1OX9A

Crystal structure of sspb-ssra complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B
publication title Structural basis of degradation signal recognition by SspB, a specificity-enhancing factor for the ClpXP proteolytic machine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase activator
total genus 21
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ox9A00
1YFNA 1OU8A 1OU9A 1OULA 1ZSZC 2NYSA 2QAZA 1ZSZA 1OX8A 1ZSZB 1TWBA 2QASA 1OX9A
chains in the Genus database with same CATH superfamily
1UUEA 1CSKA 4PKCC 1OYXA 2YUOA 2EQJA 1KIKA 3JCMP 2DXUA 2MAMA 3LGFA 1SHFA 4PJNA 4OMFB 2JT4A 1M1KR 2KVQG 1GRIA 1VIEA 2HKQB 3LH5A 1J3TA 4AG2C 1SG5A 1VQLA 2W10A 3J80E 4LXCA 3OS1A 2VUBA 2HCKA 2DMOA 3PT9A 2RI2A 4JJBA 3L2ZA 1D0ZA 2F5KA 2HQXA 4C8QB 1H92A 1O9SA 2E6ZA 5GMKm 3NTHA 1M4ZA 1QW1A 1VQ7T 2DPPB 3CD6Q 1VQ8T 2J6FA 3HPWA 1S1NA 2XD0A 4XTYA 5EG2A 2FL7A 1I5LA 3M0SA 2D9TA 1ZUKA 1UGPB 1M1KC 3NTIA 1M1GA 3OQ5A 3QO3A 4IIMA 1ZSGA 3CCJA 1IRXA 4NL2A 5GAMd 3CCLT 1MV3A 1H3ZA 1RAGB 1VQKQ 1VQ6A 2WACA 3C4SA 4HCCA 1VQ9T 4C5IA 3CCVQ 2DIQA 1C1AA 1KD1U 4CC3A 4F7UA 1OZ3A 1M90R 1PHTA 4ANJA 2X9HA 3PVLA 3J81E 3NPFA 4J9DA 2RPNA 3I56Q 1JO8A 1JJ2S 1I4K1 2RH2A 4XU1A 2LNHB 3EGDA 4KULA 2H3EB 4X34A 2ENMA 3I5RA 3CCQQ 2DXTA 2RF0A 2VB6A 3CMAQ 4OB0B 3G4ST 2XDDA 1PKTA 2GTOA 1T3SA 4PFZA 4M78D 2ZPHB 3VUBA 3L2VA 5I21A 1B34A 5GAMg 1M3BA 4JUVA 2K5IA 3X24B 4C0FA 1YHQT 1BIBA 2O31A 3OYNA 4DQ2A 2CP2A 3AT1B 2KR3A 1YITQ 2HZYA 2ROLA 1M90C 2LT4A 3HTRA 2QEXQ 4M7AG 3DLLA 1ARKA 1OV3A 4JZ4A 1W1FA 1WFWA 9ATCB 2QQAA 3CC7A 4FSXA 3FC3A 1B7TA 3E2UA 1UJYA 2CP5A 3HRTA 2DM1A 1K9AA 2EYYA 3A8MB 3SWNA 1SSHA 4KBMB 2E41A 3H6ZA 2FG0A 3JV3A 3LH0A 2YLBA 1IHVA 5A0DA 1G2BA 4BE0A 2J6KA 4M78G 3PFSA 5AYFA 1TUCA 5GANd 3GLXA 2KEAA 4C92F 2L2PA 2QA4Q 3CC4A 1K73C 5D6YA 3JCMe 1SSFA 3LGLA 4R55A 1I0CA 3URGA 4BACA 3OYAA 1X43A 5FRNA 1Q7YR 2K2VA 5HKCA 1ACMB 3CD6T 2JTEA 3PGGA 1AT1B 1YIJA 2KXDA 1O75A 2CZ1B 3QUIA 5CCAA 2GQIA 2VWFA 3QZ5B 1Y96B 2FEIA 2A7YA 2VYTA 3VS4A 1N8RR 4C0DC 1X6GA 4J6YA 2CP6A 2F5TX 2HL3A 3VRZA 1YI2Q 2K2MA 5C0MA 1CKBA 3CC2A 2GNCA 3CQTA 1VQKT 1TUDA 1Q86R 2A08A 2K3XA 4VUBA 3CCRA 4PK4A 2RMOA 1MHNA 3CCVT 4OP0A 3I55A 1M2VB 2VGMA 4RTXA 1AWWA 1VQNQ 4JS4A 1AD5A 4HVWA 3I56T 2LQNA 2LCSA 1Q7YC 2A37A 5LJ5g 2DE0X 4QT7A 1MMAA 2K4YA 3MJXA 5IHIA 2KBTA 5CKEA 3X26B 4QVCA 2BUDA 3CCEA 4L6V5 3OA6A 4M7DC 3UA7A 3S3NA 2L5QA 1QCFA 3D7SB 4J6WA 4BD3A 4EPCA 4XTXA 1LJOA 3JCMV 2EQIA 5FLXE 1WHLA 3WVDB 2JNGA 3CMEQ 1GCQA 4C92B 5CQXA 1YITT 2OTLQ 2QEXT 3V7RA 4ZN3A 3UA6A 1PG5B 1CKAA 1PM3A 1MMDA 2CUDA 4WF2A 4JRQA 4XQ3A 2V8KA 1VYTA 1R0BG 3P8BB 3ZBDA 1V29B 1G3SA 3MP1A 5IHKA 3S6WA 4XU3A 3G71A 3OSVA 1XOVA 4PFOA 2KROA 1RLPC 5FU7C 1NJIR 4OMPA 3X25B 1W2BA 5CAIA 1SRLA 4RTWA 2BE9B 2DD4A 1VQ5Q 4C8QG 1RUWA 1K76A 2J06A 2QA4T 4OMNA 3H0HA 4DOWA 3CCSA 1VQMQ 4CC7A 3VS1A 3NFCA 1NLOC 4ELZC 5GAN4 4OB3B 3OBWA 1E6GA 5KYWB 2CSIA 2JOYA 1JJ2P 1PC0A 4RCCA 5I2SA 3EG3A 2I0NA 5GAMe 4EMKB 4IUUA 1VIFA 5LJ5h 5GAMf 4ELYC 2KYBA 2IIMA 1NJIC 2HBPA 1AWJA 2HQHA 1N8RU 2RN8A 4L59A 1YI2T 4BY6C 2AIRB 1Z9ZA 5GAOm 2H3JA 1R77A 2AKKA 3ZEHA 5CK9A 1Q86U 1I5OB 1VQNT 3HFNA 2MWOA 4OMLA 2AT1B 4HCKA 3OMGA 4BDYA 3GNFB 2DAQA 2O4XB 4IUPA 2CSQA 2RK2A 3QSUA 1G5VA 1JXMA 3EG0A 2CP3A 3L2UA 5IN1A 5CKBA 3EAEA 2M1HA 3M5AA 1UHCA 1YJ9A 1D0XA 5HCKA 2DEUA 3X20B 1RLQC 1U3OA 1M3CA 4MMLA 4E47A 4J9IA 3Q1JA 2JTFA 2KYMA 1OU8A 5HK3A 3H0IA 3CMET 3J7AF 1R0CB 1E7OA 2QYZA 2QK0A 4QQ6A 2GTJA 2K9GA 2YHTA 2LTOA 3M55A 2OTLT 1I81A 3HRUA 5KE2A 4HT8A 1N27A 1X01A 3V7SA 3QDRB 4J6XA 1UG1A 4CI0C 2X4WA 3OYLA 4FW2A 1VQOT 5FWBA 5GANe 1UDLA 1V76A 4FU6A 1LOJA 2NUZA 3FRNA 1NYFA 2QGFB 1UJ0A 4K11A 5FU7B 2EJFA 4RTTA 3EFOA 3LW5E 3EFSA 2NYSA 1SHGA 2Z0WA 1WHKA 1VQ5T 1RAFB 3PIPA 3SEMA 1X6BA 4QQDA 4HKEA 2DL4A 4RCBA 1JJ2A 1ZSZA 5LJ3d 1VQMT 4F7UF 3EG9A 2QG9B 4OB2B 5DM7R 3FDRA 1FMKA 4XTWA 5LJ5f 4D8KA 1UGRB 3NMZC 3KXTA 1JU5C 2MPXC 2WSFE 5EC7A 4XU0A 7AT1B 1YWOA 3C95A 3SWNC 2LJ3A 1WXBA 3IQLA 2Y4XA 4KUDK 1YJWA 4XAXB 3CCJQ 2HBWA 1WLPB 3ASKA 1VUBA 4F7UE 2HDAA 4M75A 1VQ6Q 2D6FA 4M77A 4F17A 4L5GA 2RJDA 1WXTA 1JEGA 4XU2A 4QQGA 2P0KA 2RJEA 2CP7A 3V8LA 3JB9H 3DLMA 1KD1R 1PD0A 1WHJA 3HFOA 1W2BS 2O01E 3MEWA 1WHMA 1VA7A 1WDXA 3EHRA 3SHWA 3M4GA 2E10A 1G3TA 2NUTA 5AT1B 3M0TA 1IGUA 4C92G 3JCMg 4A4EA 3OW2A 1ZHIA 4QKUA 2QDLA 2DTOA 2KNBB 2DA9A 1OPKA 3EGXB 4PNOA 3RNJA 3VU3C 3OYBA 3MKDA 2IPOB 3H0FA 4F7UB 1QLYA 1W70A 3INZA 4ESRA 1KD1C 2L0AA 3OBYA 2LJ1A 2LVMA 1V1CA 3CC7Q 4MDWA 4MZMA 4KGXB 1IO6A 5J3BA 1FMWA 3EGDB 4N0AA 2KAFA 2R5MA 1MUZA 2NLUA 1JB0E 3CCMA 4M7AA 2C0IA 3M54A 5GAMj 5FWCA 4J8OA 1WQ7A 1KHCA 5KYYA 4J9CA 1EX4A 4JPBW 3V8JA 2LMJA 2YT6A 4CC4B 2A36A 4RTVA 1JRIA 2OTJT 1RAEB 2VC8A 3R6OA 2DL3A 2MCNA 4M7DD 1H8KA 1K9MU 2DJZA 2L3SA 2KRMA 1GCQC 2NUPB 1RL2A 1Q81R 1LCKA 4M75D 2E3HA 2MK5A 4IKFA 5KYXB 3E9GA 4Y28E 3CXCS 2FYKA 5GAN8 1YIJQ 1TSFA 3M0UA 3VS7A 2E64A 2L3PA 1AWXA 3OYMA 4B9WA 3SWNB 1OX9A 2LJ0A 3RKWA 1WA7A 5GAN5 1G3YA 2X4YA 4LUEA 3HL8A 4FYXB 2HSPA 3CCJT 1EZZB 3QPHA 4JRKA 5ECAA 3EH1A 2FPDA 2J7IA 3JCMh 1VQ4Q 2X4XA 2FPFA 1BU1A 1D1BA 4DOVA 1VYUA 3CCRQ 3I55Q 2BIVA 4GY5A 4DA4A 3VS3A 1FMVA 3M53A 4HCBA 2CH4W 4E7ZA 2X3XD 1K4US 4NOYA 2DYBA 1WIEA 1M3AA 1RI0A 2PZ1A 4OF1A 4PLIA 1TU0B 2CZ0B 5FW9A 3TVTA 3CCEQ 3UATA 1VQ7A 4A4FA 3MEVA 1VQ8A 1Q82R 3VV0A 1QKXA 3NHNA 5GJWB 3L1AA 4MZTA 5KYNA 1ZBJA 3RKXA 2E12A 2X3WD 3VS2A 2EJ9A 1K0XA 1E6HA 4ZTJA 1QCNA 4MDXA 2BTTA 4GLKA 1QKWA 2AZSA 5CQYA 2X35A 3CCLA 5HY6A 3QIIA 1VQ9A 2BKDN 2A28A 5LJ5j 2ABLA 2A3LA 2XG8D 2LP5A 5CO7A 2EGEA 1MMNA 1NEGA 2MWPA 2JMCA 4RTZA 3A5ZB 5IXFA 1N6AA 3V7CA 3PMTA 3G71Q 3BDLA 2DRKA 3QWXX 4BE2A 5LJ3e 1NLPC 4JJCA 2VXEA 1YJNT 3QYHB 4OGEA 4PFPA 1K0SA 1BI2A 2RJFA 5FRMA 3DB4A 4DBFA 2M9UA 3VS0A 3SD4A 3I9QA 5GMKl 1JXOA 5FU6C 4LD9K 5GAN3 4DBHA 4JS5A 2XIDA 2L3QA 3DKMA 4X1VA 4J9GA 2KE9A 1G83A 1B07A 4C8QA 1Q81U 2DL7A 1X27A 3OYCA 2O9SA 2LQKA 1KSWA 1YIJT 1W2BP 3OW2S 2QASA 5C6SA 3JCMf 3VYGA 1JQQA 1AWOA 3H9NA 2GQVA 4BB7A 4PLLA 3THKA 3SDZA 4J7FA 1QVGA 1MNDA 1Y07A 2WSEE 2DZ9A 4NS5A 1XJWB 3A8GB 3JCMc 1VQ4T 2EKHA 3CCRT 5DLOA 4DBQA 2RQWA 5GANg 3I55T 3FJ5A 2ZGWA 1BCOA 1ZSZC 2HL5C 2ZPBB 3KUFA 5GMKe 2DETA 1SPKA 2CREA 1XTDA 3KBGA 2F2VA 3F70A 3WXMB 4Q5WA 3GPLA 2EJGA 5GAMh 5GAN2 3CCET 3QKJA 4EMHA 5J39A 4Z88A 3FJPA 3LLRA 4JLIA 2DD5A 4XK8E 3CD6A 2YUQA 2LC4A 1UGSB 1GL5A 1GXIE 3DB3A 3LX7A 1Q82U 1XQHA 3VRYA 3CCQT 4LN2A 3OYFA 5KH6A 1FXXA 3CCUQ 3CMAT 4F7UG 2R58A 2RQTA 3LYIA 2R5AA 4LDYA 2EWNA 2CZ7B 2DX1A 1GCPA 1N8RC 4PJOA 2X51A 2YLCA 4M75C 4M77C 1W4SA 1X75C 5GAOr 1N9RA 2JW4A 2PU9B 1Q86C 2K5LA 4J9EA 3BY7A 3E1SA 1YP5A 1ZX6A 1YCYA 2D0QB 5A0LA 3G71T 2E70A 2RHUA 2YSQA 2GCXA 4LUDA 3OMCA 5CKFA 4N4HA 4M7DF 1AVZC 2E6NA 3M9QA 3A8HB 4M75F 2D0NA 4M77F 3PMIA 3RESA 2MF2A 4KGVB 1K73U 3P8HA 1GBQA 1QVFA 5FU6B 3FEOA 2FZGB 5I22A 1IGQA 4MZPA 2DF6A 2QXFA 2HQEA 4HXJA 3S3OA 1IHWA 2VASA 1UFFA 5GANh 1TS9A 3L2WA 2EFIA 4ZGEB 3QZ9B 3PNWC 5GAN6 3TCJA 1OZ2A 3JCMb 1U1SA 3L2RA 2EQUA 2P0QA 4M7DE 4N0AC 5GAOp 2EVRA 3HKSA 5CVIA 4JJNK 1ZA1B 4M75E 4M7AC 1QWFA 4M77E 1UGVA 3MP6A 1M5Q1 3M58A 3N5BB 2Y90A 1YJWQ 4EMGA 2O9VA 1RAAB 4BE1A 3PVQA 2QDYB 4C0DB 4IIOA 1EIFA 1I8FA 3ULRB 4B9XA 1M2VA 2RHIA 4DEXA 4JZ3A 1NZ9A 4LDXA 3HP9A 2SEMA 2L89A 2CGHA 3OS5A 1BB9A 5I2MA 1I1JA 4AMCA 2OX7A 2DJQA 1LPLA 4LDVA 4F16A 4IUQA 2R57A 1IREB 3RDVA 2A0FB 2JZ2A 4YTLA 3BFMA 1D09B 3VKIA 1GBRA 1T3LA 1X2QA 3QDFA 3QJ6A 1UGQB 1NBEB 3CCUT 1TG0A 2QGGA 4M7DB 1Y71A 1HD3A 2JMAA 3A1PA 3VJPA 4M75B 1YI2A 4M77B 5FROA 2PVDB 1NG2A 2X4JA 4C92A 2NWMA 3ZFJA 3CXCA 1RACB 1QWEA 1VQPA 3E9FA 4XTZA 5HK0A 1VQNA 1PSEA 2J6OA 2EW3A 6AT1B 5L23A 1QVGS 4M7AE 2MOXA 3A8LB 1N5ZA 1WJSA 1MV0B 3OW2P 1S72Q 5IAYA 3R6NA 1BIAA 3CCMQ 1ZBXA 2B86A 2XI9A 2NUTB 2XMFA 1OULA 1M8VA 4HCZA 1N9SA 1PCXA 4KRTA 1TUGB 3QXEB 1KQSA 2HMAA 2DYIA 5GANf 2RHZA 2WSCE 4OVAA 3EG2A 2COZA 1KC8R 2C0OA 1Y7XA 3C0CA 1WPYA 1HSQA 3JRZA 1M30A 2FZKB 2DNUA 4GLMA 1VQLQ 2FRYA 5I11A 5D6WA 1K9MR 3M4YA 5KYWA 2EYXA 1HJDA 3G1JA 2DL8A 2K7AA 3REAB 2YRVA 4ZNXA 2XK0A 4A54A 1H3HA 1VQOA 4EMKA 3ER0A 4HT9A 1K8AR 2AZVA 5GAOl 4OB1B 2JS2A 1X69A 4FM4B 2RHXA 1OOTA 8AT1B 1MGQA 2E5QA 5KYYB 4KT0E 3EG1A 2B8AA 4LDWA 3HHTB 2YRCA 4LNPA 4E7KA 2MMPA 4HA8A 2DXBA 2RK1A 4A4GA 1BI1A 3BE3A 4E7SA 1QVPA 3PTAA 4AG1C 4J9FA 4LD6A 2ZPFB 5IXBA 4BY6B 1KQ1A 1M2OA 1VQMA 5IT9E 5LJ3g 2F69A 2HSEB 3META 3U23A 2F1LA 4C8QC 1QCOA 2DKGA 3M56A 4J7IA 2ZAEA 3I5SA 1AZGB 1SEMA 4M4ZA 2PTKA 2DLPA 3UDCA 1QVFS 1MMGA 3G6EA 1X6OA 3GIBA 2RM4A 4FIBA 2GF7A 1W6XA 1G3WA 4D8DA 3HSBA 4FYVB 1ZQ1A 2QAZA 3JB9D 1QMCA 2LT1A 3CCLQ 3REBB 4BI8B 1BI0A 2K57A 3RUXA 1D3BA 3MP8A 4JDSA 2GBQA 2IVWA 2FZCB 4BI3A 2EYZA 1FYNA 1S72T 3RMQA 2JJ9A 3CCMT 1WXUA 4LE9A 2G6FX 2BZXA 2KSSA 4R0KA 2DZCA 2XHCA 2I2LA 3GOXA 2QQ9A 2G3RA 1YWPA 4E7HA 2MI6A 4FL6A 4E7LA 5KYUA 2D1XA 3TSWA 2ATCB 2FO0A 4IUVA 2COWA 1WHGA 5GJVB 4C8QE 4XTUA 1VQLT 3TEEA 1KC8U 4PJOC 2ZZDA 1B34B 1BKBA 4ME7A 2EIFA 5D6XA 1IXDA 2M16A 3CC4Q 2JTMA 1LVKA 2E4HA 2LQ8A 2KRNA 1M27C 2EYWA 2RHYA 3BW1A 4M78A 5LJ3h 4FT4A 4II1A 3QWYA 2YXYA 2V1RA 4QVDA 2O2OA 5LL6S 2DTIA 4M77D 3MHXA 2DK3A 2V8IA 4C5EA 5GAOn 3VYHB 1OX8A 3CBPA 5A2QE 3M57A 4F04B 1K8AU 2QTXA 1OEBA 3SFMA 2EQMA 1NPRA 2ROTA 1JBMA 2BE7D 4PJOF 2RQUA 3M0PA 4FYWB 2RQRA 2OTJA 1NM7A 1TTHB 1HK9A 3H8ZA 3QBYA 4QW2A 3VS5A 4RTYA 3CC2Q 1VQ6T 3OYHA 1DJ7B 1Y0MA 4Y92A 1ZA2B 2PQWA 1QVGP 2ZPGB 1WHHA 3SB2A 4QVZA 4P5NA 4FCYA 4TVRA 2XICA 1Q81C 2KRSA 3CBMA 1KQSS 4M7DG 2KK4A 4RUGA 4RMOA 2LDMA 5IHNA 3X28B 5GAN7 4M75G 4M77G 2E65A 3M0QA 2QQSA 4FW1A 4PJOE 5GANj 2RD1A 3OYEA 5J26A 1GFCA 4N4IA 3CPWA 3OY9A 2M51A 2AK5A 4AT1B 4RTUA 2P0PA 5GMKh 3EGXA 2CT4A 3OS0A 3PIOA 4M7AD 8ATCB 1YBYA 1OPLA 1QP3A 2H8HA 2BZYA 2DVEA 2QQBA 1KQ2A 3TREA 2CP0A 3O8VA 1WI7A 2W0ZA 1BK2A 2M0OA 3RKYA 2KT1A 2JN0A 2FHDA 3CC7T 1SRMA 2EPDA 3A8OB 3FIFA 3TQ7P 1D1AA 1Q82C 3MPUB 4KH0B 1YN8A 2QQRA 2JUFA 4HVVA 4UC4A 1IB8A 1KK7A 3G4SA 5GAOq 4J5YA 1M1FA 3MCAB 4PJOB 5LJ3f 3GBQA 4N4GA 1K73R 2VGNA 3OS2A 4KGZB 4C92C 2NUPA 4FYYB 4HVUA 1M9SA 3CC4T 1I07A 3LWHA 3CCSQ 1RI9A 3KFVA 5KYXA 3VS6A 2E1HA 1TH7A 1H641 2EBPA 3G7ZA 2HD0A 1YHQA 4PJLA 1SKUB 3H41A 4AFZC 2DILA 1TOVA 1QVFP 4JLGA 4IURA 3GNGA 4JRIA 4OGCA 2EGAA 2F2XA 5D7UA 3FB9A 2YDLA 2IG0A 3QHSA 1M8MA 1YJNA 3M0RA 1M1KU 1SF9A 3UPUA 3JAME 1T0JA 3CC2T 2DERA 2DL5A 1WYXA 2CKKA 4F14A 4BUGA 2P4RA 4OMQA 1OQKA 3C12A 2DBMA 1UE9A 2RI3A 1KHIA 1Q95G 2EGCA 2OAWA 5LJ5d 5L8RE 3JB9F 1ABQA 4EMKC 1VYVA 3TSZA 1NE8A 2LX7A 3UT1A 3ZL7C 4D6WA 1NEBA 1YJ9Q 4C0ZA 3E19A 1RABB 2D8JA 4C92E 1HXDA 4R56A 3P8DA 4FT2A 4LDUA 1PSFA 1UTIA 1FWZA 1VQ4A 2PUOB 3O5ZA 4J9BA 1VQPQ 1GFDA 4MMKA 2AKLA 2CYZB 2OAUA 2KDSA 1XNIA 4XTVA 4A53A 2FB7A 2Y4YA 1U1TA 1M90U 1VQKA 2K3BA 3CCVA 3JB9J 1QP2A 2RNAA 2K5FA 1U8RA 3UWNA 1KJWA 4WTOB 2LCLA 2HEQA 3I56A 3CXCP 4ZGJB 3OYJA 3CEYA 3VUZA 1AZEA 4C8QD 3CCQA 3CPFA 3QJYA 3CMAA 2JS0A 3A98A 2QI2A 3LWIA 4IUTA 3MO8A 1U5SA 4A63B 4JRPA 2RA2A 4NL3A 4X9DA 3CCST 1WX6A 3WVEB 2KMTA 3GF5A 1KQSP 2JXBA 1VQOQ 3CPWS 2EAYA 2P4TA 1YITA 2QEXA 2MIOA 2DBKA 4BDZA 4AFUC 2VV5A 3RERA 2DIGA 2FPEA 1RAHB 2ZPIB 1AEYA 2ZCFB 2OI3A 1WZOA 5CIUA 1LNXA 1C0MA 1Y96A 4DEYA 2CUBA 3C94A 1BCMA 3ME9A 3EFOB 1PKSA 2EYQA 4E7IA 2HAXA 1UHFA 2CZ6B 1A0NB 5DLQE 1D1CA 4AFQC 2KY9A 2FVUA 1YNZA 4E7JA 1ZSZB 4A4KA 4OMMA 2RO0A 2QA4A 4J83A 3L42A 3EG9B 2ESWA 2K6DA 2QTVA 1F1BB 1Q7YU 4M78C 3RIRA 3UF4A 3G6EQ 4PJOD 5CKHA 1KFZA 4KH1B 2YWWA 1YJ9T 2DO3A 4Z89A 1YFNA 2CH4A 3TU4K 3MEAA 5KE3A 2LX9A 4M7AF 2FRWA 3OYGA 2AHJB 3FLGA 3NGPA 1TWBA 1U06A 2PVGB 2RQVA 3PE0A 1OU9A 2HKNA 2LRQA 3HRSA 5LJ3j 3GP8A 1RAIB 2E3IA 3S3MA 4V2SA 2K3YA 1IZ6A 2RI5A 1VQPT 2V1QA 2DXCA 1AOJA 2ECZA 5GMKi 4OMOA 4RG2A 1PD1A 3OB9A 1PWTA 4ZN1A 4M78F 2YUNA 2ED0A 1PRMC 1NYGA 1G8XA 2YUPA 4ZTFA 2KI7A 3CBOA 3RBBB 5CKDA 2CT3A 1WGSA 1FX7A 2E5KA 2HNIA 2PUKB 2JVVA 4AFSC 4PJOG 2CDTA 2KXCA 3QYGB 2VVKA 3CCUA 3RMSA 2BZ8A 4O5VA 4WCIA 2SRCA 4C0GA 1VOMA 4M78E 1D3BB 1T0HA 2DEQA 2JM9A 3EGUA 3CMEA 3OYKA 2XU8A 2DRMA 1UECA 3OYDA 2OTLA 4E2FB 3NTKA 5GMKj 2ZPEB 3EHQA 2DVJA 2COYA 4O6JA 2MYSA 3JB9I 2PVOB 1RADB 4PL6A 3JCMW 1WQWA 3JCMX 1NJIU 4M7AB 5KYUB 2DTHA 1NPPA 1B3QA 2OTJQ 1YJWT 4KUIA 3JSCA 5LJ5e 4ZGDB 2M0YA 3EFRA 2EKOA 1AHJB 5A0GA 2RJCA 4Z02A 2XKOC 1ZUYA 1OI1A 1KC8C 1VQ5A 2KGTA 1R8OB 1MNEA 1HYOA 2V26A 3V8KA 5CR2A 3RR6A 1UEBA 1C6VX 1KG1A 1Z9QA 2RB6A 4M78B 1K9MC 3G6ET 1BBZA 4PJJA 1WNLA 2O4XA 1QQJA 2PNIA 4E6RA 5IH2A 2VKNA 4RG8A 4C92D 3OYIA 5KCOA 1D0YA 2F2WA 1VQ7Q 1BI3A 2P84A 1VQ8Q 4M7DA 2LQWA 1K8AC 4PJMA 3JCMd 4RKUE 2J05A 2M02A 2GFUA 3OSSC 4J9HA 2O88A 3OYYA 3M59A 5M9OA 4CRIA 5DY9A 2JM8A 2XDBA 3QG1A 2LCCA 4FSSA 2EQKA 2DFUA 4DBRA 2CS7A 1X2KA 1VQ9Q 4ORZA 4C8QF 3CPWP 1WJRA 1PNJA 2GGRA 2GFAA 2L3RA 4ATOA 2V8JA 1EFNA 2XDPA 1ZLMA 1Y57A 5KCHA 4C5GA 4BI4A 2VXFA 3I35A 2KT8A 4Y91A 1ABOA 4CC2A 3G4SQ 4X9CA 3L2QA 4Z8AA 3EH2A 2ED1A 2K79A 3MEUA 2YRDA 3JCMJ 3T9NA 2C0TA 3BDUA 2C06A 1BYMA 1WJQA 3JCMQ 2LNVA 4B6MA 4EIKA 1YHQQ 2OJ2A 3JB9G 4GBQA 2L8DA 1P92A 4C5HA 1ZUUA 4JJDA 1TXQA 1S72A 4A4HA 1UB4A 4EDUA 1YCSB 3AHUA 1K1ZA 2D8HA 1PRLC 2KQWA 2LZ6B 1YJNQ
chains in the Genus database with same CATH topology
1YFNA 1OU8A 1OU9A 1OULA 1ZSZC 2NYSA 2QAZA 1ZSZA 1OX8A 1ZSZB 1TWBA 2QASA 1OX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFN A;  1OU8 A;  1OU9 A;  1OUL A;  1ZSZ C;  2NYS A;  2QAZ A;  1ZSZ A;  1OX8 A;  1ZSZ B;  1TWB A;  2QAS A;  1OX9 A; 
#chains in the Genus database with same CATH topology
 1UUE A;  1CSK A;  4PKC C;  1OYX A;  2YUO A;  2EQJ A;  1KIK A;  3JCM P;  2DXU A;  2MAM A;  3LGF A;  1SHF A;  4PJN A;  4OMF B;  2JT4 A;  1M1K R;  2KVQ G;  1GRI A;  1VIE A;  2HKQ B;  3LH5 A;  1J3T A;  4AG2 C;  1SG5 A;  1VQL A;  2W10 A;  3J80 E;  4LXC A;  3OS1 A;  2VUB A;  2HCK A;  2DMO A;  3PT9 A;  2RI2 A;  4JJB A;  3L2Z A;  1D0Z A;  2F5K A;  2HQX A;  4C8Q B;  1H92 A;  1O9S A;  2E6Z A;  5GMK m;  3NTH A;  1M4Z A;  1QW1 A;  1VQ7 T;  2DPP B;  3CD6 Q;  1VQ8 T;  2J6F A;  3HPW A;  1S1N A;  2XD0 A;  4XTY A;  5EG2 A;  2FL7 A;  1I5L A;  3M0S A;  2D9T A;  1ZUK A;  1UGP B;  1M1K C;  3NTI A;  1M1G A;  3OQ5 A;  3QO3 A;  4IIM A;  1ZSG A;  3CCJ A;  1IRX A;  4NL2 A;  5GAM d;  3CCL T;  1MV3 A;  1H3Z A;  1RAG B;  1VQK Q;  1VQ6 A;  2WAC A;  3C4S A;  4HCC A;  1VQ9 T;  4C5I A;  3CCV Q;  2DIQ A;  1C1A A;  1KD1 U;  4CC3 A;  4F7U A;  1OZ3 A;  1M90 R;  1PHT A;  4ANJ A;  2X9H A;  3PVL A;  3J81 E;  3NPF A;  4J9D A;  2RPN A;  3I56 Q;  1JO8 A;  1JJ2 S;  1I4K 1;  2RH2 A;  4XU1 A;  2LNH B;  3EGD A;  4KUL A;  2H3E B;  4X34 A;  2ENM A;  3I5R A;  3CCQ Q;  2DXT A;  2RF0 A;  2VB6 A;  3CMA Q;  4OB0 B;  3G4S T;  2XDD A;  1PKT A;  2GTO A;  1T3S A;  4PFZ A;  4M78 D;  2ZPH B;  3VUB A;  3L2V A;  5I21 A;  1B34 A;  5GAM g;  1M3B A;  4JUV A;  2K5I A;  3X24 B;  4C0F A;  1YHQ T;  1BIB A;  2O31 A;  3OYN A;  4DQ2 A;  2CP2 A;  3AT1 B;  2KR3 A;  1YIT Q;  2HZY A;  2ROL A;  1M90 C;  2LT4 A;  3HTR A;  2QEX Q;  4M7A G;  3DLL A;  1ARK A;  1OV3 A;  4JZ4 A;  1W1F A;  1WFW A;  9ATC B;  2QQA A;  3CC7 A;  4FSX A;  3FC3 A;  1B7T A;  3E2U A;  1UJY A;  2CP5 A;  3HRT A;  2DM1 A;  1K9A A;  2EYY A;  3A8M B;  3SWN A;  1SSH A;  4KBM B;  2E41 A;  3H6Z A;  2FG0 A;  3JV3 A;  3LH0 A;  2YLB A;  1IHV A;  5A0D A;  1G2B A;  4BE0 A;  2J6K A;  4M78 G;  3PFS A;  5AYF A;  1TUC A;  5GAN d;  3GLX A;  2KEA A;  4C92 F;  2L2P A;  2QA4 Q;  3CC4 A;  1K73 C;  5D6Y A;  3JCM e;  1SSF A;  3LGL A;  4R55 A;  1I0C A;  3URG A;  4BAC A;  3OYA A;  1X43 A;  5FRN A;  1Q7Y R;  2K2V A;  5HKC A;  1ACM B;  3CD6 T;  2JTE A;  3PGG A;  1AT1 B;  1YIJ A;  2KXD A;  1O75 A;  2CZ1 B;  3QUI A;  5CCA A;  2GQI A;  2VWF A;  3QZ5 B;  1Y96 B;  2FEI A;  2A7Y A;  2VYT A;  3VS4 A;  1N8R R;  4C0D C;  1X6G A;  4J6Y A;  2CP6 A;  2F5T X;  2HL3 A;  3VRZ A;  1YI2 Q;  2K2M A;  5C0M A;  1CKB A;  3CC2 A;  2GNC A;  3CQT A;  1VQK T;  1TUD A;  1Q86 R;  2A08 A;  2K3X A;  4VUB A;  3CCR A;  4PK4 A;  2RMO A;  1MHN A;  3CCV T;  4OP0 A;  3I55 A;  1M2V B;  2VGM A;  4RTX A;  1AWW A;  1VQN Q;  4JS4 A;  1AD5 A;  4HVW A;  3I56 T;  2LQN A;  2LCS A;  1Q7Y C;  2A37 A;  5LJ5 g;  2DE0 X;  4QT7 A;  1MMA A;  2K4Y A;  3MJX A;  5IHI A;  2KBT A;  5CKE A;  3X26 B;  4QVC A;  2BUD A;  3CCE A;  4L6V 5;  3OA6 A;  4M7D C;  3UA7 A;  3S3N A;  2L5Q A;  1QCF A;  3D7S B;  4J6W A;  4BD3 A;  4EPC A;  4XTX A;  1LJO A;  3JCM V;  2EQI A;  5FLX E;  1WHL A;  3WVD B;  2JNG A;  3CME Q;  1GCQ A;  4C92 B;  5CQX A;  1YIT T;  2OTL Q;  2QEX T;  3V7R A;  4ZN3 A;  3UA6 A;  1PG5 B;  1CKA A;  1PM3 A;  1MMD A;  2CUD A;  4WF2 A;  4JRQ A;  4XQ3 A;  2V8K A;  1VYT A;  1R0B G;  3P8B B;  3ZBD A;  1V29 B;  1G3S A;  3MP1 A;  5IHK A;  3S6W A;  4XU3 A;  3G71 A;  3OSV A;  1XOV A;  4PFO A;  2KRO A;  1RLP C;  5FU7 C;  1NJI R;  4OMP A;  3X25 B;  1W2B A;  5CAI A;  1SRL A;  4RTW A;  2BE9 B;  2DD4 A;  1VQ5 Q;  4C8Q G;  1RUW A;  1K76 A;  2J06 A;  2QA4 T;  4OMN A;  3H0H A;  4DOW A;  3CCS A;  1VQM Q;  4CC7 A;  3VS1 A;  3NFC A;  1NLO C;  4ELZ C;  5GAN 4;  4OB3 B;  3OBW A;  1E6G A;  5KYW B;  2CSI A;  2JOY A;  1JJ2 P;  1PC0 A;  4RCC A;  5I2S A;  3EG3 A;  2I0N A;  5GAM e;  4EMK B;  4IUU A;  1VIF A;  5LJ5 h;  5GAM f;  4ELY C;  2KYB A;  2IIM A;  1NJI C;  2HBP A;  1AWJ A;  2HQH A;  1N8R U;  2RN8 A;  4L59 A;  1YI2 T;  4BY6 C;  2AIR B;  1Z9Z A;  5GAO m;  2H3J A;  1R77 A;  2AKK A;  3ZEH A;  5CK9 A;  1Q86 U;  1I5O B;  1VQN T;  3HFN A;  2MWO A;  4OML A;  2AT1 B;  4HCK A;  3OMG A;  4BDY A;  3GNF B;  2DAQ A;  2O4X B;  4IUP A;  2CSQ A;  2RK2 A;  3QSU A;  1G5V A;  1JXM A;  3EG0 A;  2CP3 A;  3L2U A;  5IN1 A;  5CKB A;  3EAE A;  2M1H A;  3M5A A;  1UHC A;  1YJ9 A;  1D0X A;  5HCK A;  2DEU A;  3X20 B;  1RLQ C;  1U3O A;  1M3C A;  4MML A;  4E47 A;  4J9I A;  3Q1J A;  2JTF A;  2KYM A;  1OU8 A;  5HK3 A;  3H0I A;  3CME T;  3J7A F;  1R0C B;  1E7O A;  2QYZ A;  2QK0 A;  4QQ6 A;  2GTJ A;  2K9G A;  2YHT A;  2LTO A;  3M55 A;  2OTL T;  1I81 A;  3HRU A;  5KE2 A;  4HT8 A;  1N27 A;  1X01 A;  3V7S A;  3QDR B;  4J6X A;  1UG1 A;  4CI0 C;  2X4W A;  3OYL A;  4FW2 A;  1VQO T;  5FWB A;  5GAN e;  1UDL A;  1V76 A;  4FU6 A;  1LOJ A;  2NUZ A;  3FRN A;  1NYF A;  2QGF B;  1UJ0 A;  4K11 A;  5FU7 B;  2EJF A;  4RTT A;  3EFO A;  3LW5 E;  3EFS A;  2NYS A;  1SHG A;  2Z0W A;  1WHK A;  1VQ5 T;  1RAF B;  3PIP A;  3SEM A;  1X6B A;  4QQD A;  4HKE A;  2DL4 A;  4RCB A;  1JJ2 A;  1ZSZ A;  5LJ3 d;  1VQM T;  4F7U F;  3EG9 A;  2QG9 B;  4OB2 B;  5DM7 R;  3FDR A;  1FMK A;  4XTW A;  5LJ5 f;  4D8K A;  1UGR B;  3NMZ C;  3KXT A;  1JU5 C;  2MPX C;  2WSF E;  5EC7 A;  4XU0 A;  7AT1 B;  1YWO A;  3C95 A;  3SWN C;  2LJ3 A;  1WXB A;  3IQL A;  2Y4X A;  4KUD K;  1YJW A;  4XAX B;  3CCJ Q;  2HBW A;  1WLP B;  3ASK A;  1VUB A;  4F7U E;  2HDA A;  4M75 A;  1VQ6 Q;  2D6F A;  4M77 A;  4F17 A;  4L5G A;  2RJD A;  1WXT A;  1JEG A;  4XU2 A;  4QQG A;  2P0K A;  2RJE A;  2CP7 A;  3V8L A;  3JB9 H;  3DLM A;  1KD1 R;  1PD0 A;  1WHJ A;  3HFO A;  1W2B S;  2O01 E;  3MEW A;  1WHM A;  1VA7 A;  1WDX A;  3EHR A;  3SHW A;  3M4G A;  2E10 A;  1G3T A;  2NUT A;  5AT1 B;  3M0T A;  1IGU A;  4C92 G;  3JCM g;  4A4E A;  3OW2 A;  1ZHI A;  4QKU A;  2QDL A;  2DTO A;  2KNB B;  2DA9 A;  1OPK A;  3EGX B;  4PNO A;  3RNJ A;  3VU3 C;  3OYB A;  3MKD A;  2IPO B;  3H0F A;  4F7U B;  1QLY A;  1W70 A;  3INZ A;  4ESR A;  1KD1 C;  2L0A A;  3OBY A;  2LJ1 A;  2LVM A;  1V1C A;  3CC7 Q;  4MDW A;  4MZM A;  4KGX B;  1IO6 A;  5J3B A;  1FMW A;  3EGD B;  4N0A A;  2KAF A;  2R5M A;  1MUZ A;  2NLU A;  1JB0 E;  3CCM A;  4M7A A;  2C0I A;  3M54 A;  5GAM j;  5FWC A;  4J8O A;  1WQ7 A;  1KHC A;  5KYY A;  4J9C A;  1EX4 A;  4JPB W;  3V8J A;  2LMJ A;  2YT6 A;  4CC4 B;  2A36 A;  4RTV A;  1JRI A;  2OTJ T;  1RAE B;  2VC8 A;  3R6O A;  2DL3 A;  2MCN A;  4M7D D;  1H8K A;  1K9M U;  2DJZ A;  2L3S A;  2KRM A;  1GCQ C;  2NUP B;  1RL2 A;  1Q81 R;  1LCK A;  4M75 D;  2E3H A;  2MK5 A;  4IKF A;  5KYX B;  3E9G A;  4Y28 E;  3CXC S;  2FYK A;  5GAN 8;  1YIJ Q;  1TSF A;  3M0U A;  3VS7 A;  2E64 A;  2L3P A;  1AWX A;  3OYM A;  4B9W A;  3SWN B;  1OX9 A;  2LJ0 A;  3RKW A;  1WA7 A;  5GAN 5;  1G3Y A;  2X4Y A;  4LUE A;  3HL8 A;  4FYX B;  2HSP A;  3CCJ T;  1EZZ B;  3QPH A;  4JRK A;  5ECA A;  3EH1 A;  2FPD A;  2J7I A;  3JCM h;  1VQ4 Q;  2X4X A;  2FPF A;  1BU1 A;  1D1B A;  4DOV A;  1VYU A;  3CCR Q;  3I55 Q;  2BIV A;  4GY5 A;  4DA4 A;  3VS3 A;  1FMV A;  3M53 A;  4HCB A;  2CH4 W;  4E7Z A;  2X3X D;  1K4U S;  4NOY A;  2DYB A;  1WIE A;  1M3A A;  1RI0 A;  2PZ1 A;  4OF1 A;  4PLI A;  1TU0 B;  2CZ0 B;  5FW9 A;  3TVT A;  3CCE Q;  3UAT A;  1VQ7 A;  4A4F A;  3MEV A;  1VQ8 A;  1Q82 R;  3VV0 A;  1QKX A;  3NHN A;  5GJW B;  3L1A A;  4MZT A;  5KYN A;  1ZBJ A;  3RKX A;  2E12 A;  2X3W D;  3VS2 A;  2EJ9 A;  1K0X A;  1E6H A;  4ZTJ A;  1QCN A;  4MDX A;  2BTT A;  4GLK A;  1QKW A;  2AZS A;  5CQY A;  2X35 A;  3CCL A;  5HY6 A;  3QII A;  1VQ9 A;  2BKD N;  2A28 A;  5LJ5 j;  2ABL A;  2A3L A;  2XG8 D;  2LP5 A;  5CO7 A;  2EGE A;  1MMN A;  1NEG A;  2MWP A;  2JMC A;  4RTZ A;  3A5Z B;  5IXF A;  1N6A A;  3V7C A;  3PMT A;  3G71 Q;  3BDL A;  2DRK A;  3QWX X;  4BE2 A;  5LJ3 e;  1NLP C;  4JJC A;  2VXE A;  1YJN T;  3QYH B;  4OGE A;  4PFP A;  1K0S A;  1BI2 A;  2RJF A;  5FRM A;  3DB4 A;  4DBF A;  2M9U A;  3VS0 A;  3SD4 A;  3I9Q A;  5GMK l;  1JXO A;  5FU6 C;  4LD9 K;  5GAN 3;  4DBH A;  4JS5 A;  2XID A;  2L3Q A;  3DKM A;  4X1V A;  4J9G A;  2KE9 A;  1G83 A;  1B07 A;  4C8Q A;  1Q81 U;  2DL7 A;  1X27 A;  3OYC A;  2O9S A;  2LQK A;  1KSW A;  1YIJ T;  1W2B P;  3OW2 S;  2QAS A;  5C6S A;  3JCM f;  3VYG A;  1JQQ A;  1AWO A;  3H9N A;  2GQV A;  4BB7 A;  4PLL A;  3THK A;  3SDZ A;  4J7F A;  1QVG A;  1MND A;  1Y07 A;  2WSE E;  2DZ9 A;  4NS5 A;  1XJW B;  3A8G B;  3JCM c;  1VQ4 T;  2EKH A;  3CCR T;  5DLO A;  4DBQ A;  2RQW A;  5GAN g;  3I55 T;  3FJ5 A;  2ZGW A;  1BCO A;  1ZSZ C;  2HL5 C;  2ZPB B;  3KUF A;  5GMK e;  2DET A;  1SPK A;  2CRE A;  1XTD A;  3KBG A;  2F2V A;  3F70 A;  3WXM B;  4Q5W A;  3GPL A;  2EJG A;  5GAM h;  5GAN 2;  3CCE T;  3QKJ A;  4EMH A;  5J39 A;  4Z88 A;  3FJP A;  3LLR A;  4JLI A;  2DD5 A;  4XK8 E;  3CD6 A;  2YUQ A;  2LC4 A;  1UGS B;  1GL5 A;  1GXI E;  3DB3 A;  3LX7 A;  1Q82 U;  1XQH A;  3VRY A;  3CCQ T;  4LN2 A;  3OYF A;  5KH6 A;  1FXX A;  3CCU Q;  3CMA T;  4F7U G;  2R58 A;  2RQT A;  3LYI A;  2R5A A;  4LDY A;  2EWN A;  2CZ7 B;  2DX1 A;  1GCP A;  1N8R C;  4PJO A;  2X51 A;  2YLC A;  4M75 C;  4M77 C;  1W4S A;  1X75 C;  5GAO r;  1N9R A;  2JW4 A;  2PU9 B;  1Q86 C;  2K5L A;  4J9E A;  3BY7 A;  3E1S A;  1YP5 A;  1ZX6 A;  1YCY A;  2D0Q B;  5A0L A;  3G71 T;  2E70 A;  2RHU A;  2YSQ A;  2GCX A;  4LUD A;  3OMC A;  5CKF A;  4N4H A;  4M7D F;  1AVZ C;  2E6N A;  3M9Q A;  3A8H B;  4M75 F;  2D0N A;  4M77 F;  3PMI A;  3RES A;  2MF2 A;  4KGV B;  1K73 U;  3P8H A;  1GBQ A;  1QVF A;  5FU6 B;  3FEO A;  2FZG B;  5I22 A;  1IGQ A;  4MZP A;  2DF6 A;  2QXF A;  2HQE A;  4HXJ A;  3S3O A;  1IHW A;  2VAS A;  1UFF A;  5GAN h;  1TS9 A;  3L2W A;  2EFI A;  4ZGE B;  3QZ9 B;  3PNW C;  5GAN 6;  3TCJ A;  1OZ2 A;  3JCM b;  1U1S A;  3L2R A;  2EQU A;  2P0Q A;  4M7D E;  4N0A C;  5GAO p;  2EVR A;  3HKS A;  5CVI A;  4JJN K;  1ZA1 B;  4M75 E;  4M7A C;  1QWF A;  4M77 E;  1UGV A;  3MP6 A;  1M5Q 1;  3M58 A;  3N5B B;  2Y90 A;  1YJW Q;  4EMG A;  2O9V A;  1RAA B;  4BE1 A;  3PVQ A;  2QDY B;  4C0D B;  4IIO A;  1EIF A;  1I8F A;  3ULR B;  4B9X A;  1M2V A;  2RHI A;  4DEX A;  4JZ3 A;  1NZ9 A;  4LDX A;  3HP9 A;  2SEM A;  2L89 A;  2CGH A;  3OS5 A;  1BB9 A;  5I2M A;  1I1J A;  4AMC A;  2OX7 A;  2DJQ A;  1LPL A;  4LDV A;  4F16 A;  4IUQ A;  2R57 A;  1IRE B;  3RDV A;  2A0F B;  2JZ2 A;  4YTL A;  3BFM A;  1D09 B;  3VKI A;  1GBR A;  1T3L A;  1X2Q A;  3QDF A;  3QJ6 A;  1UGQ B;  1NBE B;  3CCU T;  1TG0 A;  2QGG A;  4M7D B;  1Y71 A;  1HD3 A;  2JMA A;  3A1P A;  3VJP A;  4M75 B;  1YI2 A;  4M77 B;  5FRO A;  2PVD B;  1NG2 A;  2X4J A;  4C92 A;  2NWM A;  3ZFJ A;  3CXC A;  1RAC B;  1QWE A;  1VQP A;  3E9F A;  4XTZ A;  5HK0 A;  1VQN A;  1PSE A;  2J6O A;  2EW3 A;  6AT1 B;  5L23 A;  1QVG S;  4M7A E;  2MOX A;  3A8L B;  1N5Z A;  1WJS A;  1MV0 B;  3OW2 P;  1S72 Q;  5IAY A;  3R6N A;  1BIA A;  3CCM Q;  1ZBX A;  2B86 A;  2XI9 A;  2NUT B;  2XMF A;  1OUL A;  1M8V A;  4HCZ A;  1N9S A;  1PCX A;  4KRT A;  1TUG B;  3QXE B;  1KQS A;  2HMA A;  2DYI A;  5GAN f;  2RHZ A;  2WSC E;  4OVA A;  3EG2 A;  2COZ A;  1KC8 R;  2C0O A;  1Y7X A;  3C0C A;  1WPY A;  1HSQ A;  3JRZ A;  1M30 A;  2FZK B;  2DNU A;  4GLM A;  1VQL Q;  2FRY A;  5I11 A;  5D6W A;  1K9M R;  3M4Y A;  5KYW A;  2EYX A;  1HJD A;  3G1J A;  2DL8 A;  2K7A A;  3REA B;  2YRV A;  4ZNX A;  2XK0 A;  4A54 A;  1H3H A;  1VQO A;  4EMK A;  3ER0 A;  4HT9 A;  1K8A R;  2AZV A;  5GAO l;  4OB1 B;  2JS2 A;  1X69 A;  4FM4 B;  2RHX A;  1OOT A;  8AT1 B;  1MGQ A;  2E5Q A;  5KYY B;  4KT0 E;  3EG1 A;  2B8A A;  4LDW A;  3HHT B;  2YRC A;  4LNP A;  4E7K A;  2MMP A;  4HA8 A;  2DXB A;  2RK1 A;  4A4G A;  1BI1 A;  3BE3 A;  4E7S A;  1QVP A;  3PTA A;  4AG1 C;  4J9F A;  4LD6 A;  2ZPF B;  5IXB A;  4BY6 B;  1KQ1 A;  1M2O A;  1VQM A;  5IT9 E;  5LJ3 g;  2F69 A;  2HSE B;  3MET A;  3U23 A;  2F1L A;  4C8Q C;  1QCO A;  2DKG A;  3M56 A;  4J7I A;  2ZAE A;  3I5S A;  1AZG B;  1SEM A;  4M4Z A;  2PTK A;  2DLP A;  3UDC A;  1QVF S;  1MMG A;  3G6E A;  1X6O A;  3GIB A;  2RM4 A;  4FIB A;  2GF7 A;  1W6X A;  1G3W A;  4D8D A;  3HSB A;  4FYV B;  1ZQ1 A;  2QAZ A;  3JB9 D;  1QMC A;  2LT1 A;  3CCL Q;  3REB B;  4BI8 B;  1BI0 A;  2K57 A;  3RUX A;  1D3B A;  3MP8 A;  4JDS A;  2GBQ A;  2IVW A;  2FZC B;  4BI3 A;  2EYZ A;  1FYN A;  1S72 T;  3RMQ A;  2JJ9 A;  3CCM T;  1WXU A;  4LE9 A;  2G6F X;  2BZX A;  2KSS A;  4R0K A;  2DZC A;  2XHC A;  2I2L A;  3GOX A;  2QQ9 A;  2G3R A;  1YWP A;  4E7H A;  2MI6 A;  4FL6 A;  4E7L A;  5KYU A;  2D1X A;  3TSW A;  2ATC B;  2FO0 A;  4IUV A;  2COW A;  1WHG A;  5GJV B;  4C8Q E;  4XTU A;  1VQL T;  3TEE A;  1KC8 U;  4PJO C;  2ZZD A;  1B34 B;  1BKB A;  4ME7 A;  2EIF A;  5D6X A;  1IXD A;  2M16 A;  3CC4 Q;  2JTM A;  1LVK A;  2E4H A;  2LQ8 A;  2KRN A;  1M27 C;  2EYW A;  2RHY A;  3BW1 A;  4M78 A;  5LJ3 h;  4FT4 A;  4II1 A;  3QWY A;  2YXY A;  2V1R A;  4QVD A;  2O2O A;  5LL6 S;  2DTI A;  4M77 D;  3MHX A;  2DK3 A;  2V8I A;  4C5E A;  5GAO n;  3VYH B;  1OX8 A;  3CBP A;  5A2Q E;  3M57 A;  4F04 B;  1K8A U;  2QTX A;  1OEB A;  3SFM A;  2EQM A;  1NPR A;  2ROT A;  1JBM A;  2BE7 D;  4PJO F;  2RQU A;  3M0P A;  4FYW B;  2RQR A;  2OTJ A;  1NM7 A;  1TTH B;  1HK9 A;  3H8Z A;  3QBY A;  4QW2 A;  3VS5 A;  4RTY A;  3CC2 Q;  1VQ6 T;  3OYH A;  1DJ7 B;  1Y0M A;  4Y92 A;  1ZA2 B;  2PQW A;  1QVG P;  2ZPG B;  1WHH A;  3SB2 A;  4QVZ A;  4P5N A;  4FCY A;  4TVR A;  2XIC A;  1Q81 C;  2KRS A;  3CBM A;  1KQS S;  4M7D G;  2KK4 A;  4RUG A;  4RMO A;  2LDM A;  5IHN A;  3X28 B;  5GAN 7;  4M75 G;  4M77 G;  2E65 A;  3M0Q A;  2QQS A;  4FW1 A;  4PJO E;  5GAN j;  2RD1 A;  3OYE A;  5J26 A;  1GFC A;  4N4I A;  3CPW A;  3OY9 A;  2M51 A;  2AK5 A;  4AT1 B;  4RTU A;  2P0P A;  5GMK h;  3EGX A;  2CT4 A;  3OS0 A;  3PIO A;  4M7A D;  8ATC B;  1YBY A;  1OPL A;  1QP3 A;  2H8H A;  2BZY A;  2DVE A;  2QQB A;  1KQ2 A;  3TRE A;  2CP0 A;  3O8V A;  1WI7 A;  2W0Z A;  1BK2 A;  2M0O A;  3RKY A;  2KT1 A;  2JN0 A;  2FHD A;  3CC7 T;  1SRM A;  2EPD A;  3A8O B;  3FIF A;  3TQ7 P;  1D1A A;  1Q82 C;  3MPU B;  4KH0 B;  1YN8 A;  2QQR A;  2JUF A;  4HVV A;  4UC4 A;  1IB8 A;  1KK7 A;  3G4S A;  5GAO q;  4J5Y A;  1M1F A;  3MCA B;  4PJO B;  5LJ3 f;  3GBQ A;  4N4G A;  1K73 R;  2VGN A;  3OS2 A;  4KGZ B;  4C92 C;  2NUP A;  4FYY B;  4HVU A;  1M9S A;  3CC4 T;  1I07 A;  3LWH A;  3CCS Q;  1RI9 A;  3KFV A;  5KYX A;  3VS6 A;  2E1H A;  1TH7 A;  1H64 1;  2EBP A;  3G7Z A;  2HD0 A;  1YHQ A;  4PJL A;  1SKU B;  3H41 A;  4AFZ C;  2DIL A;  1TOV A;  1QVF P;  4JLG A;  4IUR A;  3GNG A;  4JRI A;  4OGC A;  2EGA A;  2F2X A;  5D7U A;  3FB9 A;  2YDL A;  2IG0 A;  3QHS A;  1M8M A;  1YJN A;  3M0R A;  1M1K U;  1SF9 A;  3UPU A;  3JAM E;  1T0J A;  3CC2 T;  2DER A;  2DL5 A;  1WYX A;  2CKK A;  4F14 A;  4BUG A;  2P4R A;  4OMQ A;  1OQK A;  3C12 A;  2DBM A;  1UE9 A;  2RI3 A;  1KHI A;  1Q95 G;  2EGC A;  2OAW A;  5LJ5 d;  5L8R E;  3JB9 F;  1ABQ A;  4EMK C;  1VYV A;  3TSZ A;  1NE8 A;  2LX7 A;  3UT1 A;  3ZL7 C;  4D6W A;  1NEB A;  1YJ9 Q;  4C0Z A;  3E19 A;  1RAB B;  2D8J A;  4C92 E;  1HXD A;  4R56 A;  3P8D A;  4FT2 A;  4LDU A;  1PSF A;  1UTI A;  1FWZ A;  1VQ4 A;  2PUO B;  3O5Z A;  4J9B A;  1VQP Q;  1GFD A;  4MMK A;  2AKL A;  2CYZ B;  2OAU A;  2KDS A;  1XNI A;  4XTV A;  4A53 A;  2FB7 A;  2Y4Y A;  1U1T A;  1M90 U;  1VQK A;  2K3B A;  3CCV A;  3JB9 J;  1QP2 A;  2RNA A;  2K5F A;  1U8R A;  3UWN A;  1KJW A;  4WTO B;  2LCL A;  2HEQ A;  3I56 A;  3CXC P;  4ZGJ B;  3OYJ A;  3CEY A;  3VUZ A;  1AZE A;  4C8Q D;  3CCQ A;  3CPF A;  3QJY A;  3CMA A;  2JS0 A;  3A98 A;  2QI2 A;  3LWI A;  4IUT A;  3MO8 A;  1U5S A;  4A63 B;  4JRP A;  2RA2 A;  4NL3 A;  4X9D A;  3CCS T;  1WX6 A;  3WVE B;  2KMT A;  3GF5 A;  1KQS P;  2JXB A;  1VQO Q;  3CPW S;  2EAY A;  2P4T A;  1YIT A;  2QEX A;  2MIO A;  2DBK A;  4BDZ A;  4AFU C;  2VV5 A;  3RER A;  2DIG A;  2FPE A;  1RAH B;  2ZPI B;  1AEY A;  2ZCF B;  2OI3 A;  1WZO A;  5CIU A;  1LNX A;  1C0M A;  1Y96 A;  4DEY A;  2CUB A;  3C94 A;  1BCM A;  3ME9 A;  3EFO B;  1PKS A;  2EYQ A;  4E7I A;  2HAX A;  1UHF A;  2CZ6 B;  1A0N B;  5DLQ E;  1D1C A;  4AFQ C;  2KY9 A;  2FVU A;  1YNZ A;  4E7J A;  1ZSZ B;  4A4K A;  4OMM A;  2RO0 A;  2QA4 A;  4J83 A;  3L42 A;  3EG9 B;  2ESW A;  2K6D A;  2QTV A;  1F1B B;  1Q7Y U;  4M78 C;  3RIR A;  3UF4 A;  3G6E Q;  4PJO D;  5CKH A;  1KFZ A;  4KH1 B;  2YWW A;  1YJ9 T;  2DO3 A;  4Z89 A;  1YFN A;  2CH4 A;  3TU4 K;  3MEA A;  5KE3 A;  2LX9 A;  4M7A F;  2FRW A;  3OYG A;  2AHJ B;  3FLG A;  3NGP A;  1TWB A;  1U06 A;  2PVG B;  2RQV A;  3PE0 A;  1OU9 A;  2HKN A;  2LRQ A;  3HRS A;  5LJ3 j;  3GP8 A;  1RAI B;  2E3I A;  3S3M A;  4V2S A;  2K3Y A;  1IZ6 A;  2RI5 A;  1VQP T;  2V1Q A;  2DXC A;  1AOJ A;  2ECZ A;  5GMK i;  4OMO A;  4RG2 A;  1PD1 A;  3OB9 A;  1PWT A;  4ZN1 A;  4M78 F;  2YUN A;  2ED0 A;  1PRM C;  1NYG A;  1G8X A;  2YUP A;  4ZTF A;  2KI7 A;  3CBO A;  3RBB B;  5CKD A;  2CT3 A;  1WGS A;  1FX7 A;  2E5K A;  2HNI A;  2PUK B;  2JVV A;  4AFS C;  4PJO G;  2CDT A;  2KXC A;  3QYG B;  2VVK A;  3CCU A;  3RMS A;  2BZ8 A;  4O5V A;  4WCI A;  2SRC A;  4C0G A;  1VOM A;  4M78 E;  1D3B B;  1T0H A;  2DEQ A;  2JM9 A;  3EGU A;  3CME A;  3OYK A;  2XU8 A;  2DRM A;  1UEC A;  3OYD A;  2OTL A;  4E2F B;  3NTK A;  5GMK j;  2ZPE B;  3EHQ A;  2DVJ A;  2COY A;  4O6J A;  2MYS A;  3JB9 I;  2PVO B;  1RAD B;  4PL6 A;  3JCM W;  1WQW A;  3JCM X;  1NJI U;  4M7A B;  5KYU B;  2DTH A;  1NPP A;  1B3Q A;  2OTJ Q;  1YJW T;  4KUI A;  3JSC A;  5LJ5 e;  4ZGD B;  2M0Y A;  3EFR A;  2EKO A;  1AHJ B;  5A0G A;  2RJC A;  4Z02 A;  2XKO C;  1ZUY A;  1OI1 A;  1KC8 C;  1VQ5 A;  2KGT A;  1R8O B;  1MNE A;  1HYO A;  2V26 A;  3V8K A;  5CR2 A;  3RR6 A;  1UEB A;  1C6V X;  1KG1 A;  1Z9Q A;  2RB6 A;  4M78 B;  1K9M C;  3G6E T;  1BBZ A;  4PJJ A;  1WNL A;  2O4X A;  1QQJ A;  2PNI A;  4E6R A;  5IH2 A;  2VKN A;  4RG8 A;  4C92 D;  3OYI A;  5KCO A;  1D0Y A;  2F2W A;  1VQ7 Q;  1BI3 A;  2P84 A;  1VQ8 Q;  4M7D A;  2LQW A;  1K8A C;  4PJM A;  3JCM d;  4RKU E;  2J05 A;  2M02 A;  2GFU A;  3OSS C;  4J9H A;  2O88 A;  3OYY A;  3M59 A;  5M9O A;  4CRI A;  5DY9 A;  2JM8 A;  2XDB A;  3QG1 A;  2LCC A;  4FSS A;  2EQK A;  2DFU A;  4DBR A;  2CS7 A;  1X2K A;  1VQ9 Q;  4ORZ A;  4C8Q F;  3CPW P;  1WJR A;  1PNJ A;  2GGR A;  2GFA A;  2L3R A;  4ATO A;  2V8J A;  1EFN A;  2XDP A;  1ZLM A;  1Y57 A;  5KCH A;  4C5G A;  4BI4 A;  2VXF A;  3I35 A;  2KT8 A;  4Y91 A;  1ABO A;  4CC2 A;  3G4S Q;  4X9C A;  3L2Q A;  4Z8A A;  3EH2 A;  2ED1 A;  2K79 A;  3MEU A;  2YRD A;  3JCM J;  3T9N A;  2C0T A;  3BDU A;  2C06 A;  1BYM A;  1WJQ A;  3JCM Q;  2LNV A;  4B6M A;  4EIK A;  1YHQ Q;  2OJ2 A;  3JB9 G;  4GBQ A;  2L8D A;  1P92 A;  4C5H A;  1ZUU A;  4JJD A;  1TXQ A;  1S72 A;  4A4H A;  1UB4 A;  4EDU A;  1YCS B;  3AHU A;  1K1Z A;  2D8H A;  1PRL C;  2KQW A;  2LZ6 B;  1YJN Q; 
#chains in the Genus database with same CATH homology
 1YFN A;  1OU8 A;  1OU9 A;  1OUL A;  1ZSZ C;  2NYS A;  2QAZ A;  1ZSZ A;  1OX8 A;  1ZSZ B;  1TWB A;  2QAS A;  1OX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...