2GTJA

Reduced form of adap hsh3-n-domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
96
Chain Sequence
EKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEIIRITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords FYN-binding protein
publication title Redox-Regulated Conformational Changes in an SH3 Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gtjA01
2FRYA 2NUZA 2OJ2A 3QWXX 1ZX6A 2HCKA 1ZSGA 1ARKA 3VS7A 1ZLMA 1GFCA 1WLPB 2LCSA 2D8JA 2L3PA 2F2VA 2MCNA 2LZ6B 4EIKA 1SHGA 1Z9QA 2LJ3A 2SRCA 5EC7A 4J9IA 2FRWA 3M0PA 2B86A 5IHNA 3QWYA 4JZ3A 2LP5A 4CC7A 5IH2A 5L23A 2DRMA 3U23A 1AZEA 1B07A 2W0ZA 1JXMA 2J6FA 3UA6A 1NYGA 1WA7A 4KRTA 2K6DA 3I9QA 1GL5A 2EBPA 1AZGB 2EYXA 2RQTA 3PVLA 1UG1A 2F2XA 2VKNA 2RQVA 2YUPA 4J9CA 2DL5A 4HXJA 1U06A 5FW9A 1PRMC 2X3XD 4Z88A 3CQTA 1G2BA 2KYMA 4AFQC 2KROA 3C0CA 3H0HA 3O5ZA 1VYUA 2O88A 3VS1A 1NLOC 4Y92A 2GGRA 3SEMA 3SHWA 1SEMA 2GTJA 1M8MA 2O2OA 2MOXA 4ZNXA 2DM1A 2DMOA 2EQIA 1WYXA 3REBB 2O9SA 4D8DA 2MIOA 2E5KA 2FPDA 1WXBA 2CH4W 1JQQA 2KR3A 3R6NA 1B3QA 1RLPC 2CSIA 2DL7A 1UDLA 2ROTA 3NPFA 1WXTA 2AZSA 5GJVB 1Y0MA 2D1XA 4AG1C 2EW3A 2L3SA 1HD3A 3ZL7C 3M0QA 2P4RA 1MUZA 3M0TA 5I11A 1K0SA 1KSWA 4GLMA 1LCKA 2RQWA 3KFVA 2K2MA 1KIKA 4X1VA 4OMQA 4OMPA 2EYWA 2PNIA 1H8KA 2ECZA 2AK5A 1X2KA 1M3BA 2DILA 2V1RA 1SRLA 2D8HA 4OMMA 1WX6A 4OMNA 1WFWA 4RTVA 3EGUA 3UA7A 2A36A 2JXBA 2BZ8A 1PKSA 4J9BA 2KBTA 4QT7A 3TVTA 1AOJA 1JXOA 4JZ4A 1ZBJA 2KNBB 3PVQA 3PE0A 1AWJA 2IIMA 2EYZA 1I1JA 2KYBA 1JU5C 2LQWA 4LN2A 2DBMA 4AG2C 1FYNA 2DL4A 4RTXA 1YN8A 3RBBB 2LQNA 1T0HA 2FG0A 1UUEA 4F14A 4CC4B 1SPKA 1PRLC 2EGEA 1EFNA 1QLYA 2LJ1A 2K79A 1YCSB 2ABLA 2FPFA 2RPNA 2JMCA 2KXDA 2K7AA 1X27A 1AEYA 3H41A 2YUOA 1WIEA 1QWFA 2XMFA 4WCIA 1OOTA 1K0XA 1GCQA 1A0NB 2L2PA 2KT8A 2VVKA 1CSKA 2DA9A 2JM8A 4LNPA 2A37A 2DBKA 1GFDA 2CDTA 1PWTA 1J3TA 2H8HA 1H3HA 2LNHB 1UTIA 1M30A 2O31A 4RTZA 3ULRB 1QKXA 4J9EA 3M0RA 4OMOA 2CH4A 2EYYA 2O9VA 1AWOA 1AVZC 3IQLA 4J9HA 3EG0A 2KE9A 3M0UA 1NM7A 2FPEA 1QWEA 2GQIA 2DE0X 2DYBA 3M0SA 2J6KA 2HBWA 2KEAA 4LUDA 1IO6A 3EG3A 5I22A 1NEGA 1X2QA 4JJCA 3VS4A 2FEIA 4M4ZA 1VYVA 3EG1A 2RQRA 2DX1A 2EVRA 2CREA 2DF6A 2DL8A 1M3CA 4A63B 2AZVA 2K3BA 1Y57A 3TSWA 2RN8A 1X43A 4FSSA 4K11A 2DNUA 2DLPA 2BTTA 4GBQA 2JS0A 2SEMA 4AFZC 2CUDA 1W1FA 5FWCA 2GNCA 2D0NA 1UFFA 1YWPA 5FWBA 1BBZA 1AWXA 1K1ZA 1X6GA 3EHQA 1N5ZA 3NGPA 4OMLA 2OI3A 4AFSC 4RTUA 4AFUC 2EKHA 2X3WD 2BZYA 2L0AA 1NLPC 4J9DA 2QDLA 1FMKA 1MV0B 1Z9ZA 2LX7A 2RF0A 2J06A 1SHFA 2KRSA 2ED0A 2HSPA 4Z8AA 2KRNA 1AD5A 1UGVA 1PHTA 1T3LA 2V1QA 3GBQA 2YSQA 2CT4A 1U3OA 2EGAA 4LE9A 1UHFA 1E6GA 1UJ0A 2JTEA 2ED1A 1X6BA 3EG2A 1PKTA 4HVVA 1K4US 2RMOA 2AKLA 4LUEA 2J05A 1PNJA 2JS2A 2ENMA 4CC2A 2C0IA 2KXCA 1G83A 3TSZA 4JPBW 2C0OA 2DVJA 1W6XA 4DEYA 1JO8A 1VA7A 2YDLA 2M0YA 1ABOA 4RTWA 1YWOA 2ESWA 4HCKA 5IHKA 2PZ1A 1VYTA 2OAWA 4E6RA 1GCQC 2JW4A 2AKKA 1WXUA 1AWWA 3I5SA 1KJWA 3VS3A 1WDXA 1H92A 1TUDA 2CSQA 4JJBA 4RUGA 1BB9A 3UF4A 1ZUUA 2JMAA 4DEXA 1UECA 2CUBA 2KRMA 3JV3A 1OPLA 1CKAA 1RLQC 2A28A 3VS0A 3THKA 1V1CA 3I35A 1I0CA 4CC3A 2FO0A 3REAB 1RI9A 1T3SA 1OPKA 1UE9A 5IXFA 1CKBA 2GTOA 4IIOA 2G6FX 1K9AA 1NYFA 4HVWA 1ZUYA 1NEBA 2J7IA 3H0FA 1SSHA 3H0IA 3VRYA 1S1NA 5IHIA 1WI7A 4J9FA 2K9GA 1M27C 4J9GA 1OV3A 2C0TA 5IXBA 2YUNA 1YP5A 4F17A 2KT1A 1RUWA 1TUCA 1KFZA 3NMZC 1UHCA 2DL3A 2EGCA 1GCPA 5HCKA 1YNZA 2W10A 2HDAA 2HEQA 1QKWA 3VRZA 5ECAA 3LH5A 1XOVA 2GBQA 1HSQA 2LJ0A 2A08A 4D8KA 3RNJA 2VWFA 2YUQA 3VS5A 2F2WA 2LMJA 4R0KA 1UJYA 1M3AA 2YT6A 2DRKA 2L3QA 3VS2A 4F16A 2NWMA 1GBRA 1TG0A 1SRMA 2BZXA 2J6OA 2I0NA 1E7OA 2JM9A 4RTYA 3FJ5A 1GBQA 1JEGA 1QCFA 2CT3A 2RQUA 1X69A 1E6HA 4Z89A 3VS6A 1T0JA 4ORZA 4ESRA 1K76A 3UATA 2M51A 1U5SA 1HJDA 4JJDA 1W70A 1BK2A 1BU1A 1OEBA 1ZUKA 2PTKA 2RNAA 3EHRA 3NHNA 3I5RA 2JT4A 4IIMA 4HVUA 4RTTA 1ABQA 1MV3A 2ROLA 3A98A 1NG2A 2DJQA 5GJWB 1I07A 2EPDA 1GRIA 2KGTA
chains in the Genus database with same CATH superfamily
4E7SA 1VQ8T 2FRYA 2NUZA 2HCKA 1ZSGA 2FZCB 1Q81C 4LDXA 1GFCA 2L3PA 2F2VA 3QUIA 4LD9K 1QMCA 1SHGA 3CCLA 1QW1A 5EC7A 1VQKA 2KQWA 3M0PA 5GAMe 2M02A 1RAAB 2R57A 2IVWA 2OX7A 2X4YA 3INZA 3FLGA 5GAN8 3EGXB 4CC7A 2DRMA 2YRVA 4DBRA 3UA6A 1N8RC 1NYGA 1WA7A 2COYA 3MEUA 4II1A 4KRTA 1VQLQ 3QJ6A 3FEOA 2CYZB 2JJ9A 3WVEB 2EYXA 4XTXA 2OTJA 1YI2A 1VQNA 2LC4A 4C5HA 3PIPA 2DL5A 1NPRA 1OU8A 2M16A 3CPWP 1W4SA 3NTIA 5FW9A 2K2VA 4ZN1A 3C4SA 1G2BA 2DD5A 4C92C 4DBQA 1ZSZB 4Y92A 1H3ZA 2GGRA 2RA2A 1NPPA 1BI0A 2CP5A 2YRCA 5GAOn 4ZNXA 1UEBA 1WYXA 4D8DA 2E5KA 3A8LB 2YHTA 2ZPBB 1N8RR 4FT4A 3KUFA 2BUDA 3R6NA 1B3QA 1RLPC 2CSIA 3HHTB 1M90C 3NPFA 3CEYA 1WHHA 1Y0MA 1C1AA 2EW3A 2L3SA 1NZ9A 1HD3A 5KYXB 3ZL7C 3M0QA 2VC8A 3M0TA 3OYDA 1KSWA 1KQSP 1VQPT 3CCRA 3JCMh 1Q86C 2K2MA 5LJ5h 3BFMA 3CCQQ 1KIKA 2F5TX 3G71T 3JCMW 1BCMA 1K8AC 1R77A 3JAME 2DILA 3CC2A 2YLBA 5KCHA 1QVFA 4C92G 4M78F 4E2FB 3X28B 2BZ8A 3KXTA 2MI6A 2LT4A 2XU8A 3VV0A 3CXCA 4M78B 1AOJA 4C8QC 1KD1U 4JZ4A 5HKCA 3UPUA 2KNBB 3PVQA 2X9HA 2IIMA 2ZAEA 1M90R 1I1JA 1W2BP 1JU5C 4LN2A 4KGZB 4XQ3A 4PJOA 1RADB 1PSFA 4AG2C 4LD6A 2LQNA 4M78D 2JTFA 1PG5B 4IUVA 4C0FA 3QZ5B 1PRLC 3X20B 2CP0A 1EFNA 1QLYA 1MHNA 1WHMA 1KC8U 2QEXT 1K8AR 3BY7A 2K7AA 1X27A 3CD6T 5GAN5 3LLRA 4LDUA 4M7AC 4ZTJA 4FW1A 2VVKA 1AT1B 4EMKB 4X9CA 3OBYA 2QQBA 4HT8A 4BB7A 1HYOA 1J3TA 2H8HA 1H3HA 5CQXA 4OP0A 1JJ2A 3OYIA 1VOMA 1QKXA 4J9EA 3CCUA 4B6MA 3L2RA 2L89A 2RO0A 2EYYA 3VJPA 4MZMA 2QA4Q 4C8QG 2FZGB 3VU3C 4IUPA 2EJGA 4XTWA 5M9OA 4C8QE 1JJ2S 4FW2A 1NM7A 2DE0X 3I56T 3M0SA 2KEAA 2XDPA 4QQDA 2ZCFB 4L6V5 2FEIA 2EVRA 1KK7A 1M3CA 3MEWA 5FLXE 2E3HA 3GLXA 2RN8A 3GOXA 4JDSA 2XKOC 2DLPA 1YHQA 1YJWQ 2DEQA 4MZPA 4JUVA 3HFOA 4JRKA 2DKGA 4M7AG 1QVGS 3CCST 1W1FA 3MEVA 1M2VB 1UFFA 5GANh 4M7AE 1BBZA 1PM3A 4BUGA 1K1ZA 3OS5A 3EHQA 5CQYA 1N5ZA 1VQOQ 4F7UF 3NGPA 2BE9B 4OMLA 4RTUA 4XTVA 4Z02A 2P0PA 3N5BB 2EKHA 3OS1A 2X3WD 4KUIA 3OYGA 2L0AA 2QGFB 3JCMX 3MP1A 1MV0B 2A7YA 4PJMA 1SHFA 4Z8AA 1T3LA 1D09B 4PFOA 3OYJA 1VQ5A 2XG8D 2YSQA 4PJNA 3M9QA 5GANf 1UJ0A 2ED1A 2RB6A 3EG2A 2RMOA 1ZSZA 2J05A 1PNJA 2JS2A 3HPWA 5A2QE 4NL3A 4UC4A 3L2ZA 1LVKA 2ZGWA 3URGA 1G3SA 2HBPA 3RDVA 2GQVA 4DEYA 3JB9I 1YJNQ 1VA7A 4GLKA 1ABOA 5LJ3g 1YITQ 4HCKA 5IHKA 1VYTA 2OAWA 2JW4A 2L8DA 2OTLT 1AWWA 3ASKA 3I5SA 3G4SQ 1H92A 3UF4A 1ZUUA 4DEXA 3UDCA 3EFOB 3QYHB 1YJ9T 5KE3A 5GAMh 4BY6C 1WJSA 3MCAB 2A28A 3EG9B 4PKCC 3MO8A 1I0CA 2FO0A 1T3SA 1U1SA 1UE9A 2YLCA 1CKBA 5IXFA 3VYGA 4IIOA 1N6AA 2G6FX 2F5KA 4ZTFA 3A8GB 4M77F 3T9NA 2J7IA 2P0QA 1VQLA 3H0FA 5LJ3d 4TVRA 1S1NA 4M77B 5IHIA 3MEAA 5GAMf 1OV3A 5IXBA 2YUNA 4F17A 4AT1B 3CCVQ 1BIAA 4PL6A 1Q7YC 3BW1A 2M0OA 2LCCA 3NMZC 1UHCA 5D6WA 3JCMd 1KD1C 5LJ5d 2XDDA 4OMFB 2WACA 1ZBXA 3ZBDA 5HY6A 3OYEA 3E9FA 3HTRA 1WHKA 2AT1B 4M77D 3JCMc 2CZ6B 2E10A 3SDZA 4L5GA 4D8KA 5GAOl 2VWFA 2YUQA 3F70A 1Y7XA 2LX9A 2LMJA 1UJYA 4XU2A 2QI2A 2DRKA 1VQMA 2EIFA 1QVGP 1KC8C 1M1KU 4M7DC 4F16A 2NWMA 2BKDN 4EMKA 2BZXA 2J6OA 4QW2A 3JSCA 4RTYA 5GMKl 3OW2P 4Z89A 3QBYA 1K76A 4KGXB 3OQ5A 1VQ7T 1Q7YR 4E7ZA 2ZPHB 1KD1R 3MJXA 6AT1B 3NHNA 2X51A 2Z0WA 3JB9F 3CCQA 3HSBA 4IIMA 1M5Q1 3OA6A 1HK9A 3A98A 1IGQA 5CK9A 5GJWB 1WNLA 1QP2A 3RIRA 4C0GA 2VV5A 4JS4A 4J6WA 4OGCA 4HT9A 2R5MA 3QWXX 3CCMA 1ZLMA 2LCSA 2D8JA 2MCNA 2LJ3A 1Z9QA 2SRCA 1WGSA 3V8LA 4E7LA 3SWNB 3P8HA 4J9IA 1NBEB 1D1AA 2B86A 3JB9D 5IHNA 4JZ3A 2RJCA 5IH2A 4KUDK 4M7DG 1K8AU 2CP6A 3TEEA 3U23A 1AZEA 4ELZC 2EQMA 2W0ZA 4HA8A 2GFAA 4M7DE 1ZA1B 3RMSA 3I9QA 1GL5A 5GAN3 1Q95G 2AHJB 5EG2A 4N4HA 4QKUA 2CP7A 3PIOA 4JLIA 2E12A 4KGVB 5AYFA 1UG1A 3CMAT 3G4ST 2P0KA 4XU1A 3CC4T 2OTJT 2YXYA 2X4JA 1OZ3A 4Z88A 3CQTA 4AFQC 3H0HA 1ZHIA 2M1HA 4PJOF 1RAGB 3LW5E 1RAEB 1NLOC 2QQRA 1D1BA 3M4GA 2DD4A 2D9TA 2GTJA 1M8MA 3M59A 2DM1A 2EQIA 2HMAA 1VQPQ 3RKYA 2QA4A 1FX7A 3EFSA 1WXBA 2DL7A 3G71Q 2RM4A 2E4HA 5GJVB 2AZSA 2D1XA 2RJDA 4AG1C 3CCJT 4PJJA 3RUXA 3OBWA 1Y07A 1LPLA 9ATCB 1VIEA 2O4XB 3EFOA 1WQWA 4J6XA 1TH7A 2Y4XA 2QYZA 3BE3A 1YJWA 3CCRT 4JS5A 1UGQB 4C5IA 1LNXA 1KHIA 4OMMA 1WX6A 7AT1B 4OMNA 1WFWA 1QP3A 4RTVA 4M7DA 5C0MA 1VQ4T 1PKSA 2D6FA 2KBTA 3TVTA 2EWNA 2L5QA 3G6ET 1B34B 4N4IA 3J80E 2QEXQ 3UT1A 2EYZA 3CD6Q 1NJIC 3A8MB 3G7ZA 4C92B 2XK0A 2JOYA 1BI2A 1TTHB 1UGPB 2K57A 3OB9A 1TXQA 1T0HA 1UUEA 4J6YA 3MPUB 4JJNK 2EGEA 1Q82U 2ABLA 2FPFA 2JMCA 5I21A 3I55A 1UGSB 2KXDA 3Q1JA 1AEYA 3H41A 3X25B 4Y28E 2YUOA 1WIEA 1SF9A 3QSUA 4WCIA 1OOTA 2E70A 3MHXA 3QHSA 1K0XA 1A0NB 2KT8A 1CSKA 1ZA2B 2DA9A 4AMCA 3I56Q 5CAIA 1YITA 2A37A 3J81E 1IHWA 4NS5A 2CDTA 1M1KC 2DXTA 1GFDA 4M75C 2LNHB 1BI1A 1M30A 2O31A 4FU6A 4EMGA 2DYIA 4PFZA 2YRDA 4OMOA 3V7RA 3FRNA 1QCOA 1NJIR 1S72A 3CPFA 3IQLA 2P4TA 3H8ZA 1MNEA 3EG0A 2V8JA 3M0UA 2GQIA 5KYWB 3GIBA 2HBWA 3J7AF 3CCSQ 5I22A 1NEGA 4E47A 4QVZA 3HP9A 3VS4A 3L2WA 1G8XA 4M4ZA 4E7JA 2K5LA 2RK1A 2MYSA 4C0DC 4C8QB 1VQ6A 5CKBA 2AZVA 4BI8B 3M58A 2EFIA 4OB1B 4A4KA 4FSSA 3OYKA 4ZGDB 3SWNA 3CCEA 2JS0A 2MPXC 2SEMA 1I5LA 2CUDA 2RJEA 1M1KR 1YIJQ 3QZ9B 2DK3A 4C8QD 5GMKi 2VGMA 4M75G 4AFSC 4RCBA 1NLPC 4M75E 4N0AC 5GAOq 4FT2A 3HL8A 4M7AB 1FMKA 3JCMJ 1EIFA 1Z9ZA 2ED0A 2KRNA 1AD5A 2ZZDA 4L59A 1WQ7A 1MGQA 2CT4A 1Q7YU 4C92E 1WHJA 3SD4A 1E6GA 4Q5WA 1U8RA 4FIBA 3MP6A 1QVFS 1V29B 2OTLQ 3CXCS 5A0DA 5IN1A 1VQ8A 4R55A 5L8RE 2HD0A 3TSZA 1RAIB 2DO3A 3HRTA 4JPBW 2DVJA 1D0XA 1YJ9Q 4ELYC 2DFUA 2LDMA 2YDLA 1F1BB 2QDYB 2E64A 2RI5A 1TWBA 1GCQC 2V8IA 4DOWA 1MNDA 2AKKA 4A4EA 5KE2A 1TUDA 2CSQA 3SB2A 5LJ3j 2CUBA 2O4XA 1WHLA 3PGGA 2QQ9A 2KRMA 3GNGA 5IAYA 3SFMA 2DZCA 3JV3A 4RG2A 4CRIA 1X6OA 2X35A 1V1CA 3QJYA 2AIRB 1RL2A 3RKWA 1TOVA 5LJ5j 3REAB 1RI9A 4JRQA 4KT0E 2DZ9A 2GTOA 4RMOA 1PD0A 2Y4YA 4HVWA 3JCMb 2KAFA 1NEBA 4M78C 4XK8E 4HKEA 1SSHA 1WI7A 4J9FA 3CMEQ 4FYVB 2K9GA 5GAN7 1B34A 1RUWA 2DL3A 1MMGA 2DEUA 4C92A 3P8BB 4DOVA 2XIDA 1YNZA 1FXXA 1OULA 4Y91A 1R0BG 3DLMA 5ECAA 1XOVA 1B7TA 1I5OB 4XU3A 3OYLA 2LJ0A 3UWNA 4HCCA 2FHDA 5FU6C 1VQ7Q 4R0KA 2LQKA 1OX9A 4IKFA 1Q82C 2DIQA 4X9DA 1VQPA 3VS2A 2E5QA 3GF5A 1TG0A 1VQMT 1SRMA 3C12A 3LWHA 4PLLA 3OSVA 2BIVA 4BD3A 1YIJT 1KG1A 2CT3A 2DTIA 1X69A 5KYYB 3VS6A 3X24B 4ORZA 4ESRA 3NFCA 3KBGA 3UATA 2M51A 4MMLA 4BY6B 3OYHA 1W70A 1FMWA 4QQ6A 1WHGA 2B8AA 1FWZA 1QQJA 4XAXB 3I5RA 2EQKA 1Y96B 3CCLQ 5KYWA 4HVUA 1ABQA 2ROLA 3TCJA 2QK0A 1I07A 3RERA 1QVFP 1TS9A 5I2MA 4OB0B 3OS2A 2OJ2A 2QQAA 3CXCP 2V8KA 4C8QA 4XTUA 3VS7A 2ZPEB 5DLOA 4PJLA 4BACA 1KQ2A 1Q82R 2CZ0B 5A0LA 2CKKA 1D3BA 2FRWA 3CMAQ 5GAOp 4OB2B 5HK0A 3TQ7P 3JCMg 4DBFA 4A4HA 3QWYA 5LJ5g 4ZGJB 3CC4Q 2QEXA 1VQ9T 2OTJQ 3ER0A 1VQNQ 3CD6A 4OVAA 1B07A 1VUBA 1JXMA 2K6DA 3QDFA 2EBPA 2X4XA 2Y90A 2NYSA 2H3JA 1M1FA 3L2QA 4M7DF 3OYYA 4M7AA 5KYUB 2DPPB 4M7DB 2JVVA 2RQVA 1UGRB 2YUPA 1N9SA 1U06A 4XTZA 2GF7A 1DJ7B 1PRMC 1NJIU 3V8JA 3EAEA 1GXIE 2KROA 3O5ZA 4A4FA 1JJ2P 4FSXA 2ZPGB 2O88A 1ZQ1A 4OB3B 3CCJQ 5FU7C 3SEMA 4M7DD 4E7IA 2O2OA 2LCLA 4FYXB 3ME9A 1SSFA 1I4K1 4DQ2A 3REBB 4OF1A 5GMKj 2O9SA 2VGNA 4LDYA 4V2SA 1C0MA 2MIOA 3CC7T 1YFNA 2CP2A 5LJ3e 3CMET 2FPDA 4R56A 2CH4W 5D6YA 3CCRQ 1C6VX 1UDLA 2ROTA 3A1PA 4C5GA 1BYMA 1K73U 4F7UG 1MMNA 3JCMP 2P4RA 5CO7A 1VQ4Q 4F7UE 1LCKA 3EGDB 2RQWA 4ZGEB 3KFVA 2PU9B 3G6EQ 4FYYB 4OMQA 4OMPA 2PNIA 1H8KA 2ECZA 1I8FA 5CKDA 3LH0A 1M3BA 3FDRA 2V1RA 1SRLA 1TU0B 3BDUA 1EZZB 2QG9B 2KSSA 3EGUA 3UA7A 2A36A 1G3YA 3LYIA 2JXBA 2HKQB 4M77C 2MWOA 1P92A 2XHCA 4QT7A 2E6ZA 3WVDB 3OYAA 5LL6S 4QVCA 4N4GA 4QVDA 1V76A 3QIIA 4ME7A 2K5IA 4MZTA 4XTYA 2DBMA 1XNIA 2DXUA 1FYNA 3CCLT 1YN8A 5GANg 2K3YA 3DKMA 1VQKT 4F14A 5HK3A 2VYTA 3JRZA 2HQHA 2LVMA 2YWWA 2K79A 1YCSB 2NUPB 3DB3A 1OZ2A 1M8VA 4A53A 3I55T 1YJ9A 2FZKB 4FL6A 3CPWA 2PVDB 2RH2A 1OX8A 3E1SA 2LNVA 4LNPA 1YI2T 1VQNT 1OQKA 1UTIA 5KYYA 2FL7A 4M77G 3M0RA 4WTOB 1M2OA 2CH4A 1LJOA 4PK4A 2QTVA 3FJPA 5GANd 1I81A 2LRQA 2HL3A 2KE9A 1Y96A 3JCMQ 2EAYA 3H6ZA 1QWEA 2FB7A 2DYBA 4LUDA 2J6KA 1X2QA 1IHVA 1MMDA 2I2LA 3EG1A 1VYVA 4LDWA 2DX1A 2FVUA 2MK5A 3OS0A 2DL8A 1VIFA 2K3BA 4KH0B 1Y57A 1BI3A 2VASA 1VQ6T 2DNUA 2WSFE 2BTTA 1KQSA 3ZEHA 4A54A 2F1LA 4AFZC 3NTKA 3CCET 4VUBA 5GAMg 1U1TA 5FROA 4DBHA 3R6OA 5CR2A 3OY9A 1PD1A 1AWXA 1H641 3JB9J 1X6GA 4JLGA 3L1AA 3L2VA 2OI3A 2L3RA 2DVEA 2DERA 1D1CA 5GMKm 5KYUA 4ANJA 2LX7A 2RF0A 2KMTA 1XQHA 4M75F 4XU0A 2RHZA 1PHTA 2V1QA 3HFNA 1VQOA 1VQ7A 1IREB 3CC2T 2E6NA 2NLUA 1U3OA 1RAHB 4LE9A 1UB4A 4M75B 1UHFA 1W2BA 2JTEA 5GMKe 3VKIA 2IG0A 3DLLA 1PKTA 5DY9A 4C92F 1K4US 4PJOC 2RHYA 2QTXA 4LUEA 3C95A 5GAMd 2ENMA 1BKBA 2RHUA 2XI9A 2KXCA 3TU4K 4IUUA 3HRSA 1G83A 2OAUA 2JN0A 2KY9A 2C0OA 4M75D 1JO8A 2M0YA 1N9RA 4J5YA 1YWOA 2ESWA 4PLIA 4C0DB 3PT9A 2PZ1A 4E6RA 3FC3A 4C92D 3OYMA 1WXUA 1OU9A 4NL2A 1WDXA 3VS3A 3GP8A 2RI2A 3M57A 2JMAA 1UECA 1NE8A 1YJNA 2NUTB 3EGDA 2DXBA 3QO3A 1K73C 2LQ8A 2COZA 1OPLA 2JTMA 3META 4A4GA 3THKA 2ATCB 5KYNA 2V26A 3VUZA 3CMAA 2K3XA 3G4SA 2DAQA 4YTLA 4QQGA 3CC4A 4BE1A 3CCUT 2VUBA 1K9AA 1NYFA 3S6WA 4PJOG 2WSCE 1TUGB 1TSFA 2IPOB 4C5EA 3H0IA 3QXEB 3VRYA 4PJOE 4C8QF 2QAZA 5CVIA 1M27C 2CZ7B 2E3IA 4J9GA 4MMKA 1Q81R 3L2UA 1YP5A 2C06A 3EH2A 2P84A 1TUCA 2EGCA 1GCPA 4LXCA 3OYBA 5HCKA 2PUOB 1D3BB 2W10A 2HEQA 1VQMQ 2VB6A 3VRZA 3RKXA 3LH5A 2RHIA 1K73R 1YHQT 3CCVA 3CCJA 2HKNA 4O5VA 1G3TA 2NUPA 4KBMB 4E7KA 2F2WA 3V7CA 5LJ3h 4M7AF 1RAFB 2YT6A 4PNOA 4RG8A 2I0NA 4GY5A 2JM9A 2MMPA 4RCCA 1GBQA 2KI7A 1D0ZA 2RQUA 2R5AA 1E6HA 2VXEA 2HAXA 4JJDA 1HXDA 1VQ5T 1ZSZC 3V7SA 2EYQA 1BK2A 1BU1A 1VQ4A 5LJ3f 3CCMQ 5J26A 4M7AD 2KK4A 2RJFA 2EJFA 4EPCA 3G6EA 2JT4A 1BIBA 2MWPA 2EKOA 2A0FB 1VQ9Q 1NG2A 2DJQA 1Y71A 4EDUA 1GRIA 1QVPA 2DJZA 3OYNA 3H9NA 2RD1A 3JCMf 5LJ5f 1ZX6A 1ARKA 1WLPB 3GPLA 4BE2A 2LZ6B 4EIKA 1G3WA 2PQWA 3EH1A 3LGLA 1R0CB 2LP5A 1Q86R 5L23A 3LGFA 1IRXA 2J6FA 3JB9H 2F69A 2CGHA 3CBOA 4X34A 5J3BA 3S3MA 5FU6B 1KHCA 8ATCB 1AZGB 3A8HB 3PTAA 2RQTA 3PVLA 2F2XA 3AHUA 4KULA 1WJQA 2VKNA 3WXMB 4J9CA 4HXJA 1PSEA 3CC7Q 4ATOA 2X3XD 4M75A 1JRIA 2KVQG 1VQLT 2KYMA 3C0CA 1YBYA 1VYUA 3E2UA 3HRUA 3VS1A 2ZPFB 4NOYA 3SHWA 1SEMA 2HZYA 3E9GA 2HQEA 3AT1B 2MOXA 2DMOA 1IGUA 1M4ZA 3QDRB 3S3OA 4OGEA 1JQQA 2KR3A 2D0QB 3PNWC 4KH1B 1QVGA 3OYFA 1SKUB 2E65A 3RMQA 1WXTA 4JRIA 3TREA 4B9WA 4EMKC 1KQ1A 5CKFA 1MUZA 2EQUA 5I11A 2NUTA 3OW2A 1K0SA 1MMAA 3EGXA 2WSEE 4GLMA 2DTOA 3G71A 4O6JA 4X1VA 1K9MU 2EYWA 3M4YA 4M78G 1SG5A 2AK5A 2BE7D 3VYHB 1X2KA 3JCMV 3QPHA 4F7UB 3OW2S 5FRNA 2D8HA 3BDLA 4M78E 1XJWB 2DIGA 4N0AA 1BCOA 2EQJA 3QG1A 4J9BA 3S3NA 1VQKQ 1QCNA 2QASA 3CCQT 1O75A 1JXOA 3M53A 3A5ZB 1PC0A 1ACMB 2CP3A 1WJRA 1ZBJA 3PE0A 1AWJA 1O9SA 2KYBA 2LQWA 3CCMT 5GMKh 3I55Q 2RI3A 2QQSA 5J39A 5FU7B 2JNGA 2X4WA 2DL4A 4RTXA 5D7UA 8AT1B 3M56A 3RBBB 2FG0A 4BE0A 1YI2Q 4CC4B 1SPKA 2QGGA 2QXFA 2XDBA 4MDWA 2LJ1A 2RPNA 5D6XA 5GANj 3PMIA 2H3EB 1QWFA 2XMFA 1GCQA 2L2PA 5KYXA 3D7SB 4IUQA 1IB8A 2JUFA 3C94A 1S72Q 1IXDA 2KDSA 2JM8A 2RHXA 1D0YA 2DBKA 1PWTA 1AHJB 4RTZA 3ULRB 1XTDA 4HCBA 2O9VA 2FYKA 1AWOA 1AVZC 1WZOA 3I56A 1VQ6Q 4J9HA 4J83A 2FPEA 3CCEQ 1Q81U 1IO6A 3EG3A 3FB9A 4M78A 4JJCA 2RK2A 2RQRA 2CREA 2DF6A 4A63B 4ZN3A 2PVOB 3TSWA 2GFUA 3G1JA 2QA4T 1X43A 4D6WA 4K11A 4PFPA 3MP8A 4GBQA 3CCSA 3JCMe 5LJ5e 1N8RU 1PCXA 4HCZA 4C0ZA 5FRMA 5FWCA 2PUKB 3CC2Q 2GNCA 2D0NA 5DM7R 1YWPA 5FWBA 5AT1B 3GNFB 5CKHA 4F04B 2M9UA 3HKSA 4AFUC 5GAMj 4J8OA 2BZYA 4J9DA 3NTHA 1YJWT 2QDLA 2MF2A 2HQXA 1YIJA 2A3LA 2J06A 2KRSA 3LX7A 2HSPA 2HNIA 1UGVA 4LDVA 2DTHA 2DXCA 2LT1A 3QKJA 3GBQA 1VQ8Q 3A8OB 2EGAA 2G3RA 1VQOT 4EMHA 1X6BA 5GAOr 3PMTA 3L42A 4HVVA 2AKLA 2LTOA 2GCXA 4CC2A 3CBMA 3FIFA 2C0IA 5C6SA 1G5VA 4IURA 5GAN4 2PVGB 1RI0A 3M54A 3ZFJA 3E19A 1M90U 1X75C 1W6XA 4DA4A 3OSSC 2OTLA 4RTWA 4JRPA 3EFRA 2DETA 4WF2A 1KC8R 1VQ9A 1JBMA 2CS7A 2VXFA 3CCUQ 2MAMA 1KJWA 3M55A 1Q86U 4JJBA 4RUGA 1BB9A 1OYXA 3X26B 3RR6A 1LOJA 1RACB 5I2SA 1M2VA 1R8OB 2XD0A 1X01A 1YJNT 1CKAA 1RLQC 4P5NA 5CIUA 3P8DA 5A0GA 1M1GA 3VS0A 1YITT 1FMVA 3I35A 2R58A 4CC3A 3CPWS 4F7UA 4M77E 1OPKA 3V8KA 5KH6A 2ZPIB 5IT9E 1K9MC 1ZUYA 2HL5C 4B9XA 1S72T 2E41A 1YHQQ 2EJ9A 3OYCA 3RESA 3VUBA 4BI4A 2C0TA 4BDYA 2K5FA 4IUTA 2COWA 4FM4B 2KT1A 3LWIA 4BI3A 3SWNC 4J7FA 1KFZA 3OMCA 1N27A 4PJOB 3CC7A 2HSEB 5GANe 2HDAA 3M5AA 3CMEA 1QKWA 2K4YA 2GBQA 5GAOm 1HSQA 5GAN6 4CI0C 1RABB 1YCYA 3OMGA 2A08A 1KQSS 3CCVT 3RNJA 1M9SA 2E1HA 5GAN2 1VQ5Q 3VS5A 1OI1A 5CCAA 1M3AA 5KCOA 4PJOD 1K9MR 5DLQE 2L3QA 3O8VA 1WPYA 2O01E 1GBRA 4RKUE 1E7OA 3DB4A 1EX4A 3FJ5A 1JEGA 1QCFA 4FCYA 3QYGB 3JB9G 1T0JA 3EG9A 3CBPA 1U5SA 1HJDA 4FYWB 3MKDA 1OEBA 1ZUKA 2PTKA 3PFSA 2RNAA 3EHRA 2CZ1B 2XICA 5CKEA 4E7HA 4BDZA 4J7IA 4MDXA 1JB0E 1W2BS 4RTTA 1MV3A 1IZ6A 2EPDA 4M77A 2JZ2A 2KGTA
chains in the Genus database with same CATH topology
2FRYA 2NUZA 2OJ2A 3QWXX 1ZX6A 2HCKA 1ZSGA 1ARKA 3VS7A 1ZLMA 1GFCA 1WLPB 2LCSA 2D8JA 2L3PA 2F2VA 2MCNA 2LZ6B 4EIKA 1SHGA 1Z9QA 2LJ3A 2SRCA 5EC7A 4J9IA 2FRWA 3M0PA 2B86A 5IHNA 3QWYA 4JZ3A 2LP5A 4CC7A 5IH2A 5L23A 2DRMA 3U23A 1AZEA 1B07A 2W0ZA 1JXMA 2J6FA 3UA6A 1NYGA 1WA7A 4KRTA 2K6DA 3I9QA 1GL5A 2EBPA 1AZGB 2EYXA 2RQTA 3PVLA 1UG1A 2F2XA 2VKNA 2RQVA 2YUPA 4J9CA 2DL5A 4HXJA 1U06A 5FW9A 1PRMC 2X3XD 4Z88A 3CQTA 1G2BA 2KYMA 4AFQC 2KROA 3C0CA 3H0HA 3O5ZA 1VYUA 2O88A 3VS1A 1NLOC 4Y92A 2GGRA 3SEMA 3SHWA 1SEMA 2GTJA 1M8MA 2O2OA 2MOXA 4ZNXA 2DM1A 2DMOA 2EQIA 1WYXA 3REBB 2O9SA 4D8DA 2MIOA 2E5KA 2FPDA 1WXBA 2CH4W 1JQQA 2KR3A 3R6NA 1B3QA 1RLPC 2CSIA 2DL7A 1UDLA 2ROTA 3NPFA 1WXTA 2AZSA 5GJVB 1Y0MA 2D1XA 4AG1C 2EW3A 2L3SA 1HD3A 3ZL7C 3M0QA 2P4RA 1MUZA 3M0TA 5I11A 1K0SA 1KSWA 4GLMA 1LCKA 2RQWA 3KFVA 2K2MA 1KIKA 4X1VA 4OMQA 4OMPA 2EYWA 2PNIA 1H8KA 2ECZA 2AK5A 1X2KA 1M3BA 2DILA 2V1RA 1SRLA 2D8HA 4OMMA 1WX6A 4OMNA 1WFWA 4RTVA 3EGUA 3UA7A 2A36A 2JXBA 2BZ8A 1PKSA 4J9BA 2KBTA 4QT7A 3TVTA 1AOJA 1JXOA 4JZ4A 1ZBJA 2KNBB 3PVQA 3PE0A 1AWJA 2IIMA 2EYZA 1I1JA 2KYBA 1JU5C 2LQWA 4LN2A 2DBMA 4AG2C 1FYNA 2DL4A 4RTXA 1YN8A 3RBBB 2LQNA 1T0HA 2FG0A 1UUEA 4F14A 4CC4B 1SPKA 1PRLC 2EGEA 1EFNA 1QLYA 2LJ1A 2K79A 1YCSB 2ABLA 2FPFA 2RPNA 2JMCA 2KXDA 2K7AA 1X27A 1AEYA 3H41A 2YUOA 1WIEA 1QWFA 2XMFA 4WCIA 1OOTA 1K0XA 1GCQA 1A0NB 2L2PA 2KT8A 2VVKA 1CSKA 2DA9A 2JM8A 4LNPA 2A37A 2DBKA 1GFDA 2CDTA 1PWTA 1J3TA 2H8HA 1H3HA 2LNHB 1UTIA 1M30A 2O31A 4RTZA 3ULRB 1QKXA 4J9EA 3M0RA 4OMOA 2CH4A 2EYYA 2O9VA 1AWOA 1AVZC 3IQLA 4J9HA 3EG0A 2KE9A 3M0UA 1NM7A 2FPEA 1QWEA 2GQIA 2DE0X 2DYBA 3M0SA 2J6KA 2HBWA 2KEAA 4LUDA 1IO6A 3EG3A 5I22A 1NEGA 1X2QA 4JJCA 3VS4A 2FEIA 4M4ZA 1VYVA 3EG1A 2RQRA 2DX1A 2EVRA 2CREA 2DF6A 2DL8A 1M3CA 4A63B 2AZVA 2K3BA 1Y57A 3TSWA 2RN8A 1X43A 4FSSA 4K11A 2DNUA 2DLPA 2BTTA 4GBQA 2JS0A 2SEMA 4AFZC 2CUDA 1W1FA 5FWCA 2GNCA 2D0NA 1UFFA 1YWPA 5FWBA 1BBZA 1AWXA 1K1ZA 1X6GA 3EHQA 1N5ZA 3NGPA 4OMLA 2OI3A 4AFSC 4RTUA 4AFUC 2EKHA 2X3WD 2BZYA 2L0AA 1NLPC 4J9DA 2QDLA 1FMKA 1MV0B 1Z9ZA 2LX7A 2RF0A 2J06A 1SHFA 2KRSA 2ED0A 2HSPA 4Z8AA 2KRNA 1AD5A 1UGVA 1PHTA 1T3LA 2V1QA 3GBQA 2YSQA 2CT4A 1U3OA 2EGAA 4LE9A 1UHFA 1E6GA 1UJ0A 2JTEA 2ED1A 1X6BA 3EG2A 1PKTA 4HVVA 1K4US 2RMOA 2AKLA 4LUEA 2J05A 1PNJA 2JS2A 2ENMA 4CC2A 2C0IA 2KXCA 1G83A 3TSZA 4JPBW 2C0OA 2DVJA 1W6XA 4DEYA 1JO8A 1VA7A 2YDLA 2M0YA 1ABOA 4RTWA 1YWOA 2ESWA 4HCKA 5IHKA 2PZ1A 1VYTA 2OAWA 4E6RA 1GCQC 2JW4A 2AKKA 1WXUA 1AWWA 3I5SA 1KJWA 3VS3A 1WDXA 1H92A 1TUDA 2CSQA 4JJBA 4RUGA 1BB9A 3UF4A 1ZUUA 2JMAA 4DEXA 1UECA 2CUBA 2KRMA 3JV3A 1OPLA 1CKAA 1RLQC 2A28A 3VS0A 3THKA 1V1CA 3I35A 1I0CA 4CC3A 2FO0A 3REAB 1RI9A 1T3SA 1OPKA 1UE9A 5IXFA 1CKBA 2GTOA 4IIOA 2G6FX 1K9AA 1NYFA 4HVWA 1ZUYA 1NEBA 2J7IA 3H0FA 1SSHA 3H0IA 3VRYA 1S1NA 5IHIA 1WI7A 4J9FA 2K9GA 1M27C 4J9GA 1OV3A 2C0TA 5IXBA 2YUNA 1YP5A 4F17A 2KT1A 1RUWA 1TUCA 1KFZA 3NMZC 1UHCA 2DL3A 2EGCA 1GCPA 5HCKA 1YNZA 2W10A 2HDAA 2HEQA 1QKWA 3VRZA 5ECAA 3LH5A 1XOVA 2GBQA 1HSQA 2LJ0A 2A08A 4D8KA 3RNJA 2VWFA 2YUQA 3VS5A 2F2WA 2LMJA 4R0KA 1UJYA 1M3AA 2YT6A 2DRKA 2L3QA 3VS2A 4F16A 2NWMA 1GBRA 1TG0A 1SRMA 2BZXA 2J6OA 2I0NA 1E7OA 2JM9A 4RTYA 3FJ5A 1GBQA 1JEGA 1QCFA 2CT3A 2RQUA 1X69A 1E6HA 4Z89A 3VS6A 1T0JA 4ORZA 4ESRA 1K76A 3UATA 2M51A 1U5SA 1HJDA 4JJDA 1W70A 1BK2A 1BU1A 1OEBA 1ZUKA 2PTKA 2RNAA 3EHRA 3NHNA 3I5RA 2JT4A 4IIMA 4HVUA 4RTTA 1ABQA 1MV3A 2ROLA 3A98A 1NG2A 2DJQA 5GJWB 1I07A 2EPDA 1GRIA 2KGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRY A;  2NUZ A;  2OJ2 A;  3QWX X;  1ZX6 A;  2HCK A;  1ZSG A;  1ARK A;  3VS7 A;  1ZLM A;  1GFC A;  1WLP B;  2LCS A;  2D8J A;  2L3P A;  2F2V A;  2MCN A;  2LZ6 B;  4EIK A;  1SHG A;  1Z9Q A;  2LJ3 A;  2SRC A;  5EC7 A;  4J9I A;  2FRW A;  3M0P A;  2B86 A;  5IHN A;  3QWY A;  4JZ3 A;  2LP5 A;  4CC7 A;  5IH2 A;  5L23 A;  2DRM A;  3U23 A;  1AZE A;  1B07 A;  2W0Z A;  1JXM A;  2J6F A;  3UA6 A;  1NYG A;  1WA7 A;  4KRT A;  2K6D A;  3I9Q A;  1GL5 A;  2EBP A;  1AZG B;  2EYX A;  2RQT A;  3PVL A;  1UG1 A;  2F2X A;  2VKN A;  2RQV A;  2YUP A;  4J9C A;  2DL5 A;  4HXJ A;  1U06 A;  5FW9 A;  1PRM C;  2X3X D;  4Z88 A;  3CQT A;  1G2B A;  2KYM A;  4AFQ C;  2KRO A;  3C0C A;  3H0H A;  3O5Z A;  1VYU A;  2O88 A;  3VS1 A;  1NLO C;  4Y92 A;  2GGR A;  3SEM A;  3SHW A;  1SEM A;  2GTJ A;  1M8M A;  2O2O A;  2MOX A;  4ZNX A;  2DM1 A;  2DMO A;  2EQI A;  1WYX A;  3REB B;  2O9S A;  4D8D A;  2MIO A;  2E5K A;  2FPD A;  1WXB A;  2CH4 W;  1JQQ A;  2KR3 A;  3R6N A;  1B3Q A;  1RLP C;  2CSI A;  2DL7 A;  1UDL A;  2ROT A;  3NPF A;  1WXT A;  2AZS A;  5GJV B;  1Y0M A;  2D1X A;  4AG1 C;  2EW3 A;  2L3S A;  1HD3 A;  3ZL7 C;  3M0Q A;  2P4R A;  1MUZ A;  3M0T A;  5I11 A;  1K0S A;  1KSW A;  4GLM A;  1LCK A;  2RQW A;  3KFV A;  2K2M A;  1KIK A;  4X1V A;  4OMQ A;  4OMP A;  2EYW A;  2PNI A;  1H8K A;  2ECZ A;  2AK5 A;  1X2K A;  1M3B A;  2DIL A;  2V1R A;  1SRL A;  2D8H A;  4OMM A;  1WX6 A;  4OMN A;  1WFW A;  4RTV A;  3EGU A;  3UA7 A;  2A36 A;  2JXB A;  2BZ8 A;  1PKS A;  4J9B A;  2KBT A;  4QT7 A;  3TVT A;  1AOJ A;  1JXO A;  4JZ4 A;  1ZBJ A;  2KNB B;  3PVQ A;  3PE0 A;  1AWJ A;  2IIM A;  2EYZ A;  1I1J A;  2KYB A;  1JU5 C;  2LQW A;  4LN2 A;  2DBM A;  4AG2 C;  1FYN A;  2DL4 A;  4RTX A;  1YN8 A;  3RBB B;  2LQN A;  1T0H A;  2FG0 A;  1UUE A;  4F14 A;  4CC4 B;  1SPK A;  1PRL C;  2EGE A;  1EFN A;  1QLY A;  2LJ1 A;  2K79 A;  1YCS B;  2ABL A;  2FPF A;  2RPN A;  2JMC A;  2KXD A;  2K7A A;  1X27 A;  1AEY A;  3H41 A;  2YUO A;  1WIE A;  1QWF A;  2XMF A;  4WCI A;  1OOT A;  1K0X A;  1GCQ A;  1A0N B;  2L2P A;  2KT8 A;  2VVK A;  1CSK A;  2DA9 A;  2JM8 A;  4LNP A;  2A37 A;  2DBK A;  1GFD A;  2CDT A;  1PWT A;  1J3T A;  2H8H A;  1H3H A;  2LNH B;  1UTI A;  1M30 A;  2O31 A;  4RTZ A;  3ULR B;  1QKX A;  4J9E A;  3M0R A;  4OMO A;  2CH4 A;  2EYY A;  2O9V A;  1AWO A;  1AVZ C;  3IQL A;  4J9H A;  3EG0 A;  2KE9 A;  3M0U A;  1NM7 A;  2FPE A;  1QWE A;  2GQI A;  2DE0 X;  2DYB A;  3M0S A;  2J6K A;  2HBW A;  2KEA A;  4LUD A;  1IO6 A;  3EG3 A;  5I22 A;  1NEG A;  1X2Q A;  4JJC A;  3VS4 A;  2FEI A;  4M4Z A;  1VYV A;  3EG1 A;  2RQR A;  2DX1 A;  2EVR A;  2CRE A;  2DF6 A;  2DL8 A;  1M3C A;  4A63 B;  2AZV A;  2K3B A;  1Y57 A;  3TSW A;  2RN8 A;  1X43 A;  4FSS A;  4K11 A;  2DNU A;  2DLP A;  2BTT A;  4GBQ A;  2JS0 A;  2SEM A;  4AFZ C;  2CUD A;  1W1F A;  5FWC A;  2GNC A;  2D0N A;  1UFF A;  1YWP A;  5FWB A;  1BBZ A;  1AWX A;  1K1Z A;  1X6G A;  3EHQ A;  1N5Z A;  3NGP A;  4OML A;  2OI3 A;  4AFS C;  4RTU A;  4AFU C;  2EKH A;  2X3W D;  2BZY A;  2L0A A;  1NLP C;  4J9D A;  2QDL A;  1FMK A;  1MV0 B;  1Z9Z A;  2LX7 A;  2RF0 A;  2J06 A;  1SHF A;  2KRS A;  2ED0 A;  2HSP A;  4Z8A A;  2KRN A;  1AD5 A;  1UGV A;  1PHT A;  1T3L A;  2V1Q A;  3GBQ A;  2YSQ A;  2CT4 A;  1U3O A;  2EGA A;  4LE9 A;  1UHF A;  1E6G A;  1UJ0 A;  2JTE A;  2ED1 A;  1X6B A;  3EG2 A;  1PKT A;  4HVV A;  1K4U S;  2RMO A;  2AKL A;  4LUE A;  2J05 A;  1PNJ A;  2JS2 A;  2ENM A;  4CC2 A;  2C0I A;  2KXC A;  1G83 A;  3TSZ A;  4JPB W;  2C0O A;  2DVJ A;  1W6X A;  4DEY A;  1JO8 A;  1VA7 A;  2YDL A;  2M0Y A;  1ABO A;  4RTW A;  1YWO A;  2ESW A;  4HCK A;  5IHK A;  2PZ1 A;  1VYT A;  2OAW A;  4E6R A;  1GCQ C;  2JW4 A;  2AKK A;  1WXU A;  1AWW A;  3I5S A;  1KJW A;  3VS3 A;  1WDX A;  1H92 A;  1TUD A;  2CSQ A;  4JJB A;  4RUG A;  1BB9 A;  3UF4 A;  1ZUU A;  2JMA A;  4DEX A;  1UEC A;  2CUB A;  2KRM A;  3JV3 A;  1OPL A;  1CKA A;  1RLQ C;  2A28 A;  3VS0 A;  3THK A;  1V1C A;  3I35 A;  1I0C A;  4CC3 A;  2FO0 A;  3REA B;  1RI9 A;  1T3S A;  1OPK A;  1UE9 A;  5IXF A;  1CKB A;  2GTO A;  4IIO A;  2G6F X;  1K9A A;  1NYF A;  4HVW A;  1ZUY A;  1NEB A;  2J7I A;  3H0F A;  1SSH A;  3H0I A;  3VRY A;  1S1N A;  5IHI A;  1WI7 A;  4J9F A;  2K9G A;  1M27 C;  4J9G A;  1OV3 A;  2C0T A;  5IXB A;  2YUN A;  1YP5 A;  4F17 A;  2KT1 A;  1RUW A;  1TUC A;  1KFZ A;  3NMZ C;  1UHC A;  2DL3 A;  2EGC A;  1GCP A;  5HCK A;  1YNZ A;  2W10 A;  2HDA A;  2HEQ A;  1QKW A;  3VRZ A;  5ECA A;  3LH5 A;  1XOV A;  2GBQ A;  1HSQ A;  2LJ0 A;  2A08 A;  4D8K A;  3RNJ A;  2VWF A;  2YUQ A;  3VS5 A;  2F2W A;  2LMJ A;  4R0K A;  1UJY A;  1M3A A;  2YT6 A;  2DRK A;  2L3Q A;  3VS2 A;  4F16 A;  2NWM A;  1GBR A;  1TG0 A;  1SRM A;  2BZX A;  2J6O A;  2I0N A;  1E7O A;  2JM9 A;  4RTY A;  3FJ5 A;  1GBQ A;  1JEG A;  1QCF A;  2CT3 A;  2RQU A;  1X69 A;  1E6H A;  4Z89 A;  3VS6 A;  1T0J A;  4ORZ A;  4ESR A;  1K76 A;  3UAT A;  2M51 A;  1U5S A;  1HJD A;  4JJD A;  1W70 A;  1BK2 A;  1BU1 A;  1OEB A;  1ZUK A;  2PTK A;  2RNA A;  3EHR A;  3NHN A;  3I5R A;  2JT4 A;  4IIM A;  4HVU A;  4RTT A;  1ABQ A;  1MV3 A;  2ROL A;  3A98 A;  1NG2 A;  2DJQ A;  5GJW B;  1I07 A;  2EPD A;  1GRI A;  2KGT A; 
#chains in the Genus database with same CATH topology
 4E7S A;  1VQ8 T;  2FRY A;  2NUZ A;  2HCK A;  1ZSG A;  2FZC B;  1Q81 C;  4LDX A;  1GFC A;  2L3P A;  2F2V A;  3QUI A;  4LD9 K;  1QMC A;  1SHG A;  3CCL A;  1QW1 A;  5EC7 A;  1VQK A;  2KQW A;  3M0P A;  5GAM e;  2M02 A;  1RAA B;  2R57 A;  2IVW A;  2OX7 A;  2X4Y A;  3INZ A;  3FLG A;  5GAN 8;  3EGX B;  4CC7 A;  2DRM A;  2YRV A;  4DBR A;  3UA6 A;  1N8R C;  1NYG A;  1WA7 A;  2COY A;  3MEU A;  4II1 A;  4KRT A;  1VQL Q;  3QJ6 A;  3FEO A;  2CYZ B;  2JJ9 A;  3WVE B;  2EYX A;  4XTX A;  2OTJ A;  1YI2 A;  1VQN A;  2LC4 A;  4C5H A;  3PIP A;  2DL5 A;  1NPR A;  1OU8 A;  2M16 A;  3CPW P;  1W4S A;  3NTI A;  5FW9 A;  2K2V A;  4ZN1 A;  3C4S A;  1G2B A;  2DD5 A;  4C92 C;  4DBQ A;  1ZSZ B;  4Y92 A;  1H3Z A;  2GGR A;  2RA2 A;  1NPP A;  1BI0 A;  2CP5 A;  2YRC A;  5GAO n;  4ZNX A;  1UEB A;  1WYX A;  4D8D A;  2E5K A;  3A8L B;  2YHT A;  2ZPB B;  1N8R R;  4FT4 A;  3KUF A;  2BUD A;  3R6N A;  1B3Q A;  1RLP C;  2CSI A;  3HHT B;  1M90 C;  3NPF A;  3CEY A;  1WHH A;  1Y0M A;  1C1A A;  2EW3 A;  2L3S A;  1NZ9 A;  1HD3 A;  5KYX B;  3ZL7 C;  3M0Q A;  2VC8 A;  3M0T A;  3OYD A;  1KSW A;  1KQS P;  1VQP T;  3CCR A;  3JCM h;  1Q86 C;  2K2M A;  5LJ5 h;  3BFM A;  3CCQ Q;  1KIK A;  2F5T X;  3G71 T;  3JCM W;  1BCM A;  1K8A C;  1R77 A;  3JAM E;  2DIL A;  3CC2 A;  2YLB A;  5KCH A;  1QVF A;  4C92 G;  4M78 F;  4E2F B;  3X28 B;  2BZ8 A;  3KXT A;  2MI6 A;  2LT4 A;  2XU8 A;  3VV0 A;  3CXC A;  4M78 B;  1AOJ A;  4C8Q C;  1KD1 U;  4JZ4 A;  5HKC A;  3UPU A;  2KNB B;  3PVQ A;  2X9H A;  2IIM A;  2ZAE A;  1M90 R;  1I1J A;  1W2B P;  1JU5 C;  4LN2 A;  4KGZ B;  4XQ3 A;  4PJO A;  1RAD B;  1PSF A;  4AG2 C;  4LD6 A;  2LQN A;  4M78 D;  2JTF A;  1PG5 B;  4IUV A;  4C0F A;  3QZ5 B;  1PRL C;  3X20 B;  2CP0 A;  1EFN A;  1QLY A;  1MHN A;  1WHM A;  1KC8 U;  2QEX T;  1K8A R;  3BY7 A;  2K7A A;  1X27 A;  3CD6 T;  5GAN 5;  3LLR A;  4LDU A;  4M7A C;  4ZTJ A;  4FW1 A;  2VVK A;  1AT1 B;  4EMK B;  4X9C A;  3OBY A;  2QQB A;  4HT8 A;  4BB7 A;  1HYO A;  1J3T A;  2H8H A;  1H3H A;  5CQX A;  4OP0 A;  1JJ2 A;  3OYI A;  1VOM A;  1QKX A;  4J9E A;  3CCU A;  4B6M A;  3L2R A;  2L89 A;  2RO0 A;  2EYY A;  3VJP A;  4MZM A;  2QA4 Q;  4C8Q G;  2FZG B;  3VU3 C;  4IUP A;  2EJG A;  4XTW A;  5M9O A;  4C8Q E;  1JJ2 S;  4FW2 A;  1NM7 A;  2DE0 X;  3I56 T;  3M0S A;  2KEA A;  2XDP A;  4QQD A;  2ZCF B;  4L6V 5;  2FEI A;  2EVR A;  1KK7 A;  1M3C A;  3MEW A;  5FLX E;  2E3H A;  3GLX A;  2RN8 A;  3GOX A;  4JDS A;  2XKO C;  2DLP A;  1YHQ A;  1YJW Q;  2DEQ A;  4MZP A;  4JUV A;  3HFO A;  4JRK A;  2DKG A;  4M7A G;  1QVG S;  3CCS T;  1W1F A;  3MEV A;  1M2V B;  1UFF A;  5GAN h;  4M7A E;  1BBZ A;  1PM3 A;  4BUG A;  1K1Z A;  3OS5 A;  3EHQ A;  5CQY A;  1N5Z A;  1VQO Q;  4F7U F;  3NGP A;  2BE9 B;  4OML A;  4RTU A;  4XTV A;  4Z02 A;  2P0P A;  3N5B B;  2EKH A;  3OS1 A;  2X3W D;  4KUI A;  3OYG A;  2L0A A;  2QGF B;  3JCM X;  3MP1 A;  1MV0 B;  2A7Y A;  4PJM A;  1SHF A;  4Z8A A;  1T3L A;  1D09 B;  4PFO A;  3OYJ A;  1VQ5 A;  2XG8 D;  2YSQ A;  4PJN A;  3M9Q A;  5GAN f;  1UJ0 A;  2ED1 A;  2RB6 A;  3EG2 A;  2RMO A;  1ZSZ A;  2J05 A;  1PNJ A;  2JS2 A;  3HPW A;  5A2Q E;  4NL3 A;  4UC4 A;  3L2Z A;  1LVK A;  2ZGW A;  3URG A;  1G3S A;  2HBP A;  3RDV A;  2GQV A;  4DEY A;  3JB9 I;  1YJN Q;  1VA7 A;  4GLK A;  1ABO A;  5LJ3 g;  1YIT Q;  4HCK A;  5IHK A;  1VYT A;  2OAW A;  2JW4 A;  2L8D A;  2OTL T;  1AWW A;  3ASK A;  3I5S A;  3G4S Q;  1H92 A;  3UF4 A;  1ZUU A;  4DEX A;  3UDC A;  3EFO B;  3QYH B;  1YJ9 T;  5KE3 A;  5GAM h;  4BY6 C;  1WJS A;  3MCA B;  2A28 A;  3EG9 B;  4PKC C;  3MO8 A;  1I0C A;  2FO0 A;  1T3S A;  1U1S A;  1UE9 A;  2YLC A;  1CKB A;  5IXF A;  3VYG A;  4IIO A;  1N6A A;  2G6F X;  2F5K A;  4ZTF A;  3A8G B;  4M77 F;  3T9N A;  2J7I A;  2P0Q A;  1VQL A;  3H0F A;  5LJ3 d;  4TVR A;  1S1N A;  4M77 B;  5IHI A;  3MEA A;  5GAM f;  1OV3 A;  5IXB A;  2YUN A;  4F17 A;  4AT1 B;  3CCV Q;  1BIA A;  4PL6 A;  1Q7Y C;  3BW1 A;  2M0O A;  2LCC A;  3NMZ C;  1UHC A;  5D6W A;  3JCM d;  1KD1 C;  5LJ5 d;  2XDD A;  4OMF B;  2WAC A;  1ZBX A;  3ZBD A;  5HY6 A;  3OYE A;  3E9F A;  3HTR A;  1WHK A;  2AT1 B;  4M77 D;  3JCM c;  2CZ6 B;  2E10 A;  3SDZ A;  4L5G A;  4D8K A;  5GAO l;  2VWF A;  2YUQ A;  3F70 A;  1Y7X A;  2LX9 A;  2LMJ A;  1UJY A;  4XU2 A;  2QI2 A;  2DRK A;  1VQM A;  2EIF A;  1QVG P;  1KC8 C;  1M1K U;  4M7D C;  4F16 A;  2NWM A;  2BKD N;  4EMK A;  2BZX A;  2J6O A;  4QW2 A;  3JSC A;  4RTY A;  5GMK l;  3OW2 P;  4Z89 A;  3QBY A;  1K76 A;  4KGX B;  3OQ5 A;  1VQ7 T;  1Q7Y R;  4E7Z A;  2ZPH B;  1KD1 R;  3MJX A;  6AT1 B;  3NHN A;  2X51 A;  2Z0W A;  3JB9 F;  3CCQ A;  3HSB A;  4IIM A;  1M5Q 1;  3OA6 A;  1HK9 A;  3A98 A;  1IGQ A;  5CK9 A;  5GJW B;  1WNL A;  1QP2 A;  3RIR A;  4C0G A;  2VV5 A;  4JS4 A;  4J6W A;  4OGC A;  4HT9 A;  2R5M A;  3QWX X;  3CCM A;  1ZLM A;  2LCS A;  2D8J A;  2MCN A;  2LJ3 A;  1Z9Q A;  2SRC A;  1WGS A;  3V8L A;  4E7L A;  3SWN B;  3P8H A;  4J9I A;  1NBE B;  1D1A A;  2B86 A;  3JB9 D;  5IHN A;  4JZ3 A;  2RJC A;  5IH2 A;  4KUD K;  4M7D G;  1K8A U;  2CP6 A;  3TEE A;  3U23 A;  1AZE A;  4ELZ C;  2EQM A;  2W0Z A;  4HA8 A;  2GFA A;  4M7D E;  1ZA1 B;  3RMS A;  3I9Q A;  1GL5 A;  5GAN 3;  1Q95 G;  2AHJ B;  5EG2 A;  4N4H A;  4QKU A;  2CP7 A;  3PIO A;  4JLI A;  2E12 A;  4KGV B;  5AYF A;  1UG1 A;  3CMA T;  3G4S T;  2P0K A;  4XU1 A;  3CC4 T;  2OTJ T;  2YXY A;  2X4J A;  1OZ3 A;  4Z88 A;  3CQT A;  4AFQ C;  3H0H A;  1ZHI A;  2M1H A;  4PJO F;  1RAG B;  3LW5 E;  1RAE B;  1NLO C;  2QQR A;  1D1B A;  3M4G A;  2DD4 A;  2D9T A;  2GTJ A;  1M8M A;  3M59 A;  2DM1 A;  2EQI A;  2HMA A;  1VQP Q;  3RKY A;  2QA4 A;  1FX7 A;  3EFS A;  1WXB A;  2DL7 A;  3G71 Q;  2RM4 A;  2E4H A;  5GJV B;  2AZS A;  2D1X A;  2RJD A;  4AG1 C;  3CCJ T;  4PJJ A;  3RUX A;  3OBW A;  1Y07 A;  1LPL A;  9ATC B;  1VIE A;  2O4X B;  3EFO A;  1WQW A;  4J6X A;  1TH7 A;  2Y4X A;  2QYZ A;  3BE3 A;  1YJW A;  3CCR T;  4JS5 A;  1UGQ B;  4C5I A;  1LNX A;  1KHI A;  4OMM A;  1WX6 A;  7AT1 B;  4OMN A;  1WFW A;  1QP3 A;  4RTV A;  4M7D A;  5C0M A;  1VQ4 T;  1PKS A;  2D6F A;  2KBT A;  3TVT A;  2EWN A;  2L5Q A;  3G6E T;  1B34 B;  4N4I A;  3J80 E;  2QEX Q;  3UT1 A;  2EYZ A;  3CD6 Q;  1NJI C;  3A8M B;  3G7Z A;  4C92 B;  2XK0 A;  2JOY A;  1BI2 A;  1TTH B;  1UGP B;  2K57 A;  3OB9 A;  1TXQ A;  1T0H A;  1UUE A;  4J6Y A;  3MPU B;  4JJN K;  2EGE A;  1Q82 U;  2ABL A;  2FPF A;  2JMC A;  5I21 A;  3I55 A;  1UGS B;  2KXD A;  3Q1J A;  1AEY A;  3H41 A;  3X25 B;  4Y28 E;  2YUO A;  1WIE A;  1SF9 A;  3QSU A;  4WCI A;  1OOT A;  2E70 A;  3MHX A;  3QHS A;  1K0X A;  1A0N B;  2KT8 A;  1CSK A;  1ZA2 B;  2DA9 A;  4AMC A;  3I56 Q;  5CAI A;  1YIT A;  2A37 A;  3J81 E;  1IHW A;  4NS5 A;  2CDT A;  1M1K C;  2DXT A;  1GFD A;  4M75 C;  2LNH B;  1BI1 A;  1M30 A;  2O31 A;  4FU6 A;  4EMG A;  2DYI A;  4PFZ A;  2YRD A;  4OMO A;  3V7R A;  3FRN A;  1QCO A;  1NJI R;  1S72 A;  3CPF A;  3IQL A;  2P4T A;  3H8Z A;  1MNE A;  3EG0 A;  2V8J A;  3M0U A;  2GQI A;  5KYW B;  3GIB A;  2HBW A;  3J7A F;  3CCS Q;  5I22 A;  1NEG A;  4E47 A;  4QVZ A;  3HP9 A;  3VS4 A;  3L2W A;  1G8X A;  4M4Z A;  4E7J A;  2K5L A;  2RK1 A;  2MYS A;  4C0D C;  4C8Q B;  1VQ6 A;  5CKB A;  2AZV A;  4BI8 B;  3M58 A;  2EFI A;  4OB1 B;  4A4K A;  4FSS A;  3OYK A;  4ZGD B;  3SWN A;  3CCE A;  2JS0 A;  2MPX C;  2SEM A;  1I5L A;  2CUD A;  2RJE A;  1M1K R;  1YIJ Q;  3QZ9 B;  2DK3 A;  4C8Q D;  5GMK i;  2VGM A;  4M75 G;  4AFS C;  4RCB A;  1NLP C;  4M75 E;  4N0A C;  5GAO q;  4FT2 A;  3HL8 A;  4M7A B;  1FMK A;  3JCM J;  1EIF A;  1Z9Z A;  2ED0 A;  2KRN A;  1AD5 A;  2ZZD A;  4L59 A;  1WQ7 A;  1MGQ A;  2CT4 A;  1Q7Y U;  4C92 E;  1WHJ A;  3SD4 A;  1E6G A;  4Q5W A;  1U8R A;  4FIB A;  3MP6 A;  1QVF S;  1V29 B;  2OTL Q;  3CXC S;  5A0D A;  5IN1 A;  1VQ8 A;  4R55 A;  5L8R E;  2HD0 A;  3TSZ A;  1RAI B;  2DO3 A;  3HRT A;  4JPB W;  2DVJ A;  1D0X A;  1YJ9 Q;  4ELY C;  2DFU A;  2LDM A;  2YDL A;  1F1B B;  2QDY B;  2E64 A;  2RI5 A;  1TWB A;  1GCQ C;  2V8I A;  4DOW A;  1MND A;  2AKK A;  4A4E A;  5KE2 A;  1TUD A;  2CSQ A;  3SB2 A;  5LJ3 j;  2CUB A;  2O4X A;  1WHL A;  3PGG A;  2QQ9 A;  2KRM A;  3GNG A;  5IAY A;  3SFM A;  2DZC A;  3JV3 A;  4RG2 A;  4CRI A;  1X6O A;  2X35 A;  1V1C A;  3QJY A;  2AIR B;  1RL2 A;  3RKW A;  1TOV A;  5LJ5 j;  3REA B;  1RI9 A;  4JRQ A;  4KT0 E;  2DZ9 A;  2GTO A;  4RMO A;  1PD0 A;  2Y4Y A;  4HVW A;  3JCM b;  2KAF A;  1NEB A;  4M78 C;  4XK8 E;  4HKE A;  1SSH A;  1WI7 A;  4J9F A;  3CME Q;  4FYV B;  2K9G A;  5GAN 7;  1B34 A;  1RUW A;  2DL3 A;  1MMG A;  2DEU A;  4C92 A;  3P8B B;  4DOV A;  2XID A;  1YNZ A;  1FXX A;  1OUL A;  4Y91 A;  1R0B G;  3DLM A;  5ECA A;  1XOV A;  1B7T A;  1I5O B;  4XU3 A;  3OYL A;  2LJ0 A;  3UWN A;  4HCC A;  2FHD A;  5FU6 C;  1VQ7 Q;  4R0K A;  2LQK A;  1OX9 A;  4IKF A;  1Q82 C;  2DIQ A;  4X9D A;  1VQP A;  3VS2 A;  2E5Q A;  3GF5 A;  1TG0 A;  1VQM T;  1SRM A;  3C12 A;  3LWH A;  4PLL A;  3OSV A;  2BIV A;  4BD3 A;  1YIJ T;  1KG1 A;  2CT3 A;  2DTI A;  1X69 A;  5KYY B;  3VS6 A;  3X24 B;  4ORZ A;  4ESR A;  3NFC A;  3KBG A;  3UAT A;  2M51 A;  4MML A;  4BY6 B;  3OYH A;  1W70 A;  1FMW A;  4QQ6 A;  1WHG A;  2B8A A;  1FWZ A;  1QQJ A;  4XAX B;  3I5R A;  2EQK A;  1Y96 B;  3CCL Q;  5KYW A;  4HVU A;  1ABQ A;  2ROL A;  3TCJ A;  2QK0 A;  1I07 A;  3RER A;  1QVF P;  1TS9 A;  5I2M A;  4OB0 B;  3OS2 A;  2OJ2 A;  2QQA A;  3CXC P;  2V8K A;  4C8Q A;  4XTU A;  3VS7 A;  2ZPE B;  5DLO A;  4PJL A;  4BAC A;  1KQ2 A;  1Q82 R;  2CZ0 B;  5A0L A;  2CKK A;  1D3B A;  2FRW A;  3CMA Q;  5GAO p;  4OB2 B;  5HK0 A;  3TQ7 P;  3JCM g;  4DBF A;  4A4H A;  3QWY A;  5LJ5 g;  4ZGJ B;  3CC4 Q;  2QEX A;  1VQ9 T;  2OTJ Q;  3ER0 A;  1VQN Q;  3CD6 A;  4OVA A;  1B07 A;  1VUB A;  1JXM A;  2K6D A;  3QDF A;  2EBP A;  2X4X A;  2Y90 A;  2NYS A;  2H3J A;  1M1F A;  3L2Q A;  4M7D F;  3OYY A;  4M7A A;  5KYU B;  2DPP B;  4M7D B;  2JVV A;  2RQV A;  1UGR B;  2YUP A;  1N9S A;  1U06 A;  4XTZ A;  2GF7 A;  1DJ7 B;  1PRM C;  1NJI U;  3V8J A;  3EAE A;  1GXI E;  2KRO A;  3O5Z A;  4A4F A;  1JJ2 P;  4FSX A;  2ZPG B;  2O88 A;  1ZQ1 A;  4OB3 B;  3CCJ Q;  5FU7 C;  3SEM A;  4M7D D;  4E7I A;  2O2O A;  2LCL A;  4FYX B;  3ME9 A;  1SSF A;  1I4K 1;  4DQ2 A;  3REB B;  4OF1 A;  5GMK j;  2O9S A;  2VGN A;  4LDY A;  4V2S A;  1C0M A;  2MIO A;  3CC7 T;  1YFN A;  2CP2 A;  5LJ3 e;  3CME T;  2FPD A;  4R56 A;  2CH4 W;  5D6Y A;  3CCR Q;  1C6V X;  1UDL A;  2ROT A;  3A1P A;  4C5G A;  1BYM A;  1K73 U;  4F7U G;  1MMN A;  3JCM P;  2P4R A;  5CO7 A;  1VQ4 Q;  4F7U E;  1LCK A;  3EGD B;  2RQW A;  4ZGE B;  3KFV A;  2PU9 B;  3G6E Q;  4FYY B;  4OMQ A;  4OMP A;  2PNI A;  1H8K A;  2ECZ A;  1I8F A;  5CKD A;  3LH0 A;  1M3B A;  3FDR A;  2V1R A;  1SRL A;  1TU0 B;  3BDU A;  1EZZ B;  2QG9 B;  2KSS A;  3EGU A;  3UA7 A;  2A36 A;  1G3Y A;  3LYI A;  2JXB A;  2HKQ B;  4M77 C;  2MWO A;  1P92 A;  2XHC A;  4QT7 A;  2E6Z A;  3WVD B;  3OYA A;  5LL6 S;  4QVC A;  4N4G A;  4QVD A;  1V76 A;  3QII A;  4ME7 A;  2K5I A;  4MZT A;  4XTY A;  2DBM A;  1XNI A;  2DXU A;  1FYN A;  3CCL T;  1YN8 A;  5GAN g;  2K3Y A;  3DKM A;  1VQK T;  4F14 A;  5HK3 A;  2VYT A;  3JRZ A;  2HQH A;  2LVM A;  2YWW A;  2K79 A;  1YCS B;  2NUP B;  3DB3 A;  1OZ2 A;  1M8V A;  4A53 A;  3I55 T;  1YJ9 A;  2FZK B;  4FL6 A;  3CPW A;  2PVD B;  2RH2 A;  1OX8 A;  3E1S A;  2LNV A;  4LNP A;  1YI2 T;  1VQN T;  1OQK A;  1UTI A;  5KYY A;  2FL7 A;  4M77 G;  3M0R A;  4WTO B;  1M2O A;  2CH4 A;  1LJO A;  4PK4 A;  2QTV A;  3FJP A;  5GAN d;  1I81 A;  2LRQ A;  2HL3 A;  2KE9 A;  1Y96 A;  3JCM Q;  2EAY A;  3H6Z A;  1QWE A;  2FB7 A;  2DYB A;  4LUD A;  2J6K A;  1X2Q A;  1IHV A;  1MMD A;  2I2L A;  3EG1 A;  1VYV A;  4LDW A;  2DX1 A;  2FVU A;  2MK5 A;  3OS0 A;  2DL8 A;  1VIF A;  2K3B A;  4KH0 B;  1Y57 A;  1BI3 A;  2VAS A;  1VQ6 T;  2DNU A;  2WSF E;  2BTT A;  1KQS A;  3ZEH A;  4A54 A;  2F1L A;  4AFZ C;  3NTK A;  3CCE T;  4VUB A;  5GAM g;  1U1T A;  5FRO A;  4DBH A;  3R6O A;  5CR2 A;  3OY9 A;  1PD1 A;  1AWX A;  1H64 1;  3JB9 J;  1X6G A;  4JLG A;  3L1A A;  3L2V A;  2OI3 A;  2L3R A;  2DVE A;  2DER A;  1D1C A;  5GMK m;  5KYU A;  4ANJ A;  2LX7 A;  2RF0 A;  2KMT A;  1XQH A;  4M75 F;  4XU0 A;  2RHZ A;  1PHT A;  2V1Q A;  3HFN A;  1VQO A;  1VQ7 A;  1IRE B;  3CC2 T;  2E6N A;  2NLU A;  1U3O A;  1RAH B;  4LE9 A;  1UB4 A;  4M75 B;  1UHF A;  1W2B A;  2JTE A;  5GMK e;  3VKI A;  2IG0 A;  3DLL A;  1PKT A;  5DY9 A;  4C92 F;  1K4U S;  4PJO C;  2RHY A;  2QTX A;  4LUE A;  3C95 A;  5GAM d;  2ENM A;  1BKB A;  2RHU A;  2XI9 A;  2KXC A;  3TU4 K;  4IUU A;  3HRS A;  1G83 A;  2OAU A;  2JN0 A;  2KY9 A;  2C0O A;  4M75 D;  1JO8 A;  2M0Y A;  1N9R A;  4J5Y A;  1YWO A;  2ESW A;  4PLI A;  4C0D B;  3PT9 A;  2PZ1 A;  4E6R A;  3FC3 A;  4C92 D;  3OYM A;  1WXU A;  1OU9 A;  4NL2 A;  1WDX A;  3VS3 A;  3GP8 A;  2RI2 A;  3M57 A;  2JMA A;  1UEC A;  1NE8 A;  1YJN A;  2NUT B;  3EGD A;  2DXB A;  3QO3 A;  1K73 C;  2LQ8 A;  2COZ A;  1OPL A;  2JTM A;  3MET A;  4A4G A;  3THK A;  2ATC B;  5KYN A;  2V26 A;  3VUZ A;  3CMA A;  2K3X A;  3G4S A;  2DAQ A;  4YTL A;  4QQG A;  3CC4 A;  4BE1 A;  3CCU T;  2VUB A;  1K9A A;  1NYF A;  3S6W A;  4PJO G;  2WSC E;  1TUG B;  1TSF A;  2IPO B;  4C5E A;  3H0I A;  3QXE B;  3VRY A;  4PJO E;  4C8Q F;  2QAZ A;  5CVI A;  1M27 C;  2CZ7 B;  2E3I A;  4J9G A;  4MMK A;  1Q81 R;  3L2U A;  1YP5 A;  2C06 A;  3EH2 A;  2P84 A;  1TUC A;  2EGC A;  1GCP A;  4LXC A;  3OYB A;  5HCK A;  2PUO B;  1D3B B;  2W10 A;  2HEQ A;  1VQM Q;  2VB6 A;  3VRZ A;  3RKX A;  3LH5 A;  2RHI A;  1K73 R;  1YHQ T;  3CCV A;  3CCJ A;  2HKN A;  4O5V A;  1G3T A;  2NUP A;  4KBM B;  4E7K A;  2F2W A;  3V7C A;  5LJ3 h;  4M7A F;  1RAF B;  2YT6 A;  4PNO A;  4RG8 A;  2I0N A;  4GY5 A;  2JM9 A;  2MMP A;  4RCC A;  1GBQ A;  2KI7 A;  1D0Z A;  2RQU A;  2R5A A;  1E6H A;  2VXE A;  2HAX A;  4JJD A;  1HXD A;  1VQ5 T;  1ZSZ C;  3V7S A;  2EYQ A;  1BK2 A;  1BU1 A;  1VQ4 A;  5LJ3 f;  3CCM Q;  5J26 A;  4M7A D;  2KK4 A;  2RJF A;  2EJF A;  4EPC A;  3G6E A;  2JT4 A;  1BIB A;  2MWP A;  2EKO A;  2A0F B;  1VQ9 Q;  1NG2 A;  2DJQ A;  1Y71 A;  4EDU A;  1GRI A;  1QVP A;  2DJZ A;  3OYN A;  3H9N A;  2RD1 A;  3JCM f;  5LJ5 f;  1ZX6 A;  1ARK A;  1WLP B;  3GPL A;  4BE2 A;  2LZ6 B;  4EIK A;  1G3W A;  2PQW A;  3EH1 A;  3LGL A;  1R0C B;  2LP5 A;  1Q86 R;  5L23 A;  3LGF A;  1IRX A;  2J6F A;  3JB9 H;  2F69 A;  2CGH A;  3CBO A;  4X34 A;  5J3B A;  3S3M A;  5FU6 B;  1KHC A;  8ATC B;  1AZG B;  3A8H B;  3PTA A;  2RQT A;  3PVL A;  2F2X A;  3AHU A;  4KUL A;  1WJQ A;  2VKN A;  3WXM B;  4J9C A;  4HXJ A;  1PSE A;  3CC7 Q;  4ATO A;  2X3X D;  4M75 A;  1JRI A;  2KVQ G;  1VQL T;  2KYM A;  3C0C A;  1YBY A;  1VYU A;  3E2U A;  3HRU A;  3VS1 A;  2ZPF B;  4NOY A;  3SHW A;  1SEM A;  2HZY A;  3E9G A;  2HQE A;  3AT1 B;  2MOX A;  2DMO A;  1IGU A;  1M4Z A;  3QDR B;  3S3O A;  4OGE A;  1JQQ A;  2KR3 A;  2D0Q B;  3PNW C;  4KH1 B;  1QVG A;  3OYF A;  1SKU B;  2E65 A;  3RMQ A;  1WXT A;  4JRI A;  3TRE A;  4B9W A;  4EMK C;  1KQ1 A;  5CKF A;  1MUZ A;  2EQU A;  5I11 A;  2NUT A;  3OW2 A;  1K0S A;  1MMA A;  3EGX A;  2WSE E;  4GLM A;  2DTO A;  3G71 A;  4O6J A;  4X1V A;  1K9M U;  2EYW A;  3M4Y A;  4M78 G;  1SG5 A;  2AK5 A;  2BE7 D;  3VYH B;  1X2K A;  3JCM V;  3QPH A;  4F7U B;  3OW2 S;  5FRN A;  2D8H A;  3BDL A;  4M78 E;  1XJW B;  2DIG A;  4N0A A;  1BCO A;  2EQJ A;  3QG1 A;  4J9B A;  3S3N A;  1VQK Q;  1QCN A;  2QAS A;  3CCQ T;  1O75 A;  1JXO A;  3M53 A;  3A5Z B;  1PC0 A;  1ACM B;  2CP3 A;  1WJR A;  1ZBJ A;  3PE0 A;  1AWJ A;  1O9S A;  2KYB A;  2LQW A;  3CCM T;  5GMK h;  3I55 Q;  2RI3 A;  2QQS A;  5J39 A;  5FU7 B;  2JNG A;  2X4W A;  2DL4 A;  4RTX A;  5D7U A;  8AT1 B;  3M56 A;  3RBB B;  2FG0 A;  4BE0 A;  1YI2 Q;  4CC4 B;  1SPK A;  2QGG A;  2QXF A;  2XDB A;  4MDW A;  2LJ1 A;  2RPN A;  5D6X A;  5GAN j;  3PMI A;  2H3E B;  1QWF A;  2XMF A;  1GCQ A;  2L2P A;  5KYX A;  3D7S B;  4IUQ A;  1IB8 A;  2JUF A;  3C94 A;  1S72 Q;  1IXD A;  2KDS A;  2JM8 A;  2RHX A;  1D0Y A;  2DBK A;  1PWT A;  1AHJ B;  4RTZ A;  3ULR B;  1XTD A;  4HCB A;  2O9V A;  2FYK A;  1AWO A;  1AVZ C;  1WZO A;  3I56 A;  1VQ6 Q;  4J9H A;  4J83 A;  2FPE A;  3CCE Q;  1Q81 U;  1IO6 A;  3EG3 A;  3FB9 A;  4M78 A;  4JJC A;  2RK2 A;  2RQR A;  2CRE A;  2DF6 A;  4A63 B;  4ZN3 A;  2PVO B;  3TSW A;  2GFU A;  3G1J A;  2QA4 T;  1X43 A;  4D6W A;  4K11 A;  4PFP A;  3MP8 A;  4GBQ A;  3CCS A;  3JCM e;  5LJ5 e;  1N8R U;  1PCX A;  4HCZ A;  4C0Z A;  5FRM A;  5FWC A;  2PUK B;  3CC2 Q;  2GNC A;  2D0N A;  5DM7 R;  1YWP A;  5FWB A;  5AT1 B;  3GNF B;  5CKH A;  4F04 B;  2M9U A;  3HKS A;  4AFU C;  5GAM j;  4J8O A;  2BZY A;  4J9D A;  3NTH A;  1YJW T;  2QDL A;  2MF2 A;  2HQX A;  1YIJ A;  2A3L A;  2J06 A;  2KRS A;  3LX7 A;  2HSP A;  2HNI A;  1UGV A;  4LDV A;  2DTH A;  2DXC A;  2LT1 A;  3QKJ A;  3GBQ A;  1VQ8 Q;  3A8O B;  2EGA A;  2G3R A;  1VQO T;  4EMH A;  1X6B A;  5GAO r;  3PMT A;  3L42 A;  4HVV A;  2AKL A;  2LTO A;  2GCX A;  4CC2 A;  3CBM A;  3FIF A;  2C0I A;  5C6S A;  1G5V A;  4IUR A;  5GAN 4;  2PVG B;  1RI0 A;  3M54 A;  3ZFJ A;  3E19 A;  1M90 U;  1X75 C;  1W6X A;  4DA4 A;  3OSS C;  2OTL A;  4RTW A;  4JRP A;  3EFR A;  2DET A;  4WF2 A;  1KC8 R;  1VQ9 A;  1JBM A;  2CS7 A;  2VXF A;  3CCU Q;  2MAM A;  1KJW A;  3M55 A;  1Q86 U;  4JJB A;  4RUG A;  1BB9 A;  1OYX A;  3X26 B;  3RR6 A;  1LOJ A;  1RAC B;  5I2S A;  1M2V A;  1R8O B;  2XD0 A;  1X01 A;  1YJN T;  1CKA A;  1RLQ C;  4P5N A;  5CIU A;  3P8D A;  5A0G A;  1M1G A;  3VS0 A;  1YIT T;  1FMV A;  3I35 A;  2R58 A;  4CC3 A;  3CPW S;  4F7U A;  4M77 E;  1OPK A;  3V8K A;  5KH6 A;  2ZPI B;  5IT9 E;  1K9M C;  1ZUY A;  2HL5 C;  4B9X A;  1S72 T;  2E41 A;  1YHQ Q;  2EJ9 A;  3OYC A;  3RES A;  3VUB A;  4BI4 A;  2C0T A;  4BDY A;  2K5F A;  4IUT A;  2COW A;  4FM4 B;  2KT1 A;  3LWI A;  4BI3 A;  3SWN C;  4J7F A;  1KFZ A;  3OMC A;  1N27 A;  4PJO B;  3CC7 A;  2HSE B;  5GAN e;  2HDA A;  3M5A A;  3CME A;  1QKW A;  2K4Y A;  2GBQ A;  5GAO m;  1HSQ A;  5GAN 6;  4CI0 C;  1RAB B;  1YCY A;  3OMG A;  2A08 A;  1KQS S;  3CCV T;  3RNJ A;  1M9S A;  2E1H A;  5GAN 2;  1VQ5 Q;  3VS5 A;  1OI1 A;  5CCA A;  1M3A A;  5KCO A;  4PJO D;  1K9M R;  5DLQ E;  2L3Q A;  3O8V A;  1WPY A;  2O01 E;  1GBR A;  4RKU E;  1E7O A;  3DB4 A;  1EX4 A;  3FJ5 A;  1JEG A;  1QCF A;  4FCY A;  3QYG B;  3JB9 G;  1T0J A;  3EG9 A;  3CBP A;  1U5S A;  1HJD A;  4FYW B;  3MKD A;  1OEB A;  1ZUK A;  2PTK A;  3PFS A;  2RNA A;  3EHR A;  2CZ1 B;  2XIC A;  5CKE A;  4E7H A;  4BDZ A;  4J7I A;  4MDX A;  1JB0 E;  1W2B S;  4RTT A;  1MV3 A;  1IZ6 A;  2EPD A;  4M77 A;  2JZ2 A;  2KGT A; 
#chains in the Genus database with same CATH homology
 2FRY A;  2NUZ A;  2OJ2 A;  3QWX X;  1ZX6 A;  2HCK A;  1ZSG A;  1ARK A;  3VS7 A;  1ZLM A;  1GFC A;  1WLP B;  2LCS A;  2D8J A;  2L3P A;  2F2V A;  2MCN A;  2LZ6 B;  4EIK A;  1SHG A;  1Z9Q A;  2LJ3 A;  2SRC A;  5EC7 A;  4J9I A;  2FRW A;  3M0P A;  2B86 A;  5IHN A;  3QWY A;  4JZ3 A;  2LP5 A;  4CC7 A;  5IH2 A;  5L23 A;  2DRM A;  3U23 A;  1AZE A;  1B07 A;  2W0Z A;  1JXM A;  2J6F A;  3UA6 A;  1NYG A;  1WA7 A;  4KRT A;  2K6D A;  3I9Q A;  1GL5 A;  2EBP A;  1AZG B;  2EYX A;  2RQT A;  3PVL A;  1UG1 A;  2F2X A;  2VKN A;  2RQV A;  2YUP A;  4J9C A;  2DL5 A;  4HXJ A;  1U06 A;  5FW9 A;  1PRM C;  2X3X D;  4Z88 A;  3CQT A;  1G2B A;  2KYM A;  4AFQ C;  2KRO A;  3C0C A;  3H0H A;  3O5Z A;  1VYU A;  2O88 A;  3VS1 A;  1NLO C;  4Y92 A;  2GGR A;  3SEM A;  3SHW A;  1SEM A;  2GTJ A;  1M8M A;  2O2O A;  2MOX A;  4ZNX A;  2DM1 A;  2DMO A;  2EQI A;  1WYX A;  3REB B;  2O9S A;  4D8D A;  2MIO A;  2E5K A;  2FPD A;  1WXB A;  2CH4 W;  1JQQ A;  2KR3 A;  3R6N A;  1B3Q A;  1RLP C;  2CSI A;  2DL7 A;  1UDL A;  2ROT A;  3NPF A;  1WXT A;  2AZS A;  5GJV B;  1Y0M A;  2D1X A;  4AG1 C;  2EW3 A;  2L3S A;  1HD3 A;  3ZL7 C;  3M0Q A;  2P4R A;  1MUZ A;  3M0T A;  5I11 A;  1K0S A;  1KSW A;  4GLM A;  1LCK A;  2RQW A;  3KFV A;  2K2M A;  1KIK A;  4X1V A;  4OMQ A;  4OMP A;  2EYW A;  2PNI A;  1H8K A;  2ECZ A;  2AK5 A;  1X2K A;  1M3B A;  2DIL A;  2V1R A;  1SRL A;  2D8H A;  4OMM A;  1WX6 A;  4OMN A;  1WFW A;  4RTV A;  3EGU A;  3UA7 A;  2A36 A;  2JXB A;  2BZ8 A;  1PKS A;  4J9B A;  2KBT A;  4QT7 A;  3TVT A;  1AOJ A;  1JXO A;  4JZ4 A;  1ZBJ A;  2KNB B;  3PVQ A;  3PE0 A;  1AWJ A;  2IIM A;  2EYZ A;  1I1J A;  2KYB A;  1JU5 C;  2LQW A;  4LN2 A;  2DBM A;  4AG2 C;  1FYN A;  2DL4 A;  4RTX A;  1YN8 A;  3RBB B;  2LQN A;  1T0H A;  2FG0 A;  1UUE A;  4F14 A;  4CC4 B;  1SPK A;  1PRL C;  2EGE A;  1EFN A;  1QLY A;  2LJ1 A;  2K79 A;  1YCS B;  2ABL A;  2FPF A;  2RPN A;  2JMC A;  2KXD A;  2K7A A;  1X27 A;  1AEY A;  3H41 A;  2YUO A;  1WIE A;  1QWF A;  2XMF A;  4WCI A;  1OOT A;  1K0X A;  1GCQ A;  1A0N B;  2L2P A;  2KT8 A;  2VVK A;  1CSK A;  2DA9 A;  2JM8 A;  4LNP A;  2A37 A;  2DBK A;  1GFD A;  2CDT A;  1PWT A;  1J3T A;  2H8H A;  1H3H A;  2LNH B;  1UTI A;  1M30 A;  2O31 A;  4RTZ A;  3ULR B;  1QKX A;  4J9E A;  3M0R A;  4OMO A;  2CH4 A;  2EYY A;  2O9V A;  1AWO A;  1AVZ C;  3IQL A;  4J9H A;  3EG0 A;  2KE9 A;  3M0U A;  1NM7 A;  2FPE A;  1QWE A;  2GQI A;  2DE0 X;  2DYB A;  3M0S A;  2J6K A;  2HBW A;  2KEA A;  4LUD A;  1IO6 A;  3EG3 A;  5I22 A;  1NEG A;  1X2Q A;  4JJC A;  3VS4 A;  2FEI A;  4M4Z A;  1VYV A;  3EG1 A;  2RQR A;  2DX1 A;  2EVR A;  2CRE A;  2DF6 A;  2DL8 A;  1M3C A;  4A63 B;  2AZV A;  2K3B A;  1Y57 A;  3TSW A;  2RN8 A;  1X43 A;  4FSS A;  4K11 A;  2DNU A;  2DLP A;  2BTT A;  4GBQ A;  2JS0 A;  2SEM A;  4AFZ C;  2CUD A;  1W1F A;  5FWC A;  2GNC A;  2D0N A;  1UFF A;  1YWP A;  5FWB A;  1BBZ A;  1AWX A;  1K1Z A;  1X6G A;  3EHQ A;  1N5Z A;  3NGP A;  4OML A;  2OI3 A;  4AFS C;  4RTU A;  4AFU C;  2EKH A;  2X3W D;  2BZY A;  2L0A A;  1NLP C;  4J9D A;  2QDL A;  1FMK A;  1MV0 B;  1Z9Z A;  2LX7 A;  2RF0 A;  2J06 A;  1SHF A;  2KRS A;  2ED0 A;  2HSP A;  4Z8A A;  2KRN A;  1AD5 A;  1UGV A;  1PHT A;  1T3L A;  2V1Q A;  3GBQ A;  2YSQ A;  2CT4 A;  1U3O A;  2EGA A;  4LE9 A;  1UHF A;  1E6G A;  1UJ0 A;  2JTE A;  2ED1 A;  1X6B A;  3EG2 A;  1PKT A;  4HVV A;  1K4U S;  2RMO A;  2AKL A;  4LUE A;  2J05 A;  1PNJ A;  2JS2 A;  2ENM A;  4CC2 A;  2C0I A;  2KXC A;  1G83 A;  3TSZ A;  4JPB W;  2C0O A;  2DVJ A;  1W6X A;  4DEY A;  1JO8 A;  1VA7 A;  2YDL A;  2M0Y A;  1ABO A;  4RTW A;  1YWO A;  2ESW A;  4HCK A;  5IHK A;  2PZ1 A;  1VYT A;  2OAW A;  4E6R A;  1GCQ C;  2JW4 A;  2AKK A;  1WXU A;  1AWW A;  3I5S A;  1KJW A;  3VS3 A;  1WDX A;  1H92 A;  1TUD A;  2CSQ A;  4JJB A;  4RUG A;  1BB9 A;  3UF4 A;  1ZUU A;  2JMA A;  4DEX A;  1UEC A;  2CUB A;  2KRM A;  3JV3 A;  1OPL A;  1CKA A;  1RLQ C;  2A28 A;  3VS0 A;  3THK A;  1V1C A;  3I35 A;  1I0C A;  4CC3 A;  2FO0 A;  3REA B;  1RI9 A;  1T3S A;  1OPK A;  1UE9 A;  5IXF A;  1CKB A;  2GTO A;  4IIO A;  2G6F X;  1K9A A;  1NYF A;  4HVW A;  1ZUY A;  1NEB A;  2J7I A;  3H0F A;  1SSH A;  3H0I A;  3VRY A;  1S1N A;  5IHI A;  1WI7 A;  4J9F A;  2K9G A;  1M27 C;  4J9G A;  1OV3 A;  2C0T A;  5IXB A;  2YUN A;  1YP5 A;  4F17 A;  2KT1 A;  1RUW A;  1TUC A;  1KFZ A;  3NMZ C;  1UHC A;  2DL3 A;  2EGC A;  1GCP A;  5HCK A;  1YNZ A;  2W10 A;  2HDA A;  2HEQ A;  1QKW A;  3VRZ A;  5ECA A;  3LH5 A;  1XOV A;  2GBQ A;  1HSQ A;  2LJ0 A;  2A08 A;  4D8K A;  3RNJ A;  2VWF A;  2YUQ A;  3VS5 A;  2F2W A;  2LMJ A;  4R0K A;  1UJY A;  1M3A A;  2YT6 A;  2DRK A;  2L3Q A;  3VS2 A;  4F16 A;  2NWM A;  1GBR A;  1TG0 A;  1SRM A;  2BZX A;  2J6O A;  2I0N A;  1E7O A;  2JM9 A;  4RTY A;  3FJ5 A;  1GBQ A;  1JEG A;  1QCF A;  2CT3 A;  2RQU A;  1X69 A;  1E6H A;  4Z89 A;  3VS6 A;  1T0J A;  4ORZ A;  4ESR A;  1K76 A;  3UAT A;  2M51 A;  1U5S A;  1HJD A;  4JJD A;  1W70 A;  1BK2 A;  1BU1 A;  1OEB A;  1ZUK A;  2PTK A;  2RNA A;  3EHR A;  3NHN A;  3I5R A;  2JT4 A;  4IIM A;  4HVU A;  4RTT A;  1ABQ A;  1MV3 A;  2ROL A;  3A98 A;  1NG2 A;  2DJQ A;  5GJW B;  1I07 A;  2EPD A;  1GRI A;  2KGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...