1M30A

Solution structure of n-terminal sh3 domain from oncogene protein c-crk
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
58
structure length
58
Chain Sequence
b'AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene C-crk
publication title Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 5
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1m30A00
2YUOA 4JZ3A 4CC2A 4CC3A 2KRSA 3KFVA 3R6NA 2JS0A 4RTXA 1M8MA 2QDLA 3H0IA 5IXBA 2HSPA 2SEMA 4ORZA 2DMOA 2OAWA 2GTOA 2KGTA 1N5ZA 1XOVA 3A98A 1T3SA 1UGVA 4HVWA 4AFSC 1SHFA 1OOTA 2DRKA 2I0NA 2EYZA 3TVTA 2DM1A 2DNUA 2K9GA 1ZSGA 4JJDA 2F2XA 2YDLA 2YUPA 1JXMA 3PVQA 1M3AA 2DILA 4AG1C 4F14A 4J9DA 3VS7A 4AFUC 2MOXA 1NLPC 2GBQA 3RBBB 1QKWA 2VWFA 3EG0A 2GQIA 2O2OA 1Z9ZA 2FPEA 4J9BA 4HCKA 5IXFA 1PRLC 3M0RA 3VS6A 3QWYA 2LQWA 1GBQA 1TUDA 2D0NA 2KBTA 1K9AA 4OMOA 1AZEA 3EG2A 1SHGA 1Y0MA 4EIKA 2CSIA 2EGEA 1NLOC 2DLPA 2FRYA 3H0FA 3I5SA 2V1RA 1WA7A 2NWMA 5I11A 2EPDA 1MV0B 1K0SA 2KT8A 2JM9A 2BTTA 1VYVA 2K3BA 1SRLA 2HCKA 3H41A 4RTZA 4LN2A 3ZL7C 1T3LA 3O5ZA 2E5KA 2EW3A 2D8HA 4J9HA 1ZUUA 2YUQA 2DJQA 1OPKA 2DL7A 2J6FA 3U23A 2YSQA 4J9EA 2ECZA 4OMMA 4AFZC 2CH4W 2EYXA 3I35A 1UHFA 2KXDA 5GJWB 1RI9A 1E7OA 1ARKA 2W10A 3JV3A 1OPLA 1FYNA 3GBQA 1BB9A 2JMAA 1UHCA 1W6XA 1B3QA 2C0TA 2PTKA 2K79A 2A37A 1QLYA 2DL8A 2J05A 4A63B 2D1XA 1BU1A 2V1QA 1HJDA 2D8JA 2M51A 4CC7A 2A08A 2GTJA 1K1ZA 2CREA 2EYYA 1HD3A 4LUEA 2KEAA 4ZNXA 4DEYA 1BK2A 1QCFA 4QT7A 2O9VA 2RQUA 1WFWA 1AZGB 2ESWA 2AZVA 2O9SA 3I5RA 4DEXA 4IIMA 1WXBA 1NYFA 1M30A 1K0XA 1AWWA 2EQIA 1CKBA 2FG0A 1PKTA 1AWXA 1A0NB 2LJ0A 2DA9A 1M3CA 2L2PA 1X69A 2L3PA 2DRMA 2KR3A 2EKHA 1YCSB 2CT3A 1GCPA 2HEQA 2M0YA 2A28A 2IIMA 3TSWA 2LZ6B 2EGAA 3EG3A 1GL5A 2CH4A 2JMCA 4HXJA 1QWFA 2FEIA 4JJBA 1NM7A 1OEBA 1SPKA 1WX6A 2H8HA 2HDAA 4OMLA 4J9CA 3VS3A 4OMNA 2DL3A 3M0PA 1E6GA 3EGUA 1UDLA 2FPDA 2DX1A 1PRMC 4RTYA 2C0OA 2DF6A 1ABQA 2NUZA 1ZLMA 2YUNA 4R0KA 2AK5A 1MV3A 3REAB 3NPFA 3PVLA 5FWCA 1WIEA 1JEGA 3I9QA 2ED0A 1GFCA 3VS5A 2GNCA 2AZSA 1H3HA 1FMKA 2JT4A 4D8DA 1AD5A 3NMZC 4LUDA 2BZXA 2DBMA 2RQRA 3M0TA 5HCKA 1AEYA 4K11A 3VS1A 2P4RA 2CT4A 1QKXA 2W0ZA 4KRTA 4RUGA 2K6DA 1X6GA 1V1CA 5IHKA 3CQTA 2DVJA 2HBWA 4F16A 1UUEA 1X6BA 2ABLA 2B86A 4J9GA 3NGPA 1SEMA 2DL4A 3FJ5A 2L3QA 2LP5A 4RTWA 3H0HA 1BBZA 1H8KA 4X1VA 3UF4A 1KJWA 2VVKA 4IIOA 1JXOA 2X3WD 3REBB 2MIOA 4ESRA 1ABOA 1X27A 1X2KA 4F17A 1TG0A 1SRMA 1YN8A 4RTVA 1E6HA 1K76A 1I1JA 1GCQC 1GFDA 1OV3A 2A36A 2EVRA 3M0QA 4JZ4A 2FO0A 1WXTA 5IHIA 1NEGA 1AVZC 3THKA 1VYTA 1U5SA 2LQNA 5L23A 2C0IA 4OMQA 1RUWA 1YNZA 4J9FA 2ENMA 2KRNA 1B07A 1UE9A 2EGCA 1PHTA 1X2QA 2OJ2A 4GLMA 2F2VA 1ZUKA 1T0JA 1GBRA 1WYXA 1NEBA 4JPBW 2DE0X 4HVVA 4RTTA 1EFNA 2ROTA 1PKSA 1JO8A 1AWJA 1GRIA 1PNJA 4J9IA 1YWPA 2J7IA 2KT1A 1ZBJA 1Y57A 1LCKA 1SSHA 2KYMA 1QWEA 2EBPA 2RN8A 4CC4B 2RMOA 1S1NA 3VRYA 4WCIA 1AOJA 1X43A 3VS2A 1UJYA 1U3OA 2MCNA 2RPNA 2LCSA 2XMFA 2K7AA 2GGRA 2JXBA 2K2MA 2JTEA 2AKLA 3RNJA 4LNPA 1W70A 2CUDA 1IO6A 2DBKA 3TSZA 2ED1A 3ULRB 1NYGA 2O31A 1RLQC 4Z89A 3NHNA 2O88A 3PE0A 2F2WA 4AG2C 3UATA 1CSKA 2BZ8A 5IH2A 3LH5A 1JQQA 3M0SA 2KYBA 1YWOA 4GBQA 1CKAA 4Y92A 3UA7A 2RQTA 2LX7A 2KE9A 4AFQC 3EHRA 2DYBA 4E6RA 4Z8AA 1WI7A 2KROA 4RTUA 1WLPB 2KXCA 4D8KA 1KSWA 2LNHB 2YT6A 1H92A 3UA6A 1PWTA 2FPFA 5IHNA 5I22A 2ROLA 1JU5C 5GJVB 1G2BA 3VS0A 3IQLA 4FSSA 4HVUA 5FW9A 4Z88A 3EG1A 1M27C 2EYWA 1UECA 1T0HA 2KRMA 2RNAA 1G83A 3C0CA 3SHWA 2X3XD 1ZX6A 1GCQA 2VKNA 2DL5A 4OMPA 1W1FA 2RQVA 1WDXA 5ECAA 2CSQA 3VS4A 1U06A 1UFFA 1VYUA 2G6FX 2CDTA 4JJCA 1M3BA 2BZYA 5EC7A 4M4ZA 2JM8A 1AWOA 4LE9A 2JW4A 2PZ1A 5FWBA 1MUZA 1RLPC 3M0UA 3SEMA 2RF0A 1ZUYA 2L0AA 1TUCA 2LJ1A 2LMJA 2RQWA 2CUBA 1I0CA 2SRCA 2J6KA 1UG1A 2AKKA 2KNBB 2JS2A 1UTIA 1J3TA 2LJ3A 1KFZA 1I07A 2OI3A 2PNIA 1YP5A 1KIKA 1Z9QA 3QWXX 2FRWA 1K4US 1NG2A 2L3SA 3EHQA 2J06A 3VRZA 1VA7A 1WXUA 2J6OA 1UJ0A 1HSQA
chains in the Genus database with same CATH superfamily
2X9HA 1IHVA 4JZ3A 3E1SA 2QQBA 1FWZA 3R6NA 2JS0A 5FRMA 3I56A 3JCMW 5GAOl 3CPWS 1Q7YU 3OY9A 1WGSA 2OAWA 1Q82C 4MDXA 1D1CA 4MMKA 2EYZA 1PSEA 2RK2A 4OB3B 3KUFA 3CC7T 1O75A 2F2XA 4GLKA 1M3AA 4AG1C 4C92A 4AFUC 3OMCA 2PVDB 3RBBB 1VQLT 4E7SA 3MEVA 5GANe 3JCMb 1YHQA 5IXFA 1PRLC 3VUBA 4QQGA 3QWYA 5J3BA 1NZ9A 1GBQA 3PT9A 5CKDA 1W2BA 1TUDA 3CEYA 4DOWA 4M75C 2D0NA 1SF9A 1FXXA 1BI3A 1SHGA 1UB4A 1Y0MA 5GAN8 2QGGA 3CCUT 3EGXA 2EGEA 2DK3A 1H641 1NLOC 2FRYA 1TU0B 3TCJA 3H0FA 2V1RA 1WA7A 2NWMA 2RK1A 1MV0B 2JN0A 2KT8A 2EYQA 4NL2A 1TSFA 4MMLA 1VYVA 2HQEA 3CPWA 2ZZDA 2LT4A 1Q81C 2HCKA 3H41A 1YJWT 3S6WA 4M75F 5LJ3h 5IN1A 2RO0A 3OYHA 3MHXA 2D8HA 4J9HA 2NUTA 1W4SA 2CH4W 2M16A 3A8OB 3QYHB 2NUPA 4M78B 1RI9A 1E7OA 2W10A 3V8JA 1RAIB 1VOMA 2E65A 3BY7A 1VQNT 4QVCA 2RHIA 1YJ9A 3C4SA 2C0TA 4M7DB 1VQMT 2CZ6B 2DL8A 2J05A 2DIGA 4J6WA 2O4XB 3BDUA 2JOYA 4A63B 1HJDA 2B8AA 5FRNA 2LQKA 3L1AA 2OTLT 2QG9B 2QK0A 2RJDA 4ZN3A 1G8XA 2XDBA 5LJ3j 1HD3A 4OVAA 2KEAA 4DEYA 1BK2A 4QT7A 4C8QE 4C5HA 4FCYA 2O9VA 4PFZA 3JCMX 2O9SA 3I5RA 1WQ7A 4JS4A 1VQ9A 2NLUA 1D1AA 2KK4A 1K0XA 5C0MA 2EQIA 3CMEQ 5DLOA 1M90C 4C8QB 1PKTA 4J7FA 1AWXA 4OF1A 4BI8B 2DD4A 4ZGJB 1K73R 1M3CA 3CCLQ 5LJ3e 2KR3A 1YCSB 2L5QA 3RKXA 3TSWA 2DTIA 2XDDA 5GAMh 5L8RE 2FEIA 1OEBA 1SPKA 2H8HA 3OA6A 4OMLA 1TUGB 3MEAA 3I55T 3VS3A 4OMNA 4HT9A 2K3YA 4JUVA 2QA4Q 2KSSA 3EGUA 1TS9A 1UDLA 2FPDA 3OYEA 4F7UA 1K73U 1MMGA 1ZLMA 2YUNA 1KD1R 2K5LA 3JCMQ 1MV3A 3HRSA 3FRNA 1QVGP 3OW2P 1VQPA 3FEOA 1WZOA 2LDMA 1FMKA 5CAIA 3S3NA 2XK0A 2BZXA 4V2SA 2DBMA 3HFNA 5HCKA 3GIBA 2CT4A 2W0ZA 3CCMT 1V1CA 2FZGB 1RABB 2DVJA 1RAAB 3OS1A 4F7UE 2IVWA 3GNFB 4HCZA 3CD6T 4BI3A 3E19A 4LXCA 2B86A 4J9GA 3NGPA 1ZSZC 3SFMA 1KD1U 2OTJA 2LVMA 2DL4A 4BI4A 3NFCA 3JB9G 1YJNT 2LP5A 3H0HA 4HCCA 1WQWA 1H8KA 1VQ4Q 4X1VA 3UF4A 3CCET 2E5QA 2RB6A 4WTOB 1JJ2A 3JB9I 4Y91A 1OU8A 5GAMe 4F04B 1ABOA 2M1HA 5FLXE 5FU6C 1G3SA 1TG0A 3BE3A 4MZTA 2K57A 1YITA 1GCQC 3RKYA 3M0QA 4C5GA 2PUOB 2FO0A 4JRIA 5IHIA 4LD6A 1B34B 1QVFA 1NEGA 5CIUA 2HZYA 1LOJA 3LLRA 1U5SA 1RUWA 1YNZA 3PNWC 4J9FA 1I4K1 1B07A 2VYTA 5LJ3d 3X20B 5KE2A 3E2UA 2HSEB 2QAZA 2BIVA 2F2VA 1K8AU 1GBRA 5KYYB 2COWA 1WYXA 1NEBA 3CCJT 1HYOA 3MP8A 2DE0X 3RMQA 2R58A 7AT1B 2EFIA 3OSSC 5LJ5g 2DAQA 4C8QD 4ZGDB 1JO8A 1AWJA 1N9SA 1YWPA 5KYUB 5CQXA 5KCOA 3VRYA 3VS2A 1NBEB 2D0QB 3EFOA 1K9MR 4J5YA 1IRXA 1IREB 2LCSA 2XMFA 1PSFA 2AT1B 3MKDA 2GGRA 3CCSQ 3TEEA 1W70A 4N4IA 1VUBA 3TSZA 5GMKm 3CCVQ 2DXTA 4X34A 5D7UA 4Z89A 1IXDA 1VQ6Q 3HL8A 3M9QA 1KQ1A 2BZ8A 1VQKQ 4C92C 5IH2A 1Y96A 4M7AA 3A5ZB 3G4SA 2WACA 4M75E 4XTXA 3QXEB 1CKAA 3UA7A 1OI1A 4AT1B 2LX7A 3N5BB 5HK0A 1IZ6A 1NJIC 1G3WA 2PU9B 4E6RA 1WI7A 4M77G 4RTUA 1YIJQ 2JUFA 4M75B 2KI7A 2LNHB 2QXFA 3ME9A 3P8BB 2EJFA 1PWTA 2ROLA 2E41A 1G2BA 5KYWA 1YI2A 3IQLA 4C92F 3META 1RAEB 2ATCB 2CGHA 3S3OA 2EYWA 1Q7YC 2VGMA 1D0ZA 2RNAA 1V29B 3SHWA 4LDWA 4M78G 4XU1A 1W1FA 4IKFA 2ZPGB 3CCQT 1TWBA 1UFFA 1VYUA 2CZ7B 2BZYA 1M1FA 1AWOA 5A0GA 3CC7Q 1RLPC 4LDUA 4E2FB 2RF0A 2H3EB 4M7DG 1TUCA 4PLIA 2CUBA 3PFSA 2JZ2A 2AKKA 2YXYA 3RMSA 1UGRB 2JS2A 1G3YA 3QG1A 1J3TA 1UGQB 2VV5A 1VQLQ 1C1AA 2OI3A 2YLCA 1Z9QA 4PK4A 3BFMA 2EQJA 1OX9A 2JTFA 1NG2A 3WXMB 2AIRB 4OB0B 4HT8A 2L3SA 3EHQA 1F1BB 3M4YA 3J7AF 3E9GA 3CCUQ 2LX9A 3QYGB 4CC2A 4BD3A 2YHTA 2F1LA 2O01E 2CZ1B 4RTXA 1D0YA 1BCMA 1BI2A 5IXBA 4C8QF 2HSPA 1W2BP 2SEMA 4ORZA 5LJ5j 4KUDK 2KGTA 2VB6A 1D3BB 1T3SA 1SHFA 3DB3A 1YJWQ 4IUVA 2DRKA 3OYMA 3MEUA 1I5OB 2YDLA 1O9SA 5CKFA 3TU4K 2DILA 4DOVA 5GAOr 4F14A 4BB7A 3CPWP 5KCHA 1V76A 1M2VB 1WNLA 1NLPC 5DY9A 3J81E 1VQNQ 3ASKA 5I2MA 3EG0A 2GQIA 1MNDA 1Z9ZA 2FPEA 3VS6A 1MNEA 1MMAA 1VQMQ 2G3RA 3M4GA 3RR6A 2DZCA 3CMAT 4GY5A 3SB2A 3EG2A 5GAOn 4N0AA 2CSIA 4HA8A 4FYYB 2KQWA 1UEBA 2OTLQ 3V8KA 5I11A 4KH0B 2V8KA 3OYYA 2GFUA 1QP2A 4M75D 4L59A 1Y7XA 2LT1A 4LN2A 3CCST 4EPCA 5KH6A 1N8RR 5KYXB 2ECZA 4AFZC 1NJIR 1VQ5T 4F7UF 3CC4A 1WHKA 2EYXA 2KXDA 1ARKA 4FW1A 1KK7A 1ZSZB 2X4YA 4IUUA 3G71Q 3G6ET 1BB9A 3OYLA 1VQ6T 5DM7R 4M7AD 1X75C 2V8IA 4B6MA 2PTKA 3RESA 3L2RA 2K79A 4LDXA 2RHXA 4EMKC 2V1QA 3I55Q 5J39A 4CC7A 1K73C 2A08A 1I8FA 3OS5A 5FU6B 2GCXA 1N8RU 1XJWB 1YIJT 2GFAA 1IGQA 2CREA 2EYYA 4ZNXA 4LUEA 2VXFA 3Q1JA 1VQ7T 1RL2A 1SG5A 2RQUA 1WFWA 4DBFA 1AZGB 4DEXA 4JRPA 1KQ2A 4IIMA 8ATCB 2EWNA 3V7SA 3DLMA 3CCMQ 1KHIA 4JS5A 4FL6A 3VV0A 4LDYA 1A0NB 4BUGA 3UDCA 1KD1C 3CD6Q 4NL3A 4BE0A 2M0YA 5CKHA 2YRDA 5LJ5d 1VQLA 2IIMA 3VKIA 4C0DC 3KXTA 1GL5A 3O8VA 4ELZC 1YJNQ 2MAMA 4LDVA 3VYHB 3CCEQ 5GANf 4NS5A 2X4XA 1X01A 1BIBA 4XTZA 2DL3A 3M0PA 4PFPA 1PRMC 4M77A 2C0OA 3C12A 3SWNA 3UWNA 5AT1B 4R0KA 1U8RA 4E7IA 3NPFA 5FWCA 3MEWA 1WIEA 3VS5A 2GNCA 1JJ2P 2MWPA 4D8DA 4C92E 1YJWA 4KBMB 1QMCA 2HNIA 1TXQA 4JRKA 2YLBA 4RUGA 4C92B 5AYFA 3A8HB 1YHQT 2MMPA 4F16A 1X6BA 4M7AC 1MMDA 2ABLA 2L3RA 1QVFP 3CCJQ 4PJOA 2MI6A 2XD0A 4XTVA 4J8OA 3ZFJA 4RCBA 4RG8A 5J26A 3S3MA 2RI5A 3FJ5A 4XU2A 3ZEHA 2L3QA 2BE9B 2E10A 1Y71A 4ATOA 3QJ6A 2DKGA 3EGXB 1VQ8Q 4OB2B 4DQ2A 2MIOA 4A4HA 1VQOQ 1X27A 2OAUA 4F17A 4M7AF 1SRMA 3URGA 2QEXQ 4PJOE 1I1JA 2K2VA 3V7RA 1YBYA 4OB1B 1GFDA 1BYMA 1H3ZA 2DFUA 2EVRA 4X9DA 3CBMA 3D7SB 2XICA 3INZA 4N4HA 2YRVA 1VYTA 5C6SA 3PIPA 5L23A 3JCMd 2ENMA 2NUTB 1M4ZA 3JCMc 2DD5A 1UE9A 2EQMA 1UGPB 3LH0A 2EJ9A 3CCRT 5HK3A 1YJ9T 4BE2A 1PHTA 4GLMA 3M55A 1ZUKA 1K9MC 3G7ZA 3A8LB 4ZN1A 1R77A 4HVVA 4FW2A 5LJ3f 2RJFA 2V8JA 1C6VX 1EFNA 2ROTA 2HBPA 5A0DA 1ZBJA 3G71T 1SSHA 2BKDN 4QW2A 1RAHB 4E47A 1AHJB 2EQKA 1N27A 1JJ2S 4WCIA 1X6OA 1XTDA 3M53A 1AOJA 1UJYA 2FVUA 3LGFA 2E4HA 5GAN3 2K2MA 3DB4A 2JTEA 3CCQQ 2HL3A 2CUDA 4AMCA 3G1JA 3EH1A 1AT1B 1NYGA 1XQHA 1RLQC 2EIFA 1NPPA 2VASA 4C0GA 1QVFS 3EFRA 5CKBA 3UATA 3FLGA 1R0BG 3HKSA 1N6AA 2IG0A 3LH5A 3PTAA 2E3HA 4GBQA 2DIQA 1SSFA 2KE9A 2HQXA 1YJNA 4Z8AA 2KROA 3EH2A 1JB0E 3DLLA 2OX7A 4FIBA 4C92D 3J80E 2FPFA 4N0AC 5I22A 3AT1B 5CQYA 4A4GA 1VQPT 1G3TA 3WVEB 4F7UB 4HVUA 5FW9A 2DEQA 5CK9A 3CC2Q 5I2SA 3OYCA 1WPYA 4EMKA 1ZA2B 5GAMf 1PG5B 2LQ8A 4XTWA 1ZX6A 2HD0A 4OMPA 5DLQE 2RQVA 2A7YA 2CSQA 1FMVA 1K8AR 1U06A 1M3BA 1D09B 4M4ZA 3NTKA 2JM8A 4DBQA 2JW4A 1OYXA 3M0UA 1IB8A 1RACB 2GQVA 3SEMA 2M9UA 2L0AA 3JB9F 3QDFA 4PFOA 1I0CA 2OTJT 1KG1A 1UG1A 1Y07A 2I2LA 4OMFB 2DERA 4E7HA 3X28B 4IUTA 2LJ3A 1I07A 1YP5A 3EGDA 5KYUA 1MGQA 1KC8R 4PJOD 3CMAQ 3QIIA 2J06A 2LNVA 2J6OA 1T0JA 4C5EA 1QCNA 1HSQA 1YITT 1BI1A 2YUOA 2RHZA 3QKJA 4CC3A 2KRSA 3KFVA 2L8DA 2QDLA 3CPFA 3F70A 1VQ8T 2DMOA 2MF2A 1QCOA 2K3XA 1N5ZA 1XOVA 1VQOT 4AFSC 5D6XA 2CP7A 1U1TA 1KC8U 1S72Q 3SDZA 4ME7A 1OOTA 2I0NA 4MZMA 2QEXT 3CBOA 4QQ6A 1OZ2A 2K9GA 1ZSGA 2VC8A 2YUPA 1ZBXA 4BDYA 1VQ5Q 6AT1B 2R5MA 1QQJA 4J9DA 2K5FA 3M54A 5GMKi 3HP9A 2GBQA 3G6EQ 3CMEA 4C0DB 1QKWA 2YWWA 2VWFA 3QPHA 2O2OA 4HCKA 3M0RA 2E70A 3CCLA 1FMWA 1BIAA 3P8HA 3QO3A 2LQWA 2X51A 3C94A 2QDYB 2FB7A 2KBTA 4OMOA 2BE7D 3E9FA 5CO7A 1N8RC 3JCMJ 4M77C 2DLPA 3SWNC 1N9RA 4TVRA 3I5SA 4KGZB 2EPDA 1OU9A 3RDVA 1VQ7Q 1OQKA 2JM9A 1M5Q1 3L2WA 2QA4A 1M90U 4BY6C 2QQSA 2D9TA 4M7AE 4OP0A 3C95A 4J6XA 3O5ZA 2E5KA 2EW3A 3G4ST 2DTOA 4EMHA 2KY9A 1OPKA 2DL7A 4J9EA 1Y96B 5EG2A 4M7AB 3I35A 5GJWB 3JV3A 2XDPA 4JDSA 4ZTFA 3M5AA 4E7LA 4PJOC 1FYNA 1QP3A 5LJ5h 2MPXC 4O5VA 3JCMg 1YI2T 4JJNK 1YFNA 2A37A 3I56Q 2RD1A 5KYWB 4ANJA 3EFSA 2M51A 2GTJA 3LX7A 3QJYA 1K1ZA 1VQ4A 1WHHA 4PJOF 2RA2A 4II1A 4KGXB 3FIFA 2DVEA 4C8QG 2ESWA 2FYKA 4XAXB 4E7KA 1PC0A 2DO3A 3CC2T 1NPRA 1NYFA 1M30A 1ACMB 4KUIA 3M58A 4E7JA 4DA4A 2FG0A 2LJ0A 2DA9A 1YHQQ 2L2PA 2L3PA 5GAN2 2DRMA 2EKHA 3VYGA 5GANg 2CT3A 3CXCS 3NTHA 2A28A 2LZ6B 1KHCA 3PMTA 2CH4A 2JMCA 4HXJA 4JJBA 2H3JA 2RH2A 4WF2A 2M0OA 5FROA 1WX6A 3BW1A 5LJ5e 4FYWB 3MO8A 2JNGA 2CP6A 4J9CA 1E6GA 1ZHIA 4RTYA 2DX1A 2DF6A 1ABQA 2VXEA 3RUXA 2E1HA 2AK5A 3A8MB 4O6JA 3REAB 3PVLA 2E6ZA 1PCXA 2AHJB 2ED0A 4FYVB 4PJJA 4FM4B 2KMTA 3OBYA 2P0PA 3QBYA 1SKUB 4K11A 3ER0A 4A4EA 1QKXA 3CCSA 2K6DA 3JCMh 3CCRQ 1YJ9Q 3CQTA 1R0CB 2EQUA 3WVDB 8AT1B 1S72T 2V26A 3CCVA 4B9XA 1VIEA 2CYZB 2NYSA 4F7UG 1WHGA 3G6EA 3CXCA 3EG9A 4Q5WA 2CZ0B 1VQ6A 3OYJA 2HQHA 1VQKA 2HL5C 4RTWA 2X35A 3CBPA 2DPPB 1BBZA 2WSCE 2COYA 3JB9H 1JXOA 2X3WD 3REBB 3L42A 3OYKA 4ESRA 4BACA 2FZKB 3TREA 3OYNA 1YIJA 4BDZA 1VQ9Q 1YN8A 1U1SA 5KYNA 2Y90A 1OV3A 2A36A 3HHTB 4JZ4A 1D1BA 4UC4A 3UT1A 1AVZC 3MJXA 1OZ3A 3CC4T 2DEUA 1EX4A 1LPLA 4J7IA 2KRNA 3OYAA 4YTLA 5CKEA 5HY6A 3QSUA 1KQSA 3AHUA 2EGCA 4XU0A 2JTMA 4FT2A 2OJ2A 3PMIA 4RG2A 3OYBA 1LJOA 3CC7A 4JPBW 1RAGB 3JCMe 1M1KR 4RTTA 2QTVA 2E6NA 1PNJA 2P0KA 4A54A 1Y57A 1LCKA 3GPLA 1VQPQ 2KYMA 2K5IA 1Q86U 1JBMA 3T9NA 2EBPA 2RN8A 4CC4B 5GANj 3QUIA 1RAFB 1DJ7B 2MCNA 3I56T 2RPNA 1G5VA 2KVQG 2M02A 3CCUA 2K7AA 4PJMA 2JXBA 1M9SA 4MZPA 2AKLA 3RNJA 1M1KU 4LNPA 1IO6A 3VUZA 2DYIA 4KULA 3PGGA 5GAOm 4RCCA 3NHNA 2OTJQ 2F2WA 4AG2C 2C06A 2QYZA 4RMOA 1JQQA 3M0SA 4M78A 3QZ9B 2KYBA 4M75G 1YWOA 4Y92A 2RQTA 1K8AC 3L2VA 4M77E 3OMGA 1D0XA 3MPUB 1WHLA 3JSCA 1WLPB 5GAMg 4PL6A 1KSWA 2COZA 3M59A 2YT6A 1VQNA 4M7DA 1H92A 3UA6A 1YITQ 3M56A 2CP2A 5IHNA 2O4XA 2RM4A 2A3LA 4M77B 2DXUA 3GLXA 3GOXA 3SWNB 4HCBA 1VQMA 1M27C 3GF5A 1UECA 2K4YA 4M78E 2KRMA 1G83A 4M7AG 2DL5A 1KC8C 1WDXA 5ECAA 4BY6B 3VS4A 2OTLA 3OYFA 1PM3A 3TQ7P 2DJZA 4JJCA 5EC7A 3JB9D 2FHDA 4OGEA 2EAYA 5FWBA 2CP3A 4M7DE 3P8DA 2Y4XA 3PIOA 1IGUA 2LMJA 4C8QA 2RQWA 1FX7A 2SRCA 5M9OA 3CCRA 3RKWA 4A4KA 3UPUA 4PJOB 2QQAA 1KFZA 2PNIA 2NUPB 3LYIA 2DZ9A 1TOVA 5GAN5 4XTUA 4P5NA 1K4US 1QVPA 3R6OA 3HSBA 4Y28E 3G71A 5A2QE 1WXUA 5FU7C 1GXIE 1LNXA 2QQ9A 1C0MA 1M8MA 3H0IA 3I55A 1TH7A 2PVOB 1WJQA 2GTOA 5CR2A 1Q95G 1BI0A 2X4JA 3A98A 4HVWA 4XU3A 1UGVA 1RADB 1MMNA 1VQ9T 4N4GA 3G4SQ 3A1PA 3TVTA 2XG8D 3DKMA 2DM1A 5GANd 2DNUA 4JJDA 4ZGEB 1JXMA 3PVQA 1HK9A 3QDRB 4EMGA 2YRCA 3VS7A 2MOXA 4R56A 1R8OB 4PNOA 3CCMA 4CI0C 4QVZA 3JCMP 5GAN6 4E7ZA 1YI2Q 4J9BA 1Q82R 2LCLA 3M57A 3CD6A 2P84A 1K9AA 1AZEA 2JVVA 4IURA 4EIKA 4JLIA 3CCEA 2WSFE 1WJSA 4A4FA 1K0SA 2BTTA 2KAFA 2XKOC 2PQWA 4NOYA 2K3BA 2E64A 3HRUA 5GAMj 1ZQ1A 1SRLA 1B34A 4RTZA 1Q82U 3ZL7C 5D6WA 1T3LA 3LGLA 4M77D 1UGSB 1ZUUA 2YUQA 2DJQA 2J6FA 3U23A 4X9CA 2YSQA 4OMMA 1PD1A 2HKQB 1UHFA 3L2QA 5IAYA 1I5LA 1OPLA 2VUBA 3GBQA 3LWHA 5KYYA 4QQDA 2JMAA 1TTHB 1UHCA 3OS0A 5IT9E 1W6XA 1B3QA 4M78D 4VUBA 2RJEA 3X24B 3JAME 1Q81R 1QLYA 3CCJA 3HTRA 3SD4A 2D1XA 1BU1A 4BE1A 2EKOA 2D8JA 2R57A 1I81A 2HKNA 4M7DD 2WSEE 4EMKB 2EJGA 2KDSA 2RI3A 1QCFA 5HKCA 1VQ8A 4J83A 3H9NA 2AZVA 1VQOA 5GMKl 1WXBA 2QGFB 2D6FA 1WHMA 2CS7A 5I21A 2ZPBB 1WHJA 2QEXA 1Q81U 1AWWA 1CKBA 3FB9A 5CVIA 2FL7A 4DBHA 2P0QA 1X69A 2IPOB 3NTIA 3VJPA 5GMKh 1GCPA 2HEQA 3OS2A 2A0FB 1HXDA 3EGDB 2EGAA 3EG3A 3QHSA 1ZA1B 3A8GB 1QWFA 1QVGS 3OW2S 1IHWA 1NM7A 2QTXA 2HDAA 4M75A 3X25B 2PUKB 1M90R 2QQRA 4J6YA 3CXCP 3OQ5A 2L89A 2NUZA 4MDWA 3JCMV 3OYGA 3I9QA 1JEGA 1GFCA 2DTHA 2ZGWA 3RIRA 2AZSA 1YCYA 1H3HA 2JT4A 3EFOB 3CC4Q 1AD5A 3NMZC 5GMKj 4LUDA 2F69A 4C92G 2QI2A 2RQRA 3M0TA 2RHUA 2X4WA 1AEYA 3VS1A 2P4RA 3FJPA 3CMET 4KRTA 3CCQA 1X6GA 4KGVB 4L6V5 2RHYA 1K9MU 5IHKA 4CRIA 5GAOq 2HAXA 2HBWA 1UUEA 3CCLT 1VIFA 4M78C 2RJCA 2E3IA 4JLGA 2ZPEB 5GAMd 1SEMA 3OYDA 3OBWA 2DETA 2GF7A 4M77F 5GMKe 4FT4A 9ATCB 3FC3A 2QASA 3OW2A 4XQ3A 1KJWA 4PKCC 2VVKA 1QVGA 1KQSP 1XNIA 4IIOA 4ELYC 2F5KA 4M7DC 3OYIA 1Q86C 2R5AA 5GAN4 4D6WA 1NE8A 1X2KA 2QA4T 4PLLA 3EAEA 4M78F 4KT0E 4RTVA 1E6HA 1K76A 1M1KC 5D6YA 4PJOG 3LW5E 1WXTA 1JRIA 1D3BA 3THKA 3CC2A 5GAN7 2LQNA 4M7DF 2C0IA 4OMQA 3MP6A 4ZTJA 4C8QC 4PJLA 4Z02A 4OGCA 2DXCA 3MP1A 1P92A 1X2QA 1M2VA 2LRQA 3MCAB 2LTOA 4C0FA 1M8VA 2MYSA 4KH1B 2XU8A 4FU6A 4FYXB 1PKSA 3VU3C 1GRIA 4J9IA 2CP0A 1VQ4T 2J7IA 2KT1A 1EIFA 5FU7B 2XHCA 2DXBA 1QWEA 1BCOA 1RI0A 2RMOA 2FZCB 1S1NA 2BUDA 5LJ5f 3CMAA 4IUQA 1X43A 1OX8A 1U3OA 3X26B 1B7TA 3GNGA 2ZPFB 3ZBDA 1M1GA 2LC4A 2LCCA 2VGNA 2DBKA 2CKKA 2ED1A 3ULRB 2XI9A 2O31A 4EDUA 2O88A 3PE0A 3JB9J 4XK8E 1MHNA 1CSKA 2Y4YA 1S72A 5KYXA 4IUPA 4PJNA 3H8ZA 3HPWA 1KQSS 1ZSZA 2JJ9A 4XTYA 1BKBA 5GAOp 1VQ5A 3H6ZA 4AFQC 3EHRA 4LD9K 2DYBA 2XIDA 4FSXA 2KXCA 4D8KA 2P4TA 1JU5C 5GJVB 3VS0A 2Z0WA 2ZCFB 1EZZB 4FSSA 4Z88A 3EG1A 4L5GA 3LWIA 1T0HA 3L2ZA 3BDLA 3L2UA 3RERA 3C0CA 2E12A 3GP8A 2X3XD 1PD0A 1LVKA 1GCQA 2VKNA 2MWOA 5A0LA 4JRQA 3OSVA 1QW1A 3FDRA 2CDTA 2G6FX 4C0ZA 2F5TX 2RI2A 4LE9A 3CCVT 2PZ1A 2ZAEA 3HFOA 1MUZA 1VQ7A 1ZUYA 4A53A 4C5IA 5LL6S 2LJ1A 4DBRA 4QVDA 1M2OA 3OB9A 3QZ5B 2J6KA 1OULA 5GANh 2KNBB 1VQKT 5CCAA 1UTIA 4QKUA 2CP5A 2HMAA 1Q7YR 3V8LA 3EG9B 1Q86R 3V7CA 5LJ3g 1WJRA 1KIKA 4R55A 2MK5A 4RKUE 3QWXX 1W2BS 2FRWA 2ZPIB 2ZPHB 3HRTA 2PVGB 3JCMf 3JRZA 1NJIU 5KE3A 3VRZA 3KBGA 1VA7A 4HKEA 4B9WA 1UJ0A
chains in the Genus database with same CATH topology
2YUOA 4JZ3A 4CC2A 4CC3A 2KRSA 3KFVA 3R6NA 2JS0A 4RTXA 1M8MA 2QDLA 3H0IA 5IXBA 2HSPA 2SEMA 4ORZA 2DMOA 2OAWA 2GTOA 2KGTA 1N5ZA 1XOVA 3A98A 1T3SA 1UGVA 4HVWA 4AFSC 1SHFA 1OOTA 2DRKA 2I0NA 2EYZA 3TVTA 2DM1A 2DNUA 2K9GA 1ZSGA 4JJDA 2F2XA 2YDLA 2YUPA 1JXMA 3PVQA 1M3AA 2DILA 4AG1C 4F14A 4J9DA 3VS7A 4AFUC 2MOXA 1NLPC 2GBQA 3RBBB 1QKWA 2VWFA 3EG0A 2GQIA 2O2OA 1Z9ZA 2FPEA 4J9BA 4HCKA 5IXFA 1PRLC 3M0RA 3VS6A 3QWYA 2LQWA 1GBQA 1TUDA 2D0NA 2KBTA 1K9AA 4OMOA 1AZEA 3EG2A 1SHGA 1Y0MA 4EIKA 2CSIA 2EGEA 1NLOC 2DLPA 2FRYA 3H0FA 3I5SA 2V1RA 1WA7A 2NWMA 5I11A 2EPDA 1MV0B 1K0SA 2KT8A 2JM9A 2BTTA 1VYVA 2K3BA 1SRLA 2HCKA 3H41A 4RTZA 4LN2A 3ZL7C 1T3LA 3O5ZA 2E5KA 2EW3A 2D8HA 4J9HA 1ZUUA 2YUQA 2DJQA 1OPKA 2DL7A 2J6FA 3U23A 2YSQA 4J9EA 2ECZA 4OMMA 4AFZC 2CH4W 2EYXA 3I35A 1UHFA 2KXDA 5GJWB 1RI9A 1E7OA 1ARKA 2W10A 3JV3A 1OPLA 1FYNA 3GBQA 1BB9A 2JMAA 1UHCA 1W6XA 1B3QA 2C0TA 2PTKA 2K79A 2A37A 1QLYA 2DL8A 2J05A 4A63B 2D1XA 1BU1A 2V1QA 1HJDA 2D8JA 2M51A 4CC7A 2A08A 2GTJA 1K1ZA 2CREA 2EYYA 1HD3A 4LUEA 2KEAA 4ZNXA 4DEYA 1BK2A 1QCFA 4QT7A 2O9VA 2RQUA 1WFWA 1AZGB 2ESWA 2AZVA 2O9SA 3I5RA 4DEXA 4IIMA 1WXBA 1NYFA 1M30A 1K0XA 1AWWA 2EQIA 1CKBA 2FG0A 1PKTA 1AWXA 1A0NB 2LJ0A 2DA9A 1M3CA 2L2PA 1X69A 2L3PA 2DRMA 2KR3A 2EKHA 1YCSB 2CT3A 1GCPA 2HEQA 2M0YA 2A28A 2IIMA 3TSWA 2LZ6B 2EGAA 3EG3A 1GL5A 2CH4A 2JMCA 4HXJA 1QWFA 2FEIA 4JJBA 1NM7A 1OEBA 1SPKA 1WX6A 2H8HA 2HDAA 4OMLA 4J9CA 3VS3A 4OMNA 2DL3A 3M0PA 1E6GA 3EGUA 1UDLA 2FPDA 2DX1A 1PRMC 4RTYA 2C0OA 2DF6A 1ABQA 2NUZA 1ZLMA 2YUNA 4R0KA 2AK5A 1MV3A 3REAB 3NPFA 3PVLA 5FWCA 1WIEA 1JEGA 3I9QA 2ED0A 1GFCA 3VS5A 2GNCA 2AZSA 1H3HA 1FMKA 2JT4A 4D8DA 1AD5A 3NMZC 4LUDA 2BZXA 2DBMA 2RQRA 3M0TA 5HCKA 1AEYA 4K11A 3VS1A 2P4RA 2CT4A 1QKXA 2W0ZA 4KRTA 4RUGA 2K6DA 1X6GA 1V1CA 5IHKA 3CQTA 2DVJA 2HBWA 4F16A 1UUEA 1X6BA 2ABLA 2B86A 4J9GA 3NGPA 1SEMA 2DL4A 3FJ5A 2L3QA 2LP5A 4RTWA 3H0HA 1BBZA 1H8KA 4X1VA 3UF4A 1KJWA 2VVKA 4IIOA 1JXOA 2X3WD 3REBB 2MIOA 4ESRA 1ABOA 1X27A 1X2KA 4F17A 1TG0A 1SRMA 1YN8A 4RTVA 1E6HA 1K76A 1I1JA 1GCQC 1GFDA 1OV3A 2A36A 2EVRA 3M0QA 4JZ4A 2FO0A 1WXTA 5IHIA 1NEGA 1AVZC 3THKA 1VYTA 1U5SA 2LQNA 5L23A 2C0IA 4OMQA 1RUWA 1YNZA 4J9FA 2ENMA 2KRNA 1B07A 1UE9A 2EGCA 1PHTA 1X2QA 2OJ2A 4GLMA 2F2VA 1ZUKA 1T0JA 1GBRA 1WYXA 1NEBA 4JPBW 2DE0X 4HVVA 4RTTA 1EFNA 2ROTA 1PKSA 1JO8A 1AWJA 1GRIA 1PNJA 4J9IA 1YWPA 2J7IA 2KT1A 1ZBJA 1Y57A 1LCKA 1SSHA 2KYMA 1QWEA 2EBPA 2RN8A 4CC4B 2RMOA 1S1NA 3VRYA 4WCIA 1AOJA 1X43A 3VS2A 1UJYA 1U3OA 2MCNA 2RPNA 2LCSA 2XMFA 2K7AA 2GGRA 2JXBA 2K2MA 2JTEA 2AKLA 3RNJA 4LNPA 1W70A 2CUDA 1IO6A 2DBKA 3TSZA 2ED1A 3ULRB 1NYGA 2O31A 1RLQC 4Z89A 3NHNA 2O88A 3PE0A 2F2WA 4AG2C 3UATA 1CSKA 2BZ8A 5IH2A 3LH5A 1JQQA 3M0SA 2KYBA 1YWOA 4GBQA 1CKAA 4Y92A 3UA7A 2RQTA 2LX7A 2KE9A 4AFQC 3EHRA 2DYBA 4E6RA 4Z8AA 1WI7A 2KROA 4RTUA 1WLPB 2KXCA 4D8KA 1KSWA 2LNHB 2YT6A 1H92A 3UA6A 1PWTA 2FPFA 5IHNA 5I22A 2ROLA 1JU5C 5GJVB 1G2BA 3VS0A 3IQLA 4FSSA 4HVUA 5FW9A 4Z88A 3EG1A 1M27C 2EYWA 1UECA 1T0HA 2KRMA 2RNAA 1G83A 3C0CA 3SHWA 2X3XD 1ZX6A 1GCQA 2VKNA 2DL5A 4OMPA 1W1FA 2RQVA 1WDXA 5ECAA 2CSQA 3VS4A 1U06A 1UFFA 1VYUA 2G6FX 2CDTA 4JJCA 1M3BA 2BZYA 5EC7A 4M4ZA 2JM8A 1AWOA 4LE9A 2JW4A 2PZ1A 5FWBA 1MUZA 1RLPC 3M0UA 3SEMA 2RF0A 1ZUYA 2L0AA 1TUCA 2LJ1A 2LMJA 2RQWA 2CUBA 1I0CA 2SRCA 2J6KA 1UG1A 2AKKA 2KNBB 2JS2A 1UTIA 1J3TA 2LJ3A 1KFZA 1I07A 2OI3A 2PNIA 1YP5A 1KIKA 1Z9QA 3QWXX 2FRWA 1K4US 1NG2A 2L3SA 3EHQA 2J06A 3VRZA 1VA7A 1WXUA 2J6OA 1UJ0A 1HSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUO A;  4JZ3 A;  4CC2 A;  4CC3 A;  2KRS A;  3KFV A;  3R6N A;  2JS0 A;  4RTX A;  1M8M A;  2QDL A;  3H0I A;  5IXB A;  2HSP A;  2SEM A;  4ORZ A;  2DMO A;  2OAW A;  2GTO A;  2KGT A;  1N5Z A;  1XOV A;  3A98 A;  1T3S A;  1UGV A;  4HVW A;  4AFS C;  1SHF A;  1OOT A;  2DRK A;  2I0N A;  2EYZ A;  3TVT A;  2DM1 A;  2DNU A;  2K9G A;  1ZSG A;  4JJD A;  2F2X A;  2YDL A;  2YUP A;  1JXM A;  3PVQ A;  1M3A A;  2DIL A;  4AG1 C;  4F14 A;  4J9D A;  3VS7 A;  4AFU C;  2MOX A;  1NLP C;  2GBQ A;  3RBB B;  1QKW A;  2VWF A;  3EG0 A;  2GQI A;  2O2O A;  1Z9Z A;  2FPE A;  4J9B A;  4HCK A;  5IXF A;  1PRL C;  3M0R A;  3VS6 A;  3QWY A;  2LQW A;  1GBQ A;  1TUD A;  2D0N A;  2KBT A;  1K9A A;  4OMO A;  1AZE A;  3EG2 A;  1SHG A;  1Y0M A;  4EIK A;  2CSI A;  2EGE A;  1NLO C;  2DLP A;  2FRY A;  3H0F A;  3I5S A;  2V1R A;  1WA7 A;  2NWM A;  5I11 A;  2EPD A;  1MV0 B;  1K0S A;  2KT8 A;  2JM9 A;  2BTT A;  1VYV A;  2K3B A;  1SRL A;  2HCK A;  3H41 A;  4RTZ A;  4LN2 A;  3ZL7 C;  1T3L A;  3O5Z A;  2E5K A;  2EW3 A;  2D8H A;  4J9H A;  1ZUU A;  2YUQ A;  2DJQ A;  1OPK A;  2DL7 A;  2J6F A;  3U23 A;  2YSQ A;  4J9E A;  2ECZ A;  4OMM A;  4AFZ C;  2CH4 W;  2EYX A;  3I35 A;  1UHF A;  2KXD A;  5GJW B;  1RI9 A;  1E7O A;  1ARK A;  2W10 A;  3JV3 A;  1OPL A;  1FYN A;  3GBQ A;  1BB9 A;  2JMA A;  1UHC A;  1W6X A;  1B3Q A;  2C0T A;  2PTK A;  2K79 A;  2A37 A;  1QLY A;  2DL8 A;  2J05 A;  4A63 B;  2D1X A;  1BU1 A;  2V1Q A;  1HJD A;  2D8J A;  2M51 A;  4CC7 A;  2A08 A;  2GTJ A;  1K1Z A;  2CRE A;  2EYY A;  1HD3 A;  4LUE A;  2KEA A;  4ZNX A;  4DEY A;  1BK2 A;  1QCF A;  4QT7 A;  2O9V A;  2RQU A;  1WFW A;  1AZG B;  2ESW A;  2AZV A;  2O9S A;  3I5R A;  4DEX A;  4IIM A;  1WXB A;  1NYF A;  1M30 A;  1K0X A;  1AWW A;  2EQI A;  1CKB A;  2FG0 A;  1PKT A;  1AWX A;  1A0N B;  2LJ0 A;  2DA9 A;  1M3C A;  2L2P A;  1X69 A;  2L3P A;  2DRM A;  2KR3 A;  2EKH A;  1YCS B;  2CT3 A;  1GCP A;  2HEQ A;  2M0Y A;  2A28 A;  2IIM A;  3TSW A;  2LZ6 B;  2EGA A;  3EG3 A;  1GL5 A;  2CH4 A;  2JMC A;  4HXJ A;  1QWF A;  2FEI A;  4JJB A;  1NM7 A;  1OEB A;  1SPK A;  1WX6 A;  2H8H A;  2HDA A;  4OML A;  4J9C A;  3VS3 A;  4OMN A;  2DL3 A;  3M0P A;  1E6G A;  3EGU A;  1UDL A;  2FPD A;  2DX1 A;  1PRM C;  4RTY A;  2C0O A;  2DF6 A;  1ABQ A;  2NUZ A;  1ZLM A;  2YUN A;  4R0K A;  2AK5 A;  1MV3 A;  3REA B;  3NPF A;  3PVL A;  5FWC A;  1WIE A;  1JEG A;  3I9Q A;  2ED0 A;  1GFC A;  3VS5 A;  2GNC A;  2AZS A;  1H3H A;  1FMK A;  2JT4 A;  4D8D A;  1AD5 A;  3NMZ C;  4LUD A;  2BZX A;  2DBM A;  2RQR A;  3M0T A;  5HCK A;  1AEY A;  4K11 A;  3VS1 A;  2P4R A;  2CT4 A;  1QKX A;  2W0Z A;  4KRT A;  4RUG A;  2K6D A;  1X6G A;  1V1C A;  5IHK A;  3CQT A;  2DVJ A;  2HBW A;  4F16 A;  1UUE A;  1X6B A;  2ABL A;  2B86 A;  4J9G A;  3NGP A;  1SEM A;  2DL4 A;  3FJ5 A;  2L3Q A;  2LP5 A;  4RTW A;  3H0H A;  1BBZ A;  1H8K A;  4X1V A;  3UF4 A;  1KJW A;  2VVK A;  4IIO A;  1JXO A;  2X3W D;  3REB B;  2MIO A;  4ESR A;  1ABO A;  1X27 A;  1X2K A;  4F17 A;  1TG0 A;  1SRM A;  1YN8 A;  4RTV A;  1E6H A;  1K76 A;  1I1J A;  1GCQ C;  1GFD A;  1OV3 A;  2A36 A;  2EVR A;  3M0Q A;  4JZ4 A;  2FO0 A;  1WXT A;  5IHI A;  1NEG A;  1AVZ C;  3THK A;  1VYT A;  1U5S A;  2LQN A;  5L23 A;  2C0I A;  4OMQ A;  1RUW A;  1YNZ A;  4J9F A;  2ENM A;  2KRN A;  1B07 A;  1UE9 A;  2EGC A;  1PHT A;  1X2Q A;  2OJ2 A;  4GLM A;  2F2V A;  1ZUK A;  1T0J A;  1GBR A;  1WYX A;  1NEB A;  4JPB W;  2DE0 X;  4HVV A;  4RTT A;  1EFN A;  2ROT A;  1PKS A;  1JO8 A;  1AWJ A;  1GRI A;  1PNJ A;  4J9I A;  1YWP A;  2J7I A;  2KT1 A;  1ZBJ A;  1Y57 A;  1LCK A;  1SSH A;  2KYM A;  1QWE A;  2EBP A;  2RN8 A;  4CC4 B;  2RMO A;  1S1N A;  3VRY A;  4WCI A;  1AOJ A;  1X43 A;  3VS2 A;  1UJY A;  1U3O A;  2MCN A;  2RPN A;  2LCS A;  2XMF A;  2K7A A;  2GGR A;  2JXB A;  2K2M A;  2JTE A;  2AKL A;  3RNJ A;  4LNP A;  1W70 A;  2CUD A;  1IO6 A;  2DBK A;  3TSZ A;  2ED1 A;  3ULR B;  1NYG A;  2O31 A;  1RLQ C;  4Z89 A;  3NHN A;  2O88 A;  3PE0 A;  2F2W A;  4AG2 C;  3UAT A;  1CSK A;  2BZ8 A;  5IH2 A;  3LH5 A;  1JQQ A;  3M0S A;  2KYB A;  1YWO A;  4GBQ A;  1CKA A;  4Y92 A;  3UA7 A;  2RQT A;  2LX7 A;  2KE9 A;  4AFQ C;  3EHR A;  2DYB A;  4E6R A;  4Z8A A;  1WI7 A;  2KRO A;  4RTU A;  1WLP B;  2KXC A;  4D8K A;  1KSW A;  2LNH B;  2YT6 A;  1H92 A;  3UA6 A;  1PWT A;  2FPF A;  5IHN A;  5I22 A;  2ROL A;  1JU5 C;  5GJV B;  1G2B A;  3VS0 A;  3IQL A;  4FSS A;  4HVU A;  5FW9 A;  4Z88 A;  3EG1 A;  1M27 C;  2EYW A;  1UEC A;  1T0H A;  2KRM A;  2RNA A;  1G83 A;  3C0C A;  3SHW A;  2X3X D;  1ZX6 A;  1GCQ A;  2VKN A;  2DL5 A;  4OMP A;  1W1F A;  2RQV A;  1WDX A;  5ECA A;  2CSQ A;  3VS4 A;  1U06 A;  1UFF A;  1VYU A;  2G6F X;  2CDT A;  4JJC A;  1M3B A;  2BZY A;  5EC7 A;  4M4Z A;  2JM8 A;  1AWO A;  4LE9 A;  2JW4 A;  2PZ1 A;  5FWB A;  1MUZ A;  1RLP C;  3M0U A;  3SEM A;  2RF0 A;  1ZUY A;  2L0A A;  1TUC A;  2LJ1 A;  2LMJ A;  2RQW A;  2CUB A;  1I0C A;  2SRC A;  2J6K A;  1UG1 A;  2AKK A;  2KNB B;  2JS2 A;  1UTI A;  1J3T A;  2LJ3 A;  1KFZ A;  1I07 A;  2OI3 A;  2PNI A;  1YP5 A;  1KIK A;  1Z9Q A;  3QWX X;  2FRW A;  1K4U S;  1NG2 A;  2L3S A;  3EHQ A;  2J06 A;  3VRZ A;  1VA7 A;  1WXU A;  2J6O A;  1UJ0 A;  1HSQ A; 
#chains in the Genus database with same CATH topology
 2X9H A;  1IHV A;  4JZ3 A;  3E1S A;  2QQB A;  1FWZ A;  3R6N A;  2JS0 A;  5FRM A;  3I56 A;  3JCM W;  5GAO l;  3CPW S;  1Q7Y U;  3OY9 A;  1WGS A;  2OAW A;  1Q82 C;  4MDX A;  1D1C A;  4MMK A;  2EYZ A;  1PSE A;  2RK2 A;  4OB3 B;  3KUF A;  3CC7 T;  1O75 A;  2F2X A;  4GLK A;  1M3A A;  4AG1 C;  4C92 A;  4AFU C;  3OMC A;  2PVD B;  3RBB B;  1VQL T;  4E7S A;  3MEV A;  5GAN e;  3JCM b;  1YHQ A;  5IXF A;  1PRL C;  3VUB A;  4QQG A;  3QWY A;  5J3B A;  1NZ9 A;  1GBQ A;  3PT9 A;  5CKD A;  1W2B A;  1TUD A;  3CEY A;  4DOW A;  4M75 C;  2D0N A;  1SF9 A;  1FXX A;  1BI3 A;  1SHG A;  1UB4 A;  1Y0M A;  5GAN 8;  2QGG A;  3CCU T;  3EGX A;  2EGE A;  2DK3 A;  1H64 1;  1NLO C;  2FRY A;  1TU0 B;  3TCJ A;  3H0F A;  2V1R A;  1WA7 A;  2NWM A;  2RK1 A;  1MV0 B;  2JN0 A;  2KT8 A;  2EYQ A;  4NL2 A;  1TSF A;  4MML A;  1VYV A;  2HQE A;  3CPW A;  2ZZD A;  2LT4 A;  1Q81 C;  2HCK A;  3H41 A;  1YJW T;  3S6W A;  4M75 F;  5LJ3 h;  5IN1 A;  2RO0 A;  3OYH A;  3MHX A;  2D8H A;  4J9H A;  2NUT A;  1W4S A;  2CH4 W;  2M16 A;  3A8O B;  3QYH B;  2NUP A;  4M78 B;  1RI9 A;  1E7O A;  2W10 A;  3V8J A;  1RAI B;  1VOM A;  2E65 A;  3BY7 A;  1VQN T;  4QVC A;  2RHI A;  1YJ9 A;  3C4S A;  2C0T A;  4M7D B;  1VQM T;  2CZ6 B;  2DL8 A;  2J05 A;  2DIG A;  4J6W A;  2O4X B;  3BDU A;  2JOY A;  4A63 B;  1HJD A;  2B8A A;  5FRN A;  2LQK A;  3L1A A;  2OTL T;  2QG9 B;  2QK0 A;  2RJD A;  4ZN3 A;  1G8X A;  2XDB A;  5LJ3 j;  1HD3 A;  4OVA A;  2KEA A;  4DEY A;  1BK2 A;  4QT7 A;  4C8Q E;  4C5H A;  4FCY A;  2O9V A;  4PFZ A;  3JCM X;  2O9S A;  3I5R A;  1WQ7 A;  4JS4 A;  1VQ9 A;  2NLU A;  1D1A A;  2KK4 A;  1K0X A;  5C0M A;  2EQI A;  3CME Q;  5DLO A;  1M90 C;  4C8Q B;  1PKT A;  4J7F A;  1AWX A;  4OF1 A;  4BI8 B;  2DD4 A;  4ZGJ B;  1K73 R;  1M3C A;  3CCL Q;  5LJ3 e;  2KR3 A;  1YCS B;  2L5Q A;  3RKX A;  3TSW A;  2DTI A;  2XDD A;  5GAM h;  5L8R E;  2FEI A;  1OEB A;  1SPK A;  2H8H A;  3OA6 A;  4OML A;  1TUG B;  3MEA A;  3I55 T;  3VS3 A;  4OMN A;  4HT9 A;  2K3Y A;  4JUV A;  2QA4 Q;  2KSS A;  3EGU A;  1TS9 A;  1UDL A;  2FPD A;  3OYE A;  4F7U A;  1K73 U;  1MMG A;  1ZLM A;  2YUN A;  1KD1 R;  2K5L A;  3JCM Q;  1MV3 A;  3HRS A;  3FRN A;  1QVG P;  3OW2 P;  1VQP A;  3FEO A;  1WZO A;  2LDM A;  1FMK A;  5CAI A;  3S3N A;  2XK0 A;  2BZX A;  4V2S A;  2DBM A;  3HFN A;  5HCK A;  3GIB A;  2CT4 A;  2W0Z A;  3CCM T;  1V1C A;  2FZG B;  1RAB B;  2DVJ A;  1RAA B;  3OS1 A;  4F7U E;  2IVW A;  3GNF B;  4HCZ A;  3CD6 T;  4BI3 A;  3E19 A;  4LXC A;  2B86 A;  4J9G A;  3NGP A;  1ZSZ C;  3SFM A;  1KD1 U;  2OTJ A;  2LVM A;  2DL4 A;  4BI4 A;  3NFC A;  3JB9 G;  1YJN T;  2LP5 A;  3H0H A;  4HCC A;  1WQW A;  1H8K A;  1VQ4 Q;  4X1V A;  3UF4 A;  3CCE T;  2E5Q A;  2RB6 A;  4WTO B;  1JJ2 A;  3JB9 I;  4Y91 A;  1OU8 A;  5GAM e;  4F04 B;  1ABO A;  2M1H A;  5FLX E;  5FU6 C;  1G3S A;  1TG0 A;  3BE3 A;  4MZT A;  2K57 A;  1YIT A;  1GCQ C;  3RKY A;  3M0Q A;  4C5G A;  2PUO B;  2FO0 A;  4JRI A;  5IHI A;  4LD6 A;  1B34 B;  1QVF A;  1NEG A;  5CIU A;  2HZY A;  1LOJ A;  3LLR A;  1U5S A;  1RUW A;  1YNZ A;  3PNW C;  4J9F A;  1I4K 1;  1B07 A;  2VYT A;  5LJ3 d;  3X20 B;  5KE2 A;  3E2U A;  2HSE B;  2QAZ A;  2BIV A;  2F2V A;  1K8A U;  1GBR A;  5KYY B;  2COW A;  1WYX A;  1NEB A;  3CCJ T;  1HYO A;  3MP8 A;  2DE0 X;  3RMQ A;  2R58 A;  7AT1 B;  2EFI A;  3OSS C;  5LJ5 g;  2DAQ A;  4C8Q D;  4ZGD B;  1JO8 A;  1AWJ A;  1N9S A;  1YWP A;  5KYU B;  5CQX A;  5KCO A;  3VRY A;  3VS2 A;  1NBE B;  2D0Q B;  3EFO A;  1K9M R;  4J5Y A;  1IRX A;  1IRE B;  2LCS A;  2XMF A;  1PSF A;  2AT1 B;  3MKD A;  2GGR A;  3CCS Q;  3TEE A;  1W70 A;  4N4I A;  1VUB A;  3TSZ A;  5GMK m;  3CCV Q;  2DXT A;  4X34 A;  5D7U A;  4Z89 A;  1IXD A;  1VQ6 Q;  3HL8 A;  3M9Q A;  1KQ1 A;  2BZ8 A;  1VQK Q;  4C92 C;  5IH2 A;  1Y96 A;  4M7A A;  3A5Z B;  3G4S A;  2WAC A;  4M75 E;  4XTX A;  3QXE B;  1CKA A;  3UA7 A;  1OI1 A;  4AT1 B;  2LX7 A;  3N5B B;  5HK0 A;  1IZ6 A;  1NJI C;  1G3W A;  2PU9 B;  4E6R A;  1WI7 A;  4M77 G;  4RTU A;  1YIJ Q;  2JUF A;  4M75 B;  2KI7 A;  2LNH B;  2QXF A;  3ME9 A;  3P8B B;  2EJF A;  1PWT A;  2ROL A;  2E41 A;  1G2B A;  5KYW A;  1YI2 A;  3IQL A;  4C92 F;  3MET A;  1RAE B;  2ATC B;  2CGH A;  3S3O A;  2EYW A;  1Q7Y C;  2VGM A;  1D0Z A;  2RNA A;  1V29 B;  3SHW A;  4LDW A;  4M78 G;  4XU1 A;  1W1F A;  4IKF A;  2ZPG B;  3CCQ T;  1TWB A;  1UFF A;  1VYU A;  2CZ7 B;  2BZY A;  1M1F A;  1AWO A;  5A0G A;  3CC7 Q;  1RLP C;  4LDU A;  4E2F B;  2RF0 A;  2H3E B;  4M7D G;  1TUC A;  4PLI A;  2CUB A;  3PFS A;  2JZ2 A;  2AKK A;  2YXY A;  3RMS A;  1UGR B;  2JS2 A;  1G3Y A;  3QG1 A;  1J3T A;  1UGQ B;  2VV5 A;  1VQL Q;  1C1A A;  2OI3 A;  2YLC A;  1Z9Q A;  4PK4 A;  3BFM A;  2EQJ A;  1OX9 A;  2JTF A;  1NG2 A;  3WXM B;  2AIR B;  4OB0 B;  4HT8 A;  2L3S A;  3EHQ A;  1F1B B;  3M4Y A;  3J7A F;  3E9G A;  3CCU Q;  2LX9 A;  3QYG B;  4CC2 A;  4BD3 A;  2YHT A;  2F1L A;  2O01 E;  2CZ1 B;  4RTX A;  1D0Y A;  1BCM A;  1BI2 A;  5IXB A;  4C8Q F;  2HSP A;  1W2B P;  2SEM A;  4ORZ A;  5LJ5 j;  4KUD K;  2KGT A;  2VB6 A;  1D3B B;  1T3S A;  1SHF A;  3DB3 A;  1YJW Q;  4IUV A;  2DRK A;  3OYM A;  3MEU A;  1I5O B;  2YDL A;  1O9S A;  5CKF A;  3TU4 K;  2DIL A;  4DOV A;  5GAO r;  4F14 A;  4BB7 A;  3CPW P;  5KCH A;  1V76 A;  1M2V B;  1WNL A;  1NLP C;  5DY9 A;  3J81 E;  1VQN Q;  3ASK A;  5I2M A;  3EG0 A;  2GQI A;  1MND A;  1Z9Z A;  2FPE A;  3VS6 A;  1MNE A;  1MMA A;  1VQM Q;  2G3R A;  3M4G A;  3RR6 A;  2DZC A;  3CMA T;  4GY5 A;  3SB2 A;  3EG2 A;  5GAO n;  4N0A A;  2CSI A;  4HA8 A;  4FYY B;  2KQW A;  1UEB A;  2OTL Q;  3V8K A;  5I11 A;  4KH0 B;  2V8K A;  3OYY A;  2GFU A;  1QP2 A;  4M75 D;  4L59 A;  1Y7X A;  2LT1 A;  4LN2 A;  3CCS T;  4EPC A;  5KH6 A;  1N8R R;  5KYX B;  2ECZ A;  4AFZ C;  1NJI R;  1VQ5 T;  4F7U F;  3CC4 A;  1WHK A;  2EYX A;  2KXD A;  1ARK A;  4FW1 A;  1KK7 A;  1ZSZ B;  2X4Y A;  4IUU A;  3G71 Q;  3G6E T;  1BB9 A;  3OYL A;  1VQ6 T;  5DM7 R;  4M7A D;  1X75 C;  2V8I A;  4B6M A;  2PTK A;  3RES A;  3L2R A;  2K79 A;  4LDX A;  2RHX A;  4EMK C;  2V1Q A;  3I55 Q;  5J39 A;  4CC7 A;  1K73 C;  2A08 A;  1I8F A;  3OS5 A;  5FU6 B;  2GCX A;  1N8R U;  1XJW B;  1YIJ T;  2GFA A;  1IGQ A;  2CRE A;  2EYY A;  4ZNX A;  4LUE A;  2VXF A;  3Q1J A;  1VQ7 T;  1RL2 A;  1SG5 A;  2RQU A;  1WFW A;  4DBF A;  1AZG B;  4DEX A;  4JRP A;  1KQ2 A;  4IIM A;  8ATC B;  2EWN A;  3V7S A;  3DLM A;  3CCM Q;  1KHI A;  4JS5 A;  4FL6 A;  3VV0 A;  4LDY A;  1A0N B;  4BUG A;  3UDC A;  1KD1 C;  3CD6 Q;  4NL3 A;  4BE0 A;  2M0Y A;  5CKH A;  2YRD A;  5LJ5 d;  1VQL A;  2IIM A;  3VKI A;  4C0D C;  3KXT A;  1GL5 A;  3O8V A;  4ELZ C;  1YJN Q;  2MAM A;  4LDV A;  3VYH B;  3CCE Q;  5GAN f;  4NS5 A;  2X4X A;  1X01 A;  1BIB A;  4XTZ A;  2DL3 A;  3M0P A;  4PFP A;  1PRM C;  4M77 A;  2C0O A;  3C12 A;  3SWN A;  3UWN A;  5AT1 B;  4R0K A;  1U8R A;  4E7I A;  3NPF A;  5FWC A;  3MEW A;  1WIE A;  3VS5 A;  2GNC A;  1JJ2 P;  2MWP A;  4D8D A;  4C92 E;  1YJW A;  4KBM B;  1QMC A;  2HNI A;  1TXQ A;  4JRK A;  2YLB A;  4RUG A;  4C92 B;  5AYF A;  3A8H B;  1YHQ T;  2MMP A;  4F16 A;  1X6B A;  4M7A C;  1MMD A;  2ABL A;  2L3R A;  1QVF P;  3CCJ Q;  4PJO A;  2MI6 A;  2XD0 A;  4XTV A;  4J8O A;  3ZFJ A;  4RCB A;  4RG8 A;  5J26 A;  3S3M A;  2RI5 A;  3FJ5 A;  4XU2 A;  3ZEH A;  2L3Q A;  2BE9 B;  2E10 A;  1Y71 A;  4ATO A;  3QJ6 A;  2DKG A;  3EGX B;  1VQ8 Q;  4OB2 B;  4DQ2 A;  2MIO A;  4A4H A;  1VQO Q;  1X27 A;  2OAU A;  4F17 A;  4M7A F;  1SRM A;  3URG A;  2QEX Q;  4PJO E;  1I1J A;  2K2V A;  3V7R A;  1YBY A;  4OB1 B;  1GFD A;  1BYM A;  1H3Z A;  2DFU A;  2EVR A;  4X9D A;  3CBM A;  3D7S B;  2XIC A;  3INZ A;  4N4H A;  2YRV A;  1VYT A;  5C6S A;  3PIP A;  5L23 A;  3JCM d;  2ENM A;  2NUT B;  1M4Z A;  3JCM c;  2DD5 A;  1UE9 A;  2EQM A;  1UGP B;  3LH0 A;  2EJ9 A;  3CCR T;  5HK3 A;  1YJ9 T;  4BE2 A;  1PHT A;  4GLM A;  3M55 A;  1ZUK A;  1K9M C;  3G7Z A;  3A8L B;  4ZN1 A;  1R77 A;  4HVV A;  4FW2 A;  5LJ3 f;  2RJF A;  2V8J A;  1C6V X;  1EFN A;  2ROT A;  2HBP A;  5A0D A;  1ZBJ A;  3G71 T;  1SSH A;  2BKD N;  4QW2 A;  1RAH B;  4E47 A;  1AHJ B;  2EQK A;  1N27 A;  1JJ2 S;  4WCI A;  1X6O A;  1XTD A;  3M53 A;  1AOJ A;  1UJY A;  2FVU A;  3LGF A;  2E4H A;  5GAN 3;  2K2M A;  3DB4 A;  2JTE A;  3CCQ Q;  2HL3 A;  2CUD A;  4AMC A;  3G1J A;  3EH1 A;  1AT1 B;  1NYG A;  1XQH A;  1RLQ C;  2EIF A;  1NPP A;  2VAS A;  4C0G A;  1QVF S;  3EFR A;  5CKB A;  3UAT A;  3FLG A;  1R0B G;  3HKS A;  1N6A A;  2IG0 A;  3LH5 A;  3PTA A;  2E3H A;  4GBQ A;  2DIQ A;  1SSF A;  2KE9 A;  2HQX A;  1YJN A;  4Z8A A;  2KRO A;  3EH2 A;  1JB0 E;  3DLL A;  2OX7 A;  4FIB A;  4C92 D;  3J80 E;  2FPF A;  4N0A C;  5I22 A;  3AT1 B;  5CQY A;  4A4G A;  1VQP T;  1G3T A;  3WVE B;  4F7U B;  4HVU A;  5FW9 A;  2DEQ A;  5CK9 A;  3CC2 Q;  5I2S A;  3OYC A;  1WPY A;  4EMK A;  1ZA2 B;  5GAM f;  1PG5 B;  2LQ8 A;  4XTW A;  1ZX6 A;  2HD0 A;  4OMP A;  5DLQ E;  2RQV A;  2A7Y A;  2CSQ A;  1FMV A;  1K8A R;  1U06 A;  1M3B A;  1D09 B;  4M4Z A;  3NTK A;  2JM8 A;  4DBQ A;  2JW4 A;  1OYX A;  3M0U A;  1IB8 A;  1RAC B;  2GQV A;  3SEM A;  2M9U A;  2L0A A;  3JB9 F;  3QDF A;  4PFO A;  1I0C A;  2OTJ T;  1KG1 A;  1UG1 A;  1Y07 A;  2I2L A;  4OMF B;  2DER A;  4E7H A;  3X28 B;  4IUT A;  2LJ3 A;  1I07 A;  1YP5 A;  3EGD A;  5KYU A;  1MGQ A;  1KC8 R;  4PJO D;  3CMA Q;  3QII A;  2J06 A;  2LNV A;  2J6O A;  1T0J A;  4C5E A;  1QCN A;  1HSQ A;  1YIT T;  1BI1 A;  2YUO A;  2RHZ A;  3QKJ A;  4CC3 A;  2KRS A;  3KFV A;  2L8D A;  2QDL A;  3CPF A;  3F70 A;  1VQ8 T;  2DMO A;  2MF2 A;  1QCO A;  2K3X A;  1N5Z A;  1XOV A;  1VQO T;  4AFS C;  5D6X A;  2CP7 A;  1U1T A;  1KC8 U;  1S72 Q;  3SDZ A;  4ME7 A;  1OOT A;  2I0N A;  4MZM A;  2QEX T;  3CBO A;  4QQ6 A;  1OZ2 A;  2K9G A;  1ZSG A;  2VC8 A;  2YUP A;  1ZBX A;  4BDY A;  1VQ5 Q;  6AT1 B;  2R5M A;  1QQJ A;  4J9D A;  2K5F A;  3M54 A;  5GMK i;  3HP9 A;  2GBQ A;  3G6E Q;  3CME A;  4C0D B;  1QKW A;  2YWW A;  2VWF A;  3QPH A;  2O2O A;  4HCK A;  3M0R A;  2E70 A;  3CCL A;  1FMW A;  1BIA A;  3P8H A;  3QO3 A;  2LQW A;  2X51 A;  3C94 A;  2QDY B;  2FB7 A;  2KBT A;  4OMO A;  2BE7 D;  3E9F A;  5CO7 A;  1N8R C;  3JCM J;  4M77 C;  2DLP A;  3SWN C;  1N9R A;  4TVR A;  3I5S A;  4KGZ B;  2EPD A;  1OU9 A;  3RDV A;  1VQ7 Q;  1OQK A;  2JM9 A;  1M5Q 1;  3L2W A;  2QA4 A;  1M90 U;  4BY6 C;  2QQS A;  2D9T A;  4M7A E;  4OP0 A;  3C95 A;  4J6X A;  3O5Z A;  2E5K A;  2EW3 A;  3G4S T;  2DTO A;  4EMH A;  2KY9 A;  1OPK A;  2DL7 A;  4J9E A;  1Y96 B;  5EG2 A;  4M7A B;  3I35 A;  5GJW B;  3JV3 A;  2XDP A;  4JDS A;  4ZTF A;  3M5A A;  4E7L A;  4PJO C;  1FYN A;  1QP3 A;  5LJ5 h;  2MPX C;  4O5V A;  3JCM g;  1YI2 T;  4JJN K;  1YFN A;  2A37 A;  3I56 Q;  2RD1 A;  5KYW B;  4ANJ A;  3EFS A;  2M51 A;  2GTJ A;  3LX7 A;  3QJY A;  1K1Z A;  1VQ4 A;  1WHH A;  4PJO F;  2RA2 A;  4II1 A;  4KGX B;  3FIF A;  2DVE A;  4C8Q G;  2ESW A;  2FYK A;  4XAX B;  4E7K A;  1PC0 A;  2DO3 A;  3CC2 T;  1NPR A;  1NYF A;  1M30 A;  1ACM B;  4KUI A;  3M58 A;  4E7J A;  4DA4 A;  2FG0 A;  2LJ0 A;  2DA9 A;  1YHQ Q;  2L2P A;  2L3P A;  5GAN 2;  2DRM A;  2EKH A;  3VYG A;  5GAN g;  2CT3 A;  3CXC S;  3NTH A;  2A28 A;  2LZ6 B;  1KHC A;  3PMT A;  2CH4 A;  2JMC A;  4HXJ A;  4JJB A;  2H3J A;  2RH2 A;  4WF2 A;  2M0O A;  5FRO A;  1WX6 A;  3BW1 A;  5LJ5 e;  4FYW B;  3MO8 A;  2JNG A;  2CP6 A;  4J9C A;  1E6G A;  1ZHI A;  4RTY A;  2DX1 A;  2DF6 A;  1ABQ A;  2VXE A;  3RUX A;  2E1H A;  2AK5 A;  3A8M B;  4O6J A;  3REA B;  3PVL A;  2E6Z A;  1PCX A;  2AHJ B;  2ED0 A;  4FYV B;  4PJJ A;  4FM4 B;  2KMT A;  3OBY A;  2P0P A;  3QBY A;  1SKU B;  4K11 A;  3ER0 A;  4A4E A;  1QKX A;  3CCS A;  2K6D A;  3JCM h;  3CCR Q;  1YJ9 Q;  3CQT A;  1R0C B;  2EQU A;  3WVD B;  8AT1 B;  1S72 T;  2V26 A;  3CCV A;  4B9X A;  1VIE A;  2CYZ B;  2NYS A;  4F7U G;  1WHG A;  3G6E A;  3CXC A;  3EG9 A;  4Q5W A;  2CZ0 B;  1VQ6 A;  3OYJ A;  2HQH A;  1VQK A;  2HL5 C;  4RTW A;  2X35 A;  3CBP A;  2DPP B;  1BBZ A;  2WSC E;  2COY A;  3JB9 H;  1JXO A;  2X3W D;  3REB B;  3L42 A;  3OYK A;  4ESR A;  4BAC A;  2FZK B;  3TRE A;  3OYN A;  1YIJ A;  4BDZ A;  1VQ9 Q;  1YN8 A;  1U1S A;  5KYN A;  2Y90 A;  1OV3 A;  2A36 A;  3HHT B;  4JZ4 A;  1D1B A;  4UC4 A;  3UT1 A;  1AVZ C;  3MJX A;  1OZ3 A;  3CC4 T;  2DEU A;  1EX4 A;  1LPL A;  4J7I A;  2KRN A;  3OYA A;  4YTL A;  5CKE A;  5HY6 A;  3QSU A;  1KQS A;  3AHU A;  2EGC A;  4XU0 A;  2JTM A;  4FT2 A;  2OJ2 A;  3PMI A;  4RG2 A;  3OYB A;  1LJO A;  3CC7 A;  4JPB W;  1RAG B;  3JCM e;  1M1K R;  4RTT A;  2QTV A;  2E6N A;  1PNJ A;  2P0K A;  4A54 A;  1Y57 A;  1LCK A;  3GPL A;  1VQP Q;  2KYM A;  2K5I A;  1Q86 U;  1JBM A;  3T9N A;  2EBP A;  2RN8 A;  4CC4 B;  5GAN j;  3QUI A;  1RAF B;  1DJ7 B;  2MCN A;  3I56 T;  2RPN A;  1G5V A;  2KVQ G;  2M02 A;  3CCU A;  2K7A A;  4PJM A;  2JXB A;  1M9S A;  4MZP A;  2AKL A;  3RNJ A;  1M1K U;  4LNP A;  1IO6 A;  3VUZ A;  2DYI A;  4KUL A;  3PGG A;  5GAO m;  4RCC A;  3NHN A;  2OTJ Q;  2F2W A;  4AG2 C;  2C06 A;  2QYZ A;  4RMO A;  1JQQ A;  3M0S A;  4M78 A;  3QZ9 B;  2KYB A;  4M75 G;  1YWO A;  4Y92 A;  2RQT A;  1K8A C;  3L2V A;  4M77 E;  3OMG A;  1D0X A;  3MPU B;  1WHL A;  3JSC A;  1WLP B;  5GAM g;  4PL6 A;  1KSW A;  2COZ A;  3M59 A;  2YT6 A;  1VQN A;  4M7D A;  1H92 A;  3UA6 A;  1YIT Q;  3M56 A;  2CP2 A;  5IHN A;  2O4X A;  2RM4 A;  2A3L A;  4M77 B;  2DXU A;  3GLX A;  3GOX A;  3SWN B;  4HCB A;  1VQM A;  1M27 C;  3GF5 A;  1UEC A;  2K4Y A;  4M78 E;  2KRM A;  1G83 A;  4M7A G;  2DL5 A;  1KC8 C;  1WDX A;  5ECA A;  4BY6 B;  3VS4 A;  2OTL A;  3OYF A;  1PM3 A;  3TQ7 P;  2DJZ A;  4JJC A;  5EC7 A;  3JB9 D;  2FHD A;  4OGE A;  2EAY A;  5FWB A;  2CP3 A;  4M7D E;  3P8D A;  2Y4X A;  3PIO A;  1IGU A;  2LMJ A;  4C8Q A;  2RQW A;  1FX7 A;  2SRC A;  5M9O A;  3CCR A;  3RKW A;  4A4K A;  3UPU A;  4PJO B;  2QQA A;  1KFZ A;  2PNI A;  2NUP B;  3LYI A;  2DZ9 A;  1TOV A;  5GAN 5;  4XTU A;  4P5N A;  1K4U S;  1QVP A;  3R6O A;  3HSB A;  4Y28 E;  3G71 A;  5A2Q E;  1WXU A;  5FU7 C;  1GXI E;  1LNX A;  2QQ9 A;  1C0M A;  1M8M A;  3H0I A;  3I55 A;  1TH7 A;  2PVO B;  1WJQ A;  2GTO A;  5CR2 A;  1Q95 G;  1BI0 A;  2X4J A;  3A98 A;  4HVW A;  4XU3 A;  1UGV A;  1RAD B;  1MMN A;  1VQ9 T;  4N4G A;  3G4S Q;  3A1P A;  3TVT A;  2XG8 D;  3DKM A;  2DM1 A;  5GAN d;  2DNU A;  4JJD A;  4ZGE B;  1JXM A;  3PVQ A;  1HK9 A;  3QDR B;  4EMG A;  2YRC A;  3VS7 A;  2MOX A;  4R56 A;  1R8O B;  4PNO A;  3CCM A;  4CI0 C;  4QVZ A;  3JCM P;  5GAN 6;  4E7Z A;  1YI2 Q;  4J9B A;  1Q82 R;  2LCL A;  3M57 A;  3CD6 A;  2P84 A;  1K9A A;  1AZE A;  2JVV A;  4IUR A;  4EIK A;  4JLI A;  3CCE A;  2WSF E;  1WJS A;  4A4F A;  1K0S A;  2BTT A;  2KAF A;  2XKO C;  2PQW A;  4NOY A;  2K3B A;  2E64 A;  3HRU A;  5GAM j;  1ZQ1 A;  1SRL A;  1B34 A;  4RTZ A;  1Q82 U;  3ZL7 C;  5D6W A;  1T3L A;  3LGL A;  4M77 D;  1UGS B;  1ZUU A;  2YUQ A;  2DJQ A;  2J6F A;  3U23 A;  4X9C A;  2YSQ A;  4OMM A;  1PD1 A;  2HKQ B;  1UHF A;  3L2Q A;  5IAY A;  1I5L A;  1OPL A;  2VUB A;  3GBQ A;  3LWH A;  5KYY A;  4QQD A;  2JMA A;  1TTH B;  1UHC A;  3OS0 A;  5IT9 E;  1W6X A;  1B3Q A;  4M78 D;  4VUB A;  2RJE A;  3X24 B;  3JAM E;  1Q81 R;  1QLY A;  3CCJ A;  3HTR A;  3SD4 A;  2D1X A;  1BU1 A;  4BE1 A;  2EKO A;  2D8J A;  2R57 A;  1I81 A;  2HKN A;  4M7D D;  2WSE E;  4EMK B;  2EJG A;  2KDS A;  2RI3 A;  1QCF A;  5HKC A;  1VQ8 A;  4J83 A;  3H9N A;  2AZV A;  1VQO A;  5GMK l;  1WXB A;  2QGF B;  2D6F A;  1WHM A;  2CS7 A;  5I21 A;  2ZPB B;  1WHJ A;  2QEX A;  1Q81 U;  1AWW A;  1CKB A;  3FB9 A;  5CVI A;  2FL7 A;  4DBH A;  2P0Q A;  1X69 A;  2IPO B;  3NTI A;  3VJP A;  5GMK h;  1GCP A;  2HEQ A;  3OS2 A;  2A0F B;  1HXD A;  3EGD B;  2EGA A;  3EG3 A;  3QHS A;  1ZA1 B;  3A8G B;  1QWF A;  1QVG S;  3OW2 S;  1IHW A;  1NM7 A;  2QTX A;  2HDA A;  4M75 A;  3X25 B;  2PUK B;  1M90 R;  2QQR A;  4J6Y A;  3CXC P;  3OQ5 A;  2L89 A;  2NUZ A;  4MDW A;  3JCM V;  3OYG A;  3I9Q A;  1JEG A;  1GFC A;  2DTH A;  2ZGW A;  3RIR A;  2AZS A;  1YCY A;  1H3H A;  2JT4 A;  3EFO B;  3CC4 Q;  1AD5 A;  3NMZ C;  5GMK j;  4LUD A;  2F69 A;  4C92 G;  2QI2 A;  2RQR A;  3M0T A;  2RHU A;  2X4W A;  1AEY A;  3VS1 A;  2P4R A;  3FJP A;  3CME T;  4KRT A;  3CCQ A;  1X6G A;  4KGV B;  4L6V 5;  2RHY A;  1K9M U;  5IHK A;  4CRI A;  5GAO q;  2HAX A;  2HBW A;  1UUE A;  3CCL T;  1VIF A;  4M78 C;  2RJC A;  2E3I A;  4JLG A;  2ZPE B;  5GAM d;  1SEM A;  3OYD A;  3OBW A;  2DET A;  2GF7 A;  4M77 F;  5GMK e;  4FT4 A;  9ATC B;  3FC3 A;  2QAS A;  3OW2 A;  4XQ3 A;  1KJW A;  4PKC C;  2VVK A;  1QVG A;  1KQS P;  1XNI A;  4IIO A;  4ELY C;  2F5K A;  4M7D C;  3OYI A;  1Q86 C;  2R5A A;  5GAN 4;  4D6W A;  1NE8 A;  1X2K A;  2QA4 T;  4PLL A;  3EAE A;  4M78 F;  4KT0 E;  4RTV A;  1E6H A;  1K76 A;  1M1K C;  5D6Y A;  4PJO G;  3LW5 E;  1WXT A;  1JRI A;  1D3B A;  3THK A;  3CC2 A;  5GAN 7;  2LQN A;  4M7D F;  2C0I A;  4OMQ A;  3MP6 A;  4ZTJ A;  4C8Q C;  4PJL A;  4Z02 A;  4OGC A;  2DXC A;  3MP1 A;  1P92 A;  1X2Q A;  1M2V A;  2LRQ A;  3MCA B;  2LTO A;  4C0F A;  1M8V A;  2MYS A;  4KH1 B;  2XU8 A;  4FU6 A;  4FYX B;  1PKS A;  3VU3 C;  1GRI A;  4J9I A;  2CP0 A;  1VQ4 T;  2J7I A;  2KT1 A;  1EIF A;  5FU7 B;  2XHC A;  2DXB A;  1QWE A;  1BCO A;  1RI0 A;  2RMO A;  2FZC B;  1S1N A;  2BUD A;  5LJ5 f;  3CMA A;  4IUQ A;  1X43 A;  1OX8 A;  1U3O A;  3X26 B;  1B7T A;  3GNG A;  2ZPF B;  3ZBD A;  1M1G A;  2LC4 A;  2LCC A;  2VGN A;  2DBK A;  2CKK A;  2ED1 A;  3ULR B;  2XI9 A;  2O31 A;  4EDU A;  2O88 A;  3PE0 A;  3JB9 J;  4XK8 E;  1MHN A;  1CSK A;  2Y4Y A;  1S72 A;  5KYX A;  4IUP A;  4PJN A;  3H8Z A;  3HPW A;  1KQS S;  1ZSZ A;  2JJ9 A;  4XTY A;  1BKB A;  5GAO p;  1VQ5 A;  3H6Z A;  4AFQ C;  3EHR A;  4LD9 K;  2DYB A;  2XID A;  4FSX A;  2KXC A;  4D8K A;  2P4T A;  1JU5 C;  5GJV B;  3VS0 A;  2Z0W A;  2ZCF B;  1EZZ B;  4FSS A;  4Z88 A;  3EG1 A;  4L5G A;  3LWI A;  1T0H A;  3L2Z A;  3BDL A;  3L2U A;  3RER A;  3C0C A;  2E12 A;  3GP8 A;  2X3X D;  1PD0 A;  1LVK A;  1GCQ A;  2VKN A;  2MWO A;  5A0L A;  4JRQ A;  3OSV A;  1QW1 A;  3FDR A;  2CDT A;  2G6F X;  4C0Z A;  2F5T X;  2RI2 A;  4LE9 A;  3CCV T;  2PZ1 A;  2ZAE A;  3HFO A;  1MUZ A;  1VQ7 A;  1ZUY A;  4A53 A;  4C5I A;  5LL6 S;  2LJ1 A;  4DBR A;  4QVD A;  1M2O A;  3OB9 A;  3QZ5 B;  2J6K A;  1OUL A;  5GAN h;  2KNB B;  1VQK T;  5CCA A;  1UTI A;  4QKU A;  2CP5 A;  2HMA A;  1Q7Y R;  3V8L A;  3EG9 B;  1Q86 R;  3V7C A;  5LJ3 g;  1WJR A;  1KIK A;  4R55 A;  2MK5 A;  4RKU E;  3QWX X;  1W2B S;  2FRW A;  2ZPI B;  2ZPH B;  3HRT A;  2PVG B;  3JCM f;  3JRZ A;  1NJI U;  5KE3 A;  3VRZ A;  3KBG A;  1VA7 A;  4HKE A;  4B9W A;  1UJ0 A; 
#chains in the Genus database with same CATH homology
 2YUO A;  4JZ3 A;  4CC2 A;  4CC3 A;  2KRS A;  3KFV A;  3R6N A;  2JS0 A;  4RTX A;  1M8M A;  2QDL A;  3H0I A;  5IXB A;  2HSP A;  2SEM A;  4ORZ A;  2DMO A;  2OAW A;  2GTO A;  2KGT A;  1N5Z A;  1XOV A;  3A98 A;  1T3S A;  1UGV A;  4HVW A;  4AFS C;  1SHF A;  1OOT A;  2DRK A;  2I0N A;  2EYZ A;  3TVT A;  2DM1 A;  2DNU A;  2K9G A;  1ZSG A;  4JJD A;  2F2X A;  2YDL A;  2YUP A;  1JXM A;  3PVQ A;  1M3A A;  2DIL A;  4AG1 C;  4F14 A;  4J9D A;  3VS7 A;  4AFU C;  2MOX A;  1NLP C;  2GBQ A;  3RBB B;  1QKW A;  2VWF A;  3EG0 A;  2GQI A;  2O2O A;  1Z9Z A;  2FPE A;  4J9B A;  4HCK A;  5IXF A;  1PRL C;  3M0R A;  3VS6 A;  3QWY A;  2LQW A;  1GBQ A;  1TUD A;  2D0N A;  2KBT A;  1K9A A;  4OMO A;  1AZE A;  3EG2 A;  1SHG A;  1Y0M A;  4EIK A;  2CSI A;  2EGE A;  1NLO C;  2DLP A;  2FRY A;  3H0F A;  3I5S A;  2V1R A;  1WA7 A;  2NWM A;  5I11 A;  2EPD A;  1MV0 B;  1K0S A;  2KT8 A;  2JM9 A;  2BTT A;  1VYV A;  2K3B A;  1SRL A;  2HCK A;  3H41 A;  4RTZ A;  4LN2 A;  3ZL7 C;  1T3L A;  3O5Z A;  2E5K A;  2EW3 A;  2D8H A;  4J9H A;  1ZUU A;  2YUQ A;  2DJQ A;  1OPK A;  2DL7 A;  2J6F A;  3U23 A;  2YSQ A;  4J9E A;  2ECZ A;  4OMM A;  4AFZ C;  2CH4 W;  2EYX A;  3I35 A;  1UHF A;  2KXD A;  5GJW B;  1RI9 A;  1E7O A;  1ARK A;  2W10 A;  3JV3 A;  1OPL A;  1FYN A;  3GBQ A;  1BB9 A;  2JMA A;  1UHC A;  1W6X A;  1B3Q A;  2C0T A;  2PTK A;  2K79 A;  2A37 A;  1QLY A;  2DL8 A;  2J05 A;  4A63 B;  2D1X A;  1BU1 A;  2V1Q A;  1HJD A;  2D8J A;  2M51 A;  4CC7 A;  2A08 A;  2GTJ A;  1K1Z A;  2CRE A;  2EYY A;  1HD3 A;  4LUE A;  2KEA A;  4ZNX A;  4DEY A;  1BK2 A;  1QCF A;  4QT7 A;  2O9V A;  2RQU A;  1WFW A;  1AZG B;  2ESW A;  2AZV A;  2O9S A;  3I5R A;  4DEX A;  4IIM A;  1WXB A;  1NYF A;  1M30 A;  1K0X A;  1AWW A;  2EQI A;  1CKB A;  2FG0 A;  1PKT A;  1AWX A;  1A0N B;  2LJ0 A;  2DA9 A;  1M3C A;  2L2P A;  1X69 A;  2L3P A;  2DRM A;  2KR3 A;  2EKH A;  1YCS B;  2CT3 A;  1GCP A;  2HEQ A;  2M0Y A;  2A28 A;  2IIM A;  3TSW A;  2LZ6 B;  2EGA A;  3EG3 A;  1GL5 A;  2CH4 A;  2JMC A;  4HXJ A;  1QWF A;  2FEI A;  4JJB A;  1NM7 A;  1OEB A;  1SPK A;  1WX6 A;  2H8H A;  2HDA A;  4OML A;  4J9C A;  3VS3 A;  4OMN A;  2DL3 A;  3M0P A;  1E6G A;  3EGU A;  1UDL A;  2FPD A;  2DX1 A;  1PRM C;  4RTY A;  2C0O A;  2DF6 A;  1ABQ A;  2NUZ A;  1ZLM A;  2YUN A;  4R0K A;  2AK5 A;  1MV3 A;  3REA B;  3NPF A;  3PVL A;  5FWC A;  1WIE A;  1JEG A;  3I9Q A;  2ED0 A;  1GFC A;  3VS5 A;  2GNC A;  2AZS A;  1H3H A;  1FMK A;  2JT4 A;  4D8D A;  1AD5 A;  3NMZ C;  4LUD A;  2BZX A;  2DBM A;  2RQR A;  3M0T A;  5HCK A;  1AEY A;  4K11 A;  3VS1 A;  2P4R A;  2CT4 A;  1QKX A;  2W0Z A;  4KRT A;  4RUG A;  2K6D A;  1X6G A;  1V1C A;  5IHK A;  3CQT A;  2DVJ A;  2HBW A;  4F16 A;  1UUE A;  1X6B A;  2ABL A;  2B86 A;  4J9G A;  3NGP A;  1SEM A;  2DL4 A;  3FJ5 A;  2L3Q A;  2LP5 A;  4RTW A;  3H0H A;  1BBZ A;  1H8K A;  4X1V A;  3UF4 A;  1KJW A;  2VVK A;  4IIO A;  1JXO A;  2X3W D;  3REB B;  2MIO A;  4ESR A;  1ABO A;  1X27 A;  1X2K A;  4F17 A;  1TG0 A;  1SRM A;  1YN8 A;  4RTV A;  1E6H A;  1K76 A;  1I1J A;  1GCQ C;  1GFD A;  1OV3 A;  2A36 A;  2EVR A;  3M0Q A;  4JZ4 A;  2FO0 A;  1WXT A;  5IHI A;  1NEG A;  1AVZ C;  3THK A;  1VYT A;  1U5S A;  2LQN A;  5L23 A;  2C0I A;  4OMQ A;  1RUW A;  1YNZ A;  4J9F A;  2ENM A;  2KRN A;  1B07 A;  1UE9 A;  2EGC A;  1PHT A;  1X2Q A;  2OJ2 A;  4GLM A;  2F2V A;  1ZUK A;  1T0J A;  1GBR A;  1WYX A;  1NEB A;  4JPB W;  2DE0 X;  4HVV A;  4RTT A;  1EFN A;  2ROT A;  1PKS A;  1JO8 A;  1AWJ A;  1GRI A;  1PNJ A;  4J9I A;  1YWP A;  2J7I A;  2KT1 A;  1ZBJ A;  1Y57 A;  1LCK A;  1SSH A;  2KYM A;  1QWE A;  2EBP A;  2RN8 A;  4CC4 B;  2RMO A;  1S1N A;  3VRY A;  4WCI A;  1AOJ A;  1X43 A;  3VS2 A;  1UJY A;  1U3O A;  2MCN A;  2RPN A;  2LCS A;  2XMF A;  2K7A A;  2GGR A;  2JXB A;  2K2M A;  2JTE A;  2AKL A;  3RNJ A;  4LNP A;  1W70 A;  2CUD A;  1IO6 A;  2DBK A;  3TSZ A;  2ED1 A;  3ULR B;  1NYG A;  2O31 A;  1RLQ C;  4Z89 A;  3NHN A;  2O88 A;  3PE0 A;  2F2W A;  4AG2 C;  3UAT A;  1CSK A;  2BZ8 A;  5IH2 A;  3LH5 A;  1JQQ A;  3M0S A;  2KYB A;  1YWO A;  4GBQ A;  1CKA A;  4Y92 A;  3UA7 A;  2RQT A;  2LX7 A;  2KE9 A;  4AFQ C;  3EHR A;  2DYB A;  4E6R A;  4Z8A A;  1WI7 A;  2KRO A;  4RTU A;  1WLP B;  2KXC A;  4D8K A;  1KSW A;  2LNH B;  2YT6 A;  1H92 A;  3UA6 A;  1PWT A;  2FPF A;  5IHN A;  5I22 A;  2ROL A;  1JU5 C;  5GJV B;  1G2B A;  3VS0 A;  3IQL A;  4FSS A;  4HVU A;  5FW9 A;  4Z88 A;  3EG1 A;  1M27 C;  2EYW A;  1UEC A;  1T0H A;  2KRM A;  2RNA A;  1G83 A;  3C0C A;  3SHW A;  2X3X D;  1ZX6 A;  1GCQ A;  2VKN A;  2DL5 A;  4OMP A;  1W1F A;  2RQV A;  1WDX A;  5ECA A;  2CSQ A;  3VS4 A;  1U06 A;  1UFF A;  1VYU A;  2G6F X;  2CDT A;  4JJC A;  1M3B A;  2BZY A;  5EC7 A;  4M4Z A;  2JM8 A;  1AWO A;  4LE9 A;  2JW4 A;  2PZ1 A;  5FWB A;  1MUZ A;  1RLP C;  3M0U A;  3SEM A;  2RF0 A;  1ZUY A;  2L0A A;  1TUC A;  2LJ1 A;  2LMJ A;  2RQW A;  2CUB A;  1I0C A;  2SRC A;  2J6K A;  1UG1 A;  2AKK A;  2KNB B;  2JS2 A;  1UTI A;  1J3T A;  2LJ3 A;  1KFZ A;  1I07 A;  2OI3 A;  2PNI A;  1YP5 A;  1KIK A;  1Z9Q A;  3QWX X;  2FRW A;  1K4U S;  1NG2 A;  2L3S A;  3EHQ A;  2J06 A;  3VRZ A;  1VA7 A;  1WXU A;  2J6O A;  1UJ0 A;  1HSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...