2AK5A

Beta pix-sh3 complexed with a cbl-b peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
NSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 7
publication title Cbl promotes clustering of endocytic adaptor proteins.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ak5A00
3UATA 2ESWA 5GJWB 2IIMA 3H41A 2VKNA 2DA9A 2DL4A 1M3BA 2HSPA 1FYNA 2RN8A 3NHNA 4RTXA 4CC3A 3I5SA 4M4ZA 2SEMA 3VRYA 2F2VA 2DL3A 3VS3A 1U06A 1ZUYA 3VS0A 2A08A 1T0HA 3EGUA 2RQWA 2FO0A 1WFWA 2KROA 1ABQA 2J05A 4DEXA 1WA7A 1AWXA 1WYXA 1GFCA 2EGAA 2DRKA 1K76A 3UF4A 1NM7A 1TG0A 3M0PA 5I11A 2NUZA 1OV3A 1M27C 2DX1A 1PRMC 1Z9QA 1QKWA 1GBQA 1NYGA 4R0KA 1QWEA 2RQRA 2KT8A 2K3BA 2KEAA 2LJ0A 2VVKA 4J9CA 1X69A 2P4RA 2YT6A 1J3TA 3VS7A 3JV3A 1UFFA 1Y57A 2F2XA 3EHRA 2J6KA 4LUDA 4AG2C 2J6OA 1RI9A 3M0QA 1N5ZA 2V1QA 4JPBW 2A37A 2EGEA 2GQIA 1AWWA 1M3CA 1M3AA 1I0CA 4HVWA 1ARKA 2AZVA 3QWXX 2GNCA 2KE9A 3FJ5A 1GCQA 3EG1A 3THKA 2YDLA 2BZ8A 1S1NA 2FPEA 1OPLA 2EKHA 2HBWA 2BTTA 4LUEA 1ZSGA 2HDAA 2W10A 1MV3A 4JZ4A 1K0XA 2CH4W 2O9VA 1AWOA 5I22A 1WLPB 2C0IA 4JJCA 2K2MA 1QWFA 2CT3A 1MV0B 5FWBA 3VS6A 1UJYA 3R6NA 2C0OA 4RTYA 3KFVA 1GFDA 2YUNA 4AG1C 1AWJA 1UJ0A 2K6DA 3REAB 1WI7A 2DE0X 1U5SA 2LP5A 3IQLA 1UECA 2OJ2A 1KIKA 2YUQA 5FW9A 1ZLMA 2KYMA 1TUCA 4X1VA 4JZ3A 1YCSB 1VYUA 1OPKA 4CC2A 1E6GA 2KRNA 2MIOA 2PZ1A 3VS1A 4J9EA 2LQNA 2DMOA 1SSHA 2O2OA 4J9FA 1VA7A 3UA6A 1SPKA 1X2QA 1T3SA 1X43A 1X6BA 2DJQA 4LNPA 2L3QA 3REBB 1B3QA 4EIKA 2O9SA 2JS2A 4F16A 4OMLA 4HVUA 1LCKA 5EC7A 4AFSC 1K9AA 1UE9A 2DYBA 2RPNA 4K11A 1M8MA 5FWCA 1X2KA 2G6FX 2K7AA 1YWOA 3H0HA 2DNUA 1AOJA 3I35A 2DL5A 3CQTA 3RNJA 2JT4A 2M0YA 3TSWA 2O88A 1KFZA 2FEIA 4RUGA 3U23A 2DLPA 2JM9A 4CC4B 2LMJA 1RLPC 4RTZA 2K79A 1K0SA 1AEYA 1WX6A 4Z89A 1WXTA 1BBZA 1G2BA 2JM8A 4OMPA 1K1ZA 1PNJA 3PE0A 2JS0A 3PVLA 2AK5A 1PWTA 1EFNA 5IHIA 1PKTA 2RMOA 1K4US 1UUEA 1KSWA 2EGCA 3NMZC 1T3LA 2KRMA 2L3PA 2FRYA 2QDLA 4AFZC 1PHTA 1VYVA 2CT4A 1U3OA 3ZL7C 3EHQA 4RTUA 2CDTA 2MOXA 5IXFA 3NPFA 2PTKA 2GBQA 2KR3A 1ABOA 1NLPC 2EPDA 2DRMA 4WCIA 4CC7A 2LNHB 3C0CA 1FMKA 1JU5C 1UGVA 1ZBJA 4HXJA 2DVJA 2LJ1A 1E6HA 1VYTA 2JMCA 1WXUA 2RQVA 2A36A 2KNBB 2LQWA 1YP5A 4F14A 2ABLA 2DL7A 4J9DA 1CKBA 2HCKA 1OOTA 2X3XD 2GTOA 2EW3A 1AZEA 2AKLA 4D8DA 3QWYA 1H3HA 1XOVA 2L3SA 4J9HA 2DL8A 2JXBA 3H0FA 2FPDA 2PNIA 5GJVB 1JXOA 4JJBA 4HVVA 4OMNA 2YSQA 1SHFA 3EG2A 1CSKA 4LE9A 1H8KA 2AZSA 2KYBA 4J9GA 1JEGA 2EBPA 2VWFA 2ED0A 2YUPA 5HCKA 2J06A 1A0NB 2KT1A 2JTEA 3A98A 4ESRA 1SRLA 4OMOA 1UG1A 5IH2A 1GCPA 1WIEA 1GBRA 2ECZA 3NGPA 2GTJA 1JQQA 4IIOA 1M30A 4J9BA 5IHNA 2CUDA 2LX7A 1NEBA 2E5KA 4Y92A 2D8HA 4JJDA 1I07A 1NYFA 2MCNA 2JW4A 2W0ZA 1UTIA 1GCQC 2EYZA 1ZX6A 4IIMA 1GRIA 2KXCA 1G83A 1W6XA 2KRSA 3VS5A 1HJDA 3GBQA 2LCSA 2OI3A 3PVQA 2K9GA 4GBQA 1E7OA 2X3WD 1PRLC 2DM1A 1HD3A 3VS4A 1UHCA 2CUBA 1AD5A 2H8HA 1SHGA 4KRTA 1W70A 1BB9A 4RTTA 3RBBB 3M0SA 2V1RA 1YN8A 4AFUC 1WXBA 1RUWA 1SRMA 1UDLA 1WDXA 3I9QA 2EVRA 1AZGB 3I5RA 1X6GA 1GL5A 2EQIA 2O31A 1ZUUA 1Y0MA 4RTWA 2SRCA 2C0TA 2EYXA 1UHFA 2CSQA 4A63B 1PKSA 2CSIA 3SHWA 2L0AA 1HSQA 3LH5A 2DF6A 2BZYA 1KJWA 2ED1A 2ROLA 1YNZA 4Z8AA 2XMFA 4OMQA 3VS2A 2ENMA 1AVZC 1BU1A 2FRWA 1CKAA 1T0JA 2RQUA 1QKXA 2L2PA 5IHKA 1SEMA 1MUZA 2DBMA 3TSZA 2JMAA 1RLQC 2DILA 1NG2A 5ECAA 3UA7A 4FSSA 2D1XA 2EYYA 4QT7A 2I0NA 3EG3A 2RQTA 2RF0A 1X27A 2ROTA 3M0TA 2KBTA 2F2WA 3VRZA 4ZNXA 2CREA 4Z88A 1JO8A 1QCFA 2RNAA 1H92A 4AFQC 1NLOC 2B86A 1JXMA 2J7IA 1YWPA 2HEQA 4LN2A 1Z9ZA 4F17A 5L23A 2BZXA 2FG0A 2KXDA 3TVTA 2LZ6B 3EG0A 1OEBA 4RTVA 2D0NA 4HCKA 1ZUKA 2DBKA 3ULRB 4J9IA 1B07A 4GLMA 1TUDA 3M0UA 2EYWA 2A28A 2FPFA 2J6FA 1QLYA 2M51A 4E6RA 4DEYA 2OAWA 1W1FA 4D8KA 1V1CA 3SEMA 4ORZA 2D8JA 1IO6A 2AKKA 3H0IA 1I1JA 2KGTA 3O5ZA 1BK2A 1NEGA 2YUOA 2GGRA 5IXBA 2CH4A 2NWMA 3M0RA 4OMMA 2LJ3A
chains in the Genus database with same CATH superfamily
3UATA 2IIMA 3H41A 2VKNA 4BE0A 1M3BA 2RN8A 3VRYA 1M2VB 3M53A 2DL3A 3VS3A 4P5NA 1VQ9A 2RQWA 1WFWA 2PVGB 3LW5E 4M7AB 1OULA 2J05A 3GIBA 1KQ1A 3HRUA 3OB9A 4QVCA 1K76A 1NM7A 1TG0A 2MAMA 3HFOA 4BB7A 4V2SA 3L2QA 3RKXA 1BIAA 2M02A 1Z9QA 1YJWA 3GNFB 5LL6S 4R0KA 1QWEA 3CC7T 2K3BA 4KULA 1X69A 2P4RA 2FZGB 3VS7A 3JV3A 1UFFA 2H3JA 2F2XA 3SWNB 3EHRA 4PFZA 1PSFA 3M0QA 2DTOA 2V1QA 3CCJA 3JCMc 2A37A 2EKOA 2RH2A 1AWWA 2AHJB 3GNGA 3GLXA 1B7TA 1AHJB 2RK1A 2IVWA 3C95A 3A8HB 2XICA 3EG1A 2OAUA 2YDLA 2BZ8A 1FX7A 2FPEA 1YI2Q 2K57A 1OPLA 5EG2A 1VQ4Q 2BTTA 2RI5A 1KC8R 4A53A 4JZ4A 2CH4W 3CCEA 3N5BB 1KQSP 2O4XB 5A2QE 3JCMJ 1WLPB 8AT1B 3JAME 2E5QA 1UJYA 4M78A 4BE1A 1QVGP 1N8RU 3DLLA 2JJ9A 4AG1C 1UJ0A 2K6DA 3L2RA 3REAB 3JCMP 3CC2Q 2H3EB 2XHCA 2LP5A 3IQLA 1KIKA 4M77A 1ZLMA 2KYMA 1TUCA 3OYKA 3V8LA 3KXTA 1YCSB 2A7YA 2B8AA 1Y96A 1XQHA 3JCMd 1SSHA 2LQ8A 2O2OA 1M90U 1VA7A 2K3XA 1VQ5Q 4OGCA 1T3SA 2BKDN 1X6BA 2DJQA 1G3WA 3L2UA 1B3QA 5GAN7 4C92A 1G3YA 1K9AA 3CPWS 3M56A 2NUPA 5FWCA 3BFMA 1X2KA 1YWOA 3RNJA 3TSWA 4RUGA 1IHVA 4M7DD 2LVMA 4CC4B 6AT1B 2K79A 4Z89A 1BBZA 1G2BA 5IN1A 3EG9B 4M7AC 1ZHIA 2JS0A 2AK5A 3S3MA 3CCSA 1EFNA 1D0XA 2RMOA 3J81E 1OZ3A 3CCUA 2FHDA 1KSWA 3QJYA 4HCBA 5LJ3f 4ZN3A 2KRMA 3OS0A 5IT9E 3AHUA 2QA4T 2LC4A 1PHTA 2CT4A 2E65A 1U3OA 2ZGWA 4PJOB 3ASKA 4OP0A 2CDTA 4DBHA 1IRXA 4KT0E 5KYUA 5IXFA 4ZTFA 2PTKA 4L5GA 2V26A 1ABOA 1NLPC 1M4ZA 2CP7A 3OS5A 4XU3A 4HCZA 4DBQA 1VIEA 3H6ZA 5GANd 3CCVA 1SF9A 1VQ8Q 1UGVA 1YCYA 4F04B 5GAOm 4HXJA 2DVJA 1E6HA 3BDUA 1WXUA 4E7JA 2BE9B 2JTFA 3VKIA 1VIFA 2DL7A 3JB9D 1CKBA 4X9CA 1LJOA 4FYYB 4M7AG 2GF7A 3HL8A 3M57A 3CCMT 1QVFS 3CCRQ 5KYXB 1H3HA 2NUTA 5KYYB 1YHQT 4BACA 2FYKA 2PNIA 5GJVB 4C8QA 4HVVA 2QQ9A 4C5IA 3OBWA 3SDZA 1Q82R 3EG2A 4ELZC 3SFMA 1H8KA 1WQWA 3A8LB 2EBPA 2VWFA 5GAN4 2IPOB 2QEXT 2JTEA 3CBMA 3ZBDA 4KGXB 5GANe 1SRLA 5IH2A 1WIEA 2RHXA 2JUFA 2E3HA 2ZCFB 4IIOA 4M7AE 1VQNQ 1YIJT 4XTYA 2M16A 5IAYA 2JW4A 2E6NA 2EYZA 4IIMA 3OMGA 4PJOF 3CC7Q 1G83A 2KRSA 2QGGA 1WPYA 3GBQA 4IKFA 1OU8A 1YI2A 2E70A 1VQ4A 3PVQA 2K9GA 1WJQA 1E7OA 2X3WD 2CP0A 1PRLC 4PJJA 3QZ9B 1R8OB 4F7UA 1HD3A 3VS4A 3TQ7P 2PVDB 4CRIA 3EH1A 4M78C 2XIDA 1AD5A 2YWWA 1G5VA 2GQVA 1TXQA 2FVUA 3NFCA 4HA8A 1VQ7T 5GAMe 3MEUA 3MP1A 1BI0A 4N0AC 4FYXB 2LQKA 3M0SA 2E64A 1YN8A 3MP6A 2QQSA 3C12A 3CC2A 1WHGA 5CVIA 1Q81U 1RL2A 1AZGB 1GL5A 4QQDA 5CKHA 4PLIA 1M5Q1 1Y0MA 3FRNA 4LDWA 2SRCA 2C0TA 4BD3A 1UHFA 4XTZA 3JCMV 1PKSA 1VQ5A 3EGXA 4O5VA 1RAEB 2RM4A 2ED1A 2ROLA 1Q7YC 1N8RR 3VS2A 4M78G 2VYTA 5KE3A 1D0ZA 4IUPA 3MEAA 2ENMA 1AVZC 4XTUA 3QSUA 4M7DB 4B9XA 1SG5A 3TSZA 4C5GA 5ECAA 1Q7YR 2EYYA 1ZA1B 3M59A 2HL5C 2I0NA 2RF0A 1X27A 2KBTA 4GY5A 4N4HA 2YLCA 3RMQA 3VRZA 3X25B 1N27A 2RNAA 2V8KA 1H92A 1TWBA 3SD4A 3ZEHA 2B86A 3I56T 3JSCA 1YWPA 4IUUA 2BZXA 2FG0A 1M1KC 4M78E 1N6AA 4FIBA 3HFNA 1WHKA 3OW2A 2DBKA 2XKOC 3ULRB 1JB0E 1PD1A 2DKGA 4PK4A 3JB9H 2FPFA 1M1KR 2A3LA 1H3ZA 4M77E 2OAWA 3QO3A 4RKUE 3A5ZB 3SEMA 2M1HA 2RHZA 5M9OA 1VQ8A 3NTHA 1X6OA 2QA4Q 2M9UA 2QG9B 3OYNA 1BK2A 1NEGA 3FIFA 1KD1C 2PQWA 3M0RA 4M75D 4OMMA 2ESWA 2E10A 2L3RA 3M58A 2DA9A 4RTXA 3CCRA 4M4ZA 4C8QC 4C92E 1RADB 1FWZA 4M7DF 1KD1R 4HCCA 2OTJT 1ZUYA 1F1BB 2FZCB 1N9RA 4DBFA 2KROA 1ABQA 3QIIA 5I2SA 4QVDA 5GMKj 3GP8A 1AWXA 1WYXA 2EGAA 2LNVA 2DRKA 2HAXA 5C6SA 3G6ET 1OV3A 3M54A 2Y4YA 2QQAA 3EAEA 2QQRA 2D6FA 8ATCB 1YHQQ 4FT2A 4L6V5 3M5AA 1VQMT 4LDUA 1YJ9A 2RQRA 1H641 2KEAA 4YTLA 1K8AC 2VVKA 5GAMj 2YT6A 3JCMX 3CC7A 2RI3A 1MNEA 2QEXQ 3BE3A 2COWA 2J6KA 1OZ2A 2DZCA 5LJ3e 4C8QG 1K8AR 1M3AA 2CS7A 4HVWA 1YIJQ 1ARKA 7AT1B 3VV0A 5LJ5e 1GCQA 2LTOA 3JB9F 1S1NA 1LOJA 2KI7A 3Q1JA 2EKHA 1ZSGA 2EQKA 5D6WA 4IUVA 2W10A 1MV3A 2O9VA 2LCCA 4XU2A 2DK3A 3CPFA 4JJCA 1QWFA 2CT3A 4KH0B 4D6WA 1JBMA 3R6NA 1M2VA 2C0OA 5CKFA 1GFDA 1RAGB 2JZ2A 1N9SA 2YUNA 4C8QE 3VYGA 1AWJA 3EFSA 1WI7A 1VQ7Q 4GLKA 4M7AA 4LXCA 5DLOA 4JRPA 2X51A 2EQJA 2ZPIB 2V8IA 1MNDA 2YUQA 2CZ6B 2VXFA 1BI2A 4F7UG 4EMGA 1VQLQ 4X1VA 2XDDA 1OPKA 2LT1A 2FB7A 3OYGA 2KRNA 1ZBXA 1LPLA 2LQNA 3CEYA 4EDUA 1MMDA 1X43A 1Q81R 5J3BA 3E2UA 3SWNA 4ME7A 3CXCS 4JRQA 4MZTA 2O9SA 4X9DA 4OMLA 2CZ7B 1ZSZB 4HVUA 1LCKA 1QCOA 4AFSC 2DYBA 3RERA 2K7AA 3I35A 4F7UE 2OTLT 4ZTJA 1KFZA 2DL5A 1JRIA 3CQTA 4WF2A 3FB9A 5J26A 4XK8E 1QQJA 1K0SA 1VQNT 3QXEB 1AEYA 1WX6A 4E7KA 1WXTA 1VUBA 5DM7R 4OF1A 4BUGA 3S3OA 1PNJA 3HTRA 3PVLA 2DXCA 3UT1A 1PWTA 5IHIA 2O4XA 4FT4A 1K4US 1UUEA 2JOYA 2CGHA 2XI9A 1R0CB 3JCMg 2KK4A 3A1PA 2QDLA 4AFZC 3I56Q 2XK0A 4PFPA 4LDYA 2D9TA 4C0GA 3L1AA 1UGPB 2BUDA 3EHQA 4ATOA 4RTUA 2Y90A 1YFNA 2QA4A 2MOXA 3VUZA 1UB4A 4KUIA 1HK9A 5GMKm 3QYGB 3BY7A 4WCIA 4CC7A 1B34A 2QK0A 3PIPA 1D1AA 3C0CA 4QW2A 4BY6C 4XAXB 1G3TA 1PM3A 2LJ1A 2IG0A 5I21A 5KH6A 1VYTA 2JMCA 3EH2A 2RQVA 3RR6A 3MEWA 4NL2A 2E3IA 3EFOB 1VQPT 4J9DA 4LDXA 2HCKA 3M9QA 1OOTA 3G4ST 2MI6A 2EW3A 1XTDA 3HKSA 1AZEA 2AKLA 2QI2A 4E7LA 4A4KA 1XNIA 1XOVA 5GAN5 4E7ZA 1Y07A 1RAAB 2JXBA 3H0FA 3J7AF 4QVZA 1JXOA 5LJ3j 1Y7XA 1C0MA 3CCMA 2RB6A 4N0AA 1HYOA 2MK5A 3RIRA 1YHQA 2AZSA 1QVFA 1JEGA 3LX7A 4PJMA 2OTJQ 2J06A 1V76A 5LJ5j 1Q7YU 2KT1A 5GAOp 1B34B 3M4YA 5FRMA 2DXUA 3EG9A 3ZFJA 3QYHB 3JB9I 2QEXA 2ECZA 5GANg 3MJXA 4E7HA 5GMKl 1I4K1 2DEUA 2DJZA 5GAOr 3G6EQ 1QMCA 2LX7A 4Y92A 3BDLA 2P0KA 1QW1A 1NYFA 4NS5A 2MCNA 1UTIA 1YIJA 1GCQC 1VQMQ 1GRIA 3OYDA 4PJOA 3CMAA 3VS5A 5HK0A 2LCSA 4MZPA 4M75F 2OI3A 4GBQA 4XTVA 1BI3A 4FW2A 4JS4A 2E41A 2R5MA 1M1KU 2RK2A 3OYLA 4J6XA 4OB3B 4J7FA 2H8HA 1SHGA 4HT9A 1W70A 3V7SA 4XQ3A 2DYIA 3PFSA 4Z02A 4LD9K 3CCQT 3CCLT 1VQ7A 2DTHA 4ZGEB 3JCMh 3KBGA 1RUWA 1UDLA 3I9QA 4QQGA 5KYXA 9ATCB 1IGQA 5KYYA 3VYHB 2EQIA 2E4HA 3DB4A 1KD1U 1ZUUA 5GAN2 2HSEB 2F5TX 2FZKB 3EFRA 4OB1B 3L2WA 1D3BB 1JJ2P 2CYZB 2HKQB 1RAIB 2BZYA 3SWNC 1KJWA 3CCJT 3C94A 1MMGA 4Z8AA 2KAFA 2EQUA 2QGFB 1D1CA 2QDYB 2HQXA 2RQUA 1WGSA 2VUBA 2EJ9A 1MUZA 5FU7B 2JMAA 3E9GA 2L8DA 3UA7A 1JJ2A 2V8JA 4FSSA 1TUGB 4JLIA 1ZA2B 4QT7A 1EX4A 2VC8A 3PGGA 3M0TA 2F2WA 4JUVA 3BW1A 4Z88A 3D7SB 1JO8A 2MF2A 4AFQC 2ZPGB 1MGQA 1K8AU 1KK7A 2DIQA 3SB2A 2J7IA 5L23A 4F17A 1HXDA 1QP2A 2OTLQ 2QQBA 1KQSS 5GAMd 4NL3A 1OEBA 2GFAA 3A8OB 5GANh 4OB2B 3G71T 2E12A 1B07A 3MPUB 4GLMA 1QVGS 1TUDA 1Q95G 1R77A 2EYWA 3OS2A 2WACA 3CC4T 1NJIC 5GAN3 1QLYA 4E6RA 4DEYA 4M77F 3FC3A 4D8KA 5GMKe 4R56A 2D8JA 3L2VA 2AIRB 5CO7A 4E7SA 4XU1A 2KGTA 1R0BG 2CP6A 2VGMA 1OQKA 2YRDA 5IXBA 2CH4A 4LD6A 3CD6T 5GJWB 2HSPA 4CC3A 3I5SA 4ZGDB 4C92F 1IREB 2VB6A 4IUQA 5CQXA 4BDYA 4M7DA 2VV5A 3VS0A 2A08A 1T0HA 3OYFA 4OGEA 5D6YA 2FO0A 1VQLT 4DEXA 2OTJA 3I55T 3VUBA 1VQPQ 2BE7D 1UGRB 4X34A 1PCXA 4L59A 2XD0A 3G4SQ 1ZQ1A 5I11A 4PFOA 2NUZA 1M27C 5GAOq 1PRMC 1QKWA 3G6EA 3VJPA 1GBQA 1I8FA 2KT8A 2CP3A 4PJOC 4BI3A 2WSFE 4J9CA 1VQMA 1J3TA 5GAN8 1C1AA 1Y57A 2DO3A 5CQYA 2RJEA 1NBEB 3G7ZA 4LUDA 4AG2C 4E47A 1RI9A 1N5ZA 2YXYA 4JPBW 4J5YA 2X4WA 2GQIA 1BIBA 1WJRA 3FDRA 1I0CA 3PNWC 4N4GA 2AZVA 1BCOA 3OW2P 2KY9A 1IGUA 4EMKB 4OMFB 4JDSA 1VQKT 2MWOA 5CKEA 4UC4A 5I22A 2C0IA 2K3YA 3C4SA 2K2MA 1W2BP 1MV0B 5FWBA 3VS6A 1MHNA 4CI0C 3KFVA 3R6OA 3L2ZA 3P8HA 3HHTB 4QQ6A 4B6MA 4PJOG 4PKCC 1U5SA 2CP5A 3TEEA 5L8RE 3CCQQ 4FW1A 3CCLQ 5FW9A 1QP3A 4MZMA 1WJSA 3O8VA 1W2BA 2DEQA 2EJGA 2R57A 5DLQE 1VYUA 5AT1B 1E6GA 3PT9A 2PZ1A 4J9EA 5CK9A 3EGDB 4J9FA 3WXMB 2EYQA 3T9NA 3UA6A 1IHWA 1SPKA 2NYSA 1X75C 4LNPA 1Q86C 4LDVA 4PJOE 4BI4A 3REBB 4EIKA 2X9HA 2JS2A 3PMIA 5LJ3d 5HKCA 2LCLA 3CCJQ 5J39A 2DAQA 2RPNA 3OSVA 4K11A 1M8MA 2G6FX 3H0HA 2DNUA 1AOJA 2JT4A 3DB3A 2FEIA 1Q86R 1LNXA 4FL6A 1I5LA 2DLPA 2HQEA 5LJ5d 2JM9A 2LMJA 1RLPC 2K4YA 4KGVB 4RTZA 2OTLA 3JCMf 2RO0A 1M1GA 2X4XA 4KUDK 4OMPA 3HPWA 1K1ZA 3A8GB 1VQNA 1PKTA 1K9MC 2C06A 2EGCA 2Y4XA 2L89A 1VYVA 1WHLA 3OS1A 4NOYA 3ZL7C 2D0QB 2VXEA 3GF5A 2RHIA 2GBQA 3G71Q 2EPDA 2QYZA 3H8ZA 1U1TA 2LNHB 3HRTA 3OYYA 3CC4Q 1FMKA 4DOWA 3V7RA 1JU5C 3E9FA 4ELYC 4M7DC 2DD5A 4IURA 2ZPEB 4KGZB 3UDCA 1OI1A 2DPPB 2ZPBB 2A36A 2KNBB 2ZAEA 4J83A 3JCMW 2JNGA 2LQWA 4AMCA 2HKNA 4FYVB 4F14A 2ABLA 2X3XD 4EMKC 1BI1A 2GTOA 4IUTA 1VQPA 1ZSZA 5KYWB 2L3SA 4J9HA 3S3NA 2O01E 3G4SA 3RUXA 3CD6Q 4JJBA 3M55A 3X20B 4M78D 1K73C 1M1FA 5GANf 1CSKA 1XJWB 2EIFA 2YUPA 1I5OB 4ZN1A 2VASA 3A8MB 3ER0A 4A4HA 5CKBA 3A98A 1G3SA 3V7CA 3I55Q 4OMOA 1RI0A 1K73R 1GBRA 3NGPA 2GTJA 3CCSQ 1JQQA 1UGQB 4M77D 5KE2A 3CMET 1M30A 2EAYA 2CUDA 1NEBA 2E5KA 3X24B 4M7DG 1I07A 2E1HA 2MYSA 2W0ZA 1OX9A 1ZX6A 3CPWP 3OYMA 2KXCA 1S72T 1IZ6A 1YJNT 1TTHB 4Q5WA 4BE2A 5CIUA 2GFUA 4M75A 4C5HA 5D6XA 3OMCA 1BKBA 2DM1A 2KDSA 4C92D 1D0YA 1UHCA 3RDVA 2K5FA 2HBPA 3E19A 2DZ9A 4KRTA 2DVEA 3PIOA 1BB9A 4KBMB 2CKKA 3CPWA 4RTTA 3OYIA 4C5EA 3RBBB 4M7DE 1VQ6T 1NJIU 3EFOA 3NTIA 1YITT 1WXBA 5GMKi 4KH1B 1VQKQ 2QASA 1BYMA 3E1SA 2RHYA 1VQOT 2EVRA 3CCQA 2KMTA 3CCLA 1NE8A 1D09B 3CCVQ 4A4GA 1YJ9T 2DXBA 3OYAA 1PD0A 1FXXA 3QZ5B 2EYXA 4M75B 3JB9G 2CSQA 4A63B 3RKWA 1PG5B 1V29B 1MMAA 2L0AA 4JLGA 2XDBA 4MDXA 3LH5A 1RAHB 1RACB 1X01A 4B9WA 1YNZA 2HQHA 4PJLA 4OMQA 2ZPHB 2QXFA 5DY9A 1BU1A 2FRWA 1QVFP 1T0JA 3LH0A 5IHKA 1KC8C 2DBMA 1I81A 2DILA 4RG8A 2D1XA 3LGFA 2X4YA 3QPHA 2ZZDA 3EG3A 3MHXA 2ROTA 4HT8A 4ZNXA 2CREA 2DD4A 1QCFA 1SSFA 1P92A 1UGSB 3S6WA 1NLOC 3GOXA 3TREA 3MP8A 4C8QD 4LN2A 2KXDA 3TVTA 2LZ6B 3EG0A 1EIFA 4RTVA 1WNLA 2D0NA 3OBYA 4HCKA 2FL7A 4J9IA 1FMVA 4M7AF 5FROA 3M0UA 4JS5A 3M4GA 2DFUA 4R55A 1KQSA 3G71A 2J6FA 2M51A 3JRZA 2AT1B 1W1FA 2HMAA 1V1CA 3GPLA 4DQ2A 3CC4A 2E6ZA 1QVGA 4J6WA 1I1JA 1AT1B 3QDRB 3O5ZA 1D3BA 4JRIA 2YRVA 1KHCA 3OA6A 2QTXA 2LJ3A 2GCXA 4QKUA 1ZSZC 3UPUA 1VQ9T 2DL4A 3NHNA 3QHSA 1FYNA 2EJFA 2SEMA 4M78B 2F2VA 3G1JA 2P4TA 3CD6A 1MMNA 5GAMg 1U06A 2COYA 1FMWA 3EGUA 1RABB 1W4SA 1OYXA 2COZA 3P8BB 2RA2A 2XU8A 2DERA 1WA7A 2RJDA 1GFCA 1KQ2A 1YJWT 1VQLA 3UF4A 3M0PA 4M77B 2DXTA 4DOVA 3META 2DX1A 3I55A 2P0QA 1PSEA 2F5KA 4FYWB 1Y96B 2PUOB 3H9NA 1NYGA 3JCMe 1Q86U 1KG1A 4JJNK 2LDMA 2LJ0A 5FU6B 4M75C 3LYIA 5HY6A 1EZZB 2J6OA 4C92B 2RJFA 2JTMA 5LJ5f 2F69A 2EGEA 1QVPA 2NUPB 1NPRA 1M3CA 3CMEQ 5FLXE 4MMLA 3TCJA 3QWXX 2GNCA 2KE9A 3FJ5A 3FLGA 5D7UA 4WTOB 3THKA 3OYBA 3CCET 1C6VX 3QKJA 1K9MU 2HBWA 2X35A 1S72Q 1LVKA 1TS9A 4LUEA 1G8XA 4XTXA 2HDAA 1YJNQ 1K0XA 1U8RA 4RMOA 3FJPA 1AWOA 1Q82C 1VQKA 4A4FA 3TU4K 2XG8D 4M78F 2G3RA 3J80E 2RI2A 4PJNA 4RTYA 3I56A 4FM4B 2DE0X 5AYFA 5KYUB 1TU0B 1UECA 2OJ2A 4M75G 1VQ6Q 1Y71A 5GAN6 5A0GA 2EQMA 4C0FA 4EMHA 1YITQ 3RKYA 3VU3C 1WHMA 5GMKh 3LWIA 4JZ3A 3QDFA 1VQOQ 4CC2A 3VS1A 2MIOA 5C0MA 3MCAB 5A0LA 3DKMA 3L42A 1NJIR 2DMOA 2KSSA 2R58A 1YJ9Q 4ANJA 1GXIE 3CMAT 1X2QA 4N4IA 2L3QA 5GAOl 1O9SA 1M9SA 1K73U 4F16A 5GAMh 2WSCE 1IXDA 2MMPA 2NUTB 4M75E 5EC7A 1TOVA 1UE9A 4RG2A 4HKEA 4C8QB 2HD0A 2JN0A 2O88A 2M0YA 3LLRA 4PLLA 3DLMA 3U23A 1TSFA 4EMKA 2WSEE 4A54A 4O6JA 3CCST 1UEBA 3JB9J 3CCUT 2JM8A 4J6YA 3MKDA 3PE0A 1NPPA 3P8DA 2A0FB 4RCBA 4II1A 3NMZC 4M77C 1T3LA 4C0DB 2L3PA 4PL6A 2ATCB 2FRYA 1RAFB 4VUBA 2LT4A 5CAIA 1O75A 4E2FB 2M0OA 2P0PA 1IB8A 4XU0A 2ZPFB 1N8RC 3NPFA 2KR3A 3CCVT 5KCHA 5LJ3g 2DRMA 4A4EA 2DTIA 4F7UB 1WQ7A 1KHIA 5FU6C 5CCAA 4C92C 1ZBJA 1JJ2S 2DETA 5LJ5g 2K5IA 2L5QA 3EGDA 2PU9B 2RHUA 5FU7C 3INZA 3CBOA 1YP5A 3V8KA 4AT1B 3WVDB 4FSXA 3MO8A 1WHJA 3LGLA 3QWYA 4D8DA 1M90C 3MEVA 2DL8A 2FPDA 2VGNA 3RESA 4M77G 4C8QF 4OMNA 2YSQA 1VQ9Q 3OYEA 1SHFA 4LE9A 2K2VA 2KYBA 4J9GA 4Y28E 5I2MA 2ED0A 3QUIA 5HCKA 1M90R 1A0NB 3ME9A 2QAZA 4M7AD 4ESRA 3EGXB 4DBRA 4ZGJB 2DIGA 1UG1A 1GCPA 1KC8U 2EFIA 2EWNA 4FU6A 1YJWQ 3HRSA 3QJ6A 4J9BA 5IHNA 1VOMA 4C92G 3CXCP 2D8HA 4JJDA 1WHHA 3CMEA 1YI2T 1NZ9A 4C0ZA 1VQ4T 4XTWA 4MDWA 1W6XA 3F70A 1HJDA 2X4JA 1S72A 2K5LA 3NTKA 1YJNA 4F7UF 2BIVA 2CUBA 3CXCA 1BCMA 4JRKA 2LX9A 5GANj 2PUKB 3CC2T 2V1RA 2JVVA 5GAOn 3KUFA 3CCEQ 1QCNA 2CZ0B 4BI8B 2F1LA 4AFUC 3HSBA 3OQ5A 1VQ6A 1SRMA 1WDXA 1WZOA 2QTVA 3I5RA 5KYWA 1X6GA 3WVEB 3OSSC 1YITA 3HP9A 4MMKA 4TVRA 4EPCA 3URGA 2O31A 3CCMQ 1VQOA 1K9MR 1VQ5T 4RTWA 5LJ3h 1DJ7B 4C0DC 5FRNA 2YLBA 2MPXC 2CSIA 2XDPA 3SHWA 3AT1B 1HSQA 2RJCA 4FCYA 3QBYA 2CZ1B 2DF6A 4RCCA 3V8JA 5LJ5h 3PTAA 3PMTA 4E7IA 2XMFA 3OY9A 3CBPA 2YRCA 4PNOA 4BY6B 1CKAA 1QKXA 2L2PA 4Y91A 3JCMQ 1SEMA 2NLUA 2RD1A 1TH7A 1ACMB 1RLQC 2YHTA 1NG2A 5KCOA 4J7IA 2I2LA 3CMAQ 2MWPA 2RQTA 5CKDA 1M8VA 3OYJA 1YBYA 2KVQG 3OW2S 1SKUB 4OVAA 1JXMA 2KQWA 3LWHA 5CR2A 3RMSA 2HEQA 1Z9ZA 3FEOA 3OYHA 1PC0A 1ZUKA 5HK3A 1W2BS 4BDZA 5A0DA 1U1SA 3CCUQ 2A28A 3X26B 1VQ8T 2P84A 4OB0B 2HL3A 2CP2A 2R5AA 2PVOB 2HNIA 4ORZA 1IO6A 2HZYA 2OX7A 1Q81C 2AKKA 3H0IA 3X28B 1D1BA 3JCMb 1OX8A 1Q82U 2LRQA 5KYNA 4PJOD 3UWNA 2YUOA 2Z0WA 5GAMf 2GGRA 3CCRT 1OU9A 3OYCA 1M2OA 2NWMA 4DA4A 4J8OA 3QG1A
chains in the Genus database with same CATH topology
3UATA 2ESWA 5GJWB 2IIMA 3H41A 2VKNA 2DA9A 2DL4A 1M3BA 2HSPA 1FYNA 2RN8A 3NHNA 4RTXA 4CC3A 3I5SA 4M4ZA 2SEMA 3VRYA 2F2VA 2DL3A 3VS3A 1U06A 1ZUYA 3VS0A 2A08A 1T0HA 3EGUA 2RQWA 2FO0A 1WFWA 2KROA 1ABQA 2J05A 4DEXA 1WA7A 1AWXA 1WYXA 1GFCA 2EGAA 2DRKA 1K76A 3UF4A 1NM7A 1TG0A 3M0PA 5I11A 2NUZA 1OV3A 1M27C 2DX1A 1PRMC 1Z9QA 1QKWA 1GBQA 1NYGA 4R0KA 1QWEA 2RQRA 2KT8A 2K3BA 2KEAA 2LJ0A 2VVKA 4J9CA 1X69A 2P4RA 2YT6A 1J3TA 3VS7A 3JV3A 1UFFA 1Y57A 2F2XA 3EHRA 2J6KA 4LUDA 4AG2C 2J6OA 1RI9A 3M0QA 1N5ZA 2V1QA 4JPBW 2A37A 2EGEA 2GQIA 1AWWA 1M3CA 1M3AA 1I0CA 4HVWA 1ARKA 2AZVA 3QWXX 2GNCA 2KE9A 3FJ5A 1GCQA 3EG1A 3THKA 2YDLA 2BZ8A 1S1NA 2FPEA 1OPLA 2EKHA 2HBWA 2BTTA 4LUEA 1ZSGA 2HDAA 2W10A 1MV3A 4JZ4A 1K0XA 2CH4W 2O9VA 1AWOA 5I22A 1WLPB 2C0IA 4JJCA 2K2MA 1QWFA 2CT3A 1MV0B 5FWBA 3VS6A 1UJYA 3R6NA 2C0OA 4RTYA 3KFVA 1GFDA 2YUNA 4AG1C 1AWJA 1UJ0A 2K6DA 3REAB 1WI7A 2DE0X 1U5SA 2LP5A 3IQLA 1UECA 2OJ2A 1KIKA 2YUQA 5FW9A 1ZLMA 2KYMA 1TUCA 4X1VA 4JZ3A 1YCSB 1VYUA 1OPKA 4CC2A 1E6GA 2KRNA 2MIOA 2PZ1A 3VS1A 4J9EA 2LQNA 2DMOA 1SSHA 2O2OA 4J9FA 1VA7A 3UA6A 1SPKA 1X2QA 1T3SA 1X43A 1X6BA 2DJQA 4LNPA 2L3QA 3REBB 1B3QA 4EIKA 2O9SA 2JS2A 4F16A 4OMLA 4HVUA 1LCKA 5EC7A 4AFSC 1K9AA 1UE9A 2DYBA 2RPNA 4K11A 1M8MA 5FWCA 1X2KA 2G6FX 2K7AA 1YWOA 3H0HA 2DNUA 1AOJA 3I35A 2DL5A 3CQTA 3RNJA 2JT4A 2M0YA 3TSWA 2O88A 1KFZA 2FEIA 4RUGA 3U23A 2DLPA 2JM9A 4CC4B 2LMJA 1RLPC 4RTZA 2K79A 1K0SA 1AEYA 1WX6A 4Z89A 1WXTA 1BBZA 1G2BA 2JM8A 4OMPA 1K1ZA 1PNJA 3PE0A 2JS0A 3PVLA 2AK5A 1PWTA 1EFNA 5IHIA 1PKTA 2RMOA 1K4US 1UUEA 1KSWA 2EGCA 3NMZC 1T3LA 2KRMA 2L3PA 2FRYA 2QDLA 4AFZC 1PHTA 1VYVA 2CT4A 1U3OA 3ZL7C 3EHQA 4RTUA 2CDTA 2MOXA 5IXFA 3NPFA 2PTKA 2GBQA 2KR3A 1ABOA 1NLPC 2EPDA 2DRMA 4WCIA 4CC7A 2LNHB 3C0CA 1FMKA 1JU5C 1UGVA 1ZBJA 4HXJA 2DVJA 2LJ1A 1E6HA 1VYTA 2JMCA 1WXUA 2RQVA 2A36A 2KNBB 2LQWA 1YP5A 4F14A 2ABLA 2DL7A 4J9DA 1CKBA 2HCKA 1OOTA 2X3XD 2GTOA 2EW3A 1AZEA 2AKLA 4D8DA 3QWYA 1H3HA 1XOVA 2L3SA 4J9HA 2DL8A 2JXBA 3H0FA 2FPDA 2PNIA 5GJVB 1JXOA 4JJBA 4HVVA 4OMNA 2YSQA 1SHFA 3EG2A 1CSKA 4LE9A 1H8KA 2AZSA 2KYBA 4J9GA 1JEGA 2EBPA 2VWFA 2ED0A 2YUPA 5HCKA 2J06A 1A0NB 2KT1A 2JTEA 3A98A 4ESRA 1SRLA 4OMOA 1UG1A 5IH2A 1GCPA 1WIEA 1GBRA 2ECZA 3NGPA 2GTJA 1JQQA 4IIOA 1M30A 4J9BA 5IHNA 2CUDA 2LX7A 1NEBA 2E5KA 4Y92A 2D8HA 4JJDA 1I07A 1NYFA 2MCNA 2JW4A 2W0ZA 1UTIA 1GCQC 2EYZA 1ZX6A 4IIMA 1GRIA 2KXCA 1G83A 1W6XA 2KRSA 3VS5A 1HJDA 3GBQA 2LCSA 2OI3A 3PVQA 2K9GA 4GBQA 1E7OA 2X3WD 1PRLC 2DM1A 1HD3A 3VS4A 1UHCA 2CUBA 1AD5A 2H8HA 1SHGA 4KRTA 1W70A 1BB9A 4RTTA 3RBBB 3M0SA 2V1RA 1YN8A 4AFUC 1WXBA 1RUWA 1SRMA 1UDLA 1WDXA 3I9QA 2EVRA 1AZGB 3I5RA 1X6GA 1GL5A 2EQIA 2O31A 1ZUUA 1Y0MA 4RTWA 2SRCA 2C0TA 2EYXA 1UHFA 2CSQA 4A63B 1PKSA 2CSIA 3SHWA 2L0AA 1HSQA 3LH5A 2DF6A 2BZYA 1KJWA 2ED1A 2ROLA 1YNZA 4Z8AA 2XMFA 4OMQA 3VS2A 2ENMA 1AVZC 1BU1A 2FRWA 1CKAA 1T0JA 2RQUA 1QKXA 2L2PA 5IHKA 1SEMA 1MUZA 2DBMA 3TSZA 2JMAA 1RLQC 2DILA 1NG2A 5ECAA 3UA7A 4FSSA 2D1XA 2EYYA 4QT7A 2I0NA 3EG3A 2RQTA 2RF0A 1X27A 2ROTA 3M0TA 2KBTA 2F2WA 3VRZA 4ZNXA 2CREA 4Z88A 1JO8A 1QCFA 2RNAA 1H92A 4AFQC 1NLOC 2B86A 1JXMA 2J7IA 1YWPA 2HEQA 4LN2A 1Z9ZA 4F17A 5L23A 2BZXA 2FG0A 2KXDA 3TVTA 2LZ6B 3EG0A 1OEBA 4RTVA 2D0NA 4HCKA 1ZUKA 2DBKA 3ULRB 4J9IA 1B07A 4GLMA 1TUDA 3M0UA 2EYWA 2A28A 2FPFA 2J6FA 1QLYA 2M51A 4E6RA 4DEYA 2OAWA 1W1FA 4D8KA 1V1CA 3SEMA 4ORZA 2D8JA 1IO6A 2AKKA 3H0IA 1I1JA 2KGTA 3O5ZA 1BK2A 1NEGA 2YUOA 2GGRA 5IXBA 2CH4A 2NWMA 3M0RA 4OMMA 2LJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UAT A;  2ESW A;  5GJW B;  2IIM A;  3H41 A;  2VKN A;  2DA9 A;  2DL4 A;  1M3B A;  2HSP A;  1FYN A;  2RN8 A;  3NHN A;  4RTX A;  4CC3 A;  3I5S A;  4M4Z A;  2SEM A;  3VRY A;  2F2V A;  2DL3 A;  3VS3 A;  1U06 A;  1ZUY A;  3VS0 A;  2A08 A;  1T0H A;  3EGU A;  2RQW A;  2FO0 A;  1WFW A;  2KRO A;  1ABQ A;  2J05 A;  4DEX A;  1WA7 A;  1AWX A;  1WYX A;  1GFC A;  2EGA A;  2DRK A;  1K76 A;  3UF4 A;  1NM7 A;  1TG0 A;  3M0P A;  5I11 A;  2NUZ A;  1OV3 A;  1M27 C;  2DX1 A;  1PRM C;  1Z9Q A;  1QKW A;  1GBQ A;  1NYG A;  4R0K A;  1QWE A;  2RQR A;  2KT8 A;  2K3B A;  2KEA A;  2LJ0 A;  2VVK A;  4J9C A;  1X69 A;  2P4R A;  2YT6 A;  1J3T A;  3VS7 A;  3JV3 A;  1UFF A;  1Y57 A;  2F2X A;  3EHR A;  2J6K A;  4LUD A;  4AG2 C;  2J6O A;  1RI9 A;  3M0Q A;  1N5Z A;  2V1Q A;  4JPB W;  2A37 A;  2EGE A;  2GQI A;  1AWW A;  1M3C A;  1M3A A;  1I0C A;  4HVW A;  1ARK A;  2AZV A;  3QWX X;  2GNC A;  2KE9 A;  3FJ5 A;  1GCQ A;  3EG1 A;  3THK A;  2YDL A;  2BZ8 A;  1S1N A;  2FPE A;  1OPL A;  2EKH A;  2HBW A;  2BTT A;  4LUE A;  1ZSG A;  2HDA A;  2W10 A;  1MV3 A;  4JZ4 A;  1K0X A;  2CH4 W;  2O9V A;  1AWO A;  5I22 A;  1WLP B;  2C0I A;  4JJC A;  2K2M A;  1QWF A;  2CT3 A;  1MV0 B;  5FWB A;  3VS6 A;  1UJY A;  3R6N A;  2C0O A;  4RTY A;  3KFV A;  1GFD A;  2YUN A;  4AG1 C;  1AWJ A;  1UJ0 A;  2K6D A;  3REA B;  1WI7 A;  2DE0 X;  1U5S A;  2LP5 A;  3IQL A;  1UEC A;  2OJ2 A;  1KIK A;  2YUQ A;  5FW9 A;  1ZLM A;  2KYM A;  1TUC A;  4X1V A;  4JZ3 A;  1YCS B;  1VYU A;  1OPK A;  4CC2 A;  1E6G A;  2KRN A;  2MIO A;  2PZ1 A;  3VS1 A;  4J9E A;  2LQN A;  2DMO A;  1SSH A;  2O2O A;  4J9F A;  1VA7 A;  3UA6 A;  1SPK A;  1X2Q A;  1T3S A;  1X43 A;  1X6B A;  2DJQ A;  4LNP A;  2L3Q A;  3REB B;  1B3Q A;  4EIK A;  2O9S A;  2JS2 A;  4F16 A;  4OML A;  4HVU A;  1LCK A;  5EC7 A;  4AFS C;  1K9A A;  1UE9 A;  2DYB A;  2RPN A;  4K11 A;  1M8M A;  5FWC A;  1X2K A;  2G6F X;  2K7A A;  1YWO A;  3H0H A;  2DNU A;  1AOJ A;  3I35 A;  2DL5 A;  3CQT A;  3RNJ A;  2JT4 A;  2M0Y A;  3TSW A;  2O88 A;  1KFZ A;  2FEI A;  4RUG A;  3U23 A;  2DLP A;  2JM9 A;  4CC4 B;  2LMJ A;  1RLP C;  4RTZ A;  2K79 A;  1K0S A;  1AEY A;  1WX6 A;  4Z89 A;  1WXT A;  1BBZ A;  1G2B A;  2JM8 A;  4OMP A;  1K1Z A;  1PNJ A;  3PE0 A;  2JS0 A;  3PVL A;  2AK5 A;  1PWT A;  1EFN A;  5IHI A;  1PKT A;  2RMO A;  1K4U S;  1UUE A;  1KSW A;  2EGC A;  3NMZ C;  1T3L A;  2KRM A;  2L3P A;  2FRY A;  2QDL A;  4AFZ C;  1PHT A;  1VYV A;  2CT4 A;  1U3O A;  3ZL7 C;  3EHQ A;  4RTU A;  2CDT A;  2MOX A;  5IXF A;  3NPF A;  2PTK A;  2GBQ A;  2KR3 A;  1ABO A;  1NLP C;  2EPD A;  2DRM A;  4WCI A;  4CC7 A;  2LNH B;  3C0C A;  1FMK A;  1JU5 C;  1UGV A;  1ZBJ A;  4HXJ A;  2DVJ A;  2LJ1 A;  1E6H A;  1VYT A;  2JMC A;  1WXU A;  2RQV A;  2A36 A;  2KNB B;  2LQW A;  1YP5 A;  4F14 A;  2ABL A;  2DL7 A;  4J9D A;  1CKB A;  2HCK A;  1OOT A;  2X3X D;  2GTO A;  2EW3 A;  1AZE A;  2AKL A;  4D8D A;  3QWY A;  1H3H A;  1XOV A;  2L3S A;  4J9H A;  2DL8 A;  2JXB A;  3H0F A;  2FPD A;  2PNI A;  5GJV B;  1JXO A;  4JJB A;  4HVV A;  4OMN A;  2YSQ A;  1SHF A;  3EG2 A;  1CSK A;  4LE9 A;  1H8K A;  2AZS A;  2KYB A;  4J9G A;  1JEG A;  2EBP A;  2VWF A;  2ED0 A;  2YUP A;  5HCK A;  2J06 A;  1A0N B;  2KT1 A;  2JTE A;  3A98 A;  4ESR A;  1SRL A;  4OMO A;  1UG1 A;  5IH2 A;  1GCP A;  1WIE A;  1GBR A;  2ECZ A;  3NGP A;  2GTJ A;  1JQQ A;  4IIO A;  1M30 A;  4J9B A;  5IHN A;  2CUD A;  2LX7 A;  1NEB A;  2E5K A;  4Y92 A;  2D8H A;  4JJD A;  1I07 A;  1NYF A;  2MCN A;  2JW4 A;  2W0Z A;  1UTI A;  1GCQ C;  2EYZ A;  1ZX6 A;  4IIM A;  1GRI A;  2KXC A;  1G83 A;  1W6X A;  2KRS A;  3VS5 A;  1HJD A;  3GBQ A;  2LCS A;  2OI3 A;  3PVQ A;  2K9G A;  4GBQ A;  1E7O A;  2X3W D;  1PRL C;  2DM1 A;  1HD3 A;  3VS4 A;  1UHC A;  2CUB A;  1AD5 A;  2H8H A;  1SHG A;  4KRT A;  1W70 A;  1BB9 A;  4RTT A;  3RBB B;  3M0S A;  2V1R A;  1YN8 A;  4AFU C;  1WXB A;  1RUW A;  1SRM A;  1UDL A;  1WDX A;  3I9Q A;  2EVR A;  1AZG B;  3I5R A;  1X6G A;  1GL5 A;  2EQI A;  2O31 A;  1ZUU A;  1Y0M A;  4RTW A;  2SRC A;  2C0T A;  2EYX A;  1UHF A;  2CSQ A;  4A63 B;  1PKS A;  2CSI A;  3SHW A;  2L0A A;  1HSQ A;  3LH5 A;  2DF6 A;  2BZY A;  1KJW A;  2ED1 A;  2ROL A;  1YNZ A;  4Z8A A;  2XMF A;  4OMQ A;  3VS2 A;  2ENM A;  1AVZ C;  1BU1 A;  2FRW A;  1CKA A;  1T0J A;  2RQU A;  1QKX A;  2L2P A;  5IHK A;  1SEM A;  1MUZ A;  2DBM A;  3TSZ A;  2JMA A;  1RLQ C;  2DIL A;  1NG2 A;  5ECA A;  3UA7 A;  4FSS A;  2D1X A;  2EYY A;  4QT7 A;  2I0N A;  3EG3 A;  2RQT A;  2RF0 A;  1X27 A;  2ROT A;  3M0T A;  2KBT A;  2F2W A;  3VRZ A;  4ZNX A;  2CRE A;  4Z88 A;  1JO8 A;  1QCF A;  2RNA A;  1H92 A;  4AFQ C;  1NLO C;  2B86 A;  1JXM A;  2J7I A;  1YWP A;  2HEQ A;  4LN2 A;  1Z9Z A;  4F17 A;  5L23 A;  2BZX A;  2FG0 A;  2KXD A;  3TVT A;  2LZ6 B;  3EG0 A;  1OEB A;  4RTV A;  2D0N A;  4HCK A;  1ZUK A;  2DBK A;  3ULR B;  4J9I A;  1B07 A;  4GLM A;  1TUD A;  3M0U A;  2EYW A;  2A28 A;  2FPF A;  2J6F A;  1QLY A;  2M51 A;  4E6R A;  4DEY A;  2OAW A;  1W1F A;  4D8K A;  1V1C A;  3SEM A;  4ORZ A;  2D8J A;  1IO6 A;  2AKK A;  3H0I A;  1I1J A;  2KGT A;  3O5Z A;  1BK2 A;  1NEG A;  2YUO A;  2GGR A;  5IXB A;  2CH4 A;  2NWM A;  3M0R A;  4OMM A;  2LJ3 A; 
#chains in the Genus database with same CATH topology
 3UAT A;  2IIM A;  3H41 A;  2VKN A;  4BE0 A;  1M3B A;  2RN8 A;  3VRY A;  1M2V B;  3M53 A;  2DL3 A;  3VS3 A;  4P5N A;  1VQ9 A;  2RQW A;  1WFW A;  2PVG B;  3LW5 E;  4M7A B;  1OUL A;  2J05 A;  3GIB A;  1KQ1 A;  3HRU A;  3OB9 A;  4QVC A;  1K76 A;  1NM7 A;  1TG0 A;  2MAM A;  3HFO A;  4BB7 A;  4V2S A;  3L2Q A;  3RKX A;  1BIA A;  2M02 A;  1Z9Q A;  1YJW A;  3GNF B;  5LL6 S;  4R0K A;  1QWE A;  3CC7 T;  2K3B A;  4KUL A;  1X69 A;  2P4R A;  2FZG B;  3VS7 A;  3JV3 A;  1UFF A;  2H3J A;  2F2X A;  3SWN B;  3EHR A;  4PFZ A;  1PSF A;  3M0Q A;  2DTO A;  2V1Q A;  3CCJ A;  3JCM c;  2A37 A;  2EKO A;  2RH2 A;  1AWW A;  2AHJ B;  3GNG A;  3GLX A;  1B7T A;  1AHJ B;  2RK1 A;  2IVW A;  3C95 A;  3A8H B;  2XIC A;  3EG1 A;  2OAU A;  2YDL A;  2BZ8 A;  1FX7 A;  2FPE A;  1YI2 Q;  2K57 A;  1OPL A;  5EG2 A;  1VQ4 Q;  2BTT A;  2RI5 A;  1KC8 R;  4A53 A;  4JZ4 A;  2CH4 W;  3CCE A;  3N5B B;  1KQS P;  2O4X B;  5A2Q E;  3JCM J;  1WLP B;  8AT1 B;  3JAM E;  2E5Q A;  1UJY A;  4M78 A;  4BE1 A;  1QVG P;  1N8R U;  3DLL A;  2JJ9 A;  4AG1 C;  1UJ0 A;  2K6D A;  3L2R A;  3REA B;  3JCM P;  3CC2 Q;  2H3E B;  2XHC A;  2LP5 A;  3IQL A;  1KIK A;  4M77 A;  1ZLM A;  2KYM A;  1TUC A;  3OYK A;  3V8L A;  3KXT A;  1YCS B;  2A7Y A;  2B8A A;  1Y96 A;  1XQH A;  3JCM d;  1SSH A;  2LQ8 A;  2O2O A;  1M90 U;  1VA7 A;  2K3X A;  1VQ5 Q;  4OGC A;  1T3S A;  2BKD N;  1X6B A;  2DJQ A;  1G3W A;  3L2U A;  1B3Q A;  5GAN 7;  4C92 A;  1G3Y A;  1K9A A;  3CPW S;  3M56 A;  2NUP A;  5FWC A;  3BFM A;  1X2K A;  1YWO A;  3RNJ A;  3TSW A;  4RUG A;  1IHV A;  4M7D D;  2LVM A;  4CC4 B;  6AT1 B;  2K79 A;  4Z89 A;  1BBZ A;  1G2B A;  5IN1 A;  3EG9 B;  4M7A C;  1ZHI A;  2JS0 A;  2AK5 A;  3S3M A;  3CCS A;  1EFN A;  1D0X A;  2RMO A;  3J81 E;  1OZ3 A;  3CCU A;  2FHD A;  1KSW A;  3QJY A;  4HCB A;  5LJ3 f;  4ZN3 A;  2KRM A;  3OS0 A;  5IT9 E;  3AHU A;  2QA4 T;  2LC4 A;  1PHT A;  2CT4 A;  2E65 A;  1U3O A;  2ZGW A;  4PJO B;  3ASK A;  4OP0 A;  2CDT A;  4DBH A;  1IRX A;  4KT0 E;  5KYU A;  5IXF A;  4ZTF A;  2PTK A;  4L5G A;  2V26 A;  1ABO A;  1NLP C;  1M4Z A;  2CP7 A;  3OS5 A;  4XU3 A;  4HCZ A;  4DBQ A;  1VIE A;  3H6Z A;  5GAN d;  3CCV A;  1SF9 A;  1VQ8 Q;  1UGV A;  1YCY A;  4F04 B;  5GAO m;  4HXJ A;  2DVJ A;  1E6H A;  3BDU A;  1WXU A;  4E7J A;  2BE9 B;  2JTF A;  3VKI A;  1VIF A;  2DL7 A;  3JB9 D;  1CKB A;  4X9C A;  1LJO A;  4FYY B;  4M7A G;  2GF7 A;  3HL8 A;  3M57 A;  3CCM T;  1QVF S;  3CCR Q;  5KYX B;  1H3H A;  2NUT A;  5KYY B;  1YHQ T;  4BAC A;  2FYK A;  2PNI A;  5GJV B;  4C8Q A;  4HVV A;  2QQ9 A;  4C5I A;  3OBW A;  3SDZ A;  1Q82 R;  3EG2 A;  4ELZ C;  3SFM A;  1H8K A;  1WQW A;  3A8L B;  2EBP A;  2VWF A;  5GAN 4;  2IPO B;  2QEX T;  2JTE A;  3CBM A;  3ZBD A;  4KGX B;  5GAN e;  1SRL A;  5IH2 A;  1WIE A;  2RHX A;  2JUF A;  2E3H A;  2ZCF B;  4IIO A;  4M7A E;  1VQN Q;  1YIJ T;  4XTY A;  2M16 A;  5IAY A;  2JW4 A;  2E6N A;  2EYZ A;  4IIM A;  3OMG A;  4PJO F;  3CC7 Q;  1G83 A;  2KRS A;  2QGG A;  1WPY A;  3GBQ A;  4IKF A;  1OU8 A;  1YI2 A;  2E70 A;  1VQ4 A;  3PVQ A;  2K9G A;  1WJQ A;  1E7O A;  2X3W D;  2CP0 A;  1PRL C;  4PJJ A;  3QZ9 B;  1R8O B;  4F7U A;  1HD3 A;  3VS4 A;  3TQ7 P;  2PVD B;  4CRI A;  3EH1 A;  4M78 C;  2XID A;  1AD5 A;  2YWW A;  1G5V A;  2GQV A;  1TXQ A;  2FVU A;  3NFC A;  4HA8 A;  1VQ7 T;  5GAM e;  3MEU A;  3MP1 A;  1BI0 A;  4N0A C;  4FYX B;  2LQK A;  3M0S A;  2E64 A;  1YN8 A;  3MP6 A;  2QQS A;  3C12 A;  3CC2 A;  1WHG A;  5CVI A;  1Q81 U;  1RL2 A;  1AZG B;  1GL5 A;  4QQD A;  5CKH A;  4PLI A;  1M5Q 1;  1Y0M A;  3FRN A;  4LDW A;  2SRC A;  2C0T A;  4BD3 A;  1UHF A;  4XTZ A;  3JCM V;  1PKS A;  1VQ5 A;  3EGX A;  4O5V A;  1RAE B;  2RM4 A;  2ED1 A;  2ROL A;  1Q7Y C;  1N8R R;  3VS2 A;  4M78 G;  2VYT A;  5KE3 A;  1D0Z A;  4IUP A;  3MEA A;  2ENM A;  1AVZ C;  4XTU A;  3QSU A;  4M7D B;  4B9X A;  1SG5 A;  3TSZ A;  4C5G A;  5ECA A;  1Q7Y R;  2EYY A;  1ZA1 B;  3M59 A;  2HL5 C;  2I0N A;  2RF0 A;  1X27 A;  2KBT A;  4GY5 A;  4N4H A;  2YLC A;  3RMQ A;  3VRZ A;  3X25 B;  1N27 A;  2RNA A;  2V8K A;  1H92 A;  1TWB A;  3SD4 A;  3ZEH A;  2B86 A;  3I56 T;  3JSC A;  1YWP A;  4IUU A;  2BZX A;  2FG0 A;  1M1K C;  4M78 E;  1N6A A;  4FIB A;  3HFN A;  1WHK A;  3OW2 A;  2DBK A;  2XKO C;  3ULR B;  1JB0 E;  1PD1 A;  2DKG A;  4PK4 A;  3JB9 H;  2FPF A;  1M1K R;  2A3L A;  1H3Z A;  4M77 E;  2OAW A;  3QO3 A;  4RKU E;  3A5Z B;  3SEM A;  2M1H A;  2RHZ A;  5M9O A;  1VQ8 A;  3NTH A;  1X6O A;  2QA4 Q;  2M9U A;  2QG9 B;  3OYN A;  1BK2 A;  1NEG A;  3FIF A;  1KD1 C;  2PQW A;  3M0R A;  4M75 D;  4OMM A;  2ESW A;  2E10 A;  2L3R A;  3M58 A;  2DA9 A;  4RTX A;  3CCR A;  4M4Z A;  4C8Q C;  4C92 E;  1RAD B;  1FWZ A;  4M7D F;  1KD1 R;  4HCC A;  2OTJ T;  1ZUY A;  1F1B B;  2FZC B;  1N9R A;  4DBF A;  2KRO A;  1ABQ A;  3QII A;  5I2S A;  4QVD A;  5GMK j;  3GP8 A;  1AWX A;  1WYX A;  2EGA A;  2LNV A;  2DRK A;  2HAX A;  5C6S A;  3G6E T;  1OV3 A;  3M54 A;  2Y4Y A;  2QQA A;  3EAE A;  2QQR A;  2D6F A;  8ATC B;  1YHQ Q;  4FT2 A;  4L6V 5;  3M5A A;  1VQM T;  4LDU A;  1YJ9 A;  2RQR A;  1H64 1;  2KEA A;  4YTL A;  1K8A C;  2VVK A;  5GAM j;  2YT6 A;  3JCM X;  3CC7 A;  2RI3 A;  1MNE A;  2QEX Q;  3BE3 A;  2COW A;  2J6K A;  1OZ2 A;  2DZC A;  5LJ3 e;  4C8Q G;  1K8A R;  1M3A A;  2CS7 A;  4HVW A;  1YIJ Q;  1ARK A;  7AT1 B;  3VV0 A;  5LJ5 e;  1GCQ A;  2LTO A;  3JB9 F;  1S1N A;  1LOJ A;  2KI7 A;  3Q1J A;  2EKH A;  1ZSG A;  2EQK A;  5D6W A;  4IUV A;  2W10 A;  1MV3 A;  2O9V A;  2LCC A;  4XU2 A;  2DK3 A;  3CPF A;  4JJC A;  1QWF A;  2CT3 A;  4KH0 B;  4D6W A;  1JBM A;  3R6N A;  1M2V A;  2C0O A;  5CKF A;  1GFD A;  1RAG B;  2JZ2 A;  1N9S A;  2YUN A;  4C8Q E;  3VYG A;  1AWJ A;  3EFS A;  1WI7 A;  1VQ7 Q;  4GLK A;  4M7A A;  4LXC A;  5DLO A;  4JRP A;  2X51 A;  2EQJ A;  2ZPI B;  2V8I A;  1MND A;  2YUQ A;  2CZ6 B;  2VXF A;  1BI2 A;  4F7U G;  4EMG A;  1VQL Q;  4X1V A;  2XDD A;  1OPK A;  2LT1 A;  2FB7 A;  3OYG A;  2KRN A;  1ZBX A;  1LPL A;  2LQN A;  3CEY A;  4EDU A;  1MMD A;  1X43 A;  1Q81 R;  5J3B A;  3E2U A;  3SWN A;  4ME7 A;  3CXC S;  4JRQ A;  4MZT A;  2O9S A;  4X9D A;  4OML A;  2CZ7 B;  1ZSZ B;  4HVU A;  1LCK A;  1QCO A;  4AFS C;  2DYB A;  3RER A;  2K7A A;  3I35 A;  4F7U E;  2OTL T;  4ZTJ A;  1KFZ A;  2DL5 A;  1JRI A;  3CQT A;  4WF2 A;  3FB9 A;  5J26 A;  4XK8 E;  1QQJ A;  1K0S A;  1VQN T;  3QXE B;  1AEY A;  1WX6 A;  4E7K A;  1WXT A;  1VUB A;  5DM7 R;  4OF1 A;  4BUG A;  3S3O A;  1PNJ A;  3HTR A;  3PVL A;  2DXC A;  3UT1 A;  1PWT A;  5IHI A;  2O4X A;  4FT4 A;  1K4U S;  1UUE A;  2JOY A;  2CGH A;  2XI9 A;  1R0C B;  3JCM g;  2KK4 A;  3A1P A;  2QDL A;  4AFZ C;  3I56 Q;  2XK0 A;  4PFP A;  4LDY A;  2D9T A;  4C0G A;  3L1A A;  1UGP B;  2BUD A;  3EHQ A;  4ATO A;  4RTU A;  2Y90 A;  1YFN A;  2QA4 A;  2MOX A;  3VUZ A;  1UB4 A;  4KUI A;  1HK9 A;  5GMK m;  3QYG B;  3BY7 A;  4WCI A;  4CC7 A;  1B34 A;  2QK0 A;  3PIP A;  1D1A A;  3C0C A;  4QW2 A;  4BY6 C;  4XAX B;  1G3T A;  1PM3 A;  2LJ1 A;  2IG0 A;  5I21 A;  5KH6 A;  1VYT A;  2JMC A;  3EH2 A;  2RQV A;  3RR6 A;  3MEW A;  4NL2 A;  2E3I A;  3EFO B;  1VQP T;  4J9D A;  4LDX A;  2HCK A;  3M9Q A;  1OOT A;  3G4S T;  2MI6 A;  2EW3 A;  1XTD A;  3HKS A;  1AZE A;  2AKL A;  2QI2 A;  4E7L A;  4A4K A;  1XNI A;  1XOV A;  5GAN 5;  4E7Z A;  1Y07 A;  1RAA B;  2JXB A;  3H0F A;  3J7A F;  4QVZ A;  1JXO A;  5LJ3 j;  1Y7X A;  1C0M A;  3CCM A;  2RB6 A;  4N0A A;  1HYO A;  2MK5 A;  3RIR A;  1YHQ A;  2AZS A;  1QVF A;  1JEG A;  3LX7 A;  4PJM A;  2OTJ Q;  2J06 A;  1V76 A;  5LJ5 j;  1Q7Y U;  2KT1 A;  5GAO p;  1B34 B;  3M4Y A;  5FRM A;  2DXU A;  3EG9 A;  3ZFJ A;  3QYH B;  3JB9 I;  2QEX A;  2ECZ A;  5GAN g;  3MJX A;  4E7H A;  5GMK l;  1I4K 1;  2DEU A;  2DJZ A;  5GAO r;  3G6E Q;  1QMC A;  2LX7 A;  4Y92 A;  3BDL A;  2P0K A;  1QW1 A;  1NYF A;  4NS5 A;  2MCN A;  1UTI A;  1YIJ A;  1GCQ C;  1VQM Q;  1GRI A;  3OYD A;  4PJO A;  3CMA A;  3VS5 A;  5HK0 A;  2LCS A;  4MZP A;  4M75 F;  2OI3 A;  4GBQ A;  4XTV A;  1BI3 A;  4FW2 A;  4JS4 A;  2E41 A;  2R5M A;  1M1K U;  2RK2 A;  3OYL A;  4J6X A;  4OB3 B;  4J7F A;  2H8H A;  1SHG A;  4HT9 A;  1W70 A;  3V7S A;  4XQ3 A;  2DYI A;  3PFS A;  4Z02 A;  4LD9 K;  3CCQ T;  3CCL T;  1VQ7 A;  2DTH A;  4ZGE B;  3JCM h;  3KBG A;  1RUW A;  1UDL A;  3I9Q A;  4QQG A;  5KYX A;  9ATC B;  1IGQ A;  5KYY A;  3VYH B;  2EQI A;  2E4H A;  3DB4 A;  1KD1 U;  1ZUU A;  5GAN 2;  2HSE B;  2F5T X;  2FZK B;  3EFR A;  4OB1 B;  3L2W A;  1D3B B;  1JJ2 P;  2CYZ B;  2HKQ B;  1RAI B;  2BZY A;  3SWN C;  1KJW A;  3CCJ T;  3C94 A;  1MMG A;  4Z8A A;  2KAF A;  2EQU A;  2QGF B;  1D1C A;  2QDY B;  2HQX A;  2RQU A;  1WGS A;  2VUB A;  2EJ9 A;  1MUZ A;  5FU7 B;  2JMA A;  3E9G A;  2L8D A;  3UA7 A;  1JJ2 A;  2V8J A;  4FSS A;  1TUG B;  4JLI A;  1ZA2 B;  4QT7 A;  1EX4 A;  2VC8 A;  3PGG A;  3M0T A;  2F2W A;  4JUV A;  3BW1 A;  4Z88 A;  3D7S B;  1JO8 A;  2MF2 A;  4AFQ C;  2ZPG B;  1MGQ A;  1K8A U;  1KK7 A;  2DIQ A;  3SB2 A;  2J7I A;  5L23 A;  4F17 A;  1HXD A;  1QP2 A;  2OTL Q;  2QQB A;  1KQS S;  5GAM d;  4NL3 A;  1OEB A;  2GFA A;  3A8O B;  5GAN h;  4OB2 B;  3G71 T;  2E12 A;  1B07 A;  3MPU B;  4GLM A;  1QVG S;  1TUD A;  1Q95 G;  1R77 A;  2EYW A;  3OS2 A;  2WAC A;  3CC4 T;  1NJI C;  5GAN 3;  1QLY A;  4E6R A;  4DEY A;  4M77 F;  3FC3 A;  4D8K A;  5GMK e;  4R56 A;  2D8J A;  3L2V A;  2AIR B;  5CO7 A;  4E7S A;  4XU1 A;  2KGT A;  1R0B G;  2CP6 A;  2VGM A;  1OQK A;  2YRD A;  5IXB A;  2CH4 A;  4LD6 A;  3CD6 T;  5GJW B;  2HSP A;  4CC3 A;  3I5S A;  4ZGD B;  4C92 F;  1IRE B;  2VB6 A;  4IUQ A;  5CQX A;  4BDY A;  4M7D A;  2VV5 A;  3VS0 A;  2A08 A;  1T0H A;  3OYF A;  4OGE A;  5D6Y A;  2FO0 A;  1VQL T;  4DEX A;  2OTJ A;  3I55 T;  3VUB A;  1VQP Q;  2BE7 D;  1UGR B;  4X34 A;  1PCX A;  4L59 A;  2XD0 A;  3G4S Q;  1ZQ1 A;  5I11 A;  4PFO A;  2NUZ A;  1M27 C;  5GAO q;  1PRM C;  1QKW A;  3G6E A;  3VJP A;  1GBQ A;  1I8F A;  2KT8 A;  2CP3 A;  4PJO C;  4BI3 A;  2WSF E;  4J9C A;  1VQM A;  1J3T A;  5GAN 8;  1C1A A;  1Y57 A;  2DO3 A;  5CQY A;  2RJE A;  1NBE B;  3G7Z A;  4LUD A;  4AG2 C;  4E47 A;  1RI9 A;  1N5Z A;  2YXY A;  4JPB W;  4J5Y A;  2X4W A;  2GQI A;  1BIB A;  1WJR A;  3FDR A;  1I0C A;  3PNW C;  4N4G A;  2AZV A;  1BCO A;  3OW2 P;  2KY9 A;  1IGU A;  4EMK B;  4OMF B;  4JDS A;  1VQK T;  2MWO A;  5CKE A;  4UC4 A;  5I22 A;  2C0I A;  2K3Y A;  3C4S A;  2K2M A;  1W2B P;  1MV0 B;  5FWB A;  3VS6 A;  1MHN A;  4CI0 C;  3KFV A;  3R6O A;  3L2Z A;  3P8H A;  3HHT B;  4QQ6 A;  4B6M A;  4PJO G;  4PKC C;  1U5S A;  2CP5 A;  3TEE A;  5L8R E;  3CCQ Q;  4FW1 A;  3CCL Q;  5FW9 A;  1QP3 A;  4MZM A;  1WJS A;  3O8V A;  1W2B A;  2DEQ A;  2EJG A;  2R57 A;  5DLQ E;  1VYU A;  5AT1 B;  1E6G A;  3PT9 A;  2PZ1 A;  4J9E A;  5CK9 A;  3EGD B;  4J9F A;  3WXM B;  2EYQ A;  3T9N A;  3UA6 A;  1IHW A;  1SPK A;  2NYS A;  1X75 C;  4LNP A;  1Q86 C;  4LDV A;  4PJO E;  4BI4 A;  3REB B;  4EIK A;  2X9H A;  2JS2 A;  3PMI A;  5LJ3 d;  5HKC A;  2LCL A;  3CCJ Q;  5J39 A;  2DAQ A;  2RPN A;  3OSV A;  4K11 A;  1M8M A;  2G6F X;  3H0H A;  2DNU A;  1AOJ A;  2JT4 A;  3DB3 A;  2FEI A;  1Q86 R;  1LNX A;  4FL6 A;  1I5L A;  2DLP A;  2HQE A;  5LJ5 d;  2JM9 A;  2LMJ A;  1RLP C;  2K4Y A;  4KGV B;  4RTZ A;  2OTL A;  3JCM f;  2RO0 A;  1M1G A;  2X4X A;  4KUD K;  4OMP A;  3HPW A;  1K1Z A;  3A8G B;  1VQN A;  1PKT A;  1K9M C;  2C06 A;  2EGC A;  2Y4X A;  2L89 A;  1VYV A;  1WHL A;  3OS1 A;  4NOY A;  3ZL7 C;  2D0Q B;  2VXE A;  3GF5 A;  2RHI A;  2GBQ A;  3G71 Q;  2EPD A;  2QYZ A;  3H8Z A;  1U1T A;  2LNH B;  3HRT A;  3OYY A;  3CC4 Q;  1FMK A;  4DOW A;  3V7R A;  1JU5 C;  3E9F A;  4ELY C;  4M7D C;  2DD5 A;  4IUR A;  2ZPE B;  4KGZ B;  3UDC A;  1OI1 A;  2DPP B;  2ZPB B;  2A36 A;  2KNB B;  2ZAE A;  4J83 A;  3JCM W;  2JNG A;  2LQW A;  4AMC A;  2HKN A;  4FYV B;  4F14 A;  2ABL A;  2X3X D;  4EMK C;  1BI1 A;  2GTO A;  4IUT A;  1VQP A;  1ZSZ A;  5KYW B;  2L3S A;  4J9H A;  3S3N A;  2O01 E;  3G4S A;  3RUX A;  3CD6 Q;  4JJB A;  3M55 A;  3X20 B;  4M78 D;  1K73 C;  1M1F A;  5GAN f;  1CSK A;  1XJW B;  2EIF A;  2YUP A;  1I5O B;  4ZN1 A;  2VAS A;  3A8M B;  3ER0 A;  4A4H A;  5CKB A;  3A98 A;  1G3S A;  3V7C A;  3I55 Q;  4OMO A;  1RI0 A;  1K73 R;  1GBR A;  3NGP A;  2GTJ A;  3CCS Q;  1JQQ A;  1UGQ B;  4M77 D;  5KE2 A;  3CME T;  1M30 A;  2EAY A;  2CUD A;  1NEB A;  2E5K A;  3X24 B;  4M7D G;  1I07 A;  2E1H A;  2MYS A;  2W0Z A;  1OX9 A;  1ZX6 A;  3CPW P;  3OYM A;  2KXC A;  1S72 T;  1IZ6 A;  1YJN T;  1TTH B;  4Q5W A;  4BE2 A;  5CIU A;  2GFU A;  4M75 A;  4C5H A;  5D6X A;  3OMC A;  1BKB A;  2DM1 A;  2KDS A;  4C92 D;  1D0Y A;  1UHC A;  3RDV A;  2K5F A;  2HBP A;  3E19 A;  2DZ9 A;  4KRT A;  2DVE A;  3PIO A;  1BB9 A;  4KBM B;  2CKK A;  3CPW A;  4RTT A;  3OYI A;  4C5E A;  3RBB B;  4M7D E;  1VQ6 T;  1NJI U;  3EFO A;  3NTI A;  1YIT T;  1WXB A;  5GMK i;  4KH1 B;  1VQK Q;  2QAS A;  1BYM A;  3E1S A;  2RHY A;  1VQO T;  2EVR A;  3CCQ A;  2KMT A;  3CCL A;  1NE8 A;  1D09 B;  3CCV Q;  4A4G A;  1YJ9 T;  2DXB A;  3OYA A;  1PD0 A;  1FXX A;  3QZ5 B;  2EYX A;  4M75 B;  3JB9 G;  2CSQ A;  4A63 B;  3RKW A;  1PG5 B;  1V29 B;  1MMA A;  2L0A A;  4JLG A;  2XDB A;  4MDX A;  3LH5 A;  1RAH B;  1RAC B;  1X01 A;  4B9W A;  1YNZ A;  2HQH A;  4PJL A;  4OMQ A;  2ZPH B;  2QXF A;  5DY9 A;  1BU1 A;  2FRW A;  1QVF P;  1T0J A;  3LH0 A;  5IHK A;  1KC8 C;  2DBM A;  1I81 A;  2DIL A;  4RG8 A;  2D1X A;  3LGF A;  2X4Y A;  3QPH A;  2ZZD A;  3EG3 A;  3MHX A;  2ROT A;  4HT8 A;  4ZNX A;  2CRE A;  2DD4 A;  1QCF A;  1SSF A;  1P92 A;  1UGS B;  3S6W A;  1NLO C;  3GOX A;  3TRE A;  3MP8 A;  4C8Q D;  4LN2 A;  2KXD A;  3TVT A;  2LZ6 B;  3EG0 A;  1EIF A;  4RTV A;  1WNL A;  2D0N A;  3OBY A;  4HCK A;  2FL7 A;  4J9I A;  1FMV A;  4M7A F;  5FRO A;  3M0U A;  4JS5 A;  3M4G A;  2DFU A;  4R55 A;  1KQS A;  3G71 A;  2J6F A;  2M51 A;  3JRZ A;  2AT1 B;  1W1F A;  2HMA A;  1V1C A;  3GPL A;  4DQ2 A;  3CC4 A;  2E6Z A;  1QVG A;  4J6W A;  1I1J A;  1AT1 B;  3QDR B;  3O5Z A;  1D3B A;  4JRI A;  2YRV A;  1KHC A;  3OA6 A;  2QTX A;  2LJ3 A;  2GCX A;  4QKU A;  1ZSZ C;  3UPU A;  1VQ9 T;  2DL4 A;  3NHN A;  3QHS A;  1FYN A;  2EJF A;  2SEM A;  4M78 B;  2F2V A;  3G1J A;  2P4T A;  3CD6 A;  1MMN A;  5GAM g;  1U06 A;  2COY A;  1FMW A;  3EGU A;  1RAB B;  1W4S A;  1OYX A;  2COZ A;  3P8B B;  2RA2 A;  2XU8 A;  2DER A;  1WA7 A;  2RJD A;  1GFC A;  1KQ2 A;  1YJW T;  1VQL A;  3UF4 A;  3M0P A;  4M77 B;  2DXT A;  4DOV A;  3MET A;  2DX1 A;  3I55 A;  2P0Q A;  1PSE A;  2F5K A;  4FYW B;  1Y96 B;  2PUO B;  3H9N A;  1NYG A;  3JCM e;  1Q86 U;  1KG1 A;  4JJN K;  2LDM A;  2LJ0 A;  5FU6 B;  4M75 C;  3LYI A;  5HY6 A;  1EZZ B;  2J6O A;  4C92 B;  2RJF A;  2JTM A;  5LJ5 f;  2F69 A;  2EGE A;  1QVP A;  2NUP B;  1NPR A;  1M3C A;  3CME Q;  5FLX E;  4MML A;  3TCJ A;  3QWX X;  2GNC A;  2KE9 A;  3FJ5 A;  3FLG A;  5D7U A;  4WTO B;  3THK A;  3OYB A;  3CCE T;  1C6V X;  3QKJ A;  1K9M U;  2HBW A;  2X35 A;  1S72 Q;  1LVK A;  1TS9 A;  4LUE A;  1G8X A;  4XTX A;  2HDA A;  1YJN Q;  1K0X A;  1U8R A;  4RMO A;  3FJP A;  1AWO A;  1Q82 C;  1VQK A;  4A4F A;  3TU4 K;  2XG8 D;  4M78 F;  2G3R A;  3J80 E;  2RI2 A;  4PJN A;  4RTY A;  3I56 A;  4FM4 B;  2DE0 X;  5AYF A;  5KYU B;  1TU0 B;  1UEC A;  2OJ2 A;  4M75 G;  1VQ6 Q;  1Y71 A;  5GAN 6;  5A0G A;  2EQM A;  4C0F A;  4EMH A;  1YIT Q;  3RKY A;  3VU3 C;  1WHM A;  5GMK h;  3LWI A;  4JZ3 A;  3QDF A;  1VQO Q;  4CC2 A;  3VS1 A;  2MIO A;  5C0M A;  3MCA B;  5A0L A;  3DKM A;  3L42 A;  1NJI R;  2DMO A;  2KSS A;  2R58 A;  1YJ9 Q;  4ANJ A;  1GXI E;  3CMA T;  1X2Q A;  4N4I A;  2L3Q A;  5GAO l;  1O9S A;  1M9S A;  1K73 U;  4F16 A;  5GAM h;  2WSC E;  1IXD A;  2MMP A;  2NUT B;  4M75 E;  5EC7 A;  1TOV A;  1UE9 A;  4RG2 A;  4HKE A;  4C8Q B;  2HD0 A;  2JN0 A;  2O88 A;  2M0Y A;  3LLR A;  4PLL A;  3DLM A;  3U23 A;  1TSF A;  4EMK A;  2WSE E;  4A54 A;  4O6J A;  3CCS T;  1UEB A;  3JB9 J;  3CCU T;  2JM8 A;  4J6Y A;  3MKD A;  3PE0 A;  1NPP A;  3P8D A;  2A0F B;  4RCB A;  4II1 A;  3NMZ C;  4M77 C;  1T3L A;  4C0D B;  2L3P A;  4PL6 A;  2ATC B;  2FRY A;  1RAF B;  4VUB A;  2LT4 A;  5CAI A;  1O75 A;  4E2F B;  2M0O A;  2P0P A;  1IB8 A;  4XU0 A;  2ZPF B;  1N8R C;  3NPF A;  2KR3 A;  3CCV T;  5KCH A;  5LJ3 g;  2DRM A;  4A4E A;  2DTI A;  4F7U B;  1WQ7 A;  1KHI A;  5FU6 C;  5CCA A;  4C92 C;  1ZBJ A;  1JJ2 S;  2DET A;  5LJ5 g;  2K5I A;  2L5Q A;  3EGD A;  2PU9 B;  2RHU A;  5FU7 C;  3INZ A;  3CBO A;  1YP5 A;  3V8K A;  4AT1 B;  3WVD B;  4FSX A;  3MO8 A;  1WHJ A;  3LGL A;  3QWY A;  4D8D A;  1M90 C;  3MEV A;  2DL8 A;  2FPD A;  2VGN A;  3RES A;  4M77 G;  4C8Q F;  4OMN A;  2YSQ A;  1VQ9 Q;  3OYE A;  1SHF A;  4LE9 A;  2K2V A;  2KYB A;  4J9G A;  4Y28 E;  5I2M A;  2ED0 A;  3QUI A;  5HCK A;  1M90 R;  1A0N B;  3ME9 A;  2QAZ A;  4M7A D;  4ESR A;  3EGX B;  4DBR A;  4ZGJ B;  2DIG A;  1UG1 A;  1GCP A;  1KC8 U;  2EFI A;  2EWN A;  4FU6 A;  1YJW Q;  3HRS A;  3QJ6 A;  4J9B A;  5IHN A;  1VOM A;  4C92 G;  3CXC P;  2D8H A;  4JJD A;  1WHH A;  3CME A;  1YI2 T;  1NZ9 A;  4C0Z A;  1VQ4 T;  4XTW A;  4MDW A;  1W6X A;  3F70 A;  1HJD A;  2X4J A;  1S72 A;  2K5L A;  3NTK A;  1YJN A;  4F7U F;  2BIV A;  2CUB A;  3CXC A;  1BCM A;  4JRK A;  2LX9 A;  5GAN j;  2PUK B;  3CC2 T;  2V1R A;  2JVV A;  5GAO n;  3KUF A;  3CCE Q;  1QCN A;  2CZ0 B;  4BI8 B;  2F1L A;  4AFU C;  3HSB A;  3OQ5 A;  1VQ6 A;  1SRM A;  1WDX A;  1WZO A;  2QTV A;  3I5R A;  5KYW A;  1X6G A;  3WVE B;  3OSS C;  1YIT A;  3HP9 A;  4MMK A;  4TVR A;  4EPC A;  3URG A;  2O31 A;  3CCM Q;  1VQO A;  1K9M R;  1VQ5 T;  4RTW A;  5LJ3 h;  1DJ7 B;  4C0D C;  5FRN A;  2YLB A;  2MPX C;  2CSI A;  2XDP A;  3SHW A;  3AT1 B;  1HSQ A;  2RJC A;  4FCY A;  3QBY A;  2CZ1 B;  2DF6 A;  4RCC A;  3V8J A;  5LJ5 h;  3PTA A;  3PMT A;  4E7I A;  2XMF A;  3OY9 A;  3CBP A;  2YRC A;  4PNO A;  4BY6 B;  1CKA A;  1QKX A;  2L2P A;  4Y91 A;  3JCM Q;  1SEM A;  2NLU A;  2RD1 A;  1TH7 A;  1ACM B;  1RLQ C;  2YHT A;  1NG2 A;  5KCO A;  4J7I A;  2I2L A;  3CMA Q;  2MWP A;  2RQT A;  5CKD A;  1M8V A;  3OYJ A;  1YBY A;  2KVQ G;  3OW2 S;  1SKU B;  4OVA A;  1JXM A;  2KQW A;  3LWH A;  5CR2 A;  3RMS A;  2HEQ A;  1Z9Z A;  3FEO A;  3OYH A;  1PC0 A;  1ZUK A;  5HK3 A;  1W2B S;  4BDZ A;  5A0D A;  1U1S A;  3CCU Q;  2A28 A;  3X26 B;  1VQ8 T;  2P84 A;  4OB0 B;  2HL3 A;  2CP2 A;  2R5A A;  2PVO B;  2HNI A;  4ORZ A;  1IO6 A;  2HZY A;  2OX7 A;  1Q81 C;  2AKK A;  3H0I A;  3X28 B;  1D1B A;  3JCM b;  1OX8 A;  1Q82 U;  2LRQ A;  5KYN A;  4PJO D;  3UWN A;  2YUO A;  2Z0W A;  5GAM f;  2GGR A;  3CCR T;  1OU9 A;  3OYC A;  1M2O A;  2NWM A;  4DA4 A;  4J8O A;  3QG1 A; 
#chains in the Genus database with same CATH homology
 3UAT A;  2ESW A;  5GJW B;  2IIM A;  3H41 A;  2VKN A;  2DA9 A;  2DL4 A;  1M3B A;  2HSP A;  1FYN A;  2RN8 A;  3NHN A;  4RTX A;  4CC3 A;  3I5S A;  4M4Z A;  2SEM A;  3VRY A;  2F2V A;  2DL3 A;  3VS3 A;  1U06 A;  1ZUY A;  3VS0 A;  2A08 A;  1T0H A;  3EGU A;  2RQW A;  2FO0 A;  1WFW A;  2KRO A;  1ABQ A;  2J05 A;  4DEX A;  1WA7 A;  1AWX A;  1WYX A;  1GFC A;  2EGA A;  2DRK A;  1K76 A;  3UF4 A;  1NM7 A;  1TG0 A;  3M0P A;  5I11 A;  2NUZ A;  1OV3 A;  1M27 C;  2DX1 A;  1PRM C;  1Z9Q A;  1QKW A;  1GBQ A;  1NYG A;  4R0K A;  1QWE A;  2RQR A;  2KT8 A;  2K3B A;  2KEA A;  2LJ0 A;  2VVK A;  4J9C A;  1X69 A;  2P4R A;  2YT6 A;  1J3T A;  3VS7 A;  3JV3 A;  1UFF A;  1Y57 A;  2F2X A;  3EHR A;  2J6K A;  4LUD A;  4AG2 C;  2J6O A;  1RI9 A;  3M0Q A;  1N5Z A;  2V1Q A;  4JPB W;  2A37 A;  2EGE A;  2GQI A;  1AWW A;  1M3C A;  1M3A A;  1I0C A;  4HVW A;  1ARK A;  2AZV A;  3QWX X;  2GNC A;  2KE9 A;  3FJ5 A;  1GCQ A;  3EG1 A;  3THK A;  2YDL A;  2BZ8 A;  1S1N A;  2FPE A;  1OPL A;  2EKH A;  2HBW A;  2BTT A;  4LUE A;  1ZSG A;  2HDA A;  2W10 A;  1MV3 A;  4JZ4 A;  1K0X A;  2CH4 W;  2O9V A;  1AWO A;  5I22 A;  1WLP B;  2C0I A;  4JJC A;  2K2M A;  1QWF A;  2CT3 A;  1MV0 B;  5FWB A;  3VS6 A;  1UJY A;  3R6N A;  2C0O A;  4RTY A;  3KFV A;  1GFD A;  2YUN A;  4AG1 C;  1AWJ A;  1UJ0 A;  2K6D A;  3REA B;  1WI7 A;  2DE0 X;  1U5S A;  2LP5 A;  3IQL A;  1UEC A;  2OJ2 A;  1KIK A;  2YUQ A;  5FW9 A;  1ZLM A;  2KYM A;  1TUC A;  4X1V A;  4JZ3 A;  1YCS B;  1VYU A;  1OPK A;  4CC2 A;  1E6G A;  2KRN A;  2MIO A;  2PZ1 A;  3VS1 A;  4J9E A;  2LQN A;  2DMO A;  1SSH A;  2O2O A;  4J9F A;  1VA7 A;  3UA6 A;  1SPK A;  1X2Q A;  1T3S A;  1X43 A;  1X6B A;  2DJQ A;  4LNP A;  2L3Q A;  3REB B;  1B3Q A;  4EIK A;  2O9S A;  2JS2 A;  4F16 A;  4OML A;  4HVU A;  1LCK A;  5EC7 A;  4AFS C;  1K9A A;  1UE9 A;  2DYB A;  2RPN A;  4K11 A;  1M8M A;  5FWC A;  1X2K A;  2G6F X;  2K7A A;  1YWO A;  3H0H A;  2DNU A;  1AOJ A;  3I35 A;  2DL5 A;  3CQT A;  3RNJ A;  2JT4 A;  2M0Y A;  3TSW A;  2O88 A;  1KFZ A;  2FEI A;  4RUG A;  3U23 A;  2DLP A;  2JM9 A;  4CC4 B;  2LMJ A;  1RLP C;  4RTZ A;  2K79 A;  1K0S A;  1AEY A;  1WX6 A;  4Z89 A;  1WXT A;  1BBZ A;  1G2B A;  2JM8 A;  4OMP A;  1K1Z A;  1PNJ A;  3PE0 A;  2JS0 A;  3PVL A;  2AK5 A;  1PWT A;  1EFN A;  5IHI A;  1PKT A;  2RMO A;  1K4U S;  1UUE A;  1KSW A;  2EGC A;  3NMZ C;  1T3L A;  2KRM A;  2L3P A;  2FRY A;  2QDL A;  4AFZ C;  1PHT A;  1VYV A;  2CT4 A;  1U3O A;  3ZL7 C;  3EHQ A;  4RTU A;  2CDT A;  2MOX A;  5IXF A;  3NPF A;  2PTK A;  2GBQ A;  2KR3 A;  1ABO A;  1NLP C;  2EPD A;  2DRM A;  4WCI A;  4CC7 A;  2LNH B;  3C0C A;  1FMK A;  1JU5 C;  1UGV A;  1ZBJ A;  4HXJ A;  2DVJ A;  2LJ1 A;  1E6H A;  1VYT A;  2JMC A;  1WXU A;  2RQV A;  2A36 A;  2KNB B;  2LQW A;  1YP5 A;  4F14 A;  2ABL A;  2DL7 A;  4J9D A;  1CKB A;  2HCK A;  1OOT A;  2X3X D;  2GTO A;  2EW3 A;  1AZE A;  2AKL A;  4D8D A;  3QWY A;  1H3H A;  1XOV A;  2L3S A;  4J9H A;  2DL8 A;  2JXB A;  3H0F A;  2FPD A;  2PNI A;  5GJV B;  1JXO A;  4JJB A;  4HVV A;  4OMN A;  2YSQ A;  1SHF A;  3EG2 A;  1CSK A;  4LE9 A;  1H8K A;  2AZS A;  2KYB A;  4J9G A;  1JEG A;  2EBP A;  2VWF A;  2ED0 A;  2YUP A;  5HCK A;  2J06 A;  1A0N B;  2KT1 A;  2JTE A;  3A98 A;  4ESR A;  1SRL A;  4OMO A;  1UG1 A;  5IH2 A;  1GCP A;  1WIE A;  1GBR A;  2ECZ A;  3NGP A;  2GTJ A;  1JQQ A;  4IIO A;  1M30 A;  4J9B A;  5IHN A;  2CUD A;  2LX7 A;  1NEB A;  2E5K A;  4Y92 A;  2D8H A;  4JJD A;  1I07 A;  1NYF A;  2MCN A;  2JW4 A;  2W0Z A;  1UTI A;  1GCQ C;  2EYZ A;  1ZX6 A;  4IIM A;  1GRI A;  2KXC A;  1G83 A;  1W6X A;  2KRS A;  3VS5 A;  1HJD A;  3GBQ A;  2LCS A;  2OI3 A;  3PVQ A;  2K9G A;  4GBQ A;  1E7O A;  2X3W D;  1PRL C;  2DM1 A;  1HD3 A;  3VS4 A;  1UHC A;  2CUB A;  1AD5 A;  2H8H A;  1SHG A;  4KRT A;  1W70 A;  1BB9 A;  4RTT A;  3RBB B;  3M0S A;  2V1R A;  1YN8 A;  4AFU C;  1WXB A;  1RUW A;  1SRM A;  1UDL A;  1WDX A;  3I9Q A;  2EVR A;  1AZG B;  3I5R A;  1X6G A;  1GL5 A;  2EQI A;  2O31 A;  1ZUU A;  1Y0M A;  4RTW A;  2SRC A;  2C0T A;  2EYX A;  1UHF A;  2CSQ A;  4A63 B;  1PKS A;  2CSI A;  3SHW A;  2L0A A;  1HSQ A;  3LH5 A;  2DF6 A;  2BZY A;  1KJW A;  2ED1 A;  2ROL A;  1YNZ A;  4Z8A A;  2XMF A;  4OMQ A;  3VS2 A;  2ENM A;  1AVZ C;  1BU1 A;  2FRW A;  1CKA A;  1T0J A;  2RQU A;  1QKX A;  2L2P A;  5IHK A;  1SEM A;  1MUZ A;  2DBM A;  3TSZ A;  2JMA A;  1RLQ C;  2DIL A;  1NG2 A;  5ECA A;  3UA7 A;  4FSS A;  2D1X A;  2EYY A;  4QT7 A;  2I0N A;  3EG3 A;  2RQT A;  2RF0 A;  1X27 A;  2ROT A;  3M0T A;  2KBT A;  2F2W A;  3VRZ A;  4ZNX A;  2CRE A;  4Z88 A;  1JO8 A;  1QCF A;  2RNA A;  1H92 A;  4AFQ C;  1NLO C;  2B86 A;  1JXM A;  2J7I A;  1YWP A;  2HEQ A;  4LN2 A;  1Z9Z A;  4F17 A;  5L23 A;  2BZX A;  2FG0 A;  2KXD A;  3TVT A;  2LZ6 B;  3EG0 A;  1OEB A;  4RTV A;  2D0N A;  4HCK A;  1ZUK A;  2DBK A;  3ULR B;  4J9I A;  1B07 A;  4GLM A;  1TUD A;  3M0U A;  2EYW A;  2A28 A;  2FPF A;  2J6F A;  1QLY A;  2M51 A;  4E6R A;  4DEY A;  2OAW A;  1W1F A;  4D8K A;  1V1C A;  3SEM A;  4ORZ A;  2D8J A;  1IO6 A;  2AKK A;  3H0I A;  1I1J A;  2KGT A;  3O5Z A;  1BK2 A;  1NEG A;  2YUO A;  2GGR A;  5IXB A;  2CH4 A;  2NWM A;  3M0R A;  4OMM A;  2LJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...