2XMFA

Myosin 1e sh3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'GPLGSPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN 1E SH3
publication title Myosin 1E SH3
rcsb
source organism Mus musculus
molecule tags Motor protein
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2xmfA00
3M0PA 1GBRA 4CC3A 2YT6A 2AZVA 1HD3A 1M27C 2HCKA 2D0NA 3PVLA 4AG1C 2LCSA 1PHTA 1WX6A 2O88A 3UA7A 1CSKA 1FMKA 2GNCA 2DMOA 5ECAA 1H92A 2J6OA 1ZUKA 1SHGA 1VA7A 2KXDA 3H0FA 3EG1A 3REBB 1UGVA 3M0TA 3I5RA 1ABOA 2I0NA 4R0KA 2MOXA 2OJ2A 1GFDA 1X27A 1NG2A 4GLMA 2KE9A 1VYTA 3NGPA 2VVKA 2A28A 2DX1A 1PKTA 2M51A 1JO8A 4F17A 4GBQA 1UG1A 1NM7A 2EYXA 2DE0X 3TVTA 3H0HA 1I07A 1RLQC 1K0SA 2CDTA 1SPKA 3EG2A 1AZEA 1NLPC 5IXBA 2VWFA 1UHFA 2RQTA 2ED1A 2FO0A 2KYMA 1AWWA 1GBQA 2CSQA 1YN8A 1U06A 4ZNXA 2RPNA 2D8HA 2AKKA 3EG0A 3QWXX 5IHKA 1QWFA 2EGCA 2K7AA 1UHCA 2GBQA 4D8KA 4LUDA 2DA9A 3H0IA 2GTJA 3VRYA 2D1XA 1H3HA 2AK5A 3EHRA 2J05A 2HBWA 3M0UA 1G2BA 2O9SA 1SHFA 3UATA 3VS7A 1W1FA 5HCKA 4J9CA 1WXUA 3RBBB 4F16A 2CREA 2DNUA 3VS4A 4AFSC 1PRMC 4RTWA 1JEGA 4ESRA 2DILA 3VRZA 4RTVA 2AZSA 2JT4A 2LZ6B 4LNPA 2O31A 5FWBA 4OMOA 2RQVA 1N5ZA 1PNJA 3REAB 1I0CA 4J9DA 3CQTA 1AEYA 2JW4A 1UFFA 2EYZA 3EG3A 1OPLA 2EGAA 1BB9A 2QDLA 1BBZA 2ROLA 1U3OA 4RTZA 2JS2A 2V1QA 1GCQA 2SEMA 2B86A 1AZGB 2LX7A 1SSHA 4HVVA 2W10A 4RTYA 2CT4A 1QWEA 2K79A 1E6HA 2KEAA 2EW3A 2G6FX 1QKXA 2CSIA 2KRNA 1KFZA 3ULRB 2EQIA 2GTOA 2F2XA 3C0CA 1AVZC 2EYWA 1PWTA 1RUWA 4CC4B 1AWOA 2LP5A 1B07A 2YUPA 3FJ5A 2FEIA 4HXJA 2DLPA 1M30A 2KGTA 4OMMA 1AWXA 2NWMA 4OMQA 1WA7A 3EGUA 2OAWA 2H8HA 1M3CA 1AD5A 1TUDA 2BZYA 1UDLA 2KR3A 4HVUA 3VS1A 1GFCA 4LE9A 1OOTA 4RTXA 2KT1A 2YUNA 1YP5A 1X6GA 2EBPA 4AFQC 2JTEA 4A63B 1MV0B 5IHIA 1NEBA 1UTIA 2RNAA 3M0RA 3VS6A 2A37A 1UUEA 1AOJA 2JXBA 2XMFA 3I5SA 3I9QA 3VS0A 1K9AA 2K9GA 1WFWA 4OMNA 2FPDA 5IHNA 2DBMA 1MUZA 4KRTA 1HJDA 2L3PA 3H41A 4J9IA 1ABQA 4JZ3A 3KFVA 4RTUA 1JQQA 1T0HA 2C0IA 1KSWA 5IH2A 1SEMA 2K6DA 2J06A 2BZXA 2DJQA 1A0NB 3UA6A 4JZ4A 1JXOA 3NMZC 1WYXA 2FG0A 2KYBA 2GGRA 1GCQC 2CH4W 2LNHB 3PE0A 3NHNA 2CT3A 4DEXA 2DRMA 2L3QA 2LQWA 1CKAA 1H8KA 1QKWA 4RTTA 1BK2A 2A08A 2SRCA 5GJVB 1SRLA 1EFNA 2J6KA 2NUZA 3M0SA 1WIEA 2PNIA 2DRKA 1YWOA 1BU1A 2ROTA 1JXMA 1ARKA 1ZUYA 4JJBA 2E5KA 3U23A 1ZSGA 4AFZC 1OV3A 2ENMA 2JM8A 2BZ8A 1T3SA 1Y0MA 2EKHA 2EVRA 4Z88A 2JMCA 2KNBB 2FRYA 2DF6A 1QLYA 1GL5A 1SRMA 1ZLMA 3UF4A 3VS5A 2DVJA 2J7IA 2CH4A 1I1JA 1GRIA 2IIMA 2OI3A 3JV3A 5L23A 2FRWA 1MV3A 2HSPA 3LH5A 2M0YA 3RNJA 1OPKA 1T0JA 3THKA 3TSZA 5IXFA 2J6FA 1W6XA 3M0QA 2HEQA 1X2KA 4JPBW 1OEBA 5FWCA 2L3SA 2CUBA 3VS2A 2W0ZA 1KJWA 2LJ0A 2PTKA 1UECA 2C0TA 1AWJA 2EYYA 4AFUC 5FW9A 2JS0A 3PVQA 5I11A 2MIOA 1G83A 1ZX6A 1K1ZA 1K76A 2AKLA 4J9EA 1Z9ZA 2GQIA 1B3QA 1E7OA 1WXBA 4LUEA 1UJYA 2YUOA 4LN2A 2C0OA 4HCKA 1TUCA 4IIOA 2ESWA 5GJWB 1ZBJA 2V1RA 4RUGA 4EIKA 2L2PA 2ECZA 4E6RA 4J9GA 3SEMA 2KBTA 2DL8A 1E6GA 2KXCA 4HVWA 1IO6A 2F2VA 1HSQA 1RI9A 1LCKA 1PKSA 2LJ1A 2A36A 1X43A 4M4ZA 4AG2C 4FSSA 2KROA 2MCNA 2RQUA 1NLOC 3ZL7C 2KRMA 2K2MA 2VKNA 1CKBA 4J9FA 4JJDA 3TSWA 1M8MA 1QCFA 1S1NA 1T3LA 1YNZA 2DM1A 2K3BA 1ZUUA 2RF0A 4Z89A 1M3AA 1PRLC 2DL5A 1X6BA 2PZ1A 2RQWA 3QWYA 1W70A 2YDLA 2JM9A 3EHQA 2LMJA 2O2OA 2P4RA 2RN8A 2BTTA 2D8JA 1XOVA 1V1CA 2DL7A 1GCPA 2ED0A 1J3TA 1K4US 2YSQA 2O9VA 4IIMA 1UE9A 1Y57A 4J9BA 4OMLA 2DL4A 4OMPA 4Z8AA 4CC2A 4DEYA 4D8DA 1TG0A 3I35A 3O5ZA 1KIKA 4J9HA 5EC7A 1VYVA 1U5SA 1X2QA 1X69A 1VYUA 2HDAA 1NYFA 1YCSB 2KRSA 2LJ3A 1UJ0A 1NEGA 2RQRA 1WI7A 1Z9QA 2FPFA 2CUDA 1K0XA 2DL3A 1WDXA 2KT8A 2DBKA 1YWPA 3VS3A 4JJCA 4CC7A 1FYNA 2DYBA 1RLPC 2X3WD 2L0AA 2EPDA 2ABLA 2RMOA 2X3XD 1WXTA 1NYGA 4X1VA 4K11A 2EGEA 1M3BA 1JU5C 4QT7A 3IQLA 4F14A 2YUQA 1WLPB 4WCIA 3R6NA 3GBQA 3SHWA 2F2WA 4Y92A 4ORZA 2JMAA 2LQNA 2FPEA 3NPFA 3A98A 5I22A
chains in the Genus database with same CATH superfamily
1MGQA 1VIEA 2K57A 1VQ9Q 4AG1C 3ER0A 3QYGB 3NTHA 1PHTA 2K5LA 1M1KR 1WX6A 1F1BB 1VIFA 3CCSA 3CMAQ 2O88A 2PVGB 1JJ2A 1QVGP 5ECAA 2QDYB 3CBMA 2OTLA 2QA4T 1SHGA 3CCMA 1ACMB 1V29B 5FRMA 3REBB 3JSCA 2DZ9A 4BE0A 4R0KA 2WSCE 1KQ2A 1VQOQ 2JTMA 4EMGA 2PVDB 1Q81R 1NG2A 3NGPA 2VVKA 2X51A 1YJWA 2OTLQ 4F17A 1RAGB 1OU8A 1YJNA 4L6V5 1QQJA 5GMKl 3URGA 2GFUA 2GFAA 2MYSA 3RESA 3OW2P 4C5IA 3HFOA 2QQBA 1SPKA 3EG2A 1NLPC 4QVCA 3FEOA 1RAIB 1YIJQ 1UHFA 2O4XA 1M1KC 3JCMV 3JCMe 2XDPA 3VUZA 2RHUA 3OSSC 3QWXX 1QWFA 2EGCA 1VQ9T 3CCEQ 1N6AA 3JAME 2P4TA 1QMCA 3X28B 3OYAA 4JLGA 3H0IA 3CMAT 3VRYA 2D1XA 1H3HA 2AK5A 2LQ8A 3M58A 4E7LA 1G2BA 1VQ5A 3UATA 1Q81C 3VS7A 2JTFA 2CREA 2RI5A 2DIQA 3M4YA 1TTHB 1VQMQ 1JEGA 2DILA 3VRZA 2JT4A 1X01A 1XNIA 4DOWA 3QBYA 1TOVA 2DXCA 2O31A 4J6XA 2OTJA 3LH0A 2RQVA 3L2VA 3REAB 4ZTJA 1MNEA 3CXCA 3CQTA 1VQNA 4M7DB 2JVVA 4XU2A 1BKBA 2EYZA 4EPCA 5LJ3g 4J7FA 1U3OA 2JS2A 1GCQA 2HL3A 4QQGA 2ZPIB 4C92C 4HVVA 2LC4A 3A8MB 4JRQA 1E6HA 1YIJT 3M57A 1Y71A 3AHUA 1WHLA 1KFZA 2XK0A 3ULRB 5A2QE 3S3NA 3CCET 1OULA 1QVGA 2CZ7B 3J7AF 2EYWA 2IG0A 1AWOA 4CC4B 1B07A 2RB6A 2XHCA 4KGXB 3FC3A 3WVDB 1M30A 3TQ7P 1KD1U 1AWXA 2NWMA 2RI2A 4OMQA 1VQMT 4PJOE 1YI2T 1M3CA 2BZYA 1UDLA 2QEXQ 8AT1B 2RM4A 3QJ6A 2EBPA 4AFQC 4X9CA 3VYHB 1M4ZA 3OW2A 3CC7A 2L8DA 2A37A 2JXBA 3I9QA 3CCUA 1TUGB 4OMNA 1PC0A 5CK9A 1WGSA 1HJDA 2RO0A 4J9IA 2CYZB 4HCZA 4XU1A 1JQQA 2Y4YA 1VQKA 4A4FA 1KSWA 5C6SA 5CQXA 2RJEA 4D6WA 1SEMA 4BDYA 5GAMf 2DJQA 4C5EA 2GGRA 1GCQC 5J3BA 3CCUQ 3VUBA 1HK9A 4OF1A 4OGEA 1IHVA 1YHQA 2KSSA 3CCVQ 3NHNA 2DRMA 2L3QA 4C5HA 1TS9A 1S72Q 1VQ6A 4RTTA 2SRCA 4FYXB 1NPPA 1EFNA 2F1LA 1PSEA 2NUZA 3JB9F 2M16A 3MEVA 2VXEA 1YWOA 1BU1A 1UB4A 2QEXT 3V7CA 1LVKA 1NJIR 1I4K1 3OYJA 1ZSGA 4FM4B 1OV3A 1BI1A 2RHIA 1W2BS 5GMKj 4A4HA 2PVOB 2EIFA 2QGFB 1NPRA 2AIRB 2KNBB 4PJOF 2DF6A 1QLYA 1GL5A 3AT1B 3CCLT 3JB9H 2RHYA 2DVJA 2J7IA 4JDSA 4BY6B 4C0DC 3S3OA 8ATCB 1FWZA 1N8RU 1GRIA 2OI3A 1KQSS 2HSPA 4IUTA 4B6MA 4YTLA 2HQXA 2M0YA 1OPKA 4J5YA 2J6FA 4KBMB 1WHKA 5GAMd 2L3SA 4M78B 4X9DA 2E64A 3D7SB 2LJ0A 1UECA 2P84A 1AWJA 3CCVT 5HK3A 2JS0A 2KK4A 1S72T 2MMPA 5KE3A 3VYGA 4LUEA 4OB0B 4LN2A 3M59A 4IIOA 3I56A 2ESWA 3QIIA 2R57A 5LJ5j 1TH7A 4EIKA 2L2PA 2CZ1B 3QO3A 4M7DE 3BW1A 3CD6A 1G5VA 4FW1A 2BE9B 5EG2A 1HSQA 1RI9A 5A0DA 2A36A 2DYIA 5DLOA 3I56Q 3C12A 2EFIA 3UWNA 4IKFA 6AT1B 1S1NA 5DLQE 2DM1A 1BI3A 2RF0A 3G6EA 3GP8A 3LWHA 3LLRA 2DL5A 2EJFA 2RQWA 3L42A 2YDLA 2JM9A 4UC4A 2LMJA 2P0QA 1YFNA 2O9VA 2LNVA 4IIMA 1Y57A 3CC2Q 2DD5A 1JJ2S 1N8RR 3V7SA 5L8RE 5FLXE 3JB9J 1EIFA 4N4HA 2BIVA 1U5SA 4PJOA 2P0KA 2QGGA 1NYFA 5GAOm 2CP2A 2KRSA 3SFMA 3M5AA 5IT9E 1NEGA 1Z9QA 4L59A 2CUDA 1WDXA 1ZA2B 5KCOA 1C6VX 4QQDA 1YWPA 4JS5A 4CC7A 1FYNA 5GAN7 1RLPC 4R56A 4QQ6A 2X3WD 2L0AA 5FU7C 2ABLA 1RACB 1WXTA 4M78G 1IGQA 1NYGA 3OA6A 4TVRA 4K11A 2EGEA 2COWA 4M7DF 2QQSA 5FROA 2RJCA 1JU5C 3G71Q 4XTYA 5HY6A 3GBQA 3SHWA 5GAOq 5LJ5h 2DIGA 1N8RC 1WQ7A 2F2WA 2LTOA 4ORZA 1Y07A 3QUIA 3NPFA 3JCMh 1UGSB 3M0PA 4KGZB 3CC4Q 2NUTA 3CBOA 4CC3A 2YT6A 3CC2T 4X34A 2HCKA 3L1AA 1LNXA 2R5MA 5GANj 3M53A 1NBEB 4JJNK 2FHDA 1JBMA 3J81E 1IGUA 4E7ZA 5GANf 5KYWB 1UEBA 2KY9A 1VQ4Q 1UGVA 1KK7A 1ABOA 2I0NA 3CXCS 4EDUA 3CCJA 1HYOA 2MOXA 2MF2A 2OAUA 3PTAA 1PG5B 1VYTA 3MHXA 5DM7R 1JO8A 2ZPBB 3HRSA 4GBQA 4PJOC 1FX7A 3TVTA 3G71T 3H0HA 3V8LA 2QG9B 5GAN3 1QVFP 2CDTA 4HA8A 3OS2A 2LQKA 2QA4A 2CZ6B 2K2VA 4M78E 2E3HA 5CCAA 5IXBA 4C0FA 4AMCA 3TREA 2VWFA 1IZ6A 2ED1A 2FO0A 2RQTA 2KYMA 3A8GB 1AWWA 2COZA 2EWNA 1YN8A 4FT2A 1QVGS 3FDRA 2NYSA 3RIRA 2RPNA 3EG0A 2K7AA 2QASA 4D8KA 4LUDA 2QTVA 2DA9A 2GTJA 4C8QA 5GANd 2HBWA 2O9SA 1SHFA 1VQ4T 4J9CA 5CKHA 4F16A 4M7DA 3VS4A 4AFSC 3OYFA 4FYVB 4RTWA 5GMKm 4XAXB 2RA2A 3H9NA 2AZSA 4M7AB 1KQ1A 2LDMA 4JRPA 5FWBA 4J6YA 4N0AA 1N5ZA 1PNJA 1I0CA 3V7RA 1ZHIA 1AEYA 3CMEQ 1VQ9A 2EGAA 2F5KA 2QDLA 4LD6A 2X4JA 2ROLA 4EMHA 4RTZA 2SEMA 2X9HA 3CMAA 2LX7A 1VQLT 2K79A 1FMWA 1N27A 2KEAA 2G6FX 4HT8A 2VV5A 5GMKe 3QYHB 1VQOA 1H641 2QXFA 2DZCA 4BI3A 2F2XA 4M78F 1AVZC 2E65A 2H3JA 4E47A 1XTDA 1JRIA 5I2MA 2LP5A 2NUTB 2FEIA 4OB3B 1UGQB 1RI0A 1WHHA 4WF2A 4C5GA 3EGUA 2OAWA 3CCQT 2ZPFB 1AD5A 5LJ3j 1TUDA 4HVUA 3VS1A 4P5NA 4RCCA 1YIJA 1XQHA 2YUNA 2LCLA 5IN1A 1U1TA 3L2RA 3DKMA 2JTEA 5LJ3f 4A63B 2D0QB 5IHIA 1C1AA 5D6YA 3CMET 3CCEA 1QVFA 1B34B 1UGPB 3M0RA 3VS6A 2DTHA 4RKUE 3FRNA 2E4HA 2QQAA 4M7DC 1K9AA 2LT4A 1WFWA 3JB9G 5LJ5e 2FPDA 1Q7YU 5IHNA 3JCMQ 2DBMA 2EQUA 3P8HA 2L3PA 3WXMB 4RCBA 5HKCA 4RTUA 1T0HA 2C0IA 1VQMA 2M9UA 1YI2A 5IH2A 5C0MA 1VQ7Q 2K6DA 5HK0A 4AT1B 3UA6A 4PJOG 1ZSZA 4M7AG 3CPWP 3LYIA 1GXIE 5GAN2 1U1SA 4FYYB 2KVQG 1QKWA 4J7IA 1BK2A 2FYKA 1O75A 2CP7A 2V8JA 2DFUA 1YI2Q 3M0SA 1ZQ1A 1WIEA 2PNIA 2VXFA 2V8KA 4OB1B 2HD0A 4C8QB 4EMKB 1JXMA 5FU6B 2DETA 1ARKA 1ZUYA 4JJBA 1D1BA 4AFZC 5LJ3d 2GF7A 2ENMA 2JM8A 2RH2A 4DBQA 2EVRA 4MZTA 2FRYA 1SRMA 3MPUB 1BCOA 5KH6A 4E7JA 2DXUA 4OMFB 3UF4A 3VS5A 4BDZA 1K8AU 2AT1B 2RD1A 4M78A 2XICA 3MEWA 2X4XA 2GCXA 3S3MA 3LH5A 3I55T 3RNJA 3E9FA 1T0JA 4HCBA 3TSZA 3TU4K 3M0QA 3TCJA 2JOYA 2ZAEA 4MDWA 2QEXA 2K4YA 1VQ7T 5FWCA 2FZCB 5CKDA 1QP2A 3QJYA 1BI0A 3F70A 1KJWA 3G4ST 7AT1B 2PTKA 3QXEB 1G3TA 4AFUC 5FW9A 3PVQA 2E1HA 2MIOA 1Q7YR 4HT9A 1Z9ZA 2GQIA 1B3QA 4RG2A 3CCLA 1E7OA 2E10A 1UJYA 3DLMA 1TUCA 4M7AE 1OU9A 1M2VA 5KYNA 5IAYA 4RUGA 4NL3A 2ZCFB 3O8VA 1LOJA 3L2ZA 2DL8A 4PJMA 2Y4XA 5GANe 1IO6A 4QVDA 2ZPEB 3CCLQ 2RHZA 1LCKA 4A53A 4PFZA 1BYMA 4AG2C 4FSSA 1U8RA 3EH2A 4FL6A 3CCVA 2EQKA 2MCNA 1MMAA 2EYQA 2DTOA 2VKNA 4C92B 5GAOp 5GAMj 1S72A 2DERA 3GNGA 1T3LA 4BY6C 1ZUUA 4Y91A 4Z89A 3HSBA 1YJ9Q 2PZ1A 1KHCA 2X4YA 1Q7YC 3CCRQ 3CPWA 2RN8A 1IHWA 3HRTA 2D8JA 2ZPHB 4KT0E 1K73U 2DL7A 4C8QG 3X20B 2YSQA 4M78C 4OMLA 1VQNT 3GLXA 4OMPA 4M7DG 2V26A 1R0CB 1M5Q1 4Z8AA 4RG8A 4D8DA 4RMOA 3JB9I 3SD4A 2E6ZA 4DBFA 4M75B 3JB9D 2COYA 1VYVA 1ZSZB 2KDSA 1X69A 2HDAA 3MCAB 2YLBA 3A5ZB 2LJ3A 5CKFA 3MP8A 2VB6A 2FPFA 1IXDA 4FCYA 5I2SA 1OX9A 2YWWA 4JJCA 4PJOD 3NFCA 2DYBA 3QZ9B 4DOVA 4M7AF 1KD1R 3HKSA 3V8KA 3CEYA 1IREB 3QHSA 4X1VA 3X26B 5A0LA 1EZZB 4M77B 3H6ZA 1KG1A 5CR2A 2KI7A 3IQLA 3X25B 3R6OA 2LCCA 1IB8A 1K8AC 1YJ9T 5D6WA 1VQPQ 4L5GA 4Y92A 3CCRT 2JMAA 4GLKA 1LPLA 2XU8A 4LDXA 2FPEA 1YITT 4QW2A 1GBRA 5KYWA 4PJNA 3SWNB 4E2FB 3PVLA 1M27C 4VUBA 4DQ2A 2DTIA 2HKNA 3GF5A 2CP3A 3UPUA 4BI8B 2HZYA 1M1FA 3UA7A 4C8QE 2DVEA 2GNCA 5GAMh 1H92A 2J6OA 2GQVA 3BFMA 1ZUKA 3TEEA 3H0FA 1K9MU 1KD1C 3CPFA 3OYBA 4BI4A 1OX8A 1WQWA 1D1CA 1OZ2A 1AT1B 2FZKB 1VQKT 4QVZA 2XKOC 1M2VB 2OJ2A 1N9SA 2HSEB 4GLMA 2KE9A 3JCMX 1OQKA 2A28A 2DX1A 2M51A 3FLGA 3P8DA 3CC2A 3FIFA 1UGRB 2DE0X 5M9OA 4C0DB 1TSFA 3OYHA 3M56A 4A4KA 5LJ3e 1X75C 1K0SA 4PLLA 4ZGEB 2A7YA 4XQ3A 2MWOA 3LGFA 1VQPT 4FU6A 5GMKh 3EGXB 2E3IA 1GBQA 2CSQA 3KXTA 1U06A 2YRDA 4J8OA 4OVAA 2D8HA 5IHKA 3JCMc 1KQSP 1UHCA 1O9SA 2HAXA 1ZBXA 4M7AA 3OYIA 4JRKA 2D9TA 1BI2A 1X6OA 1PD0A 1Y7XA 3G71A 5HCKA 4IURA 4WTOB 3RBBB 4R55A 3OBWA 5KCHA 2EKOA 3OYLA 2LZ6B 4LNPA 4C8QF 2MAMA 5AYFA 3OMCA 1QVFS 1VQ8Q 1Y96B 2CGHA 1MHNA 2RK1A 3CC4A 2JW4A 4C92E 4M7DD 1UFFA 3EG3A 1OPLA 3M4GA 3A8HB 1BBZA 2FB7A 1MNDA 2KMTA 2V1QA 3VKIA 2B86A 1M90U 1SSHA 1RL2A 2W10A 5LJ5g 4RTYA 4NOYA 5CO7A 4KULA 3OB9A 1VQ4A 1OZ3A 3C95A 3JCMg 2AHJB 2EQMA 2V8IA 3LX7A 2CSIA 5CQYA 1D3BA 2R58A 3MJXA 4PNOA 4M75E 2EQIA 3EGDB 3C0CA 2BUDA 2DPPB 1RUWA 4DA4A 1QP3A 2LRQA 2XI9A 4OMMA 1MMDA 1TWBA 1B34A 3DB4A 3UT1A 1SF9A 1D09B 2KR3A 3J80E 1GFCA 4LE9A 1OOTA 2MK5A 4RTXA 1WJQA 3OBYA 3JCMP 2KT1A 1YP5A 1VQ8T 2QI2A 1MV0B 2JZ2A 4M7AC 5AT1B 1NEBA 2QTXA 1I5LA 4M77E 1ZA1B 4O6JA 1R77A 3OYGA 1QCNA 1UTIA 2K5FA 2Z0WA 3GIBA 3A1PA 1UUEA 1AOJA 3PFSA 1KC8U 3VS0A 1VQLQ 3HPWA 5D6XA 3SB2A 3ASKA 4KRTA 3V8JA 4C0GA 2E41A 3H41A 4C92F 4F04B 1RABB 1ABQA 4F7UE 3BE3A 1KQSA 3CCQA 2RK2A 2F69A 3META 2J06A 5GAN4 4JZ4A 3OS0A 4BB7A 1R0BG 1WYXA 2KYBA 4EMKA 5GAMe 3PE0A 1M90R 3CMEA 2CT3A 2NLUA 4NS5A 2A08A 3OS5A 3PIPA 1Q81U 1SRLA 1M9SA 3OYEA 3CCQQ 2DEUA 4M75F 2R5AA 4JS4A 2DRKA 2ROTA 2DKGA 3OW2S 3U23A 1QCOA 2BZ8A 2VGMA 4ZGJB 5GANh 3T9NA 3M54A 2D6FA 4Z88A 4BACA 2JMCA 3JRZA 1Q95G 1ZLMA 3KUFA 2VUBA 2RJFA 1I1JA 2JUFA 3JCMW 3DB3A 1PM3A 4E7SA 2FRWA 5L23A 1MV3A 4LDUA 3HL8A 4M77F 3L2QA 3ZEHA 3H8ZA 3THKA 3CPWS 5IXFA 1M90C 4JPBW 2DK3A 4CI0C 1YBYA 2CUBA 4M78D 1WJSA 3VS2A 3A8LB 1YCYA 2C0TA 3L2WA 1KC8R 4Z02A 4F7UF 4KUIA 1D3BB 1G83A 1ZX6A 1K76A 4J9EA 2RJDA 3RKXA 1WNLA 3OYKA 1VOMA 2YUOA 4MZMA 4XTXA 4HCKA 3MKDA 5CKEA 5FRNA 1ZBJA 2V1RA 3I55A 2YXYA 2HQHA 3DLLA 1D0ZA 2ECZA 3MEAA 5A0GA 4J9GA 3SEMA 2KBTA 4KH1B 4C8QC 4EMKC 4C92A 2KXCA 1BCMA 4HVWA 3EFRA 5FU6C 1I5OB 1VQ7A 3JCMJ 2DXTA 2OX7A 4J83A 3G4SA 3CCSQ 4ATOA 1M8VA 4ME7A 2NUPA 2RQUA 1NLOC 2E6NA 2YLCA 1WJRA 3QPHA 3I55Q 4XTWA 2K2MA 1CKBA 4JJDA 3CCMQ 3TSWA 1M8MA 1QCFA 4KH0B 4N0AC 4ZN3A 1YNZA 2K3BA 4BUGA 1M3AA 1PRLC 2CS7A 1KC8C 1G3YA 1XJWB 5CAIA 3QWYA 2EJ9A 1W70A 2QAZA 2VYTA 4M75A 2O2OA 2P4RA 3G4SQ 1XOVA 1V1CA 3OYCA 1GCPA 1WHJA 3E1SA 1YJWQ 1J3TA 3GOXA 1UE9A 4J9BA 4ELZC 1YJNQ 2DL4A 2ZPGB 2DO3A 4CC2A 4ZGDB 1TG0A 2BKDN 3O5ZA 5EC7A 2Y90A 4HCCA 5J26A 3PGGA 2HL5C 4KGVB 2M0OA 1YCSB 3OS1A 5CIUA 1QW1A 2L3RA 2PQWA 4DBRA 4MDXA 2DL3A 4M77A 5GAN5 2K3YA 4II1A 2KT8A 2DBKA 3RMSA 1M2OA 3JCMb 3VS3A 2BE7D 2E12A 1VQOT 1KHIA 4BD3A 2EPDA 3CCST 2X3XD 4GY5A 2O01E 2OTLT 2A3LA 1Q86U 3EG9A 3X24B 1VQ5Q 3CCMT 4V2SA 1M3BA 2E5QA 5LJ3h 4FT4A 4F14A 3E19A 2YUQA 4F7UA 3HP9A 4WCIA 3R6NA 3SWNA 2WACA 3MP6A 2CP0A 5KYXB 4ELYC 2LQNA 2RI3A 2OTJQ 2FL7A 2H3EB 3A98A 1YJWT 2FVUA 4FW2A 1VQNQ 1Q82U 1YJNT 2AZVA 3BDUA 1HD3A 2D0NA 2FZGB 2LCSA 1NJIU 5GMKi 2B8AA 4E7HA 1CSKA 1FMKA 3PNWC 1WHGA 2DMOA 4NL2A 2KXDA 1VA7A 2QQRA 3EG1A 4PLIA 4M75C 2G3RA 4J6WA 1ZSZC 4XU0A 3M0TA 3I5RA 3OYDA 1NE8A 1YJ9A 1VUBA 2DXBA 3CCRA 1GFDA 1X27A 1YITA 2I2LA 3RUXA 4A54A 4FYWB 2M02A 1PKTA 2XDBA 1P92A 1UG1A 1RAAB 1NM7A 2EYXA 3EGXA 3OMGA 3VV0A 1VQ5T 2DD4A 2XG8D 1RAFB 1I07A 2KAFA 1RLQC 4M77C 4JUVA 2NUPB 4PJLA 4XTUA 1AZEA 5GAOn 1YITQ 3M9QA 3QKJA 4E7KA 4A4EA 4N4IA 2OTJT 4IUVA 1K8AR 3VJPA 2XIDA 4ZNXA 2L5QA 4PFOA 2AKKA 4B9WA 3CC7Q 3QZ5B 1Q86R 3QDRB 5CVIA 2IPOB 3GNFB 2GBQA 4DBHA 1MMNA 2O4XB 3SWNC 1BIAA 3EHRA 2J05A 3M0UA 5DY9A 2CP5A 2EAYA 1W1FA 3EFSA 1Y96A 3SDZA 1WXUA 3OYYA 2DNUA 1PRMC 1VQKQ 3OYMA 4ESRA 2WSFE 4CRIA 4RTVA 1DJ7B 5KYUA 1VQPA 1HXDA 1Q82R 3LW5E 4M7AD 2MPXC 4OMOA 2XDDA 3LGLA 4J9DA 1YHQQ 3FJPA 4Y28E 2K5IA 2HMAA 1VQ6Q 1BB9A 1EX4A 3EFOA 1AZGB 4PKCC 2CT4A 4JLIA 1QWEA 3EGDA 1MMGA 2CP6A 4MMLA 3EG9B 1Q86C 2EW3A 1LJOA 5I21A 1QKXA 3PMTA 4F7UB 3P8BB 2KRNA 4Q5WA 3UDCA 3EAEA 3CC7T 3E2UA 2QYZA 2GTOA 4PK4A 1QVPA 5GAMg 1PWTA 3CCUT 2HKQB 2YUPA 3FJ5A 1Q82C 1PCXA 4XU3A 4HXJA 4E7IA 2DLPA 2IVWA 2KGTA 3ZFJA 4C92G 1K73R 2WSEE 1NJIC 1WA7A 2H8HA 3HFNA 1SSFA 1X6GA 1M1GA 1TXQA 1YHQT 3INZA 4ZN1A 2LT1A 3RR6A 5LJ5f 3E9GA 4IUPA 1VQ6T 2RNAA 4PJJA 5LL6S 3N5BB 3WVEB 5KYYA 4BE2A 2XMFA 3I5SA 4N4GA 4JRIA 3JCMf 2K9GA 4M75G 1MUZA 1R8OB 3HHTB 2VASA 1W2BP 3M55A 2E70A 3VU3C 1G3WA 4JZ3A 3KFVA 5KE2A 4FSXA 3CD6Q 4ZTFA 4KUDK 3GPLA 4MZPA 4B9XA 1A0NB 1I81A 2BZXA 1N9RA 1JXOA 1V76A 3NMZC 2FG0A 2QQ9A 1K73C 1VQ8A 2RHXA 2CH4W 4LDWA 2LNHB 1JB0E 3G7ZA 4DEXA 3Q1JA 4OB2B 2LQWA 4IUUA 1CKAA 1H8KA 2VGNA 2CZ0B 3FB9A 1D0YA 4O5VA 5GJVB 3C4SA 4M77G 2J6KA 3G6EQ 2JJ9A 1FXXA 4C8QD 3RMQA 2A0FB 1B7TA 3RDVA 2E5KA 2X4WA 2EJGA 1T3SA 1Y0MA 2EKHA 2ATCB 3BY7A 5LJ5d 1K9MR 4F7UG 3QDFA 5KYUB 4MMKA 2HNIA 3A8OB 2JNGA 3ME9A 1PD1A 3EH1A 3JCMd 2CH4A 2HBPA 4XK8E 4ANJA 3LWIA 1PSFA 2IIMA 3JV3A 3I56T 2YRCA 3RKYA 3OY9A 5J39A 4IUQA 3EFOB 1W6XA 2HEQA 1X2KA 4OGCA 1WHMA 3CD6T 1SKUB 1OEBA 2ZGWA 9ATCB 2X35A 1RAHB 1AHJB 3NTIA 5CKBA 3RKWA 2W0ZA 3MEUA 2KQWA 1D0XA 2EYYA 4PL6A 3G1JA 2LX9A 5I11A 1K1ZA 2AKLA 1WXBA 3G6ET 2DAQA 1VQLA 2C0OA 1WPYA 4OP0A 1K9MC 1TU0B 5GJWB 1JJ2P 4LDVA 4XTVA 4BE1A 1G3SA 2ZZDA 4LDYA 2C06A 4E6RA 1C0MA 1E6GA 2QK0A 5FU7B 2F2VA 2VC8A 3MO8A 1OI1A 5GAN6 5GAOr 1PKSA 2LJ1A 5GAOl 1X43A 4M4ZA 1W2BA 3ZBDA 4HKEA 2KROA 3QG1A 3ZL7C 2KRMA 2PU9B 3PIOA 4J9FA 4C92D 1M1KU 3RERA 2LVMA 2EQJA 3MP1A 3CBPA 4LD9K 5KYYB 2DEQA 1I8FA 1X6BA 4PFPA 3EHQA 3CCJQ 2BTTA 3HTRA 2MWPA 2K3XA 1RAEB 2YHTA 2ED0A 1K4US 3CC4T 3PT9A 3PMIA 4LXCA 4DEYA 1OYXA 4XTZA 3I35A 4M75D 4QKUA 3QSUA 4J9HA 3OYNA 1KIKA 2JN0A 3HRUA 1X2QA 2QA4Q 1VYUA 3NTKA 2XD0A 1SG5A 1UJ0A 1RADB 2PUKB 2RQRA 1FMVA 3KBGA 5GANg 1WI7A 3L2UA 1K0XA 2HQEA 4PJOB 1D1AA 1H3ZA 5GAN8 4C0ZA 5D7UA 3OQ5A 2RMOA 2M1HA 1WZOA 5KYXA 2L89A 3CXCP 2P0PA 2PUOB 4M77D 1W4SA 2YRVA 3BDLA 4QT7A 2MI6A 3OSVA 1WLPB 1NZ9A 1BIBA 2DJZA 2CKKA 2F5TX 1G8XA 4A4GA 3S6WA 3C94A 3CCJT 4FIBA 1IRXA 5I22A
chains in the Genus database with same CATH topology
3M0PA 1GBRA 4CC3A 2YT6A 2AZVA 1HD3A 1M27C 2HCKA 2D0NA 3PVLA 4AG1C 2LCSA 1PHTA 1WX6A 2O88A 3UA7A 1CSKA 1FMKA 2GNCA 2DMOA 5ECAA 1H92A 2J6OA 1ZUKA 1SHGA 1VA7A 2KXDA 3H0FA 3EG1A 3REBB 1UGVA 3M0TA 3I5RA 1ABOA 2I0NA 4R0KA 2MOXA 2OJ2A 1GFDA 1X27A 1NG2A 4GLMA 2KE9A 1VYTA 3NGPA 2VVKA 2A28A 2DX1A 1PKTA 2M51A 1JO8A 4F17A 4GBQA 1UG1A 1NM7A 2EYXA 2DE0X 3TVTA 3H0HA 1I07A 1RLQC 1K0SA 2CDTA 1SPKA 3EG2A 1AZEA 1NLPC 5IXBA 2VWFA 1UHFA 2RQTA 2ED1A 2FO0A 2KYMA 1AWWA 1GBQA 2CSQA 1YN8A 1U06A 4ZNXA 2RPNA 2D8HA 2AKKA 3EG0A 3QWXX 5IHKA 1QWFA 2EGCA 2K7AA 1UHCA 2GBQA 4D8KA 4LUDA 2DA9A 3H0IA 2GTJA 3VRYA 2D1XA 1H3HA 2AK5A 3EHRA 2J05A 2HBWA 3M0UA 1G2BA 2O9SA 1SHFA 3UATA 3VS7A 1W1FA 5HCKA 4J9CA 1WXUA 3RBBB 4F16A 2CREA 2DNUA 3VS4A 4AFSC 1PRMC 4RTWA 1JEGA 4ESRA 2DILA 3VRZA 4RTVA 2AZSA 2JT4A 2LZ6B 4LNPA 2O31A 5FWBA 4OMOA 2RQVA 1N5ZA 1PNJA 3REAB 1I0CA 4J9DA 3CQTA 1AEYA 2JW4A 1UFFA 2EYZA 3EG3A 1OPLA 2EGAA 1BB9A 2QDLA 1BBZA 2ROLA 1U3OA 4RTZA 2JS2A 2V1QA 1GCQA 2SEMA 2B86A 1AZGB 2LX7A 1SSHA 4HVVA 2W10A 4RTYA 2CT4A 1QWEA 2K79A 1E6HA 2KEAA 2EW3A 2G6FX 1QKXA 2CSIA 2KRNA 1KFZA 3ULRB 2EQIA 2GTOA 2F2XA 3C0CA 1AVZC 2EYWA 1PWTA 1RUWA 4CC4B 1AWOA 2LP5A 1B07A 2YUPA 3FJ5A 2FEIA 4HXJA 2DLPA 1M30A 2KGTA 4OMMA 1AWXA 2NWMA 4OMQA 1WA7A 3EGUA 2OAWA 2H8HA 1M3CA 1AD5A 1TUDA 2BZYA 1UDLA 2KR3A 4HVUA 3VS1A 1GFCA 4LE9A 1OOTA 4RTXA 2KT1A 2YUNA 1YP5A 1X6GA 2EBPA 4AFQC 2JTEA 4A63B 1MV0B 5IHIA 1NEBA 1UTIA 2RNAA 3M0RA 3VS6A 2A37A 1UUEA 1AOJA 2JXBA 2XMFA 3I5SA 3I9QA 3VS0A 1K9AA 2K9GA 1WFWA 4OMNA 2FPDA 5IHNA 2DBMA 1MUZA 4KRTA 1HJDA 2L3PA 3H41A 4J9IA 1ABQA 4JZ3A 3KFVA 4RTUA 1JQQA 1T0HA 2C0IA 1KSWA 5IH2A 1SEMA 2K6DA 2J06A 2BZXA 2DJQA 1A0NB 3UA6A 4JZ4A 1JXOA 3NMZC 1WYXA 2FG0A 2KYBA 2GGRA 1GCQC 2CH4W 2LNHB 3PE0A 3NHNA 2CT3A 4DEXA 2DRMA 2L3QA 2LQWA 1CKAA 1H8KA 1QKWA 4RTTA 1BK2A 2A08A 2SRCA 5GJVB 1SRLA 1EFNA 2J6KA 2NUZA 3M0SA 1WIEA 2PNIA 2DRKA 1YWOA 1BU1A 2ROTA 1JXMA 1ARKA 1ZUYA 4JJBA 2E5KA 3U23A 1ZSGA 4AFZC 1OV3A 2ENMA 2JM8A 2BZ8A 1T3SA 1Y0MA 2EKHA 2EVRA 4Z88A 2JMCA 2KNBB 2FRYA 2DF6A 1QLYA 1GL5A 1SRMA 1ZLMA 3UF4A 3VS5A 2DVJA 2J7IA 2CH4A 1I1JA 1GRIA 2IIMA 2OI3A 3JV3A 5L23A 2FRWA 1MV3A 2HSPA 3LH5A 2M0YA 3RNJA 1OPKA 1T0JA 3THKA 3TSZA 5IXFA 2J6FA 1W6XA 3M0QA 2HEQA 1X2KA 4JPBW 1OEBA 5FWCA 2L3SA 2CUBA 3VS2A 2W0ZA 1KJWA 2LJ0A 2PTKA 1UECA 2C0TA 1AWJA 2EYYA 4AFUC 5FW9A 2JS0A 3PVQA 5I11A 2MIOA 1G83A 1ZX6A 1K1ZA 1K76A 2AKLA 4J9EA 1Z9ZA 2GQIA 1B3QA 1E7OA 1WXBA 4LUEA 1UJYA 2YUOA 4LN2A 2C0OA 4HCKA 1TUCA 4IIOA 2ESWA 5GJWB 1ZBJA 2V1RA 4RUGA 4EIKA 2L2PA 2ECZA 4E6RA 4J9GA 3SEMA 2KBTA 2DL8A 1E6GA 2KXCA 4HVWA 1IO6A 2F2VA 1HSQA 1RI9A 1LCKA 1PKSA 2LJ1A 2A36A 1X43A 4M4ZA 4AG2C 4FSSA 2KROA 2MCNA 2RQUA 1NLOC 3ZL7C 2KRMA 2K2MA 2VKNA 1CKBA 4J9FA 4JJDA 3TSWA 1M8MA 1QCFA 1S1NA 1T3LA 1YNZA 2DM1A 2K3BA 1ZUUA 2RF0A 4Z89A 1M3AA 1PRLC 2DL5A 1X6BA 2PZ1A 2RQWA 3QWYA 1W70A 2YDLA 2JM9A 3EHQA 2LMJA 2O2OA 2P4RA 2RN8A 2BTTA 2D8JA 1XOVA 1V1CA 2DL7A 1GCPA 2ED0A 1J3TA 1K4US 2YSQA 2O9VA 4IIMA 1UE9A 1Y57A 4J9BA 4OMLA 2DL4A 4OMPA 4Z8AA 4CC2A 4DEYA 4D8DA 1TG0A 3I35A 3O5ZA 1KIKA 4J9HA 5EC7A 1VYVA 1U5SA 1X2QA 1X69A 1VYUA 2HDAA 1NYFA 1YCSB 2KRSA 2LJ3A 1UJ0A 1NEGA 2RQRA 1WI7A 1Z9QA 2FPFA 2CUDA 1K0XA 2DL3A 1WDXA 2KT8A 2DBKA 1YWPA 3VS3A 4JJCA 4CC7A 1FYNA 2DYBA 1RLPC 2X3WD 2L0AA 2EPDA 2ABLA 2RMOA 2X3XD 1WXTA 1NYGA 4X1VA 4K11A 2EGEA 1M3BA 1JU5C 4QT7A 3IQLA 4F14A 2YUQA 1WLPB 4WCIA 3R6NA 3GBQA 3SHWA 2F2WA 4Y92A 4ORZA 2JMAA 2LQNA 2FPEA 3NPFA 3A98A 5I22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0P A;  1GBR A;  4CC3 A;  2YT6 A;  2AZV A;  1HD3 A;  1M27 C;  2HCK A;  2D0N A;  3PVL A;  4AG1 C;  2LCS A;  1PHT A;  1WX6 A;  2O88 A;  3UA7 A;  1CSK A;  1FMK A;  2GNC A;  2DMO A;  5ECA A;  1H92 A;  2J6O A;  1ZUK A;  1SHG A;  1VA7 A;  2KXD A;  3H0F A;  3EG1 A;  3REB B;  1UGV A;  3M0T A;  3I5R A;  1ABO A;  2I0N A;  4R0K A;  2MOX A;  2OJ2 A;  1GFD A;  1X27 A;  1NG2 A;  4GLM A;  2KE9 A;  1VYT A;  3NGP A;  2VVK A;  2A28 A;  2DX1 A;  1PKT A;  2M51 A;  1JO8 A;  4F17 A;  4GBQ A;  1UG1 A;  1NM7 A;  2EYX A;  2DE0 X;  3TVT A;  3H0H A;  1I07 A;  1RLQ C;  1K0S A;  2CDT A;  1SPK A;  3EG2 A;  1AZE A;  1NLP C;  5IXB A;  2VWF A;  1UHF A;  2RQT A;  2ED1 A;  2FO0 A;  2KYM A;  1AWW A;  1GBQ A;  2CSQ A;  1YN8 A;  1U06 A;  4ZNX A;  2RPN A;  2D8H A;  2AKK A;  3EG0 A;  3QWX X;  5IHK A;  1QWF A;  2EGC A;  2K7A A;  1UHC A;  2GBQ A;  4D8K A;  4LUD A;  2DA9 A;  3H0I A;  2GTJ A;  3VRY A;  2D1X A;  1H3H A;  2AK5 A;  3EHR A;  2J05 A;  2HBW A;  3M0U A;  1G2B A;  2O9S A;  1SHF A;  3UAT A;  3VS7 A;  1W1F A;  5HCK A;  4J9C A;  1WXU A;  3RBB B;  4F16 A;  2CRE A;  2DNU A;  3VS4 A;  4AFS C;  1PRM C;  4RTW A;  1JEG A;  4ESR A;  2DIL A;  3VRZ A;  4RTV A;  2AZS A;  2JT4 A;  2LZ6 B;  4LNP A;  2O31 A;  5FWB A;  4OMO A;  2RQV A;  1N5Z A;  1PNJ A;  3REA B;  1I0C A;  4J9D A;  3CQT A;  1AEY A;  2JW4 A;  1UFF A;  2EYZ A;  3EG3 A;  1OPL A;  2EGA A;  1BB9 A;  2QDL A;  1BBZ A;  2ROL A;  1U3O A;  4RTZ A;  2JS2 A;  2V1Q A;  1GCQ A;  2SEM A;  2B86 A;  1AZG B;  2LX7 A;  1SSH A;  4HVV A;  2W10 A;  4RTY A;  2CT4 A;  1QWE A;  2K79 A;  1E6H A;  2KEA A;  2EW3 A;  2G6F X;  1QKX A;  2CSI A;  2KRN A;  1KFZ A;  3ULR B;  2EQI A;  2GTO A;  2F2X A;  3C0C A;  1AVZ C;  2EYW A;  1PWT A;  1RUW A;  4CC4 B;  1AWO A;  2LP5 A;  1B07 A;  2YUP A;  3FJ5 A;  2FEI A;  4HXJ A;  2DLP A;  1M30 A;  2KGT A;  4OMM A;  1AWX A;  2NWM A;  4OMQ A;  1WA7 A;  3EGU A;  2OAW A;  2H8H A;  1M3C A;  1AD5 A;  1TUD A;  2BZY A;  1UDL A;  2KR3 A;  4HVU A;  3VS1 A;  1GFC A;  4LE9 A;  1OOT A;  4RTX A;  2KT1 A;  2YUN A;  1YP5 A;  1X6G A;  2EBP A;  4AFQ C;  2JTE A;  4A63 B;  1MV0 B;  5IHI A;  1NEB A;  1UTI A;  2RNA A;  3M0R A;  3VS6 A;  2A37 A;  1UUE A;  1AOJ A;  2JXB A;  2XMF A;  3I5S A;  3I9Q A;  3VS0 A;  1K9A A;  2K9G A;  1WFW A;  4OMN A;  2FPD A;  5IHN A;  2DBM A;  1MUZ A;  4KRT A;  1HJD A;  2L3P A;  3H41 A;  4J9I A;  1ABQ A;  4JZ3 A;  3KFV A;  4RTU A;  1JQQ A;  1T0H A;  2C0I A;  1KSW A;  5IH2 A;  1SEM A;  2K6D A;  2J06 A;  2BZX A;  2DJQ A;  1A0N B;  3UA6 A;  4JZ4 A;  1JXO A;  3NMZ C;  1WYX A;  2FG0 A;  2KYB A;  2GGR A;  1GCQ C;  2CH4 W;  2LNH B;  3PE0 A;  3NHN A;  2CT3 A;  4DEX A;  2DRM A;  2L3Q A;  2LQW A;  1CKA A;  1H8K A;  1QKW A;  4RTT A;  1BK2 A;  2A08 A;  2SRC A;  5GJV B;  1SRL A;  1EFN A;  2J6K A;  2NUZ A;  3M0S A;  1WIE A;  2PNI A;  2DRK A;  1YWO A;  1BU1 A;  2ROT A;  1JXM A;  1ARK A;  1ZUY A;  4JJB A;  2E5K A;  3U23 A;  1ZSG A;  4AFZ C;  1OV3 A;  2ENM A;  2JM8 A;  2BZ8 A;  1T3S A;  1Y0M A;  2EKH A;  2EVR A;  4Z88 A;  2JMC A;  2KNB B;  2FRY A;  2DF6 A;  1QLY A;  1GL5 A;  1SRM A;  1ZLM A;  3UF4 A;  3VS5 A;  2DVJ A;  2J7I A;  2CH4 A;  1I1J A;  1GRI A;  2IIM A;  2OI3 A;  3JV3 A;  5L23 A;  2FRW A;  1MV3 A;  2HSP A;  3LH5 A;  2M0Y A;  3RNJ A;  1OPK A;  1T0J A;  3THK A;  3TSZ A;  5IXF A;  2J6F A;  1W6X A;  3M0Q A;  2HEQ A;  1X2K A;  4JPB W;  1OEB A;  5FWC A;  2L3S A;  2CUB A;  3VS2 A;  2W0Z A;  1KJW A;  2LJ0 A;  2PTK A;  1UEC A;  2C0T A;  1AWJ A;  2EYY A;  4AFU C;  5FW9 A;  2JS0 A;  3PVQ A;  5I11 A;  2MIO A;  1G83 A;  1ZX6 A;  1K1Z A;  1K76 A;  2AKL A;  4J9E A;  1Z9Z A;  2GQI A;  1B3Q A;  1E7O A;  1WXB A;  4LUE A;  1UJY A;  2YUO A;  4LN2 A;  2C0O A;  4HCK A;  1TUC A;  4IIO A;  2ESW A;  5GJW B;  1ZBJ A;  2V1R A;  4RUG A;  4EIK A;  2L2P A;  2ECZ A;  4E6R A;  4J9G A;  3SEM A;  2KBT A;  2DL8 A;  1E6G A;  2KXC A;  4HVW A;  1IO6 A;  2F2V A;  1HSQ A;  1RI9 A;  1LCK A;  1PKS A;  2LJ1 A;  2A36 A;  1X43 A;  4M4Z A;  4AG2 C;  4FSS A;  2KRO A;  2MCN A;  2RQU A;  1NLO C;  3ZL7 C;  2KRM A;  2K2M A;  2VKN A;  1CKB A;  4J9F A;  4JJD A;  3TSW A;  1M8M A;  1QCF A;  1S1N A;  1T3L A;  1YNZ A;  2DM1 A;  2K3B A;  1ZUU A;  2RF0 A;  4Z89 A;  1M3A A;  1PRL C;  2DL5 A;  1X6B A;  2PZ1 A;  2RQW A;  3QWY A;  1W70 A;  2YDL A;  2JM9 A;  3EHQ A;  2LMJ A;  2O2O A;  2P4R A;  2RN8 A;  2BTT A;  2D8J A;  1XOV A;  1V1C A;  2DL7 A;  1GCP A;  2ED0 A;  1J3T A;  1K4U S;  2YSQ A;  2O9V A;  4IIM A;  1UE9 A;  1Y57 A;  4J9B A;  4OML A;  2DL4 A;  4OMP A;  4Z8A A;  4CC2 A;  4DEY A;  4D8D A;  1TG0 A;  3I35 A;  3O5Z A;  1KIK A;  4J9H A;  5EC7 A;  1VYV A;  1U5S A;  1X2Q A;  1X69 A;  1VYU A;  2HDA A;  1NYF A;  1YCS B;  2KRS A;  2LJ3 A;  1UJ0 A;  1NEG A;  2RQR A;  1WI7 A;  1Z9Q A;  2FPF A;  2CUD A;  1K0X A;  2DL3 A;  1WDX A;  2KT8 A;  2DBK A;  1YWP A;  3VS3 A;  4JJC A;  4CC7 A;  1FYN A;  2DYB A;  1RLP C;  2X3W D;  2L0A A;  2EPD A;  2ABL A;  2RMO A;  2X3X D;  1WXT A;  1NYG A;  4X1V A;  4K11 A;  2EGE A;  1M3B A;  1JU5 C;  4QT7 A;  3IQL A;  4F14 A;  2YUQ A;  1WLP B;  4WCI A;  3R6N A;  3GBQ A;  3SHW A;  2F2W A;  4Y92 A;  4ORZ A;  2JMA A;  2LQN A;  2FPE A;  3NPF A;  3A98 A;  5I22 A; 
#chains in the Genus database with same CATH topology
 1MGQ A;  1VIE A;  2K57 A;  1VQ9 Q;  4AG1 C;  3ER0 A;  3QYG B;  3NTH A;  1PHT A;  2K5L A;  1M1K R;  1WX6 A;  1F1B B;  1VIF A;  3CCS A;  3CMA Q;  2O88 A;  2PVG B;  1JJ2 A;  1QVG P;  5ECA A;  2QDY B;  3CBM A;  2OTL A;  2QA4 T;  1SHG A;  3CCM A;  1ACM B;  1V29 B;  5FRM A;  3REB B;  3JSC A;  2DZ9 A;  4BE0 A;  4R0K A;  2WSC E;  1KQ2 A;  1VQO Q;  2JTM A;  4EMG A;  2PVD B;  1Q81 R;  1NG2 A;  3NGP A;  2VVK A;  2X51 A;  1YJW A;  2OTL Q;  4F17 A;  1RAG B;  1OU8 A;  1YJN A;  4L6V 5;  1QQJ A;  5GMK l;  3URG A;  2GFU A;  2GFA A;  2MYS A;  3RES A;  3OW2 P;  4C5I A;  3HFO A;  2QQB A;  1SPK A;  3EG2 A;  1NLP C;  4QVC A;  3FEO A;  1RAI B;  1YIJ Q;  1UHF A;  2O4X A;  1M1K C;  3JCM V;  3JCM e;  2XDP A;  3VUZ A;  2RHU A;  3OSS C;  3QWX X;  1QWF A;  2EGC A;  1VQ9 T;  3CCE Q;  1N6A A;  3JAM E;  2P4T A;  1QMC A;  3X28 B;  3OYA A;  4JLG A;  3H0I A;  3CMA T;  3VRY A;  2D1X A;  1H3H A;  2AK5 A;  2LQ8 A;  3M58 A;  4E7L A;  1G2B A;  1VQ5 A;  3UAT A;  1Q81 C;  3VS7 A;  2JTF A;  2CRE A;  2RI5 A;  2DIQ A;  3M4Y A;  1TTH B;  1VQM Q;  1JEG A;  2DIL A;  3VRZ A;  2JT4 A;  1X01 A;  1XNI A;  4DOW A;  3QBY A;  1TOV A;  2DXC A;  2O31 A;  4J6X A;  2OTJ A;  3LH0 A;  2RQV A;  3L2V A;  3REA B;  4ZTJ A;  1MNE A;  3CXC A;  3CQT A;  1VQN A;  4M7D B;  2JVV A;  4XU2 A;  1BKB A;  2EYZ A;  4EPC A;  5LJ3 g;  4J7F A;  1U3O A;  2JS2 A;  1GCQ A;  2HL3 A;  4QQG A;  2ZPI B;  4C92 C;  4HVV A;  2LC4 A;  3A8M B;  4JRQ A;  1E6H A;  1YIJ T;  3M57 A;  1Y71 A;  3AHU A;  1WHL A;  1KFZ A;  2XK0 A;  3ULR B;  5A2Q E;  3S3N A;  3CCE T;  1OUL A;  1QVG A;  2CZ7 B;  3J7A F;  2EYW A;  2IG0 A;  1AWO A;  4CC4 B;  1B07 A;  2RB6 A;  2XHC A;  4KGX B;  3FC3 A;  3WVD B;  1M30 A;  3TQ7 P;  1KD1 U;  1AWX A;  2NWM A;  2RI2 A;  4OMQ A;  1VQM T;  4PJO E;  1YI2 T;  1M3C A;  2BZY A;  1UDL A;  2QEX Q;  8AT1 B;  2RM4 A;  3QJ6 A;  2EBP A;  4AFQ C;  4X9C A;  3VYH B;  1M4Z A;  3OW2 A;  3CC7 A;  2L8D A;  2A37 A;  2JXB A;  3I9Q A;  3CCU A;  1TUG B;  4OMN A;  1PC0 A;  5CK9 A;  1WGS A;  1HJD A;  2RO0 A;  4J9I A;  2CYZ B;  4HCZ A;  4XU1 A;  1JQQ A;  2Y4Y A;  1VQK A;  4A4F A;  1KSW A;  5C6S A;  5CQX A;  2RJE A;  4D6W A;  1SEM A;  4BDY A;  5GAM f;  2DJQ A;  4C5E A;  2GGR A;  1GCQ C;  5J3B A;  3CCU Q;  3VUB A;  1HK9 A;  4OF1 A;  4OGE A;  1IHV A;  1YHQ A;  2KSS A;  3CCV Q;  3NHN A;  2DRM A;  2L3Q A;  4C5H A;  1TS9 A;  1S72 Q;  1VQ6 A;  4RTT A;  2SRC A;  4FYX B;  1NPP A;  1EFN A;  2F1L A;  1PSE A;  2NUZ A;  3JB9 F;  2M16 A;  3MEV A;  2VXE A;  1YWO A;  1BU1 A;  1UB4 A;  2QEX T;  3V7C A;  1LVK A;  1NJI R;  1I4K 1;  3OYJ A;  1ZSG A;  4FM4 B;  1OV3 A;  1BI1 A;  2RHI A;  1W2B S;  5GMK j;  4A4H A;  2PVO B;  2EIF A;  2QGF B;  1NPR A;  2AIR B;  2KNB B;  4PJO F;  2DF6 A;  1QLY A;  1GL5 A;  3AT1 B;  3CCL T;  3JB9 H;  2RHY A;  2DVJ A;  2J7I A;  4JDS A;  4BY6 B;  4C0D C;  3S3O A;  8ATC B;  1FWZ A;  1N8R U;  1GRI A;  2OI3 A;  1KQS S;  2HSP A;  4IUT A;  4B6M A;  4YTL A;  2HQX A;  2M0Y A;  1OPK A;  4J5Y A;  2J6F A;  4KBM B;  1WHK A;  5GAM d;  2L3S A;  4M78 B;  4X9D A;  2E64 A;  3D7S B;  2LJ0 A;  1UEC A;  2P84 A;  1AWJ A;  3CCV T;  5HK3 A;  2JS0 A;  2KK4 A;  1S72 T;  2MMP A;  5KE3 A;  3VYG A;  4LUE A;  4OB0 B;  4LN2 A;  3M59 A;  4IIO A;  3I56 A;  2ESW A;  3QII A;  2R57 A;  5LJ5 j;  1TH7 A;  4EIK A;  2L2P A;  2CZ1 B;  3QO3 A;  4M7D E;  3BW1 A;  3CD6 A;  1G5V A;  4FW1 A;  2BE9 B;  5EG2 A;  1HSQ A;  1RI9 A;  5A0D A;  2A36 A;  2DYI A;  5DLO A;  3I56 Q;  3C12 A;  2EFI A;  3UWN A;  4IKF A;  6AT1 B;  1S1N A;  5DLQ E;  2DM1 A;  1BI3 A;  2RF0 A;  3G6E A;  3GP8 A;  3LWH A;  3LLR A;  2DL5 A;  2EJF A;  2RQW A;  3L42 A;  2YDL A;  2JM9 A;  4UC4 A;  2LMJ A;  2P0Q A;  1YFN A;  2O9V A;  2LNV A;  4IIM A;  1Y57 A;  3CC2 Q;  2DD5 A;  1JJ2 S;  1N8R R;  3V7S A;  5L8R E;  5FLX E;  3JB9 J;  1EIF A;  4N4H A;  2BIV A;  1U5S A;  4PJO A;  2P0K A;  2QGG A;  1NYF A;  5GAO m;  2CP2 A;  2KRS A;  3SFM A;  3M5A A;  5IT9 E;  1NEG A;  1Z9Q A;  4L59 A;  2CUD A;  1WDX A;  1ZA2 B;  5KCO A;  1C6V X;  4QQD A;  1YWP A;  4JS5 A;  4CC7 A;  1FYN A;  5GAN 7;  1RLP C;  4R56 A;  4QQ6 A;  2X3W D;  2L0A A;  5FU7 C;  2ABL A;  1RAC B;  1WXT A;  4M78 G;  1IGQ A;  1NYG A;  3OA6 A;  4TVR A;  4K11 A;  2EGE A;  2COW A;  4M7D F;  2QQS A;  5FRO A;  2RJC A;  1JU5 C;  3G71 Q;  4XTY A;  5HY6 A;  3GBQ A;  3SHW A;  5GAO q;  5LJ5 h;  2DIG A;  1N8R C;  1WQ7 A;  2F2W A;  2LTO A;  4ORZ A;  1Y07 A;  3QUI A;  3NPF A;  3JCM h;  1UGS B;  3M0P A;  4KGZ B;  3CC4 Q;  2NUT A;  3CBO A;  4CC3 A;  2YT6 A;  3CC2 T;  4X34 A;  2HCK A;  3L1A A;  1LNX A;  2R5M A;  5GAN j;  3M53 A;  1NBE B;  4JJN K;  2FHD A;  1JBM A;  3J81 E;  1IGU A;  4E7Z A;  5GAN f;  5KYW B;  1UEB A;  2KY9 A;  1VQ4 Q;  1UGV A;  1KK7 A;  1ABO A;  2I0N A;  3CXC S;  4EDU A;  3CCJ A;  1HYO A;  2MOX A;  2MF2 A;  2OAU A;  3PTA A;  1PG5 B;  1VYT A;  3MHX A;  5DM7 R;  1JO8 A;  2ZPB B;  3HRS A;  4GBQ A;  4PJO C;  1FX7 A;  3TVT A;  3G71 T;  3H0H A;  3V8L A;  2QG9 B;  5GAN 3;  1QVF P;  2CDT A;  4HA8 A;  3OS2 A;  2LQK A;  2QA4 A;  2CZ6 B;  2K2V A;  4M78 E;  2E3H A;  5CCA A;  5IXB A;  4C0F A;  4AMC A;  3TRE A;  2VWF A;  1IZ6 A;  2ED1 A;  2FO0 A;  2RQT A;  2KYM A;  3A8G B;  1AWW A;  2COZ A;  2EWN A;  1YN8 A;  4FT2 A;  1QVG S;  3FDR A;  2NYS A;  3RIR A;  2RPN A;  3EG0 A;  2K7A A;  2QAS A;  4D8K A;  4LUD A;  2QTV A;  2DA9 A;  2GTJ A;  4C8Q A;  5GAN d;  2HBW A;  2O9S A;  1SHF A;  1VQ4 T;  4J9C A;  5CKH A;  4F16 A;  4M7D A;  3VS4 A;  4AFS C;  3OYF A;  4FYV B;  4RTW A;  5GMK m;  4XAX B;  2RA2 A;  3H9N A;  2AZS A;  4M7A B;  1KQ1 A;  2LDM A;  4JRP A;  5FWB A;  4J6Y A;  4N0A A;  1N5Z A;  1PNJ A;  1I0C A;  3V7R A;  1ZHI A;  1AEY A;  3CME Q;  1VQ9 A;  2EGA A;  2F5K A;  2QDL A;  4LD6 A;  2X4J A;  2ROL A;  4EMH A;  4RTZ A;  2SEM A;  2X9H A;  3CMA A;  2LX7 A;  1VQL T;  2K79 A;  1FMW A;  1N27 A;  2KEA A;  2G6F X;  4HT8 A;  2VV5 A;  5GMK e;  3QYH B;  1VQO A;  1H64 1;  2QXF A;  2DZC A;  4BI3 A;  2F2X A;  4M78 F;  1AVZ C;  2E65 A;  2H3J A;  4E47 A;  1XTD A;  1JRI A;  5I2M A;  2LP5 A;  2NUT B;  2FEI A;  4OB3 B;  1UGQ B;  1RI0 A;  1WHH A;  4WF2 A;  4C5G A;  3EGU A;  2OAW A;  3CCQ T;  2ZPF B;  1AD5 A;  5LJ3 j;  1TUD A;  4HVU A;  3VS1 A;  4P5N A;  4RCC A;  1YIJ A;  1XQH A;  2YUN A;  2LCL A;  5IN1 A;  1U1T A;  3L2R A;  3DKM A;  2JTE A;  5LJ3 f;  4A63 B;  2D0Q B;  5IHI A;  1C1A A;  5D6Y A;  3CME T;  3CCE A;  1QVF A;  1B34 B;  1UGP B;  3M0R A;  3VS6 A;  2DTH A;  4RKU E;  3FRN A;  2E4H A;  2QQA A;  4M7D C;  1K9A A;  2LT4 A;  1WFW A;  3JB9 G;  5LJ5 e;  2FPD A;  1Q7Y U;  5IHN A;  3JCM Q;  2DBM A;  2EQU A;  3P8H A;  2L3P A;  3WXM B;  4RCB A;  5HKC A;  4RTU A;  1T0H A;  2C0I A;  1VQM A;  2M9U A;  1YI2 A;  5IH2 A;  5C0M A;  1VQ7 Q;  2K6D A;  5HK0 A;  4AT1 B;  3UA6 A;  4PJO G;  1ZSZ A;  4M7A G;  3CPW P;  3LYI A;  1GXI E;  5GAN 2;  1U1S A;  4FYY B;  2KVQ G;  1QKW A;  4J7I A;  1BK2 A;  2FYK A;  1O75 A;  2CP7 A;  2V8J A;  2DFU A;  1YI2 Q;  3M0S A;  1ZQ1 A;  1WIE A;  2PNI A;  2VXF A;  2V8K A;  4OB1 B;  2HD0 A;  4C8Q B;  4EMK B;  1JXM A;  5FU6 B;  2DET A;  1ARK A;  1ZUY A;  4JJB A;  1D1B A;  4AFZ C;  5LJ3 d;  2GF7 A;  2ENM A;  2JM8 A;  2RH2 A;  4DBQ A;  2EVR A;  4MZT A;  2FRY A;  1SRM A;  3MPU B;  1BCO A;  5KH6 A;  4E7J A;  2DXU A;  4OMF B;  3UF4 A;  3VS5 A;  4BDZ A;  1K8A U;  2AT1 B;  2RD1 A;  4M78 A;  2XIC A;  3MEW A;  2X4X A;  2GCX A;  3S3M A;  3LH5 A;  3I55 T;  3RNJ A;  3E9F A;  1T0J A;  4HCB A;  3TSZ A;  3TU4 K;  3M0Q A;  3TCJ A;  2JOY A;  2ZAE A;  4MDW A;  2QEX A;  2K4Y A;  1VQ7 T;  5FWC A;  2FZC B;  5CKD A;  1QP2 A;  3QJY A;  1BI0 A;  3F70 A;  1KJW A;  3G4S T;  7AT1 B;  2PTK A;  3QXE B;  1G3T A;  4AFU C;  5FW9 A;  3PVQ A;  2E1H A;  2MIO A;  1Q7Y R;  4HT9 A;  1Z9Z A;  2GQI A;  1B3Q A;  4RG2 A;  3CCL A;  1E7O A;  2E10 A;  1UJY A;  3DLM A;  1TUC A;  4M7A E;  1OU9 A;  1M2V A;  5KYN A;  5IAY A;  4RUG A;  4NL3 A;  2ZCF B;  3O8V A;  1LOJ A;  3L2Z A;  2DL8 A;  4PJM A;  2Y4X A;  5GAN e;  1IO6 A;  4QVD A;  2ZPE B;  3CCL Q;  2RHZ A;  1LCK A;  4A53 A;  4PFZ A;  1BYM A;  4AG2 C;  4FSS A;  1U8R A;  3EH2 A;  4FL6 A;  3CCV A;  2EQK A;  2MCN A;  1MMA A;  2EYQ A;  2DTO A;  2VKN A;  4C92 B;  5GAO p;  5GAM j;  1S72 A;  2DER A;  3GNG A;  1T3L A;  4BY6 C;  1ZUU A;  4Y91 A;  4Z89 A;  3HSB A;  1YJ9 Q;  2PZ1 A;  1KHC A;  2X4Y A;  1Q7Y C;  3CCR Q;  3CPW A;  2RN8 A;  1IHW A;  3HRT A;  2D8J A;  2ZPH B;  4KT0 E;  1K73 U;  2DL7 A;  4C8Q G;  3X20 B;  2YSQ A;  4M78 C;  4OML A;  1VQN T;  3GLX A;  4OMP A;  4M7D G;  2V26 A;  1R0C B;  1M5Q 1;  4Z8A A;  4RG8 A;  4D8D A;  4RMO A;  3JB9 I;  3SD4 A;  2E6Z A;  4DBF A;  4M75 B;  3JB9 D;  2COY A;  1VYV A;  1ZSZ B;  2KDS A;  1X69 A;  2HDA A;  3MCA B;  2YLB A;  3A5Z B;  2LJ3 A;  5CKF A;  3MP8 A;  2VB6 A;  2FPF A;  1IXD A;  4FCY A;  5I2S A;  1OX9 A;  2YWW A;  4JJC A;  4PJO D;  3NFC A;  2DYB A;  3QZ9 B;  4DOV A;  4M7A F;  1KD1 R;  3HKS A;  3V8K A;  3CEY A;  1IRE B;  3QHS A;  4X1V A;  3X26 B;  5A0L A;  1EZZ B;  4M77 B;  3H6Z A;  1KG1 A;  5CR2 A;  2KI7 A;  3IQL A;  3X25 B;  3R6O A;  2LCC A;  1IB8 A;  1K8A C;  1YJ9 T;  5D6W A;  1VQP Q;  4L5G A;  4Y92 A;  3CCR T;  2JMA A;  4GLK A;  1LPL A;  2XU8 A;  4LDX A;  2FPE A;  1YIT T;  4QW2 A;  1GBR A;  5KYW A;  4PJN A;  3SWN B;  4E2F B;  3PVL A;  1M27 C;  4VUB A;  4DQ2 A;  2DTI A;  2HKN A;  3GF5 A;  2CP3 A;  3UPU A;  4BI8 B;  2HZY A;  1M1F A;  3UA7 A;  4C8Q E;  2DVE A;  2GNC A;  5GAM h;  1H92 A;  2J6O A;  2GQV A;  3BFM A;  1ZUK A;  3TEE A;  3H0F A;  1K9M U;  1KD1 C;  3CPF A;  3OYB A;  4BI4 A;  1OX8 A;  1WQW A;  1D1C A;  1OZ2 A;  1AT1 B;  2FZK B;  1VQK T;  4QVZ A;  2XKO C;  1M2V B;  2OJ2 A;  1N9S A;  2HSE B;  4GLM A;  2KE9 A;  3JCM X;  1OQK A;  2A28 A;  2DX1 A;  2M51 A;  3FLG A;  3P8D A;  3CC2 A;  3FIF A;  1UGR B;  2DE0 X;  5M9O A;  4C0D B;  1TSF A;  3OYH A;  3M56 A;  4A4K A;  5LJ3 e;  1X75 C;  1K0S A;  4PLL A;  4ZGE B;  2A7Y A;  4XQ3 A;  2MWO A;  3LGF A;  1VQP T;  4FU6 A;  5GMK h;  3EGX B;  2E3I A;  1GBQ A;  2CSQ A;  3KXT A;  1U06 A;  2YRD A;  4J8O A;  4OVA A;  2D8H A;  5IHK A;  3JCM c;  1KQS P;  1UHC A;  1O9S A;  2HAX A;  1ZBX A;  4M7A A;  3OYI A;  4JRK A;  2D9T A;  1BI2 A;  1X6O A;  1PD0 A;  1Y7X A;  3G71 A;  5HCK A;  4IUR A;  4WTO B;  3RBB B;  4R55 A;  3OBW A;  5KCH A;  2EKO A;  3OYL A;  2LZ6 B;  4LNP A;  4C8Q F;  2MAM A;  5AYF A;  3OMC A;  1QVF S;  1VQ8 Q;  1Y96 B;  2CGH A;  1MHN A;  2RK1 A;  3CC4 A;  2JW4 A;  4C92 E;  4M7D D;  1UFF A;  3EG3 A;  1OPL A;  3M4G A;  3A8H B;  1BBZ A;  2FB7 A;  1MND A;  2KMT A;  2V1Q A;  3VKI A;  2B86 A;  1M90 U;  1SSH A;  1RL2 A;  2W10 A;  5LJ5 g;  4RTY A;  4NOY A;  5CO7 A;  4KUL A;  3OB9 A;  1VQ4 A;  1OZ3 A;  3C95 A;  3JCM g;  2AHJ B;  2EQM A;  2V8I A;  3LX7 A;  2CSI A;  5CQY A;  1D3B A;  2R58 A;  3MJX A;  4PNO A;  4M75 E;  2EQI A;  3EGD B;  3C0C A;  2BUD A;  2DPP B;  1RUW A;  4DA4 A;  1QP3 A;  2LRQ A;  2XI9 A;  4OMM A;  1MMD A;  1TWB A;  1B34 A;  3DB4 A;  3UT1 A;  1SF9 A;  1D09 B;  2KR3 A;  3J80 E;  1GFC A;  4LE9 A;  1OOT A;  2MK5 A;  4RTX A;  1WJQ A;  3OBY A;  3JCM P;  2KT1 A;  1YP5 A;  1VQ8 T;  2QI2 A;  1MV0 B;  2JZ2 A;  4M7A C;  5AT1 B;  1NEB A;  2QTX A;  1I5L A;  4M77 E;  1ZA1 B;  4O6J A;  1R77 A;  3OYG A;  1QCN A;  1UTI A;  2K5F A;  2Z0W A;  3GIB A;  3A1P A;  1UUE A;  1AOJ A;  3PFS A;  1KC8 U;  3VS0 A;  1VQL Q;  3HPW A;  5D6X A;  3SB2 A;  3ASK A;  4KRT A;  3V8J A;  4C0G A;  2E41 A;  3H41 A;  4C92 F;  4F04 B;  1RAB B;  1ABQ A;  4F7U E;  3BE3 A;  1KQS A;  3CCQ A;  2RK2 A;  2F69 A;  3MET A;  2J06 A;  5GAN 4;  4JZ4 A;  3OS0 A;  4BB7 A;  1R0B G;  1WYX A;  2KYB A;  4EMK A;  5GAM e;  3PE0 A;  1M90 R;  3CME A;  2CT3 A;  2NLU A;  4NS5 A;  2A08 A;  3OS5 A;  3PIP A;  1Q81 U;  1SRL A;  1M9S A;  3OYE A;  3CCQ Q;  2DEU A;  4M75 F;  2R5A A;  4JS4 A;  2DRK A;  2ROT A;  2DKG A;  3OW2 S;  3U23 A;  1QCO A;  2BZ8 A;  2VGM A;  4ZGJ B;  5GAN h;  3T9N A;  3M54 A;  2D6F A;  4Z88 A;  4BAC A;  2JMC A;  3JRZ A;  1Q95 G;  1ZLM A;  3KUF A;  2VUB A;  2RJF A;  1I1J A;  2JUF A;  3JCM W;  3DB3 A;  1PM3 A;  4E7S A;  2FRW A;  5L23 A;  1MV3 A;  4LDU A;  3HL8 A;  4M77 F;  3L2Q A;  3ZEH A;  3H8Z A;  3THK A;  3CPW S;  5IXF A;  1M90 C;  4JPB W;  2DK3 A;  4CI0 C;  1YBY A;  2CUB A;  4M78 D;  1WJS A;  3VS2 A;  3A8L B;  1YCY A;  2C0T A;  3L2W A;  1KC8 R;  4Z02 A;  4F7U F;  4KUI A;  1D3B B;  1G83 A;  1ZX6 A;  1K76 A;  4J9E A;  2RJD A;  3RKX A;  1WNL A;  3OYK A;  1VOM A;  2YUO A;  4MZM A;  4XTX A;  4HCK A;  3MKD A;  5CKE A;  5FRN A;  1ZBJ A;  2V1R A;  3I55 A;  2YXY A;  2HQH A;  3DLL A;  1D0Z A;  2ECZ A;  3MEA A;  5A0G A;  4J9G A;  3SEM A;  2KBT A;  4KH1 B;  4C8Q C;  4EMK C;  4C92 A;  2KXC A;  1BCM A;  4HVW A;  3EFR A;  5FU6 C;  1I5O B;  1VQ7 A;  3JCM J;  2DXT A;  2OX7 A;  4J83 A;  3G4S A;  3CCS Q;  4ATO A;  1M8V A;  4ME7 A;  2NUP A;  2RQU A;  1NLO C;  2E6N A;  2YLC A;  1WJR A;  3QPH A;  3I55 Q;  4XTW A;  2K2M A;  1CKB A;  4JJD A;  3CCM Q;  3TSW A;  1M8M A;  1QCF A;  4KH0 B;  4N0A C;  4ZN3 A;  1YNZ A;  2K3B A;  4BUG A;  1M3A A;  1PRL C;  2CS7 A;  1KC8 C;  1G3Y A;  1XJW B;  5CAI A;  3QWY A;  2EJ9 A;  1W70 A;  2QAZ A;  2VYT A;  4M75 A;  2O2O A;  2P4R A;  3G4S Q;  1XOV A;  1V1C A;  3OYC A;  1GCP A;  1WHJ A;  3E1S A;  1YJW Q;  1J3T A;  3GOX A;  1UE9 A;  4J9B A;  4ELZ C;  1YJN Q;  2DL4 A;  2ZPG B;  2DO3 A;  4CC2 A;  4ZGD B;  1TG0 A;  2BKD N;  3O5Z A;  5EC7 A;  2Y90 A;  4HCC A;  5J26 A;  3PGG A;  2HL5 C;  4KGV B;  2M0O A;  1YCS B;  3OS1 A;  5CIU A;  1QW1 A;  2L3R A;  2PQW A;  4DBR A;  4MDX A;  2DL3 A;  4M77 A;  5GAN 5;  2K3Y A;  4II1 A;  2KT8 A;  2DBK A;  3RMS A;  1M2O A;  3JCM b;  3VS3 A;  2BE7 D;  2E12 A;  1VQO T;  1KHI A;  4BD3 A;  2EPD A;  3CCS T;  2X3X D;  4GY5 A;  2O01 E;  2OTL T;  2A3L A;  1Q86 U;  3EG9 A;  3X24 B;  1VQ5 Q;  3CCM T;  4V2S A;  1M3B A;  2E5Q A;  5LJ3 h;  4FT4 A;  4F14 A;  3E19 A;  2YUQ A;  4F7U A;  3HP9 A;  4WCI A;  3R6N A;  3SWN A;  2WAC A;  3MP6 A;  2CP0 A;  5KYX B;  4ELY C;  2LQN A;  2RI3 A;  2OTJ Q;  2FL7 A;  2H3E B;  3A98 A;  1YJW T;  2FVU A;  4FW2 A;  1VQN Q;  1Q82 U;  1YJN T;  2AZV A;  3BDU A;  1HD3 A;  2D0N A;  2FZG B;  2LCS A;  1NJI U;  5GMK i;  2B8A A;  4E7H A;  1CSK A;  1FMK A;  3PNW C;  1WHG A;  2DMO A;  4NL2 A;  2KXD A;  1VA7 A;  2QQR A;  3EG1 A;  4PLI A;  4M75 C;  2G3R A;  4J6W A;  1ZSZ C;  4XU0 A;  3M0T A;  3I5R A;  3OYD A;  1NE8 A;  1YJ9 A;  1VUB A;  2DXB A;  3CCR A;  1GFD A;  1X27 A;  1YIT A;  2I2L A;  3RUX A;  4A54 A;  4FYW B;  2M02 A;  1PKT A;  2XDB A;  1P92 A;  1UG1 A;  1RAA B;  1NM7 A;  2EYX A;  3EGX A;  3OMG A;  3VV0 A;  1VQ5 T;  2DD4 A;  2XG8 D;  1RAF B;  1I07 A;  2KAF A;  1RLQ C;  4M77 C;  4JUV A;  2NUP B;  4PJL A;  4XTU A;  1AZE A;  5GAO n;  1YIT Q;  3M9Q A;  3QKJ A;  4E7K A;  4A4E A;  4N4I A;  2OTJ T;  4IUV A;  1K8A R;  3VJP A;  2XID A;  4ZNX A;  2L5Q A;  4PFO A;  2AKK A;  4B9W A;  3CC7 Q;  3QZ5 B;  1Q86 R;  3QDR B;  5CVI A;  2IPO B;  3GNF B;  2GBQ A;  4DBH A;  1MMN A;  2O4X B;  3SWN C;  1BIA A;  3EHR A;  2J05 A;  3M0U A;  5DY9 A;  2CP5 A;  2EAY A;  1W1F A;  3EFS A;  1Y96 A;  3SDZ A;  1WXU A;  3OYY A;  2DNU A;  1PRM C;  1VQK Q;  3OYM A;  4ESR A;  2WSF E;  4CRI A;  4RTV A;  1DJ7 B;  5KYU A;  1VQP A;  1HXD A;  1Q82 R;  3LW5 E;  4M7A D;  2MPX C;  4OMO A;  2XDD A;  3LGL A;  4J9D A;  1YHQ Q;  3FJP A;  4Y28 E;  2K5I A;  2HMA A;  1VQ6 Q;  1BB9 A;  1EX4 A;  3EFO A;  1AZG B;  4PKC C;  2CT4 A;  4JLI A;  1QWE A;  3EGD A;  1MMG A;  2CP6 A;  4MML A;  3EG9 B;  1Q86 C;  2EW3 A;  1LJO A;  5I21 A;  1QKX A;  3PMT A;  4F7U B;  3P8B B;  2KRN A;  4Q5W A;  3UDC A;  3EAE A;  3CC7 T;  3E2U A;  2QYZ A;  2GTO A;  4PK4 A;  1QVP A;  5GAM g;  1PWT A;  3CCU T;  2HKQ B;  2YUP A;  3FJ5 A;  1Q82 C;  1PCX A;  4XU3 A;  4HXJ A;  4E7I A;  2DLP A;  2IVW A;  2KGT A;  3ZFJ A;  4C92 G;  1K73 R;  2WSE E;  1NJI C;  1WA7 A;  2H8H A;  3HFN A;  1SSF A;  1X6G A;  1M1G A;  1TXQ A;  1YHQ T;  3INZ A;  4ZN1 A;  2LT1 A;  3RR6 A;  5LJ5 f;  3E9G A;  4IUP A;  1VQ6 T;  2RNA A;  4PJJ A;  5LL6 S;  3N5B B;  3WVE B;  5KYY A;  4BE2 A;  2XMF A;  3I5S A;  4N4G A;  4JRI A;  3JCM f;  2K9G A;  4M75 G;  1MUZ A;  1R8O B;  3HHT B;  2VAS A;  1W2B P;  3M55 A;  2E70 A;  3VU3 C;  1G3W A;  4JZ3 A;  3KFV A;  5KE2 A;  4FSX A;  3CD6 Q;  4ZTF A;  4KUD K;  3GPL A;  4MZP A;  4B9X A;  1A0N B;  1I81 A;  2BZX A;  1N9R A;  1JXO A;  1V76 A;  3NMZ C;  2FG0 A;  2QQ9 A;  1K73 C;  1VQ8 A;  2RHX A;  2CH4 W;  4LDW A;  2LNH B;  1JB0 E;  3G7Z A;  4DEX A;  3Q1J A;  4OB2 B;  2LQW A;  4IUU A;  1CKA A;  1H8K A;  2VGN A;  2CZ0 B;  3FB9 A;  1D0Y A;  4O5V A;  5GJV B;  3C4S A;  4M77 G;  2J6K A;  3G6E Q;  2JJ9 A;  1FXX A;  4C8Q D;  3RMQ A;  2A0F B;  1B7T A;  3RDV A;  2E5K A;  2X4W A;  2EJG A;  1T3S A;  1Y0M A;  2EKH A;  2ATC B;  3BY7 A;  5LJ5 d;  1K9M R;  4F7U G;  3QDF A;  5KYU B;  4MMK A;  2HNI A;  3A8O B;  2JNG A;  3ME9 A;  1PD1 A;  3EH1 A;  3JCM d;  2CH4 A;  2HBP A;  4XK8 E;  4ANJ A;  3LWI A;  1PSF A;  2IIM A;  3JV3 A;  3I56 T;  2YRC A;  3RKY A;  3OY9 A;  5J39 A;  4IUQ A;  3EFO B;  1W6X A;  2HEQ A;  1X2K A;  4OGC A;  1WHM A;  3CD6 T;  1SKU B;  1OEB A;  2ZGW A;  9ATC B;  2X35 A;  1RAH B;  1AHJ B;  3NTI A;  5CKB A;  3RKW A;  2W0Z A;  3MEU A;  2KQW A;  1D0X A;  2EYY A;  4PL6 A;  3G1J A;  2LX9 A;  5I11 A;  1K1Z A;  2AKL A;  1WXB A;  3G6E T;  2DAQ A;  1VQL A;  2C0O A;  1WPY A;  4OP0 A;  1K9M C;  1TU0 B;  5GJW B;  1JJ2 P;  4LDV A;  4XTV A;  4BE1 A;  1G3S A;  2ZZD A;  4LDY A;  2C06 A;  4E6R A;  1C0M A;  1E6G A;  2QK0 A;  5FU7 B;  2F2V A;  2VC8 A;  3MO8 A;  1OI1 A;  5GAN 6;  5GAO r;  1PKS A;  2LJ1 A;  5GAO l;  1X43 A;  4M4Z A;  1W2B A;  3ZBD A;  4HKE A;  2KRO A;  3QG1 A;  3ZL7 C;  2KRM A;  2PU9 B;  3PIO A;  4J9F A;  4C92 D;  1M1K U;  3RER A;  2LVM A;  2EQJ A;  3MP1 A;  3CBP A;  4LD9 K;  5KYY B;  2DEQ A;  1I8F A;  1X6B A;  4PFP A;  3EHQ A;  3CCJ Q;  2BTT A;  3HTR A;  2MWP A;  2K3X A;  1RAE B;  2YHT A;  2ED0 A;  1K4U S;  3CC4 T;  3PT9 A;  3PMI A;  4LXC A;  4DEY A;  1OYX A;  4XTZ A;  3I35 A;  4M75 D;  4QKU A;  3QSU A;  4J9H A;  3OYN A;  1KIK A;  2JN0 A;  3HRU A;  1X2Q A;  2QA4 Q;  1VYU A;  3NTK A;  2XD0 A;  1SG5 A;  1UJ0 A;  1RAD B;  2PUK B;  2RQR A;  1FMV A;  3KBG A;  5GAN g;  1WI7 A;  3L2U A;  1K0X A;  2HQE A;  4PJO B;  1D1A A;  1H3Z A;  5GAN 8;  4C0Z A;  5D7U A;  3OQ5 A;  2RMO A;  2M1H A;  1WZO A;  5KYX A;  2L89 A;  3CXC P;  2P0P A;  2PUO B;  4M77 D;  1W4S A;  2YRV A;  3BDL A;  4QT7 A;  2MI6 A;  3OSV A;  1WLP B;  1NZ9 A;  1BIB A;  2DJZ A;  2CKK A;  2F5T X;  1G8X A;  4A4G A;  3S6W A;  3C94 A;  3CCJ T;  4FIB A;  1IRX A;  5I22 A; 
#chains in the Genus database with same CATH homology
 3M0P A;  1GBR A;  4CC3 A;  2YT6 A;  2AZV A;  1HD3 A;  1M27 C;  2HCK A;  2D0N A;  3PVL A;  4AG1 C;  2LCS A;  1PHT A;  1WX6 A;  2O88 A;  3UA7 A;  1CSK A;  1FMK A;  2GNC A;  2DMO A;  5ECA A;  1H92 A;  2J6O A;  1ZUK A;  1SHG A;  1VA7 A;  2KXD A;  3H0F A;  3EG1 A;  3REB B;  1UGV A;  3M0T A;  3I5R A;  1ABO A;  2I0N A;  4R0K A;  2MOX A;  2OJ2 A;  1GFD A;  1X27 A;  1NG2 A;  4GLM A;  2KE9 A;  1VYT A;  3NGP A;  2VVK A;  2A28 A;  2DX1 A;  1PKT A;  2M51 A;  1JO8 A;  4F17 A;  4GBQ A;  1UG1 A;  1NM7 A;  2EYX A;  2DE0 X;  3TVT A;  3H0H A;  1I07 A;  1RLQ C;  1K0S A;  2CDT A;  1SPK A;  3EG2 A;  1AZE A;  1NLP C;  5IXB A;  2VWF A;  1UHF A;  2RQT A;  2ED1 A;  2FO0 A;  2KYM A;  1AWW A;  1GBQ A;  2CSQ A;  1YN8 A;  1U06 A;  4ZNX A;  2RPN A;  2D8H A;  2AKK A;  3EG0 A;  3QWX X;  5IHK A;  1QWF A;  2EGC A;  2K7A A;  1UHC A;  2GBQ A;  4D8K A;  4LUD A;  2DA9 A;  3H0I A;  2GTJ A;  3VRY A;  2D1X A;  1H3H A;  2AK5 A;  3EHR A;  2J05 A;  2HBW A;  3M0U A;  1G2B A;  2O9S A;  1SHF A;  3UAT A;  3VS7 A;  1W1F A;  5HCK A;  4J9C A;  1WXU A;  3RBB B;  4F16 A;  2CRE A;  2DNU A;  3VS4 A;  4AFS C;  1PRM C;  4RTW A;  1JEG A;  4ESR A;  2DIL A;  3VRZ A;  4RTV A;  2AZS A;  2JT4 A;  2LZ6 B;  4LNP A;  2O31 A;  5FWB A;  4OMO A;  2RQV A;  1N5Z A;  1PNJ A;  3REA B;  1I0C A;  4J9D A;  3CQT A;  1AEY A;  2JW4 A;  1UFF A;  2EYZ A;  3EG3 A;  1OPL A;  2EGA A;  1BB9 A;  2QDL A;  1BBZ A;  2ROL A;  1U3O A;  4RTZ A;  2JS2 A;  2V1Q A;  1GCQ A;  2SEM A;  2B86 A;  1AZG B;  2LX7 A;  1SSH A;  4HVV A;  2W10 A;  4RTY A;  2CT4 A;  1QWE A;  2K79 A;  1E6H A;  2KEA A;  2EW3 A;  2G6F X;  1QKX A;  2CSI A;  2KRN A;  1KFZ A;  3ULR B;  2EQI A;  2GTO A;  2F2X A;  3C0C A;  1AVZ C;  2EYW A;  1PWT A;  1RUW A;  4CC4 B;  1AWO A;  2LP5 A;  1B07 A;  2YUP A;  3FJ5 A;  2FEI A;  4HXJ A;  2DLP A;  1M30 A;  2KGT A;  4OMM A;  1AWX A;  2NWM A;  4OMQ A;  1WA7 A;  3EGU A;  2OAW A;  2H8H A;  1M3C A;  1AD5 A;  1TUD A;  2BZY A;  1UDL A;  2KR3 A;  4HVU A;  3VS1 A;  1GFC A;  4LE9 A;  1OOT A;  4RTX A;  2KT1 A;  2YUN A;  1YP5 A;  1X6G A;  2EBP A;  4AFQ C;  2JTE A;  4A63 B;  1MV0 B;  5IHI A;  1NEB A;  1UTI A;  2RNA A;  3M0R A;  3VS6 A;  2A37 A;  1UUE A;  1AOJ A;  2JXB A;  2XMF A;  3I5S A;  3I9Q A;  3VS0 A;  1K9A A;  2K9G A;  1WFW A;  4OMN A;  2FPD A;  5IHN A;  2DBM A;  1MUZ A;  4KRT A;  1HJD A;  2L3P A;  3H41 A;  4J9I A;  1ABQ A;  4JZ3 A;  3KFV A;  4RTU A;  1JQQ A;  1T0H A;  2C0I A;  1KSW A;  5IH2 A;  1SEM A;  2K6D A;  2J06 A;  2BZX A;  2DJQ A;  1A0N B;  3UA6 A;  4JZ4 A;  1JXO A;  3NMZ C;  1WYX A;  2FG0 A;  2KYB A;  2GGR A;  1GCQ C;  2CH4 W;  2LNH B;  3PE0 A;  3NHN A;  2CT3 A;  4DEX A;  2DRM A;  2L3Q A;  2LQW A;  1CKA A;  1H8K A;  1QKW A;  4RTT A;  1BK2 A;  2A08 A;  2SRC A;  5GJV B;  1SRL A;  1EFN A;  2J6K A;  2NUZ A;  3M0S A;  1WIE A;  2PNI A;  2DRK A;  1YWO A;  1BU1 A;  2ROT A;  1JXM A;  1ARK A;  1ZUY A;  4JJB A;  2E5K A;  3U23 A;  1ZSG A;  4AFZ C;  1OV3 A;  2ENM A;  2JM8 A;  2BZ8 A;  1T3S A;  1Y0M A;  2EKH A;  2EVR A;  4Z88 A;  2JMC A;  2KNB B;  2FRY A;  2DF6 A;  1QLY A;  1GL5 A;  1SRM A;  1ZLM A;  3UF4 A;  3VS5 A;  2DVJ A;  2J7I A;  2CH4 A;  1I1J A;  1GRI A;  2IIM A;  2OI3 A;  3JV3 A;  5L23 A;  2FRW A;  1MV3 A;  2HSP A;  3LH5 A;  2M0Y A;  3RNJ A;  1OPK A;  1T0J A;  3THK A;  3TSZ A;  5IXF A;  2J6F A;  1W6X A;  3M0Q A;  2HEQ A;  1X2K A;  4JPB W;  1OEB A;  5FWC A;  2L3S A;  2CUB A;  3VS2 A;  2W0Z A;  1KJW A;  2LJ0 A;  2PTK A;  1UEC A;  2C0T A;  1AWJ A;  2EYY A;  4AFU C;  5FW9 A;  2JS0 A;  3PVQ A;  5I11 A;  2MIO A;  1G83 A;  1ZX6 A;  1K1Z A;  1K76 A;  2AKL A;  4J9E A;  1Z9Z A;  2GQI A;  1B3Q A;  1E7O A;  1WXB A;  4LUE A;  1UJY A;  2YUO A;  4LN2 A;  2C0O A;  4HCK A;  1TUC A;  4IIO A;  2ESW A;  5GJW B;  1ZBJ A;  2V1R A;  4RUG A;  4EIK A;  2L2P A;  2ECZ A;  4E6R A;  4J9G A;  3SEM A;  2KBT A;  2DL8 A;  1E6G A;  2KXC A;  4HVW A;  1IO6 A;  2F2V A;  1HSQ A;  1RI9 A;  1LCK A;  1PKS A;  2LJ1 A;  2A36 A;  1X43 A;  4M4Z A;  4AG2 C;  4FSS A;  2KRO A;  2MCN A;  2RQU A;  1NLO C;  3ZL7 C;  2KRM A;  2K2M A;  2VKN A;  1CKB A;  4J9F A;  4JJD A;  3TSW A;  1M8M A;  1QCF A;  1S1N A;  1T3L A;  1YNZ A;  2DM1 A;  2K3B A;  1ZUU A;  2RF0 A;  4Z89 A;  1M3A A;  1PRL C;  2DL5 A;  1X6B A;  2PZ1 A;  2RQW A;  3QWY A;  1W70 A;  2YDL A;  2JM9 A;  3EHQ A;  2LMJ A;  2O2O A;  2P4R A;  2RN8 A;  2BTT A;  2D8J A;  1XOV A;  1V1C A;  2DL7 A;  1GCP A;  2ED0 A;  1J3T A;  1K4U S;  2YSQ A;  2O9V A;  4IIM A;  1UE9 A;  1Y57 A;  4J9B A;  4OML A;  2DL4 A;  4OMP A;  4Z8A A;  4CC2 A;  4DEY A;  4D8D A;  1TG0 A;  3I35 A;  3O5Z A;  1KIK A;  4J9H A;  5EC7 A;  1VYV A;  1U5S A;  1X2Q A;  1X69 A;  1VYU A;  2HDA A;  1NYF A;  1YCS B;  2KRS A;  2LJ3 A;  1UJ0 A;  1NEG A;  2RQR A;  1WI7 A;  1Z9Q A;  2FPF A;  2CUD A;  1K0X A;  2DL3 A;  1WDX A;  2KT8 A;  2DBK A;  1YWP A;  3VS3 A;  4JJC A;  4CC7 A;  1FYN A;  2DYB A;  1RLP C;  2X3W D;  2L0A A;  2EPD A;  2ABL A;  2RMO A;  2X3X D;  1WXT A;  1NYG A;  4X1V A;  4K11 A;  2EGE A;  1M3B A;  1JU5 C;  4QT7 A;  3IQL A;  4F14 A;  2YUQ A;  1WLP B;  4WCI A;  3R6N A;  3GBQ A;  3SHW A;  2F2W A;  4Y92 A;  4ORZ A;  2JMA A;  2LQN A;  2FPE A;  3NPF A;  3A98 A;  5I22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...