1M30A

Solution structure of n-terminal sh3 domain from oncogene protein c-crk
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
58
structure length
58
Chain Sequence
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
total genus 5
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m30A00
1CKAA 3TVTA 5ECAA 3UF4A 2CSQA 1AWWA 1K1ZA 1GBQA 2DJQA 2YUNA 3VS4A 4GBQA 2BZXA 2HBWA 2HEQA 4JZ4A 1FYNA 1NEGA 1SSHA 2JM8A 1K76A 3M0RA 4R0KA 2MIOA 2BZYA 2LQWA 2VWFA 4JPBW 1QWEA 1U3OA 1QLYA 1K0SA 1UHFA 1JXOA 1FMKA 2RNAA 2LX7A 1E6GA 2NUZA 3EG0A 1GFCA 2DL3A 2LCSA 1YN8A 2YUQA 1CSKA 1T0JA 3QWXX 2M0YA 2DE0X 2GQIA 3EG2A 3M0PA 2CT4A 1E6HA 2DM1A 1IO6A 1RI9A 1GL5A 2DF6A 2E5KA 2KYMA 1I0CA 2ECZA 1GCQA 1KJWA 2C0IA 2LMJA 1GCQC 2LJ1A 2CH4W 1AWOA 4LN2A 4ORZA 5HCKA 2RPNA 4ZNXA 2DL7A 2J6KA 1X27A 3FJ5A 1J3TA 5IHNA 2KEAA 3IQLA 1H8KA 2HDAA 2B86A 2GGRA 1BK2A 1JQQA 4CC7A 1SHFA 4AFUC 1ARKA 5FWCA 2VVKA 3REBB 1ABQA 4OMQA 4J9DA 2DMOA 1MV3A 1UG1A 3M0TA 1B07A 1WIEA 4E6RA 1UJ0A 4J9EA 2CREA 2VKNA 2EW3A 1X6GA 3RNJA 2EYZA 4OMOA 1SPKA 3CQTA 4QT7A 2KE9A 2RQVA 4Z88A 1K0XA 2C0TA 5EC7A 2KGTA 3TSWA 2L0AA 2AK5A 1WXBA 1VYUA 3VS0A 5GJVB 3ULRB 2PNIA 3EG3A 1T0HA 2EBPA 2A28A 2JW4A 1E7OA 1ZSGA 2KROA 1WYXA 1M3BA 2DRMA 1OEBA 2YT6A 2DBKA 2DX1A 2K3BA 3SEMA 1AWXA 2JTEA 4F17A 2D0NA 2ROLA 1M27C 1YWPA 3VS5A 2KRNA 2NWMA 4J9IA 2EGAA 1NLOC 3EHQA 2FRYA 4J9BA 3VS2A 2W0ZA 3RBBB 5IHIA 1QKXA 3H0IA 2RQRA 1PHTA 1AOJA 4F16A 2ABLA 2RQUA 1UTIA 1HJDA 2KRMA 1KSWA 4IIOA 4M4ZA 2P4RA 3I5RA 4OMPA 2FO0A 1Y57A 1AZEA 5FW9A 2EKHA 1H3HA 4Y92A 3SHWA 2KNBB 2D8JA 2J7IA 2X3XD 3ZL7C 1X2QA 1G2BA 3NMZC 2A37A 1NM7A 1BB9A 4JJCA 4LUEA 2RF0A 2HCKA 1JXMA 1WX6A 2L3SA 3NHNA 1Z9ZA 4HVUA 1RLQC 4AG2C 3GBQA 3VRYA 4D8DA 2F2WA 2EPDA 1QCFA 2DL8A 2AKKA 2D8HA 2ED0A 1X43A 3JV3A 4HCKA 5IH2A 1CKBA 4F14A 2GTJA 2V1QA 1ZUYA 1WDXA 3REAB 3PVLA 1T3LA 3NGPA 1KIKA 1A0NB 4JJBA 1SEMA 3EGUA 2CSIA 1X69A 3M0UA 4JZ3A 1TUCA 2OJ2A 4FSSA 1VYTA 1YP5A 2YSQA 2XMFA 4RTWA 4LUDA 2LNHB 3VRZA 2YDLA 1T3SA 2A08A 2KXCA 2DLPA 2FPEA 1QKWA 4Z89A 1TUDA 4CC2A 3LH5A 2L3QA 4LE9A 1ZUUA 2SEMA 3KFVA 2OI3A 1WLPB 2EYWA 1YNZA 4OMLA 4RTXA 3C0CA 1XOVA 1ZLMA 2KBTA 2PTKA 1GFDA 3NPFA 2JT4A 2RQWA 1ZBJA 2CT3A 2GTOA 2OAWA 2EQIA 4J9GA 2CUBA 1UJYA 2LQNA 4OMMA 2LJ0A 2C0OA 4D8KA 1PNJA 1OV3A 1TG0A 1X2KA 2JM9A 2LP5A 2KR3A 1UUEA 1SRLA 4AFQC 1PRMC 2F2XA 1WA7A 2J05A 2ENMA 4HVVA 1S1NA 2O31A 4RTZA 2W10A 3M0QA 1VA7A 2K79A 2J6FA 2KYBA 1M8MA 3H0FA 1NLPC 2K2MA 1V1CA 4RTYA 2KT1A 4LNPA 1B3QA 3O5ZA 4AG1C 1YCSB 2JS2A 4K11A 2O9SA 2K6DA 1H92A 1KFZA 4RTUA 2GBQA 4WCIA 3UA6A 2MCNA 1VYVA 1JO8A 2CH4A 2M51A 3EHRA 2PZ1A 1PRLC 3PE0A 1NYGA 2V1RA 2RQTA 2EYYA 4DEXA 2I0NA 3U23A 2L2PA 2BTTA 2LZ6B 1AVZC 2YUPA 4AFSC 2ESWA 2J6OA 2ROTA 1WI7A 3PVQA 1HD3A 3VS7A 4A63B 2AZVA 1NEBA 2KXDA 4X1VA 3R6NA 1HSQA 5IXFA 2FG0A 2EGCA 4RUGA 1W70A 3VS6A 4KRTA 2AKLA 1U06A 1JU5C 1OPKA 1NYFA 4ESRA 1M3AA 1BU1A 1ABOA 2JS0A 5IXBA 1X6BA 2A36A 2HSPA 3VS3A 1AD5A 3I5SA 2RMOA 1UFFA 1MUZA 4HVWA 2BZ8A 4RTTA 1SRMA 2G6FX 4EIKA 2CUDA 3EG1A 4OMNA 1ZUKA 1QWFA 2EGEA 1PWTA 5L23A 3VS1A 1LCKA 1Y0MA 1UHCA 2JMCA 2DL4A 4J9CA 1BBZA 1AEYA 1Z9QA 2GNCA 5FWBA 1AWJA 1PKSA 4CC4B 2L3PA 2LJ3A 1UDLA 2EYXA 4J9FA 1W6XA 1PKTA 5I11A 2FPDA 2JMAA 1I1JA 1G83A 1NG2A 1GRIA 2DRKA 2D1XA 2J06A 1W1FA 3A98A 2KRSA 1K9AA 2X3WD 1WXTA 3H0HA 2YUOA 2O9VA 1M3CA 2DYBA 4GLMA 1GCPA 2DVJA 2AZSA 2IIMA 2EVRA 4RTVA 2O88A 1AZGB 2K7AA 2SRCA 1RUWA 3QWYA 1UGVA 2JXBA 3M0SA 1RLPC 1UE9A 4Z8AA 2F2VA 5GJWB 2ED1A 2DA9A 2H8HA 1I07A 3THKA 1WXUA 2DL5A 1GBRA 1SHGA 2FPFA 2DNUA 2RN8A 2FRWA 1M30A 1OPLA 1ZX6A 2DBMA 2K9GA 4DEYA 1U5SA 3H41A 1K4US 4IIMA 1N5ZA 5IHKA 1WFWA 2CDTA 4HXJA 1YWOA 3I9QA 1UECA 2MOXA 2FEIA 2DILA 3UATA 5I22A 2KT8A 4JJDA 4J9HA 1JEGA 1MV0B 3UA7A 3I35A 2O2OA 1OOTA 3TSZA 4CC3A 1EFNA 4AFZC 2QDLA
chains in the Genus database with same CATH superfamily
3GPLA 1D3BB 2RK1A 2YWWA 1ZSZB 4F7UE 3OQ5A 2DJQA 2RHYA 9ATCB 2BZXA 2HEQA 3CBMA 2JM8A 3M0RA 2BZYA 3ME9A 1Q82U 2HKNA 1U3OA 4XTWA 4F7UA 1FMKA 1E6GA 3S3NA 3VJPA 2FYKA 4A54A 2X51A 2M0YA 3QWXX 1YJNA 2GQIA 3EG2A 2CT4A 2DM1A 4M75B 3EFOA 2VGNA 2KYMA 3S3OA 3L2UA 1KJWA 3TEEA 2E10A 2XDBA 1GCQC 3HRUA 2CH4W 4N0AC 4LN2A 1OQKA 2DL7A 2J6KA 1D1CA 1XQHA 3FJ5A 2RO0A 5IHNA 5GAMf 3OYBA 3CCQQ 2LTOA 3VUBA 1H8KA 2HDAA 1VQ5T 1VQLQ 4C0FA 1QVGA 4KULA 5D6WA 1ARKA 1VQ4Q 2PUKB 1ABQA 5FRNA 4OMQA 4PFZA 2XU8A 2DMOA 4D6WA 1R0BG 3M0TA 3CC7T 1WHLA 1WIEA 2CZ1B 2OAUA 1NE8A 2DXBA 2YLBA 1KQSS 4OB1B 3M57A 5HK3A 5KYYB 2CREA 1I4K1 3LX7A 4DBQA 1X6GA 3PGGA 3RNJA 4OMOA 1SPKA 3CQTA 2KE9A 2JN0A 2RHXA 2RQVA 4LDVA 3CCRA 2C0TA 5FU6B 1WXBA 2ATCB 1LOJA 2MI6A 2A28A 2JW4A 1D0YA 2KROA 1UGRB 2DRMA 1VIFA 3HSBA 5LL6S 4BE2A 2DZ9A 5KYXB 5GAOn 1ACMB 4J83A 2JTFA 2JTMA 2P0QA 2NWMA 4J9IA 2DVEA 3URGA 2W0ZA 5IHIA 1QKXA 2X4XA 1WHMA 1PD1A 1AOJA 1IXDA 4BDZA 4F16A 3CD6A 3OYIA 2RQUA 1KQ1A 1WHJA 4N4GA 4M77C 1Q7YU 2QGFB 2P4RA 3JB9F 4OMPA 2YRVA 2FO0A 2DJZA 4E7LA 3QZ9B 5J26A 2QA4Q 1KD1U 2EKHA 3MP1A 2V8KA 3G4ST 3CCQT 2XDPA 3OYGA 2G3RA 4HT9A 2X3XD 3H9NA 1G2BA 1ZBXA 3JB9D 2VYTA 3MEVA 3EFRA 4LDUA 1DJ7B 1Q81U 1BB9A 1C0MA 1M4ZA 2K2VA 4LUEA 4M77A 4MMLA 4A4GA 3GNFB 1TS9A 1YITQ 1TUGB 1P92A 1RADB 1Z9ZA 3JB9I 3MEWA 2QASA 3VRYA 3P8BB 3MJXA 4OVAA 5LJ3d 2ED0A 1UEBA 3QSUA 3A8OB 3J81E 3NTHA 3CBOA 1X69A 1PCXA 3M0UA 4JZ3A 3V7SA 4Y28E 3HRTA 4FSSA 1VYTA 3PTAA 3OS5A 2YDLA 2FPEA 5GAOl 4Z89A 1TUDA 5J39A 4CI0C 1ZUUA 1BI2A 4PLIA 4BB7A 1VQ4A 1WLPB 4LDYA 1B7TA 1WHGA 1IGQA 1R0CB 4FL6A 2HNIA 1Q86R 2QAZA 4BUGA 3OYMA 1GFDA 2BKDN 2RQWA 2GTOA 4J9GA 4M78E 3QKJA 1Y96A 1RL2A 1KC8R 3I55A 2CZ7B 2LJ0A 2C0OA 1VQOT 4BE0A 4IUQA 1X2KA 2HMAA 4J6WA 2LP5A 2LX9A 2E4HA 1OU9A 1G3YA 3FLGA 1SRLA 4C8QG 3PMTA 5GANh 1MMAA 2J05A 2NUPA 2JJ9A 3CMET 2W10A 3QO3A 5KYXA 1VA7A 1V29B 4N0AA 2QEXT 2KYBA 1M8MA 3H0FA 2XD0A 4A53A 1NJIR 4M75D 4RTYA 1Q86U 1KC8U 1NPRA 1OU8A 2E12A 3O5ZA 3CCEQ 3FC3A 1YCSB 2ZPEB 3ER0A 2DTIA 2F5TX 1KFZA 3M59A 1D0XA 4ZTJA 3PE0A 1NYGA 3HP9A 2RQTA 2QA4A 2L2PA 2ZGWA 4ZGDB 4EMGA 4QQGA 2JOYA 3PVQA 3G4SA 4C0DB 2AZVA 1NEBA 1WJSA 4M7DC 2KXDA 4X1VA 3R6NA 1PD0A 5GAMd 2KAFA 3MP8A 4EDUA 3NTKA 4KRTA 1U06A 1ZQ1A 1OPKA 1WQ7A 3MP6A 1NYFA 2P4TA 2H3EB 3PIOA 2DKGA 2JS0A 5AYFA 3CC4T 1X6BA 2CZ6B 1AD5A 2ZPHB 3M4YA 2JVVA 1VQ9T 3V8LA 2CP2A 3SDZA 5KE3A 1M1KU 4JLGA 2NLUA 2GFUA 2K4YA 4XAXB 1G5VA 4M78C 1PWTA 3OSSC 2O4XB 3VS1A 2LNVA 3CCEA 1YJ9T 3CCJT 1AEYA 4KUDK 2GNCA 5FWBA 4X34A 3C12A 2P0KA 4CC4B 1I8FA 2L3PA 1K73C 1FX7A 3CCQA 1VQ5A 2XDDA 3JCMf 2F69A 3V8KA 1VQLA 3JB9G 1BI1A 3FEOA 5CCAA 2RB6A 2FPDA 3V7RA 2JMAA 1K9MC 2DRKA 2CS7A 2D1XA 1W1FA 5A0GA 4C8QC 1TH7A 3HFNA 1MNDA 3UT1A 2I2LA 1YI2A 1M2VB 4XTUA 4GY5A 5KCOA 3CMEA 4FYXB 1VQMQ 4RCBA 2HQHA 2X4WA 3Q1JA 1X75C 4J6YA 4RTVA 2FHDA 1UGVA 2E6ZA 3WVEB 1VQ6Q 4JRPA 4Z8AA 1RLPC 1UE9A 3BDUA 5GJWB 3WXMB 2DA9A 5KYWA 2H8HA 2GCXA 5LJ3g 1GBRA 1SHGA 2QEXA 2COYA 7AT1B 2HQXA 2K9GA 3GLXA 1M1GA 3VYHB 1TTHB 4P5NA 1QW1A 1M2OA 1YI2T 2EJ9A 3QPHA 1QVGS 2IPOB 4C92E 3UATA 5I22A 2KT8A 3H6ZA 2LVMA 3CCMA 1OOTA 1W2BP 3G71T 1EFNA 4AFZC 1CKAA 4ATOA 1N9RA 3DLMA 2BUDA 5A0LA 4QVCA 1VQ8Q 3I55T 1G3WA 1QP3A 4E7HA 1GBQA 2DIGA 2YUNA 1K9MU 4JZ4A 4DBRA 1NEGA 1SSHA 4J7IA 3M54A 2ZPIB 3A8LB 1S72Q 2VWFA 4FCYA 4JPBW 1JXOA 3CCRQ 4C0GA 2JZ2A 2RNAA 3CCVA 1OI1A 1G3SA 1YN8A 4E7SA 1CSKA 4FM4B 5LJ5d 2DE0X 3CCLA 1YHQT 3M0PA 1ZSZA 1E6HA 1IO6A 5I2MA 2OTLA 2DF6A 2EYQA 2LDMA 1K9MR 4KGZB 1U8RA 3CEYA 4JRQA 2YRCA 1AWOA 4C8QE 1WZOA 5HCKA 2EQMA 2RPNA 4ZNXA 5DY9A 1K73R 1X27A 1LNXA 1EX4A 1J3TA 1OULA 2KEAA 2RHUA 5J3BA 5LJ3j 5L8RE 2GGRA 3MKDA 1JQQA 3RUXA 3VKIA 2A3LA 2F1LA 4FW1A 4M75A 2VVKA 3REBB 3SWNB 3BY7A 3OSVA 4IUPA 3NTIA 3OS2A 1VQNT 3S6WA 4J9EA 2VKNA 2EW3A 4XTXA 4X9CA 4ZGJB 4QT7A 4KGXB 2HQEA 4QQDA 2M0OA 4M77B 4Z88A 1M90U 4M7AD 1H641 1K0XA 1VQ6A 3JCMc 5EC7A 3TQ7P 2WSEE 1VYUA 3VS0A 4HCBA 2CZ0B 5GJVB 2QTXA 3EG3A 2VC8A 2EBPA 3MEAA 1ZSGA 4E7JA 2CYZB 3CPWA 2YT6A 2VXFA 4X9DA 4O5VA 2L8DA 4L59A 5M9OA 2OTJT 2KRNA 2PVDB 4J9BA 3VS2A 2FRYA 1JRIA 3RBBB 3CCUQ 2KY9A 3H0IA 2RQRA 3JCMh 2D6FA 4XK8E 2QQBA 2DIQA 1EZZB 4PJNA 4C8QF 1HJDA 2OTJA 4J8OA 1KQSP 1VQ8A 1I81A 3OY9A 3QDRB 2QA4T 2X9HA 5FW9A 3RERA 4MDXA 1D1AA 1W2BS 1JJ2A 4ZGEB 3QJ6A 3SHWA 2D8JA 2XI9A 3D7SB 1JJ2P 2J7IA 3ZL7C 1X2QA 3CC4Q 1QQJA 1WGSA 4II1A 2R57A 3G1JA 2YXYA 2RF0A 4RKUE 2HCKA 1Q81R 4BY6C 1JXMA 3CCLQ 1YITT 1HYOA 4HVUA 3HTRA 2FZGB 2DL8A 4HCKA 2AKKA 1UGSB 1X43A 2R5AA 2K5FA 4F14A 2GTJA 1WDXA 3PVLA 1QCNA 1Q86C 4JJBA 1SEMA 2CSIA 3QDFA 1M9SA 2QQSA 5GAN5 4DOWA 2XMFA 4LUDA 2LNHB 1T3SA 1IGUA 5D6XA 2A08A 4C5GA 1D09B 5CK9A 1QKWA 3EAEA 1I5OB 1VQNA 3EGDB 2L3QA 1R77A 4LE9A 2K3XA 2SEMA 4L5GA 3RR6A 2NUTA 1MMDA 2EYWA 1N8RR 2OTJQ 1M1KR 2QQRA 4RTXA 1XNIA 3GOXA 3C0CA 3E9GA 1Q82R 3SB2A 2RI2A 2JT4A 2CT3A 1RABB 2OAWA 3V8JA 2CUBA 3UDCA 3JCMQ 2M1HA 4LXCA 1UJYA 1YHQA 5A0DA 1VQLT 2EKOA 2WACA 2CP7A 4D8KA 2KQWA 2L5QA 1TG0A 3M53A 4R55A 2RJDA 3I56Q 1VQMA 2JM9A 2KR3A 3FRNA 2EQJA 4A4KA 1VQKA 3CMAT 1PRMC 2F2XA 1WA7A 1S1NA 2O31A 2LC4A 1K8AC 1FMVA 1JJ2S 3OBWA 1W4SA 3M0QA 1KG1A 2OX7A 4B9WA 2QEXQ 4XU1A 1NLPC 4WF2A 4IUVA 1VQ8T 3KBGA 4AG1C 3BDLA 3X25B 4J6XA 3QYHB 2O9SA 5GANg 2YLCA 1H92A 4A4EA 3CCJA 4B6MA 2MCNA 2GFAA 1IRXA 2CH4A 2M51A 3FIFA 1YIJQ 1RAFB 2EYYA 4PJOG 3G6ET 4F7UF 1U1TA 2RD1A 2V26A 2YUPA 2DERA 2E65A 2J6OA 5LJ5e 4OB2B 1HD3A 5DLQE 3VV0A 4C0DC 2ZAEA 1H3ZA 2FG0A 2AT1B 3VS6A 2CP0A 1BKBA 4PFOA 3CCVQ 2DAQA 3HFOA 3JB9J 4RG2A 3X24B 3I5SA 1K8AR 2EFIA 4M77F 2QDYB 5KYWB 2HSEB 2LQ8A 4NL2A 4RTTA 2M02A 3RESA 4HCZA 2NUTB 2CP6A 4M78B 1SG5A 5IN1A 4KUIA 2LQKA 4LD6A 4J9CA 1Z9QA 2EQKA 5KYYA 1PKSA 4ANJA 2X4JA 2A7YA 3VYGA 3MO8A 4J9FA 2MK5A 4KH1B 2DEQA 2YHTA 2QGGA 1PKTA 1B34A 2VV5A 2XHCA 4M77E 1NG2A 1M1KC 4JLIA 1X6OA 1N8RC 3BFMA 4C8QB 2KRSA 2X3WD 3H0HA 2HL3A 1HXDA 2VB6A 2E70A 2HAXA 1M3CA 1QMCA 4GLMA 3CXCP 3CPWP 3SFMA 2RK2A 2IIMA 3OYCA 1VQMT 3CCST 2EVRA 1M90C 1AZGB 3QWYA 2CP3A 3F70A 3OS1A 1B34B 1GXIE 4FU6A 1I07A 3LGFA 3THKA 2RJCA 1VQ7T 1TSFA 1X01A 2FPFA 2DXTA 2FRWA 2R5MA 3EFOB 1ZX6A 3L2RA 1N27A 3QG1A 2XK0A 3JCMP 4E7ZA 2VUBA 1U5SA 3H41A 2RI3A 4IIMA 5GAOq 1VQ4T 4ME7A 2CDTA 1Y71A 5GMKl 3EH1A 3CC7A 3G6EA 2MOXA 2ZPFB 3OYNA 1JEGA 1MV0B 4IUTA 3UA7A 4Z02A 2O2OA 1Y96B 4RMOA 3CD6Q 4CRIA 4FYVB 1O75A 4M78D 5ECAA 1ZSZC 1AT1B 4BI8B 3LW5E 1IB8A 2CSQA 1AWWA 4ELZC 4GBQA 5GAN8 2KSSA 1K76A 4R0KA 2MIOA 2ZPBB 2CP5A 1LVKA 1RAGB 3DB3A 1KHIA 1YI2Q 3E1SA 1QWEA 1QLYA 2DPPB 4UC4A 1K0SA 1WQWA 5GAMe 2COWA 4KGVB 1GFCA 2DL3A 2LCSA 1T0JA 3A8MB 2A0FB 1VQ7Q 2E5KA 3RIRA 2ECZA 1GCQA 5KE2A 3OS0A 3M56A 2C0IA 2LMJA 3S3MA 5LJ3e 2LJ1A 1U1SA 3HKSA 3E2UA 1WJRA 1VQ9Q 4J7FA 2LT4A 1OX9A 4PJOA 2B86A 1M8VA 1BK2A 3OYHA 1SHFA 4C92C 2PVOB 1KQSA 4J9DA 4M75F 1MV3A 3AT1B 1UG1A 3SD4A 5GMKj 5GAN3 1B07A 1TWBA 4E6RA 3QBYA 3CCSA 4EPCA 1OZ2A 1UJ0A 3CCMT 4BD3A 3GNGA 3CC2Q 4J5YA 4M7DD 4E47A 2EYZA 4GLKA 3C94A 2KGTA 3TSWA 2QG9B 5GANj 3JCMW 2MAMA 1WPYA 2PNIA 4WTOB 3HL8A 1UB4A 1OEBA 2DBKA 5GAMh 2K3BA 3SEMA 1AWXA 2JTEA 5FRMA 1ZA2B 1M27C 2EIFA 3EG9A 3EHQA 3G6EQ 4ZTFA 2KMTA 2AHJB 2YRDA 4M77G 2E64A 5CVIA 4LDXA 5GAN6 1NPPA 1RAIB 4FYYB 2ABLA 2KRMA 1KSWA 4IIOA 1KD1C 2RI5A 4M78F 1SKUB 2ZCFB 5GANd 4BDYA 3M58A 3EFSA 1H3HA 2DTHA 4MZMA 4MDWA 1WHKA 3JRZA 5GAN7 4EMKB 6AT1B 4EMKC 3CPFA 4OB0B 1NZ9A 2A37A 1NM7A 2M9UA 1VQOA 4NS5A 4LD9K 1Q7YR 3X20B 2V8JA 4M7AC 3GBQA 5DLOA 1BIBA 4D8DA 4MZTA 4JRKA 5CKFA 3CC2T 3OA6A 2F2WA 2DXUA 2BE9B 2EPDA 1QCFA 3JV3A 2D8HA 5IH2A 4FIBA 4M7DE 1ZUYA 3REAB 1T3LA 3NGPA 3CCRT 1A0NB 2DETA 3EGUA 2E3IA 2WSFE 3RKXA 2Y4YA 2OJ2A 1YP5A 4BY6B 3LYIA 1MGQA 4RTWA 3VRZA 5IT9E 1D0ZA 4JUVA 4PJOB 2VASA 2DLPA 5GAN4 4DA4A 1LPLA 3ZFJA 5GAOp 4CC2A 3QIIA 2DEUA 3R6OA 1BYMA 2MF2A 1XJWB 2OI3A 2DTOA 4C92D 4OMLA 1VUBA 4PKCC 3T9NA 4PNOA 5GAOr 3CCSQ 2LCCA 1XOVA 2FB7A 1MHNA 5GMKe 3QUIA 2KBTA 4C5IA 2PTKA 3NPFA 5IAYA 1ZBJA 3DKMA 4C5EA 4Y91A 4JS4A 2LQNA 3CC4A 3MPUB 3ZBDA 4ELYC 1PNJA 2KDSA 2OTLT 3PNWC 3E19A 2X35A 4PJOC 3A8GB 1LJOA 4M7AB 4O6JA 4BACA 2L89A 4C0ZA 2PQWA 2ENMA 4KBMB 4HVVA 1MMNA 2KVQG 2FL7A 1IZ6A 4XTZA 2K79A 5C6SA 3BE3A 2DYIA 2DK3A 2AIRB 2K2MA 1AHJB 4LNPA 2RH2A 3FDRA 2DXCA 2H3JA 4A4HA 1QVFS 5CQYA 2JS2A 3A5ZB 4HKEA 4K11A 4RTUA 3H8ZA 2PUOB 8AT1B 3RKYA 2B8AA 3CCVT 2GQVA 1JO8A 8ATCB 4IURA 1PRLC 3L2QA 1M1FA 2WSCE 1YIJT 4M7DA 1YJNT 2V1RA 4KT0E 3OYFA 3OB9A 4F04B 3OYDA 4DEXA 2BTTA 2P0PA 1AVZC 2LZ6B 5CKDA 2LRQA 3OYEA 2ESWA 4XU0A 1QVPA 2ROTA 1WI7A 2E5QA 1NJIU 5LJ5f 4A63B 2IVWA 4IUUA 3DLLA 4HCCA 1HSQA 5IXFA 2KI7A 3HRSA 4FT4A 4EMHA 1W70A 2AKLA 4DOVA 3JCMe 3PT9A 1NJIC 4ESRA 1BU1A 3PMIA 1Q82C 3C95A 3L2ZA 1ABOA 4R56A 2LT1A 4AT1B 5IXBA 3KUFA 1VQ7A 2A36A 2HSPA 3VS3A 1RAHB 2RMOA 1UFFA 1MUZA 4HVWA 3J7AF 2QTVA 2BZ8A 1SRMA 1IREB 3EG1A 4OMNA 5FROA 1ZUKA 3N5BB 1QWFA 2EGEA 2FZKB 5L23A 1Y0MA 1UHCA 4HT8A 3C4SA 2DL4A 2Z0WA 3CCMQ 1AWJA 1OZ3A 3MEUA 1KC8C 1M5Q1 2HBPA 2LJ3A 1W2BA 1UDLA 2COZA 4ZN3A 1W6XA 4PJOF 5EG2A 1FXXA 2MWPA 1ZHIA 1VQPQ 1I1JA 2PVGB 1G83A 1OX8A 2E41A 2J06A 4XTYA 3A98A 1Q81C 1JBMA 1MMGA 5LJ3h 3KXTA 1S72A 5LJ5g 3V7CA 3WVDB 3CC2A 3DB4A 1GCPA 2DVJA 2RA2A 5A2QE 2AZSA 4M7DF 2ZPGB 5HK0A 5I21A 2X4YA 2O88A 2GF7A 3LGLA 2SRCA 1YJWA 3CD6T 3CPWS 5I2SA 1WNLA 2ED1A 2QQ9A 4OGEA 1WXUA 3SWNC 5CKHA 3RKWA 4B9XA 4JDSA 1I5LA 2RN8A 1QVGP 3G7ZA 1OPLA 1N8RU 1EIFA 2FVUA 2FZCB 3M4GA 1K4US 4OMFB 4RG8A 2NYSA 5IHKA 3I9QA 3TREA 4KH0B 1NBEB 1UECA 2NUPB 2DILA 3EGXA 4JJDA 4J9HA 3I35A 4DBHA 3TSZA 2EAYA 5KYUB 1VQKT 4V2SA 2QDLA 1N5ZA 1YIJA 3TVTA 4C92B 3UF4A 3RMQA 1YJ9Q 5DM7R 3SWNA 4C92F 1K1ZA 3M9QA 3OW2A 1BCMA 1F1BB 4PJMA 3VS4A 4QVDA 3P8DA 1KQ2A 2HBWA 1FYNA 1PM3A 4JJNK 1Y07A 2KK4A 4OGCA 5GAOm 2LQWA 2Y4XA 2JNGA 4PJLA 5FU6C 1HK9A 1UHFA 2EWNA 2LX7A 4PL6A 2NUZA 3EG0A 3FJPA 1PC0A 2YUQA 4M7AG 4M75G 4M78G 5KYNA 1RI9A 1GL5A 1I0CA 2DD4A 4XU3A 2C06A 2O01E 2HKQB 4JRIA 5LJ3f 4ORZA 3ASKA 4M7DG 3IQLA 2IG0A 1VQ5Q 3EG9B 3E9FA 1M90R 3P8HA 1QP2A 2P84A 4CC7A 3A1PA 4AFUC 3QZ5B 5AT1B 5FWCA 3JCMg 2E1HA 2QQAA 3TCJA 1UGPB 5GANe 2MPXC 3CMEQ 1PG5B 4E2FB 3JCMJ 3I55Q 3QXEB 3GF5A 4F7UB 4A4FA 3OMGA 3LLRA 1BCOA 3G71Q 1Q95G 3I56A 2L0AA 2AK5A 1K73U 3ULRB 3X28B 2HZYA 1T0HA 2Y90A 2K57A 1E7OA 3RDVA 1WYXA 4OB3B 1M3BA 2DX1A 5LJ5j 4E7IA 3EGXB 4JS5A 4F17A 2D0NA 2ROLA 4LDWA 1YWPA 3VS5A 3LWHA 4PK4A 3LH0A 2CKKA 2EGAA 1NLOC 3RMSA 2RHZA 1IHVA 1PHTA 1VQ9A 1BI0A 3I56T 3UPUA 1UTIA 1BIAA 4M4ZA 4F7UG 4IKFA 1RI0A 3I5RA 3OW2S 1Y57A 1YJ9A 1AZEA 4QVZA 4Y92A 3O8VA 4BE1A 1QVFP 2KNBB 2K3YA 2XKOC 3G4SQ 1C6VX 4FT2A 3VU3C 4M77D 3NMZC 4QQ6A 4PJJA 2DZCA 4JJCA 2VXEA 3JSCA 4ZN1A 1K8AU 2RHIA 5GAMj 1WX6A 3G71A 4C5HA 2L3SA 5FU7B 1M2VA 3NHNA 4BI3A 1RLQC 3CMAA 4AG2C 4PLLA 2MYSA 1UGQB 2E3HA 4BI4A 4C92G 3CXCA 3OYAA 4M75C 4RCCA 1CKBA 2QI2A 2V1QA 2XICA 1KIKA 1VIEA 4OF1A 1TOVA 2M16A 5KYUA 3OYKA 1TUCA 5C0MA 1FMWA 2YSQA 4Q5WA 4XTVA 1FWZA 5FU7C 3OYYA 3CCUA 2KXCA 1VQPT 1V76A 3OMCA 4M7AF 3LH5A 4NOYA 2EJFA 3KFVA 4YTLA 5CO7A 1YNZA 3JB9H 2JUFA 3INZA 3CCUT 2D0QB 1BI3A 4MMKA 1VQPA 1TXQA 3GP8A 1ZLMA 3CXCS 3M55A 3QJYA 5CKEA 1D3BA 2EQIA 4FYWB 4FW2A 4OMMA 3HPWA 4FSXA 2R58A 3A8HB 1R8OB 1VOMA 1Q7YC 1RAAB 1OV3A 5GAN2 5FLXE 3UWNA 1VQOQ 1KHCA 1YITA 1UUEA 5KCHA 1YJWQ 4QKUA 4AFQC 3PFSA 1WHHA 1S72T 1N9SA 4RTZA 1MNEA 5GANf 2J6FA 2EJGA 4PJOE 2K5IA 2QYZA 1V1CA 3HHTB 2QXFA 2RM4A 5GAMg 3CCLT 2KT1A 1B3QA 2L3RA 1KD1R 3OW2P 1ZA1B 2RJEA 2HL5C 3EH2A 3AHUA 3EGDA 4DQ2A 3CC7Q 2F5KA 2K6DA 2MWOA 3L42A 2K5LA 3QHSA 2GBQA 4WCIA 3JCMV 3UA6A 4C8QD 5KH6A 1VYVA 2DD5A 3EHRA 2PZ1A 2BIVA 2V8IA 2RJFA 1C1AA 1JB0E 3BW1A 4E7KA 3L2WA 3OYLA 2I0NA 3U23A 5CAIA 4AFSC 1YBYA 4XQ3A 2DFUA 1Y7XA 4N4HA 3VS7A 4C92A 3CCET 2E6NA 1YHQQ 2HD0A 4N4IA 3OYJA 2EGCA 5CKBA 4RUGA 1O9SA 1RAEB 3L2VA 1TU0B 1RACB 1JU5C 3PIPA 1YJWT 1QVFA 3NFCA 3CMAQ 3META 1M3AA 2CGHA 1QCOA 1YJNQ 4XU2A 4M7AE 2DO3A 3JAME 4VUBA 5GMKm 4PFPA 1SF9A 2G6FX 4EIKA 5D7UA 2CUDA 4OP0A 1D1BA 1LCKA 3MCAB 4HA8A 4M7AA 4M78A 3JCMd 2JMCA 1G3TA 1VQNQ 1BBZA 1OYXA 3CCJQ 3JCMX 1VQ6T 4NL3A 1PSFA 2EYXA 2MMPA 2LCLA 2D9TA 3M5AA 3JCMb 4PJOD 2VGMA 5I11A 5LJ5h 2PU9B 4AMCA 4EMKA 4L6V5 1GRIA 3TU4K 1N6AA 3OBYA 5CQXA 4C8QA 1YFNA 4QW2A 1K9AA 1WXTA 4DBFA 3LWIA 2EQUA 2YUOA 2O9VA 2DYBA 1KK7A 3J80E 4MZPA 5CIUA 4M7DB 4M75E 5GMKh 5HKCA 3X26B 2K7AA 1VQKQ 1RUWA 2JXBA 5D6YA 4TVRA 3QYGB 3M0SA 3MHXA 2F2VA 1PSEA 3ZEHA 1XTDA 2OTLQ 2QK0A 2BE7D 2DL5A 3VUZA 2DNUA 2ZZDA 3L1AA 1M30A 1WJQA 2DBMA 5GMKi 4DEYA 1G8XA 3CBPA 3GIBA 2O4XA 1WFWA 4HXJA 1YWOA 2XG8D 3FB9A 1IHWA 5CR2A 2FEIA 1YCYA 5HY6A 2XIDA 1SSFA 4CC3A
chains in the Genus database with same CATH topology
1CKAA 3TVTA 5ECAA 3UF4A 2CSQA 1AWWA 1K1ZA 1GBQA 2DJQA 2YUNA 3VS4A 4GBQA 2BZXA 2HBWA 2HEQA 4JZ4A 1FYNA 1NEGA 1SSHA 2JM8A 1K76A 3M0RA 4R0KA 2MIOA 2BZYA 2LQWA 2VWFA 4JPBW 1QWEA 1U3OA 1QLYA 1K0SA 1UHFA 1JXOA 1FMKA 2RNAA 2LX7A 1E6GA 2NUZA 3EG0A 1GFCA 2DL3A 2LCSA 1YN8A 2YUQA 1CSKA 1T0JA 3QWXX 2M0YA 2DE0X 2GQIA 3EG2A 3M0PA 2CT4A 1E6HA 2DM1A 1IO6A 1RI9A 1GL5A 2DF6A 2E5KA 2KYMA 1I0CA 2ECZA 1GCQA 1KJWA 2C0IA 2LMJA 1GCQC 2LJ1A 2CH4W 1AWOA 4LN2A 4ORZA 5HCKA 2RPNA 4ZNXA 2DL7A 2J6KA 1X27A 3FJ5A 1J3TA 5IHNA 2KEAA 3IQLA 1H8KA 2HDAA 2B86A 2GGRA 1BK2A 1JQQA 4CC7A 1SHFA 4AFUC 1ARKA 5FWCA 2VVKA 3REBB 1ABQA 4OMQA 4J9DA 2DMOA 1MV3A 1UG1A 3M0TA 1B07A 1WIEA 4E6RA 1UJ0A 4J9EA 2CREA 2VKNA 2EW3A 1X6GA 3RNJA 2EYZA 4OMOA 1SPKA 3CQTA 4QT7A 2KE9A 2RQVA 4Z88A 1K0XA 2C0TA 5EC7A 2KGTA 3TSWA 2L0AA 2AK5A 1WXBA 1VYUA 3VS0A 5GJVB 3ULRB 2PNIA 3EG3A 1T0HA 2EBPA 2A28A 2JW4A 1E7OA 1ZSGA 2KROA 1WYXA 1M3BA 2DRMA 1OEBA 2YT6A 2DBKA 2DX1A 2K3BA 3SEMA 1AWXA 2JTEA 4F17A 2D0NA 2ROLA 1M27C 1YWPA 3VS5A 2KRNA 2NWMA 4J9IA 2EGAA 1NLOC 3EHQA 2FRYA 4J9BA 3VS2A 2W0ZA 3RBBB 5IHIA 1QKXA 3H0IA 2RQRA 1PHTA 1AOJA 4F16A 2ABLA 2RQUA 1UTIA 1HJDA 2KRMA 1KSWA 4IIOA 4M4ZA 2P4RA 3I5RA 4OMPA 2FO0A 1Y57A 1AZEA 5FW9A 2EKHA 1H3HA 4Y92A 3SHWA 2KNBB 2D8JA 2J7IA 2X3XD 3ZL7C 1X2QA 1G2BA 3NMZC 2A37A 1NM7A 1BB9A 4JJCA 4LUEA 2RF0A 2HCKA 1JXMA 1WX6A 2L3SA 3NHNA 1Z9ZA 4HVUA 1RLQC 4AG2C 3GBQA 3VRYA 4D8DA 2F2WA 2EPDA 1QCFA 2DL8A 2AKKA 2D8HA 2ED0A 1X43A 3JV3A 4HCKA 5IH2A 1CKBA 4F14A 2GTJA 2V1QA 1ZUYA 1WDXA 3REAB 3PVLA 1T3LA 3NGPA 1KIKA 1A0NB 4JJBA 1SEMA 3EGUA 2CSIA 1X69A 3M0UA 4JZ3A 1TUCA 2OJ2A 4FSSA 1VYTA 1YP5A 2YSQA 2XMFA 4RTWA 4LUDA 2LNHB 3VRZA 2YDLA 1T3SA 2A08A 2KXCA 2DLPA 2FPEA 1QKWA 4Z89A 1TUDA 4CC2A 3LH5A 2L3QA 4LE9A 1ZUUA 2SEMA 3KFVA 2OI3A 1WLPB 2EYWA 1YNZA 4OMLA 4RTXA 3C0CA 1XOVA 1ZLMA 2KBTA 2PTKA 1GFDA 3NPFA 2JT4A 2RQWA 1ZBJA 2CT3A 2GTOA 2OAWA 2EQIA 4J9GA 2CUBA 1UJYA 2LQNA 4OMMA 2LJ0A 2C0OA 4D8KA 1PNJA 1OV3A 1TG0A 1X2KA 2JM9A 2LP5A 2KR3A 1UUEA 1SRLA 4AFQC 1PRMC 2F2XA 1WA7A 2J05A 2ENMA 4HVVA 1S1NA 2O31A 4RTZA 2W10A 3M0QA 1VA7A 2K79A 2J6FA 2KYBA 1M8MA 3H0FA 1NLPC 2K2MA 1V1CA 4RTYA 2KT1A 4LNPA 1B3QA 3O5ZA 4AG1C 1YCSB 2JS2A 4K11A 2O9SA 2K6DA 1H92A 1KFZA 4RTUA 2GBQA 4WCIA 3UA6A 2MCNA 1VYVA 1JO8A 2CH4A 2M51A 3EHRA 2PZ1A 1PRLC 3PE0A 1NYGA 2V1RA 2RQTA 2EYYA 4DEXA 2I0NA 3U23A 2L2PA 2BTTA 2LZ6B 1AVZC 2YUPA 4AFSC 2ESWA 2J6OA 2ROTA 1WI7A 3PVQA 1HD3A 3VS7A 4A63B 2AZVA 1NEBA 2KXDA 4X1VA 3R6NA 1HSQA 5IXFA 2FG0A 2EGCA 4RUGA 1W70A 3VS6A 4KRTA 2AKLA 1U06A 1JU5C 1OPKA 1NYFA 4ESRA 1M3AA 1BU1A 1ABOA 2JS0A 5IXBA 1X6BA 2A36A 2HSPA 3VS3A 1AD5A 3I5SA 2RMOA 1UFFA 1MUZA 4HVWA 2BZ8A 4RTTA 1SRMA 2G6FX 4EIKA 2CUDA 3EG1A 4OMNA 1ZUKA 1QWFA 2EGEA 1PWTA 5L23A 3VS1A 1LCKA 1Y0MA 1UHCA 2JMCA 2DL4A 4J9CA 1BBZA 1AEYA 1Z9QA 2GNCA 5FWBA 1AWJA 1PKSA 4CC4B 2L3PA 2LJ3A 1UDLA 2EYXA 4J9FA 1W6XA 1PKTA 5I11A 2FPDA 2JMAA 1I1JA 1G83A 1NG2A 1GRIA 2DRKA 2D1XA 2J06A 1W1FA 3A98A 2KRSA 1K9AA 2X3WD 1WXTA 3H0HA 2YUOA 2O9VA 1M3CA 2DYBA 4GLMA 1GCPA 2DVJA 2AZSA 2IIMA 2EVRA 4RTVA 2O88A 1AZGB 2K7AA 2SRCA 1RUWA 3QWYA 1UGVA 2JXBA 3M0SA 1RLPC 1UE9A 4Z8AA 2F2VA 5GJWB 2ED1A 2DA9A 2H8HA 1I07A 3THKA 1WXUA 2DL5A 1GBRA 1SHGA 2FPFA 2DNUA 2RN8A 2FRWA 1M30A 1OPLA 1ZX6A 2DBMA 2K9GA 4DEYA 1U5SA 3H41A 1K4US 4IIMA 1N5ZA 5IHKA 1WFWA 2CDTA 4HXJA 1YWOA 3I9QA 1UECA 2MOXA 2FEIA 2DILA 3UATA 5I22A 2KT8A 4JJDA 4J9HA 1JEGA 1MV0B 3UA7A 3I35A 2O2OA 1OOTA 3TSZA 4CC3A 1EFNA 4AFZC 2QDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKA A;  3TVT A;  5ECA A;  3UF4 A;  2CSQ A;  1AWW A;  1K1Z A;  1GBQ A;  2DJQ A;  2YUN A;  3VS4 A;  4GBQ A;  2BZX A;  2HBW A;  2HEQ A;  4JZ4 A;  1FYN A;  1NEG A;  1SSH A;  2JM8 A;  1K76 A;  3M0R A;  4R0K A;  2MIO A;  2BZY A;  2LQW A;  2VWF A;  4JPB W;  1QWE A;  1U3O A;  1QLY A;  1K0S A;  1UHF A;  1JXO A;  1FMK A;  2RNA A;  2LX7 A;  1E6G A;  2NUZ A;  3EG0 A;  1GFC A;  2DL3 A;  2LCS A;  1YN8 A;  2YUQ A;  1CSK A;  1T0J A;  3QWX X;  2M0Y A;  2DE0 X;  2GQI A;  3EG2 A;  3M0P A;  2CT4 A;  1E6H A;  2DM1 A;  1IO6 A;  1RI9 A;  1GL5 A;  2DF6 A;  2E5K A;  2KYM A;  1I0C A;  2ECZ A;  1GCQ A;  1KJW A;  2C0I A;  2LMJ A;  1GCQ C;  2LJ1 A;  2CH4 W;  1AWO A;  4LN2 A;  4ORZ A;  5HCK A;  2RPN A;  4ZNX A;  2DL7 A;  2J6K A;  1X27 A;  3FJ5 A;  1J3T A;  5IHN A;  2KEA A;  3IQL A;  1H8K A;  2HDA A;  2B86 A;  2GGR A;  1BK2 A;  1JQQ A;  4CC7 A;  1SHF A;  4AFU C;  1ARK A;  5FWC A;  2VVK A;  3REB B;  1ABQ A;  4OMQ A;  4J9D A;  2DMO A;  1MV3 A;  1UG1 A;  3M0T A;  1B07 A;  1WIE A;  4E6R A;  1UJ0 A;  4J9E A;  2CRE A;  2VKN A;  2EW3 A;  1X6G A;  3RNJ A;  2EYZ A;  4OMO A;  1SPK A;  3CQT A;  4QT7 A;  2KE9 A;  2RQV A;  4Z88 A;  1K0X A;  2C0T A;  5EC7 A;  2KGT A;  3TSW A;  2L0A A;  2AK5 A;  1WXB A;  1VYU A;  3VS0 A;  5GJV B;  3ULR B;  2PNI A;  3EG3 A;  1T0H A;  2EBP A;  2A28 A;  2JW4 A;  1E7O A;  1ZSG A;  2KRO A;  1WYX A;  1M3B A;  2DRM A;  1OEB A;  2YT6 A;  2DBK A;  2DX1 A;  2K3B A;  3SEM A;  1AWX A;  2JTE A;  4F17 A;  2D0N A;  2ROL A;  1M27 C;  1YWP A;  3VS5 A;  2KRN A;  2NWM A;  4J9I A;  2EGA A;  1NLO C;  3EHQ A;  2FRY A;  4J9B A;  3VS2 A;  2W0Z A;  3RBB B;  5IHI A;  1QKX A;  3H0I A;  2RQR A;  1PHT A;  1AOJ A;  4F16 A;  2ABL A;  2RQU A;  1UTI A;  1HJD A;  2KRM A;  1KSW A;  4IIO A;  4M4Z A;  2P4R A;  3I5R A;  4OMP A;  2FO0 A;  1Y57 A;  1AZE A;  5FW9 A;  2EKH A;  1H3H A;  4Y92 A;  3SHW A;  2KNB B;  2D8J A;  2J7I A;  2X3X D;  3ZL7 C;  1X2Q A;  1G2B A;  3NMZ C;  2A37 A;  1NM7 A;  1BB9 A;  4JJC A;  4LUE A;  2RF0 A;  2HCK A;  1JXM A;  1WX6 A;  2L3S A;  3NHN A;  1Z9Z A;  4HVU A;  1RLQ C;  4AG2 C;  3GBQ A;  3VRY A;  4D8D A;  2F2W A;  2EPD A;  1QCF A;  2DL8 A;  2AKK A;  2D8H A;  2ED0 A;  1X43 A;  3JV3 A;  4HCK A;  5IH2 A;  1CKB A;  4F14 A;  2GTJ A;  2V1Q A;  1ZUY A;  1WDX A;  3REA B;  3PVL A;  1T3L A;  3NGP A;  1KIK A;  1A0N B;  4JJB A;  1SEM A;  3EGU A;  2CSI A;  1X69 A;  3M0U A;  4JZ3 A;  1TUC A;  2OJ2 A;  4FSS A;  1VYT A;  1YP5 A;  2YSQ A;  2XMF A;  4RTW A;  4LUD A;  2LNH B;  3VRZ A;  2YDL A;  1T3S A;  2A08 A;  2KXC A;  2DLP A;  2FPE A;  1QKW A;  4Z89 A;  1TUD A;  4CC2 A;  3LH5 A;  2L3Q A;  4LE9 A;  1ZUU A;  2SEM A;  3KFV A;  2OI3 A;  1WLP B;  2EYW A;  1YNZ A;  4OML A;  4RTX A;  3C0C A;  1XOV A;  1ZLM A;  2KBT A;  2PTK A;  1GFD A;  3NPF A;  2JT4 A;  2RQW A;  1ZBJ A;  2CT3 A;  2GTO A;  2OAW A;  2EQI A;  4J9G A;  2CUB A;  1UJY A;  2LQN A;  4OMM A;  2LJ0 A;  2C0O A;  4D8K A;  1PNJ A;  1OV3 A;  1TG0 A;  1X2K A;  2JM9 A;  2LP5 A;  2KR3 A;  1UUE A;  1SRL A;  4AFQ C;  1PRM C;  2F2X A;  1WA7 A;  2J05 A;  2ENM A;  4HVV A;  1S1N A;  2O31 A;  4RTZ A;  2W10 A;  3M0Q A;  1VA7 A;  2K79 A;  2J6F A;  2KYB A;  1M8M A;  3H0F A;  1NLP C;  2K2M A;  1V1C A;  4RTY A;  2KT1 A;  4LNP A;  1B3Q A;  3O5Z A;  4AG1 C;  1YCS B;  2JS2 A;  4K11 A;  2O9S A;  2K6D A;  1H92 A;  1KFZ A;  4RTU A;  2GBQ A;  4WCI A;  3UA6 A;  2MCN A;  1VYV A;  1JO8 A;  2CH4 A;  2M51 A;  3EHR A;  2PZ1 A;  1PRL C;  3PE0 A;  1NYG A;  2V1R A;  2RQT A;  2EYY A;  4DEX A;  2I0N A;  3U23 A;  2L2P A;  2BTT A;  2LZ6 B;  1AVZ C;  2YUP A;  4AFS C;  2ESW A;  2J6O A;  2ROT A;  1WI7 A;  3PVQ A;  1HD3 A;  3VS7 A;  4A63 B;  2AZV A;  1NEB A;  2KXD A;  4X1V A;  3R6N A;  1HSQ A;  5IXF A;  2FG0 A;  2EGC A;  4RUG A;  1W70 A;  3VS6 A;  4KRT A;  2AKL A;  1U06 A;  1JU5 C;  1OPK A;  1NYF A;  4ESR A;  1M3A A;  1BU1 A;  1ABO A;  2JS0 A;  5IXB A;  1X6B A;  2A36 A;  2HSP A;  3VS3 A;  1AD5 A;  3I5S A;  2RMO A;  1UFF A;  1MUZ A;  4HVW A;  2BZ8 A;  4RTT A;  1SRM A;  2G6F X;  4EIK A;  2CUD A;  3EG1 A;  4OMN A;  1ZUK A;  1QWF A;  2EGE A;  1PWT A;  5L23 A;  3VS1 A;  1LCK A;  1Y0M A;  1UHC A;  2JMC A;  2DL4 A;  4J9C A;  1BBZ A;  1AEY A;  1Z9Q A;  2GNC A;  5FWB A;  1AWJ A;  1PKS A;  4CC4 B;  2L3P A;  2LJ3 A;  1UDL A;  2EYX A;  4J9F A;  1W6X A;  1PKT A;  5I11 A;  2FPD A;  2JMA A;  1I1J A;  1G83 A;  1NG2 A;  1GRI A;  2DRK A;  2D1X A;  2J06 A;  1W1F A;  3A98 A;  2KRS A;  1K9A A;  2X3W D;  1WXT A;  3H0H A;  2YUO A;  2O9V A;  1M3C A;  2DYB A;  4GLM A;  1GCP A;  2DVJ A;  2AZS A;  2IIM A;  2EVR A;  4RTV A;  2O88 A;  1AZG B;  2K7A A;  2SRC A;  1RUW A;  3QWY A;  1UGV A;  2JXB A;  3M0S A;  1RLP C;  1UE9 A;  4Z8A A;  2F2V A;  5GJW B;  2ED1 A;  2DA9 A;  2H8H A;  1I07 A;  3THK A;  1WXU A;  2DL5 A;  1GBR A;  1SHG A;  2FPF A;  2DNU A;  2RN8 A;  2FRW A;  1M30 A;  1OPL A;  1ZX6 A;  2DBM A;  2K9G A;  4DEY A;  1U5S A;  3H41 A;  1K4U S;  4IIM A;  1N5Z A;  5IHK A;  1WFW A;  2CDT A;  4HXJ A;  1YWO A;  3I9Q A;  1UEC A;  2MOX A;  2FEI A;  2DIL A;  3UAT A;  5I22 A;  2KT8 A;  4JJD A;  4J9H A;  1JEG A;  1MV0 B;  3UA7 A;  3I35 A;  2O2O A;  1OOT A;  3TSZ A;  4CC3 A;  1EFN A;  4AFZ C;  2QDL A; 
#chains in the Genus database with same CATH topology
 3GPL A;  1D3B B;  2RK1 A;  2YWW A;  1ZSZ B;  4F7U E;  3OQ5 A;  2DJQ A;  2RHY A;  9ATC B;  2BZX A;  2HEQ A;  3CBM A;  2JM8 A;  3M0R A;  2BZY A;  3ME9 A;  1Q82 U;  2HKN A;  1U3O A;  4XTW A;  4F7U A;  1FMK A;  1E6G A;  3S3N A;  3VJP A;  2FYK A;  4A54 A;  2X51 A;  2M0Y A;  3QWX X;  1YJN A;  2GQI A;  3EG2 A;  2CT4 A;  2DM1 A;  4M75 B;  3EFO A;  2VGN A;  2KYM A;  3S3O A;  3L2U A;  1KJW A;  3TEE A;  2E10 A;  2XDB A;  1GCQ C;  3HRU A;  2CH4 W;  4N0A C;  4LN2 A;  1OQK A;  2DL7 A;  2J6K A;  1D1C A;  1XQH A;  3FJ5 A;  2RO0 A;  5IHN A;  5GAM f;  3OYB A;  3CCQ Q;  2LTO A;  3VUB A;  1H8K A;  2HDA A;  1VQ5 T;  1VQL Q;  4C0F A;  1QVG A;  4KUL A;  5D6W A;  1ARK A;  1VQ4 Q;  2PUK B;  1ABQ A;  5FRN A;  4OMQ A;  4PFZ A;  2XU8 A;  2DMO A;  4D6W A;  1R0B G;  3M0T A;  3CC7 T;  1WHL A;  1WIE A;  2CZ1 B;  2OAU A;  1NE8 A;  2DXB A;  2YLB A;  1KQS S;  4OB1 B;  3M57 A;  5HK3 A;  5KYY B;  2CRE A;  1I4K 1;  3LX7 A;  4DBQ A;  1X6G A;  3PGG A;  3RNJ A;  4OMO A;  1SPK A;  3CQT A;  2KE9 A;  2JN0 A;  2RHX A;  2RQV A;  4LDV A;  3CCR A;  2C0T A;  5FU6 B;  1WXB A;  2ATC B;  1LOJ A;  2MI6 A;  2A28 A;  2JW4 A;  1D0Y A;  2KRO A;  1UGR B;  2DRM A;  1VIF A;  3HSB A;  5LL6 S;  4BE2 A;  2DZ9 A;  5KYX B;  5GAO n;  1ACM B;  4J83 A;  2JTF A;  2JTM A;  2P0Q A;  2NWM A;  4J9I A;  2DVE A;  3URG A;  2W0Z A;  5IHI A;  1QKX A;  2X4X A;  1WHM A;  1PD1 A;  1AOJ A;  1IXD A;  4BDZ A;  4F16 A;  3CD6 A;  3OYI A;  2RQU A;  1KQ1 A;  1WHJ A;  4N4G A;  4M77 C;  1Q7Y U;  2QGF B;  2P4R A;  3JB9 F;  4OMP A;  2YRV A;  2FO0 A;  2DJZ A;  4E7L A;  3QZ9 B;  5J26 A;  2QA4 Q;  1KD1 U;  2EKH A;  3MP1 A;  2V8K A;  3G4S T;  3CCQ T;  2XDP A;  3OYG A;  2G3R A;  4HT9 A;  2X3X D;  3H9N A;  1G2B A;  1ZBX A;  3JB9 D;  2VYT A;  3MEV A;  3EFR A;  4LDU A;  1DJ7 B;  1Q81 U;  1BB9 A;  1C0M A;  1M4Z A;  2K2V A;  4LUE A;  4M77 A;  4MML A;  4A4G A;  3GNF B;  1TS9 A;  1YIT Q;  1TUG B;  1P92 A;  1RAD B;  1Z9Z A;  3JB9 I;  3MEW A;  2QAS A;  3VRY A;  3P8B B;  3MJX A;  4OVA A;  5LJ3 d;  2ED0 A;  1UEB A;  3QSU A;  3A8O B;  3J81 E;  3NTH A;  3CBO A;  1X69 A;  1PCX A;  3M0U A;  4JZ3 A;  3V7S A;  4Y28 E;  3HRT A;  4FSS A;  1VYT A;  3PTA A;  3OS5 A;  2YDL A;  2FPE A;  5GAO l;  4Z89 A;  1TUD A;  5J39 A;  4CI0 C;  1ZUU A;  1BI2 A;  4PLI A;  4BB7 A;  1VQ4 A;  1WLP B;  4LDY A;  1B7T A;  1WHG A;  1IGQ A;  1R0C B;  4FL6 A;  2HNI A;  1Q86 R;  2QAZ A;  4BUG A;  3OYM A;  1GFD A;  2BKD N;  2RQW A;  2GTO A;  4J9G A;  4M78 E;  3QKJ A;  1Y96 A;  1RL2 A;  1KC8 R;  3I55 A;  2CZ7 B;  2LJ0 A;  2C0O A;  1VQO T;  4BE0 A;  4IUQ A;  1X2K A;  2HMA A;  4J6W A;  2LP5 A;  2LX9 A;  2E4H A;  1OU9 A;  1G3Y A;  3FLG A;  1SRL A;  4C8Q G;  3PMT A;  5GAN h;  1MMA A;  2J05 A;  2NUP A;  2JJ9 A;  3CME T;  2W10 A;  3QO3 A;  5KYX A;  1VA7 A;  1V29 B;  4N0A A;  2QEX T;  2KYB A;  1M8M A;  3H0F A;  2XD0 A;  4A53 A;  1NJI R;  4M75 D;  4RTY A;  1Q86 U;  1KC8 U;  1NPR A;  1OU8 A;  2E12 A;  3O5Z A;  3CCE Q;  3FC3 A;  1YCS B;  2ZPE B;  3ER0 A;  2DTI A;  2F5T X;  1KFZ A;  3M59 A;  1D0X A;  4ZTJ A;  3PE0 A;  1NYG A;  3HP9 A;  2RQT A;  2QA4 A;  2L2P A;  2ZGW A;  4ZGD B;  4EMG A;  4QQG A;  2JOY A;  3PVQ A;  3G4S A;  4C0D B;  2AZV A;  1NEB A;  1WJS A;  4M7D C;  2KXD A;  4X1V A;  3R6N A;  1PD0 A;  5GAM d;  2KAF A;  3MP8 A;  4EDU A;  3NTK A;  4KRT A;  1U06 A;  1ZQ1 A;  1OPK A;  1WQ7 A;  3MP6 A;  1NYF A;  2P4T A;  2H3E B;  3PIO A;  2DKG A;  2JS0 A;  5AYF A;  3CC4 T;  1X6B A;  2CZ6 B;  1AD5 A;  2ZPH B;  3M4Y A;  2JVV A;  1VQ9 T;  3V8L A;  2CP2 A;  3SDZ A;  5KE3 A;  1M1K U;  4JLG A;  2NLU A;  2GFU A;  2K4Y A;  4XAX B;  1G5V A;  4M78 C;  1PWT A;  3OSS C;  2O4X B;  3VS1 A;  2LNV A;  3CCE A;  1YJ9 T;  3CCJ T;  1AEY A;  4KUD K;  2GNC A;  5FWB A;  4X34 A;  3C12 A;  2P0K A;  4CC4 B;  1I8F A;  2L3P A;  1K73 C;  1FX7 A;  3CCQ A;  1VQ5 A;  2XDD A;  3JCM f;  2F69 A;  3V8K A;  1VQL A;  3JB9 G;  1BI1 A;  3FEO A;  5CCA A;  2RB6 A;  2FPD A;  3V7R A;  2JMA A;  1K9M C;  2DRK A;  2CS7 A;  2D1X A;  1W1F A;  5A0G A;  4C8Q C;  1TH7 A;  3HFN A;  1MND A;  3UT1 A;  2I2L A;  1YI2 A;  1M2V B;  4XTU A;  4GY5 A;  5KCO A;  3CME A;  4FYX B;  1VQM Q;  4RCB A;  2HQH A;  2X4W A;  3Q1J A;  1X75 C;  4J6Y A;  4RTV A;  2FHD A;  1UGV A;  2E6Z A;  3WVE B;  1VQ6 Q;  4JRP A;  4Z8A A;  1RLP C;  1UE9 A;  3BDU A;  5GJW B;  3WXM B;  2DA9 A;  5KYW A;  2H8H A;  2GCX A;  5LJ3 g;  1GBR A;  1SHG A;  2QEX A;  2COY A;  7AT1 B;  2HQX A;  2K9G A;  3GLX A;  1M1G A;  3VYH B;  1TTH B;  4P5N A;  1QW1 A;  1M2O A;  1YI2 T;  2EJ9 A;  3QPH A;  1QVG S;  2IPO B;  4C92 E;  3UAT A;  5I22 A;  2KT8 A;  3H6Z A;  2LVM A;  3CCM A;  1OOT A;  1W2B P;  3G71 T;  1EFN A;  4AFZ C;  1CKA A;  4ATO A;  1N9R A;  3DLM A;  2BUD A;  5A0L A;  4QVC A;  1VQ8 Q;  3I55 T;  1G3W A;  1QP3 A;  4E7H A;  1GBQ A;  2DIG A;  2YUN A;  1K9M U;  4JZ4 A;  4DBR A;  1NEG A;  1SSH A;  4J7I A;  3M54 A;  2ZPI B;  3A8L B;  1S72 Q;  2VWF A;  4FCY A;  4JPB W;  1JXO A;  3CCR Q;  4C0G A;  2JZ2 A;  2RNA A;  3CCV A;  1OI1 A;  1G3S A;  1YN8 A;  4E7S A;  1CSK A;  4FM4 B;  5LJ5 d;  2DE0 X;  3CCL A;  1YHQ T;  3M0P A;  1ZSZ A;  1E6H A;  1IO6 A;  5I2M A;  2OTL A;  2DF6 A;  2EYQ A;  2LDM A;  1K9M R;  4KGZ B;  1U8R A;  3CEY A;  4JRQ A;  2YRC A;  1AWO A;  4C8Q E;  1WZO A;  5HCK A;  2EQM A;  2RPN A;  4ZNX A;  5DY9 A;  1K73 R;  1X27 A;  1LNX A;  1EX4 A;  1J3T A;  1OUL A;  2KEA A;  2RHU A;  5J3B A;  5LJ3 j;  5L8R E;  2GGR A;  3MKD A;  1JQQ A;  3RUX A;  3VKI A;  2A3L A;  2F1L A;  4FW1 A;  4M75 A;  2VVK A;  3REB B;  3SWN B;  3BY7 A;  3OSV A;  4IUP A;  3NTI A;  3OS2 A;  1VQN T;  3S6W A;  4J9E A;  2VKN A;  2EW3 A;  4XTX A;  4X9C A;  4ZGJ B;  4QT7 A;  4KGX B;  2HQE A;  4QQD A;  2M0O A;  4M77 B;  4Z88 A;  1M90 U;  4M7A D;  1H64 1;  1K0X A;  1VQ6 A;  3JCM c;  5EC7 A;  3TQ7 P;  2WSE E;  1VYU A;  3VS0 A;  4HCB A;  2CZ0 B;  5GJV B;  2QTX A;  3EG3 A;  2VC8 A;  2EBP A;  3MEA A;  1ZSG A;  4E7J A;  2CYZ B;  3CPW A;  2YT6 A;  2VXF A;  4X9D A;  4O5V A;  2L8D A;  4L59 A;  5M9O A;  2OTJ T;  2KRN A;  2PVD B;  4J9B A;  3VS2 A;  2FRY A;  1JRI A;  3RBB B;  3CCU Q;  2KY9 A;  3H0I A;  2RQR A;  3JCM h;  2D6F A;  4XK8 E;  2QQB A;  2DIQ A;  1EZZ B;  4PJN A;  4C8Q F;  1HJD A;  2OTJ A;  4J8O A;  1KQS P;  1VQ8 A;  1I81 A;  3OY9 A;  3QDR B;  2QA4 T;  2X9H A;  5FW9 A;  3RER A;  4MDX A;  1D1A A;  1W2B S;  1JJ2 A;  4ZGE B;  3QJ6 A;  3SHW A;  2D8J A;  2XI9 A;  3D7S B;  1JJ2 P;  2J7I A;  3ZL7 C;  1X2Q A;  3CC4 Q;  1QQJ A;  1WGS A;  4II1 A;  2R57 A;  3G1J A;  2YXY A;  2RF0 A;  4RKU E;  2HCK A;  1Q81 R;  4BY6 C;  1JXM A;  3CCL Q;  1YIT T;  1HYO A;  4HVU A;  3HTR A;  2FZG B;  2DL8 A;  4HCK A;  2AKK A;  1UGS B;  1X43 A;  2R5A A;  2K5F A;  4F14 A;  2GTJ A;  1WDX A;  3PVL A;  1QCN A;  1Q86 C;  4JJB A;  1SEM A;  2CSI A;  3QDF A;  1M9S A;  2QQS A;  5GAN 5;  4DOW A;  2XMF A;  4LUD A;  2LNH B;  1T3S A;  1IGU A;  5D6X A;  2A08 A;  4C5G A;  1D09 B;  5CK9 A;  1QKW A;  3EAE A;  1I5O B;  1VQN A;  3EGD B;  2L3Q A;  1R77 A;  4LE9 A;  2K3X A;  2SEM A;  4L5G A;  3RR6 A;  2NUT A;  1MMD A;  2EYW A;  1N8R R;  2OTJ Q;  1M1K R;  2QQR A;  4RTX A;  1XNI A;  3GOX A;  3C0C A;  3E9G A;  1Q82 R;  3SB2 A;  2RI2 A;  2JT4 A;  2CT3 A;  1RAB B;  2OAW A;  3V8J A;  2CUB A;  3UDC A;  3JCM Q;  2M1H A;  4LXC A;  1UJY A;  1YHQ A;  5A0D A;  1VQL T;  2EKO A;  2WAC A;  2CP7 A;  4D8K A;  2KQW A;  2L5Q A;  1TG0 A;  3M53 A;  4R55 A;  2RJD A;  3I56 Q;  1VQM A;  2JM9 A;  2KR3 A;  3FRN A;  2EQJ A;  4A4K A;  1VQK A;  3CMA T;  1PRM C;  2F2X A;  1WA7 A;  1S1N A;  2O31 A;  2LC4 A;  1K8A C;  1FMV A;  1JJ2 S;  3OBW A;  1W4S A;  3M0Q A;  1KG1 A;  2OX7 A;  4B9W A;  2QEX Q;  4XU1 A;  1NLP C;  4WF2 A;  4IUV A;  1VQ8 T;  3KBG A;  4AG1 C;  3BDL A;  3X25 B;  4J6X A;  3QYH B;  2O9S A;  5GAN g;  2YLC A;  1H92 A;  4A4E A;  3CCJ A;  4B6M A;  2MCN A;  2GFA A;  1IRX A;  2CH4 A;  2M51 A;  3FIF A;  1YIJ Q;  1RAF B;  2EYY A;  4PJO G;  3G6E T;  4F7U F;  1U1T A;  2RD1 A;  2V26 A;  2YUP A;  2DER A;  2E65 A;  2J6O A;  5LJ5 e;  4OB2 B;  1HD3 A;  5DLQ E;  3VV0 A;  4C0D C;  2ZAE A;  1H3Z A;  2FG0 A;  2AT1 B;  3VS6 A;  2CP0 A;  1BKB A;  4PFO A;  3CCV Q;  2DAQ A;  3HFO A;  3JB9 J;  4RG2 A;  3X24 B;  3I5S A;  1K8A R;  2EFI A;  4M77 F;  2QDY B;  5KYW B;  2HSE B;  2LQ8 A;  4NL2 A;  4RTT A;  2M02 A;  3RES A;  4HCZ A;  2NUT B;  2CP6 A;  4M78 B;  1SG5 A;  5IN1 A;  4KUI A;  2LQK A;  4LD6 A;  4J9C A;  1Z9Q A;  2EQK A;  5KYY A;  1PKS A;  4ANJ A;  2X4J A;  2A7Y A;  3VYG A;  3MO8 A;  4J9F A;  2MK5 A;  4KH1 B;  2DEQ A;  2YHT A;  2QGG A;  1PKT A;  1B34 A;  2VV5 A;  2XHC A;  4M77 E;  1NG2 A;  1M1K C;  4JLI A;  1X6O A;  1N8R C;  3BFM A;  4C8Q B;  2KRS A;  2X3W D;  3H0H A;  2HL3 A;  1HXD A;  2VB6 A;  2E70 A;  2HAX A;  1M3C A;  1QMC A;  4GLM A;  3CXC P;  3CPW P;  3SFM A;  2RK2 A;  2IIM A;  3OYC A;  1VQM T;  3CCS T;  2EVR A;  1M90 C;  1AZG B;  3QWY A;  2CP3 A;  3F70 A;  3OS1 A;  1B34 B;  1GXI E;  4FU6 A;  1I07 A;  3LGF A;  3THK A;  2RJC A;  1VQ7 T;  1TSF A;  1X01 A;  2FPF A;  2DXT A;  2FRW A;  2R5M A;  3EFO B;  1ZX6 A;  3L2R A;  1N27 A;  3QG1 A;  2XK0 A;  3JCM P;  4E7Z A;  2VUB A;  1U5S A;  3H41 A;  2RI3 A;  4IIM A;  5GAO q;  1VQ4 T;  4ME7 A;  2CDT A;  1Y71 A;  5GMK l;  3EH1 A;  3CC7 A;  3G6E A;  2MOX A;  2ZPF B;  3OYN A;  1JEG A;  1MV0 B;  4IUT A;  3UA7 A;  4Z02 A;  2O2O A;  1Y96 B;  4RMO A;  3CD6 Q;  4CRI A;  4FYV B;  1O75 A;  4M78 D;  5ECA A;  1ZSZ C;  1AT1 B;  4BI8 B;  3LW5 E;  1IB8 A;  2CSQ A;  1AWW A;  4ELZ C;  4GBQ A;  5GAN 8;  2KSS A;  1K76 A;  4R0K A;  2MIO A;  2ZPB B;  2CP5 A;  1LVK A;  1RAG B;  3DB3 A;  1KHI A;  1YI2 Q;  3E1S A;  1QWE A;  1QLY A;  2DPP B;  4UC4 A;  1K0S A;  1WQW A;  5GAM e;  2COW A;  4KGV B;  1GFC A;  2DL3 A;  2LCS A;  1T0J A;  3A8M B;  2A0F B;  1VQ7 Q;  2E5K A;  3RIR A;  2ECZ A;  1GCQ A;  5KE2 A;  3OS0 A;  3M56 A;  2C0I A;  2LMJ A;  3S3M A;  5LJ3 e;  2LJ1 A;  1U1S A;  3HKS A;  3E2U A;  1WJR A;  1VQ9 Q;  4J7F A;  2LT4 A;  1OX9 A;  4PJO A;  2B86 A;  1M8V A;  1BK2 A;  3OYH A;  1SHF A;  4C92 C;  2PVO B;  1KQS A;  4J9D A;  4M75 F;  1MV3 A;  3AT1 B;  1UG1 A;  3SD4 A;  5GMK j;  5GAN 3;  1B07 A;  1TWB A;  4E6R A;  3QBY A;  3CCS A;  4EPC A;  1OZ2 A;  1UJ0 A;  3CCM T;  4BD3 A;  3GNG A;  3CC2 Q;  4J5Y A;  4M7D D;  4E47 A;  2EYZ A;  4GLK A;  3C94 A;  2KGT A;  3TSW A;  2QG9 B;  5GAN j;  3JCM W;  2MAM A;  1WPY A;  2PNI A;  4WTO B;  3HL8 A;  1UB4 A;  1OEB A;  2DBK A;  5GAM h;  2K3B A;  3SEM A;  1AWX A;  2JTE A;  5FRM A;  1ZA2 B;  1M27 C;  2EIF A;  3EG9 A;  3EHQ A;  3G6E Q;  4ZTF A;  2KMT A;  2AHJ B;  2YRD A;  4M77 G;  2E64 A;  5CVI A;  4LDX A;  5GAN 6;  1NPP A;  1RAI B;  4FYY B;  2ABL A;  2KRM A;  1KSW A;  4IIO A;  1KD1 C;  2RI5 A;  4M78 F;  1SKU B;  2ZCF B;  5GAN d;  4BDY A;  3M58 A;  3EFS A;  1H3H A;  2DTH A;  4MZM A;  4MDW A;  1WHK A;  3JRZ A;  5GAN 7;  4EMK B;  6AT1 B;  4EMK C;  3CPF A;  4OB0 B;  1NZ9 A;  2A37 A;  1NM7 A;  2M9U A;  1VQO A;  4NS5 A;  4LD9 K;  1Q7Y R;  3X20 B;  2V8J A;  4M7A C;  3GBQ A;  5DLO A;  1BIB A;  4D8D A;  4MZT A;  4JRK A;  5CKF A;  3CC2 T;  3OA6 A;  2F2W A;  2DXU A;  2BE9 B;  2EPD A;  1QCF A;  3JV3 A;  2D8H A;  5IH2 A;  4FIB A;  4M7D E;  1ZUY A;  3REA B;  1T3L A;  3NGP A;  3CCR T;  1A0N B;  2DET A;  3EGU A;  2E3I A;  2WSF E;  3RKX A;  2Y4Y A;  2OJ2 A;  1YP5 A;  4BY6 B;  3LYI A;  1MGQ A;  4RTW A;  3VRZ A;  5IT9 E;  1D0Z A;  4JUV A;  4PJO B;  2VAS A;  2DLP A;  5GAN 4;  4DA4 A;  1LPL A;  3ZFJ A;  5GAO p;  4CC2 A;  3QII A;  2DEU A;  3R6O A;  1BYM A;  2MF2 A;  1XJW B;  2OI3 A;  2DTO A;  4C92 D;  4OML A;  1VUB A;  4PKC C;  3T9N A;  4PNO A;  5GAO r;  3CCS Q;  2LCC A;  1XOV A;  2FB7 A;  1MHN A;  5GMK e;  3QUI A;  2KBT A;  4C5I A;  2PTK A;  3NPF A;  5IAY A;  1ZBJ A;  3DKM A;  4C5E A;  4Y91 A;  4JS4 A;  2LQN A;  3CC4 A;  3MPU B;  3ZBD A;  4ELY C;  1PNJ A;  2KDS A;  2OTL T;  3PNW C;  3E19 A;  2X35 A;  4PJO C;  3A8G B;  1LJO A;  4M7A B;  4O6J A;  4BAC A;  2L89 A;  4C0Z A;  2PQW A;  2ENM A;  4KBM B;  4HVV A;  1MMN A;  2KVQ G;  2FL7 A;  1IZ6 A;  4XTZ A;  2K79 A;  5C6S A;  3BE3 A;  2DYI A;  2DK3 A;  2AIR B;  2K2M A;  1AHJ B;  4LNP A;  2RH2 A;  3FDR A;  2DXC A;  2H3J A;  4A4H A;  1QVF S;  5CQY A;  2JS2 A;  3A5Z B;  4HKE A;  4K11 A;  4RTU A;  3H8Z A;  2PUO B;  8AT1 B;  3RKY A;  2B8A A;  3CCV T;  2GQV A;  1JO8 A;  8ATC B;  4IUR A;  1PRL C;  3L2Q A;  1M1F A;  2WSC E;  1YIJ T;  4M7D A;  1YJN T;  2V1R A;  4KT0 E;  3OYF A;  3OB9 A;  4F04 B;  3OYD A;  4DEX A;  2BTT A;  2P0P A;  1AVZ C;  2LZ6 B;  5CKD A;  2LRQ A;  3OYE A;  2ESW A;  4XU0 A;  1QVP A;  2ROT A;  1WI7 A;  2E5Q A;  1NJI U;  5LJ5 f;  4A63 B;  2IVW A;  4IUU A;  3DLL A;  4HCC A;  1HSQ A;  5IXF A;  2KI7 A;  3HRS A;  4FT4 A;  4EMH A;  1W70 A;  2AKL A;  4DOV A;  3JCM e;  3PT9 A;  1NJI C;  4ESR A;  1BU1 A;  3PMI A;  1Q82 C;  3C95 A;  3L2Z A;  1ABO A;  4R56 A;  2LT1 A;  4AT1 B;  5IXB A;  3KUF A;  1VQ7 A;  2A36 A;  2HSP A;  3VS3 A;  1RAH B;  2RMO A;  1UFF A;  1MUZ A;  4HVW A;  3J7A F;  2QTV A;  2BZ8 A;  1SRM A;  1IRE B;  3EG1 A;  4OMN A;  5FRO A;  1ZUK A;  3N5B B;  1QWF A;  2EGE A;  2FZK B;  5L23 A;  1Y0M A;  1UHC A;  4HT8 A;  3C4S A;  2DL4 A;  2Z0W A;  3CCM Q;  1AWJ A;  1OZ3 A;  3MEU A;  1KC8 C;  1M5Q 1;  2HBP A;  2LJ3 A;  1W2B A;  1UDL A;  2COZ A;  4ZN3 A;  1W6X A;  4PJO F;  5EG2 A;  1FXX A;  2MWP A;  1ZHI A;  1VQP Q;  1I1J A;  2PVG B;  1G83 A;  1OX8 A;  2E41 A;  2J06 A;  4XTY A;  3A98 A;  1Q81 C;  1JBM A;  1MMG A;  5LJ3 h;  3KXT A;  1S72 A;  5LJ5 g;  3V7C A;  3WVD B;  3CC2 A;  3DB4 A;  1GCP A;  2DVJ A;  2RA2 A;  5A2Q E;  2AZS A;  4M7D F;  2ZPG B;  5HK0 A;  5I21 A;  2X4Y A;  2O88 A;  2GF7 A;  3LGL A;  2SRC A;  1YJW A;  3CD6 T;  3CPW S;  5I2S A;  1WNL A;  2ED1 A;  2QQ9 A;  4OGE A;  1WXU A;  3SWN C;  5CKH A;  3RKW A;  4B9X A;  4JDS A;  1I5L A;  2RN8 A;  1QVG P;  3G7Z A;  1OPL A;  1N8R U;  1EIF A;  2FVU A;  2FZC B;  3M4G A;  1K4U S;  4OMF B;  4RG8 A;  2NYS A;  5IHK A;  3I9Q A;  3TRE A;  4KH0 B;  1NBE B;  1UEC A;  2NUP B;  2DIL A;  3EGX A;  4JJD A;  4J9H A;  3I35 A;  4DBH A;  3TSZ A;  2EAY A;  5KYU B;  1VQK T;  4V2S A;  2QDL A;  1N5Z A;  1YIJ A;  3TVT A;  4C92 B;  3UF4 A;  3RMQ A;  1YJ9 Q;  5DM7 R;  3SWN A;  4C92 F;  1K1Z A;  3M9Q A;  3OW2 A;  1BCM A;  1F1B B;  4PJM A;  3VS4 A;  4QVD A;  3P8D A;  1KQ2 A;  2HBW A;  1FYN A;  1PM3 A;  4JJN K;  1Y07 A;  2KK4 A;  4OGC A;  5GAO m;  2LQW A;  2Y4X A;  2JNG A;  4PJL A;  5FU6 C;  1HK9 A;  1UHF A;  2EWN A;  2LX7 A;  4PL6 A;  2NUZ A;  3EG0 A;  3FJP A;  1PC0 A;  2YUQ A;  4M7A G;  4M75 G;  4M78 G;  5KYN A;  1RI9 A;  1GL5 A;  1I0C A;  2DD4 A;  4XU3 A;  2C06 A;  2O01 E;  2HKQ B;  4JRI A;  5LJ3 f;  4ORZ A;  3ASK A;  4M7D G;  3IQL A;  2IG0 A;  1VQ5 Q;  3EG9 B;  3E9F A;  1M90 R;  3P8H A;  1QP2 A;  2P84 A;  4CC7 A;  3A1P A;  4AFU C;  3QZ5 B;  5AT1 B;  5FWC A;  3JCM g;  2E1H A;  2QQA A;  3TCJ A;  1UGP B;  5GAN e;  2MPX C;  3CME Q;  1PG5 B;  4E2F B;  3JCM J;  3I55 Q;  3QXE B;  3GF5 A;  4F7U B;  4A4F A;  3OMG A;  3LLR A;  1BCO A;  3G71 Q;  1Q95 G;  3I56 A;  2L0A A;  2AK5 A;  1K73 U;  3ULR B;  3X28 B;  2HZY A;  1T0H A;  2Y90 A;  2K57 A;  1E7O A;  3RDV A;  1WYX A;  4OB3 B;  1M3B A;  2DX1 A;  5LJ5 j;  4E7I A;  3EGX B;  4JS5 A;  4F17 A;  2D0N A;  2ROL A;  4LDW A;  1YWP A;  3VS5 A;  3LWH A;  4PK4 A;  3LH0 A;  2CKK A;  2EGA A;  1NLO C;  3RMS A;  2RHZ A;  1IHV A;  1PHT A;  1VQ9 A;  1BI0 A;  3I56 T;  3UPU A;  1UTI A;  1BIA A;  4M4Z A;  4F7U G;  4IKF A;  1RI0 A;  3I5R A;  3OW2 S;  1Y57 A;  1YJ9 A;  1AZE A;  4QVZ A;  4Y92 A;  3O8V A;  4BE1 A;  1QVF P;  2KNB B;  2K3Y A;  2XKO C;  3G4S Q;  1C6V X;  4FT2 A;  3VU3 C;  4M77 D;  3NMZ C;  4QQ6 A;  4PJJ A;  2DZC A;  4JJC A;  2VXE A;  3JSC A;  4ZN1 A;  1K8A U;  2RHI A;  5GAM j;  1WX6 A;  3G71 A;  4C5H A;  2L3S A;  5FU7 B;  1M2V A;  3NHN A;  4BI3 A;  1RLQ C;  3CMA A;  4AG2 C;  4PLL A;  2MYS A;  1UGQ B;  2E3H A;  4BI4 A;  4C92 G;  3CXC A;  3OYA A;  4M75 C;  4RCC A;  1CKB A;  2QI2 A;  2V1Q A;  2XIC A;  1KIK A;  1VIE A;  4OF1 A;  1TOV A;  2M16 A;  5KYU A;  3OYK A;  1TUC A;  5C0M A;  1FMW A;  2YSQ A;  4Q5W A;  4XTV A;  1FWZ A;  5FU7 C;  3OYY A;  3CCU A;  2KXC A;  1VQP T;  1V76 A;  3OMC A;  4M7A F;  3LH5 A;  4NOY A;  2EJF A;  3KFV A;  4YTL A;  5CO7 A;  1YNZ A;  3JB9 H;  2JUF A;  3INZ A;  3CCU T;  2D0Q B;  1BI3 A;  4MMK A;  1VQP A;  1TXQ A;  3GP8 A;  1ZLM A;  3CXC S;  3M55 A;  3QJY A;  5CKE A;  1D3B A;  2EQI A;  4FYW B;  4FW2 A;  4OMM A;  3HPW A;  4FSX A;  2R58 A;  3A8H B;  1R8O B;  1VOM A;  1Q7Y C;  1RAA B;  1OV3 A;  5GAN 2;  5FLX E;  3UWN A;  1VQO Q;  1KHC A;  1YIT A;  1UUE A;  5KCH A;  1YJW Q;  4QKU A;  4AFQ C;  3PFS A;  1WHH A;  1S72 T;  1N9S A;  4RTZ A;  1MNE A;  5GAN f;  2J6F A;  2EJG A;  4PJO E;  2K5I A;  2QYZ A;  1V1C A;  3HHT B;  2QXF A;  2RM4 A;  5GAM g;  3CCL T;  2KT1 A;  1B3Q A;  2L3R A;  1KD1 R;  3OW2 P;  1ZA1 B;  2RJE A;  2HL5 C;  3EH2 A;  3AHU A;  3EGD A;  4DQ2 A;  3CC7 Q;  2F5K A;  2K6D A;  2MWO A;  3L42 A;  2K5L A;  3QHS A;  2GBQ A;  4WCI A;  3JCM V;  3UA6 A;  4C8Q D;  5KH6 A;  1VYV A;  2DD5 A;  3EHR A;  2PZ1 A;  2BIV A;  2V8I A;  2RJF A;  1C1A A;  1JB0 E;  3BW1 A;  4E7K A;  3L2W A;  3OYL A;  2I0N A;  3U23 A;  5CAI A;  4AFS C;  1YBY A;  4XQ3 A;  2DFU A;  1Y7X A;  4N4H A;  3VS7 A;  4C92 A;  3CCE T;  2E6N A;  1YHQ Q;  2HD0 A;  4N4I A;  3OYJ A;  2EGC A;  5CKB A;  4RUG A;  1O9S A;  1RAE B;  3L2V A;  1TU0 B;  1RAC B;  1JU5 C;  3PIP A;  1YJW T;  1QVF A;  3NFC A;  3CMA Q;  3MET A;  1M3A A;  2CGH A;  1QCO A;  1YJN Q;  4XU2 A;  4M7A E;  2DO3 A;  3JAM E;  4VUB A;  5GMK m;  4PFP A;  1SF9 A;  2G6F X;  4EIK A;  5D7U A;  2CUD A;  4OP0 A;  1D1B A;  1LCK A;  3MCA B;  4HA8 A;  4M7A A;  4M78 A;  3JCM d;  2JMC A;  1G3T A;  1VQN Q;  1BBZ A;  1OYX A;  3CCJ Q;  3JCM X;  1VQ6 T;  4NL3 A;  1PSF A;  2EYX A;  2MMP A;  2LCL A;  2D9T A;  3M5A A;  3JCM b;  4PJO D;  2VGM A;  5I11 A;  5LJ5 h;  2PU9 B;  4AMC A;  4EMK A;  4L6V 5;  1GRI A;  3TU4 K;  1N6A A;  3OBY A;  5CQX A;  4C8Q A;  1YFN A;  4QW2 A;  1K9A A;  1WXT A;  4DBF A;  3LWI A;  2EQU A;  2YUO A;  2O9V A;  2DYB A;  1KK7 A;  3J80 E;  4MZP A;  5CIU A;  4M7D B;  4M75 E;  5GMK h;  5HKC A;  3X26 B;  2K7A A;  1VQK Q;  1RUW A;  2JXB A;  5D6Y A;  4TVR A;  3QYG B;  3M0S A;  3MHX A;  2F2V A;  1PSE A;  3ZEH A;  1XTD A;  2OTL Q;  2QK0 A;  2BE7 D;  2DL5 A;  3VUZ A;  2DNU A;  2ZZD A;  3L1A A;  1M30 A;  1WJQ A;  2DBM A;  5GMK i;  4DEY A;  1G8X A;  3CBP A;  3GIB A;  2O4X A;  1WFW A;  4HXJ A;  1YWO A;  2XG8 D;  3FB9 A;  1IHW A;  5CR2 A;  2FEI A;  1YCY A;  5HY6 A;  2XID A;  1SSF A;  4CC3 A; 
#chains in the Genus database with same CATH homology
 1CKA A;  3TVT A;  5ECA A;  3UF4 A;  2CSQ A;  1AWW A;  1K1Z A;  1GBQ A;  2DJQ A;  2YUN A;  3VS4 A;  4GBQ A;  2BZX A;  2HBW A;  2HEQ A;  4JZ4 A;  1FYN A;  1NEG A;  1SSH A;  2JM8 A;  1K76 A;  3M0R A;  4R0K A;  2MIO A;  2BZY A;  2LQW A;  2VWF A;  4JPB W;  1QWE A;  1U3O A;  1QLY A;  1K0S A;  1UHF A;  1JXO A;  1FMK A;  2RNA A;  2LX7 A;  1E6G A;  2NUZ A;  3EG0 A;  1GFC A;  2DL3 A;  2LCS A;  1YN8 A;  2YUQ A;  1CSK A;  1T0J A;  3QWX X;  2M0Y A;  2DE0 X;  2GQI A;  3EG2 A;  3M0P A;  2CT4 A;  1E6H A;  2DM1 A;  1IO6 A;  1RI9 A;  1GL5 A;  2DF6 A;  2E5K A;  2KYM A;  1I0C A;  2ECZ A;  1GCQ A;  1KJW A;  2C0I A;  2LMJ A;  1GCQ C;  2LJ1 A;  2CH4 W;  1AWO A;  4LN2 A;  4ORZ A;  5HCK A;  2RPN A;  4ZNX A;  2DL7 A;  2J6K A;  1X27 A;  3FJ5 A;  1J3T A;  5IHN A;  2KEA A;  3IQL A;  1H8K A;  2HDA A;  2B86 A;  2GGR A;  1BK2 A;  1JQQ A;  4CC7 A;  1SHF A;  4AFU C;  1ARK A;  5FWC A;  2VVK A;  3REB B;  1ABQ A;  4OMQ A;  4J9D A;  2DMO A;  1MV3 A;  1UG1 A;  3M0T A;  1B07 A;  1WIE A;  4E6R A;  1UJ0 A;  4J9E A;  2CRE A;  2VKN A;  2EW3 A;  1X6G A;  3RNJ A;  2EYZ A;  4OMO A;  1SPK A;  3CQT A;  4QT7 A;  2KE9 A;  2RQV A;  4Z88 A;  1K0X A;  2C0T A;  5EC7 A;  2KGT A;  3TSW A;  2L0A A;  2AK5 A;  1WXB A;  1VYU A;  3VS0 A;  5GJV B;  3ULR B;  2PNI A;  3EG3 A;  1T0H A;  2EBP A;  2A28 A;  2JW4 A;  1E7O A;  1ZSG A;  2KRO A;  1WYX A;  1M3B A;  2DRM A;  1OEB A;  2YT6 A;  2DBK A;  2DX1 A;  2K3B A;  3SEM A;  1AWX A;  2JTE A;  4F17 A;  2D0N A;  2ROL A;  1M27 C;  1YWP A;  3VS5 A;  2KRN A;  2NWM A;  4J9I A;  2EGA A;  1NLO C;  3EHQ A;  2FRY A;  4J9B A;  3VS2 A;  2W0Z A;  3RBB B;  5IHI A;  1QKX A;  3H0I A;  2RQR A;  1PHT A;  1AOJ A;  4F16 A;  2ABL A;  2RQU A;  1UTI A;  1HJD A;  2KRM A;  1KSW A;  4IIO A;  4M4Z A;  2P4R A;  3I5R A;  4OMP A;  2FO0 A;  1Y57 A;  1AZE A;  5FW9 A;  2EKH A;  1H3H A;  4Y92 A;  3SHW A;  2KNB B;  2D8J A;  2J7I A;  2X3X D;  3ZL7 C;  1X2Q A;  1G2B A;  3NMZ C;  2A37 A;  1NM7 A;  1BB9 A;  4JJC A;  4LUE A;  2RF0 A;  2HCK A;  1JXM A;  1WX6 A;  2L3S A;  3NHN A;  1Z9Z A;  4HVU A;  1RLQ C;  4AG2 C;  3GBQ A;  3VRY A;  4D8D A;  2F2W A;  2EPD A;  1QCF A;  2DL8 A;  2AKK A;  2D8H A;  2ED0 A;  1X43 A;  3JV3 A;  4HCK A;  5IH2 A;  1CKB A;  4F14 A;  2GTJ A;  2V1Q A;  1ZUY A;  1WDX A;  3REA B;  3PVL A;  1T3L A;  3NGP A;  1KIK A;  1A0N B;  4JJB A;  1SEM A;  3EGU A;  2CSI A;  1X69 A;  3M0U A;  4JZ3 A;  1TUC A;  2OJ2 A;  4FSS A;  1VYT A;  1YP5 A;  2YSQ A;  2XMF A;  4RTW A;  4LUD A;  2LNH B;  3VRZ A;  2YDL A;  1T3S A;  2A08 A;  2KXC A;  2DLP A;  2FPE A;  1QKW A;  4Z89 A;  1TUD A;  4CC2 A;  3LH5 A;  2L3Q A;  4LE9 A;  1ZUU A;  2SEM A;  3KFV A;  2OI3 A;  1WLP B;  2EYW A;  1YNZ A;  4OML A;  4RTX A;  3C0C A;  1XOV A;  1ZLM A;  2KBT A;  2PTK A;  1GFD A;  3NPF A;  2JT4 A;  2RQW A;  1ZBJ A;  2CT3 A;  2GTO A;  2OAW A;  2EQI A;  4J9G A;  2CUB A;  1UJY A;  2LQN A;  4OMM A;  2LJ0 A;  2C0O A;  4D8K A;  1PNJ A;  1OV3 A;  1TG0 A;  1X2K A;  2JM9 A;  2LP5 A;  2KR3 A;  1UUE A;  1SRL A;  4AFQ C;  1PRM C;  2F2X A;  1WA7 A;  2J05 A;  2ENM A;  4HVV A;  1S1N A;  2O31 A;  4RTZ A;  2W10 A;  3M0Q A;  1VA7 A;  2K79 A;  2J6F A;  2KYB A;  1M8M A;  3H0F A;  1NLP C;  2K2M A;  1V1C A;  4RTY A;  2KT1 A;  4LNP A;  1B3Q A;  3O5Z A;  4AG1 C;  1YCS B;  2JS2 A;  4K11 A;  2O9S A;  2K6D A;  1H92 A;  1KFZ A;  4RTU A;  2GBQ A;  4WCI A;  3UA6 A;  2MCN A;  1VYV A;  1JO8 A;  2CH4 A;  2M51 A;  3EHR A;  2PZ1 A;  1PRL C;  3PE0 A;  1NYG A;  2V1R A;  2RQT A;  2EYY A;  4DEX A;  2I0N A;  3U23 A;  2L2P A;  2BTT A;  2LZ6 B;  1AVZ C;  2YUP A;  4AFS C;  2ESW A;  2J6O A;  2ROT A;  1WI7 A;  3PVQ A;  1HD3 A;  3VS7 A;  4A63 B;  2AZV A;  1NEB A;  2KXD A;  4X1V A;  3R6N A;  1HSQ A;  5IXF A;  2FG0 A;  2EGC A;  4RUG A;  1W70 A;  3VS6 A;  4KRT A;  2AKL A;  1U06 A;  1JU5 C;  1OPK A;  1NYF A;  4ESR A;  1M3A A;  1BU1 A;  1ABO A;  2JS0 A;  5IXB A;  1X6B A;  2A36 A;  2HSP A;  3VS3 A;  1AD5 A;  3I5S A;  2RMO A;  1UFF A;  1MUZ A;  4HVW A;  2BZ8 A;  4RTT A;  1SRM A;  2G6F X;  4EIK A;  2CUD A;  3EG1 A;  4OMN A;  1ZUK A;  1QWF A;  2EGE A;  1PWT A;  5L23 A;  3VS1 A;  1LCK A;  1Y0M A;  1UHC A;  2JMC A;  2DL4 A;  4J9C A;  1BBZ A;  1AEY A;  1Z9Q A;  2GNC A;  5FWB A;  1AWJ A;  1PKS A;  4CC4 B;  2L3P A;  2LJ3 A;  1UDL A;  2EYX A;  4J9F A;  1W6X A;  1PKT A;  5I11 A;  2FPD A;  2JMA A;  1I1J A;  1G83 A;  1NG2 A;  1GRI A;  2DRK A;  2D1X A;  2J06 A;  1W1F A;  3A98 A;  2KRS A;  1K9A A;  2X3W D;  1WXT A;  3H0H A;  2YUO A;  2O9V A;  1M3C A;  2DYB A;  4GLM A;  1GCP A;  2DVJ A;  2AZS A;  2IIM A;  2EVR A;  4RTV A;  2O88 A;  1AZG B;  2K7A A;  2SRC A;  1RUW A;  3QWY A;  1UGV A;  2JXB A;  3M0S A;  1RLP C;  1UE9 A;  4Z8A A;  2F2V A;  5GJW B;  2ED1 A;  2DA9 A;  2H8H A;  1I07 A;  3THK A;  1WXU A;  2DL5 A;  1GBR A;  1SHG A;  2FPF A;  2DNU A;  2RN8 A;  2FRW A;  1M30 A;  1OPL A;  1ZX6 A;  2DBM A;  2K9G A;  4DEY A;  1U5S A;  3H41 A;  1K4U S;  4IIM A;  1N5Z A;  5IHK A;  1WFW A;  2CDT A;  4HXJ A;  1YWO A;  3I9Q A;  1UEC A;  2MOX A;  2FEI A;  2DIL A;  3UAT A;  5I22 A;  2KT8 A;  4JJD A;  4J9H A;  1JEG A;  1MV0 B;  3UA7 A;  3I35 A;  2O2O A;  1OOT A;  3TSZ A;  4CC3 A;  1EFN A;  4AFZ C;  2QDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...