2AK5A

Beta pix-sh3 complexed with a cbl-b peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
NSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Cbl promotes clustering of endocytic adaptor proteins.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ak5A00
1V1CA 3PVLA 2F2VA 4GBQA 2HCKA 3H0FA 2BTTA 1QCFA 2J06A 1Z9QA 4Y92A 2ROLA 2J6KA 2A37A 2ESWA 3EG3A 2J7IA 2AKLA 4M4ZA 2ROTA 1T3LA 1M3CA 4E6RA 3R6NA 1AWXA 1AWWA 4OMPA 4LE9A 4AG2C 4ESRA 2FEIA 3QWYA 2GNCA 1QLYA 2EKHA 1MV0B 2FRYA 2P4RA 3C0CA 1WDXA 2JS0A 1UJ0A 1YP5A 3U23A 1UDLA 1HD3A 1ARKA 3H0IA 2IIMA 2DX1A 4JJDA 3EG2A 5IH2A 3NHNA 2DA9A 2LQNA 1X6GA 1JQQA 2RQVA 4JJBA 2KBTA 2V1QA 4OMLA 3NPFA 3VRZA 3VS3A 2VVKA 2CUBA 2DVJA 1T0JA 2DRMA 2X3XD 2K9GA 5ECAA 2C0OA 2CUDA 4J9CA 1GBRA 1MV3A 2JMAA 1NYGA 1M3AA 4CC7A 3UA6A 2DNUA 2FRWA 1RI9A 4AFSC 2CREA 3VS6A 1AVZC 2DL8A 4J9DA 2KROA 2LP5A 2FPFA 4AFZC 4D8KA 1K9AA 1U5SA 3SHWA 1OOTA 2EYZA 1FMKA 2DL5A 2J6FA 2YT6A 1UG1A 2D8HA 1A0NB 2LQWA 2GGRA 3UF4A 1BB9A 1JXOA 1X6BA 1UUEA 1YWOA 3A98A 1ZUYA 1RLQC 1LCKA 2DM1A 2ECZA 2F2WA 1AEYA 2YDLA 4K11A 2F2XA 1B07A 2O31A 2RQUA 1YNZA 4J9GA 5FW9A 1VYUA 5EC7A 2FPEA 1WFWA 4RTUA 1ABQA 2EYXA 1K0XA 1K76A 2CH4A 4EIKA 2CT3A 1Z9ZA 2ED0A 1E6GA 2GBQA 1E6HA 2MCNA 1AZEA 1IO6A 5I22A 3UA7A 2KXDA 2YUQA 1K4US 2NWMA 2KEAA 3VS1A 3NMZC 3THKA 1CSKA 1YCSB 1BU1A 2EGCA 2CSQA 3EHRA 1NLPC 1JXMA 1M27C 4F16A 4Z8AA 1J3TA 1WXUA 5IHNA 1PKTA 1S1NA 2DYBA 1X2QA 4ZNXA 1GRIA 3M0PA 3ULRB 2KYBA 3M0QA 3KFVA 4OMMA 2A36A 1ZBJA 2NUZA 2D0NA 4J9BA 2KE9A 1T0HA 3M0SA 2M51A 2PZ1A 2JXBA 3NGPA 2A28A 1NG2A 4AG1C 2E5KA 1ZUKA 2GTOA 2JM8A 2OAWA 3EG0A 1CKAA 3UATA 2K79A 2HSPA 4RTTA 2J6OA 1UTIA 1HSQA 4CC3A 2MIOA 3PVQA 1AWJA 2EGEA 2RQRA 1OV3A 4RTWA 1NEBA 1OPKA 4Z89A 3FJ5A 1PRMC 2VKNA 1GCPA 1M8MA 1UFFA 3PE0A 2DE0X 2DBMA 3I5RA 1SRMA 2DILA 2ED1A 2LZ6B 2KRMA 1SEMA 2C0TA 1RLPC 1WLPB 2XMFA 3GBQA 2PTKA 1WXBA 1UJYA 4AFQC 2J05A 1I0CA 1ABOA 2DJQA 1RUWA 4HCKA 3I9QA 4OMQA 2V1RA 2KR3A 1I07A 2DBKA 3REBB 1TUCA 1M3BA 3M0TA 4DEYA 2RQTA 2QDLA 1Y57A 1BK2A 2JT4A 2AK5A 4IIMA 1KFZA 4D8DA 3VRYA 5FWBA 1MUZA 2D8JA 1AD5A 5IHKA 1X2KA 3VS2A 3I35A 3CQTA 2AZSA 1GL5A 3O5ZA 1BBZA 4OMNA 1JU5C 1X27A 1Y0MA 3TSZA 2O2OA 3VS0A 5IXFA 1WX6A 4LUDA 2L3QA 2LJ1A 3QWXX 4HVVA 1CKBA 1PKSA 4IIOA 1W1FA 4GLMA 2H8HA 3VS4A 1NM7A 2CT4A 2B86A 2YSQA 4LN2A 1VA7A 2JW4A 1AZGB 2MOXA 3EHQA 2D1XA 2K7AA 2A08A 4F14A 4JJCA 2X3WD 2EQIA 1N5ZA 4LUEA 2OJ2A 4KRTA 2K3BA 2K6DA 1W6XA 3TVTA 2SEMA 2K2MA 1T3SA 1PNJA 2CSIA 1OEBA 1NYFA 1VYVA 1SSHA 2LJ0A 1YWPA 1JEGA 2KRNA 3RNJA 4JZ4A 4WCIA 1QKXA 1WA7A 1H8KA 2EGAA 2FPDA 2DMOA 1I1JA 2KXCA 1QKWA 5IXBA 1W70A 2EYWA 2RPNA 1SHFA 3EG1A 4HVUA 4HXJA 2DL7A 3M0UA 2FO0A 1UE9A 2O9SA 1WI7A 1UHFA 1EFNA 2O9VA 2BZ8A 1KIKA 2DL4A 4OMOA 2HDAA 3H0HA 3M0RA 2EW3A 5HCKA 4R0KA 4AFUC 4LNPA 2PNIA 2GTJA 1M30A 2BZYA 1WYXA 2HEQA 3JV3A 2DF6A 1X69A 1E7OA 1SRLA 4RUGA 2YUPA 2ABLA 2RF0A 2L2PA 1K0SA 4J9EA 2LCSA 4RTVA 1GFCA 2DL3A 3SEMA 2LX7A 4JZ3A 1X43A 1QWEA 1GFDA 1PHTA 1ZX6A 2KT8A 2HBWA 4DEXA 2L0AA 2RNAA 2LJ3A 4A63B 2CH4W 2M0YA 2FG0A 2KGTA 3VS7A 4RTYA 2AKKA 2BZXA 2GQIA 1OPLA 3I5SA 1AWOA 2EBPA 4J9FA 3RBBB 2EVRA 2AZVA 3IQLA 1G83A 1ZSGA 1ZUUA 4X1VA 2O88A 4JPBW 5GJVB 5GJWB 4CC4B 4J9HA 4QT7A 1H3HA 4ORZA 1K1ZA 1TG0A 1U3OA 1PWTA 2G6FX 1QWFA 1AOJA 1B3QA 1SPKA 3VS5A 4HVWA 3H41A 1ZLMA 1UHCA 2JTEA 4CC2A 3EGUA 3ZL7C 2LNHB 4F17A 4RTXA 1UECA 2JS2A 4RTZA 2I0NA 2YUNA 2C0IA 2W10A 5FWCA 1PRLC 1GCQA 2LMJA 2RN8A 1YN8A 2CDTA 1FYNA 1XOVA 2EPDA 2L3PA 2SRCA 2EYYA 2KRSA 1UGVA 3TSWA 2JM9A 4Z88A 2RQWA 3REAB 5I11A 1TUDA 4J9IA 2VWFA 2DRKA 4FSSA 2JMCA 5L23A 2KT1A 1VYTA 1WXTA 1JO8A 2KNBB 2YUOA 2OI3A 1WIEA 1GCQC 1G2BA 5IHIA 2L3SA 1SHGA 3LH5A 1H92A 1KJWA 1U06A 2ENMA 1NEGA 2DLPA 2RMOA 1KSWA 1NLOC 2W0ZA 1HJDA 1GBQA 2KYMA
chains in the Genus database with same CATH superfamily
1V1CA 2RHXA 3MEWA 1OI1A 3H0FA 1LPLA 2RM4A 3GIBA 1PG5B 2F5TX 2R5MA 1KHIA 2A37A 1ZSZC 1IGQA 1FMVA 2J7IA 1VQ9A 1LJOA 1M3CA 3BDLA 1M90U 2K3XA 1AWXA 3R6NA 3ER0A 1K73C 5A0GA 4M75A 5LJ3f 4MZPA 4M7AA 3EGDA 2EKHA 1VQMT 3QJ6A 1YJNT 4MDXA 4JLGA 1VQ5Q 3OYMA 1G8XA 3HP9A 2HZYA 2E1HA 1YP5A 1UDLA 1HD3A 2DX1A 2QA4Q 1M8VA 4JJDA 2KI7A 3OBYA 4MDWA 2DA9A 1X6GA 1XTDA 4M7DB 3QZ5B 1N9SA 3CCQQ 4QVCA 1BI3A 1QVGA 3NPFA 3VRZA 3CCRT 2VVKA 2CUBA 3TEEA 3CC2A 2K9GA 2C0OA 4J9CA 1KC8U 3LGFA 1NYGA 1NE8A 1UGRB 2JOYA 4FT4A 4BD3A 3S3OA 4XU2A 2H3JA 4HA8A 5GAN3 3JB9G 4PJJA 1OYXA 1K9AA 1MMDA 2NUPB 4OP0A 3CBPA 3SHWA 1S72T 3I56Q 3G6EA 2YT6A 1A0NB 1Q95G 3OYEA 2DXCA 4N4IA 3CMET 1BB9A 3MEAA 2CP5A 5GMKl 5A2QE 5LJ3h 2A3LA 4AT1B 2ECZA 2RHUA 1MNDA 1VQNT 1PC0A 5KE3A 2YDLA 1AEYA 5HK3A 1YITT 2O31A 2KSSA 4C0GA 1N8RR 3JB9D 4JRIA 4XTWA 3CBOA 3WVDB 3A8HB 1QCOA 1LNXA 2DD4A 2EYXA 2O4XB 4EIKA 2NUTA 1SKUB 3C12A 1E6HA 4ATOA 1AZEA 2LC4A 1M5Q1 2YUQA 2KEAA 5LL6S 1Q81R 3VS1A 3THKA 1CSKA 2RD1A 3TCJA 3OYCA 4F16A 6AT1B 1S1NA 5KYWB 5GMKj 3VV0A 3HSBA 1BIBA 4EMKB 3M0QA 2YXYA 3KFVA 4OMMA 5CKHA 3JB9H 2A36A 1Q7YR 3M5AA 1ZBJA 2HNIA 3CCST 1YI2T 2Z0WA 1M90C 3RERA 2M0OA 5HK0A 4OB2B 3LH0A 1WNLA 4TVRA 5DLQE 5GMKe 1NPRA 2JXBA 1RL2A 2A28A 2DK3A 1K9MU 3T9NA 3VJPA 1ZUKA 3EG0A 2FYKA 1OQKA 3MP1A 4HT9A 3KBGA 1YJWA 4L5GA 2MIOA 1WHJA 3QO3A 1NEBA 4DBQA 2DE0X 1I8FA 3CCMT 3I5RA 3P8HA 3OS5A 2XMFA 3Q1JA 2R58A 2DEQA 2PTKA 1WXBA 1I0CA 1RABB 2QTXA 3TQ7P 1RADB 2KR3A 1I07A 4ZN1A 3REBB 1TUCA 5LJ5d 1M3BA 2IG0A 5CIUA 4ELZC 4C0FA 3CC7Q 1RAGB 2AK5A 3CCVQ 1VQOQ 3BFMA 1KC8R 1UGPB 1MUZA 2D8JA 5IHKA 3L2ZA 3CQTA 3QKJA 1VQPQ 1GL5A 1SSFA 2DERA 4PL6A 1BBZA 3EH1A 4DOWA 3EFOB 3V8LA 2H3EB 2HSEB 3TSZA 1YJ9T 2O2OA 3VS0A 3KXTA 2FZKB 4IUTA 4FYXB 2LJ1A 3A1PA 3I55Q 1W1FA 1QVFP 4GLMA 5M9OA 4E2FB 1VQ7T 2MOXA 3CCLQ 3EHQA 1VQ8Q 3TREA 2K7AA 4F14A 2EQIA 5GANj 1RI0A 2JN0A 2OJ2A 4HCBA 3TVTA 5LJ3g 2CKKA 3HFOA 9ATCB 2CSIA 2XU8A 3UT1A 1D1AA 2RJFA 4FYVB 3VYGA 5LJ5g 3JCMe 1YWPA 1JEGA 4WCIA 4ZGDB 4FCYA 1WHGA 1H8KA 2KDSA 2DMOA 1I1JA 2KXCA 5I21A 1XJWB 2KMTA 3A8LB 1VQ9T 1VIEA 4HXJA 3SDZA 2DL7A 3M0UA 3OYGA 2P84A 1OU8A 2XDDA 1WI7A 1EFNA 1D1CA 1TOVA 2O9VA 1KIKA 3G1JA 3L2WA 3H0HA 5HCKA 3M0RA 4AFUC 1QVGP 2PNIA 3MP8A 3H6ZA 4IUUA 3MKDA 2DF6A 1FMWA 4C92C 2OAUA 2HL3A 3GNFB 2K57A 5GMKh 3OBWA 5CCAA 2E10A 4RTVA 3QIIA 3SEMA 2LQ8A 1IGUA 3JCMb 4RMOA 4BACA 5J39A 1ZX6A 1QW1A 2HBWA 3OW2A 4DEXA 3UPUA 1K9MR 2LJ3A 2YRDA 1NPPA 2M0YA 2OTJQ 3L1AA 4PJLA 1TS9A 4BDYA 1I5OB 5DY9A 5J26A 3JCMf 3M9QA 3CC2T 2VXEA 5CKFA 4X9DA 3OYYA 1ACMB 2HMAA 3O8VA 2EFIA 5GANf 8ATCB 1VQ4Q 1EZZB 2XDBA 1ZUUA 3M59A 2O88A 1R0CB 1WHLA 4JPBW 3V8JA 5GJVB 4CC4B 1KQ1A 1YFNA 4J9HA 4QT7A 3SWNA 1TG0A 3HRSA 2X4YA 3OS0A 1QWFA 5CO7A 2R5AA 1UHCA 3G6ET 4PJOG 2LNHB 4F17A 4RTXA 1YIJQ 2PU9B 4PNOA 2YUNA 3LLRA 3AT1B 5FWCA 4R55A 2QI2A 2BUDA 2HKNA 1YN8A 2E70A 2L3PA 5GAN2 3L42A 3TSWA 4Z88A 4JLIA 4II1A 2RQWA 5GMKi 5I11A 1W2BS 3EG9B 4J9IA 2DRKA 2P4TA 5CQXA 3FJPA 1VYTA 2O01E 1WXTA 2EJGA 4PJOD 2KNBB 2KQWA 2MK5A 2OI3A 2RO0A 3CC7A 1G2BA 3CCVA 5GAOn 1VQOA 1SHGA 1Y7XA 2ENMA 1KSWA 1VQPA 2Y4YA 3JCMh 4ZTJA 1YHQQ 1JRIA 1WJQA 3PVLA 4C92B 2XG8D 4GBQA 8AT1B 2BTTA 2EAYA 4Y92A 3PNWC 1VIFA 3I55A 1K73U 2F69A 4C0ZA 4PJOA 3DKMA 5FLXE 4M4ZA 3SFMA 3ZEHA 2FEIA 3QWYA 3MJXA 3CXCS 1X75C 2ZPEB 4C8QA 4HCZA 3QZ9B 1YJWT 2JS0A 4RKUE 1ARKA 3CCUQ 4PFOA 5GMKm 2IIMA 3SD4A 2IVWA 5IH2A 1BYMA 1JQQA 4IUPA 1PSEA 4HKEA 3G71T 2EQJA 3QBYA 4OMLA 3X26B 3LX7A 3CEYA 1KG1A 2DRMA 2P0QA 5D7UA 3S6WA 1GBRA 4A4GA 4KUIA 2K4YA 1M3AA 3EAEA 2DNUA 4LDWA 1PM3A 1RI9A 2M02A 1AHJB 4KGXB 2A7YA 4FT2A 2LT4A 2ZPGB 4D8KA 3QHSA 2XD0A 4M75G 1M1FA 1OOTA 5GAN7 4M7AG 1FMKA 1M2VA 2DL5A 2J6FA 1UG1A 4LDYA 2D8HA 1WQWA 2GGRA 1X6BA 1UUEA 4J6YA 5KYYA 2OTJA 3UDCA 1DJ7B 1RLQC 5GAMd 3NFCA 2F2XA 1B07A 4M77G 3OS1A 1R77A 2DKGA 2HQHA 2LTOA 4J9GA 2E3IA 3FEOA 1VYUA 5EC7A 3CD6Q 2L5QA 4EPCA 1WFWA 4RTUA 4M75D 1K0XA 2CZ0B 4M7AD 2L8DA 2CT3A 1QVFA 1TUGB 1D0XA 1E6GA 2E64A 4HT8A 3RESA 1WHHA 5GAN4 2NWMA 3RKXA 1BIAA 3LYIA 3NMZC 2VB6A 1YIJA 2DZCA 3M57A 4M77D 1JXMA 1J3TA 2K2VA 1Y96B 3V7SA 1B34A 3META 1G3YA 2KAFA 2YRVA 3M0PA 3VKIA 2F5KA 4J7IA 2HBPA 3OW2P 2OTLQ 1IHWA 4RG8A 2EYQA 2RI5A 5FU7C 2EJFA 5DM7R 3DB3A 2NUZA 2D0NA 4J9BA 1K73R 4C5HA 1QQJA 5GAMg 4JRKA 4C92F 1KQSP 4C5EA 4PFPA 2M51A 2QEXQ 2PZ1A 3NGPA 2XHCA 4F7UG 4AG1C 2JNGA 2GTOA 2JM8A 4M77A 1KK7A 4IUVA 4RTTA 2J6OA 2RHIA 2HQEA 1HSQA 4CC3A 2DTIA 1AWJA 1N6AA 3CC4A 3LGLA 1YHQA 1OPKA 1K8AU 4OB1B 3FJ5A 4RG2A 2VKNA 2IPOB 3PE0A 3BDUA 3MP6A 4JRQA 3HTRA 3P8DA 2DILA 1AT1B 2OX7A 2C0TA 3BW1A 1KHCA 3GBQA 4AFQC 2J05A 5KCHA 3OYDA 4E7LA 4OMQA 4FYYB 4ZN3A 2V1RA 4KGZB 1MGQA 4JJNK 2VUBA 4DQ2A 4IURA 2RQTA 4FYWB 4IIMA 1IHVA 1M1KC 1AD5A 1X2KA 3CPWP 3GLXA 3I35A 1X01A 1B7TA 2D9TA 1JU5C 1C1AA 1OZ3A 2RK2A 5IXFA 4LUDA 3HRTA 5KH6A 3QWXX 4OB0B 4HVVA 4F7UA 4IIOA 3G4SA 2X4XA 1BI2A 2H8HA 5D6WA 4KT0E 4A54A 2EQUA 2B86A 2ZGWA 4GLKA 1VOMA 1AZGB 4L6V5 3D7SB 5KYXA 1Y71A 1KD1C 2RHYA 1IB8A 2FHDA 1ZSZB 3CCVT 1VQOT 5HY6A 2DIQA 2VYTA 5CAIA 4KRTA 2K6DA 1W6XA 4M7DG 2FVUA 3H9NA 4MZMA 4PJNA 1VQPT 2K2MA 1UEBA 3A8OB 1NYFA 5FU7B 4P5NA 2MMPA 2RJCA 2CP6A 3OYIA 2QTVA 1YJNQ 1YBYA 1QKXA 2FPDA 2X35A 1QKWA 2LDMA 3A8GB 1W70A 2EYWA 4HVUA 3JCMQ 2FO0A 3M55A 2LVMA 3FC3A 1UHFA 3A8MB 3OYBA 2BZ8A 4M7DD 4OMOA 2RJDA 4LNPA 4DBFA 4F04B 2K5FA 4M78G 2AHJB 1M30A 4N0AA 1FX7A 3CD6A 3CCRQ 1X69A 1M90R 1SRLA 1ZQ1A 4RUGA 3CMAA 2YUPA 1VQKQ 2BE9B 1M2OA 4N4HA 2DL3A 4B9XA 1WZOA 3JB9F 1D0YA 2MYSA 5C0MA 4IKFA 5EG2A 3V8KA 1FWZA 2RJEA 4PJOC 4A63B 1K8AC 4M7DA 2BIVA 2CS7A 7AT1B 4M78D 2P0PA 4ZGJB 3INZA 3V7RA 1TWBA 5LJ3d 3I5SA 2FZGB 1K8AR 2OTLA 4J9FA 3RBBB 2EVRA 2AZVA 1QVGS 2EIFA 4ZGEB 5GAOl 1VQ5A 5GJWB 1VQNQ 3EGXB 1UGQB 5CK9A 1YITQ 2MF2A 1K1ZA 1U3OA 2QA4A 1AOJA 3HRUA 4HVWA 2VASA 3E1SA 1ZLMA 2V8IA 4M78A 3ZL7C 3CBMA 2NUPA 4RTZA 3CCQA 2I0NA 2VC8A 3GPLA 1N27A 5KYUB 2QQSA 2C0IA 3VYHB 3EFRA 4QQ6A 1PRLC 2QQRA 1GCQA 4JUVA 3MO8A 2LMJA 2RN8A 3HFNA 5I2MA 2EPDA 3EFSA 4LD6A 3JAME 1UGVA 1NBEB 5CR2A 2HKQB 2VWFA 2JMCA 4OGEA 2MAMA 2NYSA 2RH2A 4Y28E 4ANJA 1ZHIA 1JBMA 2D6FA 2O4XA 2YWWA 3CCEQ 2PVDB 3ZBDA 1XQHA 2DZ9A 2JJ9A 1YI2Q 4QVDA 1OULA 3OYNA 1YIJT 5GANe 3I56A 2DLPA 3GNGA 3C4SA 3PMTA 4O5VA 1GBQA 4OGCA 4A4KA 2F2VA 2I2LA 2HCKA 2VXFA 4O6JA 5HKCA 4E7HA 2M16A 2J06A 1HXDA 4BI3A 2EJ9A 2ROLA 2J6KA 2VGMA 2VGNA 5KYWA 3L2RA 2LQKA 3EG3A 4BI4A 2DAQA 1QMCA 4PJOE 1D3BB 1JJ2A 2ROTA 4EMKA 2QDYB 4E6RA 1D0ZA 3CCMQ 4OMPA 2XDPA 1Q82U 3RMSA 5D6YA 2ZZDA 1MV0B 4CI0C 2L89A 3RR6A 4C8QE 3QYGB 5I2SA 3E19A 2P4RA 3C0CA 4J83A 4X34A 3L2QA 1UJ0A 3CC4T 1F1BB 4FIBA 1C6VX 2CP2A 1UGSB 3OSSC 3EG2A 4M75C 1R8OB 2QK0A 4M7AC 2VV5A 4MMKA 4PK4A 1KQSA 1I5LA 5CKEA 1N9RA 3VS3A 3OYLA 4WTOB 1YJ9Q 4XK8E 2MI6A 2DVJA 1T0JA 2X3XD 5ECAA 4N4GA 1NZ9A 2QQ9A 1JB0E 1TU0B 2CUDA 4DOVA 4M77C 4E7ZA 1BKBA 2MPXC 3GF5A 1MV3A 1Q86U 3CCRA 3UA6A 3JSCA 1VQKA 4AFSC 1VQ7Q 1LOJA 3VS6A 2EWNA 2X9HA 3X20B 2CZ6B 2E65A 3AHUA 3X25B 2KROA 4FSXA 2DJZA 4AFZC 3JCMJ 2CP7A 1C0MA 2E5QA 2RI3A 2EYZA 2P0KA 3OY9A 2JUFA 3G4ST 3EFOA 1I81A 3N5BB 4C8QG 2QQAA 2DO3A 4BY6C 1YWOA 2WSEE 1LCKA 2F2WA 4FW2A 4MMLA 4K11A 2RQUA 1FXXA 1YNZA 3CPWA 3NTKA 5FW9A 1YCYA 2PQWA 2QASA 3OQ5A 1VQ9Q 1ABQA 1O75A 2RA2A 3QG1A 1K76A 1BCOA 4A4FA 3OSVA 2F1LA 1YITA 4C8QD 2GBQA 2ATCB 4BDZA 2MCNA 1IO6A 4Z02A 5GANh 1YCSB 1BU1A 2EGCA 5L8RE 3RUXA 1NLPC 1M27C 3QJYA 4NL3A 4Z8AA 2X51A 1WXUA 5IHNA 2DYBA 1X2QA 4ZNXA 1GRIA 3EH2A 4AMCA 3CCLA 2RK1A 1VQ8A 2QQBA 4M75E 3CD6T 2DD5A 4M75B 2KVQG 4M7AE 5IAYA 2K5IA 3CMAT 4M7AB 2KE9A 3EGDB 1NJIC 3CC2Q 4PKCC 1T0HA 3SB2A 2DXBA 4QQGA 1M4ZA 1Q82C 2B8AA 1PCXA 4L59A 3CCEA 3UATA 2DTOA 4KH1B 4M77E 4JDSA 2HSPA 3A5ZB 1UTIA 3PVQA 4R56A 2RQRA 4RTWA 4PJOF 1PRMC 1UFFA 2ZCFB 2DBMA 2LCCA 2OTLT 5J3BA 1SRMA 2EQKA 2LZ6B 3QPHA 3OW2S 2KRMA 1SEMA 3L2VA 1WJSA 1M9SA 1WLPB 1RACB 1VQ5T 3X28B 1RUWA 2CP0A 2EKOA 1M1KU 2QA4T 2AIRB 3M0TA 4MZTA 4DEYA 1Q86C 2QDLA 1OX8A 1Y57A 1BK2A 2JT4A 1KFZA 2XKOC 4OVAA 4D8DA 2AT1B 2E12A 5FWBA 4M7DC 3CCQT 3VS2A 3FIFA 2AZSA 1X27A 3JCMd 5LJ5j 1U8RA 4C5IA 1PSFA 1WX6A 5GANd 2GQVA 3S3MA 2R57A 4F7UE 2E6NA 1KD1U 3F70A 1VQ4A 1N8RU 1NM7A 3HPWA 2DXTA 4LN2A 1VQLQ 2V8KA 3EG9A 5LJ5e 4JJCA 2X3WD 3OS2A 4M78C 1JJ2P 4BI8B 2NUTB 3JCMW 1OZ2A 3I56T 2DIGA 3C95A 1PNJA 1VYVA 3BE3A 3VU3C 2XIDA 2KRNA 1M1GA 3JCMV 4WF2A 1YJWQ 2COWA 1WA7A 2MWPA 3DB4A 2EGAA 2CZ7B 4C92A 2PVOB 2WACA 2RPNA 3EG1A 1EIFA 4C0DC 2HAXA 5GAOm 1VQ6Q 3JCMg 4YTLA 1Q7YU 5GAN5 5A0LA 5GANg 2ZPBB 2HDAA 4DBHA 3G71Q 2EW3A 3RIRA 4R0KA 3OYHA 3JCMP 3GP8A 4DA4A 2BZYA 1WYXA 2HEQA 3QUIA 2M9UA 3JV3A 1IZ6A 2LCSA 2HQXA 3BY7A 4D6WA 5LJ5f 1W4SA 4FL6A 1QWEA 1GFDA 3L2UA 2QG9B 4M75F 1H641 2CZ1B 2L0AA 4EMKC 4M7AF 1MMNA 2RNAA 3ASKA 2JTMA 4EMHA 4M7DE 2QYZA 4XQ3A 2KGTA 2M1HA 4X9CA 3PTAA 1RAEB 3VS7A 4RTYA 2AKKA 2BZXA 4PJMA 2GQIA 3OA6A 2YLCA 3CCJQ 1RAHB 1AWOA 1G3TA 2EBPA 4LDVA 3LW5E 4M77F 1G83A 1KQ2A 1ZSGA 2DXUA 4XTVA 1VQKT 3OB9A 3HHTB 1MNEA 5FRNA 4ORZA 2W0ZA 3CCUA 2BE7D 4A53A 2G6FX 5GAN8 1SPKA 3VS5A 2BKDN 2QGGA 1M1KR 1IRXA 2JTEA 2ZPIB 4CC2A 3EGUA 4M78E 1VUBA 3M4GA 4XTXA 2JS2A 1TTHB 1ZA1B 1WPYA 1RAFB 4M78B 4EMGA 1BI0A 2W10A 3WXMB 4OB3B 1P92A 3SWNC 2D0QB 2CDTA 2DFUA 2JM9A 1N8RC 3CC7T 1GXIE 1WJRA 5AT1B 4FSSA 2ZAEA 4QQDA 5L23A 1KD1R 1IREB 1WHKA 2KT1A 5LJ5h 1LVKA 1TH7A 4C0DB 2YUOA 1WIEA 2Y90A 2Y4XA 5IHIA 3GOXA 2L3SA 2WSFE 2E3HA 4QVZA 4HCCA 1VQMQ 1H92A 1KJWA 1U06A 4F7UF 3OYKA 2EQMA 1MMGA 3I55T 1NEGA 3CPFA 2MWOA 1Q81C 5GAOp 1HJDA 4JS4A 1QVFS 4XU3A 2LRQA 3CCLT 1QCFA 3V7CA 1Z9QA 1VQ8T 1Y96A 3TU4K 2DETA 2ESWA 3VUBA 4LDUA 4C5GA 2AKLA 3RKWA 1VQLA 1Q7YC 1T3LA 4CRIA 1AWWA 4LE9A 4AG2C 4ESRA 2GNCA 1QLYA 3CCET 4JRPA 3QYHB 2DYIA 5A0DA 2DVEA 2FRYA 1WDXA 1I4K1 4QW2A 3U23A 5KYNA 4BB7A 4FM4B 2ZPFB 3H0IA 5CVIA 3HKSA 3P8BB 3NHNA 1PD0A 2LQNA 4XTZA 3JB9J 2RQVA 1XNIA 3QXEB 4JJBA 1S72Q 2KBTA 2V1QA 4C8QC 4E7IA 3WVEB 1VQ6A 1H3ZA 3C94A 3CMEQ 2FB7A 2RI2A 4NS5A 2CGHA 1OU9A 3G71A 1WQ7A 2QEXA 4XTUA 2JMAA 3PGGA 2YRCA 5IN1A 1G5VA 3SWNB 2QXFA 4CC7A 3MEUA 1OX9A 2FRWA 3M4YA 2CREA 1KC8C 1U1SA 1AVZC 2DL8A 4M7DF 4J9DA 2LP5A 2FPFA 2OTJT 2GCXA 1U5SA 3RDVA 1D1BA 3KUFA 1PD1A 3DLLA 3M53A 2RB6A 1VQ4T 2LQWA 3RKYA 2LT1A 3UF4A 1G3SA 1W2BA 3A98A 1G3WA 1ZUYA 1R0BG 2COZA 3FLGA 2DM1A 3NTIA 3CCJA 2PVGB 3PFSA 2HL5C 3FB9A 2CYZB 3NTHA 5KCOA 2E4HA 3J7AF 1Y07A 2FPEA 3X24B 4M78F 5D6XA 3ME9A 3JB9I 2YHTA 1ZSZA 3MEVA 3CCSQ 2CH4A 5GAMj 1Z9ZA 2V26A 2ED0A 2PUKB 2A0FB 4J6XA 4ELYC 5I22A 3UA7A 5KE2A 3H8ZA 1UB4A 2JTFA 2KXDA 2QAZA 1K4US 1HK9A 3M56A 4V2SA 2CSQA 3EHRA 1PKTA 2HD0A 5GAMe 4KGVB 4LDXA 5GAOq 1NJIU 3ULRB 4EDUA 4PJOB 3OYAA 2KYBA 1V29B 2LNVA 5FU6C 4E7JA 4PLIA 2E41A 3OMCA 3ZFJA 4OF1A 3CXCA 1QP3A 2E6ZA 4ZTFA 4BE1A 2DTHA 3MHXA 4C8QB 4XU0A 4Y91A 3M0SA 1YHQT 3R6OA 1NG2A 2E5KA 5FRMA 2OAWA 2LX9A 1VQMA 1CKAA 2K79A 1YJNA 4JS5A 4KUDK 2NLUA 2EGEA 3G7ZA 3J80E 1OV3A 4E47A 4Z89A 3QSUA 1K9MC 1QCNA 1GCPA 1M8MA 1TXQA 4QKUA 3J81E 1QP2A 3PMIA 2ED1A 3JRZA 1RLPC 3OYJA 4PLLA 1UJYA 2DEUA 4J8OA 4Q5WA 1ABOA 2DJQA 4XAXB 4HCKA 3I9QA 5GAMf 4XTYA 3CCUT 2DBKA 4UC4A 3EGXA 4XU1A 3VRYA 5CQYA 4NL2A 1IXDA 3OMGA 1TSFA 3O5ZA 4OMNA 1M2VB 3PIOA 3QDRB 1Y0MA 4BUGA 2PUOB 2XI9A 5KYYB 1S72A 2L3QA 3E2UA 3QDFA 5KYUA 1CKBA 1PKSA 4RCBA 3CMEA 3VS4A 5DLOA 2V8JA 4GY5A 2CT4A 2YSQA 3PIPA 1VA7A 2YLBA 2JW4A 3URGA 3LWIA 1VQNA 2D1XA 2A08A 2CP3A 1N5ZA 4LUEA 4NOYA 1MHNA 2K3BA 1EX4A 3LWHA 3FDRA 5FU6B 2SEMA 1T3SA 3UWNA 3RMQA 1OEBA 4A4EA 3M54A 1SSHA 2LJ0A 4E7KA 3RNJA 2DPPB 4ME7A 4JZ4A 1BI1A 3CC4Q 1QVPA 4C92E 1B34B 5IXBA 1SHFA 5AYFA 4KBMB 5GAMh 1VQLT 1WGSA 1ZBXA 1UE9A 2O9SA 2GFAA 5GAN6 5C6SA 3S3NA 2DL4A 4A4HA 4OMFB 1D3BA 2GTJA 2GF7A 3E9GA 5FROA 1NJIR 1JJ2S 1E7OA 2FZCB 2X4WA 3CCSA 1YI2A 2K5LA 2ABLA 3JCMX 2RF0A 1Q82R 2L2PA 4M77B 1K0SA 3M58A 4J9EA 2L3RA 1O9SA 4IUQA 1GFCA 4FW1A 1U1TA 2LX7A 4JZ3A 1X43A 3E9FA 4J6WA 1PHTA 2LCLA 2KK4A 1ZA2B 2KT8A 4N0AC 3G6EQ 1VQ6T 1MMAA 2CH4W 4C8QF 2FG0A 3FRNA 2COYA 1RAAB 1OPLA 4FU6A 3CCMA 5IT9E 2X4JA 3G4SQ 4B9WA 2JVVA 4KULA 2QEXT 4VUBA 5CKDA 1KQSS 4BY6B 1W2BP 3IQLA 5GAOr 4DBRA 4BE2A 4KH0B 4X1VA 4C92G 3OYFA 1HYOA 3DLMA 2JZ2A 3PT9A 1H3HA 5LJ3j 2RHZA 1Q86R 1PWTA 1X6OA 1B3QA 2QGFB 4B6MA 4BE0A 2C06A 2XK0A 1D09B 2FL7A 3H41A 4PFZA 1BCMA 2KY9A 1UECA 3VUZA 4F7UB 1YJ9A 2GFUA 3CCJT 1V76A 5LJ3e 4C92D 1FYNA 5CKBA 1XOVA 3HL8A 3MPUB 4RCCA 2SRCA 2XICA 2EYYA 2KRSA 3REAB 5KYXB 1RAIB 1TUDA 4LXCA 1VQ7A 2WSCE 4E7SA 4J7FA 1JO8A 4LD9K 1SF9A 1Q81U 3CXCP 1GCQC 3CPWS 1SG5A 2K3YA 3LH5A 2G3RA 3CMAQ 1WHMA 4J5YA 3JCMc 2RMOA 1NLOC 2ZPHB 1JXOA 2KYMA 3MCAB
chains in the Genus database with same CATH topology
1V1CA 3PVLA 2F2VA 4GBQA 2HCKA 3H0FA 2BTTA 1QCFA 2J06A 1Z9QA 4Y92A 2ROLA 2J6KA 2A37A 2ESWA 3EG3A 2J7IA 2AKLA 4M4ZA 2ROTA 1T3LA 1M3CA 4E6RA 3R6NA 1AWXA 1AWWA 4OMPA 4LE9A 4AG2C 4ESRA 2FEIA 3QWYA 2GNCA 1QLYA 2EKHA 1MV0B 2FRYA 2P4RA 3C0CA 1WDXA 2JS0A 1UJ0A 1YP5A 3U23A 1UDLA 1HD3A 1ARKA 3H0IA 2IIMA 2DX1A 4JJDA 3EG2A 5IH2A 3NHNA 2DA9A 2LQNA 1X6GA 1JQQA 2RQVA 4JJBA 2KBTA 2V1QA 4OMLA 3NPFA 3VRZA 3VS3A 2VVKA 2CUBA 2DVJA 1T0JA 2DRMA 2X3XD 2K9GA 5ECAA 2C0OA 2CUDA 4J9CA 1GBRA 1MV3A 2JMAA 1NYGA 1M3AA 4CC7A 3UA6A 2DNUA 2FRWA 1RI9A 4AFSC 2CREA 3VS6A 1AVZC 2DL8A 4J9DA 2KROA 2LP5A 2FPFA 4AFZC 4D8KA 1K9AA 1U5SA 3SHWA 1OOTA 2EYZA 1FMKA 2DL5A 2J6FA 2YT6A 1UG1A 2D8HA 1A0NB 2LQWA 2GGRA 3UF4A 1BB9A 1JXOA 1X6BA 1UUEA 1YWOA 3A98A 1ZUYA 1RLQC 1LCKA 2DM1A 2ECZA 2F2WA 1AEYA 2YDLA 4K11A 2F2XA 1B07A 2O31A 2RQUA 1YNZA 4J9GA 5FW9A 1VYUA 5EC7A 2FPEA 1WFWA 4RTUA 1ABQA 2EYXA 1K0XA 1K76A 2CH4A 4EIKA 2CT3A 1Z9ZA 2ED0A 1E6GA 2GBQA 1E6HA 2MCNA 1AZEA 1IO6A 5I22A 3UA7A 2KXDA 2YUQA 1K4US 2NWMA 2KEAA 3VS1A 3NMZC 3THKA 1CSKA 1YCSB 1BU1A 2EGCA 2CSQA 3EHRA 1NLPC 1JXMA 1M27C 4F16A 4Z8AA 1J3TA 1WXUA 5IHNA 1PKTA 1S1NA 2DYBA 1X2QA 4ZNXA 1GRIA 3M0PA 3ULRB 2KYBA 3M0QA 3KFVA 4OMMA 2A36A 1ZBJA 2NUZA 2D0NA 4J9BA 2KE9A 1T0HA 3M0SA 2M51A 2PZ1A 2JXBA 3NGPA 2A28A 1NG2A 4AG1C 2E5KA 1ZUKA 2GTOA 2JM8A 2OAWA 3EG0A 1CKAA 3UATA 2K79A 2HSPA 4RTTA 2J6OA 1UTIA 1HSQA 4CC3A 2MIOA 3PVQA 1AWJA 2EGEA 2RQRA 1OV3A 4RTWA 1NEBA 1OPKA 4Z89A 3FJ5A 1PRMC 2VKNA 1GCPA 1M8MA 1UFFA 3PE0A 2DE0X 2DBMA 3I5RA 1SRMA 2DILA 2ED1A 2LZ6B 2KRMA 1SEMA 2C0TA 1RLPC 1WLPB 2XMFA 3GBQA 2PTKA 1WXBA 1UJYA 4AFQC 2J05A 1I0CA 1ABOA 2DJQA 1RUWA 4HCKA 3I9QA 4OMQA 2V1RA 2KR3A 1I07A 2DBKA 3REBB 1TUCA 1M3BA 3M0TA 4DEYA 2RQTA 2QDLA 1Y57A 1BK2A 2JT4A 2AK5A 4IIMA 1KFZA 4D8DA 3VRYA 5FWBA 1MUZA 2D8JA 1AD5A 5IHKA 1X2KA 3VS2A 3I35A 3CQTA 2AZSA 1GL5A 3O5ZA 1BBZA 4OMNA 1JU5C 1X27A 1Y0MA 3TSZA 2O2OA 3VS0A 5IXFA 1WX6A 4LUDA 2L3QA 2LJ1A 3QWXX 4HVVA 1CKBA 1PKSA 4IIOA 1W1FA 4GLMA 2H8HA 3VS4A 1NM7A 2CT4A 2B86A 2YSQA 4LN2A 1VA7A 2JW4A 1AZGB 2MOXA 3EHQA 2D1XA 2K7AA 2A08A 4F14A 4JJCA 2X3WD 2EQIA 1N5ZA 4LUEA 2OJ2A 4KRTA 2K3BA 2K6DA 1W6XA 3TVTA 2SEMA 2K2MA 1T3SA 1PNJA 2CSIA 1OEBA 1NYFA 1VYVA 1SSHA 2LJ0A 1YWPA 1JEGA 2KRNA 3RNJA 4JZ4A 4WCIA 1QKXA 1WA7A 1H8KA 2EGAA 2FPDA 2DMOA 1I1JA 2KXCA 1QKWA 5IXBA 1W70A 2EYWA 2RPNA 1SHFA 3EG1A 4HVUA 4HXJA 2DL7A 3M0UA 2FO0A 1UE9A 2O9SA 1WI7A 1UHFA 1EFNA 2O9VA 2BZ8A 1KIKA 2DL4A 4OMOA 2HDAA 3H0HA 3M0RA 2EW3A 5HCKA 4R0KA 4AFUC 4LNPA 2PNIA 2GTJA 1M30A 2BZYA 1WYXA 2HEQA 3JV3A 2DF6A 1X69A 1E7OA 1SRLA 4RUGA 2YUPA 2ABLA 2RF0A 2L2PA 1K0SA 4J9EA 2LCSA 4RTVA 1GFCA 2DL3A 3SEMA 2LX7A 4JZ3A 1X43A 1QWEA 1GFDA 1PHTA 1ZX6A 2KT8A 2HBWA 4DEXA 2L0AA 2RNAA 2LJ3A 4A63B 2CH4W 2M0YA 2FG0A 2KGTA 3VS7A 4RTYA 2AKKA 2BZXA 2GQIA 1OPLA 3I5SA 1AWOA 2EBPA 4J9FA 3RBBB 2EVRA 2AZVA 3IQLA 1G83A 1ZSGA 1ZUUA 4X1VA 2O88A 4JPBW 5GJVB 5GJWB 4CC4B 4J9HA 4QT7A 1H3HA 4ORZA 1K1ZA 1TG0A 1U3OA 1PWTA 2G6FX 1QWFA 1AOJA 1B3QA 1SPKA 3VS5A 4HVWA 3H41A 1ZLMA 1UHCA 2JTEA 4CC2A 3EGUA 3ZL7C 2LNHB 4F17A 4RTXA 1UECA 2JS2A 4RTZA 2I0NA 2YUNA 2C0IA 2W10A 5FWCA 1PRLC 1GCQA 2LMJA 2RN8A 1YN8A 2CDTA 1FYNA 1XOVA 2EPDA 2L3PA 2SRCA 2EYYA 2KRSA 1UGVA 3TSWA 2JM9A 4Z88A 2RQWA 3REAB 5I11A 1TUDA 4J9IA 2VWFA 2DRKA 4FSSA 2JMCA 5L23A 2KT1A 1VYTA 1WXTA 1JO8A 2KNBB 2YUOA 2OI3A 1WIEA 1GCQC 1G2BA 5IHIA 2L3SA 1SHGA 3LH5A 1H92A 1KJWA 1U06A 2ENMA 1NEGA 2DLPA 2RMOA 1KSWA 1NLOC 2W0ZA 1HJDA 1GBQA 2KYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  3PVL A;  2F2V A;  4GBQ A;  2HCK A;  3H0F A;  2BTT A;  1QCF A;  2J06 A;  1Z9Q A;  4Y92 A;  2ROL A;  2J6K A;  2A37 A;  2ESW A;  3EG3 A;  2J7I A;  2AKL A;  4M4Z A;  2ROT A;  1T3L A;  1M3C A;  4E6R A;  3R6N A;  1AWX A;  1AWW A;  4OMP A;  4LE9 A;  4AG2 C;  4ESR A;  2FEI A;  3QWY A;  2GNC A;  1QLY A;  2EKH A;  1MV0 B;  2FRY A;  2P4R A;  3C0C A;  1WDX A;  2JS0 A;  1UJ0 A;  1YP5 A;  3U23 A;  1UDL A;  1HD3 A;  1ARK A;  3H0I A;  2IIM A;  2DX1 A;  4JJD A;  3EG2 A;  5IH2 A;  3NHN A;  2DA9 A;  2LQN A;  1X6G A;  1JQQ A;  2RQV A;  4JJB A;  2KBT A;  2V1Q A;  4OML A;  3NPF A;  3VRZ A;  3VS3 A;  2VVK A;  2CUB A;  2DVJ A;  1T0J A;  2DRM A;  2X3X D;  2K9G A;  5ECA A;  2C0O A;  2CUD A;  4J9C A;  1GBR A;  1MV3 A;  2JMA A;  1NYG A;  1M3A A;  4CC7 A;  3UA6 A;  2DNU A;  2FRW A;  1RI9 A;  4AFS C;  2CRE A;  3VS6 A;  1AVZ C;  2DL8 A;  4J9D A;  2KRO A;  2LP5 A;  2FPF A;  4AFZ C;  4D8K A;  1K9A A;  1U5S A;  3SHW A;  1OOT A;  2EYZ A;  1FMK A;  2DL5 A;  2J6F A;  2YT6 A;  1UG1 A;  2D8H A;  1A0N B;  2LQW A;  2GGR A;  3UF4 A;  1BB9 A;  1JXO A;  1X6B A;  1UUE A;  1YWO A;  3A98 A;  1ZUY A;  1RLQ C;  1LCK A;  2DM1 A;  2ECZ A;  2F2W A;  1AEY A;  2YDL A;  4K11 A;  2F2X A;  1B07 A;  2O31 A;  2RQU A;  1YNZ A;  4J9G A;  5FW9 A;  1VYU A;  5EC7 A;  2FPE A;  1WFW A;  4RTU A;  1ABQ A;  2EYX A;  1K0X A;  1K76 A;  2CH4 A;  4EIK A;  2CT3 A;  1Z9Z A;  2ED0 A;  1E6G A;  2GBQ A;  1E6H A;  2MCN A;  1AZE A;  1IO6 A;  5I22 A;  3UA7 A;  2KXD A;  2YUQ A;  1K4U S;  2NWM A;  2KEA A;  3VS1 A;  3NMZ C;  3THK A;  1CSK A;  1YCS B;  1BU1 A;  2EGC A;  2CSQ A;  3EHR A;  1NLP C;  1JXM A;  1M27 C;  4F16 A;  4Z8A A;  1J3T A;  1WXU A;  5IHN A;  1PKT A;  1S1N A;  2DYB A;  1X2Q A;  4ZNX A;  1GRI A;  3M0P A;  3ULR B;  2KYB A;  3M0Q A;  3KFV A;  4OMM A;  2A36 A;  1ZBJ A;  2NUZ A;  2D0N A;  4J9B A;  2KE9 A;  1T0H A;  3M0S A;  2M51 A;  2PZ1 A;  2JXB A;  3NGP A;  2A28 A;  1NG2 A;  4AG1 C;  2E5K A;  1ZUK A;  2GTO A;  2JM8 A;  2OAW A;  3EG0 A;  1CKA A;  3UAT A;  2K79 A;  2HSP A;  4RTT A;  2J6O A;  1UTI A;  1HSQ A;  4CC3 A;  2MIO A;  3PVQ A;  1AWJ A;  2EGE A;  2RQR A;  1OV3 A;  4RTW A;  1NEB A;  1OPK A;  4Z89 A;  3FJ5 A;  1PRM C;  2VKN A;  1GCP A;  1M8M A;  1UFF A;  3PE0 A;  2DE0 X;  2DBM A;  3I5R A;  1SRM A;  2DIL A;  2ED1 A;  2LZ6 B;  2KRM A;  1SEM A;  2C0T A;  1RLP C;  1WLP B;  2XMF A;  3GBQ A;  2PTK A;  1WXB A;  1UJY A;  4AFQ C;  2J05 A;  1I0C A;  1ABO A;  2DJQ A;  1RUW A;  4HCK A;  3I9Q A;  4OMQ A;  2V1R A;  2KR3 A;  1I07 A;  2DBK A;  3REB B;  1TUC A;  1M3B A;  3M0T A;  4DEY A;  2RQT A;  2QDL A;  1Y57 A;  1BK2 A;  2JT4 A;  2AK5 A;  4IIM A;  1KFZ A;  4D8D A;  3VRY A;  5FWB A;  1MUZ A;  2D8J A;  1AD5 A;  5IHK A;  1X2K A;  3VS2 A;  3I35 A;  3CQT A;  2AZS A;  1GL5 A;  3O5Z A;  1BBZ A;  4OMN A;  1JU5 C;  1X27 A;  1Y0M A;  3TSZ A;  2O2O A;  3VS0 A;  5IXF A;  1WX6 A;  4LUD A;  2L3Q A;  2LJ1 A;  3QWX X;  4HVV A;  1CKB A;  1PKS A;  4IIO A;  1W1F A;  4GLM A;  2H8H A;  3VS4 A;  1NM7 A;  2CT4 A;  2B86 A;  2YSQ A;  4LN2 A;  1VA7 A;  2JW4 A;  1AZG B;  2MOX A;  3EHQ A;  2D1X A;  2K7A A;  2A08 A;  4F14 A;  4JJC A;  2X3W D;  2EQI A;  1N5Z A;  4LUE A;  2OJ2 A;  4KRT A;  2K3B A;  2K6D A;  1W6X A;  3TVT A;  2SEM A;  2K2M A;  1T3S A;  1PNJ A;  2CSI A;  1OEB A;  1NYF A;  1VYV A;  1SSH A;  2LJ0 A;  1YWP A;  1JEG A;  2KRN A;  3RNJ A;  4JZ4 A;  4WCI A;  1QKX A;  1WA7 A;  1H8K A;  2EGA A;  2FPD A;  2DMO A;  1I1J A;  2KXC A;  1QKW A;  5IXB A;  1W70 A;  2EYW A;  2RPN A;  1SHF A;  3EG1 A;  4HVU A;  4HXJ A;  2DL7 A;  3M0U A;  2FO0 A;  1UE9 A;  2O9S A;  1WI7 A;  1UHF A;  1EFN A;  2O9V A;  2BZ8 A;  1KIK A;  2DL4 A;  4OMO A;  2HDA A;  3H0H A;  3M0R A;  2EW3 A;  5HCK A;  4R0K A;  4AFU C;  4LNP A;  2PNI A;  2GTJ A;  1M30 A;  2BZY A;  1WYX A;  2HEQ A;  3JV3 A;  2DF6 A;  1X69 A;  1E7O A;  1SRL A;  4RUG A;  2YUP A;  2ABL A;  2RF0 A;  2L2P A;  1K0S A;  4J9E A;  2LCS A;  4RTV A;  1GFC A;  2DL3 A;  3SEM A;  2LX7 A;  4JZ3 A;  1X43 A;  1QWE A;  1GFD A;  1PHT A;  1ZX6 A;  2KT8 A;  2HBW A;  4DEX A;  2L0A A;  2RNA A;  2LJ3 A;  4A63 B;  2CH4 W;  2M0Y A;  2FG0 A;  2KGT A;  3VS7 A;  4RTY A;  2AKK A;  2BZX A;  2GQI A;  1OPL A;  3I5S A;  1AWO A;  2EBP A;  4J9F A;  3RBB B;  2EVR A;  2AZV A;  3IQL A;  1G83 A;  1ZSG A;  1ZUU A;  4X1V A;  2O88 A;  4JPB W;  5GJV B;  5GJW B;  4CC4 B;  4J9H A;  4QT7 A;  1H3H A;  4ORZ A;  1K1Z A;  1TG0 A;  1U3O A;  1PWT A;  2G6F X;  1QWF A;  1AOJ A;  1B3Q A;  1SPK A;  3VS5 A;  4HVW A;  3H41 A;  1ZLM A;  1UHC A;  2JTE A;  4CC2 A;  3EGU A;  3ZL7 C;  2LNH B;  4F17 A;  4RTX A;  1UEC A;  2JS2 A;  4RTZ A;  2I0N A;  2YUN A;  2C0I A;  2W10 A;  5FWC A;  1PRL C;  1GCQ A;  2LMJ A;  2RN8 A;  1YN8 A;  2CDT A;  1FYN A;  1XOV A;  2EPD A;  2L3P A;  2SRC A;  2EYY A;  2KRS A;  1UGV A;  3TSW A;  2JM9 A;  4Z88 A;  2RQW A;  3REA B;  5I11 A;  1TUD A;  4J9I A;  2VWF A;  2DRK A;  4FSS A;  2JMC A;  5L23 A;  2KT1 A;  1VYT A;  1WXT A;  1JO8 A;  2KNB B;  2YUO A;  2OI3 A;  1WIE A;  1GCQ C;  1G2B A;  5IHI A;  2L3S A;  1SHG A;  3LH5 A;  1H92 A;  1KJW A;  1U06 A;  2ENM A;  1NEG A;  2DLP A;  2RMO A;  1KSW A;  1NLO C;  2W0Z A;  1HJD A;  1GBQ A;  2KYM A; 
#chains in the Genus database with same CATH topology
 1V1C A;  2RHX A;  3MEW A;  1OI1 A;  3H0F A;  1LPL A;  2RM4 A;  3GIB A;  1PG5 B;  2F5T X;  2R5M A;  1KHI A;  2A37 A;  1ZSZ C;  1IGQ A;  1FMV A;  2J7I A;  1VQ9 A;  1LJO A;  1M3C A;  3BDL A;  1M90 U;  2K3X A;  1AWX A;  3R6N A;  3ER0 A;  1K73 C;  5A0G A;  4M75 A;  5LJ3 f;  4MZP A;  4M7A A;  3EGD A;  2EKH A;  1VQM T;  3QJ6 A;  1YJN T;  4MDX A;  4JLG A;  1VQ5 Q;  3OYM A;  1G8X A;  3HP9 A;  2HZY A;  2E1H A;  1YP5 A;  1UDL A;  1HD3 A;  2DX1 A;  2QA4 Q;  1M8V A;  4JJD A;  2KI7 A;  3OBY A;  4MDW A;  2DA9 A;  1X6G A;  1XTD A;  4M7D B;  3QZ5 B;  1N9S A;  3CCQ Q;  4QVC A;  1BI3 A;  1QVG A;  3NPF A;  3VRZ A;  3CCR T;  2VVK A;  2CUB A;  3TEE A;  3CC2 A;  2K9G A;  2C0O A;  4J9C A;  1KC8 U;  3LGF A;  1NYG A;  1NE8 A;  1UGR B;  2JOY A;  4FT4 A;  4BD3 A;  3S3O A;  4XU2 A;  2H3J A;  4HA8 A;  5GAN 3;  3JB9 G;  4PJJ A;  1OYX A;  1K9A A;  1MMD A;  2NUP B;  4OP0 A;  3CBP A;  3SHW A;  1S72 T;  3I56 Q;  3G6E A;  2YT6 A;  1A0N B;  1Q95 G;  3OYE A;  2DXC A;  4N4I A;  3CME T;  1BB9 A;  3MEA A;  2CP5 A;  5GMK l;  5A2Q E;  5LJ3 h;  2A3L A;  4AT1 B;  2ECZ A;  2RHU A;  1MND A;  1VQN T;  1PC0 A;  5KE3 A;  2YDL A;  1AEY A;  5HK3 A;  1YIT T;  2O31 A;  2KSS A;  4C0G A;  1N8R R;  3JB9 D;  4JRI A;  4XTW A;  3CBO A;  3WVD B;  3A8H B;  1QCO A;  1LNX A;  2DD4 A;  2EYX A;  2O4X B;  4EIK A;  2NUT A;  1SKU B;  3C12 A;  1E6H A;  4ATO A;  1AZE A;  2LC4 A;  1M5Q 1;  2YUQ A;  2KEA A;  5LL6 S;  1Q81 R;  3VS1 A;  3THK A;  1CSK A;  2RD1 A;  3TCJ A;  3OYC A;  4F16 A;  6AT1 B;  1S1N A;  5KYW B;  5GMK j;  3VV0 A;  3HSB A;  1BIB A;  4EMK B;  3M0Q A;  2YXY A;  3KFV A;  4OMM A;  5CKH A;  3JB9 H;  2A36 A;  1Q7Y R;  3M5A A;  1ZBJ A;  2HNI A;  3CCS T;  1YI2 T;  2Z0W A;  1M90 C;  3RER A;  2M0O A;  5HK0 A;  4OB2 B;  3LH0 A;  1WNL A;  4TVR A;  5DLQ E;  5GMK e;  1NPR A;  2JXB A;  1RL2 A;  2A28 A;  2DK3 A;  1K9M U;  3T9N A;  3VJP A;  1ZUK A;  3EG0 A;  2FYK A;  1OQK A;  3MP1 A;  4HT9 A;  3KBG A;  1YJW A;  4L5G A;  2MIO A;  1WHJ A;  3QO3 A;  1NEB A;  4DBQ A;  2DE0 X;  1I8F A;  3CCM T;  3I5R A;  3P8H A;  3OS5 A;  2XMF A;  3Q1J A;  2R58 A;  2DEQ A;  2PTK A;  1WXB A;  1I0C A;  1RAB B;  2QTX A;  3TQ7 P;  1RAD B;  2KR3 A;  1I07 A;  4ZN1 A;  3REB B;  1TUC A;  5LJ5 d;  1M3B A;  2IG0 A;  5CIU A;  4ELZ C;  4C0F A;  3CC7 Q;  1RAG B;  2AK5 A;  3CCV Q;  1VQO Q;  3BFM A;  1KC8 R;  1UGP B;  1MUZ A;  2D8J A;  5IHK A;  3L2Z A;  3CQT A;  3QKJ A;  1VQP Q;  1GL5 A;  1SSF A;  2DER A;  4PL6 A;  1BBZ A;  3EH1 A;  4DOW A;  3EFO B;  3V8L A;  2H3E B;  2HSE B;  3TSZ A;  1YJ9 T;  2O2O A;  3VS0 A;  3KXT A;  2FZK B;  4IUT A;  4FYX B;  2LJ1 A;  3A1P A;  3I55 Q;  1W1F A;  1QVF P;  4GLM A;  5M9O A;  4E2F B;  1VQ7 T;  2MOX A;  3CCL Q;  3EHQ A;  1VQ8 Q;  3TRE A;  2K7A A;  4F14 A;  2EQI A;  5GAN j;  1RI0 A;  2JN0 A;  2OJ2 A;  4HCB A;  3TVT A;  5LJ3 g;  2CKK A;  3HFO A;  9ATC B;  2CSI A;  2XU8 A;  3UT1 A;  1D1A A;  2RJF A;  4FYV B;  3VYG A;  5LJ5 g;  3JCM e;  1YWP A;  1JEG A;  4WCI A;  4ZGD B;  4FCY A;  1WHG A;  1H8K A;  2KDS A;  2DMO A;  1I1J A;  2KXC A;  5I21 A;  1XJW B;  2KMT A;  3A8L B;  1VQ9 T;  1VIE A;  4HXJ A;  3SDZ A;  2DL7 A;  3M0U A;  3OYG A;  2P84 A;  1OU8 A;  2XDD A;  1WI7 A;  1EFN A;  1D1C A;  1TOV A;  2O9V A;  1KIK A;  3G1J A;  3L2W A;  3H0H A;  5HCK A;  3M0R A;  4AFU C;  1QVG P;  2PNI A;  3MP8 A;  3H6Z A;  4IUU A;  3MKD A;  2DF6 A;  1FMW A;  4C92 C;  2OAU A;  2HL3 A;  3GNF B;  2K57 A;  5GMK h;  3OBW A;  5CCA A;  2E10 A;  4RTV A;  3QII A;  3SEM A;  2LQ8 A;  1IGU A;  3JCM b;  4RMO A;  4BAC A;  5J39 A;  1ZX6 A;  1QW1 A;  2HBW A;  3OW2 A;  4DEX A;  3UPU A;  1K9M R;  2LJ3 A;  2YRD A;  1NPP A;  2M0Y A;  2OTJ Q;  3L1A A;  4PJL A;  1TS9 A;  4BDY A;  1I5O B;  5DY9 A;  5J26 A;  3JCM f;  3M9Q A;  3CC2 T;  2VXE A;  5CKF A;  4X9D A;  3OYY A;  1ACM B;  2HMA A;  3O8V A;  2EFI A;  5GAN f;  8ATC B;  1VQ4 Q;  1EZZ B;  2XDB A;  1ZUU A;  3M59 A;  2O88 A;  1R0C B;  1WHL A;  4JPB W;  3V8J A;  5GJV B;  4CC4 B;  1KQ1 A;  1YFN A;  4J9H A;  4QT7 A;  3SWN A;  1TG0 A;  3HRS A;  2X4Y A;  3OS0 A;  1QWF A;  5CO7 A;  2R5A A;  1UHC A;  3G6E T;  4PJO G;  2LNH B;  4F17 A;  4RTX A;  1YIJ Q;  2PU9 B;  4PNO A;  2YUN A;  3LLR A;  3AT1 B;  5FWC A;  4R55 A;  2QI2 A;  2BUD A;  2HKN A;  1YN8 A;  2E70 A;  2L3P A;  5GAN 2;  3L42 A;  3TSW A;  4Z88 A;  4JLI A;  4II1 A;  2RQW A;  5GMK i;  5I11 A;  1W2B S;  3EG9 B;  4J9I A;  2DRK A;  2P4T A;  5CQX A;  3FJP A;  1VYT A;  2O01 E;  1WXT A;  2EJG A;  4PJO D;  2KNB B;  2KQW A;  2MK5 A;  2OI3 A;  2RO0 A;  3CC7 A;  1G2B A;  3CCV A;  5GAO n;  1VQO A;  1SHG A;  1Y7X A;  2ENM A;  1KSW A;  1VQP A;  2Y4Y A;  3JCM h;  4ZTJ A;  1YHQ Q;  1JRI A;  1WJQ A;  3PVL A;  4C92 B;  2XG8 D;  4GBQ A;  8AT1 B;  2BTT A;  2EAY A;  4Y92 A;  3PNW C;  1VIF A;  3I55 A;  1K73 U;  2F69 A;  4C0Z A;  4PJO A;  3DKM A;  5FLX E;  4M4Z A;  3SFM A;  3ZEH A;  2FEI A;  3QWY A;  3MJX A;  3CXC S;  1X75 C;  2ZPE B;  4C8Q A;  4HCZ A;  3QZ9 B;  1YJW T;  2JS0 A;  4RKU E;  1ARK A;  3CCU Q;  4PFO A;  5GMK m;  2IIM A;  3SD4 A;  2IVW A;  5IH2 A;  1BYM A;  1JQQ A;  4IUP A;  1PSE A;  4HKE A;  3G71 T;  2EQJ A;  3QBY A;  4OML A;  3X26 B;  3LX7 A;  3CEY A;  1KG1 A;  2DRM A;  2P0Q A;  5D7U A;  3S6W A;  1GBR A;  4A4G A;  4KUI A;  2K4Y A;  1M3A A;  3EAE A;  2DNU A;  4LDW A;  1PM3 A;  1RI9 A;  2M02 A;  1AHJ B;  4KGX B;  2A7Y A;  4FT2 A;  2LT4 A;  2ZPG B;  4D8K A;  3QHS A;  2XD0 A;  4M75 G;  1M1F A;  1OOT A;  5GAN 7;  4M7A G;  1FMK A;  1M2V A;  2DL5 A;  2J6F A;  1UG1 A;  4LDY A;  2D8H A;  1WQW A;  2GGR A;  1X6B A;  1UUE A;  4J6Y A;  5KYY A;  2OTJ A;  3UDC A;  1DJ7 B;  1RLQ C;  5GAM d;  3NFC A;  2F2X A;  1B07 A;  4M77 G;  3OS1 A;  1R77 A;  2DKG A;  2HQH A;  2LTO A;  4J9G A;  2E3I A;  3FEO A;  1VYU A;  5EC7 A;  3CD6 Q;  2L5Q A;  4EPC A;  1WFW A;  4RTU A;  4M75 D;  1K0X A;  2CZ0 B;  4M7A D;  2L8D A;  2CT3 A;  1QVF A;  1TUG B;  1D0X A;  1E6G A;  2E64 A;  4HT8 A;  3RES A;  1WHH A;  5GAN 4;  2NWM A;  3RKX A;  1BIA A;  3LYI A;  3NMZ C;  2VB6 A;  1YIJ A;  2DZC A;  3M57 A;  4M77 D;  1JXM A;  1J3T A;  2K2V A;  1Y96 B;  3V7S A;  1B34 A;  3MET A;  1G3Y A;  2KAF A;  2YRV A;  3M0P A;  3VKI A;  2F5K A;  4J7I A;  2HBP A;  3OW2 P;  2OTL Q;  1IHW A;  4RG8 A;  2EYQ A;  2RI5 A;  5FU7 C;  2EJF A;  5DM7 R;  3DB3 A;  2NUZ A;  2D0N A;  4J9B A;  1K73 R;  4C5H A;  1QQJ A;  5GAM g;  4JRK A;  4C92 F;  1KQS P;  4C5E A;  4PFP A;  2M51 A;  2QEX Q;  2PZ1 A;  3NGP A;  2XHC A;  4F7U G;  4AG1 C;  2JNG A;  2GTO A;  2JM8 A;  4M77 A;  1KK7 A;  4IUV A;  4RTT A;  2J6O A;  2RHI A;  2HQE A;  1HSQ A;  4CC3 A;  2DTI A;  1AWJ A;  1N6A A;  3CC4 A;  3LGL A;  1YHQ A;  1OPK A;  1K8A U;  4OB1 B;  3FJ5 A;  4RG2 A;  2VKN A;  2IPO B;  3PE0 A;  3BDU A;  3MP6 A;  4JRQ A;  3HTR A;  3P8D A;  2DIL A;  1AT1 B;  2OX7 A;  2C0T A;  3BW1 A;  1KHC A;  3GBQ A;  4AFQ C;  2J05 A;  5KCH A;  3OYD A;  4E7L A;  4OMQ A;  4FYY B;  4ZN3 A;  2V1R A;  4KGZ B;  1MGQ A;  4JJN K;  2VUB A;  4DQ2 A;  4IUR A;  2RQT A;  4FYW B;  4IIM A;  1IHV A;  1M1K C;  1AD5 A;  1X2K A;  3CPW P;  3GLX A;  3I35 A;  1X01 A;  1B7T A;  2D9T A;  1JU5 C;  1C1A A;  1OZ3 A;  2RK2 A;  5IXF A;  4LUD A;  3HRT A;  5KH6 A;  3QWX X;  4OB0 B;  4HVV A;  4F7U A;  4IIO A;  3G4S A;  2X4X A;  1BI2 A;  2H8H A;  5D6W A;  4KT0 E;  4A54 A;  2EQU A;  2B86 A;  2ZGW A;  4GLK A;  1VOM A;  1AZG B;  4L6V 5;  3D7S B;  5KYX A;  1Y71 A;  1KD1 C;  2RHY A;  1IB8 A;  2FHD A;  1ZSZ B;  3CCV T;  1VQO T;  5HY6 A;  2DIQ A;  2VYT A;  5CAI A;  4KRT A;  2K6D A;  1W6X A;  4M7D G;  2FVU A;  3H9N A;  4MZM A;  4PJN A;  1VQP T;  2K2M A;  1UEB A;  3A8O B;  1NYF A;  5FU7 B;  4P5N A;  2MMP A;  2RJC A;  2CP6 A;  3OYI A;  2QTV A;  1YJN Q;  1YBY A;  1QKX A;  2FPD A;  2X35 A;  1QKW A;  2LDM A;  3A8G B;  1W70 A;  2EYW A;  4HVU A;  3JCM Q;  2FO0 A;  3M55 A;  2LVM A;  3FC3 A;  1UHF A;  3A8M B;  3OYB A;  2BZ8 A;  4M7D D;  4OMO A;  2RJD A;  4LNP A;  4DBF A;  4F04 B;  2K5F A;  4M78 G;  2AHJ B;  1M30 A;  4N0A A;  1FX7 A;  3CD6 A;  3CCR Q;  1X69 A;  1M90 R;  1SRL A;  1ZQ1 A;  4RUG A;  3CMA A;  2YUP A;  1VQK Q;  2BE9 B;  1M2O A;  4N4H A;  2DL3 A;  4B9X A;  1WZO A;  3JB9 F;  1D0Y A;  2MYS A;  5C0M A;  4IKF A;  5EG2 A;  3V8K A;  1FWZ A;  2RJE A;  4PJO C;  4A63 B;  1K8A C;  4M7D A;  2BIV A;  2CS7 A;  7AT1 B;  4M78 D;  2P0P A;  4ZGJ B;  3INZ A;  3V7R A;  1TWB A;  5LJ3 d;  3I5S A;  2FZG B;  1K8A R;  2OTL A;  4J9F A;  3RBB B;  2EVR A;  2AZV A;  1QVG S;  2EIF A;  4ZGE B;  5GAO l;  1VQ5 A;  5GJW B;  1VQN Q;  3EGX B;  1UGQ B;  5CK9 A;  1YIT Q;  2MF2 A;  1K1Z A;  1U3O A;  2QA4 A;  1AOJ A;  3HRU A;  4HVW A;  2VAS A;  3E1S A;  1ZLM A;  2V8I A;  4M78 A;  3ZL7 C;  3CBM A;  2NUP A;  4RTZ A;  3CCQ A;  2I0N A;  2VC8 A;  3GPL A;  1N27 A;  5KYU B;  2QQS A;  2C0I A;  3VYH B;  3EFR A;  4QQ6 A;  1PRL C;  2QQR A;  1GCQ A;  4JUV A;  3MO8 A;  2LMJ A;  2RN8 A;  3HFN A;  5I2M A;  2EPD A;  3EFS A;  4LD6 A;  3JAM E;  1UGV A;  1NBE B;  5CR2 A;  2HKQ B;  2VWF A;  2JMC A;  4OGE A;  2MAM A;  2NYS A;  2RH2 A;  4Y28 E;  4ANJ A;  1ZHI A;  1JBM A;  2D6F A;  2O4X A;  2YWW A;  3CCE Q;  2PVD B;  3ZBD A;  1XQH A;  2DZ9 A;  2JJ9 A;  1YI2 Q;  4QVD A;  1OUL A;  3OYN A;  1YIJ T;  5GAN e;  3I56 A;  2DLP A;  3GNG A;  3C4S A;  3PMT A;  4O5V A;  1GBQ A;  4OGC A;  4A4K A;  2F2V A;  2I2L A;  2HCK A;  2VXF A;  4O6J A;  5HKC A;  4E7H A;  2M16 A;  2J06 A;  1HXD A;  4BI3 A;  2EJ9 A;  2ROL A;  2J6K A;  2VGM A;  2VGN A;  5KYW A;  3L2R A;  2LQK A;  3EG3 A;  4BI4 A;  2DAQ A;  1QMC A;  4PJO E;  1D3B B;  1JJ2 A;  2ROT A;  4EMK A;  2QDY B;  4E6R A;  1D0Z A;  3CCM Q;  4OMP A;  2XDP A;  1Q82 U;  3RMS A;  5D6Y A;  2ZZD A;  1MV0 B;  4CI0 C;  2L89 A;  3RR6 A;  4C8Q E;  3QYG B;  5I2S A;  3E19 A;  2P4R A;  3C0C A;  4J83 A;  4X34 A;  3L2Q A;  1UJ0 A;  3CC4 T;  1F1B B;  4FIB A;  1C6V X;  2CP2 A;  1UGS B;  3OSS C;  3EG2 A;  4M75 C;  1R8O B;  2QK0 A;  4M7A C;  2VV5 A;  4MMK A;  4PK4 A;  1KQS A;  1I5L A;  5CKE A;  1N9R A;  3VS3 A;  3OYL A;  4WTO B;  1YJ9 Q;  4XK8 E;  2MI6 A;  2DVJ A;  1T0J A;  2X3X D;  5ECA A;  4N4G A;  1NZ9 A;  2QQ9 A;  1JB0 E;  1TU0 B;  2CUD A;  4DOV A;  4M77 C;  4E7Z A;  1BKB A;  2MPX C;  3GF5 A;  1MV3 A;  1Q86 U;  3CCR A;  3UA6 A;  3JSC A;  1VQK A;  4AFS C;  1VQ7 Q;  1LOJ A;  3VS6 A;  2EWN A;  2X9H A;  3X20 B;  2CZ6 B;  2E65 A;  3AHU A;  3X25 B;  2KRO A;  4FSX A;  2DJZ A;  4AFZ C;  3JCM J;  2CP7 A;  1C0M A;  2E5Q A;  2RI3 A;  2EYZ A;  2P0K A;  3OY9 A;  2JUF A;  3G4S T;  3EFO A;  1I81 A;  3N5B B;  4C8Q G;  2QQA A;  2DO3 A;  4BY6 C;  1YWO A;  2WSE E;  1LCK A;  2F2W A;  4FW2 A;  4MML A;  4K11 A;  2RQU A;  1FXX A;  1YNZ A;  3CPW A;  3NTK A;  5FW9 A;  1YCY A;  2PQW A;  2QAS A;  3OQ5 A;  1VQ9 Q;  1ABQ A;  1O75 A;  2RA2 A;  3QG1 A;  1K76 A;  1BCO A;  4A4F A;  3OSV A;  2F1L A;  1YIT A;  4C8Q D;  2GBQ A;  2ATC B;  4BDZ A;  2MCN A;  1IO6 A;  4Z02 A;  5GAN h;  1YCS B;  1BU1 A;  2EGC A;  5L8R E;  3RUX A;  1NLP C;  1M27 C;  3QJY A;  4NL3 A;  4Z8A A;  2X51 A;  1WXU A;  5IHN A;  2DYB A;  1X2Q A;  4ZNX A;  1GRI A;  3EH2 A;  4AMC A;  3CCL A;  2RK1 A;  1VQ8 A;  2QQB A;  4M75 E;  3CD6 T;  2DD5 A;  4M75 B;  2KVQ G;  4M7A E;  5IAY A;  2K5I A;  3CMA T;  4M7A B;  2KE9 A;  3EGD B;  1NJI C;  3CC2 Q;  4PKC C;  1T0H A;  3SB2 A;  2DXB A;  4QQG A;  1M4Z A;  1Q82 C;  2B8A A;  1PCX A;  4L59 A;  3CCE A;  3UAT A;  2DTO A;  4KH1 B;  4M77 E;  4JDS A;  2HSP A;  3A5Z B;  1UTI A;  3PVQ A;  4R56 A;  2RQR A;  4RTW A;  4PJO F;  1PRM C;  1UFF A;  2ZCF B;  2DBM A;  2LCC A;  2OTL T;  5J3B A;  1SRM A;  2EQK A;  2LZ6 B;  3QPH A;  3OW2 S;  2KRM A;  1SEM A;  3L2V A;  1WJS A;  1M9S A;  1WLP B;  1RAC B;  1VQ5 T;  3X28 B;  1RUW A;  2CP0 A;  2EKO A;  1M1K U;  2QA4 T;  2AIR B;  3M0T A;  4MZT A;  4DEY A;  1Q86 C;  2QDL A;  1OX8 A;  1Y57 A;  1BK2 A;  2JT4 A;  1KFZ A;  2XKO C;  4OVA A;  4D8D A;  2AT1 B;  2E12 A;  5FWB A;  4M7D C;  3CCQ T;  3VS2 A;  3FIF A;  2AZS A;  1X27 A;  3JCM d;  5LJ5 j;  1U8R A;  4C5I A;  1PSF A;  1WX6 A;  5GAN d;  2GQV A;  3S3M A;  2R57 A;  4F7U E;  2E6N A;  1KD1 U;  3F70 A;  1VQ4 A;  1N8R U;  1NM7 A;  3HPW A;  2DXT A;  4LN2 A;  1VQL Q;  2V8K A;  3EG9 A;  5LJ5 e;  4JJC A;  2X3W D;  3OS2 A;  4M78 C;  1JJ2 P;  4BI8 B;  2NUT B;  3JCM W;  1OZ2 A;  3I56 T;  2DIG A;  3C95 A;  1PNJ A;  1VYV A;  3BE3 A;  3VU3 C;  2XID A;  2KRN A;  1M1G A;  3JCM V;  4WF2 A;  1YJW Q;  2COW A;  1WA7 A;  2MWP A;  3DB4 A;  2EGA A;  2CZ7 B;  4C92 A;  2PVO B;  2WAC A;  2RPN A;  3EG1 A;  1EIF A;  4C0D C;  2HAX A;  5GAO m;  1VQ6 Q;  3JCM g;  4YTL A;  1Q7Y U;  5GAN 5;  5A0L A;  5GAN g;  2ZPB B;  2HDA A;  4DBH A;  3G71 Q;  2EW3 A;  3RIR A;  4R0K A;  3OYH A;  3JCM P;  3GP8 A;  4DA4 A;  2BZY A;  1WYX A;  2HEQ A;  3QUI A;  2M9U A;  3JV3 A;  1IZ6 A;  2LCS A;  2HQX A;  3BY7 A;  4D6W A;  5LJ5 f;  1W4S A;  4FL6 A;  1QWE A;  1GFD A;  3L2U A;  2QG9 B;  4M75 F;  1H64 1;  2CZ1 B;  2L0A A;  4EMK C;  4M7A F;  1MMN A;  2RNA A;  3ASK A;  2JTM A;  4EMH A;  4M7D E;  2QYZ A;  4XQ3 A;  2KGT A;  2M1H A;  4X9C A;  3PTA A;  1RAE B;  3VS7 A;  4RTY A;  2AKK A;  2BZX A;  4PJM A;  2GQI A;  3OA6 A;  2YLC A;  3CCJ Q;  1RAH B;  1AWO A;  1G3T A;  2EBP A;  4LDV A;  3LW5 E;  4M77 F;  1G83 A;  1KQ2 A;  1ZSG A;  2DXU A;  4XTV A;  1VQK T;  3OB9 A;  3HHT B;  1MNE A;  5FRN A;  4ORZ A;  2W0Z A;  3CCU A;  2BE7 D;  4A53 A;  2G6F X;  5GAN 8;  1SPK A;  3VS5 A;  2BKD N;  2QGG A;  1M1K R;  1IRX A;  2JTE A;  2ZPI B;  4CC2 A;  3EGU A;  4M78 E;  1VUB A;  3M4G A;  4XTX A;  2JS2 A;  1TTH B;  1ZA1 B;  1WPY A;  1RAF B;  4M78 B;  4EMG A;  1BI0 A;  2W10 A;  3WXM B;  4OB3 B;  1P92 A;  3SWN C;  2D0Q B;  2CDT A;  2DFU A;  2JM9 A;  1N8R C;  3CC7 T;  1GXI E;  1WJR A;  5AT1 B;  4FSS A;  2ZAE A;  4QQD A;  5L23 A;  1KD1 R;  1IRE B;  1WHK A;  2KT1 A;  5LJ5 h;  1LVK A;  1TH7 A;  4C0D B;  2YUO A;  1WIE A;  2Y90 A;  2Y4X A;  5IHI A;  3GOX A;  2L3S A;  2WSF E;  2E3H A;  4QVZ A;  4HCC A;  1VQM Q;  1H92 A;  1KJW A;  1U06 A;  4F7U F;  3OYK A;  2EQM A;  1MMG A;  3I55 T;  1NEG A;  3CPF A;  2MWO A;  1Q81 C;  5GAO p;  1HJD A;  4JS4 A;  1QVF S;  4XU3 A;  2LRQ A;  3CCL T;  1QCF A;  3V7C A;  1Z9Q A;  1VQ8 T;  1Y96 A;  3TU4 K;  2DET A;  2ESW A;  3VUB A;  4LDU A;  4C5G A;  2AKL A;  3RKW A;  1VQL A;  1Q7Y C;  1T3L A;  4CRI A;  1AWW A;  4LE9 A;  4AG2 C;  4ESR A;  2GNC A;  1QLY A;  3CCE T;  4JRP A;  3QYH B;  2DYI A;  5A0D A;  2DVE A;  2FRY A;  1WDX A;  1I4K 1;  4QW2 A;  3U23 A;  5KYN A;  4BB7 A;  4FM4 B;  2ZPF B;  3H0I A;  5CVI A;  3HKS A;  3P8B B;  3NHN A;  1PD0 A;  2LQN A;  4XTZ A;  3JB9 J;  2RQV A;  1XNI A;  3QXE B;  4JJB A;  1S72 Q;  2KBT A;  2V1Q A;  4C8Q C;  4E7I A;  3WVE B;  1VQ6 A;  1H3Z A;  3C94 A;  3CME Q;  2FB7 A;  2RI2 A;  4NS5 A;  2CGH A;  1OU9 A;  3G71 A;  1WQ7 A;  2QEX A;  4XTU A;  2JMA A;  3PGG A;  2YRC A;  5IN1 A;  1G5V A;  3SWN B;  2QXF A;  4CC7 A;  3MEU A;  1OX9 A;  2FRW A;  3M4Y A;  2CRE A;  1KC8 C;  1U1S A;  1AVZ C;  2DL8 A;  4M7D F;  4J9D A;  2LP5 A;  2FPF A;  2OTJ T;  2GCX A;  1U5S A;  3RDV A;  1D1B A;  3KUF A;  1PD1 A;  3DLL A;  3M53 A;  2RB6 A;  1VQ4 T;  2LQW A;  3RKY A;  2LT1 A;  3UF4 A;  1G3S A;  1W2B A;  3A98 A;  1G3W A;  1ZUY A;  1R0B G;  2COZ A;  3FLG A;  2DM1 A;  3NTI A;  3CCJ A;  2PVG B;  3PFS A;  2HL5 C;  3FB9 A;  2CYZ B;  3NTH A;  5KCO A;  2E4H A;  3J7A F;  1Y07 A;  2FPE A;  3X24 B;  4M78 F;  5D6X A;  3ME9 A;  3JB9 I;  2YHT A;  1ZSZ A;  3MEV A;  3CCS Q;  2CH4 A;  5GAM j;  1Z9Z A;  2V26 A;  2ED0 A;  2PUK B;  2A0F B;  4J6X A;  4ELY C;  5I22 A;  3UA7 A;  5KE2 A;  3H8Z A;  1UB4 A;  2JTF A;  2KXD A;  2QAZ A;  1K4U S;  1HK9 A;  3M56 A;  4V2S A;  2CSQ A;  3EHR A;  1PKT A;  2HD0 A;  5GAM e;  4KGV B;  4LDX A;  5GAO q;  1NJI U;  3ULR B;  4EDU A;  4PJO B;  3OYA A;  2KYB A;  1V29 B;  2LNV A;  5FU6 C;  4E7J A;  4PLI A;  2E41 A;  3OMC A;  3ZFJ A;  4OF1 A;  3CXC A;  1QP3 A;  2E6Z A;  4ZTF A;  4BE1 A;  2DTH A;  3MHX A;  4C8Q B;  4XU0 A;  4Y91 A;  3M0S A;  1YHQ T;  3R6O A;  1NG2 A;  2E5K A;  5FRM A;  2OAW A;  2LX9 A;  1VQM A;  1CKA A;  2K79 A;  1YJN A;  4JS5 A;  4KUD K;  2NLU A;  2EGE A;  3G7Z A;  3J80 E;  1OV3 A;  4E47 A;  4Z89 A;  3QSU A;  1K9M C;  1QCN A;  1GCP A;  1M8M A;  1TXQ A;  4QKU A;  3J81 E;  1QP2 A;  3PMI A;  2ED1 A;  3JRZ A;  1RLP C;  3OYJ A;  4PLL A;  1UJY A;  2DEU A;  4J8O A;  4Q5W A;  1ABO A;  2DJQ A;  4XAX B;  4HCK A;  3I9Q A;  5GAM f;  4XTY A;  3CCU T;  2DBK A;  4UC4 A;  3EGX A;  4XU1 A;  3VRY A;  5CQY A;  4NL2 A;  1IXD A;  3OMG A;  1TSF A;  3O5Z A;  4OMN A;  1M2V B;  3PIO A;  3QDR B;  1Y0M A;  4BUG A;  2PUO B;  2XI9 A;  5KYY B;  1S72 A;  2L3Q A;  3E2U A;  3QDF A;  5KYU A;  1CKB A;  1PKS A;  4RCB A;  3CME A;  3VS4 A;  5DLO A;  2V8J A;  4GY5 A;  2CT4 A;  2YSQ A;  3PIP A;  1VA7 A;  2YLB A;  2JW4 A;  3URG A;  3LWI A;  1VQN A;  2D1X A;  2A08 A;  2CP3 A;  1N5Z A;  4LUE A;  4NOY A;  1MHN A;  2K3B A;  1EX4 A;  3LWH A;  3FDR A;  5FU6 B;  2SEM A;  1T3S A;  3UWN A;  3RMQ A;  1OEB A;  4A4E A;  3M54 A;  1SSH A;  2LJ0 A;  4E7K A;  3RNJ A;  2DPP B;  4ME7 A;  4JZ4 A;  1BI1 A;  3CC4 Q;  1QVP A;  4C92 E;  1B34 B;  5IXB A;  1SHF A;  5AYF A;  4KBM B;  5GAM h;  1VQL T;  1WGS A;  1ZBX A;  1UE9 A;  2O9S A;  2GFA A;  5GAN 6;  5C6S A;  3S3N A;  2DL4 A;  4A4H A;  4OMF B;  1D3B A;  2GTJ A;  2GF7 A;  3E9G A;  5FRO A;  1NJI R;  1JJ2 S;  1E7O A;  2FZC B;  2X4W A;  3CCS A;  1YI2 A;  2K5L A;  2ABL A;  3JCM X;  2RF0 A;  1Q82 R;  2L2P A;  4M77 B;  1K0S A;  3M58 A;  4J9E A;  2L3R A;  1O9S A;  4IUQ A;  1GFC A;  4FW1 A;  1U1T A;  2LX7 A;  4JZ3 A;  1X43 A;  3E9F A;  4J6W A;  1PHT A;  2LCL A;  2KK4 A;  1ZA2 B;  2KT8 A;  4N0A C;  3G6E Q;  1VQ6 T;  1MMA A;  2CH4 W;  4C8Q F;  2FG0 A;  3FRN A;  2COY A;  1RAA B;  1OPL A;  4FU6 A;  3CCM A;  5IT9 E;  2X4J A;  3G4S Q;  4B9W A;  2JVV A;  4KUL A;  2QEX T;  4VUB A;  5CKD A;  1KQS S;  4BY6 B;  1W2B P;  3IQL A;  5GAO r;  4DBR A;  4BE2 A;  4KH0 B;  4X1V A;  4C92 G;  3OYF A;  1HYO A;  3DLM A;  2JZ2 A;  3PT9 A;  1H3H A;  5LJ3 j;  2RHZ A;  1Q86 R;  1PWT A;  1X6O A;  1B3Q A;  2QGF B;  4B6M A;  4BE0 A;  2C06 A;  2XK0 A;  1D09 B;  2FL7 A;  3H41 A;  4PFZ A;  1BCM A;  2KY9 A;  1UEC A;  3VUZ A;  4F7U B;  1YJ9 A;  2GFU A;  3CCJ T;  1V76 A;  5LJ3 e;  4C92 D;  1FYN A;  5CKB A;  1XOV A;  3HL8 A;  3MPU B;  4RCC A;  2SRC A;  2XIC A;  2EYY A;  2KRS A;  3REA B;  5KYX B;  1RAI B;  1TUD A;  4LXC A;  1VQ7 A;  2WSC E;  4E7S A;  4J7F A;  1JO8 A;  4LD9 K;  1SF9 A;  1Q81 U;  3CXC P;  1GCQ C;  3CPW S;  1SG5 A;  2K3Y A;  3LH5 A;  2G3R A;  3CMA Q;  1WHM A;  4J5Y A;  3JCM c;  2RMO A;  1NLO C;  2ZPH B;  1JXO A;  2KYM A;  3MCA B; 
#chains in the Genus database with same CATH homology
 1V1C A;  3PVL A;  2F2V A;  4GBQ A;  2HCK A;  3H0F A;  2BTT A;  1QCF A;  2J06 A;  1Z9Q A;  4Y92 A;  2ROL A;  2J6K A;  2A37 A;  2ESW A;  3EG3 A;  2J7I A;  2AKL A;  4M4Z A;  2ROT A;  1T3L A;  1M3C A;  4E6R A;  3R6N A;  1AWX A;  1AWW A;  4OMP A;  4LE9 A;  4AG2 C;  4ESR A;  2FEI A;  3QWY A;  2GNC A;  1QLY A;  2EKH A;  1MV0 B;  2FRY A;  2P4R A;  3C0C A;  1WDX A;  2JS0 A;  1UJ0 A;  1YP5 A;  3U23 A;  1UDL A;  1HD3 A;  1ARK A;  3H0I A;  2IIM A;  2DX1 A;  4JJD A;  3EG2 A;  5IH2 A;  3NHN A;  2DA9 A;  2LQN A;  1X6G A;  1JQQ A;  2RQV A;  4JJB A;  2KBT A;  2V1Q A;  4OML A;  3NPF A;  3VRZ A;  3VS3 A;  2VVK A;  2CUB A;  2DVJ A;  1T0J A;  2DRM A;  2X3X D;  2K9G A;  5ECA A;  2C0O A;  2CUD A;  4J9C A;  1GBR A;  1MV3 A;  2JMA A;  1NYG A;  1M3A A;  4CC7 A;  3UA6 A;  2DNU A;  2FRW A;  1RI9 A;  4AFS C;  2CRE A;  3VS6 A;  1AVZ C;  2DL8 A;  4J9D A;  2KRO A;  2LP5 A;  2FPF A;  4AFZ C;  4D8K A;  1K9A A;  1U5S A;  3SHW A;  1OOT A;  2EYZ A;  1FMK A;  2DL5 A;  2J6F A;  2YT6 A;  1UG1 A;  2D8H A;  1A0N B;  2LQW A;  2GGR A;  3UF4 A;  1BB9 A;  1JXO A;  1X6B A;  1UUE A;  1YWO A;  3A98 A;  1ZUY A;  1RLQ C;  1LCK A;  2DM1 A;  2ECZ A;  2F2W A;  1AEY A;  2YDL A;  4K11 A;  2F2X A;  1B07 A;  2O31 A;  2RQU A;  1YNZ A;  4J9G A;  5FW9 A;  1VYU A;  5EC7 A;  2FPE A;  1WFW A;  4RTU A;  1ABQ A;  2EYX A;  1K0X A;  1K76 A;  2CH4 A;  4EIK A;  2CT3 A;  1Z9Z A;  2ED0 A;  1E6G A;  2GBQ A;  1E6H A;  2MCN A;  1AZE A;  1IO6 A;  5I22 A;  3UA7 A;  2KXD A;  2YUQ A;  1K4U S;  2NWM A;  2KEA A;  3VS1 A;  3NMZ C;  3THK A;  1CSK A;  1YCS B;  1BU1 A;  2EGC A;  2CSQ A;  3EHR A;  1NLP C;  1JXM A;  1M27 C;  4F16 A;  4Z8A A;  1J3T A;  1WXU A;  5IHN A;  1PKT A;  1S1N A;  2DYB A;  1X2Q A;  4ZNX A;  1GRI A;  3M0P A;  3ULR B;  2KYB A;  3M0Q A;  3KFV A;  4OMM A;  2A36 A;  1ZBJ A;  2NUZ A;  2D0N A;  4J9B A;  2KE9 A;  1T0H A;  3M0S A;  2M51 A;  2PZ1 A;  2JXB A;  3NGP A;  2A28 A;  1NG2 A;  4AG1 C;  2E5K A;  1ZUK A;  2GTO A;  2JM8 A;  2OAW A;  3EG0 A;  1CKA A;  3UAT A;  2K79 A;  2HSP A;  4RTT A;  2J6O A;  1UTI A;  1HSQ A;  4CC3 A;  2MIO A;  3PVQ A;  1AWJ A;  2EGE A;  2RQR A;  1OV3 A;  4RTW A;  1NEB A;  1OPK A;  4Z89 A;  3FJ5 A;  1PRM C;  2VKN A;  1GCP A;  1M8M A;  1UFF A;  3PE0 A;  2DE0 X;  2DBM A;  3I5R A;  1SRM A;  2DIL A;  2ED1 A;  2LZ6 B;  2KRM A;  1SEM A;  2C0T A;  1RLP C;  1WLP B;  2XMF A;  3GBQ A;  2PTK A;  1WXB A;  1UJY A;  4AFQ C;  2J05 A;  1I0C A;  1ABO A;  2DJQ A;  1RUW A;  4HCK A;  3I9Q A;  4OMQ A;  2V1R A;  2KR3 A;  1I07 A;  2DBK A;  3REB B;  1TUC A;  1M3B A;  3M0T A;  4DEY A;  2RQT A;  2QDL A;  1Y57 A;  1BK2 A;  2JT4 A;  2AK5 A;  4IIM A;  1KFZ A;  4D8D A;  3VRY A;  5FWB A;  1MUZ A;  2D8J A;  1AD5 A;  5IHK A;  1X2K A;  3VS2 A;  3I35 A;  3CQT A;  2AZS A;  1GL5 A;  3O5Z A;  1BBZ A;  4OMN A;  1JU5 C;  1X27 A;  1Y0M A;  3TSZ A;  2O2O A;  3VS0 A;  5IXF A;  1WX6 A;  4LUD A;  2L3Q A;  2LJ1 A;  3QWX X;  4HVV A;  1CKB A;  1PKS A;  4IIO A;  1W1F A;  4GLM A;  2H8H A;  3VS4 A;  1NM7 A;  2CT4 A;  2B86 A;  2YSQ A;  4LN2 A;  1VA7 A;  2JW4 A;  1AZG B;  2MOX A;  3EHQ A;  2D1X A;  2K7A A;  2A08 A;  4F14 A;  4JJC A;  2X3W D;  2EQI A;  1N5Z A;  4LUE A;  2OJ2 A;  4KRT A;  2K3B A;  2K6D A;  1W6X A;  3TVT A;  2SEM A;  2K2M A;  1T3S A;  1PNJ A;  2CSI A;  1OEB A;  1NYF A;  1VYV A;  1SSH A;  2LJ0 A;  1YWP A;  1JEG A;  2KRN A;  3RNJ A;  4JZ4 A;  4WCI A;  1QKX A;  1WA7 A;  1H8K A;  2EGA A;  2FPD A;  2DMO A;  1I1J A;  2KXC A;  1QKW A;  5IXB A;  1W70 A;  2EYW A;  2RPN A;  1SHF A;  3EG1 A;  4HVU A;  4HXJ A;  2DL7 A;  3M0U A;  2FO0 A;  1UE9 A;  2O9S A;  1WI7 A;  1UHF A;  1EFN A;  2O9V A;  2BZ8 A;  1KIK A;  2DL4 A;  4OMO A;  2HDA A;  3H0H A;  3M0R A;  2EW3 A;  5HCK A;  4R0K A;  4AFU C;  4LNP A;  2PNI A;  2GTJ A;  1M30 A;  2BZY A;  1WYX A;  2HEQ A;  3JV3 A;  2DF6 A;  1X69 A;  1E7O A;  1SRL A;  4RUG A;  2YUP A;  2ABL A;  2RF0 A;  2L2P A;  1K0S A;  4J9E A;  2LCS A;  4RTV A;  1GFC A;  2DL3 A;  3SEM A;  2LX7 A;  4JZ3 A;  1X43 A;  1QWE A;  1GFD A;  1PHT A;  1ZX6 A;  2KT8 A;  2HBW A;  4DEX A;  2L0A A;  2RNA A;  2LJ3 A;  4A63 B;  2CH4 W;  2M0Y A;  2FG0 A;  2KGT A;  3VS7 A;  4RTY A;  2AKK A;  2BZX A;  2GQI A;  1OPL A;  3I5S A;  1AWO A;  2EBP A;  4J9F A;  3RBB B;  2EVR A;  2AZV A;  3IQL A;  1G83 A;  1ZSG A;  1ZUU A;  4X1V A;  2O88 A;  4JPB W;  5GJV B;  5GJW B;  4CC4 B;  4J9H A;  4QT7 A;  1H3H A;  4ORZ A;  1K1Z A;  1TG0 A;  1U3O A;  1PWT A;  2G6F X;  1QWF A;  1AOJ A;  1B3Q A;  1SPK A;  3VS5 A;  4HVW A;  3H41 A;  1ZLM A;  1UHC A;  2JTE A;  4CC2 A;  3EGU A;  3ZL7 C;  2LNH B;  4F17 A;  4RTX A;  1UEC A;  2JS2 A;  4RTZ A;  2I0N A;  2YUN A;  2C0I A;  2W10 A;  5FWC A;  1PRL C;  1GCQ A;  2LMJ A;  2RN8 A;  1YN8 A;  2CDT A;  1FYN A;  1XOV A;  2EPD A;  2L3P A;  2SRC A;  2EYY A;  2KRS A;  1UGV A;  3TSW A;  2JM9 A;  4Z88 A;  2RQW A;  3REA B;  5I11 A;  1TUD A;  4J9I A;  2VWF A;  2DRK A;  4FSS A;  2JMC A;  5L23 A;  2KT1 A;  1VYT A;  1WXT A;  1JO8 A;  2KNB B;  2YUO A;  2OI3 A;  1WIE A;  1GCQ C;  1G2B A;  5IHI A;  2L3S A;  1SHG A;  3LH5 A;  1H92 A;  1KJW A;  1U06 A;  2ENM A;  1NEG A;  2DLP A;  2RMO A;  1KSW A;  1NLO C;  2W0Z A;  1HJD A;  1GBQ A;  2KYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...