1OX9A

Crystal structure of sspb-ssra complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
b'SQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B
publication title Structural basis of degradation signal recognition by SspB, a specificity-enhancing factor for the ClpXP proteolytic machine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase activator
total genus 21
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ox9A00
1YFNA 2NYSA 1TWBA 1ZSZB 1ZSZA 1OX9A 1OX8A 2QASA 1OU9A 1OU8A 1ZSZC 2QAZA 1OULA
chains in the Genus database with same CATH superfamily
5GAMf 8ATCB 1MMDA 4F7UG 1K4US 2DMOA 4ZTJA 1UB4A 2HBPA 1Q7YU 5KYUA 4II1A 2LNVA 2MWPA 1M3BA 4BDYA 4M7AC 1EFNA 4M75D 5LJ5h 2IVWA 1R0BG 2DVEA 4QQ6A 4GY5A 2D1XA 5HCKA 1Y7XA 4A4EA 1RAAB 1D1BA 1G3YA 2Y90A 2IG0A 1KK7A 3OY9A 4PJOB 4AFUC 2OX7A 4PNOA 1VQ6A 3PVQA 3P8BB 4EPCA 1VQ8A 1ZSZA 2CP6A 1N6AA 2DVJA 1UUEA 2JM8A 2X3XD 2HDAA 1Q82R 3S3OA 1KHIA 3I56A 3CCLT 5CKDA 1OX9A 1OV3A 5I2SA 1NJIC 4KUDK 2GQIA 3A8HB 2BKDN 4JS5A 3TSZA 2CGHA 1Q86C 1GFCA 4OVAA 1K8AC 4M75A 1W4SA 2YWWA 3JSCA 2I0NA 3PT9A 2JOYA 3RKXA 2JTEA 3UATA 3PVLA 2H8HA 5IXBA 1QKXA 3CCMQ 5GAN2 1UFFA 4FM4B 4M77C 3CC2A 1W2BP 2B8AA 5CKHA 2C0IA 5FRNA 2BE7D 2RI2A 5A0LA 2RM4A 2H3EB 2DBMA 1NG2A 2DF6A 4LDWA 1IB8A 2MMPA 2DXUA 5CK9A 2COYA 4J6WA 2CT3A 2EPDA 1M4ZA 1XJWB 2DTHA 4FYYB 3Q1JA 3JCMP 2QGFB 2O2OA 4M7AE 4LE9A 4ZN1A 2KVQG 4C0DC 3JB9F 2E12A 2QYZA 3H41A 4PJNA 3OYKA 2EQKA 1PD0A 4D8DA 4C0ZA 4RTZA 1WLPB 1NE8A 3QSUA 1IGQA 4FYXB 4J9DA 3LW5E 1JO8A 4B9WA 3H0FA 1BCOA 3MPUB 4M78D 1M90C 4ZTFA 4OB2B 1SF9A 4QQGA 3EHQA 1SG5A 3QJYA 3FC3A 3VRZA 3GLXA 1JB0E 3REBB 5GMKi 2P0QA 3LX7A 1X43A 4C92F 1YJNA 2CP2A 3EGXA 2VUBA 4FW1A 3CPWS 1AZGB 2DE0X 5KE3A 2LX7A 4C5HA 2ESWA 1VQ5A 3E1SA 1TSFA 1UGQB 3JCMc 4F7UB 2KSSA 2R5MA 3QDFA 5HKCA 2RPNA 3QBYA 4M77E 1PKSA 2DKGA 2X35A 2YDLA 1MMNA 3QUIA 1GRIA 5D6WA 3JCMV 4A4GA 4LN2A 3CCQQ 2NUTB 4AT1B 2ED1A 2D6FA 2QK0A 2VC8A 2PUKB 2ATCB 4M78A 4BY6B 2RQTA 3QZ5B 2AZSA 1MNDA 2E65A 3S3NA 4UC4A 4E6RA 1B34A 4OMLA 2DD5A 2LMJA 2K7AA 3CMAQ 2E5KA 1YHQQ 3H6ZA 5GJWB 1SPKA 4BI4A 4GLKA 3OSVA 1TG0A 1LCKA 1M2OA 4RUGA 1QVFP 1VQOA 2BE9B 1SSHA 2DILA 3SFMA 3CC7Q 4DOWA 5CAIA 3OYYA 3PGGA 5GAMd 2RO0A 1WPYA 1PC0A 2X4YA 3GNFB 1VOMA 1T0HA 3CXCP 3H8ZA 5CCAA 2RQUA 4M75C 2HL3A 4FSXA 4VUBA 2JM9A 3QJ6A 2RMOA 4PLLA 3HHTB 3G7ZA 1RABB 3EG9A 4XU1A 1TU0B 1VQLT 1PWTA 1JJ2S 2EQJA 2HCKA 2E64A 3FRNA 4FT2A 3BDLA 4M7DA 4BD3A 2B86A 4RCBA 2XI9A 2ZPFB 3CBPA 6AT1B 2LCCA 3EGUA 2A0FB 3ASKA 2CDTA 2RJEA 2CYZB 3LGFA 4N4IA 1Z9ZA 3OYEA 2YHTA 3NTKA 2MI6A 5GAMg 3JCMb 1YCSB 1K73U 1AVZC 1WJRA 2VXFA 3M53A 2KNBB 2XHCA 2RHXA 3G1JA 2G3RA 3G4ST 1WGSA 3OW2P 2DK3A 2YLBA 4J9CA 1WHKA 4JZ4A 3I55Q 1E7OA 1D09B 4E7SA 1WX6A 2KRMA 3MEWA 3QPHA 1Q7YR 2FL7A 1QWEA 3TSWA 4OMQA 3M0SA 1TTHB 2V8IA 2K6DA 2QDYB 2CZ7B 2JNGA 2CZ6B 4KH0B 2KBTA 2QASA 4BACA 2L0AA 1BCMA 5CQYA 1XNIA 5GMKm 1S1NA 2YUNA 2QGGA 4LD6A 2K3BA 3CMEA 4OMFB 3DLLA 2HNIA 4PK4A 3LYIA 2KR3A 4XTVA 2J05A 1NLPC 1W2BS 1SHGA 4PFPA 2M16A 1GL5A 4BE2A 2O88A 2VGMA 4J9IA 1U5SA 4CC4B 1NLOC 4AFQC 4HA8A 1K1ZA 1NM7A 2RN8A 3JB9H 2VGNA 4EMGA 2NLUA 2E1HA 4J6XA 4X34A 1NPPA 3X26B 2XICA 3JB9G 1WA7A 3CCUA 3C0CA 3I5SA 4X9CA 3RMSA 1VQ9A 1M1KC 1TS9A 2DD4A 2LCSA 1AWXA 3M0RA 3JRZA 1I5OB 2R58A 2D0QB 3CCMT 1RI9A 3MO8A 1K9AA 2C06A 4ZN3A 4ZGEB 1M27C 1NBEB 1KQ1A 1VQ6Q 1QCNA 2DL4A 4EMKA 1VQ8Q 2KY9A 1VIEA 4RTVA 2HKQB 4PJOC 2PUOB 4E7ZA 2QA4A 3EGDB 3HRSA 4M7DC 4RG8A 5GAN3 1VQMA 4J9FA 1G83A 3M56A 1X01A 4IUUA 4MDWA 4N4GA 2O9VA 2JS0A 3GBQA 1X27A 3ULRB 3CCEA 1YWPA 1NJIR 1RUWA 1Y96B 2CSIA 2K3XA 4XU3A 2QEXA 3CC2Q 4BE0A 4FYVB 1N9RA 3M57A 3CCRA 1U1SA 3TVTA 2MYSA 4M7AD 2MK5A 3BW1A 1OX8A 1HK9A 2CP7A 2DNUA 1QCFA 1RAFB 3CCJA 1VQPA 5LJ3j 2M0OA 3KXTA 2RJFA 3QKJA 2L8DA 4ME7A 5IN1A 2OTJA 4NL3A 1UDLA 1QVFS 1WHGA 2OAUA 2HSPA 2YUQA 3M59A 1XOVA 1WJSA 1BB9A 3GF5A 1X6GA 4V2SA 2W10A 1GCQA 1IZ6A 1UJ0A 2JVVA 5D6XA 2ZGWA 2L3PA 3CXCS 3CCQT 1ACMB 4KGZB 5CIUA 2P84A 4M7AA 1GBQA 3OS5A 4PJOE 2ZCFB 1VQ4A 2EYXA 1YJNQ 4M7DE 2AKLA 2Y4XA 4M77D 3FEOA 1W1FA 3E19A 2EQUA 2L3RA 4ESRA 1D0YA 1Q81C 1PRLC 1WHJA 3CMAT 5GAN8 3JAME 3CC4T 2K57A 1VQ5Q 3DB3A 5GANj 3CBMA 2X4WA 1RL2A 1Y07A 1WZOA 2HAXA 4OMPA 7AT1B 1RACB 1OYXA 1FX7A 4HVUA 1FMKA 4MDXA 3CC7T 3V7RA 3OYJA 2HBWA 2RK1A 4KRTA 2DYBA 2X51A 2OTLA 3UA7A 1FYNA 3A98A 1CKBA 3R6NA 4HVWA 2J6OA 2E70A 1I1JA 1PG5B 3C94A 4DOVA 4C8QF 4OB3B 1VYUA 4PJMA 1YJWQ 2D0NA 4M77A 3E9GA 2DL3A 2LX9A 4Y91A 4HCCA 4CRIA 2F2XA 1G8XA 4EMKC 1VQOQ 3BE3A 3SDZA 1Z9QA 1TUGB 2EYZA 4RTXA 1M3CA 2JT4A 3OW2S 4JDSA 3V7CA 1OULA 3EFSA 1G3WA 4C92B 1OU8A 3CEYA 5KYWB 3VS6A 1FXXA 2COZA 2ZPHB 3VV0A 1KD1C 2P0PA 4IURA 5GMKl 2OJ2A 1QCOA 1M8VA 1MUZA 1K73R 4DA4A 1M9SA 2DTOA 3TU4K 3VRYA 5LL6S 1OPLA 4QT7A 4A4KA 4BB7A 4FT4A 1N8RC 4JJDA 4F7UE 2RQWA 3TREA 1WJQA 5IAYA 4R56A 3I55T 2HQXA 2H3JA 2AZVA 1M1GA 1EZZB 2LNHB 1GCQC 1WNLA 3PTAA 4DBRA 3QZ9B 4AMCA 4OP0A 3SWNB 1YIJA 2F69A 2KEAA 2DXCA 2DL5A 2RHYA 2XMFA 3VUZA 1JRIA 2F5TX 4OF1A 1RI0A 5KYYA 2BUDA 4NOYA 1KC8C 4E7HA 3CCLA 4JLIA 1N27A 1BIAA 5FRMA 2V8KA 3VS1A 2M0YA 2EKHA 3QG1A 4N0AC 1VQ7Q 2KMTA 2DX1A 4WTOB 3HFNA 5IH2A 5IHKA 2ZPEB 1G2BA 4N4HA 2LQKA 4JZ3A 3EFOB 3NGPA 5LJ5e 4BI3A 4C5EA 4C0FA 4OMMA 3CMEQ 2KXCA 1X69A 4J8OA 3A8MB 4M75F 2VKNA 3EAEA 2PU9B 1IREB 1T0JA 2DFUA 1YP5A 2PNIA 4MZMA 1JEGA 4Z8AA 1UECA 5L8RE 2A7YA 1YNZA 5GMKj 2KI7A 3L2RA 1R77A 1UTIA 2JXBA 1VQ6T 1KC8U 2CUDA 2A08A 5KYXA 4J7FA 2BZYA 3I56T 3QYGB 1CKAA 3CCVA 1D1AA 2O9SA 3CCUQ 1VQ9Q 3SEMA 2R5AA 2MAMA 2GTOA 4HT9A 3FJPA 2DA9A 3P8HA 1D0ZA 2L5QA 1H3ZA 3X20B 1OEBA 1NJIU 2F1LA 1G3SA 5GAMj 3CC2T 1BKBA 3CXCA 2C0TA 2EYQA 2PQWA 1Q86U 2FZCB 2DETA 2RH2A 2QG9B 3JB9I 2AIRB 5LJ3h 5A0DA 1K8AU 2QA4Q 2XDPA 1FMVA 3G6ET 2FYKA 2QXFA 2DPPB 1N5ZA 1M1FA 2GQVA 1VQMQ 2LJ0A 2R57A 3MP8A 1RLQC 2E6NA 1I5LA 3JCMd 2HKNA 2AKKA 4BDZA 4MMLA 3CCEQ 1X2KA 4CC3A 2L3QA 3RR6A 2WSEE 2DXBA 2LQ8A 1MMAA 2SRCA 2QEXQ 2WSFE 3CCRQ 2K4YA 5J26A 1QVPA 1KQSA 2LRQA 1VYTA 2LJ3A 4M78F 2NUPA 4LXCA 3CCJQ 1VQPQ 5GJVB 1YFNA 2OTJQ 3L1AA 5CR2A 1YJWA 2XK0A 4C8QG 1YJNT 1M3AA 2GCXA 2MPXC 2PVDB 4PFZA 2EYWA 4IUPA 2FEIA 4LUDA 5GANh 1M90U 2E10A 1NYGA 5IHNA 4NS5A 4BUGA 2X4JA 1VQ5T 3VYHB 1PSEA 4PJOD 1I81A 1D3BB 3IQLA 4HT8A 3AHUA 1ZA1B 1M2VB 2XG8D 1U3OA 4M7DD 1M8MA 1IHVA 2ROLA 1K9MC 2RI5A 1C6VX 2F2WA 3VYGA 4E7JA 1MNEA 1TWBA 5LJ5f 2VASA 3JCMg 1I4K1 4PFOA 2XIDA 1VQ4Q 3M0QA 2ZPGB 5EG2A 4R55A 2CZ1B 1HD3A 4QVDA 2O4XA 3RNJA 1AHJB 1KG1A 2DXTA 4X1VA 3UPUA 2HQHA 2CUBA 5GANe 2CKKA 4J9HA 4LUEA 2HEQA 1H641 5FU6B 2K5LA 2DIGA 5EC7A 1NPRA 1WFWA 1E6HA 2FO0A 5KE2A 2GF7A 4ELYC 1VQOT 3H9NA 4PJOA 1PRMC 2MOXA 1G3TA 5IT9E 3J80E 4HCBA 3C4SA 3L2VA 4XTWA 2OTLQ 1GCPA 3OYAA 4M7DF 4LDYA 1U1TA 4JJNK 2GFUA 1SSFA 2E3HA 3PIPA 2DRKA 3I9QA 4KGXB 5L23A 4WF2A 3TCJA 2LQWA 1K9MU 3DB4A 2J7IA 2K9GA 4P5NA 4F04B 3FB9A 3EFRA 2YXYA 2QTXA 2KE9A 2NWMA 1YI2A 3L42A 5C6SA 1BYMA 2KRNA 3RKYA 2DZ9A 4HCZA 2X4XA 4Y92A 1PCXA 1M30A 2ED0A 3QWYA 1BI0A 2RK2A 4C92C 4C5IA 3PMTA 1VQ7A 2D8HA 1AWWA 1W6XA 2SEMA 2EQMA 2M02A 1KHCA 3CCSA 2CREA 5GAOp 2EJ9A 1Q82C 3ZFJA 1AOJA 5CVIA 1ZUYA 3RBBB 2ECZA 1PKTA 2FZKB 1MGQA 1QKWA 1LNXA 1T3LA 4C8QB 2KYBA 1WXBA 3RDVA 4PKCC 3ZL7C 2EGEA 1ZX6A 4B6MA 3VU3C 1MV0B 1I8FA 3M4YA 1WYXA 2VB6A 4F7UA 1YIJQ 4E7KA 3JCMQ 3S3MA 5GAOn 2RQVA 1OZ3A 3VS7A 3SWNC 2NUTA 2RJCA 4OB1B 4JRPA 3PE0A 5KYNA 2BTTA 3CCLQ 4LDVA 2IIMA 1WHLA 3CMET 4RG2A 1TXQA 3NMZC 4C92E 2D9TA 2ZPIB 4JJCA 2XDDA 1KC8R 5GMKh 2RHZA 5GANf 1QQJA 3A8LB 3FJ5A 2DIQA 2RD1A 1HJDA 2EWNA 3CQTA 1S72A 1B7TA 4C92G 5D6YA 2FZGB 2PVOB 1B3QA 1JXMA 3OYFA 2QDLA 3CPWA 3D7SB 4HXJA 2FB7A 1YWOA 1RLPC 4JS4A 2AHJB 2NUZA 3P8DA 1WDXA 2X9HA 3CCUT 1QP2A 5KCHA 1VQ9T 1QW1A 1X2QA 2PZ1A 2JN0A 3MCAB 1PHTA 1OZ2A 5LJ5d 1Q86R 2BZXA 3OMCA 1K8AR 4Z02A 4D6WA 3OYIA 3OS0A 2QI2A 5KYUB 2CP5A 3QWXX 2F5KA 2QQSA 3WXMB 1D1CA 1M1KU 1X75C 4DQ2A 1ZBXA 3QXEB 5FROA 4M78G 3MP1A 3HFOA 2AT1B 3DKMA 5FLXE 5GAN7 1VYVA 2GNCA 2RHUA 3N5BB 1LOJA 3CCVQ 2QQAA 2MWOA 1VQMT 3OQ5A 2KDSA 3I35A 3M0UA 3CCET 4HKEA 3RIRA 1OI1A 1K0SA 1ZSZB 3J81E 2F2VA 1O75A 1G5VA 2QEXT 1FWZA 1EIFA 3ZEHA 5I11A 1ZQ1A 3CCRT 2EKOA 2J6KA 3E2UA 3M58A 1YITA 2LZ6B 5GAOq 1MHNA 3L2WA 4M7AF 4A4HA 3OYNA 1M90R 1RADB 4J7IA 3CCJT 3LLRA 3HKSA 5HY6A 2LT1A 4M75B 2NYSA 2DJZA 5LJ5g 2OTJT 4YTLA 1YHQT 2E4HA 4ZGJB 5AYFA 3G71A 4JPBW 3CD6A 4N0AA 4BI8B 2E6ZA 4A4FA 2JUFA 2YUPA 3JV3A 1JJ2A 1X6BA 3OS2A 2DRMA 3X25B 3L2QA 1YJ9A 3A8GB 1SKUB 2EYYA 2ZPBB 4BE1A 2CZ0B 4O5VA 1LJOA 2DL7A 2V8JA 3NPFA 4J83A 5FU7B 1NZ9A 1SEMA 1VQKA 4BY6C 3TEEA 2FPFA 1VQ4T 1ZSGA 1RAEB 1ABOA 2EIFA 5FWBA 3NTHA 3EH2A 4M77F 2YUOA 2YSQA 2VWFA 5J39A 1KSWA 3MEUA 1ZA2B 3VUBA 4IIOA 1GFDA 2LP5A 4PLIA 1Q81U 2QQBA 2DYIA 3BFMA 2KXDA 1YBYA 3EGXB 4DEXA 2W0ZA 4OB0B 2HMAA 4TVRA 1JBMA 2OTLT 1VQNA 4D8KA 4RTYA 3H0IA 3SHWA 1AT1B 1K9MR 3F70A 3OBYA 1LVKA 2ABLA 4GBQA 1EX4A 4C0GA 3LH5A 2A3LA 3U23A 5KCOA 1UG1A 4M78B 4ORZA 3HSBA 1KJWA 5GANd 3FLGA 1W2BA 1A0NB 1B34B 3RKWA 1J3TA 2DM1A 3EGDA 1UGPB 5I22A 2DEUA 3S6WA 2E3IA 1HSQA 3PIOA 1TH7A 1WQ7A 4M4ZA 4QVZA 4AG1C 3MEAA 2V1QA 3OBWA 3OSSC 1UGRB 3M4GA 1ZBJA 2CP3A 3ME9A 2RQRA 1HXDA 3PNWC 1PSFA 3EHRA 1KD1U 1Y96A 5DLOA 3GOXA 1NEGA 2P4TA 5ECAA 4LNPA 3O5ZA 2EQIA 1DJ7B 2LVMA 3BDUA 1YI2Q 5DY9A 3VS3A 2O01E 2Z0WA 4LDUA 4E47A 2CP0A 2DEQA 3FIFA 2O4XB 4Z89A 3DLMA 1SRMA 1N8RU 5CKFA 3OMGA 3M5AA 1UHCA 3QIIA 3O8VA 3EG9B 3CCSQ 2X3WD 5I21A 4CC2A 2KYMA 5GANg 2GFAA 1YIJT 5DLQE 4F14A 3MP6A 2QAZA 3NTIA 4M7DB 1I0CA 3JB9D 1T3SA 1GXIE 1BI2A 1FMWA 2XDBA 3VS0A 4F17A 2DO3A 4A53A 3C95A 3X24B 4C8QC 2ENMA 4E7IA 4RCCA 3WVEB 4FIBA 3QHSA 1P92A 1MV3A 4KGVB 1WI7A 4A54A 1VQ8T 2O31A 3JCMW 4IUTA 4PL6A 2I2LA 2K2MA 1LPLA 2A36A 3UT1A 1QVGP 4MZPA 4FW2A 1QWFA 4XTUA 3MEVA 4C92D 4OMOA 4J6YA 1QVFA 1RAGB 1Y0MA 2D8JA 2EBPA 4OGEA 3J7AF 2FVUA 2M1HA 3G6EA 2CSQA 1KQ2A 1WXTA 2LJ1A 1UEBA 1M1KR 1U8RA 2RHIA 4DEYA 2LC4A 1UE9A 1OQKA 2LT4A 1IRXA 2HL5C 4Y28E 1S72Q 1RAHB 4M7AG 3HTRA 2K2VA 3VKIA 1RAIB 3V7SA 2HZYA 2YRCA 2L3SA 3V8KA 1WHHA 1ARKA 1IXDA 2RJDA 2DLPA 4PJJA 1TOVA 4C92A 3CCVT 5KYWA 1W70A 4JRIA 3INZA 4ZNXA 3GP8A 4C8QE 3ZBDA 1ZUUA 1ZHIA 5LJ3e 4PJLA 2GTJA 3V8LA 4DBQA 2FRWA 2XD0A 2P0KA 2K3YA 1F1BB 4DBHA 3OA6A 4IUQA 1V29B 4K11A 4RTWA 1SRLA 2DAQA 4L6V5 4M77G 4EDUA 1QMCA 2DBKA 4NL2A 4IUVA 2JMAA 3C12A 2QQRA 4KUIA 3GNGA 2KROA 3VS5A 2XKOC 3OW2A 2RB6A 3LWIA 4XU2A 3CC4Q 1MMGA 4CI0C 4RKUE 4EMKB 4A63B 3LGLA 1VQLA 2KAFA 1VIFA 1JQQA 3SWNA 1ZSZC 2AK5A 1YITQ 2IPOB 1GBRA 3ER0A 2DZCA 1ZLMA 1YN8A 4GLMA 5FWCA 2J6FA 2L89A 5M9OA 5GAN6 1AD5A 1IO6A 4FL6A 4QKUA 1K73C 1JU5C 1JXOA 3MKDA 1PNJA 3T9NA 2YT6A 1YJWT 1N9SA 3G71Q 4L5GA 1BI3A 1X6OA 3CD6Q 2PTKA 2L2PA 1Q81R 1I07A 1CSKA 4OMNA 4EMHA 3NFCA 5HK3A 5A0GA 3HPWA 3PMIA 4PJOF 1QP3A 3A8OB 2EJFA 1YJ9Q 4OGCA 1BI1A 4X9DA 1TUCA 2MIOA 3G4SA 4FU6A 1VQKQ 1QLYA 3EFOA 2GBQA 1M5Q1 2QQ9A 5FU7C 2RA2A 1YCYA 2FRYA 1KQSP 4O6JA 1BBZA 2K79A 1O9SA 4M7AB 1SHFA 1H92A 3OB9A 3NHNA 4AFSC 4HCKA 5GAN5 1OOTA 4B9XA 3M0TA 3RERA 2J06A 3SD4A 1VQNQ 3PFSA 3URGA 3RESA 5A2QE 5DM7R 2EJGA 4HVVA 3WVDB 2OAWA 4CC7A 1KD1R 3OYLA 4RTTA 4M75E 1WIEA 4IKFA 2LCLA 1AWJA 2K5IA 2KGTA 5CQXA 2CT4A 4KULA 2VVKA 2FHDA 3QO3A 5LJ3f 3JCMJ 2YLCA 3OYGA 4M75G 2GGRA 1YI2T 5CKBA 4M78C 2JS2A 1N8RR 1NYFA 4QW2A 5LJ5j 1E6GA 4M77B 1K76A 2A28A 2JMCA 4JUVA 5KH6A 3CCMA 4KBMB 2M9UA 1VQ7T 2DERA 2JZ2A 2P4RA 4RTUA 3RMQA 5GAOm 3KFVA 1QVGS 1KFZA 2VXEA 4F7UF 3GPLA 2JW4A 3CCST 3E9FA 1VUBA 1V76A 2EW3A 1U06A 3RUXA 2VYTA 4XAXB 2BIVA 4ANJA 1OPKA 5D7UA 2EGCA 1HYOA 3OYMA 1XTDA 2XU8A 4C0DB 3JCMh 1R8OB 2JTMA 4MZTA 3FDRA 3KUFA 2FPEA 1UJYA 2WSCE 3AT1B 3OYBA 2LQNA 4LD9K 1AWOA 1Q82U 1NEBA 3KBGA 3JCMX 2HD0A 3UA6A 4XK8E 8AT1B 3A1PA 4F16A 3HRTA 5IXFA 3META 3UF4A 1D3BA 4J9GA 3TQ7P 2YRVA 1M2VA 4EIKA 3EH1A 2QTVA 3CBOA 4JJBA 4AG2C 2C0OA 4XTZA 2KT8A 1BK2A 2FG0A 3JCMe 1H3HA 2RNAA 2HSEB 2EGAA 3I56Q 1IGUA 4M78E 2DJQA 1H8KA 2MF2A 5AT1B 1K0XA 5GMKe 1TUDA 5GAMh 5CKEA 2COWA 3JB9J 3OYDA 3VS2A 3HL8A 3OYHA 2DL8A 1AEYA 3V8JA 5KYYB 3CCQA 2E5QA 2QA4T 1S72T 2K5FA 5C0MA 3LWHA 3M55A 3A5ZB 2LTOA 3EG2A 2FPDA 1Y57A 2RI3A 4C5GA 3G6EQ 1B07A 1BIBA 2OI3A 2BZ8A 3CMAA 5FW9A 3CC4A 3UWNA 2Y4YA 4Z88A 1YHQA 4J9BA 2LDMA 1V1CA 5GAMe 3M9QA 2G6FX 2M51A 1AZEA 2CH4A 4RMOA 1C0MA 5HK0A 4QVCA 3CC7A 2YRDA 4AFZC 5GAOr 1VQPT 3EG3A 1KIKA 1WQWA 9ATCB 2KK4A 1OU9A 2KT1A 4FSSA 3L2UA 2V1RA 4R0KA 3I5RA 4C8QD 2KQWA 3R6OA 1WXUA 3REAB 4XTXA 3MJXA 5GAN4 3UDCA 2VV5A 1ZUKA 1R0CB 1BU1A 1WHMA 3CPWP 4Q5WA 4PJOG 1UHFA 3OYCA 5KYXB 4DBFA 4XTYA 4ZGDB 4M7DG 2EFIA 2V26A 1VA7A 3LH0A 1YITT 4J5YA 3OS1A 4ATOA 3EG0A 3HRUA 3L2ZA 4QQDA 3GIBA 4FYWB 2HQEA 1KQSS 2DTIA 4JLGA 5IHIA 5LJ3d 3EG1A 4KT0E 5I2MA 1IHWA 2JJ9A 4C8QA 1ABQA 3G71T 4LDXA 3CD6T 4FCYA 2PVGB 4L59A 3HP9A 4J9EA 3M54A 2RF0A 2CH4W 3CPFA 5J3BA 2MCNA 4IIMA 4KH1B 1VQLQ 3VJPA 1XQHA 1UGSB 4E7LA 1YJ9T 4E2FB 3QYHB 2EAYA 1Q7YC 3JCMf 1VQKT 2KRSA 3I55A 2ZZDA 5CO7A 3X28B 4JRQA 2EVRA 4XU0A 3BY7A 1Y71A 4WCIA 1UGVA 3H0HA 3M0PA 5FU6C 1D0XA 3THKA 2WACA 2ROTA 4XQ3A 2A37A 4MMKA 3SB2A 2NUPB 1Q95G 3QDRB 4ELZC 2JTFA 4JRKA 2ZAEA 5LJ3g 5GAOl 3G4SQ 3VS4A 1PM3A 3MHXA 2CS7A 1JJ2P 1VQNT 2E41A 1PD1A 1C1AA 1QVGA
chains in the Genus database with same CATH topology
1YFNA 2NYSA 1TWBA 1ZSZB 1ZSZA 1OX9A 1OX8A 2QASA 1OU9A 1OU8A 1ZSZC 2QAZA 1OULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFN A;  2NYS A;  1TWB A;  1ZSZ B;  1ZSZ A;  1OX9 A;  1OX8 A;  2QAS A;  1OU9 A;  1OU8 A;  1ZSZ C;  2QAZ A;  1OUL A; 
#chains in the Genus database with same CATH topology
 5GAM f;  8ATC B;  1MMD A;  4F7U G;  1K4U S;  2DMO A;  4ZTJ A;  1UB4 A;  2HBP A;  1Q7Y U;  5KYU A;  4II1 A;  2LNV A;  2MWP A;  1M3B A;  4BDY A;  4M7A C;  1EFN A;  4M75 D;  5LJ5 h;  2IVW A;  1R0B G;  2DVE A;  4QQ6 A;  4GY5 A;  2D1X A;  5HCK A;  1Y7X A;  4A4E A;  1RAA B;  1D1B A;  1G3Y A;  2Y90 A;  2IG0 A;  1KK7 A;  3OY9 A;  4PJO B;  4AFU C;  2OX7 A;  4PNO A;  1VQ6 A;  3PVQ A;  3P8B B;  4EPC A;  1VQ8 A;  1ZSZ A;  2CP6 A;  1N6A A;  2DVJ A;  1UUE A;  2JM8 A;  2X3X D;  2HDA A;  1Q82 R;  3S3O A;  1KHI A;  3I56 A;  3CCL T;  5CKD A;  1OX9 A;  1OV3 A;  5I2S A;  1NJI C;  4KUD K;  2GQI A;  3A8H B;  2BKD N;  4JS5 A;  3TSZ A;  2CGH A;  1Q86 C;  1GFC A;  4OVA A;  1K8A C;  4M75 A;  1W4S A;  2YWW A;  3JSC A;  2I0N A;  3PT9 A;  2JOY A;  3RKX A;  2JTE A;  3UAT A;  3PVL A;  2H8H A;  5IXB A;  1QKX A;  3CCM Q;  5GAN 2;  1UFF A;  4FM4 B;  4M77 C;  3CC2 A;  1W2B P;  2B8A A;  5CKH A;  2C0I A;  5FRN A;  2BE7 D;  2RI2 A;  5A0L A;  2RM4 A;  2H3E B;  2DBM A;  1NG2 A;  2DF6 A;  4LDW A;  1IB8 A;  2MMP A;  2DXU A;  5CK9 A;  2COY A;  4J6W A;  2CT3 A;  2EPD A;  1M4Z A;  1XJW B;  2DTH A;  4FYY B;  3Q1J A;  3JCM P;  2QGF B;  2O2O A;  4M7A E;  4LE9 A;  4ZN1 A;  2KVQ G;  4C0D C;  3JB9 F;  2E12 A;  2QYZ A;  3H41 A;  4PJN A;  3OYK A;  2EQK A;  1PD0 A;  4D8D A;  4C0Z A;  4RTZ A;  1WLP B;  1NE8 A;  3QSU A;  1IGQ A;  4FYX B;  4J9D A;  3LW5 E;  1JO8 A;  4B9W A;  3H0F A;  1BCO A;  3MPU B;  4M78 D;  1M90 C;  4ZTF A;  4OB2 B;  1SF9 A;  4QQG A;  3EHQ A;  1SG5 A;  3QJY A;  3FC3 A;  3VRZ A;  3GLX A;  1JB0 E;  3REB B;  5GMK i;  2P0Q A;  3LX7 A;  1X43 A;  4C92 F;  1YJN A;  2CP2 A;  3EGX A;  2VUB A;  4FW1 A;  3CPW S;  1AZG B;  2DE0 X;  5KE3 A;  2LX7 A;  4C5H A;  2ESW A;  1VQ5 A;  3E1S A;  1TSF A;  1UGQ B;  3JCM c;  4F7U B;  2KSS A;  2R5M A;  3QDF A;  5HKC A;  2RPN A;  3QBY A;  4M77 E;  1PKS A;  2DKG A;  2X35 A;  2YDL A;  1MMN A;  3QUI A;  1GRI A;  5D6W A;  3JCM V;  4A4G A;  4LN2 A;  3CCQ Q;  2NUT B;  4AT1 B;  2ED1 A;  2D6F A;  2QK0 A;  2VC8 A;  2PUK B;  2ATC B;  4M78 A;  4BY6 B;  2RQT A;  3QZ5 B;  2AZS A;  1MND A;  2E65 A;  3S3N A;  4UC4 A;  4E6R A;  1B34 A;  4OML A;  2DD5 A;  2LMJ A;  2K7A A;  3CMA Q;  2E5K A;  1YHQ Q;  3H6Z A;  5GJW B;  1SPK A;  4BI4 A;  4GLK A;  3OSV A;  1TG0 A;  1LCK A;  1M2O A;  4RUG A;  1QVF P;  1VQO A;  2BE9 B;  1SSH A;  2DIL A;  3SFM A;  3CC7 Q;  4DOW A;  5CAI A;  3OYY A;  3PGG A;  5GAM d;  2RO0 A;  1WPY A;  1PC0 A;  2X4Y A;  3GNF B;  1VOM A;  1T0H A;  3CXC P;  3H8Z A;  5CCA A;  2RQU A;  4M75 C;  2HL3 A;  4FSX A;  4VUB A;  2JM9 A;  3QJ6 A;  2RMO A;  4PLL A;  3HHT B;  3G7Z A;  1RAB B;  3EG9 A;  4XU1 A;  1TU0 B;  1VQL T;  1PWT A;  1JJ2 S;  2EQJ A;  2HCK A;  2E64 A;  3FRN A;  4FT2 A;  3BDL A;  4M7D A;  4BD3 A;  2B86 A;  4RCB A;  2XI9 A;  2ZPF B;  3CBP A;  6AT1 B;  2LCC A;  3EGU A;  2A0F B;  3ASK A;  2CDT A;  2RJE A;  2CYZ B;  3LGF A;  4N4I A;  1Z9Z A;  3OYE A;  2YHT A;  3NTK A;  2MI6 A;  5GAM g;  3JCM b;  1YCS B;  1K73 U;  1AVZ C;  1WJR A;  2VXF A;  3M53 A;  2KNB B;  2XHC A;  2RHX A;  3G1J A;  2G3R A;  3G4S T;  1WGS A;  3OW2 P;  2DK3 A;  2YLB A;  4J9C A;  1WHK A;  4JZ4 A;  3I55 Q;  1E7O A;  1D09 B;  4E7S A;  1WX6 A;  2KRM A;  3MEW A;  3QPH A;  1Q7Y R;  2FL7 A;  1QWE A;  3TSW A;  4OMQ A;  3M0S A;  1TTH B;  2V8I A;  2K6D A;  2QDY B;  2CZ7 B;  2JNG A;  2CZ6 B;  4KH0 B;  2KBT A;  2QAS A;  4BAC A;  2L0A A;  1BCM A;  5CQY A;  1XNI A;  5GMK m;  1S1N A;  2YUN A;  2QGG A;  4LD6 A;  2K3B A;  3CME A;  4OMF B;  3DLL A;  2HNI A;  4PK4 A;  3LYI A;  2KR3 A;  4XTV A;  2J05 A;  1NLP C;  1W2B S;  1SHG A;  4PFP A;  2M16 A;  1GL5 A;  4BE2 A;  2O88 A;  2VGM A;  4J9I A;  1U5S A;  4CC4 B;  1NLO C;  4AFQ C;  4HA8 A;  1K1Z A;  1NM7 A;  2RN8 A;  3JB9 H;  2VGN A;  4EMG A;  2NLU A;  2E1H A;  4J6X A;  4X34 A;  1NPP A;  3X26 B;  2XIC A;  3JB9 G;  1WA7 A;  3CCU A;  3C0C A;  3I5S A;  4X9C A;  3RMS A;  1VQ9 A;  1M1K C;  1TS9 A;  2DD4 A;  2LCS A;  1AWX A;  3M0R A;  3JRZ A;  1I5O B;  2R58 A;  2D0Q B;  3CCM T;  1RI9 A;  3MO8 A;  1K9A A;  2C06 A;  4ZN3 A;  4ZGE B;  1M27 C;  1NBE B;  1KQ1 A;  1VQ6 Q;  1QCN A;  2DL4 A;  4EMK A;  1VQ8 Q;  2KY9 A;  1VIE A;  4RTV A;  2HKQ B;  4PJO C;  2PUO B;  4E7Z A;  2QA4 A;  3EGD B;  3HRS A;  4M7D C;  4RG8 A;  5GAN 3;  1VQM A;  4J9F A;  1G83 A;  3M56 A;  1X01 A;  4IUU A;  4MDW A;  4N4G A;  2O9V A;  2JS0 A;  3GBQ A;  1X27 A;  3ULR B;  3CCE A;  1YWP A;  1NJI R;  1RUW A;  1Y96 B;  2CSI A;  2K3X A;  4XU3 A;  2QEX A;  3CC2 Q;  4BE0 A;  4FYV B;  1N9R A;  3M57 A;  3CCR A;  1U1S A;  3TVT A;  2MYS A;  4M7A D;  2MK5 A;  3BW1 A;  1OX8 A;  1HK9 A;  2CP7 A;  2DNU A;  1QCF A;  1RAF B;  3CCJ A;  1VQP A;  5LJ3 j;  2M0O A;  3KXT A;  2RJF A;  3QKJ A;  2L8D A;  4ME7 A;  5IN1 A;  2OTJ A;  4NL3 A;  1UDL A;  1QVF S;  1WHG A;  2OAU A;  2HSP A;  2YUQ A;  3M59 A;  1XOV A;  1WJS A;  1BB9 A;  3GF5 A;  1X6G A;  4V2S A;  2W10 A;  1GCQ A;  1IZ6 A;  1UJ0 A;  2JVV A;  5D6X A;  2ZGW A;  2L3P A;  3CXC S;  3CCQ T;  1ACM B;  4KGZ B;  5CIU A;  2P84 A;  4M7A A;  1GBQ A;  3OS5 A;  4PJO E;  2ZCF B;  1VQ4 A;  2EYX A;  1YJN Q;  4M7D E;  2AKL A;  2Y4X A;  4M77 D;  3FEO A;  1W1F A;  3E19 A;  2EQU A;  2L3R A;  4ESR A;  1D0Y A;  1Q81 C;  1PRL C;  1WHJ A;  3CMA T;  5GAN 8;  3JAM E;  3CC4 T;  2K57 A;  1VQ5 Q;  3DB3 A;  5GAN j;  3CBM A;  2X4W A;  1RL2 A;  1Y07 A;  1WZO A;  2HAX A;  4OMP A;  7AT1 B;  1RAC B;  1OYX A;  1FX7 A;  4HVU A;  1FMK A;  4MDX A;  3CC7 T;  3V7R A;  3OYJ A;  2HBW A;  2RK1 A;  4KRT A;  2DYB A;  2X51 A;  2OTL A;  3UA7 A;  1FYN A;  3A98 A;  1CKB A;  3R6N A;  4HVW A;  2J6O A;  2E70 A;  1I1J A;  1PG5 B;  3C94 A;  4DOV A;  4C8Q F;  4OB3 B;  1VYU A;  4PJM A;  1YJW Q;  2D0N A;  4M77 A;  3E9G A;  2DL3 A;  2LX9 A;  4Y91 A;  4HCC A;  4CRI A;  2F2X A;  1G8X A;  4EMK C;  1VQO Q;  3BE3 A;  3SDZ A;  1Z9Q A;  1TUG B;  2EYZ A;  4RTX A;  1M3C A;  2JT4 A;  3OW2 S;  4JDS A;  3V7C A;  1OUL A;  3EFS A;  1G3W A;  4C92 B;  1OU8 A;  3CEY A;  5KYW B;  3VS6 A;  1FXX A;  2COZ A;  2ZPH B;  3VV0 A;  1KD1 C;  2P0P A;  4IUR A;  5GMK l;  2OJ2 A;  1QCO A;  1M8V A;  1MUZ A;  1K73 R;  4DA4 A;  1M9S A;  2DTO A;  3TU4 K;  3VRY A;  5LL6 S;  1OPL A;  4QT7 A;  4A4K A;  4BB7 A;  4FT4 A;  1N8R C;  4JJD A;  4F7U E;  2RQW A;  3TRE A;  1WJQ A;  5IAY A;  4R56 A;  3I55 T;  2HQX A;  2H3J A;  2AZV A;  1M1G A;  1EZZ B;  2LNH B;  1GCQ C;  1WNL A;  3PTA A;  4DBR A;  3QZ9 B;  4AMC A;  4OP0 A;  3SWN B;  1YIJ A;  2F69 A;  2KEA A;  2DXC A;  2DL5 A;  2RHY A;  2XMF A;  3VUZ A;  1JRI A;  2F5T X;  4OF1 A;  1RI0 A;  5KYY A;  2BUD A;  4NOY A;  1KC8 C;  4E7H A;  3CCL A;  4JLI A;  1N27 A;  1BIA A;  5FRM A;  2V8K A;  3VS1 A;  2M0Y A;  2EKH A;  3QG1 A;  4N0A C;  1VQ7 Q;  2KMT A;  2DX1 A;  4WTO B;  3HFN A;  5IH2 A;  5IHK A;  2ZPE B;  1G2B A;  4N4H A;  2LQK A;  4JZ3 A;  3EFO B;  3NGP A;  5LJ5 e;  4BI3 A;  4C5E A;  4C0F A;  4OMM A;  3CME Q;  2KXC A;  1X69 A;  4J8O A;  3A8M B;  4M75 F;  2VKN A;  3EAE A;  2PU9 B;  1IRE B;  1T0J A;  2DFU A;  1YP5 A;  2PNI A;  4MZM A;  1JEG A;  4Z8A A;  1UEC A;  5L8R E;  2A7Y A;  1YNZ A;  5GMK j;  2KI7 A;  3L2R A;  1R77 A;  1UTI A;  2JXB A;  1VQ6 T;  1KC8 U;  2CUD A;  2A08 A;  5KYX A;  4J7F A;  2BZY A;  3I56 T;  3QYG B;  1CKA A;  3CCV A;  1D1A A;  2O9S A;  3CCU Q;  1VQ9 Q;  3SEM A;  2R5A A;  2MAM A;  2GTO A;  4HT9 A;  3FJP A;  2DA9 A;  3P8H A;  1D0Z A;  2L5Q A;  1H3Z A;  3X20 B;  1OEB A;  1NJI U;  2F1L A;  1G3S A;  5GAM j;  3CC2 T;  1BKB A;  3CXC A;  2C0T A;  2EYQ A;  2PQW A;  1Q86 U;  2FZC B;  2DET A;  2RH2 A;  2QG9 B;  3JB9 I;  2AIR B;  5LJ3 h;  5A0D A;  1K8A U;  2QA4 Q;  2XDP A;  1FMV A;  3G6E T;  2FYK A;  2QXF A;  2DPP B;  1N5Z A;  1M1F A;  2GQV A;  1VQM Q;  2LJ0 A;  2R57 A;  3MP8 A;  1RLQ C;  2E6N A;  1I5L A;  3JCM d;  2HKN A;  2AKK A;  4BDZ A;  4MML A;  3CCE Q;  1X2K A;  4CC3 A;  2L3Q A;  3RR6 A;  2WSE E;  2DXB A;  2LQ8 A;  1MMA A;  2SRC A;  2QEX Q;  2WSF E;  3CCR Q;  2K4Y A;  5J26 A;  1QVP A;  1KQS A;  2LRQ A;  1VYT A;  2LJ3 A;  4M78 F;  2NUP A;  4LXC A;  3CCJ Q;  1VQP Q;  5GJV B;  1YFN A;  2OTJ Q;  3L1A A;  5CR2 A;  1YJW A;  2XK0 A;  4C8Q G;  1YJN T;  1M3A A;  2GCX A;  2MPX C;  2PVD B;  4PFZ A;  2EYW A;  4IUP A;  2FEI A;  4LUD A;  5GAN h;  1M90 U;  2E10 A;  1NYG A;  5IHN A;  4NS5 A;  4BUG A;  2X4J A;  1VQ5 T;  3VYH B;  1PSE A;  4PJO D;  1I81 A;  1D3B B;  3IQL A;  4HT8 A;  3AHU A;  1ZA1 B;  1M2V B;  2XG8 D;  1U3O A;  4M7D D;  1M8M A;  1IHV A;  2ROL A;  1K9M C;  2RI5 A;  1C6V X;  2F2W A;  3VYG A;  4E7J A;  1MNE A;  1TWB A;  5LJ5 f;  2VAS A;  3JCM g;  1I4K 1;  4PFO A;  2XID A;  1VQ4 Q;  3M0Q A;  2ZPG B;  5EG2 A;  4R55 A;  2CZ1 B;  1HD3 A;  4QVD A;  2O4X A;  3RNJ A;  1AHJ B;  1KG1 A;  2DXT A;  4X1V A;  3UPU A;  2HQH A;  2CUB A;  5GAN e;  2CKK A;  4J9H A;  4LUE A;  2HEQ A;  1H64 1;  5FU6 B;  2K5L A;  2DIG A;  5EC7 A;  1NPR A;  1WFW A;  1E6H A;  2FO0 A;  5KE2 A;  2GF7 A;  4ELY C;  1VQO T;  3H9N A;  4PJO A;  1PRM C;  2MOX A;  1G3T A;  5IT9 E;  3J80 E;  4HCB A;  3C4S A;  3L2V A;  4XTW A;  2OTL Q;  1GCP A;  3OYA A;  4M7D F;  4LDY A;  1U1T A;  4JJN K;  2GFU A;  1SSF A;  2E3H A;  3PIP A;  2DRK A;  3I9Q A;  4KGX B;  5L23 A;  4WF2 A;  3TCJ A;  2LQW A;  1K9M U;  3DB4 A;  2J7I A;  2K9G A;  4P5N A;  4F04 B;  3FB9 A;  3EFR A;  2YXY A;  2QTX A;  2KE9 A;  2NWM A;  1YI2 A;  3L42 A;  5C6S A;  1BYM A;  2KRN A;  3RKY A;  2DZ9 A;  4HCZ A;  2X4X A;  4Y92 A;  1PCX A;  1M30 A;  2ED0 A;  3QWY A;  1BI0 A;  2RK2 A;  4C92 C;  4C5I A;  3PMT A;  1VQ7 A;  2D8H A;  1AWW A;  1W6X A;  2SEM A;  2EQM A;  2M02 A;  1KHC A;  3CCS A;  2CRE A;  5GAO p;  2EJ9 A;  1Q82 C;  3ZFJ A;  1AOJ A;  5CVI A;  1ZUY A;  3RBB B;  2ECZ A;  1PKT A;  2FZK B;  1MGQ A;  1QKW A;  1LNX A;  1T3L A;  4C8Q B;  2KYB A;  1WXB A;  3RDV A;  4PKC C;  3ZL7 C;  2EGE A;  1ZX6 A;  4B6M A;  3VU3 C;  1MV0 B;  1I8F A;  3M4Y A;  1WYX A;  2VB6 A;  4F7U A;  1YIJ Q;  4E7K A;  3JCM Q;  3S3M A;  5GAO n;  2RQV A;  1OZ3 A;  3VS7 A;  3SWN C;  2NUT A;  2RJC A;  4OB1 B;  4JRP A;  3PE0 A;  5KYN A;  2BTT A;  3CCL Q;  4LDV A;  2IIM A;  1WHL A;  3CME T;  4RG2 A;  1TXQ A;  3NMZ C;  4C92 E;  2D9T A;  2ZPI B;  4JJC A;  2XDD A;  1KC8 R;  5GMK h;  2RHZ A;  5GAN f;  1QQJ A;  3A8L B;  3FJ5 A;  2DIQ A;  2RD1 A;  1HJD A;  2EWN A;  3CQT A;  1S72 A;  1B7T A;  4C92 G;  5D6Y A;  2FZG B;  2PVO B;  1B3Q A;  1JXM A;  3OYF A;  2QDL A;  3CPW A;  3D7S B;  4HXJ A;  2FB7 A;  1YWO A;  1RLP C;  4JS4 A;  2AHJ B;  2NUZ A;  3P8D A;  1WDX A;  2X9H A;  3CCU T;  1QP2 A;  5KCH A;  1VQ9 T;  1QW1 A;  1X2Q A;  2PZ1 A;  2JN0 A;  3MCA B;  1PHT A;  1OZ2 A;  5LJ5 d;  1Q86 R;  2BZX A;  3OMC A;  1K8A R;  4Z02 A;  4D6W A;  3OYI A;  3OS0 A;  2QI2 A;  5KYU B;  2CP5 A;  3QWX X;  2F5K A;  2QQS A;  3WXM B;  1D1C A;  1M1K U;  1X75 C;  4DQ2 A;  1ZBX A;  3QXE B;  5FRO A;  4M78 G;  3MP1 A;  3HFO A;  2AT1 B;  3DKM A;  5FLX E;  5GAN 7;  1VYV A;  2GNC A;  2RHU A;  3N5B B;  1LOJ A;  3CCV Q;  2QQA A;  2MWO A;  1VQM T;  3OQ5 A;  2KDS A;  3I35 A;  3M0U A;  3CCE T;  4HKE A;  3RIR A;  1OI1 A;  1K0S A;  1ZSZ B;  3J81 E;  2F2V A;  1O75 A;  1G5V A;  2QEX T;  1FWZ A;  1EIF A;  3ZEH A;  5I11 A;  1ZQ1 A;  3CCR T;  2EKO A;  2J6K A;  3E2U A;  3M58 A;  1YIT A;  2LZ6 B;  5GAO q;  1MHN A;  3L2W A;  4M7A F;  4A4H A;  3OYN A;  1M90 R;  1RAD B;  4J7I A;  3CCJ T;  3LLR A;  3HKS A;  5HY6 A;  2LT1 A;  4M75 B;  2NYS A;  2DJZ A;  5LJ5 g;  2OTJ T;  4YTL A;  1YHQ T;  2E4H A;  4ZGJ B;  5AYF A;  3G71 A;  4JPB W;  3CD6 A;  4N0A A;  4BI8 B;  2E6Z A;  4A4F A;  2JUF A;  2YUP A;  3JV3 A;  1JJ2 A;  1X6B A;  3OS2 A;  2DRM A;  3X25 B;  3L2Q A;  1YJ9 A;  3A8G B;  1SKU B;  2EYY A;  2ZPB B;  4BE1 A;  2CZ0 B;  4O5V A;  1LJO A;  2DL7 A;  2V8J A;  3NPF A;  4J83 A;  5FU7 B;  1NZ9 A;  1SEM A;  1VQK A;  4BY6 C;  3TEE A;  2FPF A;  1VQ4 T;  1ZSG A;  1RAE B;  1ABO A;  2EIF A;  5FWB A;  3NTH A;  3EH2 A;  4M77 F;  2YUO A;  2YSQ A;  2VWF A;  5J39 A;  1KSW A;  3MEU A;  1ZA2 B;  3VUB A;  4IIO A;  1GFD A;  2LP5 A;  4PLI A;  1Q81 U;  2QQB A;  2DYI A;  3BFM A;  2KXD A;  1YBY A;  3EGX B;  4DEX A;  2W0Z A;  4OB0 B;  2HMA A;  4TVR A;  1JBM A;  2OTL T;  1VQN A;  4D8K A;  4RTY A;  3H0I A;  3SHW A;  1AT1 B;  1K9M R;  3F70 A;  3OBY A;  1LVK A;  2ABL A;  4GBQ A;  1EX4 A;  4C0G A;  3LH5 A;  2A3L A;  3U23 A;  5KCO A;  1UG1 A;  4M78 B;  4ORZ A;  3HSB A;  1KJW A;  5GAN d;  3FLG A;  1W2B A;  1A0N B;  1B34 B;  3RKW A;  1J3T A;  2DM1 A;  3EGD A;  1UGP B;  5I22 A;  2DEU A;  3S6W A;  2E3I A;  1HSQ A;  3PIO A;  1TH7 A;  1WQ7 A;  4M4Z A;  4QVZ A;  4AG1 C;  3MEA A;  2V1Q A;  3OBW A;  3OSS C;  1UGR B;  3M4G A;  1ZBJ A;  2CP3 A;  3ME9 A;  2RQR A;  1HXD A;  3PNW C;  1PSF A;  3EHR A;  1KD1 U;  1Y96 A;  5DLO A;  3GOX A;  1NEG A;  2P4T A;  5ECA A;  4LNP A;  3O5Z A;  2EQI A;  1DJ7 B;  2LVM A;  3BDU A;  1YI2 Q;  5DY9 A;  3VS3 A;  2O01 E;  2Z0W A;  4LDU A;  4E47 A;  2CP0 A;  2DEQ A;  3FIF A;  2O4X B;  4Z89 A;  3DLM A;  1SRM A;  1N8R U;  5CKF A;  3OMG A;  3M5A A;  1UHC A;  3QII A;  3O8V A;  3EG9 B;  3CCS Q;  2X3W D;  5I21 A;  4CC2 A;  2KYM A;  5GAN g;  2GFA A;  1YIJ T;  5DLQ E;  4F14 A;  3MP6 A;  2QAZ A;  3NTI A;  4M7D B;  1I0C A;  3JB9 D;  1T3S A;  1GXI E;  1BI2 A;  1FMW A;  2XDB A;  3VS0 A;  4F17 A;  2DO3 A;  4A53 A;  3C95 A;  3X24 B;  4C8Q C;  2ENM A;  4E7I A;  4RCC A;  3WVE B;  4FIB A;  3QHS A;  1P92 A;  1MV3 A;  4KGV B;  1WI7 A;  4A54 A;  1VQ8 T;  2O31 A;  3JCM W;  4IUT A;  4PL6 A;  2I2L A;  2K2M A;  1LPL A;  2A36 A;  3UT1 A;  1QVG P;  4MZP A;  4FW2 A;  1QWF A;  4XTU A;  3MEV A;  4C92 D;  4OMO A;  4J6Y A;  1QVF A;  1RAG B;  1Y0M A;  2D8J A;  2EBP A;  4OGE A;  3J7A F;  2FVU A;  2M1H A;  3G6E A;  2CSQ A;  1KQ2 A;  1WXT A;  2LJ1 A;  1UEB A;  1M1K R;  1U8R A;  2RHI A;  4DEY A;  2LC4 A;  1UE9 A;  1OQK A;  2LT4 A;  1IRX A;  2HL5 C;  4Y28 E;  1S72 Q;  1RAH B;  4M7A G;  3HTR A;  2K2V A;  3VKI A;  1RAI B;  3V7S A;  2HZY A;  2YRC A;  2L3S A;  3V8K A;  1WHH A;  1ARK A;  1IXD A;  2RJD A;  2DLP A;  4PJJ A;  1TOV A;  4C92 A;  3CCV T;  5KYW A;  1W70 A;  4JRI A;  3INZ A;  4ZNX A;  3GP8 A;  4C8Q E;  3ZBD A;  1ZUU A;  1ZHI A;  5LJ3 e;  4PJL A;  2GTJ A;  3V8L A;  4DBQ A;  2FRW A;  2XD0 A;  2P0K A;  2K3Y A;  1F1B B;  4DBH A;  3OA6 A;  4IUQ A;  1V29 B;  4K11 A;  4RTW A;  1SRL A;  2DAQ A;  4L6V 5;  4M77 G;  4EDU A;  1QMC A;  2DBK A;  4NL2 A;  4IUV A;  2JMA A;  3C12 A;  2QQR A;  4KUI A;  3GNG A;  2KRO A;  3VS5 A;  2XKO C;  3OW2 A;  2RB6 A;  3LWI A;  4XU2 A;  3CC4 Q;  1MMG A;  4CI0 C;  4RKU E;  4EMK B;  4A63 B;  3LGL A;  1VQL A;  2KAF A;  1VIF A;  1JQQ A;  3SWN A;  1ZSZ C;  2AK5 A;  1YIT Q;  2IPO B;  1GBR A;  3ER0 A;  2DZC A;  1ZLM A;  1YN8 A;  4GLM A;  5FWC A;  2J6F A;  2L89 A;  5M9O A;  5GAN 6;  1AD5 A;  1IO6 A;  4FL6 A;  4QKU A;  1K73 C;  1JU5 C;  1JXO A;  3MKD A;  1PNJ A;  3T9N A;  2YT6 A;  1YJW T;  1N9S A;  3G71 Q;  4L5G A;  1BI3 A;  1X6O A;  3CD6 Q;  2PTK A;  2L2P A;  1Q81 R;  1I07 A;  1CSK A;  4OMN A;  4EMH A;  3NFC A;  5HK3 A;  5A0G A;  3HPW A;  3PMI A;  4PJO F;  1QP3 A;  3A8O B;  2EJF A;  1YJ9 Q;  4OGC A;  1BI1 A;  4X9D A;  1TUC A;  2MIO A;  3G4S A;  4FU6 A;  1VQK Q;  1QLY A;  3EFO A;  2GBQ A;  1M5Q 1;  2QQ9 A;  5FU7 C;  2RA2 A;  1YCY A;  2FRY A;  1KQS P;  4O6J A;  1BBZ A;  2K79 A;  1O9S A;  4M7A B;  1SHF A;  1H92 A;  3OB9 A;  3NHN A;  4AFS C;  4HCK A;  5GAN 5;  1OOT A;  4B9X A;  3M0T A;  3RER A;  2J06 A;  3SD4 A;  1VQN Q;  3PFS A;  3URG A;  3RES A;  5A2Q E;  5DM7 R;  2EJG A;  4HVV A;  3WVD B;  2OAW A;  4CC7 A;  1KD1 R;  3OYL A;  4RTT A;  4M75 E;  1WIE A;  4IKF A;  2LCL A;  1AWJ A;  2K5I A;  2KGT A;  5CQX A;  2CT4 A;  4KUL A;  2VVK A;  2FHD A;  3QO3 A;  5LJ3 f;  3JCM J;  2YLC A;  3OYG A;  4M75 G;  2GGR A;  1YI2 T;  5CKB A;  4M78 C;  2JS2 A;  1N8R R;  1NYF A;  4QW2 A;  5LJ5 j;  1E6G A;  4M77 B;  1K76 A;  2A28 A;  2JMC A;  4JUV A;  5KH6 A;  3CCM A;  4KBM B;  2M9U A;  1VQ7 T;  2DER A;  2JZ2 A;  2P4R A;  4RTU A;  3RMQ A;  5GAO m;  3KFV A;  1QVG S;  1KFZ A;  2VXE A;  4F7U F;  3GPL A;  2JW4 A;  3CCS T;  3E9F A;  1VUB A;  1V76 A;  2EW3 A;  1U06 A;  3RUX A;  2VYT A;  4XAX B;  2BIV A;  4ANJ A;  1OPK A;  5D7U A;  2EGC A;  1HYO A;  3OYM A;  1XTD A;  2XU8 A;  4C0D B;  3JCM h;  1R8O B;  2JTM A;  4MZT A;  3FDR A;  3KUF A;  2FPE A;  1UJY A;  2WSC E;  3AT1 B;  3OYB A;  2LQN A;  4LD9 K;  1AWO A;  1Q82 U;  1NEB A;  3KBG A;  3JCM X;  2HD0 A;  3UA6 A;  4XK8 E;  8AT1 B;  3A1P A;  4F16 A;  3HRT A;  5IXF A;  3MET A;  3UF4 A;  1D3B A;  4J9G A;  3TQ7 P;  2YRV A;  1M2V A;  4EIK A;  3EH1 A;  2QTV A;  3CBO A;  4JJB A;  4AG2 C;  2C0O A;  4XTZ A;  2KT8 A;  1BK2 A;  2FG0 A;  3JCM e;  1H3H A;  2RNA A;  2HSE B;  2EGA A;  3I56 Q;  1IGU A;  4M78 E;  2DJQ A;  1H8K A;  2MF2 A;  5AT1 B;  1K0X A;  5GMK e;  1TUD A;  5GAM h;  5CKE A;  2COW A;  3JB9 J;  3OYD A;  3VS2 A;  3HL8 A;  3OYH A;  2DL8 A;  1AEY A;  3V8J A;  5KYY B;  3CCQ A;  2E5Q A;  2QA4 T;  1S72 T;  2K5F A;  5C0M A;  3LWH A;  3M55 A;  3A5Z B;  2LTO A;  3EG2 A;  2FPD A;  1Y57 A;  2RI3 A;  4C5G A;  3G6E Q;  1B07 A;  1BIB A;  2OI3 A;  2BZ8 A;  3CMA A;  5FW9 A;  3CC4 A;  3UWN A;  2Y4Y A;  4Z88 A;  1YHQ A;  4J9B A;  2LDM A;  1V1C A;  5GAM e;  3M9Q A;  2G6F X;  2M51 A;  1AZE A;  2CH4 A;  4RMO A;  1C0M A;  5HK0 A;  4QVC A;  3CC7 A;  2YRD A;  4AFZ C;  5GAO r;  1VQP T;  3EG3 A;  1KIK A;  1WQW A;  9ATC B;  2KK4 A;  1OU9 A;  2KT1 A;  4FSS A;  3L2U A;  2V1R A;  4R0K A;  3I5R A;  4C8Q D;  2KQW A;  3R6O A;  1WXU A;  3REA B;  4XTX A;  3MJX A;  5GAN 4;  3UDC A;  2VV5 A;  1ZUK A;  1R0C B;  1BU1 A;  1WHM A;  3CPW P;  4Q5W A;  4PJO G;  1UHF A;  3OYC A;  5KYX B;  4DBF A;  4XTY A;  4ZGD B;  4M7D G;  2EFI A;  2V26 A;  1VA7 A;  3LH0 A;  1YIT T;  4J5Y A;  3OS1 A;  4ATO A;  3EG0 A;  3HRU A;  3L2Z A;  4QQD A;  3GIB A;  4FYW B;  2HQE A;  1KQS S;  2DTI A;  4JLG A;  5IHI A;  5LJ3 d;  3EG1 A;  4KT0 E;  5I2M A;  1IHW A;  2JJ9 A;  4C8Q A;  1ABQ A;  3G71 T;  4LDX A;  3CD6 T;  4FCY A;  2PVG B;  4L59 A;  3HP9 A;  4J9E A;  3M54 A;  2RF0 A;  2CH4 W;  3CPF A;  5J3B A;  2MCN A;  4IIM A;  4KH1 B;  1VQL Q;  3VJP A;  1XQH A;  1UGS B;  4E7L A;  1YJ9 T;  4E2F B;  3QYH B;  2EAY A;  1Q7Y C;  3JCM f;  1VQK T;  2KRS A;  3I55 A;  2ZZD A;  5CO7 A;  3X28 B;  4JRQ A;  2EVR A;  4XU0 A;  3BY7 A;  1Y71 A;  4WCI A;  1UGV A;  3H0H A;  3M0P A;  5FU6 C;  1D0X A;  3THK A;  2WAC A;  2ROT A;  4XQ3 A;  2A37 A;  4MMK A;  3SB2 A;  2NUP B;  1Q95 G;  3QDR B;  4ELZ C;  2JTF A;  4JRK A;  2ZAE A;  5LJ3 g;  5GAO l;  3G4S Q;  3VS4 A;  1PM3 A;  3MHX A;  2CS7 A;  1JJ2 P;  1VQN T;  2E41 A;  1PD1 A;  1C1A A;  1QVG A; 
#chains in the Genus database with same CATH homology
 1YFN A;  2NYS A;  1TWB A;  1ZSZ B;  1ZSZ A;  1OX9 A;  1OX8 A;  2QAS A;  1OU9 A;  1OU8 A;  1ZSZ C;  2QAZ A;  1OUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...