2XMFA

Myosin 1e sh3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
GPLGSPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOSIN 1E SH3
publication title Myosin 1E SH3
rcsb
source organism Mus musculus
molecule tags Motor protein
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2xmfA00
2JS2A 1BU1A 2RMOA 1S1NA 1CKAA 2PNIA 2NWMA 1WDXA 1WXBA 2JTEA 1SRMA 4AFZC 3CQTA 3REBB 4LUDA 1E6GA 1LCKA 2YUOA 4RTWA 1NLOC 1IO6A 4RUGA 1M8MA 2CUDA 2LCSA 3H0IA 4Z8AA 2YUPA 1JU5C 3UF4A 2KNBB 1NEGA 2RPNA 1T3LA 1X69A 4AFUC 1RLPC 1WXUA 2L3PA 1YNZA 2LX7A 1I1JA 5IXFA 2BZYA 2DRKA 2KYMA 2MOXA 3EHQA 2W10A 2KRMA 3I5RA 1ZUKA 1AWXA 2GTOA 4HCKA 2O31A 4J9DA 1VYUA 3PVQA 3PE0A 2KEAA 4QT7A 3SHWA 2AZVA 1PRMC 3UA6A 1UUEA 3EGUA 2EGAA 3VS2A 2SEMA 2CT3A 1U3OA 1K9AA 1PNJA 1K0XA 1CSKA 1QWEA 2EW3A 2GNCA 1JXMA 4A63B 2V1RA 2RQWA 1PHTA 2QDLA 1WXTA 2DL5A 2RN8A 1UDLA 1X43A 4J9CA 4M4ZA 2ROLA 1AZEA 3ZL7C 1K1ZA 2DYBA 2AKKA 3VRZA 4GLMA 2O88A 3VS3A 1WI7A 2DF6A 1K4US 1G83A 1MV0B 1I07A 2J6OA 2DL3A 2L2PA 2KRSA 1Y57A 2LJ3A 5FW9A 2RQUA 2KXDA 1YCSB 2C0IA 4JJBA 2OAWA 4D8KA 1GBQA 3JV3A 3UA7A 1EFNA 1ABOA 1UE9A 2JXBA 2RF0A 3QWYA 4LUEA 1I0CA 2J6KA 3SEMA 3A98A 4HVVA 2ESWA 2HSPA 2CSIA 4AG2C 1M27C 4GBQA 2O9VA 4EIKA 2EYZA 1UJ0A 2E5KA 5FWBA 1T0JA 2LNHB 1YWPA 2K2MA 4JJDA 4RTZA 4LE9A 2J06A 5L23A 1BK2A 2RQTA 1AVZC 2KBTA 1M3CA 2IIMA 1NG2A 2EYYA 2ED1A 2YUQA 3C0CA 2KRNA 2F2XA 1UTIA 5FWCA 2D0NA 4RTTA 2FRWA 4RTUA 3UATA 2DBMA 1PRLC 1WFWA 1SPKA 2DA9A 4RTYA 1A0NB 1NEBA 1AWJA 3H0HA 1E6HA 1N5ZA 3NPFA 4ORZA 1NYFA 2B86A 1ZUUA 5ECAA 1JO8A 1HJDA 3RNJA 3RBBB 2LJ0A 3I9QA 2HDAA 2ABLA 1RUWA 5IHNA 4F17A 2DL4A 3I35A 1NLPC 1ZUYA 1GFDA 1GCQA 3M0PA 3NGPA 2M0YA 1QKWA 4Z88A 2DILA 3EG3A 1QWFA 2DRMA 2DE0X 1V1CA 3U23A 2OJ2A 5HCKA 1PWTA 1TUDA 1UJYA 2DBKA 4OMNA 2CSQA 3VS4A 2DX1A 1UGVA 1PKTA 4HVWA 2AKLA 1J3TA 1TUCA 2BTTA 4JZ4A 4AG1C 2O2OA 2A08A 1M3AA 2CREA 2D8HA 2HEQA 2FPEA 1KFZA 4LN2A 2HBWA 2CH4W 1X2QA 1RLQC 2EYWA 1ARKA 4CC3A 2X3WD 2L3SA 2FG0A 2YUNA 1E7OA 1KIKA 4JPBW 1CKBA 1SHFA 2YDLA 2D8JA 2BZ8A 3KFVA 2C0TA 2RNAA 4HVUA 1GRIA 3TSWA 1ZLMA 2PZ1A 4X1VA 3NMZC 3M0QA 2XMFA 1TG0A 1MV3A 1OV3A 3EG1A 1UECA 2FRYA 2LMJA 2EQIA 2ECZA 4J9FA 2MCNA 1X6GA 1GBRA 4DEYA 2GQIA 2JW4A 2ROTA 1JXOA 1X27A 2DVJA 2DJQA 1UG1A 2SRCA 1B07A 1VYTA 2KXCA 3EHRA 3R6NA 2CH4A 2EVRA 2X3XD 1GCQC 1W70A 1H3HA 1U06A 1NYGA 2AK5A 4OMOA 2W0ZA 2EGEA 1FYNA 2LP5A 2L0AA 3VS6A 1Y0MA 2MIOA 1K0SA 1HD3A 1G2BA 1YP5A 1ABQA 1BB9A 2KGTA 3REAB 4K11A 1UHFA 4AFQC 2J6FA 1KJWA 2F2VA 1AWOA 3M0UA 4RTVA 5IHIA 2DNUA 3VS0A 5I11A 3VRYA 3H41A 2LJ1A 1B3QA 4RTXA 1AZGB 2EGCA 1M3BA 2GGRA 4KRTA 3H0FA 2L3QA 2A36A 2O9SA 1VA7A 1AD5A 1HSQA 2K79A 4CC2A 4J9BA 1WX6A 4CC4B 1T3SA 4J9HA 1OEBA 3EG2A 2A28A 5IH2A 1RI9A 2YSQA 4F16A 3O5ZA 5GJWB 5IXBA 2K3BA 5EC7A 2H8HA 1Z9QA 1OPKA 1SSHA 3VS5A 1H8KA 4Z89A 2VWFA 1Z9ZA 3THKA 1GL5A 2M51A 4F14A 1X6BA 3TVTA 3I5SA 5IHKA 2EBPA 2JM8A 2PTKA 2V1QA 2KT1A 2EYXA 4J9GA 4CC7A 1PKSA 4OMPA 3TSZA 4IIOA 4Y92A 2I0NA 1KSWA 1U5SA 1WLPB 2F2WA 2RQVA 4WCIA 2CUBA 4R0KA 4ZNXA 4OMMA 1VYVA 2J05A 2DLPA 1H92A 3LH5A 2P4RA 1SHGA 2LQNA 2KE9A 2FEIA 2D1XA 2FO0A 3PVLA 1WYXA 1WA7A 4D8DA 4OMQA 3ULRB 1T0HA 2CDTA 2DM1A 2A37A 5GJVB 2VVKA 4OMLA 2HCKA 1K76A 4IIMA 2AZSA 1YWOA 2JT4A 3VS7A 2KYBA 2JM9A 2VKNA 1SEMA 2K6DA 4LNPA 1M30A 1ZSGA 3FJ5A 3GBQA 3IQLA 1QLYA 3M0SA 1NM7A 2FPDA 1GCPA 2CT4A 1AWWA 1ZBJA 1GFCA 2EPDA 1SRLA 1OPLA 2RQRA 3QWXX 4ESRA 1JEGA 1W1FA 1FMKA 2C0OA 3VS1A 2YT6A 2LZ6B 2BZXA 4E6RA 2ENMA 2KT8A 2EKHA 2NUZA 1AOJA 2G6FX 2LQWA 2GTJA 2JMAA 1QKXA 1BBZA 3NHNA 1UFFA 4FSSA 3EG0A 4HXJA 1UHCA 1X2KA 2ED0A 1YN8A 2J7IA 2K7AA 4J9EA 1ZX6A 1OOTA 1AEYA 4J9IA 1MUZA 1QCFA 3M0TA 4AFSC 2OI3A 4DEXA 1W6XA 2DL7A 1XOVA 2K9GA 2DL8A 1WIEA 4JJCA 2GBQA 3M0RA 4JZ3A 2JS0A 2KR3A 2JMCA 2DMOA 2KROA 2FPFA 5I22A 1JQQA
chains in the Genus database with same CATH superfamily
1BU1A 1CKAA 2HQXA 2PNIA 4Y91A 4ZTFA 3JRZA 2Y90A 1WXBA 2RJFA 3HRUA 3BY7A 1RAIB 3REBB 1Y7XA 5LJ5j 1UGSB 3MEWA 3PNWC 1KQ2A 5LJ3j 4RTWA 4KUIA 4LDUA 5C0MA 4II1A 3O8VA 2L5QA 2O01E 2KDSA 1ZQ1A 2RO0A 1T3LA 2L3PA 2LC4A 3CC4Q 1YNZA 1I1JA 1BCOA 4FIBA 2DRKA 2RHZA 2W10A 4PJNA 2DIQA 2COYA 3I5RA 1AWXA 4M7DB 4XTUA 3G71T 4KT0E 3H8ZA 2MWPA 3PVQA 2QGGA 3H6ZA 3OYKA 2VXFA 2KAFA 3BE3A 2CT3A 5FU6C 2JJ9A 1K0XA 2A0FB 2YWWA 4C5EA 4A63B 1VQMQ 1EIFA 1PHTA 3C95A 2XI9A 4A4HA 1UDLA 2D0QB 4J9CA 4M4ZA 4E7HA 1AZEA 1K1ZA 1VQPT 3TEEA 3VRZA 1VQ9A 3VS3A 2BE9B 1RAHB 4KBMB 1MV0B 1YHQA 4M77C 2E3IA 4C92C 2KXDA 3EAEA 2HZYA 4FSXA 5HY6A 4DOWA 1ABOA 1I8FA 6AT1B 3SEMA 4C8QD 4RG8A 1K8AR 1PM3A 2EYZA 2OTLA 2LNHB 4BE1A 2LTOA 2IVWA 3OQ5A 3V7CA 4A54A 3CCJT 1M2OA 1M3CA 4JS5A 4YTLA 4A53A 5KCOA 1VQ6A 1KQ1A 3CMAQ 5FWCA 2D0NA 1FXXA 4RTTA 2PU9B 4BI4A 1WHHA 4M78D 4PJOE 1VQ4Q 4RTYA 1C6VX 1F1BB 1UEBA 3NPFA 5ECAA 1IREB 4B9WA 2K5LA 4C8QA 2X4XA 1N27A 3RNJA 2LJ0A 5I2SA 2QQSA 3CC7Q 3RKWA 2DL4A 1I5LA 1NLPC 4N4HA 3I56Q 1GCQA 3M0PA 3NGPA 2KMTA 2ZCFB 1QKWA 4J5YA 4E2FB 1AHJB 2QEXQ 3UT1A 4C8QB 2DRMA 2DE0X 1V1CA 4JDSA 3CCQA 3CC2Q 5CQYA 2OJ2A 1WHJA 1OI1A 4BE0A 4J7IA 2DBKA 4MDXA 3G6ET 4FU6A 1ACMB 2DKGA 1PKTA 4B9XA 1UB4A 1BYMA 4HCZA 2AKLA 1QQJA 1J3TA 3V7RA 1TUCA 2XICA 4DQ2A 3RESA 1C0MA 2M16A 4LN2A 2CZ1B 1VQKT 2OTJT 1G3WA 5I21A 2EWNA 1Y96A 4M75D 5GAMj 1W2BA 3OW2S 1AT1B 1E7OA 2E64A 2RD1A 1R77A 4IUTA 2YDLA 2D8JA 1ZSZA 3FLGA 2C0TA 5CKBA 4PL6A 3M0QA 2ATCB 5GAN3 3A5ZB 1MV3A 1OV3A 1TUGB 3FC3A 2DPPB 1Y96B 3PFSA 2FRYA 2BIVA 4F7UB 1H641 2LMJA 2ECZA 3PMTA 3M58A 2FZKB 4DEYA 1WQWA 1ZSZB 4OVAA 3G4SA 1X27A 1VQNA 4KGXB 1VYTA 2KXCA 3EHRA 2MF2A 3KUFA 2ZPGB 4MDWA 4KUDK 3JCMP 3M55A 1YJ9A 2W0ZA 1FYNA 1K0SA 1NJIR 1JJ2S 4K11A 2CP0A 3DLLA 2J6FA 5IHIA 2M0OA 4M75B 1VQ8A 2WACA 3H41A 2NUTA 2L3QA 2A36A 2O9SA 1HSQA 2K79A 2X51A 4JRKA 1VQOT 5FU7C 5CIUA 1T3SA 2EQUA 4J9HA 3MP8A 2A28A 5IH2A 2YSQA 3O5ZA 2LX9A 2VUBA 1YI2A 3LH0A 3A8HB 2QTXA 3OB9A 4Q5WA 4L59A 1KQSP 2GF7A 4N4GA 1LVKA 3L2VA 2H8HA 3JCMh 2NUTB 4BB7A 1NJIC 1OPKA 1G8XA 1OULA 3QIIA 1MNEA 1Z9ZA 1UGRB 1WJSA 3C12A 1IGUA 3TVTA 2JTMA 2VGMA 5IHKA 1VQLA 3JCMf 3S3NA 1LNXA 4OMPA 4FYXB 4Y92A 1KC8R 2EKOA 1KSWA 2V8JA 2HL3A 2XK0A 1U5SA 2F69A 2F2WA 5CKEA 3G71A 3L1AA 1HXDA 2DD4A 2YRCA 1SKUB 2CKKA 3JCMd 2HQHA 3ZFJA 4J6YA 4OMFB 1SHGA 3DKMA 5KYYA 1NJIU 4LXCA 3WVEB 2FO0A 1TOVA 3PVLA 5IAYA 1WYXA 1T0HA 2E5QA 2LVMA 4J6WA 3GNGA 1QVGP 3QUIA 2A37A 5A0GA 1BIBA 4PFZA 1JJ2P 4FW1A 4BY6C 3CC4T 2AZSA 1YWOA 1X6OA 4XTXA 1VQPA 1M2VB 2KYBA 1KC8C 2VKNA 3LX7A 3L42A 3CCUQ 3TU4K 2K6DA 3MO8A 1M30A 3IQLA 3GBQA 4E7IA 4XTWA 1M1FA 1AWWA 4FYYB 1ZBJA 1SRLA 4C0ZA 2E6ZA 4BE2A 2VXEA 4B6MA 3QDFA 2RHUA 5GMKj 1D0YA 1NPRA 3HHTB 4XQ3A 2KT8A 1VQMT 2NUZA 1AOJA 3EH2A 5AYFA 1BBZA 3OYNA 4N0AA 4FSSA 1QVPA 1QP2A 3OSVA 1QVFP 1RADB 1X2KA 4IURA 2K7AA 3EFOA 1X01A 4LD9K 1ZX6A 1OOTA 3META 2HD0A 4J9IA 2YRVA 3M0TA 2LDMA 4AFSC 3M4YA 3QZ5B 4DEXA 3JCMV 2JTFA 2A7YA 4M77E 3MJXA 4XU3A 2K9GA 1WIEA 3M0RA 4C92E 4PLLA 2JMCA 1YITQ 2ZPEB 4PJOG 1JQQA 3EFOB 2X35A 3INZA 4PJMA 4P5NA 2E6NA 5CKFA 3J81E 3CCVQ 1WDXA 2JTEA 4WTOB 1D1AA 1SRMA 4FYVB 3JB9H 2HKQB 1E6GA 1LCKA 2YUOA 2D6FA 1NLOC 4RUGA 5GANj 3X28B 2K4YA 4UC4A 1YIJQ 3BDUA 3CCEA 2V26A 3EFSA 3GPLA 2KY9A 1S72A 3CMAT 3EGXB 3H0IA 4Z8AA 2YUPA 2KNBB 2RPNA 1N9SA 1X69A 1WXUA 1VQ4T 1D0ZA 1Y71A 2LX7A 3URGA 1MMDA 2FYKA 4E7ZA 4J83A 3G6EA 4Y28E 2MOXA 5J3BA 3S6WA 3EHQA 1ZUKA 4A4GA 1Q7YR 3HKSA 4HCKA 2O31A 4J9DA 3CC7T 1I5OB 3VYGA 3NTIA 3PE0A 3I56T 4QT7A 3SHWA 1PRMC 3DB3A 2I2LA 2EGAA 4DBHA 1VQKA 3CEYA 2OTJA 3J80E 2SEMA 1CSKA 2EW3A 1JXMA 2QEXT 3NTHA 2CYZB 3CC2T 5KYWA 4C8QF 2P0QA 2K5IA 2DL5A 2M1HA 2RN8A 3OBYA 1X43A 3MPUB 3CMEA 4M7AD 2ZPIB 1M5Q1 2EIFA 2DYBA 2X4WA 4GLMA 2DYIA 2O88A 3P8HA 1Q7YC 1WI7A 3E9FA 2FVUA 3CCMA 1I07A 2DL3A 4A4FA 3G1JA 5FRMA 5FW9A 1VQ7Q 5KYWB 1YJNA 1YCSB 2KQWA 4ZN3A 4QQDA 4O5VA 1PC0A 3CBPA 3JCMe 2QA4Q 1UE9A 2RF0A 3QWYA 1WPYA 1I0CA 5CR2A 2PVDB 3A98A 4EMKB 4AG2C 4C5IA 1M27C 1TH7A 4M7DC 4EIKA 1MMAA 2M9UA 4KGZB 1UJ0A 4FT4A 4A4EA 2ZPBB 2K2MA 1NZ9A 5GAOq 2J06A 5CCAA 4JRQA 1Q7YU 1BK2A 2RHXA 1AVZC 2IIMA 3JCMg 2EYYA 2ED1A 1OZ2A 1UTIA 3LLRA 5A0LA 2P0KA 2QYZA 3OYGA 2EJFA 4XAXB 1VQOA 2FRWA 4RTUA 3OYDA 2DBMA 4M7AB 3P8BB 2PQWA 1AWJA 2DZ9A 1E6HA 1N5ZA 4ORZA 4WF2A 2O4XB 2DERA 1HJDA 1V29B 3RBBB 3N5BB 2HDAA 2ABLA 2EQKA 4M7DA 4J7FA 5IHNA 1N8RU 3I35A 2CGHA 4PFOA 2EJ9A 3QYHB 2M0YA 1ZBXA 1QP3A 4CRIA 3JB9F 3HFOA 3SB2A 3U23A 1BI2A 5HCKA 3MHXA 1TUDA 1QCNA 1B7TA 1QW1A 3VS4A 2GQVA 4HVWA 3C4SA 4C0GA 2VB6A 2DZCA 4JZ4A 4AG1C 2O2OA 3RDVA 4XK8E 2A08A 4LDXA 1M90C 2E12A 2D8HA 2HEQA 2HBWA 1X2QA 1RLQC 1PD1A 4QVCA 2KSSA 3JCMQ 4CC3A 2X3WD 2L3SA 1D3BA 3MEAA 1ZA2B 2OAUA 2CP3A 4KULA 2RNAA 4HVUA 1GRIA 2DXUA 1ZLMA 2DO3A 2PZ1A 4MZTA 3CD6A 2MYSA 1HK9A 3GOXA 1IZ6A 3EG9A 4NL3A 2RI3A 1UECA 3FEOA 5KYUA 3Q1JA 2EQIA 1D3BB 3OYJA 1M90U 2F5KA 3LGFA 4C8QC 2LCCA 5D7UA 1UG1A 5D6YA 2NYSA 3EGDA 1MMNA 1VQ6Q 2QQ9A 1XTDA 3EG9B 1R0CB 2X3XD 1DJ7B 1PSFA 2EVRA 3HRTA 1GCQC 1W70A 1TWBA 2VV5A 1SSFA 1NYGA 1OX8A 2AK5A 5KYUB 3CCUT 2LP5A 3R6OA 5DLQE 4FW2A 2MIOA 2RM4A 3CPFA 2X4JA 2X9HA 2DVEA 3OSSC 1ABQA 2QDYB 4DA4A 4AFQC 3EGDB 3RIRA 2AIRB 3VS0A 5I11A 3VRYA 4DOVA 2EGCA 1M3BA 4KRTA 2GCXA 3SDZA 4IKFA 1R8OB 1AD5A 2CS7A 3OYAA 3X20B 1Y07A 1MNDA 2V8IA 4M77G 5FLXE 4NOYA 4F16A 1LOJA 1IHVA 3CCQQ 3L2ZA 3X26B 4C92G 1O75A 2Y4YA 3CXCP 4RKUE 3OW2A 4PJLA 4PNOA 3QYGB 1W4SA 5IXBA 1KHCA 3PIOA 2YLCA 3VS5A 1SSHA 4PJJA 3THKA 1GL5A 4OB3B 4F14A 1X6BA 2C06A 1B34A 1JB0E 1ZSZC 2JM8A 4C0DB 4FCYA 2KT1A 4M78A 2WSEE 4CC7A 4IIOA 1X75C 3WXMB 2I0NA 1ZA1B 1YITT 2F1LA 4ANJA 2DIGA 2BE7D 2NUPA 2XHCA 3CC7A 3QKJA 2EAYA 1B34B 1KHIA 2HQEA 2QXFA 3LH5A 3CCVT 1I4K1 1IB8A 3JCMW 2LQNA 2E70A 3QXEB 1P92A 4M78B 3MP6A 2FEIA 1TSFA 3OYLA 1WHLA 3JB9J 3PT9A 1KQSS 4F7UA 1YIJT 2QQAA 2QEXA 2PUKB 2RHIA 3E2UA 5LJ5h 2CDTA 2DM1A 1IGQA 3CC2A 2NUPB 5GJVB 5LJ3h 2VVKA 2CZ7B 2CZ6B 3QO3A 3GLXA 3G4SQ 4QQ6A 3MEUA 3I55A 5LJ5f 5GAN8 1SEMA 1XQHA 1RABB 4LNPA 1ZSGA 5LJ3f 3M0SA 5GAN4 2FPDA 2CT4A 2R58A 2HSEB 3HPWA 2EPDA 1OPLA 3QWXX 2LT1A 2XIDA 1GXIE 4BDYA 1JEGA 3BFMA 3PIPA 1W1FA 1WHGA 4DBQA 5LJ5d 1FMKA 4JJNK 1Q86C 5LJ3d 3VS1A 3HSBA 1NBEB 4M75A 2BZXA 4J6XA 4PKCC 4E6RA 2ENMA 3GIBA 3OYIA 2LQWA 2AT1B 2DEQA 2QQBA 1RAEB 2GTJA 1QVGS 2RJDA 3OBWA 3QHSA 1UFFA 4JRIA 3HP9A 4FM4B 1UHCA 3V7SA 3OMGA 1OQKA 2DXCA 3ZBDA 4J9EA 3RMQA 4ZGDB 1YI2Q 1VQ7T 4OGEA 1QCFA 4O6JA 3V8JA 1Q86U 2QA4T 4ZTJA 4JZ3A 2JS0A 4RG2A 2KR3A 5I2MA 3LWIA 1VQLQ 1TTHB 3L2QA 3KXTA 5C6SA 2JS2A 3GNFB 4LDWA 1NE8A 1H3ZA 2F5TX 3FB9A 3CPWS 3TQ7P 4M7DE 1TU0B 4LUDA 5GAOm 4BI8B 5A2QE 3C94A 2JZ2A 3V8LA 1VQ5Q 1QVFS 1M8MA 5KE2A 2CUDA 3VU3C 5GMKi 2LCSA 4MZPA 2RHYA 5GAN7 2XG8D 1M9SA 5M9OA 2MAMA 4EMHA 5IXFA 3M54A 2XKOC 2KYMA 4E7KA 4M7AF 3PTAA 2KRMA 1KD1C 2D9TA 4R55A 1M2VA 3CBMA 5IT9E 1VYUA 4JUVA 3EFRA 2KEAA 2AZVA 3OYCA 3WVDB 1U3OA 1PNJA 4AMCA 1QWEA 2GNCA 5HKCA 4N0AC 5KYNA 2G3RA 1VIEA 2RQWA 3FDRA 2QDLA 1YFNA 4MMKA 1WXTA 1JRIA 4NL2A 8AT1B 4M7DF 2X4YA 4BD3A 2P4TA 1W2BP 1KD1U 2AKKA 3MP1A 1TS9A 9ATCB 1K4US 3UDCA 1G83A 4E47A 3PGGA 2J6OA 2L2PA 3CCRQ 2KRSA 2LJ3A 2RQUA 3QJ6A 4JJBA 2JOYA 1KG1A 4EMGA 2RI5A 4PJOD 3VUBA 3UA7A 1EFNA 3OY9A 2L8DA 3BDLA 3CCLQ 5KCHA 3CPWP 2IPOB 4R56A 4HVVA 2ESWA 1QMCA 2CSIA 1BIAA 3CCUA 4RMOA 4GBQA 2O9VA 3CCJA 3AHUA 5GAMh 2E5KA 4ATOA 1UGQB 2QG9B 3D7SB 4RTZA 2E3HA 2PUOB 1BCMA 2RQTA 2V8KA 2OTLT 1N6AA 2K5FA 3OYEA 5GAMf 1NG2A 2DK3A 7AT1B 2YUQA 2KRNA 2ZPHB 2HMAA 3FRNA 2F2XA 2E65A 3QPHA 3UATA 1YJWQ 2FL7A 1PRLC 3EGXA 2DA9A 1VQ6T 1NEBA 3CCEQ 4XU0A 5GAMd 3H0HA 1S72Q 4C8QE 5LJ5e 1ZUUA 3M4GA 4HT9A 2DJZA 4ZGJB 5LJ3e 4BY6B 4JLGA 3I9QA 5KYXA 2JNGA 3MEVA 5GAOl 1GFDA 4V2SA 4PJOB 3QBYA 1K9MR 1PD0A 5CKDA 4TVRA 3E19A 4Z88A 1QWFA 3DB4A 4L6V5 5LJ5g 3SWNA 4EMKC 5KYXB 3M5AA 3MCAB 1MGQA 1MMGA 3E1SA 5LJ3g 1UJYA 4OB2B 1G3YA 4OMNA 2CSQA 3TREA 3CCQT 3CCVA 1BKBA 2GFUA 1D1BA 3CMEQ 2BTTA 1D0XA 5HK3A 4ELZC 1BI0A 1YIJA 2CREA 3SWNB 1KFZA 1Q82C 2H3JA 3OYFA 2CH4W 1K9MC 4F7UE 3CCMQ 1M1KU 2QGFB 1ARKA 2ZZDA 1YJNQ 2E1HA 4M7AC 1N8RR 1YBYA 3OA6A 3KFVA 1WHKA 4EMKA 4OB0B 3NMZC 4NS5A 2XMFA 3CCSQ 1TG0A 2QAZA 5A0DA 5J26A 4J9FA 2MCNA 4M78F 2L3RA 1FX7A 1Q82U 2ROTA 4RCBA 3OS2A 1K9MU 2DVJA 2QQRA 2DJQA 5FROA 3JCMb 4E7LA 4PLIA 3R6NA 1U06A 2P84A 3G4ST 1N8RC 2RI2A 4HCBA 4IUQA 4OMOA 4M7AA 2L0AA 3S3MA 4EPCA 2LQKA 3LGLA 2O4XA 1HD3A 1G2BA 1YP5A 3OS0A 2DXTA 3REAB 4F7UF 2F2VA 3VJPA 1AWOA 2QA4A 1B3QA 2RH2A 4RTXA 4J9BA 2RB6A 5GMKh 5IN1A 2VYTA 1RI9A 2Y4XA 1SG5A 1M90R 2XDDA 2K3BA 2ZGWA 1ZHIA 3NTKA 1Z9QA 2AHJB 5J39A 5GAN6 4ZN1A 1YI2T 4M75F 3E9GA 4QW2A 4M7DG 1LJOA 2PTKA 2V1QA 4ZGEB 2MPXC 2EYXA 1UGPB 3QSUA 1PKSA 2R57A 3TSZA 5CO7A 3UWNA 2FZGB 1VQLT 1WLPB 2R5AA 1FMWA 2RQVA 1M8VA 1O9SA 4R0KA 4ZNXA 4OMMA 5CAIA 2CP5A 1IXDA 1VQ9Q 2P4RA 4X9CA 2KE9A 3JCMJ 5GAMe 3CXCS 2D1XA 3CD6Q 2E41A 1YHQQ 4MMLA 1WA7A 4D8DA 3CC4A 2CP7A 3ULRB 2RK1A 3PMIA 3A8GB 1VQ5T 5GANh 1K76A 4IIMA 1OU8A 3VS7A 1WZOA 4L5GA 2MWOA 2OTLQ 1QLYA 3LW5E 5GANf 1IHWA 4HA8A 2Z0WA 5GAMg 3HTRA 2RQRA 5GAOn 4ESRA 3ASKA 2HNIA 1WGSA 1VQMA 2C0OA 4C0DC 4HKEA 2KI7A 4M77D 3KBGA 2B8AA 5GANd 2LZ6B 4QKUA 4C92D 1EX4A 3OS1A 2NLUA 4ELYC 5AT1B 2EKHA 2G6FX 3T9NA 3JB9I 2DD5A 4ME7A 3LYIA 3A1PA 4RCCA 3EG0A 1K73R 2WSFE 4M78C 4IUPA 4HXJA 4DBFA 3GP8A 2ED0A 2VASA 1YN8A 2MMPA 3CCRT 3FIFA 1AEYA 3QJYA 4XTVA 1MUZA 3A8LB 3SFMA 5FU6B 3ZEHA 3CCLT 4VUBA 4JJCA 1BI1A 4M77A 1KQSA 4OB1B 1VOMA 4BI3A 1G3TA 4C92A 2DMOA 2KROA 2FPFA 3V8KA 2LCLA 2RMOA 1S1NA 2YLBA 4MZMA 1MHNA 2NWMA 4C5GA 4C8QG 1XNIA 1K8AC 2XU8A 4AFZC 1K73C 3CQTA 3CMAA 1JBMA 2RK2A 4M77B 1WQ7A 1IO6A 5HK0A 1VQ4A 5DM7R 4C92B 2K3XA 4XU1A 4PK4A 1JU5C 3UF4A 1G3SA 2MI6A 1NEGA 4AFUC 1YJWT 1RLPC 5GAOr 3TCJA 4C0FA 1RAFB 3CCET 3NFCA 2BZYA 1S72T 3DLMA 3I56A 2E4HA 3G7ZA 2GTOA 4M78G 2OX7A 4M75C 1Q86R 3I55Q 1QVGA 3UA6A 1K8AU 3JCMc 1K73U 2XD0A 1JJ2A 1UUEA 3EGUA 3VS2A 1VIFA 1D09B 1K9AA 4PJOF 1Q81R 2DFUA 2A3LA 3HL8A 1VQNQ 3HRSA 2V1RA 2RJCA 4F7UG 2HKNA 3JB9D 2ROLA 3ZL7C 1YJ9Q 2BUDA 2DXBA 1YCYA 3A8MB 2GFAA 5GMKe 2XDBA 1OU9A 2DF6A 2EQMA 2FHDA 3CMET 3M53A 3UPUA 1Y57A 1U8RA 4PFPA 1LPLA 5KH6A 3J7AF 1PG5B 2C0IA 1M4ZA 2OAWA 4D8KA 3CPWA 4N4IA 1VQ8Q 1GBQA 3JV3A 4C5HA 3CCMT 3OYBA 1D1CA 2JXBA 1V76A 1Q81C 4FYWB 2YHTA 4LUEA 1XJWB 2J6KA 4FT2A 1YJNT 3CBOA 3X24B 2LRQA 2QI2A 1QVFA 2HSPA 1WJRA 4JS4A 4CI0C 5FWBA 4M75G 1T0JA 1YWPA 3JB9G 4M7AE 1RAGB 2ZPFB 3CCST 4JJDA 4LE9A 5L23A 2ZAEA 2KBTA 4E7SA 1W2BS 1NPPA 3ER0A 3C0CA 3EH1A 3RR6A 4GLKA 2COWA 1KD1R 3RMSA 4A4KA 1WJQA 1Q81U 1WFWA 4KH1B 1SPKA 8ATCB 2QK0A 1A0NB 1VUBA 1NYFA 2B86A 3AT1B 2KVQG 3G71Q 1JO8A 2WSCE 5GANe 2EFIA 1RUWA 4F17A 1EZZB 2K2VA 1ZUYA 4F04B 1M1GA 2R5MA 5GAOp 2QTVA 3OW2P 4J8OA 4LDVA 2DILA 3EG3A 5GAN5 4BUGA 3VUZA 2PVGB 2CP2A 3GF5A 1Q95G 1PWTA 2P0PA 1RAAB 5GANg 1WHMA 2DX1A 1VQPQ 2HL5C 4XU2A 5EG2A 1UGVA 2JVVA 3M59A 1SF9A 4HCCA 2VC8A 1FMVA 4QVDA 1M3AA 1VQ5A 2FPEA 4XTYA 2VGNA 4HT8A 5GMKm 2EYWA 2FB7A 2EQJA 2FG0A 2CP6A 2YUNA 2JUFA 1KIKA 4JPBW 3L2WA 3OYMA 5FU7B 1CKBA 1SHFA 2LQ8A 2BZ8A 4FL6A 4EDUA 3TSWA 2MK5A 4X1VA 1OZ3A 5KYYB 2DTOA 3A8OB 1VQ9T 3CCJQ 5CKHA 2FZCB 3EG1A 3M56A 4AT1B 3FJPA 4PJOC 3CD6T 3MKDA 1YHQT 1U1TA 1X6GA 1GBRA 2GQIA 2JW4A 3P8DA 1JXOA 2SRCA 1B07A 1HYOA 1FWZA 2KK4A 2CH4A 1BI3A 2H3EB 2JN0A 1H3HA 4JRPA 5D6XA 4X34A 3OYHA 2EGEA 1KK7A 4LD6A 2M02A 3VS6A 1Y0MA 3LWHA 2K3YA 3QZ9B 1BB9A 2KGTA 1M1KR 4BACA 1I81A 1KC8U 2CZ0B 3CCRA 1UHFA 3RKYA 3SWNC 1KJWA 1N9RA 5GAN2 5KE3A 3M0UA 4RTVA 2DNUA 3VV0A 3H9NA 2LJ1A 4PJOA 1AZGB 3CCLA 2GGRA 4KH0B 3H0FA 2COZA 1OX9A 1VA7A 5DLOA 2EYQA 2QASA 4CC2A 1WX6A 3SD4A 4CC4B 3L2UA 3QG1A 1OEBA 3EG2A 3OS5A 2L89A 3RKXA 3G6EQ 1QCOA 5GJWB 1Q82R 5LL6S 5CQXA 5EC7A 2BKDN 3L2RA 1H8KA 2IG0A 3OMCA 4Z89A 2VWFA 1M1KC 2PVOB 2M51A 4GY5A 3S3OA 3I5SA 1VQKQ 2OTJQ 2EBPA 4M78E 1YITA 4D6WA 4J9GA 1YJWA 1PCXA 3QDRB 3JAME 3F70A 4OGCA 2YXYA 2EJGA 4BDZA 4WCIA 2CUBA 1VYVA 1U1SA 2J05A 3M57A 2DLPA 1H92A 2XDPA 5FRNA 2LT4A 4QVZA 4JLIA 2DETA 2LNVA 4OMQA 2RA2A 1IRXA 4OF1A 4XTZA 1RI0A 5GMKl 4M77F 4DBRA 4C92F 4OMLA 2HCKA 3X25B 3M9QA 2K57A 3ME9A 2JT4A 2JM9A 3FJ5A 1RL2A 5D6WA 3VKIA 2HAXA 1NM7A 1GCPA 3VYHB 5CK9A 1TXQA 1R0BG 3JSCA 1GFCA 2RJEA 4QQGA 4OP0A 2DEUA 1RACB 3I55T 3JCMX 4IUUA 1PSEA 5DY9A 4M75E 2YT6A 1VQNT 1VQOQ 3OYYA 5CVIA 2JMAA 1QKXA 1C1AA 4X9DA 4E7JA 3NHNA 2DTHA 3CCSA 1YJ9T 1VQ7A 4M7DD 4IUVA 1OYXA 2J7IA 4LDYA 3RERA 4M7AG 3HFNA 2YRDA 3RUXA 2DAQA 2OI3A 4KGVB 1VQ8T 1W6XA 2DL7A 2E10A 1XOVA 2DTIA 3CXCA 2DL8A 2GBQA 3BW1A 1WNLA 5L8RE 4Z02A 2HBPA 5I22A 1G5VA
chains in the Genus database with same CATH topology
2JS2A 1BU1A 2RMOA 1S1NA 1CKAA 2PNIA 2NWMA 1WDXA 1WXBA 2JTEA 1SRMA 4AFZC 3CQTA 3REBB 4LUDA 1E6GA 1LCKA 2YUOA 4RTWA 1NLOC 1IO6A 4RUGA 1M8MA 2CUDA 2LCSA 3H0IA 4Z8AA 2YUPA 1JU5C 3UF4A 2KNBB 1NEGA 2RPNA 1T3LA 1X69A 4AFUC 1RLPC 1WXUA 2L3PA 1YNZA 2LX7A 1I1JA 5IXFA 2BZYA 2DRKA 2KYMA 2MOXA 3EHQA 2W10A 2KRMA 3I5RA 1ZUKA 1AWXA 2GTOA 4HCKA 2O31A 4J9DA 1VYUA 3PVQA 3PE0A 2KEAA 4QT7A 3SHWA 2AZVA 1PRMC 3UA6A 1UUEA 3EGUA 2EGAA 3VS2A 2SEMA 2CT3A 1U3OA 1K9AA 1PNJA 1K0XA 1CSKA 1QWEA 2EW3A 2GNCA 1JXMA 4A63B 2V1RA 2RQWA 1PHTA 2QDLA 1WXTA 2DL5A 2RN8A 1UDLA 1X43A 4J9CA 4M4ZA 2ROLA 1AZEA 3ZL7C 1K1ZA 2DYBA 2AKKA 3VRZA 4GLMA 2O88A 3VS3A 1WI7A 2DF6A 1K4US 1G83A 1MV0B 1I07A 2J6OA 2DL3A 2L2PA 2KRSA 1Y57A 2LJ3A 5FW9A 2RQUA 2KXDA 1YCSB 2C0IA 4JJBA 2OAWA 4D8KA 1GBQA 3JV3A 3UA7A 1EFNA 1ABOA 1UE9A 2JXBA 2RF0A 3QWYA 4LUEA 1I0CA 2J6KA 3SEMA 3A98A 4HVVA 2ESWA 2HSPA 2CSIA 4AG2C 1M27C 4GBQA 2O9VA 4EIKA 2EYZA 1UJ0A 2E5KA 5FWBA 1T0JA 2LNHB 1YWPA 2K2MA 4JJDA 4RTZA 4LE9A 2J06A 5L23A 1BK2A 2RQTA 1AVZC 2KBTA 1M3CA 2IIMA 1NG2A 2EYYA 2ED1A 2YUQA 3C0CA 2KRNA 2F2XA 1UTIA 5FWCA 2D0NA 4RTTA 2FRWA 4RTUA 3UATA 2DBMA 1PRLC 1WFWA 1SPKA 2DA9A 4RTYA 1A0NB 1NEBA 1AWJA 3H0HA 1E6HA 1N5ZA 3NPFA 4ORZA 1NYFA 2B86A 1ZUUA 5ECAA 1JO8A 1HJDA 3RNJA 3RBBB 2LJ0A 3I9QA 2HDAA 2ABLA 1RUWA 5IHNA 4F17A 2DL4A 3I35A 1NLPC 1ZUYA 1GFDA 1GCQA 3M0PA 3NGPA 2M0YA 1QKWA 4Z88A 2DILA 3EG3A 1QWFA 2DRMA 2DE0X 1V1CA 3U23A 2OJ2A 5HCKA 1PWTA 1TUDA 1UJYA 2DBKA 4OMNA 2CSQA 3VS4A 2DX1A 1UGVA 1PKTA 4HVWA 2AKLA 1J3TA 1TUCA 2BTTA 4JZ4A 4AG1C 2O2OA 2A08A 1M3AA 2CREA 2D8HA 2HEQA 2FPEA 1KFZA 4LN2A 2HBWA 2CH4W 1X2QA 1RLQC 2EYWA 1ARKA 4CC3A 2X3WD 2L3SA 2FG0A 2YUNA 1E7OA 1KIKA 4JPBW 1CKBA 1SHFA 2YDLA 2D8JA 2BZ8A 3KFVA 2C0TA 2RNAA 4HVUA 1GRIA 3TSWA 1ZLMA 2PZ1A 4X1VA 3NMZC 3M0QA 2XMFA 1TG0A 1MV3A 1OV3A 3EG1A 1UECA 2FRYA 2LMJA 2EQIA 2ECZA 4J9FA 2MCNA 1X6GA 1GBRA 4DEYA 2GQIA 2JW4A 2ROTA 1JXOA 1X27A 2DVJA 2DJQA 1UG1A 2SRCA 1B07A 1VYTA 2KXCA 3EHRA 3R6NA 2CH4A 2EVRA 2X3XD 1GCQC 1W70A 1H3HA 1U06A 1NYGA 2AK5A 4OMOA 2W0ZA 2EGEA 1FYNA 2LP5A 2L0AA 3VS6A 1Y0MA 2MIOA 1K0SA 1HD3A 1G2BA 1YP5A 1ABQA 1BB9A 2KGTA 3REAB 4K11A 1UHFA 4AFQC 2J6FA 1KJWA 2F2VA 1AWOA 3M0UA 4RTVA 5IHIA 2DNUA 3VS0A 5I11A 3VRYA 3H41A 2LJ1A 1B3QA 4RTXA 1AZGB 2EGCA 1M3BA 2GGRA 4KRTA 3H0FA 2L3QA 2A36A 2O9SA 1VA7A 1AD5A 1HSQA 2K79A 4CC2A 4J9BA 1WX6A 4CC4B 1T3SA 4J9HA 1OEBA 3EG2A 2A28A 5IH2A 1RI9A 2YSQA 4F16A 3O5ZA 5GJWB 5IXBA 2K3BA 5EC7A 2H8HA 1Z9QA 1OPKA 1SSHA 3VS5A 1H8KA 4Z89A 2VWFA 1Z9ZA 3THKA 1GL5A 2M51A 4F14A 1X6BA 3TVTA 3I5SA 5IHKA 2EBPA 2JM8A 2PTKA 2V1QA 2KT1A 2EYXA 4J9GA 4CC7A 1PKSA 4OMPA 3TSZA 4IIOA 4Y92A 2I0NA 1KSWA 1U5SA 1WLPB 2F2WA 2RQVA 4WCIA 2CUBA 4R0KA 4ZNXA 4OMMA 1VYVA 2J05A 2DLPA 1H92A 3LH5A 2P4RA 1SHGA 2LQNA 2KE9A 2FEIA 2D1XA 2FO0A 3PVLA 1WYXA 1WA7A 4D8DA 4OMQA 3ULRB 1T0HA 2CDTA 2DM1A 2A37A 5GJVB 2VVKA 4OMLA 2HCKA 1K76A 4IIMA 2AZSA 1YWOA 2JT4A 3VS7A 2KYBA 2JM9A 2VKNA 1SEMA 2K6DA 4LNPA 1M30A 1ZSGA 3FJ5A 3GBQA 3IQLA 1QLYA 3M0SA 1NM7A 2FPDA 1GCPA 2CT4A 1AWWA 1ZBJA 1GFCA 2EPDA 1SRLA 1OPLA 2RQRA 3QWXX 4ESRA 1JEGA 1W1FA 1FMKA 2C0OA 3VS1A 2YT6A 2LZ6B 2BZXA 4E6RA 2ENMA 2KT8A 2EKHA 2NUZA 1AOJA 2G6FX 2LQWA 2GTJA 2JMAA 1QKXA 1BBZA 3NHNA 1UFFA 4FSSA 3EG0A 4HXJA 1UHCA 1X2KA 2ED0A 1YN8A 2J7IA 2K7AA 4J9EA 1ZX6A 1OOTA 1AEYA 4J9IA 1MUZA 1QCFA 3M0TA 4AFSC 2OI3A 4DEXA 1W6XA 2DL7A 1XOVA 2K9GA 2DL8A 1WIEA 4JJCA 2GBQA 3M0RA 4JZ3A 2JS0A 2KR3A 2JMCA 2DMOA 2KROA 2FPFA 5I22A 1JQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS2 A;  1BU1 A;  2RMO A;  1S1N A;  1CKA A;  2PNI A;  2NWM A;  1WDX A;  1WXB A;  2JTE A;  1SRM A;  4AFZ C;  3CQT A;  3REB B;  4LUD A;  1E6G A;  1LCK A;  2YUO A;  4RTW A;  1NLO C;  1IO6 A;  4RUG A;  1M8M A;  2CUD A;  2LCS A;  3H0I A;  4Z8A A;  2YUP A;  1JU5 C;  3UF4 A;  2KNB B;  1NEG A;  2RPN A;  1T3L A;  1X69 A;  4AFU C;  1RLP C;  1WXU A;  2L3P A;  1YNZ A;  2LX7 A;  1I1J A;  5IXF A;  2BZY A;  2DRK A;  2KYM A;  2MOX A;  3EHQ A;  2W10 A;  2KRM A;  3I5R A;  1ZUK A;  1AWX A;  2GTO A;  4HCK A;  2O31 A;  4J9D A;  1VYU A;  3PVQ A;  3PE0 A;  2KEA A;  4QT7 A;  3SHW A;  2AZV A;  1PRM C;  3UA6 A;  1UUE A;  3EGU A;  2EGA A;  3VS2 A;  2SEM A;  2CT3 A;  1U3O A;  1K9A A;  1PNJ A;  1K0X A;  1CSK A;  1QWE A;  2EW3 A;  2GNC A;  1JXM A;  4A63 B;  2V1R A;  2RQW A;  1PHT A;  2QDL A;  1WXT A;  2DL5 A;  2RN8 A;  1UDL A;  1X43 A;  4J9C A;  4M4Z A;  2ROL A;  1AZE A;  3ZL7 C;  1K1Z A;  2DYB A;  2AKK A;  3VRZ A;  4GLM A;  2O88 A;  3VS3 A;  1WI7 A;  2DF6 A;  1K4U S;  1G83 A;  1MV0 B;  1I07 A;  2J6O A;  2DL3 A;  2L2P A;  2KRS A;  1Y57 A;  2LJ3 A;  5FW9 A;  2RQU A;  2KXD A;  1YCS B;  2C0I A;  4JJB A;  2OAW A;  4D8K A;  1GBQ A;  3JV3 A;  3UA7 A;  1EFN A;  1ABO A;  1UE9 A;  2JXB A;  2RF0 A;  3QWY A;  4LUE A;  1I0C A;  2J6K A;  3SEM A;  3A98 A;  4HVV A;  2ESW A;  2HSP A;  2CSI A;  4AG2 C;  1M27 C;  4GBQ A;  2O9V A;  4EIK A;  2EYZ A;  1UJ0 A;  2E5K A;  5FWB A;  1T0J A;  2LNH B;  1YWP A;  2K2M A;  4JJD A;  4RTZ A;  4LE9 A;  2J06 A;  5L23 A;  1BK2 A;  2RQT A;  1AVZ C;  2KBT A;  1M3C A;  2IIM A;  1NG2 A;  2EYY A;  2ED1 A;  2YUQ A;  3C0C A;  2KRN A;  2F2X A;  1UTI A;  5FWC A;  2D0N A;  4RTT A;  2FRW A;  4RTU A;  3UAT A;  2DBM A;  1PRL C;  1WFW A;  1SPK A;  2DA9 A;  4RTY A;  1A0N B;  1NEB A;  1AWJ A;  3H0H A;  1E6H A;  1N5Z A;  3NPF A;  4ORZ A;  1NYF A;  2B86 A;  1ZUU A;  5ECA A;  1JO8 A;  1HJD A;  3RNJ A;  3RBB B;  2LJ0 A;  3I9Q A;  2HDA A;  2ABL A;  1RUW A;  5IHN A;  4F17 A;  2DL4 A;  3I35 A;  1NLP C;  1ZUY A;  1GFD A;  1GCQ A;  3M0P A;  3NGP A;  2M0Y A;  1QKW A;  4Z88 A;  2DIL A;  3EG3 A;  1QWF A;  2DRM A;  2DE0 X;  1V1C A;  3U23 A;  2OJ2 A;  5HCK A;  1PWT A;  1TUD A;  1UJY A;  2DBK A;  4OMN A;  2CSQ A;  3VS4 A;  2DX1 A;  1UGV A;  1PKT A;  4HVW A;  2AKL A;  1J3T A;  1TUC A;  2BTT A;  4JZ4 A;  4AG1 C;  2O2O A;  2A08 A;  1M3A A;  2CRE A;  2D8H A;  2HEQ A;  2FPE A;  1KFZ A;  4LN2 A;  2HBW A;  2CH4 W;  1X2Q A;  1RLQ C;  2EYW A;  1ARK A;  4CC3 A;  2X3W D;  2L3S A;  2FG0 A;  2YUN A;  1E7O A;  1KIK A;  4JPB W;  1CKB A;  1SHF A;  2YDL A;  2D8J A;  2BZ8 A;  3KFV A;  2C0T A;  2RNA A;  4HVU A;  1GRI A;  3TSW A;  1ZLM A;  2PZ1 A;  4X1V A;  3NMZ C;  3M0Q A;  2XMF A;  1TG0 A;  1MV3 A;  1OV3 A;  3EG1 A;  1UEC A;  2FRY A;  2LMJ A;  2EQI A;  2ECZ A;  4J9F A;  2MCN A;  1X6G A;  1GBR A;  4DEY A;  2GQI A;  2JW4 A;  2ROT A;  1JXO A;  1X27 A;  2DVJ A;  2DJQ A;  1UG1 A;  2SRC A;  1B07 A;  1VYT A;  2KXC A;  3EHR A;  3R6N A;  2CH4 A;  2EVR A;  2X3X D;  1GCQ C;  1W70 A;  1H3H A;  1U06 A;  1NYG A;  2AK5 A;  4OMO A;  2W0Z A;  2EGE A;  1FYN A;  2LP5 A;  2L0A A;  3VS6 A;  1Y0M A;  2MIO A;  1K0S A;  1HD3 A;  1G2B A;  1YP5 A;  1ABQ A;  1BB9 A;  2KGT A;  3REA B;  4K11 A;  1UHF A;  4AFQ C;  2J6F A;  1KJW A;  2F2V A;  1AWO A;  3M0U A;  4RTV A;  5IHI A;  2DNU A;  3VS0 A;  5I11 A;  3VRY A;  3H41 A;  2LJ1 A;  1B3Q A;  4RTX A;  1AZG B;  2EGC A;  1M3B A;  2GGR A;  4KRT A;  3H0F A;  2L3Q A;  2A36 A;  2O9S A;  1VA7 A;  1AD5 A;  1HSQ A;  2K79 A;  4CC2 A;  4J9B A;  1WX6 A;  4CC4 B;  1T3S A;  4J9H A;  1OEB A;  3EG2 A;  2A28 A;  5IH2 A;  1RI9 A;  2YSQ A;  4F16 A;  3O5Z A;  5GJW B;  5IXB A;  2K3B A;  5EC7 A;  2H8H A;  1Z9Q A;  1OPK A;  1SSH A;  3VS5 A;  1H8K A;  4Z89 A;  2VWF A;  1Z9Z A;  3THK A;  1GL5 A;  2M51 A;  4F14 A;  1X6B A;  3TVT A;  3I5S A;  5IHK A;  2EBP A;  2JM8 A;  2PTK A;  2V1Q A;  2KT1 A;  2EYX A;  4J9G A;  4CC7 A;  1PKS A;  4OMP A;  3TSZ A;  4IIO A;  4Y92 A;  2I0N A;  1KSW A;  1U5S A;  1WLP B;  2F2W A;  2RQV A;  4WCI A;  2CUB A;  4R0K A;  4ZNX A;  4OMM A;  1VYV A;  2J05 A;  2DLP A;  1H92 A;  3LH5 A;  2P4R A;  1SHG A;  2LQN A;  2KE9 A;  2FEI A;  2D1X A;  2FO0 A;  3PVL A;  1WYX A;  1WA7 A;  4D8D A;  4OMQ A;  3ULR B;  1T0H A;  2CDT A;  2DM1 A;  2A37 A;  5GJV B;  2VVK A;  4OML A;  2HCK A;  1K76 A;  4IIM A;  2AZS A;  1YWO A;  2JT4 A;  3VS7 A;  2KYB A;  2JM9 A;  2VKN A;  1SEM A;  2K6D A;  4LNP A;  1M30 A;  1ZSG A;  3FJ5 A;  3GBQ A;  3IQL A;  1QLY A;  3M0S A;  1NM7 A;  2FPD A;  1GCP A;  2CT4 A;  1AWW A;  1ZBJ A;  1GFC A;  2EPD A;  1SRL A;  1OPL A;  2RQR A;  3QWX X;  4ESR A;  1JEG A;  1W1F A;  1FMK A;  2C0O A;  3VS1 A;  2YT6 A;  2LZ6 B;  2BZX A;  4E6R A;  2ENM A;  2KT8 A;  2EKH A;  2NUZ A;  1AOJ A;  2G6F X;  2LQW A;  2GTJ A;  2JMA A;  1QKX A;  1BBZ A;  3NHN A;  1UFF A;  4FSS A;  3EG0 A;  4HXJ A;  1UHC A;  1X2K A;  2ED0 A;  1YN8 A;  2J7I A;  2K7A A;  4J9E A;  1ZX6 A;  1OOT A;  1AEY A;  4J9I A;  1MUZ A;  1QCF A;  3M0T A;  4AFS C;  2OI3 A;  4DEX A;  1W6X A;  2DL7 A;  1XOV A;  2K9G A;  2DL8 A;  1WIE A;  4JJC A;  2GBQ A;  3M0R A;  4JZ3 A;  2JS0 A;  2KR3 A;  2JMC A;  2DMO A;  2KRO A;  2FPF A;  5I22 A;  1JQQ A; 
#chains in the Genus database with same CATH topology
 1BU1 A;  1CKA A;  2HQX A;  2PNI A;  4Y91 A;  4ZTF A;  3JRZ A;  2Y90 A;  1WXB A;  2RJF A;  3HRU A;  3BY7 A;  1RAI B;  3REB B;  1Y7X A;  5LJ5 j;  1UGS B;  3MEW A;  3PNW C;  1KQ2 A;  5LJ3 j;  4RTW A;  4KUI A;  4LDU A;  5C0M A;  4II1 A;  3O8V A;  2L5Q A;  2O01 E;  2KDS A;  1ZQ1 A;  2RO0 A;  1T3L A;  2L3P A;  2LC4 A;  3CC4 Q;  1YNZ A;  1I1J A;  1BCO A;  4FIB A;  2DRK A;  2RHZ A;  2W10 A;  4PJN A;  2DIQ A;  2COY A;  3I5R A;  1AWX A;  4M7D B;  4XTU A;  3G71 T;  4KT0 E;  3H8Z A;  2MWP A;  3PVQ A;  2QGG A;  3H6Z A;  3OYK A;  2VXF A;  2KAF A;  3BE3 A;  2CT3 A;  5FU6 C;  2JJ9 A;  1K0X A;  2A0F B;  2YWW A;  4C5E A;  4A63 B;  1VQM Q;  1EIF A;  1PHT A;  3C95 A;  2XI9 A;  4A4H A;  1UDL A;  2D0Q B;  4J9C A;  4M4Z A;  4E7H A;  1AZE A;  1K1Z A;  1VQP T;  3TEE A;  3VRZ A;  1VQ9 A;  3VS3 A;  2BE9 B;  1RAH B;  4KBM B;  1MV0 B;  1YHQ A;  4M77 C;  2E3I A;  4C92 C;  2KXD A;  3EAE A;  2HZY A;  4FSX A;  5HY6 A;  4DOW A;  1ABO A;  1I8F A;  6AT1 B;  3SEM A;  4C8Q D;  4RG8 A;  1K8A R;  1PM3 A;  2EYZ A;  2OTL A;  2LNH B;  4BE1 A;  2LTO A;  2IVW A;  3OQ5 A;  3V7C A;  4A54 A;  3CCJ T;  1M2O A;  1M3C A;  4JS5 A;  4YTL A;  4A53 A;  5KCO A;  1VQ6 A;  1KQ1 A;  3CMA Q;  5FWC A;  2D0N A;  1FXX A;  4RTT A;  2PU9 B;  4BI4 A;  1WHH A;  4M78 D;  4PJO E;  1VQ4 Q;  4RTY A;  1C6V X;  1F1B B;  1UEB A;  3NPF A;  5ECA A;  1IRE B;  4B9W A;  2K5L A;  4C8Q A;  2X4X A;  1N27 A;  3RNJ A;  2LJ0 A;  5I2S A;  2QQS A;  3CC7 Q;  3RKW A;  2DL4 A;  1I5L A;  1NLP C;  4N4H A;  3I56 Q;  1GCQ A;  3M0P A;  3NGP A;  2KMT A;  2ZCF B;  1QKW A;  4J5Y A;  4E2F B;  1AHJ B;  2QEX Q;  3UT1 A;  4C8Q B;  2DRM A;  2DE0 X;  1V1C A;  4JDS A;  3CCQ A;  3CC2 Q;  5CQY A;  2OJ2 A;  1WHJ A;  1OI1 A;  4BE0 A;  4J7I A;  2DBK A;  4MDX A;  3G6E T;  4FU6 A;  1ACM B;  2DKG A;  1PKT A;  4B9X A;  1UB4 A;  1BYM A;  4HCZ A;  2AKL A;  1QQJ A;  1J3T A;  3V7R A;  1TUC A;  2XIC A;  4DQ2 A;  3RES A;  1C0M A;  2M16 A;  4LN2 A;  2CZ1 B;  1VQK T;  2OTJ T;  1G3W A;  5I21 A;  2EWN A;  1Y96 A;  4M75 D;  5GAM j;  1W2B A;  3OW2 S;  1AT1 B;  1E7O A;  2E64 A;  2RD1 A;  1R77 A;  4IUT A;  2YDL A;  2D8J A;  1ZSZ A;  3FLG A;  2C0T A;  5CKB A;  4PL6 A;  3M0Q A;  2ATC B;  5GAN 3;  3A5Z B;  1MV3 A;  1OV3 A;  1TUG B;  3FC3 A;  2DPP B;  1Y96 B;  3PFS A;  2FRY A;  2BIV A;  4F7U B;  1H64 1;  2LMJ A;  2ECZ A;  3PMT A;  3M58 A;  2FZK B;  4DEY A;  1WQW A;  1ZSZ B;  4OVA A;  3G4S A;  1X27 A;  1VQN A;  4KGX B;  1VYT A;  2KXC A;  3EHR A;  2MF2 A;  3KUF A;  2ZPG B;  4MDW A;  4KUD K;  3JCM P;  3M55 A;  1YJ9 A;  2W0Z A;  1FYN A;  1K0S A;  1NJI R;  1JJ2 S;  4K11 A;  2CP0 A;  3DLL A;  2J6F A;  5IHI A;  2M0O A;  4M75 B;  1VQ8 A;  2WAC A;  3H41 A;  2NUT A;  2L3Q A;  2A36 A;  2O9S A;  1HSQ A;  2K79 A;  2X51 A;  4JRK A;  1VQO T;  5FU7 C;  5CIU A;  1T3S A;  2EQU A;  4J9H A;  3MP8 A;  2A28 A;  5IH2 A;  2YSQ A;  3O5Z A;  2LX9 A;  2VUB A;  1YI2 A;  3LH0 A;  3A8H B;  2QTX A;  3OB9 A;  4Q5W A;  4L59 A;  1KQS P;  2GF7 A;  4N4G A;  1LVK A;  3L2V A;  2H8H A;  3JCM h;  2NUT B;  4BB7 A;  1NJI C;  1OPK A;  1G8X A;  1OUL A;  3QII A;  1MNE A;  1Z9Z A;  1UGR B;  1WJS A;  3C12 A;  1IGU A;  3TVT A;  2JTM A;  2VGM A;  5IHK A;  1VQL A;  3JCM f;  3S3N A;  1LNX A;  4OMP A;  4FYX B;  4Y92 A;  1KC8 R;  2EKO A;  1KSW A;  2V8J A;  2HL3 A;  2XK0 A;  1U5S A;  2F69 A;  2F2W A;  5CKE A;  3G71 A;  3L1A A;  1HXD A;  2DD4 A;  2YRC A;  1SKU B;  2CKK A;  3JCM d;  2HQH A;  3ZFJ A;  4J6Y A;  4OMF B;  1SHG A;  3DKM A;  5KYY A;  1NJI U;  4LXC A;  3WVE B;  2FO0 A;  1TOV A;  3PVL A;  5IAY A;  1WYX A;  1T0H A;  2E5Q A;  2LVM A;  4J6W A;  3GNG A;  1QVG P;  3QUI A;  2A37 A;  5A0G A;  1BIB A;  4PFZ A;  1JJ2 P;  4FW1 A;  4BY6 C;  3CC4 T;  2AZS A;  1YWO A;  1X6O A;  4XTX A;  1VQP A;  1M2V B;  2KYB A;  1KC8 C;  2VKN A;  3LX7 A;  3L42 A;  3CCU Q;  3TU4 K;  2K6D A;  3MO8 A;  1M30 A;  3IQL A;  3GBQ A;  4E7I A;  4XTW A;  1M1F A;  1AWW A;  4FYY B;  1ZBJ A;  1SRL A;  4C0Z A;  2E6Z A;  4BE2 A;  2VXE A;  4B6M A;  3QDF A;  2RHU A;  5GMK j;  1D0Y A;  1NPR A;  3HHT B;  4XQ3 A;  2KT8 A;  1VQM T;  2NUZ A;  1AOJ A;  3EH2 A;  5AYF A;  1BBZ A;  3OYN A;  4N0A A;  4FSS A;  1QVP A;  1QP2 A;  3OSV A;  1QVF P;  1RAD B;  1X2K A;  4IUR A;  2K7A A;  3EFO A;  1X01 A;  4LD9 K;  1ZX6 A;  1OOT A;  3MET A;  2HD0 A;  4J9I A;  2YRV A;  3M0T A;  2LDM A;  4AFS C;  3M4Y A;  3QZ5 B;  4DEX A;  3JCM V;  2JTF A;  2A7Y A;  4M77 E;  3MJX A;  4XU3 A;  2K9G A;  1WIE A;  3M0R A;  4C92 E;  4PLL A;  2JMC A;  1YIT Q;  2ZPE B;  4PJO G;  1JQQ A;  3EFO B;  2X35 A;  3INZ A;  4PJM A;  4P5N A;  2E6N A;  5CKF A;  3J81 E;  3CCV Q;  1WDX A;  2JTE A;  4WTO B;  1D1A A;  1SRM A;  4FYV B;  3JB9 H;  2HKQ B;  1E6G A;  1LCK A;  2YUO A;  2D6F A;  1NLO C;  4RUG A;  5GAN j;  3X28 B;  2K4Y A;  4UC4 A;  1YIJ Q;  3BDU A;  3CCE A;  2V26 A;  3EFS A;  3GPL A;  2KY9 A;  1S72 A;  3CMA T;  3EGX B;  3H0I A;  4Z8A A;  2YUP A;  2KNB B;  2RPN A;  1N9S A;  1X69 A;  1WXU A;  1VQ4 T;  1D0Z A;  1Y71 A;  2LX7 A;  3URG A;  1MMD A;  2FYK A;  4E7Z A;  4J83 A;  3G6E A;  4Y28 E;  2MOX A;  5J3B A;  3S6W A;  3EHQ A;  1ZUK A;  4A4G A;  1Q7Y R;  3HKS A;  4HCK A;  2O31 A;  4J9D A;  3CC7 T;  1I5O B;  3VYG A;  3NTI A;  3PE0 A;  3I56 T;  4QT7 A;  3SHW A;  1PRM C;  3DB3 A;  2I2L A;  2EGA A;  4DBH A;  1VQK A;  3CEY A;  2OTJ A;  3J80 E;  2SEM A;  1CSK A;  2EW3 A;  1JXM A;  2QEX T;  3NTH A;  2CYZ B;  3CC2 T;  5KYW A;  4C8Q F;  2P0Q A;  2K5I A;  2DL5 A;  2M1H A;  2RN8 A;  3OBY A;  1X43 A;  3MPU B;  3CME A;  4M7A D;  2ZPI B;  1M5Q 1;  2EIF A;  2DYB A;  2X4W A;  4GLM A;  2DYI A;  2O88 A;  3P8H A;  1Q7Y C;  1WI7 A;  3E9F A;  2FVU A;  3CCM A;  1I07 A;  2DL3 A;  4A4F A;  3G1J A;  5FRM A;  5FW9 A;  1VQ7 Q;  5KYW B;  1YJN A;  1YCS B;  2KQW A;  4ZN3 A;  4QQD A;  4O5V A;  1PC0 A;  3CBP A;  3JCM e;  2QA4 Q;  1UE9 A;  2RF0 A;  3QWY A;  1WPY A;  1I0C A;  5CR2 A;  2PVD B;  3A98 A;  4EMK B;  4AG2 C;  4C5I A;  1M27 C;  1TH7 A;  4M7D C;  4EIK A;  1MMA A;  2M9U A;  4KGZ B;  1UJ0 A;  4FT4 A;  4A4E A;  2ZPB B;  2K2M A;  1NZ9 A;  5GAO q;  2J06 A;  5CCA A;  4JRQ A;  1Q7Y U;  1BK2 A;  2RHX A;  1AVZ C;  2IIM A;  3JCM g;  2EYY A;  2ED1 A;  1OZ2 A;  1UTI A;  3LLR A;  5A0L A;  2P0K A;  2QYZ A;  3OYG A;  2EJF A;  4XAX B;  1VQO A;  2FRW A;  4RTU A;  3OYD A;  2DBM A;  4M7A B;  3P8B B;  2PQW A;  1AWJ A;  2DZ9 A;  1E6H A;  1N5Z A;  4ORZ A;  4WF2 A;  2O4X B;  2DER A;  1HJD A;  1V29 B;  3RBB B;  3N5B B;  2HDA A;  2ABL A;  2EQK A;  4M7D A;  4J7F A;  5IHN A;  1N8R U;  3I35 A;  2CGH A;  4PFO A;  2EJ9 A;  3QYH B;  2M0Y A;  1ZBX A;  1QP3 A;  4CRI A;  3JB9 F;  3HFO A;  3SB2 A;  3U23 A;  1BI2 A;  5HCK A;  3MHX A;  1TUD A;  1QCN A;  1B7T A;  1QW1 A;  3VS4 A;  2GQV A;  4HVW A;  3C4S A;  4C0G A;  2VB6 A;  2DZC A;  4JZ4 A;  4AG1 C;  2O2O A;  3RDV A;  4XK8 E;  2A08 A;  4LDX A;  1M90 C;  2E12 A;  2D8H A;  2HEQ A;  2HBW A;  1X2Q A;  1RLQ C;  1PD1 A;  4QVC A;  2KSS A;  3JCM Q;  4CC3 A;  2X3W D;  2L3S A;  1D3B A;  3MEA A;  1ZA2 B;  2OAU A;  2CP3 A;  4KUL A;  2RNA A;  4HVU A;  1GRI A;  2DXU A;  1ZLM A;  2DO3 A;  2PZ1 A;  4MZT A;  3CD6 A;  2MYS A;  1HK9 A;  3GOX A;  1IZ6 A;  3EG9 A;  4NL3 A;  2RI3 A;  1UEC A;  3FEO A;  5KYU A;  3Q1J A;  2EQI A;  1D3B B;  3OYJ A;  1M90 U;  2F5K A;  3LGF A;  4C8Q C;  2LCC A;  5D7U A;  1UG1 A;  5D6Y A;  2NYS A;  3EGD A;  1MMN A;  1VQ6 Q;  2QQ9 A;  1XTD A;  3EG9 B;  1R0C B;  2X3X D;  1DJ7 B;  1PSF A;  2EVR A;  3HRT A;  1GCQ C;  1W70 A;  1TWB A;  2VV5 A;  1SSF A;  1NYG A;  1OX8 A;  2AK5 A;  5KYU B;  3CCU T;  2LP5 A;  3R6O A;  5DLQ E;  4FW2 A;  2MIO A;  2RM4 A;  3CPF A;  2X4J A;  2X9H A;  2DVE A;  3OSS C;  1ABQ A;  2QDY B;  4DA4 A;  4AFQ C;  3EGD B;  3RIR A;  2AIR B;  3VS0 A;  5I11 A;  3VRY A;  4DOV A;  2EGC A;  1M3B A;  4KRT A;  2GCX A;  3SDZ A;  4IKF A;  1R8O B;  1AD5 A;  2CS7 A;  3OYA A;  3X20 B;  1Y07 A;  1MND A;  2V8I A;  4M77 G;  5FLX E;  4NOY A;  4F16 A;  1LOJ A;  1IHV A;  3CCQ Q;  3L2Z A;  3X26 B;  4C92 G;  1O75 A;  2Y4Y A;  3CXC P;  4RKU E;  3OW2 A;  4PJL A;  4PNO A;  3QYG B;  1W4S A;  5IXB A;  1KHC A;  3PIO A;  2YLC A;  3VS5 A;  1SSH A;  4PJJ A;  3THK A;  1GL5 A;  4OB3 B;  4F14 A;  1X6B A;  2C06 A;  1B34 A;  1JB0 E;  1ZSZ C;  2JM8 A;  4C0D B;  4FCY A;  2KT1 A;  4M78 A;  2WSE E;  4CC7 A;  4IIO A;  1X75 C;  3WXM B;  2I0N A;  1ZA1 B;  1YIT T;  2F1L A;  4ANJ A;  2DIG A;  2BE7 D;  2NUP A;  2XHC A;  3CC7 A;  3QKJ A;  2EAY A;  1B34 B;  1KHI A;  2HQE A;  2QXF A;  3LH5 A;  3CCV T;  1I4K 1;  1IB8 A;  3JCM W;  2LQN A;  2E70 A;  3QXE B;  1P92 A;  4M78 B;  3MP6 A;  2FEI A;  1TSF A;  3OYL A;  1WHL A;  3JB9 J;  3PT9 A;  1KQS S;  4F7U A;  1YIJ T;  2QQA A;  2QEX A;  2PUK B;  2RHI A;  3E2U A;  5LJ5 h;  2CDT A;  2DM1 A;  1IGQ A;  3CC2 A;  2NUP B;  5GJV B;  5LJ3 h;  2VVK A;  2CZ7 B;  2CZ6 B;  3QO3 A;  3GLX A;  3G4S Q;  4QQ6 A;  3MEU A;  3I55 A;  5LJ5 f;  5GAN 8;  1SEM A;  1XQH A;  1RAB B;  4LNP A;  1ZSG A;  5LJ3 f;  3M0S A;  5GAN 4;  2FPD A;  2CT4 A;  2R58 A;  2HSE B;  3HPW A;  2EPD A;  1OPL A;  3QWX X;  2LT1 A;  2XID A;  1GXI E;  4BDY A;  1JEG A;  3BFM A;  3PIP A;  1W1F A;  1WHG A;  4DBQ A;  5LJ5 d;  1FMK A;  4JJN K;  1Q86 C;  5LJ3 d;  3VS1 A;  3HSB A;  1NBE B;  4M75 A;  2BZX A;  4J6X A;  4PKC C;  4E6R A;  2ENM A;  3GIB A;  3OYI A;  2LQW A;  2AT1 B;  2DEQ A;  2QQB A;  1RAE B;  2GTJ A;  1QVG S;  2RJD A;  3OBW A;  3QHS A;  1UFF A;  4JRI A;  3HP9 A;  4FM4 B;  1UHC A;  3V7S A;  3OMG A;  1OQK A;  2DXC A;  3ZBD A;  4J9E A;  3RMQ A;  4ZGD B;  1YI2 Q;  1VQ7 T;  4OGE A;  1QCF A;  4O6J A;  3V8J A;  1Q86 U;  2QA4 T;  4ZTJ A;  4JZ3 A;  2JS0 A;  4RG2 A;  2KR3 A;  5I2M A;  3LWI A;  1VQL Q;  1TTH B;  3L2Q A;  3KXT A;  5C6S A;  2JS2 A;  3GNF B;  4LDW A;  1NE8 A;  1H3Z A;  2F5T X;  3FB9 A;  3CPW S;  3TQ7 P;  4M7D E;  1TU0 B;  4LUD A;  5GAO m;  4BI8 B;  5A2Q E;  3C94 A;  2JZ2 A;  3V8L A;  1VQ5 Q;  1QVF S;  1M8M A;  5KE2 A;  2CUD A;  3VU3 C;  5GMK i;  2LCS A;  4MZP A;  2RHY A;  5GAN 7;  2XG8 D;  1M9S A;  5M9O A;  2MAM A;  4EMH A;  5IXF A;  3M54 A;  2XKO C;  2KYM A;  4E7K A;  4M7A F;  3PTA A;  2KRM A;  1KD1 C;  2D9T A;  4R55 A;  1M2V A;  3CBM A;  5IT9 E;  1VYU A;  4JUV A;  3EFR A;  2KEA A;  2AZV A;  3OYC A;  3WVD B;  1U3O A;  1PNJ A;  4AMC A;  1QWE A;  2GNC A;  5HKC A;  4N0A C;  5KYN A;  2G3R A;  1VIE A;  2RQW A;  3FDR A;  2QDL A;  1YFN A;  4MMK A;  1WXT A;  1JRI A;  4NL2 A;  8AT1 B;  4M7D F;  2X4Y A;  4BD3 A;  2P4T A;  1W2B P;  1KD1 U;  2AKK A;  3MP1 A;  1TS9 A;  9ATC B;  1K4U S;  3UDC A;  1G83 A;  4E47 A;  3PGG A;  2J6O A;  2L2P A;  3CCR Q;  2KRS A;  2LJ3 A;  2RQU A;  3QJ6 A;  4JJB A;  2JOY A;  1KG1 A;  4EMG A;  2RI5 A;  4PJO D;  3VUB A;  3UA7 A;  1EFN A;  3OY9 A;  2L8D A;  3BDL A;  3CCL Q;  5KCH A;  3CPW P;  2IPO B;  4R56 A;  4HVV A;  2ESW A;  1QMC A;  2CSI A;  1BIA A;  3CCU A;  4RMO A;  4GBQ A;  2O9V A;  3CCJ A;  3AHU A;  5GAM h;  2E5K A;  4ATO A;  1UGQ B;  2QG9 B;  3D7S B;  4RTZ A;  2E3H A;  2PUO B;  1BCM A;  2RQT A;  2V8K A;  2OTL T;  1N6A A;  2K5F A;  3OYE A;  5GAM f;  1NG2 A;  2DK3 A;  7AT1 B;  2YUQ A;  2KRN A;  2ZPH B;  2HMA A;  3FRN A;  2F2X A;  2E65 A;  3QPH A;  3UAT A;  1YJW Q;  2FL7 A;  1PRL C;  3EGX A;  2DA9 A;  1VQ6 T;  1NEB A;  3CCE Q;  4XU0 A;  5GAM d;  3H0H A;  1S72 Q;  4C8Q E;  5LJ5 e;  1ZUU A;  3M4G A;  4HT9 A;  2DJZ A;  4ZGJ B;  5LJ3 e;  4BY6 B;  4JLG A;  3I9Q A;  5KYX A;  2JNG A;  3MEV A;  5GAO l;  1GFD A;  4V2S A;  4PJO B;  3QBY A;  1K9M R;  1PD0 A;  5CKD A;  4TVR A;  3E19 A;  4Z88 A;  1QWF A;  3DB4 A;  4L6V 5;  5LJ5 g;  3SWN A;  4EMK C;  5KYX B;  3M5A A;  3MCA B;  1MGQ A;  1MMG A;  3E1S A;  5LJ3 g;  1UJY A;  4OB2 B;  1G3Y A;  4OMN A;  2CSQ A;  3TRE A;  3CCQ T;  3CCV A;  1BKB A;  2GFU A;  1D1B A;  3CME Q;  2BTT A;  1D0X A;  5HK3 A;  4ELZ C;  1BI0 A;  1YIJ A;  2CRE A;  3SWN B;  1KFZ A;  1Q82 C;  2H3J A;  3OYF A;  2CH4 W;  1K9M C;  4F7U E;  3CCM Q;  1M1K U;  2QGF B;  1ARK A;  2ZZD A;  1YJN Q;  2E1H A;  4M7A C;  1N8R R;  1YBY A;  3OA6 A;  3KFV A;  1WHK A;  4EMK A;  4OB0 B;  3NMZ C;  4NS5 A;  2XMF A;  3CCS Q;  1TG0 A;  2QAZ A;  5A0D A;  5J26 A;  4J9F A;  2MCN A;  4M78 F;  2L3R A;  1FX7 A;  1Q82 U;  2ROT A;  4RCB A;  3OS2 A;  1K9M U;  2DVJ A;  2QQR A;  2DJQ A;  5FRO A;  3JCM b;  4E7L A;  4PLI A;  3R6N A;  1U06 A;  2P84 A;  3G4S T;  1N8R C;  2RI2 A;  4HCB A;  4IUQ A;  4OMO A;  4M7A A;  2L0A A;  3S3M A;  4EPC A;  2LQK A;  3LGL A;  2O4X A;  1HD3 A;  1G2B A;  1YP5 A;  3OS0 A;  2DXT A;  3REA B;  4F7U F;  2F2V A;  3VJP A;  1AWO A;  2QA4 A;  1B3Q A;  2RH2 A;  4RTX A;  4J9B A;  2RB6 A;  5GMK h;  5IN1 A;  2VYT A;  1RI9 A;  2Y4X A;  1SG5 A;  1M90 R;  2XDD A;  2K3B A;  2ZGW A;  1ZHI A;  3NTK A;  1Z9Q A;  2AHJ B;  5J39 A;  5GAN 6;  4ZN1 A;  1YI2 T;  4M75 F;  3E9G A;  4QW2 A;  4M7D G;  1LJO A;  2PTK A;  2V1Q A;  4ZGE B;  2MPX C;  2EYX A;  1UGP B;  3QSU A;  1PKS A;  2R57 A;  3TSZ A;  5CO7 A;  3UWN A;  2FZG B;  1VQL T;  1WLP B;  2R5A A;  1FMW A;  2RQV A;  1M8V A;  1O9S A;  4R0K A;  4ZNX A;  4OMM A;  5CAI A;  2CP5 A;  1IXD A;  1VQ9 Q;  2P4R A;  4X9C A;  2KE9 A;  3JCM J;  5GAM e;  3CXC S;  2D1X A;  3CD6 Q;  2E41 A;  1YHQ Q;  4MML A;  1WA7 A;  4D8D A;  3CC4 A;  2CP7 A;  3ULR B;  2RK1 A;  3PMI A;  3A8G B;  1VQ5 T;  5GAN h;  1K76 A;  4IIM A;  1OU8 A;  3VS7 A;  1WZO A;  4L5G A;  2MWO A;  2OTL Q;  1QLY A;  3LW5 E;  5GAN f;  1IHW A;  4HA8 A;  2Z0W A;  5GAM g;  3HTR A;  2RQR A;  5GAO n;  4ESR A;  3ASK A;  2HNI A;  1WGS A;  1VQM A;  2C0O A;  4C0D C;  4HKE A;  2KI7 A;  4M77 D;  3KBG A;  2B8A A;  5GAN d;  2LZ6 B;  4QKU A;  4C92 D;  1EX4 A;  3OS1 A;  2NLU A;  4ELY C;  5AT1 B;  2EKH A;  2G6F X;  3T9N A;  3JB9 I;  2DD5 A;  4ME7 A;  3LYI A;  3A1P A;  4RCC A;  3EG0 A;  1K73 R;  2WSF E;  4M78 C;  4IUP A;  4HXJ A;  4DBF A;  3GP8 A;  2ED0 A;  2VAS A;  1YN8 A;  2MMP A;  3CCR T;  3FIF A;  1AEY A;  3QJY A;  4XTV A;  1MUZ A;  3A8L B;  3SFM A;  5FU6 B;  3ZEH A;  3CCL T;  4VUB A;  4JJC A;  1BI1 A;  4M77 A;  1KQS A;  4OB1 B;  1VOM A;  4BI3 A;  1G3T A;  4C92 A;  2DMO A;  2KRO A;  2FPF A;  3V8K A;  2LCL A;  2RMO A;  1S1N A;  2YLB A;  4MZM A;  1MHN A;  2NWM A;  4C5G A;  4C8Q G;  1XNI A;  1K8A C;  2XU8 A;  4AFZ C;  1K73 C;  3CQT A;  3CMA A;  1JBM A;  2RK2 A;  4M77 B;  1WQ7 A;  1IO6 A;  5HK0 A;  1VQ4 A;  5DM7 R;  4C92 B;  2K3X A;  4XU1 A;  4PK4 A;  1JU5 C;  3UF4 A;  1G3S A;  2MI6 A;  1NEG A;  4AFU C;  1YJW T;  1RLP C;  5GAO r;  3TCJ A;  4C0F A;  1RAF B;  3CCE T;  3NFC A;  2BZY A;  1S72 T;  3DLM A;  3I56 A;  2E4H A;  3G7Z A;  2GTO A;  4M78 G;  2OX7 A;  4M75 C;  1Q86 R;  3I55 Q;  1QVG A;  3UA6 A;  1K8A U;  3JCM c;  1K73 U;  2XD0 A;  1JJ2 A;  1UUE A;  3EGU A;  3VS2 A;  1VIF A;  1D09 B;  1K9A A;  4PJO F;  1Q81 R;  2DFU A;  2A3L A;  3HL8 A;  1VQN Q;  3HRS A;  2V1R A;  2RJC A;  4F7U G;  2HKN A;  3JB9 D;  2ROL A;  3ZL7 C;  1YJ9 Q;  2BUD A;  2DXB A;  1YCY A;  3A8M B;  2GFA A;  5GMK e;  2XDB A;  1OU9 A;  2DF6 A;  2EQM A;  2FHD A;  3CME T;  3M53 A;  3UPU A;  1Y57 A;  1U8R A;  4PFP A;  1LPL A;  5KH6 A;  3J7A F;  1PG5 B;  2C0I A;  1M4Z A;  2OAW A;  4D8K A;  3CPW A;  4N4I A;  1VQ8 Q;  1GBQ A;  3JV3 A;  4C5H A;  3CCM T;  3OYB A;  1D1C A;  2JXB A;  1V76 A;  1Q81 C;  4FYW B;  2YHT A;  4LUE A;  1XJW B;  2J6K A;  4FT2 A;  1YJN T;  3CBO A;  3X24 B;  2LRQ A;  2QI2 A;  1QVF A;  2HSP A;  1WJR A;  4JS4 A;  4CI0 C;  5FWB A;  4M75 G;  1T0J A;  1YWP A;  3JB9 G;  4M7A E;  1RAG B;  2ZPF B;  3CCS T;  4JJD A;  4LE9 A;  5L23 A;  2ZAE A;  2KBT A;  4E7S A;  1W2B S;  1NPP A;  3ER0 A;  3C0C A;  3EH1 A;  3RR6 A;  4GLK A;  2COW A;  1KD1 R;  3RMS A;  4A4K A;  1WJQ A;  1Q81 U;  1WFW A;  4KH1 B;  1SPK A;  8ATC B;  2QK0 A;  1A0N B;  1VUB A;  1NYF A;  2B86 A;  3AT1 B;  2KVQ G;  3G71 Q;  1JO8 A;  2WSC E;  5GAN e;  2EFI A;  1RUW A;  4F17 A;  1EZZ B;  2K2V A;  1ZUY A;  4F04 B;  1M1G A;  2R5M A;  5GAO p;  2QTV A;  3OW2 P;  4J8O A;  4LDV A;  2DIL A;  3EG3 A;  5GAN 5;  4BUG A;  3VUZ A;  2PVG B;  2CP2 A;  3GF5 A;  1Q95 G;  1PWT A;  2P0P A;  1RAA B;  5GAN g;  1WHM A;  2DX1 A;  1VQP Q;  2HL5 C;  4XU2 A;  5EG2 A;  1UGV A;  2JVV A;  3M59 A;  1SF9 A;  4HCC A;  2VC8 A;  1FMV A;  4QVD A;  1M3A A;  1VQ5 A;  2FPE A;  4XTY A;  2VGN A;  4HT8 A;  5GMK m;  2EYW A;  2FB7 A;  2EQJ A;  2FG0 A;  2CP6 A;  2YUN A;  2JUF A;  1KIK A;  4JPB W;  3L2W A;  3OYM A;  5FU7 B;  1CKB A;  1SHF A;  2LQ8 A;  2BZ8 A;  4FL6 A;  4EDU A;  3TSW A;  2MK5 A;  4X1V A;  1OZ3 A;  5KYY B;  2DTO A;  3A8O B;  1VQ9 T;  3CCJ Q;  5CKH A;  2FZC B;  3EG1 A;  3M56 A;  4AT1 B;  3FJP A;  4PJO C;  3CD6 T;  3MKD A;  1YHQ T;  1U1T A;  1X6G A;  1GBR A;  2GQI A;  2JW4 A;  3P8D A;  1JXO A;  2SRC A;  1B07 A;  1HYO A;  1FWZ A;  2KK4 A;  2CH4 A;  1BI3 A;  2H3E B;  2JN0 A;  1H3H A;  4JRP A;  5D6X A;  4X34 A;  3OYH A;  2EGE A;  1KK7 A;  4LD6 A;  2M02 A;  3VS6 A;  1Y0M A;  3LWH A;  2K3Y A;  3QZ9 B;  1BB9 A;  2KGT A;  1M1K R;  4BAC A;  1I81 A;  1KC8 U;  2CZ0 B;  3CCR A;  1UHF A;  3RKY A;  3SWN C;  1KJW A;  1N9R A;  5GAN 2;  5KE3 A;  3M0U A;  4RTV A;  2DNU A;  3VV0 A;  3H9N A;  2LJ1 A;  4PJO A;  1AZG B;  3CCL A;  2GGR A;  4KH0 B;  3H0F A;  2COZ A;  1OX9 A;  1VA7 A;  5DLO A;  2EYQ A;  2QAS A;  4CC2 A;  1WX6 A;  3SD4 A;  4CC4 B;  3L2U A;  3QG1 A;  1OEB A;  3EG2 A;  3OS5 A;  2L89 A;  3RKX A;  3G6E Q;  1QCO A;  5GJW B;  1Q82 R;  5LL6 S;  5CQX A;  5EC7 A;  2BKD N;  3L2R A;  1H8K A;  2IG0 A;  3OMC A;  4Z89 A;  2VWF A;  1M1K C;  2PVO B;  2M51 A;  4GY5 A;  3S3O A;  3I5S A;  1VQK Q;  2OTJ Q;  2EBP A;  4M78 E;  1YIT A;  4D6W A;  4J9G A;  1YJW A;  1PCX A;  3QDR B;  3JAM E;  3F70 A;  4OGC A;  2YXY A;  2EJG A;  4BDZ A;  4WCI A;  2CUB A;  1VYV A;  1U1S A;  2J05 A;  3M57 A;  2DLP A;  1H92 A;  2XDP A;  5FRN A;  2LT4 A;  4QVZ A;  4JLI A;  2DET A;  2LNV A;  4OMQ A;  2RA2 A;  1IRX A;  4OF1 A;  4XTZ A;  1RI0 A;  5GMK l;  4M77 F;  4DBR A;  4C92 F;  4OML A;  2HCK A;  3X25 B;  3M9Q A;  2K57 A;  3ME9 A;  2JT4 A;  2JM9 A;  3FJ5 A;  1RL2 A;  5D6W A;  3VKI A;  2HAX A;  1NM7 A;  1GCP A;  3VYH B;  5CK9 A;  1TXQ A;  1R0B G;  3JSC A;  1GFC A;  2RJE A;  4QQG A;  4OP0 A;  2DEU A;  1RAC B;  3I55 T;  3JCM X;  4IUU A;  1PSE A;  5DY9 A;  4M75 E;  2YT6 A;  1VQN T;  1VQO Q;  3OYY A;  5CVI A;  2JMA A;  1QKX A;  1C1A A;  4X9D A;  4E7J A;  3NHN A;  2DTH A;  3CCS A;  1YJ9 T;  1VQ7 A;  4M7D D;  4IUV A;  1OYX A;  2J7I A;  4LDY A;  3RER A;  4M7A G;  3HFN A;  2YRD A;  3RUX A;  2DAQ A;  2OI3 A;  4KGV B;  1VQ8 T;  1W6X A;  2DL7 A;  2E10 A;  1XOV A;  2DTI A;  3CXC A;  2DL8 A;  2GBQ A;  3BW1 A;  1WNL A;  5L8R E;  4Z02 A;  2HBP A;  5I22 A;  1G5V A; 
#chains in the Genus database with same CATH homology
 2JS2 A;  1BU1 A;  2RMO A;  1S1N A;  1CKA A;  2PNI A;  2NWM A;  1WDX A;  1WXB A;  2JTE A;  1SRM A;  4AFZ C;  3CQT A;  3REB B;  4LUD A;  1E6G A;  1LCK A;  2YUO A;  4RTW A;  1NLO C;  1IO6 A;  4RUG A;  1M8M A;  2CUD A;  2LCS A;  3H0I A;  4Z8A A;  2YUP A;  1JU5 C;  3UF4 A;  2KNB B;  1NEG A;  2RPN A;  1T3L A;  1X69 A;  4AFU C;  1RLP C;  1WXU A;  2L3P A;  1YNZ A;  2LX7 A;  1I1J A;  5IXF A;  2BZY A;  2DRK A;  2KYM A;  2MOX A;  3EHQ A;  2W10 A;  2KRM A;  3I5R A;  1ZUK A;  1AWX A;  2GTO A;  4HCK A;  2O31 A;  4J9D A;  1VYU A;  3PVQ A;  3PE0 A;  2KEA A;  4QT7 A;  3SHW A;  2AZV A;  1PRM C;  3UA6 A;  1UUE A;  3EGU A;  2EGA A;  3VS2 A;  2SEM A;  2CT3 A;  1U3O A;  1K9A A;  1PNJ A;  1K0X A;  1CSK A;  1QWE A;  2EW3 A;  2GNC A;  1JXM A;  4A63 B;  2V1R A;  2RQW A;  1PHT A;  2QDL A;  1WXT A;  2DL5 A;  2RN8 A;  1UDL A;  1X43 A;  4J9C A;  4M4Z A;  2ROL A;  1AZE A;  3ZL7 C;  1K1Z A;  2DYB A;  2AKK A;  3VRZ A;  4GLM A;  2O88 A;  3VS3 A;  1WI7 A;  2DF6 A;  1K4U S;  1G83 A;  1MV0 B;  1I07 A;  2J6O A;  2DL3 A;  2L2P A;  2KRS A;  1Y57 A;  2LJ3 A;  5FW9 A;  2RQU A;  2KXD A;  1YCS B;  2C0I A;  4JJB A;  2OAW A;  4D8K A;  1GBQ A;  3JV3 A;  3UA7 A;  1EFN A;  1ABO A;  1UE9 A;  2JXB A;  2RF0 A;  3QWY A;  4LUE A;  1I0C A;  2J6K A;  3SEM A;  3A98 A;  4HVV A;  2ESW A;  2HSP A;  2CSI A;  4AG2 C;  1M27 C;  4GBQ A;  2O9V A;  4EIK A;  2EYZ A;  1UJ0 A;  2E5K A;  5FWB A;  1T0J A;  2LNH B;  1YWP A;  2K2M A;  4JJD A;  4RTZ A;  4LE9 A;  2J06 A;  5L23 A;  1BK2 A;  2RQT A;  1AVZ C;  2KBT A;  1M3C A;  2IIM A;  1NG2 A;  2EYY A;  2ED1 A;  2YUQ A;  3C0C A;  2KRN A;  2F2X A;  1UTI A;  5FWC A;  2D0N A;  4RTT A;  2FRW A;  4RTU A;  3UAT A;  2DBM A;  1PRL C;  1WFW A;  1SPK A;  2DA9 A;  4RTY A;  1A0N B;  1NEB A;  1AWJ A;  3H0H A;  1E6H A;  1N5Z A;  3NPF A;  4ORZ A;  1NYF A;  2B86 A;  1ZUU A;  5ECA A;  1JO8 A;  1HJD A;  3RNJ A;  3RBB B;  2LJ0 A;  3I9Q A;  2HDA A;  2ABL A;  1RUW A;  5IHN A;  4F17 A;  2DL4 A;  3I35 A;  1NLP C;  1ZUY A;  1GFD A;  1GCQ A;  3M0P A;  3NGP A;  2M0Y A;  1QKW A;  4Z88 A;  2DIL A;  3EG3 A;  1QWF A;  2DRM A;  2DE0 X;  1V1C A;  3U23 A;  2OJ2 A;  5HCK A;  1PWT A;  1TUD A;  1UJY A;  2DBK A;  4OMN A;  2CSQ A;  3VS4 A;  2DX1 A;  1UGV A;  1PKT A;  4HVW A;  2AKL A;  1J3T A;  1TUC A;  2BTT A;  4JZ4 A;  4AG1 C;  2O2O A;  2A08 A;  1M3A A;  2CRE A;  2D8H A;  2HEQ A;  2FPE A;  1KFZ A;  4LN2 A;  2HBW A;  2CH4 W;  1X2Q A;  1RLQ C;  2EYW A;  1ARK A;  4CC3 A;  2X3W D;  2L3S A;  2FG0 A;  2YUN A;  1E7O A;  1KIK A;  4JPB W;  1CKB A;  1SHF A;  2YDL A;  2D8J A;  2BZ8 A;  3KFV A;  2C0T A;  2RNA A;  4HVU A;  1GRI A;  3TSW A;  1ZLM A;  2PZ1 A;  4X1V A;  3NMZ C;  3M0Q A;  2XMF A;  1TG0 A;  1MV3 A;  1OV3 A;  3EG1 A;  1UEC A;  2FRY A;  2LMJ A;  2EQI A;  2ECZ A;  4J9F A;  2MCN A;  1X6G A;  1GBR A;  4DEY A;  2GQI A;  2JW4 A;  2ROT A;  1JXO A;  1X27 A;  2DVJ A;  2DJQ A;  1UG1 A;  2SRC A;  1B07 A;  1VYT A;  2KXC A;  3EHR A;  3R6N A;  2CH4 A;  2EVR A;  2X3X D;  1GCQ C;  1W70 A;  1H3H A;  1U06 A;  1NYG A;  2AK5 A;  4OMO A;  2W0Z A;  2EGE A;  1FYN A;  2LP5 A;  2L0A A;  3VS6 A;  1Y0M A;  2MIO A;  1K0S A;  1HD3 A;  1G2B A;  1YP5 A;  1ABQ A;  1BB9 A;  2KGT A;  3REA B;  4K11 A;  1UHF A;  4AFQ C;  2J6F A;  1KJW A;  2F2V A;  1AWO A;  3M0U A;  4RTV A;  5IHI A;  2DNU A;  3VS0 A;  5I11 A;  3VRY A;  3H41 A;  2LJ1 A;  1B3Q A;  4RTX A;  1AZG B;  2EGC A;  1M3B A;  2GGR A;  4KRT A;  3H0F A;  2L3Q A;  2A36 A;  2O9S A;  1VA7 A;  1AD5 A;  1HSQ A;  2K79 A;  4CC2 A;  4J9B A;  1WX6 A;  4CC4 B;  1T3S A;  4J9H A;  1OEB A;  3EG2 A;  2A28 A;  5IH2 A;  1RI9 A;  2YSQ A;  4F16 A;  3O5Z A;  5GJW B;  5IXB A;  2K3B A;  5EC7 A;  2H8H A;  1Z9Q A;  1OPK A;  1SSH A;  3VS5 A;  1H8K A;  4Z89 A;  2VWF A;  1Z9Z A;  3THK A;  1GL5 A;  2M51 A;  4F14 A;  1X6B A;  3TVT A;  3I5S A;  5IHK A;  2EBP A;  2JM8 A;  2PTK A;  2V1Q A;  2KT1 A;  2EYX A;  4J9G A;  4CC7 A;  1PKS A;  4OMP A;  3TSZ A;  4IIO A;  4Y92 A;  2I0N A;  1KSW A;  1U5S A;  1WLP B;  2F2W A;  2RQV A;  4WCI A;  2CUB A;  4R0K A;  4ZNX A;  4OMM A;  1VYV A;  2J05 A;  2DLP A;  1H92 A;  3LH5 A;  2P4R A;  1SHG A;  2LQN A;  2KE9 A;  2FEI A;  2D1X A;  2FO0 A;  3PVL A;  1WYX A;  1WA7 A;  4D8D A;  4OMQ A;  3ULR B;  1T0H A;  2CDT A;  2DM1 A;  2A37 A;  5GJV B;  2VVK A;  4OML A;  2HCK A;  1K76 A;  4IIM A;  2AZS A;  1YWO A;  2JT4 A;  3VS7 A;  2KYB A;  2JM9 A;  2VKN A;  1SEM A;  2K6D A;  4LNP A;  1M30 A;  1ZSG A;  3FJ5 A;  3GBQ A;  3IQL A;  1QLY A;  3M0S A;  1NM7 A;  2FPD A;  1GCP A;  2CT4 A;  1AWW A;  1ZBJ A;  1GFC A;  2EPD A;  1SRL A;  1OPL A;  2RQR A;  3QWX X;  4ESR A;  1JEG A;  1W1F A;  1FMK A;  2C0O A;  3VS1 A;  2YT6 A;  2LZ6 B;  2BZX A;  4E6R A;  2ENM A;  2KT8 A;  2EKH A;  2NUZ A;  1AOJ A;  2G6F X;  2LQW A;  2GTJ A;  2JMA A;  1QKX A;  1BBZ A;  3NHN A;  1UFF A;  4FSS A;  3EG0 A;  4HXJ A;  1UHC A;  1X2K A;  2ED0 A;  1YN8 A;  2J7I A;  2K7A A;  4J9E A;  1ZX6 A;  1OOT A;  1AEY A;  4J9I A;  1MUZ A;  1QCF A;  3M0T A;  4AFS C;  2OI3 A;  4DEX A;  1W6X A;  2DL7 A;  1XOV A;  2K9G A;  2DL8 A;  1WIE A;  4JJC A;  2GBQ A;  3M0R A;  4JZ3 A;  2JS0 A;  2KR3 A;  2JMC A;  2DMO A;  2KRO A;  2FPF A;  5I22 A;  1JQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...