4A 2KYMA 1UECA 2KR3A 1MV3A 4F17A 1G83A 1X69A 2KXDA 1KFZA 2EGCA 1XOVA 2BTTA 1K76A 2O31A 2JM9A 3LH5A 3THKA 1AWJA 3REBB 3VS2A 1NG2A 4AFSC 2EPDA 2RQVA 1CKAA 2DE0X 1GRIA 2KRMA 1W1FA 1NEGA 2LX7A 3TSZA 2FG0A 4J9GA 2W10A 4J9EA 1WFWA 1HSQA 4FSSA 2RNAA 1J3TA 3M0QA 1UFFA 2VKNA 1ZLMA 4Z89A 2DYBA 1M3BA 2CDTA 1UGVA 1YNZA 2CSQA 2DBKA 3VRYA 1GCPA 1PNJA 3UA7A 1QWEA 2F2WA 4CC7A 2A37A 1M3AA 3I9QA 4LUDA 1VYVA 3I5SA 1Y0MA 1HD3A 1OEBA 1RUWA 1G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKH A;  2XMF A;  2ROL A;  2GGR A;  2LCS A;  1RI9 A;  2RPN A;  1UG1 A;  4AFZ C;  1AD5 A;  1RLQ C;  1GFD A;  1ZUU A;  1UJY A;  2CT3 A;  2J6F A;  1K0S A;  3H0F A;  2J7I A;  1W70 A;  4AG2 C;  1NEB A;  2B86 A;  2LMJ A;  2CT4 A;  2PNI A;  2YUP A;  4CC4 B;  4RTU A;  3C0C A;  2C0O A;  2D0N A;  3EHR A;  2X3W D;  1AZE A;  2KXC A;  4Z8A A;  2RN8 A;  2FRY A;  2EW3 A;  2KRN A;  2ED1 A;  2KNB B;  5FWC A;  5L23 A;  3VS7 A;  1AWX A;  1JQQ A;  1TG0 A;  1WYX A;  1PRM C;  2JTE A;  1ZSG A;  5I22 A;  1CKB A;  2DL5 A;  2M51 A;  2ED0 A;  4HCK A;  1EFN A;  2DM1 A;  2IIM A;  3VS4 A;  1JXO A;  2LJ1 A;  2O2O A;  2EYZ A;  1SEM A;  2HSP A;  3RBB B;  1GCQ C;  3EG0 A;  1E6G A;  2ROT A;  1VYT A;  3QWX X;  2K9G A;  4RTX A;  3CQT A;  2EYW A;  1AWW A;  4CC2 A;  2CRE A;  3UF4 A;  3KFV A;  1B07 A;  4D8K A;  2DA9 A;  3UA6 A;  1H92 A;  4EIK A;  3I35 A;  2OI3 A;  2EBP A;  4J9H A;  1I07 A;  2L3Q A;  3ULR B;  4OMN A;  4IIM A;  4QT7 A;  2X3X D;  1UUE A;  4AFU C;  3VRZ A;  1ABQ A;  1WX6 A;  2FRW A;  2KRO A;  4RTT A;  3REA B;  3U23 A;  4D8D A;  2HEQ A;  4WCI A;  2LQW A;  2EQI A;  4JJB A;  4OMP A;  3M0R A;  5IHI A;  2L3P A;  1BU1 A;  2V1Q A;  2YUQ A;  2ABL A;  2SRC A;  1QKW A;  1M30 A;  5IXB A;  4AFQ C;  3EGU A;  2OAW A;  1M27 C;  1WXT A;  2DL4 A;  2DBM A;  1Z9Z A;  4LNP A;  2ECZ A;  3EG1 A;  1K0X A;  1X6B A;  2A08 A;  2P4R A;  3IQL A;  3NMZ C;  3O5Z A;  1M3C A;  2KBT A;  3M0P A;  1Z9Q A;  1JU5 C;  1WXU A;  1WDX A;  2YT6 A;  4Y92 A;  4X1V A;  1T3L A;  2DIL A;  1ARK A;  4ESR A;  3PE0 A;  2AZV A;  2J6O A;  4M4Z A;  1NYF A;  1MV0 B;  4E6R A;  4CC3 A;  2G6F X;  2FPE A;  3H0I A;  2DRK A;  2HBW A;  2DVJ A;  4RTV A;  1SHG A;  4K11 A;  4GLM A;  2GTJ A;  1M8M A;  2C0I A;  4ZNX A;  1X2Q A;  2MOX A;  1FMK A;  3M0T A;  2KRS A;  4Z88 A;  4R0K A;  4AG1 C;  1H3H A;  3EG3 A;  2D8H A;  1AZG B;  2V1R A;  2DL3 A;  1NLO C;  4J9F A;  2O9S A;  1BBZ A;  2LJ0 A;  4A63 B;  1B3Q A;  5IXF A;  1YCS B;  1SSH A;  5IHK A;  2L0A A;  2DX1 A;  2PTK A;  5FW9 A;  3H0H A;  1E6H A;  3QWY A;  2K6D A;  2KT1 A;  1WI7 A;  2AKL A;  2JXB A;  3RNJ A;  1WA7 A;  1ABO A;  4OML A;  2QDL A;  3EHQ A;  2KGT A;  1YP5 A;  2EYY A;  2SEM A;  1NLP C;  1X43 A;  4RUG A;  1CSK A;  3M0S A;  2M0Y A;  1QLY A;  2OJ2 A;  1GCQ A;  2DNU A;  5IH2 A;  1U5S A;  2GQI A;  1QWF A;  3VS1 A;  2RF0 A;  2RMO A;  1AWO A;  2L3S A;  1N5Z A;  3JV3 A;  2D8J A;  1OOT A;  4ORZ A;  2YSQ A;  5EC7 A;  1JXM A;  2H8H A;  1U06 A;  2RQU A;  3PVQ A;  4J9B A;  2KT8 A;  2BZ8 A;  2O9V A;  1HJD A;  4LE9 A;  2HDA A;  2C0T A;  2AZS A;  3SHW A;  3A98 A;  1H8K A;  1UJ0 A;  1T0H A;  2E5K A;  3M0U A;  2AKK A;  1NM7 A;  1VYU A;  3SEM A;  2DMO A;  1SRM A;  2EVR A;  4OMM A;  2NUZ A;  2VWF A;  1AOJ A;  2CUB A;  1KJW A;  2JW4 A;  1ZX6 A;  1KIK A;  3VS6 A;  5GJW B;  1X27 A;  1ZBJ A;  1TUC A;  1U3O A;  1W6X A;  1KSW A;  2ESW A;  2KE9 A;  2F2V A;  2FEI A;  1SPK A;  4LN2 A;  2GTO A;  1SRL A;  4JJD A;  2K2M A;  2FPF A;  2PZ1 A;  4RTY A;  4DEY A;  2RQR A;  1ZUK A;  2BZX A;  4JPB W;  4RTW A;  1A0N B;  1TUD A;  2JM8 A;  3H41 A;  2LZ6 B;  2MCN A;  1OPL A;  1AVZ C;  5ECA A;  1PWT A;  1QCF A;  2O88 A;  3EG2 A;  2AK5 A;  4HVW A;  4JZ4 A;  1YN8 A;  1I0C A;  2BZY A;  1VA7 A;  1QKX A;  3FJ5 A;  2I0N A;  4HVV A;  1OV3 A;  2RQW A;  1X2K A;  1GBQ A;  2DL7 A;  5FWB A;  3TVT A;  4IIO A;  2EGA A;  4F14 A;  1GFC A;  2CUD A;  4LUE A;  4KRT A;  1LCK A;  2LNH B;  5I11 A;  1UTI A;  2K3B A;  2VVK A;  5HCK A;  2L2P A;  3TSW A;  2KEA A;  2RQT A;  2DRM A;  2EYX A;  2GNC A;  1FYN A;  4F16 A;  4OMQ A;  1V1C A;  4OMO A;  4JJC A;  1WLP B;  2YDL A;  3NPF A;  4JZ3 A;  3GBQ A;  3VS0 A;  1GBR A;  2JMC A;  1S1N A;  2CH4 W;  1IO6 A;  1BK2 A;  1SHF A;  3VS5 A;  1K4U S;  1I1J A;  1T0J A;  2LJ3 A;  3R6N A;  2K7A A;  3PVL A;  3NGP A;  5GJV B;  2FO0 A;  1K9A A;  4J9D A;  1OPK A;  2KYB A;  2ENM A;  3I5R A;  2CH4 A;  1ZUY A;  1PKT A;  1UDL A;  2A28 A;  1JO8 A;  2JS0 A;  1K1Z A;  1T3S A;  1JEG A;  2D1X A;  2DLP A;  2HCK A;  1X6G A;  2DL8 A;  1PRL C;  2JMA A;  2GBQ A;  1Y57 A;  1MUZ A;  1UHC A;  2CSI A;  1PKS A;  4RTZ A;  4HVU A;  2YUO A;  1AEY A;  2FPD A;  4GBQ A;  3UAT A;  1E7O A;  1NYG A;  4J9I A;  2LP5 A;  2NWM A;  2DF6 A;  2W0Z A;  2J06 A;  2J05 A;  1WXB A;  1BB9 A;  2J6K A;  1PHT A;  1WIE A;  2F2X A;  3ZL7 C;  2YUN A;  1UE9 A;  1GL5 A;  3NHN A;  2LQN A;  4DEX A;  1YWO A;  2JS2 A;  4J9C A;  2DJQ A;  1UHF A;  2EGE A;  4HXJ A;  2K79 A;  3VS3 A;  2MIO A;  2A36 A;  1RLP C;  1YWP A;  5IHN A;  2JT4 A;  2KYM A;  1UEC A;  2KR3 A;  1MV3 A;  4F17 A;  1G83 A;  1X69 A;  2KXD A;  1KFZ A;  2EGC A;  1XOV A;  2BTT A;  1K76 A;  2O31 A;  2JM9 A;  3LH5 A;  3THK A;  1AWJ A;  3REB B;  3VS2 A;  1NG2 A;  4AFS C;  2EPD A;  2RQV A;  1CKA A;  2DE0 X;  1GRI A;  2KRM A;  1W1F A;  1NEG A;  2LX7 A;  3TSZ A;  2FG0 A;  4J9G A;  2W10 A;  4J9E A;  1WFW A;  1HSQ A;  4FSS A;  2RNA A;  1J3T A;  3M0Q A;  1UFF A;  2VKN A;  1ZLM A;  4Z89 A;  2DYB A;  1M3B A;  2CDT A;  1UGV A;  1YNZ A;  2CSQ A;  2DBK A;  3VRY A;  1GCP A;  1PNJ A;  3UA7 A;  1QWE A;  2F2W A;  4CC7 A;  2A37 A;  1M3A A;  3I9Q A;  4LUD A;  1VYV A;  3I5S A;  1Y0M A;  1HD3 A;  1OEB A;  1RUW A;  1G2B A; 
#chains in the Genus database with same CATH topology
 5LL6 S;  2XMF A;  2RPN A;  1QVG A;  2E10 A;  1BIA A;  1PSE A;  4IUV A;  5CQY A;  1AD5 A;  1ZUU A;  3TRE A;  1QVF P;  2CT3 A;  3S3N A;  2ZPI B;  1DJ7 B;  3EFO B;  1BYM A;  1K0S A;  3LH0 A;  1W70 A;  3RIR A;  2LMJ A;  5A0L A;  2E64 A;  2YUP A;  4CC4 B;  3M57 A;  3I56 Q;  5LJ5 j;  3L2V A;  3GNG A;  3G7Z A;  2HQX A;  3M55 A;  4C8Q C;  2JNG A;  1OI1 A;  2RI5 A;  2FRY A;  1YI2 T;  5FWC A;  3VJP A;  3CPW P;  1M90 R;  3CC7 Q;  3JB9 G;  1TG0 A;  4MDX A;  3PT9 A;  4M7D C;  1PRM C;  2JTE A;  1ZSG A;  5I22 A;  2M51 A;  3MP1 A;  1I81 A;  2HL3 A;  2WSE E;  3QYH B;  3GOX A;  2DM1 A;  2MWP A;  3V8J A;  4HT9 A;  1JXO A;  2LJ1 A;  2O2O A;  3QG1 A;  3V7S A;  2EWN A;  3PIO A;  1M4Z A;  2DKG A;  4XTV A;  3EG0 A;  4QVD A;  3OYH A;  2ROT A;  2OAU A;  1C1A A;  3QWX X;  4DBQ A;  2QQS A;  3JCM e;  2DZC A;  4CC2 A;  4PKC C;  4WTO B;  3KFV A;  2DA9 A;  2OI3 A;  1K9M C;  1LVK A;  5LJ5 g;  1YIJ A;  2WSC E;  1K73 C;  3UWN A;  5FU7 C;  4M75 A;  3L2Z A;  3VYH B;  4M7D F;  3KXT A;  4D8D A;  1R77 A;  4RG8 A;  4M78 E;  1RAC B;  1VQ5 A;  4MML A;  4JJB A;  1KC8 U;  5IN1 A;  3CCM A;  2XID A;  1WHJ A;  3G4S T;  1Q86 C;  2SRC A;  1QKW A;  4KBM B;  1UB4 A;  1OU8 A;  5IXB A;  2RHX A;  3MET A;  5GAO p;  4AFQ C;  3OYG A;  2C06 A;  2RJE A;  4MZP A;  2DBM A;  1Z9Z A;  4C5I A;  2OTL Q;  1WHG A;  4LNP A;  5GAN 8;  5HK3 A;  1NJI R;  1I8F A;  3CC2 A;  5D6Y A;  1O75 A;  3C94 A;  1X6B A;  3IQL A;  2FYK A;  3O5Z A;  8AT1 B;  2KBT A;  3G1J A;  3H8Z A;  4GY5 A;  2D6F A;  2V8K A;  1PD0 A;  1WJQ A;  1JU5 C;  3ME9 A;  4QQD A;  4XK8 E;  1WDX A;  2MK5 A;  4C0Z A;  3OS2 A;  2DFU A;  1M2V A;  2K3Y A;  1NZ9 A;  4X9D A;  4ESR A;  4NL2 A;  1MMN A;  5FLX E;  4J83 A;  2QK0 A;  3RMQ A;  5C6S A;  2RHY A;  3LLR A;  3MEU A;  2DVJ A;  4RTV A;  3A8G B;  1M8M A;  4LXC A;  3CCR A;  4FM4 B;  4C5E A;  3QYG B;  4KH1 B;  3QKJ A;  4AG1 C;  5CKF A;  4M77 A;  3LWH A;  2D8H A;  4MZT A;  3FDR A;  1AZG B;  4PJN A;  2DL3 A;  1B3Q A;  1XQH A;  4P5N A;  1TOV A;  5IXF A;  3LX7 A;  3JB9 I;  4M7A E;  1YCS B;  3HFN A;  3M4Y A;  1SSH A;  5GAN 7;  4DBH A;  2FL7 A;  1VQO Q;  3JB9 H;  3A8L B;  2JXB A;  2WSF E;  1ZSZ B;  4TVR A;  2DD5 A;  1IGU A;  1YP5 A;  4RUG A;  3OYJ A;  2QQB A;  1D0Y A;  2DNU A;  2PVD B;  4E47 A;  5IH2 A;  4IUR A;  2RF0 A;  1WGS A;  1N5Z A;  2F1L A;  5FU6 C;  2D8J A;  1OOT A;  5GAN 6;  4XAX B;  2CYZ B;  5CKD A;  1UEB A;  3QJY A;  5EC7 A;  2H8H A;  4C5G A;  2KSS A;  2L3R A;  1EX4 A;  3URG A;  2OTL T;  1KK7 A;  1BIB A;  2XDD A;  2COW A;  2C0T A;  2AZS A;  3EGD A;  1VIF A;  3M0U A;  4N0A C;  2XHC A;  2AHJ B;  2AKK A;  1VYU A;  3SEM A;  1LNX A;  4B9X A;  2VYT A;  1IZ6 A;  1AOJ A;  2VAS A;  1RAA B;  2CUB A;  2V8I A;  1K8A U;  1ZBJ A;  3EFS A;  4O5V A;  2GFA A;  1RAE B;  4N4I A;  3A8H B;  1YIT A;  2FEI A;  2GTO A;  2CP6 A;  4JRK A;  2VV5 A;  2K2M A;  2JVV A;  2PZ1 A;  3CC2 Q;  4HA8 A;  4DEY A;  2RQR A;  1M9S A;  1U1S A;  5I21 A;  4C92 B;  3OS1 A;  4RTW A;  1A0N B;  1RI0 A;  3H41 A;  2LZ6 B;  1Q81 U;  1OPL A;  5KCO A;  2O88 A;  3GIB A;  2QQA A;  1I5O B;  2DK3 A;  2O01 E;  3LGF A;  1X2K A;  1N9S A;  1GBQ A;  5FWB A;  2I2L A;  3CBM A;  3TVT A;  4OVA A;  4C92 E;  2CUD A;  4RG2 A;  2KDS A;  2YRC A;  3OSS C;  5DM7 R;  4LUE A;  1RAG B;  2EKO A;  4PL6 A;  3M54 A;  2K3B A;  2KEA A;  5LJ3 d;  2RQT A;  4Z02 A;  2DRM A;  1PSF A;  2QQ9 A;  5KH6 A;  4OMQ A;  1BCO A;  1IHV A;  2M16 A;  1WLP B;  2LCL A;  4BI8 B;  1W2B P;  1Y07 A;  5CAI A;  4E7Z A;  4FSX A;  4ZGJ B;  3SD4 A;  2D0Q B;  1JB0 E;  4OB0 B;  1YIJ T;  2XKO C;  3J81 E;  2ZPH B;  3A5Z B;  1IXD A;  3FB9 A;  3QJ6 A;  1JJ2 S;  3BDU A;  2KYB A;  2COZ A;  2RI3 A;  5LJ5 h;  4DBR A;  1N8R U;  4PJO A;  1VQ5 T;  2A28 A;  1JO8 A;  4BE0 A;  1TTH B;  3CCM T;  1X6G A;  3M58 A;  3GNF B;  4ZTF A;  3JAM E;  4E7H A;  2F69 A;  5KE2 A;  4RTZ A;  4QQ6 A;  3QII A;  2CZ7 B;  1AEY A;  2FPD A;  3UAT A;  1VQ8 A;  2QTX A;  1OQK A;  1QVF S;  2LRQ A;  3JCM W;  2LP5 A;  2DF6 A;  1YI2 A;  4L59 A;  4O6J A;  1AHJ B;  4D6W A;  4Y28 E;  1B7T A;  1QP3 A;  1Y71 A;  4JJN K;  3G6E A;  3ZL7 C;  1UE9 A;  3DB4 A;  4BDY A;  5IT9 E;  2DXC A;  2LQN A;  4DEX A;  1NPP A;  4FCY A;  1IRX A;  4M75 C;  1UHF A;  5GAN 2;  2RK2 A;  3CPW S;  3QHS A;  2QGF B;  1UEC A;  4N4G A;  3CC4 T;  3HPW A;  2YLB A;  5A0G A;  1QVG P;  3V8L A;  2QEX T;  2KXD A;  1S72 A;  2CP2 A;  2P0K A;  3LH5 A;  1AWJ A;  2DD4 A;  1YIT Q;  4KUI A;  4M7A F;  5KYW B;  1Q7Y C;  1CKA A;  5LJ3 h;  4J7F A;  3OYY A;  3CCR T;  4PNO A;  3TQ7 P;  2QI2 A;  1W1F A;  4EMK B;  3CCS A;  4M7D B;  2QA4 A;  2LX7 A;  4BY6 B;  3PNW C;  3OY9 A;  1WPY A;  3QZ5 B;  4WF2 A;  3RMS A;  1YHQ A;  2LCC A;  2QAZ A;  2PUO B;  2E70 A;  1UGV A;  2CSQ A;  5GAN e;  3CME A;  1YBY A;  3VRY A;  1PNJ A;  2F2W A;  2FZC B;  4M7D E;  3I9Q A;  1VQM A;  1RUW A;  1G2B A;  1KD1 R;  2YRV A;  2ROL A;  5GAO q;  3JCM b;  1VQK T;  1UG1 A;  3OS0 A;  1YCY A;  1RLQ C;  1UJY A;  3E9F A;  4M77 C;  4AG2 C;  1KQS S;  5I2S A;  5GAN 3;  2PNI A;  4RTU A;  3C0C A;  3EHR A;  3SFM A;  2GFU A;  1AZE A;  1VOM A;  4KGX B;  3R6O A;  5CKB A;  4Z8A A;  2RN8 A;  3MP6 A;  1K8A R;  2KNB B;  3JCM X;  1MMA A;  1JQQ A;  3SWN A;  1WYX A;  4XTZ A;  3OYI A;  3OA6 A;  4LDU A;  5LJ5 f;  2ED0 A;  2B8A A;  4RKU E;  4ELY C;  4C5H A;  2E65 A;  5GAM j;  3AT1 B;  2EYZ A;  3E9G A;  1TS9 A;  4A4E A;  5GMK i;  3TEE A;  1VYT A;  4XU1 A;  1YIT T;  2LT1 A;  1R0B G;  1YI2 Q;  1AWW A;  2CP5 A;  2X4W A;  2JZ2 A;  1K9M U;  4EIK A;  3M4G A;  3G6E Q;  2EBP A;  1K73 U;  4A53 A;  2DER A;  1I07 A;  4PJM A;  4OMN A;  4QT7 A;  5KYX B;  1ZQ1 A;  2FRW A;  2KRO A;  4F7U E;  4BE2 A;  2CZ6 B;  4QVC A;  4FYW B;  2R5M A;  3M0R A;  3EFO A;  3MHX A;  1Q86 U;  1S72 Q;  2V1Q A;  2ABL A;  5GAM g;  4JS4 A;  1RAB B;  2H3J A;  2Y4X A;  1RAF B;  2XI9 A;  4PJL A;  5LJ3 f;  3CCS Q;  1M90 C;  3ZEH A;  2RH2 A;  1AT1 B;  2EFI A;  2PU9 B;  9ATC B;  2FZG B;  2ECZ A;  4C0D C;  4XTY A;  3NMZ C;  2P4R A;  3VU3 C;  1M3C A;  3ZFJ A;  4XTX A;  1Z9Q A;  1W4S A;  1OZ2 A;  3G4S Q;  2YHT A;  1WXU A;  2YT6 A;  1TH7 A;  3BFM A;  4X1V A;  3CXC A;  2ZZD A;  3CME Q;  2DEQ A;  3MPU B;  4E6R A;  4DBF A;  4M4Z A;  2G6F X;  1VQM Q;  2FPE A;  2HBW A;  5HK0 A;  4JDS A;  2DYI A;  1SHG A;  5KCH A;  4J8O A;  2GTJ A;  2K57 A;  2C0I A;  2E5Q A;  4Q5W A;  1FMK A;  2KRS A;  3AHU A;  4DOW A;  4BDZ A;  4R0K A;  4A54 A;  4NOY A;  2QTV A;  2RHI A;  3QO3 A;  4J6X A;  4M78 D;  2HZY A;  1VQ8 T;  4J9F A;  1BBZ A;  3CCE A;  4J5Y A;  2VXF A;  1G3T A;  4E7K A;  3DKM A;  3G6E T;  2DX1 A;  2PTK A;  3CCV A;  3H0H A;  4A4K A;  2VGN A;  2ATC B;  1WI7 A;  2EIF A;  4KT0 E;  4OML A;  4FT4 A;  1NLP C;  1KG1 A;  4PJO C;  1CSK A;  4M78 B;  4RCB A;  2OJ2 A;  2ZPE B;  1GCQ A;  4ELZ C;  4JUV A;  2L8D A;  1S72 T;  1AWO A;  3JV3 A;  2YSQ A;  2Y4Y A;  3OS5 A;  4C8Q F;  3PVQ A;  3LWI A;  2KT8 A;  3CCS T;  2QA4 T;  4NS5 A;  2BZ8 A;  1W2B S;  3HL8 A;  1HJD A;  1MNE A;  2OX7 A;  2F5T X;  4IUP A;  4FU6 A;  4PLL A;  2EJF A;  3A98 A;  1H8K A;  3QDF A;  3FIF A;  2AT1 B;  5J39 A;  2E5K A;  3D7S B;  4IUQ A;  5LJ3 j;  2P0Q A;  1YHQ T;  2DMO A;  1VQN A;  1SRM A;  3TCJ A;  2A0F B;  1Y96 B;  4OMM A;  3M56 A;  2DTO A;  2BKD N;  1D0X A;  1KJW A;  1ZX6 A;  3CME T;  1MMG A;  5M9O A;  2CGH A;  5FRO A;  1TUC A;  1KSW A;  1VQM T;  2KE9 A;  4BUG A;  2F2V A;  4M78 G;  1SPK A;  2L5Q A;  1WHK A;  1KQS P;  2CP0 A;  2FPF A;  1RL2 A;  8ATC B;  3JCM d;  5CKE A;  2L89 A;  5GAM d;  2BZX A;  2NUP A;  4JPB W;  3HRU A;  5KYU B;  1OUL A;  2A7Y A;  3GLX A;  2MCN A;  1ZSZ A;  1AVZ C;  2H3E B;  4XTW A;  4A4F A;  2AK5 A;  5LJ3 g;  1C0M A;  3CC4 A;  1WJS A;  4XU0 A;  2QEX A;  4M7A B;  4HVV A;  1OV3 A;  3LGL A;  3OYN A;  3OQ5 A;  2LT4 A;  2DL7 A;  2EYQ A;  3C4S A;  1BCM A;  3E2U A;  4F14 A;  2MMP A;  4II1 A;  1GFC A;  1QVG S;  3HP9 A;  1M1K R;  5HCK A;  2GQV A;  2GNC A;  1K73 R;  4F16 A;  3EGX A;  4F7U F;  3HKS A;  3J7A F;  2GCX A;  3VS0 A;  2JMC A;  1S1N A;  1IO6 A;  2RO0 A;  1K4U S;  2JJ9 A;  1C6V X;  4XTU A;  3PVL A;  1D3B B;  5GJV B;  2EJ9 A;  2HAX A;  3HTR A;  2MAM A;  2M9U A;  4J9D A;  4M75 E;  1R8O B;  1VQK A;  3SWN C;  4M7A G;  3NTK A;  3LYI A;  1T3S A;  4C92 A;  1JEG A;  4ATO A;  2D1X A;  3RUX A;  5LJ5 e;  4ZGD B;  2XU8 A;  2GBQ A;  2RD1 A;  1MUZ A;  5FRM A;  5EG2 A;  3QUI A;  4GBQ A;  1N27 A;  4FYY B;  2V26 A;  1YIJ Q;  2E1H A;  3OW2 A;  3JCM h;  2DIG A;  5GAM h;  2HBP A;  2W0Z A;  2E3I A;  1OYX A;  1WXB A;  2J6K A;  2OTJ A;  1PHT A;  3GP8 A;  4C92 D;  1WIE A;  1SKU B;  2F2X A;  3P8H A;  2YUN A;  1VQ5 Q;  1QMC A;  1GL5 A;  3V7R A;  4LDX A;  1D09 B;  2EQK A;  1VQN Q;  3CCM Q;  3L2R A;  4LDY A;  2EGE A;  2MIO A;  1VQ6 T;  1X75 C;  5GAO m;  2KYM A;  4KUD K;  1X01 A;  1MV3 A;  2EGC A;  2O31 A;  4ZTJ A;  1KQ1 A;  4PJJ A;  3VS2 A;  1Q7Y U;  2X35 A;  4JS5 A;  3JB9 F;  2EPD A;  2KRM A;  4FL6 A;  2KK4 A;  1VUB A;  1NEG A;  4OB3 B;  3X25 B;  2CP7 A;  1NBE B;  5AYF A;  1VQL T;  1YFN A;  3JRZ A;  4J9G A;  2E6Z A;  5GAN j;  1I5L A;  4FSS A;  3CD6 T;  4M77 E;  2FB7 A;  3CCE T;  3M0Q A;  4EMH A;  1UFF A;  3CC4 Q;  3WVD B;  1QQJ A;  4Z89 A;  4J6Y A;  2QEX Q;  2V8J A;  1EIF A;  2CDT A;  5I2M A;  1M5Q 1;  3CCV T;  4BE1 A;  3CCR Q;  4CC7 A;  5J26 A;  3I5S A;  2EKH A;  3DLL A;  4QVZ A;  2GGR A;  1LOJ A;  1RI9 A;  4ME7 A;  2LCS A;  3L2Q A;  5GMK j;  1JBM A;  2K5F A;  1JRI A;  4C92 G;  3H0F A;  2J7I A;  1NEB A;  3OYD A;  2YLC A;  3QBY A;  3X26 B;  1KC8 R;  2CT4 A;  4DOV A;  1YJ9 T;  2MF2 A;  2R58 A;  2KXC A;  4JLI A;  1TU0 B;  2EW3 A;  3L42 A;  4FIB A;  2BIV A;  5L23 A;  2CZ0 B;  3CCJ A;  3VS7 A;  4A4H A;  1AWX A;  3C12 A;  5KYW A;  3M5A A;  4UC4 A;  1VQK Q;  2EQJ A;  1YJN A;  1VQN T;  5D7U A;  3L1A A;  3RKW A;  5HKC A;  1CKB A;  1TXQ A;  4EMK A;  4J6W A;  4HCK A;  1EFN A;  3VUB A;  4OGC A;  3MCA B;  2IIM A;  3VS4 A;  3JB9 J;  3MP8 A;  3C95 A;  2HSP A;  3VV0 A;  3OYM A;  1GCQ C;  3JSC A;  1E6G A;  3UDC A;  2P4T A;  3RES A;  2K9G A;  3CQT A;  2EYW A;  3JCM f;  4KGZ B;  2CRE A;  3UF4 A;  5GAM f;  5GAO l;  1B07 A;  4D8K A;  4LD6 A;  3OW2 S;  3UA6 A;  1H92 A;  1UGR B;  3RDV A;  2M02 A;  2BUD A;  4BD3 A;  1NE8 A;  4M7D D;  2NUT B;  1KD1 C;  4PFP A;  3KUF A;  2L3Q A;  4ANJ A;  3CXC P;  3ULR B;  2LNV A;  2DXU A;  4KUL A;  4AFU C;  1ABQ A;  4RTT A;  3U23 A;  3CEY A;  4WCI A;  2KI7 A;  3PTA A;  3MO8 A;  2LQW A;  3CMA A;  5IHI A;  2L3P A;  1PC0 A;  4C8Q B;  3OMC A;  2XD0 A;  2YUQ A;  4E7J A;  4QQG A;  4BB7 A;  1BI0 A;  2PQW A;  3VKI A;  1WJR A;  2RA2 A;  1K8A C;  1M90 U;  1N9R A;  2M0O A;  4B6M A;  4PLI A;  2XK0 A;  3EGU A;  1M27 C;  1WXT A;  3M59 A;  2DL4 A;  2JUF A;  3FRN A;  2YWW A;  3EG1 A;  3H9N A;  4M75 F;  4Y91 A;  1VQ7 T;  1WHL A;  2PVO B;  3EAE A;  3JCM c;  4C8Q E;  1ZSZ C;  3ER0 A;  3M0P A;  2O4X B;  5CCA A;  4Y92 A;  1V29 B;  4OMF B;  5GAO r;  2ZPF B;  2E12 A;  1T3L A;  2RM4 A;  1ARK A;  1Q82 C;  5HY6 A;  3PE0 A;  2J6O A;  1NYF A;  1PCX A;  2FZK B;  2DRK A;  5FU7 B;  3WXM B;  3EG9 B;  4K11 A;  2XDB A;  2FHD A;  4ZNX A;  4PJO E;  2MOX A;  2HKN A;  3PMI A;  5KYX A;  4M7D G;  3EG3 A;  1H3H A;  3RKY A;  1YJW A;  2V1R A;  1NLO C;  3CBO A;  4NL3 A;  2LJ0 A;  4A63 B;  2R5A A;  2JTF A;  4E7I A;  1ZBX A;  4B9W A;  2DAQ A;  3A1P A;  1OX8 A;  4LDW A;  3HRS A;  2E4H A;  2OTJ T;  3A8O B;  5IHK A;  1B34 B;  5GAO n;  1E6H A;  2EJG A;  2DIQ A;  2G3R A;  5GAN d;  5KYY B;  2YRD A;  1WHH A;  1QP2 A;  1ABO A;  2HD0 A;  3G71 A;  2DEU A;  3FC3 A;  4HCZ A;  4F7U B;  2QDL A;  2CP3 A;  3EHQ A;  2KGT A;  4MMK A;  3CC7 A;  2RK1 A;  2IG0 A;  1Q81 R;  3M0S A;  4C92 C;  4RMO A;  1VQ8 Q;  2M0Y A;  1U8R A;  2K5I A;  1QLY A;  4M77 F;  3PGG A;  2E3H A;  5CQX A;  2GQI A;  1QWF A;  3VS1 A;  4HCC A;  3SDZ A;  3P8D A;  2HMA A;  1U06 A;  4C0F A;  1V76 A;  3S6W A;  4HKE A;  2RI2 A;  2X4Y A;  5GAN 5;  3JCM Q;  1VQ9 A;  1WNL A;  2CZ1 B;  4OB2 B;  1NM7 A;  2KQW A;  2X4X A;  1VQP T;  2NUZ A;  2VWF A;  3JCM g;  2KY9 A;  6AT1 B;  1QW1 A;  1H3Z A;  2VUB A;  1KIK A;  2JTM A;  5GJW B;  3MEW A;  1X27 A;  3RR6 A;  1W6X A;  2QA4 Q;  4F7U G;  2ESW A;  4EPC A;  4LN2 A;  4JJD A;  1YHQ Q;  1F1B B;  4MZM A;  4X34 A;  2K2V A;  3RKX A;  2PVG B;  2DTI A;  1N8R R;  5FU6 B;  1VQ6 A;  2E41 A;  4DQ2 A;  1SG5 A;  1RAD B;  3RER A;  4M78 A;  3EG2 A;  5A2Q E;  4HVW A;  1YN8 A;  1I0C A;  2R57 A;  1HK9 A;  5GAN h;  1FWZ A;  2EQU A;  3CCJ T;  3CCL T;  1GXI E;  3HFO A;  3OBY A;  4N4H A;  3HRT A;  1YJN T;  1FMW A;  1UGP B;  3ZBD A;  1VQL A;  1H64 1;  1LCK A;  2KAF A;  5I11 A;  1UTI A;  2VVK A;  2CS7 A;  2L2P A;  1I4K 1;  1G8X A;  1KHC A;  1XJW B;  2DO3 A;  3CD6 A;  3OW2 P;  2EYX A;  2QGG A;  1YJW Q;  1UGS B;  4OMO A;  1IRE B;  1Y96 A;  5AT1 B;  3NPF A;  2QAS A;  3X20 B;  2CH4 W;  2QDY B;  1SHF A;  3VS5 A;  5GMK h;  1M1G A;  1NJI C;  5A0D A;  3OYB A;  3QPH A;  1K9A A;  3NFC A;  1QCO A;  3G71 Q;  4QKU A;  3L2W A;  2ENM A;  4J7I A;  2CH4 A;  1ZUY A;  2RJD A;  2X4J A;  1PKT A;  1D0Z A;  1UDL A;  1QCN A;  4EMK C;  1EZZ B;  3CMA T;  4BY6 C;  1VQO A;  3LW5 E;  5KYU A;  2JMA A;  2ZPB B;  3PMT A;  1Q95 G;  1Y57 A;  5DLO A;  5D6X A;  1PKS A;  2ZGW A;  4HVU A;  1QVP A;  1YJ9 A;  4FT2 A;  1E7O A;  2LX9 A;  4V2S A;  4M7A A;  2QQR A;  4CRI A;  2XDP A;  2RB6 A;  2X9H A;  3PFS A;  1VQ9 Q;  1BB9 A;  5KYN A;  5GAM e;  4R56 A;  3FLG A;  1LPL A;  2JN0 A;  1M1K C;  5L8R E;  2IPO B;  3NHN A;  3CCU A;  4PJO F;  1WQ7 A;  4IKF A;  2K79 A;  3BDL A;  3VS3 A;  4FW2 A;  3EH2 A;  4HT8 A;  4AMC A;  1M1F A;  3M9Q A;  3ASK A;  5IHN A;  2EQM A;  2JT4 A;  3EFR A;  1OZ3 A;  4M7A D;  2KR3 A;  2QG9 B;  2DJZ A;  1X69 A;  3BE3 A;  2K4Y A;  2BTT A;  3QSU A;  1G3W A;  1K76 A;  4AFS C;  1VQ4 T;  3E1S A;  4C0G A;  2DPP B;  1GRI A;  1D3B A;  1VIE A;  3V8K A;  3TSZ A;  2WAC A;  3Q1J A;  2FG0 A;  4M75 D;  1WHM A;  3MJX A;  1WFW A;  2DET A;  2HQH A;  1VQ6 Q;  2NLU A;  1YJW T;  3DLM A;  3JCM V;  3CXC S;  2VKN A;  2HKQ B;  5D6W A;  4IUT A;  3CCQ A;  2DYB A;  2K3X A;  2VXE A;  4YTL A;  5GAN f;  3I56 T;  3X28 B;  1BKB A;  1RAI B;  1M3A A;  4X9C A;  4LUD A;  1BI1 A;  1OEB A;  3G71 T;  1K9M R;  1VQL Q;  4M75 B;  3CC7 T;  3T9N A;  3CD6 Q;  2AIR B;  3OYK A;  5C0M A;  1VQ7 A;  2LVM A;  4AFZ C;  1GFD A;  3CCE Q;  2J6F A;  4LDV A;  2F5K A;  2QYZ A;  2B86 A;  3JCM P;  3CCV Q;  3OYE A;  2C0O A;  2D0N A;  1Q86 R;  1M8V A;  4L6V 5;  2DXT A;  2X3W D;  1VQ9 T;  5GMK m;  2KRN A;  2ED1 A;  1X6O A;  1MHN A;  1IB8 A;  2A3L A;  4OGE A;  4PFO A;  1WZO A;  3NTH A;  2DL5 A;  1JJ2 A;  2NUP B;  1IGQ A;  3F70 A;  4M77 D;  3INZ A;  3QDR B;  4KH0 B;  1SEM A;  3RBB B;  1G5V A;  1M2V B;  4M75 G;  1YJ9 Q;  2M1H A;  4OP0 A;  4RTX A;  4XU2 A;  1SSF A;  5DY9 A;  3JCM J;  1OU9 A;  1KD1 U;  1QVF A;  3I35 A;  2HSE B;  4J9H A;  3KBG A;  2DZ9 A;  3CCU Q;  4IIM A;  4BI3 A;  2DVE A;  3HHT B;  2X3X D;  1UUE A;  4M77 B;  3VRZ A;  5KE3 A;  1WX6 A;  3REA B;  2HEQ A;  3S3M A;  2EQI A;  3EGX B;  3CPW A;  4OMP A;  1BU1 A;  1KC8 C;  1FX7 A;  5LJ5 d;  1M30 A;  1ZA2 B;  2XIC A;  4L5G A;  2BE7 D;  4ZGE B;  5LJ3 e;  2MWO A;  2OAW A;  3I55 A;  2QXF A;  5CKH A;  2KVQ G;  3GPL A;  3OYC A;  1BI2 A;  1K0X A;  2A08 A;  4R55 A;  3QZ9 B;  1VQP A;  4E2F B;  3TU4 K;  3CCQ Q;  3H6Z A;  1G3S A;  4A4G A;  5CVI A;  5CIU A;  1MGQ A;  4M78 C;  1Q82 U;  2DIL A;  1XNI A;  3OBW A;  4M77 G;  2AZV A;  1MV0 B;  4CC3 A;  5CK9 A;  3J80 E;  7AT1 B;  3H0I A;  2VC8 A;  3EGD B;  3HSB A;  4GLM A;  2NYS A;  4PFZ A;  2K5L A;  2NUT A;  1X2Q A;  3GF5 A;  1VQ7 Q;  5GMK l;  1VQO T;  1ZA1 B;  4HCB A;  3M0T A;  1N6A A;  4Z88 A;  2RHZ A;  3CPF A;  1O9S A;  5GAN g;  3M53 A;  3FJP A;  5GAN 4;  4JLG A;  2O9S A;  1P92 A;  2P84 A;  1KQS A;  4C8Q A;  5DLQ E;  4CI0 C;  3CCL A;  4M78 F;  2KMT A;  2L0A A;  1NPR A;  3L2U A;  5FW9 A;  4M7D A;  4C0D B;  3QWY A;  2K6D A;  3CCU T;  2KT1 A;  2AKL A;  2HQE A;  2RJC A;  1PG5 B;  3RNJ A;  1WA7 A;  3OYF A;  2ZAE A;  4RCC A;  2EYY A;  2SEM A;  3EH1 A;  1X43 A;  4XU3 A;  1SF9 A;  4C8Q D;  5IAY A;  1U5S A;  4E7S A;  4VUB A;  2RMO A;  2L3S A;  1KQ2 A;  2O4X A;  4ORZ A;  1JXM A;  2OTJ Q;  3CBP A;  2RQU A;  4J9B A;  1PD1 A;  4M7A C;  2O9V A;  4LE9 A;  3A8M B;  5CO7 A;  2LTO A;  5CR2 A;  1IHW A;  2HDA A;  3SHW A;  1LJO A;  1UJ0 A;  1T0H A;  3DB3 A;  3EG9 A;  3CC2 T;  4PJO D;  2FVU A;  1Y7X A;  4ZN3 A;  4ZN1 A;  4JRI A;  3MEV A;  3CCQ T;  2EVR A;  2HNI A;  4KGV B;  3MEA A;  2JW4 A;  3X24 B;  3VS6 A;  3WVE B;  2DTH A;  1U3O A;  3I55 Q;  4F04 B;  1SRL A;  4OB1 B;  2Y90 A;  1B34 A;  2XG8 D;  4E7L A;  4RTY A;  4PJO B;  1OX9 A;  3VUZ A;  1ZUK A;  2COY A;  2ZPG B;  4DA4 A;  1TUD A;  5KYY A;  2JM8 A;  1VQP Q;  1Q81 C;  5ECA A;  4F7U A;  2BE9 B;  1PWT A;  1QCF A;  2HL5 C;  4AT1 B;  1TUG B;  4JZ4 A;  4QW2 A;  1G3Y A;  1HYO A;  1TWB A;  2BZY A;  1VA7 A;  1QKX A;  3FJ5 A;  1MMD A;  2I0N A;  3V7C A;  1XTD A;  1RAH B;  2RQW A;  2E6N A;  2P0P A;  3MKD A;  3G4S A;  1VQ4 A;  4C8Q G;  4IIO A;  2EGA A;  2CKK A;  3FEO A;  4KRT A;  3N5B B;  4MDW A;  2LNH B;  3TSW A;  2MYS A;  3UPU A;  3O8V A;  1BI3 A;  4IUU A;  1U1T A;  1FYN A;  1UGQ B;  1V1C A;  3E19 A;  4JJC A;  2YDL A;  4JZ3 A;  4BAC A;  3GBQ A;  4PJO G;  1GBR A;  1FXX A;  3CCJ Q;  4FW1 A;  1BK2 A;  3CCL Q;  3I56 A;  2ZCF B;  1YJN Q;  1NJI U;  3OYA A;  1I1J A;  1T0J A;  2LJ3 A;  4XQ3 A;  2K7A A;  3R6N A;  3NGP A;  3OB9 A;  1WQW A;  1Q7Y R;  2FO0 A;  5GMK e;  4PK4 A;  2JOY A;  1OPK A;  1D1C A;  4EDU A;  3P8B B;  3I5R A;  3OSV A;  1HXD A;  2JS0 A;  1K1Z A;  1N8R C;  2DLP A;  2HCK A;  2Z0W A;  2DL8 A;  3OMG A;  3UT1 A;  1PRL C;  1M2O A;  3BW1 A;  2RHU A;  1UHC A;  2CSI A;  2YUO A;  2D9T A;  3S3O A;  2LDM A;  2VGM A;  1NYG A;  3I55 T;  4J9I A;  2NWM A;  3BY7 A;  2J06 A;  2J05 A;  1Q82 R;  1M1K U;  1PM3 A;  4N0A A;  3QXE B;  1W2B A;  1YWO A;  2JS2 A;  1ACM B;  4J9C A;  3SB2 A;  3CMA Q;  3OYL A;  2DJQ A;  4C92 F;  4HXJ A;  2PUK B;  2A36 A;  1RLP C;  1YWP A;  2LQ8 A;  1FMV A;  4GLK A;  2EAY A;  3JB9 D;  4F17 A;  1KHI A;  1G83 A;  1KFZ A;  1XOV A;  2JM9 A;  3THK A;  2LQK A;  3REB B;  2YXY A;  4BI4 A;  1NG2 A;  2VB6 A;  3SWN B;  2RQV A;  2DXB A;  2DE0 X;  4FYV B;  2LC4 A;  4EMG A;  4JRQ A;  1D1A A;  2OTL A;  2W10 A;  4FYX B;  3VYG A;  4J9E A;  1ZHI A;  2IVW A;  1HSQ A;  2RJF A;  2X51 A;  2RNA A;  1MND A;  1J3T A;  2GF7 A;  1TSF A;  1ZLM A;  1D1B A;  1M3B A;  2MPX C;  3PIP A;  1YNZ A;  1JJ2 P;  2DBK A;  4OF1 A;  5FRN A;  1GCP A;  1VQ4 Q;  1R0C B;  3UA7 A;  1QWE A;  5J3B A;  2A37 A;  1VYV A;  1Y0M A;  1HD3 A;  4LD9 K;  4JRP A;  2MI6 A;  3NTI A; 
#chains in the Genus database with same CATH homology
 2EKH A;  2XMF A;  2ROL A;  2GGR A;  2LCS A;  1RI9 A;  2RPN A;  1UG1 A;  4AFZ C;  1AD5 A;  1RLQ C;  1GFD A;  1ZUU A;  1UJY A;  2CT3 A;  2J6F A;  1K0S A;  3H0F A;  2J7I A;  1W70 A;  4AG2 C;  1NEB A;  2B86 A;  2LMJ A;  2CT4 A;  2PNI A;  2YUP A;  4CC4 B;  4RTU A;  3C0C A;  2C0O A;  2D0N A;  3EHR A;  2X3W D;  1AZE A;  2KXC A;  4Z8A A;  2RN8 A;  2FRY A;  2EW3 A;  2KRN A;  2ED1 A;  2KNB B;  5FWC A;  5L23 A;  3VS7 A;  1AWX A;  1JQQ A;  1TG0 A;  1WYX A;  1PRM C;  2JTE A;  1ZSG A;  5I22 A;  1CKB A;  2DL5 A;  2M51 A;  2ED0 A;  4HCK A;  1EFN A;  2DM1 A;  2IIM A;  3VS4 A;  1JXO A;  2LJ1 A;  2O2O A;  2EYZ A;  1SEM A;  2HSP A;  3RBB B;  1GCQ C;  3EG0 A;  1E6G A;  2ROT A;  1VYT A;  3QWX X;  2K9G A;  4RTX A;  3CQT A;  2EYW A;  1AWW A;  4CC2 A;  2CRE A;  3UF4 A;  3KFV A;  1B07 A;  4D8K A;  2DA9 A;  3UA6 A;  1H92 A;  4EIK A;  3I35 A;  2OI3 A;  2EBP A;  4J9H A;  1I07 A;  2L3Q A;  3ULR B;  4OMN A;  4IIM A;  4QT7 A;  2X3X D;  1UUE A;  4AFU C;  3VRZ A;  1ABQ A;  1WX6 A;  2FRW A;  2KRO A;  4RTT A;  3REA B;  3U23 A;  4D8D A;  2HEQ A;  4WCI A;  2LQW A;  2EQI A;  4JJB A;  4OMP A;  3M0R A;  5IHI A;  2L3P A;  1BU1 A;  2V1Q A;  2YUQ A;  2ABL A;  2SRC A;  1QKW A;  1M30 A;  5IXB A;  4AFQ C;  3EGU A;  2OAW A;  1M27 C;  1WXT A;  2DL4 A;  2DBM A;  1Z9Z A;  4LNP A;  2ECZ A;  3EG1 A;  1K0X A;  1X6B A;  2A08 A;  2P4R A;  3IQL A;  3NMZ C;  3O5Z A;  1M3C A;  2KBT A;  3M0P A;  1Z9Q A;  1JU5 C;  1WXU A;  1WDX A;  2YT6 A;  4Y92 A;  4X1V A;  1T3L A;  2DIL A;  1ARK A;  4ESR A;  3PE0 A;  2AZV A;  2J6O A;  4M4Z A;  1NYF A;  1MV0 B;  4E6R A;  4CC3 A;  2G6F X;  2FPE A;  3H0I A;  2DRK A;  2HBW A;  2DVJ A;  4RTV A;  1SHG A;  4K11 A;  4GLM A;  2GTJ A;  1M8M A;  2C0I A;  4ZNX A;  1X2Q A;  2MOX A;  1FMK A;  3M0T A;  2KRS A;  4Z88 A;  4R0K A;  4AG1 C;  1H3H A;  3EG3 A;  2D8H A;  1AZG B;  2V1R A;  2DL3 A;  1NLO C;  4J9F A;  2O9S A;  1BBZ A;  2LJ0 A;  4A63 B;  1B3Q A;  5IXF A;  1YCS B;  1SSH A;  5IHK A;  2L0A A;  2DX1 A;  2PTK A;  5FW9 A;  3H0H A;  1E6H A;  3QWY A;  2K6D A;  2KT1 A;  1WI7 A;  2AKL A;  2JXB A;  3RNJ A;  1WA7 A;  1ABO A;  4OML A;  2QDL A;  3EHQ A;  2KGT A;  1YP5 A;  2EYY A;  2SEM A;  1NLP C;  1X43 A;  4RUG A;  1CSK A;  3M0S A;  2M0Y A;  1QLY A;  2OJ2 A;  1GCQ A;  2DNU A;  5IH2 A;  1U5S A;  2GQI A;  1QWF A;  3VS1 A;  2RF0 A;  2RMO A;  1AWO A;  2L3S A;  1N5Z A;  3JV3 A;  2D8J A;  1OOT A;  4ORZ A;  2YSQ A;  5EC7 A;  1JXM A;  2H8H A;  1U06 A;  2RQU A;  3PVQ A;  4J9B A;  2KT8 A;  2BZ8 A;  2O9V A;  1HJD A;  4LE9 A;  2HDA A;  2C0T A;  2AZS A;  3SHW A;  3A98 A;  1H8K A;  1UJ0 A;  1T0H A;  2E5K A;  3M0U A;  2AKK A;  1NM7 A;  1VYU A;  3SEM A;  2DMO A;  1SRM A;  2EVR A;  4OMM A;  2NUZ A;  2VWF A;  1AOJ A;  2CUB A;  1KJW A;  2JW4 A;  1ZX6 A;  1KIK A;  3VS6 A;  5GJW B;  1X27 A;  1ZBJ A;  1TUC A;  1U3O A;  1W6X A;  1KSW A;  2ESW A;  2KE9 A;  2F2V A;  2FEI A;  1SPK A;  4LN2 A;  2GTO A;  1SRL A;  4JJD A;  2K2M A;  2FPF A;  2PZ1 A;  4RTY A;  4DEY A;  2RQR A;  1ZUK A;  2BZX A;  4JPB W;  4RTW A;  1A0N B;  1TUD A;  2JM8 A;  3H41 A;  2LZ6 B;  2MCN A;  1OPL A;  1AVZ C;  5ECA A;  1PWT A;  1QCF A;  2O88 A;  3EG2 A;  2AK5 A;  4HVW A;  4JZ4 A;  1YN8 A;  1I0C A;  2BZY A;  1VA7 A;  1QKX A;  3FJ5 A;  2I0N A;  4HVV A;  1OV3 A;  2RQW A;  1X2K A;  1GBQ A;  2DL7 A;  5FWB A;  3TVT A;  4IIO A;  2EGA A;  4F14 A;  1GFC A;  2CUD A;  4LUE A;  4KRT A;  1LCK A;  2LNH B;  5I11 A;  1UTI A;  2K3B A;  2VVK A;  5HCK A;  2L2P A;  3TSW A;  2KEA A;  2RQT A;  2DRM A;  2EYX A;  2GNC A;  1FYN A;  4F16 A;  4OMQ A;  1V1C A;  4OMO A;  4JJC A;  1WLP B;  2YDL A;  3NPF A;  4JZ3 A;  3GBQ A;  3VS0 A;  1GBR A;  2JMC A;  1S1N A;  2CH4 W;  1IO6 A;  1BK2 A;  1SHF A;  3VS5 A;  1K4U S;  1I1J A;  1T0J A;  2LJ3 A;  3R6N A;  2K7A A;  3PVL A;  3NGP A;  5GJV B;  2FO0 A;  1K9A A;  4J9D A;  1OPK A;  2KYB A;  2ENM A;  3I5R A;  2CH4 A;  1ZUY A;  1PKT A;  1UDL A;  2A28 A;  1JO8 A;  2JS0 A;  1K1Z A;  1T3S A;  1JEG A;  2D1X A;  2DLP A;  2HCK A;  1X6G A;  2DL8 A;  1PRL C;  2JMA A;  2GBQ A;  1Y57 A;  1MUZ A;  1UHC A;  2CSI A;  1PKS A;  4RTZ A;  4HVU A;  2YUO A;  1AEY A;  2FPD A;  4GBQ A;  3UAT A;  1E7O A;  1NYG A;  4J9I A;  2LP5 A;  2NWM A;  2DF6 A;  2W0Z A;  2J06 A;  2J05 A;  1WXB A;  1BB9 A;  2J6K A;  1PHT A;  1WIE A;  2F2X A;  3ZL7 C;  2YUN A;  1UE9 A;  1GL5 A;  3NHN A;  2LQN A;  4DEX A;  1YWO A;  2JS2 A;  4J9C A;  2DJQ A;  1UHF A;  2EGE A;  4HXJ A;  2K79 A;  3VS3 A;  2MIO A;  2A36 A;  1RLP C;  1YWP A;  5IHN A;  2JT4 A;  2KYM A;  1UEC A;  2KR3 A;  1MV3 A;  4F17 A;  1G83 A;  1X69 A;  2KXD A;  1KFZ A;  2EGC A;  1XOV A;  2BTT A;  1K76 A;  2O31 A;  2JM9 A;  3LH5 A;  3THK A;  1AWJ A;  3REB B;  3VS2 A;  1NG2 A;  4AFS C;  2EPD A;  2RQV A;  1CKA A;  2DE0 X;  1GRI A;  2KRM A;  1W1F A;  1NEG A;  2LX7 A;  3TSZ A;  2FG0 A;  4J9G A;  2W10 A;  4J9E A;  1WFW A;  1HSQ A;  4FSS A;  2RNA A;  1J3T A;  3M0Q A;  1UFF A;  2VKN A;  1ZLM A;  4Z89 A;  2DYB A;  1M3B A;  2CDT A;  1UGV A;  1YNZ A;  2CSQ A;  2DBK A;  3VRY A;  1GCP A;  1PNJ A;  3UA7 A;  1QWE A;  2F2W A;  4CC7 A;  2A37 A;  1M3A A;  3I9Q A;  4LUD A;  1VYV A;  3I5S A;  1Y0M A;  1HD3 A;  1OEB A;  1RUW A;  1G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...