1M30A

Solution structure of n-terminal sh3 domain from oncogene protein c-crk
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
58
structure length
58
Chain Sequence
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
total genus 5
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m30A00
2LJ1A 1PNJA 2CT3A 1UG1A 1SPKA 4LN2A 4RTZA 2J05A 2F2VA 2OI3A 2ENMA 2O31A 1GCQA 3VS5A 1SSHA 1S1NA 3H41A 5IXBA 2O9SA 1JQQA 1OV3A 1QWFA 3REBB 1YP5A 1N5ZA 2YUQA 3RNJA 3VRZA 1WI7A 4AFSC 1NEGA 1HSQA 3M0TA 2DBMA 2GQIA 4IIMA 1MV3A 1VYUA 3QWXX 1KIKA 4HCKA 3PVLA 2KROA 4Z88A 2QDLA 1GFCA 1KFZA 2HBWA 1A0NB 5IXFA 4WCIA 2K7AA 2RPNA 2K3BA 1RI9A 2KNBB 1B3QA 4J9DA 3EG2A 1H92A 1ZLMA 4J9CA 1JO8A 1WIEA 4IIOA 4JPBW 4LNPA 1ARKA 2W10A 2K9GA 3PE0A 2KRSA 4Y92A 4KRTA 1ZUYA 2A08A 2MOXA 2DILA 5GJVB 2KT1A 1H3HA 2XMFA 4JJDA 1T0HA 2LQWA 1GCQC 3TSZA 2BZXA 1YN8A 3UF4A 4OMQA 2C0OA 2OJ2A 2L3SA 1SHGA 2CUBA 4F14A 1AWJA 1AZEA 2A36A 1AWXA 2DF6A 1BB9A 2KBTA 4OMPA 4GBQA 2JXBA 1HJDA 1E7OA 3VS0A 3I9QA 1SEMA 3M0SA 5FWBA 1M8MA 1OOTA 4CC3A 3U23A 4CC7A 2GGRA 4DEYA 1FYNA 2PZ1A 2DM1A 2LX7A 2KXDA 1M3CA 2C0TA 1UJYA 2ED1A 4RTVA 1WA7A 2F2WA 1T3SA 2FEIA 2OAWA 2KXCA 1X69A 1MUZA 2RMOA 1V1CA 2EPDA 1ABOA 1KJWA 2RNAA 2GTJA 2DLPA 2M0YA 3O5ZA 5IH2A 1CKAA 1JEGA 2A28A 2NUZA 3NGPA 1IO6A 2DE0X 1WX6A 5I22A 2LMJA 2FO0A 2DRKA 2B86A 4HVUA 1GFDA 2V1RA 1OPKA 5IHIA 3ZL7C 2AZVA 4Z8AA 4RTUA 1RLQC 1NEBA 3M0UA 3A98A 5FWCA 1NM7A 2A37A 2FPEA 4F16A 4AFZC 1RLPC 1GBQA 1YNZA 1AVZC 1BBZA 2KE9A 1W6XA 2MIOA 2SRCA 2O2OA 2IIMA 3ULRB 1CKBA 1FMKA 2K2MA 3LH5A 1W1FA 2J06A 2HDAA 4OMLA 2EGEA 2I0NA 2H8HA 4J9BA 3I35A 1VYVA 2CREA 4DEXA 2M51A 1X2KA 4RTYA 4ZNXA 2YSQA 1X6GA 2DL5A 2DYBA 4AG1C 2KEAA 2RN8A 2ROLA 2DX1A 2BZYA 1EFNA 3UA7A 2FRWA 1CSKA 4AFUC 2CUDA 3VS4A 2FPDA 2D0NA 2J6KA 4EIKA 1U06A 3IQLA 3KFVA 1T3LA 2CH4A 2DMOA 2YUOA 3NMZC 2AKKA 5IHKA 2PTKA 1BU1A 1U5SA 2EYWA 1NYFA 4D8KA 1TUDA 2LJ0A 1Y0MA 3EHQA 1AWWA 4JJCA 4RUGA 1AZGB 3JV3A 3REAB 2L0AA 1QKWA 2DL4A 2E5KA 2L2PA 2FPFA 4OMOA 2ABLA 3VS3A 2RQTA 1K1ZA 1YWPA 1UE9A 1GL5A 1OEBA 2LJ3A 1QKXA 1Z9ZA 1GCPA 1TG0A 1KSWA 2DJQA 2CH4W 2KYBA 1ZBJA 1QCFA 1YCSB 2AKLA 3R6NA 1PKSA 1G2BA 1XOVA 4CC2A 1ZSGA 3EG0A 2EKHA 1U3OA 1J3TA 4OMMA 4X1VA 2EGCA 4AFQC 3GBQA 4JZ4A 4ESRA 1HD3A 2LCSA 1WXBA 1I1JA 3PVQA 1ZX6A 4QT7A 2YT6A 1X2QA 3EHRA 2O88A 2L3QA 1PKTA 2K6DA 3H0HA 3H0FA 4RTWA 3VRYA 4F17A 3M0QA 1E6HA 1M27C 3I5SA 1BK2A 2CSIA 1K0SA 2CDTA 5ECAA 3UATA 4HXJA 2J6OA 4J9EA 1JU5C 1JXMA 1JXOA 5EC7A 3VS2A 1X27A 1UJ0A 1G83A 2J6FA 3M0PA 1SHFA 1K0XA 1NLPC 1UHCA 4RTTA 3EG1A 3SEMA 2JM9A 2F2XA 1UFFA 2KR3A 1NLOC 2EYXA 2EBPA 3M0RA 1WDXA 1ZUKA 2P4RA 1Z9QA 2YUNA 1I0CA 2JW4A 2HSPA 3TSWA 1MV0B 1M30A 2D8HA 2YUPA 1UHFA 1PWTA 1WLPB 2X3WD 4J9HA 3VS1A 1AD5A 1K9AA 3CQTA 2L3PA 2FG0A 1K4US 2AZSA 2JT4A 2RF0A 2RQVA 3H0IA 5GJWB 2LNHB 2BZ8A 1E6GA 2KYMA 1VA7A 1GBRA 1AWOA 3TVTA 2BTTA 1W70A 2DA9A 2DRMA 2DVJA 3NPFA 4E6RA 2J7IA 2C0IA 1M3AA 2GNCA 2ROTA 2D1XA 2DL7A 2RQUA 5IHNA 2JTEA 2ESWA 2G6FX 1NYGA 1UDLA 2JMAA 4R0KA 1UECA 2X3XD 4D8DA 1PHTA 1LCKA 1X6BA 5FW9A 2DL8A 3SHWA 2ED0A 3VS6A 1WXTA 1ABQA 2NWMA 1UUEA 2VVKA 3EGUA 3VS7A 1YWOA 3THKA 1I07A 2JMCA 2CSQA 3RBBB 2LQNA 5I11A 2KGTA 2KRNA 4GLMA 2EGAA 2DBKA 2JM8A 2LZ6B 2GBQA 2EYZA 4A63B 3NHNA 1WYXA 1VYTA 2JS2A 1TUCA 5HCKA 1ZUUA 2DNUA 3UA6A 2O9VA 4AG2C 1RUWA 1M3BA 4JZ3A 2EVRA 2V1QA 4J9FA 2DL3A 4HVWA 1SRLA 2LP5A 4LUDA 1AOJA 3QWYA 1SRMA 2GTOA 1NG2A 2HCKA 2CT4A 1B07A 2VWFA 4Z89A 3FJ5A 2VKNA 3I5RA 1H8KA 4J9GA 4JJBA 2EW3A 2FRYA 1QLYA 1GRIA 2JS0A 2RQWA 2D8JA 4LE9A 4LUEA 2KT8A 4OMNA 2W0ZA 4ORZA 1OPLA 3EG3A 2HEQA 2EQIA 1UTIA 4J9IA 2YDLA 1Y57A 2ECZA 2SEMA 2KRMA 1PRMC 1K76A 1AEYA 1WFWA 4M4ZA 1UGVA 4HVVA 4RTXA 4K11A 2EYYA 1QWEA 2PNIA 2AK5A 2MCNA 4FSSA 1X43A 3C0CA 5L23A 4CC4B 1T0JA 1PRLC 2RQRA 2K79A 1WXUA
chains in the Genus database with same CATH superfamily
3V7SA 2CT3A 3F70A 4M78F 2CZ0B 2QK0A 2YWWA 1QVGP 4RTZA 3CEYA 2OI3A 3BW1A 2ENMA 3S6WA 3VS5A 1SSHA 1S1NA 3H41A 2O9SA 2YRCA 1IXDA 1OV3A 1QWFA 3REBB 1N5ZA 3RESA 1VQ6A 3UWNA 3RKWA 4AFSC 5GMKl 3FC3A 2DBMA 1G3TA 1XTDA 3MP1A 4B6MA 3CCSQ 3URGA 3A8OB 4HCKA 4ZGDB 1XNIA 5KYWA 5CKFA 4Z88A 4N4GA 3SWNA 2RA2A 1GFCA 5CKDA 4E7HA 1M1GA 1YJWA 4WCIA 1R0BG 2XHCA 2L3RA 1KD1C 4Y28E 2WSFE 5D7UA 3NTKA 4IIOA 4JPBW 4LNPA 1W2BP 1Y7XA 1IHVA 2MYSA 1SG5A 3SDZA 4M77G 3OYIA 5LJ5e 3DKMA 2DILA 2EJFA 5KCOA 3UPUA 4PNOA 3P8DA 1GCQC 2O01E 4C8QF 2COYA 1ZQ1A 2CZ1B 1UEBA 4IKFA 2VXFA 2DF6A 1BB9A 4OMPA 2LCLA 3TEEA 3JB9G 1HJDA 1E7OA 4C8QD 3I9QA 2QEXQ 3RDVA 4CRIA 4CC3A 4ZGEB 2ZGWA 3BDUA 3U23A 1B7TA 3HP9A 4DEYA 2OX7A 2LX7A 5GAN3 2KXDA 4EMKC 3KBGA 1IHWA 2E6NA 4JLGA 2E64A 2F2WA 1T3SA 4EDUA 1MUZA 2EPDA 1ABOA 2RNAA 2GTJA 4OF1A 2KMTA 2A28A 1IO6A 2L5QA 2DPPB 4M78B 4OB3B 2RO0A 1OPKA 2JOYA 1RAEB 4Z8AA 1RLQC 4C8QC 4FT4A 1NM7A 2DIGA 1VQ5T 1YITT 4HKEA 4E7KA 1XQHA 4DBFA 1VQPA 2XI9A 2KE9A 4WTOB 3L2ZA 4X9CA 5CQXA 2IIMA 4RCBA 4EMHA 3OS0A 3S3OA 3VUBA 2K2MA 1VQ8A 3G6EQ 2ZPEB 3V8KA 4EMKB 3J81E 4DOWA 4LDWA 2H8HA 4DEXA 1R77A 2M51A 1X6GA 3CCMQ 2DERA 2DYBA 2KEAA 2ROLA 2OTJT 2BZYA 3N5BB 4BE1A 1M1KU 1EFNA 4XU2A 4OGCA 2EQKA 3CC4A 3JCMP 2CH4A 2K3XA 5KYYA 3E19A 3NMZC 1IB8A 1XJWB 1I5OB 3EG9A 3V8LA 1ACMB 3AT1B 3NTHA 1VQMA 2EYWA 2YRVA 2OTLQ 1PC0A 3VJPA 4LDUA 2LJ0A 4C8QB 3P8BB 2DKGA 4RUGA 3JV3A 2JTFA 4A53A 2K4YA 2E5KA 3V8JA 2Y4YA 4BY6C 3CC7A 3S3NA 2ABLA 2ZPFB 4N0AA 1YWPA 4M77F 3HHTB 1M8VA 1YHQA 2ZAEA 1Q82C 2QASA 4E7ZA 5GANd 2R58A 2DJQA 2KYBA 3I55A 1QCFA 4HCZA 4YTLA 1PKSA 2BKDN 3HPWA 2DJZA 4PJOA 3JCMW 4C5GA 2V8JA 1VQKA 1U3OA 3SWNC 1KC8R 1WXBA 1KQ1A 1EX4A 3QG1A 4QT7A 2YT6A 1K73C 2YRDA 4E7LA 3VYHB 3H0FA 3VRYA 2AIRB 1HXDA 3CMAQ 1M27C 2COZA 1M4ZA 1N27A 2CSIA 2JZ2A 5ECAA 3MEAA 2FZKB 4D6WA 3QO3A 1PSFA 3LX7A 1JXMA 2HBPA 3VS2A 1UGPB 4DBHA 5IN1A 1G83A 4BY6B 4KGXB 3GNFB 1NJIC 4XTXA 1TH7A 2RHYA 3M0PA 2KVQG 1UHCA 1IRXA 2HQXA 2CP7A 3EG1A 2V8IA 1UFFA 2LVMA 2KR3A 4XU1A 1KD1U 1TOVA 2V26A 4A54A 1I0CA 5CO7A 1BI2A 1Y71A 4NS5A 3OYMA 3EFSA 4F7UA 4KGZB 2YUPA 3PGGA 1UHFA 1M9SA 1PWTA 1P92A 3BE3A 5FU6C 1YI2T 1K9AA 4FW2A 1TWBA 2MMPA 2A3LA 3DLLA 2DO3A 2AZSA 2RQVA 1U8RA 4AT1B 2BZ8A 4ELZC 2DIQA 3JCMd 4JJNK 4FYVB 2DVJA 1Y07A 1QMCA 3NPFA 4LDYA 5GAN8 3LGLA 1BI3A 2JTEA 2EIFA 3MKDA 4M78E 3G71T 1UDLA 2X4WA 1UECA 1GXIE 1M2VB 3OSVA 4JRKA 1VQOA 4M77B 5GAMg 5DLOA 2DL8A 4FM4B 3SHWA 3VS6A 3X28B 1UUEA 4E7JA 5GANf 3EGUA 3PMTA 5GMKm 1YWOA 3THKA 2CSQA 1EZZB 2QQBA 3MP8A 4GY5A 2QGFB 3CCVA 1NZ9A 5I11A 2KRNA 5LL6S 2DEQA 2JM8A 2DXUA 5FU6B 2X4JA 3FRNA 5DY9A 2QQRA 3NHNA 1TUCA 1HYOA 1O75A 3FEOA 5HCKA 4AG2C 1RAGB 2FL7A 5CR2A 3OYHA 1D1BA 4PJOD 4JZ3A 2EVRA 3TCJA 3QIIA 3CC2T 5CIUA 5CKHA 2R5MA 4VUBA 2QA4A 4MMLA 1Q86C 1YIJT 2AT1B 2KAFA 1JJ2P 2VC8A 1JBMA 3VU3C 1NPPA 1D1CA 1D0XA 1ZHIA 3BY7A 3I5RA 5HK0A 3QYGB 2FRYA 1S72T 1QLYA 2KSSA 3CD6T 4LUEA 2KT8A 2CKKA 4OMNA 4N4IA 2VV5A 1BI0A 1RAHB 3CXCA 1MMNA 2QQAA 3QHSA 4N0AC 1UTIA 2A0FB 2YHTA 2YDLA 2CP2A 3GNGA 2Y90A 4IUTA 4M4ZA 5CCAA 2CZ6B 5GMKj 4PJOC 3RR6A 3OMCA 2AK5A 4FSSA 2HL3A 1KC8C 3C0CA 3A8GB 1T0JA 2D0QB 5GAN2 1PCXA 3H6ZA 2RI5A 2P84A 4JRPA 1UG1A 3DB3A 1SPKA 2VB6A 2GQVA 5GAMd 1GCQA 1PD1A 3HKSA 1Q82U 2FZGB 3EFOB 2DFUA 4FW1A 4M78A 2E6ZA 1X75C 1QVGA 2DZ9A 4OB0B 1YP5A 3RNJA 4BE0A 1VQ9A 5KYUA 1NEGA 3CBMA 1HSQA 4DOVA 5AT1B 1V76A 3I56Q 3M0TA 5HY6A 5LJ5g 3CCQT 1KFZA 1K73U 2VGMA 1VQ5Q 1YITQ 2K7AA 4EMKA 2VYTA 5KE2A 1H92A 3P8HA 5J26A 4J9CA 4KUDK 3H8ZA 4HT9A 1RI0A 4PL6A 4M75G 1ARKA 4Y92A 1YJNA 1K8AR 1OQKA 2FHDA 1W2BA 2MOXA 5I2MA 5GJVB 2KT1A 4NOYA 4C0DB 2XMFA 1T0HA 1NJIU 2YLCA 2OTJQ 2X51A 3Q1JA 3UF4A 4OMQA 5AYFA 4BE2A 4ANJA 3CXCS 2M16A 1SHGA 2CUBA 2IG0A 2PU9B 3HFNA 1WHLA 3NFCA 1AWJA 1AZEA 2A36A 4B9WA 4C8QA 3QJYA 5GAN7 3JCMQ 2KBTA 3OYBA 2JXBA 3OY9A 1FX7A 2PVOB 1DJ7B 1WGSA 4M77E 1M8MA 4ELYC 1AHJB 1OOTA 2GGRA 1FYNA 1QCOA 3CMET 3JSCA 1M90C 4IUUA 2C0TA 2XDPA 3OS2A 1WA7A 1R0CB 1VQ7T 1LPLA 4JRIA 1VQNT 1V1CA 3H9NA 3KXTA 1QVGS 3O5ZA 5IH2A 3RERA 3OYNA 3CCEA 5L8RE 4A4EA 1WX6A 1F1BB 1UGQB 2LMJA 4J6YA 4XK8E 2DRKA 1BIBA 1TUGB 1WHHA 4HVUA 3PT9A 2V1RA 3ZL7C 2K5IA 1NEBA 5FWCA 1RAAB 1VQ5A 2LQKA 1RLPC 1GBQA 2XK0A 1AVZC 3OYFA 1BBZA 3PIOA 2RJCA 1W6XA 2SRCA 1FMKA 4M78D 3LH5A 4M7DE 2HDAA 4XU3A 4Z02A 3PFSA 2XD0A 2BE9B 4J9BA 3I35A 1WQ7A 3L1AA 1FMVA 4RTYA 1W2BS 2D6FA 2YSQA 3M56A 1WHJA 4AG1C 3X24B 3LW5E 1YJ9T 3UA7A 3CCRA 2FRWA 1CSKA 4AFUC 2CUDA 3IQLA 3KFVA 1Q86U 3E9FA 1VQ4T 2RI3A 5IHKA 3CCUA 1YI2Q 2F69A 1WJRA 2KK4A 1U5SA 4DQ2A 4M7AE 4FIBA 1TUDA 4CI0C 1Y0MA 1OZ2A 1AWWA 3C12A 1TXQA 4JJCA 4OMFB 1QKWA 2DL4A 4KH1B 2EYQA 4OMOA 3VS3A 1K1ZA 3G4ST 1GL5A 5GAOr 5GANj 4M78C 1KHCA 1OEBA 1M2VA 5FU7C 2M9UA 4M77A 1GCPA 3EFRA 7AT1B 3R6NA 4LDXA 5I2SA 3G71Q 4J6XA 1XOVA 5GMKi 1D09B 1SKUB 3A8HB 3JCMJ 2RK2A 4JS5A 3V7CA 4BDYA 3HSBA 2CYZB 4KULA 1Q7YU 4AFQC 2EGCA 1EIFA 4JZ4A 5IT9E 1HD3A 1WPYA 3VV0A 2L3QA 5J3BA 2K6DA 2CZ7B 2G3RA 4C0FA 1KQ2A 3SB2A 3M0QA 1SSFA 1D3BB 4HA8A 4PJNA 4JS4A 5FRMA 5LJ3f 2RB6A 2MI6A 2LT4A 4FCYA 4J9EA 1Q81C 1JXOA 5EC7A 1N8RR 2XKOC 3OMGA 4M7DG 3QKJA 3JCMc 3I56T 3OW2P 4NL3A 1SHFA 3CC2Q 3CCSA 5FU7B 1NLPC 3QYHB 1QVPA 4ZGJB 3OYGA 2F2XA 5KYUB 1N6AA 1YIJQ 3CCLT 2EBPA 4FT2A 3M0RA 2LNVA 3SFMA 3X26B 1WDXA 3JB9J 3FLGA 3OBWA 2JW4A 3T9NA 3RKYA 1S72Q 1MV0B 2D8HA 4QVDA 3JCMX 2CP6A 3CD6Q 2RHIA 1YI2A 1VQLT 4MDWA 4M7AG 3VS1A 1AD5A 1K9MR 3HRTA 2FG0A 3X25B 5GAOq 5GJWB 2Z0WA 4BACA 1E6GA 1GBRA 2M1HA 1AWOA 1SF9A 1D0YA 1VQ6T 3FJPA 4JUVA 4E6RA 2C0IA 2EAYA 1M3AA 2GNCA 4IUPA 5CVIA 2D1XA 5IHNA 2DTIA 1ZSZB 2ESWA 2WSEE 2KI7A 5FROA 5CAIA 2JMAA 3EFOA 3L42A 3TQ7P 5FW9A 3QXEB 2QEXA 1BYMA 2BIVA 3QBYA 1YJWT 1WXTA 1M90U 1ABQA 2NWMA 2VVKA 4IURA 4KH0B 1YBYA 3OB9A 3M58A 3VS7A 1I07A 3FDRA 2PUKB 4OP0A 2DK3A 1VUBA 3GIBA 2EGAA 4L59A 2EYZA 1PM3A 1M5Q1 1WYXA 2BE7D 3CCQQ 1VYTA 4M77D 1ZUUA 1UB4A 1C0MA 3UA6A 4V2SA 4RCCA 3MJXA 1WHGA 2RHUA 1ZA2B 4J9FA 4R56A 3JB9F 1B34B 1SRLA 2NYSA 4LUDA 1AOJA 3QWYA 3WVDB 1YIJA 2CT4A 3QZ9B 1OX8A 5GAN6 2VWFA 2OAUA 3JB9D 2KQWA 4C92G 2LX9A 4ME7A 4J9GA 4JJBA 4PFOA 1JJ2A 3M57A 5J39A 2DTHA 1W4SA 1WHKA 4ORZA 2X35A 1OPLA 3G6EA 2HEQA 3G7ZA 4FSXA 2EQIA 3VYGA 4J9IA 2CS7A 4M7DF 2ECZA 3CCMA 4M77C 3NTIA 1AEYA 4C0ZA 4RTXA 1M2OA 4MMKA 2XU8A 3GLXA 1QWEA 2PNIA 2E5QA 2E41A 5KYNA 2LCCA 4CC4B 4F7UG 3CMEQ 3PVQA 2DETA 4EMGA 2OTLA 1VQ7Q 4ATOA 2J05A 2F2VA 3CCJQ 1VQNQ 4M7AF 3HFOA 1VQPT 2YUQA 2LT1A 2V8KA 4IUQA 2VASA 1WI7A 2EJ9A 5LJ3h 1VQ8T 3M5AA 5GMKh 4XTWA 1U1TA 3MO8A 3QWXX 1QVFP 4DBQA 2QDLA 4DBRA 2ZPIB 3M4YA 2K3YA 1QP3A 2PUOB 5IXFA 3CC4T 2GFUA 2RPNA 1M1KR 4FYWB 2KNBB 2X4XA 4HT8A 4J9DA 3EG2A 3INZA 4P5NA 3KUFA 1JO8A 3CMAA 3JCMV 4C5IA 2WSCE 1VQMT 1Q81U 4HCBA 2KRSA 3JB9I 4E7SA 1UGRB 2A08A 2P4TA 1NPRA 1JJ2S 3CC7T 2DD5A 1G5VA 1YJ9Q 2RHZA 3TSZA 3TU4K 1QQJA 1WJSA 2OJ2A 1YHQT 4J8OA 3GPLA 2HMAA 2DZCA 1OI1A 2QAZA 4A4HA 1VQ4Q 2K5LA 3I55T 1AWXA 2RK1A 2MWOA 1RACB 3EH2A 3QDFA 4MDXA 3R6OA 4M75E 3VS0A 1BIAA 1VQKT 4FYYB 5FWBA 4OB1B 1OU8A 3BDLA 4RMOA 5KH6A 2DM1A 2EKOA 4M7DB 2CP5A 3G4SQ 1RAFB 2EFIA 3VUZA 1NE8A 4XTYA 2KXCA 1WJQA 2JVVA 2O4XB 1KJWA 1VIEA 2M0YA 3PNWC 5LJ3j 1OX9A 1JEGA 1OULA 2NUZA 3V7RA 2DE0X 1UGSB 1D3BA 2FO0A 4KGVB 3E9GA 2HZYA 5DM7R 1GFDA 2H3JA 5IHIA 4M7AB 2QQSA 2AZVA 4RTUA 1LVKA 3GF5A 1KG1A 3JCMf 2A37A 4QVCA 2FPEA 4C0DC 4F16A 4AFZC 3LYIA 4BUGA 1D1AA 3O8VA 5HKCA 1KD1R 1IGUA 2MIOA 1JB0E 3ULRB 3M55A 1ZA1B 3EAEA 4J7IA 2DAQA 3CPWS 1X2KA 4ZNXA 2HQHA 4ZN1A 1TSFA 3CCLQ 5CQYA 1TS9A 5DLQE 5LJ3g 2FPDA 1MMAA 2YUOA 3RMQA 2E12A 2EWNA 4XU0A 2AKKA 3EH1A 4RKUE 3CPWP 4ZTFA 1VQLQ 2PTKA 2NUTB 1VQOT 4TVRA 4UC4A 3EHQA 8AT1B 3G1JA 2FPFA 5GAN5 2CGHA 1ZSZA 1UE9A 2ZPBB 3CCVT 1VQ6Q 1QKXA 1Z9ZA 3L2QA 4O6JA 1TG0A 1KSWA 4QQ6A 1ZBJA 1YCSB 4C8QG 2JUFA 1ZSGA 3EG0A 4L5GA 1J3TA 1YJWQ 2H3EB 4OMMA 4X1VA 3GBQA 2R57A 4J83A 1IZ6A 4ESRA 2LCSA 3J80E 1ZX6A 4FYXB 2IPOB 2PVGB 3EHRA 2O88A 4A4KA 1G3SA 3H0HA 3RMSA 2FYKA 1BCMA 4F17A 2QA4T 5GANh 3I5SA 2GCXA 3CCJT 2CDTA 4E47A 3GP8A 3UATA 4HXJA 1IGQA 3ME9A 1B34A 4J7FA 1JU5C 2VXEA 3LLRA 4GLKA 3UT1A 1X27A 1UJ0A 2HD0A 1I5LA 2J6FA 8ATCB 2LRQA 3I56A 2X9HA 1BCOA 5GAMf 3SEMA 2JM9A 3HRSA 5LJ5d 5GAOn 5GAOl 3LH0A 3OW2A 1NLOC 3DB4A 3OQ5A 2P4RA 4WF2A 1YITA 1JRIA 4QQDA 3C4SA 2HSPA 3OYYA 5C0MA 2ATCB 3QZ5B 4NL2A 5A2QE 1QP2A 2X3WD 5FRNA 3D7SB 1KQSS 4RG2A 3CQTA 2L3PA 1H3ZA 1KHIA 2DXBA 1K4US 4DA4A 2VUBA 2MF2A 3ZBDA 2DEUA 1RABB 1VA7A 2OTJA 1Q82R 9ATCB 4JDSA 1VQ9T 3OYEA 4ZN3A 1KQSP 2DL7A 2EQUA 1N9RA 4L6V5 2RM4A 1H641 1PHTA 1LCKA 3QSUA 3OYAA 1X6BA 3OYKA 2ED0A 3CBPA 4Y91A 4M75F 1VQPQ 1K73R 2JMCA 5LJ3e 5KYXB 3JCMh 3C94A 5GMKe 2KGTA 2LTOA 5I21A 2DBKA 2XIDA 1VQ8Q 3GOXA 2F5KA 4A63B 2A7YA 4M75D 4OVAA 2MAMA 1YJNT 4X9DA 2EQJA 2HAXA 1KC8U 2DNUA 1RUWA 4C5HA 2QDYB 1NJIR 1G3YA 2V1QA 3CC4Q 4JLIA 1PD0A 4HVWA 2LP5A 2QQ9A 3MHXA 1SRMA 3ASKA 2GTOA 3OW2S 2HCKA 1VQMQ 2E65A 4Z89A 3FJ5A 1K8AC 2KY9A 1VOMA 1H8KA 2EW3A 2HKNA 2D9TA 1NBEB 2JS0A 1GRIA 3CC7Q 2RQWA 2D8JA 4LE9A 2X4YA 1PSEA 3HTRA 4RG8A 4PJOE 5LJ5f 1YHQQ 5GANg 2QG9B 4A4GA 4MZTA 1ZSZC 4M75C 3X20B 2GF7A 3OA6A 3I55Q 4PFZA 1Y57A 2E4HA 2SEMA 3TREA 1K76A 3MEVA 3L2VA 4M7DA 2NUPA 1VQKQ 2EYYA 5C6SA 3MPUB 3CCET 4PJLA 1X6OA 4C92E 1X43A 5L23A 5D6YA 2LC4A 1PRLC 1WXUA 2O4XA 1K0SA 1WQWA 2LJ1A 1PNJA 4LN2A 1Y96B 2ZZDA 2O31A 2P0PA 5IXBA 2FVUA 2HQEA 2P0QA 1JQQA 3BFMA 6AT1B 4KT0E 4LXCA 4XTUA 4XAXB 4M7AA 3VRZA 3LGFA 2FZCB 3MEUA 2RJEA 4FU6A 2GQIA 4FL6A 3A5ZB 4IIMA 1MV3A 1OU9A 4J6WA 1VYUA 1KIKA 5D6XA 3G71A 3JB9H 4M75B 1YFNA 4F7UE 1R8OB 3PVLA 2KROA 4IUVA 3PIPA 1G8XA 2HBWA 1QVFA 3CPFA 3CCRT 1A0NB 2L8DA 2QYZA 5GAMh 4XTZA 4JRQA 2K3BA 1RI9A 2E3IA 3E2UA 3JAME 1B3QA 3OYJA 2RHXA 1ZLMA 1Q86R 4ZTJA 3CCUT 1WIEA 1RAIB 2W10A 5HK3A 2K9GA 3PE0A 3EGDB 2PQWA 4KRTA 1LOJA 1ZUYA 2YXYA 1H3HA 3M54A 4JJDA 2B8AA 3JCMg 2LQWA 4PJOG 2BZXA 1YN8A 2C0OA 2L3SA 2ZPGB 2NUTA 3A8MB 3UDCA 4F14A 2EJGA 3CC2A 4R55A 4PJJA 2ZCFB 3L2WA 3EGXB 4GBQA 2M0OA 3HRUA 1VQOQ 4C0GA 1QCNA 1SEMA 4EPCA 3M0SA 4E2FB 4QW2A 3SD4A 2PVDB 4Q5WA 1S72A 4CC7A 3MCAB 2PZ1A 3CD6A 2DYIA 1I8FA 2IVWA 1Q7YR 5GAN4 3CCVQ 2BUDA 2XG8D 1M3CA 2COWA 1UJYA 3FIFA 2ED1A 4RTVA 4C92A 2FEIA 2OAWA 4BI8B 3QJ6A 1X69A 2RMOA 4PLLA 2DLPA 3C95A 2HSEB 1CKAA 3WXMB 3NGPA 3PTAA 2F1LA 5I22A 3E1SA 4M7DD 1ZBXA 5EG2A 2B86A 1I81A 3CCST 4KBMB 5GANe 4LDVA 2QTVA 2QA4Q 3M0UA 5GAMj 3A98A 2LQ8A 4PFPA 3RUXA 1QVFS 5CKEA 1IREB 1YNZA 5KYWB 3HL8A 3SWNB 2O2OA 2QI2A 2NLUA 1CKBA 1FMWA 4O5VA 1N8RC 5GAOm 1AT1B 1W1FA 2J06A 4OMLA 2EGEA 2I0NA 2AHJB 4M7AD 1OYXA 1VYVA 2CREA 2K57A 1M1FA 3CCQA 2EQMA 2DL5A 3A1PA 5LJ5h 3OSSC 2RN8A 1FWZA 2DX1A 3OS1A 4BDZA 4BI3A 3VS4A 2D0NA 2J6KA 1V29B 4EIKA 1U06A 3M4GA 1T3LA 2DMOA 4M7DC 3JRZA 1K8AU 4A4FA 4AMCA 2RD1A 3MP6A 1BU1A 1NYFA 3CPWA 2QEXT 4D8KA 2MWPA 1K9MC 4OGEA 1TU0B 1AZGB 3REAB 2L0AA 1WZOA 2L2PA 5M9OA 1O9SA 2RQTA 3L2RA 5CK9A 1M90R 2C06A 2LJ3A 1VQ9Q 4N4HA 2RI2A 4QKUA 2I2LA 4PJOF 4M7AC 2CH4W 2P0KA 2XICA 2VGNA 2RJDA 1X01A 2AKLA 1HK9A 1G2BA 3CBOA 4CC2A 2JJ9A 2EKHA 5KYXA 3MEWA 1C6VX 1D0ZA 3JCMe 3FB9A 4KUIA 2L89A 1I1JA 2Y4XA 1X2QA 2NUPB 3CMEA 4B9XA 1PKTA 4C92F 4RTWA 4OB2B 1E6HA 3JCMb 1C1AA 1VQ7A 3OBYA 1PG5B 1BK2A 3CCJA 3OYLA 2DVEA 1YJNQ 1VQNA 3L2UA 2J6OA 4BD3A 4C8QE 4C92D 3WVEB 3G6ET 2QGGA 1QW1A 2YLBA 2CP0A 3META 5LJ5j 1K0XA 4RTTA 1BKBA 3CCMT 2GFAA 2EYXA 3A8LB 1ZUKA 1Z9QA 4MZPA 4F7UF 1MGQA 5A0GA 1N9SA 2E3HA 2YUNA 4PKCC 1VIFA 3PMIA 3TSWA 1WNLA 1M30A 4M78G 2QTXA 1WLPB 2E70A 4J9HA 5IAYA 1Q7YC 2QXFA 1LNXA 2OTLT 5KYYB 3OYDA 2JTMA 3EG9B 2JT4A 2RF0A 3H0IA 3M53A 2LNHB 1I4K1 2KYMA 4QVZA 2E10A 4C92C 1YJ9A 3TVTA 2BTTA 4PK4A 1W70A 2DA9A 1RL2A 2DRMA 3CCEQ 2HL5C 5GAOp 2J7IA 1BI1A 1VQ4A 2ROTA 3OS5A 2RH2A 2RQUA 1Y96A 2E1HA 2G6FX 1NYGA 4R0KA 2JN0A 2X3XD 4D8DA 1KQSA 4C5EA 3QDRB 4XTVA 3ZEHA 1MNDA 2JNGA 4LD6A 3OYCA 1G3WA 1YCYA 5D6WA 4E7IA 4PJOB 4QQGA 2M02A 2XDDA 3G4SA 3RBBB 3QUIA 4M75A 2LQNA 2RJFA 4GLMA 1WHMA 3ER0A 2LZ6B 3CMAT 2GBQA 3M59A 4F04B 2MK5A 3DLMA 3RKXA 2JS2A 1Q81R 5GAMe 2O9VA 1MHNA 2F5TX 3LWHA 3J7AF 3M9QA 4C92B 1M3BA 2KDSA 3CCRQ 4LD9K 5A0LA 2DD4A 2DL3A 3LWIA 5KE3A 4BB7A 2DXCA 3EGDA 1M1KC 1MNEA 3QPHA 2LDMA 2CP3A 4PJMA 3ZFJA 3CCUQ 4II1A 1NG2A 1B07A 4J5YA 2ZPHB 3AHUA 1U1SA 2XDBA 1Q95G 2VKNA 1KK7A 1MMGA 2FB7A 1N8RU 4HCCA 3CXCP 2WACA 2HKQB 5CKBA 4X34A 3S3MA 2W0ZA 3EGXA 4XQ3A 2HNIA 2K5FA 3EG3A 5FLXE 3VKIA 4MZMA 5A0DA 4F7UB 1LJOA 2KRMA 1PRMC 1WFWA 1UGVA 4HVVA 2DTOA 3CCLA 4PLIA 4K11A 2DXTA 1FXXA 5KCHA 2R5AA 1RADB 5LJ3d 2MPXC 3RIRA 2MCNA 4BI4A 1K9MU 2RQRA 2K2VA 1TTHB 2K79A 1VQLA 1MMDA 1OZ3A
chains in the Genus database with same CATH topology
2LJ1A 1PNJA 2CT3A 1UG1A 1SPKA 4LN2A 4RTZA 2J05A 2F2VA 2OI3A 2ENMA 2O31A 1GCQA 3VS5A 1SSHA 1S1NA 3H41A 5IXBA 2O9SA 1JQQA 1OV3A 1QWFA 3REBB 1YP5A 1N5ZA 2YUQA 3RNJA 3VRZA 1WI7A 4AFSC 1NEGA 1HSQA 3M0TA 2DBMA 2GQIA 4IIMA 1MV3A 1VYUA 3QWXX 1KIKA 4HCKA 3PVLA 2KROA 4Z88A 2QDLA 1GFCA 1KFZA 2HBWA 1A0NB 5IXFA 4WCIA 2K7AA 2RPNA 2K3BA 1RI9A 2KNBB 1B3QA 4J9DA 3EG2A 1H92A 1ZLMA 4J9CA 1JO8A 1WIEA 4IIOA 4JPBW 4LNPA 1ARKA 2W10A 2K9GA 3PE0A 2KRSA 4Y92A 4KRTA 1ZUYA 2A08A 2MOXA 2DILA 5GJVB 2KT1A 1H3HA 2XMFA 4JJDA 1T0HA 2LQWA 1GCQC 3TSZA 2BZXA 1YN8A 3UF4A 4OMQA 2C0OA 2OJ2A 2L3SA 1SHGA 2CUBA 4F14A 1AWJA 1AZEA 2A36A 1AWXA 2DF6A 1BB9A 2KBTA 4OMPA 4GBQA 2JXBA 1HJDA 1E7OA 3VS0A 3I9QA 1SEMA 3M0SA 5FWBA 1M8MA 1OOTA 4CC3A 3U23A 4CC7A 2GGRA 4DEYA 1FYNA 2PZ1A 2DM1A 2LX7A 2KXDA 1M3CA 2C0TA 1UJYA 2ED1A 4RTVA 1WA7A 2F2WA 1T3SA 2FEIA 2OAWA 2KXCA 1X69A 1MUZA 2RMOA 1V1CA 2EPDA 1ABOA 1KJWA 2RNAA 2GTJA 2DLPA 2M0YA 3O5ZA 5IH2A 1CKAA 1JEGA 2A28A 2NUZA 3NGPA 1IO6A 2DE0X 1WX6A 5I22A 2LMJA 2FO0A 2DRKA 2B86A 4HVUA 1GFDA 2V1RA 1OPKA 5IHIA 3ZL7C 2AZVA 4Z8AA 4RTUA 1RLQC 1NEBA 3M0UA 3A98A 5FWCA 1NM7A 2A37A 2FPEA 4F16A 4AFZC 1RLPC 1GBQA 1YNZA 1AVZC 1BBZA 2KE9A 1W6XA 2MIOA 2SRCA 2O2OA 2IIMA 3ULRB 1CKBA 1FMKA 2K2MA 3LH5A 1W1FA 2J06A 2HDAA 4OMLA 2EGEA 2I0NA 2H8HA 4J9BA 3I35A 1VYVA 2CREA 4DEXA 2M51A 1X2KA 4RTYA 4ZNXA 2YSQA 1X6GA 2DL5A 2DYBA 4AG1C 2KEAA 2RN8A 2ROLA 2DX1A 2BZYA 1EFNA 3UA7A 2FRWA 1CSKA 4AFUC 2CUDA 3VS4A 2FPDA 2D0NA 2J6KA 4EIKA 1U06A 3IQLA 3KFVA 1T3LA 2CH4A 2DMOA 2YUOA 3NMZC 2AKKA 5IHKA 2PTKA 1BU1A 1U5SA 2EYWA 1NYFA 4D8KA 1TUDA 2LJ0A 1Y0MA 3EHQA 1AWWA 4JJCA 4RUGA 1AZGB 3JV3A 3REAB 2L0AA 1QKWA 2DL4A 2E5KA 2L2PA 2FPFA 4OMOA 2ABLA 3VS3A 2RQTA 1K1ZA 1YWPA 1UE9A 1GL5A 1OEBA 2LJ3A 1QKXA 1Z9ZA 1GCPA 1TG0A 1KSWA 2DJQA 2CH4W 2KYBA 1ZBJA 1QCFA 1YCSB 2AKLA 3R6NA 1PKSA 1G2BA 1XOVA 4CC2A 1ZSGA 3EG0A 2EKHA 1U3OA 1J3TA 4OMMA 4X1VA 2EGCA 4AFQC 3GBQA 4JZ4A 4ESRA 1HD3A 2LCSA 1WXBA 1I1JA 3PVQA 1ZX6A 4QT7A 2YT6A 1X2QA 3EHRA 2O88A 2L3QA 1PKTA 2K6DA 3H0HA 3H0FA 4RTWA 3VRYA 4F17A 3M0QA 1E6HA 1M27C 3I5SA 1BK2A 2CSIA 1K0SA 2CDTA 5ECAA 3UATA 4HXJA 2J6OA 4J9EA 1JU5C 1JXMA 1JXOA 5EC7A 3VS2A 1X27A 1UJ0A 1G83A 2J6FA 3M0PA 1SHFA 1K0XA 1NLPC 1UHCA 4RTTA 3EG1A 3SEMA 2JM9A 2F2XA 1UFFA 2KR3A 1NLOC 2EYXA 2EBPA 3M0RA 1WDXA 1ZUKA 2P4RA 1Z9QA 2YUNA 1I0CA 2JW4A 2HSPA 3TSWA 1MV0B 1M30A 2D8HA 2YUPA 1UHFA 1PWTA 1WLPB 2X3WD 4J9HA 3VS1A 1AD5A 1K9AA 3CQTA 2L3PA 2FG0A 1K4US 2AZSA 2JT4A 2RF0A 2RQVA 3H0IA 5GJWB 2LNHB 2BZ8A 1E6GA 2KYMA 1VA7A 1GBRA 1AWOA 3TVTA 2BTTA 1W70A 2DA9A 2DRMA 2DVJA 3NPFA 4E6RA 2J7IA 2C0IA 1M3AA 2GNCA 2ROTA 2D1XA 2DL7A 2RQUA 5IHNA 2JTEA 2ESWA 2G6FX 1NYGA 1UDLA 2JMAA 4R0KA 1UECA 2X3XD 4D8DA 1PHTA 1LCKA 1X6BA 5FW9A 2DL8A 3SHWA 2ED0A 3VS6A 1WXTA 1ABQA 2NWMA 1UUEA 2VVKA 3EGUA 3VS7A 1YWOA 3THKA 1I07A 2JMCA 2CSQA 3RBBB 2LQNA 5I11A 2KGTA 2KRNA 4GLMA 2EGAA 2DBKA 2JM8A 2LZ6B 2GBQA 2EYZA 4A63B 3NHNA 1WYXA 1VYTA 2JS2A 1TUCA 5HCKA 1ZUUA 2DNUA 3UA6A 2O9VA 4AG2C 1RUWA 1M3BA 4JZ3A 2EVRA 2V1QA 4J9FA 2DL3A 4HVWA 1SRLA 2LP5A 4LUDA 1AOJA 3QWYA 1SRMA 2GTOA 1NG2A 2HCKA 2CT4A 1B07A 2VWFA 4Z89A 3FJ5A 2VKNA 3I5RA 1H8KA 4J9GA 4JJBA 2EW3A 2FRYA 1QLYA 1GRIA 2JS0A 2RQWA 2D8JA 4LE9A 4LUEA 2KT8A 4OMNA 2W0ZA 4ORZA 1OPLA 3EG3A 2HEQA 2EQIA 1UTIA 4J9IA 2YDLA 1Y57A 2ECZA 2SEMA 2KRMA 1PRMC 1K76A 1AEYA 1WFWA 4M4ZA 1UGVA 4HVVA 4RTXA 4K11A 2EYYA 1QWEA 2PNIA 2AK5A 2MCNA 4FSSA 1X43A 3C0CA 5L23A 4CC4B 1T0JA 1PRLC 2RQRA 2K79A 1WXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ1 A;  1PNJ A;  2CT3 A;  1UG1 A;  1SPK A;  4LN2 A;  4RTZ A;  2J05 A;  2F2V A;  2OI3 A;  2ENM A;  2O31 A;  1GCQ A;  3VS5 A;  1SSH A;  1S1N A;  3H41 A;  5IXB A;  2O9S A;  1JQQ A;  1OV3 A;  1QWF A;  3REB B;  1YP5 A;  1N5Z A;  2YUQ A;  3RNJ A;  3VRZ A;  1WI7 A;  4AFS C;  1NEG A;  1HSQ A;  3M0T A;  2DBM A;  2GQI A;  4IIM A;  1MV3 A;  1VYU A;  3QWX X;  1KIK A;  4HCK A;  3PVL A;  2KRO A;  4Z88 A;  2QDL A;  1GFC A;  1KFZ A;  2HBW A;  1A0N B;  5IXF A;  4WCI A;  2K7A A;  2RPN A;  2K3B A;  1RI9 A;  2KNB B;  1B3Q A;  4J9D A;  3EG2 A;  1H92 A;  1ZLM A;  4J9C A;  1JO8 A;  1WIE A;  4IIO A;  4JPB W;  4LNP A;  1ARK A;  2W10 A;  2K9G A;  3PE0 A;  2KRS A;  4Y92 A;  4KRT A;  1ZUY A;  2A08 A;  2MOX A;  2DIL A;  5GJV B;  2KT1 A;  1H3H A;  2XMF A;  4JJD A;  1T0H A;  2LQW A;  1GCQ C;  3TSZ A;  2BZX A;  1YN8 A;  3UF4 A;  4OMQ A;  2C0O A;  2OJ2 A;  2L3S A;  1SHG A;  2CUB A;  4F14 A;  1AWJ A;  1AZE A;  2A36 A;  1AWX A;  2DF6 A;  1BB9 A;  2KBT A;  4OMP A;  4GBQ A;  2JXB A;  1HJD A;  1E7O A;  3VS0 A;  3I9Q A;  1SEM A;  3M0S A;  5FWB A;  1M8M A;  1OOT A;  4CC3 A;  3U23 A;  4CC7 A;  2GGR A;  4DEY A;  1FYN A;  2PZ1 A;  2DM1 A;  2LX7 A;  2KXD A;  1M3C A;  2C0T A;  1UJY A;  2ED1 A;  4RTV A;  1WA7 A;  2F2W A;  1T3S A;  2FEI A;  2OAW A;  2KXC A;  1X69 A;  1MUZ A;  2RMO A;  1V1C A;  2EPD A;  1ABO A;  1KJW A;  2RNA A;  2GTJ A;  2DLP A;  2M0Y A;  3O5Z A;  5IH2 A;  1CKA A;  1JEG A;  2A28 A;  2NUZ A;  3NGP A;  1IO6 A;  2DE0 X;  1WX6 A;  5I22 A;  2LMJ A;  2FO0 A;  2DRK A;  2B86 A;  4HVU A;  1GFD A;  2V1R A;  1OPK A;  5IHI A;  3ZL7 C;  2AZV A;  4Z8A A;  4RTU A;  1RLQ C;  1NEB A;  3M0U A;  3A98 A;  5FWC A;  1NM7 A;  2A37 A;  2FPE A;  4F16 A;  4AFZ C;  1RLP C;  1GBQ A;  1YNZ A;  1AVZ C;  1BBZ A;  2KE9 A;  1W6X A;  2MIO A;  2SRC A;  2O2O A;  2IIM A;  3ULR B;  1CKB A;  1FMK A;  2K2M A;  3LH5 A;  1W1F A;  2J06 A;  2HDA A;  4OML A;  2EGE A;  2I0N A;  2H8H A;  4J9B A;  3I35 A;  1VYV A;  2CRE A;  4DEX A;  2M51 A;  1X2K A;  4RTY A;  4ZNX A;  2YSQ A;  1X6G A;  2DL5 A;  2DYB A;  4AG1 C;  2KEA A;  2RN8 A;  2ROL A;  2DX1 A;  2BZY A;  1EFN A;  3UA7 A;  2FRW A;  1CSK A;  4AFU C;  2CUD A;  3VS4 A;  2FPD A;  2D0N A;  2J6K A;  4EIK A;  1U06 A;  3IQL A;  3KFV A;  1T3L A;  2CH4 A;  2DMO A;  2YUO A;  3NMZ C;  2AKK A;  5IHK A;  2PTK A;  1BU1 A;  1U5S A;  2EYW A;  1NYF A;  4D8K A;  1TUD A;  2LJ0 A;  1Y0M A;  3EHQ A;  1AWW A;  4JJC A;  4RUG A;  1AZG B;  3JV3 A;  3REA B;  2L0A A;  1QKW A;  2DL4 A;  2E5K A;  2L2P A;  2FPF A;  4OMO A;  2ABL A;  3VS3 A;  2RQT A;  1K1Z A;  1YWP A;  1UE9 A;  1GL5 A;  1OEB A;  2LJ3 A;  1QKX A;  1Z9Z A;  1GCP A;  1TG0 A;  1KSW A;  2DJQ A;  2CH4 W;  2KYB A;  1ZBJ A;  1QCF A;  1YCS B;  2AKL A;  3R6N A;  1PKS A;  1G2B A;  1XOV A;  4CC2 A;  1ZSG A;  3EG0 A;  2EKH A;  1U3O A;  1J3T A;  4OMM A;  4X1V A;  2EGC A;  4AFQ C;  3GBQ A;  4JZ4 A;  4ESR A;  1HD3 A;  2LCS A;  1WXB A;  1I1J A;  3PVQ A;  1ZX6 A;  4QT7 A;  2YT6 A;  1X2Q A;  3EHR A;  2O88 A;  2L3Q A;  1PKT A;  2K6D A;  3H0H A;  3H0F A;  4RTW A;  3VRY A;  4F17 A;  3M0Q A;  1E6H A;  1M27 C;  3I5S A;  1BK2 A;  2CSI A;  1K0S A;  2CDT A;  5ECA A;  3UAT A;  4HXJ A;  2J6O A;  4J9E A;  1JU5 C;  1JXM A;  1JXO A;  5EC7 A;  3VS2 A;  1X27 A;  1UJ0 A;  1G83 A;  2J6F A;  3M0P A;  1SHF A;  1K0X A;  1NLP C;  1UHC A;  4RTT A;  3EG1 A;  3SEM A;  2JM9 A;  2F2X A;  1UFF A;  2KR3 A;  1NLO C;  2EYX A;  2EBP A;  3M0R A;  1WDX A;  1ZUK A;  2P4R A;  1Z9Q A;  2YUN A;  1I0C A;  2JW4 A;  2HSP A;  3TSW A;  1MV0 B;  1M30 A;  2D8H A;  2YUP A;  1UHF A;  1PWT A;  1WLP B;  2X3W D;  4J9H A;  3VS1 A;  1AD5 A;  1K9A A;  3CQT A;  2L3P A;  2FG0 A;  1K4U S;  2AZS A;  2JT4 A;  2RF0 A;  2RQV A;  3H0I A;  5GJW B;  2LNH B;  2BZ8 A;  1E6G A;  2KYM A;  1VA7 A;  1GBR A;  1AWO A;  3TVT A;  2BTT A;  1W70 A;  2DA9 A;  2DRM A;  2DVJ A;  3NPF A;  4E6R A;  2J7I A;  2C0I A;  1M3A A;  2GNC A;  2ROT A;  2D1X A;  2DL7 A;  2RQU A;  5IHN A;  2JTE A;  2ESW A;  2G6F X;  1NYG A;  1UDL A;  2JMA A;  4R0K A;  1UEC A;  2X3X D;  4D8D A;  1PHT A;  1LCK A;  1X6B A;  5FW9 A;  2DL8 A;  3SHW A;  2ED0 A;  3VS6 A;  1WXT A;  1ABQ A;  2NWM A;  1UUE A;  2VVK A;  3EGU A;  3VS7 A;  1YWO A;  3THK A;  1I07 A;  2JMC A;  2CSQ A;  3RBB B;  2LQN A;  5I11 A;  2KGT A;  2KRN A;  4GLM A;  2EGA A;  2DBK A;  2JM8 A;  2LZ6 B;  2GBQ A;  2EYZ A;  4A63 B;  3NHN A;  1WYX A;  1VYT A;  2JS2 A;  1TUC A;  5HCK A;  1ZUU A;  2DNU A;  3UA6 A;  2O9V A;  4AG2 C;  1RUW A;  1M3B A;  4JZ3 A;  2EVR A;  2V1Q A;  4J9F A;  2DL3 A;  4HVW A;  1SRL A;  2LP5 A;  4LUD A;  1AOJ A;  3QWY A;  1SRM A;  2GTO A;  1NG2 A;  2HCK A;  2CT4 A;  1B07 A;  2VWF A;  4Z89 A;  3FJ5 A;  2VKN A;  3I5R A;  1H8K A;  4J9G A;  4JJB A;  2EW3 A;  2FRY A;  1QLY A;  1GRI A;  2JS0 A;  2RQW A;  2D8J A;  4LE9 A;  4LUE A;  2KT8 A;  4OMN A;  2W0Z A;  4ORZ A;  1OPL A;  3EG3 A;  2HEQ A;  2EQI A;  1UTI A;  4J9I A;  2YDL A;  1Y57 A;  2ECZ A;  2SEM A;  2KRM A;  1PRM C;  1K76 A;  1AEY A;  1WFW A;  4M4Z A;  1UGV A;  4HVV A;  4RTX A;  4K11 A;  2EYY A;  1QWE A;  2PNI A;  2AK5 A;  2MCN A;  4FSS A;  1X43 A;  3C0C A;  5L23 A;  4CC4 B;  1T0J A;  1PRL C;  2RQR A;  2K79 A;  1WXU A; 
#chains in the Genus database with same CATH topology
 3V7S A;  2CT3 A;  3F70 A;  4M78 F;  2CZ0 B;  2QK0 A;  2YWW A;  1QVG P;  4RTZ A;  3CEY A;  2OI3 A;  3BW1 A;  2ENM A;  3S6W A;  3VS5 A;  1SSH A;  1S1N A;  3H41 A;  2O9S A;  2YRC A;  1IXD A;  1OV3 A;  1QWF A;  3REB B;  1N5Z A;  3RES A;  1VQ6 A;  3UWN A;  3RKW A;  4AFS C;  5GMK l;  3FC3 A;  2DBM A;  1G3T A;  1XTD A;  3MP1 A;  4B6M A;  3CCS Q;  3URG A;  3A8O B;  4HCK A;  4ZGD B;  1XNI A;  5KYW A;  5CKF A;  4Z88 A;  4N4G A;  3SWN A;  2RA2 A;  1GFC A;  5CKD A;  4E7H A;  1M1G A;  1YJW A;  4WCI A;  1R0B G;  2XHC A;  2L3R A;  1KD1 C;  4Y28 E;  2WSF E;  5D7U A;  3NTK A;  4IIO A;  4JPB W;  4LNP A;  1W2B P;  1Y7X A;  1IHV A;  2MYS A;  1SG5 A;  3SDZ A;  4M77 G;  3OYI A;  5LJ5 e;  3DKM A;  2DIL A;  2EJF A;  5KCO A;  3UPU A;  4PNO A;  3P8D A;  1GCQ C;  2O01 E;  4C8Q F;  2COY A;  1ZQ1 A;  2CZ1 B;  1UEB A;  4IKF A;  2VXF A;  2DF6 A;  1BB9 A;  4OMP A;  2LCL A;  3TEE A;  3JB9 G;  1HJD A;  1E7O A;  4C8Q D;  3I9Q A;  2QEX Q;  3RDV A;  4CRI A;  4CC3 A;  4ZGE B;  2ZGW A;  3BDU A;  3U23 A;  1B7T A;  3HP9 A;  4DEY A;  2OX7 A;  2LX7 A;  5GAN 3;  2KXD A;  4EMK C;  3KBG A;  1IHW A;  2E6N A;  4JLG A;  2E64 A;  2F2W A;  1T3S A;  4EDU A;  1MUZ A;  2EPD A;  1ABO A;  2RNA A;  2GTJ A;  4OF1 A;  2KMT A;  2A28 A;  1IO6 A;  2L5Q A;  2DPP B;  4M78 B;  4OB3 B;  2RO0 A;  1OPK A;  2JOY A;  1RAE B;  4Z8A A;  1RLQ C;  4C8Q C;  4FT4 A;  1NM7 A;  2DIG A;  1VQ5 T;  1YIT T;  4HKE A;  4E7K A;  1XQH A;  4DBF A;  1VQP A;  2XI9 A;  2KE9 A;  4WTO B;  3L2Z A;  4X9C A;  5CQX A;  2IIM A;  4RCB A;  4EMH A;  3OS0 A;  3S3O A;  3VUB A;  2K2M A;  1VQ8 A;  3G6E Q;  2ZPE B;  3V8K A;  4EMK B;  3J81 E;  4DOW A;  4LDW A;  2H8H A;  4DEX A;  1R77 A;  2M51 A;  1X6G A;  3CCM Q;  2DER A;  2DYB A;  2KEA A;  2ROL A;  2OTJ T;  2BZY A;  3N5B B;  4BE1 A;  1M1K U;  1EFN A;  4XU2 A;  4OGC A;  2EQK A;  3CC4 A;  3JCM P;  2CH4 A;  2K3X A;  5KYY A;  3E19 A;  3NMZ C;  1IB8 A;  1XJW B;  1I5O B;  3EG9 A;  3V8L A;  1ACM B;  3AT1 B;  3NTH A;  1VQM A;  2EYW A;  2YRV A;  2OTL Q;  1PC0 A;  3VJP A;  4LDU A;  2LJ0 A;  4C8Q B;  3P8B B;  2DKG A;  4RUG A;  3JV3 A;  2JTF A;  4A53 A;  2K4Y A;  2E5K A;  3V8J A;  2Y4Y A;  4BY6 C;  3CC7 A;  3S3N A;  2ABL A;  2ZPF B;  4N0A A;  1YWP A;  4M77 F;  3HHT B;  1M8V A;  1YHQ A;  2ZAE A;  1Q82 C;  2QAS A;  4E7Z A;  5GAN d;  2R58 A;  2DJQ A;  2KYB A;  3I55 A;  1QCF A;  4HCZ A;  4YTL A;  1PKS A;  2BKD N;  3HPW A;  2DJZ A;  4PJO A;  3JCM W;  4C5G A;  2V8J A;  1VQK A;  1U3O A;  3SWN C;  1KC8 R;  1WXB A;  1KQ1 A;  1EX4 A;  3QG1 A;  4QT7 A;  2YT6 A;  1K73 C;  2YRD A;  4E7L A;  3VYH B;  3H0F A;  3VRY A;  2AIR B;  1HXD A;  3CMA Q;  1M27 C;  2COZ A;  1M4Z A;  1N27 A;  2CSI A;  2JZ2 A;  5ECA A;  3MEA A;  2FZK B;  4D6W A;  3QO3 A;  1PSF A;  3LX7 A;  1JXM A;  2HBP A;  3VS2 A;  1UGP B;  4DBH A;  5IN1 A;  1G83 A;  4BY6 B;  4KGX B;  3GNF B;  1NJI C;  4XTX A;  1TH7 A;  2RHY A;  3M0P A;  2KVQ G;  1UHC A;  1IRX A;  2HQX A;  2CP7 A;  3EG1 A;  2V8I A;  1UFF A;  2LVM A;  2KR3 A;  4XU1 A;  1KD1 U;  1TOV A;  2V26 A;  4A54 A;  1I0C A;  5CO7 A;  1BI2 A;  1Y71 A;  4NS5 A;  3OYM A;  3EFS A;  4F7U A;  4KGZ B;  2YUP A;  3PGG A;  1UHF A;  1M9S A;  1PWT A;  1P92 A;  3BE3 A;  5FU6 C;  1YI2 T;  1K9A A;  4FW2 A;  1TWB A;  2MMP A;  2A3L A;  3DLL A;  2DO3 A;  2AZS A;  2RQV A;  1U8R A;  4AT1 B;  2BZ8 A;  4ELZ C;  2DIQ A;  3JCM d;  4JJN K;  4FYV B;  2DVJ A;  1Y07 A;  1QMC A;  3NPF A;  4LDY A;  5GAN 8;  3LGL A;  1BI3 A;  2JTE A;  2EIF A;  3MKD A;  4M78 E;  3G71 T;  1UDL A;  2X4W A;  1UEC A;  1GXI E;  1M2V B;  3OSV A;  4JRK A;  1VQO A;  4M77 B;  5GAM g;  5DLO A;  2DL8 A;  4FM4 B;  3SHW A;  3VS6 A;  3X28 B;  1UUE A;  4E7J A;  5GAN f;  3EGU A;  3PMT A;  5GMK m;  1YWO A;  3THK A;  2CSQ A;  1EZZ B;  2QQB A;  3MP8 A;  4GY5 A;  2QGF B;  3CCV A;  1NZ9 A;  5I11 A;  2KRN A;  5LL6 S;  2DEQ A;  2JM8 A;  2DXU A;  5FU6 B;  2X4J A;  3FRN A;  5DY9 A;  2QQR A;  3NHN A;  1TUC A;  1HYO A;  1O75 A;  3FEO A;  5HCK A;  4AG2 C;  1RAG B;  2FL7 A;  5CR2 A;  3OYH A;  1D1B A;  4PJO D;  4JZ3 A;  2EVR A;  3TCJ A;  3QII A;  3CC2 T;  5CIU A;  5CKH A;  2R5M A;  4VUB A;  2QA4 A;  4MML A;  1Q86 C;  1YIJ T;  2AT1 B;  2KAF A;  1JJ2 P;  2VC8 A;  1JBM A;  3VU3 C;  1NPP A;  1D1C A;  1D0X A;  1ZHI A;  3BY7 A;  3I5R A;  5HK0 A;  3QYG B;  2FRY A;  1S72 T;  1QLY A;  2KSS A;  3CD6 T;  4LUE A;  2KT8 A;  2CKK A;  4OMN A;  4N4I A;  2VV5 A;  1BI0 A;  1RAH B;  3CXC A;  1MMN A;  2QQA A;  3QHS A;  4N0A C;  1UTI A;  2A0F B;  2YHT A;  2YDL A;  2CP2 A;  3GNG A;  2Y90 A;  4IUT A;  4M4Z A;  5CCA A;  2CZ6 B;  5GMK j;  4PJO C;  3RR6 A;  3OMC A;  2AK5 A;  4FSS A;  2HL3 A;  1KC8 C;  3C0C A;  3A8G B;  1T0J A;  2D0Q B;  5GAN 2;  1PCX A;  3H6Z A;  2RI5 A;  2P84 A;  4JRP A;  1UG1 A;  3DB3 A;  1SPK A;  2VB6 A;  2GQV A;  5GAM d;  1GCQ A;  1PD1 A;  3HKS A;  1Q82 U;  2FZG B;  3EFO B;  2DFU A;  4FW1 A;  4M78 A;  2E6Z A;  1X75 C;  1QVG A;  2DZ9 A;  4OB0 B;  1YP5 A;  3RNJ A;  4BE0 A;  1VQ9 A;  5KYU A;  1NEG A;  3CBM A;  1HSQ A;  4DOV A;  5AT1 B;  1V76 A;  3I56 Q;  3M0T A;  5HY6 A;  5LJ5 g;  3CCQ T;  1KFZ A;  1K73 U;  2VGM A;  1VQ5 Q;  1YIT Q;  2K7A A;  4EMK A;  2VYT A;  5KE2 A;  1H92 A;  3P8H A;  5J26 A;  4J9C A;  4KUD K;  3H8Z A;  4HT9 A;  1RI0 A;  4PL6 A;  4M75 G;  1ARK A;  4Y92 A;  1YJN A;  1K8A R;  1OQK A;  2FHD A;  1W2B A;  2MOX A;  5I2M A;  5GJV B;  2KT1 A;  4NOY A;  4C0D B;  2XMF A;  1T0H A;  1NJI U;  2YLC A;  2OTJ Q;  2X51 A;  3Q1J A;  3UF4 A;  4OMQ A;  5AYF A;  4BE2 A;  4ANJ A;  3CXC S;  2M16 A;  1SHG A;  2CUB A;  2IG0 A;  2PU9 B;  3HFN A;  1WHL A;  3NFC A;  1AWJ A;  1AZE A;  2A36 A;  4B9W A;  4C8Q A;  3QJY A;  5GAN 7;  3JCM Q;  2KBT A;  3OYB A;  2JXB A;  3OY9 A;  1FX7 A;  2PVO B;  1DJ7 B;  1WGS A;  4M77 E;  1M8M A;  4ELY C;  1AHJ B;  1OOT A;  2GGR A;  1FYN A;  1QCO A;  3CME T;  3JSC A;  1M90 C;  4IUU A;  2C0T A;  2XDP A;  3OS2 A;  1WA7 A;  1R0C B;  1VQ7 T;  1LPL A;  4JRI A;  1VQN T;  1V1C A;  3H9N A;  3KXT A;  1QVG S;  3O5Z A;  5IH2 A;  3RER A;  3OYN A;  3CCE A;  5L8R E;  4A4E A;  1WX6 A;  1F1B B;  1UGQ B;  2LMJ A;  4J6Y A;  4XK8 E;  2DRK A;  1BIB A;  1TUG B;  1WHH A;  4HVU A;  3PT9 A;  2V1R A;  3ZL7 C;  2K5I A;  1NEB A;  5FWC A;  1RAA B;  1VQ5 A;  2LQK A;  1RLP C;  1GBQ A;  2XK0 A;  1AVZ C;  3OYF A;  1BBZ A;  3PIO A;  2RJC A;  1W6X A;  2SRC A;  1FMK A;  4M78 D;  3LH5 A;  4M7D E;  2HDA A;  4XU3 A;  4Z02 A;  3PFS A;  2XD0 A;  2BE9 B;  4J9B A;  3I35 A;  1WQ7 A;  3L1A A;  1FMV A;  4RTY A;  1W2B S;  2D6F A;  2YSQ A;  3M56 A;  1WHJ A;  4AG1 C;  3X24 B;  3LW5 E;  1YJ9 T;  3UA7 A;  3CCR A;  2FRW A;  1CSK A;  4AFU C;  2CUD A;  3IQL A;  3KFV A;  1Q86 U;  3E9F A;  1VQ4 T;  2RI3 A;  5IHK A;  3CCU A;  1YI2 Q;  2F69 A;  1WJR A;  2KK4 A;  1U5S A;  4DQ2 A;  4M7A E;  4FIB A;  1TUD A;  4CI0 C;  1Y0M A;  1OZ2 A;  1AWW A;  3C12 A;  1TXQ A;  4JJC A;  4OMF B;  1QKW A;  2DL4 A;  4KH1 B;  2EYQ A;  4OMO A;  3VS3 A;  1K1Z A;  3G4S T;  1GL5 A;  5GAO r;  5GAN j;  4M78 C;  1KHC A;  1OEB A;  1M2V A;  5FU7 C;  2M9U A;  4M77 A;  1GCP A;  3EFR A;  7AT1 B;  3R6N A;  4LDX A;  5I2S A;  3G71 Q;  4J6X A;  1XOV A;  5GMK i;  1D09 B;  1SKU B;  3A8H B;  3JCM J;  2RK2 A;  4JS5 A;  3V7C A;  4BDY A;  3HSB A;  2CYZ B;  4KUL A;  1Q7Y U;  4AFQ C;  2EGC A;  1EIF A;  4JZ4 A;  5IT9 E;  1HD3 A;  1WPY A;  3VV0 A;  2L3Q A;  5J3B A;  2K6D A;  2CZ7 B;  2G3R A;  4C0F A;  1KQ2 A;  3SB2 A;  3M0Q A;  1SSF A;  1D3B B;  4HA8 A;  4PJN A;  4JS4 A;  5FRM A;  5LJ3 f;  2RB6 A;  2MI6 A;  2LT4 A;  4FCY A;  4J9E A;  1Q81 C;  1JXO A;  5EC7 A;  1N8R R;  2XKO C;  3OMG A;  4M7D G;  3QKJ A;  3JCM c;  3I56 T;  3OW2 P;  4NL3 A;  1SHF A;  3CC2 Q;  3CCS A;  5FU7 B;  1NLP C;  3QYH B;  1QVP A;  4ZGJ B;  3OYG A;  2F2X A;  5KYU B;  1N6A A;  1YIJ Q;  3CCL T;  2EBP A;  4FT2 A;  3M0R A;  2LNV A;  3SFM A;  3X26 B;  1WDX A;  3JB9 J;  3FLG A;  3OBW A;  2JW4 A;  3T9N A;  3RKY A;  1S72 Q;  1MV0 B;  2D8H A;  4QVD A;  3JCM X;  2CP6 A;  3CD6 Q;  2RHI A;  1YI2 A;  1VQL T;  4MDW A;  4M7A G;  3VS1 A;  1AD5 A;  1K9M R;  3HRT A;  2FG0 A;  3X25 B;  5GAO q;  5GJW B;  2Z0W A;  4BAC A;  1E6G A;  1GBR A;  2M1H A;  1AWO A;  1SF9 A;  1D0Y A;  1VQ6 T;  3FJP A;  4JUV A;  4E6R A;  2C0I A;  2EAY A;  1M3A A;  2GNC A;  4IUP A;  5CVI A;  2D1X A;  5IHN A;  2DTI A;  1ZSZ B;  2ESW A;  2WSE E;  2KI7 A;  5FRO A;  5CAI A;  2JMA A;  3EFO A;  3L42 A;  3TQ7 P;  5FW9 A;  3QXE B;  2QEX A;  1BYM A;  2BIV A;  3QBY A;  1YJW T;  1WXT A;  1M90 U;  1ABQ A;  2NWM A;  2VVK A;  4IUR A;  4KH0 B;  1YBY A;  3OB9 A;  3M58 A;  3VS7 A;  1I07 A;  3FDR A;  2PUK B;  4OP0 A;  2DK3 A;  1VUB A;  3GIB A;  2EGA A;  4L59 A;  2EYZ A;  1PM3 A;  1M5Q 1;  1WYX A;  2BE7 D;  3CCQ Q;  1VYT A;  4M77 D;  1ZUU A;  1UB4 A;  1C0M A;  3UA6 A;  4V2S A;  4RCC A;  3MJX A;  1WHG A;  2RHU A;  1ZA2 B;  4J9F A;  4R56 A;  3JB9 F;  1B34 B;  1SRL A;  2NYS A;  4LUD A;  1AOJ A;  3QWY A;  3WVD B;  1YIJ A;  2CT4 A;  3QZ9 B;  1OX8 A;  5GAN 6;  2VWF A;  2OAU A;  3JB9 D;  2KQW A;  4C92 G;  2LX9 A;  4ME7 A;  4J9G A;  4JJB A;  4PFO A;  1JJ2 A;  3M57 A;  5J39 A;  2DTH A;  1W4S A;  1WHK A;  4ORZ A;  2X35 A;  1OPL A;  3G6E A;  2HEQ A;  3G7Z A;  4FSX A;  2EQI A;  3VYG A;  4J9I A;  2CS7 A;  4M7D F;  2ECZ A;  3CCM A;  4M77 C;  3NTI A;  1AEY A;  4C0Z A;  4RTX A;  1M2O A;  4MMK A;  2XU8 A;  3GLX A;  1QWE A;  2PNI A;  2E5Q A;  2E41 A;  5KYN A;  2LCC A;  4CC4 B;  4F7U G;  3CME Q;  3PVQ A;  2DET A;  4EMG A;  2OTL A;  1VQ7 Q;  4ATO A;  2J05 A;  2F2V A;  3CCJ Q;  1VQN Q;  4M7A F;  3HFO A;  1VQP T;  2YUQ A;  2LT1 A;  2V8K A;  4IUQ A;  2VAS A;  1WI7 A;  2EJ9 A;  5LJ3 h;  1VQ8 T;  3M5A A;  5GMK h;  4XTW A;  1U1T A;  3MO8 A;  3QWX X;  1QVF P;  4DBQ A;  2QDL A;  4DBR A;  2ZPI B;  3M4Y A;  2K3Y A;  1QP3 A;  2PUO B;  5IXF A;  3CC4 T;  2GFU A;  2RPN A;  1M1K R;  4FYW B;  2KNB B;  2X4X A;  4HT8 A;  4J9D A;  3EG2 A;  3INZ A;  4P5N A;  3KUF A;  1JO8 A;  3CMA A;  3JCM V;  4C5I A;  2WSC E;  1VQM T;  1Q81 U;  4HCB A;  2KRS A;  3JB9 I;  4E7S A;  1UGR B;  2A08 A;  2P4T A;  1NPR A;  1JJ2 S;  3CC7 T;  2DD5 A;  1G5V A;  1YJ9 Q;  2RHZ A;  3TSZ A;  3TU4 K;  1QQJ A;  1WJS A;  2OJ2 A;  1YHQ T;  4J8O A;  3GPL A;  2HMA A;  2DZC A;  1OI1 A;  2QAZ A;  4A4H A;  1VQ4 Q;  2K5L A;  3I55 T;  1AWX A;  2RK1 A;  2MWO A;  1RAC B;  3EH2 A;  3QDF A;  4MDX A;  3R6O A;  4M75 E;  3VS0 A;  1BIA A;  1VQK T;  4FYY B;  5FWB A;  4OB1 B;  1OU8 A;  3BDL A;  4RMO A;  5KH6 A;  2DM1 A;  2EKO A;  4M7D B;  2CP5 A;  3G4S Q;  1RAF B;  2EFI A;  3VUZ A;  1NE8 A;  4XTY A;  2KXC A;  1WJQ A;  2JVV A;  2O4X B;  1KJW A;  1VIE A;  2M0Y A;  3PNW C;  5LJ3 j;  1OX9 A;  1JEG A;  1OUL A;  2NUZ A;  3V7R A;  2DE0 X;  1UGS B;  1D3B A;  2FO0 A;  4KGV B;  3E9G A;  2HZY A;  5DM7 R;  1GFD A;  2H3J A;  5IHI A;  4M7A B;  2QQS A;  2AZV A;  4RTU A;  1LVK A;  3GF5 A;  1KG1 A;  3JCM f;  2A37 A;  4QVC A;  2FPE A;  4C0D C;  4F16 A;  4AFZ C;  3LYI A;  4BUG A;  1D1A A;  3O8V A;  5HKC A;  1KD1 R;  1IGU A;  2MIO A;  1JB0 E;  3ULR B;  3M55 A;  1ZA1 B;  3EAE A;  4J7I A;  2DAQ A;  3CPW S;  1X2K A;  4ZNX A;  2HQH A;  4ZN1 A;  1TSF A;  3CCL Q;  5CQY A;  1TS9 A;  5DLQ E;  5LJ3 g;  2FPD A;  1MMA A;  2YUO A;  3RMQ A;  2E12 A;  2EWN A;  4XU0 A;  2AKK A;  3EH1 A;  4RKU E;  3CPW P;  4ZTF A;  1VQL Q;  2PTK A;  2NUT B;  1VQO T;  4TVR A;  4UC4 A;  3EHQ A;  8AT1 B;  3G1J A;  2FPF A;  5GAN 5;  2CGH A;  1ZSZ A;  1UE9 A;  2ZPB B;  3CCV T;  1VQ6 Q;  1QKX A;  1Z9Z A;  3L2Q A;  4O6J A;  1TG0 A;  1KSW A;  4QQ6 A;  1ZBJ A;  1YCS B;  4C8Q G;  2JUF A;  1ZSG A;  3EG0 A;  4L5G A;  1J3T A;  1YJW Q;  2H3E B;  4OMM A;  4X1V A;  3GBQ A;  2R57 A;  4J83 A;  1IZ6 A;  4ESR A;  2LCS A;  3J80 E;  1ZX6 A;  4FYX B;  2IPO B;  2PVG B;  3EHR A;  2O88 A;  4A4K A;  1G3S A;  3H0H A;  3RMS A;  2FYK A;  1BCM A;  4F17 A;  2QA4 T;  5GAN h;  3I5S A;  2GCX A;  3CCJ T;  2CDT A;  4E47 A;  3GP8 A;  3UAT A;  4HXJ A;  1IGQ A;  3ME9 A;  1B34 A;  4J7F A;  1JU5 C;  2VXE A;  3LLR A;  4GLK A;  3UT1 A;  1X27 A;  1UJ0 A;  2HD0 A;  1I5L A;  2J6F A;  8ATC B;  2LRQ A;  3I56 A;  2X9H A;  1BCO A;  5GAM f;  3SEM A;  2JM9 A;  3HRS A;  5LJ5 d;  5GAO n;  5GAO l;  3LH0 A;  3OW2 A;  1NLO C;  3DB4 A;  3OQ5 A;  2P4R A;  4WF2 A;  1YIT A;  1JRI A;  4QQD A;  3C4S A;  2HSP A;  3OYY A;  5C0M A;  2ATC B;  3QZ5 B;  4NL2 A;  5A2Q E;  1QP2 A;  2X3W D;  5FRN A;  3D7S B;  1KQS S;  4RG2 A;  3CQT A;  2L3P A;  1H3Z A;  1KHI A;  2DXB A;  1K4U S;  4DA4 A;  2VUB A;  2MF2 A;  3ZBD A;  2DEU A;  1RAB B;  1VA7 A;  2OTJ A;  1Q82 R;  9ATC B;  4JDS A;  1VQ9 T;  3OYE A;  4ZN3 A;  1KQS P;  2DL7 A;  2EQU A;  1N9R A;  4L6V 5;  2RM4 A;  1H64 1;  1PHT A;  1LCK A;  3QSU A;  3OYA A;  1X6B A;  3OYK A;  2ED0 A;  3CBP A;  4Y91 A;  4M75 F;  1VQP Q;  1K73 R;  2JMC A;  5LJ3 e;  5KYX B;  3JCM h;  3C94 A;  5GMK e;  2KGT A;  2LTO A;  5I21 A;  2DBK A;  2XID A;  1VQ8 Q;  3GOX A;  2F5K A;  4A63 B;  2A7Y A;  4M75 D;  4OVA A;  2MAM A;  1YJN T;  4X9D A;  2EQJ A;  2HAX A;  1KC8 U;  2DNU A;  1RUW A;  4C5H A;  2QDY B;  1NJI R;  1G3Y A;  2V1Q A;  3CC4 Q;  4JLI A;  1PD0 A;  4HVW A;  2LP5 A;  2QQ9 A;  3MHX A;  1SRM A;  3ASK A;  2GTO A;  3OW2 S;  2HCK A;  1VQM Q;  2E65 A;  4Z89 A;  3FJ5 A;  1K8A C;  2KY9 A;  1VOM A;  1H8K A;  2EW3 A;  2HKN A;  2D9T A;  1NBE B;  2JS0 A;  1GRI A;  3CC7 Q;  2RQW A;  2D8J A;  4LE9 A;  2X4Y A;  1PSE A;  3HTR A;  4RG8 A;  4PJO E;  5LJ5 f;  1YHQ Q;  5GAN g;  2QG9 B;  4A4G A;  4MZT A;  1ZSZ C;  4M75 C;  3X20 B;  2GF7 A;  3OA6 A;  3I55 Q;  4PFZ A;  1Y57 A;  2E4H A;  2SEM A;  3TRE A;  1K76 A;  3MEV A;  3L2V A;  4M7D A;  2NUP A;  1VQK Q;  2EYY A;  5C6S A;  3MPU B;  3CCE T;  4PJL A;  1X6O A;  4C92 E;  1X43 A;  5L23 A;  5D6Y A;  2LC4 A;  1PRL C;  1WXU A;  2O4X A;  1K0S A;  1WQW A;  2LJ1 A;  1PNJ A;  4LN2 A;  1Y96 B;  2ZZD A;  2O31 A;  2P0P A;  5IXB A;  2FVU A;  2HQE A;  2P0Q A;  1JQQ A;  3BFM A;  6AT1 B;  4KT0 E;  4LXC A;  4XTU A;  4XAX B;  4M7A A;  3VRZ A;  3LGF A;  2FZC B;  3MEU A;  2RJE A;  4FU6 A;  2GQI A;  4FL6 A;  3A5Z B;  4IIM A;  1MV3 A;  1OU9 A;  4J6W A;  1VYU A;  1KIK A;  5D6X A;  3G71 A;  3JB9 H;  4M75 B;  1YFN A;  4F7U E;  1R8O B;  3PVL A;  2KRO A;  4IUV A;  3PIP A;  1G8X A;  2HBW A;  1QVF A;  3CPF A;  3CCR T;  1A0N B;  2L8D A;  2QYZ A;  5GAM h;  4XTZ A;  4JRQ A;  2K3B A;  1RI9 A;  2E3I A;  3E2U A;  3JAM E;  1B3Q A;  3OYJ A;  2RHX A;  1ZLM A;  1Q86 R;  4ZTJ A;  3CCU T;  1WIE A;  1RAI B;  2W10 A;  5HK3 A;  2K9G A;  3PE0 A;  3EGD B;  2PQW A;  4KRT A;  1LOJ A;  1ZUY A;  2YXY A;  1H3H A;  3M54 A;  4JJD A;  2B8A A;  3JCM g;  2LQW A;  4PJO G;  2BZX A;  1YN8 A;  2C0O A;  2L3S A;  2ZPG B;  2NUT A;  3A8M B;  3UDC A;  4F14 A;  2EJG A;  3CC2 A;  4R55 A;  4PJJ A;  2ZCF B;  3L2W A;  3EGX B;  4GBQ A;  2M0O A;  3HRU A;  1VQO Q;  4C0G A;  1QCN A;  1SEM A;  4EPC A;  3M0S A;  4E2F B;  4QW2 A;  3SD4 A;  2PVD B;  4Q5W A;  1S72 A;  4CC7 A;  3MCA B;  2PZ1 A;  3CD6 A;  2DYI A;  1I8F A;  2IVW A;  1Q7Y R;  5GAN 4;  3CCV Q;  2BUD A;  2XG8 D;  1M3C A;  2COW A;  1UJY A;  3FIF A;  2ED1 A;  4RTV A;  4C92 A;  2FEI A;  2OAW A;  4BI8 B;  3QJ6 A;  1X69 A;  2RMO A;  4PLL A;  2DLP A;  3C95 A;  2HSE B;  1CKA A;  3WXM B;  3NGP A;  3PTA A;  2F1L A;  5I22 A;  3E1S A;  4M7D D;  1ZBX A;  5EG2 A;  2B86 A;  1I81 A;  3CCS T;  4KBM B;  5GAN e;  4LDV A;  2QTV A;  2QA4 Q;  3M0U A;  5GAM j;  3A98 A;  2LQ8 A;  4PFP A;  3RUX A;  1QVF S;  5CKE A;  1IRE B;  1YNZ A;  5KYW B;  3HL8 A;  3SWN B;  2O2O A;  2QI2 A;  2NLU A;  1CKB A;  1FMW A;  4O5V A;  1N8R C;  5GAO m;  1AT1 B;  1W1F A;  2J06 A;  4OML A;  2EGE A;  2I0N A;  2AHJ B;  4M7A D;  1OYX A;  1VYV A;  2CRE A;  2K57 A;  1M1F A;  3CCQ A;  2EQM A;  2DL5 A;  3A1P A;  5LJ5 h;  3OSS C;  2RN8 A;  1FWZ A;  2DX1 A;  3OS1 A;  4BDZ A;  4BI3 A;  3VS4 A;  2D0N A;  2J6K A;  1V29 B;  4EIK A;  1U06 A;  3M4G A;  1T3L A;  2DMO A;  4M7D C;  3JRZ A;  1K8A U;  4A4F A;  4AMC A;  2RD1 A;  3MP6 A;  1BU1 A;  1NYF A;  3CPW A;  2QEX T;  4D8K A;  2MWP A;  1K9M C;  4OGE A;  1TU0 B;  1AZG B;  3REA B;  2L0A A;  1WZO A;  2L2P A;  5M9O A;  1O9S A;  2RQT A;  3L2R A;  5CK9 A;  1M90 R;  2C06 A;  2LJ3 A;  1VQ9 Q;  4N4H A;  2RI2 A;  4QKU A;  2I2L A;  4PJO F;  4M7A C;  2CH4 W;  2P0K A;  2XIC A;  2VGN A;  2RJD A;  1X01 A;  2AKL A;  1HK9 A;  1G2B A;  3CBO A;  4CC2 A;  2JJ9 A;  2EKH A;  5KYX A;  3MEW A;  1C6V X;  1D0Z A;  3JCM e;  3FB9 A;  4KUI A;  2L89 A;  1I1J A;  2Y4X A;  1X2Q A;  2NUP B;  3CME A;  4B9X A;  1PKT A;  4C92 F;  4RTW A;  4OB2 B;  1E6H A;  3JCM b;  1C1A A;  1VQ7 A;  3OBY A;  1PG5 B;  1BK2 A;  3CCJ A;  3OYL A;  2DVE A;  1YJN Q;  1VQN A;  3L2U A;  2J6O A;  4BD3 A;  4C8Q E;  4C92 D;  3WVE B;  3G6E T;  2QGG A;  1QW1 A;  2YLB A;  2CP0 A;  3MET A;  5LJ5 j;  1K0X A;  4RTT A;  1BKB A;  3CCM T;  2GFA A;  2EYX A;  3A8L B;  1ZUK A;  1Z9Q A;  4MZP A;  4F7U F;  1MGQ A;  5A0G A;  1N9S A;  2E3H A;  2YUN A;  4PKC C;  1VIF A;  3PMI A;  3TSW A;  1WNL A;  1M30 A;  4M78 G;  2QTX A;  1WLP B;  2E70 A;  4J9H A;  5IAY A;  1Q7Y C;  2QXF A;  1LNX A;  2OTL T;  5KYY B;  3OYD A;  2JTM A;  3EG9 B;  2JT4 A;  2RF0 A;  3H0I A;  3M53 A;  2LNH B;  1I4K 1;  2KYM A;  4QVZ A;  2E10 A;  4C92 C;  1YJ9 A;  3TVT A;  2BTT A;  4PK4 A;  1W70 A;  2DA9 A;  1RL2 A;  2DRM A;  3CCE Q;  2HL5 C;  5GAO p;  2J7I A;  1BI1 A;  1VQ4 A;  2ROT A;  3OS5 A;  2RH2 A;  2RQU A;  1Y96 A;  2E1H A;  2G6F X;  1NYG A;  4R0K A;  2JN0 A;  2X3X D;  4D8D A;  1KQS A;  4C5E A;  3QDR B;  4XTV A;  3ZEH A;  1MND A;  2JNG A;  4LD6 A;  3OYC A;  1G3W A;  1YCY A;  5D6W A;  4E7I A;  4PJO B;  4QQG A;  2M02 A;  2XDD A;  3G4S A;  3RBB B;  3QUI A;  4M75 A;  2LQN A;  2RJF A;  4GLM A;  1WHM A;  3ER0 A;  2LZ6 B;  3CMA T;  2GBQ A;  3M59 A;  4F04 B;  2MK5 A;  3DLM A;  3RKX A;  2JS2 A;  1Q81 R;  5GAM e;  2O9V A;  1MHN A;  2F5T X;  3LWH A;  3J7A F;  3M9Q A;  4C92 B;  1M3B A;  2KDS A;  3CCR Q;  4LD9 K;  5A0L A;  2DD4 A;  2DL3 A;  3LWI A;  5KE3 A;  4BB7 A;  2DXC A;  3EGD A;  1M1K C;  1MNE A;  3QPH A;  2LDM A;  2CP3 A;  4PJM A;  3ZFJ A;  3CCU Q;  4II1 A;  1NG2 A;  1B07 A;  4J5Y A;  2ZPH B;  3AHU A;  1U1S A;  2XDB A;  1Q95 G;  2VKN A;  1KK7 A;  1MMG A;  2FB7 A;  1N8R U;  4HCC A;  3CXC P;  2WAC A;  2HKQ B;  5CKB A;  4X34 A;  3S3M A;  2W0Z A;  3EGX A;  4XQ3 A;  2HNI A;  2K5F A;  3EG3 A;  5FLX E;  3VKI A;  4MZM A;  5A0D A;  4F7U B;  1LJO A;  2KRM A;  1PRM C;  1WFW A;  1UGV A;  4HVV A;  2DTO A;  3CCL A;  4PLI A;  4K11 A;  2DXT A;  1FXX A;  5KCH A;  2R5A A;  1RAD B;  5LJ3 d;  2MPX C;  3RIR A;  2MCN A;  4BI4 A;  1K9M U;  2RQR A;  2K2V A;  1TTH B;  2K79 A;  1VQL A;  1MMD A;  1OZ3 A; 
#chains in the Genus database with same CATH homology
 2LJ1 A;  1PNJ A;  2CT3 A;  1UG1 A;  1SPK A;  4LN2 A;  4RTZ A;  2J05 A;  2F2V A;  2OI3 A;  2ENM A;  2O31 A;  1GCQ A;  3VS5 A;  1SSH A;  1S1N A;  3H41 A;  5IXB A;  2O9S A;  1JQQ A;  1OV3 A;  1QWF A;  3REB B;  1YP5 A;  1N5Z A;  2YUQ A;  3RNJ A;  3VRZ A;  1WI7 A;  4AFS C;  1NEG A;  1HSQ A;  3M0T A;  2DBM A;  2GQI A;  4IIM A;  1MV3 A;  1VYU A;  3QWX X;  1KIK A;  4HCK A;  3PVL A;  2KRO A;  4Z88 A;  2QDL A;  1GFC A;  1KFZ A;  2HBW A;  1A0N B;  5IXF A;  4WCI A;  2K7A A;  2RPN A;  2K3B A;  1RI9 A;  2KNB B;  1B3Q A;  4J9D A;  3EG2 A;  1H92 A;  1ZLM A;  4J9C A;  1JO8 A;  1WIE A;  4IIO A;  4JPB W;  4LNP A;  1ARK A;  2W10 A;  2K9G A;  3PE0 A;  2KRS A;  4Y92 A;  4KRT A;  1ZUY A;  2A08 A;  2MOX A;  2DIL A;  5GJV B;  2KT1 A;  1H3H A;  2XMF A;  4JJD A;  1T0H A;  2LQW A;  1GCQ C;  3TSZ A;  2BZX A;  1YN8 A;  3UF4 A;  4OMQ A;  2C0O A;  2OJ2 A;  2L3S A;  1SHG A;  2CUB A;  4F14 A;  1AWJ A;  1AZE A;  2A36 A;  1AWX A;  2DF6 A;  1BB9 A;  2KBT A;  4OMP A;  4GBQ A;  2JXB A;  1HJD A;  1E7O A;  3VS0 A;  3I9Q A;  1SEM A;  3M0S A;  5FWB A;  1M8M A;  1OOT A;  4CC3 A;  3U23 A;  4CC7 A;  2GGR A;  4DEY A;  1FYN A;  2PZ1 A;  2DM1 A;  2LX7 A;  2KXD A;  1M3C A;  2C0T A;  1UJY A;  2ED1 A;  4RTV A;  1WA7 A;  2F2W A;  1T3S A;  2FEI A;  2OAW A;  2KXC A;  1X69 A;  1MUZ A;  2RMO A;  1V1C A;  2EPD A;  1ABO A;  1KJW A;  2RNA A;  2GTJ A;  2DLP A;  2M0Y A;  3O5Z A;  5IH2 A;  1CKA A;  1JEG A;  2A28 A;  2NUZ A;  3NGP A;  1IO6 A;  2DE0 X;  1WX6 A;  5I22 A;  2LMJ A;  2FO0 A;  2DRK A;  2B86 A;  4HVU A;  1GFD A;  2V1R A;  1OPK A;  5IHI A;  3ZL7 C;  2AZV A;  4Z8A A;  4RTU A;  1RLQ C;  1NEB A;  3M0U A;  3A98 A;  5FWC A;  1NM7 A;  2A37 A;  2FPE A;  4F16 A;  4AFZ C;  1RLP C;  1GBQ A;  1YNZ A;  1AVZ C;  1BBZ A;  2KE9 A;  1W6X A;  2MIO A;  2SRC A;  2O2O A;  2IIM A;  3ULR B;  1CKB A;  1FMK A;  2K2M A;  3LH5 A;  1W1F A;  2J06 A;  2HDA A;  4OML A;  2EGE A;  2I0N A;  2H8H A;  4J9B A;  3I35 A;  1VYV A;  2CRE A;  4DEX A;  2M51 A;  1X2K A;  4RTY A;  4ZNX A;  2YSQ A;  1X6G A;  2DL5 A;  2DYB A;  4AG1 C;  2KEA A;  2RN8 A;  2ROL A;  2DX1 A;  2BZY A;  1EFN A;  3UA7 A;  2FRW A;  1CSK A;  4AFU C;  2CUD A;  3VS4 A;  2FPD A;  2D0N A;  2J6K A;  4EIK A;  1U06 A;  3IQL A;  3KFV A;  1T3L A;  2CH4 A;  2DMO A;  2YUO A;  3NMZ C;  2AKK A;  5IHK A;  2PTK A;  1BU1 A;  1U5S A;  2EYW A;  1NYF A;  4D8K A;  1TUD A;  2LJ0 A;  1Y0M A;  3EHQ A;  1AWW A;  4JJC A;  4RUG A;  1AZG B;  3JV3 A;  3REA B;  2L0A A;  1QKW A;  2DL4 A;  2E5K A;  2L2P A;  2FPF A;  4OMO A;  2ABL A;  3VS3 A;  2RQT A;  1K1Z A;  1YWP A;  1UE9 A;  1GL5 A;  1OEB A;  2LJ3 A;  1QKX A;  1Z9Z A;  1GCP A;  1TG0 A;  1KSW A;  2DJQ A;  2CH4 W;  2KYB A;  1ZBJ A;  1QCF A;  1YCS B;  2AKL A;  3R6N A;  1PKS A;  1G2B A;  1XOV A;  4CC2 A;  1ZSG A;  3EG0 A;  2EKH A;  1U3O A;  1J3T A;  4OMM A;  4X1V A;  2EGC A;  4AFQ C;  3GBQ A;  4JZ4 A;  4ESR A;  1HD3 A;  2LCS A;  1WXB A;  1I1J A;  3PVQ A;  1ZX6 A;  4QT7 A;  2YT6 A;  1X2Q A;  3EHR A;  2O88 A;  2L3Q A;  1PKT A;  2K6D A;  3H0H A;  3H0F A;  4RTW A;  3VRY A;  4F17 A;  3M0Q A;  1E6H A;  1M27 C;  3I5S A;  1BK2 A;  2CSI A;  1K0S A;  2CDT A;  5ECA A;  3UAT A;  4HXJ A;  2J6O A;  4J9E A;  1JU5 C;  1JXM A;  1JXO A;  5EC7 A;  3VS2 A;  1X27 A;  1UJ0 A;  1G83 A;  2J6F A;  3M0P A;  1SHF A;  1K0X A;  1NLP C;  1UHC A;  4RTT A;  3EG1 A;  3SEM A;  2JM9 A;  2F2X A;  1UFF A;  2KR3 A;  1NLO C;  2EYX A;  2EBP A;  3M0R A;  1WDX A;  1ZUK A;  2P4R A;  1Z9Q A;  2YUN A;  1I0C A;  2JW4 A;  2HSP A;  3TSW A;  1MV0 B;  1M30 A;  2D8H A;  2YUP A;  1UHF A;  1PWT A;  1WLP B;  2X3W D;  4J9H A;  3VS1 A;  1AD5 A;  1K9A A;  3CQT A;  2L3P A;  2FG0 A;  1K4U S;  2AZS A;  2JT4 A;  2RF0 A;  2RQV A;  3H0I A;  5GJW B;  2LNH B;  2BZ8 A;  1E6G A;  2KYM A;  1VA7 A;  1GBR A;  1AWO A;  3TVT A;  2BTT A;  1W70 A;  2DA9 A;  2DRM A;  2DVJ A;  3NPF A;  4E6R A;  2J7I A;  2C0I A;  1M3A A;  2GNC A;  2ROT A;  2D1X A;  2DL7 A;  2RQU A;  5IHN A;  2JTE A;  2ESW A;  2G6F X;  1NYG A;  1UDL A;  2JMA A;  4R0K A;  1UEC A;  2X3X D;  4D8D A;  1PHT A;  1LCK A;  1X6B A;  5FW9 A;  2DL8 A;  3SHW A;  2ED0 A;  3VS6 A;  1WXT A;  1ABQ A;  2NWM A;  1UUE A;  2VVK A;  3EGU A;  3VS7 A;  1YWO A;  3THK A;  1I07 A;  2JMC A;  2CSQ A;  3RBB B;  2LQN A;  5I11 A;  2KGT A;  2KRN A;  4GLM A;  2EGA A;  2DBK A;  2JM8 A;  2LZ6 B;  2GBQ A;  2EYZ A;  4A63 B;  3NHN A;  1WYX A;  1VYT A;  2JS2 A;  1TUC A;  5HCK A;  1ZUU A;  2DNU A;  3UA6 A;  2O9V A;  4AG2 C;  1RUW A;  1M3B A;  4JZ3 A;  2EVR A;  2V1Q A;  4J9F A;  2DL3 A;  4HVW A;  1SRL A;  2LP5 A;  4LUD A;  1AOJ A;  3QWY A;  1SRM A;  2GTO A;  1NG2 A;  2HCK A;  2CT4 A;  1B07 A;  2VWF A;  4Z89 A;  3FJ5 A;  2VKN A;  3I5R A;  1H8K A;  4J9G A;  4JJB A;  2EW3 A;  2FRY A;  1QLY A;  1GRI A;  2JS0 A;  2RQW A;  2D8J A;  4LE9 A;  4LUE A;  2KT8 A;  4OMN A;  2W0Z A;  4ORZ A;  1OPL A;  3EG3 A;  2HEQ A;  2EQI A;  1UTI A;  4J9I A;  2YDL A;  1Y57 A;  2ECZ A;  2SEM A;  2KRM A;  1PRM C;  1K76 A;  1AEY A;  1WFW A;  4M4Z A;  1UGV A;  4HVV A;  4RTX A;  4K11 A;  2EYY A;  1QWE A;  2PNI A;  2AK5 A;  2MCN A;  4FSS A;  1X43 A;  3C0C A;  5L23 A;  4CC4 B;  1T0J A;  1PRL C;  2RQR A;  2K79 A;  1WXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...