1OX9A

Crystal structure of sspb-ssra complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SQLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of degradation signal recognition by SspB, a specificity-enhancing factor for the ClpXP proteolytic machine
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase activator
molecule keywords Stringent starvation protein B
total genus 21
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ox9A00
2QAZA 1ZSZC 2QASA 1OU9A 1ZSZB 1OX9A 1OULA 1OX8A 1YFNA 2NYSA 1OU8A 1ZSZA 1TWBA
chains in the Genus database with same CATH superfamily
3SEMA 1GCQC 4BE1A 2LMJA 4JLIA 4J6WA 2NUPA 3OYLA 4MZMA 1O75A 5GAOn 2K3BA 1N27A 1OYXA 1R0BG 4IIOA 1MHNA 3G4ST 2KYMA 1M2VB 4DBRA 1NPPA 4ATOA 1D09B 1YJNT 1M27C 1VQ4Q 1BI1A 4LNPA 1VA7A 4M78B 3JB9J 3CCMQ 4IUUA 5GMKm 2RNAA 5IHNA 1X01A 2HBPA 3T9NA 1VQLQ 2JTMA 2QYZA 3HRTA 1KC8C 3GOXA 1WLPB 3MP1A 1BYMA 4M77G 1WNLA 2GTJA 3PT9A 3A1PA 1M90R 1VQNQ 2XICA 2C0OA 4C92C 3I56A 2W0ZA 2CUBA 5GMKe 3S6WA 2AHJB 2QK0A 2KGTA 4M77E 2JW4A 3META 3SB2A 2DILA 1YJNA 3OYDA 1W4SA 2GGRA 4HCKA 4OMQA 3V7CA 1WXUA 3RIRA 3JCMg 1QWEA 4LDYA 2XDPA 4C8QD 2BTTA 2XG8D 3H0FA 3RBBB 2OTLQ 1D0XA 3OBWA 3J81E 4L59A 2MWPA 4R56A 2QQRA 3NMZC 1FMKA 3WXMB 5CO7A 3CEYA 2HZYA 3CCQA 4QKUA 3L42A 4RTXA 1HSQA 4X9CA 4E7KA 2GTOA 5CAIA 2RQUA 4FL6A 2CZ1B 3RUXA 4M7DA 2LJ1A 3CXCA 5GAN7 1YI2T 2E70A 2K3XA 5GAN8 5FWBA 4AG2C 3CMEA 4HVUA 2R5AA 3C95A 1M90U 2KR3A 1K9MU 1Q81C 1AWJA 1TG0A 1JEGA 5D7UA 3D7SB 3VS4A 1PHTA 4C0DC 2AZVA 4OP0A 1EIFA 1YIJT 5KYNA 5J3BA 1G3SA 5KYWB 1U06A 3M57A 5CR2A 4XTVA 1JJ2P 5FLXE 1RLPC 2M02A 3NTIA 4K11A 1MMNA 1M9SA 2OTLA 4M7DF 4FW1A 4BD3A 2HL5C 2LP5A 3CMAT 3EAEA 1UHFA 2LVMA 3CC2A 2D6FA 3VUBA 2LCSA 4XTXA 4KGZB 4GBQA 5D6WA 4J9GA 2RQVA 4JRKA 1HD3A 1I5OB 1B34B 2RHZA 2EIFA 4M75F 1KG1A 5GAN6 1BI0A 1YCSB 4F14A 3BDUA 2WSCE 2YUNA 2CP2A 1UDLA 1YFNA 3QWXX 4NS5A 2EAYA 1HXDA 2JN0A 4OB2B 1TWBA 1RABB 2X4JA 3E9GA 3GF5A 3JCMP 2PU9B 3REAB 2EWNA 3CMAQ 2DETA 4DEYA 1D0ZA 3OW2P 3PIOA 2PUOB 3JCMb 1K9AA 1IGQA 4WTOB 1Q81R 2L0AA 3CPFA 3UA6A 1PKTA 4NL2A 3SHWA 3PTAA 1SEMA 2DVJA 5LJ5f 1Q82U 1M1KC 5IT9E 1M3CA 1IGUA 2R58A 1FYNA 2CH4A 2DZ9A 5GANh 5KCOA 3EFSA 1B07A 1QWFA 4PJJA 3P8BB 4FW2A 2RM4A 3JCMc 4LD6A 1GL5A 1SRMA 3M59A 5FU7C 4X1VA 3CC4Q 1VQMA 2DO3A 1KQ2A 2B8AA 3CPWA 1T3LA 1AT1B 3P8HA 2PVOB 2E65A 1D3BA 2H3JA 2XKOC 1GBQA 3ULRB 4CRIA 2Y90A 4EDUA 4ORZA 5C6SA 2HSPA 4Y91A 4F7UG 4M7AC 2QDLA 4DBFA 2RN8A 3OSSC 3ME9A 3J7AF 3UWNA 2DD4A 2JT4A 5KYUA 3M0TA 2ZPIB 4M78A 4BE0A 1RAEB 4J9CA 5LJ3g 4BI8B 5IAYA 4PFOA 4M7AA 3EGXB 2WSEE 3JV3A 3EG3A 1S72T 1IRXA 4N4HA 4PK4A 1KC8U 5C0MA 2V8IA 4OGEA 1G2BA 1VQ9T 2J6FA 1IHVA 5HK3A 3VYHB 3QDFA 2A37A 1VQ8A 4C92E 3DKMA 1C1AA 2EYYA 1CSKA 2CP3A 1MV3A 8AT1B 2DIQA 3CCSA 2F2VA 1ZUUA 2DLPA 2V26A 1BCOA 2GFAA 1UFFA 2Y4XA 2RHUA 3EG1A 2K9GA 3OYBA 3DB3A 2DL5A 3S3NA 3EH1A 3CC2Q 1QVPA 5GMKh 4EPCA 2KI7A 3JAME 2EQKA 2KK4A 5LJ5g 4M7AE 1VQ5A 1OZ3A 2ZPGB 9ATCB 5FW9A 1C6VX 4KRTA 4M75C 2J7IA 3UDCA 2E3HA 4F7UE 3RERA 3EFOB 3P8DA 3I9QA 1N9SA 1WHMA 1Y7XA 3CCVA 4QW2A 2K57A 3VS2A 2JTFA 2C0IA 3OS5A 2FPDA 1VQ5Q 2FEIA 1QQJA 2GCXA 1LJOA 2HNIA 2DL3A 1IB8A 3CPWS 3JRZA 2F69A 4OMPA 4E7HA 2RD1A 2CZ6B 4KULA 1G8XA 2OTLT 4IKFA 1TXQA 1H8KA 4QVDA 1Y57A 2KXDA 3KBGA 4DEXA 3VYGA 1IZ6A 4OGCA 3ZEHA 1VQ4A 4N0AA 2MCNA 5KYYA 2P84A 4PFPA 1VQ7A 3FLGA 2KEAA 4C92B 3SWNC 2E12A 2GBQA 1G5VA 1K76A 2O9SA 3SFMA 1YJ9A 5GAN2 3EGDB 1XQHA 3I56T 2CKKA 1W2BP 1TTHB 4QQDA 1WZOA 2PVGB 4OB1B 2JMCA 3GBQA 4N4GA 3M56A 3ZFJA 2R5MA 4EMHA 2DBKA 3MCAB 2QQAA 3CCUQ 1A0NB 2WSFE 1KSWA 2K4YA 3A8MB 1OPLA 2VXFA 1VQKA 4OMLA 2LDMA 2NYSA 2BIVA 2ABLA 1NE8A 3OYJA 2CYZB 1CKBA 4FYYB 2QDYB 1MGQA 1Q7YU 1D0YA 2GF7A 5A0GA 4C5HA 3QIIA 3OYYA 3CCLQ 2DE0X 4JDSA 2EJGA 3H41A 3MJXA 4B9XA 4FYVB 1WJRA 1N8RU 5M9OA 2K2MA 4KUIA 4AMCA 1ABQA 1ZSZB 4C8QG 3CPWP 1UUEA 3CBPA 1RLQC 2XDDA 2M1HA 1QVFS 3EHQA 4QT7A 1K1ZA 2JVVA 4OB0B 3URGA 2HQXA 5FRNA 1N6AA 4OB3B 1YNZA 4KUDK 3M4GA 4JRIA 5CKBA 3C12A 1RAGB 4M7AG 1VYVA 4XTYA 5I2SA 4F16A 4NOYA 3VS0A 1EFNA 2GFUA 3MPUB 1M2OA 3REBB 1VYUA 1M8VA 2RF0A 4PJOE 1YITQ 2QEXT 3CCJT 3FRNA 5AYFA 1QKWA 1NJIC 1G3WA 3I5SA 2VASA 5GANj 1VQ8T 1VQ6T 1K73C 2HKNA 4M7AB 1ZHIA 6AT1B 1LNXA 3UA7A 4JS5A 2EJFA 1ZBXA 1AWWA 3G4SA 4OMFB 5GANe 4M77B 4XQ3A 1OX8A 3L2QA 1NEGA 3LWHA 2L8DA 1TSFA 1BCMA 2FPFA 1JBMA 2DK3A 3CD6T 1W1FA 1YJ9Q 3VS5A 5I2MA 1NZ9A 1Y07A 5IH2A 3FB9A 1VQ5T 1NYGA 3H8ZA 4XU0A 1Y96B 4WCIA 1QKXA 2PQWA 4Q5WA 2DX1A 4XU1A 1GBRA 4DBQA 2E5KA 2DD5A 1WQWA 3OYNA 3UATA 3RKWA 3CC4T 4M78E 5GMKl 1TS9A 1VQ6Q 1V29B 2GNCA 2M0YA 1PSEA 4MMKA 2BE9B 4M77D 1OU8A 4JZ4A 1YN8A 4FYWB 1BU1A 5A0DA 3VJPA 4AFZC 1YITT 1Q86R 3O8VA 2EQUA 1QVFA 3V8KA 4AT1B 2J06A 3S3MA 1KD1U 2JXBA 1U1TA 3QPHA 1VQ7T 1N9RA 1LVKA 3DLLA 3LH5A 2YUOA 4A54A 3G6EA 2RPNA 2DTIA 3L1AA 3M54A 3TU4K 1XJWB 3M58A 1LOJA 3UF4A 3CC4A 4E2FB 1I8FA 1ZA2B 3JB9H 2NUTA 3DB4A 5GAOp 2FO0A 4FM4B 3EFRA 1Q86C 2MAMA 3MO8A 4PJLA 1PCXA 3TCJA 4M78D 4PJOA 1S72Q 2CREA 4PL6A 5GAOr 2ROTA 4X34A 2LCLA 5CIUA 5EC7A 1VQKQ 4EIKA 1OX9A 1YJWT 1JB0E 1FX7A 5GAMj 2QQSA 4PJOC 2OI3A 2P0QA 4JJCA 4CI0C 1QVGA 3CD6Q 1VQOA 1OI1A 2JM9A 3LGLA 2K5FA 3CC7T 4M7DC 4C0ZA 1KD1C 4JRPA 2KBTA 2LJ0A 1KHIA 4C5GA 1KQSA 3MEWA 2KYBA 1QP2A 3QZ5B 1VQOQ 3PIPA 2J6KA 2C06A 4P5NA 4XU3A 2DVEA 3I55Q 4FSSA 1UEBA 1I0CA 1I07A 1UTIA 2FHDA 2BE7D 2VKNA 1YP5A 2L3PA 4L6V5 1TU0B 4KH0B 1S1NA 1Q7YR 2HCKA 3LLRA 5KYUB 2EJ9A 2DXCA 2EVRA 1K73U 3VUZA 5LJ3d 2Z0WA 2KSSA 2X3XD 1YI2Q 4FU6A 2VVKA 3OYFA 2QA4T 4E7ZA 4ZNXA 2PZ1A 4Z8AA 1G3YA 4M77F 3R6OA 3M0UA 1N8RR 2LNHB 2KY9A 1AVZC 1E6HA 2NLUA 1VQ4T 2D8HA 5KE3A 1M2VA 1RL2A 2VV5A 2YHTA 4OMMA 1Y0MA 1K73R 1IO6A 2BZXA 2OTJQ 4RTYA 2QGGA 4PNOA 1X27A 2ZPEB 4J9FA 5FU6C 5HKCA 1CKAA 5ECAA 3I5RA 2EQMA 1SF9A 4R55A 4M7AD 1SRLA 3RNJA 2LTOA 1M1FA 3QYGB 4C0GA 2FRYA 3LGFA 1ZLMA 2YSQA 1SSFA 2CT4A 4DBHA 4F7UA 4ZN3A 2K2VA 2FB7A 3CCSQ 1WYXA 3JCMJ 2EPDA 1N8RC 2HBWA 1HYOA 2JS2A 2RI2A 3PNWC 2FPEA 5CQYA 4F17A 2WACA 2DZCA 4J6YA 1U3OA 2CSIA 1QVGS 3VKIA 4J9BA 4AFQC 1VOMA 3PMTA 4KGVB 5A2QE 4ELZC 3JCMf 2CT3A 3LWIA 1W2BS 1JXMA 1KFZA 2RJFA 2ZPBB 1AZGB 4XK8E 1EX4A 2YUQA 4LDWA 3OYMA 4PLLA 2XHCA 5GAOq 4FT2A 5DY9A 5GANf 1MV0B 2M0OA 2ZCFB 1K8AC 2ED1A 5I21A 1YIJA 2RB6A 2M16A 1XNIA 3FJ5A 3I56Q 3V7RA 2A36A 2LJ3A 3EG9B 3HRUA 1H3ZA 1BIAA 4ESRA 2YT6A 2DL7A 4M78C 2RJCA 3GLXA 3NHNA 2OJ2A 1AWOA 1JXOA 3QYHB 2MWOA 2A28A 2ZPFB 1ZSGA 1V1CA 3M0SA 5GMKi 4NL3A 2LX9A 1ZA1B 3JCMV 1MMDA 3MP8A 2L3RA 1I5LA 3X25B 2KDSA 3INZA 4M75E 3G1JA 4RG2A 2EQJA 3A8GB 4MDXA 4AFSC 1Z9QA 1FMWA 3QJYA 4HA8A 1VQ8Q 2DNUA 1IXDA 2JOYA 2VYTA 4QQ6A 1U8RA 4ZTFA 5L23A 4JZ3A 4RTWA 1OPKA 4C0DB 1K9MC 1LPLA 1PM3A 1ZQ1A 4JLGA 2J05A 2RH2A 5FROA 3OS1A 1YJWA 2LZ6B 1G3TA 4BDZA 3CCLA 1QVGP 3JB9F 1QP3A 5L8RE 3HPWA 3CC7A 1KC8R 2O31A 2RA2A 2YRDA 5GAOl 3CCQT 3OB9A 2XDBA 4JJBA 2NUPB 2P4TA 1S72A 2DEUA 2QTVA 3BDLA 1VQPA 2BUDA 3BFMA 1JRIA 2R57A 3QJ6A 2HEQA 3A5ZB 3GNFB 1M90C 4RG8A 1RAIB 2X4XA 3JB9I 4KBMB 2X9HA 1M1GA 4A4HA 4O6JA 2E64A 5IHKA 1Q95G 2HMAA 1QCFA 2L89A 3L2WA 4DOVA 1SHGA 4PKCC 4JS4A 4J7IA 3EG0A 4A4EA 1YHQA 1T0JA 3LH0A 2E6ZA 3V8JA 2DEQA 2EYZA 1JJ2A 2YXYA 5GAOm 3QXEB 2D8JA 3SWNA 2IPOB 1I1JA 3H6ZA 3L2ZA 1M4ZA 1NPRA 2LX7A 4PJMA 3JCMh 4IUVA 1OV3A 1KHCA 2VB6A 1R8OB 3JCMW 3BY7A 3CMEQ 1NLOC 3TREA 3JB9G 2DJQA 5CVIA 3TSZA 4RCCA 3TVTA 2E41A 1Z9ZA 4LXCA 2P4RA 3RKYA 5HCKA 4RUGA 2QA4Q 2QAZA 3CCUT 3EH2A 3A8LB 4HVVA 4HKEA 1YHQT 2MMPA 2ZPHB 3OYIA 2EYXA 3Q1JA 1H641 1WQ7A 1QLYA 2LQWA 5FRMA 2KNBB 5DLOA 4C8QC 2HDAA 4E7IA 2EBPA 3DLMA 1GXIE 1Y96A 3EGXA 3ASKA 3UT1A 3OW2A 1SSHA 3TEEA 1WHGA 4OMNA 4C8QA 3PVQA 1D1CA 3H0IA 2YRCA 1VQOT 1OEBA 2DRKA 4C92D 4XTWA 2QI2A 2LNVA 4HXJA 5GAN3 2VC8A 2KQWA 2RK2A 4FYXB 4MZTA 2KRNA 2G3RA 1HK9A 2PNIA 1DJ7B 4M78G 1M5Q1 2IVWA 2E6NA 1ZUYA 2V8JA 3OYCA 1AD5A 4M7DD 5GAMf 4BE2A 2GQVA 3L2UA 2QQBA 1KQSP 3JCMX 2SRCA 3I35A 2KRMA 4OMOA 4ZGJB 4E6RA 4M4ZA 3A8OB 3CXCP 4Z88A 4E7SA 4LDVA 1AWXA 4ANJA 1ARKA 1FWZA 2QEXQ 3CCJQ 1W70A 2X51A 1X6OA 5KE2A 1ACMB 3QZ9B 4PJOB 2DRMA 1W6XA 5LJ5e 5J39A 3EHRA 1SHFA 3EG9A 2DYIA 3CBMA 3G71T 3CCRA 2F2XA 3J80E 1YIJQ 1Q7YC 1G83A 1E6GA 2JS0A 2MIOA 1PRLC 2DKGA 4FCYA 3HRSA 1HJDA 1RI0A 2KMTA 4A4FA 1WHHA 1UGRB 4GY5A 2QTXA 4JRQA 4CC4B 3TSWA 1FMVA 2GQIA 3MKDA 5GAMh 1UECA 4C92G 1WGSA 4EMGA 3ER0A 1KJWA 4GLMA 3BW1A 4A4GA 1UHCA 3E1SA 1PWTA 1Y71A 3VRYA 4D8KA 2D0QB 2HQHA 2KXCA 1VQNA 3PVLA 1KK7A 1FXXA 2FRWA 2LT1A 3I55A 1TUCA 2DPPB 3G71A 2YLCA 3CCRT 1WJQA 5GAMe 3M0PA 4RCBA 3ZL7C 2DL4A 2DFUA 3N5BB 2KT8A 3NFCA 1VQLA 1UJYA 1KD1R 2EKOA 2DA9A 2EKHA 4J9DA 3G71Q 1ZX6A 4D6WA 1AEYA 4LUDA 2AKLA 2DXUA 2XK0A 3QBYA 1B34A 1OQKA 1PNJA 4A63B 2RHYA 4LE9A 4WF2A 2D0NA 1PD0A 2RI5A 2EGEA 1GFCA 1VQNT 2MI6A 3QDRB 2XI9A 1E7OA 7AT1B 5LJ3j 3U23A 2LC4A 2DERA 3QKJA 4N4IA 1WX6A 4M75D 4BB7A 1YI2A 2H8HA 4DA4A 1VQLT 2F1LA 1J3TA 1UE9A 2ESWA 3CCVQ 3HHTB 3CMET 4F7UB 2AK5A 1GCPA 1SPKA 4UC4A 1PKSA 5LJ3h 1TOVA 1QW1A 2XMFA 3MHXA 3SWNB 3HFNA 1SKUB 2LQ8A 4DOWA 2SEMA 1WXTA 2CP0A 1KQ1A 3PFSA 2COYA 3X24B 4JUVA 4FT4A 3VS6A 5HY6A 2O2OA 1PD1A 1PRMC 4X9DA 1ZUKA 3GPLA 2DMOA 3RESA 1O9SA 2CZ7B 2JUFA 4LDXA 5IN1A 4M75B 5HK0A 2H3EB 2L3QA 1K8AU 3H0HA 3NTKA 2CP6A 3MP6A 3CCLT 4LDUA 1KIKA 2AT1B 4KGXB 4M77C 1OOTA 3NGPA 4M78F 4BDYA 3X28B 4EMKC 2HAXA 2CP5A 1RAHB 2DXTA 2EGAA 2YDLA 2AKKA 1I81A 5I11A 4M77A 4M7DB 1RI9A 4PLIA 4CC3A 4BACA 4EMKA 1C0MA 2C0TA 4CC2A 1YJNQ 4RTTA 3KXTA 2EW3A 3QG1A 3THKA 2HL3A 1Q81U 1R77A 4FIBA 1P92A 4J9HA 4CC7A 3PGGA 2CSQA 2MOXA 3RDVA 4ZN1A 2KE9A 2E5QA 2QQ9A 1NLPC 5KYWA 3OS0A 4C5EA 2RMOA 4Y92A 1WHJA 5CKDA 2X3WD 2BKDN 3VS1A 5GJVB 1BIBA 2JMAA 1VQMQ 1OZ2A 1K0XA 3JB9D 3HTRA 1UB4A 3OYKA 2QASA 2O88A 4ZGDB 4IURA 2OX7A 1VQMT 3CCMA 1GCQA 2RQRA 3SDZA 2KROA 2OAWA 3M4YA 3OMGA 2RHXA 3EG2A 3L2VA 3V7SA 2DM1A 4JJNK 4MZPA 4J83A 4PJNA 2O9VA 4IUPA 2DL8A 2QXFA 2DTHA 4O5VA 2EYQA 1X43A 3PMIA 2CS7A 1K4US 3OYAA 4BY6B 4M7DG 2FL7A 4QVZA 2B86A 5IHIA 3UPUA 3CMAA 2J6OA 5KYXB 2AZSA 3CD6A 1YBYA 3PE0A 3CC2T 4M7DE 5A0LA 3WVDB 2YLBA 1M3BA 4ELYC 3IQLA 3C0CA 1ZSZA 4C92A 4C5IA 3VS7A 3S3OA 2HQEA 3VS3A 5CK9A 2P0KA 3CC7Q 2Y4YA 1X2QA 5GMKj 2HD0A 2PTKA 2X4YA 3CCST 3ZBDA 1ZSZC 2QA4A 1YJWQ 1YWOA 1K8AR 2DTOA 3E19A 3CCEQ 3MEUA 1D3BB 2ZZDA 3CQTA 1B3QA 1Q82R 2RQTA 5IXFA 4QVCA 4C8QF 1M1KR 5CKEA 5GAN4 5LJ5d 2E4HA 2RHIA 4B6MA 3FC3A 4Z02A 2E1HA 1GRIA 2I0NA 4AFUC 5CKFA 1VYTA 2V1RA 4VUBA 2CZ0B 2EQIA 3V8LA 3CCVT 2MPXC 5FWCA 1UG1A 4JPBW 3HP9A 3FIFA 5DLQE 1H3HA 5KH6A 4IUTA 1AOJA 2I2LA 3TQ7P 4TVRA 3FEOA 3HL8A 1VQPQ 2K3YA 1BBZA 2ROLA 3QO3A 2RQWA 1EZZB 2O4XB 8ATCB 5LL6S 1N5ZA 2QGFB 2K7AA 2DXBA 4BY6C 4E47A 1OU9A 1RACB 3CCUA 1M1KU 2AIRB 3BE3A 1K9MR 2HSEB 1RUWA 3RMSA 2OTJT 2LCCA 1XOVA 3F70A 4HT8A 1MUZA 2JM8A 3CCRQ 4L5GA 2ED0A 2F5TX 2VUBA 4LUEA 1KQSS 1T3SA 3EFOA 4BI3A 5IXBA 5D6YA 1VQKT 2A7YA 1PSFA 2K5IA 4RMOA 4J7FA 2RK1A 5LJ5h 1MMGA 2ZAEA 3CXCS 3OY9A 2A3LA 4HCZA 5GAMg 1ABOA 3AT1B 5CCAA 1UJ0A 2DAQA 5GAMd 2FZKB 1JU5C 1TUDA 4OF1A 1K0SA 5D6XA 2E10A 4HCBA 1VIFA 2NWMA 3GIBA 3OS2A 1VQPT 1WDXA 1JO8A 1BI2A 3NPFA 2DBMA 3MEAA 1NM7A 4AG1C 1NJIU 3CBOA 1QVFP 1RADB 3LYIA 1QMCA 1AZEA 1UGPB 2CGHA 1R0CB 1JJ2S 3OMCA 2KT1A 1JQQA 3QWYA 3G7ZA 1UGQB 3G4SQ 1RAFB 4C0FA 3HSBA 3A98A 2DJZA 2M51A 1QCNA 1VIEA 1D1AA 2MYSA 1U1SA 1NEBA 5EG2A 1X6BA 2K79A 3A8HB 3VV0A 4D8DA 1BK2A 4R0KA 3MEVA 2FZGB 2OAUA 3M55A 4DQ2A 3SD4A 4II1A 2ECZA 1NYFA 3KFVA 3WVEB 2RJEA 4ZTJA 3VRZA 3JCMQ 3HFOA 2L2PA 4BI4A 1UGSB 5GAN5 1VUBA 5KYXA 2NUTB 3M0QA 1U5SA 1WA7A 1X75C 2PVDB 3OW2S 4M7AF 2ATCB 3VU3C 4PJOF 3KUFA 2FZCB 3X20B 1OULA 3M5AA 1MNDA 2CH4W 2M9UA 1UGVA 3LX7A 4XTZA 3E9FA 2RO0A 2HKQB 1WHKA 2XU8A 1ZBJA 3JCMe 4PFZA 4YTLA 3CCEA 1GFDA 4QQGA 4OVAA 4F04B 2A08A 1YHQQ 3AHUA 2COZA 4MMLA 5CQXA 3M9QA 2MF2A 3OYGA 3I55T 1NJIR 4LN2A 4JJDA 3OBYA 1X69A 4XAXB 3NTHA 4BUGA 3H9NA 4M75A 2LQKA 4F7UF 2KRSA 3CCMT 4J9EA 2JNGA 3JCMd 1WFWA 1WIEA 1T0HA 5LJ3f 3M53A 1BKBA 2V1QA 5GANd 3M0RA 1H92A 5GANg 4J9IA 3OYHA 1NG2A 1NBEB 4A53A 2BZ8A 2X4WA 3FJPA 4KT0E 3HKSA 4HCCA 1X2KA 5AT1B 3G6ET 4MDWA 2XD0A 4PJOD 1XTDA 1LCKA 4EMKB 1D1BA 4N0AC 2EYWA 2VWFA 4XU2A 5FU6B 2QG9B 4HT9A 1IHWA 4ME7A 1WI7A 1W2BA 2KVQG 2RI3A 2CP7A 1V76A 2ZGWA 3O5ZA 2O4XA 2XIDA 4C8QE 2X35A 4RTUA 1VQ7Q 3C4SA 2P0PA 4HVWA 4FSXA 4IIMA 4C8QB 1WXBA 2YWWA 3JSCA 2EGCA 2JTEA 3OA6A 3RMQA 2K6DA 2CDTA 2FG0A 1AHJB 2PUKB 4IUQA 2L5QA 1IREB 3X26B 3FDRA 2G6FX 4C92F 2D1XA 2E3IA 4J5YA 3OQ5A 4RTVA 2A0FB 5LJ3e 2QEXA 3CCJA 1RAAB 2MK5A 1MMAA 1MNEA 1WJSA 2KAFA 1YJ9T 3C94A 4V2SA 1VQ6A 4B9WA 2VGMA 2FYKA 5DM7R 3GP8A 2VXEA 1YCYA 1B7TA 2RJDA 5CKHA 3RKXA 1M3AA 1Q82C 4A4KA 4J6XA 3CCQQ 4XTUA 1BI3A 2IG0A 1X6GA 5I22A 2LQNA 2YRVA 3OSVA 2ENMA 4KH1B 3QUIA 3EGUA 3E2UA 3LW5E 3OYEA 1TH7A 5GJWB 3L2RA 1TUGB 1VQ9A 2CUDA 4RKUE 2LT4A 2V8KA 1WHLA 2IIMA 2COWA 2JJ9A 4Y28E 1M30A 3R6NA 5KYYB 4PJOG 2VGNA 4LD9K 2OTJA 4ZGEB 1F1BB 2L3SA 1PC0A 1SG5A 4J8OA 2D9TA 4M75G 3QSUA 4RTZA 2DYBA 1M8MA 5FU7B 3EGDA 2DIGA 2DF6A 2W10A 4E7JA 1YITA 1YWPA 2BZYA 2LRQA 3RR6A 2JZ2A 3GNGA 4GLKA 1QCOA 2K5LA 1VQ9Q 2O01E 1WPYA 2NUZA 2F2WA 3CCET 2EFIA 2YUPA 5LJ5j 1I4K1 4E7LA 2FVUA 3G6EQ 1Q86U 4Z89A 5KCHA 2F5KA 1PG5B 1BB9A 3QHSA 5J26A
chains in the Genus database with same CATH topology
2QAZA 1ZSZC 2QASA 1OU9A 1ZSZB 1OX9A 1OULA 1OX8A 1YFNA 2NYSA 1OU8A 1ZSZA 1TWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAZ A;  1ZSZ C;  2QAS A;  1OU9 A;  1ZSZ B;  1OX9 A;  1OUL A;  1OX8 A;  1YFN A;  2NYS A;  1OU8 A;  1ZSZ A;  1TWB A; 
#chains in the Genus database with same CATH topology
 3SEM A;  1GCQ C;  4BE1 A;  2LMJ A;  4JLI A;  4J6W A;  2NUP A;  3OYL A;  4MZM A;  1O75 A;  5GAO n;  2K3B A;  1N27 A;  1OYX A;  1R0B G;  4IIO A;  1MHN A;  3G4S T;  2KYM A;  1M2V B;  4DBR A;  1NPP A;  4ATO A;  1D09 B;  1YJN T;  1M27 C;  1VQ4 Q;  1BI1 A;  4LNP A;  1VA7 A;  4M78 B;  3JB9 J;  3CCM Q;  4IUU A;  5GMK m;  2RNA A;  5IHN A;  1X01 A;  2HBP A;  3T9N A;  1VQL Q;  2JTM A;  2QYZ A;  3HRT A;  1KC8 C;  3GOX A;  1WLP B;  3MP1 A;  1BYM A;  4M77 G;  1WNL A;  2GTJ A;  3PT9 A;  3A1P A;  1M90 R;  1VQN Q;  2XIC A;  2C0O A;  4C92 C;  3I56 A;  2W0Z A;  2CUB A;  5GMK e;  3S6W A;  2AHJ B;  2QK0 A;  2KGT A;  4M77 E;  2JW4 A;  3MET A;  3SB2 A;  2DIL A;  1YJN A;  3OYD A;  1W4S A;  2GGR A;  4HCK A;  4OMQ A;  3V7C A;  1WXU A;  3RIR A;  3JCM g;  1QWE A;  4LDY A;  2XDP A;  4C8Q D;  2BTT A;  2XG8 D;  3H0F A;  3RBB B;  2OTL Q;  1D0X A;  3OBW A;  3J81 E;  4L59 A;  2MWP A;  4R56 A;  2QQR A;  3NMZ C;  1FMK A;  3WXM B;  5CO7 A;  3CEY A;  2HZY A;  3CCQ A;  4QKU A;  3L42 A;  4RTX A;  1HSQ A;  4X9C A;  4E7K A;  2GTO A;  5CAI A;  2RQU A;  4FL6 A;  2CZ1 B;  3RUX A;  4M7D A;  2LJ1 A;  3CXC A;  5GAN 7;  1YI2 T;  2E70 A;  2K3X A;  5GAN 8;  5FWB A;  4AG2 C;  3CME A;  4HVU A;  2R5A A;  3C95 A;  1M90 U;  2KR3 A;  1K9M U;  1Q81 C;  1AWJ A;  1TG0 A;  1JEG A;  5D7U A;  3D7S B;  3VS4 A;  1PHT A;  4C0D C;  2AZV A;  4OP0 A;  1EIF A;  1YIJ T;  5KYN A;  5J3B A;  1G3S A;  5KYW B;  1U06 A;  3M57 A;  5CR2 A;  4XTV A;  1JJ2 P;  5FLX E;  1RLP C;  2M02 A;  3NTI A;  4K11 A;  1MMN A;  1M9S A;  2OTL A;  4M7D F;  4FW1 A;  4BD3 A;  2HL5 C;  2LP5 A;  3CMA T;  3EAE A;  1UHF A;  2LVM A;  3CC2 A;  2D6F A;  3VUB A;  2LCS A;  4XTX A;  4KGZ B;  4GBQ A;  5D6W A;  4J9G A;  2RQV A;  4JRK A;  1HD3 A;  1I5O B;  1B34 B;  2RHZ A;  2EIF A;  4M75 F;  1KG1 A;  5GAN 6;  1BI0 A;  1YCS B;  4F14 A;  3BDU A;  2WSC E;  2YUN A;  2CP2 A;  1UDL A;  1YFN A;  3QWX X;  4NS5 A;  2EAY A;  1HXD A;  2JN0 A;  4OB2 B;  1TWB A;  1RAB B;  2X4J A;  3E9G A;  3GF5 A;  3JCM P;  2PU9 B;  3REA B;  2EWN A;  3CMA Q;  2DET A;  4DEY A;  1D0Z A;  3OW2 P;  3PIO A;  2PUO B;  3JCM b;  1K9A A;  1IGQ A;  4WTO B;  1Q81 R;  2L0A A;  3CPF A;  3UA6 A;  1PKT A;  4NL2 A;  3SHW A;  3PTA A;  1SEM A;  2DVJ A;  5LJ5 f;  1Q82 U;  1M1K C;  5IT9 E;  1M3C A;  1IGU A;  2R58 A;  1FYN A;  2CH4 A;  2DZ9 A;  5GAN h;  5KCO A;  3EFS A;  1B07 A;  1QWF A;  4PJJ A;  3P8B B;  4FW2 A;  2RM4 A;  3JCM c;  4LD6 A;  1GL5 A;  1SRM A;  3M59 A;  5FU7 C;  4X1V A;  3CC4 Q;  1VQM A;  2DO3 A;  1KQ2 A;  2B8A A;  3CPW A;  1T3L A;  1AT1 B;  3P8H A;  2PVO B;  2E65 A;  1D3B A;  2H3J A;  2XKO C;  1GBQ A;  3ULR B;  4CRI A;  2Y90 A;  4EDU A;  4ORZ A;  5C6S A;  2HSP A;  4Y91 A;  4F7U G;  4M7A C;  2QDL A;  4DBF A;  2RN8 A;  3OSS C;  3ME9 A;  3J7A F;  3UWN A;  2DD4 A;  2JT4 A;  5KYU A;  3M0T A;  2ZPI B;  4M78 A;  4BE0 A;  1RAE B;  4J9C A;  5LJ3 g;  4BI8 B;  5IAY A;  4PFO A;  4M7A A;  3EGX B;  2WSE E;  3JV3 A;  3EG3 A;  1S72 T;  1IRX A;  4N4H A;  4PK4 A;  1KC8 U;  5C0M A;  2V8I A;  4OGE A;  1G2B A;  1VQ9 T;  2J6F A;  1IHV A;  5HK3 A;  3VYH B;  3QDF A;  2A37 A;  1VQ8 A;  4C92 E;  3DKM A;  1C1A A;  2EYY A;  1CSK A;  2CP3 A;  1MV3 A;  8AT1 B;  2DIQ A;  3CCS A;  2F2V A;  1ZUU A;  2DLP A;  2V26 A;  1BCO A;  2GFA A;  1UFF A;  2Y4X A;  2RHU A;  3EG1 A;  2K9G A;  3OYB A;  3DB3 A;  2DL5 A;  3S3N A;  3EH1 A;  3CC2 Q;  1QVP A;  5GMK h;  4EPC A;  2KI7 A;  3JAM E;  2EQK A;  2KK4 A;  5LJ5 g;  4M7A E;  1VQ5 A;  1OZ3 A;  2ZPG B;  9ATC B;  5FW9 A;  1C6V X;  4KRT A;  4M75 C;  2J7I A;  3UDC A;  2E3H A;  4F7U E;  3RER A;  3EFO B;  3P8D A;  3I9Q A;  1N9S A;  1WHM A;  1Y7X A;  3CCV A;  4QW2 A;  2K57 A;  3VS2 A;  2JTF A;  2C0I A;  3OS5 A;  2FPD A;  1VQ5 Q;  2FEI A;  1QQJ A;  2GCX A;  1LJO A;  2HNI A;  2DL3 A;  1IB8 A;  3CPW S;  3JRZ A;  2F69 A;  4OMP A;  4E7H A;  2RD1 A;  2CZ6 B;  4KUL A;  1G8X A;  2OTL T;  4IKF A;  1TXQ A;  1H8K A;  4QVD A;  1Y57 A;  2KXD A;  3KBG A;  4DEX A;  3VYG A;  1IZ6 A;  4OGC A;  3ZEH A;  1VQ4 A;  4N0A A;  2MCN A;  5KYY A;  2P84 A;  4PFP A;  1VQ7 A;  3FLG A;  2KEA A;  4C92 B;  3SWN C;  2E12 A;  2GBQ A;  1G5V A;  1K76 A;  2O9S A;  3SFM A;  1YJ9 A;  5GAN 2;  3EGD B;  1XQH A;  3I56 T;  2CKK A;  1W2B P;  1TTH B;  4QQD A;  1WZO A;  2PVG B;  4OB1 B;  2JMC A;  3GBQ A;  4N4G A;  3M56 A;  3ZFJ A;  2R5M A;  4EMH A;  2DBK A;  3MCA B;  2QQA A;  3CCU Q;  1A0N B;  2WSF E;  1KSW A;  2K4Y A;  3A8M B;  1OPL A;  2VXF A;  1VQK A;  4OML A;  2LDM A;  2NYS A;  2BIV A;  2ABL A;  1NE8 A;  3OYJ A;  2CYZ B;  1CKB A;  4FYY B;  2QDY B;  1MGQ A;  1Q7Y U;  1D0Y A;  2GF7 A;  5A0G A;  4C5H A;  3QII A;  3OYY A;  3CCL Q;  2DE0 X;  4JDS A;  2EJG A;  3H41 A;  3MJX A;  4B9X A;  4FYV B;  1WJR A;  1N8R U;  5M9O A;  2K2M A;  4KUI A;  4AMC A;  1ABQ A;  1ZSZ B;  4C8Q G;  3CPW P;  1UUE A;  3CBP A;  1RLQ C;  2XDD A;  2M1H A;  1QVF S;  3EHQ A;  4QT7 A;  1K1Z A;  2JVV A;  4OB0 B;  3URG A;  2HQX A;  5FRN A;  1N6A A;  4OB3 B;  1YNZ A;  4KUD K;  3M4G A;  4JRI A;  5CKB A;  3C12 A;  1RAG B;  4M7A G;  1VYV A;  4XTY A;  5I2S A;  4F16 A;  4NOY A;  3VS0 A;  1EFN A;  2GFU A;  3MPU B;  1M2O A;  3REB B;  1VYU A;  1M8V A;  2RF0 A;  4PJO E;  1YIT Q;  2QEX T;  3CCJ T;  3FRN A;  5AYF A;  1QKW A;  1NJI C;  1G3W A;  3I5S A;  2VAS A;  5GAN j;  1VQ8 T;  1VQ6 T;  1K73 C;  2HKN A;  4M7A B;  1ZHI A;  6AT1 B;  1LNX A;  3UA7 A;  4JS5 A;  2EJF A;  1ZBX A;  1AWW A;  3G4S A;  4OMF B;  5GAN e;  4M77 B;  4XQ3 A;  1OX8 A;  3L2Q A;  1NEG A;  3LWH A;  2L8D A;  1TSF A;  1BCM A;  2FPF A;  1JBM A;  2DK3 A;  3CD6 T;  1W1F A;  1YJ9 Q;  3VS5 A;  5I2M A;  1NZ9 A;  1Y07 A;  5IH2 A;  3FB9 A;  1VQ5 T;  1NYG A;  3H8Z A;  4XU0 A;  1Y96 B;  4WCI A;  1QKX A;  2PQW A;  4Q5W A;  2DX1 A;  4XU1 A;  1GBR A;  4DBQ A;  2E5K A;  2DD5 A;  1WQW A;  3OYN A;  3UAT A;  3RKW A;  3CC4 T;  4M78 E;  5GMK l;  1TS9 A;  1VQ6 Q;  1V29 B;  2GNC A;  2M0Y A;  1PSE A;  4MMK A;  2BE9 B;  4M77 D;  1OU8 A;  4JZ4 A;  1YN8 A;  4FYW B;  1BU1 A;  5A0D A;  3VJP A;  4AFZ C;  1YIT T;  1Q86 R;  3O8V A;  2EQU A;  1QVF A;  3V8K A;  4AT1 B;  2J06 A;  3S3M A;  1KD1 U;  2JXB A;  1U1T A;  3QPH A;  1VQ7 T;  1N9R A;  1LVK A;  3DLL A;  3LH5 A;  2YUO A;  4A54 A;  3G6E A;  2RPN A;  2DTI A;  3L1A A;  3M54 A;  3TU4 K;  1XJW B;  3M58 A;  1LOJ A;  3UF4 A;  3CC4 A;  4E2F B;  1I8F A;  1ZA2 B;  3JB9 H;  2NUT A;  3DB4 A;  5GAO p;  2FO0 A;  4FM4 B;  3EFR A;  1Q86 C;  2MAM A;  3MO8 A;  4PJL A;  1PCX A;  3TCJ A;  4M78 D;  4PJO A;  1S72 Q;  2CRE A;  4PL6 A;  5GAO r;  2ROT A;  4X34 A;  2LCL A;  5CIU A;  5EC7 A;  1VQK Q;  4EIK A;  1OX9 A;  1YJW T;  1JB0 E;  1FX7 A;  5GAM j;  2QQS A;  4PJO C;  2OI3 A;  2P0Q A;  4JJC A;  4CI0 C;  1QVG A;  3CD6 Q;  1VQO A;  1OI1 A;  2JM9 A;  3LGL A;  2K5F A;  3CC7 T;  4M7D C;  4C0Z A;  1KD1 C;  4JRP A;  2KBT A;  2LJ0 A;  1KHI A;  4C5G A;  1KQS A;  3MEW A;  2KYB A;  1QP2 A;  3QZ5 B;  1VQO Q;  3PIP A;  2J6K A;  2C06 A;  4P5N A;  4XU3 A;  2DVE A;  3I55 Q;  4FSS A;  1UEB A;  1I0C A;  1I07 A;  1UTI A;  2FHD A;  2BE7 D;  2VKN A;  1YP5 A;  2L3P A;  4L6V 5;  1TU0 B;  4KH0 B;  1S1N A;  1Q7Y R;  2HCK A;  3LLR A;  5KYU B;  2EJ9 A;  2DXC A;  2EVR A;  1K73 U;  3VUZ A;  5LJ3 d;  2Z0W A;  2KSS A;  2X3X D;  1YI2 Q;  4FU6 A;  2VVK A;  3OYF A;  2QA4 T;  4E7Z A;  4ZNX A;  2PZ1 A;  4Z8A A;  1G3Y A;  4M77 F;  3R6O A;  3M0U A;  1N8R R;  2LNH B;  2KY9 A;  1AVZ C;  1E6H A;  2NLU A;  1VQ4 T;  2D8H A;  5KE3 A;  1M2V A;  1RL2 A;  2VV5 A;  2YHT A;  4OMM A;  1Y0M A;  1K73 R;  1IO6 A;  2BZX A;  2OTJ Q;  4RTY A;  2QGG A;  4PNO A;  1X27 A;  2ZPE B;  4J9F A;  5FU6 C;  5HKC A;  1CKA A;  5ECA A;  3I5R A;  2EQM A;  1SF9 A;  4R55 A;  4M7A D;  1SRL A;  3RNJ A;  2LTO A;  1M1F A;  3QYG B;  4C0G A;  2FRY A;  3LGF A;  1ZLM A;  2YSQ A;  1SSF A;  2CT4 A;  4DBH A;  4F7U A;  4ZN3 A;  2K2V A;  2FB7 A;  3CCS Q;  1WYX A;  3JCM J;  2EPD A;  1N8R C;  2HBW A;  1HYO A;  2JS2 A;  2RI2 A;  3PNW C;  2FPE A;  5CQY A;  4F17 A;  2WAC A;  2DZC A;  4J6Y A;  1U3O A;  2CSI A;  1QVG S;  3VKI A;  4J9B A;  4AFQ C;  1VOM A;  3PMT A;  4KGV B;  5A2Q E;  4ELZ C;  3JCM f;  2CT3 A;  3LWI A;  1W2B S;  1JXM A;  1KFZ A;  2RJF A;  2ZPB B;  1AZG B;  4XK8 E;  1EX4 A;  2YUQ A;  4LDW A;  3OYM A;  4PLL A;  2XHC A;  5GAO q;  4FT2 A;  5DY9 A;  5GAN f;  1MV0 B;  2M0O A;  2ZCF B;  1K8A C;  2ED1 A;  5I21 A;  1YIJ A;  2RB6 A;  2M16 A;  1XNI A;  3FJ5 A;  3I56 Q;  3V7R A;  2A36 A;  2LJ3 A;  3EG9 B;  3HRU A;  1H3Z A;  1BIA A;  4ESR A;  2YT6 A;  2DL7 A;  4M78 C;  2RJC A;  3GLX A;  3NHN A;  2OJ2 A;  1AWO A;  1JXO A;  3QYH B;  2MWO A;  2A28 A;  2ZPF B;  1ZSG A;  1V1C A;  3M0S A;  5GMK i;  4NL3 A;  2LX9 A;  1ZA1 B;  3JCM V;  1MMD A;  3MP8 A;  2L3R A;  1I5L A;  3X25 B;  2KDS A;  3INZ A;  4M75 E;  3G1J A;  4RG2 A;  2EQJ A;  3A8G B;  4MDX A;  4AFS C;  1Z9Q A;  1FMW A;  3QJY A;  4HA8 A;  1VQ8 Q;  2DNU A;  1IXD A;  2JOY A;  2VYT A;  4QQ6 A;  1U8R A;  4ZTF A;  5L23 A;  4JZ3 A;  4RTW A;  1OPK A;  4C0D B;  1K9M C;  1LPL A;  1PM3 A;  1ZQ1 A;  4JLG A;  2J05 A;  2RH2 A;  5FRO A;  3OS1 A;  1YJW A;  2LZ6 B;  1G3T A;  4BDZ A;  3CCL A;  1QVG P;  3JB9 F;  1QP3 A;  5L8R E;  3HPW A;  3CC7 A;  1KC8 R;  2O31 A;  2RA2 A;  2YRD A;  5GAO l;  3CCQ T;  3OB9 A;  2XDB A;  4JJB A;  2NUP B;  2P4T A;  1S72 A;  2DEU A;  2QTV A;  3BDL A;  1VQP A;  2BUD A;  3BFM A;  1JRI A;  2R57 A;  3QJ6 A;  2HEQ A;  3A5Z B;  3GNF B;  1M90 C;  4RG8 A;  1RAI B;  2X4X A;  3JB9 I;  4KBM B;  2X9H A;  1M1G A;  4A4H A;  4O6J A;  2E64 A;  5IHK A;  1Q95 G;  2HMA A;  1QCF A;  2L89 A;  3L2W A;  4DOV A;  1SHG A;  4PKC C;  4JS4 A;  4J7I A;  3EG0 A;  4A4E A;  1YHQ A;  1T0J A;  3LH0 A;  2E6Z A;  3V8J A;  2DEQ A;  2EYZ A;  1JJ2 A;  2YXY A;  5GAO m;  3QXE B;  2D8J A;  3SWN A;  2IPO B;  1I1J A;  3H6Z A;  3L2Z A;  1M4Z A;  1NPR A;  2LX7 A;  4PJM A;  3JCM h;  4IUV A;  1OV3 A;  1KHC A;  2VB6 A;  1R8O B;  3JCM W;  3BY7 A;  3CME Q;  1NLO C;  3TRE A;  3JB9 G;  2DJQ A;  5CVI A;  3TSZ A;  4RCC A;  3TVT A;  2E41 A;  1Z9Z A;  4LXC A;  2P4R A;  3RKY A;  5HCK A;  4RUG A;  2QA4 Q;  2QAZ A;  3CCU T;  3EH2 A;  3A8L B;  4HVV A;  4HKE A;  1YHQ T;  2MMP A;  2ZPH B;  3OYI A;  2EYX A;  3Q1J A;  1H64 1;  1WQ7 A;  1QLY A;  2LQW A;  5FRM A;  2KNB B;  5DLO A;  4C8Q C;  2HDA A;  4E7I A;  2EBP A;  3DLM A;  1GXI E;  1Y96 A;  3EGX A;  3ASK A;  3UT1 A;  3OW2 A;  1SSH A;  3TEE A;  1WHG A;  4OMN A;  4C8Q A;  3PVQ A;  1D1C A;  3H0I A;  2YRC A;  1VQO T;  1OEB A;  2DRK A;  4C92 D;  4XTW A;  2QI2 A;  2LNV A;  4HXJ A;  5GAN 3;  2VC8 A;  2KQW A;  2RK2 A;  4FYX B;  4MZT A;  2KRN A;  2G3R A;  1HK9 A;  2PNI A;  1DJ7 B;  4M78 G;  1M5Q 1;  2IVW A;  2E6N A;  1ZUY A;  2V8J A;  3OYC A;  1AD5 A;  4M7D D;  5GAM f;  4BE2 A;  2GQV A;  3L2U A;  2QQB A;  1KQS P;  3JCM X;  2SRC A;  3I35 A;  2KRM A;  4OMO A;  4ZGJ B;  4E6R A;  4M4Z A;  3A8O B;  3CXC P;  4Z88 A;  4E7S A;  4LDV A;  1AWX A;  4ANJ A;  1ARK A;  1FWZ A;  2QEX Q;  3CCJ Q;  1W70 A;  2X51 A;  1X6O A;  5KE2 A;  1ACM B;  3QZ9 B;  4PJO B;  2DRM A;  1W6X A;  5LJ5 e;  5J39 A;  3EHR A;  1SHF A;  3EG9 A;  2DYI A;  3CBM A;  3G71 T;  3CCR A;  2F2X A;  3J80 E;  1YIJ Q;  1Q7Y C;  1G83 A;  1E6G A;  2JS0 A;  2MIO A;  1PRL C;  2DKG A;  4FCY A;  3HRS A;  1HJD A;  1RI0 A;  2KMT A;  4A4F A;  1WHH A;  1UGR B;  4GY5 A;  2QTX A;  4JRQ A;  4CC4 B;  3TSW A;  1FMV A;  2GQI A;  3MKD A;  5GAM h;  1UEC A;  4C92 G;  1WGS A;  4EMG A;  3ER0 A;  1KJW A;  4GLM A;  3BW1 A;  4A4G A;  1UHC A;  3E1S A;  1PWT A;  1Y71 A;  3VRY A;  4D8K A;  2D0Q B;  2HQH A;  2KXC A;  1VQN A;  3PVL A;  1KK7 A;  1FXX A;  2FRW A;  2LT1 A;  3I55 A;  1TUC A;  2DPP B;  3G71 A;  2YLC A;  3CCR T;  1WJQ A;  5GAM e;  3M0P A;  4RCB A;  3ZL7 C;  2DL4 A;  2DFU A;  3N5B B;  2KT8 A;  3NFC A;  1VQL A;  1UJY A;  1KD1 R;  2EKO A;  2DA9 A;  2EKH A;  4J9D A;  3G71 Q;  1ZX6 A;  4D6W A;  1AEY A;  4LUD A;  2AKL A;  2DXU A;  2XK0 A;  3QBY A;  1B34 A;  1OQK A;  1PNJ A;  4A63 B;  2RHY A;  4LE9 A;  4WF2 A;  2D0N A;  1PD0 A;  2RI5 A;  2EGE A;  1GFC A;  1VQN T;  2MI6 A;  3QDR B;  2XI9 A;  1E7O A;  7AT1 B;  5LJ3 j;  3U23 A;  2LC4 A;  2DER A;  3QKJ A;  4N4I A;  1WX6 A;  4M75 D;  4BB7 A;  1YI2 A;  2H8H A;  4DA4 A;  1VQL T;  2F1L A;  1J3T A;  1UE9 A;  2ESW A;  3CCV Q;  3HHT B;  3CME T;  4F7U B;  2AK5 A;  1GCP A;  1SPK A;  4UC4 A;  1PKS A;  5LJ3 h;  1TOV A;  1QW1 A;  2XMF A;  3MHX A;  3SWN B;  3HFN A;  1SKU B;  2LQ8 A;  4DOW A;  2SEM A;  1WXT A;  2CP0 A;  1KQ1 A;  3PFS A;  2COY A;  3X24 B;  4JUV A;  4FT4 A;  3VS6 A;  5HY6 A;  2O2O A;  1PD1 A;  1PRM C;  4X9D A;  1ZUK A;  3GPL A;  2DMO A;  3RES A;  1O9S A;  2CZ7 B;  2JUF A;  4LDX A;  5IN1 A;  4M75 B;  5HK0 A;  2H3E B;  2L3Q A;  1K8A U;  3H0H A;  3NTK A;  2CP6 A;  3MP6 A;  3CCL T;  4LDU A;  1KIK A;  2AT1 B;  4KGX B;  4M77 C;  1OOT A;  3NGP A;  4M78 F;  4BDY A;  3X28 B;  4EMK C;  2HAX A;  2CP5 A;  1RAH B;  2DXT A;  2EGA A;  2YDL A;  2AKK A;  1I81 A;  5I11 A;  4M77 A;  4M7D B;  1RI9 A;  4PLI A;  4CC3 A;  4BAC A;  4EMK A;  1C0M A;  2C0T A;  4CC2 A;  1YJN Q;  4RTT A;  3KXT A;  2EW3 A;  3QG1 A;  3THK A;  2HL3 A;  1Q81 U;  1R77 A;  4FIB A;  1P92 A;  4J9H A;  4CC7 A;  3PGG A;  2CSQ A;  2MOX A;  3RDV A;  4ZN1 A;  2KE9 A;  2E5Q A;  2QQ9 A;  1NLP C;  5KYW A;  3OS0 A;  4C5E A;  2RMO A;  4Y92 A;  1WHJ A;  5CKD A;  2X3W D;  2BKD N;  3VS1 A;  5GJV B;  1BIB A;  2JMA A;  1VQM Q;  1OZ2 A;  1K0X A;  3JB9 D;  3HTR A;  1UB4 A;  3OYK A;  2QAS A;  2O88 A;  4ZGD B;  4IUR A;  2OX7 A;  1VQM T;  3CCM A;  1GCQ A;  2RQR A;  3SDZ A;  2KRO A;  2OAW A;  3M4Y A;  3OMG A;  2RHX A;  3EG2 A;  3L2V A;  3V7S A;  2DM1 A;  4JJN K;  4MZP A;  4J83 A;  4PJN A;  2O9V A;  4IUP A;  2DL8 A;  2QXF A;  2DTH A;  4O5V A;  2EYQ A;  1X43 A;  3PMI A;  2CS7 A;  1K4U S;  3OYA A;  4BY6 B;  4M7D G;  2FL7 A;  4QVZ A;  2B86 A;  5IHI A;  3UPU A;  3CMA A;  2J6O A;  5KYX B;  2AZS A;  3CD6 A;  1YBY A;  3PE0 A;  3CC2 T;  4M7D E;  5A0L A;  3WVD B;  2YLB A;  1M3B A;  4ELY C;  3IQL A;  3C0C A;  1ZSZ A;  4C92 A;  4C5I A;  3VS7 A;  3S3O A;  2HQE A;  3VS3 A;  5CK9 A;  2P0K A;  3CC7 Q;  2Y4Y A;  1X2Q A;  5GMK j;  2HD0 A;  2PTK A;  2X4Y A;  3CCS T;  3ZBD A;  1ZSZ C;  2QA4 A;  1YJW Q;  1YWO A;  1K8A R;  2DTO A;  3E19 A;  3CCE Q;  3MEU A;  1D3B B;  2ZZD A;  3CQT A;  1B3Q A;  1Q82 R;  2RQT A;  5IXF A;  4QVC A;  4C8Q F;  1M1K R;  5CKE A;  5GAN 4;  5LJ5 d;  2E4H A;  2RHI A;  4B6M A;  3FC3 A;  4Z02 A;  2E1H A;  1GRI A;  2I0N A;  4AFU C;  5CKF A;  1VYT A;  2V1R A;  4VUB A;  2CZ0 B;  2EQI A;  3V8L A;  3CCV T;  2MPX C;  5FWC A;  1UG1 A;  4JPB W;  3HP9 A;  3FIF A;  5DLQ E;  1H3H A;  5KH6 A;  4IUT A;  1AOJ A;  2I2L A;  3TQ7 P;  4TVR A;  3FEO A;  3HL8 A;  1VQP Q;  2K3Y A;  1BBZ A;  2ROL A;  3QO3 A;  2RQW A;  1EZZ B;  2O4X B;  8ATC B;  5LL6 S;  1N5Z A;  2QGF B;  2K7A A;  2DXB A;  4BY6 C;  4E47 A;  1OU9 A;  1RAC B;  3CCU A;  1M1K U;  2AIR B;  3BE3 A;  1K9M R;  2HSE B;  1RUW A;  3RMS A;  2OTJ T;  2LCC A;  1XOV A;  3F70 A;  4HT8 A;  1MUZ A;  2JM8 A;  3CCR Q;  4L5G A;  2ED0 A;  2F5T X;  2VUB A;  4LUE A;  1KQS S;  1T3S A;  3EFO A;  4BI3 A;  5IXB A;  5D6Y A;  1VQK T;  2A7Y A;  1PSF A;  2K5I A;  4RMO A;  4J7F A;  2RK1 A;  5LJ5 h;  1MMG A;  2ZAE A;  3CXC S;  3OY9 A;  2A3L A;  4HCZ A;  5GAM g;  1ABO A;  3AT1 B;  5CCA A;  1UJ0 A;  2DAQ A;  5GAM d;  2FZK B;  1JU5 C;  1TUD A;  4OF1 A;  1K0S A;  5D6X A;  2E10 A;  4HCB A;  1VIF A;  2NWM A;  3GIB A;  3OS2 A;  1VQP T;  1WDX A;  1JO8 A;  1BI2 A;  3NPF A;  2DBM A;  3MEA A;  1NM7 A;  4AG1 C;  1NJI U;  3CBO A;  1QVF P;  1RAD B;  3LYI A;  1QMC A;  1AZE A;  1UGP B;  2CGH A;  1R0C B;  1JJ2 S;  3OMC A;  2KT1 A;  1JQQ A;  3QWY A;  3G7Z A;  1UGQ B;  3G4S Q;  1RAF B;  4C0F A;  3HSB A;  3A98 A;  2DJZ A;  2M51 A;  1QCN A;  1VIE A;  1D1A A;  2MYS A;  1U1S A;  1NEB A;  5EG2 A;  1X6B A;  2K79 A;  3A8H B;  3VV0 A;  4D8D A;  1BK2 A;  4R0K A;  3MEV A;  2FZG B;  2OAU A;  3M55 A;  4DQ2 A;  3SD4 A;  4II1 A;  2ECZ A;  1NYF A;  3KFV A;  3WVE B;  2RJE A;  4ZTJ A;  3VRZ A;  3JCM Q;  3HFO A;  2L2P A;  4BI4 A;  1UGS B;  5GAN 5;  1VUB A;  5KYX A;  2NUT B;  3M0Q A;  1U5S A;  1WA7 A;  1X75 C;  2PVD B;  3OW2 S;  4M7A F;  2ATC B;  3VU3 C;  4PJO F;  3KUF A;  2FZC B;  3X20 B;  1OUL A;  3M5A A;  1MND A;  2CH4 W;  2M9U A;  1UGV A;  3LX7 A;  4XTZ A;  3E9F A;  2RO0 A;  2HKQ B;  1WHK A;  2XU8 A;  1ZBJ A;  3JCM e;  4PFZ A;  4YTL A;  3CCE A;  1GFD A;  4QQG A;  4OVA A;  4F04 B;  2A08 A;  1YHQ Q;  3AHU A;  2COZ A;  4MML A;  5CQX A;  3M9Q A;  2MF2 A;  3OYG A;  3I55 T;  1NJI R;  4LN2 A;  4JJD A;  3OBY A;  1X69 A;  4XAX B;  3NTH A;  4BUG A;  3H9N A;  4M75 A;  2LQK A;  4F7U F;  2KRS A;  3CCM T;  4J9E A;  2JNG A;  3JCM d;  1WFW A;  1WIE A;  1T0H A;  5LJ3 f;  3M53 A;  1BKB A;  2V1Q A;  5GAN d;  3M0R A;  1H92 A;  5GAN g;  4J9I A;  3OYH A;  1NG2 A;  1NBE B;  4A53 A;  2BZ8 A;  2X4W A;  3FJP A;  4KT0 E;  3HKS A;  4HCC A;  1X2K A;  5AT1 B;  3G6E T;  4MDW A;  2XD0 A;  4PJO D;  1XTD A;  1LCK A;  4EMK B;  1D1B A;  4N0A C;  2EYW A;  2VWF A;  4XU2 A;  5FU6 B;  2QG9 B;  4HT9 A;  1IHW A;  4ME7 A;  1WI7 A;  1W2B A;  2KVQ G;  2RI3 A;  2CP7 A;  1V76 A;  2ZGW A;  3O5Z A;  2O4X A;  2XID A;  4C8Q E;  2X35 A;  4RTU A;  1VQ7 Q;  3C4S A;  2P0P A;  4HVW A;  4FSX A;  4IIM A;  4C8Q B;  1WXB A;  2YWW A;  3JSC A;  2EGC A;  2JTE A;  3OA6 A;  3RMQ A;  2K6D A;  2CDT A;  2FG0 A;  1AHJ B;  2PUK B;  4IUQ A;  2L5Q A;  1IRE B;  3X26 B;  3FDR A;  2G6F X;  4C92 F;  2D1X A;  2E3I A;  4J5Y A;  3OQ5 A;  4RTV A;  2A0F B;  5LJ3 e;  2QEX A;  3CCJ A;  1RAA B;  2MK5 A;  1MMA A;  1MNE A;  1WJS A;  2KAF A;  1YJ9 T;  3C94 A;  4V2S A;  1VQ6 A;  4B9W A;  2VGM A;  2FYK A;  5DM7 R;  3GP8 A;  2VXE A;  1YCY A;  1B7T A;  2RJD A;  5CKH A;  3RKX A;  1M3A A;  1Q82 C;  4A4K A;  4J6X A;  3CCQ Q;  4XTU A;  1BI3 A;  2IG0 A;  1X6G A;  5I22 A;  2LQN A;  2YRV A;  3OSV A;  2ENM A;  4KH1 B;  3QUI A;  3EGU A;  3E2U A;  3LW5 E;  3OYE A;  1TH7 A;  5GJW B;  3L2R A;  1TUG B;  1VQ9 A;  2CUD A;  4RKU E;  2LT4 A;  2V8K A;  1WHL A;  2IIM A;  2COW A;  2JJ9 A;  4Y28 E;  1M30 A;  3R6N A;  5KYY B;  4PJO G;  2VGN A;  4LD9 K;  2OTJ A;  4ZGE B;  1F1B B;  2L3S A;  1PC0 A;  1SG5 A;  4J8O A;  2D9T A;  4M75 G;  3QSU A;  4RTZ A;  2DYB A;  1M8M A;  5FU7 B;  3EGD A;  2DIG A;  2DF6 A;  2W10 A;  4E7J A;  1YIT A;  1YWP A;  2BZY A;  2LRQ A;  3RR6 A;  2JZ2 A;  3GNG A;  4GLK A;  1QCO A;  2K5L A;  1VQ9 Q;  2O01 E;  1WPY A;  2NUZ A;  2F2W A;  3CCE T;  2EFI A;  2YUP A;  5LJ5 j;  1I4K 1;  4E7L A;  2FVU A;  3G6E Q;  1Q86 U;  4Z89 A;  5KCH A;  2F5K A;  1PG5 B;  1BB9 A;  3QHS A;  5J26 A; 
#chains in the Genus database with same CATH homology
 2QAZ A;  1ZSZ C;  2QAS A;  1OU9 A;  1ZSZ B;  1OX9 A;  1OUL A;  1OX8 A;  1YFN A;  2NYS A;  1OU8 A;  1ZSZ A;  1TWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...